data_3AVS
# 
_entry.id   3AVS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3AVS         
RCSB  RCSB029756   
WWPDB D_1000029756 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3AVR 
_pdbx_database_related.details        'The H3-bound structure' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3AVS 
_pdbx_database_status.recvd_initial_deposition_date   2011-03-07 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sengoku, T.'  1 
'Yokoyama, S.' 2 
# 
_citation.id                        primary 
_citation.title                     'Structural basis for histone H3 Lys 27 demethylation by UTX/KDM6A' 
_citation.journal_abbrev            'Genes Dev.' 
_citation.journal_volume            25 
_citation.page_first                2266 
_citation.page_last                 2277 
_citation.year                      2011 
_citation.journal_id_ASTM           GEDEEP 
_citation.country                   US 
_citation.journal_id_ISSN           0890-9369 
_citation.journal_id_CSD            2056 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22002947 
_citation.pdbx_database_id_DOI      10.1101/gad.172296.111 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Sengoku, T.'  1 
primary 'Yokoyama, S.' 2 
# 
_cell.entry_id           3AVS 
_cell.length_a           78.872 
_cell.length_b           82.879 
_cell.length_c           92.923 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3AVS 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Lysine-specific demethylase 6A' 60264.375 1   1.14.11.- ? 'UNP residues 880-1401' ? 
2 non-polymer syn N-OXALYLGLYCINE                  147.086   1   ?         ? ?                       ? 
3 non-polymer syn 'ZINC ION'                       65.409    1   ?         ? ?                       ? 
4 non-polymer syn 'NICKEL (II) ION'                58.693    3   ?         ? ?                       ? 
5 non-polymer syn 'CHLORIDE ION'                   35.453    1   ?         ? ?                       ? 
6 non-polymer syn 1,2-ETHANEDIOL                   62.068    10  ?         ? ?                       ? 
7 water       nat water                            18.015    344 ?         ? ?                       ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Histone demethylase UTX, Ubiquitously-transcribed TPR protein on the X chromosome, Ubiquitously-transcribed X chromosome tetratricopeptide repeat protein
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPGYQDPNSQIIPSMSVSIYPSSAEVLKACRNLGKNGLSNSSILLDKCPPPRPPSSPYPPLPKDKLNPPTPSIYLENKRD
AFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHT
TIAKYAQYQASSFQESLREENEKRSHHKDHSDSESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFV
RVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLM
GSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQSVKSIVPM
VHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFVTNESNS
RKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSASS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPGYQDPNSQIIPSMSVSIYPSSAEVLKACRNLGKNGLSNSSILLDKCPPPRPPSSPYPPLPKDKLNPPTPSIYLENKRD
AFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHT
TIAKYAQYQASSFQESLREENEKRSHHKDHSDSESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFV
RVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLM
GSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQSVKSIVPM
VHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFVTNESNS
RKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSASS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   GLY n 
1 4   TYR n 
1 5   GLN n 
1 6   ASP n 
1 7   PRO n 
1 8   ASN n 
1 9   SER n 
1 10  GLN n 
1 11  ILE n 
1 12  ILE n 
1 13  PRO n 
1 14  SER n 
1 15  MET n 
1 16  SER n 
1 17  VAL n 
1 18  SER n 
1 19  ILE n 
1 20  TYR n 
1 21  PRO n 
1 22  SER n 
1 23  SER n 
1 24  ALA n 
1 25  GLU n 
1 26  VAL n 
1 27  LEU n 
1 28  LYS n 
1 29  ALA n 
1 30  CYS n 
1 31  ARG n 
1 32  ASN n 
1 33  LEU n 
1 34  GLY n 
1 35  LYS n 
1 36  ASN n 
1 37  GLY n 
1 38  LEU n 
1 39  SER n 
1 40  ASN n 
1 41  SER n 
1 42  SER n 
1 43  ILE n 
1 44  LEU n 
1 45  LEU n 
1 46  ASP n 
1 47  LYS n 
1 48  CYS n 
1 49  PRO n 
1 50  PRO n 
1 51  PRO n 
1 52  ARG n 
1 53  PRO n 
1 54  PRO n 
1 55  SER n 
1 56  SER n 
1 57  PRO n 
1 58  TYR n 
1 59  PRO n 
1 60  PRO n 
1 61  LEU n 
1 62  PRO n 
1 63  LYS n 
1 64  ASP n 
1 65  LYS n 
1 66  LEU n 
1 67  ASN n 
1 68  PRO n 
1 69  PRO n 
1 70  THR n 
1 71  PRO n 
1 72  SER n 
1 73  ILE n 
1 74  TYR n 
1 75  LEU n 
1 76  GLU n 
1 77  ASN n 
1 78  LYS n 
1 79  ARG n 
1 80  ASP n 
1 81  ALA n 
1 82  PHE n 
1 83  PHE n 
1 84  PRO n 
1 85  PRO n 
1 86  LEU n 
1 87  HIS n 
1 88  GLN n 
1 89  PHE n 
1 90  CYS n 
1 91  THR n 
1 92  ASN n 
1 93  PRO n 
1 94  ASN n 
1 95  ASN n 
1 96  PRO n 
1 97  VAL n 
1 98  THR n 
1 99  VAL n 
1 100 ILE n 
1 101 ARG n 
1 102 GLY n 
1 103 LEU n 
1 104 ALA n 
1 105 GLY n 
1 106 ALA n 
1 107 LEU n 
1 108 LYS n 
1 109 LEU n 
1 110 ASP n 
1 111 LEU n 
1 112 GLY n 
1 113 LEU n 
1 114 PHE n 
1 115 SER n 
1 116 THR n 
1 117 LYS n 
1 118 THR n 
1 119 LEU n 
1 120 VAL n 
1 121 GLU n 
1 122 ALA n 
1 123 ASN n 
1 124 ASN n 
1 125 GLU n 
1 126 HIS n 
1 127 MET n 
1 128 VAL n 
1 129 GLU n 
1 130 VAL n 
1 131 ARG n 
1 132 THR n 
1 133 GLN n 
1 134 LEU n 
1 135 LEU n 
1 136 GLN n 
1 137 PRO n 
1 138 ALA n 
1 139 ASP n 
1 140 GLU n 
1 141 ASN n 
1 142 TRP n 
1 143 ASP n 
1 144 PRO n 
1 145 THR n 
1 146 GLY n 
1 147 THR n 
1 148 LYS n 
1 149 LYS n 
1 150 ILE n 
1 151 TRP n 
1 152 HIS n 
1 153 CYS n 
1 154 GLU n 
1 155 SER n 
1 156 ASN n 
1 157 ARG n 
1 158 SER n 
1 159 HIS n 
1 160 THR n 
1 161 THR n 
1 162 ILE n 
1 163 ALA n 
1 164 LYS n 
1 165 TYR n 
1 166 ALA n 
1 167 GLN n 
1 168 TYR n 
1 169 GLN n 
1 170 ALA n 
1 171 SER n 
1 172 SER n 
1 173 PHE n 
1 174 GLN n 
1 175 GLU n 
1 176 SER n 
1 177 LEU n 
1 178 ARG n 
1 179 GLU n 
1 180 GLU n 
1 181 ASN n 
1 182 GLU n 
1 183 LYS n 
1 184 ARG n 
1 185 SER n 
1 186 HIS n 
1 187 HIS n 
1 188 LYS n 
1 189 ASP n 
1 190 HIS n 
1 191 SER n 
1 192 ASP n 
1 193 SER n 
1 194 GLU n 
1 195 SER n 
1 196 THR n 
1 197 SER n 
1 198 SER n 
1 199 ASP n 
1 200 ASN n 
1 201 SER n 
1 202 GLY n 
1 203 ARG n 
1 204 ARG n 
1 205 ARG n 
1 206 LYS n 
1 207 GLY n 
1 208 PRO n 
1 209 PHE n 
1 210 LYS n 
1 211 THR n 
1 212 ILE n 
1 213 LYS n 
1 214 PHE n 
1 215 GLY n 
1 216 THR n 
1 217 ASN n 
1 218 ILE n 
1 219 ASP n 
1 220 LEU n 
1 221 SER n 
1 222 ASP n 
1 223 ASP n 
1 224 LYS n 
1 225 LYS n 
1 226 TRP n 
1 227 LYS n 
1 228 LEU n 
1 229 GLN n 
1 230 LEU n 
1 231 HIS n 
1 232 GLU n 
1 233 LEU n 
1 234 THR n 
1 235 LYS n 
1 236 LEU n 
1 237 PRO n 
1 238 ALA n 
1 239 PHE n 
1 240 VAL n 
1 241 ARG n 
1 242 VAL n 
1 243 VAL n 
1 244 SER n 
1 245 ALA n 
1 246 GLY n 
1 247 ASN n 
1 248 LEU n 
1 249 LEU n 
1 250 SER n 
1 251 HIS n 
1 252 VAL n 
1 253 GLY n 
1 254 HIS n 
1 255 THR n 
1 256 ILE n 
1 257 LEU n 
1 258 GLY n 
1 259 MET n 
1 260 ASN n 
1 261 THR n 
1 262 VAL n 
1 263 GLN n 
1 264 LEU n 
1 265 TYR n 
1 266 MET n 
1 267 LYS n 
1 268 VAL n 
1 269 PRO n 
1 270 GLY n 
1 271 SER n 
1 272 ARG n 
1 273 THR n 
1 274 PRO n 
1 275 GLY n 
1 276 HIS n 
1 277 GLN n 
1 278 GLU n 
1 279 ASN n 
1 280 ASN n 
1 281 ASN n 
1 282 PHE n 
1 283 CYS n 
1 284 SER n 
1 285 VAL n 
1 286 ASN n 
1 287 ILE n 
1 288 ASN n 
1 289 ILE n 
1 290 GLY n 
1 291 PRO n 
1 292 GLY n 
1 293 ASP n 
1 294 CYS n 
1 295 GLU n 
1 296 TRP n 
1 297 PHE n 
1 298 VAL n 
1 299 VAL n 
1 300 PRO n 
1 301 GLU n 
1 302 GLY n 
1 303 TYR n 
1 304 TRP n 
1 305 GLY n 
1 306 VAL n 
1 307 LEU n 
1 308 ASN n 
1 309 ASP n 
1 310 PHE n 
1 311 CYS n 
1 312 GLU n 
1 313 LYS n 
1 314 ASN n 
1 315 ASN n 
1 316 LEU n 
1 317 ASN n 
1 318 PHE n 
1 319 LEU n 
1 320 MET n 
1 321 GLY n 
1 322 SER n 
1 323 TRP n 
1 324 TRP n 
1 325 PRO n 
1 326 ASN n 
1 327 LEU n 
1 328 GLU n 
1 329 ASP n 
1 330 LEU n 
1 331 TYR n 
1 332 GLU n 
1 333 ALA n 
1 334 ASN n 
1 335 VAL n 
1 336 PRO n 
1 337 VAL n 
1 338 TYR n 
1 339 ARG n 
1 340 PHE n 
1 341 ILE n 
1 342 GLN n 
1 343 ARG n 
1 344 PRO n 
1 345 GLY n 
1 346 ASP n 
1 347 LEU n 
1 348 VAL n 
1 349 TRP n 
1 350 ILE n 
1 351 ASN n 
1 352 ALA n 
1 353 GLY n 
1 354 THR n 
1 355 VAL n 
1 356 HIS n 
1 357 TRP n 
1 358 VAL n 
1 359 GLN n 
1 360 ALA n 
1 361 ILE n 
1 362 GLY n 
1 363 TRP n 
1 364 CYS n 
1 365 ASN n 
1 366 ASN n 
1 367 ILE n 
1 368 ALA n 
1 369 TRP n 
1 370 ASN n 
1 371 VAL n 
1 372 GLY n 
1 373 PRO n 
1 374 LEU n 
1 375 THR n 
1 376 ALA n 
1 377 CYS n 
1 378 GLN n 
1 379 TYR n 
1 380 LYS n 
1 381 LEU n 
1 382 ALA n 
1 383 VAL n 
1 384 GLU n 
1 385 ARG n 
1 386 TYR n 
1 387 GLU n 
1 388 TRP n 
1 389 ASN n 
1 390 LYS n 
1 391 LEU n 
1 392 GLN n 
1 393 SER n 
1 394 VAL n 
1 395 LYS n 
1 396 SER n 
1 397 ILE n 
1 398 VAL n 
1 399 PRO n 
1 400 MET n 
1 401 VAL n 
1 402 HIS n 
1 403 LEU n 
1 404 SER n 
1 405 TRP n 
1 406 ASN n 
1 407 MET n 
1 408 ALA n 
1 409 ARG n 
1 410 ASN n 
1 411 ILE n 
1 412 LYS n 
1 413 VAL n 
1 414 SER n 
1 415 ASP n 
1 416 PRO n 
1 417 LYS n 
1 418 LEU n 
1 419 PHE n 
1 420 GLU n 
1 421 MET n 
1 422 ILE n 
1 423 LYS n 
1 424 TYR n 
1 425 CYS n 
1 426 LEU n 
1 427 LEU n 
1 428 ARG n 
1 429 THR n 
1 430 LEU n 
1 431 LYS n 
1 432 GLN n 
1 433 CYS n 
1 434 GLN n 
1 435 THR n 
1 436 LEU n 
1 437 ARG n 
1 438 GLU n 
1 439 ALA n 
1 440 LEU n 
1 441 ILE n 
1 442 ALA n 
1 443 ALA n 
1 444 GLY n 
1 445 LYS n 
1 446 GLU n 
1 447 ILE n 
1 448 ILE n 
1 449 TRP n 
1 450 HIS n 
1 451 GLY n 
1 452 ARG n 
1 453 THR n 
1 454 LYS n 
1 455 GLU n 
1 456 GLU n 
1 457 PRO n 
1 458 ALA n 
1 459 HIS n 
1 460 TYR n 
1 461 CYS n 
1 462 SER n 
1 463 ILE n 
1 464 CYS n 
1 465 GLU n 
1 466 VAL n 
1 467 GLU n 
1 468 VAL n 
1 469 PHE n 
1 470 ASP n 
1 471 LEU n 
1 472 LEU n 
1 473 PHE n 
1 474 VAL n 
1 475 THR n 
1 476 ASN n 
1 477 GLU n 
1 478 SER n 
1 479 ASN n 
1 480 SER n 
1 481 ARG n 
1 482 LYS n 
1 483 THR n 
1 484 TYR n 
1 485 ILE n 
1 486 VAL n 
1 487 HIS n 
1 488 CYS n 
1 489 GLN n 
1 490 ASP n 
1 491 CYS n 
1 492 ALA n 
1 493 ARG n 
1 494 LYS n 
1 495 THR n 
1 496 SER n 
1 497 GLY n 
1 498 ASN n 
1 499 LEU n 
1 500 GLU n 
1 501 ASN n 
1 502 PHE n 
1 503 VAL n 
1 504 VAL n 
1 505 LEU n 
1 506 GLU n 
1 507 GLN n 
1 508 TYR n 
1 509 LYS n 
1 510 MET n 
1 511 GLU n 
1 512 ASP n 
1 513 LEU n 
1 514 MET n 
1 515 GLN n 
1 516 VAL n 
1 517 TYR n 
1 518 ASP n 
1 519 GLN n 
1 520 PHE n 
1 521 THR n 
1 522 LEU n 
1 523 ALA n 
1 524 PRO n 
1 525 PRO n 
1 526 LEU n 
1 527 PRO n 
1 528 SER n 
1 529 ALA n 
1 530 SER n 
1 531 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'KDM6A, UTX' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET47 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KDM6A_HUMAN 
_struct_ref.pdbx_db_accession          O15550 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;QIIPSMSVSIYPSSAEVLKACRNLGKNGLSNSSILLDKCPPPRPPSSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQF
CTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQ
ASSFQESLREENEKRSHHKDHSDSESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLL
SHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLED
LYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQSVKSIVPMVHLSWNMAR
NIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFVTNESNSRKTYIVHCQ
DCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSASS
;
_struct_ref.pdbx_align_begin           880 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3AVS 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 10 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 531 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O15550 
_struct_ref_seq.db_align_beg                  880 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1401 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       880 
_struct_ref_seq.pdbx_auth_seq_align_end       1401 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3AVS GLY A 1 ? UNP O15550 ? ? 'EXPRESSION TAG' 871 1 
1 3AVS PRO A 2 ? UNP O15550 ? ? 'EXPRESSION TAG' 872 2 
1 3AVS GLY A 3 ? UNP O15550 ? ? 'EXPRESSION TAG' 873 3 
1 3AVS TYR A 4 ? UNP O15550 ? ? 'EXPRESSION TAG' 874 4 
1 3AVS GLN A 5 ? UNP O15550 ? ? 'EXPRESSION TAG' 875 5 
1 3AVS ASP A 6 ? UNP O15550 ? ? 'EXPRESSION TAG' 876 6 
1 3AVS PRO A 7 ? UNP O15550 ? ? 'EXPRESSION TAG' 877 7 
1 3AVS ASN A 8 ? UNP O15550 ? ? 'EXPRESSION TAG' 878 8 
1 3AVS SER A 9 ? UNP O15550 ? ? 'EXPRESSION TAG' 879 9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ?                 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'    ?                 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE          ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL    'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE         ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ?                 'C5 H11 N O2 S'  149.211 
NI  non-polymer         . 'NICKEL (II) ION' ?                 'Ni 2'           58.693  
OGA non-polymer         . N-OXALYLGLYCINE   ?                 'C4 H5 N O5'     147.086 
PHE 'L-peptide linking' y PHENYLALANINE     ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE            ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ?                 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'        ?                 'Zn 2'           65.409  
# 
_exptl.entry_id          3AVS 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.52 
_exptl_crystal.density_percent_sol   51.19 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
'0.1M Tris-HCl (pH 8.5), 0.2M Li2SO4, 18-20% PEG 3350, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RAYONIX MX225HE' 
_diffrn_detector.pdbx_collection_date   2010-07-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Double Si(111) crystals' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL41XU' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL41XU 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     3AVS 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.85 
_reflns.number_obs                   50265 
_reflns.number_all                   52689 
_reflns.percent_possible_obs         95.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  1.85 
_reflns_shell.d_res_low                   1.88 
_reflns_shell.percent_possible_all        75.3 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 3AVS 
_refine.ls_number_reflns_obs                     50150 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.066 
_refine.ls_d_res_high                            1.850 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1844 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1826 
_refine.ls_R_factor_R_free                       0.2179 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.14 
_refine.ls_number_reflns_R_free                  2578 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            4.5061 
_refine.aniso_B[2][2]                            -1.9859 
_refine.aniso_B[3][3]                            -2.5202 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.372 
_refine.solvent_model_param_bsol                 36.672 
_refine.pdbx_solvent_vdw_probe_radii             1.00 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.89 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.22 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_work_R_set                   0.8452 
_refine.pdbx_overall_phase_error                 22.2300 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3806 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         55 
_refine_hist.number_atoms_solvent             344 
_refine_hist.number_atoms_total               4205 
_refine_hist.d_res_high                       1.850 
_refine_hist.d_res_low                        30.066 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.003  ? ? 4003 'X-RAY DIFFRACTION' ? 
f_angle_d          0.811  ? ? 5438 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 14.554 ? ? 1485 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.050  ? ? 588  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.003  ? ? 702  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
'X-RAY DIFFRACTION' 18 1.8501 1.8857  2033 0.2683 75.00  0.3054 . . 127 . . . . 
'X-RAY DIFFRACTION' 18 1.8857 1.9242  2176 0.2601 80.00  0.3139 . . 125 . . . . 
'X-RAY DIFFRACTION' 18 1.9242 1.9660  2321 0.2512 84.00  0.2767 . . 130 . . . . 
'X-RAY DIFFRACTION' 18 1.9660 2.0118  2447 0.2297 90.00  0.2756 . . 139 . . . . 
'X-RAY DIFFRACTION' 18 2.0118 2.0621  2575 0.2203 94.00  0.2719 . . 120 . . . . 
'X-RAY DIFFRACTION' 18 2.0621 2.1178  2711 0.2095 99.00  0.2584 . . 148 . . . . 
'X-RAY DIFFRACTION' 18 2.1178 2.1801  2755 0.2011 100.00 0.2642 . . 154 . . . . 
'X-RAY DIFFRACTION' 18 2.1801 2.2505  2729 0.1977 100.00 0.2481 . . 146 . . . . 
'X-RAY DIFFRACTION' 18 2.2505 2.3309  2750 0.1898 100.00 0.2186 . . 147 . . . . 
'X-RAY DIFFRACTION' 18 2.3309 2.4241  2757 0.1889 100.00 0.2472 . . 141 . . . . 
'X-RAY DIFFRACTION' 18 2.4241 2.5344  2762 0.1933 100.00 0.2180 . . 153 . . . . 
'X-RAY DIFFRACTION' 18 2.5344 2.6680  2768 0.1816 100.00 0.2417 . . 148 . . . . 
'X-RAY DIFFRACTION' 18 2.6680 2.8350  2764 0.1761 100.00 0.2123 . . 161 . . . . 
'X-RAY DIFFRACTION' 18 2.8350 3.0537  2766 0.1832 100.00 0.2250 . . 138 . . . . 
'X-RAY DIFFRACTION' 18 3.0537 3.3606  2783 0.1900 99.00  0.2301 . . 142 . . . . 
'X-RAY DIFFRACTION' 18 3.3606 3.8461  2773 0.1764 99.00  0.2164 . . 165 . . . . 
'X-RAY DIFFRACTION' 18 3.8461 4.8424  2827 0.1409 99.00  0.1707 . . 155 . . . . 
'X-RAY DIFFRACTION' 18 4.8424 30.0698 2875 0.1789 96.00  0.1817 . . 139 . . . . 
# 
_struct.entry_id                  3AVS 
_struct.title                     'Catalytic fragment of UTX/KDM6A bound with N-oxyalylglycine, and Ni(II)' 
_struct.pdbx_descriptor           'Lysine-specific demethylase 6A (E.C.1.14.11.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3AVS 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'Cupin superfamily, tri/dimethyllysine demethylase, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
H N N 6 ? 
I N N 6 ? 
J N N 6 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
O N N 6 ? 
P N N 6 ? 
Q N N 6 ? 
R N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 22  ? ARG A 31  ? SER A 892  ARG A 901  1 ? 10 
HELX_P HELX_P2  2  PRO A 62  ? LEU A 66  ? PRO A 932  LEU A 936  5 ? 5  
HELX_P HELX_P3  3  ASN A 77  ? PHE A 82  ? ASN A 947  PHE A 952  1 ? 6  
HELX_P HELX_P4  4  PRO A 84  ? ASN A 92  ? PRO A 954  ASN A 962  1 ? 9  
HELX_P HELX_P5  5  GLY A 102 ? LYS A 108 ? GLY A 972  LYS A 978  1 ? 7  
HELX_P HELX_P6  6  ASP A 110 ? PHE A 114 ? ASP A 980  PHE A 984  5 ? 5  
HELX_P HELX_P7  7  SER A 115 ? ASN A 124 ? SER A 985  ASN A 994  1 ? 10 
HELX_P HELX_P8  8  ILE A 162 ? LEU A 177 ? ILE A 1032 LEU A 1047 1 ? 16 
HELX_P HELX_P9  9  TRP A 226 ? LEU A 233 ? TRP A 1096 LEU A 1103 1 ? 8  
HELX_P HELX_P10 10 THR A 234 ? LEU A 236 ? THR A 1104 LEU A 1106 5 ? 3  
HELX_P HELX_P11 11 PRO A 237 ? ARG A 241 ? PRO A 1107 ARG A 1111 5 ? 5  
HELX_P HELX_P12 12 ASN A 247 ? VAL A 252 ? ASN A 1117 VAL A 1122 5 ? 6  
HELX_P HELX_P13 13 GLU A 278 ? PHE A 282 ? GLU A 1148 PHE A 1152 5 ? 5  
HELX_P HELX_P14 14 PRO A 300 ? GLY A 302 ? PRO A 1170 GLY A 1172 5 ? 3  
HELX_P HELX_P15 15 TYR A 303 ? ASN A 314 ? TYR A 1173 ASN A 1184 1 ? 12 
HELX_P HELX_P16 16 ASN A 326 ? ALA A 333 ? ASN A 1196 ALA A 1203 1 ? 8  
HELX_P HELX_P17 17 THR A 375 ? GLN A 392 ? THR A 1245 GLN A 1262 1 ? 18 
HELX_P HELX_P18 18 PRO A 399 ? ILE A 411 ? PRO A 1269 ILE A 1281 1 ? 13 
HELX_P HELX_P19 19 ASP A 415 ? ALA A 443 ? ASP A 1285 ALA A 1313 1 ? 29 
HELX_P HELX_P20 20 ASN A 476 ? ARG A 481 ? ASN A 1346 ARG A 1351 1 ? 6  
HELX_P HELX_P21 21 CYS A 488 ? SER A 496 ? CYS A 1358 SER A 1366 1 ? 9  
HELX_P HELX_P22 22 LYS A 509 ? PHE A 520 ? LYS A 1379 PHE A 1390 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A GLU 278 OE2   ? ? ? 1_555 D NI  . NI ? ? A GLU 1148 A NI  1503 1_555 ? ? ? ? ? ? ? 2.105 ? 
metalc2  metalc ? ? A HIS 356 NE2   ? ? ? 1_555 D NI  . NI ? ? A HIS 1226 A NI  1503 1_555 ? ? ? ? ? ? ? 2.192 ? 
metalc3  metalc ? ? D NI  .   NI    ? ? ? 1_555 R HOH . O  ? ? A NI  1503 A HOH 276  1_555 ? ? ? ? ? ? ? 2.198 ? 
metalc4  metalc ? ? A HIS 276 NE2   ? ? ? 1_555 D NI  . NI ? ? A HIS 1146 A NI  1503 1_555 ? ? ? ? ? ? ? 2.236 ? 
metalc5  metalc ? ? B OGA .   O2    ? ? ? 1_555 D NI  . NI ? ? A OGA 1501 A NI  1503 1_555 ? ? ? ? ? ? ? 2.239 ? 
metalc6  metalc ? ? B OGA .   "O2'" ? ? ? 1_555 D NI  . NI ? ? A OGA 1501 A NI  1503 1_555 ? ? ? ? ? ? ? 2.243 ? 
metalc7  metalc ? ? A CYS 488 SG    ? ? ? 1_555 C ZN  . ZN ? ? A CYS 1358 A ZN  1502 1_555 ? ? ? ? ? ? ? 2.310 ? 
metalc8  metalc ? ? A CYS 464 SG    ? ? ? 1_555 C ZN  . ZN ? ? A CYS 1334 A ZN  1502 1_555 ? ? ? ? ? ? ? 2.378 ? 
metalc9  metalc ? ? A CYS 461 SG    ? ? ? 1_555 C ZN  . ZN ? ? A CYS 1331 A ZN  1502 1_555 ? ? ? ? ? ? ? 2.390 ? 
metalc10 metalc ? ? A CYS 491 SG    ? ? ? 1_555 C ZN  . ZN ? ? A CYS 1361 A ZN  1502 1_555 ? ? ? ? ? ? ? 2.428 ? 
metalc11 metalc ? ? A HIS 450 NE2   ? ? ? 1_555 E NI  . NI ? ? A HIS 1320 A NI  1504 1_555 ? ? ? ? ? ? ? 2.741 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 58  A . ? TYR 928  A PRO 59  A ? PRO 929  A 1 2.42 
2 GLY 290 A . ? GLY 1160 A PRO 291 A ? PRO 1161 A 1 4.31 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 4 ? 
C ? 3 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
A 8 9 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 72  ? TYR A 74  ? SER A 942  TYR A 944  
A 2 VAL A 97  ? ARG A 101 ? VAL A 967  ARG A 971  
A 3 LEU A 347 ? ILE A 350 ? LEU A 1217 ILE A 1220 
A 4 CYS A 283 ? PRO A 291 ? CYS A 1153 PRO A 1161 
A 5 CYS A 364 ? VAL A 371 ? CYS A 1234 VAL A 1241 
A 6 GLN A 263 ? LYS A 267 ? GLN A 1133 LYS A 1137 
A 7 THR A 211 ? ASP A 219 ? THR A 1081 ASP A 1089 
A 8 MET A 127 ? LEU A 134 ? MET A 997  LEU A 1004 
A 9 ASN A 156 ? THR A 161 ? ASN A 1026 THR A 1031 
B 1 ARG A 272 ? HIS A 276 ? ARG A 1142 HIS A 1146 
B 2 VAL A 355 ? ALA A 360 ? VAL A 1225 ALA A 1230 
B 3 CYS A 294 ? VAL A 299 ? CYS A 1164 VAL A 1169 
B 4 TYR A 338 ? GLN A 342 ? TYR A 1208 GLN A 1212 
C 1 ILE A 448 ? TRP A 449 ? ILE A 1318 TRP A 1319 
C 2 PHE A 502 ? GLU A 506 ? PHE A 1372 GLU A 1376 
C 3 LEU A 471 ? THR A 475 ? LEU A 1341 THR A 1345 
D 1 HIS A 459 ? TYR A 460 ? HIS A 1329 TYR A 1330 
D 2 GLU A 467 ? VAL A 468 ? GLU A 1337 VAL A 1338 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 73  ? N ILE A 943  O ARG A 101 ? O ARG A 971  
A 2 3 N ILE A 100 ? N ILE A 970  O LEU A 347 ? O LEU A 1217 
A 3 4 O VAL A 348 ? O VAL A 1218 N ASN A 286 ? N ASN A 1156 
A 4 5 N ILE A 289 ? N ILE A 1159 O ASN A 365 ? O ASN A 1235 
A 5 6 O ASN A 366 ? O ASN A 1236 N TYR A 265 ? N TYR A 1135 
A 6 7 O MET A 266 ? O MET A 1136 N GLY A 215 ? N GLY A 1085 
A 7 8 O THR A 216 ? O THR A 1086 N GLU A 129 ? N GLU A 999  
A 8 9 N VAL A 130 ? N VAL A 1000 O SER A 158 ? O SER A 1028 
B 1 2 N THR A 273 ? N THR A 1143 O VAL A 358 ? O VAL A 1228 
B 2 3 O GLN A 359 ? O GLN A 1229 N GLU A 295 ? N GLU A 1165 
B 3 4 N CYS A 294 ? N CYS A 1164 O GLN A 342 ? O GLN A 1212 
C 1 2 N ILE A 448 ? N ILE A 1318 O GLU A 506 ? O GLU A 1376 
C 2 3 O VAL A 503 ? O VAL A 1373 N VAL A 474 ? N VAL A 1344 
D 1 2 N HIS A 459 ? N HIS A 1329 O VAL A 468 ? O VAL A 1338 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE OGA A 1501' 
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 1502'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NI A 1503'  
AC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE NI A 1504'  
AC5 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE NI A 1505'  
AC6 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL A 1506'  
AC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE EDO A 1507' 
AC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE EDO A 1508' 
AC9 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE EDO A 1509' 
BC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE EDO A 1510' 
BC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE EDO A 1511' 
BC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE EDO A 1512' 
BC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE EDO A 1513' 
BC5 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE EDO A 1514' 
BC6 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE EDO A 1515' 
BC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO A 1516' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 11 HOH R .   ? HOH A 7    . ? 1_555 ? 
2  AC1 11 LYS A 267 ? LYS A 1137 . ? 1_555 ? 
3  AC1 11 THR A 273 ? THR A 1143 . ? 1_555 ? 
4  AC1 11 HIS A 276 ? HIS A 1146 . ? 1_555 ? 
5  AC1 11 GLU A 278 ? GLU A 1148 . ? 1_555 ? 
6  AC1 11 SER A 284 ? SER A 1154 . ? 1_555 ? 
7  AC1 11 ASN A 286 ? ASN A 1156 . ? 1_555 ? 
8  AC1 11 TRP A 296 ? TRP A 1166 . ? 1_555 ? 
9  AC1 11 HIS A 356 ? HIS A 1226 . ? 1_555 ? 
10 AC1 11 ALA A 368 ? ALA A 1238 . ? 1_555 ? 
11 AC1 11 NI  D .   ? NI  A 1503 . ? 1_555 ? 
12 AC2 4  CYS A 461 ? CYS A 1331 . ? 1_555 ? 
13 AC2 4  CYS A 464 ? CYS A 1334 . ? 1_555 ? 
14 AC2 4  CYS A 488 ? CYS A 1358 . ? 1_555 ? 
15 AC2 4  CYS A 491 ? CYS A 1361 . ? 1_555 ? 
16 AC3 5  HOH R .   ? HOH A 276  . ? 1_555 ? 
17 AC3 5  HIS A 276 ? HIS A 1146 . ? 1_555 ? 
18 AC3 5  GLU A 278 ? GLU A 1148 . ? 1_555 ? 
19 AC3 5  HIS A 356 ? HIS A 1226 . ? 1_555 ? 
20 AC3 5  OGA B .   ? OGA A 1501 . ? 1_555 ? 
21 AC4 2  HOH R .   ? HOH A 215  . ? 1_555 ? 
22 AC4 2  HIS A 450 ? HIS A 1320 . ? 1_555 ? 
23 AC5 1  HIS A 231 ? HIS A 1101 . ? 1_555 ? 
24 AC6 1  ARG A 157 ? ARG A 1027 . ? 1_555 ? 
25 AC7 2  HOH R .   ? HOH A 233  . ? 1_555 ? 
26 AC7 2  HIS A 251 ? HIS A 1121 . ? 1_555 ? 
27 AC8 4  VAL A 383 ? VAL A 1253 . ? 1_555 ? 
28 AC8 4  GLU A 387 ? GLU A 1257 . ? 1_555 ? 
29 AC8 4  CYS A 425 ? CYS A 1295 . ? 1_555 ? 
30 AC8 4  ARG A 428 ? ARG A 1298 . ? 1_555 ? 
31 AC9 2  TYR A 58  ? TYR A 928  . ? 1_555 ? 
32 AC9 2  EDO K .   ? EDO A 1510 . ? 2_555 ? 
33 BC1 6  HOH R .   ? HOH A 317  . ? 1_555 ? 
34 BC1 6  THR A 160 ? THR A 1030 . ? 1_555 ? 
35 BC1 6  LYS A 164 ? LYS A 1034 . ? 1_555 ? 
36 BC1 6  TYR A 165 ? TYR A 1035 . ? 1_555 ? 
37 BC1 6  LYS A 213 ? LYS A 1083 . ? 1_555 ? 
38 BC1 6  EDO J .   ? EDO A 1509 . ? 2_554 ? 
39 BC2 4  HOH R .   ? HOH A 35   . ? 1_555 ? 
40 BC2 4  HOH R .   ? HOH A 211  . ? 1_555 ? 
41 BC2 4  ARG A 343 ? ARG A 1213 . ? 1_555 ? 
42 BC2 4  PRO A 344 ? PRO A 1214 . ? 1_555 ? 
43 BC3 3  HOH R .   ? HOH A 176  . ? 1_555 ? 
44 BC3 3  HOH R .   ? HOH A 306  . ? 1_555 ? 
45 BC3 3  GLU A 76  ? GLU A 946  . ? 3_645 ? 
46 BC4 6  HOH R .   ? HOH A 190  . ? 1_555 ? 
47 BC4 6  LEU A 111 ? LEU A 981  . ? 1_555 ? 
48 BC4 6  GLY A 112 ? GLY A 982  . ? 1_555 ? 
49 BC4 6  SER A 115 ? SER A 985  . ? 1_555 ? 
50 BC4 6  ILE A 289 ? ILE A 1159 . ? 1_555 ? 
51 BC4 6  EDO O .   ? EDO A 1514 . ? 1_555 ? 
52 BC5 10 HOH R .   ? HOH A 107  . ? 1_555 ? 
53 BC5 10 HOH R .   ? HOH A 278  . ? 1_555 ? 
54 BC5 10 SER A 115 ? SER A 985  . ? 1_555 ? 
55 BC5 10 THR A 116 ? THR A 986  . ? 1_555 ? 
56 BC5 10 GLN A 169 ? GLN A 1039 . ? 1_555 ? 
57 BC5 10 GLY A 290 ? GLY A 1160 . ? 1_555 ? 
58 BC5 10 PRO A 291 ? PRO A 1161 . ? 1_555 ? 
59 BC5 10 CYS A 364 ? CYS A 1234 . ? 1_555 ? 
60 BC5 10 ASN A 365 ? ASN A 1235 . ? 1_555 ? 
61 BC5 10 EDO N .   ? EDO A 1513 . ? 1_555 ? 
62 BC6 7  HOH R .   ? HOH A 12   . ? 1_555 ? 
63 BC6 7  HOH R .   ? HOH A 84   . ? 3_655 ? 
64 BC6 7  HOH R .   ? HOH A 165  . ? 1_555 ? 
65 BC6 7  HOH R .   ? HOH A 219  . ? 1_555 ? 
66 BC6 7  ILE A 19  ? ILE A 889  . ? 3_655 ? 
67 BC6 7  PRO A 21  ? PRO A 891  . ? 3_655 ? 
68 BC6 7  ARG A 101 ? ARG A 971  . ? 1_555 ? 
69 BC7 5  HOH R .   ? HOH A 309  . ? 1_555 ? 
70 BC7 5  ALA A 238 ? ALA A 1108 . ? 1_555 ? 
71 BC7 5  ARG A 241 ? ARG A 1111 . ? 1_555 ? 
72 BC7 5  SER A 244 ? SER A 1114 . ? 1_555 ? 
73 BC7 5  ALA A 245 ? ALA A 1115 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3AVS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3AVS 
_atom_sites.fract_transf_matrix[1][1]   0.012679 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012066 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010762 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
H  
N  
NI 
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . SER A 1 16  ? 59.646 -16.646 21.337  1.00 80.66  ? 886  SER A N     1 
ATOM   2    C  CA    . SER A 1 16  ? 58.374 -16.693 20.626  1.00 84.20  ? 886  SER A CA    1 
ATOM   3    C  C     . SER A 1 16  ? 58.116 -18.085 20.048  1.00 77.73  ? 886  SER A C     1 
ATOM   4    O  O     . SER A 1 16  ? 58.914 -18.618 19.282  1.00 82.16  ? 886  SER A O     1 
ATOM   5    C  CB    . SER A 1 16  ? 58.342 -15.633 19.522  1.00 76.42  ? 886  SER A CB    1 
ATOM   6    O  OG    . SER A 1 16  ? 59.347 -15.870 18.552  1.00 86.67  ? 886  SER A OG    1 
ATOM   7    H  HA    . SER A 1 16  ? 57.652 -16.492 21.256  1.00 100.98 ? 886  SER A HA    1 
ATOM   8    H  HB2   . SER A 1 16  ? 57.474 -15.658 19.088  1.00 91.65  ? 886  SER A HB2   1 
ATOM   9    H  HB3   . SER A 1 16  ? 58.488 -14.761 19.920  1.00 91.65  ? 886  SER A HB3   1 
ATOM   10   H  HG    . SER A 1 16  ? 59.777 -16.539 18.750  1.00 103.95 ? 886  SER A HG    1 
ATOM   11   N  N     . VAL A 1 17  ? 56.970 -18.647 20.414  1.00 56.94  ? 887  VAL A N     1 
ATOM   12   C  CA    . VAL A 1 17  ? 56.630 -20.030 20.101  1.00 65.05  ? 887  VAL A CA    1 
ATOM   13   C  C     . VAL A 1 17  ? 55.506 -20.069 19.083  1.00 51.82  ? 887  VAL A C     1 
ATOM   14   O  O     . VAL A 1 17  ? 54.442 -19.499 19.315  1.00 69.94  ? 887  VAL A O     1 
ATOM   15   C  CB    . VAL A 1 17  ? 56.140 -20.774 21.364  1.00 57.41  ? 887  VAL A CB    1 
ATOM   16   C  CG1   . VAL A 1 17  ? 55.731 -22.204 21.031  1.00 50.75  ? 887  VAL A CG1   1 
ATOM   17   C  CG2   . VAL A 1 17  ? 57.204 -20.755 22.453  1.00 53.40  ? 887  VAL A CG2   1 
ATOM   18   H  H     . VAL A 1 17  ? 56.357 -18.237 20.856  1.00 68.27  ? 887  VAL A H     1 
ATOM   19   H  HA    . VAL A 1 17  ? 57.411 -20.496 19.736  1.00 78.01  ? 887  VAL A HA    1 
ATOM   20   H  HB    . VAL A 1 17  ? 55.349 -20.312 21.713  1.00 68.84  ? 887  VAL A HB    1 
ATOM   21   H  HG11  . VAL A 1 17  ? 55.432 -22.638 21.834  1.00 60.85  ? 887  VAL A HG11  1 
ATOM   22   H  HG12  . VAL A 1 17  ? 55.021 -22.183 20.386  1.00 60.85  ? 887  VAL A HG12  1 
ATOM   23   H  HG13  . VAL A 1 17  ? 56.489 -22.669 20.670  1.00 60.85  ? 887  VAL A HG13  1 
ATOM   24   H  HG21  . VAL A 1 17  ? 56.871 -21.223 23.223  1.00 64.02  ? 887  VAL A HG21  1 
ATOM   25   H  HG22  . VAL A 1 17  ? 57.995 -21.187 22.124  1.00 64.02  ? 887  VAL A HG22  1 
ATOM   26   H  HG23  . VAL A 1 17  ? 57.399 -19.844 22.683  1.00 64.02  ? 887  VAL A HG23  1 
ATOM   27   N  N     . SER A 1 18  ? 55.734 -20.738 17.958  1.00 47.61  ? 888  SER A N     1 
ATOM   28   C  CA    . SER A 1 18  ? 54.678 -20.922 16.971  1.00 51.51  ? 888  SER A CA    1 
ATOM   29   C  C     . SER A 1 18  ? 53.800 -22.096 17.389  1.00 39.33  ? 888  SER A C     1 
ATOM   30   O  O     . SER A 1 18  ? 54.300 -23.185 17.666  1.00 45.27  ? 888  SER A O     1 
ATOM   31   C  CB    . SER A 1 18  ? 55.274 -21.171 15.588  1.00 56.30  ? 888  SER A CB    1 
ATOM   32   O  OG    . SER A 1 18  ? 54.254 -21.325 14.617  1.00 55.52  ? 888  SER A OG    1 
ATOM   33   H  H     . SER A 1 18  ? 56.487 -21.092 17.743  1.00 57.08  ? 888  SER A H     1 
ATOM   34   H  HA    . SER A 1 18  ? 54.123 -20.116 16.931  1.00 61.75  ? 888  SER A HA    1 
ATOM   35   H  HB2   . SER A 1 18  ? 55.831 -20.415 15.343  1.00 67.50  ? 888  SER A HB2   1 
ATOM   36   H  HB3   . SER A 1 18  ? 55.808 -21.981 15.615  1.00 67.50  ? 888  SER A HB3   1 
ATOM   37   H  HG    . SER A 1 18  ? 53.518 -21.253 14.970  1.00 66.56  ? 888  SER A HG    1 
ATOM   38   N  N     . ILE A 1 19  ? 52.491 -21.870 17.444  1.00 38.91  ? 889  ILE A N     1 
ATOM   39   C  CA    . ILE A 1 19  ? 51.559 -22.900 17.888  1.00 42.69  ? 889  ILE A CA    1 
ATOM   40   C  C     . ILE A 1 19  ? 50.707 -23.425 16.738  1.00 34.87  ? 889  ILE A C     1 
ATOM   41   O  O     . ILE A 1 19  ? 49.806 -24.234 16.950  1.00 36.66  ? 889  ILE A O     1 
ATOM   42   C  CB    . ILE A 1 19  ? 50.624 -22.375 18.998  1.00 34.97  ? 889  ILE A CB    1 
ATOM   43   C  CG1   . ILE A 1 19  ? 49.736 -21.248 18.464  1.00 34.77  ? 889  ILE A CG1   1 
ATOM   44   C  CG2   . ILE A 1 19  ? 51.438 -21.888 20.188  1.00 35.26  ? 889  ILE A CG2   1 
ATOM   45   C  CD1   . ILE A 1 19  ? 48.646 -20.826 19.428  1.00 35.68  ? 889  ILE A CD1   1 
ATOM   46   H  H     . ILE A 1 19  ? 52.117 -21.126 17.228  1.00 46.64  ? 889  ILE A H     1 
ATOM   47   H  HA    . ILE A 1 19  ? 52.069 -23.653 18.253  1.00 51.18  ? 889  ILE A HA    1 
ATOM   48   H  HB    . ILE A 1 19  ? 50.055 -23.103 19.291  1.00 41.91  ? 889  ILE A HB    1 
ATOM   49   H  HG12  . ILE A 1 19  ? 50.289 -20.473 18.282  1.00 41.67  ? 889  ILE A HG12  1 
ATOM   50   H  HG13  . ILE A 1 19  ? 49.309 -21.547 17.646  1.00 41.67  ? 889  ILE A HG13  1 
ATOM   51   H  HG21  . ILE A 1 19  ? 50.838 -21.566 20.865  1.00 42.25  ? 889  ILE A HG21  1 
ATOM   52   H  HG22  . ILE A 1 19  ? 51.957 -22.619 20.531  1.00 42.25  ? 889  ILE A HG22  1 
ATOM   53   H  HG23  . ILE A 1 19  ? 52.018 -21.180 19.901  1.00 42.25  ? 889  ILE A HG23  1 
ATOM   54   H  HD11  . ILE A 1 19  ? 48.132 -20.120 19.028  1.00 42.76  ? 889  ILE A HD11  1 
ATOM   55   H  HD12  . ILE A 1 19  ? 48.081 -21.580 19.610  1.00 42.76  ? 889  ILE A HD12  1 
ATOM   56   H  HD13  . ILE A 1 19  ? 49.052 -20.516 20.241  1.00 42.76  ? 889  ILE A HD13  1 
ATOM   57   N  N     . TYR A 1 20  ? 50.992 -22.967 15.523  1.00 34.33  ? 890  TYR A N     1 
ATOM   58   C  CA    . TYR A 1 20  ? 50.217 -23.378 14.360  1.00 34.10  ? 890  TYR A CA    1 
ATOM   59   C  C     . TYR A 1 20  ? 51.056 -24.196 13.384  1.00 42.95  ? 890  TYR A C     1 
ATOM   60   O  O     . TYR A 1 20  ? 52.247 -23.940 13.213  1.00 34.97  ? 890  TYR A O     1 
ATOM   61   C  CB    . TYR A 1 20  ? 49.641 -22.152 13.647  1.00 34.33  ? 890  TYR A CB    1 
ATOM   62   C  CG    . TYR A 1 20  ? 48.701 -21.340 14.509  1.00 34.51  ? 890  TYR A CG    1 
ATOM   63   C  CD1   . TYR A 1 20  ? 47.397 -21.762 14.735  1.00 46.02  ? 890  TYR A CD1   1 
ATOM   64   C  CD2   . TYR A 1 20  ? 49.118 -20.155 15.104  1.00 42.64  ? 890  TYR A CD2   1 
ATOM   65   C  CE1   . TYR A 1 20  ? 46.531 -21.023 15.527  1.00 43.57  ? 890  TYR A CE1   1 
ATOM   66   C  CE2   . TYR A 1 20  ? 48.262 -19.411 15.892  1.00 41.74  ? 890  TYR A CE2   1 
ATOM   67   C  CZ    . TYR A 1 20  ? 46.969 -19.848 16.101  1.00 49.70  ? 890  TYR A CZ    1 
ATOM   68   O  OH    . TYR A 1 20  ? 46.113 -19.112 16.892  1.00 41.89  ? 890  TYR A OH    1 
ATOM   69   H  H     . TYR A 1 20  ? 51.629 -22.417 15.347  1.00 41.14  ? 890  TYR A H     1 
ATOM   70   H  HA    . TYR A 1 20  ? 49.468 -23.935 14.656  1.00 40.86  ? 890  TYR A HA    1 
ATOM   71   H  HB2   . TYR A 1 20  ? 50.372 -21.574 13.377  1.00 41.14  ? 890  TYR A HB2   1 
ATOM   72   H  HB3   . TYR A 1 20  ? 49.148 -22.447 12.865  1.00 41.14  ? 890  TYR A HB3   1 
ATOM   73   H  HD1   . TYR A 1 20  ? 47.099 -22.553 14.348  1.00 55.16  ? 890  TYR A HD1   1 
ATOM   74   H  HD2   . TYR A 1 20  ? 49.988 -19.856 14.964  1.00 51.11  ? 890  TYR A HD2   1 
ATOM   75   H  HE1   . TYR A 1 20  ? 45.660 -21.317 15.669  1.00 52.23  ? 890  TYR A HE1   1 
ATOM   76   H  HE2   . TYR A 1 20  ? 48.556 -18.619 16.282  1.00 50.03  ? 890  TYR A HE2   1 
ATOM   77   H  HH    . TYR A 1 20  ? 45.865 -19.562 17.531  1.00 50.21  ? 890  TYR A HH    1 
ATOM   78   N  N     . PRO A 1 21  ? 50.428 -25.184 12.731  1.00 36.87  ? 891  PRO A N     1 
ATOM   79   C  CA    . PRO A 1 21  ? 51.144 -26.009 11.754  1.00 39.25  ? 891  PRO A CA    1 
ATOM   80   C  C     . PRO A 1 21  ? 51.521 -25.203 10.518  1.00 41.82  ? 891  PRO A C     1 
ATOM   81   O  O     . PRO A 1 21  ? 50.913 -24.165 10.260  1.00 36.54  ? 891  PRO A O     1 
ATOM   82   C  CB    . PRO A 1 21  ? 50.131 -27.105 11.406  1.00 38.39  ? 891  PRO A CB    1 
ATOM   83   C  CG    . PRO A 1 21  ? 48.803 -26.511 11.690  1.00 33.81  ? 891  PRO A CG    1 
ATOM   84   C  CD    . PRO A 1 21  ? 48.998 -25.531 12.817  1.00 43.25  ? 891  PRO A CD    1 
ATOM   85   H  HA    . PRO A 1 21  ? 51.945 -26.408 12.153  1.00 47.04  ? 891  PRO A HA    1 
ATOM   86   H  HB2   . PRO A 1 21  ? 50.209 -27.336 10.467  1.00 46.01  ? 891  PRO A HB2   1 
ATOM   87   H  HB3   . PRO A 1 21  ? 50.285 -27.882 11.965  1.00 46.01  ? 891  PRO A HB3   1 
ATOM   88   H  HG2   . PRO A 1 21  ? 48.478 -26.055 10.898  1.00 40.51  ? 891  PRO A HG2   1 
ATOM   89   H  HG3   . PRO A 1 21  ? 48.186 -27.211 11.955  1.00 40.51  ? 891  PRO A HG3   1 
ATOM   90   H  HD2   . PRO A 1 21  ? 48.451 -24.743 12.677  1.00 51.84  ? 891  PRO A HD2   1 
ATOM   91   H  HD3   . PRO A 1 21  ? 48.804 -25.952 13.668  1.00 51.84  ? 891  PRO A HD3   1 
ATOM   92   N  N     . SER A 1 22  ? 52.528 -25.660 9.782   1.00 37.32  ? 892  SER A N     1 
ATOM   93   C  CA    . SER A 1 22  ? 52.904 -25.024 8.527   1.00 35.86  ? 892  SER A CA    1 
ATOM   94   C  C     . SER A 1 22  ? 51.847 -25.350 7.483   1.00 33.34  ? 892  SER A C     1 
ATOM   95   O  O     . SER A 1 22  ? 51.069 -26.285 7.654   1.00 38.47  ? 892  SER A O     1 
ATOM   96   C  CB    . SER A 1 22  ? 54.271 -25.522 8.061   1.00 36.43  ? 892  SER A CB    1 
ATOM   97   O  OG    . SER A 1 22  ? 54.200 -26.876 7.654   1.00 37.78  ? 892  SER A OG    1 
ATOM   98   H  H     . SER A 1 22  ? 53.011 -26.341 9.989   1.00 44.73  ? 892  SER A H     1 
ATOM   99   H  HA    . SER A 1 22  ? 52.944 -24.052 8.645   1.00 42.98  ? 892  SER A HA    1 
ATOM   100  H  HB2   . SER A 1 22  ? 54.565 -24.982 7.311   1.00 43.66  ? 892  SER A HB2   1 
ATOM   101  H  HB3   . SER A 1 22  ? 54.902 -25.445 8.794   1.00 43.66  ? 892  SER A HB3   1 
ATOM   102  H  HG    . SER A 1 22  ? 53.434 -27.155 7.740   1.00 45.28  ? 892  SER A HG    1 
ATOM   103  N  N     . SER A 1 23  ? 51.820 -24.584 6.399   1.00 33.86  ? 893  SER A N     1 
ATOM   104  C  CA    . SER A 1 23  ? 50.838 -24.813 5.349   1.00 38.93  ? 893  SER A CA    1 
ATOM   105  C  C     . SER A 1 23  ? 51.058 -26.186 4.719   1.00 40.84  ? 893  SER A C     1 
ATOM   106  O  O     . SER A 1 23  ? 50.106 -26.857 4.326   1.00 41.90  ? 893  SER A O     1 
ATOM   107  C  CB    . SER A 1 23  ? 50.916 -23.715 4.287   1.00 38.54  ? 893  SER A CB    1 
ATOM   108  O  OG    . SER A 1 23  ? 52.130 -23.791 3.566   1.00 35.94  ? 893  SER A OG    1 
ATOM   109  H  H     . SER A 1 23  ? 52.356 -23.929 6.249   1.00 40.58  ? 893  SER A H     1 
ATOM   110  H  HA    . SER A 1 23  ? 49.939 -24.797 5.739   1.00 46.66  ? 893  SER A HA    1 
ATOM   111  H  HB2   . SER A 1 23  ? 50.176 -23.821 3.669   1.00 46.19  ? 893  SER A HB2   1 
ATOM   112  H  HB3   . SER A 1 23  ? 50.862 -22.850 4.723   1.00 46.19  ? 893  SER A HB3   1 
ATOM   113  H  HG    . SER A 1 23  ? 52.159 -23.197 3.001   1.00 43.07  ? 893  SER A HG    1 
ATOM   114  N  N     . ALA A 1 24  ? 52.317 -26.602 4.630   1.00 37.84  ? 894  ALA A N     1 
ATOM   115  C  CA    . ALA A 1 24  ? 52.650 -27.917 4.092   1.00 39.93  ? 894  ALA A CA    1 
ATOM   116  C  C     . ALA A 1 24  ? 52.059 -29.013 4.971   1.00 38.44  ? 894  ALA A C     1 
ATOM   117  O  O     . ALA A 1 24  ? 51.616 -30.049 4.478   1.00 38.69  ? 894  ALA A O     1 
ATOM   118  C  CB    . ALA A 1 24  ? 54.156 -28.082 3.984   1.00 42.25  ? 894  ALA A CB    1 
ATOM   119  H  H     . ALA A 1 24  ? 53.000 -26.140 4.876   1.00 45.36  ? 894  ALA A H     1 
ATOM   120  H  HA    . ALA A 1 24  ? 52.267 -28.004 3.194   1.00 47.87  ? 894  ALA A HA    1 
ATOM   121  H  HB1   . ALA A 1 24  ? 54.350 -28.953 3.628   1.00 50.65  ? 894  ALA A HB1   1 
ATOM   122  H  HB2   . ALA A 1 24  ? 54.503 -27.404 3.399   1.00 50.65  ? 894  ALA A HB2   1 
ATOM   123  H  HB3   . ALA A 1 24  ? 54.543 -27.991 4.858   1.00 50.65  ? 894  ALA A HB3   1 
ATOM   124  N  N     . GLU A 1 25  ? 52.059 -28.781 6.279   1.00 37.63  ? 895  GLU A N     1 
ATOM   125  C  CA    . GLU A 1 25  ? 51.492 -29.734 7.222   1.00 48.69  ? 895  GLU A CA    1 
ATOM   126  C  C     . GLU A 1 25  ? 49.974 -29.765 7.095   1.00 44.21  ? 895  GLU A C     1 
ATOM   127  O  O     . GLU A 1 25  ? 49.363 -30.827 7.171   1.00 35.80  ? 895  GLU A O     1 
ATOM   128  C  CB    . GLU A 1 25  ? 51.903 -29.383 8.653   1.00 43.55  ? 895  GLU A CB    1 
ATOM   129  C  CG    . GLU A 1 25  ? 53.304 -29.848 9.020   1.00 44.22  ? 895  GLU A CG    1 
ATOM   130  C  CD    . GLU A 1 25  ? 53.739 -29.380 10.397  1.00 55.45  ? 895  GLU A CD    1 
ATOM   131  O  OE1   . GLU A 1 25  ? 53.277 -28.306 10.838  1.00 41.72  ? 895  GLU A OE1   1 
ATOM   132  O  OE2   . GLU A 1 25  ? 54.542 -30.087 11.040  1.00 46.62  ? 895  GLU A OE2   1 
ATOM   133  H  H     . GLU A 1 25  ? 52.384 -28.074 6.646   1.00 45.10  ? 895  GLU A H     1 
ATOM   134  H  HA    . GLU A 1 25  ? 51.833 -30.630 7.017   1.00 58.38  ? 895  GLU A HA    1 
ATOM   135  H  HB2   . GLU A 1 25  ? 51.873 -28.420 8.760   1.00 52.20  ? 895  GLU A HB2   1 
ATOM   136  H  HB3   . GLU A 1 25  ? 51.281 -29.802 9.269   1.00 52.20  ? 895  GLU A HB3   1 
ATOM   137  H  HG2   . GLU A 1 25  ? 53.328 -30.818 9.012   1.00 53.01  ? 895  GLU A HG2   1 
ATOM   138  H  HG3   . GLU A 1 25  ? 53.934 -29.496 8.371   1.00 53.01  ? 895  GLU A HG3   1 
ATOM   139  N  N     . VAL A 1 26  ? 49.367 -28.600 6.893   1.00 41.43  ? 896  VAL A N     1 
ATOM   140  C  CA    . VAL A 1 26  ? 47.921 -28.522 6.724   1.00 43.49  ? 896  VAL A CA    1 
ATOM   141  C  C     . VAL A 1 26  ? 47.505 -29.282 5.470   1.00 39.96  ? 896  VAL A C     1 
ATOM   142  O  O     . VAL A 1 26  ? 46.537 -30.038 5.482   1.00 40.61  ? 896  VAL A O     1 
ATOM   143  C  CB    . VAL A 1 26  ? 47.434 -27.061 6.621   1.00 41.20  ? 896  VAL A CB    1 
ATOM   144  C  CG1   . VAL A 1 26  ? 45.946 -27.018 6.303   1.00 36.36  ? 896  VAL A CG1   1 
ATOM   145  C  CG2   . VAL A 1 26  ? 47.725 -26.312 7.912   1.00 35.68  ? 896  VAL A CG2   1 
ATOM   146  H  H     . VAL A 1 26  ? 49.769 -27.841 6.851   1.00 49.65  ? 896  VAL A H     1 
ATOM   147  H  HA    . VAL A 1 26  ? 47.483 -28.939 7.495   1.00 52.13  ? 896  VAL A HA    1 
ATOM   148  H  HB    . VAL A 1 26  ? 47.914 -26.613 5.893   1.00 49.38  ? 896  VAL A HB    1 
ATOM   149  H  HG11  . VAL A 1 26  ? 45.666 -26.101 6.244   1.00 43.57  ? 896  VAL A HG11  1 
ATOM   150  H  HG12  . VAL A 1 26  ? 45.793 -27.462 5.466   1.00 43.57  ? 896  VAL A HG12  1 
ATOM   151  H  HG13  . VAL A 1 26  ? 45.464 -27.463 7.003   1.00 43.57  ? 896  VAL A HG13  1 
ATOM   152  H  HG21  . VAL A 1 26  ? 47.414 -25.408 7.825   1.00 42.76  ? 896  VAL A HG21  1 
ATOM   153  H  HG22  . VAL A 1 26  ? 47.269 -26.747 8.635   1.00 42.76  ? 896  VAL A HG22  1 
ATOM   154  H  HG23  . VAL A 1 26  ? 48.672 -26.319 8.070   1.00 42.76  ? 896  VAL A HG23  1 
ATOM   155  N  N     . LEU A 1 27  ? 48.253 -29.082 4.391   1.00 38.24  ? 897  LEU A N     1 
ATOM   156  C  CA    . LEU A 1 27  ? 47.947 -29.712 3.114   1.00 45.22  ? 897  LEU A CA    1 
ATOM   157  C  C     . LEU A 1 27  ? 48.100 -31.227 3.213   1.00 49.19  ? 897  LEU A C     1 
ATOM   158  O  O     . LEU A 1 27  ? 47.244 -31.977 2.748   1.00 43.30  ? 897  LEU A O     1 
ATOM   159  C  CB    . LEU A 1 27  ? 48.859 -29.146 2.021   1.00 48.12  ? 897  LEU A CB    1 
ATOM   160  C  CG    . LEU A 1 27  ? 48.812 -29.809 0.641   1.00 70.82  ? 897  LEU A CG    1 
ATOM   161  C  CD1   . LEU A 1 27  ? 47.386 -30.088 0.194   1.00 71.99  ? 897  LEU A CD1   1 
ATOM   162  C  CD2   . LEU A 1 27  ? 49.533 -28.942 -0.382  1.00 58.34  ? 897  LEU A CD2   1 
ATOM   163  H  H     . LEU A 1 27  ? 48.951 -28.580 4.373   1.00 45.83  ? 897  LEU A H     1 
ATOM   164  H  HA    . LEU A 1 27  ? 47.019 -29.513 2.870   1.00 54.20  ? 897  LEU A HA    1 
ATOM   165  H  HB2   . LEU A 1 27  ? 48.630 -28.212 1.895   1.00 57.69  ? 897  LEU A HB2   1 
ATOM   166  H  HB3   . LEU A 1 27  ? 49.775 -29.208 2.334   1.00 57.69  ? 897  LEU A HB3   1 
ATOM   167  H  HG    . LEU A 1 27  ? 49.278 -30.659 0.688   1.00 84.93  ? 897  LEU A HG    1 
ATOM   168  H  HD11  . LEU A 1 27  ? 47.405 -30.502 -0.672  1.00 86.33  ? 897  LEU A HD11  1 
ATOM   169  H  HD12  . LEU A 1 27  ? 46.969 -30.676 0.829   1.00 86.33  ? 897  LEU A HD12  1 
ATOM   170  H  HD13  . LEU A 1 27  ? 46.905 -29.259 0.150   1.00 86.33  ? 897  LEU A HD13  1 
ATOM   171  H  HD21  . LEU A 1 27  ? 49.493 -29.372 -1.239  1.00 69.95  ? 897  LEU A HD21  1 
ATOM   172  H  HD22  . LEU A 1 27  ? 49.100 -28.086 -0.424  1.00 69.95  ? 897  LEU A HD22  1 
ATOM   173  H  HD23  . LEU A 1 27  ? 50.447 -28.834 -0.110  1.00 69.95  ? 897  LEU A HD23  1 
ATOM   174  N  N     . LYS A 1 28  ? 49.187 -31.674 3.831   1.00 37.34  ? 898  LYS A N     1 
ATOM   175  C  CA    . LYS A 1 28  ? 49.448 -33.102 3.981   1.00 45.48  ? 898  LYS A CA    1 
ATOM   176  C  C     . LYS A 1 28  ? 48.322 -33.764 4.773   1.00 49.39  ? 898  LYS A C     1 
ATOM   177  O  O     . LYS A 1 28  ? 47.934 -34.897 4.492   1.00 44.67  ? 898  LYS A O     1 
ATOM   178  C  CB    . LYS A 1 28  ? 50.796 -33.330 4.672   1.00 53.17  ? 898  LYS A CB    1 
ATOM   179  C  CG    . LYS A 1 28  ? 51.307 -34.766 4.603   1.00 60.10  ? 898  LYS A CG    1 
ATOM   180  C  CD    . LYS A 1 28  ? 52.705 -34.882 5.202   1.00 69.41  ? 898  LYS A CD    1 
ATOM   181  C  CE    . LYS A 1 28  ? 53.167 -36.330 5.309   1.00 70.11  ? 898  LYS A CE    1 
ATOM   182  N  NZ    . LYS A 1 28  ? 53.255 -37.005 3.985   1.00 59.72  ? 898  LYS A NZ    1 
ATOM   183  H  H     . LYS A 1 28  ? 49.793 -31.168 4.174   1.00 44.75  ? 898  LYS A H     1 
ATOM   184  H  HA    . LYS A 1 28  ? 49.484 -33.517 3.094   1.00 54.52  ? 898  LYS A HA    1 
ATOM   185  H  HB2   . LYS A 1 28  ? 51.460 -32.761 4.252   1.00 63.75  ? 898  LYS A HB2   1 
ATOM   186  H  HB3   . LYS A 1 28  ? 50.708 -33.093 5.608   1.00 63.75  ? 898  LYS A HB3   1 
ATOM   187  H  HG2   . LYS A 1 28  ? 50.712 -35.344 5.106   1.00 72.07  ? 898  LYS A HG2   1 
ATOM   188  H  HG3   . LYS A 1 28  ? 51.348 -35.049 3.676   1.00 72.07  ? 898  LYS A HG3   1 
ATOM   189  H  HD2   . LYS A 1 28  ? 53.333 -34.406 4.637   1.00 83.23  ? 898  LYS A HD2   1 
ATOM   190  H  HD3   . LYS A 1 28  ? 52.702 -34.500 6.093   1.00 83.23  ? 898  LYS A HD3   1 
ATOM   191  H  HE2   . LYS A 1 28  ? 54.048 -36.351 5.716   1.00 84.07  ? 898  LYS A HE2   1 
ATOM   192  H  HE3   . LYS A 1 28  ? 52.536 -36.823 5.856   1.00 84.07  ? 898  LYS A HE3   1 
ATOM   193  H  HZ1   . LYS A 1 28  ? 52.457 -37.006 3.591   1.00 71.61  ? 898  LYS A HZ1   1 
ATOM   194  H  HZ2   . LYS A 1 28  ? 53.835 -36.576 3.463   1.00 71.61  ? 898  LYS A HZ2   1 
ATOM   195  H  HZ3   . LYS A 1 28  ? 53.527 -37.846 4.090   1.00 71.61  ? 898  LYS A HZ3   1 
ATOM   196  N  N     . ALA A 1 29  ? 47.791 -33.045 5.755   1.00 49.40  ? 899  ALA A N     1 
ATOM   197  C  CA    . ALA A 1 29  ? 46.705 -33.560 6.580   1.00 54.92  ? 899  ALA A CA    1 
ATOM   198  C  C     . ALA A 1 29  ? 45.417 -33.713 5.775   1.00 54.73  ? 899  ALA A C     1 
ATOM   199  O  O     . ALA A 1 29  ? 44.638 -34.635 6.014   1.00 52.63  ? 899  ALA A O     1 
ATOM   200  C  CB    . ALA A 1 29  ? 46.475 -32.649 7.775   1.00 58.21  ? 899  ALA A CB    1 
ATOM   201  H  H     . ALA A 1 29  ? 48.044 -32.250 5.966   1.00 59.22  ? 899  ALA A H     1 
ATOM   202  H  HA    . ALA A 1 29  ? 46.956 -34.445 6.919   1.00 65.84  ? 899  ALA A HA    1 
ATOM   203  H  HB1   . ALA A 1 29  ? 45.757 -33.005 8.304   1.00 69.80  ? 899  ALA A HB1   1 
ATOM   204  H  HB2   . ALA A 1 29  ? 47.279 -32.610 8.297   1.00 69.80  ? 899  ALA A HB2   1 
ATOM   205  H  HB3   . ALA A 1 29  ? 46.245 -31.772 7.459   1.00 69.80  ? 899  ALA A HB3   1 
ATOM   206  N  N     . CYS A 1 30  ? 45.191 -32.809 4.826   1.00 37.62  ? 900  CYS A N     1 
ATOM   207  C  CA    . CYS A 1 30  ? 43.984 -32.855 4.005   1.00 54.97  ? 900  CYS A CA    1 
ATOM   208  C  C     . CYS A 1 30  ? 44.035 -33.989 2.983   1.00 67.46  ? 900  CYS A C     1 
ATOM   209  O  O     . CYS A 1 30  ? 43.001 -34.414 2.468   1.00 56.89  ? 900  CYS A O     1 
ATOM   210  C  CB    . CYS A 1 30  ? 43.779 -31.526 3.275   1.00 57.33  ? 900  CYS A CB    1 
ATOM   211  S  SG    . CYS A 1 30  ? 43.419 -30.122 4.354   1.00 49.04  ? 900  CYS A SG    1 
ATOM   212  H  H     . CYS A 1 30  ? 45.721 -32.159 4.637   1.00 45.09  ? 900  CYS A H     1 
ATOM   213  H  HA    . CYS A 1 30  ? 43.209 -33.005 4.585   1.00 65.90  ? 900  CYS A HA    1 
ATOM   214  H  HB2   . CYS A 1 30  ? 44.587 -31.317 2.780   1.00 68.74  ? 900  CYS A HB2   1 
ATOM   215  H  HB3   . CYS A 1 30  ? 43.036 -31.622 2.659   1.00 68.74  ? 900  CYS A HB3   1 
ATOM   216  H  HG    . CYS A 1 30  ? 44.334 -29.969 5.115   1.00 58.79  ? 900  CYS A HG    1 
ATOM   217  N  N     . ARG A 1 31  ? 45.236 -34.476 2.692   1.00 68.72  ? 901  ARG A N     1 
ATOM   218  C  CA    . ARG A 1 31  ? 45.410 -35.490 1.657   1.00 84.30  ? 901  ARG A CA    1 
ATOM   219  C  C     . ARG A 1 31  ? 45.082 -36.903 2.141   1.00 87.08  ? 901  ARG A C     1 
ATOM   220  O  O     . ARG A 1 31  ? 45.070 -37.844 1.346   1.00 97.40  ? 901  ARG A O     1 
ATOM   221  C  CB    . ARG A 1 31  ? 46.828 -35.433 1.082   1.00 85.50  ? 901  ARG A CB    1 
ATOM   222  C  CG    . ARG A 1 31  ? 47.079 -34.193 0.236   1.00 93.02  ? 901  ARG A CG    1 
ATOM   223  C  CD    . ARG A 1 31  ? 48.309 -34.331 -0.645  1.00 100.72 ? 901  ARG A CD    1 
ATOM   224  N  NE    . ARG A 1 31  ? 48.577 -33.100 -1.385  1.00 94.92  ? 901  ARG A NE    1 
ATOM   225  C  CZ    . ARG A 1 31  ? 47.879 -32.692 -2.442  1.00 101.93 ? 901  ARG A CZ    1 
ATOM   226  N  NH1   . ARG A 1 31  ? 46.860 -33.414 -2.892  1.00 103.78 ? 901  ARG A NH1   1 
ATOM   227  N  NH2   . ARG A 1 31  ? 48.196 -31.556 -3.049  1.00 94.19  ? 901  ARG A NH2   1 
ATOM   228  H  H     . ARG A 1 31  ? 45.967 -34.237 3.078   1.00 82.41  ? 901  ARG A H     1 
ATOM   229  H  HA    . ARG A 1 31  ? 44.792 -35.286 0.925   1.00 101.10 ? 901  ARG A HA    1 
ATOM   230  H  HB2   . ARG A 1 31  ? 47.465 -35.429 1.814   1.00 102.54 ? 901  ARG A HB2   1 
ATOM   231  H  HB3   . ARG A 1 31  ? 46.972 -36.211 0.522   1.00 102.54 ? 901  ARG A HB3   1 
ATOM   232  H  HG2   . ARG A 1 31  ? 46.312 -34.042 -0.339  1.00 111.57 ? 901  ARG A HG2   1 
ATOM   233  H  HG3   . ARG A 1 31  ? 47.211 -33.431 0.821   1.00 111.57 ? 901  ARG A HG3   1 
ATOM   234  H  HD2   . ARG A 1 31  ? 49.080 -34.526 -0.090  1.00 120.80 ? 901  ARG A HD2   1 
ATOM   235  H  HD3   . ARG A 1 31  ? 48.166 -35.046 -1.285  1.00 120.80 ? 901  ARG A HD3   1 
ATOM   236  H  HE    . ARG A 1 31  ? 49.228 -32.606 -1.119  1.00 113.84 ? 901  ARG A HE    1 
ATOM   237  H  HH11  . ARG A 1 31  ? 46.650 -34.151 -2.501  1.00 124.48 ? 901  ARG A HH11  1 
ATOM   238  H  HH12  . ARG A 1 31  ? 46.412 -33.146 -3.575  1.00 124.48 ? 901  ARG A HH12  1 
ATOM   239  H  HH21  . ARG A 1 31  ? 48.855 -31.084 -2.761  1.00 112.97 ? 901  ARG A HH21  1 
ATOM   240  H  HH22  . ARG A 1 31  ? 47.744 -31.293 -3.732  1.00 112.97 ? 901  ARG A HH22  1 
ATOM   241  N  N     . ASN A 1 32  ? 44.813 -37.053 3.435   1.00 85.11  ? 902  ASN A N     1 
ATOM   242  C  CA    . ASN A 1 32  ? 44.352 -38.332 3.966   1.00 98.95  ? 902  ASN A CA    1 
ATOM   243  C  C     . ASN A 1 32  ? 43.132 -38.834 3.196   1.00 105.50 ? 902  ASN A C     1 
ATOM   244  O  O     . ASN A 1 32  ? 41.996 -38.707 3.655   1.00 103.20 ? 902  ASN A O     1 
ATOM   245  C  CB    . ASN A 1 32  ? 44.008 -38.219 5.455   1.00 97.76  ? 902  ASN A CB    1 
ATOM   246  C  CG    . ASN A 1 32  ? 45.241 -38.121 6.350   1.00 107.33 ? 902  ASN A CG    1 
ATOM   247  O  OD1   . ASN A 1 32  ? 45.129 -37.779 7.528   1.00 99.38  ? 902  ASN A OD1   1 
ATOM   248  N  ND2   . ASN A 1 32  ? 46.417 -38.414 5.798   1.00 105.51 ? 902  ASN A ND2   1 
ATOM   249  H  H     . ASN A 1 32  ? 44.888 -36.432 4.025   1.00 102.07 ? 902  ASN A H     1 
ATOM   250  H  HA    . ASN A 1 32  ? 45.067 -38.995 3.868   1.00 118.69 ? 902  ASN A HA    1 
ATOM   251  H  HB2   . ASN A 1 32  ? 43.473 -37.421 5.595   1.00 117.25 ? 902  ASN A HB2   1 
ATOM   252  H  HB3   . ASN A 1 32  ? 43.506 -39.004 5.723   1.00 117.25 ? 902  ASN A HB3   1 
ATOM   253  H  HD21  . ASN A 1 32  ? 47.136 -38.371 6.268   1.00 126.56 ? 902  ASN A HD21  1 
ATOM   254  H  HD22  . ASN A 1 32  ? 46.458 -38.647 4.971   1.00 126.56 ? 902  ASN A HD22  1 
ATOM   255  N  N     . ASN A 1 40  ? 44.810 -41.683 11.303  1.00 75.52  ? 910  ASN A N     1 
ATOM   256  C  CA    . ASN A 1 40  ? 45.906 -40.780 11.636  1.00 87.76  ? 910  ASN A CA    1 
ATOM   257  C  C     . ASN A 1 40  ? 45.461 -39.716 12.632  1.00 72.49  ? 910  ASN A C     1 
ATOM   258  O  O     . ASN A 1 40  ? 44.266 -39.523 12.852  1.00 50.55  ? 910  ASN A O     1 
ATOM   259  C  CB    . ASN A 1 40  ? 46.445 -40.109 10.373  1.00 94.34  ? 910  ASN A CB    1 
ATOM   260  C  CG    . ASN A 1 40  ? 46.575 -41.072 9.208   1.00 101.87 ? 910  ASN A CG    1 
ATOM   261  O  OD1   . ASN A 1 40  ? 46.428 -40.682 8.050   1.00 106.36 ? 910  ASN A OD1   1 
ATOM   262  N  ND2   . ASN A 1 40  ? 46.836 -42.340 9.510   1.00 100.63 ? 910  ASN A ND2   1 
ATOM   263  H  HA    . ASN A 1 40  ? 46.634 -41.295 12.043  1.00 105.26 ? 910  ASN A HA    1 
ATOM   264  H  HB2   . ASN A 1 40  ? 45.840 -39.399 10.109  1.00 113.16 ? 910  ASN A HB2   1 
ATOM   265  H  HB3   . ASN A 1 40  ? 47.324 -39.744 10.559  1.00 113.16 ? 910  ASN A HB3   1 
ATOM   266  H  HD21  . ASN A 1 40  ? 46.919 -42.923 8.883   1.00 120.70 ? 910  ASN A HD21  1 
ATOM   267  H  HD22  . ASN A 1 40  ? 46.923 -42.578 10.332  1.00 120.70 ? 910  ASN A HD22  1 
ATOM   268  N  N     . SER A 1 41  ? 46.429 -39.022 13.226  1.00 61.98  ? 911  SER A N     1 
ATOM   269  C  CA    . SER A 1 41  ? 46.136 -37.997 14.224  1.00 68.15  ? 911  SER A CA    1 
ATOM   270  C  C     . SER A 1 41  ? 45.609 -36.712 13.574  1.00 63.75  ? 911  SER A C     1 
ATOM   271  O  O     . SER A 1 41  ? 45.946 -36.395 12.432  1.00 45.14  ? 911  SER A O     1 
ATOM   272  C  CB    . SER A 1 41  ? 47.379 -37.700 15.074  1.00 44.00  ? 911  SER A CB    1 
ATOM   273  O  OG    . SER A 1 41  ? 48.481 -37.319 14.270  1.00 42.66  ? 911  SER A OG    1 
ATOM   274  H  H     . SER A 1 41  ? 47.268 -39.126 13.067  1.00 74.32  ? 911  SER A H     1 
ATOM   275  H  HA    . SER A 1 41  ? 45.438 -38.334 14.824  1.00 81.72  ? 911  SER A HA    1 
ATOM   276  H  HB2   . SER A 1 41  ? 47.174 -36.977 15.687  1.00 52.74  ? 911  SER A HB2   1 
ATOM   277  H  HB3   . SER A 1 41  ? 47.616 -38.497 15.573  1.00 52.74  ? 911  SER A HB3   1 
ATOM   278  H  HG    . SER A 1 41  ? 49.133 -37.165 14.742  1.00 51.13  ? 911  SER A HG    1 
ATOM   279  N  N     . SER A 1 42  ? 44.770 -35.990 14.311  1.00 43.92  ? 912  SER A N     1 
ATOM   280  C  CA    . SER A 1 42  ? 44.183 -34.741 13.841  1.00 54.10  ? 912  SER A CA    1 
ATOM   281  C  C     . SER A 1 42  ? 45.149 -33.586 14.074  1.00 58.05  ? 912  SER A C     1 
ATOM   282  O  O     . SER A 1 42  ? 45.987 -33.650 14.972  1.00 57.41  ? 912  SER A O     1 
ATOM   283  C  CB    . SER A 1 42  ? 42.878 -34.468 14.593  1.00 69.19  ? 912  SER A CB    1 
ATOM   284  O  OG    . SER A 1 42  ? 42.042 -35.611 14.611  1.00 67.93  ? 912  SER A OG    1 
ATOM   285  H  H     . SER A 1 42  ? 44.522 -36.208 15.105  1.00 52.64  ? 912  SER A H     1 
ATOM   286  H  HA    . SER A 1 42  ? 43.989 -34.804 12.882  1.00 64.86  ? 912  SER A HA    1 
ATOM   287  H  HB2   . SER A 1 42  ? 43.089 -34.219 15.507  1.00 82.97  ? 912  SER A HB2   1 
ATOM   288  H  HB3   . SER A 1 42  ? 42.408 -33.742 14.153  1.00 82.97  ? 912  SER A HB3   1 
ATOM   289  H  HG    . SER A 1 42  ? 41.349 -35.446 15.017  1.00 81.47  ? 912  SER A HG    1 
ATOM   290  N  N     . ILE A 1 43  ? 45.042 -32.532 13.270  1.00 42.96  ? 913  ILE A N     1 
ATOM   291  C  CA    . ILE A 1 43  ? 45.816 -31.322 13.533  1.00 56.94  ? 913  ILE A CA    1 
ATOM   292  C  C     . ILE A 1 43  ? 45.010 -30.355 14.400  1.00 59.90  ? 913  ILE A C     1 
ATOM   293  O  O     . ILE A 1 43  ? 45.573 -29.686 15.265  1.00 43.49  ? 913  ILE A O     1 
ATOM   294  C  CB    . ILE A 1 43  ? 46.315 -30.624 12.240  1.00 57.57  ? 913  ILE A CB    1 
ATOM   295  C  CG1   . ILE A 1 43  ? 45.156 -30.301 11.297  1.00 74.39  ? 913  ILE A CG1   1 
ATOM   296  C  CG2   . ILE A 1 43  ? 47.342 -31.497 11.532  1.00 64.65  ? 913  ILE A CG2   1 
ATOM   297  C  CD1   . ILE A 1 43  ? 45.579 -29.472 10.099  1.00 75.57  ? 913  ILE A CD1   1 
ATOM   298  H  H     . ILE A 1 43  ? 44.537 -32.491 12.575  1.00 51.50  ? 913  ILE A H     1 
ATOM   299  H  HA    . ILE A 1 43  ? 46.611 -31.576 14.047  1.00 68.27  ? 913  ILE A HA    1 
ATOM   300  H  HB    . ILE A 1 43  ? 46.744 -29.791 12.490  1.00 69.03  ? 913  ILE A HB    1 
ATOM   301  H  HG12  . ILE A 1 43  ? 44.777 -31.130 10.968  1.00 89.22  ? 913  ILE A HG12  1 
ATOM   302  H  HG13  . ILE A 1 43  ? 44.484 -29.800 11.785  1.00 89.22  ? 913  ILE A HG13  1 
ATOM   303  H  HG21  . ILE A 1 43  ? 47.637 -31.048 10.736  1.00 77.52  ? 913  ILE A HG21  1 
ATOM   304  H  HG22  . ILE A 1 43  ? 48.086 -31.643 12.120  1.00 77.52  ? 913  ILE A HG22  1 
ATOM   305  H  HG23  . ILE A 1 43  ? 46.935 -32.335 11.303  1.00 77.52  ? 913  ILE A HG23  1 
ATOM   306  H  HD11  . ILE A 1 43  ? 44.811 -29.303 9.549   1.00 90.63  ? 913  ILE A HD11  1 
ATOM   307  H  HD12  . ILE A 1 43  ? 45.949 -28.642 10.408  1.00 90.63  ? 913  ILE A HD12  1 
ATOM   308  H  HD13  . ILE A 1 43  ? 46.239 -29.959 9.600   1.00 90.63  ? 913  ILE A HD13  1 
ATOM   309  N  N     . LEU A 1 44  ? 43.698 -30.287 14.179  1.00 41.49  ? 914  LEU A N     1 
ATOM   310  C  CA    . LEU A 1 44  ? 42.827 -29.513 15.064  1.00 67.22  ? 914  LEU A CA    1 
ATOM   311  C  C     . LEU A 1 44  ? 41.383 -30.019 15.108  1.00 68.44  ? 914  LEU A C     1 
ATOM   312  O  O     . LEU A 1 44  ? 40.938 -30.764 14.236  1.00 66.73  ? 914  LEU A O     1 
ATOM   313  C  CB    . LEU A 1 44  ? 42.846 -28.023 14.698  1.00 72.79  ? 914  LEU A CB    1 
ATOM   314  C  CG    . LEU A 1 44  ? 42.518 -27.587 13.267  1.00 72.28  ? 914  LEU A CG    1 
ATOM   315  C  CD1   . LEU A 1 44  ? 41.411 -28.417 12.638  1.00 76.14  ? 914  LEU A CD1   1 
ATOM   316  C  CD2   . LEU A 1 44  ? 42.143 -26.110 13.268  1.00 80.12  ? 914  LEU A CD2   1 
ATOM   317  H  H     . LEU A 1 44  ? 43.289 -30.676 13.530  1.00 49.73  ? 914  LEU A H     1 
ATOM   318  H  HA    . LEU A 1 44  ? 43.182 -29.587 15.975  1.00 80.61  ? 914  LEU A HA    1 
ATOM   319  H  HB2   . LEU A 1 44  ? 42.211 -27.573 15.276  1.00 87.29  ? 914  LEU A HB2   1 
ATOM   320  H  HB3   . LEU A 1 44  ? 43.736 -27.687 14.892  1.00 87.29  ? 914  LEU A HB3   1 
ATOM   321  H  HG    . LEU A 1 44  ? 43.312 -27.690 12.720  1.00 86.68  ? 914  LEU A HG    1 
ATOM   322  H  HD11  . LEU A 1 44  ? 41.250 -28.099 11.747  1.00 91.31  ? 914  LEU A HD11  1 
ATOM   323  H  HD12  . LEU A 1 44  ? 41.686 -29.336 12.614  1.00 91.31  ? 914  LEU A HD12  1 
ATOM   324  H  HD13  . LEU A 1 44  ? 40.615 -28.327 13.167  1.00 91.31  ? 914  LEU A HD13  1 
ATOM   325  H  HD21  . LEU A 1 44  ? 41.938 -25.840 12.370  1.00 96.09  ? 914  LEU A HD21  1 
ATOM   326  H  HD22  . LEU A 1 44  ? 41.377 -25.983 13.831  1.00 96.09  ? 914  LEU A HD22  1 
ATOM   327  H  HD23  . LEU A 1 44  ? 42.885 -25.600 13.602  1.00 96.09  ? 914  LEU A HD23  1 
ATOM   328  N  N     . LEU A 1 45  ? 40.666 -29.606 16.149  1.00 60.88  ? 915  LEU A N     1 
ATOM   329  C  CA    . LEU A 1 45  ? 39.253 -29.924 16.301  1.00 70.27  ? 915  LEU A CA    1 
ATOM   330  C  C     . LEU A 1 45  ? 38.432 -28.963 15.450  1.00 94.15  ? 915  LEU A C     1 
ATOM   331  O  O     . LEU A 1 45  ? 38.305 -27.783 15.778  1.00 93.50  ? 915  LEU A O     1 
ATOM   332  C  CB    . LEU A 1 45  ? 38.849 -29.809 17.774  1.00 66.34  ? 915  LEU A CB    1 
ATOM   333  C  CG    . LEU A 1 45  ? 37.388 -30.079 18.145  1.00 65.40  ? 915  LEU A CG    1 
ATOM   334  C  CD1   . LEU A 1 45  ? 36.929 -31.433 17.635  1.00 69.10  ? 915  LEU A CD1   1 
ATOM   335  C  CD2   . LEU A 1 45  ? 37.211 -29.986 19.653  1.00 69.33  ? 915  LEU A CD2   1 
ATOM   336  H  H     . LEU A 1 45  ? 40.984 -29.132 16.792  1.00 73.00  ? 915  LEU A H     1 
ATOM   337  H  HA    . LEU A 1 45  ? 39.084 -30.840 15.997  1.00 84.27  ? 915  LEU A HA    1 
ATOM   338  H  HB2   . LEU A 1 45  ? 39.388 -30.436 18.281  1.00 79.56  ? 915  LEU A HB2   1 
ATOM   339  H  HB3   . LEU A 1 45  ? 39.052 -28.908 18.069  1.00 79.56  ? 915  LEU A HB3   1 
ATOM   340  H  HG    . LEU A 1 45  ? 36.829 -29.400 17.736  1.00 78.42  ? 915  LEU A HG    1 
ATOM   341  H  HD11  . LEU A 1 45  ? 36.012 -31.566 17.885  1.00 82.86  ? 915  LEU A HD11  1 
ATOM   342  H  HD12  . LEU A 1 45  ? 37.013 -31.451 16.678  1.00 82.86  ? 915  LEU A HD12  1 
ATOM   343  H  HD13  . LEU A 1 45  ? 37.478 -32.116 18.025  1.00 82.86  ? 915  LEU A HD13  1 
ATOM   344  H  HD21  . LEU A 1 45  ? 36.291 -30.158 19.870  1.00 83.14  ? 915  LEU A HD21  1 
ATOM   345  H  HD22  . LEU A 1 45  ? 37.774 -30.639 20.074  1.00 83.14  ? 915  LEU A HD22  1 
ATOM   346  H  HD23  . LEU A 1 45  ? 37.457 -29.105 19.943  1.00 83.14  ? 915  LEU A HD23  1 
ATOM   347  N  N     . ASP A 1 46  ? 37.881 -29.473 14.353  1.00 104.60 ? 916  ASP A N     1 
ATOM   348  C  CA    . ASP A 1 46  ? 37.138 -28.636 13.416  1.00 116.58 ? 916  ASP A CA    1 
ATOM   349  C  C     . ASP A 1 46  ? 35.677 -28.484 13.832  1.00 119.12 ? 916  ASP A C     1 
ATOM   350  O  O     . ASP A 1 46  ? 34.974 -27.599 13.342  1.00 119.37 ? 916  ASP A O     1 
ATOM   351  C  CB    . ASP A 1 46  ? 37.254 -29.174 11.986  1.00 119.88 ? 916  ASP A CB    1 
ATOM   352  C  CG    . ASP A 1 46  ? 37.097 -30.682 11.908  1.00 126.95 ? 916  ASP A CG    1 
ATOM   353  O  OD1   . ASP A 1 46  ? 36.187 -31.226 12.568  1.00 127.42 ? 916  ASP A OD1   1 
ATOM   354  O  OD2   . ASP A 1 46  ? 37.892 -31.322 11.187  1.00 124.75 ? 916  ASP A OD2   1 
ATOM   355  H  H     . ASP A 1 46  ? 37.922 -30.301 14.128  1.00 125.47 ? 916  ASP A H     1 
ATOM   356  H  HA    . ASP A 1 46  ? 37.536 -27.740 13.423  1.00 139.84 ? 916  ASP A HA    1 
ATOM   357  H  HB2   . ASP A 1 46  ? 36.561 -28.772 11.439  1.00 143.80 ? 916  ASP A HB2   1 
ATOM   358  H  HB3   . ASP A 1 46  ? 38.129 -28.946 11.633  1.00 143.80 ? 916  ASP A HB3   1 
ATOM   359  N  N     . LYS A 1 47  ? 35.219 -29.347 14.734  1.00 125.98 ? 917  LYS A N     1 
ATOM   360  C  CA    . LYS A 1 47  ? 33.973 -29.090 15.436  1.00 119.93 ? 917  LYS A CA    1 
ATOM   361  C  C     . LYS A 1 47  ? 34.212 -27.819 16.231  1.00 111.23 ? 917  LYS A C     1 
ATOM   362  O  O     . LYS A 1 47  ? 35.197 -27.719 16.961  1.00 109.41 ? 917  LYS A O     1 
ATOM   363  C  CB    . LYS A 1 47  ? 33.615 -30.233 16.389  1.00 113.32 ? 917  LYS A CB    1 
ATOM   364  C  CG    . LYS A 1 47  ? 33.638 -31.625 15.773  1.00 112.72 ? 917  LYS A CG    1 
ATOM   365  C  CD    . LYS A 1 47  ? 32.660 -31.754 14.619  1.00 117.40 ? 917  LYS A CD    1 
ATOM   366  C  CE    . LYS A 1 47  ? 31.619 -32.829 14.895  1.00 121.08 ? 917  LYS A CE    1 
ATOM   367  N  NZ    . LYS A 1 47  ? 30.762 -33.095 13.708  1.00 117.04 ? 917  LYS A NZ    1 
ATOM   368  H  H     . LYS A 1 47  ? 35.609 -30.081 14.954  1.00 151.12 ? 917  LYS A H     1 
ATOM   369  H  HA    . LYS A 1 47  ? 33.240 -28.949 14.801  1.00 143.86 ? 917  LYS A HA    1 
ATOM   370  H  HB2   . LYS A 1 47  ? 34.247 -30.230 17.125  1.00 135.93 ? 917  LYS A HB2   1 
ATOM   371  H  HB3   . LYS A 1 47  ? 32.720 -30.081 16.730  1.00 135.93 ? 917  LYS A HB3   1 
ATOM   372  H  HG2   . LYS A 1 47  ? 34.529 -31.808 15.435  1.00 135.21 ? 917  LYS A HG2   1 
ATOM   373  H  HG3   . LYS A 1 47  ? 33.396 -32.277 16.449  1.00 135.21 ? 917  LYS A HG3   1 
ATOM   374  H  HD2   . LYS A 1 47  ? 32.199 -30.910 14.492  1.00 140.82 ? 917  LYS A HD2   1 
ATOM   375  H  HD3   . LYS A 1 47  ? 33.143 -31.999 13.814  1.00 140.82 ? 917  LYS A HD3   1 
ATOM   376  H  HE2   . LYS A 1 47  ? 32.069 -33.654 15.134  1.00 145.24 ? 917  LYS A HE2   1 
ATOM   377  H  HE3   . LYS A 1 47  ? 31.047 -32.538 15.622  1.00 145.24 ? 917  LYS A HE3   1 
ATOM   378  H  HZ1   . LYS A 1 47  ? 30.165 -33.727 13.900  1.00 140.39 ? 917  LYS A HZ1   1 
ATOM   379  H  HZ2   . LYS A 1 47  ? 30.332 -32.353 13.470  1.00 140.39 ? 917  LYS A HZ2   1 
ATOM   380  H  HZ3   . LYS A 1 47  ? 31.264 -33.370 13.026  1.00 140.39 ? 917  LYS A HZ3   1 
ATOM   381  N  N     . CYS A 1 48  ? 33.332 -26.839 16.082  1.00 106.06 ? 918  CYS A N     1 
ATOM   382  C  CA    . CYS A 1 48  ? 33.512 -25.567 16.767  1.00 97.93  ? 918  CYS A CA    1 
ATOM   383  C  C     . CYS A 1 48  ? 32.249 -25.164 17.508  1.00 94.34  ? 918  CYS A C     1 
ATOM   384  O  O     . CYS A 1 48  ? 31.141 -25.387 17.022  1.00 98.72  ? 918  CYS A O     1 
ATOM   385  C  CB    . CYS A 1 48  ? 33.911 -24.477 15.771  1.00 92.73  ? 918  CYS A CB    1 
ATOM   386  S  SG    . CYS A 1 48  ? 35.684 -24.129 15.738  1.00 114.84 ? 918  CYS A SG    1 
ATOM   387  H  H     . CYS A 1 48  ? 32.625 -26.884 15.594  1.00 127.22 ? 918  CYS A H     1 
ATOM   388  H  HA    . CYS A 1 48  ? 34.233 -25.657 17.424  1.00 117.46 ? 918  CYS A HA    1 
ATOM   389  H  HB2   . CYS A 1 48  ? 33.647 -24.756 14.881  1.00 111.23 ? 918  CYS A HB2   1 
ATOM   390  H  HB3   . CYS A 1 48  ? 33.452 -23.655 16.007  1.00 111.23 ? 918  CYS A HB3   1 
ATOM   391  H  HG    . CYS A 1 48  ? 36.273 -25.129 15.433  1.00 137.76 ? 918  CYS A HG    1 
ATOM   392  N  N     . PRO A 1 49  ? 32.413 -24.563 18.694  1.00 87.17  ? 919  PRO A N     1 
ATOM   393  C  CA    . PRO A 1 49  ? 31.236 -24.149 19.460  1.00 85.73  ? 919  PRO A CA    1 
ATOM   394  C  C     . PRO A 1 49  ? 30.465 -23.078 18.695  1.00 88.34  ? 919  PRO A C     1 
ATOM   395  O  O     . PRO A 1 49  ? 31.026 -22.020 18.403  1.00 75.80  ? 919  PRO A O     1 
ATOM   396  C  CB    . PRO A 1 49  ? 31.827 -23.573 20.755  1.00 74.36  ? 919  PRO A CB    1 
ATOM   397  C  CG    . PRO A 1 49  ? 33.309 -23.819 20.696  1.00 74.54  ? 919  PRO A CG    1 
ATOM   398  C  CD    . PRO A 1 49  ? 33.665 -24.053 19.274  1.00 84.97  ? 919  PRO A CD    1 
ATOM   399  H  HA    . PRO A 1 49  ? 30.655 -24.912 19.661  1.00 102.82 ? 919  PRO A HA    1 
ATOM   400  H  HB2   . PRO A 1 49  ? 31.643 -22.622 20.798  1.00 89.17  ? 919  PRO A HB2   1 
ATOM   401  H  HB3   . PRO A 1 49  ? 31.439 -24.029 21.518  1.00 89.17  ? 919  PRO A HB3   1 
ATOM   402  H  HG2   . PRO A 1 49  ? 33.776 -23.039 21.036  1.00 89.39  ? 919  PRO A HG2   1 
ATOM   403  H  HG3   . PRO A 1 49  ? 33.525 -24.599 21.230  1.00 89.39  ? 919  PRO A HG3   1 
ATOM   404  H  HD2   . PRO A 1 49  ? 33.921 -23.220 18.847  1.00 101.90 ? 919  PRO A HD2   1 
ATOM   405  H  HD3   . PRO A 1 49  ? 34.367 -24.719 19.205  1.00 101.90 ? 919  PRO A HD3   1 
ATOM   406  N  N     . PRO A 1 50  ? 29.195 -23.352 18.361  1.00 88.85  ? 920  PRO A N     1 
ATOM   407  C  CA    . PRO A 1 50  ? 28.392 -22.437 17.544  1.00 83.03  ? 920  PRO A CA    1 
ATOM   408  C  C     . PRO A 1 50  ? 27.919 -21.207 18.318  1.00 78.91  ? 920  PRO A C     1 
ATOM   409  O  O     . PRO A 1 50  ? 27.600 -21.307 19.502  1.00 66.28  ? 920  PRO A O     1 
ATOM   410  C  CB    . PRO A 1 50  ? 27.205 -23.304 17.119  1.00 85.11  ? 920  PRO A CB    1 
ATOM   411  C  CG    . PRO A 1 50  ? 27.062 -24.304 18.210  1.00 94.28  ? 920  PRO A CG    1 
ATOM   412  C  CD    . PRO A 1 50  ? 28.447 -24.567 18.732  1.00 92.77  ? 920  PRO A CD    1 
ATOM   413  H  HA    . PRO A 1 50  ? 28.892 -22.154 16.750  1.00 99.58  ? 920  PRO A HA    1 
ATOM   414  H  HB2   . PRO A 1 50  ? 26.408 -22.756 17.046  1.00 102.07 ? 920  PRO A HB2   1 
ATOM   415  H  HB3   . PRO A 1 50  ? 27.403 -23.740 16.275  1.00 102.07 ? 920  PRO A HB3   1 
ATOM   416  H  HG2   . PRO A 1 50  ? 26.499 -23.938 18.911  1.00 113.08 ? 920  PRO A HG2   1 
ATOM   417  H  HG3   . PRO A 1 50  ? 26.673 -25.118 17.854  1.00 113.08 ? 920  PRO A HG3   1 
ATOM   418  H  HD2   . PRO A 1 50  ? 28.431 -24.672 19.696  1.00 111.27 ? 920  PRO A HD2   1 
ATOM   419  H  HD3   . PRO A 1 50  ? 28.830 -25.345 18.296  1.00 111.27 ? 920  PRO A HD3   1 
ATOM   420  N  N     . PRO A 1 51  ? 27.868 -20.051 17.644  1.00 65.00  ? 921  PRO A N     1 
ATOM   421  C  CA    . PRO A 1 51  ? 27.542 -18.771 18.282  1.00 68.67  ? 921  PRO A CA    1 
ATOM   422  C  C     . PRO A 1 51  ? 26.138 -18.742 18.883  1.00 79.74  ? 921  PRO A C     1 
ATOM   423  O  O     . PRO A 1 51  ? 25.235 -19.414 18.386  1.00 74.76  ? 921  PRO A O     1 
ATOM   424  C  CB    . PRO A 1 51  ? 27.654 -17.766 17.130  1.00 59.27  ? 921  PRO A CB    1 
ATOM   425  C  CG    . PRO A 1 51  ? 27.455 -18.571 15.895  1.00 52.73  ? 921  PRO A CG    1 
ATOM   426  C  CD    . PRO A 1 51  ? 28.038 -19.917 16.188  1.00 69.32  ? 921  PRO A CD    1 
ATOM   427  H  HA    . PRO A 1 51  ? 28.201 -18.552 18.974  1.00 82.35  ? 921  PRO A HA    1 
ATOM   428  H  HB2   . PRO A 1 51  ? 26.963 -17.091 17.215  1.00 71.07  ? 921  PRO A HB2   1 
ATOM   429  H  HB3   . PRO A 1 51  ? 28.535 -17.359 17.135  1.00 71.07  ? 921  PRO A HB3   1 
ATOM   430  H  HG2   . PRO A 1 51  ? 26.506 -18.644 15.705  1.00 63.22  ? 921  PRO A HG2   1 
ATOM   431  H  HG3   . PRO A 1 51  ? 27.920 -18.151 15.155  1.00 63.22  ? 921  PRO A HG3   1 
ATOM   432  H  HD2   . PRO A 1 51  ? 27.541 -20.609 15.724  1.00 83.13  ? 921  PRO A HD2   1 
ATOM   433  H  HD3   . PRO A 1 51  ? 28.979 -19.936 15.954  1.00 83.13  ? 921  PRO A HD3   1 
ATOM   434  N  N     . ARG A 1 52  ? 25.974 -17.969 19.952  1.00 63.79  ? 922  ARG A N     1 
ATOM   435  C  CA    . ARG A 1 52  ? 24.677 -17.793 20.595  1.00 66.95  ? 922  ARG A CA    1 
ATOM   436  C  C     . ARG A 1 52  ? 24.655 -16.440 21.308  1.00 71.21  ? 922  ARG A C     1 
ATOM   437  O  O     . ARG A 1 52  ? 25.703 -15.941 21.720  1.00 66.53  ? 922  ARG A O     1 
ATOM   438  C  CB    . ARG A 1 52  ? 24.420 -18.925 21.591  1.00 49.94  ? 922  ARG A CB    1 
ATOM   439  C  CG    . ARG A 1 52  ? 23.011 -18.941 22.156  1.00 76.53  ? 922  ARG A CG    1 
ATOM   440  C  CD    . ARG A 1 52  ? 22.762 -20.168 23.015  1.00 94.04  ? 922  ARG A CD    1 
ATOM   441  N  NE    . ARG A 1 52  ? 23.784 -20.330 24.048  1.00 100.23 ? 922  ARG A NE    1 
ATOM   442  C  CZ    . ARG A 1 52  ? 24.489 -21.441 24.250  1.00 98.54  ? 922  ARG A CZ    1 
ATOM   443  N  NH1   . ARG A 1 52  ? 24.291 -22.515 23.495  1.00 96.24  ? 922  ARG A NH1   1 
ATOM   444  N  NH2   . ARG A 1 52  ? 25.396 -21.479 25.216  1.00 95.66  ? 922  ARG A NH2   1 
ATOM   445  H  H     . ARG A 1 52  ? 26.609 -17.528 20.329  1.00 76.50  ? 922  ARG A H     1 
ATOM   446  H  HA    . ARG A 1 52  ? 23.968 -17.803 19.919  1.00 80.29  ? 922  ARG A HA    1 
ATOM   447  H  HB2   . ARG A 1 52  ? 24.570 -19.773 21.145  1.00 59.88  ? 922  ARG A HB2   1 
ATOM   448  H  HB3   . ARG A 1 52  ? 25.036 -18.833 22.335  1.00 59.88  ? 922  ARG A HB3   1 
ATOM   449  H  HG2   . ARG A 1 52  ? 22.879 -18.154 22.706  1.00 91.78  ? 922  ARG A HG2   1 
ATOM   450  H  HG3   . ARG A 1 52  ? 22.374 -18.950 21.424  1.00 91.78  ? 922  ARG A HG3   1 
ATOM   451  H  HD2   . ARG A 1 52  ? 21.901 -20.081 23.453  1.00 112.79 ? 922  ARG A HD2   1 
ATOM   452  H  HD3   . ARG A 1 52  ? 22.773 -20.958 22.453  1.00 112.79 ? 922  ARG A HD3   1 
ATOM   453  H  HE    . ARG A 1 52  ? 23.941 -19.659 24.563  1.00 120.22 ? 922  ARG A HE    1 
ATOM   454  H  HH11  . ARG A 1 52  ? 23.705 -22.498 22.866  1.00 115.44 ? 922  ARG A HH11  1 
ATOM   455  H  HH12  . ARG A 1 52  ? 24.751 -23.229 23.634  1.00 115.44 ? 922  ARG A HH12  1 
ATOM   456  H  HH21  . ARG A 1 52  ? 25.528 -20.788 25.709  1.00 114.74 ? 922  ARG A HH21  1 
ATOM   457  H  HH22  . ARG A 1 52  ? 25.851 -22.197 25.350  1.00 114.74 ? 922  ARG A HH22  1 
ATOM   458  N  N     . PRO A 1 53  ? 23.464 -15.835 21.454  1.00 61.52  ? 923  PRO A N     1 
ATOM   459  C  CA    . PRO A 1 53  ? 23.410 -14.521 22.104  1.00 52.26  ? 923  PRO A CA    1 
ATOM   460  C  C     . PRO A 1 53  ? 23.651 -14.645 23.605  1.00 55.60  ? 923  PRO A C     1 
ATOM   461  O  O     . PRO A 1 53  ? 23.045 -15.503 24.248  1.00 54.37  ? 923  PRO A O     1 
ATOM   462  C  CB    . PRO A 1 53  ? 21.978 -14.039 21.821  1.00 50.74  ? 923  PRO A CB    1 
ATOM   463  C  CG    . PRO A 1 53  ? 21.385 -15.035 20.848  1.00 50.45  ? 923  PRO A CG    1 
ATOM   464  C  CD    . PRO A 1 53  ? 22.125 -16.306 21.071  1.00 55.30  ? 923  PRO A CD    1 
ATOM   465  H  HA    . PRO A 1 53  ? 24.059 -13.903 21.707  1.00 62.66  ? 923  PRO A HA    1 
ATOM   466  H  HB2   . PRO A 1 53  ? 21.470 -14.027 22.647  1.00 60.83  ? 923  PRO A HB2   1 
ATOM   467  H  HB3   . PRO A 1 53  ? 22.006 -13.153 21.426  1.00 60.83  ? 923  PRO A HB3   1 
ATOM   468  H  HG2   . PRO A 1 53  ? 20.441 -15.151 21.037  1.00 60.48  ? 923  PRO A HG2   1 
ATOM   469  H  HG3   . PRO A 1 53  ? 21.515 -14.719 19.940  1.00 60.48  ? 923  PRO A HG3   1 
ATOM   470  H  HD2   . PRO A 1 53  ? 21.722 -16.812 21.795  1.00 66.31  ? 923  PRO A HD2   1 
ATOM   471  H  HD3   . PRO A 1 53  ? 22.167 -16.824 20.252  1.00 66.31  ? 923  PRO A HD3   1 
ATOM   472  N  N     . PRO A 1 54  ? 24.524 -13.795 24.161  1.00 56.43  ? 924  PRO A N     1 
ATOM   473  C  CA    . PRO A 1 54  ? 24.914 -13.936 25.567  1.00 51.74  ? 924  PRO A CA    1 
ATOM   474  C  C     . PRO A 1 54  ? 23.747 -13.707 26.516  1.00 40.38  ? 924  PRO A C     1 
ATOM   475  O  O     . PRO A 1 54  ? 22.833 -12.945 26.202  1.00 56.46  ? 924  PRO A O     1 
ATOM   476  C  CB    . PRO A 1 54  ? 25.960 -12.832 25.748  1.00 47.62  ? 924  PRO A CB    1 
ATOM   477  C  CG    . PRO A 1 54  ? 25.573 -11.795 24.751  1.00 44.60  ? 924  PRO A CG    1 
ATOM   478  C  CD    . PRO A 1 54  ? 25.073 -12.567 23.560  1.00 41.08  ? 924  PRO A CD    1 
ATOM   479  H  HA    . PRO A 1 54  ? 25.319 -14.813 25.735  1.00 62.03  ? 924  PRO A HA    1 
ATOM   480  H  HB2   . PRO A 1 54  ? 25.914 -12.479 26.650  1.00 57.09  ? 924  PRO A HB2   1 
ATOM   481  H  HB3   . PRO A 1 54  ? 26.844 -13.182 25.557  1.00 57.09  ? 924  PRO A HB3   1 
ATOM   482  H  HG2   . PRO A 1 54  ? 24.871 -11.235 25.117  1.00 53.46  ? 924  PRO A HG2   1 
ATOM   483  H  HG3   . PRO A 1 54  ? 26.349 -11.263 24.514  1.00 53.46  ? 924  PRO A HG3   1 
ATOM   484  H  HD2   . PRO A 1 54  ? 24.375 -12.071 23.105  1.00 49.24  ? 924  PRO A HD2   1 
ATOM   485  H  HD3   . PRO A 1 54  ? 25.807 -12.780 22.963  1.00 49.24  ? 924  PRO A HD3   1 
ATOM   486  N  N     . SER A 1 55  ? 23.775 -14.363 27.669  1.00 47.61  ? 925  SER A N     1 
ATOM   487  C  CA    . SER A 1 55  ? 22.786 -14.095 28.701  1.00 47.83  ? 925  SER A CA    1 
ATOM   488  C  C     . SER A 1 55  ? 23.112 -12.745 29.319  1.00 51.56  ? 925  SER A C     1 
ATOM   489  O  O     . SER A 1 55  ? 24.168 -12.173 29.046  1.00 43.73  ? 925  SER A O     1 
ATOM   490  C  CB    . SER A 1 55  ? 22.802 -15.186 29.771  1.00 63.58  ? 925  SER A CB    1 
ATOM   491  O  OG    . SER A 1 55  ? 24.053 -15.230 30.434  1.00 66.76  ? 925  SER A OG    1 
ATOM   492  H  H     . SER A 1 55  ? 24.353 -14.965 27.877  1.00 57.08  ? 925  SER A H     1 
ATOM   493  H  HA    . SER A 1 55  ? 21.891 -14.054 28.303  1.00 57.34  ? 925  SER A HA    1 
ATOM   494  H  HB2   . SER A 1 55  ? 22.107 -15.000 30.421  1.00 76.24  ? 925  SER A HB2   1 
ATOM   495  H  HB3   . SER A 1 55  ? 22.639 -16.044 29.348  1.00 76.24  ? 925  SER A HB3   1 
ATOM   496  H  HG    . SER A 1 55  ? 24.554 -14.659 30.127  1.00 80.06  ? 925  SER A HG    1 
ATOM   497  N  N     . SER A 1 56  ? 22.211 -12.237 30.152  1.00 47.79  ? 926  SER A N     1 
ATOM   498  C  CA    . SER A 1 56  ? 22.411 -10.933 30.772  1.00 46.46  ? 926  SER A CA    1 
ATOM   499  C  C     . SER A 1 56  ? 23.728 -10.907 31.540  1.00 46.31  ? 926  SER A C     1 
ATOM   500  O  O     . SER A 1 56  ? 24.024 -11.825 32.306  1.00 49.83  ? 926  SER A O     1 
ATOM   501  C  CB    . SER A 1 56  ? 21.254 -10.601 31.711  1.00 64.02  ? 926  SER A CB    1 
ATOM   502  O  OG    . SER A 1 56  ? 21.250 -9.217  32.031  1.00 54.96  ? 926  SER A OG    1 
ATOM   503  H  H     . SER A 1 56  ? 21.477 -12.626 30.374  1.00 57.29  ? 926  SER A H     1 
ATOM   504  H  HA    . SER A 1 56  ? 22.448 -10.246 30.075  1.00 55.70  ? 926  SER A HA    1 
ATOM   505  H  HB2   . SER A 1 56  ? 20.418 -10.827 31.275  1.00 76.77  ? 926  SER A HB2   1 
ATOM   506  H  HB3   . SER A 1 56  ? 21.353 -11.114 32.528  1.00 76.77  ? 926  SER A HB3   1 
ATOM   507  H  HG    . SER A 1 56  ? 20.626 -9.048  32.535  1.00 65.90  ? 926  SER A HG    1 
ATOM   508  N  N     . PRO A 1 57  ? 24.526 -9.850  31.336  1.00 47.15  ? 927  PRO A N     1 
ATOM   509  C  CA    . PRO A 1 57  ? 25.854 -9.751  31.948  1.00 39.58  ? 927  PRO A CA    1 
ATOM   510  C  C     . PRO A 1 57  ? 25.870 -10.021 33.451  1.00 44.13  ? 927  PRO A C     1 
ATOM   511  O  O     . PRO A 1 57  ? 24.875 -9.815  34.149  1.00 42.67  ? 927  PRO A O     1 
ATOM   512  C  CB    . PRO A 1 57  ? 26.251 -8.300  31.673  1.00 40.19  ? 927  PRO A CB    1 
ATOM   513  C  CG    . PRO A 1 57  ? 25.548 -7.959  30.417  1.00 44.99  ? 927  PRO A CG    1 
ATOM   514  C  CD    . PRO A 1 57  ? 24.237 -8.695  30.467  1.00 50.64  ? 927  PRO A CD    1 
ATOM   515  H  HA    . PRO A 1 57  ? 26.484 -10.353 31.500  1.00 47.44  ? 927  PRO A HA    1 
ATOM   516  H  HB2   . PRO A 1 57  ? 25.952 -7.733  32.401  1.00 48.17  ? 927  PRO A HB2   1 
ATOM   517  H  HB3   . PRO A 1 57  ? 27.212 -8.238  31.559  1.00 48.17  ? 927  PRO A HB3   1 
ATOM   518  H  HG2   . PRO A 1 57  ? 25.400 -7.001  30.377  1.00 53.93  ? 927  PRO A HG2   1 
ATOM   519  H  HG3   . PRO A 1 57  ? 26.076 -8.255  29.659  1.00 53.93  ? 927  PRO A HG3   1 
ATOM   520  H  HD2   . PRO A 1 57  ? 23.551 -8.136  30.864  1.00 60.71  ? 927  PRO A HD2   1 
ATOM   521  H  HD3   . PRO A 1 57  ? 23.983 -8.994  29.580  1.00 60.71  ? 927  PRO A HD3   1 
ATOM   522  N  N     . TYR A 1 58  ? 27.015 -10.489 33.930  1.00 35.55  ? 928  TYR A N     1 
ATOM   523  C  CA    . TYR A 1 58  ? 27.258 -10.643 35.354  1.00 35.35  ? 928  TYR A CA    1 
ATOM   524  C  C     . TYR A 1 58  ? 28.506 -9.848  35.715  1.00 43.58  ? 928  TYR A C     1 
ATOM   525  O  O     . TYR A 1 58  ? 29.495 -9.888  34.986  1.00 43.94  ? 928  TYR A O     1 
ATOM   526  C  CB    . TYR A 1 58  ? 27.461 -12.113 35.715  1.00 38.91  ? 928  TYR A CB    1 
ATOM   527  C  CG    . TYR A 1 58  ? 27.650 -12.326 37.195  1.00 38.57  ? 928  TYR A CG    1 
ATOM   528  C  CD1   . TYR A 1 58  ? 26.593 -12.734 37.997  1.00 34.07  ? 928  TYR A CD1   1 
ATOM   529  C  CD2   . TYR A 1 58  ? 28.880 -12.093 37.798  1.00 43.42  ? 928  TYR A CD2   1 
ATOM   530  C  CE1   . TYR A 1 58  ? 26.760 -12.919 39.356  1.00 36.67  ? 928  TYR A CE1   1 
ATOM   531  C  CE2   . TYR A 1 58  ? 29.056 -12.276 39.155  1.00 51.00  ? 928  TYR A CE2   1 
ATOM   532  C  CZ    . TYR A 1 58  ? 27.992 -12.689 39.928  1.00 45.02  ? 928  TYR A CZ    1 
ATOM   533  O  OH    . TYR A 1 58  ? 28.157 -12.871 41.280  1.00 40.61  ? 928  TYR A OH    1 
ATOM   534  H  H     . TYR A 1 58  ? 27.680 -10.728 33.439  1.00 42.61  ? 928  TYR A H     1 
ATOM   535  H  HA    . TYR A 1 58  ? 26.498 -10.292 35.864  1.00 42.36  ? 928  TYR A HA    1 
ATOM   536  H  HB2   . TYR A 1 58  ? 26.680 -12.618 35.436  1.00 46.64  ? 928  TYR A HB2   1 
ATOM   537  H  HB3   . TYR A 1 58  ? 28.251 -12.445 35.260  1.00 46.64  ? 928  TYR A HB3   1 
ATOM   538  H  HD1   . TYR A 1 58  ? 25.761 -12.891 37.613  1.00 40.82  ? 928  TYR A HD1   1 
ATOM   539  H  HD2   . TYR A 1 58  ? 29.599 -11.815 37.277  1.00 52.04  ? 928  TYR A HD2   1 
ATOM   540  H  HE1   . TYR A 1 58  ? 26.044 -13.197 39.881  1.00 43.94  ? 928  TYR A HE1   1 
ATOM   541  H  HE2   . TYR A 1 58  ? 29.886 -12.121 39.545  1.00 61.15  ? 928  TYR A HE2   1 
ATOM   542  H  HH    . TYR A 1 58  ? 28.392 -12.168 41.631  1.00 48.68  ? 928  TYR A HH    1 
ATOM   543  N  N     . PRO A 1 59  ? 28.473 -9.126  36.846  1.00 48.31  ? 929  PRO A N     1 
ATOM   544  C  CA    . PRO A 1 59  ? 27.364 -9.063  37.804  1.00 44.48  ? 929  PRO A CA    1 
ATOM   545  C  C     . PRO A 1 59  ? 26.222 -8.179  37.319  1.00 34.27  ? 929  PRO A C     1 
ATOM   546  O  O     . PRO A 1 59  ? 26.455 -7.267  36.526  1.00 34.39  ? 929  PRO A O     1 
ATOM   547  C  CB    . PRO A 1 59  ? 28.016 -8.433  39.036  1.00 41.17  ? 929  PRO A CB    1 
ATOM   548  C  CG    . PRO A 1 59  ? 29.070 -7.550  38.473  1.00 58.22  ? 929  PRO A CG    1 
ATOM   549  C  CD    . PRO A 1 59  ? 29.600 -8.272  37.261  1.00 52.01  ? 929  PRO A CD    1 
ATOM   550  H  HA    . PRO A 1 59  ? 27.031 -9.959  38.021  1.00 53.32  ? 929  PRO A HA    1 
ATOM   551  H  HB2   . PRO A 1 59  ? 27.360 -7.917  39.530  1.00 49.35  ? 929  PRO A HB2   1 
ATOM   552  H  HB3   . PRO A 1 59  ? 28.406 -9.125  39.593  1.00 49.35  ? 929  PRO A HB3   1 
ATOM   553  H  HG2   . PRO A 1 59  ? 28.680 -6.698  38.219  1.00 69.81  ? 929  PRO A HG2   1 
ATOM   554  H  HG3   . PRO A 1 59  ? 29.773 -7.422  39.129  1.00 69.81  ? 929  PRO A HG3   1 
ATOM   555  H  HD2   . PRO A 1 59  ? 29.820 -7.639  36.560  1.00 62.36  ? 929  PRO A HD2   1 
ATOM   556  H  HD3   . PRO A 1 59  ? 30.366 -8.817  37.501  1.00 62.36  ? 929  PRO A HD3   1 
ATOM   557  N  N     . PRO A 1 60  ? 24.997 -8.444  37.796  1.00 40.97  ? 930  PRO A N     1 
ATOM   558  C  CA    . PRO A 1 60  ? 23.841 -7.607  37.462  1.00 24.68  ? 930  PRO A CA    1 
ATOM   559  C  C     . PRO A 1 60  ? 23.976 -6.208  38.053  1.00 31.13  ? 930  PRO A C     1 
ATOM   560  O  O     . PRO A 1 60  ? 24.678 -6.031  39.050  1.00 31.01  ? 930  PRO A O     1 
ATOM   561  C  CB    . PRO A 1 60  ? 22.672 -8.352  38.113  1.00 31.01  ? 930  PRO A CB    1 
ATOM   562  C  CG    . PRO A 1 60  ? 23.292 -9.118  39.233  1.00 36.73  ? 930  PRO A CG    1 
ATOM   563  C  CD    . PRO A 1 60  ? 24.641 -9.529  38.728  1.00 43.22  ? 930  PRO A CD    1 
ATOM   564  H  HA    . PRO A 1 60  ? 23.710 -7.555  36.493  1.00 29.56  ? 930  PRO A HA    1 
ATOM   565  H  HB2   . PRO A 1 60  ? 22.023 -7.714  38.450  1.00 37.15  ? 930  PRO A HB2   1 
ATOM   566  H  HB3   . PRO A 1 60  ? 22.265 -8.952  37.469  1.00 37.15  ? 930  PRO A HB3   1 
ATOM   567  H  HG2   . PRO A 1 60  ? 23.377 -8.547  40.013  1.00 44.02  ? 930  PRO A HG2   1 
ATOM   568  H  HG3   . PRO A 1 60  ? 22.750 -9.897  39.436  1.00 44.02  ? 930  PRO A HG3   1 
ATOM   569  H  HD2   . PRO A 1 60  ? 25.278 -9.572  39.458  1.00 51.81  ? 930  PRO A HD2   1 
ATOM   570  H  HD3   . PRO A 1 60  ? 24.583 -10.375 38.256  1.00 51.81  ? 930  PRO A HD3   1 
ATOM   571  N  N     . LEU A 1 61  ? 23.315 -5.231  37.441  1.00 31.26  ? 931  LEU A N     1 
ATOM   572  C  CA    . LEU A 1 61  ? 23.384 -3.844  37.896  1.00 27.01  ? 931  LEU A CA    1 
ATOM   573  C  C     . LEU A 1 61  ? 22.118 -3.470  38.653  1.00 30.65  ? 931  LEU A C     1 
ATOM   574  O  O     . LEU A 1 61  ? 21.015 -3.830  38.237  1.00 30.42  ? 931  LEU A O     1 
ATOM   575  C  CB    . LEU A 1 61  ? 23.546 -2.893  36.706  1.00 26.81  ? 931  LEU A CB    1 
ATOM   576  C  CG    . LEU A 1 61  ? 24.822 -3.007  35.870  1.00 29.95  ? 931  LEU A CG    1 
ATOM   577  C  CD1   . LEU A 1 61  ? 24.784 -2.003  34.721  1.00 30.99  ? 931  LEU A CD1   1 
ATOM   578  C  CD2   . LEU A 1 61  ? 26.063 -2.800  36.724  1.00 28.87  ? 931  LEU A CD2   1 
ATOM   579  H  H     . LEU A 1 61  ? 22.813 -5.346  36.752  1.00 37.45  ? 931  LEU A H     1 
ATOM   580  H  HA    . LEU A 1 61  ? 24.152 -3.732  38.494  1.00 32.36  ? 931  LEU A HA    1 
ATOM   581  H  HB2   . LEU A 1 61  ? 22.800 -3.037  36.104  1.00 32.12  ? 931  LEU A HB2   1 
ATOM   582  H  HB3   . LEU A 1 61  ? 23.510 -1.984  37.044  1.00 32.12  ? 931  LEU A HB3   1 
ATOM   583  H  HG    . LEU A 1 61  ? 24.868 -3.897  35.487  1.00 35.88  ? 931  LEU A HG    1 
ATOM   584  H  HD11  . LEU A 1 61  ? 25.590 -2.087  34.206  1.00 37.13  ? 931  LEU A HD11  1 
ATOM   585  H  HD12  . LEU A 1 61  ? 24.022 -2.189  34.168  1.00 37.13  ? 931  LEU A HD12  1 
ATOM   586  H  HD13  . LEU A 1 61  ? 24.718 -1.116  35.083  1.00 37.13  ? 931  LEU A HD13  1 
ATOM   587  H  HD21  . LEU A 1 61  ? 26.841 -2.879  36.168  1.00 34.59  ? 931  LEU A HD21  1 
ATOM   588  H  HD22  . LEU A 1 61  ? 26.028 -1.925  37.118  1.00 34.59  ? 931  LEU A HD22  1 
ATOM   589  H  HD23  . LEU A 1 61  ? 26.083 -3.469  37.412  1.00 34.59  ? 931  LEU A HD23  1 
ATOM   590  N  N     . PRO A 1 62  ? 22.269 -2.737  39.767  1.00 31.03  ? 932  PRO A N     1 
ATOM   591  C  CA    . PRO A 1 62  ? 21.098 -2.254  40.501  1.00 24.39  ? 932  PRO A CA    1 
ATOM   592  C  C     . PRO A 1 62  ? 20.452 -1.066  39.792  1.00 39.73  ? 932  PRO A C     1 
ATOM   593  O  O     . PRO A 1 62  ? 21.043 -0.496  38.875  1.00 31.55  ? 932  PRO A O     1 
ATOM   594  C  CB    . PRO A 1 62  ? 21.688 -1.825  41.847  1.00 30.47  ? 932  PRO A CB    1 
ATOM   595  C  CG    . PRO A 1 62  ? 23.077 -1.402  41.518  1.00 29.88  ? 932  PRO A CG    1 
ATOM   596  C  CD    . PRO A 1 62  ? 23.531 -2.308  40.400  1.00 34.59  ? 932  PRO A CD    1 
ATOM   597  H  HA    . PRO A 1 62  ? 20.442 -2.970  40.633  1.00 29.21  ? 932  PRO A HA    1 
ATOM   598  H  HB2   . PRO A 1 62  ? 21.177 -1.084  42.209  1.00 36.51  ? 932  PRO A HB2   1 
ATOM   599  H  HB3   . PRO A 1 62  ? 21.691 -2.577  42.460  1.00 36.51  ? 932  PRO A HB3   1 
ATOM   600  H  HG2   . PRO A 1 62  ? 23.075 -0.476  41.228  1.00 35.80  ? 932  PRO A HG2   1 
ATOM   601  H  HG3   . PRO A 1 62  ? 23.644 -1.513  42.298  1.00 35.80  ? 932  PRO A HG3   1 
ATOM   602  H  HD2   . PRO A 1 62  ? 24.076 -1.815  39.766  1.00 41.45  ? 932  PRO A HD2   1 
ATOM   603  H  HD3   . PRO A 1 62  ? 24.007 -3.073  40.757  1.00 41.45  ? 932  PRO A HD3   1 
ATOM   604  N  N     . LYS A 1 63  ? 19.251 -0.698  40.222  1.00 35.23  ? 933  LYS A N     1 
ATOM   605  C  CA    . LYS A 1 63  ? 18.497 0.377   39.589  1.00 36.94  ? 933  LYS A CA    1 
ATOM   606  C  C     . LYS A 1 63  ? 19.276 1.687   39.528  1.00 35.69  ? 933  LYS A C     1 
ATOM   607  O  O     . LYS A 1 63  ? 19.110 2.464   38.590  1.00 33.60  ? 933  LYS A O     1 
ATOM   608  C  CB    . LYS A 1 63  ? 17.184 0.606   40.340  1.00 37.34  ? 933  LYS A CB    1 
ATOM   609  C  CG    . LYS A 1 63  ? 16.263 -0.600  40.366  1.00 39.99  ? 933  LYS A CG    1 
ATOM   610  C  CD    . LYS A 1 63  ? 15.969 -1.106  38.965  1.00 49.22  ? 933  LYS A CD    1 
ATOM   611  C  CE    . LYS A 1 63  ? 14.882 -2.167  38.979  1.00 54.10  ? 933  LYS A CE    1 
ATOM   612  N  NZ    . LYS A 1 63  ? 14.592 -2.685  37.616  1.00 54.01  ? 933  LYS A NZ    1 
ATOM   613  H  H     . LYS A 1 63  ? 18.846 -1.061  40.888  1.00 42.22  ? 933  LYS A H     1 
ATOM   614  H  HA    . LYS A 1 63  ? 18.278 0.113   38.671  1.00 44.27  ? 933  LYS A HA    1 
ATOM   615  H  HB2   . LYS A 1 63  ? 17.388 0.842   41.258  1.00 44.76  ? 933  LYS A HB2   1 
ATOM   616  H  HB3   . LYS A 1 63  ? 16.705 1.334   39.913  1.00 44.76  ? 933  LYS A HB3   1 
ATOM   617  H  HG2   . LYS A 1 63  ? 16.687 -1.316  40.865  1.00 47.93  ? 933  LYS A HG2   1 
ATOM   618  H  HG3   . LYS A 1 63  ? 15.422 -0.352  40.782  1.00 47.93  ? 933  LYS A HG3   1 
ATOM   619  H  HD2   . LYS A 1 63  ? 15.667 -0.367  38.414  1.00 59.01  ? 933  LYS A HD2   1 
ATOM   620  H  HD3   . LYS A 1 63  ? 16.773 -1.498  38.591  1.00 59.01  ? 933  LYS A HD3   1 
ATOM   621  H  HE2   . LYS A 1 63  ? 15.170 -2.912  39.530  1.00 64.86  ? 933  LYS A HE2   1 
ATOM   622  H  HE3   . LYS A 1 63  ? 14.066 -1.783  39.336  1.00 64.86  ? 933  LYS A HE3   1 
ATOM   623  H  HZ1   . LYS A 1 63  ? 13.953 -3.303  37.655  1.00 64.76  ? 933  LYS A HZ1   1 
ATOM   624  H  HZ2   . LYS A 1 63  ? 14.319 -2.020  37.090  1.00 64.76  ? 933  LYS A HZ2   1 
ATOM   625  H  HZ3   . LYS A 1 63  ? 15.325 -3.048  37.266  1.00 64.76  ? 933  LYS A HZ3   1 
ATOM   626  N  N     . ASP A 1 64  ? 20.120 1.934   40.526  1.00 30.69  ? 934  ASP A N     1 
ATOM   627  C  CA    . ASP A 1 64  ? 20.837 3.206   40.624  1.00 30.06  ? 934  ASP A CA    1 
ATOM   628  C  C     . ASP A 1 64  ? 22.011 3.319   39.645  1.00 31.73  ? 934  ASP A C     1 
ATOM   629  O  O     . ASP A 1 64  ? 22.666 4.356   39.571  1.00 28.89  ? 934  ASP A O     1 
ATOM   630  C  CB    . ASP A 1 64  ? 21.335 3.423   42.056  1.00 38.27  ? 934  ASP A CB    1 
ATOM   631  C  CG    . ASP A 1 64  ? 22.248 2.309   42.528  1.00 48.89  ? 934  ASP A CG    1 
ATOM   632  O  OD1   . ASP A 1 64  ? 23.481 2.460   42.409  1.00 38.27  ? 934  ASP A OD1   1 
ATOM   633  O  OD2   . ASP A 1 64  ? 21.735 1.277   43.011  1.00 44.68  ? 934  ASP A OD2   1 
ATOM   634  H  H     . ASP A 1 64  ? 20.296 1.381   41.161  1.00 36.78  ? 934  ASP A H     1 
ATOM   635  H  HA    . ASP A 1 64  ? 20.212 3.931   40.417  1.00 36.01  ? 934  ASP A HA    1 
ATOM   636  H  HB2   . ASP A 1 64  ? 21.830 4.256   42.096  1.00 45.86  ? 934  ASP A HB2   1 
ATOM   637  H  HB3   . ASP A 1 64  ? 20.572 3.461   42.653  1.00 45.86  ? 934  ASP A HB3   1 
ATOM   638  N  N     . LYS A 1 65  ? 22.276 2.254   38.897  1.00 29.25  ? 935  LYS A N     1 
ATOM   639  C  CA    . LYS A 1 65  ? 23.349 2.273   37.909  1.00 35.09  ? 935  LYS A CA    1 
ATOM   640  C  C     . LYS A 1 65  ? 22.826 2.101   36.483  1.00 32.12  ? 935  LYS A C     1 
ATOM   641  O  O     . LYS A 1 65  ? 23.598 1.810   35.571  1.00 30.85  ? 935  LYS A O     1 
ATOM   642  C  CB    . LYS A 1 65  ? 24.387 1.191   38.226  1.00 30.12  ? 935  LYS A CB    1 
ATOM   643  C  CG    . LYS A 1 65  ? 25.251 1.523   39.434  1.00 36.80  ? 935  LYS A CG    1 
ATOM   644  C  CD    . LYS A 1 65  ? 26.417 0.561   39.608  1.00 46.51  ? 935  LYS A CD    1 
ATOM   645  C  CE    . LYS A 1 65  ? 27.196 0.880   40.881  1.00 54.69  ? 935  LYS A CE    1 
ATOM   646  N  NZ    . LYS A 1 65  ? 28.511 0.183   40.956  1.00 66.21  ? 935  LYS A NZ    1 
ATOM   647  H  H     . LYS A 1 65  ? 21.850 1.508   38.942  1.00 35.04  ? 935  LYS A H     1 
ATOM   648  H  HA    . LYS A 1 65  ? 23.801 3.141   37.956  1.00 42.05  ? 935  LYS A HA    1 
ATOM   649  H  HB2   . LYS A 1 65  ? 23.927 0.357   38.409  1.00 36.09  ? 935  LYS A HB2   1 
ATOM   650  H  HB3   . LYS A 1 65  ? 24.974 1.083   37.461  1.00 36.09  ? 935  LYS A HB3   1 
ATOM   651  H  HG2   . LYS A 1 65  ? 25.612 2.417   39.328  1.00 44.11  ? 935  LYS A HG2   1 
ATOM   652  H  HG3   . LYS A 1 65  ? 24.704 1.480   40.235  1.00 44.11  ? 935  LYS A HG3   1 
ATOM   653  H  HD2   . LYS A 1 65  ? 26.080 -0.346  39.674  1.00 55.76  ? 935  LYS A HD2   1 
ATOM   654  H  HD3   . LYS A 1 65  ? 27.019 0.643   38.852  1.00 55.76  ? 935  LYS A HD3   1 
ATOM   655  H  HE2   . LYS A 1 65  ? 27.362 1.835   40.917  1.00 65.57  ? 935  LYS A HE2   1 
ATOM   656  H  HE3   . LYS A 1 65  ? 26.669 0.606   41.649  1.00 65.57  ? 935  LYS A HE3   1 
ATOM   657  H  HZ1   . LYS A 1 65  ? 28.927 0.398   41.713  1.00 79.40  ? 935  LYS A HZ1   1 
ATOM   658  H  HZ2   . LYS A 1 65  ? 28.389 -0.699  40.934  1.00 79.40  ? 935  LYS A HZ2   1 
ATOM   659  H  HZ3   . LYS A 1 65  ? 29.021 0.421   40.267  1.00 79.40  ? 935  LYS A HZ3   1 
ATOM   660  N  N     . LEU A 1 66  ? 21.527 2.303   36.282  1.00 24.42  ? 936  LEU A N     1 
ATOM   661  C  CA    . LEU A 1 66  ? 20.927 2.053   34.970  1.00 29.16  ? 936  LEU A CA    1 
ATOM   662  C  C     . LEU A 1 66  ? 20.820 3.312   34.105  1.00 30.88  ? 936  LEU A C     1 
ATOM   663  O  O     . LEU A 1 66  ? 20.374 3.244   32.963  1.00 25.12  ? 936  LEU A O     1 
ATOM   664  C  CB    . LEU A 1 66  ? 19.545 1.413   35.117  1.00 30.45  ? 936  LEU A CB    1 
ATOM   665  C  CG    . LEU A 1 66  ? 19.454 0.085   35.875  1.00 33.95  ? 936  LEU A CG    1 
ATOM   666  C  CD1   . LEU A 1 66  ? 18.019 -0.407  35.846  1.00 26.66  ? 936  LEU A CD1   1 
ATOM   667  C  CD2   . LEU A 1 66  ? 20.394 -0.980  35.304  1.00 23.76  ? 936  LEU A CD2   1 
ATOM   668  H  H     . LEU A 1 66  ? 20.975 2.581   36.880  1.00 29.25  ? 936  LEU A H     1 
ATOM   669  H  HA    . LEU A 1 66  ? 21.495 1.415   34.489  1.00 34.94  ? 936  LEU A HA    1 
ATOM   670  H  HB2   . LEU A 1 66  ? 18.971 2.043   35.579  1.00 36.48  ? 936  LEU A HB2   1 
ATOM   671  H  HB3   . LEU A 1 66  ? 19.192 1.255   34.227  1.00 36.48  ? 936  LEU A HB3   1 
ATOM   672  H  HG    . LEU A 1 66  ? 19.700 0.235   36.802  1.00 40.69  ? 936  LEU A HG    1 
ATOM   673  H  HD11  . LEU A 1 66  ? 17.965 -1.239  36.322  1.00 31.93  ? 936  LEU A HD11  1 
ATOM   674  H  HD12  . LEU A 1 66  ? 17.456 0.248   36.265  1.00 31.93  ? 936  LEU A HD12  1 
ATOM   675  H  HD13  . LEU A 1 66  ? 17.751 -0.533  34.933  1.00 31.93  ? 936  LEU A HD13  1 
ATOM   676  H  HD21  . LEU A 1 66  ? 20.297 -1.787  35.814  1.00 28.46  ? 936  LEU A HD21  1 
ATOM   677  H  HD22  . LEU A 1 66  ? 20.161 -1.142  34.387  1.00 28.46  ? 936  LEU A HD22  1 
ATOM   678  H  HD23  . LEU A 1 66  ? 21.298 -0.662  35.362  1.00 28.46  ? 936  LEU A HD23  1 
ATOM   679  N  N     . ASN A 1 67  ? 21.217 4.457   34.648  1.00 22.66  ? 937  ASN A N     1 
ATOM   680  C  CA    . ASN A 1 67  ? 21.244 5.696   33.874  1.00 31.06  ? 937  ASN A CA    1 
ATOM   681  C  C     . ASN A 1 67  ? 22.601 6.389   33.987  1.00 26.26  ? 937  ASN A C     1 
ATOM   682  O  O     . ASN A 1 67  ? 22.694 7.520   34.467  1.00 28.30  ? 937  ASN A O     1 
ATOM   683  C  CB    . ASN A 1 67  ? 20.125 6.637   34.328  1.00 30.56  ? 937  ASN A CB    1 
ATOM   684  C  CG    . ASN A 1 67  ? 18.744 6.111   33.982  1.00 46.67  ? 937  ASN A CG    1 
ATOM   685  O  OD1   . ASN A 1 67  ? 18.297 6.216   32.841  1.00 46.76  ? 937  ASN A OD1   1 
ATOM   686  N  ND2   . ASN A 1 67  ? 18.057 5.547   34.970  1.00 46.97  ? 937  ASN A ND2   1 
ATOM   687  H  H     . ASN A 1 67  ? 21.477 4.546   35.463  1.00 27.13  ? 937  ASN A H     1 
ATOM   688  H  HA    . ASN A 1 67  ? 21.093 5.483   32.929  1.00 37.22  ? 937  ASN A HA    1 
ATOM   689  H  HB2   . ASN A 1 67  ? 20.174 6.745   35.291  1.00 36.62  ? 937  ASN A HB2   1 
ATOM   690  H  HB3   . ASN A 1 67  ? 20.237 7.496   33.892  1.00 36.62  ? 937  ASN A HB3   1 
ATOM   691  H  HD21  . ASN A 1 67  ? 17.270 5.234   34.822  1.00 56.31  ? 937  ASN A HD21  1 
ATOM   692  H  HD22  . ASN A 1 67  ? 18.400 5.495   35.757  1.00 56.31  ? 937  ASN A HD22  1 
ATOM   693  N  N     . PRO A 1 68  ? 23.663 5.706   33.534  1.00 29.68  ? 938  PRO A N     1 
ATOM   694  C  CA    . PRO A 1 68  ? 25.035 6.201   33.691  1.00 26.95  ? 938  PRO A CA    1 
ATOM   695  C  C     . PRO A 1 68  ? 25.327 7.437   32.845  1.00 27.05  ? 938  PRO A C     1 
ATOM   696  O  O     . PRO A 1 68  ? 24.729 7.608   31.782  1.00 25.52  ? 938  PRO A O     1 
ATOM   697  C  CB    . PRO A 1 68  ? 25.889 5.021   33.213  1.00 29.27  ? 938  PRO A CB    1 
ATOM   698  C  CG    . PRO A 1 68  ? 25.003 4.271   32.263  1.00 28.32  ? 938  PRO A CG    1 
ATOM   699  C  CD    . PRO A 1 68  ? 23.613 4.421   32.814  1.00 28.28  ? 938  PRO A CD    1 
ATOM   700  H  HA    . PRO A 1 68  ? 25.230 6.389   34.633  1.00 32.28  ? 938  PRO A HA    1 
ATOM   701  H  HB2   . PRO A 1 68  ? 26.679 5.351   32.758  1.00 35.07  ? 938  PRO A HB2   1 
ATOM   702  H  HB3   . PRO A 1 68  ? 26.133 4.464   33.969  1.00 35.07  ? 938  PRO A HB3   1 
ATOM   703  H  HG2   . PRO A 1 68  ? 25.065 4.664   31.379  1.00 33.93  ? 938  PRO A HG2   1 
ATOM   704  H  HG3   . PRO A 1 68  ? 25.264 3.337   32.242  1.00 33.93  ? 938  PRO A HG3   1 
ATOM   705  H  HD2   . PRO A 1 68  ? 22.966 4.463   32.092  1.00 33.89  ? 938  PRO A HD2   1 
ATOM   706  H  HD3   . PRO A 1 68  ? 23.413 3.697   33.429  1.00 33.89  ? 938  PRO A HD3   1 
ATOM   707  N  N     . PRO A 1 69  ? 26.243 8.297   33.315  1.00 31.93  ? 939  PRO A N     1 
ATOM   708  C  CA    . PRO A 1 69  ? 26.658 9.458   32.523  1.00 26.75  ? 939  PRO A CA    1 
ATOM   709  C  C     . PRO A 1 69  ? 27.482 9.015   31.323  1.00 29.21  ? 939  PRO A C     1 
ATOM   710  O  O     . PRO A 1 69  ? 28.076 7.937   31.353  1.00 25.82  ? 939  PRO A O     1 
ATOM   711  C  CB    . PRO A 1 69  ? 27.522 10.255  33.500  1.00 28.04  ? 939  PRO A CB    1 
ATOM   712  C  CG    . PRO A 1 69  ? 28.081 9.221   34.421  1.00 30.80  ? 939  PRO A CG    1 
ATOM   713  C  CD    . PRO A 1 69  ? 26.978 8.209   34.590  1.00 31.50  ? 939  PRO A CD    1 
ATOM   714  H  HA    . PRO A 1 69  ? 25.887 9.990   32.235  1.00 32.04  ? 939  PRO A HA    1 
ATOM   715  H  HB2   . PRO A 1 69  ? 28.231 10.709  33.019  1.00 33.59  ? 939  PRO A HB2   1 
ATOM   716  H  HB3   . PRO A 1 69  ? 26.972 10.889  33.986  1.00 33.59  ? 939  PRO A HB3   1 
ATOM   717  H  HG2   . PRO A 1 69  ? 28.863 8.812   34.018  1.00 36.91  ? 939  PRO A HG2   1 
ATOM   718  H  HG3   . PRO A 1 69  ? 28.306 9.628   35.272  1.00 36.91  ? 939  PRO A HG3   1 
ATOM   719  H  HD2   . PRO A 1 69  ? 27.349 7.321   34.706  1.00 37.74  ? 939  PRO A HD2   1 
ATOM   720  H  HD3   . PRO A 1 69  ? 26.403 8.456   35.330  1.00 37.74  ? 939  PRO A HD3   1 
ATOM   721  N  N     . THR A 1 70  ? 27.519 9.836   30.282  1.00 27.80  ? 940  THR A N     1 
ATOM   722  C  CA    . THR A 1 70  ? 28.207 9.466   29.055  1.00 28.31  ? 940  THR A CA    1 
ATOM   723  C  C     . THR A 1 70  ? 29.688 9.801   29.141  1.00 24.16  ? 940  THR A C     1 
ATOM   724  O  O     . THR A 1 70  ? 30.050 10.922  29.504  1.00 26.19  ? 940  THR A O     1 
ATOM   725  C  CB    . THR A 1 70  ? 27.603 10.200  27.844  1.00 40.20  ? 940  THR A CB    1 
ATOM   726  O  OG1   . THR A 1 70  ? 26.210 9.880   27.737  1.00 38.09  ? 940  THR A OG1   1 
ATOM   727  C  CG2   . THR A 1 70  ? 28.316 9.796   26.565  1.00 28.18  ? 940  THR A CG2   1 
ATOM   728  H  H     . THR A 1 70  ? 27.154 10.615  30.261  1.00 33.30  ? 940  THR A H     1 
ATOM   729  H  HA    . THR A 1 70  ? 28.116 8.502   28.909  1.00 33.92  ? 940  THR A HA    1 
ATOM   730  H  HB    . THR A 1 70  ? 27.705 11.157  27.963  1.00 48.19  ? 940  THR A HB    1 
ATOM   731  H  HG1   . THR A 1 70  ? 25.815 10.112  28.417  1.00 45.65  ? 940  THR A HG1   1 
ATOM   732  H  HG21  . THR A 1 70  ? 27.932 10.259  25.816  1.00 33.76  ? 940  THR A HG21  1 
ATOM   733  H  HG22  . THR A 1 70  ? 29.248 10.019  26.625  1.00 33.76  ? 940  THR A HG22  1 
ATOM   734  H  HG23  . THR A 1 70  ? 28.229 8.851   26.425  1.00 33.76  ? 940  THR A HG23  1 
ATOM   735  N  N     . PRO A 1 71  ? 30.556 8.829   28.815  1.00 23.37  ? 941  PRO A N     1 
ATOM   736  C  CA    . PRO A 1 71  ? 31.986 9.141   28.754  1.00 20.73  ? 941  PRO A CA    1 
ATOM   737  C  C     . PRO A 1 71  ? 32.226 10.301  27.791  1.00 27.23  ? 941  PRO A C     1 
ATOM   738  O  O     . PRO A 1 71  ? 31.775 10.247  26.646  1.00 22.93  ? 941  PRO A O     1 
ATOM   739  C  CB    . PRO A 1 71  ? 32.606 7.844   28.230  1.00 25.29  ? 941  PRO A CB    1 
ATOM   740  C  CG    . PRO A 1 71  ? 31.648 6.778   28.650  1.00 26.30  ? 941  PRO A CG    1 
ATOM   741  C  CD    . PRO A 1 71  ? 30.290 7.408   28.530  1.00 24.30  ? 941  PRO A CD    1 
ATOM   742  H  HA    . PRO A 1 71  ? 32.342 9.354   29.642  1.00 24.82  ? 941  PRO A HA    1 
ATOM   743  H  HB2   . PRO A 1 71  ? 32.679 7.882   27.263  1.00 30.29  ? 941  PRO A HB2   1 
ATOM   744  H  HB3   . PRO A 1 71  ? 33.476 7.707   28.637  1.00 30.29  ? 941  PRO A HB3   1 
ATOM   745  H  HG2   . PRO A 1 71  ? 31.726 6.015   28.055  1.00 31.50  ? 941  PRO A HG2   1 
ATOM   746  H  HG3   . PRO A 1 71  ? 31.828 6.519   29.567  1.00 31.50  ? 941  PRO A HG3   1 
ATOM   747  H  HD2   . PRO A 1 71  ? 29.945 7.301   27.630  1.00 29.10  ? 941  PRO A HD2   1 
ATOM   748  H  HD3   . PRO A 1 71  ? 29.685 7.037   29.192  1.00 29.10  ? 941  PRO A HD3   1 
ATOM   749  N  N     . SER A 1 72  ? 32.913 11.339  28.257  1.00 25.69  ? 942  SER A N     1 
ATOM   750  C  CA    . SER A 1 72  ? 33.045 12.572  27.490  1.00 27.60  ? 942  SER A CA    1 
ATOM   751  C  C     . SER A 1 72  ? 34.490 13.040  27.373  1.00 31.24  ? 942  SER A C     1 
ATOM   752  O  O     . SER A 1 72  ? 35.293 12.875  28.288  1.00 26.23  ? 942  SER A O     1 
ATOM   753  C  CB    . SER A 1 72  ? 32.218 13.683  28.140  1.00 31.68  ? 942  SER A CB    1 
ATOM   754  O  OG    . SER A 1 72  ? 30.874 13.281  28.325  1.00 25.22  ? 942  SER A OG    1 
ATOM   755  H  H     . SER A 1 72  ? 33.314 11.354  29.018  1.00 30.77  ? 942  SER A H     1 
ATOM   756  H  HA    . SER A 1 72  ? 32.699 12.424  26.585  1.00 33.07  ? 942  SER A HA    1 
ATOM   757  H  HB2   . SER A 1 72  ? 32.604 13.897  29.004  1.00 37.95  ? 942  SER A HB2   1 
ATOM   758  H  HB3   . SER A 1 72  ? 32.237 14.465  27.567  1.00 37.95  ? 942  SER A HB3   1 
ATOM   759  H  HG    . SER A 1 72  ? 30.770 12.516  28.049  1.00 30.21  ? 942  SER A HG    1 
ATOM   760  N  N     . ILE A 1 73  ? 34.805 13.635  26.231  1.00 31.50  ? 943  ILE A N     1 
ATOM   761  C  CA    . ILE A 1 73  ? 36.086 14.283  26.017  1.00 28.01  ? 943  ILE A CA    1 
ATOM   762  C  C     . ILE A 1 73  ? 35.796 15.721  25.628  1.00 26.60  ? 943  ILE A C     1 
ATOM   763  O  O     . ILE A 1 73  ? 35.028 15.968  24.707  1.00 25.03  ? 943  ILE A O     1 
ATOM   764  C  CB    . ILE A 1 73  ? 36.876 13.602  24.896  1.00 34.94  ? 943  ILE A CB    1 
ATOM   765  C  CG1   . ILE A 1 73  ? 37.260 12.179  25.315  1.00 30.36  ? 943  ILE A CG1   1 
ATOM   766  C  CG2   . ILE A 1 73  ? 38.113 14.419  24.544  1.00 30.53  ? 943  ILE A CG2   1 
ATOM   767  C  CD1   . ILE A 1 73  ? 37.976 11.402  24.236  1.00 39.75  ? 943  ILE A CD1   1 
ATOM   768  H  H     . ILE A 1 73  ? 34.280 13.676  25.551  1.00 37.75  ? 943  ILE A H     1 
ATOM   769  H  HA    . ILE A 1 73  ? 36.616 14.271  26.842  1.00 33.56  ? 943  ILE A HA    1 
ATOM   770  H  HB    . ILE A 1 73  ? 36.310 13.548  24.110  1.00 41.87  ? 943  ILE A HB    1 
ATOM   771  H  HG12  . ILE A 1 73  ? 37.847 12.228  26.085  1.00 36.38  ? 943  ILE A HG12  1 
ATOM   772  H  HG13  . ILE A 1 73  ? 36.454 11.693  25.546  1.00 36.38  ? 943  ILE A HG13  1 
ATOM   773  H  HG21  . ILE A 1 73  ? 38.591 13.973  23.840  1.00 36.58  ? 943  ILE A HG21  1 
ATOM   774  H  HG22  . ILE A 1 73  ? 37.838 15.291  24.252  1.00 36.58  ? 943  ILE A HG22  1 
ATOM   775  H  HG23  . ILE A 1 73  ? 38.670 14.494  25.322  1.00 36.58  ? 943  ILE A HG23  1 
ATOM   776  H  HD11  . ILE A 1 73  ? 38.184 10.526  24.569  1.00 47.64  ? 943  ILE A HD11  1 
ATOM   777  H  HD12  . ILE A 1 73  ? 37.404 11.334  23.468  1.00 47.64  ? 943  ILE A HD12  1 
ATOM   778  H  HD13  . ILE A 1 73  ? 38.785 11.864  24.003  1.00 47.64  ? 943  ILE A HD13  1 
ATOM   779  N  N     . TYR A 1 74  ? 36.400 16.671  26.331  1.00 26.83  ? 944  TYR A N     1 
ATOM   780  C  CA    . TYR A 1 74  ? 36.135 18.082  26.082  1.00 27.07  ? 944  TYR A CA    1 
ATOM   781  C  C     . TYR A 1 74  ? 37.325 18.733  25.385  1.00 28.14  ? 944  TYR A C     1 
ATOM   782  O  O     . TYR A 1 74  ? 38.305 19.100  26.028  1.00 35.86  ? 944  TYR A O     1 
ATOM   783  C  CB    . TYR A 1 74  ? 35.825 18.799  27.399  1.00 30.59  ? 944  TYR A CB    1 
ATOM   784  C  CG    . TYR A 1 74  ? 34.689 18.164  28.177  1.00 30.13  ? 944  TYR A CG    1 
ATOM   785  C  CD1   . TYR A 1 74  ? 33.367 18.519  27.930  1.00 25.18  ? 944  TYR A CD1   1 
ATOM   786  C  CD2   . TYR A 1 74  ? 34.939 17.207  29.154  1.00 31.73  ? 944  TYR A CD2   1 
ATOM   787  C  CE1   . TYR A 1 74  ? 32.327 17.940  28.637  1.00 26.67  ? 944  TYR A CE1   1 
ATOM   788  C  CE2   . TYR A 1 74  ? 33.908 16.622  29.864  1.00 31.45  ? 944  TYR A CE2   1 
ATOM   789  C  CZ    . TYR A 1 74  ? 32.604 16.992  29.603  1.00 31.04  ? 944  TYR A CZ    1 
ATOM   790  O  OH    . TYR A 1 74  ? 31.577 16.409  30.309  1.00 27.01  ? 944  TYR A OH    1 
ATOM   791  H  H     . TYR A 1 74  ? 36.968 16.525  26.960  1.00 32.14  ? 944  TYR A H     1 
ATOM   792  H  HA    . TYR A 1 74  ? 35.353 18.166  25.496  1.00 32.43  ? 944  TYR A HA    1 
ATOM   793  H  HB2   . TYR A 1 74  ? 36.617 18.781  27.960  1.00 36.65  ? 944  TYR A HB2   1 
ATOM   794  H  HB3   . TYR A 1 74  ? 35.579 19.717  27.207  1.00 36.65  ? 944  TYR A HB3   1 
ATOM   795  H  HD1   . TYR A 1 74  ? 33.179 19.157  27.280  1.00 30.17  ? 944  TYR A HD1   1 
ATOM   796  H  HD2   . TYR A 1 74  ? 35.817 16.956  29.333  1.00 38.03  ? 944  TYR A HD2   1 
ATOM   797  H  HE1   . TYR A 1 74  ? 31.448 18.186  28.462  1.00 31.95  ? 944  TYR A HE1   1 
ATOM   798  H  HE2   . TYR A 1 74  ? 34.091 15.984  30.515  1.00 37.69  ? 944  TYR A HE2   1 
ATOM   799  H  HH    . TYR A 1 74  ? 31.069 16.020  29.796  1.00 32.36  ? 944  TYR A HH    1 
ATOM   800  N  N     . LEU A 1 75  ? 37.230 18.872  24.065  1.00 24.46  ? 945  LEU A N     1 
ATOM   801  C  CA    . LEU A 1 75  ? 38.320 19.418  23.267  1.00 26.73  ? 945  LEU A CA    1 
ATOM   802  C  C     . LEU A 1 75  ? 38.272 20.941  23.222  1.00 30.86  ? 945  LEU A C     1 
ATOM   803  O  O     . LEU A 1 75  ? 37.197 21.538  23.212  1.00 28.56  ? 945  LEU A O     1 
ATOM   804  C  CB    . LEU A 1 75  ? 38.259 18.877  21.837  1.00 27.05  ? 945  LEU A CB    1 
ATOM   805  C  CG    . LEU A 1 75  ? 38.403 17.367  21.649  1.00 32.83  ? 945  LEU A CG    1 
ATOM   806  C  CD1   . LEU A 1 75  ? 38.506 17.047  20.162  1.00 27.82  ? 945  LEU A CD1   1 
ATOM   807  C  CD2   . LEU A 1 75  ? 39.613 16.838  22.401  1.00 30.38  ? 945  LEU A CD2   1 
ATOM   808  H  H     . LEU A 1 75  ? 36.536 18.654  23.606  1.00 29.30  ? 945  LEU A H     1 
ATOM   809  H  HA    . LEU A 1 75  ? 39.176 19.149  23.661  1.00 32.02  ? 945  LEU A HA    1 
ATOM   810  H  HB2   . LEU A 1 75  ? 37.403 19.131  21.456  1.00 32.41  ? 945  LEU A HB2   1 
ATOM   811  H  HB3   . LEU A 1 75  ? 38.970 19.296  21.327  1.00 32.41  ? 945  LEU A HB3   1 
ATOM   812  H  HG    . LEU A 1 75  ? 37.613 16.926  21.999  1.00 39.35  ? 945  LEU A HG    1 
ATOM   813  H  HD11  . LEU A 1 75  ? 38.596 16.098  20.053  1.00 33.33  ? 945  LEU A HD11  1 
ATOM   814  H  HD12  . LEU A 1 75  ? 37.710 17.354  19.721  1.00 33.33  ? 945  LEU A HD12  1 
ATOM   815  H  HD13  . LEU A 1 75  ? 39.274 17.494  19.800  1.00 33.33  ? 945  LEU A HD13  1 
ATOM   816  H  HD21  . LEU A 1 75  ? 39.676 15.890  22.263  1.00 36.40  ? 945  LEU A HD21  1 
ATOM   817  H  HD22  . LEU A 1 75  ? 40.402 17.271  22.066  1.00 36.40  ? 945  LEU A HD22  1 
ATOM   818  H  HD23  . LEU A 1 75  ? 39.506 17.028  23.336  1.00 36.40  ? 945  LEU A HD23  1 
ATOM   819  N  N     . GLU A 1 76  ? 39.448 21.558  23.180  1.00 32.97  ? 946  GLU A N     1 
ATOM   820  C  CA    . GLU A 1 76  ? 39.559 23.012  23.098  1.00 36.71  ? 946  GLU A CA    1 
ATOM   821  C  C     . GLU A 1 76  ? 40.519 23.422  21.981  1.00 41.23  ? 946  GLU A C     1 
ATOM   822  O  O     . GLU A 1 76  ? 40.220 24.315  21.189  1.00 41.38  ? 946  GLU A O     1 
ATOM   823  C  CB    . GLU A 1 76  ? 40.034 23.583  24.436  1.00 33.90  ? 946  GLU A CB    1 
ATOM   824  C  CG    . GLU A 1 76  ? 39.143 23.201  25.611  1.00 69.39  ? 946  GLU A CG    1 
ATOM   825  C  CD    . GLU A 1 76  ? 39.620 23.777  26.932  1.00 71.90  ? 946  GLU A CD    1 
ATOM   826  O  OE1   . GLU A 1 76  ? 40.735 23.423  27.371  1.00 75.55  ? 946  GLU A OE1   1 
ATOM   827  O  OE2   . GLU A 1 76  ? 38.877 24.580  27.534  1.00 55.21  ? 946  GLU A OE2   1 
ATOM   828  H  H     . GLU A 1 76  ? 40.207 21.153  23.198  1.00 39.50  ? 946  GLU A H     1 
ATOM   829  H  HA    . GLU A 1 76  ? 38.678 23.391  22.898  1.00 44.00  ? 946  GLU A HA    1 
ATOM   830  H  HB2   . GLU A 1 76  ? 40.927 23.251  24.619  1.00 40.62  ? 946  GLU A HB2   1 
ATOM   831  H  HB3   . GLU A 1 76  ? 40.048 24.551  24.376  1.00 40.62  ? 946  GLU A HB3   1 
ATOM   832  H  HG2   . GLU A 1 76  ? 38.246 23.533  25.447  1.00 83.22  ? 946  GLU A HG2   1 
ATOM   833  H  HG3   . GLU A 1 76  ? 39.128 22.235  25.694  1.00 83.22  ? 946  GLU A HG3   1 
ATOM   834  N  N     . ASN A 1 77  ? 41.672 22.761  21.927  1.00 38.71  ? 947  ASN A N     1 
ATOM   835  C  CA    . ASN A 1 77  ? 42.700 23.063  20.937  1.00 58.01  ? 947  ASN A CA    1 
ATOM   836  C  C     . ASN A 1 77  ? 42.868 21.919  19.941  1.00 46.91  ? 947  ASN A C     1 
ATOM   837  O  O     . ASN A 1 77  ? 42.527 20.774  20.237  1.00 36.41  ? 947  ASN A O     1 
ATOM   838  C  CB    . ASN A 1 77  ? 44.037 23.328  21.631  1.00 48.62  ? 947  ASN A CB    1 
ATOM   839  C  CG    . ASN A 1 77  ? 43.906 24.261  22.818  1.00 59.31  ? 947  ASN A CG    1 
ATOM   840  O  OD1   . ASN A 1 77  ? 43.850 25.480  22.660  1.00 64.03  ? 947  ASN A OD1   1 
ATOM   841  N  ND2   . ASN A 1 77  ? 43.868 23.692  24.016  1.00 52.54  ? 947  ASN A ND2   1 
ATOM   842  H  H     . ASN A 1 77  ? 41.885 22.122  22.462  1.00 46.40  ? 947  ASN A H     1 
ATOM   843  H  HA    . ASN A 1 77  ? 42.445 23.869  20.442  1.00 69.55  ? 947  ASN A HA    1 
ATOM   844  H  HB2   . ASN A 1 77  ? 44.399 22.486  21.950  1.00 58.29  ? 947  ASN A HB2   1 
ATOM   845  H  HB3   . ASN A 1 77  ? 44.648 23.733  20.996  1.00 58.29  ? 947  ASN A HB3   1 
ATOM   846  H  HD21  . ASN A 1 77  ? 43.916 22.836  24.087  1.00 62.99  ? 947  ASN A HD21  1 
ATOM   847  H  HD22  . ASN A 1 77  ? 43.794 24.179  24.721  1.00 62.99  ? 947  ASN A HD22  1 
ATOM   848  N  N     . LYS A 1 78  ? 43.397 22.238  18.763  1.00 44.73  ? 948  LYS A N     1 
ATOM   849  C  CA    . LYS A 1 78  ? 43.671 21.236  17.739  1.00 49.59  ? 948  LYS A CA    1 
ATOM   850  C  C     . LYS A 1 78  ? 44.529 20.113  18.310  1.00 44.67  ? 948  LYS A C     1 
ATOM   851  O  O     . LYS A 1 78  ? 44.330 18.942  17.996  1.00 40.70  ? 948  LYS A O     1 
ATOM   852  C  CB    . LYS A 1 78  ? 44.385 21.881  16.547  1.00 53.50  ? 948  LYS A CB    1 
ATOM   853  C  CG    . LYS A 1 78  ? 44.830 20.899  15.465  1.00 55.98  ? 948  LYS A CG    1 
ATOM   854  C  CD    . LYS A 1 78  ? 45.643 21.597  14.379  1.00 69.32  ? 948  LYS A CD    1 
ATOM   855  C  CE    . LYS A 1 78  ? 46.866 20.783  13.971  1.00 80.38  ? 948  LYS A CE    1 
ATOM   856  N  NZ    . LYS A 1 78  ? 46.537 19.649  13.061  1.00 79.07  ? 948  LYS A NZ    1 
ATOM   857  H  H     . LYS A 1 78  ? 43.609 23.039  18.531  1.00 53.62  ? 948  LYS A H     1 
ATOM   858  H  HA    . LYS A 1 78  ? 42.826 20.851  17.424  1.00 59.45  ? 948  LYS A HA    1 
ATOM   859  H  HB2   . LYS A 1 78  ? 43.783 22.520  16.134  1.00 64.14  ? 948  LYS A HB2   1 
ATOM   860  H  HB3   . LYS A 1 78  ? 45.176 22.340  16.871  1.00 64.14  ? 948  LYS A HB3   1 
ATOM   861  H  HG2   . LYS A 1 78  ? 45.384 20.211  15.866  1.00 67.12  ? 948  LYS A HG2   1 
ATOM   862  H  HG3   . LYS A 1 78  ? 44.048 20.502  15.052  1.00 67.12  ? 948  LYS A HG3   1 
ATOM   863  H  HD2   . LYS A 1 78  ? 45.086 21.721  13.595  1.00 83.13  ? 948  LYS A HD2   1 
ATOM   864  H  HD3   . LYS A 1 78  ? 45.948 22.455  14.712  1.00 83.13  ? 948  LYS A HD3   1 
ATOM   865  H  HE2   . LYS A 1 78  ? 47.491 21.364  13.511  1.00 96.40  ? 948  LYS A HE2   1 
ATOM   866  H  HE3   . LYS A 1 78  ? 47.280 20.416  14.767  1.00 96.40  ? 948  LYS A HE3   1 
ATOM   867  H  HZ1   . LYS A 1 78  ? 45.970 19.093  13.461  1.00 94.83  ? 948  LYS A HZ1   1 
ATOM   868  H  HZ2   . LYS A 1 78  ? 46.163 19.958  12.315  1.00 94.83  ? 948  LYS A HZ2   1 
ATOM   869  H  HZ3   . LYS A 1 78  ? 47.279 19.205  12.850  1.00 94.83  ? 948  LYS A HZ3   1 
ATOM   870  N  N     . ARG A 1 79  ? 45.485 20.484  19.155  1.00 41.24  ? 949  ARG A N     1 
ATOM   871  C  CA    . ARG A 1 79  ? 46.426 19.529  19.729  1.00 55.87  ? 949  ARG A CA    1 
ATOM   872  C  C     . ARG A 1 79  ? 45.738 18.534  20.664  1.00 44.09  ? 949  ARG A C     1 
ATOM   873  O  O     . ARG A 1 79  ? 46.187 17.397  20.807  1.00 39.34  ? 949  ARG A O     1 
ATOM   874  C  CB    . ARG A 1 79  ? 47.523 20.276  20.487  1.00 68.83  ? 949  ARG A CB    1 
ATOM   875  C  CG    . ARG A 1 79  ? 46.995 21.113  21.634  1.00 86.95  ? 949  ARG A CG    1 
ATOM   876  C  CD    . ARG A 1 79  ? 48.022 22.112  22.131  1.00 104.69 ? 949  ARG A CD    1 
ATOM   877  N  NE    . ARG A 1 79  ? 47.540 22.820  23.314  1.00 111.97 ? 949  ARG A NE    1 
ATOM   878  C  CZ    . ARG A 1 79  ? 47.397 22.257  24.509  1.00 114.24 ? 949  ARG A CZ    1 
ATOM   879  N  NH1   . ARG A 1 79  ? 47.694 20.977  24.684  1.00 110.28 ? 949  ARG A NH1   1 
ATOM   880  N  NH2   . ARG A 1 79  ? 46.950 22.970  25.534  1.00 115.58 ? 949  ARG A NH2   1 
ATOM   881  H  H     . ARG A 1 79  ? 45.610 21.294  19.415  1.00 49.43  ? 949  ARG A H     1 
ATOM   882  H  HA    . ARG A 1 79  ? 46.849 19.022  19.005  1.00 66.98  ? 949  ARG A HA    1 
ATOM   883  H  HB2   . ARG A 1 79  ? 48.148 19.631  20.852  1.00 82.54  ? 949  ARG A HB2   1 
ATOM   884  H  HB3   . ARG A 1 79  ? 47.982 20.869  19.872  1.00 82.54  ? 949  ARG A HB3   1 
ATOM   885  H  HG2   . ARG A 1 79  ? 46.214 21.605  21.335  1.00 104.29 ? 949  ARG A HG2   1 
ATOM   886  H  HG3   . ARG A 1 79  ? 46.759 20.529  22.371  1.00 104.29 ? 949  ARG A HG3   1 
ATOM   887  H  HD2   . ARG A 1 79  ? 48.837 21.643  22.367  1.00 125.58 ? 949  ARG A HD2   1 
ATOM   888  H  HD3   . ARG A 1 79  ? 48.198 22.765  21.436  1.00 125.58 ? 949  ARG A HD3   1 
ATOM   889  H  HE    . ARG A 1 79  ? 47.403 23.666  23.248  1.00 134.31 ? 949  ARG A HE    1 
ATOM   890  H  HH11  . ARG A 1 79  ? 47.984 20.509  24.023  1.00 132.28 ? 949  ARG A HH11  1 
ATOM   891  H  HH12  . ARG A 1 79  ? 47.600 20.615  25.458  1.00 132.28 ? 949  ARG A HH12  1 
ATOM   892  H  HH21  . ARG A 1 79  ? 46.755 23.801  25.427  1.00 138.63 ? 949  ARG A HH21  1 
ATOM   893  H  HH22  . ARG A 1 79  ? 46.859 22.603  26.306  1.00 138.63 ? 949  ARG A HH22  1 
ATOM   894  N  N     . ASP A 1 80  ? 44.658 18.966  21.307  1.00 33.62  ? 950  ASP A N     1 
ATOM   895  C  CA    . ASP A 1 80  ? 43.895 18.086  22.190  1.00 40.07  ? 950  ASP A CA    1 
ATOM   896  C  C     . ASP A 1 80  ? 43.357 16.876  21.432  1.00 39.39  ? 950  ASP A C     1 
ATOM   897  O  O     . ASP A 1 80  ? 43.267 15.781  21.983  1.00 36.95  ? 950  ASP A O     1 
ATOM   898  C  CB    . ASP A 1 80  ? 42.720 18.834  22.826  1.00 49.01  ? 950  ASP A CB    1 
ATOM   899  C  CG    . ASP A 1 80  ? 43.163 19.968  23.728  1.00 50.03  ? 950  ASP A CG    1 
ATOM   900  O  OD1   . ASP A 1 80  ? 44.360 20.033  24.072  1.00 58.96  ? 950  ASP A OD1   1 
ATOM   901  O  OD2   . ASP A 1 80  ? 42.302 20.789  24.102  1.00 38.84  ? 950  ASP A OD2   1 
ATOM   902  H  H     . ASP A 1 80  ? 44.345 19.764  21.250  1.00 40.29  ? 950  ASP A H     1 
ATOM   903  H  HA    . ASP A 1 80  ? 44.479 17.764  22.908  1.00 48.02  ? 950  ASP A HA    1 
ATOM   904  H  HB2   . ASP A 1 80  ? 42.168 19.210  22.123  1.00 58.75  ? 950  ASP A HB2   1 
ATOM   905  H  HB3   . ASP A 1 80  ? 42.201 18.212  23.359  1.00 58.75  ? 950  ASP A HB3   1 
ATOM   906  N  N     . ALA A 1 81  ? 42.991 17.085  20.171  1.00 42.21  ? 951  ALA A N     1 
ATOM   907  C  CA    . ALA A 1 81  ? 42.401 16.031  19.347  1.00 39.79  ? 951  ALA A CA    1 
ATOM   908  C  C     . ALA A 1 81  ? 43.417 14.950  18.991  1.00 34.64  ? 951  ALA A C     1 
ATOM   909  O  O     . ALA A 1 81  ? 43.050 13.801  18.743  1.00 36.40  ? 951  ALA A O     1 
ATOM   910  C  CB    . ALA A 1 81  ? 41.812 16.630  18.076  1.00 39.41  ? 951  ALA A CB    1 
ATOM   911  H  H     . ALA A 1 81  ? 43.073 17.838  19.763  1.00 50.60  ? 951  ALA A H     1 
ATOM   912  H  HA    . ALA A 1 81  ? 41.673 15.607  19.847  1.00 47.70  ? 951  ALA A HA    1 
ATOM   913  H  HB1   . ALA A 1 81  ? 41.430 15.925  17.547  1.00 47.23  ? 951  ALA A HB1   1 
ATOM   914  H  HB2   . ALA A 1 81  ? 41.133 17.265  18.316  1.00 47.23  ? 951  ALA A HB2   1 
ATOM   915  H  HB3   . ALA A 1 81  ? 42.511 17.067  17.584  1.00 47.23  ? 951  ALA A HB3   1 
ATOM   916  N  N     . PHE A 1 82  ? 44.692 15.323  18.962  1.00 37.13  ? 952  PHE A N     1 
ATOM   917  C  CA    . PHE A 1 82  ? 45.752 14.401  18.570  1.00 42.19  ? 952  PHE A CA    1 
ATOM   918  C  C     . PHE A 1 82  ? 46.489 13.824  19.778  1.00 48.30  ? 952  PHE A C     1 
ATOM   919  O  O     . PHE A 1 82  ? 47.478 13.109  19.630  1.00 48.16  ? 952  PHE A O     1 
ATOM   920  C  CB    . PHE A 1 82  ? 46.728 15.100  17.619  1.00 33.12  ? 952  PHE A CB    1 
ATOM   921  C  CG    . PHE A 1 82  ? 46.133 15.413  16.276  1.00 43.36  ? 952  PHE A CG    1 
ATOM   922  C  CD1   . PHE A 1 82  ? 46.267 14.526  15.219  1.00 43.77  ? 952  PHE A CD1   1 
ATOM   923  C  CD2   . PHE A 1 82  ? 45.423 16.584  16.075  1.00 40.12  ? 952  PHE A CD2   1 
ATOM   924  C  CE1   . PHE A 1 82  ? 45.711 14.808  13.984  1.00 39.37  ? 952  PHE A CE1   1 
ATOM   925  C  CE2   . PHE A 1 82  ? 44.866 16.872  14.845  1.00 38.87  ? 952  PHE A CE2   1 
ATOM   926  C  CZ    . PHE A 1 82  ? 45.009 15.983  13.798  1.00 37.59  ? 952  PHE A CZ    1 
ATOM   927  H  H     . PHE A 1 82  ? 44.971 16.111  19.167  1.00 44.50  ? 952  PHE A H     1 
ATOM   928  H  HA    . PHE A 1 82  ? 45.350 13.652  18.084  1.00 50.58  ? 952  PHE A HA    1 
ATOM   929  H  HB2   . PHE A 1 82  ? 47.013 15.936  18.020  1.00 39.69  ? 952  PHE A HB2   1 
ATOM   930  H  HB3   . PHE A 1 82  ? 47.495 14.524  17.478  1.00 39.69  ? 952  PHE A HB3   1 
ATOM   931  H  HD1   . PHE A 1 82  ? 46.738 13.734  15.340  1.00 52.47  ? 952  PHE A HD1   1 
ATOM   932  H  HD2   . PHE A 1 82  ? 45.323 17.186  16.776  1.00 48.08  ? 952  PHE A HD2   1 
ATOM   933  H  HE1   . PHE A 1 82  ? 45.810 14.208  13.281  1.00 47.19  ? 952  PHE A HE1   1 
ATOM   934  H  HE2   . PHE A 1 82  ? 44.394 17.664  14.722  1.00 46.59  ? 952  PHE A HE2   1 
ATOM   935  H  HZ    . PHE A 1 82  ? 44.636 16.176  12.968  1.00 45.05  ? 952  PHE A HZ    1 
ATOM   936  N  N     . PHE A 1 83  ? 45.994 14.132  20.972  1.00 47.20  ? 953  PHE A N     1 
ATOM   937  C  CA    . PHE A 1 83  ? 46.539 13.572  22.201  1.00 40.82  ? 953  PHE A CA    1 
ATOM   938  C  C     . PHE A 1 83  ? 46.356 12.050  22.165  1.00 44.41  ? 953  PHE A C     1 
ATOM   939  O  O     . PHE A 1 83  ? 45.233 11.566  22.062  1.00 38.58  ? 953  PHE A O     1 
ATOM   940  C  CB    . PHE A 1 83  ? 45.821 14.194  23.402  1.00 49.38  ? 953  PHE A CB    1 
ATOM   941  C  CG    . PHE A 1 83  ? 46.409 13.821  24.731  1.00 49.94  ? 953  PHE A CG    1 
ATOM   942  C  CD1   . PHE A 1 83  ? 47.769 13.933  24.963  1.00 61.26  ? 953  PHE A CD1   1 
ATOM   943  C  CD2   . PHE A 1 83  ? 45.592 13.381  25.759  1.00 45.47  ? 953  PHE A CD2   1 
ATOM   944  C  CE1   . PHE A 1 83  ? 48.305 13.594  26.191  1.00 56.30  ? 953  PHE A CE1   1 
ATOM   945  C  CE2   . PHE A 1 83  ? 46.120 13.044  26.988  1.00 64.19  ? 953  PHE A CE2   1 
ATOM   946  C  CZ    . PHE A 1 83  ? 47.479 13.151  27.205  1.00 62.28  ? 953  PHE A CZ    1 
ATOM   947  H  H     . PHE A 1 83  ? 45.334 14.670  21.098  1.00 56.58  ? 953  PHE A H     1 
ATOM   948  H  HA    . PHE A 1 83  ? 47.496 13.774  22.264  1.00 48.93  ? 953  PHE A HA    1 
ATOM   949  H  HB2   . PHE A 1 83  ? 45.861 15.160  23.323  1.00 59.20  ? 953  PHE A HB2   1 
ATOM   950  H  HB3   . PHE A 1 83  ? 44.896 13.903  23.397  1.00 59.20  ? 953  PHE A HB3   1 
ATOM   951  H  HD1   . PHE A 1 83  ? 48.329 14.229  24.283  1.00 73.45  ? 953  PHE A HD1   1 
ATOM   952  H  HD2   . PHE A 1 83  ? 44.675 13.306  25.617  1.00 54.51  ? 953  PHE A HD2   1 
ATOM   953  H  HE1   . PHE A 1 83  ? 49.221 13.668  26.336  1.00 67.50  ? 953  PHE A HE1   1 
ATOM   954  H  HE2   . PHE A 1 83  ? 45.562 12.745  27.668  1.00 76.97  ? 953  PHE A HE2   1 
ATOM   955  H  HZ    . PHE A 1 83  ? 47.838 12.924  28.033  1.00 74.68  ? 953  PHE A HZ    1 
ATOM   956  N  N     . PRO A 1 84  ? 47.465 11.290  22.224  1.00 53.66  ? 954  PRO A N     1 
ATOM   957  C  CA    . PRO A 1 84  ? 47.432 9.828   22.049  1.00 51.31  ? 954  PRO A CA    1 
ATOM   958  C  C     . PRO A 1 84  ? 46.448 9.071   22.955  1.00 50.76  ? 954  PRO A C     1 
ATOM   959  O  O     . PRO A 1 84  ? 45.790 8.144   22.483  1.00 46.67  ? 954  PRO A O     1 
ATOM   960  C  CB    . PRO A 1 84  ? 48.876 9.410   22.344  1.00 53.65  ? 954  PRO A CB    1 
ATOM   961  C  CG    . PRO A 1 84  ? 49.682 10.598  21.960  1.00 64.83  ? 954  PRO A CG    1 
ATOM   962  C  CD    . PRO A 1 84  ? 48.846 11.794  22.330  1.00 55.14  ? 954  PRO A CD    1 
ATOM   963  H  HA    . PRO A 1 84  ? 47.227 9.612   21.116  1.00 61.52  ? 954  PRO A HA    1 
ATOM   964  H  HB2   . PRO A 1 84  ? 48.976 9.214   23.289  1.00 64.33  ? 954  PRO A HB2   1 
ATOM   965  H  HB3   . PRO A 1 84  ? 49.114 8.641   21.803  1.00 64.33  ? 954  PRO A HB3   1 
ATOM   966  H  HG2   . PRO A 1 84  ? 50.516 10.599  22.455  1.00 77.74  ? 954  PRO A HG2   1 
ATOM   967  H  HG3   . PRO A 1 84  ? 49.851 10.582  21.005  1.00 77.74  ? 954  PRO A HG3   1 
ATOM   968  H  HD2   . PRO A 1 84  ? 49.036 12.072  23.239  1.00 66.11  ? 954  PRO A HD2   1 
ATOM   969  H  HD3   . PRO A 1 84  ? 48.991 12.517  21.699  1.00 66.11  ? 954  PRO A HD3   1 
ATOM   970  N  N     . PRO A 1 85  ? 46.350 9.446   24.238  1.00 53.83  ? 955  PRO A N     1 
ATOM   971  C  CA    . PRO A 1 85  ? 45.396 8.741   25.106  1.00 50.69  ? 955  PRO A CA    1 
ATOM   972  C  C     . PRO A 1 85  ? 43.940 8.830   24.639  1.00 54.37  ? 955  PRO A C     1 
ATOM   973  O  O     . PRO A 1 85  ? 43.098 8.097   25.158  1.00 40.47  ? 955  PRO A O     1 
ATOM   974  C  CB    . PRO A 1 85  ? 45.565 9.448   26.452  1.00 48.17  ? 955  PRO A CB    1 
ATOM   975  C  CG    . PRO A 1 85  ? 46.954 9.964   26.428  1.00 55.18  ? 955  PRO A CG    1 
ATOM   976  C  CD    . PRO A 1 85  ? 47.205 10.371  25.002  1.00 36.41  ? 955  PRO A CD    1 
ATOM   977  H  HA    . PRO A 1 85  ? 45.651 7.800   25.199  1.00 60.77  ? 955  PRO A HA    1 
ATOM   978  H  HB2   . PRO A 1 85  ? 44.928 10.176  26.524  1.00 57.75  ? 955  PRO A HB2   1 
ATOM   979  H  HB3   . PRO A 1 85  ? 45.446 8.812   27.175  1.00 57.75  ? 955  PRO A HB3   1 
ATOM   980  H  HG2   . PRO A 1 85  ? 47.028 10.728  27.020  1.00 66.16  ? 955  PRO A HG2   1 
ATOM   981  H  HG3   . PRO A 1 85  ? 47.567 9.262   26.696  1.00 66.16  ? 955  PRO A HG3   1 
ATOM   982  H  HD2   . PRO A 1 85  ? 46.926 11.289  24.857  1.00 43.64  ? 955  PRO A HD2   1 
ATOM   983  H  HD3   . PRO A 1 85  ? 48.137 10.240  24.770  1.00 43.64  ? 955  PRO A HD3   1 
ATOM   984  N  N     . LEU A 1 86  ? 43.645 9.711   23.688  1.00 35.40  ? 956  LEU A N     1 
ATOM   985  C  CA    . LEU A 1 86  ? 42.287 9.837   23.166  1.00 42.33  ? 956  LEU A CA    1 
ATOM   986  C  C     . LEU A 1 86  ? 41.815 8.522   22.572  1.00 36.33  ? 956  LEU A C     1 
ATOM   987  O  O     . LEU A 1 86  ? 40.721 8.050   22.880  1.00 30.98  ? 956  LEU A O     1 
ATOM   988  C  CB    . LEU A 1 86  ? 42.209 10.915  22.088  1.00 52.47  ? 956  LEU A CB    1 
ATOM   989  C  CG    . LEU A 1 86  ? 41.154 11.983  22.355  1.00 43.76  ? 956  LEU A CG    1 
ATOM   990  C  CD1   . LEU A 1 86  ? 41.622 12.855  23.503  1.00 62.12  ? 956  LEU A CD1   1 
ATOM   991  C  CD2   . LEU A 1 86  ? 40.882 12.821  21.114  1.00 30.32  ? 956  LEU A CD2   1 
ATOM   992  H  H     . LEU A 1 86  ? 44.213 10.247  23.327  1.00 42.42  ? 956  LEU A H     1 
ATOM   993  H  HA    . LEU A 1 86  ? 41.680 10.084  23.895  1.00 50.74  ? 956  LEU A HA    1 
ATOM   994  H  HB2   . LEU A 1 86  ? 43.069 11.358  22.026  1.00 62.91  ? 956  LEU A HB2   1 
ATOM   995  H  HB3   . LEU A 1 86  ? 41.995 10.494  21.240  1.00 62.91  ? 956  LEU A HB3   1 
ATOM   996  H  HG    . LEU A 1 86  ? 40.325 11.554  22.619  1.00 52.46  ? 956  LEU A HG    1 
ATOM   997  H  HD11  . LEU A 1 86  ? 40.960 13.528  23.674  1.00 74.49  ? 956  LEU A HD11  1 
ATOM   998  H  HD12  . LEU A 1 86  ? 41.741 12.307  24.282  1.00 74.49  ? 956  LEU A HD12  1 
ATOM   999  H  HD13  . LEU A 1 86  ? 42.455 13.267  23.263  1.00 74.49  ? 956  LEU A HD13  1 
ATOM   1000 H  HD21  . LEU A 1 86  ? 41.696 13.253  20.844  1.00 36.32  ? 956  LEU A HD21  1 
ATOM   1001 H  HD22  . LEU A 1 86  ? 40.567 12.246  20.412  1.00 36.32  ? 956  LEU A HD22  1 
ATOM   1002 H  HD23  . LEU A 1 86  ? 40.215 13.480  21.322  1.00 36.32  ? 956  LEU A HD23  1 
ATOM   1003 N  N     . HIS A 1 87  ? 42.643 7.951   21.703  1.00 33.34  ? 957  HIS A N     1 
ATOM   1004 C  CA    . HIS A 1 87  ? 42.329 6.694   21.034  1.00 39.14  ? 957  HIS A CA    1 
ATOM   1005 C  C     . HIS A 1 87  ? 41.961 5.616   22.051  1.00 42.89  ? 957  HIS A C     1 
ATOM   1006 O  O     . HIS A 1 87  ? 40.968 4.905   21.894  1.00 35.48  ? 957  HIS A O     1 
ATOM   1007 C  CB    . HIS A 1 87  ? 43.537 6.236   20.208  1.00 45.87  ? 957  HIS A CB    1 
ATOM   1008 C  CG    . HIS A 1 87  ? 43.221 5.169   19.205  1.00 56.19  ? 957  HIS A CG    1 
ATOM   1009 N  ND1   . HIS A 1 87  ? 44.181 4.609   18.387  1.00 66.42  ? 957  HIS A ND1   1 
ATOM   1010 C  CD2   . HIS A 1 87  ? 42.055 4.561   18.884  1.00 53.35  ? 957  HIS A CD2   1 
ATOM   1011 C  CE1   . HIS A 1 87  ? 43.618 3.703   17.606  1.00 64.54  ? 957  HIS A CE1   1 
ATOM   1012 N  NE2   . HIS A 1 87  ? 42.328 3.655   17.888  1.00 59.88  ? 957  HIS A NE2   1 
ATOM   1013 H  H     . HIS A 1 87  ? 43.407 8.278   21.482  1.00 39.95  ? 957  HIS A H     1 
ATOM   1014 H  HA    . HIS A 1 87  ? 41.569 6.825   20.429  1.00 46.91  ? 957  HIS A HA    1 
ATOM   1015 H  HB2   . HIS A 1 87  ? 43.893 6.999   19.725  1.00 54.98  ? 957  HIS A HB2   1 
ATOM   1016 H  HB3   . HIS A 1 87  ? 44.212 5.886   20.810  1.00 54.98  ? 957  HIS A HB3   1 
ATOM   1017 H  HD1   . HIS A 1 87  ? 45.015 4.817   18.384  1.00 79.64  ? 957  HIS A HD1   1 
ATOM   1018 H  HD2   . HIS A 1 87  ? 41.223 4.727   19.266  1.00 63.96  ? 957  HIS A HD2   1 
ATOM   1019 H  HE1   . HIS A 1 87  ? 44.056 3.187   16.968  1.00 77.39  ? 957  HIS A HE1   1 
ATOM   1020 H  HE2   . HIS A 1 87  ? 41.753 3.139   17.510  1.00 71.81  ? 957  HIS A HE2   1 
ATOM   1021 N  N     . GLN A 1 88  ? 42.769 5.516   23.100  1.00 38.93  ? 958  GLN A N     1 
ATOM   1022 C  CA    . GLN A 1 88  ? 42.622 4.463   24.096  1.00 36.77  ? 958  GLN A CA    1 
ATOM   1023 C  C     . GLN A 1 88  ? 41.353 4.639   24.920  1.00 34.42  ? 958  GLN A C     1 
ATOM   1024 O  O     . GLN A 1 88  ? 40.735 3.660   25.323  1.00 31.20  ? 958  GLN A O     1 
ATOM   1025 C  CB    . GLN A 1 88  ? 43.838 4.444   25.024  1.00 50.48  ? 958  GLN A CB    1 
ATOM   1026 C  CG    . GLN A 1 88  ? 45.165 4.518   24.290  1.00 66.03  ? 958  GLN A CG    1 
ATOM   1027 C  CD    . GLN A 1 88  ? 45.252 3.521   23.152  1.00 81.65  ? 958  GLN A CD    1 
ATOM   1028 O  OE1   . GLN A 1 88  ? 44.924 2.345   23.315  1.00 84.91  ? 958  GLN A OE1   1 
ATOM   1029 N  NE2   . GLN A 1 88  ? 45.683 3.989   21.985  1.00 83.23  ? 958  GLN A NE2   1 
ATOM   1030 H  H     . GLN A 1 88  ? 43.420 6.055   23.260  1.00 46.66  ? 958  GLN A H     1 
ATOM   1031 H  HA    . GLN A 1 88  ? 42.572 3.596   23.641  1.00 44.07  ? 958  GLN A HA    1 
ATOM   1032 H  HB2   . GLN A 1 88  ? 43.786 5.205   25.622  1.00 60.52  ? 958  GLN A HB2   1 
ATOM   1033 H  HB3   . GLN A 1 88  ? 43.827 3.621   25.536  1.00 60.52  ? 958  GLN A HB3   1 
ATOM   1034 H  HG2   . GLN A 1 88  ? 45.273 5.408   23.920  1.00 79.18  ? 958  GLN A HG2   1 
ATOM   1035 H  HG3   . GLN A 1 88  ? 45.883 4.327   24.913  1.00 79.18  ? 958  GLN A HG3   1 
ATOM   1036 H  HE21  . GLN A 1 88  ? 45.750 3.463   21.308  1.00 99.82  ? 958  GLN A HE21  1 
ATOM   1037 H  HE22  . GLN A 1 88  ? 45.895 4.819   21.907  1.00 99.82  ? 958  GLN A HE22  1 
ATOM   1038 N  N     . PHE A 1 89  ? 40.974 5.886   25.179  1.00 31.24  ? 959  PHE A N     1 
ATOM   1039 C  CA    . PHE A 1 89  ? 39.761 6.172   25.937  1.00 29.29  ? 959  PHE A CA    1 
ATOM   1040 C  C     . PHE A 1 89  ? 38.539 5.721   25.136  1.00 29.21  ? 959  PHE A C     1 
ATOM   1041 O  O     . PHE A 1 89  ? 37.608 5.131   25.682  1.00 31.76  ? 959  PHE A O     1 
ATOM   1042 C  CB    . PHE A 1 89  ? 39.679 7.670   26.256  1.00 28.62  ? 959  PHE A CB    1 
ATOM   1043 C  CG    . PHE A 1 89  ? 38.506 8.053   27.122  1.00 31.35  ? 959  PHE A CG    1 
ATOM   1044 C  CD1   . PHE A 1 89  ? 38.646 8.150   28.500  1.00 31.85  ? 959  PHE A CD1   1 
ATOM   1045 C  CD2   . PHE A 1 89  ? 37.267 8.332   26.558  1.00 26.70  ? 959  PHE A CD2   1 
ATOM   1046 C  CE1   . PHE A 1 89  ? 37.570 8.509   29.302  1.00 36.02  ? 959  PHE A CE1   1 
ATOM   1047 C  CE2   . PHE A 1 89  ? 36.187 8.691   27.353  1.00 29.23  ? 959  PHE A CE2   1 
ATOM   1048 C  CZ    . PHE A 1 89  ? 36.340 8.783   28.727  1.00 26.24  ? 959  PHE A CZ    1 
ATOM   1049 H  H     . PHE A 1 89  ? 41.403 6.587   24.927  1.00 37.43  ? 959  PHE A H     1 
ATOM   1050 H  HA    . PHE A 1 89  ? 39.779 5.675   26.781  1.00 35.09  ? 959  PHE A HA    1 
ATOM   1051 H  HB2   . PHE A 1 89  ? 40.488 7.933   26.721  1.00 34.29  ? 959  PHE A HB2   1 
ATOM   1052 H  HB3   . PHE A 1 89  ? 39.604 8.162   25.424  1.00 34.29  ? 959  PHE A HB3   1 
ATOM   1053 H  HD1   . PHE A 1 89  ? 39.470 7.969   28.892  1.00 38.16  ? 959  PHE A HD1   1 
ATOM   1054 H  HD2   . PHE A 1 89  ? 37.159 8.273   25.636  1.00 31.98  ? 959  PHE A HD2   1 
ATOM   1055 H  HE1   . PHE A 1 89  ? 37.677 8.568   30.224  1.00 43.17  ? 959  PHE A HE1   1 
ATOM   1056 H  HE2   . PHE A 1 89  ? 35.362 8.873   26.963  1.00 35.02  ? 959  PHE A HE2   1 
ATOM   1057 H  HZ    . PHE A 1 89  ? 35.618 9.022   29.263  1.00 31.43  ? 959  PHE A HZ    1 
ATOM   1058 N  N     . CYS A 1 90  ? 38.556 5.984   23.834  1.00 25.53  ? 960  CYS A N     1 
ATOM   1059 C  CA    . CYS A 1 90  ? 37.424 5.650   22.977  1.00 22.70  ? 960  CYS A CA    1 
ATOM   1060 C  C     . CYS A 1 90  ? 37.302 4.140   22.771  1.00 25.37  ? 960  CYS A C     1 
ATOM   1061 O  O     . CYS A 1 90  ? 36.193 3.603   22.721  1.00 29.50  ? 960  CYS A O     1 
ATOM   1062 C  CB    . CYS A 1 90  ? 37.557 6.349   21.624  1.00 25.06  ? 960  CYS A CB    1 
ATOM   1063 S  SG    . CYS A 1 90  ? 37.294 8.144   21.687  1.00 29.89  ? 960  CYS A SG    1 
ATOM   1064 H  H     . CYS A 1 90  ? 39.212 6.356   23.421  1.00 30.58  ? 960  CYS A H     1 
ATOM   1065 H  HA    . CYS A 1 90  ? 36.599 5.965   23.401  1.00 27.18  ? 960  CYS A HA    1 
ATOM   1066 H  HB2   . CYS A 1 90  ? 38.450 6.193   21.279  1.00 30.02  ? 960  CYS A HB2   1 
ATOM   1067 H  HB3   . CYS A 1 90  ? 36.900 5.976   21.015  1.00 30.02  ? 960  CYS A HB3   1 
ATOM   1068 H  HG    . CYS A 1 90  ? 38.107 8.632   22.424  1.00 35.81  ? 960  CYS A HG    1 
ATOM   1069 N  N     . THR A 1 91  ? 38.441 3.461   22.656  1.00 27.82  ? 961  THR A N     1 
ATOM   1070 C  CA    . THR A 1 91  ? 38.457 2.025   22.366  1.00 33.24  ? 961  THR A CA    1 
ATOM   1071 C  C     . THR A 1 91  ? 38.295 1.178   23.627  1.00 33.56  ? 961  THR A C     1 
ATOM   1072 O  O     . THR A 1 91  ? 38.019 -0.019  23.547  1.00 32.20  ? 961  THR A O     1 
ATOM   1073 C  CB    . THR A 1 91  ? 39.756 1.610   21.642  1.00 39.40  ? 961  THR A CB    1 
ATOM   1074 O  OG1   . THR A 1 91  ? 40.891 1.936   22.451  1.00 38.07  ? 961  THR A OG1   1 
ATOM   1075 C  CG2   . THR A 1 91  ? 39.873 2.322   20.307  1.00 34.09  ? 961  THR A CG2   1 
ATOM   1076 H  H     . THR A 1 91  ? 39.222 3.808   22.742  1.00 33.33  ? 961  THR A H     1 
ATOM   1077 H  HA    . THR A 1 91  ? 37.706 1.819   21.771  1.00 39.84  ? 961  THR A HA    1 
ATOM   1078 H  HB    . THR A 1 91  ? 39.742 0.654   21.478  1.00 47.23  ? 961  THR A HB    1 
ATOM   1079 H  HG1   . THR A 1 91  ? 41.582 1.716   22.068  1.00 45.62  ? 961  THR A HG1   1 
ATOM   1080 H  HG21  . THR A 1 91  ? 40.683 2.058   19.864  1.00 40.86  ? 961  THR A HG21  1 
ATOM   1081 H  HG22  . THR A 1 91  ? 39.125 2.098   19.749  1.00 40.86  ? 961  THR A HG22  1 
ATOM   1082 H  HG23  . THR A 1 91  ? 39.887 3.272   20.443  1.00 40.86  ? 961  THR A HG23  1 
ATOM   1083 N  N     . ASN A 1 92  ? 38.456 1.803   24.789  1.00 29.85  ? 962  ASN A N     1 
ATOM   1084 C  CA    . ASN A 1 92  ? 38.270 1.114   26.062  1.00 33.95  ? 962  ASN A CA    1 
ATOM   1085 C  C     . ASN A 1 92  ? 36.927 0.374   26.094  1.00 26.83  ? 962  ASN A C     1 
ATOM   1086 O  O     . ASN A 1 92  ? 35.875 0.995   25.973  1.00 25.88  ? 962  ASN A O     1 
ATOM   1087 C  CB    . ASN A 1 92  ? 38.332 2.125   27.208  1.00 33.66  ? 962  ASN A CB    1 
ATOM   1088 C  CG    . ASN A 1 92  ? 38.410 1.465   28.569  1.00 49.43  ? 962  ASN A CG    1 
ATOM   1089 O  OD1   . ASN A 1 92  ? 37.944 0.343   28.755  1.00 39.95  ? 962  ASN A OD1   1 
ATOM   1090 N  ND2   . ASN A 1 92  ? 38.999 2.163   29.531  1.00 46.63  ? 962  ASN A ND2   1 
ATOM   1091 H  H     . ASN A 1 92  ? 38.674 2.631   24.867  1.00 35.77  ? 962  ASN A H     1 
ATOM   1092 H  HA    . ASN A 1 92  ? 38.988 0.459   26.187  1.00 40.68  ? 962  ASN A HA    1 
ATOM   1093 H  HB2   . ASN A 1 92  ? 39.121 2.679   27.099  1.00 40.34  ? 962  ASN A HB2   1 
ATOM   1094 H  HB3   . ASN A 1 92  ? 37.534 2.676   27.188  1.00 40.34  ? 962  ASN A HB3   1 
ATOM   1095 H  HD21  . ASN A 1 92  ? 39.069 1.832   30.321  1.00 55.90  ? 962  ASN A HD21  1 
ATOM   1096 H  HD22  . ASN A 1 92  ? 39.312 2.946   29.364  1.00 55.90  ? 962  ASN A HD22  1 
ATOM   1097 N  N     . PRO A 1 93  ? 36.956 -0.959  26.248  1.00 27.23  ? 963  PRO A N     1 
ATOM   1098 C  CA    . PRO A 1 93  ? 35.710 -1.739  26.232  1.00 34.10  ? 963  PRO A CA    1 
ATOM   1099 C  C     . PRO A 1 93  ? 34.688 -1.299  27.284  1.00 33.91  ? 963  PRO A C     1 
ATOM   1100 O  O     . PRO A 1 93  ? 33.485 -1.489  27.093  1.00 28.49  ? 963  PRO A O     1 
ATOM   1101 C  CB    . PRO A 1 93  ? 36.185 -3.167  26.522  1.00 37.47  ? 963  PRO A CB    1 
ATOM   1102 C  CG    . PRO A 1 93  ? 37.604 -3.192  26.087  1.00 51.33  ? 963  PRO A CG    1 
ATOM   1103 C  CD    . PRO A 1 93  ? 38.147 -1.819  26.362  1.00 33.72  ? 963  PRO A CD    1 
ATOM   1104 H  HA    . PRO A 1 93  ? 35.298 -1.707  25.343  1.00 40.87  ? 963  PRO A HA    1 
ATOM   1105 H  HB2   . PRO A 1 93  ? 36.113 -3.349  27.472  1.00 44.91  ? 963  PRO A HB2   1 
ATOM   1106 H  HB3   . PRO A 1 93  ? 35.657 -3.798  26.009  1.00 44.91  ? 963  PRO A HB3   1 
ATOM   1107 H  HG2   . PRO A 1 93  ? 38.089 -3.858  26.599  1.00 61.54  ? 963  PRO A HG2   1 
ATOM   1108 H  HG3   . PRO A 1 93  ? 37.649 -3.392  25.139  1.00 61.54  ? 963  PRO A HG3   1 
ATOM   1109 H  HD2   . PRO A 1 93  ? 38.514 -1.773  27.259  1.00 40.41  ? 963  PRO A HD2   1 
ATOM   1110 H  HD3   . PRO A 1 93  ? 38.806 -1.574  25.694  1.00 40.41  ? 963  PRO A HD3   1 
ATOM   1111 N  N     . ASN A 1 94  ? 35.161 -0.725  28.384  1.00 26.52  ? 964  ASN A N     1 
ATOM   1112 C  CA    . ASN A 1 94  ? 34.268 -0.264  29.442  1.00 30.96  ? 964  ASN A CA    1 
ATOM   1113 C  C     . ASN A 1 94  ? 33.524 1.021   29.082  1.00 35.23  ? 964  ASN A C     1 
ATOM   1114 O  O     . ASN A 1 94  ? 32.603 1.423   29.793  1.00 28.11  ? 964  ASN A O     1 
ATOM   1115 C  CB    . ASN A 1 94  ? 35.048 -0.066  30.743  1.00 31.14  ? 964  ASN A CB    1 
ATOM   1116 C  CG    . ASN A 1 94  ? 35.638 -1.359  31.268  1.00 44.09  ? 964  ASN A CG    1 
ATOM   1117 O  OD1   . ASN A 1 94  ? 35.031 -2.423  31.152  1.00 51.35  ? 964  ASN A OD1   1 
ATOM   1118 N  ND2   . ASN A 1 94  ? 36.831 -1.276  31.841  1.00 48.85  ? 964  ASN A ND2   1 
ATOM   1119 H  H     . ASN A 1 94  ? 35.995 -0.590  28.543  1.00 31.77  ? 964  ASN A H     1 
ATOM   1120 H  HA    . ASN A 1 94  ? 33.596 -0.958  29.604  1.00 37.09  ? 964  ASN A HA    1 
ATOM   1121 H  HB2   . ASN A 1 94  ? 35.776 0.555   30.585  1.00 37.31  ? 964  ASN A HB2   1 
ATOM   1122 H  HB3   . ASN A 1 94  ? 34.450 0.288   31.420  1.00 37.31  ? 964  ASN A HB3   1 
ATOM   1123 H  HD21  . ASN A 1 94  ? 37.228 -0.515  31.899  1.00 58.56  ? 964  ASN A HD21  1 
ATOM   1124 H  HD22  . ASN A 1 94  ? 37.208 -1.983  32.154  1.00 58.56  ? 964  ASN A HD22  1 
ATOM   1125 N  N     . ASN A 1 95  ? 33.930 1.669   27.992  1.00 25.33  ? 965  ASN A N     1 
ATOM   1126 C  CA    . ASN A 1 95  ? 33.225 2.846   27.480  1.00 26.18  ? 965  ASN A CA    1 
ATOM   1127 C  C     . ASN A 1 95  ? 32.453 2.493   26.214  1.00 26.20  ? 965  ASN A C     1 
ATOM   1128 O  O     . ASN A 1 95  ? 33.032 2.448   25.130  1.00 25.36  ? 965  ASN A O     1 
ATOM   1129 C  CB    . ASN A 1 95  ? 34.212 3.976   27.179  1.00 23.17  ? 965  ASN A CB    1 
ATOM   1130 C  CG    . ASN A 1 95  ? 34.914 4.479   28.419  1.00 35.24  ? 965  ASN A CG    1 
ATOM   1131 O  OD1   . ASN A 1 95  ? 34.351 4.454   29.509  1.00 31.05  ? 965  ASN A OD1   1 
ATOM   1132 N  ND2   . ASN A 1 95  ? 36.153 4.933   28.261  1.00 27.05  ? 965  ASN A ND2   1 
ATOM   1133 H  H     . ASN A 1 95  ? 34.618 1.446   27.526  1.00 30.34  ? 965  ASN A H     1 
ATOM   1134 H  HA    . ASN A 1 95  ? 32.587 3.163   28.154  1.00 31.36  ? 965  ASN A HA    1 
ATOM   1135 H  HB2   . ASN A 1 95  ? 34.887 3.651   26.562  1.00 27.74  ? 965  ASN A HB2   1 
ATOM   1136 H  HB3   . ASN A 1 95  ? 33.731 4.720   26.783  1.00 27.74  ? 965  ASN A HB3   1 
ATOM   1137 H  HD21  . ASN A 1 95  ? 36.592 5.230   28.939  1.00 32.40  ? 965  ASN A HD21  1 
ATOM   1138 H  HD22  . ASN A 1 95  ? 36.516 4.931   27.482  1.00 32.40  ? 965  ASN A HD22  1 
ATOM   1139 N  N     . PRO A 1 96  ? 31.142 2.234   26.344  1.00 24.93  ? 966  PRO A N     1 
ATOM   1140 C  CA    . PRO A 1 96  ? 30.345 1.789   25.192  1.00 19.98  ? 966  PRO A CA    1 
ATOM   1141 C  C     . PRO A 1 96  ? 30.235 2.874   24.132  1.00 22.49  ? 966  PRO A C     1 
ATOM   1142 O  O     . PRO A 1 96  ? 30.108 2.573   22.946  1.00 22.11  ? 966  PRO A O     1 
ATOM   1143 C  CB    . PRO A 1 96  ? 28.966 1.505   25.797  1.00 25.87  ? 966  PRO A CB    1 
ATOM   1144 C  CG    . PRO A 1 96  ? 29.203 1.372   27.273  1.00 41.11  ? 966  PRO A CG    1 
ATOM   1145 C  CD    . PRO A 1 96  ? 30.345 2.284   27.580  1.00 26.17  ? 966  PRO A CD    1 
ATOM   1146 H  HA    . PRO A 1 96  ? 30.716 0.971   24.801  1.00 23.92  ? 966  PRO A HA    1 
ATOM   1147 H  HB2   . PRO A 1 96  ? 28.369 2.246   25.611  1.00 30.99  ? 966  PRO A HB2   1 
ATOM   1148 H  HB3   . PRO A 1 96  ? 28.613 0.679   25.430  1.00 30.99  ? 966  PRO A HB3   1 
ATOM   1149 H  HG2   . PRO A 1 96  ? 28.408 1.645   27.757  1.00 49.28  ? 966  PRO A HG2   1 
ATOM   1150 H  HG3   . PRO A 1 96  ? 29.433 0.453   27.484  1.00 49.28  ? 966  PRO A HG3   1 
ATOM   1151 H  HD2   . PRO A 1 96  ? 30.026 3.185   27.742  1.00 31.35  ? 966  PRO A HD2   1 
ATOM   1152 H  HD3   . PRO A 1 96  ? 30.859 1.945   28.330  1.00 31.35  ? 966  PRO A HD3   1 
ATOM   1153 N  N     . VAL A 1 97  ? 30.281 4.126   24.573  1.00 21.69  ? 967  VAL A N     1 
ATOM   1154 C  CA    . VAL A 1 97  ? 30.195 5.270   23.681  1.00 20.01  ? 967  VAL A CA    1 
ATOM   1155 C  C     . VAL A 1 97  ? 31.031 6.393   24.283  1.00 26.45  ? 967  VAL A C     1 
ATOM   1156 O  O     . VAL A 1 97  ? 31.167 6.482   25.503  1.00 21.59  ? 967  VAL A O     1 
ATOM   1157 C  CB    . VAL A 1 97  ? 28.729 5.727   23.507  1.00 16.22  ? 967  VAL A CB    1 
ATOM   1158 C  CG1   . VAL A 1 97  ? 28.130 6.156   24.848  1.00 20.41  ? 967  VAL A CG1   1 
ATOM   1159 C  CG2   . VAL A 1 97  ? 28.626 6.851   22.486  1.00 18.10  ? 967  VAL A CG2   1 
ATOM   1160 H  H     . VAL A 1 97  ? 30.363 4.340   25.402  1.00 25.98  ? 967  VAL A H     1 
ATOM   1161 H  HA    . VAL A 1 97  ? 30.562 5.036   22.803  1.00 23.96  ? 967  VAL A HA    1 
ATOM   1162 H  HB    . VAL A 1 97  ? 28.201 4.972   23.172  1.00 19.40  ? 967  VAL A HB    1 
ATOM   1163 H  HG11  . VAL A 1 97  ? 27.222 6.435   24.710  1.00 24.43  ? 967  VAL A HG11  1 
ATOM   1164 H  HG12  . VAL A 1 97  ? 28.156 5.412   25.454  1.00 24.43  ? 967  VAL A HG12  1 
ATOM   1165 H  HG13  . VAL A 1 97  ? 28.646 6.885   25.201  1.00 24.43  ? 967  VAL A HG13  1 
ATOM   1166 H  HG21  . VAL A 1 97  ? 27.706 7.112   22.401  1.00 21.66  ? 967  VAL A HG21  1 
ATOM   1167 H  HG22  . VAL A 1 97  ? 29.152 7.596   22.788  1.00 21.66  ? 967  VAL A HG22  1 
ATOM   1168 H  HG23  . VAL A 1 97  ? 28.958 6.538   21.642  1.00 21.66  ? 967  VAL A HG23  1 
ATOM   1169 N  N     . THR A 1 98  ? 31.620 7.222   23.427  1.00 19.38  ? 968  THR A N     1 
ATOM   1170 C  CA    . THR A 1 98  ? 32.311 8.427   23.874  1.00 17.76  ? 968  THR A CA    1 
ATOM   1171 C  C     . THR A 1 98  ? 31.820 9.591   23.029  1.00 23.30  ? 968  THR A C     1 
ATOM   1172 O  O     . THR A 1 98  ? 31.740 9.490   21.809  1.00 23.25  ? 968  THR A O     1 
ATOM   1173 C  CB    . THR A 1 98  ? 33.845 8.308   23.725  1.00 24.97  ? 968  THR A CB    1 
ATOM   1174 O  OG1   . THR A 1 98  ? 34.331 7.246   24.549  1.00 26.99  ? 968  THR A OG1   1 
ATOM   1175 C  CG2   . THR A 1 98  ? 34.543 9.609   24.135  1.00 24.26  ? 968  THR A CG2   1 
ATOM   1176 H  H     . THR A 1 98  ? 31.634 7.108   22.575  1.00 23.20  ? 968  THR A H     1 
ATOM   1177 H  HA    . THR A 1 98  ? 32.096 8.605   24.813  1.00 21.26  ? 968  THR A HA    1 
ATOM   1178 H  HB    . THR A 1 98  ? 34.064 8.123   22.799  1.00 29.91  ? 968  THR A HB    1 
ATOM   1179 H  HG1   . THR A 1 98  ? 33.985 6.537   24.326  1.00 32.33  ? 968  THR A HG1   1 
ATOM   1180 H  HG21  . THR A 1 98  ? 35.494 9.516   24.035  1.00 29.06  ? 968  THR A HG21  1 
ATOM   1181 H  HG22  . THR A 1 98  ? 34.241 10.332  23.580  1.00 29.06  ? 968  THR A HG22  1 
ATOM   1182 H  HG23  . THR A 1 98  ? 34.344 9.813   25.051  1.00 29.06  ? 968  THR A HG23  1 
ATOM   1183 N  N     . VAL A 1 99  ? 31.461 10.689  23.675  1.00 21.27  ? 969  VAL A N     1 
ATOM   1184 C  CA    . VAL A 1 99  ? 31.130 11.891  22.938  1.00 18.20  ? 969  VAL A CA    1 
ATOM   1185 C  C     . VAL A 1 99  ? 32.307 12.850  23.066  1.00 21.27  ? 969  VAL A C     1 
ATOM   1186 O  O     . VAL A 1 99  ? 32.762 13.148  24.167  1.00 22.12  ? 969  VAL A O     1 
ATOM   1187 C  CB    . VAL A 1 99  ? 29.814 12.543  23.421  1.00 20.49  ? 969  VAL A CB    1 
ATOM   1188 C  CG1   . VAL A 1 99  ? 29.905 12.952  24.893  1.00 24.57  ? 969  VAL A CG1   1 
ATOM   1189 C  CG2   . VAL A 1 99  ? 29.477 13.745  22.543  1.00 19.04  ? 969  VAL A CG2   1 
ATOM   1190 H  H     . VAL A 1 99  ? 31.402 10.763  24.530  1.00 25.47  ? 969  VAL A H     1 
ATOM   1191 H  HA    . VAL A 1 99  ? 31.025 11.664  21.990  1.00 21.78  ? 969  VAL A HA    1 
ATOM   1192 H  HB    . VAL A 1 99  ? 29.087 11.892  23.333  1.00 24.53  ? 969  VAL A HB    1 
ATOM   1193 H  HG11  . VAL A 1 99  ? 29.073 13.351  25.158  1.00 29.43  ? 969  VAL A HG11  1 
ATOM   1194 H  HG12  . VAL A 1 99  ? 30.077 12.170  25.424  1.00 29.43  ? 969  VAL A HG12  1 
ATOM   1195 H  HG13  . VAL A 1 99  ? 30.621 13.583  24.998  1.00 29.43  ? 969  VAL A HG13  1 
ATOM   1196 H  HG21  . VAL A 1 99  ? 28.659 14.139  22.854  1.00 22.79  ? 969  VAL A HG21  1 
ATOM   1197 H  HG22  . VAL A 1 99  ? 30.192 14.384  22.601  1.00 22.79  ? 969  VAL A HG22  1 
ATOM   1198 H  HG23  . VAL A 1 99  ? 29.374 13.450  21.635  1.00 22.79  ? 969  VAL A HG23  1 
ATOM   1199 N  N     . ILE A 1 100 ? 32.818 13.293  21.924  1.00 19.36  ? 970  ILE A N     1 
ATOM   1200 C  CA    . ILE A 1 100 ? 33.938 14.216  21.880  1.00 23.34  ? 970  ILE A CA    1 
ATOM   1201 C  C     . ILE A 1 100 ? 33.395 15.611  21.620  1.00 25.10  ? 970  ILE A C     1 
ATOM   1202 O  O     . ILE A 1 100 ? 33.091 15.974  20.485  1.00 22.04  ? 970  ILE A O     1 
ATOM   1203 C  CB    . ILE A 1 100 ? 34.947 13.821  20.787  1.00 23.36  ? 970  ILE A CB    1 
ATOM   1204 C  CG1   . ILE A 1 100 ? 35.344 12.350  20.957  1.00 24.83  ? 970  ILE A CG1   1 
ATOM   1205 C  CG2   . ILE A 1 100 ? 36.176 14.733  20.840  1.00 25.99  ? 970  ILE A CG2   1 
ATOM   1206 C  CD1   . ILE A 1 100 ? 36.564 11.942  20.171  1.00 25.42  ? 970  ILE A CD1   1 
ATOM   1207 H  H     . ILE A 1 100 ? 32.526 13.067  21.147  1.00 23.18  ? 970  ILE A H     1 
ATOM   1208 H  HA    . ILE A 1 100 ? 34.398 14.216  22.745  1.00 27.95  ? 970  ILE A HA    1 
ATOM   1209 H  HB    . ILE A 1 100 ? 34.522 13.928  19.921  1.00 27.98  ? 970  ILE A HB    1 
ATOM   1210 H  HG12  . ILE A 1 100 ? 35.528 12.185  21.895  1.00 29.74  ? 970  ILE A HG12  1 
ATOM   1211 H  HG13  . ILE A 1 100 ? 34.605 11.793  20.666  1.00 29.74  ? 970  ILE A HG13  1 
ATOM   1212 H  HG21  . ILE A 1 100 ? 36.790 14.469  20.151  1.00 31.14  ? 970  ILE A HG21  1 
ATOM   1213 H  HG22  . ILE A 1 100 ? 35.897 15.641  20.701  1.00 31.14  ? 970  ILE A HG22  1 
ATOM   1214 H  HG23  . ILE A 1 100 ? 36.591 14.646  21.701  1.00 31.14  ? 970  ILE A HG23  1 
ATOM   1215 H  HD11  . ILE A 1 100 ? 36.743 11.012  20.332  1.00 30.45  ? 970  ILE A HD11  1 
ATOM   1216 H  HD12  . ILE A 1 100 ? 36.396 12.085  19.236  1.00 30.45  ? 970  ILE A HD12  1 
ATOM   1217 H  HD13  . ILE A 1 100 ? 37.311 12.473  20.455  1.00 30.45  ? 970  ILE A HD13  1 
ATOM   1218 N  N     . ARG A 1 101 ? 33.250 16.377  22.695  1.00 23.98  ? 971  ARG A N     1 
ATOM   1219 C  CA    . ARG A 1 101 ? 32.692 17.719  22.626  1.00 21.72  ? 971  ARG A CA    1 
ATOM   1220 C  C     . ARG A 1 101 ? 33.645 18.692  21.943  1.00 24.69  ? 971  ARG A C     1 
ATOM   1221 O  O     . ARG A 1 101 ? 34.849 18.680  22.200  1.00 25.62  ? 971  ARG A O     1 
ATOM   1222 C  CB    . ARG A 1 101 ? 32.374 18.217  24.037  1.00 28.71  ? 971  ARG A CB    1 
ATOM   1223 C  CG    . ARG A 1 101 ? 31.466 17.289  24.830  1.00 26.25  ? 971  ARG A CG    1 
ATOM   1224 C  CD    . ARG A 1 101 ? 30.102 17.162  24.186  1.00 24.98  ? 971  ARG A CD    1 
ATOM   1225 N  NE    . ARG A 1 101 ? 29.160 16.433  25.033  1.00 24.99  ? 971  ARG A NE    1 
ATOM   1226 C  CZ    . ARG A 1 101 ? 27.863 16.307  24.769  1.00 23.54  ? 971  ARG A CZ    1 
ATOM   1227 N  NH1   . ARG A 1 101 ? 27.358 16.859  23.674  1.00 23.99  ? 971  ARG A NH1   1 
ATOM   1228 N  NH2   . ARG A 1 101 ? 27.074 15.627  25.594  1.00 22.49  ? 971  ARG A NH2   1 
ATOM   1229 H  H     . ARG A 1 101 ? 33.472 16.136  23.490  1.00 28.72  ? 971  ARG A H     1 
ATOM   1230 H  HA    . ARG A 1 101 ? 31.857 17.696  22.113  1.00 26.01  ? 971  ARG A HA    1 
ATOM   1231 H  HB2   . ARG A 1 101 ? 33.204 18.311  24.530  1.00 34.39  ? 971  ARG A HB2   1 
ATOM   1232 H  HB3   . ARG A 1 101 ? 31.932 19.078  23.972  1.00 34.39  ? 971  ARG A HB3   1 
ATOM   1233 H  HG2   . ARG A 1 101 ? 31.867 16.406  24.870  1.00 31.45  ? 971  ARG A HG2   1 
ATOM   1234 H  HG3   . ARG A 1 101 ? 31.348 17.644  25.725  1.00 31.45  ? 971  ARG A HG3   1 
ATOM   1235 H  HD2   . ARG A 1 101 ? 29.741 18.048  24.027  1.00 29.93  ? 971  ARG A HD2   1 
ATOM   1236 H  HD3   . ARG A 1 101 ? 30.189 16.681  23.348  1.00 29.93  ? 971  ARG A HD3   1 
ATOM   1237 H  HE    . ARG A 1 101 ? 29.470 16.030  25.726  1.00 29.93  ? 971  ARG A HE    1 
ATOM   1238 H  HH11  . ARG A 1 101 ? 27.869 17.300  23.140  1.00 28.73  ? 971  ARG A HH11  1 
ATOM   1239 H  HH12  . ARG A 1 101 ? 26.520 16.779  23.499  1.00 28.73  ? 971  ARG A HH12  1 
ATOM   1240 H  HH21  . ARG A 1 101 ? 27.402 15.267  26.304  1.00 26.93  ? 971  ARG A HH21  1 
ATOM   1241 H  HH22  . ARG A 1 101 ? 26.236 15.546  25.419  1.00 26.93  ? 971  ARG A HH22  1 
ATOM   1242 N  N     . GLY A 1 102 ? 33.099 19.533  21.071  1.00 23.00  ? 972  GLY A N     1 
ATOM   1243 C  CA    . GLY A 1 102 ? 33.857 20.615  20.471  1.00 28.87  ? 972  GLY A CA    1 
ATOM   1244 C  C     . GLY A 1 102 ? 34.899 20.162  19.469  1.00 34.31  ? 972  GLY A C     1 
ATOM   1245 O  O     . GLY A 1 102 ? 35.879 20.865  19.231  1.00 28.70  ? 972  GLY A O     1 
ATOM   1246 H  H     . GLY A 1 102 ? 32.280 19.495  20.810  1.00 27.55  ? 972  GLY A H     1 
ATOM   1247 H  HA2   . GLY A 1 102 ? 33.246 21.218  20.019  1.00 34.59  ? 972  GLY A HA2   1 
ATOM   1248 H  HA3   . GLY A 1 102 ? 34.309 21.112  21.171  1.00 34.59  ? 972  GLY A HA3   1 
ATOM   1249 N  N     . LEU A 1 103 ? 34.690 18.997  18.865  1.00 29.20  ? 973  LEU A N     1 
ATOM   1250 C  CA    . LEU A 1 103 ? 35.678 18.452  17.942  1.00 22.68  ? 973  LEU A CA    1 
ATOM   1251 C  C     . LEU A 1 103 ? 35.860 19.323  16.700  1.00 21.88  ? 973  LEU A C     1 
ATOM   1252 O  O     . LEU A 1 103 ? 36.987 19.645  16.317  1.00 30.59  ? 973  LEU A O     1 
ATOM   1253 C  CB    . LEU A 1 103 ? 35.302 17.038  17.505  1.00 26.71  ? 973  LEU A CB    1 
ATOM   1254 C  CG    . LEU A 1 103 ? 36.303 16.541  16.458  1.00 34.58  ? 973  LEU A CG    1 
ATOM   1255 C  CD1   . LEU A 1 103 ? 37.257 15.526  17.053  1.00 46.07  ? 973  LEU A CD1   1 
ATOM   1256 C  CD2   . LEU A 1 103 ? 35.596 15.988  15.237  1.00 31.24  ? 973  LEU A CD2   1 
ATOM   1257 H  H     . LEU A 1 103 ? 33.991 18.507  18.970  1.00 34.99  ? 973  LEU A H     1 
ATOM   1258 H  HA    . LEU A 1 103 ? 36.543 18.402  18.401  1.00 27.16  ? 973  LEU A HA    1 
ATOM   1259 H  HB2   . LEU A 1 103 ? 35.331 16.442  18.269  1.00 32.00  ? 973  LEU A HB2   1 
ATOM   1260 H  HB3   . LEU A 1 103 ? 34.417 17.044  17.109  1.00 32.00  ? 973  LEU A HB3   1 
ATOM   1261 H  HG    . LEU A 1 103 ? 36.835 17.297  16.163  1.00 41.45  ? 973  LEU A HG    1 
ATOM   1262 H  HD11  . LEU A 1 103 ? 36.752 14.778  17.381  1.00 55.23  ? 973  LEU A HD11  1 
ATOM   1263 H  HD12  . LEU A 1 103 ? 37.869 15.235  16.373  1.00 55.23  ? 973  LEU A HD12  1 
ATOM   1264 H  HD13  . LEU A 1 103 ? 37.739 15.937  17.775  1.00 55.23  ? 973  LEU A HD13  1 
ATOM   1265 H  HD21  . LEU A 1 103 ? 36.253 15.687  14.605  1.00 37.43  ? 973  LEU A HD21  1 
ATOM   1266 H  HD22  . LEU A 1 103 ? 35.038 15.254  15.505  1.00 37.43  ? 973  LEU A HD22  1 
ATOM   1267 H  HD23  . LEU A 1 103 ? 35.059 16.682  14.847  1.00 37.43  ? 973  LEU A HD23  1 
ATOM   1268 N  N     . ALA A 1 104 ? 34.754 19.695  16.068  1.00 24.89  ? 974  ALA A N     1 
ATOM   1269 C  CA    . ALA A 1 104 ? 34.821 20.466  14.831  1.00 27.47  ? 974  ALA A CA    1 
ATOM   1270 C  C     . ALA A 1 104 ? 35.510 21.807  15.074  1.00 27.86  ? 974  ALA A C     1 
ATOM   1271 O  O     . ALA A 1 104 ? 36.340 22.243  14.278  1.00 27.78  ? 974  ALA A O     1 
ATOM   1272 C  CB    . ALA A 1 104 ? 33.422 20.673  14.245  1.00 24.48  ? 974  ALA A CB    1 
ATOM   1273 H  H     . ALA A 1 104 ? 33.956 19.515  16.331  1.00 29.81  ? 974  ALA A H     1 
ATOM   1274 H  HA    . ALA A 1 104 ? 35.352 19.968  14.175  1.00 32.91  ? 974  ALA A HA    1 
ATOM   1275 H  HB1   . ALA A 1 104 ? 33.496 21.182  13.434  1.00 29.33  ? 974  ALA A HB1   1 
ATOM   1276 H  HB2   . ALA A 1 104 ? 33.031 19.816  14.060  1.00 29.33  ? 974  ALA A HB2   1 
ATOM   1277 H  HB3   . ALA A 1 104 ? 32.884 21.148  14.882  1.00 29.33  ? 974  ALA A HB3   1 
ATOM   1278 N  N     . GLY A 1 105 ? 35.174 22.453  16.184  1.00 28.78  ? 975  GLY A N     1 
ATOM   1279 C  CA    . GLY A 1 105 ? 35.745 23.749  16.507  1.00 29.08  ? 975  GLY A CA    1 
ATOM   1280 C  C     . GLY A 1 105 ? 37.238 23.669  16.772  1.00 42.75  ? 975  GLY A C     1 
ATOM   1281 O  O     . GLY A 1 105 ? 37.999 24.537  16.346  1.00 33.67  ? 975  GLY A O     1 
ATOM   1282 H  H     . GLY A 1 105 ? 34.615 22.159  16.768  1.00 34.48  ? 975  GLY A H     1 
ATOM   1283 H  HA2   . GLY A 1 105 ? 35.596 24.362  15.770  1.00 34.84  ? 975  GLY A HA2   1 
ATOM   1284 H  HA3   . GLY A 1 105 ? 35.311 24.107  17.298  1.00 34.84  ? 975  GLY A HA3   1 
ATOM   1285 N  N     . ALA A 1 106 ? 37.658 22.618  17.472  1.00 31.24  ? 976  ALA A N     1 
ATOM   1286 C  CA    . ALA A 1 106 ? 39.062 22.438  17.836  1.00 29.64  ? 976  ALA A CA    1 
ATOM   1287 C  C     . ALA A 1 106 ? 39.941 22.225  16.605  1.00 32.71  ? 976  ALA A C     1 
ATOM   1288 O  O     . ALA A 1 106 ? 41.087 22.674  16.565  1.00 33.13  ? 976  ALA A O     1 
ATOM   1289 C  CB    . ALA A 1 106 ? 39.213 21.265  18.802  1.00 29.76  ? 976  ALA A CB    1 
ATOM   1290 H  H     . ALA A 1 106 ? 37.143 21.988  17.751  1.00 37.43  ? 976  ALA A H     1 
ATOM   1291 H  HA    . ALA A 1 106 ? 39.376 23.246  18.293  1.00 35.51  ? 976  ALA A HA    1 
ATOM   1292 H  HB1   . ALA A 1 106 ? 40.141 21.165  19.028  1.00 35.66  ? 976  ALA A HB1   1 
ATOM   1293 H  HB2   . ALA A 1 106 ? 38.701 21.445  19.593  1.00 35.66  ? 976  ALA A HB2   1 
ATOM   1294 H  HB3   . ALA A 1 106 ? 38.891 20.467  18.377  1.00 35.66  ? 976  ALA A HB3   1 
ATOM   1295 N  N     . LEU A 1 107 ? 39.403 21.533  15.606  1.00 31.68  ? 977  LEU A N     1 
ATOM   1296 C  CA    . LEU A 1 107 ? 40.137 21.271  14.372  1.00 31.86  ? 977  LEU A CA    1 
ATOM   1297 C  C     . LEU A 1 107 ? 39.801 22.316  13.316  1.00 35.73  ? 977  LEU A C     1 
ATOM   1298 O  O     . LEU A 1 107 ? 40.335 22.284  12.208  1.00 35.33  ? 977  LEU A O     1 
ATOM   1299 C  CB    . LEU A 1 107 ? 39.796 19.882  13.833  1.00 33.67  ? 977  LEU A CB    1 
ATOM   1300 C  CG    . LEU A 1 107 ? 40.094 18.696  14.751  1.00 32.68  ? 977  LEU A CG    1 
ATOM   1301 C  CD1   . LEU A 1 107 ? 39.489 17.429  14.169  1.00 37.56  ? 977  LEU A CD1   1 
ATOM   1302 C  CD2   . LEU A 1 107 ? 41.589 18.528  14.968  1.00 32.67  ? 977  LEU A CD2   1 
ATOM   1303 H  H     . LEU A 1 107 ? 38.609 21.202  15.618  1.00 37.96  ? 977  LEU A H     1 
ATOM   1304 H  HA    . LEU A 1 107 ? 41.100 21.308  14.551  1.00 38.17  ? 977  LEU A HA    1 
ATOM   1305 H  HB2   . LEU A 1 107 ? 38.846 19.859  13.635  1.00 40.34  ? 977  LEU A HB2   1 
ATOM   1306 H  HB3   . LEU A 1 107 ? 40.297 19.744  13.014  1.00 40.34  ? 977  LEU A HB3   1 
ATOM   1307 H  HG    . LEU A 1 107 ? 39.682 18.855  15.615  1.00 39.16  ? 977  LEU A HG    1 
ATOM   1308 H  HD11  . LEU A 1 107 ? 38.539 17.544  14.091  1.00 45.01  ? 977  LEU A HD11  1 
ATOM   1309 H  HD12  . LEU A 1 107 ? 39.872 17.270  13.303  1.00 45.01  ? 977  LEU A HD12  1 
ATOM   1310 H  HD13  . LEU A 1 107 ? 39.683 16.693  14.753  1.00 45.01  ? 977  LEU A HD13  1 
ATOM   1311 H  HD21  . LEU A 1 107 ? 41.738 17.777  15.547  1.00 39.14  ? 977  LEU A HD21  1 
ATOM   1312 H  HD22  . LEU A 1 107 ? 42.013 18.377  14.120  1.00 39.14  ? 977  LEU A HD22  1 
ATOM   1313 H  HD23  . LEU A 1 107 ? 41.938 19.326  15.371  1.00 39.14  ? 977  LEU A HD23  1 
ATOM   1314 N  N     . LYS A 1 108 ? 38.915 23.241  13.668  1.00 29.78  ? 978  LYS A N     1 
ATOM   1315 C  CA    . LYS A 1 108 ? 38.428 24.234  12.723  1.00 33.44  ? 978  LYS A CA    1 
ATOM   1316 C  C     . LYS A 1 108 ? 37.976 23.567  11.425  1.00 33.98  ? 978  LYS A C     1 
ATOM   1317 O  O     . LYS A 1 108 ? 38.319 24.011  10.330  1.00 34.35  ? 978  LYS A O     1 
ATOM   1318 C  CB    . LYS A 1 108 ? 39.501 25.291  12.450  1.00 51.13  ? 978  LYS A CB    1 
ATOM   1319 C  CG    . LYS A 1 108 ? 39.762 26.213  13.637  1.00 55.99  ? 978  LYS A CG    1 
ATOM   1320 C  CD    . LYS A 1 108 ? 40.811 27.267  13.315  1.00 71.75  ? 978  LYS A CD    1 
ATOM   1321 C  CE    . LYS A 1 108 ? 42.017 27.163  14.237  1.00 83.71  ? 978  LYS A CE    1 
ATOM   1322 N  NZ    . LYS A 1 108 ? 41.797 27.850  15.541  1.00 82.57  ? 978  LYS A NZ    1 
ATOM   1323 H  H     . LYS A 1 108 ? 38.578 23.314  14.456  1.00 35.68  ? 978  LYS A H     1 
ATOM   1324 H  HA    . LYS A 1 108 ? 37.652 24.688  13.113  1.00 40.07  ? 978  LYS A HA    1 
ATOM   1325 H  HB2   . LYS A 1 108 ? 40.334 24.844  12.232  1.00 61.29  ? 978  LYS A HB2   1 
ATOM   1326 H  HB3   . LYS A 1 108 ? 39.217 25.841  11.703  1.00 61.29  ? 978  LYS A HB3   1 
ATOM   1327 H  HG2   . LYS A 1 108 ? 38.939 26.668  13.875  1.00 67.14  ? 978  LYS A HG2   1 
ATOM   1328 H  HG3   . LYS A 1 108 ? 40.083 25.686  14.386  1.00 67.14  ? 978  LYS A HG3   1 
ATOM   1329 H  HD2   . LYS A 1 108 ? 41.116 27.146  12.402  1.00 86.05  ? 978  LYS A HD2   1 
ATOM   1330 H  HD3   . LYS A 1 108 ? 40.422 28.149  13.424  1.00 86.05  ? 978  LYS A HD3   1 
ATOM   1331 H  HE2   . LYS A 1 108 ? 42.198 26.227  14.417  1.00 100.40 ? 978  LYS A HE2   1 
ATOM   1332 H  HE3   . LYS A 1 108 ? 42.783 27.573  13.806  1.00 100.40 ? 978  LYS A HE3   1 
ATOM   1333 H  HZ1   . LYS A 1 108 ? 42.521 27.769  16.053  1.00 99.03  ? 978  LYS A HZ1   1 
ATOM   1334 H  HZ2   . LYS A 1 108 ? 41.635 28.715  15.404  1.00 99.03  ? 978  LYS A HZ2   1 
ATOM   1335 H  HZ3   . LYS A 1 108 ? 41.102 27.488  15.962  1.00 99.03  ? 978  LYS A HZ3   1 
ATOM   1336 N  N     . LEU A 1 109 ? 37.219 22.481  11.562  1.00 33.37  ? 979  LEU A N     1 
ATOM   1337 C  CA    . LEU A 1 109 ? 36.536 21.869  10.430  1.00 34.79  ? 979  LEU A CA    1 
ATOM   1338 C  C     . LEU A 1 109 ? 35.470 22.825  9.923   1.00 35.44  ? 979  LEU A C     1 
ATOM   1339 O  O     . LEU A 1 109 ? 34.772 23.455  10.713  1.00 53.53  ? 979  LEU A O     1 
ATOM   1340 C  CB    . LEU A 1 109 ? 35.848 20.568  10.848  1.00 30.72  ? 979  LEU A CB    1 
ATOM   1341 C  CG    . LEU A 1 109 ? 36.677 19.387  11.350  1.00 38.24  ? 979  LEU A CG    1 
ATOM   1342 C  CD1   . LEU A 1 109 ? 35.791 18.142  11.380  1.00 35.45  ? 979  LEU A CD1   1 
ATOM   1343 C  CD2   . LEU A 1 109 ? 37.899 19.149  10.484  1.00 38.60  ? 979  LEU A CD2   1 
ATOM   1344 H  H     . LEU A 1 109 ? 37.085 22.077  12.310  1.00 39.99  ? 979  LEU A H     1 
ATOM   1345 H  HA    . LEU A 1 109 ? 37.173 21.682  9.709   1.00 41.69  ? 979  LEU A HA    1 
ATOM   1346 H  HB2   . LEU A 1 109 ? 35.223 20.785  11.557  1.00 36.80  ? 979  LEU A HB2   1 
ATOM   1347 H  HB3   . LEU A 1 109 ? 35.348 20.246  10.082  1.00 36.80  ? 979  LEU A HB3   1 
ATOM   1348 H  HG    . LEU A 1 109 ? 36.976 19.569  12.254  1.00 45.83  ? 979  LEU A HG    1 
ATOM   1349 H  HD11  . LEU A 1 109 ? 36.309 17.398  11.696  1.00 42.49  ? 979  LEU A HD11  1 
ATOM   1350 H  HD12  . LEU A 1 109 ? 35.051 18.300  11.971  1.00 42.49  ? 979  LEU A HD12  1 
ATOM   1351 H  HD13  . LEU A 1 109 ? 35.469 17.966  10.493  1.00 42.49  ? 979  LEU A HD13  1 
ATOM   1352 H  HD21  . LEU A 1 109 ? 37.614 18.963  9.586   1.00 46.27  ? 979  LEU A HD21  1 
ATOM   1353 H  HD22  . LEU A 1 109 ? 38.449 19.936  10.496  1.00 46.27  ? 979  LEU A HD22  1 
ATOM   1354 H  HD23  . LEU A 1 109 ? 38.388 18.401  10.834  1.00 46.27  ? 979  LEU A HD23  1 
ATOM   1355 N  N     . ASP A 1 110 ? 35.329 22.922  8.607   1.00 31.24  ? 980  ASP A N     1 
ATOM   1356 C  CA    . ASP A 1 110 ? 34.269 23.724  8.018   1.00 37.86  ? 980  ASP A CA    1 
ATOM   1357 C  C     . ASP A 1 110 ? 33.042 22.846  7.789   1.00 37.18  ? 980  ASP A C     1 
ATOM   1358 O  O     . ASP A 1 110 ? 32.924 22.181  6.761   1.00 40.38  ? 980  ASP A O     1 
ATOM   1359 C  CB    . ASP A 1 110 ? 34.736 24.346  6.701   1.00 35.23  ? 980  ASP A CB    1 
ATOM   1360 C  CG    . ASP A 1 110 ? 33.675 25.220  6.061   1.00 37.70  ? 980  ASP A CG    1 
ATOM   1361 O  OD1   . ASP A 1 110 ? 32.702 25.585  6.752   1.00 42.42  ? 980  ASP A OD1   1 
ATOM   1362 O  OD2   . ASP A 1 110 ? 33.822 25.552  4.868   1.00 39.17  ? 980  ASP A OD2   1 
ATOM   1363 H  H     . ASP A 1 110 ? 35.837 22.533  8.033   1.00 37.43  ? 980  ASP A H     1 
ATOM   1364 H  HA    . ASP A 1 110 ? 34.024 24.446  8.634   1.00 45.37  ? 980  ASP A HA    1 
ATOM   1365 H  HB2   . ASP A 1 110 ? 35.517 24.896  6.870   1.00 42.21  ? 980  ASP A HB2   1 
ATOM   1366 H  HB3   . ASP A 1 110 ? 34.957 23.637  6.078   1.00 42.21  ? 980  ASP A HB3   1 
ATOM   1367 N  N     . LEU A 1 111 ? 32.137 22.841  8.764   1.00 31.44  ? 981  LEU A N     1 
ATOM   1368 C  CA    . LEU A 1 111 ? 30.901 22.073  8.668   1.00 32.57  ? 981  LEU A CA    1 
ATOM   1369 C  C     . LEU A 1 111 ? 29.987 22.650  7.591   1.00 31.10  ? 981  LEU A C     1 
ATOM   1370 O  O     . LEU A 1 111 ? 29.037 21.997  7.158   1.00 30.14  ? 981  LEU A O     1 
ATOM   1371 C  CB    . LEU A 1 111 ? 30.172 22.068  10.012  1.00 32.39  ? 981  LEU A CB    1 
ATOM   1372 C  CG    . LEU A 1 111 ? 30.965 21.514  11.198  1.00 46.70  ? 981  LEU A CG    1 
ATOM   1373 C  CD1   . LEU A 1 111 ? 30.219 21.760  12.501  1.00 32.68  ? 981  LEU A CD1   1 
ATOM   1374 C  CD2   . LEU A 1 111 ? 31.256 20.032  11.009  1.00 43.61  ? 981  LEU A CD2   1 
ATOM   1375 H  H     . LEU A 1 111 ? 32.217 23.280  9.498   1.00 37.67  ? 981  LEU A H     1 
ATOM   1376 H  HA    . LEU A 1 111 ? 31.113 21.146  8.429   1.00 39.03  ? 981  LEU A HA    1 
ATOM   1377 H  HB2   . LEU A 1 111 ? 29.926 22.981  10.229  1.00 38.81  ? 981  LEU A HB2   1 
ATOM   1378 H  HB3   . LEU A 1 111 ? 29.370 21.530  9.923   1.00 38.81  ? 981  LEU A HB3   1 
ATOM   1379 H  HG    . LEU A 1 111 ? 31.815 21.979  11.250  1.00 55.98  ? 981  LEU A HG    1 
ATOM   1380 H  HD11  . LEU A 1 111 ? 30.735 21.404  13.228  1.00 39.17  ? 981  LEU A HD11  1 
ATOM   1381 H  HD12  . LEU A 1 111 ? 30.096 22.705  12.618  1.00 39.17  ? 981  LEU A HD12  1 
ATOM   1382 H  HD13  . LEU A 1 111 ? 29.365 21.321  12.460  1.00 39.17  ? 981  LEU A HD13  1 
ATOM   1383 H  HD21  . LEU A 1 111 ? 31.753 19.712  11.766  1.00 52.28  ? 981  LEU A HD21  1 
ATOM   1384 H  HD22  . LEU A 1 111 ? 30.425 19.557  10.938  1.00 52.28  ? 981  LEU A HD22  1 
ATOM   1385 H  HD23  . LEU A 1 111 ? 31.770 19.915  10.206  1.00 52.28  ? 981  LEU A HD23  1 
ATOM   1386 N  N     . GLY A 1 112 ? 30.269 23.880  7.174   1.00 28.26  ? 982  GLY A N     1 
ATOM   1387 C  CA    . GLY A 1 112 ? 29.526 24.511  6.096   1.00 32.71  ? 982  GLY A CA    1 
ATOM   1388 C  C     . GLY A 1 112 ? 29.590 23.713  4.806   1.00 33.43  ? 982  GLY A C     1 
ATOM   1389 O  O     . GLY A 1 112 ? 28.665 23.747  3.993   1.00 30.92  ? 982  GLY A O     1 
ATOM   1390 H  H     . GLY A 1 112 ? 30.893 24.372  7.503   1.00 33.86  ? 982  GLY A H     1 
ATOM   1391 H  HA2   . GLY A 1 112 ? 28.596 24.604  6.355   1.00 39.19  ? 982  GLY A HA2   1 
ATOM   1392 H  HA3   . GLY A 1 112 ? 29.888 25.396  5.928   1.00 39.19  ? 982  GLY A HA3   1 
ATOM   1393 N  N     . LEU A 1 113 ? 30.687 22.988  4.615   1.00 30.44  ? 983  LEU A N     1 
ATOM   1394 C  CA    . LEU A 1 113 ? 30.847 22.135  3.442   1.00 31.82  ? 983  LEU A CA    1 
ATOM   1395 C  C     . LEU A 1 113 ? 29.777 21.046  3.386   1.00 30.75  ? 983  LEU A C     1 
ATOM   1396 O  O     . LEU A 1 113 ? 29.519 20.471  2.329   1.00 28.28  ? 983  LEU A O     1 
ATOM   1397 C  CB    . LEU A 1 113 ? 32.237 21.494  3.443   1.00 30.24  ? 983  LEU A CB    1 
ATOM   1398 C  CG    . LEU A 1 113 ? 33.384 22.438  3.084   1.00 35.11  ? 983  LEU A CG    1 
ATOM   1399 C  CD1   . LEU A 1 113 ? 34.733 21.782  3.331   1.00 31.42  ? 983  LEU A CD1   1 
ATOM   1400 C  CD2   . LEU A 1 113 ? 33.258 22.879  1.636   1.00 45.12  ? 983  LEU A CD2   1 
ATOM   1401 H  H     . LEU A 1 113 ? 31.358 22.973  5.153   1.00 36.48  ? 983  LEU A H     1 
ATOM   1402 H  HA    . LEU A 1 113 ? 30.765 22.683  2.634   1.00 38.13  ? 983  LEU A HA    1 
ATOM   1403 H  HB2   . LEU A 1 113 ? 32.413 21.143  4.330   1.00 36.23  ? 983  LEU A HB2   1 
ATOM   1404 H  HB3   . LEU A 1 113 ? 32.242 20.769  2.799   1.00 36.23  ? 983  LEU A HB3   1 
ATOM   1405 H  HG    . LEU A 1 113 ? 33.329 23.229  3.644   1.00 42.07  ? 983  LEU A HG    1 
ATOM   1406 H  HD11  . LEU A 1 113 ? 35.429 22.401  3.096   1.00 37.65  ? 983  LEU A HD11  1 
ATOM   1407 H  HD12  . LEU A 1 113 ? 34.802 21.549  4.259   1.00 37.65  ? 983  LEU A HD12  1 
ATOM   1408 H  HD13  . LEU A 1 113 ? 34.800 20.993  2.789   1.00 37.65  ? 983  LEU A HD13  1 
ATOM   1409 H  HD21  . LEU A 1 113 ? 33.984 23.470  1.425   1.00 54.09  ? 983  LEU A HD21  1 
ATOM   1410 H  HD22  . LEU A 1 113 ? 33.291 22.104  1.070   1.00 54.09  ? 983  LEU A HD22  1 
ATOM   1411 H  HD23  . LEU A 1 113 ? 32.420 23.334  1.521   1.00 54.09  ? 983  LEU A HD23  1 
ATOM   1412 N  N     . PHE A 1 114 ? 29.159 20.767  4.529   1.00 33.71  ? 984  PHE A N     1 
ATOM   1413 C  CA    . PHE A 1 114 ? 28.144 19.721  4.624   1.00 29.62  ? 984  PHE A CA    1 
ATOM   1414 C  C     . PHE A 1 114 ? 26.744 20.270  4.900   1.00 32.16  ? 984  PHE A C     1 
ATOM   1415 O  O     . PHE A 1 114 ? 25.836 19.512  5.229   1.00 29.07  ? 984  PHE A O     1 
ATOM   1416 C  CB    . PHE A 1 114 ? 28.528 18.716  5.713   1.00 26.13  ? 984  PHE A CB    1 
ATOM   1417 C  CG    . PHE A 1 114 ? 29.837 18.032  5.461   1.00 23.11  ? 984  PHE A CG    1 
ATOM   1418 C  CD1   . PHE A 1 114 ? 29.894 16.875  4.701   1.00 23.08  ? 984  PHE A CD1   1 
ATOM   1419 C  CD2   . PHE A 1 114 ? 31.015 18.551  5.976   1.00 26.35  ? 984  PHE A CD2   1 
ATOM   1420 C  CE1   . PHE A 1 114 ? 31.101 16.245  4.463   1.00 29.56  ? 984  PHE A CE1   1 
ATOM   1421 C  CE2   . PHE A 1 114 ? 32.225 17.925  5.744   1.00 29.62  ? 984  PHE A CE2   1 
ATOM   1422 C  CZ    . PHE A 1 114 ? 32.268 16.773  4.986   1.00 23.88  ? 984  PHE A CZ    1 
ATOM   1423 H  H     . PHE A 1 114 ? 29.310 21.174  5.272   1.00 40.39  ? 984  PHE A H     1 
ATOM   1424 H  HA    . PHE A 1 114 ? 28.111 19.239  3.772   1.00 35.49  ? 984  PHE A HA    1 
ATOM   1425 H  HB2   . PHE A 1 114 ? 28.595 19.183  6.561   1.00 31.30  ? 984  PHE A HB2   1 
ATOM   1426 H  HB3   . PHE A 1 114 ? 27.841 18.034  5.765   1.00 31.30  ? 984  PHE A HB3   1 
ATOM   1427 H  HD1   . PHE A 1 114 ? 29.111 16.517  4.348   1.00 27.64  ? 984  PHE A HD1   1 
ATOM   1428 H  HD2   . PHE A 1 114 ? 30.990 19.328  6.487   1.00 31.56  ? 984  PHE A HD2   1 
ATOM   1429 H  HE1   . PHE A 1 114 ? 31.129 15.468  3.954   1.00 35.42  ? 984  PHE A HE1   1 
ATOM   1430 H  HE2   . PHE A 1 114 ? 33.009 18.281  6.095   1.00 35.48  ? 984  PHE A HE2   1 
ATOM   1431 H  HZ    . PHE A 1 114 ? 33.081 16.350  4.828   1.00 28.60  ? 984  PHE A HZ    1 
ATOM   1432 N  N     . SER A 1 115 ? 26.569 21.582  4.776   1.00 28.92  ? 985  SER A N     1 
ATOM   1433 C  CA    . SER A 1 115 ? 25.246 22.173  4.926   1.00 30.17  ? 985  SER A CA    1 
ATOM   1434 C  C     . SER A 1 115 ? 24.398 21.777  3.729   1.00 30.61  ? 985  SER A C     1 
ATOM   1435 O  O     . SER A 1 115 ? 24.917 21.483  2.654   1.00 26.38  ? 985  SER A O     1 
ATOM   1436 C  CB    . SER A 1 115 ? 25.324 23.700  5.029   1.00 28.94  ? 985  SER A CB    1 
ATOM   1437 O  OG    . SER A 1 115 ? 25.630 24.283  3.774   1.00 32.44  ? 985  SER A OG    1 
ATOM   1438 H  H     . SER A 1 115 ? 27.194 22.146  4.605   1.00 34.64  ? 985  SER A H     1 
ATOM   1439 H  HA    . SER A 1 115 ? 24.821 21.827  5.738   1.00 36.15  ? 985  SER A HA    1 
ATOM   1440 H  HB2   . SER A 1 115 ? 24.468 24.039  5.333   1.00 34.67  ? 985  SER A HB2   1 
ATOM   1441 H  HB3   . SER A 1 115 ? 26.018 23.937  5.664   1.00 34.67  ? 985  SER A HB3   1 
ATOM   1442 H  HG    . SER A 1 115 ? 25.713 23.698  3.205   1.00 38.87  ? 985  SER A HG    1 
ATOM   1443 N  N     . THR A 1 116 ? 23.088 21.769  3.917   1.00 30.20  ? 986  THR A N     1 
ATOM   1444 C  CA    . THR A 1 116 ? 22.174 21.393  2.853   1.00 31.02  ? 986  THR A CA    1 
ATOM   1445 C  C     . THR A 1 116 ? 22.318 22.319  1.652   1.00 28.61  ? 986  THR A C     1 
ATOM   1446 O  O     . THR A 1 116 ? 22.278 21.872  0.514   1.00 34.12  ? 986  THR A O     1 
ATOM   1447 C  CB    . THR A 1 116 ? 20.736 21.411  3.361   1.00 29.66  ? 986  THR A CB    1 
ATOM   1448 O  OG1   . THR A 1 116 ? 20.582 20.369  4.332   1.00 29.06  ? 986  THR A OG1   1 
ATOM   1449 C  CG2   . THR A 1 116 ? 19.755 21.197  2.220   1.00 27.65  ? 986  THR A CG2   1 
ATOM   1450 H  H     . THR A 1 116 ? 22.702 21.978  4.656   1.00 36.18  ? 986  THR A H     1 
ATOM   1451 H  HA    . THR A 1 116 ? 22.381 20.481  2.561   1.00 37.17  ? 986  THR A HA    1 
ATOM   1452 H  HB    . THR A 1 116 ? 20.548 22.269  3.773   1.00 35.54  ? 986  THR A HB    1 
ATOM   1453 H  HG1   . THR A 1 116 ? 19.813 20.363  4.617   1.00 34.81  ? 986  THR A HG1   1 
ATOM   1454 H  HG21  . THR A 1 116 ? 19.855 21.893  1.566   1.00 33.12  ? 986  THR A HG21  1 
ATOM   1455 H  HG22  . THR A 1 116 ? 19.919 20.349  1.801   1.00 33.12  ? 986  THR A HG22  1 
ATOM   1456 H  HG23  . THR A 1 116 ? 18.855 21.210  2.554   1.00 33.12  ? 986  THR A HG23  1 
ATOM   1457 N  N     . LYS A 1 117 ? 22.495 23.609  1.908   1.00 32.37  ? 987  LYS A N     1 
ATOM   1458 C  CA    . LYS A 1 117 ? 22.691 24.578  0.838   1.00 38.80  ? 987  LYS A CA    1 
ATOM   1459 C  C     . LYS A 1 117 ? 23.890 24.195  -0.031  1.00 40.18  ? 987  LYS A C     1 
ATOM   1460 O  O     . LYS A 1 117 ? 23.794 24.153  -1.258  1.00 32.56  ? 987  LYS A O     1 
ATOM   1461 C  CB    . LYS A 1 117 ? 22.880 25.976  1.430   1.00 51.46  ? 987  LYS A CB    1 
ATOM   1462 C  CG    . LYS A 1 117 ? 23.358 27.026  0.440   1.00 54.30  ? 987  LYS A CG    1 
ATOM   1463 C  CD    . LYS A 1 117 ? 23.540 28.375  1.124   1.00 74.30  ? 987  LYS A CD    1 
ATOM   1464 C  CE    . LYS A 1 117 ? 23.924 29.468  0.138   1.00 77.40  ? 987  LYS A CE    1 
ATOM   1465 N  NZ    . LYS A 1 117 ? 25.267 29.242  -0.466  1.00 79.40  ? 987  LYS A NZ    1 
ATOM   1466 H  H     . LYS A 1 117 ? 22.506 23.951  2.698   1.00 38.79  ? 987  LYS A H     1 
ATOM   1467 H  HA    . LYS A 1 117 ? 21.894 24.593  0.268   1.00 46.50  ? 987  LYS A HA    1 
ATOM   1468 H  HB2   . LYS A 1 117 ? 22.031 26.277  1.791   1.00 61.69  ? 987  LYS A HB2   1 
ATOM   1469 H  HB3   . LYS A 1 117 ? 23.537 25.924  2.143   1.00 61.69  ? 987  LYS A HB3   1 
ATOM   1470 H  HG2   . LYS A 1 117 ? 24.212 26.754  0.069   1.00 65.10  ? 987  LYS A HG2   1 
ATOM   1471 H  HG3   . LYS A 1 117 ? 22.700 27.127  -0.266  1.00 65.10  ? 987  LYS A HG3   1 
ATOM   1472 H  HD2   . LYS A 1 117 ? 22.706 28.631  1.549   1.00 89.10  ? 987  LYS A HD2   1 
ATOM   1473 H  HD3   . LYS A 1 117 ? 24.245 28.304  1.786   1.00 89.10  ? 987  LYS A HD3   1 
ATOM   1474 H  HE2   . LYS A 1 117 ? 23.271 29.491  -0.580  1.00 92.82  ? 987  LYS A HE2   1 
ATOM   1475 H  HE3   . LYS A 1 117 ? 23.941 30.321  0.600   1.00 92.82  ? 987  LYS A HE3   1 
ATOM   1476 H  HZ1   . LYS A 1 117 ? 25.887 29.223  0.172   1.00 95.23  ? 987  LYS A HZ1   1 
ATOM   1477 H  HZ2   . LYS A 1 117 ? 25.277 28.467  -0.902  1.00 95.23  ? 987  LYS A HZ2   1 
ATOM   1478 H  HZ3   . LYS A 1 117 ? 25.458 29.898  -1.036  1.00 95.23  ? 987  LYS A HZ3   1 
ATOM   1479 N  N     . THR A 1 118 ? 25.016 23.906  0.611   1.00 32.27  ? 988  THR A N     1 
ATOM   1480 C  CA    . THR A 1 118 ? 26.234 23.541  -0.103  1.00 33.01  ? 988  THR A CA    1 
ATOM   1481 C  C     . THR A 1 118 ? 26.064 22.221  -0.851  1.00 34.71  ? 988  THR A C     1 
ATOM   1482 O  O     . THR A 1 118 ? 26.578 22.055  -1.956  1.00 30.87  ? 988  THR A O     1 
ATOM   1483 C  CB    . THR A 1 118 ? 27.429 23.422  0.861   1.00 31.02  ? 988  THR A CB    1 
ATOM   1484 O  OG1   . THR A 1 118 ? 27.624 24.669  1.540   1.00 33.98  ? 988  THR A OG1   1 
ATOM   1485 C  CG2   . THR A 1 118 ? 28.696 23.058  0.102   1.00 35.98  ? 988  THR A CG2   1 
ATOM   1486 H  H     . THR A 1 118 ? 25.101 23.914  1.467   1.00 38.66  ? 988  THR A H     1 
ATOM   1487 H  HA    . THR A 1 118 ? 26.441 24.239  -0.759  1.00 39.56  ? 988  THR A HA    1 
ATOM   1488 H  HB    . THR A 1 118 ? 27.251 22.725  1.511   1.00 37.17  ? 988  THR A HB    1 
ATOM   1489 H  HG1   . THR A 1 118 ? 28.259 24.612  2.055   1.00 40.72  ? 988  THR A HG1   1 
ATOM   1490 H  HG21  . THR A 1 118 ? 29.434 22.986  0.711   1.00 43.11  ? 988  THR A HG21  1 
ATOM   1491 H  HG22  . THR A 1 118 ? 28.579 22.217  -0.347  1.00 43.11  ? 988  THR A HG22  1 
ATOM   1492 H  HG23  . THR A 1 118 ? 28.894 23.735  -0.550  1.00 43.11  ? 988  THR A HG23  1 
ATOM   1493 N  N     . LEU A 1 119 ? 25.337 21.289  -0.246  1.00 32.40  ? 989  LEU A N     1 
ATOM   1494 C  CA    . LEU A 1 119 ? 25.114 19.981  -0.850  1.00 34.47  ? 989  LEU A CA    1 
ATOM   1495 C  C     . LEU A 1 119 ? 24.263 20.105  -2.110  1.00 33.52  ? 989  LEU A C     1 
ATOM   1496 O  O     . LEU A 1 119 ? 24.548 19.468  -3.120  1.00 32.27  ? 989  LEU A O     1 
ATOM   1497 C  CB    . LEU A 1 119 ? 24.433 19.042  0.147   1.00 31.04  ? 989  LEU A CB    1 
ATOM   1498 C  CG    . LEU A 1 119 ? 25.260 18.714  1.391   1.00 35.61  ? 989  LEU A CG    1 
ATOM   1499 C  CD1   . LEU A 1 119 ? 24.411 18.002  2.431   1.00 44.36  ? 989  LEU A CD1   1 
ATOM   1500 C  CD2   . LEU A 1 119 ? 26.473 17.882  1.017   1.00 32.51  ? 989  LEU A CD2   1 
ATOM   1501 H  H     . LEU A 1 119 ? 24.959 21.390  0.520   1.00 38.83  ? 989  LEU A H     1 
ATOM   1502 H  HA    . LEU A 1 119 ? 25.976 19.589  -1.100  1.00 41.30  ? 989  LEU A HA    1 
ATOM   1503 H  HB2   . LEU A 1 119 ? 23.607 19.455  0.446   1.00 37.19  ? 989  LEU A HB2   1 
ATOM   1504 H  HB3   . LEU A 1 119 ? 24.235 18.206  -0.302  1.00 37.19  ? 989  LEU A HB3   1 
ATOM   1505 H  HG    . LEU A 1 119 ? 25.578 19.542  1.783   1.00 42.67  ? 989  LEU A HG    1 
ATOM   1506 H  HD11  . LEU A 1 119 ? 24.954 17.809  3.198   1.00 53.18  ? 989  LEU A HD11  1 
ATOM   1507 H  HD12  . LEU A 1 119 ? 23.681 18.573  2.681   1.00 53.18  ? 989  LEU A HD12  1 
ATOM   1508 H  HD13  . LEU A 1 119 ? 24.074 17.186  2.053   1.00 53.18  ? 989  LEU A HD13  1 
ATOM   1509 H  HD21  . LEU A 1 119 ? 26.976 17.689  1.812   1.00 38.95  ? 989  LEU A HD21  1 
ATOM   1510 H  HD22  . LEU A 1 119 ? 26.177 17.064  0.610   1.00 38.95  ? 989  LEU A HD22  1 
ATOM   1511 H  HD23  . LEU A 1 119 ? 27.014 18.379  0.400   1.00 38.95  ? 989  LEU A HD23  1 
ATOM   1512 N  N     . VAL A 1 120 ? 23.221 20.929  -2.047  1.00 32.79  ? 990  VAL A N     1 
ATOM   1513 C  CA    . VAL A 1 120 ? 22.352 21.147  -3.201  1.00 37.50  ? 990  VAL A CA    1 
ATOM   1514 C  C     . VAL A 1 120 ? 23.145 21.752  -4.355  1.00 38.95  ? 990  VAL A C     1 
ATOM   1515 O  O     . VAL A 1 120 ? 22.974 21.363  -5.509  1.00 41.82  ? 990  VAL A O     1 
ATOM   1516 C  CB    . VAL A 1 120 ? 21.169 22.074  -2.857  1.00 45.04  ? 990  VAL A CB    1 
ATOM   1517 C  CG1   . VAL A 1 120 ? 20.444 22.514  -4.124  1.00 54.11  ? 990  VAL A CG1   1 
ATOM   1518 C  CG2   . VAL A 1 120 ? 20.208 21.381  -1.908  1.00 39.52  ? 990  VAL A CG2   1 
ATOM   1519 H  H     . VAL A 1 120 ? 22.995 21.375  -1.347  1.00 39.29  ? 990  VAL A H     1 
ATOM   1520 H  HA    . VAL A 1 120 ? 21.989 20.286  -3.497  1.00 44.95  ? 990  VAL A HA    1 
ATOM   1521 H  HB    . VAL A 1 120 ? 21.511 22.876  -2.410  1.00 53.99  ? 990  VAL A HB    1 
ATOM   1522 H  HG11  . VAL A 1 120 ? 19.714 23.089  -3.882  1.00 64.87  ? 990  VAL A HG11  1 
ATOM   1523 H  HG12  . VAL A 1 120 ? 21.061 22.987  -4.688  1.00 64.87  ? 990  VAL A HG12  1 
ATOM   1524 H  HG13  . VAL A 1 120 ? 20.112 21.737  -4.579  1.00 64.87  ? 990  VAL A HG13  1 
ATOM   1525 H  HG21  . VAL A 1 120 ? 19.481 21.977  -1.709  1.00 47.36  ? 990  VAL A HG21  1 
ATOM   1526 H  HG22  . VAL A 1 120 ? 19.873 20.586  -2.328  1.00 47.36  ? 990  VAL A HG22  1 
ATOM   1527 H  HG23  . VAL A 1 120 ? 20.675 21.154  -1.101  1.00 47.36  ? 990  VAL A HG23  1 
ATOM   1528 N  N     . GLU A 1 121 ? 24.014 22.706  -4.040  1.00 36.02  ? 991  GLU A N     1 
ATOM   1529 C  CA    . GLU A 1 121 ? 24.821 23.362  -5.062  1.00 41.77  ? 991  GLU A CA    1 
ATOM   1530 C  C     . GLU A 1 121 ? 25.818 22.393  -5.692  1.00 42.73  ? 991  GLU A C     1 
ATOM   1531 O  O     . GLU A 1 121 ? 26.072 22.450  -6.894  1.00 38.33  ? 991  GLU A O     1 
ATOM   1532 C  CB    . GLU A 1 121 ? 25.548 24.569  -4.466  1.00 37.48  ? 991  GLU A CB    1 
ATOM   1533 C  CG    . GLU A 1 121 ? 24.600 25.675  -4.033  1.00 69.59  ? 991  GLU A CG    1 
ATOM   1534 C  CD    . GLU A 1 121 ? 25.282 26.774  -3.240  1.00 87.76  ? 991  GLU A CD    1 
ATOM   1535 O  OE1   . GLU A 1 121 ? 26.464 26.606  -2.874  1.00 95.08  ? 991  GLU A OE1   1 
ATOM   1536 O  OE2   . GLU A 1 121 ? 24.630 27.807  -2.980  1.00 82.99  ? 991  GLU A OE2   1 
ATOM   1537 H  H     . GLU A 1 121 ? 24.155 22.992  -3.242  1.00 43.17  ? 991  GLU A H     1 
ATOM   1538 H  HA    . GLU A 1 121 ? 24.230 23.688  -5.772  1.00 50.07  ? 991  GLU A HA    1 
ATOM   1539 H  HB2   . GLU A 1 121 ? 26.050 24.282  -3.687  1.00 44.93  ? 991  GLU A HB2   1 
ATOM   1540 H  HB3   . GLU A 1 121 ? 26.151 24.935  -5.132  1.00 44.93  ? 991  GLU A HB3   1 
ATOM   1541 H  HG2   . GLU A 1 121 ? 24.206 26.078  -4.822  1.00 83.45  ? 991  GLU A HG2   1 
ATOM   1542 H  HG3   . GLU A 1 121 ? 23.905 25.292  -3.475  1.00 83.45  ? 991  GLU A HG3   1 
ATOM   1543 N  N     . ALA A 1 122 ? 26.369 21.496  -4.880  1.00 36.37  ? 992  ALA A N     1 
ATOM   1544 C  CA    . ALA A 1 122 ? 27.362 20.537  -5.354  1.00 35.88  ? 992  ALA A CA    1 
ATOM   1545 C  C     . ALA A 1 122 ? 26.755 19.486  -6.282  1.00 43.00  ? 992  ALA A C     1 
ATOM   1546 O  O     . ALA A 1 122 ? 27.203 19.322  -7.416  1.00 40.18  ? 992  ALA A O     1 
ATOM   1547 C  CB    . ALA A 1 122 ? 28.040 19.861  -4.174  1.00 33.03  ? 992  ALA A CB    1 
ATOM   1548 H  H     . ALA A 1 122 ? 26.182 21.421  -4.044  1.00 43.58  ? 992  ALA A H     1 
ATOM   1549 H  HA    . ALA A 1 122 ? 28.050 21.020  -5.858  1.00 42.99  ? 992  ALA A HA    1 
ATOM   1550 H  HB1   . ALA A 1 122 ? 28.689 19.235  -4.504  1.00 39.58  ? 992  ALA A HB1   1 
ATOM   1551 H  HB2   . ALA A 1 122 ? 28.472 20.530  -3.637  1.00 39.58  ? 992  ALA A HB2   1 
ATOM   1552 H  HB3   . ALA A 1 122 ? 27.376 19.402  -3.654  1.00 39.58  ? 992  ALA A HB3   1 
ATOM   1553 N  N     . ASN A 1 123 ? 25.749 18.765  -5.796  1.00 39.07  ? 993  ASN A N     1 
ATOM   1554 C  CA    . ASN A 1 123 ? 25.115 17.711  -6.585  1.00 38.94  ? 993  ASN A CA    1 
ATOM   1555 C  C     . ASN A 1 123 ? 23.616 17.616  -6.335  1.00 40.13  ? 993  ASN A C     1 
ATOM   1556 O  O     . ASN A 1 123 ? 23.164 16.746  -5.596  1.00 31.91  ? 993  ASN A O     1 
ATOM   1557 C  CB    . ASN A 1 123 ? 25.754 16.363  -6.256  1.00 38.64  ? 993  ASN A CB    1 
ATOM   1558 C  CG    . ASN A 1 123 ? 27.249 16.356  -6.488  1.00 33.29  ? 993  ASN A CG    1 
ATOM   1559 O  OD1   . ASN A 1 123 ? 27.717 16.025  -7.576  1.00 43.80  ? 993  ASN A OD1   1 
ATOM   1560 N  ND2   . ASN A 1 123 ? 28.010 16.723  -5.464  1.00 28.95  ? 993  ASN A ND2   1 
ATOM   1561 H  H     . ASN A 1 123 ? 25.414 18.865  -5.010  1.00 46.83  ? 993  ASN A H     1 
ATOM   1562 H  HA    . ASN A 1 123 ? 25.255 17.892  -7.538  1.00 46.67  ? 993  ASN A HA    1 
ATOM   1563 H  HB2   . ASN A 1 123 ? 25.594 16.157  -5.322  1.00 46.31  ? 993  ASN A HB2   1 
ATOM   1564 H  HB3   . ASN A 1 123 ? 25.359 15.679  -6.819  1.00 46.31  ? 993  ASN A HB3   1 
ATOM   1565 H  HD21  . ASN A 1 123 ? 28.866 16.735  -5.547  1.00 34.69  ? 993  ASN A HD21  1 
ATOM   1566 H  HD22  . ASN A 1 123 ? 27.647 16.949  -4.718  1.00 34.69  ? 993  ASN A HD22  1 
ATOM   1567 N  N     . ASN A 1 124 ? 22.839 18.478  -6.980  1.00 35.18  ? 994  ASN A N     1 
ATOM   1568 C  CA    . ASN A 1 124 ? 21.433 18.628  -6.627  1.00 43.16  ? 994  ASN A CA    1 
ATOM   1569 C  C     . ASN A 1 124 ? 20.561 17.435  -7.034  1.00 34.50  ? 994  ASN A C     1 
ATOM   1570 O  O     . ASN A 1 124 ? 19.473 17.251  -6.492  1.00 36.04  ? 994  ASN A O     1 
ATOM   1571 C  CB    . ASN A 1 124 ? 20.876 19.932  -7.207  1.00 49.76  ? 994  ASN A CB    1 
ATOM   1572 C  CG    . ASN A 1 124 ? 20.597 19.842  -8.689  1.00 55.81  ? 994  ASN A CG    1 
ATOM   1573 O  OD1   . ASN A 1 124 ? 21.511 19.667  -9.495  1.00 55.92  ? 994  ASN A OD1   1 
ATOM   1574 N  ND2   . ASN A 1 124 ? 19.330 19.976  -9.060  1.00 56.79  ? 994  ASN A ND2   1 
ATOM   1575 H  H     . ASN A 1 124 ? 23.100 18.986  -7.624  1.00 42.16  ? 994  ASN A H     1 
ATOM   1576 H  HA    . ASN A 1 124 ? 21.375 18.702  -5.652  1.00 51.73  ? 994  ASN A HA    1 
ATOM   1577 H  HB2   . ASN A 1 124 ? 20.043 20.147  -6.758  1.00 59.65  ? 994  ASN A HB2   1 
ATOM   1578 H  HB3   . ASN A 1 124 ? 21.521 20.642  -7.065  1.00 59.65  ? 994  ASN A HB3   1 
ATOM   1579 H  HD21  . ASN A 1 124 ? 19.119 19.933  -9.892  1.00 68.09  ? 994  ASN A HD21  1 
ATOM   1580 H  HD22  . ASN A 1 124 ? 18.720 20.106  -8.468  1.00 68.09  ? 994  ASN A HD22  1 
ATOM   1581 N  N     . GLU A 1 125 ? 21.040 16.619  -7.968  1.00 31.34  ? 995  GLU A N     1 
ATOM   1582 C  CA    . GLU A 1 125 ? 20.280 15.451  -8.412  1.00 31.03  ? 995  GLU A CA    1 
ATOM   1583 C  C     . GLU A 1 125 ? 20.738 14.170  -7.717  1.00 33.88  ? 995  GLU A C     1 
ATOM   1584 O  O     . GLU A 1 125 ? 20.260 13.080  -8.030  1.00 31.71  ? 995  GLU A O     1 
ATOM   1585 C  CB    . GLU A 1 125 ? 20.402 15.270  -9.927  1.00 39.68  ? 995  GLU A CB    1 
ATOM   1586 C  CG    . GLU A 1 125 ? 20.036 16.503  -10.745 1.00 59.12  ? 995  GLU A CG    1 
ATOM   1587 C  CD    . GLU A 1 125 ? 18.552 16.830  -10.706 1.00 74.85  ? 995  GLU A CD    1 
ATOM   1588 O  OE1   . GLU A 1 125 ? 17.930 16.700  -9.629  1.00 63.15  ? 995  GLU A OE1   1 
ATOM   1589 O  OE2   . GLU A 1 125 ? 18.006 17.221  -11.760 1.00 92.29  ? 995  GLU A OE2   1 
ATOM   1590 H  H     . GLU A 1 125 ? 21.799 16.717  -8.361  1.00 37.55  ? 995  GLU A H     1 
ATOM   1591 H  HA    . GLU A 1 125 ? 19.333 15.588  -8.199  1.00 37.18  ? 995  GLU A HA    1 
ATOM   1592 H  HB2   . GLU A 1 125 ? 21.320 15.039  -10.138 1.00 47.56  ? 995  GLU A HB2   1 
ATOM   1593 H  HB3   . GLU A 1 125 ? 19.813 14.550  -10.201 1.00 47.56  ? 995  GLU A HB3   1 
ATOM   1594 H  HG2   . GLU A 1 125 ? 20.519 17.268  -10.395 1.00 70.89  ? 995  GLU A HG2   1 
ATOM   1595 H  HG3   . GLU A 1 125 ? 20.283 16.351  -11.671 1.00 70.89  ? 995  GLU A HG3   1 
ATOM   1596 N  N     . HIS A 1 126 ? 21.667 14.301  -6.778  1.00 30.51  ? 996  HIS A N     1 
ATOM   1597 C  CA    . HIS A 1 126 ? 22.199 13.139  -6.073  1.00 31.66  ? 996  HIS A CA    1 
ATOM   1598 C  C     . HIS A 1 126 ? 21.083 12.398  -5.341  1.00 36.56  ? 996  HIS A C     1 
ATOM   1599 O  O     . HIS A 1 126 ? 20.158 13.016  -4.821  1.00 28.73  ? 996  HIS A O     1 
ATOM   1600 C  CB    . HIS A 1 126 ? 23.274 13.570  -5.082  1.00 30.46  ? 996  HIS A CB    1 
ATOM   1601 C  CG    . HIS A 1 126 ? 24.215 12.473  -4.711  1.00 33.55  ? 996  HIS A CG    1 
ATOM   1602 N  ND1   . HIS A 1 126 ? 25.202 12.021  -5.560  1.00 36.30  ? 996  HIS A ND1   1 
ATOM   1603 C  CD2   . HIS A 1 126 ? 24.317 11.728  -3.586  1.00 31.43  ? 996  HIS A CD2   1 
ATOM   1604 C  CE1   . HIS A 1 126 ? 25.873 11.048  -4.972  1.00 35.67  ? 996  HIS A CE1   1 
ATOM   1605 N  NE2   . HIS A 1 126 ? 25.357 10.853  -3.772  1.00 33.96  ? 996  HIS A NE2   1 
ATOM   1606 H  H     . HIS A 1 126 ? 22.007 15.051  -6.530  1.00 36.56  ? 996  HIS A H     1 
ATOM   1607 H  HA    . HIS A 1 126 ? 22.604 12.525  -6.720  1.00 37.93  ? 996  HIS A HA    1 
ATOM   1608 H  HB2   . HIS A 1 126 ? 23.794 14.287  -5.476  1.00 36.50  ? 996  HIS A HB2   1 
ATOM   1609 H  HB3   . HIS A 1 126 ? 22.844 13.881  -4.270  1.00 36.50  ? 996  HIS A HB3   1 
ATOM   1610 H  HD1   . HIS A 1 126 ? 25.357 12.326  -6.349  1.00 43.51  ? 996  HIS A HD1   1 
ATOM   1611 H  HD2   . HIS A 1 126 ? 23.784 11.799  -2.827  1.00 37.66  ? 996  HIS A HD2   1 
ATOM   1612 H  HE1   . HIS A 1 126 ? 26.590 10.581  -5.339  1.00 42.74  ? 996  HIS A HE1   1 
ATOM   1613 H  HE2   . HIS A 1 126 ? 25.627 10.269  -3.201  1.00 40.69  ? 996  HIS A HE2   1 
ATOM   1614 N  N     . MET A 1 127 ? 21.174 11.073  -5.289  1.00 29.84  ? 997  MET A N     1 
ATOM   1615 C  CA    . MET A 1 127 ? 20.097 10.276  -4.718  1.00 25.01  ? 997  MET A CA    1 
ATOM   1616 C  C     . MET A 1 127 ? 20.084 10.320  -3.196  1.00 21.56  ? 997  MET A C     1 
ATOM   1617 O  O     . MET A 1 127 ? 21.129 10.383  -2.550  1.00 27.83  ? 997  MET A O     1 
ATOM   1618 C  CB    . MET A 1 127 ? 20.192 8.823   -5.177  1.00 32.47  ? 997  MET A CB    1 
ATOM   1619 C  CG    . MET A 1 127 ? 19.006 7.976   -4.731  1.00 45.02  ? 997  MET A CG    1 
ATOM   1620 S  SD    . MET A 1 127 ? 19.048 6.299   -5.389  1.00 61.35  ? 997  MET A SD    1 
ATOM   1621 C  CE    . MET A 1 127 ? 19.698 6.605   -7.029  1.00 33.84  ? 997  MET A CE    1 
ATOM   1622 H  H     . MET A 1 127 ? 21.844 10.616  -5.575  1.00 35.75  ? 997  MET A H     1 
ATOM   1623 H  HA    . MET A 1 127 ? 19.244 10.632  -5.044  1.00 29.96  ? 997  MET A HA    1 
ATOM   1624 H  HB2   . MET A 1 127 ? 20.228 8.800   -6.146  1.00 38.91  ? 997  MET A HB2   1 
ATOM   1625 H  HB3   . MET A 1 127 ? 20.997 8.428   -4.807  1.00 38.91  ? 997  MET A HB3   1 
ATOM   1626 H  HG2   . MET A 1 127 ? 19.007 7.917   -3.763  1.00 53.97  ? 997  MET A HG2   1 
ATOM   1627 H  HG3   . MET A 1 127 ? 18.187 8.396   -5.036  1.00 53.97  ? 997  MET A HG3   1 
ATOM   1628 H  HE1   . MET A 1 127 ? 19.771 5.770   -7.496  1.00 40.55  ? 997  MET A HE1   1 
ATOM   1629 H  HE2   . MET A 1 127 ? 19.099 7.192   -7.497  1.00 40.55  ? 997  MET A HE2   1 
ATOM   1630 H  HE3   . MET A 1 127 ? 20.563 7.014   -6.950  1.00 40.55  ? 997  MET A HE3   1 
ATOM   1631 N  N     . VAL A 1 128 ? 18.878 10.280  -2.641  1.00 24.67  ? 998  VAL A N     1 
ATOM   1632 C  CA    . VAL A 1 128 ? 18.672 10.267  -1.203  1.00 24.43  ? 998  VAL A CA    1 
ATOM   1633 C  C     . VAL A 1 128 ? 17.655 9.184   -0.893  1.00 27.64  ? 998  VAL A C     1 
ATOM   1634 O  O     . VAL A 1 128 ? 16.573 9.164   -1.476  1.00 27.99  ? 998  VAL A O     1 
ATOM   1635 C  CB    . VAL A 1 128 ? 18.113 11.616  -0.697  1.00 25.69  ? 998  VAL A CB    1 
ATOM   1636 C  CG1   . VAL A 1 128 ? 17.865 11.565  0.808   1.00 23.07  ? 998  VAL A CG1   1 
ATOM   1637 C  CG2   . VAL A 1 128 ? 19.055 12.759  -1.049  1.00 30.59  ? 998  VAL A CG2   1 
ATOM   1638 H  H     . VAL A 1 128 ? 18.146 10.259  -3.091  1.00 29.55  ? 998  VAL A H     1 
ATOM   1639 H  HA    . VAL A 1 128 ? 19.512 10.068  -0.738  1.00 29.26  ? 998  VAL A HA    1 
ATOM   1640 H  HB    . VAL A 1 128 ? 17.254 11.787  -1.137  1.00 30.78  ? 998  VAL A HB    1 
ATOM   1641 H  HG11  . VAL A 1 128 ? 17.519 12.413  1.096   1.00 27.63  ? 998  VAL A HG11  1 
ATOM   1642 H  HG12  . VAL A 1 128 ? 17.230 10.871  0.997   1.00 27.63  ? 998  VAL A HG12  1 
ATOM   1643 H  HG13  . VAL A 1 128 ? 18.695 11.382  1.255   1.00 27.63  ? 998  VAL A HG13  1 
ATOM   1644 H  HG21  . VAL A 1 128 ? 18.682 13.582  -0.724  1.00 36.65  ? 998  VAL A HG21  1 
ATOM   1645 H  HG22  . VAL A 1 128 ? 19.907 12.600  -0.638  1.00 36.65  ? 998  VAL A HG22  1 
ATOM   1646 H  HG23  . VAL A 1 128 ? 19.154 12.799  -2.003  1.00 36.65  ? 998  VAL A HG23  1 
ATOM   1647 N  N     . GLU A 1 129 ? 17.994 8.271   0.006   1.00 21.50  ? 999  GLU A N     1 
ATOM   1648 C  CA    . GLU A 1 129 ? 17.010 7.306   0.462   1.00 24.12  ? 999  GLU A CA    1 
ATOM   1649 C  C     . GLU A 1 129 ? 16.147 7.994   1.510   1.00 32.71  ? 999  GLU A C     1 
ATOM   1650 O  O     . GLU A 1 129 ? 16.652 8.693   2.379   1.00 30.57  ? 999  GLU A O     1 
ATOM   1651 C  CB    . GLU A 1 129 ? 17.672 6.056   1.036   1.00 25.46  ? 999  GLU A CB    1 
ATOM   1652 C  CG    . GLU A 1 129 ? 16.672 5.071   1.616   1.00 29.13  ? 999  GLU A CG    1 
ATOM   1653 C  CD    . GLU A 1 129 ? 17.337 3.880   2.269   1.00 41.52  ? 999  GLU A CD    1 
ATOM   1654 O  OE1   . GLU A 1 129 ? 18.391 3.438   1.769   1.00 34.75  ? 999  GLU A OE1   1 
ATOM   1655 O  OE2   . GLU A 1 129 ? 16.808 3.392   3.289   1.00 45.31  ? 999  GLU A OE2   1 
ATOM   1656 H  H     . GLU A 1 129 ? 18.773 8.189   0.361   1.00 25.75  ? 999  GLU A H     1 
ATOM   1657 H  HA    . GLU A 1 129 ? 16.438 7.040   -0.288  1.00 28.89  ? 999  GLU A HA    1 
ATOM   1658 H  HB2   . GLU A 1 129 ? 18.161 5.606   0.330   1.00 30.50  ? 999  GLU A HB2   1 
ATOM   1659 H  HB3   . GLU A 1 129 ? 18.279 6.319   1.746   1.00 30.50  ? 999  GLU A HB3   1 
ATOM   1660 H  HG2   . GLU A 1 129 ? 16.137 5.522   2.288   1.00 34.90  ? 999  GLU A HG2   1 
ATOM   1661 H  HG3   . GLU A 1 129 ? 16.102 4.743   0.903   1.00 34.90  ? 999  GLU A HG3   1 
ATOM   1662 N  N     . VAL A 1 130 ? 14.840 7.813   1.410   1.00 25.42  ? 1000 VAL A N     1 
ATOM   1663 C  CA    . VAL A 1 130 ? 13.915 8.472   2.312   1.00 30.68  ? 1000 VAL A CA    1 
ATOM   1664 C  C     . VAL A 1 130 ? 13.189 7.444   3.164   1.00 36.40  ? 1000 VAL A C     1 
ATOM   1665 O  O     . VAL A 1 130 ? 12.689 6.441   2.661   1.00 29.62  ? 1000 VAL A O     1 
ATOM   1666 C  CB    . VAL A 1 130 ? 12.893 9.321   1.530   1.00 32.34  ? 1000 VAL A CB    1 
ATOM   1667 C  CG1   . VAL A 1 130 ? 11.842 9.893   2.465   1.00 33.33  ? 1000 VAL A CG1   1 
ATOM   1668 C  CG2   . VAL A 1 130 ? 13.608 10.434  0.778   1.00 30.11  ? 1000 VAL A CG2   1 
ATOM   1669 H  H     . VAL A 1 130 ? 14.462 7.309   0.824   1.00 30.45  ? 1000 VAL A H     1 
ATOM   1670 H  HA    . VAL A 1 130 ? 14.415 9.067   2.908   1.00 36.76  ? 1000 VAL A HA    1 
ATOM   1671 H  HB    . VAL A 1 130 ? 12.440 8.752   0.873   1.00 38.76  ? 1000 VAL A HB    1 
ATOM   1672 H  HG11  . VAL A 1 130 ? 11.220 10.416  1.954   1.00 39.94  ? 1000 VAL A HG11  1 
ATOM   1673 H  HG12  . VAL A 1 130 ? 11.384 9.170   2.899   1.00 39.94  ? 1000 VAL A HG12  1 
ATOM   1674 H  HG13  . VAL A 1 130 ? 12.275 10.446  3.120   1.00 39.94  ? 1000 VAL A HG13  1 
ATOM   1675 H  HG21  . VAL A 1 130 ? 12.959 10.952  0.296   1.00 36.07  ? 1000 VAL A HG21  1 
ATOM   1676 H  HG22  . VAL A 1 130 ? 14.070 10.991  1.409   1.00 36.07  ? 1000 VAL A HG22  1 
ATOM   1677 H  HG23  . VAL A 1 130 ? 14.236 10.044  0.165   1.00 36.07  ? 1000 VAL A HG23  1 
ATOM   1678 N  N     . ARG A 1 131 ? 13.165 7.686   4.468   1.00 29.64  ? 1001 ARG A N     1 
ATOM   1679 C  CA    . ARG A 1 131 ? 12.380 6.874   5.382   1.00 29.36  ? 1001 ARG A CA    1 
ATOM   1680 C  C     . ARG A 1 131 ? 11.232 7.719   5.910   1.00 27.18  ? 1001 ARG A C     1 
ATOM   1681 O  O     . ARG A 1 131 ? 11.444 8.729   6.575   1.00 30.46  ? 1001 ARG A O     1 
ATOM   1682 C  CB    . ARG A 1 131 ? 13.243 6.361   6.534   1.00 24.77  ? 1001 ARG A CB    1 
ATOM   1683 C  CG    . ARG A 1 131 ? 14.263 5.312   6.109   1.00 26.59  ? 1001 ARG A CG    1 
ATOM   1684 C  CD    . ARG A 1 131 ? 13.589 4.004   5.699   1.00 26.31  ? 1001 ARG A CD    1 
ATOM   1685 N  NE    . ARG A 1 131 ? 14.545 3.057   5.131   1.00 37.53  ? 1001 ARG A NE    1 
ATOM   1686 C  CZ    . ARG A 1 131 ? 14.329 1.750   5.003   1.00 45.75  ? 1001 ARG A CZ    1 
ATOM   1687 N  NH1   . ARG A 1 131 ? 13.186 1.214   5.411   1.00 35.30  ? 1001 ARG A NH1   1 
ATOM   1688 N  NH2   . ARG A 1 131 ? 15.264 0.975   4.469   1.00 37.58  ? 1001 ARG A NH2   1 
ATOM   1689 H  H     . ARG A 1 131 ? 13.600 8.322   4.850   1.00 35.51  ? 1001 ARG A H     1 
ATOM   1690 H  HA    . ARG A 1 131 ? 12.008 6.104   4.902   1.00 35.17  ? 1001 ARG A HA    1 
ATOM   1691 H  HB2   . ARG A 1 131 ? 13.728 7.107   6.919   1.00 29.67  ? 1001 ARG A HB2   1 
ATOM   1692 H  HB3   . ARG A 1 131 ? 12.667 5.961   7.204   1.00 29.67  ? 1001 ARG A HB3   1 
ATOM   1693 H  HG2   . ARG A 1 131 ? 14.766 5.645   5.349   1.00 31.86  ? 1001 ARG A HG2   1 
ATOM   1694 H  HG3   . ARG A 1 131 ? 14.859 5.127   6.851   1.00 31.86  ? 1001 ARG A HG3   1 
ATOM   1695 H  HD2   . ARG A 1 131 ? 13.185 3.595   6.480   1.00 31.52  ? 1001 ARG A HD2   1 
ATOM   1696 H  HD3   . ARG A 1 131 ? 12.912 4.190   5.030   1.00 31.52  ? 1001 ARG A HD3   1 
ATOM   1697 H  HE    . ARG A 1 131 ? 15.300 3.365   4.860   1.00 44.98  ? 1001 ARG A HE    1 
ATOM   1698 H  HH11  . ARG A 1 131 ? 12.576 1.712   5.757   1.00 42.31  ? 1001 ARG A HH11  1 
ATOM   1699 H  HH12  . ARG A 1 131 ? 13.053 0.368   5.326   1.00 42.31  ? 1001 ARG A HH12  1 
ATOM   1700 H  HH21  . ARG A 1 131 ? 16.008 1.317   4.205   1.00 45.04  ? 1001 ARG A HH21  1 
ATOM   1701 H  HH22  . ARG A 1 131 ? 15.127 0.129   4.388   1.00 45.04  ? 1001 ARG A HH22  1 
ATOM   1702 N  N     . THR A 1 132 ? 10.013 7.307   5.588   1.00 29.45  ? 1002 THR A N     1 
ATOM   1703 C  CA    . THR A 1 132 ? 8.826  8.010   6.043   1.00 27.94  ? 1002 THR A CA    1 
ATOM   1704 C  C     . THR A 1 132 ? 8.373  7.384   7.349   1.00 29.39  ? 1002 THR A C     1 
ATOM   1705 O  O     . THR A 1 132 ? 8.151  6.177   7.421   1.00 29.70  ? 1002 THR A O     1 
ATOM   1706 C  CB    . THR A 1 132 ? 7.702  7.939   4.996   1.00 36.02  ? 1002 THR A CB    1 
ATOM   1707 O  OG1   . THR A 1 132 ? 8.136  8.592   3.795   1.00 35.66  ? 1002 THR A OG1   1 
ATOM   1708 C  CG2   . THR A 1 132 ? 6.435  8.614   5.510   1.00 34.28  ? 1002 THR A CG2   1 
ATOM   1709 H  H     . THR A 1 132 ? 9.846  6.617   5.103   1.00 35.28  ? 1002 THR A H     1 
ATOM   1710 H  HA    . THR A 1 132 ? 9.044  8.952   6.206   1.00 33.47  ? 1002 THR A HA    1 
ATOM   1711 H  HB    . THR A 1 132 ? 7.499  7.011   4.803   1.00 43.17  ? 1002 THR A HB    1 
ATOM   1712 H  HG1   . THR A 1 132 ? 8.805  8.221   3.501   1.00 42.74  ? 1002 THR A HG1   1 
ATOM   1713 H  HG21  . THR A 1 132 ? 5.744  8.562   4.847   1.00 41.08  ? 1002 THR A HG21  1 
ATOM   1714 H  HG22  . THR A 1 132 ? 6.134  8.178   6.310   1.00 41.08  ? 1002 THR A HG22  1 
ATOM   1715 H  HG23  . THR A 1 132 ? 6.612  9.537   5.706   1.00 41.08  ? 1002 THR A HG23  1 
ATOM   1716 N  N     . GLN A 1 133 ? 8.252  8.215   8.377   1.00 26.98  ? 1003 GLN A N     1 
ATOM   1717 C  CA    . GLN A 1 133 ? 7.973  7.747   9.724   1.00 31.16  ? 1003 GLN A CA    1 
ATOM   1718 C  C     . GLN A 1 133 ? 6.900  8.616   10.366  1.00 34.16  ? 1003 GLN A C     1 
ATOM   1719 O  O     . GLN A 1 133 ? 6.486  9.630   9.805   1.00 39.80  ? 1003 GLN A O     1 
ATOM   1720 C  CB    . GLN A 1 133 ? 9.250  7.810   10.569  1.00 30.20  ? 1003 GLN A CB    1 
ATOM   1721 C  CG    . GLN A 1 133 ? 10.456 7.117   9.935   1.00 32.31  ? 1003 GLN A CG    1 
ATOM   1722 C  CD    . GLN A 1 133 ? 11.747 7.363   10.702  1.00 32.62  ? 1003 GLN A CD    1 
ATOM   1723 O  OE1   . GLN A 1 133 ? 11.883 8.356   11.411  1.00 31.98  ? 1003 GLN A OE1   1 
ATOM   1724 N  NE2   . GLN A 1 133 ? 12.702 6.456   10.555  1.00 27.66  ? 1003 GLN A NE2   1 
ATOM   1725 H  H     . GLN A 1 133 ? 8.329  9.069   8.317   1.00 32.32  ? 1003 GLN A H     1 
ATOM   1726 H  HA    . GLN A 1 133 ? 7.655  6.820   9.697   1.00 37.34  ? 1003 GLN A HA    1 
ATOM   1727 H  HB2   . GLN A 1 133 ? 9.485  8.740   10.709  1.00 36.18  ? 1003 GLN A HB2   1 
ATOM   1728 H  HB3   . GLN A 1 133 ? 9.080  7.383   11.423  1.00 36.18  ? 1003 GLN A HB3   1 
ATOM   1729 H  HG2   . GLN A 1 133 ? 10.297 6.160   9.916   1.00 38.71  ? 1003 GLN A HG2   1 
ATOM   1730 H  HG3   . GLN A 1 133 ? 10.575 7.451   9.033   1.00 38.71  ? 1003 GLN A HG3   1 
ATOM   1731 H  HE21  . GLN A 1 133 ? 13.451 6.549   10.967  1.00 33.13  ? 1003 GLN A HE21  1 
ATOM   1732 H  HE22  . GLN A 1 133 ? 12.573 5.774   10.048  1.00 33.13  ? 1003 GLN A HE22  1 
ATOM   1733 N  N     . LEU A 1 134 ? 6.448  8.209   11.544  1.00 36.01  ? 1004 LEU A N     1 
ATOM   1734 C  CA    . LEU A 1 134 ? 5.558  9.035   12.346  1.00 42.59  ? 1004 LEU A CA    1 
ATOM   1735 C  C     . LEU A 1 134 ? 6.363  9.816   13.375  1.00 45.85  ? 1004 LEU A C     1 
ATOM   1736 O  O     . LEU A 1 134 ? 7.240  9.263   14.036  1.00 40.88  ? 1004 LEU A O     1 
ATOM   1737 C  CB    . LEU A 1 134 ? 4.526  8.164   13.057  1.00 47.49  ? 1004 LEU A CB    1 
ATOM   1738 C  CG    . LEU A 1 134 ? 3.644  7.325   12.134  1.00 54.71  ? 1004 LEU A CG    1 
ATOM   1739 C  CD1   . LEU A 1 134 ? 2.778  6.371   12.943  1.00 57.05  ? 1004 LEU A CD1   1 
ATOM   1740 C  CD2   . LEU A 1 134 ? 2.789  8.225   11.256  1.00 45.89  ? 1004 LEU A CD2   1 
ATOM   1741 H  H     . LEU A 1 134 ? 6.645  7.453   11.904  1.00 43.15  ? 1004 LEU A H     1 
ATOM   1742 H  HA    . LEU A 1 134 ? 5.087  9.670   11.767  1.00 51.05  ? 1004 LEU A HA    1 
ATOM   1743 H  HB2   . LEU A 1 134 ? 4.992  7.555   13.650  1.00 56.94  ? 1004 LEU A HB2   1 
ATOM   1744 H  HB3   . LEU A 1 134 ? 3.942  8.740   13.576  1.00 56.94  ? 1004 LEU A HB3   1 
ATOM   1745 H  HG    . LEU A 1 134 ? 4.212  6.794   11.554  1.00 65.60  ? 1004 LEU A HG    1 
ATOM   1746 H  HD11  . LEU A 1 134 ? 2.235  5.856   12.341  1.00 68.40  ? 1004 LEU A HD11  1 
ATOM   1747 H  HD12  . LEU A 1 134 ? 3.347  5.787   13.450  1.00 68.40  ? 1004 LEU A HD12  1 
ATOM   1748 H  HD13  . LEU A 1 134 ? 2.220  6.880   13.534  1.00 68.40  ? 1004 LEU A HD13  1 
ATOM   1749 H  HD21  . LEU A 1 134 ? 2.244  7.677   10.686  1.00 55.02  ? 1004 LEU A HD21  1 
ATOM   1750 H  HD22  . LEU A 1 134 ? 2.232  8.770   11.817  1.00 55.02  ? 1004 LEU A HD22  1 
ATOM   1751 H  HD23  . LEU A 1 134 ? 3.364  8.780   10.725  1.00 55.02  ? 1004 LEU A HD23  1 
ATOM   1752 N  N     . LEU A 1 135 ? 6.075  11.107  13.496  1.00 37.72  ? 1005 LEU A N     1 
ATOM   1753 C  CA    . LEU A 1 135 ? 6.676  11.922  14.542  1.00 42.96  ? 1005 LEU A CA    1 
ATOM   1754 C  C     . LEU A 1 135 ? 6.203  11.378  15.881  1.00 56.54  ? 1005 LEU A C     1 
ATOM   1755 O  O     . LEU A 1 135 ? 5.009  11.382  16.175  1.00 55.08  ? 1005 LEU A O     1 
ATOM   1756 C  CB    . LEU A 1 135 ? 6.273  13.389  14.381  1.00 49.02  ? 1005 LEU A CB    1 
ATOM   1757 C  CG    . LEU A 1 135 ? 6.867  14.397  15.370  1.00 53.87  ? 1005 LEU A CG    1 
ATOM   1758 C  CD1   . LEU A 1 135 ? 8.359  14.187  15.557  1.00 48.45  ? 1005 LEU A CD1   1 
ATOM   1759 C  CD2   . LEU A 1 135 ? 6.586  15.815  14.898  1.00 60.59  ? 1005 LEU A CD2   1 
ATOM   1760 H  H     . LEU A 1 135 ? 5.533  11.535  12.984  1.00 45.21  ? 1005 LEU A H     1 
ATOM   1761 H  HA    . LEU A 1 135 ? 7.653  11.854  14.498  1.00 51.50  ? 1005 LEU A HA    1 
ATOM   1762 H  HB2   . LEU A 1 135 ? 6.535  13.676  13.492  1.00 58.77  ? 1005 LEU A HB2   1 
ATOM   1763 H  HB3   . LEU A 1 135 ? 5.308  13.446  14.462  1.00 58.77  ? 1005 LEU A HB3   1 
ATOM   1764 H  HG    . LEU A 1 135 ? 6.439  14.280  16.233  1.00 64.59  ? 1005 LEU A HG    1 
ATOM   1765 H  HD11  . LEU A 1 135 ? 8.690  14.836  16.182  1.00 58.08  ? 1005 LEU A HD11  1 
ATOM   1766 H  HD12  . LEU A 1 135 ? 8.510  13.301  15.894  1.00 58.08  ? 1005 LEU A HD12  1 
ATOM   1767 H  HD13  . LEU A 1 135 ? 8.798  14.294  14.710  1.00 58.08  ? 1005 LEU A HD13  1 
ATOM   1768 H  HD21  . LEU A 1 135 ? 6.963  16.434  15.527  1.00 72.66  ? 1005 LEU A HD21  1 
ATOM   1769 H  HD22  . LEU A 1 135 ? 6.985  15.941  14.034  1.00 72.66  ? 1005 LEU A HD22  1 
ATOM   1770 H  HD23  . LEU A 1 135 ? 5.636  15.943  14.842  1.00 72.66  ? 1005 LEU A HD23  1 
ATOM   1771 N  N     . GLN A 1 136 ? 7.147  10.900  16.683  1.00 41.54  ? 1006 GLN A N     1 
ATOM   1772 C  CA    . GLN A 1 136 ? 6.832  10.272  17.956  1.00 31.68  ? 1006 GLN A CA    1 
ATOM   1773 C  C     . GLN A 1 136 ? 7.231  11.207  19.087  1.00 38.28  ? 1006 GLN A C     1 
ATOM   1774 O  O     . GLN A 1 136 ? 8.156  12.004  18.938  1.00 40.10  ? 1006 GLN A O     1 
ATOM   1775 C  CB    . GLN A 1 136 ? 7.570  8.940   18.083  1.00 31.03  ? 1006 GLN A CB    1 
ATOM   1776 C  CG    . GLN A 1 136 ? 7.100  7.870   17.110  1.00 39.88  ? 1006 GLN A CG    1 
ATOM   1777 C  CD    . GLN A 1 136 ? 5.785  7.234   17.527  1.00 48.53  ? 1006 GLN A CD    1 
ATOM   1778 O  OE1   . GLN A 1 136 ? 5.261  7.509   18.606  1.00 44.38  ? 1006 GLN A OE1   1 
ATOM   1779 N  NE2   . GLN A 1 136 ? 5.248  6.377   16.669  1.00 43.60  ? 1006 GLN A NE2   1 
ATOM   1780 H  H     . GLN A 1 136 ? 7.988  10.927  16.508  1.00 49.80  ? 1006 GLN A H     1 
ATOM   1781 H  HA    . GLN A 1 136 ? 5.868  10.104  18.012  1.00 37.96  ? 1006 GLN A HA    1 
ATOM   1782 H  HB2   . GLN A 1 136 ? 8.515  9.091   17.922  1.00 37.18  ? 1006 GLN A HB2   1 
ATOM   1783 H  HB3   . GLN A 1 136 ? 7.442  8.598   18.982  1.00 37.18  ? 1006 GLN A HB3   1 
ATOM   1784 H  HG2   . GLN A 1 136 ? 6.975  8.272   16.236  1.00 47.80  ? 1006 GLN A HG2   1 
ATOM   1785 H  HG3   . GLN A 1 136 ? 7.770  7.171   17.062  1.00 47.80  ? 1006 GLN A HG3   1 
ATOM   1786 H  HE21  . GLN A 1 136 ? 4.504  5.990   16.858  1.00 52.26  ? 1006 GLN A HE21  1 
ATOM   1787 H  HE22  . GLN A 1 136 ? 5.644  6.209   15.924  1.00 52.26  ? 1006 GLN A HE22  1 
ATOM   1788 N  N     . PRO A 1 137 ? 6.529  11.119  20.225  1.00 43.16  ? 1007 PRO A N     1 
ATOM   1789 C  CA    . PRO A 1 137 ? 6.820  12.008  21.353  1.00 43.01  ? 1007 PRO A CA    1 
ATOM   1790 C  C     . PRO A 1 137 ? 8.043  11.567  22.148  1.00 37.71  ? 1007 PRO A C     1 
ATOM   1791 O  O     . PRO A 1 137 ? 8.151  10.398  22.513  1.00 35.47  ? 1007 PRO A O     1 
ATOM   1792 C  CB    . PRO A 1 137 ? 5.563  11.890  22.214  1.00 50.69  ? 1007 PRO A CB    1 
ATOM   1793 C  CG    . PRO A 1 137 ? 5.070  10.509  21.955  1.00 49.42  ? 1007 PRO A CG    1 
ATOM   1794 C  CD    . PRO A 1 137 ? 5.413  10.202  20.516  1.00 48.09  ? 1007 PRO A CD    1 
ATOM   1795 H  HA    . PRO A 1 137 ? 6.932  12.933  21.051  1.00 51.56  ? 1007 PRO A HA    1 
ATOM   1796 H  HB2   . PRO A 1 137 ? 5.791  12.006  23.149  1.00 60.78  ? 1007 PRO A HB2   1 
ATOM   1797 H  HB3   . PRO A 1 137 ? 4.909  12.549  21.933  1.00 60.78  ? 1007 PRO A HB3   1 
ATOM   1798 H  HG2   . PRO A 1 137 ? 5.517  9.888   22.551  1.00 59.25  ? 1007 PRO A HG2   1 
ATOM   1799 H  HG3   . PRO A 1 137 ? 4.110  10.477  22.089  1.00 59.25  ? 1007 PRO A HG3   1 
ATOM   1800 H  HD2   . PRO A 1 137 ? 5.702  9.280   20.427  1.00 57.66  ? 1007 PRO A HD2   1 
ATOM   1801 H  HD3   . PRO A 1 137 ? 4.658  10.395  19.940  1.00 57.66  ? 1007 PRO A HD3   1 
ATOM   1802 N  N     . ALA A 1 138 ? 8.952  12.504  22.395  1.00 33.15  ? 1008 ALA A N     1 
ATOM   1803 C  CA    . ALA A 1 138 ? 10.105 12.274  23.258  1.00 50.64  ? 1008 ALA A CA    1 
ATOM   1804 C  C     . ALA A 1 138 ? 10.841 10.979  22.925  1.00 32.89  ? 1008 ALA A C     1 
ATOM   1805 O  O     . ALA A 1 138 ? 11.272 10.785  21.793  1.00 36.46  ? 1008 ALA A O     1 
ATOM   1806 C  CB    . ALA A 1 138 ? 9.673  12.284  24.708  1.00 52.90  ? 1008 ALA A CB    1 
ATOM   1807 H  H     . ALA A 1 138 ? 8.922  13.299  22.066  1.00 39.72  ? 1008 ALA A H     1 
ATOM   1808 H  HA    . ALA A 1 138 ? 10.738 13.012  23.133  1.00 60.71  ? 1008 ALA A HA    1 
ATOM   1809 H  HB1   . ALA A 1 138 ? 10.442 12.131  25.264  1.00 63.42  ? 1008 ALA A HB1   1 
ATOM   1810 H  HB2   . ALA A 1 138 ? 9.285  13.138  24.913  1.00 63.42  ? 1008 ALA A HB2   1 
ATOM   1811 H  HB3   . ALA A 1 138 ? 9.026  11.588  24.846  1.00 63.42  ? 1008 ALA A HB3   1 
ATOM   1812 N  N     . ASP A 1 139 ? 10.979 10.101  23.917  1.00 32.75  ? 1009 ASP A N     1 
ATOM   1813 C  CA    . ASP A 1 139 ? 11.765 8.878   23.779  1.00 35.45  ? 1009 ASP A CA    1 
ATOM   1814 C  C     . ASP A 1 139 ? 10.875 7.661   23.551  1.00 32.39  ? 1009 ASP A C     1 
ATOM   1815 O  O     . ASP A 1 139 ? 11.329 6.522   23.650  1.00 39.67  ? 1009 ASP A O     1 
ATOM   1816 C  CB    . ASP A 1 139 ? 12.598 8.658   25.043  1.00 34.20  ? 1009 ASP A CB    1 
ATOM   1817 C  CG    . ASP A 1 139 ? 11.742 8.567   26.297  1.00 51.64  ? 1009 ASP A CG    1 
ATOM   1818 O  OD1   . ASP A 1 139 ? 10.592 8.097   26.202  1.00 46.42  ? 1009 ASP A OD1   1 
ATOM   1819 O  OD2   . ASP A 1 139 ? 12.214 8.972   27.376  1.00 40.38  ? 1009 ASP A OD2   1 
ATOM   1820 H  H     . ASP A 1 139 ? 10.620 10.194  24.693  1.00 39.24  ? 1009 ASP A H     1 
ATOM   1821 H  HA    . ASP A 1 139 ? 12.374 8.965   23.016  1.00 42.48  ? 1009 ASP A HA    1 
ATOM   1822 H  HB2   . ASP A 1 139 ? 13.093 7.828   24.956  1.00 40.98  ? 1009 ASP A HB2   1 
ATOM   1823 H  HB3   . ASP A 1 139 ? 13.212 9.401   25.151  1.00 40.98  ? 1009 ASP A HB3   1 
ATOM   1824 N  N     . GLU A 1 140 ? 9.606  7.909   23.243  1.00 37.13  ? 1010 GLU A N     1 
ATOM   1825 C  CA    . GLU A 1 140 ? 8.603  6.852   23.186  1.00 30.60  ? 1010 GLU A CA    1 
ATOM   1826 C  C     . GLU A 1 140 ? 8.286  6.454   21.756  1.00 33.06  ? 1010 GLU A C     1 
ATOM   1827 O  O     . GLU A 1 140 ? 8.515  7.216   20.820  1.00 37.57  ? 1010 GLU A O     1 
ATOM   1828 C  CB    . GLU A 1 140 ? 7.314  7.316   23.877  1.00 42.25  ? 1010 GLU A CB    1 
ATOM   1829 C  CG    . GLU A 1 140 ? 7.483  7.630   25.358  1.00 34.66  ? 1010 GLU A CG    1 
ATOM   1830 C  CD    . GLU A 1 140 ? 6.335  8.446   25.934  1.00 53.24  ? 1010 GLU A CD    1 
ATOM   1831 O  OE1   . GLU A 1 140 ? 5.411  8.813   25.179  1.00 37.00  ? 1010 GLU A OE1   1 
ATOM   1832 O  OE2   . GLU A 1 140 ? 6.361  8.729   27.149  1.00 47.65  ? 1010 GLU A OE2   1 
ATOM   1833 H  H     . GLU A 1 140 ? 9.298  8.691   23.061  1.00 44.50  ? 1010 GLU A H     1 
ATOM   1834 H  HA    . GLU A 1 140 ? 8.938  6.062   23.659  1.00 36.67  ? 1010 GLU A HA    1 
ATOM   1835 H  HB2   . GLU A 1 140 ? 6.998  8.122   23.438  1.00 50.65  ? 1010 GLU A HB2   1 
ATOM   1836 H  HB3   . GLU A 1 140 ? 6.648  6.616   23.797  1.00 50.65  ? 1010 GLU A HB3   1 
ATOM   1837 H  HG2   . GLU A 1 140 ? 7.534  6.797   25.852  1.00 41.54  ? 1010 GLU A HG2   1 
ATOM   1838 H  HG3   . GLU A 1 140 ? 8.301  8.137   25.481  1.00 41.54  ? 1010 GLU A HG3   1 
ATOM   1839 N  N     . ASN A 1 141 ? 7.757  5.247   21.595  1.00 31.25  ? 1011 ASN A N     1 
ATOM   1840 C  CA    . ASN A 1 141 ? 7.235  4.804   20.313  1.00 31.59  ? 1011 ASN A CA    1 
ATOM   1841 C  C     . ASN A 1 141 ? 5.877  4.146   20.509  1.00 42.46  ? 1011 ASN A C     1 
ATOM   1842 O  O     . ASN A 1 141 ? 5.775  3.127   21.186  1.00 36.57  ? 1011 ASN A O     1 
ATOM   1843 C  CB    . ASN A 1 141 ? 8.195  3.822   19.646  1.00 30.61  ? 1011 ASN A CB    1 
ATOM   1844 C  CG    . ASN A 1 141 ? 7.746  3.434   18.255  1.00 36.46  ? 1011 ASN A CG    1 
ATOM   1845 O  OD1   . ASN A 1 141 ? 7.731  4.260   17.343  1.00 38.18  ? 1011 ASN A OD1   1 
ATOM   1846 N  ND2   . ASN A 1 141 ? 7.373  2.174   18.084  1.00 33.33  ? 1011 ASN A ND2   1 
ATOM   1847 H  H     . ASN A 1 141 ? 7.689  4.662   22.221  1.00 37.44  ? 1011 ASN A H     1 
ATOM   1848 H  HA    . ASN A 1 141 ? 7.122  5.577   19.722  1.00 37.85  ? 1011 ASN A HA    1 
ATOM   1849 H  HB2   . ASN A 1 141 ? 9.071  4.232   19.576  1.00 36.68  ? 1011 ASN A HB2   1 
ATOM   1850 H  HB3   . ASN A 1 141 ? 8.246  3.015   20.181  1.00 36.68  ? 1011 ASN A HB3   1 
ATOM   1851 H  HD21  . ASN A 1 141 ? 7.109  1.905   17.310  1.00 39.94  ? 1011 ASN A HD21  1 
ATOM   1852 H  HD22  . ASN A 1 141 ? 7.394  1.626   18.745  1.00 39.94  ? 1011 ASN A HD22  1 
ATOM   1853 N  N     . TRP A 1 142 ? 4.842  4.739   19.920  1.00 44.83  ? 1012 TRP A N     1 
ATOM   1854 C  CA    . TRP A 1 142 ? 3.478  4.233   20.037  1.00 51.79  ? 1012 TRP A CA    1 
ATOM   1855 C  C     . TRP A 1 142 ? 3.014  3.633   18.718  1.00 43.95  ? 1012 TRP A C     1 
ATOM   1856 O  O     . TRP A 1 142 ? 3.487  4.025   17.651  1.00 37.19  ? 1012 TRP A O     1 
ATOM   1857 C  CB    . TRP A 1 142 ? 2.524  5.368   20.410  1.00 38.23  ? 1012 TRP A CB    1 
ATOM   1858 C  CG    . TRP A 1 142 ? 2.780  5.973   21.750  1.00 52.02  ? 1012 TRP A CG    1 
ATOM   1859 C  CD1   . TRP A 1 142 ? 3.727  6.901   22.060  1.00 44.21  ? 1012 TRP A CD1   1 
ATOM   1860 C  CD2   . TRP A 1 142 ? 2.070  5.702   22.964  1.00 52.96  ? 1012 TRP A CD2   1 
ATOM   1861 N  NE1   . TRP A 1 142 ? 3.656  7.222   23.393  1.00 48.71  ? 1012 TRP A NE1   1 
ATOM   1862 C  CE2   . TRP A 1 142 ? 2.646  6.499   23.971  1.00 52.04  ? 1012 TRP A CE2   1 
ATOM   1863 C  CE3   . TRP A 1 142 ? 1.004  4.862   23.297  1.00 62.86  ? 1012 TRP A CE3   1 
ATOM   1864 C  CZ2   . TRP A 1 142 ? 2.193  6.481   25.288  1.00 63.73  ? 1012 TRP A CZ2   1 
ATOM   1865 C  CZ3   . TRP A 1 142 ? 0.556  4.844   24.605  1.00 65.99  ? 1012 TRP A CZ3   1 
ATOM   1866 C  CH2   . TRP A 1 142 ? 1.150  5.649   25.584  1.00 64.92  ? 1012 TRP A CH2   1 
ATOM   1867 H  H     . TRP A 1 142 ? 4.906  5.448   19.438  1.00 53.73  ? 1012 TRP A H     1 
ATOM   1868 H  HA    . TRP A 1 142 ? 3.437  3.543   20.731  1.00 62.09  ? 1012 TRP A HA    1 
ATOM   1869 H  HB2   . TRP A 1 142 ? 2.605  6.073   19.748  1.00 45.82  ? 1012 TRP A HB2   1 
ATOM   1870 H  HB3   . TRP A 1 142 ? 1.617  5.024   20.411  1.00 45.82  ? 1012 TRP A HB3   1 
ATOM   1871 H  HD1   . TRP A 1 142 ? 4.336  7.263   21.457  1.00 53.00  ? 1012 TRP A HD1   1 
ATOM   1872 H  HE1   . TRP A 1 142 ? 4.163  7.785   23.800  1.00 58.39  ? 1012 TRP A HE1   1 
ATOM   1873 H  HE3   . TRP A 1 142 ? 0.605  4.324   22.652  1.00 75.38  ? 1012 TRP A HE3   1 
ATOM   1874 H  HZ2   . TRP A 1 142 ? 2.586  7.014   25.941  1.00 76.42  ? 1012 TRP A HZ2   1 
ATOM   1875 H  HZ3   . TRP A 1 142 ? -0.152 4.288   24.838  1.00 79.13  ? 1012 TRP A HZ3   1 
ATOM   1876 H  HH2   . TRP A 1 142 ? 0.828  5.616   26.456  1.00 77.85  ? 1012 TRP A HH2   1 
ATOM   1877 N  N     . ASP A 1 143 ? 2.076  2.693   18.788  1.00 50.54  ? 1013 ASP A N     1 
ATOM   1878 C  CA    . ASP A 1 143 ? 1.428  2.194   17.586  1.00 57.94  ? 1013 ASP A CA    1 
ATOM   1879 C  C     . ASP A 1 143 ? 0.775  3.396   16.907  1.00 55.79  ? 1013 ASP A C     1 
ATOM   1880 O  O     . ASP A 1 143 ? 0.632  4.453   17.522  1.00 48.22  ? 1013 ASP A O     1 
ATOM   1881 C  CB    . ASP A 1 143 ? 0.398  1.116   17.926  1.00 66.32  ? 1013 ASP A CB    1 
ATOM   1882 C  CG    . ASP A 1 143 ? -0.947 1.692   18.309  1.00 69.46  ? 1013 ASP A CG    1 
ATOM   1883 O  OD1   . ASP A 1 143 ? -1.087 2.176   19.449  1.00 55.65  ? 1013 ASP A OD1   1 
ATOM   1884 O  OD2   . ASP A 1 143 ? -1.870 1.645   17.469  1.00 65.43  ? 1013 ASP A OD2   1 
ATOM   1885 H  H     . ASP A 1 143 ? 1.800  2.330   19.518  1.00 60.59  ? 1013 ASP A H     1 
ATOM   1886 H  HA    . ASP A 1 143 ? 2.098  1.813   16.980  1.00 69.47  ? 1013 ASP A HA    1 
ATOM   1887 H  HB2   . ASP A 1 143 ? 0.271  0.545   17.153  1.00 79.52  ? 1013 ASP A HB2   1 
ATOM   1888 H  HB3   . ASP A 1 143 ? 0.724  0.593   18.675  1.00 79.52  ? 1013 ASP A HB3   1 
ATOM   1889 N  N     . PRO A 1 144 ? 0.389  3.249   15.633  1.00 52.67  ? 1014 PRO A N     1 
ATOM   1890 C  CA    . PRO A 1 144 ? -0.060 4.410   14.851  1.00 62.56  ? 1014 PRO A CA    1 
ATOM   1891 C  C     . PRO A 1 144 ? -1.364 5.043   15.349  1.00 67.56  ? 1014 PRO A C     1 
ATOM   1892 O  O     . PRO A 1 144 ? -1.634 6.197   15.016  1.00 63.15  ? 1014 PRO A O     1 
ATOM   1893 C  CB    . PRO A 1 144 ? -0.245 3.839   13.438  1.00 60.73  ? 1014 PRO A CB    1 
ATOM   1894 C  CG    . PRO A 1 144 ? 0.465  2.510   13.444  1.00 59.51  ? 1014 PRO A CG    1 
ATOM   1895 C  CD    . PRO A 1 144 ? 0.360  2.008   14.843  1.00 48.93  ? 1014 PRO A CD    1 
ATOM   1896 H  HA    . PRO A 1 144 ? 0.641  5.094   14.832  1.00 75.01  ? 1014 PRO A HA    1 
ATOM   1897 H  HB2   . PRO A 1 144 ? -1.190 3.720   13.255  1.00 72.82  ? 1014 PRO A HB2   1 
ATOM   1898 H  HB3   . PRO A 1 144 ? 0.157  4.438   12.789  1.00 72.82  ? 1014 PRO A HB3   1 
ATOM   1899 H  HG2   . PRO A 1 144 ? 0.025  1.902   12.829  1.00 71.36  ? 1014 PRO A HG2   1 
ATOM   1900 H  HG3   . PRO A 1 144 ? 1.394  2.636   13.195  1.00 71.36  ? 1014 PRO A HG3   1 
ATOM   1901 H  HD2   . PRO A 1 144 ? -0.479 1.540   14.975  1.00 58.66  ? 1014 PRO A HD2   1 
ATOM   1902 H  HD3   . PRO A 1 144 ? 1.122  1.448   15.062  1.00 58.66  ? 1014 PRO A HD3   1 
ATOM   1903 N  N     . THR A 1 145 ? -2.151 4.309   16.132  1.00 55.12  ? 1015 THR A N     1 
ATOM   1904 C  CA    . THR A 1 145 ? -3.415 4.831   16.648  1.00 78.10  ? 1015 THR A CA    1 
ATOM   1905 C  C     . THR A 1 145 ? -3.222 5.614   17.949  1.00 80.58  ? 1015 THR A C     1 
ATOM   1906 O  O     . THR A 1 145 ? -4.135 6.298   18.411  1.00 84.87  ? 1015 THR A O     1 
ATOM   1907 C  CB    . THR A 1 145 ? -4.441 3.702   16.899  1.00 74.95  ? 1015 THR A CB    1 
ATOM   1908 O  OG1   . THR A 1 145 ? -4.086 2.974   18.080  1.00 73.02  ? 1015 THR A OG1   1 
ATOM   1909 C  CG2   . THR A 1 145 ? -4.501 2.749   15.711  1.00 69.38  ? 1015 THR A CG2   1 
ATOM   1910 H  H     . THR A 1 145 ? -1.975 3.505   16.381  1.00 66.08  ? 1015 THR A H     1 
ATOM   1911 H  HA    . THR A 1 145 ? -3.798 5.442   15.985  1.00 93.67  ? 1015 THR A HA    1 
ATOM   1912 H  HB    . THR A 1 145 ? -5.321 4.092   17.018  1.00 89.89  ? 1015 THR A HB    1 
ATOM   1913 H  HG1   . THR A 1 145 ? -4.630 2.374   18.214  1.00 87.57  ? 1015 THR A HG1   1 
ATOM   1914 H  HG21  . THR A 1 145 ? -5.141 2.054   15.880  1.00 83.20  ? 1015 THR A HG21  1 
ATOM   1915 H  HG22  . THR A 1 145 ? -4.761 3.227   14.920  1.00 83.20  ? 1015 THR A HG22  1 
ATOM   1916 H  HG23  . THR A 1 145 ? -3.639 2.351   15.566  1.00 83.20  ? 1015 THR A HG23  1 
ATOM   1917 N  N     . GLY A 1 146 ? -2.034 5.507   18.538  1.00 68.54  ? 1016 GLY A N     1 
ATOM   1918 C  CA    . GLY A 1 146 ? -1.715 6.232   19.755  1.00 64.33  ? 1016 GLY A CA    1 
ATOM   1919 C  C     . GLY A 1 146 ? -2.271 5.558   20.994  1.00 69.82  ? 1016 GLY A C     1 
ATOM   1920 O  O     . GLY A 1 146 ? -2.478 6.201   22.023  1.00 52.66  ? 1016 GLY A O     1 
ATOM   1921 H  H     . GLY A 1 146 ? -1.392 5.015   18.246  1.00 82.20  ? 1016 GLY A H     1 
ATOM   1922 H  HA2   . GLY A 1 146 ? -0.752 6.300   19.848  1.00 77.14  ? 1016 GLY A HA2   1 
ATOM   1923 H  HA3   . GLY A 1 146 ? -2.082 7.128   19.702  1.00 77.14  ? 1016 GLY A HA3   1 
ATOM   1924 N  N     . THR A 1 147 ? -2.509 4.254   20.893  1.00 64.89  ? 1017 THR A N     1 
ATOM   1925 C  CA    . THR A 1 147 ? -3.112 3.495   21.980  1.00 69.83  ? 1017 THR A CA    1 
ATOM   1926 C  C     . THR A 1 147 ? -2.090 2.976   22.990  1.00 71.98  ? 1017 THR A C     1 
ATOM   1927 O  O     . THR A 1 147 ? -2.315 3.057   24.197  1.00 57.67  ? 1017 THR A O     1 
ATOM   1928 C  CB    . THR A 1 147 ? -3.912 2.300   21.433  1.00 74.78  ? 1017 THR A CB    1 
ATOM   1929 O  OG1   . THR A 1 147 ? -4.948 2.775   20.565  1.00 70.98  ? 1017 THR A OG1   1 
ATOM   1930 C  CG2   . THR A 1 147 ? -4.533 1.503   22.569  1.00 81.01  ? 1017 THR A CG2   1 
ATOM   1931 H  H     . THR A 1 147 ? -2.327 3.783   20.197  1.00 77.82  ? 1017 THR A H     1 
ATOM   1932 H  HA    . THR A 1 147 ? -3.737 4.077   22.461  1.00 83.74  ? 1017 THR A HA    1 
ATOM   1933 H  HB    . THR A 1 147 ? -3.319 1.714   20.936  1.00 89.68  ? 1017 THR A HB    1 
ATOM   1934 H  HG1   . THR A 1 147 ? -5.454 3.271   20.978  1.00 85.12  ? 1017 THR A HG1   1 
ATOM   1935 H  HG21  . THR A 1 147 ? -5.029 0.760   22.215  1.00 97.16  ? 1017 THR A HG21  1 
ATOM   1936 H  HG22  . THR A 1 147 ? -3.846 1.170   23.150  1.00 97.16  ? 1017 THR A HG22  1 
ATOM   1937 H  HG23  . THR A 1 147 ? -5.127 2.062   23.075  1.00 97.16  ? 1017 THR A HG23  1 
ATOM   1938 N  N     . LYS A 1 148 ? -0.972 2.443   22.503  1.00 61.53  ? 1018 LYS A N     1 
ATOM   1939 C  CA    . LYS A 1 148 ? 0.012  1.819   23.384  1.00 67.22  ? 1018 LYS A CA    1 
ATOM   1940 C  C     . LYS A 1 148 ? 1.439  1.888   22.838  1.00 58.74  ? 1018 LYS A C     1 
ATOM   1941 O  O     . LYS A 1 148 ? 1.651  1.999   21.633  1.00 42.35  ? 1018 LYS A O     1 
ATOM   1942 C  CB    . LYS A 1 148 ? -0.366 0.357   23.635  1.00 64.41  ? 1018 LYS A CB    1 
ATOM   1943 C  CG    . LYS A 1 148 ? -0.340 -0.518  22.389  1.00 66.91  ? 1018 LYS A CG    1 
ATOM   1944 C  CD    . LYS A 1 148 ? -0.604 -1.974  22.744  1.00 75.56  ? 1018 LYS A CD    1 
ATOM   1945 C  CE    . LYS A 1 148 ? -0.006 -2.931  21.722  1.00 81.08  ? 1018 LYS A CE    1 
ATOM   1946 N  NZ    . LYS A 1 148 ? -0.896 -3.164  20.552  1.00 85.07  ? 1018 LYS A NZ    1 
ATOM   1947 H  H     . LYS A 1 148 ? -0.760 2.430   21.669  1.00 73.78  ? 1018 LYS A H     1 
ATOM   1948 H  HA    . LYS A 1 148 ? 0.000  2.283   24.247  1.00 80.61  ? 1018 LYS A HA    1 
ATOM   1949 H  HB2   . LYS A 1 148 ? 0.258  -0.021  24.274  1.00 77.24  ? 1018 LYS A HB2   1 
ATOM   1950 H  HB3   . LYS A 1 148 ? -1.265 0.326   23.998  1.00 77.24  ? 1018 LYS A HB3   1 
ATOM   1951 H  HG2   . LYS A 1 148 ? -1.029 -0.223  21.774  1.00 80.23  ? 1018 LYS A HG2   1 
ATOM   1952 H  HG3   . LYS A 1 148 ? 0.534  -0.459  21.972  1.00 80.23  ? 1018 LYS A HG3   1 
ATOM   1953 H  HD2   . LYS A 1 148 ? -0.208 -2.168  23.608  1.00 90.62  ? 1018 LYS A HD2   1 
ATOM   1954 H  HD3   . LYS A 1 148 ? -1.562 -2.125  22.774  1.00 90.62  ? 1018 LYS A HD3   1 
ATOM   1955 H  HE2   . LYS A 1 148 ? 0.828  -2.561  21.394  1.00 97.24  ? 1018 LYS A HE2   1 
ATOM   1956 H  HE3   . LYS A 1 148 ? 0.157  -3.787  22.149  1.00 97.24  ? 1018 LYS A HE3   1 
ATOM   1957 H  HZ1   . LYS A 1 148 ? -0.508 -3.727  19.982  1.00 102.03 ? 1018 LYS A HZ1   1 
ATOM   1958 H  HZ2   . LYS A 1 148 ? -1.669 -3.513  20.823  1.00 102.03 ? 1018 LYS A HZ2   1 
ATOM   1959 H  HZ3   . LYS A 1 148 ? -1.057 -2.395  20.134  1.00 102.03 ? 1018 LYS A HZ3   1 
ATOM   1960 N  N     . LYS A 1 149 ? 2.412  1.821   23.742  1.00 54.27  ? 1019 LYS A N     1 
ATOM   1961 C  CA    . LYS A 1 149 ? 3.821  1.776   23.368  1.00 61.24  ? 1019 LYS A CA    1 
ATOM   1962 C  C     . LYS A 1 149 ? 4.156  0.427   22.734  1.00 57.12  ? 1019 LYS A C     1 
ATOM   1963 O  O     . LYS A 1 149 ? 3.833  -0.621  23.290  1.00 50.33  ? 1019 LYS A O     1 
ATOM   1964 C  CB    . LYS A 1 149 ? 4.702  1.983   24.603  1.00 56.65  ? 1019 LYS A CB    1 
ATOM   1965 C  CG    . LYS A 1 149 ? 4.692  3.395   25.185  1.00 64.52  ? 1019 LYS A CG    1 
ATOM   1966 C  CD    . LYS A 1 149 ? 4.938  3.364   26.693  1.00 67.14  ? 1019 LYS A CD    1 
ATOM   1967 C  CE    . LYS A 1 149 ? 5.680  4.597   27.190  1.00 69.24  ? 1019 LYS A CE    1 
ATOM   1968 N  NZ    . LYS A 1 149 ? 7.064  4.268   27.641  1.00 65.71  ? 1019 LYS A NZ    1 
ATOM   1969 H  H     . LYS A 1 149 ? 2.278  1.801   24.591  1.00 65.07  ? 1019 LYS A H     1 
ATOM   1970 H  HA    . LYS A 1 149 ? 4.014  2.485   22.720  1.00 73.43  ? 1019 LYS A HA    1 
ATOM   1971 H  HB2   . LYS A 1 149 ? 4.402  1.379   25.300  1.00 67.93  ? 1019 LYS A HB2   1 
ATOM   1972 H  HB3   . LYS A 1 149 ? 5.619  1.773   24.366  1.00 67.93  ? 1019 LYS A HB3   1 
ATOM   1973 H  HG2   . LYS A 1 149 ? 5.396  3.919   24.770  1.00 77.36  ? 1019 LYS A HG2   1 
ATOM   1974 H  HG3   . LYS A 1 149 ? 3.828  3.804   25.023  1.00 77.36  ? 1019 LYS A HG3   1 
ATOM   1975 H  HD2   . LYS A 1 149 ? 4.085  3.322   27.152  1.00 80.52  ? 1019 LYS A HD2   1 
ATOM   1976 H  HD3   . LYS A 1 149 ? 5.472  2.585   26.911  1.00 80.52  ? 1019 LYS A HD3   1 
ATOM   1977 H  HE2   . LYS A 1 149 ? 5.742  5.244   26.470  1.00 83.03  ? 1019 LYS A HE2   1 
ATOM   1978 H  HE3   . LYS A 1 149 ? 5.199  4.978   27.942  1.00 83.03  ? 1019 LYS A HE3   1 
ATOM   1979 H  HZ1   . LYS A 1 149 ? 7.475  5.005   27.926  1.00 78.79  ? 1019 LYS A HZ1   1 
ATOM   1980 H  HZ2   . LYS A 1 149 ? 7.035  3.678   28.307  1.00 78.79  ? 1019 LYS A HZ2   1 
ATOM   1981 H  HZ3   . LYS A 1 149 ? 7.529  3.920   26.966  1.00 78.79  ? 1019 LYS A HZ3   1 
ATOM   1982 N  N     . ILE A 1 150 ? 4.799  0.454   21.569  1.00 38.84  ? 1020 ILE A N     1 
ATOM   1983 C  CA    . ILE A 1 150 ? 5.260  -0.771  20.919  1.00 31.60  ? 1020 ILE A CA    1 
ATOM   1984 C  C     . ILE A 1 150 ? 6.723  -0.653  20.505  1.00 31.19  ? 1020 ILE A C     1 
ATOM   1985 O  O     . ILE A 1 150 ? 7.286  0.437   20.480  1.00 32.09  ? 1020 ILE A O     1 
ATOM   1986 C  CB    . ILE A 1 150 ? 4.426  -1.100  19.669  1.00 39.40  ? 1020 ILE A CB    1 
ATOM   1987 C  CG1   . ILE A 1 150 ? 4.423  0.087   18.705  1.00 35.17  ? 1020 ILE A CG1   1 
ATOM   1988 C  CG2   . ILE A 1 150 ? 3.005  -1.470  20.063  1.00 52.87  ? 1020 ILE A CG2   1 
ATOM   1989 C  CD1   . ILE A 1 150 ? 3.822  -0.231  17.350  1.00 43.83  ? 1020 ILE A CD1   1 
ATOM   1990 H  H     . ILE A 1 150 ? 4.981  1.172   21.133  1.00 46.55  ? 1020 ILE A H     1 
ATOM   1991 H  HA    . ILE A 1 150 ? 5.179  -1.519  21.547  1.00 37.86  ? 1020 ILE A HA    1 
ATOM   1992 H  HB    . ILE A 1 150 ? 4.830  -1.860  19.221  1.00 47.22  ? 1020 ILE A HB    1 
ATOM   1993 H  HG12  . ILE A 1 150 ? 3.905  0.808   19.097  1.00 42.15  ? 1020 ILE A HG12  1 
ATOM   1994 H  HG13  . ILE A 1 150 ? 5.337  0.378   18.563  1.00 42.15  ? 1020 ILE A HG13  1 
ATOM   1995 H  HG21  . ILE A 1 150 ? 2.504  -1.672  19.269  1.00 63.39  ? 1020 ILE A HG21  1 
ATOM   1996 H  HG22  . ILE A 1 150 ? 3.031  -2.239  20.638  1.00 63.39  ? 1020 ILE A HG22  1 
ATOM   1997 H  HG23  . ILE A 1 150 ? 2.606  -0.729  20.524  1.00 63.39  ? 1020 ILE A HG23  1 
ATOM   1998 H  HD11  . ILE A 1 150 ? 3.854  0.556   16.801  1.00 52.54  ? 1020 ILE A HD11  1 
ATOM   1999 H  HD12  . ILE A 1 150 ? 4.330  -0.936  16.941  1.00 52.54  ? 1020 ILE A HD12  1 
ATOM   2000 H  HD13  . ILE A 1 150 ? 2.911  -0.510  17.470  1.00 52.54  ? 1020 ILE A HD13  1 
ATOM   2001 N  N     . TRP A 1 151 ? 7.336  -1.784  20.178  1.00 35.56  ? 1021 TRP A N     1 
ATOM   2002 C  CA    . TRP A 1 151 ? 8.730  -1.793  19.763  1.00 34.90  ? 1021 TRP A CA    1 
ATOM   2003 C  C     . TRP A 1 151 ? 8.871  -1.553  18.264  1.00 39.55  ? 1021 TRP A C     1 
ATOM   2004 O  O     . TRP A 1 151 ? 9.861  -0.981  17.822  1.00 30.10  ? 1021 TRP A O     1 
ATOM   2005 C  CB    . TRP A 1 151 ? 9.401  -3.109  20.163  1.00 33.47  ? 1021 TRP A CB    1 
ATOM   2006 C  CG    . TRP A 1 151 ? 9.878  -3.119  21.585  1.00 46.56  ? 1021 TRP A CG    1 
ATOM   2007 C  CD1   . TRP A 1 151 ? 9.115  -2.955  22.705  1.00 52.59  ? 1021 TRP A CD1   1 
ATOM   2008 C  CD2   . TRP A 1 151 ? 11.225 -3.304  22.040  1.00 38.32  ? 1021 TRP A CD2   1 
ATOM   2009 N  NE1   . TRP A 1 151 ? 9.904  -3.023  23.829  1.00 45.00  ? 1021 TRP A NE1   1 
ATOM   2010 C  CE2   . TRP A 1 151 ? 11.203 -3.238  23.449  1.00 33.77  ? 1021 TRP A CE2   1 
ATOM   2011 C  CE3   . TRP A 1 151 ? 12.447 -3.519  21.394  1.00 33.39  ? 1021 TRP A CE3   1 
ATOM   2012 C  CZ2   . TRP A 1 151 ? 12.354 -3.379  24.222  1.00 28.45  ? 1021 TRP A CZ2   1 
ATOM   2013 C  CZ3   . TRP A 1 151 ? 13.589 -3.662  22.164  1.00 26.64  ? 1021 TRP A CZ3   1 
ATOM   2014 C  CH2   . TRP A 1 151 ? 13.535 -3.587  23.563  1.00 25.15  ? 1021 TRP A CH2   1 
ATOM   2015 H  H     . TRP A 1 151 ? 6.966  -2.560  20.189  1.00 42.62  ? 1021 TRP A H     1 
ATOM   2016 H  HA    . TRP A 1 151 ? 9.199  -1.068  20.226  1.00 41.82  ? 1021 TRP A HA    1 
ATOM   2017 H  HB2   . TRP A 1 151 ? 8.764  -3.833  20.057  1.00 40.11  ? 1021 TRP A HB2   1 
ATOM   2018 H  HB3   . TRP A 1 151 ? 10.169 -3.258  19.590  1.00 40.11  ? 1021 TRP A HB3   1 
ATOM   2019 H  HD1   . TRP A 1 151 ? 8.196  -2.813  22.708  1.00 63.05  ? 1021 TRP A HD1   1 
ATOM   2020 H  HE1   . TRP A 1 151 ? 9.627  -2.945  24.639  1.00 53.94  ? 1021 TRP A HE1   1 
ATOM   2021 H  HE3   . TRP A 1 151 ? 12.491 -3.567  20.467  1.00 40.01  ? 1021 TRP A HE3   1 
ATOM   2022 H  HZ2   . TRP A 1 151 ? 12.320 -3.333  25.151  1.00 34.09  ? 1021 TRP A HZ2   1 
ATOM   2023 H  HZ3   . TRP A 1 151 ? 14.407 -3.803  21.745  1.00 31.91  ? 1021 TRP A HZ3   1 
ATOM   2024 H  HH2   . TRP A 1 151 ? 14.318 -3.686  24.054  1.00 30.12  ? 1021 TRP A HH2   1 
ATOM   2025 N  N     . HIS A 1 152 ? 7.886  -1.967  17.475  1.00 36.50  ? 1022 HIS A N     1 
ATOM   2026 C  CA    . HIS A 1 152 ? 8.017  -1.839  16.028  1.00 34.07  ? 1022 HIS A CA    1 
ATOM   2027 C  C     . HIS A 1 152 ? 8.034  -0.381  15.573  1.00 39.63  ? 1022 HIS A C     1 
ATOM   2028 O  O     . HIS A 1 152 ? 7.110  0.384   15.851  1.00 36.34  ? 1022 HIS A O     1 
ATOM   2029 C  CB    . HIS A 1 152 ? 6.914  -2.582  15.281  1.00 41.66  ? 1022 HIS A CB    1 
ATOM   2030 C  CG    . HIS A 1 152 ? 7.045  -2.477  13.794  1.00 47.58  ? 1022 HIS A CG    1 
ATOM   2031 N  ND1   . HIS A 1 152 ? 6.343  -1.555  13.047  1.00 51.27  ? 1022 HIS A ND1   1 
ATOM   2032 C  CD2   . HIS A 1 152 ? 7.834  -3.146  12.920  1.00 49.15  ? 1022 HIS A CD2   1 
ATOM   2033 C  CE1   . HIS A 1 152 ? 6.676  -1.678  11.774  1.00 52.37  ? 1022 HIS A CE1   1 
ATOM   2034 N  NE2   . HIS A 1 152 ? 7.579  -2.636  11.670  1.00 61.71  ? 1022 HIS A NE2   1 
ATOM   2035 H  H     . HIS A 1 152 ? 7.148  -2.318  17.744  1.00 43.74  ? 1022 HIS A H     1 
ATOM   2036 H  HA    . HIS A 1 152 ? 8.871  -2.238  15.760  1.00 40.83  ? 1022 HIS A HA    1 
ATOM   2037 H  HB2   . HIS A 1 152 ? 6.950  -3.521  15.519  1.00 49.93  ? 1022 HIS A HB2   1 
ATOM   2038 H  HB3   . HIS A 1 152 ? 6.055  -2.208  15.533  1.00 49.93  ? 1022 HIS A HB3   1 
ATOM   2039 H  HD1   . HIS A 1 152 ? 5.770  -0.995  13.359  1.00 61.47  ? 1022 HIS A HD1   1 
ATOM   2040 H  HD2   . HIS A 1 152 ? 8.428  -3.831  13.126  1.00 58.92  ? 1022 HIS A HD2   1 
ATOM   2041 H  HE1   . HIS A 1 152 ? 6.333  -1.175  11.071  1.00 62.79  ? 1022 HIS A HE1   1 
ATOM   2042 H  HE2   . HIS A 1 152 ? 7.947  -2.899  10.938  1.00 74.00  ? 1022 HIS A HE2   1 
ATOM   2043 N  N     . CYS A 1 153 ? 9.088  -0.020  14.849  1.00 32.24  ? 1023 CYS A N     1 
ATOM   2044 C  CA    . CYS A 1 153 ? 9.286  1.337   14.360  1.00 35.00  ? 1023 CYS A CA    1 
ATOM   2045 C  C     . CYS A 1 153 ? 8.933  1.412   12.880  1.00 38.47  ? 1023 CYS A C     1 
ATOM   2046 O  O     . CYS A 1 153 ? 9.638  0.857   12.039  1.00 35.43  ? 1023 CYS A O     1 
ATOM   2047 C  CB    . CYS A 1 153 ? 10.746 1.755   14.571  1.00 28.56  ? 1023 CYS A CB    1 
ATOM   2048 S  SG    . CYS A 1 153 ? 11.182 3.347   13.839  1.00 45.49  ? 1023 CYS A SG    1 
ATOM   2049 H  H     . CYS A 1 153 ? 9.719  -0.560  14.623  1.00 38.63  ? 1023 CYS A H     1 
ATOM   2050 H  HA    . CYS A 1 153 ? 8.707  1.955   14.854  1.00 41.94  ? 1023 CYS A HA    1 
ATOM   2051 H  HB2   . CYS A 1 153 ? 10.918 1.812   15.524  1.00 34.22  ? 1023 CYS A HB2   1 
ATOM   2052 H  HB3   . CYS A 1 153 ? 11.321 1.082   14.174  1.00 34.22  ? 1023 CYS A HB3   1 
ATOM   2053 H  HG    . CYS A 1 153 ? 10.995 3.297   12.655  1.00 54.53  ? 1023 CYS A HG    1 
ATOM   2054 N  N     . GLU A 1 154 ? 7.836  2.091   12.562  1.00 37.28  ? 1024 GLU A N     1 
ATOM   2055 C  CA    . GLU A 1 154 ? 7.402  2.216   11.175  1.00 44.31  ? 1024 GLU A CA    1 
ATOM   2056 C  C     . GLU A 1 154 ? 8.328  3.156   10.418  1.00 29.07  ? 1024 GLU A C     1 
ATOM   2057 O  O     . GLU A 1 154 ? 8.445  4.332   10.755  1.00 38.65  ? 1024 GLU A O     1 
ATOM   2058 C  CB    . GLU A 1 154 ? 5.964  2.734   11.096  1.00 47.05  ? 1024 GLU A CB    1 
ATOM   2059 C  CG    . GLU A 1 154 ? 5.493  3.008   9.669   1.00 72.71  ? 1024 GLU A CG    1 
ATOM   2060 C  CD    . GLU A 1 154 ? 4.253  3.880   9.613   1.00 76.15  ? 1024 GLU A CD    1 
ATOM   2061 O  OE1   . GLU A 1 154 ? 3.249  3.531   10.270  1.00 66.22  ? 1024 GLU A OE1   1 
ATOM   2062 O  OE2   . GLU A 1 154 ? 4.285  4.917   8.914   1.00 68.93  ? 1024 GLU A OE2   1 
ATOM   2063 H  H     . GLU A 1 154 ? 7.326  2.488   13.129  1.00 44.68  ? 1024 GLU A H     1 
ATOM   2064 H  HA    . GLU A 1 154 ? 7.436  1.337   10.744  1.00 53.11  ? 1024 GLU A HA    1 
ATOM   2065 H  HB2   . GLU A 1 154 ? 5.370  2.072   11.483  1.00 56.40  ? 1024 GLU A HB2   1 
ATOM   2066 H  HB3   . GLU A 1 154 ? 5.902  3.564   11.594  1.00 56.40  ? 1024 GLU A HB3   1 
ATOM   2067 H  HG2   . GLU A 1 154 ? 6.201  3.463   9.185   1.00 87.19  ? 1024 GLU A HG2   1 
ATOM   2068 H  HG3   . GLU A 1 154 ? 5.286  2.165   9.238   1.00 87.19  ? 1024 GLU A HG3   1 
ATOM   2069 N  N     . SER A 1 155 ? 8.983  2.630   9.391   1.00 36.15  ? 1025 SER A N     1 
ATOM   2070 C  CA    . SER A 1 155 ? 9.926  3.413   8.606   1.00 31.47  ? 1025 SER A CA    1 
ATOM   2071 C  C     . SER A 1 155 ? 9.956  2.889   7.178   1.00 39.32  ? 1025 SER A C     1 
ATOM   2072 O  O     . SER A 1 155 ? 10.659 1.927   6.879   1.00 43.41  ? 1025 SER A O     1 
ATOM   2073 C  CB    . SER A 1 155 ? 11.318 3.320   9.232   1.00 30.64  ? 1025 SER A CB    1 
ATOM   2074 O  OG    . SER A 1 155 ? 12.229 4.197   8.600   1.00 42.60  ? 1025 SER A OG    1 
ATOM   2075 H  H     . SER A 1 155 ? 8.898  1.816   9.126   1.00 43.33  ? 1025 SER A H     1 
ATOM   2076 H  HA    . SER A 1 155 ? 9.648  4.353   8.593   1.00 37.71  ? 1025 SER A HA    1 
ATOM   2077 H  HB2   . SER A 1 155 ? 11.256 3.556   10.171  1.00 36.71  ? 1025 SER A HB2   1 
ATOM   2078 H  HB3   . SER A 1 155 ? 11.643 2.411   9.141   1.00 36.71  ? 1025 SER A HB3   1 
ATOM   2079 H  HG    . SER A 1 155 ? 12.968 4.133   8.949   1.00 51.06  ? 1025 SER A HG    1 
ATOM   2080 N  N     . ASN A 1 156 ? 9.196  3.530   6.296   1.00 37.58  ? 1026 ASN A N     1 
ATOM   2081 C  CA    . ASN A 1 156 ? 9.010  3.027   4.938   1.00 35.89  ? 1026 ASN A CA    1 
ATOM   2082 C  C     . ASN A 1 156 ? 9.932  3.692   3.922   1.00 31.18  ? 1026 ASN A C     1 
ATOM   2083 O  O     . ASN A 1 156 ? 10.141 4.901   3.954   1.00 32.73  ? 1026 ASN A O     1 
ATOM   2084 C  CB    . ASN A 1 156 ? 7.549  3.195   4.526   1.00 40.97  ? 1026 ASN A CB    1 
ATOM   2085 C  CG    . ASN A 1 156 ? 6.598  2.504   5.484   1.00 54.52  ? 1026 ASN A CG    1 
ATOM   2086 O  OD1   . ASN A 1 156 ? 5.625  3.098   5.949   1.00 58.02  ? 1026 ASN A OD1   1 
ATOM   2087 N  ND2   . ASN A 1 156 ? 6.891  1.248   5.805   1.00 42.12  ? 1026 ASN A ND2   1 
ATOM   2088 H  H     . ASN A 1 156 ? 8.774  4.262   6.460   1.00 45.04  ? 1026 ASN A H     1 
ATOM   2089 H  HA    . ASN A 1 156 ? 9.209  2.068   4.933   1.00 43.02  ? 1026 ASN A HA    1 
ATOM   2090 H  HB2   . ASN A 1 156 ? 7.330  4.140   4.512   1.00 49.11  ? 1026 ASN A HB2   1 
ATOM   2091 H  HB3   . ASN A 1 156 ? 7.422  2.810   3.645   1.00 49.11  ? 1026 ASN A HB3   1 
ATOM   2092 H  HD21  . ASN A 1 156 ? 6.383  0.812   6.345   1.00 50.49  ? 1026 ASN A HD21  1 
ATOM   2093 H  HD22  . ASN A 1 156 ? 7.589  0.871   5.472   1.00 50.49  ? 1026 ASN A HD22  1 
ATOM   2094 N  N     . ARG A 1 157 ? 10.462 2.890   3.004   1.00 31.81  ? 1027 ARG A N     1 
ATOM   2095 C  CA    . ARG A 1 157 ? 11.512 3.342   2.101   1.00 37.79  ? 1027 ARG A CA    1 
ATOM   2096 C  C     . ARG A 1 157 ? 10.991 3.900   0.778   1.00 42.05  ? 1027 ARG A C     1 
ATOM   2097 O  O     . ARG A 1 157 ? 10.081 3.342   0.162   1.00 34.46  ? 1027 ARG A O     1 
ATOM   2098 C  CB    . ARG A 1 157 ? 12.479 2.194   1.807   1.00 36.01  ? 1027 ARG A CB    1 
ATOM   2099 C  CG    . ARG A 1 157 ? 13.683 2.611   0.979   1.00 31.47  ? 1027 ARG A CG    1 
ATOM   2100 C  CD    . ARG A 1 157 ? 14.617 1.443   0.706   1.00 43.14  ? 1027 ARG A CD    1 
ATOM   2101 N  NE    . ARG A 1 157 ? 14.146 0.614   -0.398  1.00 44.83  ? 1027 ARG A NE    1 
ATOM   2102 C  CZ    . ARG A 1 157 ? 14.942 -0.004  -1.266  1.00 36.55  ? 1027 ARG A CZ    1 
ATOM   2103 N  NH1   . ARG A 1 157 ? 16.260 0.108   -1.168  1.00 38.14  ? 1027 ARG A NH1   1 
ATOM   2104 N  NH2   . ARG A 1 157 ? 14.418 -0.734  -2.240  1.00 48.89  ? 1027 ARG A NH2   1 
ATOM   2105 H  H     . ARG A 1 157 ? 10.227 2.072   2.884   1.00 38.11  ? 1027 ARG A H     1 
ATOM   2106 H  HA    . ARG A 1 157 ? 12.020 4.054   2.543   1.00 45.30  ? 1027 ARG A HA    1 
ATOM   2107 H  HB2   . ARG A 1 157 ? 12.806 1.836   2.648   1.00 43.16  ? 1027 ARG A HB2   1 
ATOM   2108 H  HB3   . ARG A 1 157 ? 12.006 1.503   1.317   1.00 43.16  ? 1027 ARG A HB3   1 
ATOM   2109 H  HG2   . ARG A 1 157 ? 13.379 2.960   0.127   1.00 37.71  ? 1027 ARG A HG2   1 
ATOM   2110 H  HG3   . ARG A 1 157 ? 14.181 3.290   1.460   1.00 37.71  ? 1027 ARG A HG3   1 
ATOM   2111 H  HD2   . ARG A 1 157 ? 15.495 1.785   0.475   1.00 51.71  ? 1027 ARG A HD2   1 
ATOM   2112 H  HD3   . ARG A 1 157 ? 14.672 0.888   1.499   1.00 51.71  ? 1027 ARG A HD3   1 
ATOM   2113 H  HE    . ARG A 1 157 ? 13.297 0.518   -0.494  1.00 53.74  ? 1027 ARG A HE    1 
ATOM   2114 H  HH11  . ARG A 1 157 ? 16.606 0.581   -0.538  1.00 45.72  ? 1027 ARG A HH11  1 
ATOM   2115 H  HH12  . ARG A 1 157 ? 16.769 -0.295  -1.732  1.00 45.72  ? 1027 ARG A HH12  1 
ATOM   2116 H  HH21  . ARG A 1 157 ? 13.564 -0.810  -2.308  1.00 58.61  ? 1027 ARG A HH21  1 
ATOM   2117 H  HH22  . ARG A 1 157 ? 14.932 -1.134  -2.801  1.00 58.61  ? 1027 ARG A HH22  1 
ATOM   2118 N  N     . SER A 1 158 ? 11.590 5.010   0.359   1.00 34.09  ? 1028 SER A N     1 
ATOM   2119 C  CA    . SER A 1 158 ? 11.401 5.562   -0.975  1.00 33.19  ? 1028 SER A CA    1 
ATOM   2120 C  C     . SER A 1 158 ? 12.717 6.227   -1.376  1.00 33.67  ? 1028 SER A C     1 
ATOM   2121 O  O     . SER A 1 158 ? 13.705 6.133   -0.653  1.00 28.46  ? 1028 SER A O     1 
ATOM   2122 C  CB    . SER A 1 158 ? 10.253 6.573   -0.991  1.00 31.61  ? 1028 SER A CB    1 
ATOM   2123 O  OG    . SER A 1 158 ? 10.563 7.720   -0.216  1.00 35.82  ? 1028 SER A OG    1 
ATOM   2124 H  H     . SER A 1 158 ? 12.126 5.473   0.846   1.00 40.85  ? 1028 SER A H     1 
ATOM   2125 H  HA    . SER A 1 158 ? 11.201 4.843   -1.610  1.00 39.78  ? 1028 SER A HA    1 
ATOM   2126 H  HB2   . SER A 1 158 ? 10.088 6.847   -1.906  1.00 37.87  ? 1028 SER A HB2   1 
ATOM   2127 H  HB3   . SER A 1 158 ? 9.459  6.152   -0.625  1.00 37.87  ? 1028 SER A HB3   1 
ATOM   2128 H  HG    . SER A 1 158 ? 9.938  8.250   -0.236  1.00 42.92  ? 1028 SER A HG    1 
ATOM   2129 N  N     . HIS A 1 159 ? 12.741 6.900   -2.520  1.00 31.58  ? 1029 HIS A N     1 
ATOM   2130 C  CA    . HIS A 1 159 ? 13.959 7.572   -2.965  1.00 31.79  ? 1029 HIS A CA    1 
ATOM   2131 C  C     . HIS A 1 159 ? 13.641 8.886   -3.659  1.00 35.97  ? 1029 HIS A C     1 
ATOM   2132 O  O     . HIS A 1 159 ? 12.660 8.992   -4.390  1.00 34.69  ? 1029 HIS A O     1 
ATOM   2133 C  CB    . HIS A 1 159 ? 14.773 6.667   -3.895  1.00 27.64  ? 1029 HIS A CB    1 
ATOM   2134 C  CG    . HIS A 1 159 ? 15.352 5.470   -3.209  1.00 33.54  ? 1029 HIS A CG    1 
ATOM   2135 N  ND1   . HIS A 1 159 ? 14.636 4.310   -3.006  1.00 34.74  ? 1029 HIS A ND1   1 
ATOM   2136 C  CD2   . HIS A 1 159 ? 16.576 5.255   -2.670  1.00 35.63  ? 1029 HIS A CD2   1 
ATOM   2137 C  CE1   . HIS A 1 159 ? 15.393 3.432   -2.373  1.00 30.87  ? 1029 HIS A CE1   1 
ATOM   2138 N  NE2   . HIS A 1 159 ? 16.575 3.981   -2.157  1.00 32.88  ? 1029 HIS A NE2   1 
ATOM   2139 H  H     . HIS A 1 159 ? 12.072 6.984   -3.054  1.00 37.84  ? 1029 HIS A H     1 
ATOM   2140 H  HA    . HIS A 1 159 ? 14.513 7.773   -2.182  1.00 38.09  ? 1029 HIS A HA    1 
ATOM   2141 H  HB2   . HIS A 1 159 ? 14.196 6.351   -4.608  1.00 33.11  ? 1029 HIS A HB2   1 
ATOM   2142 H  HB3   . HIS A 1 159 ? 15.507 7.180   -4.268  1.00 33.11  ? 1029 HIS A HB3   1 
ATOM   2143 H  HD1   . HIS A 1 159 ? 13.823 4.179   -3.252  1.00 41.63  ? 1029 HIS A HD1   1 
ATOM   2144 H  HD2   . HIS A 1 159 ? 17.284 5.858   -2.649  1.00 42.71  ? 1029 HIS A HD2   1 
ATOM   2145 H  HE1   . HIS A 1 159 ? 15.139 2.574   -2.124  1.00 36.99  ? 1029 HIS A HE1   1 
ATOM   2146 H  HE2   . HIS A 1 159 ? 17.237 3.601   -1.762  1.00 39.41  ? 1029 HIS A HE2   1 
ATOM   2147 N  N     . THR A 1 160 ? 14.482 9.884   -3.418  1.00 35.79  ? 1030 THR A N     1 
ATOM   2148 C  CA    . THR A 1 160 ? 14.311 11.203  -4.007  1.00 35.64  ? 1030 THR A CA    1 
ATOM   2149 C  C     . THR A 1 160 ? 15.688 11.772  -4.348  1.00 31.18  ? 1030 THR A C     1 
ATOM   2150 O  O     . THR A 1 160 ? 16.681 11.044  -4.359  1.00 28.32  ? 1030 THR A O     1 
ATOM   2151 C  CB    . THR A 1 160 ? 13.550 12.149  -3.046  1.00 31.71  ? 1030 THR A CB    1 
ATOM   2152 O  OG1   . THR A 1 160 ? 13.272 13.391  -3.702  1.00 33.49  ? 1030 THR A OG1   1 
ATOM   2153 C  CG2   . THR A 1 160 ? 14.361 12.410  -1.780  1.00 31.29  ? 1030 THR A CG2   1 
ATOM   2154 H  H     . THR A 1 160 ? 15.172 9.820   -2.907  1.00 42.90  ? 1030 THR A H     1 
ATOM   2155 H  HA    . THR A 1 160 ? 13.795 11.124  -4.837  1.00 42.71  ? 1030 THR A HA    1 
ATOM   2156 H  HB    . THR A 1 160 ? 12.713 11.733  -2.788  1.00 38.00  ? 1030 THR A HB    1 
ATOM   2157 H  HG1   . THR A 1 160 ? 12.869 13.893  -3.194  1.00 40.13  ? 1030 THR A HG1   1 
ATOM   2158 H  HG21  . THR A 1 160 ? 13.876 12.998  -1.196  1.00 37.49  ? 1030 THR A HG21  1 
ATOM   2159 H  HG22  . THR A 1 160 ? 14.529 11.584  -1.322  1.00 37.49  ? 1030 THR A HG22  1 
ATOM   2160 H  HG23  . THR A 1 160 ? 15.199 12.818  -2.007  1.00 37.49  ? 1030 THR A HG23  1 
ATOM   2161 N  N     . THR A 1 161 ? 15.744 13.064  -4.652  1.00 27.29  ? 1031 THR A N     1 
ATOM   2162 C  CA    . THR A 1 161 ? 17.011 13.733  -4.908  1.00 31.16  ? 1031 THR A CA    1 
ATOM   2163 C  C     . THR A 1 161 ? 17.351 14.650  -3.741  1.00 28.43  ? 1031 THR A C     1 
ATOM   2164 O  O     . THR A 1 161 ? 16.492 14.964  -2.922  1.00 32.35  ? 1031 THR A O     1 
ATOM   2165 C  CB    . THR A 1 161 ? 16.940 14.580  -6.187  1.00 32.69  ? 1031 THR A CB    1 
ATOM   2166 O  OG1   . THR A 1 161 ? 15.896 15.550  -6.053  1.00 32.55  ? 1031 THR A OG1   1 
ATOM   2167 C  CG2   . THR A 1 161 ? 16.664 13.699  -7.403  1.00 32.42  ? 1031 THR A CG2   1 
ATOM   2168 H  H     . THR A 1 161 ? 15.057 13.577  -4.715  1.00 32.69  ? 1031 THR A H     1 
ATOM   2169 H  HA    . THR A 1 161 ? 17.724 13.069  -5.007  1.00 37.33  ? 1031 THR A HA    1 
ATOM   2170 H  HB    . THR A 1 161 ? 17.787 15.033  -6.322  1.00 39.17  ? 1031 THR A HB    1 
ATOM   2171 H  HG1   . THR A 1 161 ? 16.049 16.039  -5.412  1.00 39.01  ? 1031 THR A HG1   1 
ATOM   2172 H  HG21  . THR A 1 161 ? 16.622 14.239  -8.196  1.00 38.84  ? 1031 THR A HG21  1 
ATOM   2173 H  HG22  . THR A 1 161 ? 17.364 13.051  -7.504  1.00 38.84  ? 1031 THR A HG22  1 
ATOM   2174 H  HG23  . THR A 1 161 ? 15.828 13.241  -7.293  1.00 38.84  ? 1031 THR A HG23  1 
ATOM   2175 N  N     . ILE A 1 162 ? 18.606 15.081  -3.669  1.00 29.45  ? 1032 ILE A N     1 
ATOM   2176 C  CA    . ILE A 1 162 ? 19.025 16.021  -2.638  1.00 28.75  ? 1032 ILE A CA    1 
ATOM   2177 C  C     . ILE A 1 162 ? 18.244 17.321  -2.767  1.00 34.69  ? 1032 ILE A C     1 
ATOM   2178 O  O     . ILE A 1 162 ? 17.847 17.917  -1.772  1.00 30.45  ? 1032 ILE A O     1 
ATOM   2179 C  CB    . ILE A 1 162 ? 20.519 16.352  -2.744  1.00 31.70  ? 1032 ILE A CB    1 
ATOM   2180 C  CG1   . ILE A 1 162 ? 21.358 15.176  -2.246  1.00 38.12  ? 1032 ILE A CG1   1 
ATOM   2181 C  CG2   . ILE A 1 162 ? 20.843 17.606  -1.936  1.00 43.36  ? 1032 ILE A CG2   1 
ATOM   2182 C  CD1   . ILE A 1 162 ? 22.845 15.475  -2.167  1.00 35.68  ? 1032 ILE A CD1   1 
ATOM   2183 H  H     . ILE A 1 162 ? 19.234 14.843  -4.207  1.00 35.28  ? 1032 ILE A H     1 
ATOM   2184 H  HA    . ILE A 1 162 ? 18.851 15.638  -1.753  1.00 34.44  ? 1032 ILE A HA    1 
ATOM   2185 H  HB    . ILE A 1 162 ? 20.736 16.517  -3.675  1.00 37.98  ? 1032 ILE A HB    1 
ATOM   2186 H  HG12  . ILE A 1 162 ? 21.057 14.931  -1.357  1.00 45.69  ? 1032 ILE A HG12  1 
ATOM   2187 H  HG13  . ILE A 1 162 ? 21.239 14.428  -2.852  1.00 45.69  ? 1032 ILE A HG13  1 
ATOM   2188 H  HG21  . ILE A 1 162 ? 20.616 17.451  -1.016  1.00 51.98  ? 1032 ILE A HG21  1 
ATOM   2189 H  HG22  . ILE A 1 162 ? 21.781 17.795  -2.015  1.00 51.98  ? 1032 ILE A HG22  1 
ATOM   2190 H  HG23  . ILE A 1 162 ? 20.330 18.340  -2.281  1.00 51.98  ? 1032 ILE A HG23  1 
ATOM   2191 H  HD11  . ILE A 1 162 ? 23.304 14.694  -1.848  1.00 42.76  ? 1032 ILE A HD11  1 
ATOM   2192 H  HD12  . ILE A 1 162 ? 23.164 15.709  -3.042  1.00 42.76  ? 1032 ILE A HD12  1 
ATOM   2193 H  HD13  . ILE A 1 162 ? 22.984 16.207  -1.561  1.00 42.76  ? 1032 ILE A HD13  1 
ATOM   2194 N  N     . ALA A 1 163 ? 18.032 17.764  -3.999  1.00 34.60  ? 1033 ALA A N     1 
ATOM   2195 C  CA    . ALA A 1 163 ? 17.343 19.025  -4.234  1.00 36.83  ? 1033 ALA A CA    1 
ATOM   2196 C  C     . ALA A 1 163 ? 15.941 18.974  -3.636  1.00 37.41  ? 1033 ALA A C     1 
ATOM   2197 O  O     . ALA A 1 163 ? 15.494 19.919  -2.990  1.00 34.70  ? 1033 ALA A O     1 
ATOM   2198 C  CB    . ALA A 1 163 ? 17.279 19.326  -5.727  1.00 38.24  ? 1033 ALA A CB    1 
ATOM   2199 H  H     . ALA A 1 163 ? 18.277 17.355  -4.715  1.00 41.46  ? 1033 ALA A H     1 
ATOM   2200 H  HA    . ALA A 1 163 ? 17.837 19.749  -3.796  1.00 44.14  ? 1033 ALA A HA    1 
ATOM   2201 H  HB1   . ALA A 1 163 ? 16.821 20.160  -5.858  1.00 45.84  ? 1033 ALA A HB1   1 
ATOM   2202 H  HB2   . ALA A 1 163 ? 18.173 19.385  -6.072  1.00 45.84  ? 1033 ALA A HB2   1 
ATOM   2203 H  HB3   . ALA A 1 163 ? 16.803 18.619  -6.168  1.00 45.84  ? 1033 ALA A HB3   1 
ATOM   2204 N  N     . LYS A 1 164 ? 15.256 17.857  -3.839  1.00 32.87  ? 1034 LYS A N     1 
ATOM   2205 C  CA    . LYS A 1 164 ? 13.879 17.733  -3.392  1.00 31.74  ? 1034 LYS A CA    1 
ATOM   2206 C  C     . LYS A 1 164 ? 13.783 17.479  -1.888  1.00 37.56  ? 1034 LYS A C     1 
ATOM   2207 O  O     . LYS A 1 164 ? 12.846 17.944  -1.240  1.00 30.41  ? 1034 LYS A O     1 
ATOM   2208 C  CB    . LYS A 1 164 ? 13.148 16.653  -4.190  1.00 40.83  ? 1034 LYS A CB    1 
ATOM   2209 C  CG    . LYS A 1 164 ? 12.680 17.146  -5.552  1.00 39.68  ? 1034 LYS A CG    1 
ATOM   2210 C  CD    . LYS A 1 164 ? 11.905 16.085  -6.307  1.00 59.72  ? 1034 LYS A CD    1 
ATOM   2211 C  CE    . LYS A 1 164 ? 11.334 16.641  -7.603  1.00 62.55  ? 1034 LYS A CE    1 
ATOM   2212 N  NZ    . LYS A 1 164 ? 10.567 15.621  -8.369  1.00 51.95  ? 1034 LYS A NZ    1 
ATOM   2213 H  H     . LYS A 1 164 ? 15.565 17.158  -4.233  1.00 39.39  ? 1034 LYS A H     1 
ATOM   2214 H  HA    . LYS A 1 164 ? 13.423 18.582  -3.570  1.00 38.03  ? 1034 LYS A HA    1 
ATOM   2215 H  HB2   . LYS A 1 164 ? 13.747 15.904  -4.332  1.00 48.94  ? 1034 LYS A HB2   1 
ATOM   2216 H  HB3   . LYS A 1 164 ? 12.367 16.365  -3.691  1.00 48.94  ? 1034 LYS A HB3   1 
ATOM   2217 H  HG2   . LYS A 1 164 ? 12.100 17.914  -5.430  1.00 47.56  ? 1034 LYS A HG2   1 
ATOM   2218 H  HG3   . LYS A 1 164 ? 13.453 17.392  -6.084  1.00 47.56  ? 1034 LYS A HG3   1 
ATOM   2219 H  HD2   . LYS A 1 164 ? 12.498 15.349  -6.526  1.00 71.60  ? 1034 LYS A HD2   1 
ATOM   2220 H  HD3   . LYS A 1 164 ? 11.169 15.772  -5.758  1.00 71.60  ? 1034 LYS A HD3   1 
ATOM   2221 H  HE2   . LYS A 1 164 ? 10.735 17.375  -7.397  1.00 75.01  ? 1034 LYS A HE2   1 
ATOM   2222 H  HE3   . LYS A 1 164 ? 12.062 16.953  -8.163  1.00 75.01  ? 1034 LYS A HE3   1 
ATOM   2223 H  HZ1   . LYS A 1 164 ? 10.249 15.980  -9.119  1.00 62.29  ? 1034 LYS A HZ1   1 
ATOM   2224 H  HZ2   . LYS A 1 164 ? 11.096 14.937  -8.578  1.00 62.29  ? 1034 LYS A HZ2   1 
ATOM   2225 H  HZ3   . LYS A 1 164 ? 9.887  15.322  -7.880  1.00 62.29  ? 1034 LYS A HZ3   1 
ATOM   2226 N  N     . TYR A 1 165 ? 14.740 16.760  -1.312  1.00 27.78  ? 1035 TYR A N     1 
ATOM   2227 C  CA    . TYR A 1 165 ? 14.709 16.591  0.134   1.00 24.55  ? 1035 TYR A CA    1 
ATOM   2228 C  C     . TYR A 1 165 ? 15.114 17.895  0.819   1.00 26.11  ? 1035 TYR A C     1 
ATOM   2229 O  O     . TYR A 1 165 ? 14.585 18.246  1.867   1.00 29.13  ? 1035 TYR A O     1 
ATOM   2230 C  CB    . TYR A 1 165 ? 15.596 15.443  0.626   1.00 32.02  ? 1035 TYR A CB    1 
ATOM   2231 C  CG    . TYR A 1 165 ? 15.391 15.243  2.107   1.00 29.79  ? 1035 TYR A CG    1 
ATOM   2232 C  CD1   . TYR A 1 165 ? 14.358 14.447  2.580   1.00 22.92  ? 1035 TYR A CD1   1 
ATOM   2233 C  CD2   . TYR A 1 165 ? 16.181 15.910  3.032   1.00 24.06  ? 1035 TYR A CD2   1 
ATOM   2234 C  CE1   . TYR A 1 165 ? 14.140 14.292  3.933   1.00 29.75  ? 1035 TYR A CE1   1 
ATOM   2235 C  CE2   . TYR A 1 165 ? 15.971 15.765  4.383   1.00 30.56  ? 1035 TYR A CE2   1 
ATOM   2236 C  CZ    . TYR A 1 165 ? 14.948 14.956  4.830   1.00 28.72  ? 1035 TYR A CZ    1 
ATOM   2237 O  OH    . TYR A 1 165 ? 14.735 14.814  6.178   1.00 29.99  ? 1035 TYR A OH    1 
ATOM   2238 H  H     . TYR A 1 165 ? 15.394 16.375  -1.717  1.00 33.29  ? 1035 TYR A H     1 
ATOM   2239 H  HA    . TYR A 1 165 ? 13.789 16.389  0.403   1.00 29.41  ? 1035 TYR A HA    1 
ATOM   2240 H  HB2   . TYR A 1 165 ? 15.354 14.624  0.166   1.00 38.37  ? 1035 TYR A HB2   1 
ATOM   2241 H  HB3   . TYR A 1 165 ? 16.528 15.661  0.469   1.00 38.37  ? 1035 TYR A HB3   1 
ATOM   2242 H  HD1   . TYR A 1 165 ? 13.810 14.002  1.975   1.00 27.44  ? 1035 TYR A HD1   1 
ATOM   2243 H  HD2   . TYR A 1 165 ? 16.869 16.460  2.733   1.00 28.82  ? 1035 TYR A HD2   1 
ATOM   2244 H  HE1   . TYR A 1 165 ? 13.450 13.748  4.238   1.00 35.65  ? 1035 TYR A HE1   1 
ATOM   2245 H  HE2   . TYR A 1 165 ? 16.514 16.210  4.992   1.00 36.61  ? 1035 TYR A HE2   1 
ATOM   2246 H  HH    . TYR A 1 165 ? 14.571 15.544  6.514   1.00 35.94  ? 1035 TYR A HH    1 
ATOM   2247 N  N     . ALA A 1 166 ? 16.052 18.613  0.216   1.00 28.32  ? 1036 ALA A N     1 
ATOM   2248 C  CA    . ALA A 1 166 ? 16.505 19.889  0.755   1.00 25.90  ? 1036 ALA A CA    1 
ATOM   2249 C  C     . ALA A 1 166 ? 15.337 20.866  0.816   1.00 31.81  ? 1036 ALA A C     1 
ATOM   2250 O  O     . ALA A 1 166 ? 15.196 21.630  1.768   1.00 30.77  ? 1036 ALA A O     1 
ATOM   2251 C  CB    . ALA A 1 166 ? 17.613 20.452  -0.104  1.00 29.56  ? 1036 ALA A CB    1 
ATOM   2252 H  H     . ALA A 1 166 ? 16.445 18.381  -0.513  1.00 33.93  ? 1036 ALA A H     1 
ATOM   2253 H  HA    . ALA A 1 166 ? 16.850 19.758  1.663   1.00 31.03  ? 1036 ALA A HA    1 
ATOM   2254 H  HB1   . ALA A 1 166 ? 17.899 21.291  0.265   1.00 35.41  ? 1036 ALA A HB1   1 
ATOM   2255 H  HB2   . ALA A 1 166 ? 18.346 19.832  -0.114  1.00 35.41  ? 1036 ALA A HB2   1 
ATOM   2256 H  HB3   . ALA A 1 166 ? 17.281 20.582  -0.996  1.00 35.41  ? 1036 ALA A HB3   1 
ATOM   2257 N  N     . GLN A 1 167 ? 14.503 20.840  -0.216  1.00 34.01  ? 1037 GLN A N     1 
ATOM   2258 C  CA    . GLN A 1 167 ? 13.327 21.693  -0.269  1.00 44.29  ? 1037 GLN A CA    1 
ATOM   2259 C  C     . GLN A 1 167 ? 12.373 21.348  0.873   1.00 40.57  ? 1037 GLN A C     1 
ATOM   2260 O  O     . GLN A 1 167 ? 11.808 22.236  1.511   1.00 36.90  ? 1037 GLN A O     1 
ATOM   2261 C  CB    . GLN A 1 167 ? 12.639 21.539  -1.628  1.00 50.51  ? 1037 GLN A CB    1 
ATOM   2262 C  CG    . GLN A 1 167 ? 11.244 22.126  -1.716  1.00 74.46  ? 1037 GLN A CG    1 
ATOM   2263 C  CD    . GLN A 1 167 ? 10.630 21.928  -3.091  1.00 91.30  ? 1037 GLN A CD    1 
ATOM   2264 O  OE1   . GLN A 1 167 ? 11.167 21.197  -3.923  1.00 70.17  ? 1037 GLN A OE1   1 
ATOM   2265 N  NE2   . GLN A 1 167 ? 9.502  22.585  -3.338  1.00 102.82 ? 1037 GLN A NE2   1 
ATOM   2266 H  H     . GLN A 1 167 ? 14.599 20.333  -0.904  1.00 40.76  ? 1037 GLN A H     1 
ATOM   2267 H  HA    . GLN A 1 167 ? 13.601 22.629  -0.168  1.00 53.09  ? 1037 GLN A HA    1 
ATOM   2268 H  HB2   . GLN A 1 167 ? 13.183 21.978  -2.300  1.00 60.55  ? 1037 GLN A HB2   1 
ATOM   2269 H  HB3   . GLN A 1 167 ? 12.571 20.593  -1.833  1.00 60.55  ? 1037 GLN A HB3   1 
ATOM   2270 H  HG2   . GLN A 1 167 ? 10.673 21.689  -1.065  1.00 89.29  ? 1037 GLN A HG2   1 
ATOM   2271 H  HG3   . GLN A 1 167 ? 11.287 23.078  -1.538  1.00 89.29  ? 1037 GLN A HG3   1 
ATOM   2272 H  HE21  . GLN A 1 167 ? 9.117  22.505  -4.102  1.00 123.33 ? 1037 GLN A HE21  1 
ATOM   2273 H  HE22  . GLN A 1 167 ? 9.158  23.090  -2.733  1.00 123.33 ? 1037 GLN A HE22  1 
ATOM   2274 N  N     . TYR A 1 168 ? 12.216 20.056  1.139   1.00 34.89  ? 1038 TYR A N     1 
ATOM   2275 C  CA    . TYR A 1 168 ? 11.345 19.593  2.215   1.00 36.12  ? 1038 TYR A CA    1 
ATOM   2276 C  C     . TYR A 1 168 ? 11.885 19.958  3.598   1.00 45.62  ? 1038 TYR A C     1 
ATOM   2277 O  O     . TYR A 1 168 ? 11.137 20.389  4.471   1.00 35.47  ? 1038 TYR A O     1 
ATOM   2278 C  CB    . TYR A 1 168 ? 11.166 18.081  2.135   1.00 33.97  ? 1038 TYR A CB    1 
ATOM   2279 C  CG    . TYR A 1 168 ? 10.584 17.485  3.393   1.00 29.02  ? 1038 TYR A CG    1 
ATOM   2280 C  CD1   . TYR A 1 168 ? 9.225  17.576  3.661   1.00 38.60  ? 1038 TYR A CD1   1 
ATOM   2281 C  CD2   . TYR A 1 168 ? 11.395 16.831  4.316   1.00 35.89  ? 1038 TYR A CD2   1 
ATOM   2282 C  CE1   . TYR A 1 168 ? 8.686  17.032  4.813   1.00 54.27  ? 1038 TYR A CE1   1 
ATOM   2283 C  CE2   . TYR A 1 168 ? 10.865 16.283  5.470   1.00 34.00  ? 1038 TYR A CE2   1 
ATOM   2284 C  CZ    . TYR A 1 168 ? 9.508  16.387  5.714   1.00 49.35  ? 1038 TYR A CZ    1 
ATOM   2285 O  OH    . TYR A 1 168 ? 8.971  15.846  6.860   1.00 37.10  ? 1038 TYR A OH    1 
ATOM   2286 H  H     . TYR A 1 168 ? 12.605 19.422  0.708   1.00 41.81  ? 1038 TYR A H     1 
ATOM   2287 H  HA    . TYR A 1 168 ? 10.464 20.010  2.114   1.00 43.29  ? 1038 TYR A HA    1 
ATOM   2288 H  HB2   . TYR A 1 168 ? 10.566 17.874  1.401   1.00 40.71  ? 1038 TYR A HB2   1 
ATOM   2289 H  HB3   . TYR A 1 168 ? 12.031 17.669  1.982   1.00 40.71  ? 1038 TYR A HB3   1 
ATOM   2290 H  HD1   . TYR A 1 168 ? 8.667  18.010  3.056   1.00 46.27  ? 1038 TYR A HD1   1 
ATOM   2291 H  HD2   . TYR A 1 168 ? 12.307 16.760  4.154   1.00 43.02  ? 1038 TYR A HD2   1 
ATOM   2292 H  HE1   . TYR A 1 168 ? 7.773  17.100  4.979   1.00 65.07  ? 1038 TYR A HE1   1 
ATOM   2293 H  HE2   . TYR A 1 168 ? 11.418 15.848  6.079   1.00 40.74  ? 1038 TYR A HE2   1 
ATOM   2294 H  HH    . TYR A 1 168 ? 9.312  16.191  7.521   1.00 44.46  ? 1038 TYR A HH    1 
ATOM   2295 N  N     . GLN A 1 169 ? 13.184 19.765  3.795   1.00 30.95  ? 1039 GLN A N     1 
ATOM   2296 C  CA    . GLN A 1 169 ? 13.821 20.051  5.073   1.00 29.23  ? 1039 GLN A CA    1 
ATOM   2297 C  C     . GLN A 1 169 ? 13.668 21.535  5.403   1.00 35.35  ? 1039 GLN A C     1 
ATOM   2298 O  O     . GLN A 1 169 ? 13.333 21.904  6.530   1.00 34.57  ? 1039 GLN A O     1 
ATOM   2299 C  CB    . GLN A 1 169 ? 15.302 19.682  5.005   1.00 28.06  ? 1039 GLN A CB    1 
ATOM   2300 C  CG    . GLN A 1 169 ? 16.001 19.589  6.349   1.00 29.01  ? 1039 GLN A CG    1 
ATOM   2301 C  CD    . GLN A 1 169 ? 17.508 19.544  6.196   1.00 36.32  ? 1039 GLN A CD    1 
ATOM   2302 O  OE1   . GLN A 1 169 ? 18.061 20.177  5.301   1.00 31.46  ? 1039 GLN A OE1   1 
ATOM   2303 N  NE2   . GLN A 1 169 ? 18.178 18.788  7.058   1.00 23.95  ? 1039 GLN A NE2   1 
ATOM   2304 H  H     . GLN A 1 169 ? 13.724 19.466  3.196   1.00 37.08  ? 1039 GLN A H     1 
ATOM   2305 H  HA    . GLN A 1 169 ? 13.396 19.524  5.782   1.00 35.01  ? 1039 GLN A HA    1 
ATOM   2306 H  HB2   . GLN A 1 169 ? 15.385 18.818  4.572   1.00 33.62  ? 1039 GLN A HB2   1 
ATOM   2307 H  HB3   . GLN A 1 169 ? 15.764 20.354  4.480   1.00 33.62  ? 1039 GLN A HB3   1 
ATOM   2308 H  HG2   . GLN A 1 169 ? 15.774 20.367  6.882   1.00 34.75  ? 1039 GLN A HG2   1 
ATOM   2309 H  HG3   . GLN A 1 169 ? 15.718 18.779  6.802   1.00 34.75  ? 1039 GLN A HG3   1 
ATOM   2310 H  HE21  . GLN A 1 169 ? 19.035 18.733  7.007   1.00 28.69  ? 1039 GLN A HE21  1 
ATOM   2311 H  HE22  . GLN A 1 169 ? 17.755 18.352  7.667   1.00 28.69  ? 1039 GLN A HE22  1 
ATOM   2312 N  N     . ALA A 1 170 ? 13.908 22.376  4.402   1.00 37.11  ? 1040 ALA A N     1 
ATOM   2313 C  CA    . ALA A 1 170 ? 13.862 23.826  4.567   1.00 47.76  ? 1040 ALA A CA    1 
ATOM   2314 C  C     . ALA A 1 170 ? 12.445 24.320  4.840   1.00 46.24  ? 1040 ALA A C     1 
ATOM   2315 O  O     . ALA A 1 170 ? 12.244 25.234  5.639   1.00 48.25  ? 1040 ALA A O     1 
ATOM   2316 C  CB    . ALA A 1 170 ? 14.427 24.514  3.329   1.00 38.44  ? 1040 ALA A CB    1 
ATOM   2317 H  H     . ALA A 1 170 ? 14.104 22.127  3.602   1.00 44.47  ? 1040 ALA A H     1 
ATOM   2318 H  HA    . ALA A 1 170 ? 14.420 24.076  5.332   1.00 57.26  ? 1040 ALA A HA    1 
ATOM   2319 H  HB1   . ALA A 1 170 ? 14.389 25.465  3.456   1.00 46.07  ? 1040 ALA A HB1   1 
ATOM   2320 H  HB2   . ALA A 1 170 ? 15.338 24.237  3.207   1.00 46.07  ? 1040 ALA A HB2   1 
ATOM   2321 H  HB3   . ALA A 1 170 ? 13.902 24.264  2.565   1.00 46.07  ? 1040 ALA A HB3   1 
ATOM   2322 N  N     . SER A 1 171 ? 11.464 23.721  4.174   1.00 40.37  ? 1041 SER A N     1 
ATOM   2323 C  CA    . SER A 1 171 ? 10.081 24.148  4.331   1.00 65.62  ? 1041 SER A CA    1 
ATOM   2324 C  C     . SER A 1 171 ? 9.504  23.629  5.643   1.00 64.57  ? 1041 SER A C     1 
ATOM   2325 O  O     . SER A 1 171 ? 8.647  24.268  6.247   1.00 58.82  ? 1041 SER A O     1 
ATOM   2326 C  CB    . SER A 1 171 ? 9.227  23.681  3.147   1.00 67.96  ? 1041 SER A CB    1 
ATOM   2327 O  OG    . SER A 1 171 ? 8.862  22.315  3.261   1.00 74.74  ? 1041 SER A OG    1 
ATOM   2328 H  H     . SER A 1 171 ? 11.574 23.066  3.627   1.00 48.38  ? 1041 SER A H     1 
ATOM   2329 H  HA    . SER A 1 171 ? 10.052 25.127  4.355   1.00 78.68  ? 1041 SER A HA    1 
ATOM   2330 H  HB2   . SER A 1 171 ? 8.420  24.217  3.113   1.00 81.50  ? 1041 SER A HB2   1 
ATOM   2331 H  HB3   . SER A 1 171 ? 9.735  23.800  2.330   1.00 81.50  ? 1041 SER A HB3   1 
ATOM   2332 H  HG    . SER A 1 171 ? 9.173  21.998  3.951   1.00 89.63  ? 1041 SER A HG    1 
ATOM   2333 N  N     . SER A 1 172 ? 9.979  22.468  6.079   1.00 38.74  ? 1042 SER A N     1 
ATOM   2334 C  CA    . SER A 1 172 ? 9.567  21.903  7.355   1.00 42.22  ? 1042 SER A CA    1 
ATOM   2335 C  C     . SER A 1 172 ? 9.936  22.873  8.464   1.00 49.55  ? 1042 SER A C     1 
ATOM   2336 O  O     . SER A 1 172 ? 9.162  23.096  9.396   1.00 50.55  ? 1042 SER A O     1 
ATOM   2337 C  CB    . SER A 1 172 ? 10.260 20.561  7.589   1.00 55.94  ? 1042 SER A CB    1 
ATOM   2338 O  OG    . SER A 1 172 ? 10.100 20.124  8.930   1.00 54.33  ? 1042 SER A OG    1 
ATOM   2339 H  H     . SER A 1 172 ? 10.545 21.984  5.649   1.00 46.43  ? 1042 SER A H     1 
ATOM   2340 H  HA    . SER A 1 172 ? 8.597  21.766  7.362   1.00 50.60  ? 1042 SER A HA    1 
ATOM   2341 H  HB2   . SER A 1 172 ? 9.872  19.899  6.995   1.00 67.08  ? 1042 SER A HB2   1 
ATOM   2342 H  HB3   . SER A 1 172 ? 11.206 20.658  7.401   1.00 67.08  ? 1042 SER A HB3   1 
ATOM   2343 H  HG    . SER A 1 172 ? 10.477 19.404  9.038   1.00 65.14  ? 1042 SER A HG    1 
ATOM   2344 N  N     . PHE A 1 173 ? 11.124 23.455  8.350   1.00 35.05  ? 1043 PHE A N     1 
ATOM   2345 C  CA    . PHE A 1 173 ? 11.615 24.394  9.346   1.00 50.91  ? 1043 PHE A CA    1 
ATOM   2346 C  C     . PHE A 1 173 ? 10.837 25.707  9.323   1.00 71.91  ? 1043 PHE A C     1 
ATOM   2347 O  O     . PHE A 1 173 ? 10.440 26.217  10.369  1.00 63.36  ? 1043 PHE A O     1 
ATOM   2348 C  CB    . PHE A 1 173 ? 13.100 24.676  9.132   1.00 42.54  ? 1043 PHE A CB    1 
ATOM   2349 C  CG    . PHE A 1 173 ? 13.636 25.760  10.016  1.00 59.29  ? 1043 PHE A CG    1 
ATOM   2350 C  CD1   . PHE A 1 173 ? 13.706 25.579  11.387  1.00 68.32  ? 1043 PHE A CD1   1 
ATOM   2351 C  CD2   . PHE A 1 173 ? 14.061 26.964  9.481   1.00 71.16  ? 1043 PHE A CD2   1 
ATOM   2352 C  CE1   . PHE A 1 173 ? 14.193 26.577  12.208  1.00 73.56  ? 1043 PHE A CE1   1 
ATOM   2353 C  CE2   . PHE A 1 173 ? 14.552 27.966  10.297  1.00 75.08  ? 1043 PHE A CE2   1 
ATOM   2354 C  CZ    . PHE A 1 173 ? 14.618 27.772  11.662  1.00 71.38  ? 1043 PHE A CZ    1 
ATOM   2355 H  H     . PHE A 1 173 ? 11.669 23.320  7.698   1.00 42.00  ? 1043 PHE A H     1 
ATOM   2356 H  HA    . PHE A 1 173 ? 11.509 23.997  10.236  1.00 61.04  ? 1043 PHE A HA    1 
ATOM   2357 H  HB2   . PHE A 1 173 ? 13.602 23.866  9.317   1.00 51.00  ? 1043 PHE A HB2   1 
ATOM   2358 H  HB3   . PHE A 1 173 ? 13.238 24.947  8.211   1.00 51.00  ? 1043 PHE A HB3   1 
ATOM   2359 H  HD1   . PHE A 1 173 ? 13.421 24.775  11.759  1.00 81.93  ? 1043 PHE A HD1   1 
ATOM   2360 H  HD2   . PHE A 1 173 ? 14.018 27.099  8.562   1.00 85.33  ? 1043 PHE A HD2   1 
ATOM   2361 H  HE1   . PHE A 1 173 ? 14.238 26.443  13.127  1.00 88.22  ? 1043 PHE A HE1   1 
ATOM   2362 H  HE2   . PHE A 1 173 ? 14.836 28.771  9.927   1.00 90.04  ? 1043 PHE A HE2   1 
ATOM   2363 H  HZ    . PHE A 1 173 ? 14.947 28.445  12.213  1.00 85.59  ? 1043 PHE A HZ    1 
ATOM   2364 N  N     . GLN A 1 174 ? 10.630 26.260  8.132   1.00 64.80  ? 1044 GLN A N     1 
ATOM   2365 C  CA    . GLN A 1 174 ? 9.879  27.505  7.997   1.00 76.68  ? 1044 GLN A CA    1 
ATOM   2366 C  C     . GLN A 1 174 ? 8.474  27.336  8.565   1.00 78.01  ? 1044 GLN A C     1 
ATOM   2367 O  O     . GLN A 1 174 ? 7.932  28.241  9.197   1.00 81.81  ? 1044 GLN A O     1 
ATOM   2368 C  CB    . GLN A 1 174 ? 9.810  27.935  6.531   1.00 74.28  ? 1044 GLN A CB    1 
ATOM   2369 C  CG    . GLN A 1 174 ? 11.142 28.400  5.964   1.00 72.70  ? 1044 GLN A CG    1 
ATOM   2370 C  CD    . GLN A 1 174 ? 11.717 29.577  6.727   1.00 82.64  ? 1044 GLN A CD    1 
ATOM   2371 O  OE1   . GLN A 1 174 ? 11.012 30.542  7.022   1.00 87.10  ? 1044 GLN A OE1   1 
ATOM   2372 N  NE2   . GLN A 1 174 ? 13.000 29.500  7.060   1.00 73.83  ? 1044 GLN A NE2   1 
ATOM   2373 H  H     . GLN A 1 174 ? 10.912 25.936  7.387   1.00 77.70  ? 1044 GLN A H     1 
ATOM   2374 H  HA    . GLN A 1 174 ? 10.332 28.211  8.504   1.00 91.95  ? 1044 GLN A HA    1 
ATOM   2375 H  HB2   . GLN A 1 174 ? 9.507  27.182  5.999   1.00 89.07  ? 1044 GLN A HB2   1 
ATOM   2376 H  HB3   . GLN A 1 174 ? 9.181  28.669  6.450   1.00 89.07  ? 1044 GLN A HB3   1 
ATOM   2377 H  HG2   . GLN A 1 174 ? 11.779 27.670  6.012   1.00 87.18  ? 1044 GLN A HG2   1 
ATOM   2378 H  HG3   . GLN A 1 174 ? 11.016 28.671  5.041   1.00 87.18  ? 1044 GLN A HG3   1 
ATOM   2379 H  HE21  . GLN A 1 174 ? 13.372 30.143  7.493   1.00 88.55  ? 1044 GLN A HE21  1 
ATOM   2380 H  HE22  . GLN A 1 174 ? 13.460 28.806  6.842   1.00 88.55  ? 1044 GLN A HE22  1 
ATOM   2381 N  N     . GLU A 1 175 ? 7.899  26.160  8.341   1.00 75.00  ? 1045 GLU A N     1 
ATOM   2382 C  CA    . GLU A 1 175 ? 6.571  25.834  8.841   1.00 85.79  ? 1045 GLU A CA    1 
ATOM   2383 C  C     . GLU A 1 175 ? 6.543  25.857  10.364  1.00 92.52  ? 1045 GLU A C     1 
ATOM   2384 O  O     . GLU A 1 175 ? 5.529  26.209  10.967  1.00 99.10  ? 1045 GLU A O     1 
ATOM   2385 C  CB    . GLU A 1 175 ? 6.151  24.452  8.340   1.00 89.44  ? 1045 GLU A CB    1 
ATOM   2386 C  CG    . GLU A 1 175 ? 4.807  23.977  8.866   1.00 101.58 ? 1045 GLU A CG    1 
ATOM   2387 C  CD    . GLU A 1 175 ? 4.598  22.488  8.669   1.00 114.32 ? 1045 GLU A CD    1 
ATOM   2388 O  OE1   . GLU A 1 175 ? 4.801  21.724  9.637   1.00 114.45 ? 1045 GLU A OE1   1 
ATOM   2389 O  OE2   . GLU A 1 175 ? 4.233  22.078  7.549   1.00 115.19 ? 1045 GLU A OE2   1 
ATOM   2390 H  H     . GLU A 1 175 ? 8.265  25.523  7.894   1.00 89.95  ? 1045 GLU A H     1 
ATOM   2391 H  HA    . GLU A 1 175 ? 5.927  26.493  8.509   1.00 102.89 ? 1045 GLU A HA    1 
ATOM   2392 H  HB2   . GLU A 1 175 ? 6.097  24.475  7.371   1.00 107.27 ? 1045 GLU A HB2   1 
ATOM   2393 H  HB3   . GLU A 1 175 ? 6.820  23.805  8.614   1.00 107.27 ? 1045 GLU A HB3   1 
ATOM   2394 H  HG2   . GLU A 1 175 ? 4.754  24.165  9.816   1.00 121.84 ? 1045 GLU A HG2   1 
ATOM   2395 H  HG3   . GLU A 1 175 ? 4.099  24.445  8.395   1.00 121.84 ? 1045 GLU A HG3   1 
ATOM   2396 N  N     . SER A 1 176 ? 7.655  25.476  10.985  1.00 76.14  ? 1046 SER A N     1 
ATOM   2397 C  CA    . SER A 1 176 ? 7.735  25.429  12.439  1.00 86.10  ? 1046 SER A CA    1 
ATOM   2398 C  C     . SER A 1 176 ? 7.802  26.833  13.035  1.00 92.85  ? 1046 SER A C     1 
ATOM   2399 O  O     . SER A 1 176 ? 7.298  27.068  14.133  1.00 92.70  ? 1046 SER A O     1 
ATOM   2400 C  CB    . SER A 1 176 ? 8.950  24.615  12.886  1.00 77.20  ? 1046 SER A CB    1 
ATOM   2401 O  OG    . SER A 1 176 ? 10.135 25.388  12.823  1.00 75.71  ? 1046 SER A OG    1 
ATOM   2402 H  H     . SER A 1 176 ? 8.379  25.240  10.584  1.00 91.31  ? 1046 SER A H     1 
ATOM   2403 H  HA    . SER A 1 176 ? 6.932  24.990  12.788  1.00 103.26 ? 1046 SER A HA    1 
ATOM   2404 H  HB2   . SER A 1 176 ? 8.813  24.322  13.801  1.00 92.58  ? 1046 SER A HB2   1 
ATOM   2405 H  HB3   . SER A 1 176 ? 9.045  23.845  12.304  1.00 92.58  ? 1046 SER A HB3   1 
ATOM   2406 H  HG    . SER A 1 176 ? 10.777 24.938  13.066  1.00 90.80  ? 1046 SER A HG    1 
ATOM   2407 N  N     . LEU A 1 177 ? 8.424  27.763  12.315  1.00 84.23  ? 1047 LEU A N     1 
ATOM   2408 C  CA    . LEU A 1 177 ? 8.472  29.154  12.753  1.00 93.98  ? 1047 LEU A CA    1 
ATOM   2409 C  C     . LEU A 1 177 ? 7.060  29.732  12.813  1.00 106.70 ? 1047 LEU A C     1 
ATOM   2410 O  O     . LEU A 1 177 ? 6.836  30.807  13.371  1.00 104.58 ? 1047 LEU A O     1 
ATOM   2411 C  CB    . LEU A 1 177 ? 9.336  29.996  11.810  1.00 88.46  ? 1047 LEU A CB    1 
ATOM   2412 C  CG    . LEU A 1 177 ? 10.809 29.605  11.678  1.00 88.12  ? 1047 LEU A CG    1 
ATOM   2413 C  CD1   . LEU A 1 177 ? 11.623 30.798  11.200  1.00 85.96  ? 1047 LEU A CD1   1 
ATOM   2414 C  CD2   . LEU A 1 177 ? 11.357 29.087  12.996  1.00 84.20  ? 1047 LEU A CD2   1 
ATOM   2415 H  H     . LEU A 1 177 ? 8.825  27.614  11.569  1.00 101.02 ? 1047 LEU A H     1 
ATOM   2416 H  HA    . LEU A 1 177 ? 8.862  29.199  13.651  1.00 112.72 ? 1047 LEU A HA    1 
ATOM   2417 H  HB2   . LEU A 1 177 ? 8.947  29.946  10.922  1.00 106.10 ? 1047 LEU A HB2   1 
ATOM   2418 H  HB3   . LEU A 1 177 ? 9.311  30.915  12.118  1.00 106.10 ? 1047 LEU A HB3   1 
ATOM   2419 H  HG    . LEU A 1 177 ? 10.893 28.899  11.019  1.00 105.69 ? 1047 LEU A HG    1 
ATOM   2420 H  HD11  . LEU A 1 177 ? 11.290 31.080  10.345  1.00 103.10 ? 1047 LEU A HD11  1 
ATOM   2421 H  HD12  . LEU A 1 177 ? 11.537 31.510  11.838  1.00 103.10 ? 1047 LEU A HD12  1 
ATOM   2422 H  HD13  . LEU A 1 177 ? 12.544 30.536  11.123  1.00 103.10 ? 1047 LEU A HD13  1 
ATOM   2423 H  HD21  . LEU A 1 177 ? 12.281 28.851  12.879  1.00 100.99 ? 1047 LEU A HD21  1 
ATOM   2424 H  HD22  . LEU A 1 177 ? 11.276 29.775  13.660  1.00 100.99 ? 1047 LEU A HD22  1 
ATOM   2425 H  HD23  . LEU A 1 177 ? 10.853 28.314  13.262  1.00 100.99 ? 1047 LEU A HD23  1 
ATOM   2426 N  N     . ARG A 1 178 ? 6.114  29.004  12.231  1.00 110.16 ? 1048 ARG A N     1 
ATOM   2427 C  CA    . ARG A 1 178 ? 4.721  29.424  12.189  1.00 113.75 ? 1048 ARG A CA    1 
ATOM   2428 C  C     . ARG A 1 178 ? 3.847  28.473  13.001  1.00 111.46 ? 1048 ARG A C     1 
ATOM   2429 O  O     . ARG A 1 178 ? 4.172  28.130  14.139  1.00 98.29  ? 1048 ARG A O     1 
ATOM   2430 C  CB    . ARG A 1 178 ? 4.247  29.467  10.737  1.00 119.60 ? 1048 ARG A CB    1 
ATOM   2431 C  CG    . ARG A 1 178 ? 2.742  29.538  10.558  1.00 130.51 ? 1048 ARG A CG    1 
ATOM   2432 C  CD    . ARG A 1 178 ? 2.338  29.028  9.186   1.00 135.57 ? 1048 ARG A CD    1 
ATOM   2433 N  NE    . ARG A 1 178 ? 2.309  27.566  9.134   1.00 135.15 ? 1048 ARG A NE    1 
ATOM   2434 C  CZ    . ARG A 1 178 ? 1.287  26.844  8.679   1.00 136.90 ? 1048 ARG A CZ    1 
ATOM   2435 N  NH1   . ARG A 1 178 ? 0.192  27.436  8.217   1.00 139.55 ? 1048 ARG A NH1   1 
ATOM   2436 N  NH2   . ARG A 1 178 ? 1.362  25.520  8.680   1.00 128.18 ? 1048 ARG A NH2   1 
ATOM   2437 H  H     . ARG A 1 178 ? 6.258  28.249  11.845  1.00 132.14 ? 1048 ARG A H     1 
ATOM   2438 H  HA    . ARG A 1 178 ? 4.639  30.324  12.570  1.00 136.44 ? 1048 ARG A HA    1 
ATOM   2439 H  HB2   . ARG A 1 178 ? 4.630  30.249  10.309  1.00 143.47 ? 1048 ARG A HB2   1 
ATOM   2440 H  HB3   . ARG A 1 178 ? 4.558  28.666  10.287  1.00 143.47 ? 1048 ARG A HB3   1 
ATOM   2441 H  HG2   . ARG A 1 178 ? 2.311  28.985  11.229  1.00 156.55 ? 1048 ARG A HG2   1 
ATOM   2442 H  HG3   . ARG A 1 178 ? 2.450  30.459  10.640  1.00 156.55 ? 1048 ARG A HG3   1 
ATOM   2443 H  HD2   . ARG A 1 178 ? 1.451  29.356  8.972   1.00 162.62 ? 1048 ARG A HD2   1 
ATOM   2444 H  HD3   . ARG A 1 178 ? 2.979  29.341  8.528   1.00 162.62 ? 1048 ARG A HD3   1 
ATOM   2445 H  HE    . ARG A 1 178 ? 3.002  27.143  9.419   1.00 162.13 ? 1048 ARG A HE    1 
ATOM   2446 H  HH11  . ARG A 1 178 ? 0.136  28.294  8.214   1.00 167.41 ? 1048 ARG A HH11  1 
ATOM   2447 H  HH12  . ARG A 1 178 ? -0.462 26.961  7.924   1.00 167.41 ? 1048 ARG A HH12  1 
ATOM   2448 H  HH21  . ARG A 1 178 ? 2.069  25.130  8.976   1.00 153.76 ? 1048 ARG A HH21  1 
ATOM   2449 H  HH22  . ARG A 1 178 ? 0.704  25.052  8.384   1.00 153.76 ? 1048 ARG A HH22  1 
ATOM   2450 N  N     . PRO A 1 208 ? -2.773 9.739   15.902  1.00 90.46  ? 1078 PRO A N     1 
ATOM   2451 C  CA    . PRO A 1 208 ? -2.857 11.149  15.521  1.00 92.84  ? 1078 PRO A CA    1 
ATOM   2452 C  C     . PRO A 1 208 ? -1.478 11.794  15.401  1.00 92.20  ? 1078 PRO A C     1 
ATOM   2453 O  O     . PRO A 1 208 ? -1.280 12.920  15.859  1.00 91.91  ? 1078 PRO A O     1 
ATOM   2454 C  CB    . PRO A 1 208 ? -3.638 11.764  16.685  1.00 99.36  ? 1078 PRO A CB    1 
ATOM   2455 C  CG    . PRO A 1 208 ? -3.354 10.854  17.878  1.00 95.30  ? 1078 PRO A CG    1 
ATOM   2456 C  CD    . PRO A 1 208 ? -2.702 9.588   17.364  1.00 85.44  ? 1078 PRO A CD    1 
ATOM   2457 H  HA    . PRO A 1 208 ? -3.356 11.259  14.685  1.00 111.35 ? 1078 PRO A HA    1 
ATOM   2458 H  HB2   . PRO A 1 208 ? -3.318 12.664  16.855  1.00 119.18 ? 1078 PRO A HB2   1 
ATOM   2459 H  HB3   . PRO A 1 208 ? -4.585 11.770  16.476  1.00 119.18 ? 1078 PRO A HB3   1 
ATOM   2460 H  HG2   . PRO A 1 208 ? -2.757 11.312  18.491  1.00 114.30 ? 1078 PRO A HG2   1 
ATOM   2461 H  HG3   . PRO A 1 208 ? -4.190 10.642  18.322  1.00 114.30 ? 1078 PRO A HG3   1 
ATOM   2462 H  HD2   . PRO A 1 208 ? -1.777 9.541   17.655  1.00 102.47 ? 1078 PRO A HD2   1 
ATOM   2463 H  HD3   . PRO A 1 208 ? -3.204 8.809   17.649  1.00 102.47 ? 1078 PRO A HD3   1 
ATOM   2464 N  N     . PHE A 1 209 ? -0.536 11.083  14.789  1.00 80.34  ? 1079 PHE A N     1 
ATOM   2465 C  CA    . PHE A 1 209 ? 0.820  11.593  14.622  1.00 74.58  ? 1079 PHE A CA    1 
ATOM   2466 C  C     . PHE A 1 209 ? 1.021  12.153  13.219  1.00 73.22  ? 1079 PHE A C     1 
ATOM   2467 O  O     . PHE A 1 209 ? 0.487  11.621  12.246  1.00 69.08  ? 1079 PHE A O     1 
ATOM   2468 C  CB    . PHE A 1 209 ? 1.845  10.486  14.881  1.00 65.87  ? 1079 PHE A CB    1 
ATOM   2469 C  CG    . PHE A 1 209 ? 1.728  9.852   16.238  1.00 59.43  ? 1079 PHE A CG    1 
ATOM   2470 C  CD1   . PHE A 1 209 ? 1.976  10.586  17.385  1.00 57.76  ? 1079 PHE A CD1   1 
ATOM   2471 C  CD2   . PHE A 1 209 ? 1.383  8.517   16.364  1.00 54.47  ? 1079 PHE A CD2   1 
ATOM   2472 C  CE1   . PHE A 1 209 ? 1.871  10.003  18.633  1.00 59.93  ? 1079 PHE A CE1   1 
ATOM   2473 C  CE2   . PHE A 1 209 ? 1.279  7.928   17.609  1.00 60.76  ? 1079 PHE A CE2   1 
ATOM   2474 C  CZ    . PHE A 1 209 ? 1.523  8.672   18.744  1.00 56.75  ? 1079 PHE A CZ    1 
ATOM   2475 H  H     . PHE A 1 209 ? -0.658 10.297  14.460  1.00 96.35  ? 1079 PHE A H     1 
ATOM   2476 H  HA    . PHE A 1 209 ? 0.976  12.314  15.267  1.00 89.44  ? 1079 PHE A HA    1 
ATOM   2477 H  HB2   . PHE A 1 209 ? 1.727  9.789   14.216  1.00 78.99  ? 1079 PHE A HB2   1 
ATOM   2478 H  HB3   . PHE A 1 209 ? 2.736  10.863  14.806  1.00 78.99  ? 1079 PHE A HB3   1 
ATOM   2479 H  HD1   . PHE A 1 209 ? 2.210  11.483  17.315  1.00 69.26  ? 1079 PHE A HD1   1 
ATOM   2480 H  HD2   . PHE A 1 209 ? 1.216  8.011   15.602  1.00 65.31  ? 1079 PHE A HD2   1 
ATOM   2481 H  HE1   . PHE A 1 209 ? 2.037  10.506  19.397  1.00 71.87  ? 1079 PHE A HE1   1 
ATOM   2482 H  HE2   . PHE A 1 209 ? 1.043  7.031   17.681  1.00 72.86  ? 1079 PHE A HE2   1 
ATOM   2483 H  HZ    . PHE A 1 209 ? 1.453  8.277   19.584  1.00 68.04  ? 1079 PHE A HZ    1 
ATOM   2484 N  N     . LYS A 1 210 ? 1.792  13.231  13.121  1.00 58.06  ? 1080 LYS A N     1 
ATOM   2485 C  CA    . LYS A 1 210 ? 2.116  13.822  11.829  1.00 65.01  ? 1080 LYS A CA    1 
ATOM   2486 C  C     . LYS A 1 210 ? 3.201  12.994  11.147  1.00 57.48  ? 1080 LYS A C     1 
ATOM   2487 O  O     . LYS A 1 210 ? 4.077  12.444  11.807  1.00 56.44  ? 1080 LYS A O     1 
ATOM   2488 C  CB    . LYS A 1 210 ? 2.572  15.274  12.007  1.00 74.37  ? 1080 LYS A CB    1 
ATOM   2489 C  CG    . LYS A 1 210 ? 3.965  15.578  11.474  1.00 87.57  ? 1080 LYS A CG    1 
ATOM   2490 C  CD    . LYS A 1 210 ? 4.391  16.997  11.831  1.00 98.18  ? 1080 LYS A CD    1 
ATOM   2491 C  CE    . LYS A 1 210 ? 4.135  17.977  10.696  1.00 96.07  ? 1080 LYS A CE    1 
ATOM   2492 N  NZ    . LYS A 1 210 ? 5.382  18.302  9.948   1.00 94.38  ? 1080 LYS A NZ    1 
ATOM   2493 H  H     . LYS A 1 210 ? 2.141  13.641  13.792  1.00 69.62  ? 1080 LYS A H     1 
ATOM   2494 H  HA    . LYS A 1 210 ? 1.319  13.816  11.260  1.00 77.95  ? 1080 LYS A HA    1 
ATOM   2495 H  HB2   . LYS A 1 210 ? 1.948  15.853  11.542  1.00 89.19  ? 1080 LYS A HB2   1 
ATOM   2496 H  HB3   . LYS A 1 210 ? 2.568  15.485  12.954  1.00 89.19  ? 1080 LYS A HB3   1 
ATOM   2497 H  HG2   . LYS A 1 210 ? 4.602  14.960  11.867  1.00 105.03 ? 1080 LYS A HG2   1 
ATOM   2498 H  HG3   . LYS A 1 210 ? 3.965  15.492  10.508  1.00 105.03 ? 1080 LYS A HG3   1 
ATOM   2499 H  HD2   . LYS A 1 210 ? 3.889  17.295  12.605  1.00 117.76 ? 1080 LYS A HD2   1 
ATOM   2500 H  HD3   . LYS A 1 210 ? 5.341  17.005  12.027  1.00 117.76 ? 1080 LYS A HD3   1 
ATOM   2501 H  HE2   . LYS A 1 210 ? 3.502  17.585  10.073  1.00 115.23 ? 1080 LYS A HE2   1 
ATOM   2502 H  HE3   . LYS A 1 210 ? 3.777  18.801  11.061  1.00 115.23 ? 1080 LYS A HE3   1 
ATOM   2503 H  HZ1   . LYS A 1 210 ? 5.203  18.876  9.291   1.00 113.20 ? 1080 LYS A HZ1   1 
ATOM   2504 H  HZ2   . LYS A 1 210 ? 5.979  18.669  10.497  1.00 113.20 ? 1080 LYS A HZ2   1 
ATOM   2505 H  HZ3   . LYS A 1 210 ? 5.729  17.561  9.598   1.00 113.20 ? 1080 LYS A HZ3   1 
ATOM   2506 N  N     . THR A 1 211 ? 3.135  12.900  9.825   1.00 53.03  ? 1081 THR A N     1 
ATOM   2507 C  CA    . THR A 1 211 ? 4.115  12.136  9.062   1.00 44.47  ? 1081 THR A CA    1 
ATOM   2508 C  C     . THR A 1 211 ? 5.334  12.990  8.717   1.00 49.63  ? 1081 THR A C     1 
ATOM   2509 O  O     . THR A 1 211 ? 5.197  14.141  8.308   1.00 46.70  ? 1081 THR A O     1 
ATOM   2510 C  CB    . THR A 1 211 ? 3.490  11.586  7.764   1.00 55.88  ? 1081 THR A CB    1 
ATOM   2511 O  OG1   . THR A 1 211 ? 2.901  10.306  8.021   1.00 60.22  ? 1081 THR A OG1   1 
ATOM   2512 C  CG2   . THR A 1 211 ? 4.538  11.443  6.672   1.00 51.97  ? 1081 THR A CG2   1 
ATOM   2513 H  H     . THR A 1 211 ? 2.527  13.271  9.342   1.00 63.58  ? 1081 THR A H     1 
ATOM   2514 H  HA    . THR A 1 211 ? 4.418  11.375  9.600   1.00 53.31  ? 1081 THR A HA    1 
ATOM   2515 H  HB    . THR A 1 211 ? 2.805  12.198  7.452   1.00 67.00  ? 1081 THR A HB    1 
ATOM   2516 H  HG1   . THR A 1 211 ? 2.318  10.374  8.593   1.00 72.21  ? 1081 THR A HG1   1 
ATOM   2517 H  HG21  . THR A 1 211 ? 4.133  11.100  5.872   1.00 62.30  ? 1081 THR A HG21  1 
ATOM   2518 H  HG22  . THR A 1 211 ? 4.931  12.297  6.481   1.00 62.30  ? 1081 THR A HG22  1 
ATOM   2519 H  HG23  . THR A 1 211 ? 5.227  10.838  6.957   1.00 62.30  ? 1081 THR A HG23  1 
ATOM   2520 N  N     . ILE A 1 212 ? 6.525  12.421  8.889   1.00 41.36  ? 1082 ILE A N     1 
ATOM   2521 C  CA    . ILE A 1 212 ? 7.763  13.109  8.542   1.00 28.36  ? 1082 ILE A CA    1 
ATOM   2522 C  C     . ILE A 1 212 ? 8.629  12.238  7.644   1.00 33.70  ? 1082 ILE A C     1 
ATOM   2523 O  O     . ILE A 1 212 ? 8.391  11.039  7.508   1.00 36.94  ? 1082 ILE A O     1 
ATOM   2524 C  CB    . ILE A 1 212 ? 8.584  13.484  9.791   1.00 34.75  ? 1082 ILE A CB    1 
ATOM   2525 C  CG1   . ILE A 1 212 ? 8.909  12.236  10.612  1.00 38.81  ? 1082 ILE A CG1   1 
ATOM   2526 C  CG2   . ILE A 1 212 ? 7.832  14.493  10.635  1.00 40.21  ? 1082 ILE A CG2   1 
ATOM   2527 C  CD1   . ILE A 1 212 ? 9.967  12.468  11.666  1.00 33.86  ? 1082 ILE A CD1   1 
ATOM   2528 H  H     . ILE A 1 212 ? 6.642  11.631  9.207   1.00 49.58  ? 1082 ILE A H     1 
ATOM   2529 H  HA    . ILE A 1 212 ? 7.548  13.933  8.057   1.00 33.97  ? 1082 ILE A HA    1 
ATOM   2530 H  HB    . ILE A 1 212 ? 9.417  13.887  9.500   1.00 41.64  ? 1082 ILE A HB    1 
ATOM   2531 H  HG12  . ILE A 1 212 ? 8.103  11.937  11.061  1.00 46.52  ? 1082 ILE A HG12  1 
ATOM   2532 H  HG13  . ILE A 1 212 ? 9.231  11.543  10.015  1.00 46.52  ? 1082 ILE A HG13  1 
ATOM   2533 H  HG21  . ILE A 1 212 ? 8.361  14.712  11.405  1.00 48.19  ? 1082 ILE A HG21  1 
ATOM   2534 H  HG22  . ILE A 1 212 ? 7.674  15.282  10.111  1.00 48.19  ? 1082 ILE A HG22  1 
ATOM   2535 H  HG23  . ILE A 1 212 ? 6.996  14.109  10.909  1.00 48.19  ? 1082 ILE A HG23  1 
ATOM   2536 H  HD11  . ILE A 1 212 ? 10.120 11.647  12.140  1.00 40.58  ? 1082 ILE A HD11  1 
ATOM   2537 H  HD12  . ILE A 1 212 ? 10.777 12.754  11.237  1.00 40.58  ? 1082 ILE A HD12  1 
ATOM   2538 H  HD13  . ILE A 1 212 ? 9.660  13.145  12.273  1.00 40.58  ? 1082 ILE A HD13  1 
ATOM   2539 N  N     . LYS A 1 213 ? 9.639  12.849  7.036   1.00 35.19  ? 1083 LYS A N     1 
ATOM   2540 C  CA    . LYS A 1 213 ? 10.534 12.131  6.142   1.00 30.37  ? 1083 LYS A CA    1 
ATOM   2541 C  C     . LYS A 1 213 ? 11.988 12.386  6.519   1.00 39.18  ? 1083 LYS A C     1 
ATOM   2542 O  O     . LYS A 1 213 ? 12.375 13.506  6.853   1.00 32.81  ? 1083 LYS A O     1 
ATOM   2543 C  CB    . LYS A 1 213 ? 10.273 12.521  4.687   1.00 27.50  ? 1083 LYS A CB    1 
ATOM   2544 C  CG    . LYS A 1 213 ? 8.878  12.150  4.208   1.00 42.04  ? 1083 LYS A CG    1 
ATOM   2545 C  CD    . LYS A 1 213 ? 8.630  12.582  2.774   1.00 55.20  ? 1083 LYS A CD    1 
ATOM   2546 C  CE    . LYS A 1 213 ? 8.668  14.093  2.635   1.00 68.30  ? 1083 LYS A CE    1 
ATOM   2547 N  NZ    . LYS A 1 213 ? 8.252  14.546  1.280   1.00 73.15  ? 1083 LYS A NZ    1 
ATOM   2548 H  H     . LYS A 1 213 ? 9.827  13.684  7.125   1.00 42.18  ? 1083 LYS A H     1 
ATOM   2549 H  HA    . LYS A 1 213 ? 10.366 11.170  6.230   1.00 36.38  ? 1083 LYS A HA    1 
ATOM   2550 H  HB2   . LYS A 1 213 ? 10.374 13.481  4.596   1.00 32.95  ? 1083 LYS A HB2   1 
ATOM   2551 H  HB3   . LYS A 1 213 ? 10.914 12.065  4.119   1.00 32.95  ? 1083 LYS A HB3   1 
ATOM   2552 H  HG2   . LYS A 1 213 ? 8.771  11.187  4.256   1.00 50.39  ? 1083 LYS A HG2   1 
ATOM   2553 H  HG3   . LYS A 1 213 ? 8.221  12.587  4.772   1.00 50.39  ? 1083 LYS A HG3   1 
ATOM   2554 H  HD2   . LYS A 1 213 ? 9.318  12.206  2.202   1.00 66.18  ? 1083 LYS A HD2   1 
ATOM   2555 H  HD3   . LYS A 1 213 ? 7.754  12.272  2.493   1.00 66.18  ? 1083 LYS A HD3   1 
ATOM   2556 H  HE2   . LYS A 1 213 ? 8.063  14.487  3.283   1.00 81.90  ? 1083 LYS A HE2   1 
ATOM   2557 H  HE3   . LYS A 1 213 ? 9.573  14.404  2.792   1.00 81.90  ? 1083 LYS A HE3   1 
ATOM   2558 H  HZ1   . LYS A 1 213 ? 8.796  14.202  0.665   1.00 87.73  ? 1083 LYS A HZ1   1 
ATOM   2559 H  HZ2   . LYS A 1 213 ? 7.420  14.278  1.112   1.00 87.73  ? 1083 LYS A HZ2   1 
ATOM   2560 H  HZ3   . LYS A 1 213 ? 8.286  15.434  1.232   1.00 87.73  ? 1083 LYS A HZ3   1 
ATOM   2561 N  N     . PHE A 1 214 ? 12.781 11.326  6.437   1.00 33.13  ? 1084 PHE A N     1 
ATOM   2562 C  CA    . PHE A 1 214 ? 14.143 11.300  6.950   1.00 25.92  ? 1084 PHE A CA    1 
ATOM   2563 C  C     . PHE A 1 214 ? 15.072 10.907  5.803   1.00 29.43  ? 1084 PHE A C     1 
ATOM   2564 O  O     . PHE A 1 214 ? 14.965 9.811   5.261   1.00 26.34  ? 1084 PHE A O     1 
ATOM   2565 C  CB    . PHE A 1 214 ? 14.197 10.285  8.104   1.00 27.67  ? 1084 PHE A CB    1 
ATOM   2566 C  CG    . PHE A 1 214 ? 15.582 9.987   8.632   1.00 28.39  ? 1084 PHE A CG    1 
ATOM   2567 C  CD1   . PHE A 1 214 ? 16.669 10.800  8.342   1.00 23.39  ? 1084 PHE A CD1   1 
ATOM   2568 C  CD2   . PHE A 1 214 ? 15.784 8.869   9.438   1.00 27.48  ? 1084 PHE A CD2   1 
ATOM   2569 C  CE1   . PHE A 1 214 ? 17.936 10.500  8.849   1.00 26.10  ? 1084 PHE A CE1   1 
ATOM   2570 C  CE2   . PHE A 1 214 ? 17.041 8.565   9.943   1.00 26.79  ? 1084 PHE A CE2   1 
ATOM   2571 C  CZ    . PHE A 1 214 ? 18.117 9.379   9.648   1.00 26.37  ? 1084 PHE A CZ    1 
ATOM   2572 H  H     . PHE A 1 214 ? 12.543 10.583  6.075   1.00 39.70  ? 1084 PHE A H     1 
ATOM   2573 H  HA    . PHE A 1 214 ? 14.397 12.186  7.284   1.00 31.05  ? 1084 PHE A HA    1 
ATOM   2574 H  HB2   . PHE A 1 214 ? 13.671 10.630  8.842   1.00 33.15  ? 1084 PHE A HB2   1 
ATOM   2575 H  HB3   . PHE A 1 214 ? 13.815 9.448   7.796   1.00 33.15  ? 1084 PHE A HB3   1 
ATOM   2576 H  HD1   . PHE A 1 214 ? 16.553 11.552  7.806   1.00 28.01  ? 1084 PHE A HD1   1 
ATOM   2577 H  HD2   . PHE A 1 214 ? 15.064 8.317   9.641   1.00 32.92  ? 1084 PHE A HD2   1 
ATOM   2578 H  HE1   . PHE A 1 214 ? 18.658 11.049  8.648   1.00 31.26  ? 1084 PHE A HE1   1 
ATOM   2579 H  HE2   . PHE A 1 214 ? 17.158 7.814   10.479  1.00 32.10  ? 1084 PHE A HE2   1 
ATOM   2580 H  HZ    . PHE A 1 214 ? 18.961 9.179   9.985   1.00 31.59  ? 1084 PHE A HZ    1 
ATOM   2581 N  N     . GLY A 1 215 ? 15.957 11.818  5.409   1.00 25.23  ? 1085 GLY A N     1 
ATOM   2582 C  CA    . GLY A 1 215 ? 16.938 11.531  4.375   1.00 24.33  ? 1085 GLY A CA    1 
ATOM   2583 C  C     . GLY A 1 215 ? 18.112 10.753  4.939   1.00 27.23  ? 1085 GLY A C     1 
ATOM   2584 O  O     . GLY A 1 215 ? 18.833 11.243  5.795   1.00 26.21  ? 1085 GLY A O     1 
ATOM   2585 H  H     . GLY A 1 215 ? 16.007 12.615  5.728   1.00 30.22  ? 1085 GLY A H     1 
ATOM   2586 H  HA2   . GLY A 1 215 ? 16.527 11.008  3.669   1.00 29.14  ? 1085 GLY A HA2   1 
ATOM   2587 H  HA3   . GLY A 1 215 ? 17.267 12.361  3.996   1.00 29.14  ? 1085 GLY A HA3   1 
ATOM   2588 N  N     . THR A 1 216 ? 18.325 9.540   4.449   1.00 27.94  ? 1086 THR A N     1 
ATOM   2589 C  CA    . THR A 1 216 ? 19.289 8.650   5.076   1.00 23.13  ? 1086 THR A CA    1 
ATOM   2590 C  C     . THR A 1 216 ? 20.186 7.959   4.054   1.00 30.43  ? 1086 THR A C     1 
ATOM   2591 O  O     . THR A 1 216 ? 19.861 7.886   2.870   1.00 34.17  ? 1086 THR A O     1 
ATOM   2592 C  CB    . THR A 1 216 ? 18.566 7.584   5.921   1.00 31.59  ? 1086 THR A CB    1 
ATOM   2593 O  OG1   . THR A 1 216 ? 19.508 6.923   6.775   1.00 43.51  ? 1086 THR A OG1   1 
ATOM   2594 C  CG2   . THR A 1 216 ? 17.874 6.561   5.017   1.00 25.82  ? 1086 THR A CG2   1 
ATOM   2595 H  H     . THR A 1 216 ? 17.928 9.210   3.760   1.00 33.47  ? 1086 THR A H     1 
ATOM   2596 H  HA    . THR A 1 216 ? 19.862 9.173   5.676   1.00 27.70  ? 1086 THR A HA    1 
ATOM   2597 H  HB    . THR A 1 216 ? 17.889 8.014   6.465   1.00 37.85  ? 1086 THR A HB    1 
ATOM   2598 H  HG1   . THR A 1 216 ? 19.126 6.355   7.226   1.00 52.16  ? 1086 THR A HG1   1 
ATOM   2599 H  HG21  . THR A 1 216 ? 17.426 5.901   5.552   1.00 30.93  ? 1086 THR A HG21  1 
ATOM   2600 H  HG22  . THR A 1 216 ? 17.228 7.001   4.459   1.00 30.93  ? 1086 THR A HG22  1 
ATOM   2601 H  HG23  . THR A 1 216 ? 18.522 6.124   4.460   1.00 30.93  ? 1086 THR A HG23  1 
ATOM   2602 N  N     . ASN A 1 217 ? 21.326 7.469   4.523   1.00 33.92  ? 1087 ASN A N     1 
ATOM   2603 C  CA    . ASN A 1 217 ? 22.221 6.669   3.698   1.00 32.98  ? 1087 ASN A CA    1 
ATOM   2604 C  C     . ASN A 1 217 ? 22.585 7.349   2.386   1.00 38.75  ? 1087 ASN A C     1 
ATOM   2605 O  O     . ASN A 1 217 ? 22.652 6.697   1.347   1.00 44.36  ? 1087 ASN A O     1 
ATOM   2606 C  CB    . ASN A 1 217 ? 21.596 5.299   3.406   1.00 41.24  ? 1087 ASN A CB    1 
ATOM   2607 C  CG    . ASN A 1 217 ? 21.297 4.505   4.671   1.00 61.35  ? 1087 ASN A CG    1 
ATOM   2608 O  OD1   . ASN A 1 217 ? 21.838 4.785   5.739   1.00 42.91  ? 1087 ASN A OD1   1 
ATOM   2609 N  ND2   . ASN A 1 217 ? 20.437 3.500   4.549   1.00 55.67  ? 1087 ASN A ND2   1 
ATOM   2610 H  H     . ASN A 1 217 ? 21.608 7.588   5.327   1.00 40.65  ? 1087 ASN A H     1 
ATOM   2611 H  HA    . ASN A 1 217 ? 23.053 6.517   4.194   1.00 39.52  ? 1087 ASN A HA    1 
ATOM   2612 H  HB2   . ASN A 1 217 ? 20.762 5.428   2.929   1.00 49.44  ? 1087 ASN A HB2   1 
ATOM   2613 H  HB3   . ASN A 1 217 ? 22.212 4.780   2.865   1.00 49.44  ? 1087 ASN A HB3   1 
ATOM   2614 H  HD21  . ASN A 1 217 ? 20.235 3.021   5.234   1.00 66.75  ? 1087 ASN A HD21  1 
ATOM   2615 H  HD22  . ASN A 1 217 ? 20.083 3.328   3.785   1.00 66.75  ? 1087 ASN A HD22  1 
ATOM   2616 N  N     . ILE A 1 218 ? 22.819 8.657   2.434   1.00 23.72  ? 1088 ILE A N     1 
ATOM   2617 C  CA    . ILE A 1 218 ? 23.234 9.405   1.249   1.00 27.03  ? 1088 ILE A CA    1 
ATOM   2618 C  C     . ILE A 1 218 ? 24.717 9.164   0.968   1.00 33.73  ? 1088 ILE A C     1 
ATOM   2619 O  O     . ILE A 1 218 ? 25.571 9.383   1.825   1.00 23.39  ? 1088 ILE A O     1 
ATOM   2620 C  CB    . ILE A 1 218 ? 22.948 10.902  1.412   1.00 30.31  ? 1088 ILE A CB    1 
ATOM   2621 C  CG1   . ILE A 1 218 ? 21.444 11.117  1.587   1.00 29.31  ? 1088 ILE A CG1   1 
ATOM   2622 C  CG2   . ILE A 1 218 ? 23.449 11.669  0.203   1.00 28.54  ? 1088 ILE A CG2   1 
ATOM   2623 C  CD1   . ILE A 1 218 ? 21.087 12.365  2.340   1.00 27.29  ? 1088 ILE A CD1   1 
ATOM   2624 H  H     . ILE A 1 218 ? 22.745 9.138   3.143   1.00 28.41  ? 1088 ILE A H     1 
ATOM   2625 H  HA    . ILE A 1 218 ? 22.725 9.083   0.477   1.00 32.38  ? 1088 ILE A HA    1 
ATOM   2626 H  HB    . ILE A 1 218 ? 23.407 11.226  2.203   1.00 36.32  ? 1088 ILE A HB    1 
ATOM   2627 H  HG12  . ILE A 1 218 ? 21.033 11.174  0.710   1.00 35.11  ? 1088 ILE A HG12  1 
ATOM   2628 H  HG13  . ILE A 1 218 ? 21.075 10.363  2.073   1.00 35.11  ? 1088 ILE A HG13  1 
ATOM   2629 H  HG21  . ILE A 1 218 ? 24.395 11.534  0.118   1.00 34.19  ? 1088 ILE A HG21  1 
ATOM   2630 H  HG22  . ILE A 1 218 ? 23.000 11.343  -0.581  1.00 34.19  ? 1088 ILE A HG22  1 
ATOM   2631 H  HG23  . ILE A 1 218 ? 23.260 12.602  0.325   1.00 34.19  ? 1088 ILE A HG23  1 
ATOM   2632 H  HD11  . ILE A 1 218 ? 20.132 12.428  2.407   1.00 32.69  ? 1088 ILE A HD11  1 
ATOM   2633 H  HD12  . ILE A 1 218 ? 21.475 12.322  3.218   1.00 32.69  ? 1088 ILE A HD12  1 
ATOM   2634 H  HD13  . ILE A 1 218 ? 21.433 13.125  1.867   1.00 32.69  ? 1088 ILE A HD13  1 
ATOM   2635 N  N     . ASP A 1 219 ? 25.008 8.710   -0.246  1.00 28.95  ? 1089 ASP A N     1 
ATOM   2636 C  CA    . ASP A 1 219 ? 26.322 8.170   -0.591  1.00 25.34  ? 1089 ASP A CA    1 
ATOM   2637 C  C     . ASP A 1 219 ? 27.340 9.252   -0.954  1.00 36.35  ? 1089 ASP A C     1 
ATOM   2638 O  O     . ASP A 1 219 ? 27.267 9.848   -2.025  1.00 31.43  ? 1089 ASP A O     1 
ATOM   2639 C  CB    . ASP A 1 219 ? 26.160 7.191   -1.758  1.00 26.07  ? 1089 ASP A CB    1 
ATOM   2640 C  CG    . ASP A 1 219 ? 27.476 6.615   -2.232  1.00 32.07  ? 1089 ASP A CG    1 
ATOM   2641 O  OD1   . ASP A 1 219 ? 28.490 6.768   -1.521  1.00 37.28  ? 1089 ASP A OD1   1 
ATOM   2642 O  OD2   . ASP A 1 219 ? 27.491 5.994   -3.315  1.00 36.09  ? 1089 ASP A OD2   1 
ATOM   2643 H  H     . ASP A 1 219 ? 24.452 8.704   -0.901  1.00 34.68  ? 1089 ASP A H     1 
ATOM   2644 H  HA    . ASP A 1 219 ? 26.673 7.671   0.177   1.00 30.35  ? 1089 ASP A HA    1 
ATOM   2645 H  HB2   . ASP A 1 219 ? 25.595 6.454   -1.476  1.00 31.23  ? 1089 ASP A HB2   1 
ATOM   2646 H  HB3   . ASP A 1 219 ? 25.751 7.655   -2.505  1.00 31.23  ? 1089 ASP A HB3   1 
ATOM   2647 N  N     . LEU A 1 220 ? 28.295 9.491   -0.059  1.00 25.10  ? 1090 LEU A N     1 
ATOM   2648 C  CA    . LEU A 1 220 ? 29.355 10.469  -0.301  1.00 26.41  ? 1090 LEU A CA    1 
ATOM   2649 C  C     . LEU A 1 220 ? 30.682 9.796   -0.679  1.00 26.45  ? 1090 LEU A C     1 
ATOM   2650 O  O     . LEU A 1 220 ? 31.758 10.270  -0.313  1.00 29.76  ? 1090 LEU A O     1 
ATOM   2651 C  CB    . LEU A 1 220 ? 29.545 11.359  0.936   1.00 25.92  ? 1090 LEU A CB    1 
ATOM   2652 C  CG    . LEU A 1 220 ? 28.954 12.769  0.833   1.00 34.62  ? 1090 LEU A CG    1 
ATOM   2653 C  CD1   . LEU A 1 220 ? 27.482 12.697  0.464   1.00 29.93  ? 1090 LEU A CD1   1 
ATOM   2654 C  CD2   . LEU A 1 220 ? 29.153 13.566  2.125   1.00 31.23  ? 1090 LEU A CD2   1 
ATOM   2655 H  H     . LEU A 1 220 ? 28.352 9.096   0.703   1.00 30.06  ? 1090 LEU A H     1 
ATOM   2656 H  HA    . LEU A 1 220 ? 29.089 11.045  -1.047  1.00 31.63  ? 1090 LEU A HA    1 
ATOM   2657 H  HB2   . LEU A 1 220 ? 29.126 10.923  1.694   1.00 31.05  ? 1090 LEU A HB2   1 
ATOM   2658 H  HB3   . LEU A 1 220 ? 30.495 11.454  1.102   1.00 31.05  ? 1090 LEU A HB3   1 
ATOM   2659 H  HG    . LEU A 1 220 ? 29.411 13.244  0.122   1.00 41.49  ? 1090 LEU A HG    1 
ATOM   2660 H  HD11  . LEU A 1 220 ? 27.131 13.589  0.405   1.00 35.86  ? 1090 LEU A HD11  1 
ATOM   2661 H  HD12  . LEU A 1 220 ? 27.393 12.253  -0.382  1.00 35.86  ? 1090 LEU A HD12  1 
ATOM   2662 H  HD13  . LEU A 1 220 ? 27.014 12.205  1.143   1.00 35.86  ? 1090 LEU A HD13  1 
ATOM   2663 H  HD21  . LEU A 1 220 ? 28.769 14.439  2.015   1.00 37.42  ? 1090 LEU A HD21  1 
ATOM   2664 H  HD22  . LEU A 1 220 ? 28.718 13.105  2.846   1.00 37.42  ? 1090 LEU A HD22  1 
ATOM   2665 H  HD23  . LEU A 1 220 ? 30.093 13.642  2.303   1.00 37.42  ? 1090 LEU A HD23  1 
ATOM   2666 N  N     . SER A 1 221 ? 30.601 8.697   -1.422  1.00 23.32  ? 1091 SER A N     1 
ATOM   2667 C  CA    . SER A 1 221 ? 31.789 7.910   -1.752  1.00 27.72  ? 1091 SER A CA    1 
ATOM   2668 C  C     . SER A 1 221 ? 32.586 8.470   -2.929  1.00 33.11  ? 1091 SER A C     1 
ATOM   2669 O  O     . SER A 1 221 ? 33.793 8.252   -3.019  1.00 35.26  ? 1091 SER A O     1 
ATOM   2670 C  CB    . SER A 1 221 ? 31.399 6.465   -2.062  1.00 28.26  ? 1091 SER A CB    1 
ATOM   2671 O  OG    . SER A 1 221 ? 30.576 6.391   -3.211  1.00 30.51  ? 1091 SER A OG    1 
ATOM   2672 H  H     . SER A 1 221 ? 29.870 8.384   -1.749  1.00 27.93  ? 1091 SER A H     1 
ATOM   2673 H  HA    . SER A 1 221 ? 32.382 7.897   -0.972  1.00 33.20  ? 1091 SER A HA    1 
ATOM   2674 H  HB2   . SER A 1 221 ? 32.204 5.948   -2.218  1.00 33.86  ? 1091 SER A HB2   1 
ATOM   2675 H  HB3   . SER A 1 221 ? 30.914 6.101   -1.304  1.00 33.86  ? 1091 SER A HB3   1 
ATOM   2676 H  HG    . SER A 1 221 ? 30.376 5.610   -3.363  1.00 36.56  ? 1091 SER A HG    1 
ATOM   2677 N  N     . ASP A 1 222 ? 31.918 9.183   -3.830  1.00 33.03  ? 1092 ASP A N     1 
ATOM   2678 C  CA    . ASP A 1 222 ? 32.559 9.636   -5.064  1.00 32.29  ? 1092 ASP A CA    1 
ATOM   2679 C  C     . ASP A 1 222 ? 33.381 10.908  -4.853  1.00 33.22  ? 1092 ASP A C     1 
ATOM   2680 O  O     . ASP A 1 222 ? 32.836 12.005  -4.703  1.00 33.06  ? 1092 ASP A O     1 
ATOM   2681 C  CB    . ASP A 1 222 ? 31.509 9.861   -6.151  1.00 32.95  ? 1092 ASP A CB    1 
ATOM   2682 C  CG    . ASP A 1 222 ? 32.121 10.021  -7.531  1.00 53.50  ? 1092 ASP A CG    1 
ATOM   2683 O  OD1   . ASP A 1 222 ? 33.349 10.218  -7.622  1.00 42.74  ? 1092 ASP A OD1   1 
ATOM   2684 O  OD2   . ASP A 1 222 ? 31.373 9.952   -8.526  1.00 41.69  ? 1092 ASP A OD2   1 
ATOM   2685 H  H     . ASP A 1 222 ? 31.095 9.418   -3.752  1.00 39.58  ? 1092 ASP A H     1 
ATOM   2686 H  HA    . ASP A 1 222 ? 33.169 8.936   -5.377  1.00 38.70  ? 1092 ASP A HA    1 
ATOM   2687 H  HB2   . ASP A 1 222 ? 30.910 9.098   -6.175  1.00 39.48  ? 1092 ASP A HB2   1 
ATOM   2688 H  HB3   . ASP A 1 222 ? 31.011 10.668  -5.948  1.00 39.48  ? 1092 ASP A HB3   1 
ATOM   2689 N  N     . ASP A 1 223 ? 34.700 10.753  -4.862  1.00 34.47  ? 1093 ASP A N     1 
ATOM   2690 C  CA    . ASP A 1 223 ? 35.609 11.865  -4.603  1.00 44.94  ? 1093 ASP A CA    1 
ATOM   2691 C  C     . ASP A 1 223 ? 35.568 12.936  -5.693  1.00 47.27  ? 1093 ASP A C     1 
ATOM   2692 O  O     . ASP A 1 223 ? 36.071 14.044  -5.503  1.00 38.52  ? 1093 ASP A O     1 
ATOM   2693 C  CB    . ASP A 1 223 ? 37.039 11.349  -4.457  1.00 55.17  ? 1093 ASP A CB    1 
ATOM   2694 C  CG    . ASP A 1 223 ? 38.019 12.452  -4.112  1.00 74.80  ? 1093 ASP A CG    1 
ATOM   2695 O  OD1   . ASP A 1 223 ? 38.225 12.705  -2.906  1.00 68.11  ? 1093 ASP A OD1   1 
ATOM   2696 O  OD2   . ASP A 1 223 ? 38.577 13.070  -5.043  1.00 79.99  ? 1093 ASP A OD2   1 
ATOM   2697 H  H     . ASP A 1 223 ? 35.098 10.007  -5.017  1.00 41.31  ? 1093 ASP A H     1 
ATOM   2698 H  HA    . ASP A 1 223 ? 35.355 12.289  -3.757  1.00 53.88  ? 1093 ASP A HA    1 
ATOM   2699 H  HB2   . ASP A 1 223 ? 37.067 10.688  -3.748  1.00 66.15  ? 1093 ASP A HB2   1 
ATOM   2700 H  HB3   . ASP A 1 223 ? 37.319 10.949  -5.295  1.00 66.15  ? 1093 ASP A HB3   1 
ATOM   2701 N  N     . LYS A 1 224 ? 34.978 12.607  -6.835  1.00 36.91  ? 1094 LYS A N     1 
ATOM   2702 C  CA    . LYS A 1 224 ? 34.877 13.560  -7.938  1.00 54.67  ? 1094 LYS A CA    1 
ATOM   2703 C  C     . LYS A 1 224 ? 33.650 14.456  -7.805  1.00 51.16  ? 1094 LYS A C     1 
ATOM   2704 O  O     . LYS A 1 224 ? 33.582 15.518  -8.421  1.00 54.85  ? 1094 LYS A O     1 
ATOM   2705 C  CB    . LYS A 1 224 ? 34.861 12.823  -9.276  1.00 61.92  ? 1094 LYS A CB    1 
ATOM   2706 C  CG    . LYS A 1 224 ? 36.239 12.355  -9.713  1.00 71.85  ? 1094 LYS A CG    1 
ATOM   2707 C  CD    . LYS A 1 224 ? 36.172 11.176  -10.668 1.00 83.39  ? 1094 LYS A CD    1 
ATOM   2708 C  CE    . LYS A 1 224 ? 37.562 10.797  -11.158 1.00 93.13  ? 1094 LYS A CE    1 
ATOM   2709 N  NZ    . LYS A 1 224 ? 37.964 9.429   -10.730 1.00 93.11  ? 1094 LYS A NZ    1 
ATOM   2710 H  H     . LYS A 1 224 ? 34.628 11.839  -6.999  1.00 44.24  ? 1094 LYS A H     1 
ATOM   2711 H  HA    . LYS A 1 224 ? 35.669 14.137  -7.926  1.00 65.55  ? 1094 LYS A HA    1 
ATOM   2712 H  HB2   . LYS A 1 224 ? 34.290 12.043  -9.200  1.00 74.25  ? 1094 LYS A HB2   1 
ATOM   2713 H  HB3   . LYS A 1 224 ? 34.517 13.419  -9.960  1.00 74.25  ? 1094 LYS A HB3   1 
ATOM   2714 H  HG2   . LYS A 1 224 ? 36.693 13.083  -10.166 1.00 86.16  ? 1094 LYS A HG2   1 
ATOM   2715 H  HG3   . LYS A 1 224 ? 36.744 12.082  -8.932  1.00 86.16  ? 1094 LYS A HG3   1 
ATOM   2716 H  HD2   . LYS A 1 224 ? 35.790 10.411  -10.209 1.00 100.01 ? 1094 LYS A HD2   1 
ATOM   2717 H  HD3   . LYS A 1 224 ? 35.630 11.414  -11.436 1.00 100.01 ? 1094 LYS A HD3   1 
ATOM   2718 H  HE2   . LYS A 1 224 ? 37.575 10.825  -12.127 1.00 111.70 ? 1094 LYS A HE2   1 
ATOM   2719 H  HE3   . LYS A 1 224 ? 38.207 11.427  -10.798 1.00 111.70 ? 1094 LYS A HE3   1 
ATOM   2720 H  HZ1   . LYS A 1 224 ? 38.780 9.243   -11.033 1.00 111.68 ? 1094 LYS A HZ1   1 
ATOM   2721 H  HZ2   . LYS A 1 224 ? 37.967 9.378   -9.841  1.00 111.68 ? 1094 LYS A HZ2   1 
ATOM   2722 H  HZ3   . LYS A 1 224 ? 37.391 8.829   -11.052 1.00 111.68 ? 1094 LYS A HZ3   1 
ATOM   2723 N  N     . LYS A 1 225 ? 32.681 14.024  -7.006  1.00 29.32  ? 1095 LYS A N     1 
ATOM   2724 C  CA    . LYS A 1 225 ? 31.503 14.841  -6.737  1.00 33.47  ? 1095 LYS A CA    1 
ATOM   2725 C  C     . LYS A 1 225 ? 31.621 15.562  -5.394  1.00 32.74  ? 1095 LYS A C     1 
ATOM   2726 O  O     . LYS A 1 225 ? 31.006 16.607  -5.189  1.00 35.89  ? 1095 LYS A O     1 
ATOM   2727 C  CB    . LYS A 1 225 ? 30.237 13.982  -6.767  1.00 31.88  ? 1095 LYS A CB    1 
ATOM   2728 C  CG    . LYS A 1 225 ? 29.986 13.315  -8.110  1.00 40.38  ? 1095 LYS A CG    1 
ATOM   2729 C  CD    . LYS A 1 225 ? 28.837 12.319  -8.045  1.00 43.44  ? 1095 LYS A CD    1 
ATOM   2730 C  CE    . LYS A 1 225 ? 28.533 11.744  -9.424  1.00 54.56  ? 1095 LYS A CE    1 
ATOM   2731 N  NZ    . LYS A 1 225 ? 27.386 10.792  -9.419  1.00 55.73  ? 1095 LYS A NZ    1 
ATOM   2732 H  H     . LYS A 1 225 ? 32.681 13.262  -6.607  1.00 35.13  ? 1095 LYS A H     1 
ATOM   2733 H  HA    . LYS A 1 225 ? 31.422 15.522  -7.437  1.00 40.11  ? 1095 LYS A HA    1 
ATOM   2734 H  HB2   . LYS A 1 225 ? 30.316 13.283  -6.099  1.00 38.20  ? 1095 LYS A HB2   1 
ATOM   2735 H  HB3   . LYS A 1 225 ? 29.472 14.544  -6.567  1.00 38.20  ? 1095 LYS A HB3   1 
ATOM   2736 H  HG2   . LYS A 1 225 ? 29.761 13.993  -8.766  1.00 48.40  ? 1095 LYS A HG2   1 
ATOM   2737 H  HG3   . LYS A 1 225 ? 30.785 12.838  -8.383  1.00 48.40  ? 1095 LYS A HG3   1 
ATOM   2738 H  HD2   . LYS A 1 225 ? 29.079 11.588  -7.455  1.00 52.07  ? 1095 LYS A HD2   1 
ATOM   2739 H  HD3   . LYS A 1 225 ? 28.042 12.767  -7.718  1.00 52.07  ? 1095 LYS A HD3   1 
ATOM   2740 H  HE2   . LYS A 1 225 ? 28.315 12.471  -10.028 1.00 65.41  ? 1095 LYS A HE2   1 
ATOM   2741 H  HE3   . LYS A 1 225 ? 29.314 11.268  -9.747  1.00 65.41  ? 1095 LYS A HE3   1 
ATOM   2742 H  HZ1   . LYS A 1 225 ? 26.650 11.205  -9.134  1.00 66.81  ? 1095 LYS A HZ1   1 
ATOM   2743 H  HZ2   . LYS A 1 225 ? 27.244 10.482  -10.241 1.00 66.81  ? 1095 LYS A HZ2   1 
ATOM   2744 H  HZ3   . LYS A 1 225 ? 27.561 10.108  -8.878  1.00 66.81  ? 1095 LYS A HZ3   1 
ATOM   2745 N  N     . TRP A 1 226 ? 32.425 15.005  -4.492  1.00 34.26  ? 1096 TRP A N     1 
ATOM   2746 C  CA    . TRP A 1 226 ? 32.501 15.495  -3.119  1.00 27.11  ? 1096 TRP A CA    1 
ATOM   2747 C  C     . TRP A 1 226 ? 33.930 15.808  -2.692  1.00 37.20  ? 1096 TRP A C     1 
ATOM   2748 O  O     . TRP A 1 226 ? 34.290 15.620  -1.536  1.00 30.77  ? 1096 TRP A O     1 
ATOM   2749 C  CB    . TRP A 1 226 ? 31.910 14.448  -2.172  1.00 27.75  ? 1096 TRP A CB    1 
ATOM   2750 C  CG    . TRP A 1 226 ? 30.535 14.027  -2.561  1.00 26.90  ? 1096 TRP A CG    1 
ATOM   2751 C  CD1   . TRP A 1 226 ? 30.163 12.834  -3.112  1.00 27.11  ? 1096 TRP A CD1   1 
ATOM   2752 C  CD2   . TRP A 1 226 ? 29.341 14.806  -2.443  1.00 30.06  ? 1096 TRP A CD2   1 
ATOM   2753 N  NE1   . TRP A 1 226 ? 28.807 12.821  -3.338  1.00 25.68  ? 1096 TRP A NE1   1 
ATOM   2754 C  CE2   . TRP A 1 226 ? 28.280 14.021  -2.937  1.00 25.14  ? 1096 TRP A CE2   1 
ATOM   2755 C  CE3   . TRP A 1 226 ? 29.065 16.091  -1.964  1.00 33.77  ? 1096 TRP A CE3   1 
ATOM   2756 C  CZ2   . TRP A 1 226 ? 26.964 14.480  -2.966  1.00 27.43  ? 1096 TRP A CZ2   1 
ATOM   2757 C  CZ3   . TRP A 1 226 ? 27.761 16.544  -1.993  1.00 30.12  ? 1096 TRP A CZ3   1 
ATOM   2758 C  CH2   . TRP A 1 226 ? 26.726 15.741  -2.489  1.00 34.62  ? 1096 TRP A CH2   1 
ATOM   2759 H  H     . TRP A 1 226 ? 32.941 14.336  -4.652  1.00 41.05  ? 1096 TRP A H     1 
ATOM   2760 H  HA    . TRP A 1 226 ? 31.971 16.315  -3.039  1.00 32.48  ? 1096 TRP A HA    1 
ATOM   2761 H  HB2   . TRP A 1 226 ? 32.477 13.661  -2.177  1.00 33.25  ? 1096 TRP A HB2   1 
ATOM   2762 H  HB3   . TRP A 1 226 ? 31.868 14.820  -1.277  1.00 33.25  ? 1096 TRP A HB3   1 
ATOM   2763 H  HD1   . TRP A 1 226 ? 30.742 12.132  -3.304  1.00 32.47  ? 1096 TRP A HD1   1 
ATOM   2764 H  HE1   . TRP A 1 226 ? 28.363 12.168  -3.678  1.00 30.76  ? 1096 TRP A HE1   1 
ATOM   2765 H  HE3   . TRP A 1 226 ? 29.747 16.630  -1.633  1.00 40.47  ? 1096 TRP A HE3   1 
ATOM   2766 H  HZ2   . TRP A 1 226 ? 26.275 13.949  -3.294  1.00 32.86  ? 1096 TRP A HZ2   1 
ATOM   2767 H  HZ3   . TRP A 1 226 ? 27.567 17.397  -1.677  1.00 36.08  ? 1096 TRP A HZ3   1 
ATOM   2768 H  HH2   . TRP A 1 226 ? 25.857 16.072  -2.496  1.00 41.48  ? 1096 TRP A HH2   1 
ATOM   2769 N  N     . LYS A 1 227 ? 34.741 16.297  -3.621  1.00 35.36  ? 1097 LYS A N     1 
ATOM   2770 C  CA    . LYS A 1 227 ? 36.170 16.459  -3.370  1.00 32.98  ? 1097 LYS A CA    1 
ATOM   2771 C  C     . LYS A 1 227 ? 36.488 17.307  -2.136  1.00 36.93  ? 1097 LYS A C     1 
ATOM   2772 O  O     . LYS A 1 227 ? 37.302 16.911  -1.304  1.00 36.98  ? 1097 LYS A O     1 
ATOM   2773 C  CB    . LYS A 1 227 ? 36.863 17.055  -4.592  1.00 36.91  ? 1097 LYS A CB    1 
ATOM   2774 C  CG    . LYS A 1 227 ? 38.360 17.162  -4.418  1.00 61.26  ? 1097 LYS A CG    1 
ATOM   2775 C  CD    . LYS A 1 227 ? 39.026 17.778  -5.626  1.00 77.84  ? 1097 LYS A CD    1 
ATOM   2776 C  CE    . LYS A 1 227 ? 40.527 17.833  -5.432  1.00 82.62  ? 1097 LYS A CE    1 
ATOM   2777 N  NZ    . LYS A 1 227 ? 41.175 18.787  -6.360  1.00 97.84  ? 1097 LYS A NZ    1 
ATOM   2778 H  H     . LYS A 1 227 ? 34.491 16.543  -4.406  1.00 42.37  ? 1097 LYS A H     1 
ATOM   2779 H  HA    . LYS A 1 227 ? 36.557 15.571  -3.219  1.00 39.52  ? 1097 LYS A HA    1 
ATOM   2780 H  HB2   . LYS A 1 227 ? 36.690 16.489  -5.361  1.00 44.24  ? 1097 LYS A HB2   1 
ATOM   2781 H  HB3   . LYS A 1 227 ? 36.514 17.946  -4.750  1.00 44.24  ? 1097 LYS A HB3   1 
ATOM   2782 H  HG2   . LYS A 1 227 ? 38.552 17.721  -3.649  1.00 73.45  ? 1097 LYS A HG2   1 
ATOM   2783 H  HG3   . LYS A 1 227 ? 38.730 16.275  -4.288  1.00 73.45  ? 1097 LYS A HG3   1 
ATOM   2784 H  HD2   . LYS A 1 227 ? 38.837 17.238  -6.410  1.00 93.35  ? 1097 LYS A HD2   1 
ATOM   2785 H  HD3   . LYS A 1 227 ? 38.699 18.683  -5.750  1.00 93.35  ? 1097 LYS A HD3   1 
ATOM   2786 H  HE2   . LYS A 1 227 ? 40.720 18.117  -4.525  1.00 99.08  ? 1097 LYS A HE2   1 
ATOM   2787 H  HE3   . LYS A 1 227 ? 40.901 16.953  -5.594  1.00 99.08  ? 1097 LYS A HE3   1 
ATOM   2788 H  HZ1   . LYS A 1 227 ? 42.054 18.797  -6.222  1.00 117.36 ? 1097 LYS A HZ1   1 
ATOM   2789 H  HZ2   . LYS A 1 227 ? 41.018 18.546  -7.203  1.00 117.36 ? 1097 LYS A HZ2   1 
ATOM   2790 H  HZ3   . LYS A 1 227 ? 40.852 19.606  -6.229  1.00 117.36 ? 1097 LYS A HZ3   1 
ATOM   2791 N  N     . LEU A 1 228 ? 35.863 18.474  -2.025  1.00 34.27  ? 1098 LEU A N     1 
ATOM   2792 C  CA    . LEU A 1 228 ? 36.138 19.380  -0.912  1.00 29.96  ? 1098 LEU A CA    1 
ATOM   2793 C  C     . LEU A 1 228 ? 35.617 18.800  0.398   1.00 34.92  ? 1098 LEU A C     1 
ATOM   2794 O  O     . LEU A 1 228 ? 36.250 18.936  1.445   1.00 35.99  ? 1098 LEU A O     1 
ATOM   2795 C  CB    . LEU A 1 228 ? 35.499 20.747  -1.157  1.00 40.19  ? 1098 LEU A CB    1 
ATOM   2796 C  CG    . LEU A 1 228 ? 36.168 21.629  -2.214  1.00 59.71  ? 1098 LEU A CG    1 
ATOM   2797 C  CD1   . LEU A 1 228 ? 35.348 22.887  -2.454  1.00 59.72  ? 1098 LEU A CD1   1 
ATOM   2798 C  CD2   . LEU A 1 228 ? 37.586 21.983  -1.795  1.00 48.77  ? 1098 LEU A CD2   1 
ATOM   2799 H  H     . LEU A 1 228 ? 35.275 18.766  -2.581  1.00 41.07  ? 1098 LEU A H     1 
ATOM   2800 H  HA    . LEU A 1 228 ? 37.106 19.504  -0.829  1.00 35.90  ? 1098 LEU A HA    1 
ATOM   2801 H  HB2   . LEU A 1 228 ? 34.581 20.608  -1.438  1.00 48.17  ? 1098 LEU A HB2   1 
ATOM   2802 H  HB3   . LEU A 1 228 ? 35.508 21.241  -0.323  1.00 48.17  ? 1098 LEU A HB3   1 
ATOM   2803 H  HG    . LEU A 1 228 ? 36.217 21.139  -3.049  1.00 71.59  ? 1098 LEU A HG    1 
ATOM   2804 H  HD11  . LEU A 1 228 ? 35.786 23.424  -3.118  1.00 71.61  ? 1098 LEU A HD11  1 
ATOM   2805 H  HD12  . LEU A 1 228 ? 34.473 22.636  -2.759  1.00 71.61  ? 1098 LEU A HD12  1 
ATOM   2806 H  HD13  . LEU A 1 228 ? 35.280 23.377  -1.631  1.00 71.61  ? 1098 LEU A HD13  1 
ATOM   2807 H  HD21  . LEU A 1 228 ? 38.093 21.174  -1.692  1.00 58.47  ? 1098 LEU A HD21  1 
ATOM   2808 H  HD22  . LEU A 1 228 ? 37.983 22.535  -2.472  1.00 58.47  ? 1098 LEU A HD22  1 
ATOM   2809 H  HD23  . LEU A 1 228 ? 37.555 22.458  -0.961  1.00 58.47  ? 1098 LEU A HD23  1 
ATOM   2810 N  N     . GLN A 1 229 ? 34.457 18.154  0.327   1.00 30.33  ? 1099 GLN A N     1 
ATOM   2811 C  CA    . GLN A 1 229 ? 33.852 17.531  1.498   1.00 33.77  ? 1099 GLN A CA    1 
ATOM   2812 C  C     . GLN A 1 229 ? 34.770 16.466  2.079   1.00 33.66  ? 1099 GLN A C     1 
ATOM   2813 O  O     . GLN A 1 229 ? 35.105 16.502  3.262   1.00 32.04  ? 1099 GLN A O     1 
ATOM   2814 C  CB    . GLN A 1 229 ? 32.503 16.902  1.141   1.00 25.10  ? 1099 GLN A CB    1 
ATOM   2815 C  CG    . GLN A 1 229 ? 31.359 17.896  1.021   1.00 31.30  ? 1099 GLN A CG    1 
ATOM   2816 C  CD    . GLN A 1 229 ? 31.449 18.743  -0.237  1.00 33.91  ? 1099 GLN A CD    1 
ATOM   2817 O  OE1   . GLN A 1 229 ? 32.012 18.321  -1.244  1.00 31.53  ? 1099 GLN A OE1   1 
ATOM   2818 N  NE2   . GLN A 1 229 ? 30.891 19.944  -0.184  1.00 30.47  ? 1099 GLN A NE2   1 
ATOM   2819 H  H     . GLN A 1 229 ? 33.998 18.062  -0.394  1.00 36.34  ? 1099 GLN A H     1 
ATOM   2820 H  HA    . GLN A 1 229 ? 33.700 18.214  2.185   1.00 40.47  ? 1099 GLN A HA    1 
ATOM   2821 H  HB2   . GLN A 1 229 ? 32.588 16.447  0.289   1.00 30.06  ? 1099 GLN A HB2   1 
ATOM   2822 H  HB3   . GLN A 1 229 ? 32.266 16.262  1.831   1.00 30.06  ? 1099 GLN A HB3   1 
ATOM   2823 H  HG2   . GLN A 1 229 ? 30.519 17.411  0.997   1.00 37.50  ? 1099 GLN A HG2   1 
ATOM   2824 H  HG3   . GLN A 1 229 ? 31.376 18.492  1.786   1.00 37.50  ? 1099 GLN A HG3   1 
ATOM   2825 H  HE21  . GLN A 1 229 ? 30.916 20.460  -0.871  1.00 36.51  ? 1099 GLN A HE21  1 
ATOM   2826 H  HE22  . GLN A 1 229 ? 30.503 20.206  0.537   1.00 36.51  ? 1099 GLN A HE22  1 
ATOM   2827 N  N     . LEU A 1 230 ? 35.173 15.514  1.245   1.00 32.44  ? 1100 LEU A N     1 
ATOM   2828 C  CA    . LEU A 1 230 ? 36.004 14.409  1.705   1.00 31.82  ? 1100 LEU A CA    1 
ATOM   2829 C  C     . LEU A 1 230 ? 37.382 14.897  2.143   1.00 31.40  ? 1100 LEU A C     1 
ATOM   2830 O  O     . LEU A 1 230 ? 37.972 14.353  3.073   1.00 32.07  ? 1100 LEU A O     1 
ATOM   2831 C  CB    . LEU A 1 230 ? 36.126 13.341  0.615   1.00 28.23  ? 1100 LEU A CB    1 
ATOM   2832 C  CG    . LEU A 1 230 ? 34.802 12.666  0.246   1.00 30.57  ? 1100 LEU A CG    1 
ATOM   2833 C  CD1   . LEU A 1 230 ? 35.019 11.562  -0.781  1.00 31.44  ? 1100 LEU A CD1   1 
ATOM   2834 C  CD2   . LEU A 1 230 ? 34.116 12.113  1.492   1.00 31.17  ? 1100 LEU A CD2   1 
ATOM   2835 H  H     . LEU A 1 230 ? 34.979 15.484  0.408   1.00 38.87  ? 1100 LEU A H     1 
ATOM   2836 H  HA    . LEU A 1 230 ? 35.574 13.994  2.482   1.00 38.13  ? 1100 LEU A HA    1 
ATOM   2837 H  HB2   . LEU A 1 230 ? 36.480 13.755  -0.187  1.00 33.82  ? 1100 LEU A HB2   1 
ATOM   2838 H  HB3   . LEU A 1 230 ? 36.734 12.651  0.923   1.00 33.82  ? 1100 LEU A HB3   1 
ATOM   2839 H  HG    . LEU A 1 230 ? 34.213 13.327  -0.149  1.00 36.62  ? 1100 LEU A HG    1 
ATOM   2840 H  HD11  . LEU A 1 230 ? 34.173 11.160  -0.991  1.00 37.68  ? 1100 LEU A HD11  1 
ATOM   2841 H  HD12  . LEU A 1 230 ? 35.405 11.944  -1.572  1.00 37.68  ? 1100 LEU A HD12  1 
ATOM   2842 H  HD13  . LEU A 1 230 ? 35.612 10.904  -0.411  1.00 37.68  ? 1100 LEU A HD13  1 
ATOM   2843 H  HD21  . LEU A 1 230 ? 33.291 11.695  1.235   1.00 37.35  ? 1100 LEU A HD21  1 
ATOM   2844 H  HD22  . LEU A 1 230 ? 34.694 11.468  1.907   1.00 37.35  ? 1100 LEU A HD22  1 
ATOM   2845 H  HD23  . LEU A 1 230 ? 33.942 12.836  2.099   1.00 37.35  ? 1100 LEU A HD23  1 
ATOM   2846 N  N     . HIS A 1 231 ? 37.894 15.931  1.486   1.00 34.20  ? 1101 HIS A N     1 
ATOM   2847 C  CA    . HIS A 1 231 ? 39.199 16.457  1.856   1.00 34.20  ? 1101 HIS A CA    1 
ATOM   2848 C  C     . HIS A 1 231 ? 39.157 17.086  3.238   1.00 34.14  ? 1101 HIS A C     1 
ATOM   2849 O  O     . HIS A 1 231 ? 40.141 17.054  3.967   1.00 30.35  ? 1101 HIS A O     1 
ATOM   2850 C  CB    . HIS A 1 231 ? 39.697 17.494  0.855   1.00 49.58  ? 1101 HIS A CB    1 
ATOM   2851 C  CG    . HIS A 1 231 ? 41.013 18.095  1.236   1.00 62.67  ? 1101 HIS A CG    1 
ATOM   2852 N  ND1   . HIS A 1 231 ? 41.117 19.267  1.953   1.00 66.54  ? 1101 HIS A ND1   1 
ATOM   2853 C  CD2   . HIS A 1 231 ? 42.281 17.669  1.025   1.00 74.63  ? 1101 HIS A CD2   1 
ATOM   2854 C  CE1   . HIS A 1 231 ? 42.393 19.546  2.154   1.00 74.20  ? 1101 HIS A CE1   1 
ATOM   2855 N  NE2   . HIS A 1 231 ? 43.120 18.592  1.601   1.00 84.43  ? 1101 HIS A NE2   1 
ATOM   2856 H  H     . HIS A 1 231 ? 37.513 16.340  0.833   1.00 40.98  ? 1101 HIS A H     1 
ATOM   2857 H  HA    . HIS A 1 231 ? 39.846 15.721  1.877   1.00 40.99  ? 1101 HIS A HA    1 
ATOM   2858 H  HB2   . HIS A 1 231 ? 39.802 17.070  -0.011  1.00 59.43  ? 1101 HIS A HB2   1 
ATOM   2859 H  HB3   . HIS A 1 231 ? 39.047 18.211  0.796   1.00 59.43  ? 1101 HIS A HB3   1 
ATOM   2860 H  HD1   . HIS A 1 231 ? 40.455 19.746  2.222   1.00 79.79  ? 1101 HIS A HD1   1 
ATOM   2861 H  HD2   . HIS A 1 231 ? 42.537 16.900  0.568   1.00 89.50  ? 1101 HIS A HD2   1 
ATOM   2862 H  HE1   . HIS A 1 231 ? 42.722 20.288  2.608   1.00 88.98  ? 1101 HIS A HE1   1 
ATOM   2863 H  HE2   . HIS A 1 231 ? 43.979 18.555  1.601   1.00 101.26 ? 1101 HIS A HE2   1 
ATOM   2864 N  N     . GLU A 1 232 ? 38.019 17.668  3.594   1.00 31.27  ? 1102 GLU A N     1 
ATOM   2865 C  CA    . GLU A 1 232 ? 37.886 18.307  4.893   1.00 30.52  ? 1102 GLU A CA    1 
ATOM   2866 C  C     . GLU A 1 232 ? 38.089 17.285  6.012   1.00 34.26  ? 1102 GLU A C     1 
ATOM   2867 O  O     . GLU A 1 232 ? 38.570 17.620  7.093   1.00 30.38  ? 1102 GLU A O     1 
ATOM   2868 C  CB    . GLU A 1 232 ? 36.511 18.962  5.022   1.00 37.35  ? 1102 GLU A CB    1 
ATOM   2869 C  CG    . GLU A 1 232 ? 36.397 19.923  6.189   1.00 33.04  ? 1102 GLU A CG    1 
ATOM   2870 C  CD    . GLU A 1 232 ? 37.259 21.163  6.016   1.00 40.76  ? 1102 GLU A CD    1 
ATOM   2871 O  OE1   . GLU A 1 232 ? 37.797 21.373  4.909   1.00 38.81  ? 1102 GLU A OE1   1 
ATOM   2872 O  OE2   . GLU A 1 232 ? 37.398 21.929  6.989   1.00 38.25  ? 1102 GLU A OE2   1 
ATOM   2873 H  H     . GLU A 1 232 ? 37.313 17.705  3.105   1.00 37.46  ? 1102 GLU A H     1 
ATOM   2874 H  HA    . GLU A 1 232 ? 38.569 19.004  4.983   1.00 36.57  ? 1102 GLU A HA    1 
ATOM   2875 H  HB2   . GLU A 1 232 ? 36.324 19.458  4.210   1.00 44.76  ? 1102 GLU A HB2   1 
ATOM   2876 H  HB3   . GLU A 1 232 ? 35.845 18.267  5.143   1.00 44.76  ? 1102 GLU A HB3   1 
ATOM   2877 H  HG2   . GLU A 1 232 ? 35.474 20.208  6.274   1.00 39.59  ? 1102 GLU A HG2   1 
ATOM   2878 H  HG3   . GLU A 1 232 ? 36.682 19.471  6.999   1.00 39.59  ? 1102 GLU A HG3   1 
ATOM   2879 N  N     . LEU A 1 233 ? 37.733 16.033  5.741   1.00 25.76  ? 1103 LEU A N     1 
ATOM   2880 C  CA    . LEU A 1 233 ? 37.775 14.990  6.765   1.00 24.74  ? 1103 LEU A CA    1 
ATOM   2881 C  C     . LEU A 1 233 ? 39.169 14.397  6.972   1.00 30.30  ? 1103 LEU A C     1 
ATOM   2882 O  O     . LEU A 1 233 ? 39.378 13.623  7.905   1.00 29.28  ? 1103 LEU A O     1 
ATOM   2883 C  CB    . LEU A 1 233 ? 36.773 13.882  6.428   1.00 23.97  ? 1103 LEU A CB    1 
ATOM   2884 C  CG    . LEU A 1 233 ? 35.331 14.382  6.317   1.00 25.61  ? 1103 LEU A CG    1 
ATOM   2885 C  CD1   . LEU A 1 233 ? 34.378 13.249  5.965   1.00 23.22  ? 1103 LEU A CD1   1 
ATOM   2886 C  CD2   . LEU A 1 233 ? 34.910 15.061  7.611   1.00 30.21  ? 1103 LEU A CD2   1 
ATOM   2887 H  H     . LEU A 1 233 ? 37.463 15.760  4.972   1.00 30.85  ? 1103 LEU A H     1 
ATOM   2888 H  HA    . LEU A 1 233 ? 37.497 15.385  7.617   1.00 29.63  ? 1103 LEU A HA    1 
ATOM   2889 H  HB2   . LEU A 1 233 ? 37.017 13.485  5.577   1.00 28.71  ? 1103 LEU A HB2   1 
ATOM   2890 H  HB3   . LEU A 1 233 ? 36.802 13.209  7.126   1.00 28.71  ? 1103 LEU A HB3   1 
ATOM   2891 H  HG    . LEU A 1 233 ? 35.283 15.042  5.607   1.00 30.67  ? 1103 LEU A HG    1 
ATOM   2892 H  HD11  . LEU A 1 233 ? 33.486 13.600  5.904   1.00 27.81  ? 1103 LEU A HD11  1 
ATOM   2893 H  HD12  . LEU A 1 233 ? 34.640 12.871  5.123   1.00 27.81  ? 1103 LEU A HD12  1 
ATOM   2894 H  HD13  . LEU A 1 233 ? 34.421 12.580  6.652   1.00 27.81  ? 1103 LEU A HD13  1 
ATOM   2895 H  HD21  . LEU A 1 233 ? 34.004 15.368  7.522   1.00 36.19  ? 1103 LEU A HD21  1 
ATOM   2896 H  HD22  . LEU A 1 233 ? 34.972 14.428  8.330   1.00 36.19  ? 1103 LEU A HD22  1 
ATOM   2897 H  HD23  . LEU A 1 233 ? 35.493 15.805  7.778   1.00 36.19  ? 1103 LEU A HD23  1 
ATOM   2898 N  N     . THR A 1 234 ? 40.126 14.760  6.120   1.00 25.76  ? 1104 THR A N     1 
ATOM   2899 C  CA    . THR A 1 234 ? 41.501 14.304  6.319   1.00 29.58  ? 1104 THR A CA    1 
ATOM   2900 C  C     . THR A 1 234 ? 42.160 15.070  7.465   1.00 32.77  ? 1104 THR A C     1 
ATOM   2901 O  O     . THR A 1 234 ? 43.273 14.747  7.879   1.00 33.27  ? 1104 THR A O     1 
ATOM   2902 C  CB    . THR A 1 234 ? 42.366 14.441  5.043   1.00 45.54  ? 1104 THR A CB    1 
ATOM   2903 O  OG1   . THR A 1 234 ? 42.550 15.825  4.721   1.00 42.61  ? 1104 THR A OG1   1 
ATOM   2904 C  CG2   . THR A 1 234 ? 41.718 13.719  3.869   1.00 34.74  ? 1104 THR A CG2   1 
ATOM   2905 H  H     . THR A 1 234 ? 40.010 15.260  5.431   1.00 30.86  ? 1104 THR A H     1 
ATOM   2906 H  HA    . THR A 1 234 ? 41.484 13.356  6.566   1.00 35.44  ? 1104 THR A HA    1 
ATOM   2907 H  HB    . THR A 1 234 ? 43.232 14.036  5.203   1.00 54.59  ? 1104 THR A HB    1 
ATOM   2908 H  HG1   . THR A 1 234 ? 41.823 16.181  4.590   1.00 51.08  ? 1104 THR A HG1   1 
ATOM   2909 H  HG21  . THR A 1 234 ? 42.264 13.812  3.085   1.00 41.63  ? 1104 THR A HG21  1 
ATOM   2910 H  HG22  . THR A 1 234 ? 41.620 12.785  4.072   1.00 41.63  ? 1104 THR A HG22  1 
ATOM   2911 H  HG23  . THR A 1 234 ? 40.851 14.092  3.692   1.00 41.63  ? 1104 THR A HG23  1 
ATOM   2912 N  N     . LYS A 1 235 ? 41.467 16.081  7.982   1.00 32.02  ? 1105 LYS A N     1 
ATOM   2913 C  CA    . LYS A 1 235 ? 41.967 16.843  9.124   1.00 38.34  ? 1105 LYS A CA    1 
ATOM   2914 C  C     . LYS A 1 235 ? 41.782 16.092  10.440  1.00 37.96  ? 1105 LYS A C     1 
ATOM   2915 O  O     . LYS A 1 235 ? 42.398 16.440  11.446  1.00 34.16  ? 1105 LYS A O     1 
ATOM   2916 C  CB    . LYS A 1 235 ? 41.259 18.195  9.222   1.00 32.71  ? 1105 LYS A CB    1 
ATOM   2917 C  CG    . LYS A 1 235 ? 41.561 19.146  8.083   1.00 34.06  ? 1105 LYS A CG    1 
ATOM   2918 C  CD    . LYS A 1 235 ? 40.774 20.436  8.237   1.00 52.38  ? 1105 LYS A CD    1 
ATOM   2919 C  CE    . LYS A 1 235 ? 41.082 21.422  7.119   1.00 55.39  ? 1105 LYS A CE    1 
ATOM   2920 N  NZ    . LYS A 1 235 ? 40.204 22.622  7.173   1.00 51.38  ? 1105 LYS A NZ    1 
ATOM   2921 H  H     . LYS A 1 235 ? 40.703 16.347  7.689   1.00 38.37  ? 1105 LYS A H     1 
ATOM   2922 H  HA    . LYS A 1 235 ? 42.925 17.010  9.001   1.00 45.95  ? 1105 LYS A HA    1 
ATOM   2923 H  HB2   . LYS A 1 235 ? 40.301 18.044  9.233   1.00 39.20  ? 1105 LYS A HB2   1 
ATOM   2924 H  HB3   . LYS A 1 235 ? 41.531 18.628  10.046  1.00 39.20  ? 1105 LYS A HB3   1 
ATOM   2925 H  HG2   . LYS A 1 235 ? 42.507 19.362  8.085   1.00 40.81  ? 1105 LYS A HG2   1 
ATOM   2926 H  HG3   . LYS A 1 235 ? 41.311 18.732  7.243   1.00 40.81  ? 1105 LYS A HG3   1 
ATOM   2927 H  HD2   . LYS A 1 235 ? 39.825 20.236  8.212   1.00 62.80  ? 1105 LYS A HD2   1 
ATOM   2928 H  HD3   . LYS A 1 235 ? 41.006 20.853  9.082   1.00 62.80  ? 1105 LYS A HD3   1 
ATOM   2929 H  HE2   . LYS A 1 235 ? 42.002 21.717  7.200   1.00 66.41  ? 1105 LYS A HE2   1 
ATOM   2930 H  HE3   . LYS A 1 235 ? 40.944 20.986  6.264   1.00 66.41  ? 1105 LYS A HE3   1 
ATOM   2931 H  HZ1   . LYS A 1 235 ? 39.352 22.379  7.096   1.00 61.60  ? 1105 LYS A HZ1   1 
ATOM   2932 H  HZ2   . LYS A 1 235 ? 40.315 23.045  7.948   1.00 61.60  ? 1105 LYS A HZ2   1 
ATOM   2933 H  HZ3   . LYS A 1 235 ? 40.408 23.178  6.509   1.00 61.60  ? 1105 LYS A HZ3   1 
ATOM   2934 N  N     . LEU A 1 236 ? 40.926 15.075  10.441  1.00 33.27  ? 1106 LEU A N     1 
ATOM   2935 C  CA    . LEU A 1 236 ? 40.660 14.304  11.655  1.00 28.24  ? 1106 LEU A CA    1 
ATOM   2936 C  C     . LEU A 1 236 ? 41.898 13.533  12.091  1.00 29.12  ? 1106 LEU A C     1 
ATOM   2937 O  O     . LEU A 1 236 ? 42.739 13.185  11.265  1.00 30.76  ? 1106 LEU A O     1 
ATOM   2938 C  CB    . LEU A 1 236 ? 39.511 13.317  11.423  1.00 27.44  ? 1106 LEU A CB    1 
ATOM   2939 C  CG    . LEU A 1 236 ? 38.156 13.929  11.063  1.00 27.55  ? 1106 LEU A CG    1 
ATOM   2940 C  CD1   . LEU A 1 236 ? 37.169 12.859  10.599  1.00 26.76  ? 1106 LEU A CD1   1 
ATOM   2941 C  CD2   . LEU A 1 236 ? 37.600 14.703  12.243  1.00 24.83  ? 1106 LEU A CD2   1 
ATOM   2942 H  H     . LEU A 1 236 ? 40.484 14.810  9.752   1.00 39.87  ? 1106 LEU A H     1 
ATOM   2943 H  HA    . LEU A 1 236 ? 40.403 14.913  12.378  1.00 33.83  ? 1106 LEU A HA    1 
ATOM   2944 H  HB2   . LEU A 1 236 ? 39.761 12.723  10.698  1.00 32.87  ? 1106 LEU A HB2   1 
ATOM   2945 H  HB3   . LEU A 1 236 ? 39.386 12.799  12.234  1.00 32.87  ? 1106 LEU A HB3   1 
ATOM   2946 H  HG    . LEU A 1 236 ? 38.280 14.554  10.331  1.00 33.00  ? 1106 LEU A HG    1 
ATOM   2947 H  HD11  . LEU A 1 236 ? 36.333 13.278  10.382  1.00 32.05  ? 1106 LEU A HD11  1 
ATOM   2948 H  HD12  . LEU A 1 236 ? 37.527 12.420  9.824   1.00 32.05  ? 1106 LEU A HD12  1 
ATOM   2949 H  HD13  . LEU A 1 236 ? 37.043 12.223  11.307  1.00 32.05  ? 1106 LEU A HD13  1 
ATOM   2950 H  HD21  . LEU A 1 236 ? 36.751 15.079  11.998  1.00 29.74  ? 1106 LEU A HD21  1 
ATOM   2951 H  HD22  . LEU A 1 236 ? 37.491 14.104  12.985  1.00 29.74  ? 1106 LEU A HD22  1 
ATOM   2952 H  HD23  . LEU A 1 236 ? 38.214 15.403  12.474  1.00 29.74  ? 1106 LEU A HD23  1 
ATOM   2953 N  N     . PRO A 1 237 ? 42.016 13.263  13.398  1.00 25.84  ? 1107 PRO A N     1 
ATOM   2954 C  CA    . PRO A 1 237 ? 43.093 12.379  13.852  1.00 30.08  ? 1107 PRO A CA    1 
ATOM   2955 C  C     . PRO A 1 237 ? 42.940 10.986  13.246  1.00 26.18  ? 1107 PRO A C     1 
ATOM   2956 O  O     . PRO A 1 237 ? 41.833 10.590  12.883  1.00 24.43  ? 1107 PRO A O     1 
ATOM   2957 C  CB    . PRO A 1 237 ? 42.922 12.353  15.377  1.00 31.28  ? 1107 PRO A CB    1 
ATOM   2958 C  CG    . PRO A 1 237 ? 41.550 12.887  15.642  1.00 32.70  ? 1107 PRO A CG    1 
ATOM   2959 C  CD    . PRO A 1 237 ? 41.232 13.812  14.517  1.00 28.34  ? 1107 PRO A CD    1 
ATOM   2960 H  HA    . PRO A 1 237 ? 43.970 12.751  13.621  1.00 36.04  ? 1107 PRO A HA    1 
ATOM   2961 H  HB2   . PRO A 1 237 ? 43.000 11.440  15.696  1.00 37.48  ? 1107 PRO A HB2   1 
ATOM   2962 H  HB3   . PRO A 1 237 ? 43.593 12.918  15.789  1.00 37.48  ? 1107 PRO A HB3   1 
ATOM   2963 H  HG2   . PRO A 1 237 ? 40.916 12.153  15.667  1.00 39.18  ? 1107 PRO A HG2   1 
ATOM   2964 H  HG3   . PRO A 1 237 ? 41.547 13.366  16.486  1.00 39.18  ? 1107 PRO A HG3   1 
ATOM   2965 H  HD2   . PRO A 1 237 ? 40.284 13.784  14.312  1.00 33.95  ? 1107 PRO A HD2   1 
ATOM   2966 H  HD3   . PRO A 1 237 ? 41.525 14.713  14.726  1.00 33.95  ? 1107 PRO A HD3   1 
ATOM   2967 N  N     . ALA A 1 238 ? 44.044 10.258  13.136  1.00 25.52  ? 1108 ALA A N     1 
ATOM   2968 C  CA    . ALA A 1 238 ? 44.054 8.993   12.410  1.00 27.04  ? 1108 ALA A CA    1 
ATOM   2969 C  C     . ALA A 1 238 ? 42.984 8.014   12.898  1.00 28.38  ? 1108 ALA A C     1 
ATOM   2970 O  O     . ALA A 1 238 ? 42.364 7.317   12.093  1.00 32.96  ? 1108 ALA A O     1 
ATOM   2971 C  CB    . ALA A 1 238 ? 45.436 8.351   12.495  1.00 33.38  ? 1108 ALA A CB    1 
ATOM   2972 H  H     . ALA A 1 238 ? 44.804 10.475  13.474  1.00 30.56  ? 1108 ALA A H     1 
ATOM   2973 H  HA    . ALA A 1 238 ? 43.873 9.178   11.465  1.00 32.40  ? 1108 ALA A HA    1 
ATOM   2974 H  HB1   . ALA A 1 238 ? 45.425 7.521   12.013  1.00 40.00  ? 1108 ALA A HB1   1 
ATOM   2975 H  HB2   . ALA A 1 238 ? 46.081 8.947   12.107  1.00 40.00  ? 1108 ALA A HB2   1 
ATOM   2976 H  HB3   . ALA A 1 238 ? 45.650 8.191   13.417  1.00 40.00  ? 1108 ALA A HB3   1 
ATOM   2977 N  N     . PHE A 1 239 ? 42.751 7.965   14.206  1.00 29.11  ? 1109 PHE A N     1 
ATOM   2978 C  CA    . PHE A 1 239 ? 41.923 6.898   14.764  1.00 29.12  ? 1109 PHE A CA    1 
ATOM   2979 C  C     . PHE A 1 239 ? 40.439 7.019   14.412  1.00 27.45  ? 1109 PHE A C     1 
ATOM   2980 O  O     . PHE A 1 239 ? 39.696 6.056   14.580  1.00 25.23  ? 1109 PHE A O     1 
ATOM   2981 C  CB    . PHE A 1 239 ? 42.134 6.750   16.283  1.00 28.40  ? 1109 PHE A CB    1 
ATOM   2982 C  CG    . PHE A 1 239 ? 41.288 7.667   17.126  1.00 36.61  ? 1109 PHE A CG    1 
ATOM   2983 C  CD1   . PHE A 1 239 ? 40.099 7.217   17.684  1.00 28.25  ? 1109 PHE A CD1   1 
ATOM   2984 C  CD2   . PHE A 1 239 ? 41.700 8.963   17.393  1.00 36.22  ? 1109 PHE A CD2   1 
ATOM   2985 C  CE1   . PHE A 1 239 ? 39.328 8.048   18.476  1.00 30.42  ? 1109 PHE A CE1   1 
ATOM   2986 C  CE2   . PHE A 1 239 ? 40.932 9.801   18.184  1.00 34.31  ? 1109 PHE A CE2   1 
ATOM   2987 C  CZ    . PHE A 1 239 ? 39.743 9.343   18.725  1.00 34.83  ? 1109 PHE A CZ    1 
ATOM   2988 H  H     . PHE A 1 239 ? 43.054 8.526   14.784  1.00 34.88  ? 1109 PHE A H     1 
ATOM   2989 H  HA    . PHE A 1 239 ? 42.229 6.057   14.363  1.00 34.88  ? 1109 PHE A HA    1 
ATOM   2990 H  HB2   . PHE A 1 239 ? 41.922 5.838   16.537  1.00 34.02  ? 1109 PHE A HB2   1 
ATOM   2991 H  HB3   . PHE A 1 239 ? 43.063 6.938   16.486  1.00 34.02  ? 1109 PHE A HB3   1 
ATOM   2992 H  HD1   . PHE A 1 239 ? 39.815 6.347   17.519  1.00 33.84  ? 1109 PHE A HD1   1 
ATOM   2993 H  HD2   . PHE A 1 239 ? 42.497 9.276   17.031  1.00 43.41  ? 1109 PHE A HD2   1 
ATOM   2994 H  HE1   . PHE A 1 239 ? 38.529 7.737   18.837  1.00 36.44  ? 1109 PHE A HE1   1 
ATOM   2995 H  HE2   . PHE A 1 239 ? 41.214 10.671  18.350  1.00 41.12  ? 1109 PHE A HE2   1 
ATOM   2996 H  HZ    . PHE A 1 239 ? 39.225 9.905   19.255  1.00 41.74  ? 1109 PHE A HZ    1 
ATOM   2997 N  N     . VAL A 1 240 ? 40.007 8.174   13.907  1.00 25.49  ? 1110 VAL A N     1 
ATOM   2998 C  CA    . VAL A 1 240 ? 38.621 8.314   13.444  1.00 22.25  ? 1110 VAL A CA    1 
ATOM   2999 C  C     . VAL A 1 240 ? 38.491 8.545   11.937  1.00 24.30  ? 1110 VAL A C     1 
ATOM   3000 O  O     . VAL A 1 240 ? 37.386 8.706   11.436  1.00 24.86  ? 1110 VAL A O     1 
ATOM   3001 C  CB    . VAL A 1 240 ? 37.867 9.463   14.159  1.00 23.87  ? 1110 VAL A CB    1 
ATOM   3002 C  CG1   . VAL A 1 240 ? 37.737 9.179   15.649  1.00 29.24  ? 1110 VAL A CG1   1 
ATOM   3003 C  CG2   . VAL A 1 240 ? 38.554 10.802  13.910  1.00 25.29  ? 1110 VAL A CG2   1 
ATOM   3004 H  H     . VAL A 1 240 ? 40.486 8.883   13.821  1.00 30.53  ? 1110 VAL A H     1 
ATOM   3005 H  HA    . VAL A 1 240 ? 38.146 7.482   13.651  1.00 26.64  ? 1110 VAL A HA    1 
ATOM   3006 H  HB    . VAL A 1 240 ? 36.962 9.521   13.789  1.00 28.59  ? 1110 VAL A HB    1 
ATOM   3007 H  HG11  . VAL A 1 240 ? 37.268 9.906   16.065  1.00 35.03  ? 1110 VAL A HG11  1 
ATOM   3008 H  HG12  . VAL A 1 240 ? 37.250 8.361   15.770  1.00 35.03  ? 1110 VAL A HG12  1 
ATOM   3009 H  HG13  . VAL A 1 240 ? 38.615 9.096   16.028  1.00 35.03  ? 1110 VAL A HG13  1 
ATOM   3010 H  HG21  . VAL A 1 240 ? 38.066 11.493  14.365  1.00 30.29  ? 1110 VAL A HG21  1 
ATOM   3011 H  HG22  . VAL A 1 240 ? 39.452 10.760  14.247  1.00 30.29  ? 1110 VAL A HG22  1 
ATOM   3012 H  HG23  . VAL A 1 240 ? 38.566 10.976  12.966  1.00 30.29  ? 1110 VAL A HG23  1 
ATOM   3013 N  N     . ARG A 1 241 ? 39.606 8.566   11.216  1.00 23.82  ? 1111 ARG A N     1 
ATOM   3014 C  CA    . ARG A 1 241 ? 39.561 8.823   9.776   1.00 25.78  ? 1111 ARG A CA    1 
ATOM   3015 C  C     . ARG A 1 241 ? 38.874 7.703   9.001   1.00 24.87  ? 1111 ARG A C     1 
ATOM   3016 O  O     . ARG A 1 241 ? 38.882 6.544   9.419   1.00 23.97  ? 1111 ARG A O     1 
ATOM   3017 C  CB    . ARG A 1 241 ? 40.970 9.032   9.218   1.00 28.81  ? 1111 ARG A CB    1 
ATOM   3018 C  CG    . ARG A 1 241 ? 41.576 10.380  9.564   1.00 38.27  ? 1111 ARG A CG    1 
ATOM   3019 C  CD    . ARG A 1 241 ? 42.648 10.778  8.560   1.00 33.86  ? 1111 ARG A CD    1 
ATOM   3020 N  NE    . ARG A 1 241 ? 43.917 10.103  8.809   1.00 53.68  ? 1111 ARG A NE    1 
ATOM   3021 C  CZ    . ARG A 1 241 ? 44.939 10.641  9.471   1.00 53.17  ? 1111 ARG A CZ    1 
ATOM   3022 N  NH1   . ARG A 1 241 ? 44.857 11.873  9.956   1.00 56.58  ? 1111 ARG A NH1   1 
ATOM   3023 N  NH2   . ARG A 1 241 ? 46.051 9.942   9.646   1.00 47.28  ? 1111 ARG A NH2   1 
ATOM   3024 H  H     . ARG A 1 241 ? 40.396 8.437   11.530  1.00 28.52  ? 1111 ARG A H     1 
ATOM   3025 H  HA    . ARG A 1 241 ? 39.054 9.648   9.620   1.00 30.88  ? 1111 ARG A HA    1 
ATOM   3026 H  HB2   . ARG A 1 241 ? 41.553 8.344   9.578   1.00 34.52  ? 1111 ARG A HB2   1 
ATOM   3027 H  HB3   . ARG A 1 241 ? 40.937 8.961   8.252   1.00 34.52  ? 1111 ARG A HB3   1 
ATOM   3028 H  HG2   . ARG A 1 241 ? 40.881 11.057  9.553   1.00 45.86  ? 1111 ARG A HG2   1 
ATOM   3029 H  HG3   . ARG A 1 241 ? 41.985 10.333  10.443  1.00 45.86  ? 1111 ARG A HG3   1 
ATOM   3030 H  HD2   . ARG A 1 241 ? 42.350 10.541  7.668   1.00 40.58  ? 1111 ARG A HD2   1 
ATOM   3031 H  HD3   . ARG A 1 241 ? 42.798 11.735  8.619   1.00 40.58  ? 1111 ARG A HD3   1 
ATOM   3032 H  HE    . ARG A 1 241 ? 44.011 9.303   8.509   1.00 64.36  ? 1111 ARG A HE    1 
ATOM   3033 H  HH11  . ARG A 1 241 ? 44.138 12.332  9.846   1.00 67.84  ? 1111 ARG A HH11  1 
ATOM   3034 H  HH12  . ARG A 1 241 ? 45.523 12.213  10.382  1.00 67.84  ? 1111 ARG A HH12  1 
ATOM   3035 H  HH21  . ARG A 1 241 ? 46.111 9.143   9.334   1.00 56.68  ? 1111 ARG A HH21  1 
ATOM   3036 H  HH22  . ARG A 1 241 ? 46.713 10.288  10.072  1.00 56.68  ? 1111 ARG A HH22  1 
ATOM   3037 N  N     . VAL A 1 242 ? 38.294 8.059   7.858   1.00 23.16  ? 1112 VAL A N     1 
ATOM   3038 C  CA    . VAL A 1 242 ? 37.631 7.089   6.992   1.00 30.26  ? 1112 VAL A CA    1 
ATOM   3039 C  C     . VAL A 1 242 ? 38.645 6.089   6.452   1.00 31.46  ? 1112 VAL A C     1 
ATOM   3040 O  O     . VAL A 1 242 ? 38.349 4.903   6.308   1.00 23.35  ? 1112 VAL A O     1 
ATOM   3041 C  CB    . VAL A 1 242 ? 36.956 7.777   5.788   1.00 34.64  ? 1112 VAL A CB    1 
ATOM   3042 C  CG1   . VAL A 1 242 ? 36.185 6.760   4.957   1.00 32.80  ? 1112 VAL A CG1   1 
ATOM   3043 C  CG2   . VAL A 1 242 ? 36.039 8.894   6.254   1.00 32.68  ? 1112 VAL A CG2   1 
ATOM   3044 H  H     . VAL A 1 242 ? 38.271 8.865   7.560   1.00 27.73  ? 1112 VAL A H     1 
ATOM   3045 H  HA    . VAL A 1 242 ? 36.949 6.603   7.500   1.00 36.25  ? 1112 VAL A HA    1 
ATOM   3046 H  HB    . VAL A 1 242 ? 37.648 8.172   5.217   1.00 41.51  ? 1112 VAL A HB    1 
ATOM   3047 H  HG11  . VAL A 1 242 ? 35.774 7.210   4.215   1.00 39.30  ? 1112 VAL A HG11  1 
ATOM   3048 H  HG12  . VAL A 1 242 ? 36.795 6.091   4.638   1.00 39.30  ? 1112 VAL A HG12  1 
ATOM   3049 H  HG13  . VAL A 1 242 ? 35.511 6.354   5.507   1.00 39.30  ? 1112 VAL A HG13  1 
ATOM   3050 H  HG21  . VAL A 1 242 ? 35.633 9.305   5.487   1.00 39.17  ? 1112 VAL A HG21  1 
ATOM   3051 H  HG22  . VAL A 1 242 ? 35.362 8.524   6.825   1.00 39.17  ? 1112 VAL A HG22  1 
ATOM   3052 H  HG23  . VAL A 1 242 ? 36.557 9.542   6.736   1.00 39.17  ? 1112 VAL A HG23  1 
ATOM   3053 N  N     . VAL A 1 243 ? 39.836 6.588   6.136   1.00 25.00  ? 1113 VAL A N     1 
ATOM   3054 C  CA    . VAL A 1 243 ? 40.929 5.752   5.654   1.00 29.22  ? 1113 VAL A CA    1 
ATOM   3055 C  C     . VAL A 1 243 ? 42.173 5.955   6.514   1.00 31.96  ? 1113 VAL A C     1 
ATOM   3056 O  O     . VAL A 1 243 ? 42.584 7.087   6.768   1.00 28.06  ? 1113 VAL A O     1 
ATOM   3057 C  CB    . VAL A 1 243 ? 41.299 6.091   4.197   1.00 33.21  ? 1113 VAL A CB    1 
ATOM   3058 C  CG1   . VAL A 1 243 ? 42.420 5.181   3.709   1.00 33.46  ? 1113 VAL A CG1   1 
ATOM   3059 C  CG2   . VAL A 1 243 ? 40.085 5.978   3.294   1.00 38.84  ? 1113 VAL A CG2   1 
ATOM   3060 H  H     . VAL A 1 243 ? 40.038 7.422   6.193   1.00 29.94  ? 1113 VAL A H     1 
ATOM   3061 H  HA    . VAL A 1 243 ? 40.667 4.809   5.700   1.00 35.01  ? 1113 VAL A HA    1 
ATOM   3062 H  HB    . VAL A 1 243 ? 41.621 7.015   4.157   1.00 39.80  ? 1113 VAL A HB    1 
ATOM   3063 H  HG11  . VAL A 1 243 ? 42.633 5.410   2.801   1.00 40.10  ? 1113 VAL A HG11  1 
ATOM   3064 H  HG12  . VAL A 1 243 ? 43.190 5.307   4.268   1.00 40.10  ? 1113 VAL A HG12  1 
ATOM   3065 H  HG13  . VAL A 1 243 ? 42.125 4.269   3.756   1.00 40.10  ? 1113 VAL A HG13  1 
ATOM   3066 H  HG21  . VAL A 1 243 ? 40.343 6.193   2.395   1.00 46.55  ? 1113 VAL A HG21  1 
ATOM   3067 H  HG22  . VAL A 1 243 ? 39.750 5.079   3.332   1.00 46.55  ? 1113 VAL A HG22  1 
ATOM   3068 H  HG23  . VAL A 1 243 ? 39.412 6.591   3.598   1.00 46.55  ? 1113 VAL A HG23  1 
ATOM   3069 N  N     A SER A 1 244 ? 42.757 4.857   6.978   0.45 26.61  ? 1114 SER A N     1 
ATOM   3070 N  N     B SER A 1 244 ? 42.765 4.848   6.955   0.55 26.86  ? 1114 SER A N     1 
ATOM   3071 C  CA    A SER A 1 244 ? 44.041 4.910   7.665   0.45 28.44  ? 1114 SER A CA    1 
ATOM   3072 C  CA    B SER A 1 244 ? 43.981 4.875   7.762   0.55 29.05  ? 1114 SER A CA    1 
ATOM   3073 C  C     A SER A 1 244 ? 44.646 3.516   7.766   0.45 43.18  ? 1114 SER A C     1 
ATOM   3074 C  C     B SER A 1 244 ? 44.645 3.500   7.751   0.55 43.88  ? 1114 SER A C     1 
ATOM   3075 O  O     A SER A 1 244 ? 43.942 2.511   7.663   0.45 32.30  ? 1114 SER A O     1 
ATOM   3076 O  O     B SER A 1 244 ? 43.979 2.486   7.547   0.55 34.22  ? 1114 SER A O     1 
ATOM   3077 C  CB    A SER A 1 244 ? 43.897 5.526   9.059   0.45 34.79  ? 1114 SER A CB    1 
ATOM   3078 C  CB    B SER A 1 244 ? 43.650 5.282   9.200   0.55 34.21  ? 1114 SER A CB    1 
ATOM   3079 O  OG    A SER A 1 244 ? 43.230 4.650   9.952   0.45 26.56  ? 1114 SER A OG    1 
ATOM   3080 O  OG    B SER A 1 244 ? 44.783 5.182   10.046  0.55 35.16  ? 1114 SER A OG    1 
ATOM   3081 H  H     A SER A 1 244 ? 42.429 4.065   6.907   0.45 31.88  ? 1114 SER A H     1 
ATOM   3082 H  H     B SER A 1 244 ? 42.475 4.054   6.797   0.55 32.17  ? 1114 SER A H     1 
ATOM   3083 H  HA    A SER A 1 244 ? 44.657 5.471   7.148   0.45 34.07  ? 1114 SER A HA    1 
ATOM   3084 H  HA    B SER A 1 244 ? 44.608 5.529   7.389   0.55 34.81  ? 1114 SER A HA    1 
ATOM   3085 H  HB2   A SER A 1 244 ? 44.780 5.717   9.410   0.45 41.69  ? 1114 SER A HB2   1 
ATOM   3086 H  HB2   B SER A 1 244 ? 43.339 6.201   9.202   0.55 41.00  ? 1114 SER A HB2   1 
ATOM   3087 H  HB3   A SER A 1 244 ? 43.386 6.347   8.987   0.45 41.69  ? 1114 SER A HB3   1 
ATOM   3088 H  HB3   B SER A 1 244 ? 42.954 4.698   9.539   0.55 41.00  ? 1114 SER A HB3   1 
ATOM   3089 H  HG    A SER A 1 244 ? 43.164 4.999   10.691  0.45 31.81  ? 1114 SER A HG    1 
ATOM   3090 H  HG    B SER A 1 244 ? 45.431 4.920   9.617   0.55 42.14  ? 1114 SER A HG    1 
ATOM   3091 N  N     . ALA A 1 245 ? 45.957 3.466   7.965   1.00 36.66  ? 1115 ALA A N     1 
ATOM   3092 C  CA    . ALA A 1 245 ? 46.676 2.200   8.042   1.00 36.39  ? 1115 ALA A CA    1 
ATOM   3093 C  C     . ALA A 1 245 ? 46.214 1.387   9.246   1.00 38.03  ? 1115 ALA A C     1 
ATOM   3094 O  O     . ALA A 1 245 ? 46.272 0.159   9.234   1.00 38.16  ? 1115 ALA A O     1 
ATOM   3095 C  CB    . ALA A 1 245 ? 48.174 2.448   8.119   1.00 43.64  ? 1115 ALA A CB    1 
ATOM   3096 H  H     A ALA A 1 245 ? 46.459 4.158   8.060   0.50 43.94  ? 1115 ALA A H     1 
ATOM   3097 H  H     B ALA A 1 245 ? 46.453 4.161   8.069   0.50 43.94  ? 1115 ALA A H     1 
ATOM   3098 H  HA    . ALA A 1 245 ? 46.495 1.678   7.233   1.00 43.61  ? 1115 ALA A HA    1 
ATOM   3099 H  HB1   . ALA A 1 245 ? 48.627 1.603   8.169   1.00 52.31  ? 1115 ALA A HB1   1 
ATOM   3100 H  HB2   . ALA A 1 245 ? 48.452 2.924   7.333   1.00 52.31  ? 1115 ALA A HB2   1 
ATOM   3101 H  HB3   . ALA A 1 245 ? 48.364 2.969   8.903   1.00 52.31  ? 1115 ALA A HB3   1 
ATOM   3102 N  N     . GLY A 1 246 ? 45.758 2.075   10.288  1.00 29.73  ? 1116 GLY A N     1 
ATOM   3103 C  CA    . GLY A 1 246 ? 45.319 1.407   11.500  1.00 32.61  ? 1116 GLY A CA    1 
ATOM   3104 C  C     . GLY A 1 246 ? 43.832 1.099   11.515  1.00 33.91  ? 1116 GLY A C     1 
ATOM   3105 O  O     . GLY A 1 246 ? 43.259 0.804   12.561  1.00 33.88  ? 1116 GLY A O     1 
ATOM   3106 H  H     . GLY A 1 246 ? 45.694 2.932   10.315  1.00 35.62  ? 1116 GLY A H     1 
ATOM   3107 H  HA2   . GLY A 1 246 ? 45.803 0.572   11.598  1.00 39.07  ? 1116 GLY A HA2   1 
ATOM   3108 H  HA3   . GLY A 1 246 ? 45.521 1.968   12.265  1.00 39.07  ? 1116 GLY A HA3   1 
ATOM   3109 N  N     . ASN A 1 247 ? 43.205 1.161   10.346  1.00 27.52  ? 1117 ASN A N     1 
ATOM   3110 C  CA    . ASN A 1 247 ? 41.781 0.883   10.223  1.00 25.49  ? 1117 ASN A CA    1 
ATOM   3111 C  C     . ASN A 1 247 ? 41.582 -0.405  9.427   1.00 25.12  ? 1117 ASN A C     1 
ATOM   3112 O  O     . ASN A 1 247 ? 41.963 -0.490  8.262   1.00 26.11  ? 1117 ASN A O     1 
ATOM   3113 C  CB    . ASN A 1 247 ? 41.081 2.070   9.552   1.00 27.26  ? 1117 ASN A CB    1 
ATOM   3114 C  CG    . ASN A 1 247 ? 39.591 1.848   9.356   1.00 28.17  ? 1117 ASN A CG    1 
ATOM   3115 O  OD1   . ASN A 1 247 ? 39.043 0.813   9.731   1.00 25.93  ? 1117 ASN A OD1   1 
ATOM   3116 N  ND2   . ASN A 1 247 ? 38.927 2.834   8.770   1.00 23.26  ? 1117 ASN A ND2   1 
ATOM   3117 H  H     . ASN A 1 247 ? 43.587 1.365   9.603   1.00 32.97  ? 1117 ASN A H     1 
ATOM   3118 H  HA    . ASN A 1 247 ? 41.395 0.759   11.115  1.00 30.53  ? 1117 ASN A HA    1 
ATOM   3119 H  HB2   . ASN A 1 247 ? 41.195 2.857   10.106  1.00 32.65  ? 1117 ASN A HB2   1 
ATOM   3120 H  HB3   . ASN A 1 247 ? 41.478 2.218   8.679   1.00 32.65  ? 1117 ASN A HB3   1 
ATOM   3121 H  HD21  . ASN A 1 247 ? 38.081 2.762   8.635   1.00 27.86  ? 1117 ASN A HD21  1 
ATOM   3122 H  HD22  . ASN A 1 247 ? 39.342 3.546   8.526   1.00 27.86  ? 1117 ASN A HD22  1 
ATOM   3123 N  N     . LEU A 1 248 ? 41.007 -1.414  10.076  1.00 25.63  ? 1118 LEU A N     1 
ATOM   3124 C  CA    . LEU A 1 248 ? 40.770 -2.708  9.444   1.00 20.90  ? 1118 LEU A CA    1 
ATOM   3125 C  C     . LEU A 1 248 ? 40.014 -2.560  8.131   1.00 24.00  ? 1118 LEU A C     1 
ATOM   3126 O  O     . LEU A 1 248 ? 40.291 -3.264  7.167   1.00 24.73  ? 1118 LEU A O     1 
ATOM   3127 C  CB    . LEU A 1 248 ? 39.973 -3.630  10.377  1.00 23.73  ? 1118 LEU A CB    1 
ATOM   3128 C  CG    . LEU A 1 248 ? 40.636 -4.046  11.690  1.00 30.10  ? 1118 LEU A CG    1 
ATOM   3129 C  CD1   . LEU A 1 248 ? 39.834 -5.154  12.371  1.00 26.62  ? 1118 LEU A CD1   1 
ATOM   3130 C  CD2   . LEU A 1 248 ? 42.056 -4.496  11.434  1.00 33.09  ? 1118 LEU A CD2   1 
ATOM   3131 H  H     . LEU A 1 248 ? 40.743 -1.374  10.893  1.00 30.70  ? 1118 LEU A H     1 
ATOM   3132 H  HA    . LEU A 1 248 ? 41.631 -3.136  9.254   1.00 25.03  ? 1118 LEU A HA    1 
ATOM   3133 H  HB2   . LEU A 1 248 ? 39.145 -3.180  10.607  1.00 28.42  ? 1118 LEU A HB2   1 
ATOM   3134 H  HB3   . LEU A 1 248 ? 39.769 -4.444  9.891   1.00 28.42  ? 1118 LEU A HB3   1 
ATOM   3135 H  HG    . LEU A 1 248 ? 40.665 -3.283  12.288  1.00 36.07  ? 1118 LEU A HG    1 
ATOM   3136 H  HD11  . LEU A 1 248 ? 40.270 -5.397  13.191  1.00 31.89  ? 1118 LEU A HD11  1 
ATOM   3137 H  HD12  . LEU A 1 248 ? 38.948 -4.831  12.554  1.00 31.89  ? 1118 LEU A HD12  1 
ATOM   3138 H  HD13  . LEU A 1 248 ? 39.790 -5.914  11.786  1.00 31.89  ? 1118 LEU A HD13  1 
ATOM   3139 H  HD21  . LEU A 1 248 ? 42.457 -4.754  12.267  1.00 39.65  ? 1118 LEU A HD21  1 
ATOM   3140 H  HD22  . LEU A 1 248 ? 42.042 -5.244  10.832  1.00 39.65  ? 1118 LEU A HD22  1 
ATOM   3141 H  HD23  . LEU A 1 248 ? 42.548 -3.770  11.044  1.00 39.65  ? 1118 LEU A HD23  1 
ATOM   3142 N  N     . LEU A 1 249 ? 39.048 -1.650  8.094   1.00 21.77  ? 1119 LEU A N     1 
ATOM   3143 C  CA    . LEU A 1 249 ? 38.208 -1.497  6.913   1.00 21.41  ? 1119 LEU A CA    1 
ATOM   3144 C  C     . LEU A 1 249 ? 38.977 -0.919  5.726   1.00 28.14  ? 1119 LEU A C     1 
ATOM   3145 O  O     . LEU A 1 249 ? 38.542 -1.045  4.584   1.00 23.85  ? 1119 LEU A O     1 
ATOM   3146 C  CB    . LEU A 1 249 ? 36.987 -0.635  7.236   1.00 21.63  ? 1119 LEU A CB    1 
ATOM   3147 C  CG    . LEU A 1 249 ? 36.087 -1.195  8.341   1.00 25.95  ? 1119 LEU A CG    1 
ATOM   3148 C  CD1   . LEU A 1 249 ? 34.968 -0.209  8.643   1.00 22.87  ? 1119 LEU A CD1   1 
ATOM   3149 C  CD2   . LEU A 1 249 ? 35.516 -2.567  7.966   1.00 21.80  ? 1119 LEU A CD2   1 
ATOM   3150 H  H     . LEU A 1 249 ? 38.860 -1.111  8.737   1.00 26.06  ? 1119 LEU A H     1 
ATOM   3151 H  HA    . LEU A 1 249 ? 37.881 -2.382  6.648   1.00 25.63  ? 1119 LEU A HA    1 
ATOM   3152 H  HB2   . LEU A 1 249 ? 37.293 0.240   7.521   1.00 25.90  ? 1119 LEU A HB2   1 
ATOM   3153 H  HB3   . LEU A 1 249 ? 36.449 -0.548  6.434   1.00 25.90  ? 1119 LEU A HB3   1 
ATOM   3154 H  HG    . LEU A 1 249 ? 36.613 -1.303  9.149   1.00 31.08  ? 1119 LEU A HG    1 
ATOM   3155 H  HD11  . LEU A 1 249 ? 35.354 0.621   8.933   1.00 27.39  ? 1119 LEU A HD11  1 
ATOM   3156 H  HD12  . LEU A 1 249 ? 34.451 -0.070  7.847   1.00 27.39  ? 1119 LEU A HD12  1 
ATOM   3157 H  HD13  . LEU A 1 249 ? 34.412 -0.571  9.337   1.00 27.39  ? 1119 LEU A HD13  1 
ATOM   3158 H  HD21  . LEU A 1 249 ? 34.960 -2.881  8.683   1.00 26.10  ? 1119 LEU A HD21  1 
ATOM   3159 H  HD22  . LEU A 1 249 ? 34.998 -2.481  7.163   1.00 26.10  ? 1119 LEU A HD22  1 
ATOM   3160 H  HD23  . LEU A 1 249 ? 36.243 -3.179  7.823   1.00 26.10  ? 1119 LEU A HD23  1 
ATOM   3161 N  N     . SER A 1 250 ? 40.119 -0.292  5.994   1.00 23.84  ? 1120 SER A N     1 
ATOM   3162 C  CA    . SER A 1 250 ? 40.984 0.204   4.926   1.00 25.93  ? 1120 SER A CA    1 
ATOM   3163 C  C     . SER A 1 250 ? 41.778 -0.938  4.286   1.00 30.54  ? 1120 SER A C     1 
ATOM   3164 O  O     . SER A 1 250 ? 42.473 -0.736  3.290   1.00 26.78  ? 1120 SER A O     1 
ATOM   3165 C  CB    . SER A 1 250 ? 41.950 1.264   5.461   1.00 27.69  ? 1120 SER A CB    1 
ATOM   3166 O  OG    . SER A 1 250 ? 41.252 2.371   6.006   1.00 30.44  ? 1120 SER A OG    1 
ATOM   3167 H  H     . SER A 1 250 ? 40.417 -0.141  6.787   1.00 28.55  ? 1120 SER A H     1 
ATOM   3168 H  HA    . SER A 1 250 ? 40.431 0.618   4.231   1.00 31.06  ? 1120 SER A HA    1 
ATOM   3169 H  HB2   . SER A 1 250 ? 42.499 0.867   6.155   1.00 33.17  ? 1120 SER A HB2   1 
ATOM   3170 H  HB3   . SER A 1 250 ? 42.511 1.574   4.733   1.00 33.17  ? 1120 SER A HB3   1 
ATOM   3171 H  HG    . SER A 1 250 ? 40.443 2.253   5.941   1.00 36.48  ? 1120 SER A HG    1 
ATOM   3172 N  N     . HIS A 1 251 ? 41.674 -2.134  4.862   1.00 22.51  ? 1121 HIS A N     1 
ATOM   3173 C  CA    . HIS A 1 251 ? 42.411 -3.293  4.362   1.00 26.97  ? 1121 HIS A CA    1 
ATOM   3174 C  C     . HIS A 1 251 ? 41.509 -4.273  3.628   1.00 28.17  ? 1121 HIS A C     1 
ATOM   3175 O  O     . HIS A 1 251 ? 41.964 -5.325  3.179   1.00 29.46  ? 1121 HIS A O     1 
ATOM   3176 C  CB    . HIS A 1 251 ? 43.135 -4.006  5.507   1.00 23.73  ? 1121 HIS A CB    1 
ATOM   3177 C  CG    . HIS A 1 251 ? 44.352 -3.279  5.985   1.00 28.56  ? 1121 HIS A CG    1 
ATOM   3178 N  ND1   . HIS A 1 251 ? 44.309 -2.343  6.997   1.00 40.21  ? 1121 HIS A ND1   1 
ATOM   3179 C  CD2   . HIS A 1 251 ? 45.641 -3.329  5.576   1.00 30.87  ? 1121 HIS A CD2   1 
ATOM   3180 C  CE1   . HIS A 1 251 ? 45.520 -1.857  7.195   1.00 24.62  ? 1121 HIS A CE1   1 
ATOM   3181 N  NE2   . HIS A 1 251 ? 46.348 -2.439  6.346   1.00 33.45  ? 1121 HIS A NE2   1 
ATOM   3182 H  H     . HIS A 1 251 ? 41.181 -2.301  5.546   1.00 26.96  ? 1121 HIS A H     1 
ATOM   3183 H  HA    . HIS A 1 251 ? 43.090 -2.982  3.728   1.00 32.30  ? 1121 HIS A HA    1 
ATOM   3184 H  HB2   . HIS A 1 251 ? 42.527 -4.093  6.258   1.00 28.42  ? 1121 HIS A HB2   1 
ATOM   3185 H  HB3   . HIS A 1 251 ? 43.413 -4.884  5.204   1.00 28.42  ? 1121 HIS A HB3   1 
ATOM   3186 H  HD1   . HIS A 1 251 ? 43.603 -2.114  7.432   1.00 48.19  ? 1121 HIS A HD1   1 
ATOM   3187 H  HD2   . HIS A 1 251 ? 45.984 -3.869  4.901   1.00 36.98  ? 1121 HIS A HD2   1 
ATOM   3188 H  HE1   . HIS A 1 251 ? 45.752 -1.216  7.828   1.00 29.48  ? 1121 HIS A HE1   1 
ATOM   3189 H  HE2   . HIS A 1 251 ? 47.192 -2.286  6.286   1.00 40.08  ? 1121 HIS A HE2   1 
ATOM   3190 N  N     . VAL A 1 252 ? 40.232 -3.927  3.502   1.00 28.22  ? 1122 VAL A N     1 
ATOM   3191 C  CA    . VAL A 1 252 ? 39.284 -4.783  2.802   1.00 23.68  ? 1122 VAL A CA    1 
ATOM   3192 C  C     . VAL A 1 252 ? 39.648 -4.868  1.323   1.00 32.80  ? 1122 VAL A C     1 
ATOM   3193 O  O     . VAL A 1 252 ? 39.443 -5.897  0.691   1.00 29.46  ? 1122 VAL A O     1 
ATOM   3194 C  CB    . VAL A 1 252 ? 37.835 -4.275  2.958   1.00 24.69  ? 1122 VAL A CB    1 
ATOM   3195 C  CG1   . VAL A 1 252 ? 36.895 -5.039  2.037   1.00 31.19  ? 1122 VAL A CG1   1 
ATOM   3196 C  CG2   . VAL A 1 252 ? 37.383 -4.396  4.413   1.00 21.78  ? 1122 VAL A CG2   1 
ATOM   3197 H  H     . VAL A 1 252 ? 39.891 -3.201  3.812   1.00 33.81  ? 1122 VAL A H     1 
ATOM   3198 H  HA    . VAL A 1 252 ? 39.331 -5.687  3.178   1.00 28.36  ? 1122 VAL A HA    1 
ATOM   3199 H  HB    . VAL A 1 252 ? 37.801 -3.328  2.708   1.00 29.57  ? 1122 VAL A HB    1 
ATOM   3200 H  HG11  . VAL A 1 252 ? 36.003 -4.704  2.154   1.00 37.37  ? 1122 VAL A HG11  1 
ATOM   3201 H  HG12  . VAL A 1 252 ? 37.176 -4.912  1.128   1.00 37.37  ? 1122 VAL A HG12  1 
ATOM   3202 H  HG13  . VAL A 1 252 ? 36.927 -5.972  2.262   1.00 37.37  ? 1122 VAL A HG13  1 
ATOM   3203 H  HG21  . VAL A 1 252 ? 36.482 -4.075  4.488   1.00 26.08  ? 1122 VAL A HG21  1 
ATOM   3204 H  HG22  . VAL A 1 252 ? 37.426 -5.318  4.678   1.00 26.08  ? 1122 VAL A HG22  1 
ATOM   3205 H  HG23  . VAL A 1 252 ? 37.965 -3.869  4.966   1.00 26.08  ? 1122 VAL A HG23  1 
ATOM   3206 N  N     . GLY A 1 253 ? 40.184 -3.782  0.776   1.00 35.16  ? 1123 GLY A N     1 
ATOM   3207 C  CA    . GLY A 1 253 ? 40.661 -3.779  -0.596  1.00 33.84  ? 1123 GLY A CA    1 
ATOM   3208 C  C     . GLY A 1 253 ? 39.641 -3.270  -1.599  1.00 30.09  ? 1123 GLY A C     1 
ATOM   3209 O  O     . GLY A 1 253 ? 39.956 -3.075  -2.773  1.00 38.49  ? 1123 GLY A O     1 
ATOM   3210 H  H     . GLY A 1 253 ? 40.281 -3.030  1.182   1.00 42.14  ? 1123 GLY A H     1 
ATOM   3211 H  HA2   . GLY A 1 253 ? 41.451 -3.220  -0.658  1.00 40.56  ? 1123 GLY A HA2   1 
ATOM   3212 H  HA3   . GLY A 1 253 ? 40.909 -4.682  -0.849  1.00 40.56  ? 1123 GLY A HA3   1 
ATOM   3213 N  N     . HIS A 1 254 ? 38.413 -3.059  -1.139  1.00 34.33  ? 1124 HIS A N     1 
ATOM   3214 C  CA    . HIS A 1 254 ? 37.354 -2.537  -1.995  1.00 33.48  ? 1124 HIS A CA    1 
ATOM   3215 C  C     . HIS A 1 254 ? 36.324 -1.774  -1.180  1.00 37.59  ? 1124 HIS A C     1 
ATOM   3216 O  O     . HIS A 1 254 ? 36.353 -1.790  0.049   1.00 25.18  ? 1124 HIS A O     1 
ATOM   3217 C  CB    . HIS A 1 254 ? 36.670 -3.668  -2.765  1.00 28.72  ? 1124 HIS A CB    1 
ATOM   3218 C  CG    . HIS A 1 254 ? 36.107 -4.745  -1.888  1.00 23.78  ? 1124 HIS A CG    1 
ATOM   3219 N  ND1   . HIS A 1 254 ? 36.859 -5.810  -1.444  1.00 24.73  ? 1124 HIS A ND1   1 
ATOM   3220 C  CD2   . HIS A 1 254 ? 34.864 -4.924  -1.383  1.00 28.94  ? 1124 HIS A CD2   1 
ATOM   3221 C  CE1   . HIS A 1 254 ? 36.104 -6.601  -0.702  1.00 24.18  ? 1124 HIS A CE1   1 
ATOM   3222 N  NE2   . HIS A 1 254 ? 34.889 -6.087  -0.649  1.00 27.50  ? 1124 HIS A NE2   1 
ATOM   3223 H  H     . HIS A 1 254 ? 38.166 -3.211  -0.329  1.00 41.14  ? 1124 HIS A H     1 
ATOM   3224 H  HA    . HIS A 1 254 ? 37.745 -1.919  -2.647  1.00 40.12  ? 1124 HIS A HA    1 
ATOM   3225 H  HB2   . HIS A 1 254 ? 35.940 -3.296  -3.283  1.00 34.41  ? 1124 HIS A HB2   1 
ATOM   3226 H  HB3   . HIS A 1 254 ? 37.319 -4.079  -3.358  1.00 34.41  ? 1124 HIS A HB3   1 
ATOM   3227 H  HD1   . HIS A 1 254 ? 37.690 -5.942  -1.624  1.00 29.62  ? 1124 HIS A HD1   1 
ATOM   3228 H  HD2   . HIS A 1 254 ? 34.130 -4.367  -1.510  1.00 34.67  ? 1124 HIS A HD2   1 
ATOM   3229 H  HE1   . HIS A 1 254 ? 36.381 -7.385  -0.285  1.00 28.96  ? 1124 HIS A HE1   1 
ATOM   3230 H  HE2   . HIS A 1 254 ? 34.223 -6.422  -0.222  1.00 32.94  ? 1124 HIS A HE2   1 
ATOM   3231 N  N     . THR A 1 255 ? 35.401 -1.125  -1.879  1.00 28.64  ? 1125 THR A N     1 
ATOM   3232 C  CA    . THR A 1 255 ? 34.429 -0.249  -1.247  1.00 27.41  ? 1125 THR A CA    1 
ATOM   3233 C  C     . THR A 1 255 ? 33.318 -1.037  -0.571  1.00 29.31  ? 1125 THR A C     1 
ATOM   3234 O  O     . THR A 1 255 ? 32.721 -1.932  -1.166  1.00 31.98  ? 1125 THR A O     1 
ATOM   3235 C  CB    . THR A 1 255 ? 33.806 0.717   -2.275  1.00 31.53  ? 1125 THR A CB    1 
ATOM   3236 O  OG1   . THR A 1 255 ? 34.810 1.631   -2.736  1.00 31.32  ? 1125 THR A OG1   1 
ATOM   3237 C  CG2   . THR A 1 255 ? 32.662 1.504   -1.655  1.00 27.73  ? 1125 THR A CG2   1 
ATOM   3238 H  H     . THR A 1 255 ? 35.317 -1.177  -2.734  1.00 34.32  ? 1125 THR A H     1 
ATOM   3239 H  HA    . THR A 1 255 ? 34.881 0.287   -0.562  1.00 32.84  ? 1125 THR A HA    1 
ATOM   3240 H  HB    . THR A 1 255 ? 33.460 0.211   -3.027  1.00 37.79  ? 1125 THR A HB    1 
ATOM   3241 H  HG1   . THR A 1 255 ? 35.107 2.062   -2.105  1.00 37.53  ? 1125 THR A HG1   1 
ATOM   3242 H  HG21  . THR A 1 255 ? 32.283 2.100   -2.305  1.00 33.22  ? 1125 THR A HG21  1 
ATOM   3243 H  HG22  . THR A 1 255 ? 31.979 0.902   -1.348  1.00 33.22  ? 1125 THR A HG22  1 
ATOM   3244 H  HG23  . THR A 1 255 ? 32.983 2.017   -0.909  1.00 33.22  ? 1125 THR A HG23  1 
ATOM   3245 N  N     . ILE A 1 256 ? 33.070 -0.706  0.690   1.00 22.42  ? 1126 ILE A N     1 
ATOM   3246 C  CA    . ILE A 1 256 ? 31.889 -1.165  1.403   1.00 23.03  ? 1126 ILE A CA    1 
ATOM   3247 C  C     . ILE A 1 256 ? 31.093 0.078   1.778   1.00 20.90  ? 1126 ILE A C     1 
ATOM   3248 O  O     . ILE A 1 256 ? 31.406 0.746   2.760   1.00 23.14  ? 1126 ILE A O     1 
ATOM   3249 C  CB    . ILE A 1 256 ? 32.269 -1.950  2.672   1.00 22.68  ? 1126 ILE A CB    1 
ATOM   3250 C  CG1   . ILE A 1 256 ? 33.197 -3.115  2.315   1.00 30.62  ? 1126 ILE A CG1   1 
ATOM   3251 C  CG2   . ILE A 1 256 ? 31.019 -2.458  3.390   1.00 22.21  ? 1126 ILE A CG2   1 
ATOM   3252 C  CD1   . ILE A 1 256 ? 33.557 -4.001  3.501   1.00 38.36  ? 1126 ILE A CD1   1 
ATOM   3253 H  H     . ILE A 1 256 ? 33.584 -0.205  1.164   1.00 26.85  ? 1126 ILE A H     1 
ATOM   3254 H  HA    . ILE A 1 256 ? 31.343 -1.735  0.822   1.00 27.57  ? 1126 ILE A HA    1 
ATOM   3255 H  HB    . ILE A 1 256 ? 32.744 -1.352  3.270   1.00 27.16  ? 1126 ILE A HB    1 
ATOM   3256 H  HG12  . ILE A 1 256 ? 32.760 -3.671  1.652   1.00 36.69  ? 1126 ILE A HG12  1 
ATOM   3257 H  HG13  . ILE A 1 256 ? 34.022 -2.757  1.951   1.00 36.69  ? 1126 ILE A HG13  1 
ATOM   3258 H  HG21  . ILE A 1 256 ? 31.285 -2.942  4.175   1.00 26.59  ? 1126 ILE A HG21  1 
ATOM   3259 H  HG22  . ILE A 1 256 ? 30.474 -1.707  3.637   1.00 26.59  ? 1126 ILE A HG22  1 
ATOM   3260 H  HG23  . ILE A 1 256 ? 30.532 -3.036  2.798   1.00 26.59  ? 1126 ILE A HG23  1 
ATOM   3261 H  HD11  . ILE A 1 256 ? 34.003 -3.468  4.164   1.00 45.97  ? 1126 ILE A HD11  1 
ATOM   3262 H  HD12  . ILE A 1 256 ? 32.753 -4.374  3.867   1.00 45.97  ? 1126 ILE A HD12  1 
ATOM   3263 H  HD13  . ILE A 1 256 ? 34.138 -4.704  3.200   1.00 45.97  ? 1126 ILE A HD13  1 
ATOM   3264 N  N     . LEU A 1 257 ? 30.073 0.390   0.984   1.00 24.94  ? 1127 LEU A N     1 
ATOM   3265 C  CA    . LEU A 1 257 ? 29.365 1.660   1.099   1.00 32.02  ? 1127 LEU A CA    1 
ATOM   3266 C  C     . LEU A 1 257 ? 28.860 1.921   2.515   1.00 30.66  ? 1127 LEU A C     1 
ATOM   3267 O  O     . LEU A 1 257 ? 28.203 1.074   3.115   1.00 34.66  ? 1127 LEU A O     1 
ATOM   3268 C  CB    . LEU A 1 257 ? 28.192 1.701   0.116   1.00 32.87  ? 1127 LEU A CB    1 
ATOM   3269 C  CG    . LEU A 1 257 ? 28.559 1.908   -1.355  1.00 35.57  ? 1127 LEU A CG    1 
ATOM   3270 C  CD1   . LEU A 1 257 ? 27.307 1.877   -2.210  1.00 43.19  ? 1127 LEU A CD1   1 
ATOM   3271 C  CD2   . LEU A 1 257 ? 29.306 3.221   -1.548  1.00 33.86  ? 1127 LEU A CD2   1 
ATOM   3272 H  H     . LEU A 1 257 ? 29.768 -0.124  0.365   1.00 29.88  ? 1127 LEU A H     1 
ATOM   3273 H  HA    . LEU A 1 257 ? 29.979 2.386   0.862   1.00 38.37  ? 1127 LEU A HA    1 
ATOM   3274 H  HB2   . LEU A 1 257 ? 27.712 0.860   0.178   1.00 39.39  ? 1127 LEU A HB2   1 
ATOM   3275 H  HB3   . LEU A 1 257 ? 27.604 2.428   0.372   1.00 39.39  ? 1127 LEU A HB3   1 
ATOM   3276 H  HG    . LEU A 1 257 ? 29.139 1.186   -1.643  1.00 42.63  ? 1127 LEU A HG    1 
ATOM   3277 H  HD11  . LEU A 1 257 ? 27.553 2.008   -3.128  1.00 51.77  ? 1127 LEU A HD11  1 
ATOM   3278 H  HD12  . LEU A 1 257 ? 26.879 1.024   -2.104  1.00 51.77  ? 1127 LEU A HD12  1 
ATOM   3279 H  HD13  . LEU A 1 257 ? 26.717 2.578   -1.925  1.00 51.77  ? 1127 LEU A HD13  1 
ATOM   3280 H  HD21  . LEU A 1 257 ? 28.745 3.945   -1.260  1.00 40.58  ? 1127 LEU A HD21  1 
ATOM   3281 H  HD22  . LEU A 1 257 ? 30.111 3.202   -1.024  1.00 40.58  ? 1127 LEU A HD22  1 
ATOM   3282 H  HD23  . LEU A 1 257 ? 29.522 3.324   -2.477  1.00 40.58  ? 1127 LEU A HD23  1 
ATOM   3283 N  N     . GLY A 1 258 ? 29.174 3.101   3.041   1.00 24.53  ? 1128 GLY A N     1 
ATOM   3284 C  CA    . GLY A 1 258 ? 28.693 3.513   4.349   1.00 29.89  ? 1128 GLY A CA    1 
ATOM   3285 C  C     . GLY A 1 258 ? 29.589 3.064   5.486   1.00 30.05  ? 1128 GLY A C     1 
ATOM   3286 O  O     . GLY A 1 258 ? 29.460 3.543   6.614   1.00 25.91  ? 1128 GLY A O     1 
ATOM   3287 H  H     . GLY A 1 258 ? 29.670 3.686   2.653   1.00 29.38  ? 1128 GLY A H     1 
ATOM   3288 H  HA2   . GLY A 1 258 ? 28.628 4.480   4.376   1.00 35.81  ? 1128 GLY A HA2   1 
ATOM   3289 H  HA3   . GLY A 1 258 ? 27.808 3.144   4.495   1.00 35.81  ? 1128 GLY A HA3   1 
ATOM   3290 N  N     . MET A 1 259 ? 30.501 2.143   5.198   1.00 21.47  ? 1129 MET A N     1 
ATOM   3291 C  CA    . MET A 1 259 ? 31.449 1.687   6.209   1.00 22.93  ? 1129 MET A CA    1 
ATOM   3292 C  C     . MET A 1 259 ? 32.833 2.279   5.970   1.00 25.72  ? 1129 MET A C     1 
ATOM   3293 O  O     . MET A 1 259 ? 33.337 3.013   6.814   1.00 22.55  ? 1129 MET A O     1 
ATOM   3294 C  CB    . MET A 1 259 ? 31.501 0.163   6.255   1.00 18.13  ? 1129 MET A CB    1 
ATOM   3295 C  CG    . MET A 1 259 ? 30.154 -0.460  6.581   1.00 19.00  ? 1129 MET A CG    1 
ATOM   3296 S  SD    . MET A 1 259 ? 30.297 -2.181  7.098   1.00 25.27  ? 1129 MET A SD    1 
ATOM   3297 C  CE    . MET A 1 259 ? 31.126 -1.979  8.675   1.00 24.69  ? 1129 MET A CE    1 
ATOM   3298 H  H     . MET A 1 259 ? 30.592 1.767   4.429   1.00 25.71  ? 1129 MET A H     1 
ATOM   3299 H  HA    . MET A 1 259 ? 31.133 1.992   7.084   1.00 27.46  ? 1129 MET A HA    1 
ATOM   3300 H  HB2   . MET A 1 259 ? 31.783 -0.170  5.389   1.00 21.71  ? 1129 MET A HB2   1 
ATOM   3301 H  HB3   . MET A 1 259 ? 32.132 -0.112  6.938   1.00 21.71  ? 1129 MET A HB3   1 
ATOM   3302 H  HG2   . MET A 1 259 ? 29.742 0.038   7.305   1.00 22.74  ? 1129 MET A HG2   1 
ATOM   3303 H  HG3   . MET A 1 259 ? 29.591 -0.429  5.792   1.00 22.74  ? 1129 MET A HG3   1 
ATOM   3304 H  HE1   . MET A 1 259 ? 31.266 -2.844  9.067   1.00 29.57  ? 1129 MET A HE1   1 
ATOM   3305 H  HE2   . MET A 1 259 ? 31.970 -1.544  8.530   1.00 29.57  ? 1129 MET A HE2   1 
ATOM   3306 H  HE3   . MET A 1 259 ? 30.576 -1.443  9.250   1.00 29.57  ? 1129 MET A HE3   1 
ATOM   3307 N  N     . ASN A 1 260 ? 33.455 1.979   4.832   1.00 20.99  ? 1130 ASN A N     1 
ATOM   3308 C  CA    . ASN A 1 260 ? 34.721 2.636   4.511   1.00 20.93  ? 1130 ASN A CA    1 
ATOM   3309 C  C     . ASN A 1 260 ? 34.530 3.755   3.495   1.00 19.40  ? 1130 ASN A C     1 
ATOM   3310 O  O     . ASN A 1 260 ? 35.477 4.181   2.836   1.00 25.96  ? 1130 ASN A O     1 
ATOM   3311 C  CB    . ASN A 1 260 ? 35.804 1.639   4.071   1.00 22.47  ? 1130 ASN A CB    1 
ATOM   3312 C  CG    . ASN A 1 260 ? 35.430 0.862   2.827   1.00 25.20  ? 1130 ASN A CG    1 
ATOM   3313 O  OD1   . ASN A 1 260 ? 34.571 1.274   2.052   1.00 23.75  ? 1130 ASN A OD1   1 
ATOM   3314 N  ND2   . ASN A 1 260 ? 36.088 -0.274  2.627   1.00 28.73  ? 1130 ASN A ND2   1 
ATOM   3315 H  H     . ASN A 1 260 ? 33.175 1.417   4.245   1.00 25.13  ? 1130 ASN A H     1 
ATOM   3316 H  HA    . ASN A 1 260 ? 35.049 3.058   5.332   1.00 25.06  ? 1130 ASN A HA    1 
ATOM   3317 H  HB2   . ASN A 1 260 ? 36.622 2.125   3.884   1.00 26.91  ? 1130 ASN A HB2   1 
ATOM   3318 H  HB3   . ASN A 1 260 ? 35.955 1.001   4.786   1.00 26.91  ? 1130 ASN A HB3   1 
ATOM   3319 H  HD21  . ASN A 1 260 ? 35.915 -0.756  1.936   1.00 34.42  ? 1130 ASN A HD21  1 
ATOM   3320 H  HD22  . ASN A 1 260 ? 36.687 -0.529  3.190   1.00 34.42  ? 1130 ASN A HD22  1 
ATOM   3321 N  N     . THR A 1 261 ? 33.291 4.226   3.385   1.00 22.60  ? 1131 THR A N     1 
ATOM   3322 C  CA    . THR A 1 261 ? 32.998 5.468   2.685   1.00 22.49  ? 1131 THR A CA    1 
ATOM   3323 C  C     . THR A 1 261 ? 32.000 6.269   3.518   1.00 26.15  ? 1131 THR A C     1 
ATOM   3324 O  O     . THR A 1 261 ? 31.271 5.716   4.344   1.00 20.15  ? 1131 THR A O     1 
ATOM   3325 C  CB    . THR A 1 261 ? 32.414 5.228   1.280   1.00 21.74  ? 1131 THR A CB    1 
ATOM   3326 O  OG1   . THR A 1 261 ? 31.148 4.570   1.390   1.00 28.69  ? 1131 THR A OG1   1 
ATOM   3327 C  CG2   . THR A 1 261 ? 33.363 4.380   0.431   1.00 26.75  ? 1131 THR A CG2   1 
ATOM   3328 H  H     . THR A 1 261 ? 32.597 3.838   3.711   1.00 27.07  ? 1131 THR A H     1 
ATOM   3329 H  HA    . THR A 1 261 ? 33.820 5.994   2.594   1.00 26.93  ? 1131 THR A HA    1 
ATOM   3330 H  HB    . THR A 1 261 ? 32.292 6.081   0.836   1.00 26.04  ? 1131 THR A HB    1 
ATOM   3331 H  HG1   . THR A 1 261 ? 30.627 5.034   1.821   1.00 34.37  ? 1131 THR A HG1   1 
ATOM   3332 H  HG21  . THR A 1 261 ? 32.986 4.239   -0.441  1.00 32.04  ? 1131 THR A HG21  1 
ATOM   3333 H  HG22  . THR A 1 261 ? 34.207 4.827   0.336   1.00 32.04  ? 1131 THR A HG22  1 
ATOM   3334 H  HG23  . THR A 1 261 ? 33.506 3.528   0.850   1.00 32.04  ? 1131 THR A HG23  1 
ATOM   3335 N  N     . VAL A 1 262 ? 31.964 7.573   3.293   1.00 20.02  ? 1132 VAL A N     1 
ATOM   3336 C  CA    . VAL A 1 262 ? 31.148 8.452   4.111   1.00 21.45  ? 1132 VAL A CA    1 
ATOM   3337 C  C     . VAL A 1 262 ? 29.685 8.403   3.703   1.00 25.71  ? 1132 VAL A C     1 
ATOM   3338 O  O     . VAL A 1 262 ? 29.346 8.398   2.521   1.00 26.07  ? 1132 VAL A O     1 
ATOM   3339 C  CB    . VAL A 1 262 ? 31.633 9.911   4.028   1.00 23.54  ? 1132 VAL A CB    1 
ATOM   3340 C  CG1   . VAL A 1 262 ? 30.700 10.823  4.812   1.00 22.95  ? 1132 VAL A CG1   1 
ATOM   3341 C  CG2   . VAL A 1 262 ? 33.058 10.028  4.551   1.00 24.71  ? 1132 VAL A CG2   1 
ATOM   3342 H  H     . VAL A 1 262 ? 32.404 7.975   2.672   1.00 23.97  ? 1132 VAL A H     1 
ATOM   3343 H  HA    . VAL A 1 262 ? 31.211 8.165   5.046   1.00 25.68  ? 1132 VAL A HA    1 
ATOM   3344 H  HB    . VAL A 1 262 ? 31.627 10.199  3.092   1.00 28.19  ? 1132 VAL A HB    1 
ATOM   3345 H  HG11  . VAL A 1 262 ? 31.019 11.726  4.747   1.00 27.48  ? 1132 VAL A HG11  1 
ATOM   3346 H  HG12  . VAL A 1 262 ? 29.817 10.760  4.440   1.00 27.48  ? 1132 VAL A HG12  1 
ATOM   3347 H  HG13  . VAL A 1 262 ? 30.689 10.544  5.730   1.00 27.48  ? 1132 VAL A HG13  1 
ATOM   3348 H  HG21  . VAL A 1 262 ? 33.338 10.944  4.489   1.00 29.60  ? 1132 VAL A HG21  1 
ATOM   3349 H  HG22  . VAL A 1 262 ? 33.079 9.740   5.466   1.00 29.60  ? 1132 VAL A HG22  1 
ATOM   3350 H  HG23  . VAL A 1 262 ? 33.632 9.473   4.018   1.00 29.60  ? 1132 VAL A HG23  1 
ATOM   3351 N  N     . GLN A 1 263 ? 28.825 8.365   4.709   1.00 21.97  ? 1133 GLN A N     1 
ATOM   3352 C  CA    A GLN A 1 263 ? 27.386 8.404   4.528   0.47 21.43  ? 1133 GLN A CA    1 
ATOM   3353 C  CA    B GLN A 1 263 ? 27.392 8.439   4.481   0.53 20.32  ? 1133 GLN A CA    1 
ATOM   3354 C  C     . GLN A 1 263 ? 26.862 9.686   5.167   1.00 21.86  ? 1133 GLN A C     1 
ATOM   3355 O  O     . GLN A 1 263 ? 27.323 10.066  6.240   1.00 21.80  ? 1133 GLN A O     1 
ATOM   3356 C  CB    A GLN A 1 263 ? 26.767 7.184   5.206   0.47 28.71  ? 1133 GLN A CB    1 
ATOM   3357 C  CB    B GLN A 1 263 ? 26.683 7.187   4.999   0.53 30.44  ? 1133 GLN A CB    1 
ATOM   3358 C  CG    A GLN A 1 263 ? 25.274 7.257   5.401   0.47 24.75  ? 1133 GLN A CG    1 
ATOM   3359 C  CG    B GLN A 1 263 ? 26.020 6.367   3.899   0.53 36.02  ? 1133 GLN A CG    1 
ATOM   3360 C  CD    A GLN A 1 263 ? 24.737 6.047   6.135   0.47 42.06  ? 1133 GLN A CD    1 
ATOM   3361 C  CD    B GLN A 1 263 ? 25.472 5.046   4.400   0.53 30.06  ? 1133 GLN A CD    1 
ATOM   3362 O  OE1   A GLN A 1 263 ? 25.382 5.000   6.191   0.47 37.95  ? 1133 GLN A OE1   1 
ATOM   3363 O  OE1   B GLN A 1 263 ? 25.345 4.831   5.604   0.53 38.28  ? 1133 GLN A OE1   1 
ATOM   3364 N  NE2   A GLN A 1 263 ? 23.555 6.187   6.710   0.47 40.82  ? 1133 GLN A NE2   1 
ATOM   3365 N  NE2   B GLN A 1 263 ? 25.148 4.150   3.475   0.53 35.02  ? 1133 GLN A NE2   1 
ATOM   3366 H  H     A GLN A 1 263 ? 29.062 8.314   5.534   0.47 26.31  ? 1133 GLN A H     1 
ATOM   3367 H  H     B GLN A 1 263 ? 29.047 8.295   5.537   0.53 26.31  ? 1133 GLN A H     1 
ATOM   3368 H  HA    A GLN A 1 263 ? 27.160 8.398   3.574   0.47 25.66  ? 1133 GLN A HA    1 
ATOM   3369 H  HA    B GLN A 1 263 ? 27.219 8.518   3.520   0.53 24.32  ? 1133 GLN A HA    1 
ATOM   3370 H  HB2   A GLN A 1 263 ? 26.954 6.402   4.664   0.47 34.39  ? 1133 GLN A HB2   1 
ATOM   3371 H  HB2   B GLN A 1 263 ? 27.333 6.619   5.442   0.53 36.48  ? 1133 GLN A HB2   1 
ATOM   3372 H  HB3   A GLN A 1 263 ? 27.172 7.078   6.080   0.47 34.39  ? 1133 GLN A HB3   1 
ATOM   3373 H  HB3   B GLN A 1 263 ? 25.995 7.453   5.628   0.53 36.48  ? 1133 GLN A HB3   1 
ATOM   3374 H  HG2   A GLN A 1 263 ? 25.059 8.046   5.923   0.47 29.65  ? 1133 GLN A HG2   1 
ATOM   3375 H  HG2   B GLN A 1 263 ? 25.283 6.876   3.527   0.53 43.16  ? 1133 GLN A HG2   1 
ATOM   3376 H  HG3   A GLN A 1 263 ? 24.841 7.301   4.534   0.47 29.65  ? 1133 GLN A HG3   1 
ATOM   3377 H  HG3   B GLN A 1 263 ? 26.674 6.177   3.208   0.53 43.16  ? 1133 GLN A HG3   1 
ATOM   3378 H  HE21  A GLN A 1 263 ? 23.136 6.935   6.654   0.47 48.93  ? 1133 GLN A HE21  1 
ATOM   3379 H  HE21  B GLN A 1 263 ? 24.832 3.385   3.709   0.53 41.97  ? 1133 GLN A HE21  1 
ATOM   3380 H  HE22  A GLN A 1 263 ? 23.206 5.529   7.139   0.47 48.93  ? 1133 GLN A HE22  1 
ATOM   3381 H  HE22  B GLN A 1 263 ? 25.254 4.335   2.641   0.53 41.97  ? 1133 GLN A HE22  1 
ATOM   3382 N  N     . LEU A 1 264 ? 25.909 10.347  4.521   1.00 21.59  ? 1134 LEU A N     1 
ATOM   3383 C  CA    . LEU A 1 264 ? 25.332 11.563  5.073   1.00 22.50  ? 1134 LEU A CA    1 
ATOM   3384 C  C     . LEU A 1 264 ? 23.848 11.372  5.354   1.00 26.74  ? 1134 LEU A C     1 
ATOM   3385 O  O     . LEU A 1 264 ? 23.152 10.641  4.647   1.00 21.89  ? 1134 LEU A O     1 
ATOM   3386 C  CB    . LEU A 1 264 ? 25.544 12.752  4.129   1.00 27.89  ? 1134 LEU A CB    1 
ATOM   3387 C  CG    . LEU A 1 264 ? 24.971 14.079  4.645   1.00 27.55  ? 1134 LEU A CG    1 
ATOM   3388 C  CD1   . LEU A 1 264 ? 25.917 15.231  4.372   1.00 29.77  ? 1134 LEU A CD1   1 
ATOM   3389 C  CD2   . LEU A 1 264 ? 23.604 14.345  4.037   1.00 42.43  ? 1134 LEU A CD2   1 
ATOM   3390 H  H     . LEU A 1 264 ? 25.581 10.112  3.762   1.00 25.85  ? 1134 LEU A H     1 
ATOM   3391 H  HA    . LEU A 1 264 ? 25.776 11.768  5.923   1.00 26.94  ? 1134 LEU A HA    1 
ATOM   3392 H  HB2   . LEU A 1 264 ? 26.497 12.875  3.994   1.00 33.41  ? 1134 LEU A HB2   1 
ATOM   3393 H  HB3   . LEU A 1 264 ? 25.116 12.556  3.281   1.00 33.41  ? 1134 LEU A HB3   1 
ATOM   3394 H  HG    . LEU A 1 264 ? 24.858 14.014  5.606   1.00 33.00  ? 1134 LEU A HG    1 
ATOM   3395 H  HD11  . LEU A 1 264 ? 25.527 16.041  4.708   1.00 35.67  ? 1134 LEU A HD11  1 
ATOM   3396 H  HD12  . LEU A 1 264 ? 26.752 15.061  4.816   1.00 35.67  ? 1134 LEU A HD12  1 
ATOM   3397 H  HD13  . LEU A 1 264 ? 26.058 15.302  3.426   1.00 35.67  ? 1134 LEU A HD13  1 
ATOM   3398 H  HD21  . LEU A 1 264 ? 23.269 15.178  4.375   1.00 50.86  ? 1134 LEU A HD21  1 
ATOM   3399 H  HD22  . LEU A 1 264 ? 23.690 14.389  3.082   1.00 50.86  ? 1134 LEU A HD22  1 
ATOM   3400 H  HD23  . LEU A 1 264 ? 23.010 13.630  4.280   1.00 50.86  ? 1134 LEU A HD23  1 
ATOM   3401 N  N     . TYR A 1 265 ? 23.381 12.039  6.402   1.00 21.86  ? 1135 TYR A N     1 
ATOM   3402 C  CA    . TYR A 1 265 ? 21.984 12.022  6.798   1.00 20.45  ? 1135 TYR A CA    1 
ATOM   3403 C  C     . TYR A 1 265 ? 21.472 13.450  6.733   1.00 21.56  ? 1135 TYR A C     1 
ATOM   3404 O  O     . TYR A 1 265 ? 22.172 14.368  7.142   1.00 22.52  ? 1135 TYR A O     1 
ATOM   3405 C  CB    . TYR A 1 265 ? 21.856 11.541  8.241   1.00 20.84  ? 1135 TYR A CB    1 
ATOM   3406 C  CG    . TYR A 1 265 ? 22.350 10.140  8.497   1.00 19.97  ? 1135 TYR A CG    1 
ATOM   3407 C  CD1   . TYR A 1 265 ? 21.472 9.063   8.467   1.00 26.78  ? 1135 TYR A CD1   1 
ATOM   3408 C  CD2   . TYR A 1 265 ? 23.683 9.895   8.798   1.00 24.62  ? 1135 TYR A CD2   1 
ATOM   3409 C  CE1   . TYR A 1 265 ? 21.909 7.780   8.714   1.00 37.59  ? 1135 TYR A CE1   1 
ATOM   3410 C  CE2   . TYR A 1 265 ? 24.131 8.613   9.051   1.00 39.26  ? 1135 TYR A CE2   1 
ATOM   3411 C  CZ    . TYR A 1 265 ? 23.239 7.560   9.008   1.00 47.11  ? 1135 TYR A CZ    1 
ATOM   3412 O  OH    . TYR A 1 265 ? 23.672 6.280   9.259   1.00 44.65  ? 1135 TYR A OH    1 
ATOM   3413 H  H     . TYR A 1 265 ? 23.873 12.524  6.914   1.00 26.18  ? 1135 TYR A H     1 
ATOM   3414 H  HA    . TYR A 1 265 ? 21.456 11.448  6.204   1.00 24.49  ? 1135 TYR A HA    1 
ATOM   3415 H  HB2   . TYR A 1 265 ? 22.366 12.139  8.810   1.00 24.96  ? 1135 TYR A HB2   1 
ATOM   3416 H  HB3   . TYR A 1 265 ? 20.920 11.571  8.493   1.00 24.96  ? 1135 TYR A HB3   1 
ATOM   3417 H  HD1   . TYR A 1 265 ? 20.575 9.210   8.271   1.00 32.08  ? 1135 TYR A HD1   1 
ATOM   3418 H  HD2   . TYR A 1 265 ? 24.284 10.605  8.829   1.00 29.49  ? 1135 TYR A HD2   1 
ATOM   3419 H  HE1   . TYR A 1 265 ? 21.311 7.068   8.688   1.00 45.05  ? 1135 TYR A HE1   1 
ATOM   3420 H  HE2   . TYR A 1 265 ? 25.027 8.460   9.248   1.00 47.06  ? 1135 TYR A HE2   1 
ATOM   3421 H  HH    . TYR A 1 265 ? 23.989 6.234   10.014  1.00 53.52  ? 1135 TYR A HH    1 
ATOM   3422 N  N     . MET A 1 266 ? 20.260 13.634  6.223   1.00 24.10  ? 1136 MET A N     1 
ATOM   3423 C  CA    . MET A 1 266 ? 19.588 14.926  6.281   1.00 27.70  ? 1136 MET A CA    1 
ATOM   3424 C  C     . MET A 1 266 ? 18.305 14.725  7.069   1.00 25.03  ? 1136 MET A C     1 
ATOM   3425 O  O     . MET A 1 266 ? 17.480 13.893  6.703   1.00 27.85  ? 1136 MET A O     1 
ATOM   3426 C  CB    . MET A 1 266 ? 19.295 15.433  4.869   1.00 20.29  ? 1136 MET A CB    1 
ATOM   3427 C  CG    . MET A 1 266 ? 20.558 15.642  4.048   1.00 24.38  ? 1136 MET A CG    1 
ATOM   3428 S  SD    . MET A 1 266 ? 20.240 15.989  2.310   1.00 32.52  ? 1136 MET A SD    1 
ATOM   3429 C  CE    . MET A 1 266 ? 19.669 17.684  2.413   1.00 28.99  ? 1136 MET A CE    1 
ATOM   3430 H  H     . MET A 1 266 ? 19.800 13.019  5.835   1.00 28.87  ? 1136 MET A H     1 
ATOM   3431 H  HA    . MET A 1 266 ? 20.159 15.578  6.738   1.00 33.18  ? 1136 MET A HA    1 
ATOM   3432 H  HB2   . MET A 1 266 ? 18.742 14.783  4.408   1.00 24.30  ? 1136 MET A HB2   1 
ATOM   3433 H  HB3   . MET A 1 266 ? 18.831 16.282  4.927   1.00 24.30  ? 1136 MET A HB3   1 
ATOM   3434 H  HG2   . MET A 1 266 ? 21.049 16.393  4.416   1.00 29.20  ? 1136 MET A HG2   1 
ATOM   3435 H  HG3   . MET A 1 266 ? 21.099 14.838  4.097   1.00 29.20  ? 1136 MET A HG3   1 
ATOM   3436 H  HE1   . MET A 1 266 ? 19.460 17.997  1.530   1.00 34.74  ? 1136 MET A HE1   1 
ATOM   3437 H  HE2   . MET A 1 266 ? 18.884 17.716  2.966   1.00 34.74  ? 1136 MET A HE2   1 
ATOM   3438 H  HE3   . MET A 1 266 ? 20.363 18.225  2.797   1.00 34.74  ? 1136 MET A HE3   1 
ATOM   3439 N  N     . LYS A 1 267 ? 18.136 15.475  8.154   1.00 23.94  ? 1137 LYS A N     1 
ATOM   3440 C  CA    . LYS A 1 267 ? 17.084 15.171  9.115   1.00 18.72  ? 1137 LYS A CA    1 
ATOM   3441 C  C     . LYS A 1 267 ? 16.138 16.332  9.393   1.00 28.71  ? 1137 LYS A C     1 
ATOM   3442 O  O     . LYS A 1 267 ? 16.510 17.498  9.284   1.00 26.39  ? 1137 LYS A O     1 
ATOM   3443 C  CB    . LYS A 1 267 ? 17.708 14.733  10.441  1.00 18.54  ? 1137 LYS A CB    1 
ATOM   3444 C  CG    . LYS A 1 267 ? 18.764 13.657  10.306  1.00 20.65  ? 1137 LYS A CG    1 
ATOM   3445 C  CD    . LYS A 1 267 ? 19.210 13.175  11.676  1.00 26.61  ? 1137 LYS A CD    1 
ATOM   3446 C  CE    . LYS A 1 267 ? 20.302 12.120  11.587  1.00 20.88  ? 1137 LYS A CE    1 
ATOM   3447 N  NZ    . LYS A 1 267 ? 20.850 11.822  12.943  1.00 23.48  ? 1137 LYS A NZ    1 
ATOM   3448 H  H     . LYS A 1 267 ? 18.615 16.161  8.355   1.00 28.67  ? 1137 LYS A H     1 
ATOM   3449 H  HA    . LYS A 1 267 ? 16.549 14.424  8.772   1.00 22.41  ? 1137 LYS A HA    1 
ATOM   3450 H  HB2   . LYS A 1 267 ? 18.124 15.503  10.859  1.00 22.19  ? 1137 LYS A HB2   1 
ATOM   3451 H  HB3   . LYS A 1 267 ? 17.007 14.388  11.016  1.00 22.19  ? 1137 LYS A HB3   1 
ATOM   3452 H  HG2   . LYS A 1 267 ? 18.396 12.902  9.820   1.00 24.73  ? 1137 LYS A HG2   1 
ATOM   3453 H  HG3   . LYS A 1 267 ? 19.535 14.017  9.840   1.00 24.73  ? 1137 LYS A HG3   1 
ATOM   3454 H  HD2   . LYS A 1 267 ? 19.558 13.927  12.180  1.00 31.88  ? 1137 LYS A HD2   1 
ATOM   3455 H  HD3   . LYS A 1 267 ? 18.452 12.786  12.139  1.00 31.88  ? 1137 LYS A HD3   1 
ATOM   3456 H  HE2   . LYS A 1 267 ? 19.932 11.303  11.218  1.00 25.00  ? 1137 LYS A HE2   1 
ATOM   3457 H  HE3   . LYS A 1 267 ? 21.024 12.449  11.028  1.00 25.00  ? 1137 LYS A HE3   1 
ATOM   3458 H  HZ1   . LYS A 1 267 ? 21.195 12.561  13.301  1.00 28.12  ? 1137 LYS A HZ1   1 
ATOM   3459 H  HZ2   . LYS A 1 267 ? 20.202 11.519  13.473  1.00 28.12  ? 1137 LYS A HZ2   1 
ATOM   3460 H  HZ3   . LYS A 1 267 ? 21.488 11.205  12.884  1.00 28.12  ? 1137 LYS A HZ3   1 
ATOM   3461 N  N     . VAL A 1 268 ? 14.908 15.986  9.754   1.00 25.79  ? 1138 VAL A N     1 
ATOM   3462 C  CA    . VAL A 1 268 ? 13.996 16.926  10.384  1.00 30.56  ? 1138 VAL A CA    1 
ATOM   3463 C  C     . VAL A 1 268 ? 13.710 16.392  11.783  1.00 31.60  ? 1138 VAL A C     1 
ATOM   3464 O  O     . VAL A 1 268 ? 13.962 15.220  12.063  1.00 25.77  ? 1138 VAL A O     1 
ATOM   3465 C  CB    . VAL A 1 268 ? 12.679 17.076  9.599   1.00 28.89  ? 1138 VAL A CB    1 
ATOM   3466 C  CG1   . VAL A 1 268 ? 12.941 17.676  8.227   1.00 31.35  ? 1138 VAL A CG1   1 
ATOM   3467 C  CG2   . VAL A 1 268 ? 11.969 15.737  9.478   1.00 27.08  ? 1138 VAL A CG2   1 
ATOM   3468 H  H     . VAL A 1 268 ? 14.575 15.201  9.642   1.00 30.89  ? 1138 VAL A H     1 
ATOM   3469 H  HA    . VAL A 1 268 ? 14.422 17.805  10.460  1.00 36.61  ? 1138 VAL A HA    1 
ATOM   3470 H  HB    . VAL A 1 268 ? 12.087 17.686  10.087  1.00 34.61  ? 1138 VAL A HB    1 
ATOM   3471 H  HG11  . VAL A 1 268 ? 12.107 17.759  7.758   1.00 37.56  ? 1138 VAL A HG11  1 
ATOM   3472 H  HG12  . VAL A 1 268 ? 13.343 18.540  8.336   1.00 37.56  ? 1138 VAL A HG12  1 
ATOM   3473 H  HG13  . VAL A 1 268 ? 13.533 17.097  7.741   1.00 37.56  ? 1138 VAL A HG13  1 
ATOM   3474 H  HG21  . VAL A 1 268 ? 11.154 15.859  8.986   1.00 32.44  ? 1138 VAL A HG21  1 
ATOM   3475 H  HG22  . VAL A 1 268 ? 12.542 15.121  9.015   1.00 32.44  ? 1138 VAL A HG22  1 
ATOM   3476 H  HG23  . VAL A 1 268 ? 11.775 15.405  10.357  1.00 32.44  ? 1138 VAL A HG23  1 
ATOM   3477 N  N     . PRO A 1 269 ? 13.200 17.249  12.676  1.00 28.61  ? 1139 PRO A N     1 
ATOM   3478 C  CA    . PRO A 1 269 ? 12.917 16.785  14.038  1.00 31.65  ? 1139 PRO A CA    1 
ATOM   3479 C  C     . PRO A 1 269 ? 12.087 15.502  14.040  1.00 32.68  ? 1139 PRO A C     1 
ATOM   3480 O  O     . PRO A 1 269 ? 11.083 15.417  13.331  1.00 29.61  ? 1139 PRO A O     1 
ATOM   3481 C  CB    . PRO A 1 269 ? 12.136 17.953  14.645  1.00 34.17  ? 1139 PRO A CB    1 
ATOM   3482 C  CG    . PRO A 1 269 ? 12.655 19.153  13.919  1.00 32.15  ? 1139 PRO A CG    1 
ATOM   3483 C  CD    . PRO A 1 269 ? 12.929 18.689  12.509  1.00 28.40  ? 1139 PRO A CD    1 
ATOM   3484 H  HA    . PRO A 1 269 ? 13.748 16.646  14.538  1.00 37.93  ? 1139 PRO A HA    1 
ATOM   3485 H  HB2   . PRO A 1 269 ? 11.187 17.834  14.484  1.00 40.94  ? 1139 PRO A HB2   1 
ATOM   3486 H  HB3   . PRO A 1 269 ? 12.322 18.016  15.595  1.00 40.94  ? 1139 PRO A HB3   1 
ATOM   3487 H  HG2   . PRO A 1 269 ? 11.982 19.852  13.924  1.00 38.52  ? 1139 PRO A HG2   1 
ATOM   3488 H  HG3   . PRO A 1 269 ? 13.471 19.462  14.342  1.00 38.52  ? 1139 PRO A HG3   1 
ATOM   3489 H  HD2   . PRO A 1 269 ? 12.148 18.824  11.950  1.00 34.02  ? 1139 PRO A HD2   1 
ATOM   3490 H  HD3   . PRO A 1 269 ? 13.708 19.141  12.149  1.00 34.02  ? 1139 PRO A HD3   1 
ATOM   3491 N  N     . GLY A 1 270 ? 12.525 14.509  14.809  1.00 29.82  ? 1140 GLY A N     1 
ATOM   3492 C  CA    . GLY A 1 270 ? 11.819 13.244  14.919  1.00 33.05  ? 1140 GLY A CA    1 
ATOM   3493 C  C     . GLY A 1 270 ? 12.370 12.139  14.029  1.00 36.52  ? 1140 GLY A C     1 
ATOM   3494 O  O     . GLY A 1 270 ? 11.950 10.988  14.136  1.00 28.85  ? 1140 GLY A O     1 
ATOM   3495 H  H     . GLY A 1 270 ? 13.242 14.548  15.283  1.00 35.73  ? 1140 GLY A H     1 
ATOM   3496 H  HA2   . GLY A 1 270 ? 11.859 12.938  15.838  1.00 39.60  ? 1140 GLY A HA2   1 
ATOM   3497 H  HA3   . GLY A 1 270 ? 10.887 13.381  14.686  1.00 39.60  ? 1140 GLY A HA3   1 
ATOM   3498 N  N     . SER A 1 271 ? 13.309 12.481  13.150  1.00 27.22  ? 1141 SER A N     1 
ATOM   3499 C  CA    . SER A 1 271 ? 13.911 11.500  12.248  1.00 26.65  ? 1141 SER A CA    1 
ATOM   3500 C  C     . SER A 1 271 ? 14.710 10.480  13.050  1.00 30.50  ? 1141 SER A C     1 
ATOM   3501 O  O     . SER A 1 271 ? 15.681 10.833  13.713  1.00 24.00  ? 1141 SER A O     1 
ATOM   3502 C  CB    . SER A 1 271 ? 14.823 12.195  11.235  1.00 24.83  ? 1141 SER A CB    1 
ATOM   3503 O  OG    . SER A 1 271 ? 14.079 13.039  10.372  1.00 29.68  ? 1141 SER A OG    1 
ATOM   3504 H  H     . SER A 1 271 ? 13.617 13.279  13.055  1.00 32.61  ? 1141 SER A H     1 
ATOM   3505 H  HA    . SER A 1 271 ? 13.205 11.028  11.759  1.00 31.92  ? 1141 SER A HA    1 
ATOM   3506 H  HB2   . SER A 1 271 ? 15.475 12.731  11.714  1.00 29.75  ? 1141 SER A HB2   1 
ATOM   3507 H  HB3   . SER A 1 271 ? 15.275 11.521  10.703  1.00 29.75  ? 1141 SER A HB3   1 
ATOM   3508 H  HG    . SER A 1 271 ? 13.283 13.007  10.566  1.00 35.56  ? 1141 SER A HG    1 
ATOM   3509 N  N     . ARG A 1 272 ? 14.309 9.214   12.978  1.00 26.41  ? 1142 ARG A N     1 
ATOM   3510 C  CA    . ARG A 1 272 ? 14.895 8.180   13.823  1.00 26.37  ? 1142 ARG A CA    1 
ATOM   3511 C  C     . ARG A 1 272 ? 15.661 7.106   13.063  1.00 19.67  ? 1142 ARG A C     1 
ATOM   3512 O  O     . ARG A 1 272 ? 15.221 6.620   12.018  1.00 22.99  ? 1142 ARG A O     1 
ATOM   3513 C  CB    . ARG A 1 272 ? 13.805 7.505   14.656  1.00 24.35  ? 1142 ARG A CB    1 
ATOM   3514 C  CG    . ARG A 1 272 ? 13.353 8.332   15.834  1.00 28.19  ? 1142 ARG A CG    1 
ATOM   3515 C  CD    . ARG A 1 272 ? 12.241 7.648   16.593  1.00 27.89  ? 1142 ARG A CD    1 
ATOM   3516 N  NE    . ARG A 1 272 ? 11.962 8.346   17.842  1.00 27.69  ? 1142 ARG A NE    1 
ATOM   3517 C  CZ    . ARG A 1 272 ? 11.019 7.992   18.708  1.00 39.86  ? 1142 ARG A CZ    1 
ATOM   3518 N  NH1   . ARG A 1 272 ? 10.246 6.941   18.460  1.00 26.29  ? 1142 ARG A NH1   1 
ATOM   3519 N  NH2   . ARG A 1 272 ? 10.847 8.694   19.820  1.00 30.18  ? 1142 ARG A NH2   1 
ATOM   3520 H  H     . ARG A 1 272 ? 13.697 8.928   12.445  1.00 31.64  ? 1142 ARG A H     1 
ATOM   3521 H  HA    . ARG A 1 272 ? 15.522 8.606   14.445  1.00 31.58  ? 1142 ARG A HA    1 
ATOM   3522 H  HB2   . ARG A 1 272 ? 13.033 7.344   14.091  1.00 29.17  ? 1142 ARG A HB2   1 
ATOM   3523 H  HB3   . ARG A 1 272 ? 14.147 6.663   14.996  1.00 29.17  ? 1142 ARG A HB3   1 
ATOM   3524 H  HG2   . ARG A 1 272 ? 14.099 8.461   16.440  1.00 33.77  ? 1142 ARG A HG2   1 
ATOM   3525 H  HG3   . ARG A 1 272 ? 13.024 9.188   15.518  1.00 33.77  ? 1142 ARG A HG3   1 
ATOM   3526 H  HD2   . ARG A 1 272 ? 11.434 7.651   16.054  1.00 33.41  ? 1142 ARG A HD2   1 
ATOM   3527 H  HD3   . ARG A 1 272 ? 12.505 6.739   16.802  1.00 33.41  ? 1142 ARG A HD3   1 
ATOM   3528 H  HE    . ARG A 1 272 ? 12.442 9.034   18.031  1.00 33.18  ? 1142 ARG A HE    1 
ATOM   3529 H  HH11  . ARG A 1 272 ? 10.357 6.485   17.739  1.00 31.49  ? 1142 ARG A HH11  1 
ATOM   3530 H  HH12  . ARG A 1 272 ? 9.635  6.714   19.022  1.00 31.49  ? 1142 ARG A HH12  1 
ATOM   3531 H  HH21  . ARG A 1 272 ? 11.347 9.376   19.980  1.00 36.16  ? 1142 ARG A HH21  1 
ATOM   3532 H  HH22  . ARG A 1 272 ? 10.236 8.468   20.382  1.00 36.16  ? 1142 ARG A HH22  1 
ATOM   3533 N  N     . THR A 1 273 ? 16.818 6.749   13.605  1.00 21.77  ? 1143 THR A N     1 
ATOM   3534 C  CA    . THR A 1 273 ? 17.512 5.532   13.225  1.00 22.40  ? 1143 THR A CA    1 
ATOM   3535 C  C     . THR A 1 273 ? 17.263 4.527   14.338  1.00 22.81  ? 1143 THR A C     1 
ATOM   3536 O  O     . THR A 1 273 ? 17.768 4.695   15.447  1.00 23.37  ? 1143 THR A O     1 
ATOM   3537 C  CB    . THR A 1 273 ? 19.022 5.765   13.079  1.00 24.53  ? 1143 THR A CB    1 
ATOM   3538 O  OG1   . THR A 1 273 ? 19.262 6.707   12.026  1.00 24.19  ? 1143 THR A OG1   1 
ATOM   3539 C  CG2   . THR A 1 273 ? 19.741 4.454   12.763  1.00 25.54  ? 1143 THR A CG2   1 
ATOM   3540 H  H     . THR A 1 273 ? 17.228 7.206   14.208  1.00 26.07  ? 1143 THR A H     1 
ATOM   3541 H  HA    . THR A 1 273 ? 17.152 5.181   12.383  1.00 26.83  ? 1143 THR A HA    1 
ATOM   3542 H  HB    . THR A 1 273 ? 19.376 6.115   13.911  1.00 29.38  ? 1143 THR A HB    1 
ATOM   3543 H  HG1   . THR A 1 273 ? 18.894 7.419   12.198  1.00 28.97  ? 1143 THR A HG1   1 
ATOM   3544 H  HG21  . THR A 1 273 ? 20.684 4.611   12.674  1.00 30.59  ? 1143 THR A HG21  1 
ATOM   3545 H  HG22  . THR A 1 273 ? 19.595 3.822   13.470  1.00 30.59  ? 1143 THR A HG22  1 
ATOM   3546 H  HG23  . THR A 1 273 ? 19.406 4.087   11.942  1.00 30.59  ? 1143 THR A HG23  1 
ATOM   3547 N  N     . PRO A 1 274 ? 16.469 3.485   14.058  1.00 22.34  ? 1144 PRO A N     1 
ATOM   3548 C  CA    . PRO A 1 274 ? 16.094 2.546   15.121  1.00 25.83  ? 1144 PRO A CA    1 
ATOM   3549 C  C     . PRO A 1 274 ? 17.254 1.661   15.572  1.00 25.31  ? 1144 PRO A C     1 
ATOM   3550 O  O     . PRO A 1 274 ? 18.339 1.725   15.004  1.00 22.85  ? 1144 PRO A O     1 
ATOM   3551 C  CB    . PRO A 1 274 ? 14.977 1.716   14.480  1.00 27.43  ? 1144 PRO A CB    1 
ATOM   3552 C  CG    . PRO A 1 274 ? 15.226 1.803   13.020  1.00 32.77  ? 1144 PRO A CG    1 
ATOM   3553 C  CD    . PRO A 1 274 ? 15.826 3.159   12.774  1.00 31.37  ? 1144 PRO A CD    1 
ATOM   3554 H  HA    . PRO A 1 274 ? 15.735 3.031   15.894  1.00 30.95  ? 1144 PRO A HA    1 
ATOM   3555 H  HB2   . PRO A 1 274 ? 15.037 0.797   14.784  1.00 32.87  ? 1144 PRO A HB2   1 
ATOM   3556 H  HB3   . PRO A 1 274 ? 14.115 2.098   14.705  1.00 32.87  ? 1144 PRO A HB3   1 
ATOM   3557 H  HG2   . PRO A 1 274 ? 15.846 1.105   12.755  1.00 39.27  ? 1144 PRO A HG2   1 
ATOM   3558 H  HG3   . PRO A 1 274 ? 14.387 1.712   12.543  1.00 39.27  ? 1144 PRO A HG3   1 
ATOM   3559 H  HD2   . PRO A 1 274 ? 16.487 3.113   12.066  1.00 37.59  ? 1144 PRO A HD2   1 
ATOM   3560 H  HD3   . PRO A 1 274 ? 15.130 3.804   12.570  1.00 37.59  ? 1144 PRO A HD3   1 
ATOM   3561 N  N     . GLY A 1 275 ? 17.006 0.850   16.594  1.00 21.36  ? 1145 GLY A N     1 
ATOM   3562 C  CA    . GLY A 1 275 ? 18.041 0.072   17.253  1.00 26.60  ? 1145 GLY A CA    1 
ATOM   3563 C  C     . GLY A 1 275 ? 18.849 -0.827  16.342  1.00 25.92  ? 1145 GLY A C     1 
ATOM   3564 O  O     . GLY A 1 275 ? 18.306 -1.497  15.465  1.00 24.26  ? 1145 GLY A O     1 
ATOM   3565 H  H     . GLY A 1 275 ? 16.223 0.732   16.930  1.00 25.58  ? 1145 GLY A H     1 
ATOM   3566 H  HA2   . GLY A 1 275 ? 18.655 0.678   17.695  1.00 31.87  ? 1145 GLY A HA2   1 
ATOM   3567 H  HA3   . GLY A 1 275 ? 17.630 -0.485  17.933  1.00 31.87  ? 1145 GLY A HA3   1 
ATOM   3568 N  N     . HIS A 1 276 ? 20.159 -0.852  16.557  1.00 23.13  ? 1146 HIS A N     1 
ATOM   3569 C  CA    . HIS A 1 276 ? 21.022 -1.731  15.786  1.00 24.59  ? 1146 HIS A CA    1 
ATOM   3570 C  C     . HIS A 1 276 ? 22.422 -1.797  16.368  1.00 28.15  ? 1146 HIS A C     1 
ATOM   3571 O  O     . HIS A 1 276 ? 22.826 -0.960  17.179  1.00 22.42  ? 1146 HIS A O     1 
ATOM   3572 C  CB    . HIS A 1 276 ? 21.125 -1.233  14.348  1.00 22.37  ? 1146 HIS A CB    1 
ATOM   3573 C  CG    . HIS A 1 276 ? 21.828 0.082   14.226  1.00 28.54  ? 1146 HIS A CG    1 
ATOM   3574 N  ND1   . HIS A 1 276 ? 21.286 1.260   14.692  1.00 40.55  ? 1146 HIS A ND1   1 
ATOM   3575 C  CD2   . HIS A 1 276 ? 23.036 0.401   13.705  1.00 32.89  ? 1146 HIS A CD2   1 
ATOM   3576 C  CE1   . HIS A 1 276 ? 22.127 2.252   14.454  1.00 28.27  ? 1146 HIS A CE1   1 
ATOM   3577 N  NE2   . HIS A 1 276 ? 23.193 1.758   13.854  1.00 30.43  ? 1146 HIS A NE2   1 
ATOM   3578 H  H     . HIS A 1 276 ? 20.569 -0.372  17.140  1.00 27.70  ? 1146 HIS A H     1 
ATOM   3579 H  HA    . HIS A 1 276 ? 20.645 -2.635  15.777  1.00 29.46  ? 1146 HIS A HA    1 
ATOM   3580 H  HB2   . HIS A 1 276 ? 21.619 -1.885  13.825  1.00 26.79  ? 1146 HIS A HB2   1 
ATOM   3581 H  HB3   . HIS A 1 276 ? 20.231 -1.129  13.987  1.00 26.79  ? 1146 HIS A HB3   1 
ATOM   3582 H  HD1   . HIS A 1 276 ? 20.519 1.338   15.074  1.00 48.60  ? 1146 HIS A HD1   1 
ATOM   3583 H  HD2   . HIS A 1 276 ? 23.641 -0.186  13.311  1.00 39.41  ? 1146 HIS A HD2   1 
ATOM   3584 H  HE1   . HIS A 1 276 ? 21.990 3.146   14.671  1.00 33.87  ? 1146 HIS A HE1   1 
ATOM   3585 N  N     . GLN A 1 277 ? 23.154 -2.819  15.948  1.00 22.99  ? 1147 GLN A N     1 
ATOM   3586 C  CA    . GLN A 1 277 ? 24.596 -2.834  16.084  1.00 19.60  ? 1147 GLN A CA    1 
ATOM   3587 C  C     . GLN A 1 277 ? 25.126 -2.620  14.680  1.00 20.71  ? 1147 GLN A C     1 
ATOM   3588 O  O     . GLN A 1 277 ? 24.465 -2.989  13.704  1.00 21.79  ? 1147 GLN A O     1 
ATOM   3589 C  CB    . GLN A 1 277 ? 25.084 -4.171  16.649  1.00 18.16  ? 1147 GLN A CB    1 
ATOM   3590 C  CG    . GLN A 1 277 ? 24.710 -4.393  18.112  1.00 21.93  ? 1147 GLN A CG    1 
ATOM   3591 C  CD    . GLN A 1 277 ? 24.961 -5.820  18.571  1.00 24.82  ? 1147 GLN A CD    1 
ATOM   3592 O  OE1   . GLN A 1 277 ? 24.373 -6.762  18.046  1.00 25.38  ? 1147 GLN A OE1   1 
ATOM   3593 N  NE2   . GLN A 1 277 ? 25.837 -5.984  19.553  1.00 22.45  ? 1147 GLN A NE2   1 
ATOM   3594 H  H     . GLN A 1 277 ? 22.831 -3.524  15.576  1.00 27.53  ? 1147 GLN A H     1 
ATOM   3595 H  HA    . GLN A 1 277 ? 24.896 -2.102  16.663  1.00 23.47  ? 1147 GLN A HA    1 
ATOM   3596 H  HB2   . GLN A 1 277 ? 24.692 -4.891  16.130  1.00 21.74  ? 1147 GLN A HB2   1 
ATOM   3597 H  HB3   . GLN A 1 277 ? 26.051 -4.205  16.581  1.00 21.74  ? 1147 GLN A HB3   1 
ATOM   3598 H  HG2   . GLN A 1 277 ? 25.242 -3.801  18.667  1.00 26.26  ? 1147 GLN A HG2   1 
ATOM   3599 H  HG3   . GLN A 1 277 ? 23.767 -4.201  18.230  1.00 26.26  ? 1147 GLN A HG3   1 
ATOM   3600 H  HE21  . GLN A 1 277 ? 26.012 -6.773  19.846  1.00 26.89  ? 1147 GLN A HE21  1 
ATOM   3601 H  HE22  . GLN A 1 277 ? 26.230 -5.301  19.897  1.00 26.89  ? 1147 GLN A HE22  1 
ATOM   3602 N  N     . GLU A 1 278 ? 26.300 -2.011  14.569  1.00 21.60  ? 1148 GLU A N     1 
ATOM   3603 C  CA    . GLU A 1 278 ? 26.931 -1.819  13.270  1.00 20.44  ? 1148 GLU A CA    1 
ATOM   3604 C  C     . GLU A 1 278 ? 27.141 -3.161  12.592  1.00 32.55  ? 1148 GLU A C     1 
ATOM   3605 O  O     . GLU A 1 278 ? 27.165 -4.202  13.248  1.00 23.18  ? 1148 GLU A O     1 
ATOM   3606 C  CB    . GLU A 1 278 ? 28.282 -1.124  13.424  1.00 20.01  ? 1148 GLU A CB    1 
ATOM   3607 C  CG    . GLU A 1 278 ? 28.202 0.227   14.090  1.00 19.55  ? 1148 GLU A CG    1 
ATOM   3608 C  CD    . GLU A 1 278 ? 27.244 1.159   13.385  1.00 26.25  ? 1148 GLU A CD    1 
ATOM   3609 O  OE1   . GLU A 1 278 ? 27.343 1.332   12.149  1.00 24.37  ? 1148 GLU A OE1   1 
ATOM   3610 O  OE2   . GLU A 1 278 ? 26.381 1.716   14.077  1.00 27.05  ? 1148 GLU A OE2   1 
ATOM   3611 H  H     . GLU A 1 278 ? 26.752 -1.699  15.231  1.00 25.86  ? 1148 GLU A H     1 
ATOM   3612 H  HA    . GLU A 1 278 ? 26.355 -1.266  12.702  1.00 24.47  ? 1148 GLU A HA    1 
ATOM   3613 H  HB2   . GLU A 1 278 ? 28.863 -1.685  13.962  1.00 23.96  ? 1148 GLU A HB2   1 
ATOM   3614 H  HB3   . GLU A 1 278 ? 28.671 -0.998  12.544  1.00 23.96  ? 1148 GLU A HB3   1 
ATOM   3615 H  HG2   . GLU A 1 278 ? 27.894 0.113   15.003  1.00 23.40  ? 1148 GLU A HG2   1 
ATOM   3616 H  HG3   . GLU A 1 278 ? 29.081 0.637   14.083  1.00 23.40  ? 1148 GLU A HG3   1 
ATOM   3617 N  N     . ASN A 1 279 ? 27.287 -3.129  11.274  1.00 20.85  ? 1149 ASN A N     1 
ATOM   3618 C  CA    . ASN A 1 279 ? 27.653 -4.320  10.525  1.00 20.97  ? 1149 ASN A CA    1 
ATOM   3619 C  C     . ASN A 1 279 ? 28.913 -4.952  11.100  1.00 18.18  ? 1149 ASN A C     1 
ATOM   3620 O  O     . ASN A 1 279 ? 29.935 -4.285  11.260  1.00 20.95  ? 1149 ASN A O     1 
ATOM   3621 C  CB    . ASN A 1 279 ? 27.866 -3.963  9.058   1.00 21.42  ? 1149 ASN A CB    1 
ATOM   3622 C  CG    . ASN A 1 279 ? 26.578 -3.545  8.371   1.00 25.89  ? 1149 ASN A CG    1 
ATOM   3623 O  OD1   . ASN A 1 279 ? 25.543 -4.193  8.519   1.00 33.98  ? 1149 ASN A OD1   1 
ATOM   3624 N  ND2   . ASN A 1 279 ? 26.635 -2.456  7.621   1.00 29.05  ? 1149 ASN A ND2   1 
ATOM   3625 H  H     . ASN A 1 279 ? 27.179 -2.428  10.789  1.00 24.96  ? 1149 ASN A H     1 
ATOM   3626 H  HA    . ASN A 1 279 ? 26.926 -4.975  10.581  1.00 25.11  ? 1149 ASN A HA    1 
ATOM   3627 H  HB2   . ASN A 1 279 ? 28.492 -3.225  8.999   1.00 25.65  ? 1149 ASN A HB2   1 
ATOM   3628 H  HB3   . ASN A 1 279 ? 28.218 -4.737  8.592   1.00 25.65  ? 1149 ASN A HB3   1 
ATOM   3629 H  HD21  . ASN A 1 279 ? 25.931 -2.179  7.211   1.00 34.80  ? 1149 ASN A HD21  1 
ATOM   3630 H  HD22  . ASN A 1 279 ? 27.375 -2.026  7.543   1.00 34.80  ? 1149 ASN A HD22  1 
ATOM   3631 N  N     . ASN A 1 280 ? 28.823 -6.239  11.420  1.00 20.42  ? 1150 ASN A N     1 
ATOM   3632 C  CA    . ASN A 1 280 ? 29.943 -6.991  11.974  1.00 20.12  ? 1150 ASN A CA    1 
ATOM   3633 C  C     . ASN A 1 280 ? 30.599 -6.292  13.160  1.00 23.11  ? 1150 ASN A C     1 
ATOM   3634 O  O     . ASN A 1 280 ? 31.801 -6.424  13.389  1.00 20.80  ? 1150 ASN A O     1 
ATOM   3635 C  CB    . ASN A 1 280 ? 30.962 -7.303  10.879  1.00 23.94  ? 1150 ASN A CB    1 
ATOM   3636 C  CG    . ASN A 1 280 ? 30.460 -8.363  9.906   1.00 29.41  ? 1150 ASN A CG    1 
ATOM   3637 O  OD1   . ASN A 1 280 ? 30.625 -9.562  10.136  1.00 33.39  ? 1150 ASN A OD1   1 
ATOM   3638 N  ND2   . ASN A 1 280 ? 29.830 -7.924  8.825   1.00 18.89  ? 1150 ASN A ND2   1 
ATOM   3639 H  H     . ASN A 1 280 ? 28.108 -6.708  11.323  1.00 24.45  ? 1150 ASN A H     1 
ATOM   3640 H  HA    . ASN A 1 280 ? 29.600 -7.849  12.301  1.00 24.08  ? 1150 ASN A HA    1 
ATOM   3641 H  HB2   . ASN A 1 280 ? 31.145 -6.494  10.375  1.00 28.68  ? 1150 ASN A HB2   1 
ATOM   3642 H  HB3   . ASN A 1 280 ? 31.778 -7.632  11.288  1.00 28.68  ? 1150 ASN A HB3   1 
ATOM   3643 H  HD21  . ASN A 1 280 ? 29.724 -7.080  8.702   1.00 22.62  ? 1150 ASN A HD21  1 
ATOM   3644 H  HD22  . ASN A 1 280 ? 29.528 -8.484  8.246   1.00 22.62  ? 1150 ASN A HD22  1 
ATOM   3645 N  N     . ASN A 1 281 ? 29.788 -5.558  13.916  1.00 18.37  ? 1151 ASN A N     1 
ATOM   3646 C  CA    . ASN A 1 281 ? 30.217 -4.963  15.181  1.00 20.02  ? 1151 ASN A CA    1 
ATOM   3647 C  C     . ASN A 1 281 ? 31.384 -3.983  15.057  1.00 16.81  ? 1151 ASN A C     1 
ATOM   3648 O  O     . ASN A 1 281 ? 32.149 -3.795  16.002  1.00 19.98  ? 1151 ASN A O     1 
ATOM   3649 C  CB    . ASN A 1 281 ? 30.576 -6.059  16.190  1.00 21.64  ? 1151 ASN A CB    1 
ATOM   3650 C  CG    . ASN A 1 281 ? 29.351 -6.696  16.822  1.00 29.97  ? 1151 ASN A CG    1 
ATOM   3651 O  OD1   . ASN A 1 281 ? 28.283 -6.082  16.898  1.00 27.28  ? 1151 ASN A OD1   1 
ATOM   3652 N  ND2   . ASN A 1 281 ? 29.502 -7.932  17.287  1.00 24.65  ? 1151 ASN A ND2   1 
ATOM   3653 H  H     . ASN A 1 281 ? 28.970 -5.387  13.715  1.00 21.99  ? 1151 ASN A H     1 
ATOM   3654 H  HA    . ASN A 1 281 ? 29.461 -4.463  15.553  1.00 23.96  ? 1151 ASN A HA    1 
ATOM   3655 H  HB2   . ASN A 1 281 ? 31.076 -6.755  15.736  1.00 25.91  ? 1151 ASN A HB2   1 
ATOM   3656 H  HB3   . ASN A 1 281 ? 31.113 -5.672  16.899  1.00 25.91  ? 1151 ASN A HB3   1 
ATOM   3657 H  HD21  . ASN A 1 281 ? 28.838 -8.337  17.655  1.00 29.53  ? 1151 ASN A HD21  1 
ATOM   3658 H  HD22  . ASN A 1 281 ? 30.263 -8.326  17.220  1.00 29.53  ? 1151 ASN A HD22  1 
ATOM   3659 N  N     . PHE A 1 282 ? 31.520 -3.346  13.903  1.00 20.44  ? 1152 PHE A N     1 
ATOM   3660 C  CA    . PHE A 1 282 ? 32.573 -2.353  13.737  1.00 16.00  ? 1152 PHE A CA    1 
ATOM   3661 C  C     . PHE A 1 282 ? 32.199 -1.048  14.425  1.00 17.58  ? 1152 PHE A C     1 
ATOM   3662 O  O     . PHE A 1 282 ? 31.024 -0.706  14.537  1.00 23.00  ? 1152 PHE A O     1 
ATOM   3663 C  CB    . PHE A 1 282 ? 32.896 -2.141  12.258  1.00 16.57  ? 1152 PHE A CB    1 
ATOM   3664 C  CG    . PHE A 1 282 ? 33.813 -3.186  11.711  1.00 19.42  ? 1152 PHE A CG    1 
ATOM   3665 C  CD1   . PHE A 1 282 ? 35.184 -3.012  11.767  1.00 18.82  ? 1152 PHE A CD1   1 
ATOM   3666 C  CD2   . PHE A 1 282 ? 33.309 -4.372  11.199  1.00 21.11  ? 1152 PHE A CD2   1 
ATOM   3667 C  CE1   . PHE A 1 282 ? 36.043 -3.988  11.292  1.00 27.33  ? 1152 PHE A CE1   1 
ATOM   3668 C  CE2   . PHE A 1 282 ? 34.163 -5.354  10.725  1.00 28.30  ? 1152 PHE A CE2   1 
ATOM   3669 C  CZ    . PHE A 1 282 ? 35.533 -5.158  10.768  1.00 21.42  ? 1152 PHE A CZ    1 
ATOM   3670 H  H     . PHE A 1 282 ? 31.026 -3.467  13.209  1.00 24.47  ? 1152 PHE A H     1 
ATOM   3671 H  HA    . PHE A 1 282 ? 33.386 -2.689  14.169  1.00 19.14  ? 1152 PHE A HA    1 
ATOM   3672 H  HB2   . PHE A 1 282 ? 32.072 -2.168  11.747  1.00 19.83  ? 1152 PHE A HB2   1 
ATOM   3673 H  HB3   . PHE A 1 282 ? 33.326 -1.278  12.149  1.00 19.83  ? 1152 PHE A HB3   1 
ATOM   3674 H  HD1   . PHE A 1 282 ? 35.533 -2.225  12.118  1.00 22.53  ? 1152 PHE A HD1   1 
ATOM   3675 H  HD2   . PHE A 1 282 ? 32.389 -4.507  11.168  1.00 25.28  ? 1152 PHE A HD2   1 
ATOM   3676 H  HE1   . PHE A 1 282 ? 36.962 -3.854  11.322  1.00 32.75  ? 1152 PHE A HE1   1 
ATOM   3677 H  HE2   . PHE A 1 282 ? 33.816 -6.141  10.370  1.00 33.91  ? 1152 PHE A HE2   1 
ATOM   3678 H  HZ    . PHE A 1 282 ? 36.108 -5.814  10.446  1.00 25.65  ? 1152 PHE A HZ    1 
ATOM   3679 N  N     . CYS A 1 283 ? 33.209 -0.341  14.918  1.00 21.01  ? 1153 CYS A N     1 
ATOM   3680 C  CA    . CYS A 1 283 ? 32.989 0.941   15.569  1.00 16.45  ? 1153 CYS A CA    1 
ATOM   3681 C  C     . CYS A 1 283 ? 32.397 1.924   14.570  1.00 19.60  ? 1153 CYS A C     1 
ATOM   3682 O  O     . CYS A 1 283 ? 32.568 1.770   13.362  1.00 18.47  ? 1153 CYS A O     1 
ATOM   3683 C  CB    . CYS A 1 283 ? 34.306 1.479   16.126  1.00 19.28  ? 1153 CYS A CB    1 
ATOM   3684 S  SG    . CYS A 1 283 ? 35.008 0.441   17.433  1.00 22.75  ? 1153 CYS A SG    1 
ATOM   3685 H  H     . CYS A 1 283 ? 34.033 -0.584  14.888  1.00 25.15  ? 1153 CYS A H     1 
ATOM   3686 H  HA    . CYS A 1 283 ? 32.358 0.830   16.310  1.00 19.69  ? 1153 CYS A HA    1 
ATOM   3687 H  HB2   . CYS A 1 283 ? 34.954 1.530   15.406  1.00 23.08  ? 1153 CYS A HB2   1 
ATOM   3688 H  HB3   . CYS A 1 283 ? 34.153 2.362   16.496  1.00 23.08  ? 1153 CYS A HB3   1 
ATOM   3689 H  HG    . CYS A 1 283 ? 36.035 0.933   17.813  1.00 27.25  ? 1153 CYS A HG    1 
ATOM   3690 N  N     . SER A 1 284 ? 31.707 2.939   15.077  1.00 17.91  ? 1154 SER A N     1 
ATOM   3691 C  CA    . SER A 1 284 ? 31.112 3.950   14.218  1.00 21.01  ? 1154 SER A CA    1 
ATOM   3692 C  C     . SER A 1 284 ? 31.571 5.335   14.643  1.00 21.40  ? 1154 SER A C     1 
ATOM   3693 O  O     . SER A 1 284 ? 31.836 5.577   15.814  1.00 19.09  ? 1154 SER A O     1 
ATOM   3694 C  CB    . SER A 1 284 ? 29.585 3.865   14.276  1.00 22.68  ? 1154 SER A CB    1 
ATOM   3695 O  OG    . SER A 1 284 ? 28.998 4.749   13.342  1.00 43.18  ? 1154 SER A OG    1 
ATOM   3696 H  H     . SER A 1 284 ? 31.570 3.065   15.917  1.00 21.43  ? 1154 SER A H     1 
ATOM   3697 H  HA    . SER A 1 284 ? 31.396 3.800   13.293  1.00 25.15  ? 1154 SER A HA    1 
ATOM   3698 H  HB2   . SER A 1 284 ? 29.311 2.958   14.068  1.00 27.16  ? 1154 SER A HB2   1 
ATOM   3699 H  HB3   . SER A 1 284 ? 29.289 4.105   15.168  1.00 27.16  ? 1154 SER A HB3   1 
ATOM   3700 H  HG    . SER A 1 284 ? 28.181 4.696   13.381  1.00 51.76  ? 1154 SER A HG    1 
ATOM   3701 N  N     . VAL A 1 285 ? 31.659 6.236   13.672  1.00 16.80  ? 1155 VAL A N     1 
ATOM   3702 C  CA    . VAL A 1 285 ? 32.033 7.621   13.905  1.00 16.74  ? 1155 VAL A CA    1 
ATOM   3703 C  C     . VAL A 1 285 ? 30.929 8.474   13.303  1.00 18.51  ? 1155 VAL A C     1 
ATOM   3704 O  O     . VAL A 1 285 ? 30.501 8.224   12.181  1.00 18.94  ? 1155 VAL A O     1 
ATOM   3705 C  CB    . VAL A 1 285 ? 33.376 7.953   13.219  1.00 24.46  ? 1155 VAL A CB    1 
ATOM   3706 C  CG1   . VAL A 1 285 ? 33.695 9.437   13.337  1.00 26.73  ? 1155 VAL A CG1   1 
ATOM   3707 C  CG2   . VAL A 1 285 ? 34.502 7.103   13.805  1.00 25.83  ? 1155 VAL A CG2   1 
ATOM   3708 H  H     . VAL A 1 285 ? 31.502 6.060   12.845  1.00 20.11  ? 1155 VAL A H     1 
ATOM   3709 H  HA    . VAL A 1 285 ? 32.101 7.802   14.866  1.00 20.04  ? 1155 VAL A HA    1 
ATOM   3710 H  HB    . VAL A 1 285 ? 33.305 7.737   12.265  1.00 29.29  ? 1155 VAL A HB    1 
ATOM   3711 H  HG11  . VAL A 1 285 ? 34.533 9.612   12.903  1.00 32.02  ? 1155 VAL A HG11  1 
ATOM   3712 H  HG12  . VAL A 1 285 ? 32.996 9.942   12.916  1.00 32.02  ? 1155 VAL A HG12  1 
ATOM   3713 H  HG13  . VAL A 1 285 ? 33.753 9.671   14.267  1.00 32.02  ? 1155 VAL A HG13  1 
ATOM   3714 H  HG21  . VAL A 1 285 ? 35.324 7.327   13.363  1.00 30.94  ? 1155 VAL A HG21  1 
ATOM   3715 H  HG22  . VAL A 1 285 ? 34.574 7.286   14.744  1.00 30.94  ? 1155 VAL A HG22  1 
ATOM   3716 H  HG23  . VAL A 1 285 ? 34.297 6.175   13.666  1.00 30.94  ? 1155 VAL A HG23  1 
ATOM   3717 N  N     . ASN A 1 286 ? 30.458 9.468   14.049  1.00 18.55  ? 1156 ASN A N     1 
ATOM   3718 C  CA    . ASN A 1 286 ? 29.359 10.308  13.590  1.00 16.52  ? 1156 ASN A CA    1 
ATOM   3719 C  C     . ASN A 1 286 ? 29.604 11.758  14.002  1.00 21.86  ? 1156 ASN A C     1 
ATOM   3720 O  O     . ASN A 1 286 ? 29.837 12.042  15.172  1.00 20.67  ? 1156 ASN A O     1 
ATOM   3721 C  CB    . ASN A 1 286 ? 28.034 9.790   14.174  1.00 18.33  ? 1156 ASN A CB    1 
ATOM   3722 C  CG    . ASN A 1 286 ? 26.820 10.590  13.706  1.00 21.31  ? 1156 ASN A CG    1 
ATOM   3723 O  OD1   . ASN A 1 286 ? 26.775 11.813  13.835  1.00 21.91  ? 1156 ASN A OD1   1 
ATOM   3724 N  ND2   . ASN A 1 286 ? 25.827 9.892   13.166  1.00 20.14  ? 1156 ASN A ND2   1 
ATOM   3725 H  H     . ASN A 1 286 ? 30.758 9.677   14.828  1.00 22.20  ? 1156 ASN A H     1 
ATOM   3726 H  HA    . ASN A 1 286 ? 29.304 10.268  12.612  1.00 19.77  ? 1156 ASN A HA    1 
ATOM   3727 H  HB2   . ASN A 1 286 ? 27.908 8.868   13.900  1.00 21.94  ? 1156 ASN A HB2   1 
ATOM   3728 H  HB3   . ASN A 1 286 ? 28.074 9.846   15.141  1.00 21.94  ? 1156 ASN A HB3   1 
ATOM   3729 H  HD21  . ASN A 1 286 ? 25.120 10.295  12.886  1.00 24.12  ? 1156 ASN A HD21  1 
ATOM   3730 H  HD22  . ASN A 1 286 ? 25.890 9.037   13.096  1.00 24.12  ? 1156 ASN A HD22  1 
ATOM   3731 N  N     . ILE A 1 287 ? 29.584 12.670  13.037  1.00 19.57  ? 1157 ILE A N     1 
ATOM   3732 C  CA    . ILE A 1 287 ? 29.690 14.092  13.344  1.00 19.45  ? 1157 ILE A CA    1 
ATOM   3733 C  C     . ILE A 1 287 ? 28.395 14.805  12.980  1.00 19.76  ? 1157 ILE A C     1 
ATOM   3734 O  O     . ILE A 1 287 ? 27.896 14.668  11.865  1.00 19.07  ? 1157 ILE A O     1 
ATOM   3735 C  CB    . ILE A 1 287 ? 30.855 14.747  12.584  1.00 24.25  ? 1157 ILE A CB    1 
ATOM   3736 C  CG1   . ILE A 1 287 ? 32.180 14.101  12.989  1.00 27.24  ? 1157 ILE A CG1   1 
ATOM   3737 C  CG2   . ILE A 1 287 ? 30.896 16.247  12.869  1.00 22.19  ? 1157 ILE A CG2   1 
ATOM   3738 C  CD1   . ILE A 1 287 ? 33.346 14.469  12.087  1.00 23.14  ? 1157 ILE A CD1   1 
ATOM   3739 H  H     . ILE A 1 287 ? 29.511 12.494  12.198  1.00 23.42  ? 1157 ILE A H     1 
ATOM   3740 H  HA    . ILE A 1 287 ? 29.846 14.206  14.305  1.00 23.28  ? 1157 ILE A HA    1 
ATOM   3741 H  HB    . ILE A 1 287 ? 30.720 14.614  11.633  1.00 29.05  ? 1157 ILE A HB    1 
ATOM   3742 H  HG12  . ILE A 1 287 ? 32.402 14.382  13.890  1.00 32.64  ? 1157 ILE A HG12  1 
ATOM   3743 H  HG13  . ILE A 1 287 ? 32.078 13.136  12.962  1.00 32.64  ? 1157 ILE A HG13  1 
ATOM   3744 H  HG21  . ILE A 1 287 ? 31.628 16.636  12.386  1.00 26.57  ? 1157 ILE A HG21  1 
ATOM   3745 H  HG22  . ILE A 1 287 ? 30.068 16.642  12.584  1.00 26.57  ? 1157 ILE A HG22  1 
ATOM   3746 H  HG23  . ILE A 1 287 ? 31.016 16.382  13.812  1.00 26.57  ? 1157 ILE A HG23  1 
ATOM   3747 H  HD11  . ILE A 1 287 ? 34.137 14.027  12.404  1.00 27.72  ? 1157 ILE A HD11  1 
ATOM   3748 H  HD12  . ILE A 1 287 ? 33.149 14.187  11.191  1.00 27.72  ? 1157 ILE A HD12  1 
ATOM   3749 H  HD13  . ILE A 1 287 ? 33.470 15.421  12.111  1.00 27.72  ? 1157 ILE A HD13  1 
ATOM   3750 N  N     . ASN A 1 288 ? 27.851 15.565  13.924  1.00 20.28  ? 1158 ASN A N     1 
ATOM   3751 C  CA    . ASN A 1 288 ? 26.648 16.351  13.675  1.00 21.59  ? 1158 ASN A CA    1 
ATOM   3752 C  C     . ASN A 1 288 ? 27.019 17.668  13.000  1.00 21.07  ? 1158 ASN A C     1 
ATOM   3753 O  O     . ASN A 1 288 ? 27.813 18.442  13.528  1.00 21.73  ? 1158 ASN A O     1 
ATOM   3754 C  CB    . ASN A 1 288 ? 25.910 16.605  14.992  1.00 17.49  ? 1158 ASN A CB    1 
ATOM   3755 C  CG    . ASN A 1 288 ? 24.584 17.324  14.803  1.00 29.68  ? 1158 ASN A CG    1 
ATOM   3756 O  OD1   . ASN A 1 288 ? 24.187 17.655  13.688  1.00 25.77  ? 1158 ASN A OD1   1 
ATOM   3757 N  ND2   . ASN A 1 288 ? 23.883 17.552  15.906  1.00 23.80  ? 1158 ASN A ND2   1 
ATOM   3758 H  H     . ASN A 1 288 ? 28.161 15.643  14.722  1.00 24.28  ? 1158 ASN A H     1 
ATOM   3759 H  HA    . ASN A 1 288 ? 26.051 15.854  13.077  1.00 25.85  ? 1158 ASN A HA    1 
ATOM   3760 H  HB2   . ASN A 1 288 ? 25.730 15.753  15.421  1.00 20.94  ? 1158 ASN A HB2   1 
ATOM   3761 H  HB3   . ASN A 1 288 ? 26.469 17.153  15.565  1.00 20.94  ? 1158 ASN A HB3   1 
ATOM   3762 H  HD21  . ASN A 1 288 ? 23.125 17.956  15.858  1.00 28.51  ? 1158 ASN A HD21  1 
ATOM   3763 H  HD22  . ASN A 1 288 ? 24.187 17.297  16.669  1.00 28.51  ? 1158 ASN A HD22  1 
ATOM   3764 N  N     . ILE A 1 289 ? 26.463 17.906  11.818  1.00 21.15  ? 1159 ILE A N     1 
ATOM   3765 C  CA    . ILE A 1 289 ? 26.739 19.128  11.068  1.00 22.87  ? 1159 ILE A CA    1 
ATOM   3766 C  C     . ILE A 1 289 ? 25.965 20.321  11.622  1.00 26.48  ? 1159 ILE A C     1 
ATOM   3767 O  O     . ILE A 1 289 ? 26.421 21.461  11.532  1.00 28.61  ? 1159 ILE A O     1 
ATOM   3768 C  CB    . ILE A 1 289 ? 26.380 18.950  9.583   1.00 20.67  ? 1159 ILE A CB    1 
ATOM   3769 C  CG1   . ILE A 1 289 ? 27.126 17.745  9.001   1.00 23.19  ? 1159 ILE A CG1   1 
ATOM   3770 C  CG2   . ILE A 1 289 ? 26.696 20.225  8.791   1.00 22.97  ? 1159 ILE A CG2   1 
ATOM   3771 C  CD1   . ILE A 1 289 ? 28.627 17.794  9.222   1.00 23.13  ? 1159 ILE A CD1   1 
ATOM   3772 H  H     . ILE A 1 289 ? 25.917 17.371  11.425  1.00 25.32  ? 1159 ILE A H     1 
ATOM   3773 H  HA    . ILE A 1 289 ? 27.696 19.331  11.128  1.00 27.39  ? 1159 ILE A HA    1 
ATOM   3774 H  HB    . ILE A 1 289 ? 25.427 18.779  9.519   1.00 24.75  ? 1159 ILE A HB    1 
ATOM   3775 H  HG12  . ILE A 1 289 ? 26.790 16.937  9.420   1.00 27.77  ? 1159 ILE A HG12  1 
ATOM   3776 H  HG13  . ILE A 1 289 ? 26.968 17.711  8.045   1.00 27.77  ? 1159 ILE A HG13  1 
ATOM   3777 H  HG21  . ILE A 1 289 ? 26.462 20.086  7.870   1.00 27.51  ? 1159 ILE A HG21  1 
ATOM   3778 H  HG22  . ILE A 1 289 ? 26.184 20.952  9.153   1.00 27.51  ? 1159 ILE A HG22  1 
ATOM   3779 H  HG23  . ILE A 1 289 ? 27.634 20.415  8.866   1.00 27.51  ? 1159 ILE A HG23  1 
ATOM   3780 H  HD11  . ILE A 1 289 ? 29.025 17.012  8.834   1.00 27.70  ? 1159 ILE A HD11  1 
ATOM   3781 H  HD12  . ILE A 1 289 ? 28.978 18.584  8.804   1.00 27.70  ? 1159 ILE A HD12  1 
ATOM   3782 H  HD13  . ILE A 1 289 ? 28.803 17.817  10.166  1.00 27.70  ? 1159 ILE A HD13  1 
ATOM   3783 N  N     . GLY A 1 290 ? 24.790 20.050  12.182  1.00 25.24  ? 1160 GLY A N     1 
ATOM   3784 C  CA    . GLY A 1 290 ? 23.914 21.098  12.675  1.00 29.09  ? 1160 GLY A CA    1 
ATOM   3785 C  C     . GLY A 1 290 ? 22.905 21.506  11.617  1.00 25.38  ? 1160 GLY A C     1 
ATOM   3786 O  O     . GLY A 1 290 ? 22.836 20.887  10.553  1.00 24.83  ? 1160 GLY A O     1 
ATOM   3787 H  H     . GLY A 1 290 ? 24.477 19.256  12.288  1.00 30.23  ? 1160 GLY A H     1 
ATOM   3788 H  HA2   . GLY A 1 290 ? 23.436 20.784  13.458  1.00 34.85  ? 1160 GLY A HA2   1 
ATOM   3789 H  HA3   . GLY A 1 290 ? 24.439 21.876  12.921  1.00 34.85  ? 1160 GLY A HA3   1 
ATOM   3790 N  N     . PRO A 1 291 ? 22.132 22.570  11.884  1.00 28.05  ? 1161 PRO A N     1 
ATOM   3791 C  CA    . PRO A 1 291 ? 22.249 23.419  13.076  1.00 25.46  ? 1161 PRO A CA    1 
ATOM   3792 C  C     . PRO A 1 291 ? 21.605 22.845  14.344  1.00 31.76  ? 1161 PRO A C     1 
ATOM   3793 O  O     . PRO A 1 291 ? 21.864 23.366  15.428  1.00 29.89  ? 1161 PRO A O     1 
ATOM   3794 C  CB    . PRO A 1 291 ? 21.540 24.711  12.648  1.00 28.87  ? 1161 PRO A CB    1 
ATOM   3795 C  CG    . PRO A 1 291 ? 20.536 24.274  11.637  1.00 30.28  ? 1161 PRO A CG    1 
ATOM   3796 C  CD    . PRO A 1 291 ? 21.138 23.089  10.926  1.00 30.89  ? 1161 PRO A CD    1 
ATOM   3797 H  HA    . PRO A 1 291 ? 23.192 23.617  13.257  1.00 30.49  ? 1161 PRO A HA    1 
ATOM   3798 H  HB2   . PRO A 1 291 ? 21.104 25.115  13.415  1.00 34.59  ? 1161 PRO A HB2   1 
ATOM   3799 H  HB3   . PRO A 1 291 ? 22.182 25.323  12.254  1.00 34.59  ? 1161 PRO A HB3   1 
ATOM   3800 H  HG2   . PRO A 1 291 ? 19.715 24.019  12.086  1.00 36.28  ? 1161 PRO A HG2   1 
ATOM   3801 H  HG3   . PRO A 1 291 ? 20.371 24.997  11.012  1.00 36.28  ? 1161 PRO A HG3   1 
ATOM   3802 H  HD2   . PRO A 1 291 ? 20.458 22.420  10.750  1.00 37.02  ? 1161 PRO A HD2   1 
ATOM   3803 H  HD3   . PRO A 1 291 ? 21.576 23.374  10.108  1.00 37.02  ? 1161 PRO A HD3   1 
ATOM   3804 N  N     . GLY A 1 292 ? 20.802 21.790  14.220  1.00 27.83  ? 1162 GLY A N     1 
ATOM   3805 C  CA    . GLY A 1 292 ? 20.090 21.235  15.363  1.00 27.43  ? 1162 GLY A CA    1 
ATOM   3806 C  C     . GLY A 1 292 ? 20.846 20.101  16.045  1.00 24.56  ? 1162 GLY A C     1 
ATOM   3807 O  O     . GLY A 1 292 ? 21.906 19.691  15.576  1.00 25.09  ? 1162 GLY A O     1 
ATOM   3808 H  H     . GLY A 1 292 ? 20.654 21.378  13.480  1.00 33.34  ? 1162 GLY A H     1 
ATOM   3809 H  HA2   . GLY A 1 292 ? 19.937 21.935  16.016  1.00 32.86  ? 1162 GLY A HA2   1 
ATOM   3810 H  HA3   . GLY A 1 292 ? 19.230 20.896  15.071  1.00 32.86  ? 1162 GLY A HA3   1 
ATOM   3811 N  N     . ASP A 1 293 ? 20.297 19.594  17.150  1.00 24.60  ? 1163 ASP A N     1 
ATOM   3812 C  CA    . ASP A 1 293 ? 20.941 18.537  17.935  1.00 20.69  ? 1163 ASP A CA    1 
ATOM   3813 C  C     . ASP A 1 293 ? 20.345 17.169  17.623  1.00 24.23  ? 1163 ASP A C     1 
ATOM   3814 O  O     . ASP A 1 293 ? 19.240 17.070  17.103  1.00 25.65  ? 1163 ASP A O     1 
ATOM   3815 C  CB    . ASP A 1 293 ? 20.759 18.789  19.436  1.00 22.21  ? 1163 ASP A CB    1 
ATOM   3816 C  CG    . ASP A 1 293 ? 21.359 20.103  19.899  1.00 35.02  ? 1163 ASP A CG    1 
ATOM   3817 O  OD1   . ASP A 1 293 ? 22.386 20.540  19.341  1.00 27.58  ? 1163 ASP A OD1   1 
ATOM   3818 O  OD2   . ASP A 1 293 ? 20.801 20.690  20.846  1.00 36.46  ? 1163 ASP A OD2   1 
ATOM   3819 H  H     . ASP A 1 293 ? 19.541 19.849  17.471  1.00 29.47  ? 1163 ASP A H     1 
ATOM   3820 H  HA    . ASP A 1 293 ? 21.900 18.515  17.734  1.00 24.77  ? 1163 ASP A HA    1 
ATOM   3821 H  HB2   . ASP A 1 293 ? 19.811 18.805  19.640  1.00 26.59  ? 1163 ASP A HB2   1 
ATOM   3822 H  HB3   . ASP A 1 293 ? 21.191 18.074  19.929  1.00 26.59  ? 1163 ASP A HB3   1 
ATOM   3823 N  N     . CYS A 1 294 ? 21.087 16.117  17.959  1.00 25.04  ? 1164 CYS A N     1 
ATOM   3824 C  CA    . CYS A 1 294 ? 20.571 14.753  17.919  1.00 19.75  ? 1164 CYS A CA    1 
ATOM   3825 C  C     . CYS A 1 294 ? 20.585 14.168  19.322  1.00 22.09  ? 1164 CYS A C     1 
ATOM   3826 O  O     . CYS A 1 294 ? 21.397 14.563  20.149  1.00 27.33  ? 1164 CYS A O     1 
ATOM   3827 C  CB    . CYS A 1 294 ? 21.429 13.876  17.009  1.00 20.93  ? 1164 CYS A CB    1 
ATOM   3828 S  SG    . CYS A 1 294 ? 21.246 14.272  15.269  1.00 26.39  ? 1164 CYS A SG    1 
ATOM   3829 H  H     . CYS A 1 294 ? 21.906 16.169  18.218  1.00 29.99  ? 1164 CYS A H     1 
ATOM   3830 H  HA    . CYS A 1 294 ? 19.650 14.754  17.584  1.00 23.64  ? 1164 CYS A HA    1 
ATOM   3831 H  HB2   . CYS A 1 294 ? 22.362 13.995  17.245  1.00 25.06  ? 1164 CYS A HB2   1 
ATOM   3832 H  HB3   . CYS A 1 294 ? 21.172 12.949  17.132  1.00 25.06  ? 1164 CYS A HB3   1 
ATOM   3833 H  HG    . CYS A 1 294 ? 21.570 15.413  15.091  1.00 31.61  ? 1164 CYS A HG    1 
ATOM   3834 N  N     . GLU A 1 295 ? 19.692 13.224  19.585  1.00 21.08  ? 1165 GLU A N     1 
ATOM   3835 C  CA    . GLU A 1 295 ? 19.667 12.527  20.864  1.00 22.71  ? 1165 GLU A CA    1 
ATOM   3836 C  C     . GLU A 1 295 ? 20.011 11.063  20.644  1.00 24.41  ? 1165 GLU A C     1 
ATOM   3837 O  O     . GLU A 1 295 ? 19.434 10.406  19.774  1.00 24.99  ? 1165 GLU A O     1 
ATOM   3838 C  CB    . GLU A 1 295 ? 18.292 12.647  21.512  1.00 24.07  ? 1165 GLU A CB    1 
ATOM   3839 C  CG    . GLU A 1 295 ? 18.195 11.995  22.874  1.00 29.73  ? 1165 GLU A CG    1 
ATOM   3840 C  CD    . GLU A 1 295 ? 16.906 12.353  23.585  1.00 27.54  ? 1165 GLU A CD    1 
ATOM   3841 O  OE1   . GLU A 1 295 ? 15.871 12.475  22.911  1.00 30.46  ? 1165 GLU A OE1   1 
ATOM   3842 O  OE2   . GLU A 1 295 ? 16.928 12.528  24.816  1.00 27.53  ? 1165 GLU A OE2   1 
ATOM   3843 H  H     . GLU A 1 295 ? 19.083 12.966  19.035  1.00 25.24  ? 1165 GLU A H     1 
ATOM   3844 H  HA    . GLU A 1 295 ? 20.333 12.919  21.467  1.00 27.19  ? 1165 GLU A HA    1 
ATOM   3845 H  HB2   . GLU A 1 295 ? 18.078 13.587  21.619  1.00 28.83  ? 1165 GLU A HB2   1 
ATOM   3846 H  HB3   . GLU A 1 295 ? 17.637 12.225  20.935  1.00 28.83  ? 1165 GLU A HB3   1 
ATOM   3847 H  HG2   . GLU A 1 295 ? 18.224 11.031  22.768  1.00 35.62  ? 1165 GLU A HG2   1 
ATOM   3848 H  HG3   . GLU A 1 295 ? 18.936 12.294  23.424  1.00 35.62  ? 1165 GLU A HG3   1 
ATOM   3849 N  N     . TRP A 1 296 ? 20.949 10.561  21.439  1.00 20.00  ? 1166 TRP A N     1 
ATOM   3850 C  CA    . TRP A 1 296 ? 21.444 9.201   21.301  1.00 21.35  ? 1166 TRP A CA    1 
ATOM   3851 C  C     . TRP A 1 296 ? 21.047 8.344   22.495  1.00 20.50  ? 1166 TRP A C     1 
ATOM   3852 O  O     . TRP A 1 296 ? 21.055 8.809   23.635  1.00 21.28  ? 1166 TRP A O     1 
ATOM   3853 C  CB    . TRP A 1 296 ? 22.969 9.211   21.181  1.00 17.08  ? 1166 TRP A CB    1 
ATOM   3854 C  CG    . TRP A 1 296 ? 23.470 9.744   19.875  1.00 18.52  ? 1166 TRP A CG    1 
ATOM   3855 C  CD1   . TRP A 1 296 ? 23.379 11.031  19.425  1.00 23.58  ? 1166 TRP A CD1   1 
ATOM   3856 C  CD2   . TRP A 1 296 ? 24.150 9.007   18.852  1.00 17.78  ? 1166 TRP A CD2   1 
ATOM   3857 N  NE1   . TRP A 1 296 ? 23.954 11.137  18.182  1.00 22.38  ? 1166 TRP A NE1   1 
ATOM   3858 C  CE2   . TRP A 1 296 ? 24.438 9.907   17.808  1.00 19.83  ? 1166 TRP A CE2   1 
ATOM   3859 C  CE3   . TRP A 1 296 ? 24.544 7.668   18.716  1.00 20.38  ? 1166 TRP A CE3   1 
ATOM   3860 C  CZ2   . TRP A 1 296 ? 25.098 9.516   16.640  1.00 23.53  ? 1166 TRP A CZ2   1 
ATOM   3861 C  CZ3   . TRP A 1 296 ? 25.201 7.281   17.560  1.00 16.47  ? 1166 TRP A CZ3   1 
ATOM   3862 C  CH2   . TRP A 1 296 ? 25.472 8.203   16.536  1.00 19.34  ? 1166 TRP A CH2   1 
ATOM   3863 H  H     . TRP A 1 296 ? 21.321 11.000  22.079  1.00 23.94  ? 1166 TRP A H     1 
ATOM   3864 H  HA    . TRP A 1 296 ? 21.071 8.797   20.490  1.00 25.56  ? 1166 TRP A HA    1 
ATOM   3865 H  HB2   . TRP A 1 296 ? 23.335 9.766   21.887  1.00 20.45  ? 1166 TRP A HB2   1 
ATOM   3866 H  HB3   . TRP A 1 296 ? 23.296 8.302   21.275  1.00 20.45  ? 1166 TRP A HB3   1 
ATOM   3867 H  HD1   . TRP A 1 296 ? 22.980 11.731  19.890  1.00 28.24  ? 1166 TRP A HD1   1 
ATOM   3868 H  HE1   . TRP A 1 296 ? 24.005 11.857  17.715  1.00 26.81  ? 1166 TRP A HE1   1 
ATOM   3869 H  HE3   . TRP A 1 296 ? 24.368 7.051   19.390  1.00 24.40  ? 1166 TRP A HE3   1 
ATOM   3870 H  HZ2   . TRP A 1 296 ? 25.281 10.126  15.961  1.00 28.17  ? 1166 TRP A HZ2   1 
ATOM   3871 H  HZ3   . TRP A 1 296 ? 25.466 6.395   17.460  1.00 19.71  ? 1166 TRP A HZ3   1 
ATOM   3872 H  HH2   . TRP A 1 296 ? 25.915 7.915   15.770  1.00 23.15  ? 1166 TRP A HH2   1 
ATOM   3873 N  N     . PHE A 1 297 ? 20.710 7.089   22.213  1.00 18.17  ? 1167 PHE A N     1 
ATOM   3874 C  CA    . PHE A 1 297 ? 20.425 6.095   23.238  1.00 20.49  ? 1167 PHE A CA    1 
ATOM   3875 C  C     . PHE A 1 297 ? 21.383 4.932   23.012  1.00 22.48  ? 1167 PHE A C     1 
ATOM   3876 O  O     . PHE A 1 297 ? 21.497 4.423   21.899  1.00 23.73  ? 1167 PHE A O     1 
ATOM   3877 C  CB    . PHE A 1 297 ? 18.971 5.625   23.145  1.00 16.71  ? 1167 PHE A CB    1 
ATOM   3878 C  CG    . PHE A 1 297 ? 17.966 6.742   23.253  1.00 23.78  ? 1167 PHE A CG    1 
ATOM   3879 C  CD1   . PHE A 1 297 ? 17.333 7.010   24.459  1.00 25.65  ? 1167 PHE A CD1   1 
ATOM   3880 C  CD2   . PHE A 1 297 ? 17.660 7.527   22.155  1.00 23.80  ? 1167 PHE A CD2   1 
ATOM   3881 C  CE1   . PHE A 1 297 ? 16.413 8.033   24.565  1.00 29.99  ? 1167 PHE A CE1   1 
ATOM   3882 C  CE2   . PHE A 1 297 ? 16.742 8.559   22.256  1.00 26.48  ? 1167 PHE A CE2   1 
ATOM   3883 C  CZ    . PHE A 1 297 ? 16.117 8.811   23.463  1.00 35.00  ? 1167 PHE A CZ    1 
ATOM   3884 H  H     . PHE A 1 297 ? 20.638 6.783   21.412  1.00 21.75  ? 1167 PHE A H     1 
ATOM   3885 H  HA    . PHE A 1 297 ? 20.584 6.474   24.128  1.00 24.53  ? 1167 PHE A HA    1 
ATOM   3886 H  HB2   . PHE A 1 297 ? 18.837 5.187   22.290  1.00 19.99  ? 1167 PHE A HB2   1 
ATOM   3887 H  HB3   . PHE A 1 297 ? 18.798 4.999   23.866  1.00 19.99  ? 1167 PHE A HB3   1 
ATOM   3888 H  HD1   . PHE A 1 297 ? 17.529 6.490   25.205  1.00 30.72  ? 1167 PHE A HD1   1 
ATOM   3889 H  HD2   . PHE A 1 297 ? 18.079 7.362   21.341  1.00 28.50  ? 1167 PHE A HD2   1 
ATOM   3890 H  HE1   . PHE A 1 297 ? 15.995 8.202   25.379  1.00 35.93  ? 1167 PHE A HE1   1 
ATOM   3891 H  HE2   . PHE A 1 297 ? 16.543 9.079   21.511  1.00 31.72  ? 1167 PHE A HE2   1 
ATOM   3892 H  HZ    . PHE A 1 297 ? 15.497 9.501   23.532  1.00 41.95  ? 1167 PHE A HZ    1 
ATOM   3893 N  N     . VAL A 1 298 ? 22.075 4.515   24.066  1.00 17.95  ? 1168 VAL A N     1 
ATOM   3894 C  CA    . VAL A 1 298 ? 23.167 3.559   23.926  1.00 22.48  ? 1168 VAL A CA    1 
ATOM   3895 C  C     . VAL A 1 298 ? 23.107 2.485   25.009  1.00 26.53  ? 1168 VAL A C     1 
ATOM   3896 O  O     . VAL A 1 298 ? 22.873 2.780   26.179  1.00 26.59  ? 1168 VAL A O     1 
ATOM   3897 C  CB    . VAL A 1 298 ? 24.535 4.280   23.989  1.00 24.43  ? 1168 VAL A CB    1 
ATOM   3898 C  CG1   . VAL A 1 298 ? 25.642 3.323   24.420  1.00 22.85  ? 1168 VAL A CG1   1 
ATOM   3899 C  CG2   . VAL A 1 298 ? 24.868 4.932   22.638  1.00 22.57  ? 1168 VAL A CG2   1 
ATOM   3900 H  H     . VAL A 1 298 ? 21.932 4.771   24.874  1.00 21.48  ? 1168 VAL A H     1 
ATOM   3901 H  HA    . VAL A 1 298 ? 23.096 3.117   23.055  1.00 26.92  ? 1168 VAL A HA    1 
ATOM   3902 H  HB    . VAL A 1 298 ? 24.483 4.994   24.658  1.00 29.26  ? 1168 VAL A HB    1 
ATOM   3903 H  HG11  . VAL A 1 298 ? 26.474 3.801   24.448  1.00 27.36  ? 1168 VAL A HG11  1 
ATOM   3904 H  HG12  . VAL A 1 298 ? 25.433 2.977   25.291  1.00 27.36  ? 1168 VAL A HG12  1 
ATOM   3905 H  HG13  . VAL A 1 298 ? 25.698 2.605   23.786  1.00 27.36  ? 1168 VAL A HG13  1 
ATOM   3906 H  HG21  . VAL A 1 298 ? 25.719 5.370   22.705  1.00 27.03  ? 1168 VAL A HG21  1 
ATOM   3907 H  HG22  . VAL A 1 298 ? 24.902 4.250   21.963  1.00 27.03  ? 1168 VAL A HG22  1 
ATOM   3908 H  HG23  . VAL A 1 298 ? 24.185 5.572   22.424  1.00 27.03  ? 1168 VAL A HG23  1 
ATOM   3909 N  N     . VAL A 1 299 ? 23.316 1.239   24.600  1.00 21.66  ? 1169 VAL A N     1 
ATOM   3910 C  CA    . VAL A 1 299 ? 23.347 0.102   25.511  1.00 21.57  ? 1169 VAL A CA    1 
ATOM   3911 C  C     . VAL A 1 299 ? 24.639 -0.668  25.255  1.00 27.09  ? 1169 VAL A C     1 
ATOM   3912 O  O     . VAL A 1 299 ? 25.018 -0.879  24.102  1.00 22.58  ? 1169 VAL A O     1 
ATOM   3913 C  CB    . VAL A 1 299 ? 22.120 -0.817  25.300  1.00 23.22  ? 1169 VAL A CB    1 
ATOM   3914 C  CG1   . VAL A 1 299 ? 22.313 -2.158  26.005  1.00 26.62  ? 1169 VAL A CG1   1 
ATOM   3915 C  CG2   . VAL A 1 299 ? 20.851 -0.122  25.785  1.00 24.54  ? 1169 VAL A CG2   1 
ATOM   3916 H  H     . VAL A 1 299 ? 23.446 1.021   23.778  1.00 25.94  ? 1169 VAL A H     1 
ATOM   3917 H  HA    . VAL A 1 299 ? 23.347 0.420   26.438  1.00 25.83  ? 1169 VAL A HA    1 
ATOM   3918 H  HB    . VAL A 1 299 ? 22.018 -0.994  24.341  1.00 27.81  ? 1169 VAL A HB    1 
ATOM   3919 H  HG11  . VAL A 1 299 ? 21.538 -2.704  25.856  1.00 31.89  ? 1169 VAL A HG11  1 
ATOM   3920 H  HG12  . VAL A 1 299 ? 23.092 -2.590  25.646  1.00 31.89  ? 1169 VAL A HG12  1 
ATOM   3921 H  HG13  . VAL A 1 299 ? 22.428 -2.003  26.945  1.00 31.89  ? 1169 VAL A HG13  1 
ATOM   3922 H  HG21  . VAL A 1 299 ? 20.102 -0.707  25.646  1.00 29.39  ? 1169 VAL A HG21  1 
ATOM   3923 H  HG22  . VAL A 1 299 ? 20.942 0.077   26.720  1.00 29.39  ? 1169 VAL A HG22  1 
ATOM   3924 H  HG23  . VAL A 1 299 ? 20.730 0.690   25.287  1.00 29.39  ? 1169 VAL A HG23  1 
ATOM   3925 N  N     . PRO A 1 300 ? 25.337 -1.076  26.325  1.00 22.84  ? 1170 PRO A N     1 
ATOM   3926 C  CA    . PRO A 1 300 ? 26.627 -1.748  26.125  1.00 19.77  ? 1170 PRO A CA    1 
ATOM   3927 C  C     . PRO A 1 300 ? 26.507 -3.055  25.345  1.00 23.82  ? 1170 PRO A C     1 
ATOM   3928 O  O     . PRO A 1 300 ? 25.481 -3.728  25.406  1.00 23.53  ? 1170 PRO A O     1 
ATOM   3929 C  CB    . PRO A 1 300 ? 27.110 -2.021  27.554  1.00 24.85  ? 1170 PRO A CB    1 
ATOM   3930 C  CG    . PRO A 1 300 ? 26.373 -1.034  28.404  1.00 25.53  ? 1170 PRO A CG    1 
ATOM   3931 C  CD    . PRO A 1 300 ? 25.032 -0.882  27.753  1.00 18.75  ? 1170 PRO A CD    1 
ATOM   3932 H  HA    . PRO A 1 300 ? 27.260 -1.152  25.673  1.00 23.66  ? 1170 PRO A HA    1 
ATOM   3933 H  HB2   . PRO A 1 300 ? 26.885 -2.930  27.808  1.00 29.76  ? 1170 PRO A HB2   1 
ATOM   3934 H  HB3   . PRO A 1 300 ? 28.068 -1.875  27.609  1.00 29.76  ? 1170 PRO A HB3   1 
ATOM   3935 H  HG2   . PRO A 1 300 ? 26.279 -1.383  29.304  1.00 30.58  ? 1170 PRO A HG2   1 
ATOM   3936 H  HG3   . PRO A 1 300 ? 26.848 -0.188  28.411  1.00 30.58  ? 1170 PRO A HG3   1 
ATOM   3937 H  HD2   . PRO A 1 300 ? 24.423 -1.569  28.066  1.00 22.45  ? 1170 PRO A HD2   1 
ATOM   3938 H  HD3   . PRO A 1 300 ? 24.678 0.008   27.907  1.00 22.45  ? 1170 PRO A HD3   1 
ATOM   3939 N  N     . GLU A 1 301 ? 27.572 -3.400  24.628  1.00 21.17  ? 1171 GLU A N     1 
ATOM   3940 C  CA    . GLU A 1 301 ? 27.610 -4.580  23.773  1.00 21.62  ? 1171 GLU A CA    1 
ATOM   3941 C  C     . GLU A 1 301 ? 27.144 -5.835  24.506  1.00 24.08  ? 1171 GLU A C     1 
ATOM   3942 O  O     . GLU A 1 301 ? 26.434 -6.664  23.939  1.00 24.12  ? 1171 GLU A O     1 
ATOM   3943 C  CB    . GLU A 1 301 ? 29.037 -4.780  23.251  1.00 22.97  ? 1171 GLU A CB    1 
ATOM   3944 C  CG    . GLU A 1 301 ? 29.204 -5.915  22.252  1.00 23.84  ? 1171 GLU A CG    1 
ATOM   3945 C  CD    . GLU A 1 301 ? 29.356 -7.268  22.913  1.00 29.23  ? 1171 GLU A CD    1 
ATOM   3946 O  OE1   . GLU A 1 301 ? 29.926 -7.330  24.022  1.00 28.17  ? 1171 GLU A OE1   1 
ATOM   3947 O  OE2   . GLU A 1 301 ? 28.906 -8.271  22.319  1.00 31.99  ? 1171 GLU A OE2   1 
ATOM   3948 H  H     . GLU A 1 301 ? 28.306 -2.952  24.621  1.00 25.35  ? 1171 GLU A H     1 
ATOM   3949 H  HA    . GLU A 1 301 ? 27.020 -4.439  23.003  1.00 25.89  ? 1171 GLU A HA    1 
ATOM   3950 H  HB2   . GLU A 1 301 ? 29.323 -3.962  22.814  1.00 27.51  ? 1171 GLU A HB2   1 
ATOM   3951 H  HB3   . GLU A 1 301 ? 29.617 -4.967  24.005  1.00 27.51  ? 1171 GLU A HB3   1 
ATOM   3952 H  HG2   . GLU A 1 301 ? 28.422 -5.949  21.679  1.00 28.56  ? 1171 GLU A HG2   1 
ATOM   3953 H  HG3   . GLU A 1 301 ? 29.998 -5.751  21.719  1.00 28.56  ? 1171 GLU A HG3   1 
ATOM   3954 N  N     . GLY A 1 302 ? 27.539 -5.970  25.768  1.00 28.69  ? 1172 GLY A N     1 
ATOM   3955 C  CA    . GLY A 1 302 ? 27.272 -7.179  26.530  1.00 30.20  ? 1172 GLY A CA    1 
ATOM   3956 C  C     . GLY A 1 302 ? 25.795 -7.470  26.741  1.00 30.85  ? 1172 GLY A C     1 
ATOM   3957 O  O     . GLY A 1 302 ? 25.422 -8.576  27.129  1.00 28.48  ? 1172 GLY A O     1 
ATOM   3958 H  H     . GLY A 1 302 ? 27.968 -5.368  26.208  1.00 34.37  ? 1172 GLY A H     1 
ATOM   3959 H  HA2   . GLY A 1 302 ? 27.665 -7.937  26.070  1.00 36.19  ? 1172 GLY A HA2   1 
ATOM   3960 H  HA3   . GLY A 1 302 ? 27.691 -7.104  27.402  1.00 36.19  ? 1172 GLY A HA3   1 
ATOM   3961 N  N     . TYR A 1 303 ? 24.948 -6.478  26.490  1.00 22.91  ? 1173 TYR A N     1 
ATOM   3962 C  CA    . TYR A 1 303 ? 23.512 -6.633  26.688  1.00 24.08  ? 1173 TYR A CA    1 
ATOM   3963 C  C     . TYR A 1 303 ? 22.753 -6.942  25.400  1.00 24.26  ? 1173 TYR A C     1 
ATOM   3964 O  O     . TYR A 1 303 ? 21.523 -6.943  25.402  1.00 24.76  ? 1173 TYR A O     1 
ATOM   3965 C  CB    . TYR A 1 303 ? 22.923 -5.369  27.328  1.00 25.26  ? 1173 TYR A CB    1 
ATOM   3966 C  CG    . TYR A 1 303 ? 23.275 -5.211  28.790  1.00 25.63  ? 1173 TYR A CG    1 
ATOM   3967 C  CD1   . TYR A 1 303 ? 22.424 -5.683  29.786  1.00 27.21  ? 1173 TYR A CD1   1 
ATOM   3968 C  CD2   . TYR A 1 303 ? 24.459 -4.601  29.175  1.00 23.60  ? 1173 TYR A CD2   1 
ATOM   3969 C  CE1   . TYR A 1 303 ? 22.745 -5.547  31.124  1.00 30.78  ? 1173 TYR A CE1   1 
ATOM   3970 C  CE2   . TYR A 1 303 ? 24.790 -4.460  30.513  1.00 28.31  ? 1173 TYR A CE2   1 
ATOM   3971 C  CZ    . TYR A 1 303 ? 23.930 -4.935  31.481  1.00 31.25  ? 1173 TYR A CZ    1 
ATOM   3972 O  OH    . TYR A 1 303 ? 24.257 -4.796  32.807  1.00 30.28  ? 1173 TYR A OH    1 
ATOM   3973 H  H     . TYR A 1 303 ? 25.181 -5.702  26.202  1.00 27.44  ? 1173 TYR A H     1 
ATOM   3974 H  HA    . TYR A 1 303 ? 23.361 -7.378  27.307  1.00 28.84  ? 1173 TYR A HA    1 
ATOM   3975 H  HB2   . TYR A 1 303 ? 23.261 -4.592  26.856  1.00 30.25  ? 1173 TYR A HB2   1 
ATOM   3976 H  HB3   . TYR A 1 303 ? 21.957 -5.403  27.257  1.00 30.25  ? 1173 TYR A HB3   1 
ATOM   3977 H  HD1   . TYR A 1 303 ? 21.626 -6.097  29.547  1.00 32.60  ? 1173 TYR A HD1   1 
ATOM   3978 H  HD2   . TYR A 1 303 ? 25.041 -4.281  28.524  1.00 28.26  ? 1173 TYR A HD2   1 
ATOM   3979 H  HE1   . TYR A 1 303 ? 22.166 -5.867  31.778  1.00 36.89  ? 1173 TYR A HE1   1 
ATOM   3980 H  HE2   . TYR A 1 303 ? 25.587 -4.048  30.757  1.00 33.92  ? 1173 TYR A HE2   1 
ATOM   3981 H  HH    . TYR A 1 303 ? 24.343 -4.002  32.993  1.00 36.28  ? 1173 TYR A HH    1 
ATOM   3982 N  N     . TRP A 1 304 ? 23.461 -7.218  24.306  1.00 24.23  ? 1174 TRP A N     1 
ATOM   3983 C  CA    . TRP A 1 304 ? 22.783 -7.403  23.020  1.00 25.31  ? 1174 TRP A CA    1 
ATOM   3984 C  C     . TRP A 1 304 ? 21.922 -8.662  23.011  1.00 22.43  ? 1174 TRP A C     1 
ATOM   3985 O  O     . TRP A 1 304 ? 20.933 -8.733  22.287  1.00 27.14  ? 1174 TRP A O     1 
ATOM   3986 C  CB    . TRP A 1 304 ? 23.770 -7.399  21.841  1.00 25.74  ? 1174 TRP A CB    1 
ATOM   3987 C  CG    . TRP A 1 304 ? 24.515 -8.682  21.587  1.00 27.29  ? 1174 TRP A CG    1 
ATOM   3988 C  CD1   . TRP A 1 304 ? 25.739 -9.036  22.088  1.00 27.03  ? 1174 TRP A CD1   1 
ATOM   3989 C  CD2   . TRP A 1 304 ? 24.104 -9.764  20.736  1.00 25.33  ? 1174 TRP A CD2   1 
ATOM   3990 N  NE1   . TRP A 1 304 ? 26.108 -10.276 21.610  1.00 28.12  ? 1174 TRP A NE1   1 
ATOM   3991 C  CE2   . TRP A 1 304 ? 25.121 -10.744 20.782  1.00 29.54  ? 1174 TRP A CE2   1 
ATOM   3992 C  CE3   . TRP A 1 304 ? 22.975 -10.002 19.945  1.00 22.65  ? 1174 TRP A CE3   1 
ATOM   3993 C  CZ2   . TRP A 1 304 ? 25.040 -11.941 20.069  1.00 27.61  ? 1174 TRP A CZ2   1 
ATOM   3994 C  CZ3   . TRP A 1 304 ? 22.894 -11.197 19.241  1.00 30.76  ? 1174 TRP A CZ3   1 
ATOM   3995 C  CH2   . TRP A 1 304 ? 23.922 -12.147 19.305  1.00 26.71  ? 1174 TRP A CH2   1 
ATOM   3996 H  H     . TRP A 1 304 ? 24.316 -7.302  24.278  1.00 29.02  ? 1174 TRP A H     1 
ATOM   3997 H  HA    . TRP A 1 304 ? 22.178 -6.644  22.888  1.00 30.31  ? 1174 TRP A HA    1 
ATOM   3998 H  HB2   . TRP A 1 304 ? 23.276 -7.189  21.033  1.00 30.83  ? 1174 TRP A HB2   1 
ATOM   3999 H  HB3   . TRP A 1 304 ? 24.432 -6.709  22.001  1.00 30.83  ? 1174 TRP A HB3   1 
ATOM   4000 H  HD1   . TRP A 1 304 ? 26.247 -8.516  22.667  1.00 32.37  ? 1174 TRP A HD1   1 
ATOM   4001 H  HE1   . TRP A 1 304 ? 26.836 -10.690 21.804  1.00 33.68  ? 1174 TRP A HE1   1 
ATOM   4002 H  HE3   . TRP A 1 304 ? 22.289 -9.376  19.897  1.00 27.12  ? 1174 TRP A HE3   1 
ATOM   4003 H  HZ2   . TRP A 1 304 ? 25.719 -12.575 20.112  1.00 33.07  ? 1174 TRP A HZ2   1 
ATOM   4004 H  HZ3   . TRP A 1 304 ? 22.148 -11.366 18.712  1.00 36.86  ? 1174 TRP A HZ3   1 
ATOM   4005 H  HH2   . TRP A 1 304 ? 23.841 -12.938 18.822  1.00 31.99  ? 1174 TRP A HH2   1 
ATOM   4006 N  N     . GLY A 1 305 ? 22.292 -9.646  23.822  1.00 29.21  ? 1175 GLY A N     1 
ATOM   4007 C  CA    . GLY A 1 305 ? 21.489 -10.846 23.965  1.00 30.59  ? 1175 GLY A CA    1 
ATOM   4008 C  C     . GLY A 1 305 ? 20.149 -10.525 24.598  1.00 30.51  ? 1175 GLY A C     1 
ATOM   4009 O  O     . GLY A 1 305 ? 19.113 -11.034 24.173  1.00 31.44  ? 1175 GLY A O     1 
ATOM   4010 H  H     . GLY A 1 305 ? 23.007 -9.640  24.300  1.00 35.00  ? 1175 GLY A H     1 
ATOM   4011 H  HA2   . GLY A 1 305 ? 21.336 -11.245 23.095  1.00 36.65  ? 1175 GLY A HA2   1 
ATOM   4012 H  HA3   . GLY A 1 305 ? 21.954 -11.487 24.526  1.00 36.65  ? 1175 GLY A HA3   1 
ATOM   4013 N  N     . VAL A 1 306 ? 20.168 -9.674  25.620  1.00 33.14  ? 1176 VAL A N     1 
ATOM   4014 C  CA    . VAL A 1 306 ? 18.941 -9.258  26.290  1.00 28.06  ? 1176 VAL A CA    1 
ATOM   4015 C  C     . VAL A 1 306 ? 18.038 -8.506  25.321  1.00 35.29  ? 1176 VAL A C     1 
ATOM   4016 O  O     . VAL A 1 306 ? 16.827 -8.710  25.313  1.00 29.83  ? 1176 VAL A O     1 
ATOM   4017 C  CB    . VAL A 1 306 ? 19.234 -8.361  27.513  1.00 27.89  ? 1176 VAL A CB    1 
ATOM   4018 C  CG1   . VAL A 1 306 ? 17.934 -7.843  28.125  1.00 34.13  ? 1176 VAL A CG1   1 
ATOM   4019 C  CG2   . VAL A 1 306 ? 20.041 -9.128  28.547  1.00 27.72  ? 1176 VAL A CG2   1 
ATOM   4020 H  H     . VAL A 1 306 ? 20.882 -9.323  25.946  1.00 39.72  ? 1176 VAL A H     1 
ATOM   4021 H  HA    . VAL A 1 306 ? 18.460 -10.052 26.602  1.00 33.62  ? 1176 VAL A HA    1 
ATOM   4022 H  HB    . VAL A 1 306 ? 19.764 -7.589  27.225  1.00 33.41  ? 1176 VAL A HB    1 
ATOM   4023 H  HG11  . VAL A 1 306 ? 18.143 -7.290  28.881  1.00 40.90  ? 1176 VAL A HG11  1 
ATOM   4024 H  HG12  . VAL A 1 306 ? 17.461 -7.330  27.465  1.00 40.90  ? 1176 VAL A HG12  1 
ATOM   4025 H  HG13  . VAL A 1 306 ? 17.400 -8.590  28.403  1.00 40.90  ? 1176 VAL A HG13  1 
ATOM   4026 H  HG21  . VAL A 1 306 ? 20.212 -8.554  29.298  1.00 33.21  ? 1176 VAL A HG21  1 
ATOM   4027 H  HG22  . VAL A 1 306 ? 19.539 -9.896  28.829  1.00 33.21  ? 1176 VAL A HG22  1 
ATOM   4028 H  HG23  . VAL A 1 306 ? 20.871 -9.406  28.152  1.00 33.21  ? 1176 VAL A HG23  1 
ATOM   4029 N  N     . LEU A 1 307 ? 18.630 -7.642  24.502  1.00 32.54  ? 1177 LEU A N     1 
ATOM   4030 C  CA    . LEU A 1 307 ? 17.866 -6.887  23.517  1.00 26.85  ? 1177 LEU A CA    1 
ATOM   4031 C  C     . LEU A 1 307 ? 17.346 -7.803  22.420  1.00 28.07  ? 1177 LEU A C     1 
ATOM   4032 O  O     . LEU A 1 307 ? 16.251 -7.603  21.910  1.00 28.21  ? 1177 LEU A O     1 
ATOM   4033 C  CB    . LEU A 1 307 ? 18.715 -5.762  22.918  1.00 26.83  ? 1177 LEU A CB    1 
ATOM   4034 C  CG    . LEU A 1 307 ? 18.628 -4.433  23.675  1.00 31.07  ? 1177 LEU A CG    1 
ATOM   4035 C  CD1   . LEU A 1 307 ? 19.037 -4.602  25.128  1.00 30.57  ? 1177 LEU A CD1   1 
ATOM   4036 C  CD2   . LEU A 1 307 ? 19.484 -3.373  23.003  1.00 40.97  ? 1177 LEU A CD2   1 
ATOM   4037 H  H     . LEU A 1 307 ? 19.473 -7.476  24.496  1.00 38.99  ? 1177 LEU A H     1 
ATOM   4038 H  HA    . LEU A 1 307 ? 17.093 -6.478  23.960  1.00 32.17  ? 1177 LEU A HA    1 
ATOM   4039 H  HB2   . LEU A 1 307 ? 19.644 -6.041  22.918  1.00 32.14  ? 1177 LEU A HB2   1 
ATOM   4040 H  HB3   . LEU A 1 307 ? 18.421 -5.603  22.008  1.00 32.14  ? 1177 LEU A HB3   1 
ATOM   4041 H  HG    . LEU A 1 307 ? 17.708 -4.125  23.660  1.00 37.23  ? 1177 LEU A HG    1 
ATOM   4042 H  HD11  . LEU A 1 307 ? 19.942 -4.920  25.162  1.00 36.62  ? 1177 LEU A HD11  1 
ATOM   4043 H  HD12  . LEU A 1 307 ? 18.971 -3.753  25.572  1.00 36.62  ? 1177 LEU A HD12  1 
ATOM   4044 H  HD13  . LEU A 1 307 ? 18.450 -5.237  25.546  1.00 36.62  ? 1177 LEU A HD13  1 
ATOM   4045 H  HD21  . LEU A 1 307 ? 19.410 -2.553  23.497  1.00 49.11  ? 1177 LEU A HD21  1 
ATOM   4046 H  HD22  . LEU A 1 307 ? 20.397 -3.670  22.993  1.00 49.11  ? 1177 LEU A HD22  1 
ATOM   4047 H  HD23  . LEU A 1 307 ? 19.172 -3.244  22.104  1.00 49.11  ? 1177 LEU A HD23  1 
ATOM   4048 N  N     . ASN A 1 308 ? 18.127 -8.815  22.062  1.00 25.08  ? 1178 ASN A N     1 
ATOM   4049 C  CA    . ASN A 1 308 ? 17.689 -9.779  21.065  1.00 28.14  ? 1178 ASN A CA    1 
ATOM   4050 C  C     . ASN A 1 308 ? 16.436 -10.489 21.563  1.00 26.03  ? 1178 ASN A C     1 
ATOM   4051 O  O     . ASN A 1 308 ? 15.509 -10.753 20.800  1.00 38.22  ? 1178 ASN A O     1 
ATOM   4052 C  CB    . ASN A 1 308 ? 18.788 -10.800 20.780  1.00 30.18  ? 1178 ASN A CB    1 
ATOM   4053 C  CG    . ASN A 1 308 ? 18.319 -11.914 19.869  1.00 39.52  ? 1178 ASN A CG    1 
ATOM   4054 O  OD1   . ASN A 1 308 ? 18.213 -11.735 18.655  1.00 34.62  ? 1178 ASN A OD1   1 
ATOM   4055 N  ND2   . ASN A 1 308 ? 18.028 -13.072 20.450  1.00 39.66  ? 1178 ASN A ND2   1 
ATOM   4056 H  H     . ASN A 1 308 ? 18.912 -8.965  22.380  1.00 30.04  ? 1178 ASN A H     1 
ATOM   4057 H  HA    . ASN A 1 308 ? 17.472 -9.313  20.231  1.00 33.71  ? 1178 ASN A HA    1 
ATOM   4058 H  HB2   . ASN A 1 308 ? 19.533 -10.353 20.349  1.00 36.16  ? 1178 ASN A HB2   1 
ATOM   4059 H  HB3   . ASN A 1 308 ? 19.077 -11.197 21.616  1.00 36.16  ? 1178 ASN A HB3   1 
ATOM   4060 H  HD21  . ASN A 1 308 ? 17.757 -13.736 19.975  1.00 47.54  ? 1178 ASN A HD21  1 
ATOM   4061 H  HD22  . ASN A 1 308 ? 18.111 -13.159 21.302  1.00 47.54  ? 1178 ASN A HD22  1 
ATOM   4062 N  N     A ASP A 1 309 ? 16.406 -10.795 22.856  0.77 28.73  ? 1179 ASP A N     1 
ATOM   4063 N  N     B ASP A 1 309 ? 16.428 -10.777 22.860  0.23 40.59  ? 1179 ASP A N     1 
ATOM   4064 C  CA    A ASP A 1 309 ? 15.264 -11.487 23.441  0.77 39.02  ? 1179 ASP A CA    1 
ATOM   4065 C  CA    B ASP A 1 309 ? 15.319 -11.459 23.510  0.23 44.85  ? 1179 ASP A CA    1 
ATOM   4066 C  C     A ASP A 1 309 ? 14.036 -10.585 23.479  0.77 33.00  ? 1179 ASP A C     1 
ATOM   4067 C  C     B ASP A 1 309 ? 14.066 -10.592 23.485  0.23 44.17  ? 1179 ASP A C     1 
ATOM   4068 O  O     A ASP A 1 309 ? 12.928 -11.037 23.210  0.77 37.96  ? 1179 ASP A O     1 
ATOM   4069 O  O     B ASP A 1 309 ? 12.977 -11.073 23.182  0.23 49.59  ? 1179 ASP A O     1 
ATOM   4070 C  CB    A ASP A 1 309 ? 15.594 -12.000 24.842  0.77 37.21  ? 1179 ASP A CB    1 
ATOM   4071 C  CB    B ASP A 1 309 ? 15.698 -11.791 24.953  0.23 48.07  ? 1179 ASP A CB    1 
ATOM   4072 C  CG    A ASP A 1 309 ? 16.616 -13.118 24.825  0.77 48.79  ? 1179 ASP A CG    1 
ATOM   4073 C  CG    B ASP A 1 309 ? 14.613 -12.547 25.682  0.23 55.52  ? 1179 ASP A CG    1 
ATOM   4074 O  OD1   A ASP A 1 309 ? 16.902 -13.650 23.730  0.77 43.37  ? 1179 ASP A OD1   1 
ATOM   4075 O  OD1   B ASP A 1 309 ? 14.560 -13.788 25.549  0.23 58.69  ? 1179 ASP A OD1   1 
ATOM   4076 O  OD2   A ASP A 1 309 ? 17.128 -13.472 25.907  0.77 53.80  ? 1179 ASP A OD2   1 
ATOM   4077 O  OD2   B ASP A 1 309 ? 13.817 -11.901 26.395  0.23 57.93  ? 1179 ASP A OD2   1 
ATOM   4078 H  H     A ASP A 1 309 ? 17.034 -10.614 23.415  0.77 34.43  ? 1179 ASP A H     1 
ATOM   4079 H  H     B ASP A 1 309 ? 17.071 -10.582 23.397  0.23 48.65  ? 1179 ASP A H     1 
ATOM   4080 H  HA    A ASP A 1 309 ? 15.047 -12.263 22.883  0.77 46.76  ? 1179 ASP A HA    1 
ATOM   4081 H  HA    B ASP A 1 309 ? 15.127 -12.296 23.038  0.23 53.76  ? 1179 ASP A HA    1 
ATOM   4082 H  HB2   A ASP A 1 309 ? 15.955 -11.270 25.370  0.77 44.59  ? 1179 ASP A HB2   1 
ATOM   4083 H  HB2   B ASP A 1 309 ? 16.498 -12.340 24.951  0.23 57.63  ? 1179 ASP A HB2   1 
ATOM   4084 H  HB3   A ASP A 1 309 ? 14.784 -12.339 25.255  0.77 44.59  ? 1179 ASP A HB3   1 
ATOM   4085 H  HB3   B ASP A 1 309 ? 15.864 -10.965 25.434  0.23 57.63  ? 1179 ASP A HB3   1 
ATOM   4086 N  N     . PHE A 1 310 ? 14.229 -9.312  23.808  1.00 33.27  ? 1180 PHE A N     1 
ATOM   4087 C  CA    . PHE A 1 310 ? 13.125 -8.361  23.773  1.00 29.88  ? 1180 PHE A CA    1 
ATOM   4088 C  C     . PHE A 1 310 ? 12.529 -8.315  22.372  1.00 48.44  ? 1180 PHE A C     1 
ATOM   4089 O  O     . PHE A 1 310 ? 11.312 -8.335  22.205  1.00 42.71  ? 1180 PHE A O     1 
ATOM   4090 C  CB    . PHE A 1 310 ? 13.585 -6.959  24.177  1.00 32.74  ? 1180 PHE A CB    1 
ATOM   4091 C  CG    . PHE A 1 310 ? 13.433 -6.667  25.643  1.00 44.14  ? 1180 PHE A CG    1 
ATOM   4092 C  CD1   . PHE A 1 310 ? 12.190 -6.747  26.252  1.00 45.50  ? 1180 PHE A CD1   1 
ATOM   4093 C  CD2   . PHE A 1 310 ? 14.526 -6.295  26.407  1.00 29.25  ? 1180 PHE A CD2   1 
ATOM   4094 C  CE1   . PHE A 1 310 ? 12.042 -6.475  27.598  1.00 44.61  ? 1180 PHE A CE1   1 
ATOM   4095 C  CE2   . PHE A 1 310 ? 14.384 -6.018  27.758  1.00 27.92  ? 1180 PHE A CE2   1 
ATOM   4096 C  CZ    . PHE A 1 310 ? 13.140 -6.109  28.352  1.00 38.32  ? 1180 PHE A CZ    1 
ATOM   4097 H  H     A PHE A 1 310 ? 14.982 -8.977  24.052  0.50 39.87  ? 1180 PHE A H     1 
ATOM   4098 H  H     B PHE A 1 310 ? 14.978 -8.968  24.053  0.50 39.87  ? 1180 PHE A H     1 
ATOM   4099 H  HA    . PHE A 1 310 ? 12.427 -8.649  24.397  1.00 35.81  ? 1180 PHE A HA    1 
ATOM   4100 H  HB2   . PHE A 1 310 ? 14.524 -6.861  23.951  1.00 39.23  ? 1180 PHE A HB2   1 
ATOM   4101 H  HB3   . PHE A 1 310 ? 13.061 -6.305  23.689  1.00 39.23  ? 1180 PHE A HB3   1 
ATOM   4102 H  HD1   . PHE A 1 310 ? 11.447 -6.994  25.750  1.00 54.54  ? 1180 PHE A HD1   1 
ATOM   4103 H  HD2   . PHE A 1 310 ? 15.365 -6.233  26.010  1.00 35.04  ? 1180 PHE A HD2   1 
ATOM   4104 H  HE1   . PHE A 1 310 ? 11.204 -6.536  27.996  1.00 53.48  ? 1180 PHE A HE1   1 
ATOM   4105 H  HE2   . PHE A 1 310 ? 15.125 -5.773  28.264  1.00 33.45  ? 1180 PHE A HE2   1 
ATOM   4106 H  HZ    . PHE A 1 310 ? 13.043 -5.925  29.259  1.00 45.93  ? 1180 PHE A HZ    1 
ATOM   4107 N  N     . CYS A 1 311 ? 13.391 -8.260  21.362  1.00 41.98  ? 1181 CYS A N     1 
ATOM   4108 C  CA    . CYS A 1 311 ? 12.926 -8.186  19.986  1.00 29.16  ? 1181 CYS A CA    1 
ATOM   4109 C  C     . CYS A 1 311 ? 12.047 -9.391  19.675  1.00 36.55  ? 1181 CYS A C     1 
ATOM   4110 O  O     . CYS A 1 311 ? 10.922 -9.236  19.210  1.00 38.10  ? 1181 CYS A O     1 
ATOM   4111 C  CB    . CYS A 1 311 ? 14.106 -8.096  19.015  1.00 27.43  ? 1181 CYS A CB    1 
ATOM   4112 S  SG    . CYS A 1 311 ? 14.852 -6.437  18.934  1.00 32.13  ? 1181 CYS A SG    1 
ATOM   4113 H  H     . CYS A 1 311 ? 14.247 -8.265  21.448  1.00 50.32  ? 1181 CYS A H     1 
ATOM   4114 H  HA    . CYS A 1 311 ? 12.382 -7.378  19.877  1.00 34.94  ? 1181 CYS A HA    1 
ATOM   4115 H  HB2   . CYS A 1 311 ? 14.794 -8.718  19.298  1.00 32.86  ? 1181 CYS A HB2   1 
ATOM   4116 H  HB3   . CYS A 1 311 ? 13.798 -8.327  18.124  1.00 32.86  ? 1181 CYS A HB3   1 
ATOM   4117 H  HG    . CYS A 1 311 ? 14.020 -5.651  18.572  1.00 38.50  ? 1181 CYS A HG    1 
ATOM   4118 N  N     . GLU A 1 312 ? 12.553 -10.585 19.961  1.00 39.47  ? 1182 GLU A N     1 
ATOM   4119 C  CA    . GLU A 1 312 ? 11.818 -11.820 19.692  1.00 59.65  ? 1182 GLU A CA    1 
ATOM   4120 C  C     . GLU A 1 312 ? 10.460 -11.862 20.393  1.00 58.38  ? 1182 GLU A C     1 
ATOM   4121 O  O     . GLU A 1 312 ? 9.470  -12.306 19.815  1.00 54.10  ? 1182 GLU A O     1 
ATOM   4122 C  CB    . GLU A 1 312 ? 12.651 -13.034 20.110  1.00 56.75  ? 1182 GLU A CB    1 
ATOM   4123 C  CG    . GLU A 1 312 ? 13.786 -13.357 19.154  1.00 75.40  ? 1182 GLU A CG    1 
ATOM   4124 C  CD    . GLU A 1 312 ? 13.298 -13.615 17.741  1.00 84.13  ? 1182 GLU A CD    1 
ATOM   4125 O  OE1   . GLU A 1 312 ? 14.081 -13.399 16.792  1.00 67.41  ? 1182 GLU A OE1   1 
ATOM   4126 O  OE2   . GLU A 1 312 ? 12.132 -14.034 17.581  1.00 91.84  ? 1182 GLU A OE2   1 
ATOM   4127 H  H     . GLU A 1 312 ? 13.327 -10.711 20.315  1.00 47.31  ? 1182 GLU A H     1 
ATOM   4128 H  HA    . GLU A 1 312 ? 11.657 -11.886 18.727  1.00 71.52  ? 1182 GLU A HA    1 
ATOM   4129 H  HB2   . GLU A 1 312 ? 13.037 -12.862 20.982  1.00 68.04  ? 1182 GLU A HB2   1 
ATOM   4130 H  HB3   . GLU A 1 312 ? 12.071 -13.810 20.154  1.00 68.04  ? 1182 GLU A HB3   1 
ATOM   4131 H  HG2   . GLU A 1 312 ? 14.401 -12.608 19.128  1.00 90.43  ? 1182 GLU A HG2   1 
ATOM   4132 H  HG3   . GLU A 1 312 ? 14.244 -14.154 19.464  1.00 90.43  ? 1182 GLU A HG3   1 
ATOM   4133 N  N     . LYS A 1 313 ? 10.419 -11.406 21.639  1.00 43.87  ? 1183 LYS A N     1 
ATOM   4134 C  CA    . LYS A 1 313 ? 9.186  -11.416 22.418  1.00 58.91  ? 1183 LYS A CA    1 
ATOM   4135 C  C     . LYS A 1 313 ? 8.155  -10.467 21.815  1.00 61.82  ? 1183 LYS A C     1 
ATOM   4136 O  O     . LYS A 1 313 ? 6.952  -10.657 21.986  1.00 58.77  ? 1183 LYS A O     1 
ATOM   4137 C  CB    . LYS A 1 313 ? 9.468  -11.046 23.877  1.00 58.20  ? 1183 LYS A CB    1 
ATOM   4138 C  CG    . LYS A 1 313 ? 10.162 -12.149 24.668  1.00 81.63  ? 1183 LYS A CG    1 
ATOM   4139 C  CD    . LYS A 1 313 ? 10.467 -11.716 26.096  1.00 94.08  ? 1183 LYS A CD    1 
ATOM   4140 C  CE    . LYS A 1 313 ? 10.603 -12.912 27.034  1.00 98.18  ? 1183 LYS A CE    1 
ATOM   4141 N  NZ    . LYS A 1 313 ? 11.637 -13.887 26.593  1.00 86.31  ? 1183 LYS A NZ    1 
ATOM   4142 H  H     . LYS A 1 313 ? 11.096 -11.083 22.060  1.00 52.59  ? 1183 LYS A H     1 
ATOM   4143 H  HA    . LYS A 1 313 ? 8.809  -12.320 22.403  1.00 70.63  ? 1183 LYS A HA    1 
ATOM   4144 H  HB2   . LYS A 1 313 ? 10.041 -10.263 23.896  1.00 69.78  ? 1183 LYS A HB2   1 
ATOM   4145 H  HB3   . LYS A 1 313 ? 8.627  -10.849 24.318  1.00 69.78  ? 1183 LYS A HB3   1 
ATOM   4146 H  HG2   . LYS A 1 313 ? 9.583  -12.927 24.704  1.00 97.89  ? 1183 LYS A HG2   1 
ATOM   4147 H  HG3   . LYS A 1 313 ? 10.999 -12.375 24.234  1.00 97.89  ? 1183 LYS A HG3   1 
ATOM   4148 H  HD2   . LYS A 1 313 ? 11.304 -11.225 26.108  1.00 112.84 ? 1183 LYS A HD2   1 
ATOM   4149 H  HD3   . LYS A 1 313 ? 9.745  -11.156 26.421  1.00 112.84 ? 1183 LYS A HD3   1 
ATOM   4150 H  HE2   . LYS A 1 313 ? 10.850 -12.593 27.916  1.00 117.75 ? 1183 LYS A HE2   1 
ATOM   4151 H  HE3   . LYS A 1 313 ? 9.752  -13.376 27.076  1.00 117.75 ? 1183 LYS A HE3   1 
ATOM   4152 H  HZ1   . LYS A 1 313 ? 11.680 -14.565 27.168  1.00 103.52 ? 1183 LYS A HZ1   1 
ATOM   4153 H  HZ2   . LYS A 1 313 ? 11.431 -14.205 25.787  1.00 103.52 ? 1183 LYS A HZ2   1 
ATOM   4154 H  HZ3   . LYS A 1 313 ? 12.432 -13.490 26.553  1.00 103.52 ? 1183 LYS A HZ3   1 
ATOM   4155 N  N     . ASN A 1 314 ? 8.634  -9.449  21.106  1.00 44.19  ? 1184 ASN A N     1 
ATOM   4156 C  CA    . ASN A 1 314 ? 7.753  -8.516  20.412  1.00 38.40  ? 1184 ASN A CA    1 
ATOM   4157 C  C     . ASN A 1 314 ? 7.599  -8.874  18.932  1.00 45.15  ? 1184 ASN A C     1 
ATOM   4158 O  O     . ASN A 1 314 ? 7.180  -8.050  18.122  1.00 45.25  ? 1184 ASN A O     1 
ATOM   4159 C  CB    . ASN A 1 314 ? 8.271  -7.085  20.563  1.00 41.78  ? 1184 ASN A CB    1 
ATOM   4160 C  CG    . ASN A 1 314 ? 8.017  -6.516  21.948  1.00 50.88  ? 1184 ASN A CG    1 
ATOM   4161 O  OD1   . ASN A 1 314 ? 6.926  -6.028  22.238  1.00 44.58  ? 1184 ASN A OD1   1 
ATOM   4162 N  ND2   . ASN A 1 314 ? 9.025  -6.572  22.808  1.00 40.97  ? 1184 ASN A ND2   1 
ATOM   4163 H  H     . ASN A 1 314 ? 9.471  -9.276  21.011  1.00 52.97  ? 1184 ASN A H     1 
ATOM   4164 H  HA    . ASN A 1 314 ? 6.865  -8.557  20.823  1.00 46.02  ? 1184 ASN A HA    1 
ATOM   4165 H  HB2   . ASN A 1 314 ? 9.228  -7.076  20.405  1.00 50.08  ? 1184 ASN A HB2   1 
ATOM   4166 H  HB3   . ASN A 1 314 ? 7.823  -6.516  19.917  1.00 50.08  ? 1184 ASN A HB3   1 
ATOM   4167 H  HD21  . ASN A 1 314 ? 8.929  -6.262  23.605  1.00 49.11  ? 1184 ASN A HD21  1 
ATOM   4168 H  HD22  . ASN A 1 314 ? 9.775  -6.918  22.570  1.00 49.11  ? 1184 ASN A HD22  1 
ATOM   4169 N  N     . ASN A 1 315 ? 7.943  -10.113 18.596  1.00 42.65  ? 1185 ASN A N     1 
ATOM   4170 C  CA    . ASN A 1 315 ? 7.830  -10.620 17.233  1.00 49.18  ? 1185 ASN A CA    1 
ATOM   4171 C  C     . ASN A 1 315 ? 8.594  -9.760  16.232  1.00 54.60  ? 1185 ASN A C     1 
ATOM   4172 O  O     . ASN A 1 315 ? 8.103  -9.462  15.144  1.00 45.74  ? 1185 ASN A O     1 
ATOM   4173 C  CB    . ASN A 1 315 ? 6.360  -10.725 16.826  1.00 63.88  ? 1185 ASN A CB    1 
ATOM   4174 C  CG    . ASN A 1 315 ? 6.162  -11.555 15.573  1.00 79.26  ? 1185 ASN A CG    1 
ATOM   4175 O  OD1   . ASN A 1 315 ? 6.348  -12.772 15.587  1.00 82.27  ? 1185 ASN A OD1   1 
ATOM   4176 N  ND2   . ASN A 1 315 ? 5.774  -10.902 14.483  1.00 66.69  ? 1185 ASN A ND2   1 
ATOM   4177 H  H     . ASN A 1 315 ? 8.252  -10.691 19.153  1.00 51.12  ? 1185 ASN A H     1 
ATOM   4178 H  HA    . ASN A 1 315 ? 8.212  -11.522 17.202  1.00 58.96  ? 1185 ASN A HA    1 
ATOM   4179 H  HB2   . ASN A 1 315 ? 5.861  -11.142 17.546  1.00 76.60  ? 1185 ASN A HB2   1 
ATOM   4180 H  HB3   . ASN A 1 315 ? 6.015  -9.835  16.655  1.00 76.60  ? 1185 ASN A HB3   1 
ATOM   4181 H  HD21  . ASN A 1 315 ? 5.648  -11.329 13.748  1.00 79.97  ? 1185 ASN A HD21  1 
ATOM   4182 H  HD22  . ASN A 1 315 ? 5.650  -10.051 14.513  1.00 79.97  ? 1185 ASN A HD22  1 
ATOM   4183 N  N     . LEU A 1 316 ? 9.807  -9.375  16.610  1.00 41.10  ? 1186 LEU A N     1 
ATOM   4184 C  CA    . LEU A 1 316 ? 10.664 -8.557  15.764  1.00 36.64  ? 1186 LEU A CA    1 
ATOM   4185 C  C     . LEU A 1 316 ? 12.014 -9.234  15.591  1.00 40.64  ? 1186 LEU A C     1 
ATOM   4186 O  O     . LEU A 1 316 ? 12.473 -9.961  16.470  1.00 40.10  ? 1186 LEU A O     1 
ATOM   4187 C  CB    . LEU A 1 316 ? 10.858 -7.173  16.384  1.00 30.78  ? 1186 LEU A CB    1 
ATOM   4188 C  CG    . LEU A 1 316 ? 9.628  -6.265  16.374  1.00 38.86  ? 1186 LEU A CG    1 
ATOM   4189 C  CD1   . LEU A 1 316 ? 9.743  -5.185  17.441  1.00 36.16  ? 1186 LEU A CD1   1 
ATOM   4190 C  CD2   . LEU A 1 316 ? 9.437  -5.652  14.993  1.00 44.47  ? 1186 LEU A CD2   1 
ATOM   4191 H  H     . LEU A 1 316 ? 10.162 -9.578  17.367  1.00 49.27  ? 1186 LEU A H     1 
ATOM   4192 H  HA    . LEU A 1 316 ? 10.251 -8.451  14.881  1.00 43.92  ? 1186 LEU A HA    1 
ATOM   4193 H  HB2   . LEU A 1 316 ? 11.127 -7.287  17.309  1.00 36.88  ? 1186 LEU A HB2   1 
ATOM   4194 H  HB3   . LEU A 1 316 ? 11.561 -6.715  15.897  1.00 36.88  ? 1186 LEU A HB3   1 
ATOM   4195 H  HG    . LEU A 1 316 ? 8.843  -6.799  16.574  1.00 46.58  ? 1186 LEU A HG    1 
ATOM   4196 H  HD11  . LEU A 1 316 ? 8.959  -4.632  17.411  1.00 43.33  ? 1186 LEU A HD11  1 
ATOM   4197 H  HD12  . LEU A 1 316 ? 9.816  -5.603  18.302  1.00 43.33  ? 1186 LEU A HD12  1 
ATOM   4198 H  HD13  . LEU A 1 316 ? 10.524 -4.656  17.266  1.00 43.33  ? 1186 LEU A HD13  1 
ATOM   4199 H  HD21  . LEU A 1 316 ? 8.661  -5.087  15.007  1.00 53.30  ? 1186 LEU A HD21  1 
ATOM   4200 H  HD22  . LEU A 1 316 ? 10.215 -5.136  14.770  1.00 53.30  ? 1186 LEU A HD22  1 
ATOM   4201 H  HD23  . LEU A 1 316 ? 9.317  -6.358  14.352  1.00 53.30  ? 1186 LEU A HD23  1 
ATOM   4202 N  N     . ASN A 1 317 ? 12.650 -8.993  14.453  1.00 31.00  ? 1187 ASN A N     1 
ATOM   4203 C  CA    . ASN A 1 317 ? 13.974 -9.536  14.208  1.00 35.79  ? 1187 ASN A CA    1 
ATOM   4204 C  C     . ASN A 1 317 ? 15.043 -8.557  14.676  1.00 31.88  ? 1187 ASN A C     1 
ATOM   4205 O  O     . ASN A 1 317 ? 15.049 -7.397  14.275  1.00 33.76  ? 1187 ASN A O     1 
ATOM   4206 C  CB    . ASN A 1 317 ? 14.167 -9.851  12.729  1.00 39.95  ? 1187 ASN A CB    1 
ATOM   4207 C  CG    . ASN A 1 317 ? 15.410 -10.668 12.478  1.00 41.95  ? 1187 ASN A CG    1 
ATOM   4208 O  OD1   . ASN A 1 317 ? 16.467 -10.127 12.168  1.00 33.83  ? 1187 ASN A OD1   1 
ATOM   4209 N  ND2   . ASN A 1 317 ? 15.296 -11.981 12.634  1.00 42.30  ? 1187 ASN A ND2   1 
ATOM   4210 H  H     . ASN A 1 317 ? 12.336 -8.518  13.808  1.00 37.15  ? 1187 ASN A H     1 
ATOM   4211 H  HA    . ASN A 1 317 ? 14.079 -10.368 14.714  1.00 42.89  ? 1187 ASN A HA    1 
ATOM   4212 H  HB2   . ASN A 1 317 ? 13.404 -10.357 12.410  1.00 47.88  ? 1187 ASN A HB2   1 
ATOM   4213 H  HB3   . ASN A 1 317 ? 14.247 -9.020  12.235  1.00 47.88  ? 1187 ASN A HB3   1 
ATOM   4214 H  HD21  . ASN A 1 317 ? 15.977 -12.490 12.502  1.00 50.71  ? 1187 ASN A HD21  1 
ATOM   4215 H  HD22  . ASN A 1 317 ? 14.542 -12.322 12.867  1.00 50.71  ? 1187 ASN A HD22  1 
ATOM   4216 N  N     . PHE A 1 318 ? 15.939 -9.032  15.531  1.00 27.15  ? 1188 PHE A N     1 
ATOM   4217 C  CA    . PHE A 1 318 ? 16.972 -8.183  16.106  1.00 28.68  ? 1188 PHE A CA    1 
ATOM   4218 C  C     . PHE A 1 318 ? 17.895 -7.598  15.042  1.00 32.05  ? 1188 PHE A C     1 
ATOM   4219 O  O     . PHE A 1 318 ? 18.105 -6.387  14.996  1.00 29.58  ? 1188 PHE A O     1 
ATOM   4220 C  CB    . PHE A 1 318 ? 17.803 -8.968  17.120  1.00 29.17  ? 1188 PHE A CB    1 
ATOM   4221 C  CG    . PHE A 1 318 ? 18.940 -8.178  17.703  1.00 30.23  ? 1188 PHE A CG    1 
ATOM   4222 C  CD1   . PHE A 1 318 ? 18.710 -7.239  18.695  1.00 25.02  ? 1188 PHE A CD1   1 
ATOM   4223 C  CD2   . PHE A 1 318 ? 20.237 -8.372  17.256  1.00 28.37  ? 1188 PHE A CD2   1 
ATOM   4224 C  CE1   . PHE A 1 318 ? 19.751 -6.508  19.232  1.00 28.89  ? 1188 PHE A CE1   1 
ATOM   4225 C  CE2   . PHE A 1 318 ? 21.285 -7.643  17.790  1.00 30.49  ? 1188 PHE A CE2   1 
ATOM   4226 C  CZ    . PHE A 1 318 ? 21.041 -6.710  18.780  1.00 26.13  ? 1188 PHE A CZ    1 
ATOM   4227 H  H     . PHE A 1 318 ? 15.971 -9.850  15.796  1.00 32.52  ? 1188 PHE A H     1 
ATOM   4228 H  HA    . PHE A 1 318 ? 16.544 -7.438  16.577  1.00 34.36  ? 1188 PHE A HA    1 
ATOM   4229 H  HB2   . PHE A 1 318 ? 17.227 -9.243  17.851  1.00 34.94  ? 1188 PHE A HB2   1 
ATOM   4230 H  HB3   . PHE A 1 318 ? 18.176 -9.748  16.682  1.00 34.94  ? 1188 PHE A HB3   1 
ATOM   4231 H  HD1   . PHE A 1 318 ? 17.843 -7.099  19.003  1.00 29.97  ? 1188 PHE A HD1   1 
ATOM   4232 H  HD2   . PHE A 1 318 ? 20.405 -8.998  16.590  1.00 33.99  ? 1188 PHE A HD2   1 
ATOM   4233 H  HE1   . PHE A 1 318 ? 19.585 -5.881  19.898  1.00 34.61  ? 1188 PHE A HE1   1 
ATOM   4234 H  HE2   . PHE A 1 318 ? 22.152 -7.781  17.483  1.00 36.53  ? 1188 PHE A HE2   1 
ATOM   4235 H  HZ    . PHE A 1 318 ? 21.744 -6.219  19.141  1.00 31.30  ? 1188 PHE A HZ    1 
ATOM   4236 N  N     . LEU A 1 319 ? 18.447 -8.459  14.192  1.00 25.57  ? 1189 LEU A N     1 
ATOM   4237 C  CA    . LEU A 1 319 ? 19.455 -8.035  13.218  1.00 30.94  ? 1189 LEU A CA    1 
ATOM   4238 C  C     . LEU A 1 319 ? 18.898 -7.212  12.050  1.00 35.71  ? 1189 LEU A C     1 
ATOM   4239 O  O     . LEU A 1 319 ? 19.537 -6.264  11.599  1.00 33.27  ? 1189 LEU A O     1 
ATOM   4240 C  CB    . LEU A 1 319 ? 20.185 -9.255  12.654  1.00 26.78  ? 1189 LEU A CB    1 
ATOM   4241 C  CG    . LEU A 1 319 ? 20.957 -10.108 13.660  1.00 27.86  ? 1189 LEU A CG    1 
ATOM   4242 C  CD1   . LEU A 1 319 ? 21.467 -11.375 12.993  1.00 30.41  ? 1189 LEU A CD1   1 
ATOM   4243 C  CD2   . LEU A 1 319 ? 22.108 -9.316  14.273  1.00 25.90  ? 1189 LEU A CD2   1 
ATOM   4244 H  H     . LEU A 1 319 ? 18.257 -9.297  14.157  1.00 30.62  ? 1189 LEU A H     1 
ATOM   4245 H  HA    . LEU A 1 319 ? 20.118 -7.480  13.679  1.00 37.07  ? 1189 LEU A HA    1 
ATOM   4246 H  HB2   . LEU A 1 319 ? 19.531 -9.832  12.230  1.00 32.08  ? 1189 LEU A HB2   1 
ATOM   4247 H  HB3   . LEU A 1 319 ? 20.822 -8.948  11.990  1.00 32.08  ? 1189 LEU A HB3   1 
ATOM   4248 H  HG    . LEU A 1 319 ? 20.358 -10.368 14.378  1.00 33.37  ? 1189 LEU A HG    1 
ATOM   4249 H  HD11  . LEU A 1 319 ? 21.947 -11.897 13.640  1.00 36.44  ? 1189 LEU A HD11  1 
ATOM   4250 H  HD12  . LEU A 1 319 ? 20.718 -11.875 12.660  1.00 36.44  ? 1189 LEU A HD12  1 
ATOM   4251 H  HD13  . LEU A 1 319 ? 22.048 -11.134 12.268  1.00 36.44  ? 1189 LEU A HD13  1 
ATOM   4252 H  HD21  . LEU A 1 319 ? 22.573 -9.875  14.899  1.00 31.02  ? 1189 LEU A HD21  1 
ATOM   4253 H  HD22  . LEU A 1 319 ? 22.704 -9.040  13.573  1.00 31.02  ? 1189 LEU A HD22  1 
ATOM   4254 H  HD23  . LEU A 1 319 ? 21.752 -8.546  14.723  1.00 31.02  ? 1189 LEU A HD23  1 
ATOM   4255 N  N     . MET A 1 320 ? 17.719 -7.581  11.560  1.00 29.72  ? 1190 MET A N     1 
ATOM   4256 C  CA    . MET A 1 320 ? 17.192 -7.014  10.320  1.00 41.96  ? 1190 MET A CA    1 
ATOM   4257 C  C     . MET A 1 320 ? 15.894 -6.234  10.520  1.00 34.83  ? 1190 MET A C     1 
ATOM   4258 O  O     . MET A 1 320 ? 15.399 -5.599  9.591   1.00 37.92  ? 1190 MET A O     1 
ATOM   4259 C  CB    . MET A 1 320 ? 16.952 -8.133  9.301   1.00 39.68  ? 1190 MET A CB    1 
ATOM   4260 C  CG    . MET A 1 320 ? 18.210 -8.878  8.886   1.00 44.72  ? 1190 MET A CG    1 
ATOM   4261 S  SD    . MET A 1 320 ? 19.381 -7.821  8.014   1.00 62.92  ? 1190 MET A SD    1 
ATOM   4262 C  CE    . MET A 1 320 ? 18.465 -7.466  6.514   1.00 56.58  ? 1190 MET A CE    1 
ATOM   4263 H  H     . MET A 1 320 ? 17.201 -8.161  11.927  1.00 35.61  ? 1190 MET A H     1 
ATOM   4264 H  HA    . MET A 1 320 ? 17.865 -6.409  9.943   1.00 50.30  ? 1190 MET A HA    1 
ATOM   4265 H  HB2   . MET A 1 320 ? 16.339 -8.779  9.687   1.00 47.57  ? 1190 MET A HB2   1 
ATOM   4266 H  HB3   . MET A 1 320 ? 16.560 -7.747  8.502   1.00 47.57  ? 1190 MET A HB3   1 
ATOM   4267 H  HG2   . MET A 1 320 ? 18.649 -9.224  9.679   1.00 53.61  ? 1190 MET A HG2   1 
ATOM   4268 H  HG3   . MET A 1 320 ? 17.966 -9.608  8.296   1.00 53.61  ? 1190 MET A HG3   1 
ATOM   4269 H  HE1   . MET A 1 320 ? 18.996 -6.897  5.952   1.00 67.84  ? 1190 MET A HE1   1 
ATOM   4270 H  HE2   . MET A 1 320 ? 18.277 -8.291  6.061   1.00 67.84  ? 1190 MET A HE2   1 
ATOM   4271 H  HE3   . MET A 1 320 ? 17.645 -7.025  6.747   1.00 67.84  ? 1190 MET A HE3   1 
ATOM   4272 N  N     . GLY A 1 321 ? 15.347 -6.285  11.727  1.00 27.80  ? 1191 GLY A N     1 
ATOM   4273 C  CA    . GLY A 1 321 ? 14.069 -5.658  12.010  1.00 31.71  ? 1191 GLY A CA    1 
ATOM   4274 C  C     . GLY A 1 321 ? 14.199 -4.184  12.342  1.00 37.99  ? 1191 GLY A C     1 
ATOM   4275 O  O     . GLY A 1 321 ? 15.301 -3.665  12.519  1.00 31.35  ? 1191 GLY A O     1 
ATOM   4276 H  H     . GLY A 1 321 ? 15.701 -6.680  12.404  1.00 33.31  ? 1191 GLY A H     1 
ATOM   4277 H  HA2   . GLY A 1 321 ? 13.488 -5.748  11.239  1.00 38.00  ? 1191 GLY A HA2   1 
ATOM   4278 H  HA3   . GLY A 1 321 ? 13.650 -6.106  12.762  1.00 38.00  ? 1191 GLY A HA3   1 
ATOM   4279 N  N     . SER A 1 322 ? 13.058 -3.510  12.430  1.00 30.53  ? 1192 SER A N     1 
ATOM   4280 C  CA    . SER A 1 322 ? 13.014 -2.088  12.728  1.00 32.28  ? 1192 SER A CA    1 
ATOM   4281 C  C     . SER A 1 322 ? 12.352 -1.898  14.089  1.00 39.22  ? 1192 SER A C     1 
ATOM   4282 O  O     . SER A 1 322 ? 11.137 -2.035  14.219  1.00 30.83  ? 1192 SER A O     1 
ATOM   4283 C  CB    . SER A 1 322 ? 12.224 -1.357  11.642  1.00 33.73  ? 1192 SER A CB    1 
ATOM   4284 O  OG    . SER A 1 322 ? 12.195 0.037   11.877  1.00 35.04  ? 1192 SER A OG    1 
ATOM   4285 H  H     . SER A 1 322 ? 12.282 -3.864  12.319  1.00 36.58  ? 1192 SER A H     1 
ATOM   4286 H  HA    . SER A 1 322 ? 13.923 -1.724  12.761  1.00 38.68  ? 1192 SER A HA    1 
ATOM   4287 H  HB2   . SER A 1 322 ? 12.643 -1.523  10.783  1.00 40.42  ? 1192 SER A HB2   1 
ATOM   4288 H  HB3   . SER A 1 322 ? 11.314 -1.693  11.635  1.00 40.42  ? 1192 SER A HB3   1 
ATOM   4289 H  HG    . SER A 1 322 ? 11.768 0.412   11.286  1.00 41.99  ? 1192 SER A HG    1 
ATOM   4290 N  N     . TRP A 1 323 ? 13.154 -1.597  15.107  1.00 26.46  ? 1193 TRP A N     1 
ATOM   4291 C  CA    . TRP A 1 323 ? 12.642 -1.528  16.471  1.00 28.96  ? 1193 TRP A CA    1 
ATOM   4292 C  C     . TRP A 1 323 ? 13.209 -0.349  17.258  1.00 29.21  ? 1193 TRP A C     1 
ATOM   4293 O  O     . TRP A 1 323 ? 14.373 0.015   17.107  1.00 24.61  ? 1193 TRP A O     1 
ATOM   4294 C  CB    . TRP A 1 323 ? 12.920 -2.841  17.214  1.00 30.33  ? 1193 TRP A CB    1 
ATOM   4295 C  CG    . TRP A 1 323 ? 14.292 -3.400  16.981  1.00 32.04  ? 1193 TRP A CG    1 
ATOM   4296 C  CD1   . TRP A 1 323 ? 14.672 -4.230  15.969  1.00 30.67  ? 1193 TRP A CD1   1 
ATOM   4297 C  CD2   . TRP A 1 323 ? 15.464 -3.175  17.778  1.00 29.39  ? 1193 TRP A CD2   1 
ATOM   4298 N  NE1   . TRP A 1 323 ? 16.006 -4.537  16.083  1.00 26.71  ? 1193 TRP A NE1   1 
ATOM   4299 C  CE2   . TRP A 1 323 ? 16.515 -3.903  17.186  1.00 26.56  ? 1193 TRP A CE2   1 
ATOM   4300 C  CE3   . TRP A 1 323 ? 15.725 -2.431  18.935  1.00 27.51  ? 1193 TRP A CE3   1 
ATOM   4301 C  CZ2   . TRP A 1 323 ? 17.809 -3.908  17.708  1.00 21.59  ? 1193 TRP A CZ2   1 
ATOM   4302 C  CZ3   . TRP A 1 323 ? 17.008 -2.440  19.456  1.00 31.53  ? 1193 TRP A CZ3   1 
ATOM   4303 C  CH2   . TRP A 1 323 ? 18.035 -3.172  18.841  1.00 25.50  ? 1193 TRP A CH2   1 
ATOM   4304 H  H     . TRP A 1 323 ? 13.994 -1.430  15.034  1.00 31.70  ? 1193 TRP A H     1 
ATOM   4305 H  HA    . TRP A 1 323 ? 11.670 -1.414  16.432  1.00 34.69  ? 1193 TRP A HA    1 
ATOM   4306 H  HB2   . TRP A 1 323 ? 12.822 -2.686  18.167  1.00 36.34  ? 1193 TRP A HB2   1 
ATOM   4307 H  HB3   . TRP A 1 323 ? 12.277 -3.506  16.923  1.00 36.34  ? 1193 TRP A HB3   1 
ATOM   4308 H  HD1   . TRP A 1 323 ? 14.110 -4.543  15.297  1.00 36.75  ? 1193 TRP A HD1   1 
ATOM   4309 H  HE1   . TRP A 1 323 ? 16.449 -5.044  15.549  1.00 31.99  ? 1193 TRP A HE1   1 
ATOM   4310 H  HE3   . TRP A 1 323 ? 15.049 -1.944  19.348  1.00 32.96  ? 1193 TRP A HE3   1 
ATOM   4311 H  HZ2   . TRP A 1 323 ? 18.491 -4.393  17.304  1.00 25.86  ? 1193 TRP A HZ2   1 
ATOM   4312 H  HZ3   . TRP A 1 323 ? 17.194 -1.948  20.223  1.00 37.78  ? 1193 TRP A HZ3   1 
ATOM   4313 H  HH2   . TRP A 1 323 ? 18.888 -3.157  19.211  1.00 30.54  ? 1193 TRP A HH2   1 
ATOM   4314 N  N     . TRP A 1 324 ? 12.353 0.246   18.082  1.00 26.51  ? 1194 TRP A N     1 
ATOM   4315 C  CA    . TRP A 1 324 ? 12.712 1.350   18.960  1.00 26.98  ? 1194 TRP A CA    1 
ATOM   4316 C  C     . TRP A 1 324 ? 12.397 0.933   20.387  1.00 31.45  ? 1194 TRP A C     1 
ATOM   4317 O  O     . TRP A 1 324 ? 11.230 0.882   20.772  1.00 34.62  ? 1194 TRP A O     1 
ATOM   4318 C  CB    . TRP A 1 324 ? 11.887 2.582   18.603  1.00 22.60  ? 1194 TRP A CB    1 
ATOM   4319 C  CG    . TRP A 1 324 ? 12.252 3.813   19.372  1.00 28.26  ? 1194 TRP A CG    1 
ATOM   4320 C  CD1   . TRP A 1 324 ? 11.707 4.243   20.551  1.00 28.31  ? 1194 TRP A CD1   1 
ATOM   4321 C  CD2   . TRP A 1 324 ? 13.237 4.787   19.007  1.00 28.30  ? 1194 TRP A CD2   1 
ATOM   4322 N  NE1   . TRP A 1 324 ? 12.296 5.423   20.939  1.00 27.38  ? 1194 TRP A NE1   1 
ATOM   4323 C  CE2   . TRP A 1 324 ? 13.237 5.778   20.008  1.00 21.71  ? 1194 TRP A CE2   1 
ATOM   4324 C  CE3   . TRP A 1 324 ? 14.120 4.916   17.929  1.00 28.80  ? 1194 TRP A CE3   1 
ATOM   4325 C  CZ2   . TRP A 1 324 ? 14.090 6.882   19.967  1.00 32.87  ? 1194 TRP A CZ2   1 
ATOM   4326 C  CZ3   . TRP A 1 324 ? 14.962 6.013   17.888  1.00 27.89  ? 1194 TRP A CZ3   1 
ATOM   4327 C  CH2   . TRP A 1 324 ? 14.943 6.979   18.902  1.00 29.78  ? 1194 TRP A CH2   1 
ATOM   4328 H  H     . TRP A 1 324 ? 11.527 0.017   18.151  1.00 31.75  ? 1194 TRP A H     1 
ATOM   4329 H  HA    . TRP A 1 324 ? 13.667 1.558   18.881  1.00 32.32  ? 1194 TRP A HA    1 
ATOM   4330 H  HB2   . TRP A 1 324 ? 12.010 2.776   17.660  1.00 27.06  ? 1194 TRP A HB2   1 
ATOM   4331 H  HB3   . TRP A 1 324 ? 10.952 2.391   18.778  1.00 27.06  ? 1194 TRP A HB3   1 
ATOM   4332 H  HD1   . TRP A 1 324 ? 11.035 3.804   21.020  1.00 33.91  ? 1194 TRP A HD1   1 
ATOM   4333 H  HE1   . TRP A 1 324 ? 12.106 5.866   21.652  1.00 32.80  ? 1194 TRP A HE1   1 
ATOM   4334 H  HE3   . TRP A 1 324 ? 14.139 4.278   17.253  1.00 34.51  ? 1194 TRP A HE3   1 
ATOM   4335 H  HZ2   . TRP A 1 324 ? 14.079 7.526   20.638  1.00 39.39  ? 1194 TRP A HZ2   1 
ATOM   4336 H  HZ3   . TRP A 1 324 ? 15.554 6.108   17.177  1.00 33.41  ? 1194 TRP A HZ3   1 
ATOM   4337 H  HH2   . TRP A 1 324 ? 15.521 7.706   18.848  1.00 35.68  ? 1194 TRP A HH2   1 
ATOM   4338 N  N     . PRO A 1 325 ? 13.433 0.633   21.182  1.00 26.32  ? 1195 PRO A N     1 
ATOM   4339 C  CA    . PRO A 1 325 ? 13.222 0.062   22.516  1.00 26.57  ? 1195 PRO A CA    1 
ATOM   4340 C  C     . PRO A 1 325 ? 12.318 0.894   23.420  1.00 26.78  ? 1195 PRO A C     1 
ATOM   4341 O  O     . PRO A 1 325 ? 12.356 2.125   23.402  1.00 33.19  ? 1195 PRO A O     1 
ATOM   4342 C  CB    . PRO A 1 325 ? 14.640 0.009   23.095  1.00 28.88  ? 1195 PRO A CB    1 
ATOM   4343 C  CG    . PRO A 1 325 ? 15.526 -0.089  21.898  1.00 33.41  ? 1195 PRO A CG    1 
ATOM   4344 C  CD    . PRO A 1 325 ? 14.867 0.781   20.872  1.00 31.27  ? 1195 PRO A CD    1 
ATOM   4345 H  HA    . PRO A 1 325 ? 12.865 -0.848  22.445  1.00 31.83  ? 1195 PRO A HA    1 
ATOM   4346 H  HB2   . PRO A 1 325 ? 14.822 0.821   23.594  1.00 34.60  ? 1195 PRO A HB2   1 
ATOM   4347 H  HB3   . PRO A 1 325 ? 14.735 -0.773  23.660  1.00 34.60  ? 1195 PRO A HB3   1 
ATOM   4348 H  HG2   . PRO A 1 325 ? 16.410 0.245   22.116  1.00 40.03  ? 1195 PRO A HG2   1 
ATOM   4349 H  HG3   . PRO A 1 325 ? 15.568 -1.009  21.595  1.00 40.03  ? 1195 PRO A HG3   1 
ATOM   4350 H  HD2   . PRO A 1 325 ? 15.144 1.704   20.981  1.00 37.46  ? 1195 PRO A HD2   1 
ATOM   4351 H  HD3   . PRO A 1 325 ? 15.056 0.453   19.979  1.00 37.46  ? 1195 PRO A HD3   1 
ATOM   4352 N  N     . ASN A 1 326 ? 11.506 0.205   24.211  1.00 35.54  ? 1196 ASN A N     1 
ATOM   4353 C  CA    . ASN A 1 326 ? 10.741 0.849   25.265  1.00 33.08  ? 1196 ASN A CA    1 
ATOM   4354 C  C     . ASN A 1 326 ? 11.642 0.990   26.483  1.00 29.26  ? 1196 ASN A C     1 
ATOM   4355 O  O     . ASN A 1 326 ? 12.044 -0.009  27.079  1.00 28.14  ? 1196 ASN A O     1 
ATOM   4356 C  CB    . ASN A 1 326 ? 9.502  0.016   25.601  1.00 40.81  ? 1196 ASN A CB    1 
ATOM   4357 C  CG    . ASN A 1 326 ? 8.582  0.707   26.588  1.00 49.34  ? 1196 ASN A CG    1 
ATOM   4358 O  OD1   . ASN A 1 326 ? 9.017  1.533   27.387  1.00 37.45  ? 1196 ASN A OD1   1 
ATOM   4359 N  ND2   . ASN A 1 326 ? 7.299  0.369   26.534  1.00 41.66  ? 1196 ASN A ND2   1 
ATOM   4360 H  H     . ASN A 1 326 ? 11.381 -0.644  24.156  1.00 42.59  ? 1196 ASN A H     1 
ATOM   4361 H  HA    . ASN A 1 326 ? 10.456 1.740   24.974  1.00 39.64  ? 1196 ASN A HA    1 
ATOM   4362 H  HB2   . ASN A 1 326 ? 9.001  -0.148  24.787  1.00 48.91  ? 1196 ASN A HB2   1 
ATOM   4363 H  HB3   . ASN A 1 326 ? 9.784  -0.826  25.993  1.00 48.91  ? 1196 ASN A HB3   1 
ATOM   4364 H  HD21  . ASN A 1 326 ? 6.736  0.732   27.072  1.00 49.94  ? 1196 ASN A HD21  1 
ATOM   4365 H  HD22  . ASN A 1 326 ? 7.031  -0.213  25.960  1.00 49.94  ? 1196 ASN A HD22  1 
ATOM   4366 N  N     . LEU A 1 327 ? 11.974 2.227   26.842  1.00 32.90  ? 1197 LEU A N     1 
ATOM   4367 C  CA    . LEU A 1 327 ? 12.918 2.478   27.929  1.00 30.57  ? 1197 LEU A CA    1 
ATOM   4368 C  C     . LEU A 1 327 ? 12.440 1.898   29.256  1.00 34.44  ? 1197 LEU A C     1 
ATOM   4369 O  O     . LEU A 1 327 ? 13.249 1.532   30.103  1.00 32.99  ? 1197 LEU A O     1 
ATOM   4370 C  CB    . LEU A 1 327 ? 13.173 3.978   28.092  1.00 31.12  ? 1197 LEU A CB    1 
ATOM   4371 C  CG    . LEU A 1 327 ? 13.961 4.668   26.976  1.00 29.14  ? 1197 LEU A CG    1 
ATOM   4372 C  CD1   . LEU A 1 327 ? 14.433 6.034   27.451  1.00 38.06  ? 1197 LEU A CD1   1 
ATOM   4373 C  CD2   . LEU A 1 327 ? 15.143 3.822   26.537  1.00 25.31  ? 1197 LEU A CD2   1 
ATOM   4374 H  H     . LEU A 1 327 ? 11.668 2.940   26.471  1.00 39.42  ? 1197 LEU A H     1 
ATOM   4375 H  HA    . LEU A 1 327 ? 13.772 2.052   27.708  1.00 36.63  ? 1197 LEU A HA    1 
ATOM   4376 H  HB2   . LEU A 1 327 ? 12.314 4.426   28.155  1.00 37.29  ? 1197 LEU A HB2   1 
ATOM   4377 H  HB3   . LEU A 1 327 ? 13.665 4.113   28.916  1.00 37.29  ? 1197 LEU A HB3   1 
ATOM   4378 H  HG    . LEU A 1 327 ? 13.381 4.798   26.209  1.00 34.91  ? 1197 LEU A HG    1 
ATOM   4379 H  HD11  . LEU A 1 327 ? 14.926 6.457   26.744  1.00 45.62  ? 1197 LEU A HD11  1 
ATOM   4380 H  HD12  . LEU A 1 327 ? 13.667 6.566   27.681  1.00 45.62  ? 1197 LEU A HD12  1 
ATOM   4381 H  HD13  . LEU A 1 327 ? 14.996 5.920   28.220  1.00 45.62  ? 1197 LEU A HD13  1 
ATOM   4382 H  HD21  . LEU A 1 327 ? 15.614 4.282   25.839  1.00 30.32  ? 1197 LEU A HD21  1 
ATOM   4383 H  HD22  . LEU A 1 327 ? 15.723 3.684   27.289  1.00 30.32  ? 1197 LEU A HD22  1 
ATOM   4384 H  HD23  . LEU A 1 327 ? 14.819 2.978   26.214  1.00 30.32  ? 1197 LEU A HD23  1 
ATOM   4385 N  N     . GLU A 1 328 ? 11.127 1.830   29.443  1.00 37.35  ? 1198 GLU A N     1 
ATOM   4386 C  CA    . GLU A 1 328 ? 10.567 1.261   30.666  1.00 48.39  ? 1198 GLU A CA    1 
ATOM   4387 C  C     . GLU A 1 328 ? 10.852 -0.237  30.750  1.00 37.61  ? 1198 GLU A C     1 
ATOM   4388 O  O     . GLU A 1 328 ? 11.121 -0.764  31.829  1.00 36.45  ? 1198 GLU A O     1 
ATOM   4389 C  CB    . GLU A 1 328 ? 9.064  1.536   30.748  1.00 49.56  ? 1198 GLU A CB    1 
ATOM   4390 C  CG    . GLU A 1 328 ? 8.733  2.977   31.119  1.00 68.23  ? 1198 GLU A CG    1 
ATOM   4391 C  CD    . GLU A 1 328 ? 7.267  3.319   30.925  1.00 79.75  ? 1198 GLU A CD    1 
ATOM   4392 O  OE1   . GLU A 1 328 ? 6.432  2.390   30.890  1.00 72.33  ? 1198 GLU A OE1   1 
ATOM   4393 O  OE2   . GLU A 1 328 ? 6.951  4.521   30.803  1.00 78.01  ? 1198 GLU A OE2   1 
ATOM   4394 H  H     . GLU A 1 328 ? 10.539 2.105   28.879  1.00 44.76  ? 1198 GLU A H     1 
ATOM   4395 H  HA    . GLU A 1 328 ? 10.993 1.691   31.437  1.00 58.01  ? 1198 GLU A HA    1 
ATOM   4396 H  HB2   . GLU A 1 328 ? 8.663  1.351   29.885  1.00 59.42  ? 1198 GLU A HB2   1 
ATOM   4397 H  HB3   . GLU A 1 328 ? 8.675  0.958   31.423  1.00 59.42  ? 1198 GLU A HB3   1 
ATOM   4398 H  HG2   . GLU A 1 328 ? 8.952  3.120   32.053  1.00 81.82  ? 1198 GLU A HG2   1 
ATOM   4399 H  HG3   . GLU A 1 328 ? 9.256  3.574   30.561  1.00 81.82  ? 1198 GLU A HG3   1 
ATOM   4400 N  N     . ASP A 1 329 ? 10.798 -0.916  29.609  1.00 41.00  ? 1199 ASP A N     1 
ATOM   4401 C  CA    . ASP A 1 329 ? 11.148 -2.332  29.544  1.00 36.39  ? 1199 ASP A CA    1 
ATOM   4402 C  C     . ASP A 1 329 ? 12.614 -2.565  29.896  1.00 35.56  ? 1199 ASP A C     1 
ATOM   4403 O  O     . ASP A 1 329 ? 12.941 -3.504  30.620  1.00 30.59  ? 1199 ASP A O     1 
ATOM   4404 C  CB    . ASP A 1 329 ? 10.868 -2.895  28.150  1.00 33.99  ? 1199 ASP A CB    1 
ATOM   4405 C  CG    . ASP A 1 329 ? 9.388  -3.044  27.867  1.00 47.06  ? 1199 ASP A CG    1 
ATOM   4406 O  OD1   . ASP A 1 329 ? 8.598  -3.108  28.831  1.00 43.73  ? 1199 ASP A OD1   1 
ATOM   4407 O  OD2   . ASP A 1 329 ? 9.014  -3.108  26.678  1.00 41.22  ? 1199 ASP A OD2   1 
ATOM   4408 H  H     . ASP A 1 329 ? 10.560 -0.579  28.854  1.00 49.15  ? 1199 ASP A H     1 
ATOM   4409 H  HA    . ASP A 1 329 ? 10.599 -2.827  30.187  1.00 43.61  ? 1199 ASP A HA    1 
ATOM   4410 H  HB2   . ASP A 1 329 ? 11.242 -2.295  27.485  1.00 40.73  ? 1199 ASP A HB2   1 
ATOM   4411 H  HB3   . ASP A 1 329 ? 11.278 -3.771  28.074  1.00 40.73  ? 1199 ASP A HB3   1 
ATOM   4412 N  N     . LEU A 1 330 ? 13.499 -1.719  29.377  1.00 31.59  ? 1200 LEU A N     1 
ATOM   4413 C  CA    . LEU A 1 330 ? 14.926 -1.876  29.638  1.00 26.60  ? 1200 LEU A CA    1 
ATOM   4414 C  C     . LEU A 1 330 ? 15.235 -1.666  31.113  1.00 29.06  ? 1200 LEU A C     1 
ATOM   4415 O  O     . LEU A 1 330 ? 15.972 -2.440  31.719  1.00 30.63  ? 1200 LEU A O     1 
ATOM   4416 C  CB    . LEU A 1 330 ? 15.747 -0.901  28.793  1.00 24.80  ? 1200 LEU A CB    1 
ATOM   4417 C  CG    . LEU A 1 330 ? 15.643 -1.113  27.282  1.00 27.08  ? 1200 LEU A CG    1 
ATOM   4418 C  CD1   . LEU A 1 330 ? 16.629 -0.214  26.546  1.00 24.41  ? 1200 LEU A CD1   1 
ATOM   4419 C  CD2   . LEU A 1 330 ? 15.878 -2.572  26.921  1.00 28.35  ? 1200 LEU A CD2   1 
ATOM   4420 H  H     . LEU A 1 330 ? 13.301 -1.050  28.873  1.00 37.85  ? 1200 LEU A H     1 
ATOM   4421 H  HA    . LEU A 1 330 ? 15.196 -2.787  29.398  1.00 31.87  ? 1200 LEU A HA    1 
ATOM   4422 H  HB2   . LEU A 1 330 ? 15.447 0.001   28.983  1.00 29.70  ? 1200 LEU A HB2   1 
ATOM   4423 H  HB3   . LEU A 1 330 ? 16.682 -0.992  29.038  1.00 29.70  ? 1200 LEU A HB3   1 
ATOM   4424 H  HG    . LEU A 1 330 ? 14.749 -0.874  26.992  1.00 32.44  ? 1200 LEU A HG    1 
ATOM   4425 H  HD11  . LEU A 1 330 ? 16.545 -0.365  25.602  1.00 29.24  ? 1200 LEU A HD11  1 
ATOM   4426 H  HD12  . LEU A 1 330 ? 16.429 0.702   26.751  1.00 29.24  ? 1200 LEU A HD12  1 
ATOM   4427 H  HD13  . LEU A 1 330 ? 17.520 -0.427  26.834  1.00 29.24  ? 1200 LEU A HD13  1 
ATOM   4428 H  HD21  . LEU A 1 330 ? 15.806 -2.673  25.969  1.00 33.96  ? 1200 LEU A HD21  1 
ATOM   4429 H  HD22  . LEU A 1 330 ? 16.755 -2.828  27.213  1.00 33.96  ? 1200 LEU A HD22  1 
ATOM   4430 H  HD23  . LEU A 1 330 ? 15.216 -3.112  27.359  1.00 33.96  ? 1200 LEU A HD23  1 
ATOM   4431 N  N     . TYR A 1 331 ? 14.668 -0.612  31.687  1.00 29.42  ? 1201 TYR A N     1 
ATOM   4432 C  CA    . TYR A 1 331 ? 14.894 -0.298  33.092  1.00 27.61  ? 1201 TYR A CA    1 
ATOM   4433 C  C     . TYR A 1 331 ? 14.471 -1.461  33.988  1.00 34.67  ? 1201 TYR A C     1 
ATOM   4434 O  O     . TYR A 1 331 ? 15.152 -1.792  34.956  1.00 36.01  ? 1201 TYR A O     1 
ATOM   4435 C  CB    . TYR A 1 331 ? 14.126 0.966   33.474  1.00 38.16  ? 1201 TYR A CB    1 
ATOM   4436 C  CG    . TYR A 1 331 ? 14.316 1.402   34.910  1.00 44.45  ? 1201 TYR A CG    1 
ATOM   4437 C  CD1   . TYR A 1 331 ? 15.401 2.186   35.278  1.00 44.08  ? 1201 TYR A CD1   1 
ATOM   4438 C  CD2   . TYR A 1 331 ? 13.401 1.041   35.896  1.00 43.42  ? 1201 TYR A CD2   1 
ATOM   4439 C  CE1   . TYR A 1 331 ? 15.578 2.595   36.589  1.00 48.22  ? 1201 TYR A CE1   1 
ATOM   4440 C  CE2   . TYR A 1 331 ? 13.570 1.445   37.210  1.00 42.99  ? 1201 TYR A CE2   1 
ATOM   4441 C  CZ    . TYR A 1 331 ? 14.660 2.223   37.549  1.00 48.31  ? 1201 TYR A CZ    1 
ATOM   4442 O  OH    . TYR A 1 331 ? 14.835 2.631   38.849  1.00 56.37  ? 1201 TYR A OH    1 
ATOM   4443 H  H     . TYR A 1 331 ? 14.146 -0.061  31.283  1.00 35.25  ? 1201 TYR A H     1 
ATOM   4444 H  HA    . TYR A 1 331 ? 15.849 -0.132  33.236  1.00 33.08  ? 1201 TYR A HA    1 
ATOM   4445 H  HB2   . TYR A 1 331 ? 14.421 1.693   32.904  1.00 45.74  ? 1201 TYR A HB2   1 
ATOM   4446 H  HB3   . TYR A 1 331 ? 13.179 0.807   33.338  1.00 45.74  ? 1201 TYR A HB3   1 
ATOM   4447 H  HD1   . TYR A 1 331 ? 16.021 2.439   34.633  1.00 52.84  ? 1201 TYR A HD1   1 
ATOM   4448 H  HD2   . TYR A 1 331 ? 12.667 0.518   35.668  1.00 52.04  ? 1201 TYR A HD2   1 
ATOM   4449 H  HE1   . TYR A 1 331 ? 16.311 3.119   36.821  1.00 57.81  ? 1201 TYR A HE1   1 
ATOM   4450 H  HE2   . TYR A 1 331 ? 12.952 1.196   37.860  1.00 51.54  ? 1201 TYR A HE2   1 
ATOM   4451 H  HH    . TYR A 1 331 ? 14.839 3.450   38.888  1.00 67.59  ? 1201 TYR A HH    1 
ATOM   4452 N  N     . GLU A 1 332 ? 13.349 -2.091  33.666  1.00 40.19  ? 1202 GLU A N     1 
ATOM   4453 C  CA    . GLU A 1 332 ? 12.849 -3.169  34.509  1.00 54.67  ? 1202 GLU A CA    1 
ATOM   4454 C  C     . GLU A 1 332 ? 13.672 -4.446  34.350  1.00 42.94  ? 1202 GLU A C     1 
ATOM   4455 O  O     . GLU A 1 332 ? 13.669 -5.300  35.233  1.00 41.38  ? 1202 GLU A O     1 
ATOM   4456 C  CB    . GLU A 1 332 ? 11.372 -3.445  34.228  1.00 56.89  ? 1202 GLU A CB    1 
ATOM   4457 C  CG    . GLU A 1 332 ? 10.630 -4.048  35.418  1.00 88.16  ? 1202 GLU A CG    1 
ATOM   4458 C  CD    . GLU A 1 332 ? 10.972 -3.363  36.735  1.00 96.98  ? 1202 GLU A CD    1 
ATOM   4459 O  OE1   . GLU A 1 332 ? 11.087 -2.118  36.753  1.00 90.69  ? 1202 GLU A OE1   1 
ATOM   4460 O  OE2   . GLU A 1 332 ? 11.135 -4.071  37.752  1.00 85.69  ? 1202 GLU A OE2   1 
ATOM   4461 H  H     . GLU A 1 332 ? 12.865 -1.918  32.976  1.00 48.17  ? 1202 GLU A H     1 
ATOM   4462 H  HA    . GLU A 1 332 ? 12.922 -2.889  35.445  1.00 65.55  ? 1202 GLU A HA    1 
ATOM   4463 H  HB2   . GLU A 1 332 ? 10.935 -2.610  33.997  1.00 68.21  ? 1202 GLU A HB2   1 
ATOM   4464 H  HB3   . GLU A 1 332 ? 11.304 -4.069  33.488  1.00 68.21  ? 1202 GLU A HB3   1 
ATOM   4465 H  HG2   . GLU A 1 332 ? 9.675  -3.959  35.273  1.00 105.74 ? 1202 GLU A HG2   1 
ATOM   4466 H  HG3   . GLU A 1 332 ? 10.868 -4.985  35.497  1.00 105.74 ? 1202 GLU A HG3   1 
ATOM   4467 N  N     . ALA A 1 333 ? 14.381 -4.573  33.232  1.00 39.40  ? 1203 ALA A N     1 
ATOM   4468 C  CA    . ALA A 1 333 ? 15.261 -5.719  33.019  1.00 33.86  ? 1203 ALA A CA    1 
ATOM   4469 C  C     . ALA A 1 333 ? 16.701 -5.397  33.423  1.00 32.63  ? 1203 ALA A C     1 
ATOM   4470 O  O     . ALA A 1 333 ? 17.621 -6.153  33.121  1.00 33.36  ? 1203 ALA A O     1 
ATOM   4471 C  CB    . ALA A 1 333 ? 15.201 -6.171  31.566  1.00 34.54  ? 1203 ALA A CB    1 
ATOM   4472 H  H     . ALA A 1 333 ? 14.371 -4.010  32.582  1.00 47.22  ? 1203 ALA A H     1 
ATOM   4473 H  HA    . ALA A 1 333 ? 14.952 -6.463  33.577  1.00 40.58  ? 1203 ALA A HA    1 
ATOM   4474 H  HB1   . ALA A 1 333 ? 15.482 -5.447  31.002  1.00 41.39  ? 1203 ALA A HB1   1 
ATOM   4475 H  HB2   . ALA A 1 333 ? 15.786 -6.924  31.449  1.00 41.39  ? 1203 ALA A HB2   1 
ATOM   4476 H  HB3   . ALA A 1 333 ? 14.299 -6.421  31.353  1.00 41.39  ? 1203 ALA A HB3   1 
ATOM   4477 N  N     . ASN A 1 334 ? 16.893 -4.275  34.107  1.00 30.56  ? 1204 ASN A N     1 
ATOM   4478 C  CA    . ASN A 1 334 ? 18.219 -3.892  34.584  1.00 32.96  ? 1204 ASN A CA    1 
ATOM   4479 C  C     . ASN A 1 334 ? 19.229 -3.746  33.449  1.00 25.73  ? 1204 ASN A C     1 
ATOM   4480 O  O     . ASN A 1 334 ? 20.379 -4.165  33.569  1.00 27.75  ? 1204 ASN A O     1 
ATOM   4481 C  CB    . ASN A 1 334 ? 18.731 -4.916  35.594  1.00 36.20  ? 1204 ASN A CB    1 
ATOM   4482 C  CG    . ASN A 1 334 ? 17.757 -5.147  36.729  1.00 39.34  ? 1204 ASN A CG    1 
ATOM   4483 O  OD1   . ASN A 1 334 ? 17.321 -6.271  36.970  1.00 59.49  ? 1204 ASN A OD1   1 
ATOM   4484 N  ND2   . ASN A 1 334 ? 17.402 -4.077  37.427  1.00 41.27  ? 1204 ASN A ND2   1 
ATOM   4485 H  H     . ASN A 1 334 ? 16.272 -3.716  34.309  1.00 36.61  ? 1204 ASN A H     1 
ATOM   4486 H  HA    . ASN A 1 334 ? 18.153 -3.027  35.040  1.00 39.49  ? 1204 ASN A HA    1 
ATOM   4487 H  HB2   . ASN A 1 334 ? 18.873 -5.763  35.143  1.00 43.39  ? 1204 ASN A HB2   1 
ATOM   4488 H  HB3   . ASN A 1 334 ? 19.565 -4.598  35.974  1.00 43.39  ? 1204 ASN A HB3   1 
ATOM   4489 H  HD21  . ASN A 1 334 ? 17.723 -3.305  37.224  1.00 49.47  ? 1204 ASN A HD21  1 
ATOM   4490 H  HD22  . ASN A 1 334 ? 16.850 -4.154  38.082  1.00 49.47  ? 1204 ASN A HD22  1 
ATOM   4491 N  N     . VAL A 1 335 ? 18.788 -3.151  32.348  1.00 29.20  ? 1205 VAL A N     1 
ATOM   4492 C  CA    . VAL A 1 335 ? 19.670 -2.841  31.230  1.00 26.32  ? 1205 VAL A CA    1 
ATOM   4493 C  C     . VAL A 1 335 ? 20.071 -1.375  31.331  1.00 24.01  ? 1205 VAL A C     1 
ATOM   4494 O  O     . VAL A 1 335 ? 19.211 -0.500  31.321  1.00 25.08  ? 1205 VAL A O     1 
ATOM   4495 C  CB    . VAL A 1 335 ? 18.965 -3.070  29.878  1.00 25.27  ? 1205 VAL A CB    1 
ATOM   4496 C  CG1   . VAL A 1 335 ? 19.853 -2.624  28.715  1.00 20.31  ? 1205 VAL A CG1   1 
ATOM   4497 C  CG2   . VAL A 1 335 ? 18.570 -4.529  29.725  1.00 28.92  ? 1205 VAL A CG2   1 
ATOM   4498 H  H     . VAL A 1 335 ? 17.971 -2.914  32.222  1.00 34.99  ? 1205 VAL A H     1 
ATOM   4499 H  HA    . VAL A 1 335 ? 20.476 -3.398  31.271  1.00 31.53  ? 1205 VAL A HA    1 
ATOM   4500 H  HB    . VAL A 1 335 ? 18.146 -2.532  29.854  1.00 30.27  ? 1205 VAL A HB    1 
ATOM   4501 H  HG11  . VAL A 1 335 ? 19.387 -2.779  27.890  1.00 24.32  ? 1205 VAL A HG11  1 
ATOM   4502 H  HG12  . VAL A 1 335 ? 20.047 -1.689  28.811  1.00 24.32  ? 1205 VAL A HG12  1 
ATOM   4503 H  HG13  . VAL A 1 335 ? 20.667 -3.131  28.732  1.00 24.32  ? 1205 VAL A HG13  1 
ATOM   4504 H  HG21  . VAL A 1 335 ? 18.133 -4.647  28.878  1.00 34.65  ? 1205 VAL A HG21  1 
ATOM   4505 H  HG22  . VAL A 1 335 ? 19.360 -5.072  29.765  1.00 34.65  ? 1205 VAL A HG22  1 
ATOM   4506 H  HG23  . VAL A 1 335 ? 17.972 -4.766  30.438  1.00 34.65  ? 1205 VAL A HG23  1 
ATOM   4507 N  N     . PRO A 1 336 ? 21.378 -1.094  31.435  1.00 24.93  ? 1206 PRO A N     1 
ATOM   4508 C  CA    . PRO A 1 336 ? 21.765 0.316   31.536  1.00 24.72  ? 1206 PRO A CA    1 
ATOM   4509 C  C     . PRO A 1 336 ? 21.643 1.039   30.195  1.00 22.33  ? 1206 PRO A C     1 
ATOM   4510 O  O     . PRO A 1 336 ? 21.959 0.461   29.154  1.00 22.91  ? 1206 PRO A O     1 
ATOM   4511 C  CB    . PRO A 1 336 ? 23.227 0.244   31.977  1.00 22.94  ? 1206 PRO A CB    1 
ATOM   4512 C  CG    . PRO A 1 336 ? 23.721 -1.043  31.417  1.00 24.15  ? 1206 PRO A CG    1 
ATOM   4513 C  CD    . PRO A 1 336 ? 22.546 -1.994  31.474  1.00 26.16  ? 1206 PRO A CD    1 
ATOM   4514 H  HA    . PRO A 1 336 ? 21.232 0.778   32.216  1.00 29.61  ? 1206 PRO A HA    1 
ATOM   4515 H  HB2   . PRO A 1 336 ? 23.720 0.993   31.606  1.00 27.47  ? 1206 PRO A HB2   1 
ATOM   4516 H  HB3   . PRO A 1 336 ? 23.279 0.242   32.945  1.00 27.47  ? 1206 PRO A HB3   1 
ATOM   4517 H  HG2   . PRO A 1 336 ? 24.008 -0.910  30.500  1.00 28.92  ? 1206 PRO A HG2   1 
ATOM   4518 H  HG3   . PRO A 1 336 ? 24.454 -1.374  31.959  1.00 28.92  ? 1206 PRO A HG3   1 
ATOM   4519 H  HD2   . PRO A 1 336 ? 22.547 -2.580  30.702  1.00 31.33  ? 1206 PRO A HD2   1 
ATOM   4520 H  HD3   . PRO A 1 336 ? 22.558 -2.497  32.303  1.00 31.33  ? 1206 PRO A HD3   1 
ATOM   4521 N  N     . VAL A 1 337 ? 21.180 2.285   30.228  1.00 24.12  ? 1207 VAL A N     1 
ATOM   4522 C  CA    . VAL A 1 337 ? 21.053 3.092   29.021  1.00 21.17  ? 1207 VAL A CA    1 
ATOM   4523 C  C     . VAL A 1 337 ? 21.811 4.405   29.176  1.00 26.56  ? 1207 VAL A C     1 
ATOM   4524 O  O     . VAL A 1 337 ? 21.541 5.190   30.088  1.00 23.69  ? 1207 VAL A O     1 
ATOM   4525 C  CB    . VAL A 1 337 ? 19.580 3.412   28.694  1.00 26.13  ? 1207 VAL A CB    1 
ATOM   4526 C  CG1   . VAL A 1 337 ? 19.493 4.303   27.461  1.00 24.36  ? 1207 VAL A CG1   1 
ATOM   4527 C  CG2   . VAL A 1 337 ? 18.790 2.129   28.481  1.00 32.61  ? 1207 VAL A CG2   1 
ATOM   4528 H  H     . VAL A 1 337 ? 20.930 2.689   30.945  1.00 28.89  ? 1207 VAL A H     1 
ATOM   4529 H  HA    . VAL A 1 337 ? 21.437 2.603   28.264  1.00 25.35  ? 1207 VAL A HA    1 
ATOM   4530 H  HB    . VAL A 1 337 ? 19.181 3.894   29.448  1.00 31.30  ? 1207 VAL A HB    1 
ATOM   4531 H  HG11  . VAL A 1 337 ? 18.570 4.490   27.275  1.00 29.18  ? 1207 VAL A HG11  1 
ATOM   4532 H  HG12  . VAL A 1 337 ? 19.965 5.121   27.633  1.00 29.18  ? 1207 VAL A HG12  1 
ATOM   4533 H  HG13  . VAL A 1 337 ? 19.892 3.846   26.717  1.00 29.18  ? 1207 VAL A HG13  1 
ATOM   4534 H  HG21  . VAL A 1 337 ? 17.878 2.354   28.280  1.00 39.07  ? 1207 VAL A HG21  1 
ATOM   4535 H  HG22  . VAL A 1 337 ? 19.176 1.642   27.750  1.00 39.07  ? 1207 VAL A HG22  1 
ATOM   4536 H  HG23  . VAL A 1 337 ? 18.828 1.602   29.283  1.00 39.07  ? 1207 VAL A HG23  1 
ATOM   4537 N  N     . TYR A 1 338 ? 22.779 4.614   28.292  1.00 20.78  ? 1208 TYR A N     1 
ATOM   4538 C  CA    . TYR A 1 338 ? 23.454 5.892   28.154  1.00 22.92  ? 1208 TYR A CA    1 
ATOM   4539 C  C     . TYR A 1 338 ? 22.611 6.771   27.245  1.00 27.19  ? 1208 TYR A C     1 
ATOM   4540 O  O     . TYR A 1 338 ? 22.267 6.376   26.137  1.00 26.35  ? 1208 TYR A O     1 
ATOM   4541 C  CB    . TYR A 1 338 ? 24.838 5.684   27.538  1.00 19.06  ? 1208 TYR A CB    1 
ATOM   4542 C  CG    . TYR A 1 338 ? 25.772 4.876   28.408  1.00 24.87  ? 1208 TYR A CG    1 
ATOM   4543 C  CD1   . TYR A 1 338 ? 26.805 5.490   29.111  1.00 22.20  ? 1208 TYR A CD1   1 
ATOM   4544 C  CD2   . TYR A 1 338 ? 25.620 3.501   28.535  1.00 27.16  ? 1208 TYR A CD2   1 
ATOM   4545 C  CE1   . TYR A 1 338 ? 27.662 4.752   29.918  1.00 25.07  ? 1208 TYR A CE1   1 
ATOM   4546 C  CE2   . TYR A 1 338 ? 26.466 2.757   29.338  1.00 27.96  ? 1208 TYR A CE2   1 
ATOM   4547 C  CZ    . TYR A 1 338 ? 27.489 3.383   30.022  1.00 28.69  ? 1208 TYR A CZ    1 
ATOM   4548 O  OH    . TYR A 1 338 ? 28.329 2.637   30.821  1.00 27.51  ? 1208 TYR A OH    1 
ATOM   4549 H  H     . TYR A 1 338 ? 23.067 4.014   27.748  1.00 24.88  ? 1208 TYR A H     1 
ATOM   4550 H  HA    . TYR A 1 338 ? 23.548 6.324   29.028  1.00 27.45  ? 1208 TYR A HA    1 
ATOM   4551 H  HB2   . TYR A 1 338 ? 24.739 5.215   26.695  1.00 22.81  ? 1208 TYR A HB2   1 
ATOM   4552 H  HB3   . TYR A 1 338 ? 25.247 6.550   27.387  1.00 22.81  ? 1208 TYR A HB3   1 
ATOM   4553 H  HD1   . TYR A 1 338 ? 26.923 6.410   29.040  1.00 26.58  ? 1208 TYR A HD1   1 
ATOM   4554 H  HD2   . TYR A 1 338 ? 24.934 3.073   28.075  1.00 32.53  ? 1208 TYR A HD2   1 
ATOM   4555 H  HE1   . TYR A 1 338 ? 28.349 5.173   30.381  1.00 30.03  ? 1208 TYR A HE1   1 
ATOM   4556 H  HE2   . TYR A 1 338 ? 26.352 1.837   29.410  1.00 33.49  ? 1208 TYR A HE2   1 
ATOM   4557 H  HH    . TYR A 1 338 ? 28.281 2.896   31.598  1.00 32.95  ? 1208 TYR A HH    1 
ATOM   4558 N  N     . ARG A 1 339 ? 22.271 7.962   27.716  1.00 25.19  ? 1209 ARG A N     1 
ATOM   4559 C  CA    . ARG A 1 339 ? 21.424 8.859   26.950  1.00 21.46  ? 1209 ARG A CA    1 
ATOM   4560 C  C     . ARG A 1 339 ? 22.045 10.248  26.959  1.00 26.59  ? 1209 ARG A C     1 
ATOM   4561 O  O     . ARG A 1 339 ? 22.364 10.785  28.020  1.00 23.87  ? 1209 ARG A O     1 
ATOM   4562 C  CB    . ARG A 1 339 ? 20.022 8.876   27.556  1.00 28.67  ? 1209 ARG A CB    1 
ATOM   4563 C  CG    . ARG A 1 339 ? 19.046 9.800   26.872  1.00 27.12  ? 1209 ARG A CG    1 
ATOM   4564 C  CD    . ARG A 1 339 ? 17.676 9.712   27.525  1.00 29.51  ? 1209 ARG A CD    1 
ATOM   4565 N  NE    . ARG A 1 339 ? 16.705 10.556  26.838  1.00 34.75  ? 1209 ARG A NE    1 
ATOM   4566 C  CZ    . ARG A 1 339 ? 15.393 10.508  27.038  1.00 32.75  ? 1209 ARG A CZ    1 
ATOM   4567 N  NH1   . ARG A 1 339 ? 14.885 9.646   27.906  1.00 29.98  ? 1209 ARG A NH1   1 
ATOM   4568 N  NH2   . ARG A 1 339 ? 14.589 11.317  26.363  1.00 31.39  ? 1209 ARG A NH2   1 
ATOM   4569 H  H     . ARG A 1 339 ? 22.519 8.274   28.478  1.00 30.18  ? 1209 ARG A H     1 
ATOM   4570 H  HA    . ARG A 1 339 ? 21.364 8.547   26.023  1.00 25.70  ? 1209 ARG A HA    1 
ATOM   4571 H  HB2   . ARG A 1 339 ? 19.656 7.978   27.512  1.00 34.35  ? 1209 ARG A HB2   1 
ATOM   4572 H  HB3   . ARG A 1 339 ? 20.090 9.154   28.482  1.00 34.35  ? 1209 ARG A HB3   1 
ATOM   4573 H  HG2   . ARG A 1 339 ? 19.363 10.714  26.945  1.00 32.49  ? 1209 ARG A HG2   1 
ATOM   4574 H  HG3   . ARG A 1 339 ? 18.959 9.544   25.941  1.00 32.49  ? 1209 ARG A HG3   1 
ATOM   4575 H  HD2   . ARG A 1 339 ? 17.362 8.795   27.490  1.00 35.36  ? 1209 ARG A HD2   1 
ATOM   4576 H  HD3   . ARG A 1 339 ? 17.740 10.011  28.446  1.00 35.36  ? 1209 ARG A HD3   1 
ATOM   4577 H  HE    . ARG A 1 339 ? 17.002 11.123  26.264  1.00 41.64  ? 1209 ARG A HE    1 
ATOM   4578 H  HH11  . ARG A 1 339 ? 15.406 9.119   28.344  1.00 35.92  ? 1209 ARG A HH11  1 
ATOM   4579 H  HH12  . ARG A 1 339 ? 14.035 9.614   28.034  1.00 35.92  ? 1209 ARG A HH12  1 
ATOM   4580 H  HH21  . ARG A 1 339 ? 14.917 11.877  25.798  1.00 37.61  ? 1209 ARG A HH21  1 
ATOM   4581 H  HH22  . ARG A 1 339 ? 13.739 11.285  26.492  1.00 37.61  ? 1209 ARG A HH22  1 
ATOM   4582 N  N     . PHE A 1 340 ? 22.240 10.825  25.778  1.00 23.06  ? 1210 PHE A N     1 
ATOM   4583 C  CA    . PHE A 1 340 ? 22.884 12.132  25.689  1.00 22.44  ? 1210 PHE A CA    1 
ATOM   4584 C  C     . PHE A 1 340 ? 22.510 12.868  24.414  1.00 24.77  ? 1210 PHE A C     1 
ATOM   4585 O  O     . PHE A 1 340 ? 21.919 12.296  23.501  1.00 24.17  ? 1210 PHE A O     1 
ATOM   4586 C  CB    . PHE A 1 340 ? 24.404 11.977  25.762  1.00 24.43  ? 1210 PHE A CB    1 
ATOM   4587 C  CG    . PHE A 1 340 ? 25.006 11.305  24.556  1.00 22.32  ? 1210 PHE A CG    1 
ATOM   4588 C  CD1   . PHE A 1 340 ? 25.481 12.059  23.491  1.00 25.50  ? 1210 PHE A CD1   1 
ATOM   4589 C  CD2   . PHE A 1 340 ? 25.103 9.921   24.490  1.00 23.05  ? 1210 PHE A CD2   1 
ATOM   4590 C  CE1   . PHE A 1 340 ? 26.038 11.447  22.378  1.00 31.83  ? 1210 PHE A CE1   1 
ATOM   4591 C  CE2   . PHE A 1 340 ? 25.659 9.301   23.377  1.00 23.68  ? 1210 PHE A CE2   1 
ATOM   4592 C  CZ    . PHE A 1 340 ? 26.125 10.067  22.320  1.00 21.27  ? 1210 PHE A CZ    1 
ATOM   4593 H  H     . PHE A 1 340 ? 22.012 10.486  25.021  1.00 27.62  ? 1210 PHE A H     1 
ATOM   4594 H  HA    . PHE A 1 340 ? 22.598 12.680  26.450  1.00 26.87  ? 1210 PHE A HA    1 
ATOM   4595 H  HB2   . PHE A 1 340 ? 24.804 12.858  25.841  1.00 29.26  ? 1210 PHE A HB2   1 
ATOM   4596 H  HB3   . PHE A 1 340 ? 24.627 11.444  26.541  1.00 29.26  ? 1210 PHE A HB3   1 
ATOM   4597 H  HD1   . PHE A 1 340 ? 25.423 12.987  23.524  1.00 30.54  ? 1210 PHE A HD1   1 
ATOM   4598 H  HD2   . PHE A 1 340 ? 24.790 9.404   25.196  1.00 27.60  ? 1210 PHE A HD2   1 
ATOM   4599 H  HE1   . PHE A 1 340 ? 26.350 11.963  21.670  1.00 38.14  ? 1210 PHE A HE1   1 
ATOM   4600 H  HE2   . PHE A 1 340 ? 25.718 8.373   23.342  1.00 28.36  ? 1210 PHE A HE2   1 
ATOM   4601 H  HZ    . PHE A 1 340 ? 26.499 9.655   21.575  1.00 25.47  ? 1210 PHE A HZ    1 
ATOM   4602 N  N     . ILE A 1 341 ? 22.863 14.148  24.370  1.00 20.69  ? 1211 ILE A N     1 
ATOM   4603 C  CA    . ILE A 1 341 ? 22.607 14.995  23.219  1.00 23.58  ? 1211 ILE A CA    1 
ATOM   4604 C  C     . ILE A 1 341 ? 23.914 15.274  22.495  1.00 21.88  ? 1211 ILE A C     1 
ATOM   4605 O  O     . ILE A 1 341 ? 24.906 15.631  23.116  1.00 25.43  ? 1211 ILE A O     1 
ATOM   4606 C  CB    . ILE A 1 341 ? 22.005 16.346  23.643  1.00 24.07  ? 1211 ILE A CB    1 
ATOM   4607 C  CG1   . ILE A 1 341 ? 20.679 16.138  24.379  1.00 34.93  ? 1211 ILE A CG1   1 
ATOM   4608 C  CG2   . ILE A 1 341 ? 21.819 17.249  22.426  1.00 23.75  ? 1211 ILE A CG2   1 
ATOM   4609 C  CD1   . ILE A 1 341 ? 19.594 15.551  23.522  1.00 30.18  ? 1211 ILE A CD1   1 
ATOM   4610 H  H     . ILE A 1 341 ? 23.263 14.556  25.013  1.00 24.77  ? 1211 ILE A H     1 
ATOM   4611 H  HA    . ILE A 1 341 ? 21.989 14.548  22.604  1.00 28.24  ? 1211 ILE A HA    1 
ATOM   4612 H  HB    . ILE A 1 341 ? 22.625 16.779  24.251  1.00 28.83  ? 1211 ILE A HB    1 
ATOM   4613 H  HG12  . ILE A 1 341 ? 20.828 15.535  25.125  1.00 41.86  ? 1211 ILE A HG12  1 
ATOM   4614 H  HG13  . ILE A 1 341 ? 20.366 16.996  24.708  1.00 41.86  ? 1211 ILE A HG13  1 
ATOM   4615 H  HG21  . ILE A 1 341 ? 21.443 18.085  22.712  1.00 28.44  ? 1211 ILE A HG21  1 
ATOM   4616 H  HG22  . ILE A 1 341 ? 22.674 17.397  22.015  1.00 28.44  ? 1211 ILE A HG22  1 
ATOM   4617 H  HG23  . ILE A 1 341 ? 21.227 16.818  21.806  1.00 28.44  ? 1211 ILE A HG23  1 
ATOM   4618 H  HD11  . ILE A 1 341 ? 18.799 15.450  24.051  1.00 36.15  ? 1211 ILE A HD11  1 
ATOM   4619 H  HD12  . ILE A 1 341 ? 19.425 16.141  22.784  1.00 36.15  ? 1211 ILE A HD12  1 
ATOM   4620 H  HD13  . ILE A 1 341 ? 19.882 14.694  23.198  1.00 36.15  ? 1211 ILE A HD13  1 
ATOM   4621 N  N     . GLN A 1 342 ? 23.906 15.088  21.181  1.00 18.08  ? 1212 GLN A N     1 
ATOM   4622 C  CA    . GLN A 1 342 ? 25.035 15.426  20.329  1.00 19.73  ? 1212 GLN A CA    1 
ATOM   4623 C  C     . GLN A 1 342 ? 24.751 16.760  19.651  1.00 19.30  ? 1212 GLN A C     1 
ATOM   4624 O  O     . GLN A 1 342 ? 23.820 16.871  18.860  1.00 21.04  ? 1212 GLN A O     1 
ATOM   4625 C  CB    . GLN A 1 342 ? 25.223 14.338  19.267  1.00 20.51  ? 1212 GLN A CB    1 
ATOM   4626 C  CG    . GLN A 1 342 ? 26.302 14.630  18.232  1.00 17.10  ? 1212 GLN A CG    1 
ATOM   4627 C  CD    . GLN A 1 342 ? 26.189 13.727  17.016  1.00 19.33  ? 1212 GLN A CD    1 
ATOM   4628 O  OE1   . GLN A 1 342 ? 25.092 13.324  16.632  1.00 20.56  ? 1212 GLN A OE1   1 
ATOM   4629 N  NE2   . GLN A 1 342 ? 27.324 13.407  16.403  1.00 20.16  ? 1212 GLN A NE2   1 
ATOM   4630 H  H     . GLN A 1 342 ? 23.239 14.758  20.750  1.00 21.63  ? 1212 GLN A H     1 
ATOM   4631 H  HA    . GLN A 1 342 ? 25.853 15.502  20.863  1.00 23.62  ? 1212 GLN A HA    1 
ATOM   4632 H  HB2   . GLN A 1 342 ? 25.461 13.510  19.713  1.00 24.56  ? 1212 GLN A HB2   1 
ATOM   4633 H  HB3   . GLN A 1 342 ? 24.385 14.223  18.792  1.00 24.56  ? 1212 GLN A HB3   1 
ATOM   4634 H  HG2   . GLN A 1 342 ? 26.217 15.549  17.935  1.00 20.46  ? 1212 GLN A HG2   1 
ATOM   4635 H  HG3   . GLN A 1 342 ? 27.174 14.488  18.633  1.00 20.46  ? 1212 GLN A HG3   1 
ATOM   4636 H  HE21  . GLN A 1 342 ? 27.310 12.899  15.710  1.00 24.14  ? 1212 GLN A HE21  1 
ATOM   4637 H  HE22  . GLN A 1 342 ? 28.073 13.709  16.700  1.00 24.14  ? 1212 GLN A HE22  1 
ATOM   4638 N  N     . ARG A 1 343 ? 25.550 17.772  19.968  1.00 17.92  ? 1213 ARG A N     1 
ATOM   4639 C  CA    . ARG A 1 343 ? 25.366 19.105  19.406  1.00 19.21  ? 1213 ARG A CA    1 
ATOM   4640 C  C     . ARG A 1 343 ? 26.119 19.222  18.087  1.00 25.55  ? 1213 ARG A C     1 
ATOM   4641 O  O     . ARG A 1 343 ? 26.948 18.373  17.764  1.00 24.48  ? 1213 ARG A O     1 
ATOM   4642 C  CB    . ARG A 1 343 ? 25.895 20.161  20.377  1.00 22.29  ? 1213 ARG A CB    1 
ATOM   4643 C  CG    . ARG A 1 343 ? 25.393 20.018  21.806  1.00 24.20  ? 1213 ARG A CG    1 
ATOM   4644 C  CD    . ARG A 1 343 ? 26.252 20.840  22.757  1.00 26.94  ? 1213 ARG A CD    1 
ATOM   4645 N  NE    . ARG A 1 343 ? 27.662 20.496  22.608  1.00 26.14  ? 1213 ARG A NE    1 
ATOM   4646 C  CZ    . ARG A 1 343 ? 28.677 21.212  23.082  1.00 37.11  ? 1213 ARG A CZ    1 
ATOM   4647 N  NH1   . ARG A 1 343 ? 28.459 22.334  23.758  1.00 25.41  ? 1213 ARG A NH1   1 
ATOM   4648 N  NH2   . ARG A 1 343 ? 29.920 20.800  22.877  1.00 24.13  ? 1213 ARG A NH2   1 
ATOM   4649 H  H     . ARG A 1 343 ? 26.214 17.711  20.512  1.00 21.45  ? 1213 ARG A H     1 
ATOM   4650 H  HA    . ARG A 1 343 ? 24.414 19.270  19.244  1.00 23.00  ? 1213 ARG A HA    1 
ATOM   4651 H  HB2   . ARG A 1 343 ? 26.863 20.105  20.398  1.00 26.69  ? 1213 ARG A HB2   1 
ATOM   4652 H  HB3   . ARG A 1 343 ? 25.627 21.037  20.057  1.00 26.69  ? 1213 ARG A HB3   1 
ATOM   4653 H  HG2   . ARG A 1 343 ? 24.479 20.339  21.862  1.00 28.98  ? 1213 ARG A HG2   1 
ATOM   4654 H  HG3   . ARG A 1 343 ? 25.442 19.087  22.075  1.00 28.98  ? 1213 ARG A HG3   1 
ATOM   4655 H  HD2   . ARG A 1 343 ? 26.144 21.782  22.556  1.00 32.28  ? 1213 ARG A HD2   1 
ATOM   4656 H  HD3   . ARG A 1 343 ? 25.987 20.656  23.672  1.00 32.28  ? 1213 ARG A HD3   1 
ATOM   4657 H  HE    . ARG A 1 343 ? 27.851 19.774  22.180  1.00 31.32  ? 1213 ARG A HE    1 
ATOM   4658 H  HH11  . ARG A 1 343 ? 27.654 22.606  23.891  1.00 30.44  ? 1213 ARG A HH11  1 
ATOM   4659 H  HH12  . ARG A 1 343 ? 29.122 22.790  24.061  1.00 30.44  ? 1213 ARG A HH12  1 
ATOM   4660 H  HH21  . ARG A 1 343 ? 30.065 20.072  22.442  1.00 28.90  ? 1213 ARG A HH21  1 
ATOM   4661 H  HH22  . ARG A 1 343 ? 30.580 21.257  23.184  1.00 28.90  ? 1213 ARG A HH22  1 
ATOM   4662 N  N     . PRO A 1 344 ? 25.839 20.280  17.317  1.00 24.52  ? 1214 PRO A N     1 
ATOM   4663 C  CA    . PRO A 1 344 ? 26.633 20.490  16.104  1.00 22.09  ? 1214 PRO A CA    1 
ATOM   4664 C  C     . PRO A 1 344 ? 28.124 20.562  16.433  1.00 25.32  ? 1214 PRO A C     1 
ATOM   4665 O  O     . PRO A 1 344 ? 28.502 21.243  17.379  1.00 26.57  ? 1214 PRO A O     1 
ATOM   4666 C  CB    . PRO A 1 344 ? 26.119 21.835  15.586  1.00 27.50  ? 1214 PRO A CB    1 
ATOM   4667 C  CG    . PRO A 1 344 ? 24.710 21.899  16.077  1.00 26.30  ? 1214 PRO A CG    1 
ATOM   4668 C  CD    . PRO A 1 344 ? 24.743 21.256  17.437  1.00 27.93  ? 1214 PRO A CD    1 
ATOM   4669 H  HA    . PRO A 1 344 ? 26.464 19.786  15.443  1.00 26.45  ? 1214 PRO A HA    1 
ATOM   4670 H  HB2   . PRO A 1 344 ? 26.649 22.557  15.960  1.00 32.95  ? 1214 PRO A HB2   1 
ATOM   4671 H  HB3   . PRO A 1 344 ? 26.149 21.849  14.617  1.00 32.95  ? 1214 PRO A HB3   1 
ATOM   4672 H  HG2   . PRO A 1 344 ? 24.427 22.824  16.141  1.00 31.50  ? 1214 PRO A HG2   1 
ATOM   4673 H  HG3   . PRO A 1 344 ? 24.131 21.403  15.477  1.00 31.50  ? 1214 PRO A HG3   1 
ATOM   4674 H  HD2   . PRO A 1 344 ? 24.948 21.915  18.118  1.00 33.46  ? 1214 PRO A HD2   1 
ATOM   4675 H  HD3   . PRO A 1 344 ? 23.904 20.804  17.618  1.00 33.46  ? 1214 PRO A HD3   1 
ATOM   4676 N  N     . GLY A 1 345 ? 28.950 19.843  15.681  1.00 19.13  ? 1215 GLY A N     1 
ATOM   4677 C  CA    . GLY A 1 345 ? 30.387 19.862  15.887  1.00 22.03  ? 1215 GLY A CA    1 
ATOM   4678 C  C     . GLY A 1 345 ? 30.888 18.770  16.814  1.00 24.89  ? 1215 GLY A C     1 
ATOM   4679 O  O     . GLY A 1 345 ? 32.092 18.541  16.896  1.00 25.26  ? 1215 GLY A O     1 
ATOM   4680 H  H     . GLY A 1 345 ? 28.696 19.331  15.039  1.00 22.90  ? 1215 GLY A H     1 
ATOM   4681 H  HA2   . GLY A 1 345 ? 30.832 19.760  15.031  1.00 26.37  ? 1215 GLY A HA2   1 
ATOM   4682 H  HA3   . GLY A 1 345 ? 30.643 20.719  16.262  1.00 26.37  ? 1215 GLY A HA3   1 
ATOM   4683 N  N     . ASP A 1 346 ? 29.978 18.101  17.518  1.00 19.53  ? 1216 ASP A N     1 
ATOM   4684 C  CA    . ASP A 1 346 ? 30.362 17.002  18.405  1.00 18.84  ? 1216 ASP A CA    1 
ATOM   4685 C  C     . ASP A 1 346 ? 30.494 15.705  17.626  1.00 25.58  ? 1216 ASP A C     1 
ATOM   4686 O  O     . ASP A 1 346 ? 29.672 15.404  16.756  1.00 22.30  ? 1216 ASP A O     1 
ATOM   4687 C  CB    . ASP A 1 346 ? 29.328 16.778  19.506  1.00 19.60  ? 1216 ASP A CB    1 
ATOM   4688 C  CG    . ASP A 1 346 ? 29.260 17.917  20.493  1.00 25.45  ? 1216 ASP A CG    1 
ATOM   4689 O  OD1   . ASP A 1 346 ? 30.204 18.730  20.553  1.00 25.82  ? 1216 ASP A OD1   1 
ATOM   4690 O  OD2   . ASP A 1 346 ? 28.255 17.985  21.221  1.00 22.65  ? 1216 ASP A OD2   1 
ATOM   4691 H  H     . ASP A 1 346 ? 29.134 18.262  17.501  1.00 23.38  ? 1216 ASP A H     1 
ATOM   4692 H  HA    . ASP A 1 346 ? 31.225 17.204  18.823  1.00 22.56  ? 1216 ASP A HA    1 
ATOM   4693 H  HB2   . ASP A 1 346 ? 28.452 16.681  19.101  1.00 23.46  ? 1216 ASP A HB2   1 
ATOM   4694 H  HB3   . ASP A 1 346 ? 29.558 15.972  19.995  1.00 23.46  ? 1216 ASP A HB3   1 
ATOM   4695 N  N     . LEU A 1 347 ? 31.514 14.929  17.969  1.00 19.77  ? 1217 LEU A N     1 
ATOM   4696 C  CA    . LEU A 1 347 ? 31.738 13.636  17.345  1.00 20.16  ? 1217 LEU A CA    1 
ATOM   4697 C  C     . LEU A 1 347 ? 31.322 12.538  18.311  1.00 19.60  ? 1217 LEU A C     1 
ATOM   4698 O  O     . LEU A 1 347 ? 31.710 12.552  19.473  1.00 22.56  ? 1217 LEU A O     1 
ATOM   4699 C  CB    . LEU A 1 347 ? 33.216 13.475  16.974  1.00 22.15  ? 1217 LEU A CB    1 
ATOM   4700 C  CG    . LEU A 1 347 ? 33.601 12.194  16.228  1.00 24.89  ? 1217 LEU A CG    1 
ATOM   4701 C  CD1   . LEU A 1 347 ? 34.819 12.442  15.334  1.00 22.16  ? 1217 LEU A CD1   1 
ATOM   4702 C  CD2   . LEU A 1 347 ? 33.858 11.038  17.202  1.00 20.79  ? 1217 LEU A CD2   1 
ATOM   4703 H  H     . LEU A 1 347 ? 32.096 15.132  18.568  1.00 23.66  ? 1217 LEU A H     1 
ATOM   4704 H  HA    . LEU A 1 347 ? 31.198 13.561  16.531  1.00 24.14  ? 1217 LEU A HA    1 
ATOM   4705 H  HB2   . LEU A 1 347 ? 33.469 14.223  16.411  1.00 26.52  ? 1217 LEU A HB2   1 
ATOM   4706 H  HB3   . LEU A 1 347 ? 33.737 13.499  17.792  1.00 26.52  ? 1217 LEU A HB3   1 
ATOM   4707 H  HG    . LEU A 1 347 ? 32.863 11.936  15.654  1.00 29.81  ? 1217 LEU A HG    1 
ATOM   4708 H  HD11  . LEU A 1 347 ? 35.042 11.628  14.878  1.00 26.54  ? 1217 LEU A HD11  1 
ATOM   4709 H  HD12  . LEU A 1 347 ? 34.605 13.128  14.697  1.00 26.54  ? 1217 LEU A HD12  1 
ATOM   4710 H  HD13  . LEU A 1 347 ? 35.556 12.723  15.882  1.00 26.54  ? 1217 LEU A HD13  1 
ATOM   4711 H  HD21  . LEU A 1 347 ? 34.096 10.255  16.701  1.00 24.89  ? 1217 LEU A HD21  1 
ATOM   4712 H  HD22  . LEU A 1 347 ? 34.575 11.281  17.792  1.00 24.89  ? 1217 LEU A HD22  1 
ATOM   4713 H  HD23  . LEU A 1 347 ? 33.059 10.873  17.708  1.00 24.89  ? 1217 LEU A HD23  1 
ATOM   4714 N  N     . VAL A 1 348 ? 30.523 11.593  17.832  1.00 17.32  ? 1218 VAL A N     1 
ATOM   4715 C  CA    . VAL A 1 348 ? 30.143 10.439  18.637  1.00 17.63  ? 1218 VAL A CA    1 
ATOM   4716 C  C     . VAL A 1 348 ? 30.903 9.209   18.160  1.00 20.52  ? 1218 VAL A C     1 
ATOM   4717 O  O     . VAL A 1 348 ? 30.867 8.861   16.980  1.00 17.81  ? 1218 VAL A O     1 
ATOM   4718 C  CB    . VAL A 1 348 ? 28.625 10.176  18.569  1.00 19.88  ? 1218 VAL A CB    1 
ATOM   4719 C  CG1   . VAL A 1 348 ? 28.276 8.838   19.218  1.00 20.13  ? 1218 VAL A CG1   1 
ATOM   4720 C  CG2   . VAL A 1 348 ? 27.856 11.315  19.239  1.00 20.09  ? 1218 VAL A CG2   1 
ATOM   4721 H  H     . VAL A 1 348 ? 30.186 11.597  17.040  1.00 20.72  ? 1218 VAL A H     1 
ATOM   4722 H  HA    . VAL A 1 348 ? 30.384 10.605  19.572  1.00 21.10  ? 1218 VAL A HA    1 
ATOM   4723 H  HB    . VAL A 1 348 ? 28.350 10.137  17.629  1.00 23.80  ? 1218 VAL A HB    1 
ATOM   4724 H  HG11  . VAL A 1 348 ? 27.327 8.701   19.161  1.00 24.10  ? 1218 VAL A HG11  1 
ATOM   4725 H  HG12  . VAL A 1 348 ? 28.737 8.136   18.753  1.00 24.10  ? 1218 VAL A HG12  1 
ATOM   4726 H  HG13  . VAL A 1 348 ? 28.550 8.856   20.138  1.00 24.10  ? 1218 VAL A HG13  1 
ATOM   4727 H  HG21  . VAL A 1 348 ? 26.916 11.130  19.185  1.00 24.05  ? 1218 VAL A HG21  1 
ATOM   4728 H  HG22  . VAL A 1 348 ? 28.126 11.375  20.158  1.00 24.05  ? 1218 VAL A HG22  1 
ATOM   4729 H  HG23  . VAL A 1 348 ? 28.056 12.136  18.783  1.00 24.05  ? 1218 VAL A HG23  1 
ATOM   4730 N  N     . TRP A 1 349 ? 31.606 8.574   19.092  1.00 20.33  ? 1219 TRP A N     1 
ATOM   4731 C  CA    . TRP A 1 349 ? 32.303 7.324   18.842  1.00 18.80  ? 1219 TRP A CA    1 
ATOM   4732 C  C     . TRP A 1 349 ? 31.494 6.184   19.444  1.00 17.34  ? 1219 TRP A C     1 
ATOM   4733 O  O     . TRP A 1 349 ? 31.303 6.124   20.655  1.00 22.34  ? 1219 TRP A O     1 
ATOM   4734 C  CB    . TRP A 1 349 ? 33.694 7.352   19.481  1.00 19.48  ? 1219 TRP A CB    1 
ATOM   4735 C  CG    . TRP A 1 349 ? 34.405 6.031   19.411  1.00 23.23  ? 1219 TRP A CG    1 
ATOM   4736 C  CD1   . TRP A 1 349 ? 34.262 4.974   20.266  1.00 28.24  ? 1219 TRP A CD1   1 
ATOM   4737 C  CD2   . TRP A 1 349 ? 35.366 5.624   18.426  1.00 21.31  ? 1219 TRP A CD2   1 
ATOM   4738 N  NE1   . TRP A 1 349 ? 35.075 3.936   19.874  1.00 22.78  ? 1219 TRP A NE1   1 
ATOM   4739 C  CE2   . TRP A 1 349 ? 35.762 4.308   18.748  1.00 23.60  ? 1219 TRP A CE2   1 
ATOM   4740 C  CE3   . TRP A 1 349 ? 35.927 6.243   17.304  1.00 17.60  ? 1219 TRP A CE3   1 
ATOM   4741 C  CZ2   . TRP A 1 349 ? 36.697 3.599   17.988  1.00 24.43  ? 1219 TRP A CZ2   1 
ATOM   4742 C  CZ3   . TRP A 1 349 ? 36.856 5.541   16.548  1.00 24.30  ? 1219 TRP A CZ3   1 
ATOM   4743 C  CH2   . TRP A 1 349 ? 37.233 4.229   16.896  1.00 24.27  ? 1219 TRP A CH2   1 
ATOM   4744 H  H     . TRP A 1 349 ? 31.694 8.859   19.898  1.00 24.34  ? 1219 TRP A H     1 
ATOM   4745 H  HA    . TRP A 1 349 ? 32.396 7.177   17.878  1.00 22.50  ? 1219 TRP A HA    1 
ATOM   4746 H  HB2   . TRP A 1 349 ? 34.238 8.009   19.020  1.00 23.32  ? 1219 TRP A HB2   1 
ATOM   4747 H  HB3   . TRP A 1 349 ? 33.605 7.594   20.416  1.00 23.32  ? 1219 TRP A HB3   1 
ATOM   4748 H  HD1   . TRP A 1 349 ? 33.697 4.960   21.004  1.00 33.83  ? 1219 TRP A HD1   1 
ATOM   4749 H  HE1   . TRP A 1 349 ? 35.141 3.176   20.272  1.00 27.28  ? 1219 TRP A HE1   1 
ATOM   4750 H  HE3   . TRP A 1 349 ? 35.681 7.109   17.069  1.00 21.06  ? 1219 TRP A HE3   1 
ATOM   4751 H  HZ2   . TRP A 1 349 ? 36.948 2.734   18.217  1.00 29.26  ? 1219 TRP A HZ2   1 
ATOM   4752 H  HZ3   . TRP A 1 349 ? 37.235 5.944   15.800  1.00 29.10  ? 1219 TRP A HZ3   1 
ATOM   4753 H  HH2   . TRP A 1 349 ? 37.858 3.781   16.373  1.00 29.07  ? 1219 TRP A HH2   1 
ATOM   4754 N  N     . ILE A 1 350 ? 31.006 5.293   18.590  1.00 20.76  ? 1220 ILE A N     1 
ATOM   4755 C  CA    . ILE A 1 350 ? 30.284 4.106   19.033  1.00 17.80  ? 1220 ILE A CA    1 
ATOM   4756 C  C     . ILE A 1 350 ? 31.258 2.935   19.067  1.00 19.36  ? 1220 ILE A C     1 
ATOM   4757 O  O     . ILE A 1 350 ? 31.790 2.530   18.032  1.00 17.34  ? 1220 ILE A O     1 
ATOM   4758 C  CB    . ILE A 1 350 ? 29.109 3.792   18.086  1.00 18.76  ? 1220 ILE A CB    1 
ATOM   4759 C  CG1   . ILE A 1 350 ? 28.073 4.919   18.137  1.00 23.41  ? 1220 ILE A CG1   1 
ATOM   4760 C  CG2   . ILE A 1 350 ? 28.454 2.460   18.447  1.00 24.23  ? 1220 ILE A CG2   1 
ATOM   4761 C  CD1   . ILE A 1 350 ? 27.217 4.918   19.397  1.00 24.77  ? 1220 ILE A CD1   1 
ATOM   4762 H  H     . ILE A 1 350 ? 31.081 5.354   17.735  1.00 24.86  ? 1220 ILE A H     1 
ATOM   4763 H  HA    . ILE A 1 350 ? 29.931 4.250   19.936  1.00 21.31  ? 1220 ILE A HA    1 
ATOM   4764 H  HB    . ILE A 1 350 ? 29.452 3.730   17.180  1.00 22.46  ? 1220 ILE A HB    1 
ATOM   4765 H  HG12  . ILE A 1 350 ? 28.536 5.770   18.094  1.00 28.04  ? 1220 ILE A HG12  1 
ATOM   4766 H  HG13  . ILE A 1 350 ? 27.478 4.830   17.375  1.00 28.04  ? 1220 ILE A HG13  1 
ATOM   4767 H  HG21  . ILE A 1 350 ? 27.729 2.295   17.841  1.00 29.02  ? 1220 ILE A HG21  1 
ATOM   4768 H  HG22  . ILE A 1 350 ? 29.108 1.761   18.375  1.00 29.02  ? 1220 ILE A HG22  1 
ATOM   4769 H  HG23  . ILE A 1 350 ? 28.124 2.509   19.347  1.00 29.02  ? 1220 ILE A HG23  1 
ATOM   4770 H  HD11  . ILE A 1 350 ? 26.596 5.649   19.353  1.00 29.67  ? 1220 ILE A HD11  1 
ATOM   4771 H  HD12  . ILE A 1 350 ? 26.740 4.086   19.450  1.00 29.67  ? 1220 ILE A HD12  1 
ATOM   4772 H  HD13  . ILE A 1 350 ? 27.788 5.018   20.162  1.00 29.67  ? 1220 ILE A HD13  1 
ATOM   4773 N  N     . ASN A 1 351 ? 31.504 2.402   20.260  1.00 18.37  ? 1221 ASN A N     1 
ATOM   4774 C  CA    . ASN A 1 351 ? 32.481 1.333   20.423  1.00 18.00  ? 1221 ASN A CA    1 
ATOM   4775 C  C     . ASN A 1 351 ? 31.964 0.025   19.822  1.00 18.14  ? 1221 ASN A C     1 
ATOM   4776 O  O     . ASN A 1 351 ? 30.800 -0.073  19.445  1.00 21.45  ? 1221 ASN A O     1 
ATOM   4777 C  CB    . ASN A 1 351 ? 32.851 1.161   21.902  1.00 18.88  ? 1221 ASN A CB    1 
ATOM   4778 C  CG    . ASN A 1 351 ? 34.306 0.760   22.096  1.00 28.17  ? 1221 ASN A CG    1 
ATOM   4779 O  OD1   . ASN A 1 351 ? 35.041 0.573   21.129  1.00 32.11  ? 1221 ASN A OD1   1 
ATOM   4780 N  ND2   . ASN A 1 351 ? 34.732 0.647   23.351  1.00 26.00  ? 1221 ASN A ND2   1 
ATOM   4781 H  H     . ASN A 1 351 ? 31.118 2.642   20.990  1.00 21.99  ? 1221 ASN A H     1 
ATOM   4782 H  HA    . ASN A 1 351 ? 33.297 1.579   19.940  1.00 21.54  ? 1221 ASN A HA    1 
ATOM   4783 H  HB2   . ASN A 1 351 ? 32.706 2.001   22.364  1.00 22.60  ? 1221 ASN A HB2   1 
ATOM   4784 H  HB3   . ASN A 1 351 ? 32.294 0.468   22.289  1.00 22.60  ? 1221 ASN A HB3   1 
ATOM   4785 H  HD21  . ASN A 1 351 ? 35.547 0.423   23.509  1.00 31.14  ? 1221 ASN A HD21  1 
ATOM   4786 H  HD22  . ASN A 1 351 ? 34.193 0.798   24.003  1.00 31.14  ? 1221 ASN A HD22  1 
ATOM   4787 N  N     . ALA A 1 352 ? 32.841 -0.969  19.724  1.00 18.90  ? 1222 ALA A N     1 
ATOM   4788 C  CA    . ALA A 1 352 ? 32.540 -2.192  18.987  1.00 21.47  ? 1222 ALA A CA    1 
ATOM   4789 C  C     . ALA A 1 352 ? 31.353 -2.938  19.584  1.00 19.85  ? 1222 ALA A C     1 
ATOM   4790 O  O     . ALA A 1 352 ? 31.362 -3.301  20.758  1.00 20.93  ? 1222 ALA A O     1 
ATOM   4791 C  CB    . ALA A 1 352 ? 33.770 -3.096  18.943  1.00 19.91  ? 1222 ALA A CB    1 
ATOM   4792 H  H     . ALA A 1 352 ? 33.625 -0.960  20.079  1.00 22.62  ? 1222 ALA A H     1 
ATOM   4793 H  HA    . ALA A 1 352 ? 32.310 -1.954  18.064  1.00 25.71  ? 1222 ALA A HA    1 
ATOM   4794 H  HB1   . ALA A 1 352 ? 33.553 -3.894  18.455  1.00 23.84  ? 1222 ALA A HB1   1 
ATOM   4795 H  HB2   . ALA A 1 352 ? 34.485 -2.628  18.505  1.00 23.84  ? 1222 ALA A HB2   1 
ATOM   4796 H  HB3   . ALA A 1 352 ? 34.025 -3.320  19.841  1.00 23.84  ? 1222 ALA A HB3   1 
ATOM   4797 N  N     . GLY A 1 353 ? 30.331 -3.154  18.760  1.00 21.34  ? 1223 GLY A N     1 
ATOM   4798 C  CA    . GLY A 1 353 ? 29.158 -3.912  19.159  1.00 22.90  ? 1223 GLY A CA    1 
ATOM   4799 C  C     . GLY A 1 353 ? 28.187 -3.160  20.055  1.00 23.34  ? 1223 GLY A C     1 
ATOM   4800 O  O     . GLY A 1 353 ? 27.206 -3.727  20.521  1.00 20.07  ? 1223 GLY A O     1 
ATOM   4801 H  H     . GLY A 1 353 ? 30.297 -2.866  17.951  1.00 25.55  ? 1223 GLY A H     1 
ATOM   4802 H  HA2   . GLY A 1 353 ? 28.677 -4.189  18.364  1.00 27.42  ? 1223 GLY A HA2   1 
ATOM   4803 H  HA3   . GLY A 1 353 ? 29.444 -4.709  19.631  1.00 27.42  ? 1223 GLY A HA3   1 
ATOM   4804 N  N     . THR A 1 354 ? 28.445 -1.882  20.300  1.00 21.05  ? 1224 THR A N     1 
ATOM   4805 C  CA    . THR A 1 354 ? 27.540 -1.086  21.124  1.00 15.65  ? 1224 THR A CA    1 
ATOM   4806 C  C     . THR A 1 354 ? 26.185 -0.956  20.438  1.00 21.06  ? 1224 THR A C     1 
ATOM   4807 O  O     . THR A 1 354 ? 26.106 -0.607  19.263  1.00 23.92  ? 1224 THR A O     1 
ATOM   4808 C  CB    . THR A 1 354 ? 28.114 0.314   21.399  1.00 16.35  ? 1224 THR A CB    1 
ATOM   4809 O  OG1   . THR A 1 354 ? 29.265 0.196   22.243  1.00 19.25  ? 1224 THR A OG1   1 
ATOM   4810 C  CG2   . THR A 1 354 ? 27.081 1.204   22.083  1.00 19.81  ? 1224 THR A CG2   1 
ATOM   4811 H  H     . THR A 1 354 ? 29.129 -1.454  20.004  1.00 25.20  ? 1224 THR A H     1 
ATOM   4812 H  HA    . THR A 1 354 ? 27.406 -1.536  21.984  1.00 18.72  ? 1224 THR A HA    1 
ATOM   4813 H  HB    . THR A 1 354 ? 28.370 0.729   20.560  1.00 19.56  ? 1224 THR A HB    1 
ATOM   4814 H  HG1   . THR A 1 354 ? 29.056 -0.156  22.953  1.00 23.04  ? 1224 THR A HG1   1 
ATOM   4815 H  HG21  . THR A 1 354 ? 27.455 2.073   22.247  1.00 23.72  ? 1224 THR A HG21  1 
ATOM   4816 H  HG22  . THR A 1 354 ? 26.307 1.298   21.522  1.00 23.72  ? 1224 THR A HG22  1 
ATOM   4817 H  HG23  . THR A 1 354 ? 26.816 0.815   22.919  1.00 23.72  ? 1224 THR A HG23  1 
ATOM   4818 N  N     . VAL A 1 355 ? 25.119 -1.257  21.173  1.00 20.71  ? 1225 VAL A N     1 
ATOM   4819 C  CA    . VAL A 1 355 ? 23.768 -1.159  20.633  1.00 26.10  ? 1225 VAL A CA    1 
ATOM   4820 C  C     . VAL A 1 355 ? 23.276 0.278   20.782  1.00 23.33  ? 1225 VAL A C     1 
ATOM   4821 O  O     . VAL A 1 355 ? 23.443 0.887   21.836  1.00 23.11  ? 1225 VAL A O     1 
ATOM   4822 C  CB    . VAL A 1 355 ? 22.808 -2.121  21.360  1.00 27.46  ? 1225 VAL A CB    1 
ATOM   4823 C  CG1   . VAL A 1 355 ? 21.432 -2.080  20.723  1.00 24.41  ? 1225 VAL A CG1   1 
ATOM   4824 C  CG2   . VAL A 1 355 ? 23.363 -3.546  21.340  1.00 25.22  ? 1225 VAL A CG2   1 
ATOM   4825 H  H     . VAL A 1 355 ? 25.152 -1.521  21.991  1.00 24.80  ? 1225 VAL A H     1 
ATOM   4826 H  HA    . VAL A 1 355 ? 23.778 -1.389  19.681  1.00 31.26  ? 1225 VAL A HA    1 
ATOM   4827 H  HB    . VAL A 1 355 ? 22.719 -1.841  22.295  1.00 32.89  ? 1225 VAL A HB    1 
ATOM   4828 H  HG11  . VAL A 1 355 ? 20.853 -2.686  21.192  1.00 29.24  ? 1225 VAL A HG11  1 
ATOM   4829 H  HG12  . VAL A 1 355 ? 21.087 -1.186  20.782  1.00 29.24  ? 1225 VAL A HG12  1 
ATOM   4830 H  HG13  . VAL A 1 355 ? 21.506 -2.344  19.803  1.00 29.24  ? 1225 VAL A HG13  1 
ATOM   4831 H  HG21  . VAL A 1 355 ? 22.750 -4.127  21.797  1.00 30.21  ? 1225 VAL A HG21  1 
ATOM   4832 H  HG22  . VAL A 1 355 ? 23.464 -3.829  20.428  1.00 30.21  ? 1225 VAL A HG22  1 
ATOM   4833 H  HG23  . VAL A 1 355 ? 24.215 -3.556  21.783  1.00 30.21  ? 1225 VAL A HG23  1 
ATOM   4834 N  N     . HIS A 1 356 ? 22.694 0.841   19.728  1.00 18.48  ? 1226 HIS A N     1 
ATOM   4835 C  CA    . HIS A 1 356 ? 22.259 2.234   19.797  1.00 20.14  ? 1226 HIS A CA    1 
ATOM   4836 C  C     . HIS A 1 356 ? 21.103 2.564   18.865  1.00 18.81  ? 1226 HIS A C     1 
ATOM   4837 O  O     . HIS A 1 356 ? 20.863 1.878   17.870  1.00 18.99  ? 1226 HIS A O     1 
ATOM   4838 C  CB    . HIS A 1 356 ? 23.431 3.167   19.492  1.00 21.20  ? 1226 HIS A CB    1 
ATOM   4839 C  CG    . HIS A 1 356 ? 24.086 2.894   18.179  1.00 22.11  ? 1226 HIS A CG    1 
ATOM   4840 N  ND1   . HIS A 1 356 ? 24.871 1.779   17.956  1.00 21.12  ? 1226 HIS A ND1   1 
ATOM   4841 C  CD2   . HIS A 1 356 ? 24.074 3.579   17.012  1.00 25.43  ? 1226 HIS A CD2   1 
ATOM   4842 C  CE1   . HIS A 1 356 ? 25.313 1.795   16.715  1.00 21.10  ? 1226 HIS A CE1   1 
ATOM   4843 N  NE2   . HIS A 1 356 ? 24.846 2.879   16.119  1.00 24.31  ? 1226 HIS A NE2   1 
ATOM   4844 H  H     . HIS A 1 356 ? 22.542 0.450   18.977  1.00 22.12  ? 1226 HIS A H     1 
ATOM   4845 H  HA    . HIS A 1 356 ? 21.962 2.421   20.712  1.00 24.11  ? 1226 HIS A HA    1 
ATOM   4846 H  HB2   . HIS A 1 356 ? 23.108 4.081   19.479  1.00 25.39  ? 1226 HIS A HB2   1 
ATOM   4847 H  HB3   . HIS A 1 356 ? 24.101 3.064   20.185  1.00 25.39  ? 1226 HIS A HB3   1 
ATOM   4848 H  HD1   . HIS A 1 356 ? 25.045 1.170   18.538  1.00 25.29  ? 1226 HIS A HD1   1 
ATOM   4849 H  HD2   . HIS A 1 356 ? 23.629 4.379   16.847  1.00 30.47  ? 1226 HIS A HD2   1 
ATOM   4850 H  HE1   . HIS A 1 356 ? 25.862 1.154   16.325  1.00 25.27  ? 1226 HIS A HE1   1 
ATOM   4851 N  N     . TRP A 1 357 ? 20.387 3.628   19.212  1.00 21.43  ? 1227 TRP A N     1 
ATOM   4852 C  CA    . TRP A 1 357 ? 19.371 4.196   18.343  1.00 22.46  ? 1227 TRP A CA    1 
ATOM   4853 C  C     . TRP A 1 357 ? 19.390 5.716   18.513  1.00 19.45  ? 1227 TRP A C     1 
ATOM   4854 O  O     . TRP A 1 357 ? 19.871 6.219   19.522  1.00 21.62  ? 1227 TRP A O     1 
ATOM   4855 C  CB    . TRP A 1 357 ? 17.990 3.581   18.619  1.00 21.50  ? 1227 TRP A CB    1 
ATOM   4856 C  CG    . TRP A 1 357 ? 17.533 3.554   20.076  1.00 21.45  ? 1227 TRP A CG    1 
ATOM   4857 C  CD1   . TRP A 1 357 ? 16.574 4.348   20.646  1.00 23.53  ? 1227 TRP A CD1   1 
ATOM   4858 C  CD2   . TRP A 1 357 ? 17.991 2.675   21.119  1.00 24.38  ? 1227 TRP A CD2   1 
ATOM   4859 N  NE1   . TRP A 1 357 ? 16.415 4.023   21.970  1.00 24.92  ? 1227 TRP A NE1   1 
ATOM   4860 C  CE2   . TRP A 1 357 ? 17.270 3.001   22.287  1.00 24.04  ? 1227 TRP A CE2   1 
ATOM   4861 C  CE3   . TRP A 1 357 ? 18.942 1.650   21.179  1.00 24.97  ? 1227 TRP A CE3   1 
ATOM   4862 C  CZ2   . TRP A 1 357 ? 17.474 2.344   23.503  1.00 25.63  ? 1227 TRP A CZ2   1 
ATOM   4863 C  CZ3   . TRP A 1 357 ? 19.143 0.997   22.389  1.00 23.85  ? 1227 TRP A CZ3   1 
ATOM   4864 C  CH2   . TRP A 1 357 ? 18.412 1.349   23.535  1.00 25.59  ? 1227 TRP A CH2   1 
ATOM   4865 H  H     . TRP A 1 357 ? 20.475 4.044   19.959  1.00 25.67  ? 1227 TRP A H     1 
ATOM   4866 H  HA    . TRP A 1 357 ? 19.605 3.997   17.412  1.00 26.90  ? 1227 TRP A HA    1 
ATOM   4867 H  HB2   . TRP A 1 357 ? 17.328 4.084   18.120  1.00 25.75  ? 1227 TRP A HB2   1 
ATOM   4868 H  HB3   . TRP A 1 357 ? 17.999 2.663   18.305  1.00 25.75  ? 1227 TRP A HB3   1 
ATOM   4869 H  HD1   . TRP A 1 357 ? 16.096 5.008   20.199  1.00 28.17  ? 1227 TRP A HD1   1 
ATOM   4870 H  HE1   . TRP A 1 357 ? 15.867 4.402   22.514  1.00 29.84  ? 1227 TRP A HE1   1 
ATOM   4871 H  HE3   . TRP A 1 357 ? 19.431 1.413   20.424  1.00 29.90  ? 1227 TRP A HE3   1 
ATOM   4872 H  HZ2   . TRP A 1 357 ? 16.991 2.576   24.264  1.00 30.70  ? 1227 TRP A HZ2   1 
ATOM   4873 H  HZ3   . TRP A 1 357 ? 19.773 0.314   22.440  1.00 28.56  ? 1227 TRP A HZ3   1 
ATOM   4874 H  HH2   . TRP A 1 357 ? 18.566 0.893   24.331  1.00 30.65  ? 1227 TRP A HH2   1 
ATOM   4875 N  N     . VAL A 1 358 ? 18.893 6.441   17.516  1.00 18.48  ? 1228 VAL A N     1 
ATOM   4876 C  CA    . VAL A 1 358 ? 19.139 7.878   17.418  1.00 19.55  ? 1228 VAL A CA    1 
ATOM   4877 C  C     . VAL A 1 358 ? 17.911 8.611   16.892  1.00 22.97  ? 1228 VAL A C     1 
ATOM   4878 O  O     . VAL A 1 358 ? 17.140 8.065   16.104  1.00 20.00  ? 1228 VAL A O     1 
ATOM   4879 C  CB    . VAL A 1 358 ? 20.317 8.163   16.454  1.00 26.04  ? 1228 VAL A CB    1 
ATOM   4880 C  CG1   . VAL A 1 358 ? 20.729 9.635   16.514  1.00 19.92  ? 1228 VAL A CG1   1 
ATOM   4881 C  CG2   . VAL A 1 358 ? 21.507 7.253   16.769  1.00 17.43  ? 1228 VAL A CG2   1 
ATOM   4882 H  H     . VAL A 1 358 ? 18.408 6.125   16.881  1.00 22.12  ? 1228 VAL A H     1 
ATOM   4883 H  HA    . VAL A 1 358 ? 19.364 8.235   18.302  1.00 23.41  ? 1228 VAL A HA    1 
ATOM   4884 H  HB    . VAL A 1 358 ? 20.028 7.971   15.538  1.00 31.20  ? 1228 VAL A HB    1 
ATOM   4885 H  HG11  . VAL A 1 358 ? 21.459 9.780   15.908  1.00 23.85  ? 1228 VAL A HG11  1 
ATOM   4886 H  HG12  . VAL A 1 358 ? 19.979 10.179  16.261  1.00 23.85  ? 1228 VAL A HG12  1 
ATOM   4887 H  HG13  . VAL A 1 358 ? 21.000 9.847   17.410  1.00 23.85  ? 1228 VAL A HG13  1 
ATOM   4888 H  HG21  . VAL A 1 358 ? 22.221 7.450   16.158  1.00 20.86  ? 1228 VAL A HG21  1 
ATOM   4889 H  HG22  . VAL A 1 358 ? 21.793 7.413   17.671  1.00 20.86  ? 1228 VAL A HG22  1 
ATOM   4890 H  HG23  . VAL A 1 358 ? 21.235 6.337   16.669  1.00 20.86  ? 1228 VAL A HG23  1 
ATOM   4891 N  N     . GLN A 1 359 ? 17.729 9.854   17.325  1.00 22.41  ? 1229 GLN A N     1 
ATOM   4892 C  CA    . GLN A 1 359 ? 16.673 10.694  16.767  1.00 25.11  ? 1229 GLN A CA    1 
ATOM   4893 C  C     . GLN A 1 359 ? 17.113 12.149  16.701  1.00 22.12  ? 1229 GLN A C     1 
ATOM   4894 O  O     . GLN A 1 359 ? 17.807 12.637  17.587  1.00 26.41  ? 1229 GLN A O     1 
ATOM   4895 C  CB    . GLN A 1 359 ? 15.389 10.579  17.591  1.00 21.85  ? 1229 GLN A CB    1 
ATOM   4896 C  CG    . GLN A 1 359 ? 15.464 11.195  18.981  1.00 25.21  ? 1229 GLN A CG    1 
ATOM   4897 C  CD    . GLN A 1 359 ? 14.171 11.023  19.750  1.00 34.98  ? 1229 GLN A CD    1 
ATOM   4898 O  OE1   . GLN A 1 359 ? 13.144 10.657  19.183  1.00 33.60  ? 1229 GLN A OE1   1 
ATOM   4899 N  NE2   . GLN A 1 359 ? 14.217 11.279  21.049  1.00 25.56  ? 1229 GLN A NE2   1 
ATOM   4900 H  H     . GLN A 1 359 ? 18.200 10.234  17.937  1.00 26.84  ? 1229 GLN A H     1 
ATOM   4901 H  HA    . GLN A 1 359 ? 16.476 10.395  15.855  1.00 30.08  ? 1229 GLN A HA    1 
ATOM   4902 H  HB2   . GLN A 1 359 ? 14.673 11.025  17.111  1.00 26.16  ? 1229 GLN A HB2   1 
ATOM   4903 H  HB3   . GLN A 1 359 ? 15.173 9.639   17.698  1.00 26.16  ? 1229 GLN A HB3   1 
ATOM   4904 H  HG2   . GLN A 1 359 ? 16.174 10.763  19.482  1.00 30.20  ? 1229 GLN A HG2   1 
ATOM   4905 H  HG3   . GLN A 1 359 ? 15.644 12.144  18.899  1.00 30.20  ? 1229 GLN A HG3   1 
ATOM   4906 H  HE21  . GLN A 1 359 ? 13.508 11.196  21.529  1.00 30.62  ? 1229 GLN A HE21  1 
ATOM   4907 H  HE22  . GLN A 1 359 ? 14.955 11.528  21.413  1.00 30.62  ? 1229 GLN A HE22  1 
ATOM   4908 N  N     . ALA A 1 360 ? 16.714 12.837  15.640  1.00 22.10  ? 1230 ALA A N     1 
ATOM   4909 C  CA    . ALA A 1 360 ? 16.982 14.259  15.527  1.00 22.13  ? 1230 ALA A CA    1 
ATOM   4910 C  C     . ALA A 1 360 ? 16.038 15.002  16.464  1.00 31.72  ? 1230 ALA A C     1 
ATOM   4911 O  O     . ALA A 1 360 ? 14.851 14.699  16.530  1.00 27.09  ? 1230 ALA A O     1 
ATOM   4912 C  CB    . ALA A 1 360 ? 16.785 14.722  14.095  1.00 21.53  ? 1230 ALA A CB    1 
ATOM   4913 H  H     . ALA A 1 360 ? 16.287 12.503  14.973  1.00 26.46  ? 1230 ALA A H     1 
ATOM   4914 H  HA    . ALA A 1 360 ? 17.906 14.446  15.796  1.00 26.50  ? 1230 ALA A HA    1 
ATOM   4915 H  HB1   . ALA A 1 360 ? 17.389 14.240  13.525  1.00 25.78  ? 1230 ALA A HB1   1 
ATOM   4916 H  HB2   . ALA A 1 360 ? 15.878 14.549  13.833  1.00 25.78  ? 1230 ALA A HB2   1 
ATOM   4917 H  HB3   . ALA A 1 360 ? 16.967 15.664  14.044  1.00 25.78  ? 1230 ALA A HB3   1 
ATOM   4918 N  N     . ILE A 1 361 ? 16.577 15.950  17.217  1.00 27.04  ? 1231 ILE A N     1 
ATOM   4919 C  CA    . ILE A 1 361 ? 15.751 16.841  18.017  1.00 24.91  ? 1231 ILE A CA    1 
ATOM   4920 C  C     . ILE A 1 361 ? 15.434 18.091  17.207  1.00 33.96  ? 1231 ILE A C     1 
ATOM   4921 O  O     . ILE A 1 361 ? 14.328 18.621  17.274  1.00 37.64  ? 1231 ILE A O     1 
ATOM   4922 C  CB    . ILE A 1 361 ? 16.455 17.235  19.326  1.00 31.67  ? 1231 ILE A CB    1 
ATOM   4923 C  CG1   . ILE A 1 361 ? 16.654 16.001  20.211  1.00 34.09  ? 1231 ILE A CG1   1 
ATOM   4924 C  CG2   . ILE A 1 361 ? 15.655 18.299  20.069  1.00 41.25  ? 1231 ILE A CG2   1 
ATOM   4925 C  CD1   . ILE A 1 361 ? 15.400 15.167  20.391  1.00 31.30  ? 1231 ILE A CD1   1 
ATOM   4926 H  H     . ILE A 1 361 ? 17.422 16.098  17.283  1.00 32.39  ? 1231 ILE A H     1 
ATOM   4927 H  HA    . ILE A 1 361 ? 14.908 16.394  18.239  1.00 29.84  ? 1231 ILE A HA    1 
ATOM   4928 H  HB    . ILE A 1 361 ? 17.326 17.602  19.109  1.00 37.94  ? 1231 ILE A HB    1 
ATOM   4929 H  HG12  . ILE A 1 361 ? 17.331 15.434  19.810  1.00 40.85  ? 1231 ILE A HG12  1 
ATOM   4930 H  HG13  . ILE A 1 361 ? 16.946 16.290  21.090  1.00 40.85  ? 1231 ILE A HG13  1 
ATOM   4931 H  HG21  . ILE A 1 361 ? 16.115 18.526  20.880  1.00 49.45  ? 1231 ILE A HG21  1 
ATOM   4932 H  HG22  . ILE A 1 361 ? 15.573 19.075  19.510  1.00 49.45  ? 1231 ILE A HG22  1 
ATOM   4933 H  HG23  . ILE A 1 361 ? 14.784 17.949  20.272  1.00 49.45  ? 1231 ILE A HG23  1 
ATOM   4934 H  HD11  . ILE A 1 361 ? 15.602 14.416  20.954  1.00 37.50  ? 1231 ILE A HD11  1 
ATOM   4935 H  HD12  . ILE A 1 361 ? 14.720 15.709  20.799  1.00 37.50  ? 1231 ILE A HD12  1 
ATOM   4936 H  HD13  . ILE A 1 361 ? 15.102 14.862  19.531  1.00 37.50  ? 1231 ILE A HD13  1 
ATOM   4937 N  N     . GLY A 1 362 ? 16.413 18.553  16.436  1.00 30.76  ? 1232 GLY A N     1 
ATOM   4938 C  CA    . GLY A 1 362 ? 16.231 19.716  15.589  1.00 29.59  ? 1232 GLY A CA    1 
ATOM   4939 C  C     . GLY A 1 362 ? 16.359 19.357  14.123  1.00 34.07  ? 1232 GLY A C     1 
ATOM   4940 O  O     . GLY A 1 362 ? 16.232 18.191  13.745  1.00 31.64  ? 1232 GLY A O     1 
ATOM   4941 H  H     . GLY A 1 362 ? 17.197 18.204  16.388  1.00 36.85  ? 1232 GLY A H     1 
ATOM   4942 H  HA2   . GLY A 1 362 ? 15.351 20.096  15.740  1.00 35.45  ? 1232 GLY A HA2   1 
ATOM   4943 H  HA3   . GLY A 1 362 ? 16.900 20.385  15.804  1.00 35.45  ? 1232 GLY A HA3   1 
ATOM   4944 N  N     . TRP A 1 363 ? 16.601 20.368  13.297  1.00 27.23  ? 1233 TRP A N     1 
ATOM   4945 C  CA    . TRP A 1 363 ? 16.911 20.160  11.891  1.00 27.51  ? 1233 TRP A CA    1 
ATOM   4946 C  C     . TRP A 1 363 ? 18.424 20.116  11.781  1.00 30.41  ? 1233 TRP A C     1 
ATOM   4947 O  O     . TRP A 1 363 ? 19.099 21.055  12.186  1.00 30.23  ? 1233 TRP A O     1 
ATOM   4948 C  CB    . TRP A 1 363 ? 16.352 21.305  11.036  1.00 25.97  ? 1233 TRP A CB    1 
ATOM   4949 C  CG    . TRP A 1 363 ? 14.854 21.307  10.929  1.00 29.41  ? 1233 TRP A CG    1 
ATOM   4950 C  CD1   . TRP A 1 363 ? 14.108 20.848  9.884   1.00 33.71  ? 1233 TRP A CD1   1 
ATOM   4951 C  CD2   . TRP A 1 363 ? 13.919 21.791  11.906  1.00 27.99  ? 1233 TRP A CD2   1 
ATOM   4952 N  NE1   . TRP A 1 363 ? 12.771 21.014  10.146  1.00 35.76  ? 1233 TRP A NE1   1 
ATOM   4953 C  CE2   . TRP A 1 363 ? 12.627 21.590  11.381  1.00 33.91  ? 1233 TRP A CE2   1 
ATOM   4954 C  CE3   . TRP A 1 363 ? 14.050 22.373  13.170  1.00 29.62  ? 1233 TRP A CE3   1 
ATOM   4955 C  CZ2   . TRP A 1 363 ? 11.474 21.949  12.076  1.00 41.08  ? 1233 TRP A CZ2   1 
ATOM   4956 C  CZ3   . TRP A 1 363 ? 12.905 22.727  13.859  1.00 39.95  ? 1233 TRP A CZ3   1 
ATOM   4957 C  CH2   . TRP A 1 363 ? 11.634 22.515  13.311  1.00 43.06  ? 1233 TRP A CH2   1 
ATOM   4958 H  H     . TRP A 1 363 ? 16.592 21.195  13.532  1.00 32.62  ? 1233 TRP A H     1 
ATOM   4959 H  HA    . TRP A 1 363 ? 16.537 19.309  11.581  1.00 32.96  ? 1233 TRP A HA    1 
ATOM   4960 H  HB2   . TRP A 1 363 ? 16.623 22.149  11.430  1.00 31.11  ? 1233 TRP A HB2   1 
ATOM   4961 H  HB3   . TRP A 1 363 ? 16.713 21.229  10.139  1.00 31.11  ? 1233 TRP A HB3   1 
ATOM   4962 H  HD1   . TRP A 1 363 ? 14.455 20.475  9.106   1.00 40.40  ? 1233 TRP A HD1   1 
ATOM   4963 H  HE1   . TRP A 1 363 ? 12.127 20.791  9.621   1.00 42.85  ? 1233 TRP A HE1   1 
ATOM   4964 H  HE3   . TRP A 1 363 ? 14.891 22.515  13.542  1.00 35.49  ? 1233 TRP A HE3   1 
ATOM   4965 H  HZ2   . TRP A 1 363 ? 10.629 21.810  11.714  1.00 49.24  ? 1233 TRP A HZ2   1 
ATOM   4966 H  HZ3   . TRP A 1 363 ? 12.980 23.115  14.701  1.00 47.89  ? 1233 TRP A HZ3   1 
ATOM   4967 H  HH2   . TRP A 1 363 ? 10.881 22.766  13.796  1.00 51.62  ? 1233 TRP A HH2   1 
ATOM   4968 N  N     . CYS A 1 364 ? 18.964 19.027  11.252  1.00 25.70  ? 1234 CYS A N     1 
ATOM   4969 C  CA    . CYS A 1 364 ? 20.410 18.888  11.160  1.00 26.92  ? 1234 CYS A CA    1 
ATOM   4970 C  C     . CYS A 1 364 ? 20.807 17.850  10.118  1.00 28.01  ? 1234 CYS A C     1 
ATOM   4971 O  O     . CYS A 1 364 ? 19.994 17.030  9.704   1.00 26.72  ? 1234 CYS A O     1 
ATOM   4972 C  CB    . CYS A 1 364 ? 20.976 18.470  12.514  1.00 27.21  ? 1234 CYS A CB    1 
ATOM   4973 S  SG    . CYS A 1 364 ? 20.388 16.844  13.055  1.00 30.33  ? 1234 CYS A SG    1 
ATOM   4974 H  H     . CYS A 1 364 ? 18.520 18.359  10.941  1.00 30.78  ? 1234 CYS A H     1 
ATOM   4975 H  HA    . CYS A 1 364 ? 20.807 19.748  10.909  1.00 32.24  ? 1234 CYS A HA    1 
ATOM   4976 H  HB2   . CYS A 1 364 ? 21.943 18.433  12.454  1.00 32.60  ? 1234 CYS A HB2   1 
ATOM   4977 H  HB3   . CYS A 1 364 ? 20.710 19.121  13.182  1.00 32.60  ? 1234 CYS A HB3   1 
ATOM   4978 H  HG    . CYS A 1 364 ? 19.192 16.872  13.146  1.00 36.34  ? 1234 CYS A HG    1 
ATOM   4979 N  N     . ASN A 1 365 ? 22.064 17.900  9.693   1.00 25.69  ? 1235 ASN A N     1 
ATOM   4980 C  CA    . ASN A 1 365 ? 22.653 16.820  8.913   1.00 23.49  ? 1235 ASN A CA    1 
ATOM   4981 C  C     . ASN A 1 365 ? 23.695 16.128  9.773   1.00 24.93  ? 1235 ASN A C     1 
ATOM   4982 O  O     . ASN A 1 365 ? 24.225 16.729  10.700  1.00 24.27  ? 1235 ASN A O     1 
ATOM   4983 C  CB    . ASN A 1 365 ? 23.318 17.359  7.649   1.00 21.65  ? 1235 ASN A CB    1 
ATOM   4984 C  CG    . ASN A 1 365 ? 22.350 18.094  6.744   1.00 25.89  ? 1235 ASN A CG    1 
ATOM   4985 O  OD1   . ASN A 1 365 ? 21.134 17.973  6.880   1.00 25.07  ? 1235 ASN A OD1   1 
ATOM   4986 N  ND2   . ASN A 1 365 ? 22.891 18.858  5.808   1.00 25.48  ? 1235 ASN A ND2   1 
ATOM   4987 H  H     . ASN A 1 365 ? 22.601 18.555  9.846   1.00 30.77  ? 1235 ASN A H     1 
ATOM   4988 H  HA    . ASN A 1 365 ? 21.963 16.172  8.661   1.00 28.13  ? 1235 ASN A HA    1 
ATOM   4989 H  HB2   . ASN A 1 365 ? 24.021 17.978  7.902   1.00 25.92  ? 1235 ASN A HB2   1 
ATOM   4990 H  HB3   . ASN A 1 365 ? 23.693 16.618  7.148   1.00 25.92  ? 1235 ASN A HB3   1 
ATOM   4991 H  HD21  . ASN A 1 365 ? 22.387 19.298  5.267   1.00 30.52  ? 1235 ASN A HD21  1 
ATOM   4992 H  HD22  . ASN A 1 365 ? 23.746 18.915  5.741   1.00 30.52  ? 1235 ASN A HD22  1 
ATOM   4993 N  N     . ASN A 1 366 ? 23.979 14.866  9.476   1.00 22.30  ? 1236 ASN A N     1 
ATOM   4994 C  CA    . ASN A 1 366 ? 25.064 14.152  10.133  1.00 21.61  ? 1236 ASN A CA    1 
ATOM   4995 C  C     . ASN A 1 366 ? 25.900 13.469  9.068   1.00 20.68  ? 1236 ASN A C     1 
ATOM   4996 O  O     . ASN A 1 366 ? 25.407 13.183  7.985   1.00 19.36  ? 1236 ASN A O     1 
ATOM   4997 C  CB    . ASN A 1 366 ? 24.523 13.091  11.100  1.00 18.00  ? 1236 ASN A CB    1 
ATOM   4998 C  CG    . ASN A 1 366 ? 23.795 13.691  12.288  1.00 21.48  ? 1236 ASN A CG    1 
ATOM   4999 O  OD1   . ASN A 1 366 ? 24.284 13.644  13.417  1.00 26.15  ? 1236 ASN A OD1   1 
ATOM   5000 N  ND2   . ASN A 1 366 ? 22.614 14.249  12.042  1.00 23.06  ? 1236 ASN A ND2   1 
ATOM   5001 H  H     . ASN A 1 366 ? 23.555 14.399  8.892   1.00 26.70  ? 1236 ASN A H     1 
ATOM   5002 H  HA    . ASN A 1 366 ? 25.629 14.780  10.630  1.00 25.87  ? 1236 ASN A HA    1 
ATOM   5003 H  HB2   . ASN A 1 366 ? 23.900 12.519  10.625  1.00 21.55  ? 1236 ASN A HB2   1 
ATOM   5004 H  HB3   . ASN A 1 366 ? 25.264 12.565  11.438  1.00 21.55  ? 1236 ASN A HB3   1 
ATOM   5005 H  HD21  . ASN A 1 366 ? 22.163 14.602  12.683  1.00 27.61  ? 1236 ASN A HD21  1 
ATOM   5006 H  HD22  . ASN A 1 366 ? 22.301 14.257  11.241  1.00 27.61  ? 1236 ASN A HD22  1 
ATOM   5007 N  N     . ILE A 1 367 ? 27.167 13.216  9.364   1.00 19.52  ? 1237 ILE A N     1 
ATOM   5008 C  CA    . ILE A 1 367 ? 27.968 12.349  8.513   1.00 19.14  ? 1237 ILE A CA    1 
ATOM   5009 C  C     . ILE A 1 367 ? 28.499 11.231  9.385   1.00 19.36  ? 1237 ILE A C     1 
ATOM   5010 O  O     . ILE A 1 367 ? 28.696 11.411  10.585  1.00 17.87  ? 1237 ILE A O     1 
ATOM   5011 C  CB    . ILE A 1 367 ? 29.129 13.097  7.831   1.00 22.35  ? 1237 ILE A CB    1 
ATOM   5012 C  CG1   . ILE A 1 367 ? 29.943 13.871  8.870   1.00 21.50  ? 1237 ILE A CG1   1 
ATOM   5013 C  CG2   . ILE A 1 367 ? 28.587 14.033  6.748   1.00 22.99  ? 1237 ILE A CG2   1 
ATOM   5014 C  CD1   . ILE A 1 367 ? 31.103 14.649  8.279   1.00 18.29  ? 1237 ILE A CD1   1 
ATOM   5015 H  H     . ILE A 1 367 ? 27.585 13.531  10.047  1.00 23.37  ? 1237 ILE A H     1 
ATOM   5016 H  HA    . ILE A 1 367 ? 27.399 11.958  7.818   1.00 22.91  ? 1237 ILE A HA    1 
ATOM   5017 H  HB    . ILE A 1 367 ? 29.710 12.444  7.410   1.00 26.77  ? 1237 ILE A HB    1 
ATOM   5018 H  HG12  . ILE A 1 367 ? 29.358 14.503  9.317   1.00 25.75  ? 1237 ILE A HG12  1 
ATOM   5019 H  HG13  . ILE A 1 367 ? 30.304 13.243  9.515   1.00 25.75  ? 1237 ILE A HG13  1 
ATOM   5020 H  HG21  . ILE A 1 367 ? 29.323 14.490  6.334   1.00 27.53  ? 1237 ILE A HG21  1 
ATOM   5021 H  HG22  . ILE A 1 367 ? 28.114 13.513  6.094   1.00 27.53  ? 1237 ILE A HG22  1 
ATOM   5022 H  HG23  . ILE A 1 367 ? 27.993 14.668  7.154   1.00 27.53  ? 1237 ILE A HG23  1 
ATOM   5023 H  HD11  . ILE A 1 367 ? 31.564 15.107  8.986   1.00 21.90  ? 1237 ILE A HD11  1 
ATOM   5024 H  HD12  . ILE A 1 367 ? 31.699 14.037  7.841   1.00 21.90  ? 1237 ILE A HD12  1 
ATOM   5025 H  HD13  . ILE A 1 367 ? 30.762 15.285  7.645   1.00 21.90  ? 1237 ILE A HD13  1 
ATOM   5026 N  N     . ALA A 1 368 ? 28.707 10.065  8.796   1.00 20.49  ? 1238 ALA A N     1 
ATOM   5027 C  CA    . ALA A 1 368 ? 29.082 8.906   9.588   1.00 20.56  ? 1238 ALA A CA    1 
ATOM   5028 C  C     . ALA A 1 368 ? 29.740 7.850   8.724   1.00 17.79  ? 1238 ALA A C     1 
ATOM   5029 O  O     . ALA A 1 368 ? 29.493 7.771   7.522   1.00 20.27  ? 1238 ALA A O     1 
ATOM   5030 C  CB    . ALA A 1 368 ? 27.854 8.328   10.291  1.00 18.63  ? 1238 ALA A CB    1 
ATOM   5031 H  H     . ALA A 1 368 ? 28.638 9.918   7.951   1.00 24.53  ? 1238 ALA A H     1 
ATOM   5032 H  HA    . ALA A 1 368 ? 29.725 9.182   10.275  1.00 24.61  ? 1238 ALA A HA    1 
ATOM   5033 H  HB1   . ALA A 1 368 ? 28.121 7.565   10.809  1.00 22.31  ? 1238 ALA A HB1   1 
ATOM   5034 H  HB2   . ALA A 1 368 ? 27.478 8.999   10.865  1.00 22.31  ? 1238 ALA A HB2   1 
ATOM   5035 H  HB3   . ALA A 1 368 ? 27.210 8.066   9.628   1.00 22.31  ? 1238 ALA A HB3   1 
ATOM   5036 N  N     . TRP A 1 369 ? 30.586 7.049   9.356   1.00 18.56  ? 1239 TRP A N     1 
ATOM   5037 C  CA    . TRP A 1 369 ? 31.255 5.939   8.698   1.00 20.32  ? 1239 TRP A CA    1 
ATOM   5038 C  C     . TRP A 1 369 ? 31.740 4.999   9.794   1.00 18.70  ? 1239 TRP A C     1 
ATOM   5039 O  O     . TRP A 1 369 ? 31.567 5.279   10.976  1.00 20.57  ? 1239 TRP A O     1 
ATOM   5040 C  CB    . TRP A 1 369 ? 32.423 6.437   7.847   1.00 19.46  ? 1239 TRP A CB    1 
ATOM   5041 C  CG    . TRP A 1 369 ? 33.413 7.268   8.610   1.00 21.03  ? 1239 TRP A CG    1 
ATOM   5042 C  CD1   . TRP A 1 369 ? 34.548 6.830   9.219   1.00 18.30  ? 1239 TRP A CD1   1 
ATOM   5043 C  CD2   . TRP A 1 369 ? 33.354 8.684   8.839   1.00 22.28  ? 1239 TRP A CD2   1 
ATOM   5044 N  NE1   . TRP A 1 369 ? 35.203 7.881   9.817   1.00 22.80  ? 1239 TRP A NE1   1 
ATOM   5045 C  CE2   . TRP A 1 369 ? 34.489 9.031   9.600   1.00 22.52  ? 1239 TRP A CE2   1 
ATOM   5046 C  CE3   . TRP A 1 369 ? 32.451 9.690   8.478   1.00 19.13  ? 1239 TRP A CE3   1 
ATOM   5047 C  CZ2   . TRP A 1 369 ? 34.749 10.340  10.005  1.00 21.49  ? 1239 TRP A CZ2   1 
ATOM   5048 C  CZ3   . TRP A 1 369 ? 32.708 10.994  8.886   1.00 18.43  ? 1239 TRP A CZ3   1 
ATOM   5049 C  CH2   . TRP A 1 369 ? 33.848 11.304  9.642   1.00 26.24  ? 1239 TRP A CH2   1 
ATOM   5050 H  H     . TRP A 1 369 ? 30.794 7.131   10.186  1.00 22.21  ? 1239 TRP A H     1 
ATOM   5051 H  HA    . TRP A 1 369 ? 30.622 5.460   8.123   1.00 24.33  ? 1239 TRP A HA    1 
ATOM   5052 H  HB2   . TRP A 1 369 ? 32.895 5.671   7.485   1.00 23.30  ? 1239 TRP A HB2   1 
ATOM   5053 H  HB3   . TRP A 1 369 ? 32.074 6.980   7.124   1.00 23.30  ? 1239 TRP A HB3   1 
ATOM   5054 H  HD1   . TRP A 1 369 ? 34.840 5.947   9.229   1.00 21.90  ? 1239 TRP A HD1   1 
ATOM   5055 H  HE1   . TRP A 1 369 ? 35.940 7.826   10.256  1.00 27.30  ? 1239 TRP A HE1   1 
ATOM   5056 H  HE3   . TRP A 1 369 ? 31.692 9.489   7.979   1.00 22.90  ? 1239 TRP A HE3   1 
ATOM   5057 H  HZ2   . TRP A 1 369 ? 35.504 10.549  10.507  1.00 25.73  ? 1239 TRP A HZ2   1 
ATOM   5058 H  HZ3   . TRP A 1 369 ? 32.116 11.672  8.653   1.00 22.06  ? 1239 TRP A HZ3   1 
ATOM   5059 H  HH2   . TRP A 1 369 ? 33.998 12.185  9.898   1.00 31.43  ? 1239 TRP A HH2   1 
ATOM   5060 N  N     . ASN A 1 370 ? 32.332 3.878   9.411   1.00 19.41  ? 1240 ASN A N     1 
ATOM   5061 C  CA    . ASN A 1 370 ? 32.838 2.933   10.396  1.00 17.42  ? 1240 ASN A CA    1 
ATOM   5062 C  C     . ASN A 1 370 ? 34.358 2.918   10.426  1.00 19.70  ? 1240 ASN A C     1 
ATOM   5063 O  O     . ASN A 1 370 ? 35.011 3.336   9.473   1.00 21.44  ? 1240 ASN A O     1 
ATOM   5064 C  CB    . ASN A 1 370 ? 32.305 1.530   10.101  1.00 16.45  ? 1240 ASN A CB    1 
ATOM   5065 C  CG    . ASN A 1 370 ? 30.793 1.445   10.220  1.00 21.31  ? 1240 ASN A CG    1 
ATOM   5066 O  OD1   . ASN A 1 370 ? 30.071 1.569   9.231   1.00 24.41  ? 1240 ASN A OD1   1 
ATOM   5067 N  ND2   . ASN A 1 370 ? 30.306 1.242   11.441  1.00 21.37  ? 1240 ASN A ND2   1 
ATOM   5068 H  H     . ASN A 1 370 ? 32.453 3.640   8.594   1.00 23.24  ? 1240 ASN A H     1 
ATOM   5069 H  HA    . ASN A 1 370 ? 32.520 3.198   11.285  1.00 20.85  ? 1240 ASN A HA    1 
ATOM   5070 H  HB2   . ASN A 1 370 ? 32.549 1.282   9.195   1.00 19.68  ? 1240 ASN A HB2   1 
ATOM   5071 H  HB3   . ASN A 1 370 ? 32.692 0.904   10.732  1.00 19.68  ? 1240 ASN A HB3   1 
ATOM   5072 H  HD21  . ASN A 1 370 ? 29.456 1.186   11.561  1.00 25.58  ? 1240 ASN A HD21  1 
ATOM   5073 H  HD22  . ASN A 1 370 ? 30.841 1.165   12.110  1.00 25.58  ? 1240 ASN A HD22  1 
ATOM   5074 N  N     . VAL A 1 371 ? 34.915 2.456   11.537  1.00 19.85  ? 1241 VAL A N     1 
ATOM   5075 C  CA    . VAL A 1 371 ? 36.340 2.165   11.607  1.00 19.15  ? 1241 VAL A CA    1 
ATOM   5076 C  C     . VAL A 1 371 ? 36.499 0.879   12.401  1.00 18.51  ? 1241 VAL A C     1 
ATOM   5077 O  O     . VAL A 1 371 ? 35.649 0.541   13.225  1.00 20.98  ? 1241 VAL A O     1 
ATOM   5078 C  CB    . VAL A 1 371 ? 37.145 3.300   12.285  1.00 23.74  ? 1241 VAL A CB    1 
ATOM   5079 C  CG1   . VAL A 1 371 ? 36.908 4.633   11.564  1.00 23.03  ? 1241 VAL A CG1   1 
ATOM   5080 C  CG2   . VAL A 1 371 ? 36.786 3.421   13.754  1.00 30.59  ? 1241 VAL A CG2   1 
ATOM   5081 H  H     . VAL A 1 371 ? 34.488 2.302   12.268  1.00 23.76  ? 1241 VAL A H     1 
ATOM   5082 H  HA    . VAL A 1 371 ? 36.693 2.024   10.704  1.00 22.92  ? 1241 VAL A HA    1 
ATOM   5083 H  HB    . VAL A 1 371 ? 38.101 3.091   12.225  1.00 28.43  ? 1241 VAL A HB    1 
ATOM   5084 H  HG11  . VAL A 1 371 ? 37.417 5.320   12.002  1.00 27.58  ? 1241 VAL A HG11  1 
ATOM   5085 H  HG12  . VAL A 1 371 ? 37.190 4.548   10.651  1.00 27.58  ? 1241 VAL A HG12  1 
ATOM   5086 H  HG13  . VAL A 1 371 ? 35.973 4.846   11.600  1.00 27.58  ? 1241 VAL A HG13  1 
ATOM   5087 H  HG21  . VAL A 1 371 ? 37.300 4.131   14.144  1.00 36.66  ? 1241 VAL A HG21  1 
ATOM   5088 H  HG22  . VAL A 1 371 ? 35.848 3.615   13.831  1.00 36.66  ? 1241 VAL A HG22  1 
ATOM   5089 H  HG23  . VAL A 1 371 ? 36.986 2.591   14.193  1.00 36.66  ? 1241 VAL A HG23  1 
ATOM   5090 N  N     . GLY A 1 372 ? 37.572 0.150   12.130  1.00 25.05  ? 1242 GLY A N     1 
ATOM   5091 C  CA    . GLY A 1 372 ? 37.912 -1.022  12.909  1.00 21.42  ? 1242 GLY A CA    1 
ATOM   5092 C  C     . GLY A 1 372 ? 39.293 -0.851  13.501  1.00 20.90  ? 1242 GLY A C     1 
ATOM   5093 O  O     . GLY A 1 372 ? 40.290 -0.993  12.803  1.00 22.94  ? 1242 GLY A O     1 
ATOM   5094 H  H     . GLY A 1 372 ? 38.124 0.318   11.492  1.00 30.01  ? 1242 GLY A H     1 
ATOM   5095 H  HA2   . GLY A 1 372 ? 37.272 -1.140  13.629  1.00 25.65  ? 1242 GLY A HA2   1 
ATOM   5096 H  HA3   . GLY A 1 372 ? 37.904 -1.811  12.345  1.00 25.65  ? 1242 GLY A HA3   1 
ATOM   5097 N  N     . PRO A 1 373 ? 39.366 -0.519  14.792  1.00 22.73  ? 1243 PRO A N     1 
ATOM   5098 C  CA    . PRO A 1 373 ? 40.683 -0.455  15.428  1.00 27.59  ? 1243 PRO A CA    1 
ATOM   5099 C  C     . PRO A 1 373 ? 41.420 -1.775  15.270  1.00 25.81  ? 1243 PRO A C     1 
ATOM   5100 O  O     . PRO A 1 373 ? 40.784 -2.827  15.255  1.00 25.10  ? 1243 PRO A O     1 
ATOM   5101 C  CB    . PRO A 1 373 ? 40.348 -0.204  16.897  1.00 31.02  ? 1243 PRO A CB    1 
ATOM   5102 C  CG    . PRO A 1 373 ? 39.037 0.509   16.865  1.00 26.00  ? 1243 PRO A CG    1 
ATOM   5103 C  CD    . PRO A 1 373 ? 38.292 -0.023  15.669  1.00 23.85  ? 1243 PRO A CD    1 
ATOM   5104 H  HA    . PRO A 1 373 ? 41.219 0.283   15.069  1.00 33.06  ? 1243 PRO A HA    1 
ATOM   5105 H  HB2   . PRO A 1 373 ? 40.269 -1.050  17.365  1.00 37.17  ? 1243 PRO A HB2   1 
ATOM   5106 H  HB3   . PRO A 1 373 ? 41.033 0.352   17.300  1.00 37.17  ? 1243 PRO A HB3   1 
ATOM   5107 H  HG2   . PRO A 1 373 ? 38.547 0.322   17.681  1.00 31.15  ? 1243 PRO A HG2   1 
ATOM   5108 H  HG3   . PRO A 1 373 ? 39.190 1.463   16.772  1.00 31.15  ? 1243 PRO A HG3   1 
ATOM   5109 H  HD2   . PRO A 1 373 ? 37.706 -0.750  15.931  1.00 28.56  ? 1243 PRO A HD2   1 
ATOM   5110 H  HD3   . PRO A 1 373 ? 37.800 0.690   15.231  1.00 28.56  ? 1243 PRO A HD3   1 
ATOM   5111 N  N     . LEU A 1 374 ? 42.740 -1.718  15.150  1.00 24.21  ? 1244 LEU A N     1 
ATOM   5112 C  CA    . LEU A 1 374 ? 43.545 -2.920  15.016  1.00 28.91  ? 1244 LEU A CA    1 
ATOM   5113 C  C     . LEU A 1 374 ? 43.747 -3.541  16.391  1.00 25.94  ? 1244 LEU A C     1 
ATOM   5114 O  O     . LEU A 1 374 ? 44.829 -3.453  16.970  1.00 29.46  ? 1244 LEU A O     1 
ATOM   5115 C  CB    . LEU A 1 374 ? 44.896 -2.582  14.381  1.00 29.37  ? 1244 LEU A CB    1 
ATOM   5116 C  CG    . LEU A 1 374 ? 45.865 -3.747  14.163  1.00 42.00  ? 1244 LEU A CG    1 
ATOM   5117 C  CD1   . LEU A 1 374 ? 45.343 -4.675  13.074  1.00 39.10  ? 1244 LEU A CD1   1 
ATOM   5118 C  CD2   . LEU A 1 374 ? 47.256 -3.232  13.816  1.00 38.55  ? 1244 LEU A CD2   1 
ATOM   5119 H  H     . LEU A 1 374 ? 43.196 -0.988  15.143  1.00 29.00  ? 1244 LEU A H     1 
ATOM   5120 H  HA    . LEU A 1 374 ? 43.081 -3.567  14.444  1.00 34.64  ? 1244 LEU A HA    1 
ATOM   5121 H  HB2   . LEU A 1 374 ? 44.730 -2.181  13.513  1.00 35.19  ? 1244 LEU A HB2   1 
ATOM   5122 H  HB3   . LEU A 1 374 ? 45.345 -1.938  14.951  1.00 35.19  ? 1244 LEU A HB3   1 
ATOM   5123 H  HG    . LEU A 1 374 ? 45.932 -4.258  14.984  1.00 50.35  ? 1244 LEU A HG    1 
ATOM   5124 H  HD11  . LEU A 1 374 ? 45.965 -5.396  12.954  1.00 46.87  ? 1244 LEU A HD11  1 
ATOM   5125 H  HD12  . LEU A 1 374 ? 44.488 -5.020  13.341  1.00 46.87  ? 1244 LEU A HD12  1 
ATOM   5126 H  HD13  . LEU A 1 374 ? 45.255 -4.178  12.257  1.00 46.87  ? 1244 LEU A HD13  1 
ATOM   5127 H  HD21  . LEU A 1 374 ? 47.842 -3.980  13.685  1.00 46.20  ? 1244 LEU A HD21  1 
ATOM   5128 H  HD22  . LEU A 1 374 ? 47.204 -2.711  13.011  1.00 46.20  ? 1244 LEU A HD22  1 
ATOM   5129 H  HD23  . LEU A 1 374 ? 47.576 -2.687  14.539  1.00 46.20  ? 1244 LEU A HD23  1 
ATOM   5130 N  N     . THR A 1 375 ? 42.702 -4.169  16.914  1.00 25.13  ? 1245 THR A N     1 
ATOM   5131 C  CA    . THR A 1 375 ? 42.756 -4.740  18.251  1.00 29.31  ? 1245 THR A CA    1 
ATOM   5132 C  C     . THR A 1 375 ? 42.102 -6.110  18.287  1.00 33.02  ? 1245 THR A C     1 
ATOM   5133 O  O     . THR A 1 375 ? 41.197 -6.401  17.505  1.00 22.23  ? 1245 THR A O     1 
ATOM   5134 C  CB    . THR A 1 375 ? 42.019 -3.861  19.270  1.00 28.58  ? 1245 THR A CB    1 
ATOM   5135 O  OG1   . THR A 1 375 ? 40.620 -3.843  18.960  1.00 25.14  ? 1245 THR A OG1   1 
ATOM   5136 C  CG2   . THR A 1 375 ? 42.560 -2.440  19.255  1.00 28.51  ? 1245 THR A CG2   1 
ATOM   5137 H  H     . THR A 1 375 ? 41.948 -4.278  16.514  1.00 30.10  ? 1245 THR A H     1 
ATOM   5138 H  HA    . THR A 1 375 ? 43.690 -4.831  18.533  1.00 35.12  ? 1245 THR A HA    1 
ATOM   5139 H  HB    . THR A 1 375 ? 42.146 -4.226  20.159  1.00 34.25  ? 1245 THR A HB    1 
ATOM   5140 H  HG1   . THR A 1 375 ? 40.219 -3.375  19.500  1.00 30.11  ? 1245 THR A HG1   1 
ATOM   5141 H  HG21  . THR A 1 375 ? 42.089 -1.903  19.897  1.00 34.15  ? 1245 THR A HG21  1 
ATOM   5142 H  HG22  . THR A 1 375 ? 43.494 -2.443  19.476  1.00 34.15  ? 1245 THR A HG22  1 
ATOM   5143 H  HG23  . THR A 1 375 ? 42.447 -2.055  18.383  1.00 34.15  ? 1245 THR A HG23  1 
ATOM   5144 N  N     . ALA A 1 376 ? 42.555 -6.939  19.219  1.00 25.63  ? 1246 ALA A N     1 
ATOM   5145 C  CA    . ALA A 1 376 ? 41.960 -8.245  19.439  1.00 26.47  ? 1246 ALA A CA    1 
ATOM   5146 C  C     . ALA A 1 376 ? 40.464 -8.112  19.694  1.00 20.93  ? 1246 ALA A C     1 
ATOM   5147 O  O     . ALA A 1 376 ? 39.674 -8.903  19.195  1.00 28.23  ? 1246 ALA A O     1 
ATOM   5148 C  CB    . ALA A 1 376 ? 42.634 -8.936  20.613  1.00 29.06  ? 1246 ALA A CB    1 
ATOM   5149 H  H     . ALA A 1 376 ? 43.215 -6.763  19.742  1.00 30.70  ? 1246 ALA A H     1 
ATOM   5150 H  HA    . ALA A 1 376 ? 42.089 -8.799  18.640  1.00 31.70  ? 1246 ALA A HA    1 
ATOM   5151 H  HB1   . ALA A 1 376 ? 42.229 -9.797  20.744  1.00 34.82  ? 1246 ALA A HB1   1 
ATOM   5152 H  HB2   . ALA A 1 376 ? 43.569 -9.040  20.420  1.00 34.82  ? 1246 ALA A HB2   1 
ATOM   5153 H  HB3   . ALA A 1 376 ? 42.520 -8.397  21.400  1.00 34.82  ? 1246 ALA A HB3   1 
ATOM   5154 N  N     A CYS A 1 377 ? 40.074 -7.105  20.467  0.44 25.87  ? 1247 CYS A N     1 
ATOM   5155 N  N     B CYS A 1 377 ? 40.081 -7.105  20.475  0.56 22.70  ? 1247 CYS A N     1 
ATOM   5156 C  CA    A CYS A 1 377 ? 38.669 -6.941  20.827  0.44 27.67  ? 1247 CYS A CA    1 
ATOM   5157 C  CA    B CYS A 1 377 ? 38.678 -6.897  20.836  0.56 28.01  ? 1247 CYS A CA    1 
ATOM   5158 C  C     A CYS A 1 377 ? 37.791 -6.711  19.597  0.44 28.42  ? 1247 CYS A C     1 
ATOM   5159 C  C     B CYS A 1 377 ? 37.794 -6.699  19.607  0.56 28.27  ? 1247 CYS A C     1 
ATOM   5160 O  O     A CYS A 1 377 ? 36.754 -7.352  19.450  0.44 25.10  ? 1247 CYS A O     1 
ATOM   5161 O  O     B CYS A 1 377 ? 36.758 -7.343  19.473  0.56 22.76  ? 1247 CYS A O     1 
ATOM   5162 C  CB    A CYS A 1 377 ? 38.494 -5.786  21.813  0.44 35.24  ? 1247 CYS A CB    1 
ATOM   5163 C  CB    B CYS A 1 377 ? 38.534 -5.687  21.764  0.56 34.18  ? 1247 CYS A CB    1 
ATOM   5164 S  SG    A CYS A 1 377 ? 36.815 -5.644  22.507  0.44 41.79  ? 1247 CYS A SG    1 
ATOM   5165 S  SG    B CYS A 1 377 ? 39.305 -5.893  23.393  0.56 47.11  ? 1247 CYS A SG    1 
ATOM   5166 H  H     A CYS A 1 377 ? 40.598 -6.507  20.794  0.44 30.99  ? 1247 CYS A H     1 
ATOM   5167 H  H     B CYS A 1 377 ? 40.617 -6.524  20.813  0.56 27.19  ? 1247 CYS A H     1 
ATOM   5168 H  HA    A CYS A 1 377 ? 38.359 -7.760  21.267  0.44 33.14  ? 1247 CYS A HA    1 
ATOM   5169 H  HA    B CYS A 1 377 ? 38.353 -7.687  21.317  0.56 33.56  ? 1247 CYS A HA    1 
ATOM   5170 H  HB2   A CYS A 1 377 ? 39.109 -5.912  22.552  0.44 42.23  ? 1247 CYS A HB2   1 
ATOM   5171 H  HB2   B CYS A 1 377 ? 38.946 -4.919  21.338  0.56 40.96  ? 1247 CYS A HB2   1 
ATOM   5172 H  HB3   A CYS A 1 377 ? 38.696 -4.954  21.357  0.44 42.23  ? 1247 CYS A HB3   1 
ATOM   5173 H  HB3   B CYS A 1 377 ? 37.590 -5.515  21.905  0.56 40.96  ? 1247 CYS A HB3   1 
ATOM   5174 H  HG    A CYS A 1 377 ? 36.547 -6.656  23.092  0.44 50.09  ? 1247 CYS A HG    1 
ATOM   5175 H  HG    B CYS A 1 377 ? 38.799 -6.828  23.949  0.56 56.48  ? 1247 CYS A HG    1 
ATOM   5176 N  N     . GLN A 1 378 ? 38.205 -5.802  18.717  1.00 23.68  ? 1248 GLN A N     1 
ATOM   5177 C  CA    . GLN A 1 378 ? 37.431 -5.505  17.512  1.00 26.70  ? 1248 GLN A CA    1 
ATOM   5178 C  C     . GLN A 1 378 ? 37.362 -6.716  16.580  1.00 24.47  ? 1248 GLN A C     1 
ATOM   5179 O  O     . GLN A 1 378 ? 36.302 -7.056  16.061  1.00 21.25  ? 1248 GLN A O     1 
ATOM   5180 C  CB    . GLN A 1 378 ? 38.034 -4.316  16.763  1.00 25.88  ? 1248 GLN A CB    1 
ATOM   5181 C  CG    . GLN A 1 378 ? 37.398 -4.046  15.397  1.00 18.99  ? 1248 GLN A CG    1 
ATOM   5182 C  CD    . GLN A 1 378 ? 35.970 -3.528  15.492  1.00 27.45  ? 1248 GLN A CD    1 
ATOM   5183 O  OE1   . GLN A 1 378 ? 35.723 -2.327  15.368  1.00 22.85  ? 1248 GLN A OE1   1 
ATOM   5184 N  NE2   . GLN A 1 378 ? 35.023 -4.433  15.700  1.00 20.15  ? 1248 GLN A NE2   1 
ATOM   5185 H  H     A GLN A 1 378 ? 38.929 -5.344  18.793  0.50 28.36  ? 1248 GLN A H     1 
ATOM   5186 H  H     B GLN A 1 378 ? 38.933 -5.349  18.786  0.50 28.36  ? 1248 GLN A H     1 
ATOM   5187 H  HA    . GLN A 1 378 ? 36.516 -5.268  17.771  1.00 31.98  ? 1248 GLN A HA    1 
ATOM   5188 H  HB2   . GLN A 1 378 ? 37.922 -3.518  17.304  1.00 31.01  ? 1248 GLN A HB2   1 
ATOM   5189 H  HB3   . GLN A 1 378 ? 38.979 -4.484  16.621  1.00 31.01  ? 1248 GLN A HB3   1 
ATOM   5190 H  HG2   . GLN A 1 378 ? 37.927 -3.381  14.930  1.00 22.73  ? 1248 GLN A HG2   1 
ATOM   5191 H  HG3   . GLN A 1 378 ? 37.383 -4.872  14.889  1.00 22.73  ? 1248 GLN A HG3   1 
ATOM   5192 H  HE21  . GLN A 1 378 ? 34.201 -4.189  15.761  1.00 24.12  ? 1248 GLN A HE21  1 
ATOM   5193 H  HE22  . GLN A 1 378 ? 35.232 -5.264  15.775  1.00 24.12  ? 1248 GLN A HE22  1 
ATOM   5194 N  N     . TYR A 1 379 ? 38.497 -7.364  16.360  1.00 22.37  ? 1249 TYR A N     1 
ATOM   5195 C  CA    . TYR A 1 379 ? 38.543 -8.487  15.433  1.00 22.23  ? 1249 TYR A CA    1 
ATOM   5196 C  C     . TYR A 1 379 ? 37.668 -9.625  15.958  1.00 25.13  ? 1249 TYR A C     1 
ATOM   5197 O  O     . TYR A 1 379 ? 36.915 -10.244 15.209  1.00 22.58  ? 1249 TYR A O     1 
ATOM   5198 C  CB    . TYR A 1 379 ? 39.986 -8.955  15.225  1.00 20.60  ? 1249 TYR A CB    1 
ATOM   5199 C  CG    . TYR A 1 379 ? 40.121 -10.061 14.202  1.00 23.00  ? 1249 TYR A CG    1 
ATOM   5200 C  CD1   . TYR A 1 379 ? 40.076 -9.786  12.838  1.00 22.14  ? 1249 TYR A CD1   1 
ATOM   5201 C  CD2   . TYR A 1 379 ? 40.283 -11.381 14.599  1.00 23.84  ? 1249 TYR A CD2   1 
ATOM   5202 C  CE1   . TYR A 1 379 ? 40.197 -10.799 11.899  1.00 22.56  ? 1249 TYR A CE1   1 
ATOM   5203 C  CE2   . TYR A 1 379 ? 40.404 -12.398 13.670  1.00 24.84  ? 1249 TYR A CE2   1 
ATOM   5204 C  CZ    . TYR A 1 379 ? 40.357 -12.104 12.325  1.00 21.76  ? 1249 TYR A CZ    1 
ATOM   5205 O  OH    . TYR A 1 379 ? 40.478 -13.123 11.408  1.00 22.26  ? 1249 TYR A OH    1 
ATOM   5206 H  H     . TYR A 1 379 ? 39.250 -7.176  16.731  1.00 26.78  ? 1249 TYR A H     1 
ATOM   5207 H  HA    . TYR A 1 379 ? 38.186 -8.203  14.566  1.00 26.62  ? 1249 TYR A HA    1 
ATOM   5208 H  HB2   . TYR A 1 379 ? 40.519 -8.203  14.922  1.00 24.66  ? 1249 TYR A HB2   1 
ATOM   5209 H  HB3   . TYR A 1 379 ? 40.333 -9.286  16.068  1.00 24.66  ? 1249 TYR A HB3   1 
ATOM   5210 H  HD1   . TYR A 1 379 ? 39.967 -8.907  12.552  1.00 26.51  ? 1249 TYR A HD1   1 
ATOM   5211 H  HD2   . TYR A 1 379 ? 40.313 -11.584 15.506  1.00 28.55  ? 1249 TYR A HD2   1 
ATOM   5212 H  HE1   . TYR A 1 379 ? 40.166 -10.602 10.991  1.00 27.02  ? 1249 TYR A HE1   1 
ATOM   5213 H  HE2   . TYR A 1 379 ? 40.512 -13.277 13.953  1.00 29.75  ? 1249 TYR A HE2   1 
ATOM   5214 H  HH    . TYR A 1 379 ? 41.133 -12.995 10.932  1.00 26.66  ? 1249 TYR A HH    1 
ATOM   5215 N  N     . LYS A 1 380 ? 37.752 -9.874  17.259  1.00 22.96  ? 1250 LYS A N     1 
ATOM   5216 C  CA    . LYS A 1 380 ? 36.995 -10.950 17.888  1.00 21.56  ? 1250 LYS A CA    1 
ATOM   5217 C  C     . LYS A 1 380 ? 35.494 -10.728 17.725  1.00 27.09  ? 1250 LYS A C     1 
ATOM   5218 O  O     . LYS A 1 380 ? 34.763 -11.632 17.336  1.00 25.68  ? 1250 LYS A O     1 
ATOM   5219 C  CB    . LYS A 1 380 ? 37.356 -11.041 19.370  1.00 25.83  ? 1250 LYS A CB    1 
ATOM   5220 C  CG    . LYS A 1 380 ? 36.535 -12.037 20.164  1.00 30.87  ? 1250 LYS A CG    1 
ATOM   5221 C  CD    . LYS A 1 380 ? 37.098 -12.175 21.570  1.00 30.92  ? 1250 LYS A CD    1 
ATOM   5222 C  CE    . LYS A 1 380 ? 36.345 -13.208 22.387  1.00 49.81  ? 1250 LYS A CE    1 
ATOM   5223 N  NZ    . LYS A 1 380 ? 37.128 -13.622 23.584  1.00 64.52  ? 1250 LYS A NZ    1 
ATOM   5224 H  H     . LYS A 1 380 ? 38.245 -9.430  17.806  1.00 27.49  ? 1250 LYS A H     1 
ATOM   5225 H  HA    . LYS A 1 380 ? 37.227 -11.802 17.462  1.00 25.82  ? 1250 LYS A HA    1 
ATOM   5226 H  HB2   . LYS A 1 380 ? 38.287 -11.302 19.446  1.00 30.94  ? 1250 LYS A HB2   1 
ATOM   5227 H  HB3   . LYS A 1 380 ? 37.228 -10.168 19.774  1.00 30.94  ? 1250 LYS A HB3   1 
ATOM   5228 H  HG2   . LYS A 1 380 ? 35.619 -11.725 20.227  1.00 36.99  ? 1250 LYS A HG2   1 
ATOM   5229 H  HG3   . LYS A 1 380 ? 36.570 -12.904 19.731  1.00 36.99  ? 1250 LYS A HG3   1 
ATOM   5230 H  HD2   . LYS A 1 380 ? 38.026 -12.450 21.515  1.00 37.05  ? 1250 LYS A HD2   1 
ATOM   5231 H  HD3   . LYS A 1 380 ? 37.029 -11.321 22.025  1.00 37.05  ? 1250 LYS A HD3   1 
ATOM   5232 H  HE2   . LYS A 1 380 ? 35.504 -12.829 22.689  1.00 59.72  ? 1250 LYS A HE2   1 
ATOM   5233 H  HE3   . LYS A 1 380 ? 36.184 -13.994 21.842  1.00 59.72  ? 1250 LYS A HE3   1 
ATOM   5234 H  HZ1   . LYS A 1 380 ? 36.672 -14.228 24.051  1.00 77.36  ? 1250 LYS A HZ1   1 
ATOM   5235 H  HZ2   . LYS A 1 380 ? 37.905 -13.976 23.332  1.00 77.36  ? 1250 LYS A HZ2   1 
ATOM   5236 H  HZ3   . LYS A 1 380 ? 37.287 -12.917 24.102  1.00 77.36  ? 1250 LYS A HZ3   1 
ATOM   5237 N  N     . LEU A 1 381 ? 35.042 -9.514  18.021  1.00 20.04  ? 1251 LEU A N     1 
ATOM   5238 C  CA    . LEU A 1 381 ? 33.632 -9.172  17.899  1.00 18.22  ? 1251 LEU A CA    1 
ATOM   5239 C  C     . LEU A 1 381 ? 33.151 -9.240  16.446  1.00 25.79  ? 1251 LEU A C     1 
ATOM   5240 O  O     . LEU A 1 381 ? 32.018 -9.643  16.180  1.00 23.57  ? 1251 LEU A O     1 
ATOM   5241 C  CB    . LEU A 1 381 ? 33.376 -7.779  18.484  1.00 20.89  ? 1251 LEU A CB    1 
ATOM   5242 C  CG    . LEU A 1 381 ? 33.291 -7.745  20.015  1.00 33.35  ? 1251 LEU A CG    1 
ATOM   5243 C  CD1   . LEU A 1 381 ? 33.353 -6.317  20.552  1.00 28.85  ? 1251 LEU A CD1   1 
ATOM   5244 C  CD2   . LEU A 1 381 ? 32.022 -8.447  20.490  1.00 33.45  ? 1251 LEU A CD2   1 
ATOM   5245 H  H     . LEU A 1 381 ? 35.537 -8.867  18.297  1.00 23.99  ? 1251 LEU A H     1 
ATOM   5246 H  HA    . LEU A 1 381 ? 33.105 -9.816  18.418  1.00 21.81  ? 1251 LEU A HA    1 
ATOM   5247 H  HB2   . LEU A 1 381 ? 34.100 -7.191  18.215  1.00 25.01  ? 1251 LEU A HB2   1 
ATOM   5248 H  HB3   . LEU A 1 381 ? 32.535 -7.444  18.134  1.00 25.01  ? 1251 LEU A HB3   1 
ATOM   5249 H  HG    . LEU A 1 381 ? 34.049 -8.229  20.378  1.00 39.96  ? 1251 LEU A HG    1 
ATOM   5250 H  HD11  . LEU A 1 381 ? 34.184 -5.918  20.282  1.00 34.57  ? 1251 LEU A HD11  1 
ATOM   5251 H  HD12  . LEU A 1 381 ? 32.617 -5.816  20.193  1.00 34.57  ? 1251 LEU A HD12  1 
ATOM   5252 H  HD13  . LEU A 1 381 ? 33.297 -6.341  21.510  1.00 34.57  ? 1251 LEU A HD13  1 
ATOM   5253 H  HD21  . LEU A 1 381 ? 31.988 -8.415  21.449  1.00 40.09  ? 1251 LEU A HD21  1 
ATOM   5254 H  HD22  . LEU A 1 381 ? 31.259 -7.997  20.120  1.00 40.09  ? 1251 LEU A HD22  1 
ATOM   5255 H  HD23  . LEU A 1 381 ? 32.041 -9.360  20.193  1.00 40.09  ? 1251 LEU A HD23  1 
ATOM   5256 N  N     . ALA A 1 382 ? 34.013 -8.853  15.509  1.00 20.17  ? 1252 ALA A N     1 
ATOM   5257 C  CA    . ALA A 1 382 ? 33.662 -8.878  14.093  1.00 20.90  ? 1252 ALA A CA    1 
ATOM   5258 C  C     . ALA A 1 382 ? 33.509 -10.314 13.603  1.00 21.91  ? 1252 ALA A C     1 
ATOM   5259 O  O     . ALA A 1 382 ? 32.605 -10.622 12.831  1.00 24.46  ? 1252 ALA A O     1 
ATOM   5260 C  CB    . ALA A 1 382 ? 34.716 -8.138  13.259  1.00 21.81  ? 1252 ALA A CB    1 
ATOM   5261 H  H     . ALA A 1 382 ? 34.809 -8.571  15.669  1.00 24.14  ? 1252 ALA A H     1 
ATOM   5262 H  HA    . ALA A 1 382 ? 32.803 -8.422  13.969  1.00 25.03  ? 1252 ALA A HA    1 
ATOM   5263 H  HB1   . ALA A 1 382 ? 34.461 -8.170  12.334  1.00 26.12  ? 1252 ALA A HB1   1 
ATOM   5264 H  HB2   . ALA A 1 382 ? 34.764 -7.226  13.555  1.00 26.12  ? 1252 ALA A HB2   1 
ATOM   5265 H  HB3   . ALA A 1 382 ? 35.566 -8.567  13.380  1.00 26.12  ? 1252 ALA A HB3   1 
ATOM   5266 N  N     . VAL A 1 383 ? 34.395 -11.191 14.058  1.00 21.46  ? 1253 VAL A N     1 
ATOM   5267 C  CA    . VAL A 1 383 ? 34.342 -12.592 13.664  1.00 20.74  ? 1253 VAL A CA    1 
ATOM   5268 C  C     . VAL A 1 383 ? 33.127 -13.272 14.289  1.00 23.66  ? 1253 VAL A C     1 
ATOM   5269 O  O     . VAL A 1 383 ? 32.454 -14.068 13.636  1.00 24.80  ? 1253 VAL A O     1 
ATOM   5270 C  CB    . VAL A 1 383 ? 35.642 -13.334 14.048  1.00 26.15  ? 1253 VAL A CB    1 
ATOM   5271 C  CG1   . VAL A 1 383 ? 35.465 -14.846 13.930  1.00 29.61  ? 1253 VAL A CG1   1 
ATOM   5272 C  CG2   . VAL A 1 383 ? 36.796 -12.855 13.169  1.00 27.25  ? 1253 VAL A CG2   1 
ATOM   5273 H  H     . VAL A 1 383 ? 35.038 -10.999 14.596  1.00 25.69  ? 1253 VAL A H     1 
ATOM   5274 H  HA    . VAL A 1 383 ? 34.246 -12.643 12.690  1.00 24.84  ? 1253 VAL A HA    1 
ATOM   5275 H  HB    . VAL A 1 383 ? 35.865 -13.127 14.979  1.00 31.32  ? 1253 VAL A HB    1 
ATOM   5276 H  HG11  . VAL A 1 383 ? 36.288 -15.276 14.174  1.00 35.48  ? 1253 VAL A HG11  1 
ATOM   5277 H  HG12  . VAL A 1 383 ? 34.762 -15.125 14.520  1.00 35.48  ? 1253 VAL A HG12  1 
ATOM   5278 H  HG13  . VAL A 1 383 ? 35.238 -15.063 13.023  1.00 35.48  ? 1253 VAL A HG13  1 
ATOM   5279 H  HG21  . VAL A 1 383 ? 37.595 -13.325 13.420  1.00 32.65  ? 1253 VAL A HG21  1 
ATOM   5280 H  HG22  . VAL A 1 383 ? 36.584 -13.036 12.251  1.00 32.65  ? 1253 VAL A HG22  1 
ATOM   5281 H  HG23  . VAL A 1 383 ? 36.916 -11.912 13.299  1.00 32.65  ? 1253 VAL A HG23  1 
ATOM   5282 N  N     . GLU A 1 384 ? 32.834 -12.945 15.546  1.00 26.60  ? 1254 GLU A N     1 
ATOM   5283 C  CA    . GLU A 1 384 ? 31.690 -13.539 16.233  1.00 29.27  ? 1254 GLU A CA    1 
ATOM   5284 C  C     . GLU A 1 384 ? 30.393 -13.197 15.511  1.00 33.06  ? 1254 GLU A C     1 
ATOM   5285 O  O     . GLU A 1 384 ? 29.548 -14.065 15.309  1.00 26.17  ? 1254 GLU A O     1 
ATOM   5286 C  CB    . GLU A 1 384 ? 31.613 -13.072 17.690  1.00 26.96  ? 1254 GLU A CB    1 
ATOM   5287 C  CG    . GLU A 1 384 ? 32.650 -13.709 18.599  1.00 36.92  ? 1254 GLU A CG    1 
ATOM   5288 C  CD    . GLU A 1 384 ? 32.657 -13.104 19.994  1.00 59.22  ? 1254 GLU A CD    1 
ATOM   5289 O  OE1   . GLU A 1 384 ? 31.868 -12.168 20.248  1.00 41.33  ? 1254 GLU A OE1   1 
ATOM   5290 O  OE2   . GLU A 1 384 ? 33.452 -13.567 20.838  1.00 41.05  ? 1254 GLU A OE2   1 
ATOM   5291 H  H     . GLU A 1 384 ? 33.280 -12.384 16.021  1.00 31.86  ? 1254 GLU A H     1 
ATOM   5292 H  HA    . GLU A 1 384 ? 31.789 -14.514 16.233  1.00 35.07  ? 1254 GLU A HA    1 
ATOM   5293 H  HB2   . GLU A 1 384 ? 31.746 -12.111 17.717  1.00 32.30  ? 1254 GLU A HB2   1 
ATOM   5294 H  HB3   . GLU A 1 384 ? 30.736 -13.291 18.042  1.00 32.30  ? 1254 GLU A HB3   1 
ATOM   5295 H  HG2   . GLU A 1 384 ? 32.458 -14.656 18.683  1.00 44.25  ? 1254 GLU A HG2   1 
ATOM   5296 H  HG3   . GLU A 1 384 ? 33.530 -13.581 18.212  1.00 44.25  ? 1254 GLU A HG3   1 
ATOM   5297 N  N     . ARG A 1 385 ? 30.238 -11.936 15.118  1.00 21.96  ? 1255 ARG A N     1 
ATOM   5298 C  CA    . ARG A 1 385 ? 29.029 -11.513 14.422  1.00 26.51  ? 1255 ARG A CA    1 
ATOM   5299 C  C     . ARG A 1 385 ? 28.992 -12.136 13.030  1.00 24.12  ? 1255 ARG A C     1 
ATOM   5300 O  O     . ARG A 1 385 ? 27.927 -12.459 12.520  1.00 25.25  ? 1255 ARG A O     1 
ATOM   5301 C  CB    . ARG A 1 385 ? 28.945 -9.981  14.352  1.00 19.60  ? 1255 ARG A CB    1 
ATOM   5302 C  CG    . ARG A 1 385 ? 27.693 -9.430  13.654  1.00 23.18  ? 1255 ARG A CG    1 
ATOM   5303 C  CD    . ARG A 1 385 ? 26.410 -10.165 14.057  1.00 21.52  ? 1255 ARG A CD    1 
ATOM   5304 N  NE    . ARG A 1 385 ? 26.201 -10.205 15.503  1.00 22.76  ? 1255 ARG A NE    1 
ATOM   5305 C  CZ    . ARG A 1 385 ? 25.635 -9.233  16.215  1.00 23.74  ? 1255 ARG A CZ    1 
ATOM   5306 N  NH1   . ARG A 1 385 ? 25.236 -8.118  15.619  1.00 22.92  ? 1255 ARG A NH1   1 
ATOM   5307 N  NH2   . ARG A 1 385 ? 25.484 -9.371  17.528  1.00 22.00  ? 1255 ARG A NH2   1 
ATOM   5308 H  H     . ARG A 1 385 ? 30.814 -11.310 15.241  1.00 26.29  ? 1255 ARG A H     1 
ATOM   5309 H  HA    . ARG A 1 385 ? 28.247 -11.836 14.917  1.00 31.76  ? 1255 ARG A HA    1 
ATOM   5310 H  HB2   . ARG A 1 385 ? 28.953 -9.630  15.256  1.00 23.46  ? 1255 ARG A HB2   1 
ATOM   5311 H  HB3   . ARG A 1 385 ? 29.718 -9.652  13.868  1.00 23.46  ? 1255 ARG A HB3   1 
ATOM   5312 H  HG2   . ARG A 1 385 ? 27.588 -8.494  13.887  1.00 27.76  ? 1255 ARG A HG2   1 
ATOM   5313 H  HG3   . ARG A 1 385 ? 27.801 -9.522  12.694  1.00 27.76  ? 1255 ARG A HG3   1 
ATOM   5314 H  HD2   . ARG A 1 385 ? 25.650 -9.713  13.658  1.00 25.76  ? 1255 ARG A HD2   1 
ATOM   5315 H  HD3   . ARG A 1 385 ? 26.457 -11.079 13.737  1.00 25.76  ? 1255 ARG A HD3   1 
ATOM   5316 H  HE    . ARG A 1 385 ? 26.463 -10.907 15.925  1.00 27.25  ? 1255 ARG A HE    1 
ATOM   5317 H  HH11  . ARG A 1 385 ? 25.332 -8.027  14.770  1.00 27.45  ? 1255 ARG A HH11  1 
ATOM   5318 H  HH12  . ARG A 1 385 ? 24.874 -7.490  16.082  1.00 27.45  ? 1255 ARG A HH12  1 
ATOM   5319 H  HH21  . ARG A 1 385 ? 25.747 -10.092 17.917  1.00 26.34  ? 1255 ARG A HH21  1 
ATOM   5320 H  HH22  . ARG A 1 385 ? 25.125 -8.740  17.988  1.00 26.34  ? 1255 ARG A HH22  1 
ATOM   5321 N  N     . TYR A 1 386 ? 30.163 -12.312 12.426  1.00 23.06  ? 1256 TYR A N     1 
ATOM   5322 C  CA    . TYR A 1 386 ? 30.271 -12.976 11.132  1.00 21.59  ? 1256 TYR A CA    1 
ATOM   5323 C  C     . TYR A 1 386 ? 29.706 -14.399 11.222  1.00 26.17  ? 1256 TYR A C     1 
ATOM   5324 O  O     . TYR A 1 386 ? 28.954 -14.840 10.354  1.00 25.39  ? 1256 TYR A O     1 
ATOM   5325 C  CB    . TYR A 1 386 ? 31.737 -13.001 10.686  1.00 22.90  ? 1256 TYR A CB    1 
ATOM   5326 C  CG    . TYR A 1 386 ? 31.987 -13.631 9.333   1.00 21.34  ? 1256 TYR A CG    1 
ATOM   5327 C  CD1   . TYR A 1 386 ? 31.852 -12.894 8.165   1.00 19.96  ? 1256 TYR A CD1   1 
ATOM   5328 C  CD2   . TYR A 1 386 ? 32.383 -14.958 9.228   1.00 25.28  ? 1256 TYR A CD2   1 
ATOM   5329 C  CE1   . TYR A 1 386 ? 32.092 -13.464 6.928   1.00 28.04  ? 1256 TYR A CE1   1 
ATOM   5330 C  CE2   . TYR A 1 386 ? 32.626 -15.538 7.999   1.00 25.95  ? 1256 TYR A CE2   1 
ATOM   5331 C  CZ    . TYR A 1 386 ? 32.479 -14.786 6.852   1.00 26.98  ? 1256 TYR A CZ    1 
ATOM   5332 O  OH    . TYR A 1 386 ? 32.719 -15.360 5.627   1.00 27.47  ? 1256 TYR A OH    1 
ATOM   5333 H  H     . TYR A 1 386 ? 30.916 -12.053 12.749  1.00 27.62  ? 1256 TYR A H     1 
ATOM   5334 H  HA    . TYR A 1 386 ? 29.752 -12.479 10.465  1.00 25.85  ? 1256 TYR A HA    1 
ATOM   5335 H  HB2   . TYR A 1 386 ? 32.063 -12.089 10.648  1.00 27.42  ? 1256 TYR A HB2   1 
ATOM   5336 H  HB3   . TYR A 1 386 ? 32.249 -13.502 11.340  1.00 27.42  ? 1256 TYR A HB3   1 
ATOM   5337 H  HD1   . TYR A 1 386 ? 31.592 -12.002 8.214   1.00 23.90  ? 1256 TYR A HD1   1 
ATOM   5338 H  HD2   . TYR A 1 386 ? 32.483 -15.467 10.000  1.00 30.28  ? 1256 TYR A HD2   1 
ATOM   5339 H  HE1   . TYR A 1 386 ? 31.994 -12.960 6.153   1.00 33.59  ? 1256 TYR A HE1   1 
ATOM   5340 H  HE2   . TYR A 1 386 ? 32.886 -16.429 7.944   1.00 31.08  ? 1256 TYR A HE2   1 
ATOM   5341 H  HH    . TYR A 1 386 ? 33.322 -14.958 5.243   1.00 32.91  ? 1256 TYR A HH    1 
ATOM   5342 N  N     . GLU A 1 387 ? 30.056 -15.105 12.292  1.00 26.56  ? 1257 GLU A N     1 
ATOM   5343 C  CA    . GLU A 1 387 ? 29.615 -16.486 12.477  1.00 32.58  ? 1257 GLU A CA    1 
ATOM   5344 C  C     . GLU A 1 387 ? 28.128 -16.552 12.825  1.00 29.45  ? 1257 GLU A C     1 
ATOM   5345 O  O     . GLU A 1 387 ? 27.405 -17.421 12.332  1.00 27.15  ? 1257 GLU A O     1 
ATOM   5346 C  CB    . GLU A 1 387 ? 30.451 -17.167 13.565  1.00 26.13  ? 1257 GLU A CB    1 
ATOM   5347 C  CG    . GLU A 1 387 ? 31.879 -17.469 13.134  1.00 34.00  ? 1257 GLU A CG    1 
ATOM   5348 C  CD    . GLU A 1 387 ? 31.931 -18.391 11.926  1.00 56.25  ? 1257 GLU A CD    1 
ATOM   5349 O  OE1   . GLU A 1 387 ? 31.147 -19.362 11.886  1.00 52.71  ? 1257 GLU A OE1   1 
ATOM   5350 O  OE2   . GLU A 1 387 ? 32.741 -18.138 11.011  1.00 46.25  ? 1257 GLU A OE2   1 
ATOM   5351 H  H     . GLU A 1 387 ? 30.550 -14.807 12.929  1.00 31.82  ? 1257 GLU A H     1 
ATOM   5352 H  HA    . GLU A 1 387 ? 29.751 -16.978 11.640  1.00 39.04  ? 1257 GLU A HA    1 
ATOM   5353 H  HB2   . GLU A 1 387 ? 30.491 -16.584 14.340  1.00 31.30  ? 1257 GLU A HB2   1 
ATOM   5354 H  HB3   . GLU A 1 387 ? 30.028 -18.006 13.806  1.00 31.30  ? 1257 GLU A HB3   1 
ATOM   5355 H  HG2   . GLU A 1 387 ? 32.323 -16.639 12.899  1.00 40.74  ? 1257 GLU A HG2   1 
ATOM   5356 H  HG3   . GLU A 1 387 ? 32.346 -17.903 13.864  1.00 40.74  ? 1257 GLU A HG3   1 
ATOM   5357 N  N     . TRP A 1 388 ? 27.677 -15.624 13.665  1.00 25.59  ? 1258 TRP A N     1 
ATOM   5358 C  CA    . TRP A 1 388 ? 26.276 -15.552 14.065  1.00 28.17  ? 1258 TRP A CA    1 
ATOM   5359 C  C     . TRP A 1 388 ? 25.411 -15.246 12.847  1.00 29.72  ? 1258 TRP A C     1 
ATOM   5360 O  O     . TRP A 1 388 ? 24.346 -15.834 12.668  1.00 29.16  ? 1258 TRP A O     1 
ATOM   5361 C  CB    . TRP A 1 388 ? 26.084 -14.480 15.144  1.00 22.27  ? 1258 TRP A CB    1 
ATOM   5362 C  CG    . TRP A 1 388 ? 24.651 -14.297 15.595  1.00 24.36  ? 1258 TRP A CG    1 
ATOM   5363 C  CD1   . TRP A 1 388 ? 23.879 -13.179 15.444  1.00 28.20  ? 1258 TRP A CD1   1 
ATOM   5364 C  CD2   . TRP A 1 388 ? 23.830 -15.261 16.269  1.00 34.83  ? 1258 TRP A CD2   1 
ATOM   5365 N  NE1   . TRP A 1 388 ? 22.632 -13.387 15.984  1.00 30.48  ? 1258 TRP A NE1   1 
ATOM   5366 C  CE2   . TRP A 1 388 ? 22.575 -14.657 16.496  1.00 30.94  ? 1258 TRP A CE2   1 
ATOM   5367 C  CE3   . TRP A 1 388 ? 24.034 -16.576 16.702  1.00 31.56  ? 1258 TRP A CE3   1 
ATOM   5368 C  CZ2   . TRP A 1 388 ? 21.528 -15.322 17.136  1.00 33.60  ? 1258 TRP A CZ2   1 
ATOM   5369 C  CZ3   . TRP A 1 388 ? 22.993 -17.236 17.338  1.00 42.85  ? 1258 TRP A CZ3   1 
ATOM   5370 C  CH2   . TRP A 1 388 ? 21.756 -16.607 17.548  1.00 41.41  ? 1258 TRP A CH2   1 
ATOM   5371 H  H     . TRP A 1 388 ? 28.171 -15.016 14.021  1.00 30.66  ? 1258 TRP A H     1 
ATOM   5372 H  HA    . TRP A 1 388 ? 25.998 -16.416 14.434  1.00 33.75  ? 1258 TRP A HA    1 
ATOM   5373 H  HB2   . TRP A 1 388 ? 26.608 -14.725 15.923  1.00 26.67  ? 1258 TRP A HB2   1 
ATOM   5374 H  HB3   . TRP A 1 388 ? 26.394 -13.629 14.796  1.00 26.67  ? 1258 TRP A HB3   1 
ATOM   5375 H  HD1   . TRP A 1 388 ? 24.158 -12.390 15.039  1.00 33.78  ? 1258 TRP A HD1   1 
ATOM   5376 H  HE1   . TRP A 1 388 ? 21.990 -12.814 15.997  1.00 36.52  ? 1258 TRP A HE1   1 
ATOM   5377 H  HE3   . TRP A 1 388 ? 24.851 -16.999 16.567  1.00 37.82  ? 1258 TRP A HE3   1 
ATOM   5378 H  HZ2   . TRP A 1 388 ? 20.707 -14.909 17.276  1.00 40.27  ? 1258 TRP A HZ2   1 
ATOM   5379 H  HZ3   . TRP A 1 388 ? 23.117 -18.110 17.630  1.00 51.37  ? 1258 TRP A HZ3   1 
ATOM   5380 H  HH2   . TRP A 1 388 ? 21.076 -17.074 17.977  1.00 49.64  ? 1258 TRP A HH2   1 
ATOM   5381 N  N     . ASN A 1 389 ? 25.886 -14.335 12.004  1.00 23.83  ? 1259 ASN A N     1 
ATOM   5382 C  CA    . ASN A 1 389 ? 25.183 -13.984 10.775  1.00 31.43  ? 1259 ASN A CA    1 
ATOM   5383 C  C     . ASN A 1 389 ? 24.982 -15.216 9.899   1.00 30.40  ? 1259 ASN A C     1 
ATOM   5384 O  O     . ASN A 1 389 ? 23.904 -15.425 9.352   1.00 30.48  ? 1259 ASN A O     1 
ATOM   5385 C  CB    . ASN A 1 389 ? 25.941 -12.897 10.001  1.00 25.26  ? 1259 ASN A CB    1 
ATOM   5386 C  CG    . ASN A 1 389 ? 25.686 -11.497 10.549  1.00 25.57  ? 1259 ASN A CG    1 
ATOM   5387 O  OD1   . ASN A 1 389 ? 24.731 -11.271 11.295  1.00 24.96  ? 1259 ASN A OD1   1 
ATOM   5388 N  ND2   . ASN A 1 389 ? 26.535 -10.549 10.169  1.00 24.72  ? 1259 ASN A ND2   1 
ATOM   5389 H  H     . ASN A 1 389 ? 26.620 -13.903 12.121  1.00 28.54  ? 1259 ASN A H     1 
ATOM   5390 H  HA    . ASN A 1 389 ? 24.299 -13.630 11.006  1.00 37.66  ? 1259 ASN A HA    1 
ATOM   5391 H  HB2   . ASN A 1 389 ? 26.893 -13.073 10.059  1.00 30.26  ? 1259 ASN A HB2   1 
ATOM   5392 H  HB3   . ASN A 1 389 ? 25.655 -12.912 9.074   1.00 30.26  ? 1259 ASN A HB3   1 
ATOM   5393 H  HD21  . ASN A 1 389 ? 26.433 -9.743  10.452  1.00 29.61  ? 1259 ASN A HD21  1 
ATOM   5394 H  HD22  . ASN A 1 389 ? 27.186 -10.741 9.641   1.00 29.61  ? 1259 ASN A HD22  1 
ATOM   5395 N  N     . LYS A 1 390 ? 26.019 -16.035 9.772   1.00 29.17  ? 1260 LYS A N     1 
ATOM   5396 C  CA    . LYS A 1 390 ? 25.929 -17.249 8.963   1.00 31.88  ? 1260 LYS A CA    1 
ATOM   5397 C  C     . LYS A 1 390 ? 24.796 -18.138 9.469   1.00 31.17  ? 1260 LYS A C     1 
ATOM   5398 O  O     . LYS A 1 390 ? 24.010 -18.668 8.685   1.00 36.90  ? 1260 LYS A O     1 
ATOM   5399 C  CB    . LYS A 1 390 ? 27.256 -18.014 8.985   1.00 34.40  ? 1260 LYS A CB    1 
ATOM   5400 C  CG    . LYS A 1 390 ? 28.172 -17.692 7.817   1.00 53.68  ? 1260 LYS A CG    1 
ATOM   5401 C  CD    . LYS A 1 390 ? 29.641 -17.913 8.156   1.00 61.91  ? 1260 LYS A CD    1 
ATOM   5402 C  CE    . LYS A 1 390 ? 30.015 -19.385 8.155   1.00 59.13  ? 1260 LYS A CE    1 
ATOM   5403 N  NZ    . LYS A 1 390 ? 31.058 -19.687 7.132   1.00 67.97  ? 1260 LYS A NZ    1 
ATOM   5404 H  H     . LYS A 1 390 ? 26.785 -15.913 10.143  1.00 34.94  ? 1260 LYS A H     1 
ATOM   5405 H  HA    . LYS A 1 390 ? 25.733 -17.003 8.035   1.00 38.20  ? 1260 LYS A HA    1 
ATOM   5406 H  HB2   . LYS A 1 390 ? 27.730 -17.793 9.802   1.00 41.23  ? 1260 LYS A HB2   1 
ATOM   5407 H  HB3   . LYS A 1 390 ? 27.069 -18.965 8.961   1.00 41.23  ? 1260 LYS A HB3   1 
ATOM   5408 H  HG2   . LYS A 1 390 ? 27.946 -18.266 7.068   1.00 64.35  ? 1260 LYS A HG2   1 
ATOM   5409 H  HG3   . LYS A 1 390 ? 28.057 -16.761 7.570   1.00 64.35  ? 1260 LYS A HG3   1 
ATOM   5410 H  HD2   . LYS A 1 390 ? 30.191 -17.461 7.497   1.00 74.23  ? 1260 LYS A HD2   1 
ATOM   5411 H  HD3   . LYS A 1 390 ? 29.819 -17.557 9.041   1.00 74.23  ? 1260 LYS A HD3   1 
ATOM   5412 H  HE2   . LYS A 1 390 ? 30.365 -19.627 9.026   1.00 70.90  ? 1260 LYS A HE2   1 
ATOM   5413 H  HE3   . LYS A 1 390 ? 29.228 -19.915 7.951   1.00 70.90  ? 1260 LYS A HE3   1 
ATOM   5414 H  HZ1   . LYS A 1 390 ? 31.260 -20.553 7.150   1.00 81.51  ? 1260 LYS A HZ1   1 
ATOM   5415 H  HZ2   . LYS A 1 390 ? 30.758 -19.476 6.321   1.00 81.51  ? 1260 LYS A HZ2   1 
ATOM   5416 H  HZ3   . LYS A 1 390 ? 31.793 -19.214 7.300   1.00 81.51  ? 1260 LYS A HZ3   1 
ATOM   5417 N  N     . LEU A 1 391 ? 24.707 -18.278 10.788  1.00 30.78  ? 1261 LEU A N     1 
ATOM   5418 C  CA    . LEU A 1 391 ? 23.699 -19.130 11.404  1.00 35.17  ? 1261 LEU A CA    1 
ATOM   5419 C  C     . LEU A 1 391 ? 22.302 -18.556 11.194  1.00 47.64  ? 1261 LEU A C     1 
ATOM   5420 O  O     . LEU A 1 391 ? 21.323 -19.298 11.142  1.00 40.23  ? 1261 LEU A O     1 
ATOM   5421 C  CB    . LEU A 1 391 ? 23.984 -19.281 12.899  1.00 38.68  ? 1261 LEU A CB    1 
ATOM   5422 C  CG    . LEU A 1 391 ? 23.418 -20.519 13.595  1.00 54.22  ? 1261 LEU A CG    1 
ATOM   5423 C  CD1   . LEU A 1 391 ? 23.934 -21.795 12.939  1.00 53.81  ? 1261 LEU A CD1   1 
ATOM   5424 C  CD2   . LEU A 1 391 ? 23.778 -20.495 15.070  1.00 51.82  ? 1261 LEU A CD2   1 
ATOM   5425 H  H     . LEU A 1 391 ? 25.225 -17.887 11.352  1.00 36.88  ? 1261 LEU A H     1 
ATOM   5426 H  HA    . LEU A 1 391 ? 23.731 -20.019 10.993  1.00 42.15  ? 1261 LEU A HA    1 
ATOM   5427 H  HB2   . LEU A 1 391 ? 24.946 -19.300 13.022  1.00 46.36  ? 1261 LEU A HB2   1 
ATOM   5428 H  HB3   . LEU A 1 391 ? 23.620 -18.506 13.355  1.00 46.36  ? 1261 LEU A HB3   1 
ATOM   5429 H  HG    . LEU A 1 391 ? 22.451 -20.511 13.520  1.00 65.01  ? 1261 LEU A HG    1 
ATOM   5430 H  HD11  . LEU A 1 391 ? 23.562 -22.553 13.396  1.00 64.52  ? 1261 LEU A HD11  1 
ATOM   5431 H  HD12  . LEU A 1 391 ? 23.663 -21.803 12.018  1.00 64.52  ? 1261 LEU A HD12  1 
ATOM   5432 H  HD13  . LEU A 1 391 ? 24.891 -21.812 13.000  1.00 64.52  ? 1261 LEU A HD13  1 
ATOM   5433 H  HD21  . LEU A 1 391 ? 23.416 -21.278 15.492  1.00 62.12  ? 1261 LEU A HD21  1 
ATOM   5434 H  HD22  . LEU A 1 391 ? 24.734 -20.487 15.159  1.00 62.12  ? 1261 LEU A HD22  1 
ATOM   5435 H  HD23  . LEU A 1 391 ? 23.405 -19.705 15.470  1.00 62.12  ? 1261 LEU A HD23  1 
ATOM   5436 N  N     . GLN A 1 392 ? 22.216 -17.234 11.064  1.00 34.35  ? 1262 GLN A N     1 
ATOM   5437 C  CA    . GLN A 1 392 ? 20.931 -16.559 10.905  1.00 28.90  ? 1262 GLN A CA    1 
ATOM   5438 C  C     . GLN A 1 392 ? 20.616 -16.250 9.439   1.00 34.60  ? 1262 GLN A C     1 
ATOM   5439 O  O     . GLN A 1 392 ? 19.631 -15.578 9.137   1.00 42.66  ? 1262 GLN A O     1 
ATOM   5440 C  CB    . GLN A 1 392 ? 20.919 -15.260 11.715  1.00 30.26  ? 1262 GLN A CB    1 
ATOM   5441 C  CG    . GLN A 1 392 ? 21.151 -15.460 13.206  1.00 39.72  ? 1262 GLN A CG    1 
ATOM   5442 C  CD    . GLN A 1 392 ? 20.105 -16.353 13.845  1.00 45.80  ? 1262 GLN A CD    1 
ATOM   5443 O  OE1   . GLN A 1 392 ? 18.906 -16.157 13.653  1.00 46.04  ? 1262 GLN A OE1   1 
ATOM   5444 N  NE2   . GLN A 1 392 ? 20.556 -17.345 14.606  1.00 41.45  ? 1262 GLN A NE2   1 
ATOM   5445 H  H     . GLN A 1 392 ? 22.892 -16.702 11.065  1.00 41.16  ? 1262 GLN A H     1 
ATOM   5446 H  HA    . GLN A 1 392 ? 20.221 -17.139 11.251  1.00 34.63  ? 1262 GLN A HA    1 
ATOM   5447 H  HB2   . GLN A 1 392 ? 21.620 -14.678 11.382  1.00 36.25  ? 1262 GLN A HB2   1 
ATOM   5448 H  HB3   . GLN A 1 392 ? 20.056 -14.832 11.604  1.00 36.25  ? 1262 GLN A HB3   1 
ATOM   5449 H  HG2   . GLN A 1 392 ? 22.019 -15.872 13.339  1.00 47.61  ? 1262 GLN A HG2   1 
ATOM   5450 H  HG3   . GLN A 1 392 ? 21.120 -14.598 13.649  1.00 47.61  ? 1262 GLN A HG3   1 
ATOM   5451 H  HE21  . GLN A 1 392 ? 21.402 -17.454 14.714  1.00 49.68  ? 1262 GLN A HE21  1 
ATOM   5452 H  HE22  . GLN A 1 392 ? 20.002 -17.879 14.990  1.00 49.68  ? 1262 GLN A HE22  1 
ATOM   5453 N  N     . SER A 1 393 ? 21.454 -16.743 8.534   1.00 32.34  ? 1263 SER A N     1 
ATOM   5454 C  CA    . SER A 1 393 ? 21.339 -16.404 7.117   1.00 43.26  ? 1263 SER A CA    1 
ATOM   5455 C  C     . SER A 1 393 ? 21.144 -14.899 6.923   1.00 46.27  ? 1263 SER A C     1 
ATOM   5456 O  O     . SER A 1 393 ? 20.260 -14.459 6.189   1.00 45.65  ? 1263 SER A O     1 
ATOM   5457 C  CB    . SER A 1 393 ? 20.195 -17.180 6.463   1.00 60.17  ? 1263 SER A CB    1 
ATOM   5458 O  OG    . SER A 1 393 ? 20.482 -18.568 6.432   1.00 57.81  ? 1263 SER A OG    1 
ATOM   5459 H  H     . SER A 1 393 ? 22.102 -17.279 8.714   1.00 38.75  ? 1263 SER A H     1 
ATOM   5460 H  HA    . SER A 1 393 ? 22.171 -16.658 6.664   1.00 51.86  ? 1263 SER A HA    1 
ATOM   5461 H  HB2   . SER A 1 393 ? 19.383 -17.037 6.974   1.00 72.15  ? 1263 SER A HB2   1 
ATOM   5462 H  HB3   . SER A 1 393 ? 20.076 -16.862 5.554   1.00 72.15  ? 1263 SER A HB3   1 
ATOM   5463 H  HG    . SER A 1 393 ? 21.215 -18.710 6.772   1.00 69.31  ? 1263 SER A HG    1 
ATOM   5464 N  N     . VAL A 1 394 ? 21.977 -14.120 7.603   1.00 34.00  ? 1264 VAL A N     1 
ATOM   5465 C  CA    . VAL A 1 394 ? 22.026 -12.676 7.422   1.00 28.89  ? 1264 VAL A CA    1 
ATOM   5466 C  C     . VAL A 1 394 ? 23.370 -12.328 6.803   1.00 28.66  ? 1264 VAL A C     1 
ATOM   5467 O  O     . VAL A 1 394 ? 24.406 -12.848 7.216   1.00 27.81  ? 1264 VAL A O     1 
ATOM   5468 C  CB    . VAL A 1 394 ? 21.864 -11.938 8.768   1.00 28.51  ? 1264 VAL A CB    1 
ATOM   5469 C  CG1   . VAL A 1 394 ? 22.142 -10.450 8.609   1.00 30.55  ? 1264 VAL A CG1   1 
ATOM   5470 C  CG2   . VAL A 1 394 ? 20.467 -12.172 9.337   1.00 35.06  ? 1264 VAL A CG2   1 
ATOM   5471 H  H     . VAL A 1 394 ? 22.536 -14.411 8.188   1.00 40.75  ? 1264 VAL A H     1 
ATOM   5472 H  HA    . VAL A 1 394 ? 21.311 -12.391 6.815   1.00 34.61  ? 1264 VAL A HA    1 
ATOM   5473 H  HB    . VAL A 1 394 ? 22.513 -12.299 9.407   1.00 34.15  ? 1264 VAL A HB    1 
ATOM   5474 H  HG11  . VAL A 1 394 ? 22.034 -10.019 9.460   1.00 36.60  ? 1264 VAL A HG11  1 
ATOM   5475 H  HG12  . VAL A 1 394 ? 23.041 -10.332 8.294   1.00 36.60  ? 1264 VAL A HG12  1 
ATOM   5476 H  HG13  . VAL A 1 394 ? 21.522 -10.083 7.975   1.00 36.60  ? 1264 VAL A HG13  1 
ATOM   5477 H  HG21  . VAL A 1 394 ? 20.388 -11.706 10.172  1.00 42.02  ? 1264 VAL A HG21  1 
ATOM   5478 H  HG22  . VAL A 1 394 ? 19.817 -11.841 8.714   1.00 42.02  ? 1264 VAL A HG22  1 
ATOM   5479 H  HG23  . VAL A 1 394 ? 20.340 -13.114 9.474   1.00 42.02  ? 1264 VAL A HG23  1 
ATOM   5480 N  N     . LYS A 1 395 ? 23.360 -11.453 5.806   1.00 25.91  ? 1265 LYS A N     1 
ATOM   5481 C  CA    . LYS A 1 395 ? 24.586 -11.115 5.099   1.00 30.02  ? 1265 LYS A CA    1 
ATOM   5482 C  C     . LYS A 1 395 ? 25.556 -10.316 5.967   1.00 30.38  ? 1265 LYS A C     1 
ATOM   5483 O  O     . LYS A 1 395 ? 25.179 -9.315  6.578   1.00 26.74  ? 1265 LYS A O     1 
ATOM   5484 C  CB    . LYS A 1 395 ? 24.267 -10.321 3.836   1.00 31.24  ? 1265 LYS A CB    1 
ATOM   5485 C  CG    . LYS A 1 395 ? 25.476 -10.082 2.965   1.00 28.48  ? 1265 LYS A CG    1 
ATOM   5486 C  CD    . LYS A 1 395 ? 25.093 -9.381  1.681   1.00 34.07  ? 1265 LYS A CD    1 
ATOM   5487 C  CE    . LYS A 1 395 ? 26.327 -9.049  0.859   1.00 45.24  ? 1265 LYS A CE    1 
ATOM   5488 N  NZ    . LYS A 1 395 ? 25.982 -8.263  -0.351  1.00 43.32  ? 1265 LYS A NZ    1 
ATOM   5489 H  H     . LYS A 1 395 ? 22.660 -11.043 5.520   1.00 31.04  ? 1265 LYS A H     1 
ATOM   5490 H  HA    . LYS A 1 395 ? 25.035 -11.943 4.830   1.00 35.97  ? 1265 LYS A HA    1 
ATOM   5491 H  HB2   . LYS A 1 395 ? 23.614 -10.811 3.313   1.00 37.43  ? 1265 LYS A HB2   1 
ATOM   5492 H  HB3   . LYS A 1 395 ? 23.906 -9.457  4.090   1.00 37.43  ? 1265 LYS A HB3   1 
ATOM   5493 H  HG2   . LYS A 1 395 ? 26.109 -9.522  3.441   1.00 34.12  ? 1265 LYS A HG2   1 
ATOM   5494 H  HG3   . LYS A 1 395 ? 25.882 -10.933 2.738   1.00 34.12  ? 1265 LYS A HG3   1 
ATOM   5495 H  HD2   . LYS A 1 395 ? 24.522 -9.962  1.155   1.00 40.83  ? 1265 LYS A HD2   1 
ATOM   5496 H  HD3   . LYS A 1 395 ? 24.633 -8.553  1.891   1.00 40.83  ? 1265 LYS A HD3   1 
ATOM   5497 H  HE2   . LYS A 1 395 ? 26.938 -8.524  1.398   1.00 54.23  ? 1265 LYS A HE2   1 
ATOM   5498 H  HE3   . LYS A 1 395 ? 26.752 -9.873  0.575   1.00 54.23  ? 1265 LYS A HE3   1 
ATOM   5499 H  HZ1   . LYS A 1 395 ? 26.719 -8.082  -0.816  1.00 51.93  ? 1265 LYS A HZ1   1 
ATOM   5500 H  HZ2   . LYS A 1 395 ? 25.423 -8.727  -0.865  1.00 51.93  ? 1265 LYS A HZ2   1 
ATOM   5501 H  HZ3   . LYS A 1 395 ? 25.592 -7.499  -0.116  1.00 51.93  ? 1265 LYS A HZ3   1 
ATOM   5502 N  N     . SER A 1 396 ? 26.807 -10.770 6.010   1.00 21.20  ? 1266 SER A N     1 
ATOM   5503 C  CA    . SER A 1 396 ? 27.890 -10.012 6.626   1.00 23.82  ? 1266 SER A CA    1 
ATOM   5504 C  C     . SER A 1 396 ? 28.428 -9.023  5.602   1.00 30.37  ? 1266 SER A C     1 
ATOM   5505 O  O     . SER A 1 396 ? 29.066 -9.414  4.627   1.00 25.95  ? 1266 SER A O     1 
ATOM   5506 C  CB    . SER A 1 396 ? 29.018 -10.944 7.074   1.00 21.93  ? 1266 SER A CB    1 
ATOM   5507 O  OG    . SER A 1 396 ? 28.725 -11.571 8.311   1.00 27.15  ? 1266 SER A OG    1 
ATOM   5508 H  H     . SER A 1 396 ? 27.055 -11.526 5.684   1.00 25.38  ? 1266 SER A H     1 
ATOM   5509 H  HA    . SER A 1 396 ? 27.555 -9.518  7.403   1.00 28.52  ? 1266 SER A HA    1 
ATOM   5510 H  HB2   . SER A 1 396 ? 29.145 -11.628 6.399   1.00 26.26  ? 1266 SER A HB2   1 
ATOM   5511 H  HB3   . SER A 1 396 ? 29.832 -10.425 7.172   1.00 26.26  ? 1266 SER A HB3   1 
ATOM   5512 H  HG    . SER A 1 396 ? 29.343 -12.064 8.529   1.00 32.53  ? 1266 SER A HG    1 
ATOM   5513 N  N     . ILE A 1 397 ? 28.169 -7.743  5.829   1.00 28.51  ? 1267 ILE A N     1 
ATOM   5514 C  CA    . ILE A 1 397 ? 28.574 -6.701  4.898   1.00 29.89  ? 1267 ILE A CA    1 
ATOM   5515 C  C     . ILE A 1 397 ? 30.091 -6.576  4.838   1.00 28.61  ? 1267 ILE A C     1 
ATOM   5516 O  O     . ILE A 1 397 ? 30.647 -6.142  3.832   1.00 27.87  ? 1267 ILE A O     1 
ATOM   5517 C  CB    . ILE A 1 397 ? 27.934 -5.351  5.284   1.00 30.65  ? 1267 ILE A CB    1 
ATOM   5518 C  CG1   . ILE A 1 397 ? 26.430 -5.398  5.011   1.00 41.66  ? 1267 ILE A CG1   1 
ATOM   5519 C  CG2   . ILE A 1 397 ? 28.566 -4.203  4.522   1.00 34.69  ? 1267 ILE A CG2   1 
ATOM   5520 C  CD1   . ILE A 1 397 ? 26.080 -5.774  3.586   1.00 34.10  ? 1267 ILE A CD1   1 
ATOM   5521 H  H     . ILE A 1 397 ? 27.754 -7.448  6.523   1.00 34.16  ? 1267 ILE A H     1 
ATOM   5522 H  HA    . ILE A 1 397 ? 28.257 -6.938  4.001   1.00 35.81  ? 1267 ILE A HA    1 
ATOM   5523 H  HB    . ILE A 1 397 ? 28.071 -5.205  6.233   1.00 36.73  ? 1267 ILE A HB    1 
ATOM   5524 H  HG12  . ILE A 1 397 ? 26.026 -6.055  5.599   1.00 49.94  ? 1267 ILE A HG12  1 
ATOM   5525 H  HG13  . ILE A 1 397 ? 26.053 -4.522  5.187   1.00 49.94  ? 1267 ILE A HG13  1 
ATOM   5526 H  HG21  . ILE A 1 397 ? 28.143 -3.383  4.787   1.00 41.57  ? 1267 ILE A HG21  1 
ATOM   5527 H  HG22  . ILE A 1 397 ? 29.503 -4.171  4.727   1.00 41.57  ? 1267 ILE A HG22  1 
ATOM   5528 H  HG23  . ILE A 1 397 ? 28.441 -4.347  3.581   1.00 41.57  ? 1267 ILE A HG23  1 
ATOM   5529 H  HD11  . ILE A 1 397 ? 25.125 -5.783  3.491   1.00 40.87  ? 1267 ILE A HD11  1 
ATOM   5530 H  HD12  . ILE A 1 397 ? 26.463 -5.127  2.989   1.00 40.87  ? 1267 ILE A HD12  1 
ATOM   5531 H  HD13  . ILE A 1 397 ? 26.436 -6.645  3.396   1.00 40.87  ? 1267 ILE A HD13  1 
ATOM   5532 N  N     . VAL A 1 398 ? 30.762 -6.952  5.919   1.00 22.48  ? 1268 VAL A N     1 
ATOM   5533 C  CA    . VAL A 1 398 ? 32.214 -7.013  5.911   1.00 22.25  ? 1268 VAL A CA    1 
ATOM   5534 C  C     . VAL A 1 398 ? 32.602 -8.463  5.662   1.00 25.84  ? 1268 VAL A C     1 
ATOM   5535 O  O     . VAL A 1 398 ? 32.287 -9.336  6.471   1.00 25.84  ? 1268 VAL A O     1 
ATOM   5536 C  CB    . VAL A 1 398 ? 32.816 -6.521  7.238   1.00 20.97  ? 1268 VAL A CB    1 
ATOM   5537 C  CG1   . VAL A 1 398 ? 34.340 -6.535  7.169   1.00 24.68  ? 1268 VAL A CG1   1 
ATOM   5538 C  CG2   . VAL A 1 398 ? 32.299 -5.112  7.574   1.00 22.74  ? 1268 VAL A CG2   1 
ATOM   5539 H  H     . VAL A 1 398 ? 30.401 -7.177  6.666   1.00 26.93  ? 1268 VAL A H     1 
ATOM   5540 H  HA    . VAL A 1 398 ? 32.565 -6.461  5.180   1.00 26.65  ? 1268 VAL A HA    1 
ATOM   5541 H  HB    . VAL A 1 398 ? 32.539 -7.125  7.958   1.00 25.10  ? 1268 VAL A HB    1 
ATOM   5542 H  HG11  . VAL A 1 398 ? 34.693 -6.224  8.007   1.00 29.56  ? 1268 VAL A HG11  1 
ATOM   5543 H  HG12  . VAL A 1 398 ? 34.636 -7.432  7.001   1.00 29.56  ? 1268 VAL A HG12  1 
ATOM   5544 H  HG13  . VAL A 1 398 ? 34.625 -5.956  6.459   1.00 29.56  ? 1268 VAL A HG13  1 
ATOM   5545 H  HG21  . VAL A 1 398 ? 32.688 -4.827  8.404   1.00 27.23  ? 1268 VAL A HG21  1 
ATOM   5546 H  HG22  . VAL A 1 398 ? 32.552 -4.510  6.870   1.00 27.23  ? 1268 VAL A HG22  1 
ATOM   5547 H  HG23  . VAL A 1 398 ? 31.343 -5.141  7.652   1.00 27.23  ? 1268 VAL A HG23  1 
ATOM   5548 N  N     . PRO A 1 399 ? 33.267 -8.733  4.526   1.00 21.77  ? 1269 PRO A N     1 
ATOM   5549 C  CA    . PRO A 1 399 ? 33.672 -10.109 4.221   1.00 24.30  ? 1269 PRO A CA    1 
ATOM   5550 C  C     . PRO A 1 399 ? 34.893 -10.500 5.052   1.00 23.64  ? 1269 PRO A C     1 
ATOM   5551 O  O     . PRO A 1 399 ? 36.015 -10.253 4.627   1.00 23.42  ? 1269 PRO A O     1 
ATOM   5552 C  CB    . PRO A 1 399 ? 34.020 -10.038 2.731   1.00 23.04  ? 1269 PRO A CB    1 
ATOM   5553 C  CG    . PRO A 1 399 ? 34.528 -8.643  2.541   1.00 23.68  ? 1269 PRO A CG    1 
ATOM   5554 C  CD    . PRO A 1 399 ? 33.737 -7.780  3.502   1.00 26.85  ? 1269 PRO A CD    1 
ATOM   5555 H  HA    . PRO A 1 399 ? 32.937 -10.740 4.370   1.00 29.10  ? 1269 PRO A HA    1 
ATOM   5556 H  HB2   . PRO A 1 399 ? 34.709 -10.688 2.522   1.00 27.59  ? 1269 PRO A HB2   1 
ATOM   5557 H  HB3   . PRO A 1 399 ? 33.224 -10.192 2.198   1.00 27.59  ? 1269 PRO A HB3   1 
ATOM   5558 H  HG2   . PRO A 1 399 ? 35.474 -8.610  2.753   1.00 28.36  ? 1269 PRO A HG2   1 
ATOM   5559 H  HG3   . PRO A 1 399 ? 34.373 -8.363  1.625   1.00 28.36  ? 1269 PRO A HG3   1 
ATOM   5560 H  HD2   . PRO A 1 399 ? 34.311 -7.109  3.904   1.00 32.17  ? 1269 PRO A HD2   1 
ATOM   5561 H  HD3   . PRO A 1 399 ? 32.982 -7.374  3.047   1.00 32.17  ? 1269 PRO A HD3   1 
ATOM   5562 N  N     . MET A 1 400 ? 34.674 -11.097 6.221   1.00 21.70  ? 1270 MET A N     1 
ATOM   5563 C  CA    . MET A 1 400 ? 35.747 -11.276 7.202   1.00 21.04  ? 1270 MET A CA    1 
ATOM   5564 C  C     . MET A 1 400 ? 36.842 -12.243 6.755   1.00 21.67  ? 1270 MET A C     1 
ATOM   5565 O  O     . MET A 1 400 ? 37.979 -12.131 7.200   1.00 24.07  ? 1270 MET A O     1 
ATOM   5566 C  CB    . MET A 1 400 ? 35.175 -11.728 8.551   1.00 20.94  ? 1270 MET A CB    1 
ATOM   5567 C  CG    . MET A 1 400 ? 34.398 -10.637 9.287   1.00 20.36  ? 1270 MET A CG    1 
ATOM   5568 S  SD    . MET A 1 400 ? 35.344 -9.112  9.543   1.00 23.04  ? 1270 MET A SD    1 
ATOM   5569 C  CE    . MET A 1 400 ? 36.675 -9.691  10.592  1.00 27.03  ? 1270 MET A CE    1 
ATOM   5570 H  H     . MET A 1 400 ? 33.913 -11.408 6.473   1.00 25.98  ? 1270 MET A H     1 
ATOM   5571 H  HA    . MET A 1 400 ? 36.165 -10.402 7.350   1.00 25.20  ? 1270 MET A HA    1 
ATOM   5572 H  HB2   . MET A 1 400 ? 34.572 -12.472 8.401   1.00 25.08  ? 1270 MET A HB2   1 
ATOM   5573 H  HB3   . MET A 1 400 ? 35.907 -12.008 9.122   1.00 25.08  ? 1270 MET A HB3   1 
ATOM   5574 H  HG2   . MET A 1 400 ? 33.608 -10.413 8.771   1.00 24.38  ? 1270 MET A HG2   1 
ATOM   5575 H  HG3   . MET A 1 400 ? 34.137 -10.974 10.159  1.00 24.38  ? 1270 MET A HG3   1 
ATOM   5576 H  HE1   . MET A 1 400 ? 37.254 -8.953  10.797  1.00 32.38  ? 1270 MET A HE1   1 
ATOM   5577 H  HE2   . MET A 1 400 ? 36.302 -10.050 11.400  1.00 32.38  ? 1270 MET A HE2   1 
ATOM   5578 H  HE3   . MET A 1 400 ? 37.165 -10.372 10.126  1.00 32.38  ? 1270 MET A HE3   1 
ATOM   5579 N  N     . VAL A 1 401 ? 36.516 -13.192 5.885   1.00 22.31  ? 1271 VAL A N     1 
ATOM   5580 C  CA    . VAL A 1 401 ? 37.542 -14.105 5.393   1.00 19.93  ? 1271 VAL A CA    1 
ATOM   5581 C  C     . VAL A 1 401 ? 38.451 -13.362 4.409   1.00 20.62  ? 1271 VAL A C     1 
ATOM   5582 O  O     . VAL A 1 401 ? 39.666 -13.342 4.570   1.00 22.45  ? 1271 VAL A O     1 
ATOM   5583 C  CB    . VAL A 1 401 ? 36.926 -15.377 4.769   1.00 27.55  ? 1271 VAL A CB    1 
ATOM   5584 C  CG1   . VAL A 1 401 ? 38.008 -16.268 4.180   1.00 22.64  ? 1271 VAL A CG1   1 
ATOM   5585 C  CG2   . VAL A 1 401 ? 36.135 -16.143 5.827   1.00 24.69  ? 1271 VAL A CG2   1 
ATOM   5586 H  H     . VAL A 1 401 ? 35.727 -13.327 5.570   1.00 26.71  ? 1271 VAL A H     1 
ATOM   5587 H  HA    . VAL A 1 401 ? 38.096 -14.388 6.151   1.00 23.86  ? 1271 VAL A HA    1 
ATOM   5588 H  HB    . VAL A 1 401 ? 36.312 -15.121 4.050   1.00 33.01  ? 1271 VAL A HB    1 
ATOM   5589 H  HG11  . VAL A 1 401 ? 37.598 -17.048 3.800   1.00 27.11  ? 1271 VAL A HG11  1 
ATOM   5590 H  HG12  . VAL A 1 401 ? 38.478 -15.781 3.499   1.00 27.11  ? 1271 VAL A HG12  1 
ATOM   5591 H  HG13  . VAL A 1 401 ? 38.616 -16.524 4.878   1.00 27.11  ? 1271 VAL A HG13  1 
ATOM   5592 H  HG21  . VAL A 1 401 ? 35.759 -16.930 5.427   1.00 29.58  ? 1271 VAL A HG21  1 
ATOM   5593 H  HG22  . VAL A 1 401 ? 36.728 -16.390 6.541   1.00 29.58  ? 1271 VAL A HG22  1 
ATOM   5594 H  HG23  . VAL A 1 401 ? 35.435 -15.578 6.162   1.00 29.58  ? 1271 VAL A HG23  1 
ATOM   5595 N  N     . HIS A 1 402 ? 37.849 -12.724 3.414   1.00 22.90  ? 1272 HIS A N     1 
ATOM   5596 C  CA    . HIS A 1 402 ? 38.587 -11.915 2.447   1.00 20.62  ? 1272 HIS A CA    1 
ATOM   5597 C  C     . HIS A 1 402 ? 39.477 -10.907 3.178   1.00 22.94  ? 1272 HIS A C     1 
ATOM   5598 O  O     . HIS A 1 402 ? 40.662 -10.766 2.880   1.00 21.91  ? 1272 HIS A O     1 
ATOM   5599 C  CB    . HIS A 1 402 ? 37.596 -11.185 1.536   1.00 22.03  ? 1272 HIS A CB    1 
ATOM   5600 C  CG    . HIS A 1 402 ? 38.242 -10.316 0.501   1.00 30.02  ? 1272 HIS A CG    1 
ATOM   5601 N  ND1   . HIS A 1 402 ? 38.683 -9.038  0.769   1.00 38.02  ? 1272 HIS A ND1   1 
ATOM   5602 C  CD2   . HIS A 1 402 ? 38.510 -10.539 -0.807  1.00 31.68  ? 1272 HIS A CD2   1 
ATOM   5603 C  CE1   . HIS A 1 402 ? 39.203 -8.515  -0.327  1.00 23.64  ? 1272 HIS A CE1   1 
ATOM   5604 N  NE2   . HIS A 1 402 ? 39.108 -9.405  -1.299  1.00 46.10  ? 1272 HIS A NE2   1 
ATOM   5605 H  H     . HIS A 1 402 ? 37.001 -12.742 3.273   1.00 27.43  ? 1272 HIS A H     1 
ATOM   5606 H  HA    . HIS A 1 402 ? 39.154 -12.494 1.896   1.00 24.68  ? 1272 HIS A HA    1 
ATOM   5607 H  HB2   . HIS A 1 402 ? 37.055 -11.844 1.073   1.00 26.38  ? 1272 HIS A HB2   1 
ATOM   5608 H  HB3   . HIS A 1 402 ? 37.027 -10.620 2.083   1.00 26.38  ? 1272 HIS A HB3   1 
ATOM   5609 H  HD1   . HIS A 1 402 ? 38.633 -8.644  1.532   1.00 45.57  ? 1272 HIS A HD1   1 
ATOM   5610 H  HD2   . HIS A 1 402 ? 38.326 -11.317 -1.283  1.00 37.96  ? 1272 HIS A HD2   1 
ATOM   5611 H  HE1   . HIS A 1 402 ? 39.570 -7.663  -0.403  1.00 28.31  ? 1272 HIS A HE1   1 
ATOM   5612 H  HE2   . HIS A 1 402 ? 39.378 -9.293  -2.107  1.00 55.26  ? 1272 HIS A HE2   1 
ATOM   5613 N  N     . LEU A 1 403 ? 38.895 -10.218 4.153   1.00 20.76  ? 1273 LEU A N     1 
ATOM   5614 C  CA    . LEU A 1 403 ? 39.621 -9.214  4.922   1.00 21.57  ? 1273 LEU A CA    1 
ATOM   5615 C  C     . LEU A 1 403 ? 40.773 -9.825  5.715   1.00 23.03  ? 1273 LEU A C     1 
ATOM   5616 O  O     . LEU A 1 403 ? 41.870 -9.276  5.740   1.00 19.88  ? 1273 LEU A O     1 
ATOM   5617 C  CB    . LEU A 1 403 ? 38.670 -8.486  5.873   1.00 24.70  ? 1273 LEU A CB    1 
ATOM   5618 C  CG    . LEU A 1 403 ? 39.343 -7.569  6.897   1.00 27.33  ? 1273 LEU A CG    1 
ATOM   5619 C  CD1   . LEU A 1 403 ? 40.148 -6.475  6.205   1.00 22.86  ? 1273 LEU A CD1   1 
ATOM   5620 C  CD2   . LEU A 1 403 ? 38.298 -6.964  7.821   1.00 29.28  ? 1273 LEU A CD2   1 
ATOM   5621 H  H     . LEU A 1 403 ? 38.074 -10.313 4.390   1.00 24.86  ? 1273 LEU A H     1 
ATOM   5622 H  HA    . LEU A 1 403 ? 39.997 -8.551  4.305   1.00 25.83  ? 1273 LEU A HA    1 
ATOM   5623 H  HB2   . LEU A 1 403 ? 38.067 -7.939  5.345   1.00 29.58  ? 1273 LEU A HB2   1 
ATOM   5624 H  HB3   . LEU A 1 403 ? 38.161 -9.148  6.365   1.00 29.58  ? 1273 LEU A HB3   1 
ATOM   5625 H  HG    . LEU A 1 403 ? 39.953 -8.094  7.439   1.00 32.74  ? 1273 LEU A HG    1 
ATOM   5626 H  HD11  . LEU A 1 403 ? 40.557 -5.919  6.872   1.00 27.38  ? 1273 LEU A HD11  1 
ATOM   5627 H  HD12  . LEU A 1 403 ? 40.825 -6.884  5.660   1.00 27.38  ? 1273 LEU A HD12  1 
ATOM   5628 H  HD13  . LEU A 1 403 ? 39.558 -5.952  5.658   1.00 27.38  ? 1273 LEU A HD13  1 
ATOM   5629 H  HD21  . LEU A 1 403 ? 38.736 -6.392  8.456   1.00 35.08  ? 1273 LEU A HD21  1 
ATOM   5630 H  HD22  . LEU A 1 403 ? 37.676 -6.454  7.296   1.00 35.08  ? 1273 LEU A HD22  1 
ATOM   5631 H  HD23  . LEU A 1 403 ? 37.838 -7.671  8.279   1.00 35.08  ? 1273 LEU A HD23  1 
ATOM   5632 N  N     . SER A 1 404 ? 40.528 -10.957 6.365   1.00 21.29  ? 1274 SER A N     1 
ATOM   5633 C  CA    . SER A 1 404 ? 41.554 -11.574 7.201   1.00 24.60  ? 1274 SER A CA    1 
ATOM   5634 C  C     . SER A 1 404 ? 42.782 -11.918 6.366   1.00 29.34  ? 1274 SER A C     1 
ATOM   5635 O  O     . SER A 1 404 ? 43.916 -11.724 6.802   1.00 24.34  ? 1274 SER A O     1 
ATOM   5636 C  CB    . SER A 1 404 ? 41.014 -12.826 7.889   1.00 26.62  ? 1274 SER A CB    1 
ATOM   5637 O  OG    . SER A 1 404 ? 40.046 -12.485 8.863   1.00 25.49  ? 1274 SER A OG    1 
ATOM   5638 H  H     . SER A 1 404 ? 39.783 -11.386 6.340   1.00 25.49  ? 1274 SER A H     1 
ATOM   5639 H  HA    . SER A 1 404 ? 41.826 -10.938 7.895   1.00 29.46  ? 1274 SER A HA    1 
ATOM   5640 H  HB2   . SER A 1 404 ? 40.604 -13.401 7.224   1.00 31.89  ? 1274 SER A HB2   1 
ATOM   5641 H  HB3   . SER A 1 404 ? 41.748 -13.291 8.322   1.00 31.89  ? 1274 SER A HB3   1 
ATOM   5642 H  HG    . SER A 1 404 ? 39.946 -11.671 8.886   1.00 30.53  ? 1274 SER A HG    1 
ATOM   5643 N  N     . TRP A 1 405 ? 42.557 -12.414 5.155   1.00 23.29  ? 1275 TRP A N     1 
ATOM   5644 C  CA    . TRP A 1 405 ? 43.665 -12.769 4.277   1.00 25.10  ? 1275 TRP A CA    1 
ATOM   5645 C  C     . TRP A 1 405 ? 44.403 -11.523 3.787   1.00 27.46  ? 1275 TRP A C     1 
ATOM   5646 O  O     . TRP A 1 405 ? 45.615 -11.555 3.599   1.00 33.55  ? 1275 TRP A O     1 
ATOM   5647 C  CB    . TRP A 1 405 ? 43.178 -13.630 3.108   1.00 26.66  ? 1275 TRP A CB    1 
ATOM   5648 C  CG    . TRP A 1 405 ? 42.974 -15.046 3.528   1.00 25.40  ? 1275 TRP A CG    1 
ATOM   5649 C  CD1   . TRP A 1 405 ? 41.818 -15.607 3.983   1.00 22.07  ? 1275 TRP A CD1   1 
ATOM   5650 C  CD2   . TRP A 1 405 ? 43.967 -16.080 3.570   1.00 25.10  ? 1275 TRP A CD2   1 
ATOM   5651 N  NE1   . TRP A 1 405 ? 42.027 -16.929 4.298   1.00 23.43  ? 1275 TRP A NE1   1 
ATOM   5652 C  CE2   . TRP A 1 405 ? 43.337 -17.244 4.053   1.00 27.01  ? 1275 TRP A CE2   1 
ATOM   5653 C  CE3   . TRP A 1 405 ? 45.326 -16.133 3.244   1.00 27.05  ? 1275 TRP A CE3   1 
ATOM   5654 C  CZ2   . TRP A 1 405 ? 44.019 -18.451 4.215   1.00 25.46  ? 1275 TRP A CZ2   1 
ATOM   5655 C  CZ3   . TRP A 1 405 ? 46.001 -17.333 3.403   1.00 26.78  ? 1275 TRP A CZ3   1 
ATOM   5656 C  CH2   . TRP A 1 405 ? 45.346 -18.476 3.884   1.00 27.73  ? 1275 TRP A CH2   1 
ATOM   5657 H  H     . TRP A 1 405 ? 41.777 -12.555 4.820   1.00 27.90  ? 1275 TRP A H     1 
ATOM   5658 H  HA    . TRP A 1 405 ? 44.305 -13.305 4.789   1.00 30.06  ? 1275 TRP A HA    1 
ATOM   5659 H  HB2   . TRP A 1 405 ? 42.332 -13.284 2.784   1.00 31.93  ? 1275 TRP A HB2   1 
ATOM   5660 H  HB3   . TRP A 1 405 ? 43.841 -13.615 2.400   1.00 31.93  ? 1275 TRP A HB3   1 
ATOM   5661 H  HD1   . TRP A 1 405 ? 41.007 -15.161 4.069   1.00 26.43  ? 1275 TRP A HD1   1 
ATOM   5662 H  HE1   . TRP A 1 405 ? 41.430 -17.471 4.597   1.00 28.07  ? 1275 TRP A HE1   1 
ATOM   5663 H  HE3   . TRP A 1 405 ? 45.767 -15.379 2.925   1.00 32.40  ? 1275 TRP A HE3   1 
ATOM   5664 H  HZ2   . TRP A 1 405 ? 43.586 -19.211 4.531   1.00 30.49  ? 1275 TRP A HZ2   1 
ATOM   5665 H  HZ3   . TRP A 1 405 ? 46.905 -17.380 3.188   1.00 32.08  ? 1275 TRP A HZ3   1 
ATOM   5666 H  HH2   . TRP A 1 405 ? 45.824 -19.268 3.980   1.00 33.22  ? 1275 TRP A HH2   1 
ATOM   5667 N  N     . ASN A 1 406 ? 43.680 -10.424 3.597   1.00 27.95  ? 1276 ASN A N     1 
ATOM   5668 C  CA    . ASN A 1 406 ? 44.327 -9.155  3.260   1.00 24.64  ? 1276 ASN A CA    1 
ATOM   5669 C  C     . ASN A 1 406 ? 45.131 -8.592  4.432   1.00 27.76  ? 1276 ASN A C     1 
ATOM   5670 O  O     . ASN A 1 406 ? 46.197 -8.012  4.243   1.00 36.53  ? 1276 ASN A O     1 
ATOM   5671 C  CB    . ASN A 1 406 ? 43.302 -8.120  2.800   1.00 22.56  ? 1276 ASN A CB    1 
ATOM   5672 C  CG    . ASN A 1 406 ? 43.071 -8.155  1.303   1.00 34.24  ? 1276 ASN A CG    1 
ATOM   5673 O  OD1   . ASN A 1 406 ? 43.828 -8.776  0.556   1.00 37.94  ? 1276 ASN A OD1   1 
ATOM   5674 N  ND2   . ASN A 1 406 ? 42.029 -7.471  0.856   1.00 31.02  ? 1276 ASN A ND2   1 
ATOM   5675 H  H     . ASN A 1 406 ? 42.823 -10.383 3.655   1.00 33.49  ? 1276 ASN A H     1 
ATOM   5676 H  HA    . ASN A 1 406 ? 44.950 -9.308  2.519   1.00 29.51  ? 1276 ASN A HA    1 
ATOM   5677 H  HB2   . ASN A 1 406 ? 42.455 -8.296  3.239   1.00 27.02  ? 1276 ASN A HB2   1 
ATOM   5678 H  HB3   . ASN A 1 406 ? 43.620 -7.234  3.034   1.00 27.02  ? 1276 ASN A HB3   1 
ATOM   5679 H  HD21  . ASN A 1 406 ? 41.529 -7.040  1.407   1.00 37.17  ? 1276 ASN A HD21  1 
ATOM   5680 H  HD22  . ASN A 1 406 ? 41.853 -7.457  0.015   1.00 37.17  ? 1276 ASN A HD22  1 
ATOM   5681 N  N     . MET A 1 407 ? 44.612 -8.760  5.642   1.00 28.13  ? 1277 MET A N     1 
ATOM   5682 C  CA    . MET A 1 407 ? 45.311 -8.310  6.835   1.00 29.12  ? 1277 MET A CA    1 
ATOM   5683 C  C     . MET A 1 407 ? 46.629 -9.061  6.932   1.00 37.05  ? 1277 MET A C     1 
ATOM   5684 O  O     . MET A 1 407 ? 47.647 -8.495  7.318   1.00 31.88  ? 1277 MET A O     1 
ATOM   5685 C  CB    . MET A 1 407 ? 44.468 -8.554  8.092   1.00 26.28  ? 1277 MET A CB    1 
ATOM   5686 C  CG    . MET A 1 407 ? 43.364 -7.519  8.328   1.00 31.61  ? 1277 MET A CG    1 
ATOM   5687 S  SD    . MET A 1 407 ? 42.042 -8.096  9.427   1.00 34.40  ? 1277 MET A SD    1 
ATOM   5688 C  CE    . MET A 1 407 ? 42.878 -8.119  11.013  1.00 32.83  ? 1277 MET A CE    1 
ATOM   5689 H  H     . MET A 1 407 ? 43.853 -9.134  5.798   1.00 33.70  ? 1277 MET A H     1 
ATOM   5690 H  HA    . MET A 1 407 ? 45.489 -7.349  6.764   1.00 34.88  ? 1277 MET A HA    1 
ATOM   5691 H  HB2   . MET A 1 407 ? 44.045 -9.424  8.018   1.00 31.49  ? 1277 MET A HB2   1 
ATOM   5692 H  HB3   . MET A 1 407 ? 45.054 -8.541  8.866   1.00 31.49  ? 1277 MET A HB3   1 
ATOM   5693 H  HG2   . MET A 1 407 ? 43.757 -6.727  8.727   1.00 37.87  ? 1277 MET A HG2   1 
ATOM   5694 H  HG3   . MET A 1 407 ? 42.962 -7.291  7.475   1.00 37.87  ? 1277 MET A HG3   1 
ATOM   5695 H  HE1   . MET A 1 407 ? 42.261 -8.416  11.686  1.00 39.34  ? 1277 MET A HE1   1 
ATOM   5696 H  HE2   . MET A 1 407 ? 43.624 -8.721  10.963  1.00 39.34  ? 1277 MET A HE2   1 
ATOM   5697 H  HE3   . MET A 1 407 ? 43.184 -7.232  11.216  1.00 39.34  ? 1277 MET A HE3   1 
ATOM   5698 N  N     . ALA A 1 408 ? 46.605 -10.338 6.563   1.00 29.58  ? 1278 ALA A N     1 
ATOM   5699 C  CA    . ALA A 1 408 ? 47.791 -11.181 6.649   1.00 31.15  ? 1278 ALA A CA    1 
ATOM   5700 C  C     . ALA A 1 408 ? 48.840 -10.759 5.622   1.00 32.53  ? 1278 ALA A C     1 
ATOM   5701 O  O     . ALA A 1 408 ? 50.039 -10.880 5.869   1.00 39.54  ? 1278 ALA A O     1 
ATOM   5702 C  CB    . ALA A 1 408 ? 47.413 -12.649 6.462   1.00 25.35  ? 1278 ALA A CB    1 
ATOM   5703 H  H     . ALA A 1 408 ? 45.910 -10.742 6.257   1.00 35.44  ? 1278 ALA A H     1 
ATOM   5704 H  HA    . ALA A 1 408 ? 48.185 -11.083 7.540   1.00 37.32  ? 1278 ALA A HA    1 
ATOM   5705 H  HB1   . ALA A 1 408 ? 48.207 -13.185 6.522   1.00 30.37  ? 1278 ALA A HB1   1 
ATOM   5706 H  HB2   . ALA A 1 408 ? 46.794 -12.902 7.150   1.00 30.37  ? 1278 ALA A HB2   1 
ATOM   5707 H  HB3   . ALA A 1 408 ? 47.008 -12.759 5.599   1.00 30.37  ? 1278 ALA A HB3   1 
ATOM   5708 N  N     A ARG A 1 409 ? 48.386 -10.265 4.473   0.63 31.07  ? 1279 ARG A N     1 
ATOM   5709 N  N     B ARG A 1 409 ? 48.383 -10.265 4.476   0.37 32.90  ? 1279 ARG A N     1 
ATOM   5710 C  CA    A ARG A 1 409 ? 49.298 -9.791  3.435   0.63 32.03  ? 1279 ARG A CA    1 
ATOM   5711 C  CA    B ARG A 1 409 ? 49.285 -9.785  3.435   0.37 34.03  ? 1279 ARG A CA    1 
ATOM   5712 C  C     A ARG A 1 409 ? 49.912 -8.439  3.800   0.63 38.71  ? 1279 ARG A C     1 
ATOM   5713 C  C     B ARG A 1 409 ? 49.911 -8.443  3.809   0.37 38.50  ? 1279 ARG A C     1 
ATOM   5714 O  O     A ARG A 1 409 ? 51.080 -8.184  3.510   0.63 44.79  ? 1279 ARG A O     1 
ATOM   5715 O  O     B ARG A 1 409 ? 51.089 -8.203  3.543   0.37 42.32  ? 1279 ARG A O     1 
ATOM   5716 C  CB    A ARG A 1 409 ? 48.579 -9.647  2.090   0.63 42.36  ? 1279 ARG A CB    1 
ATOM   5717 C  CB    B ARG A 1 409 ? 48.534 -9.631  2.110   0.37 41.13  ? 1279 ARG A CB    1 
ATOM   5718 C  CG    A ARG A 1 409 ? 47.947 -10.913 1.540   0.63 39.81  ? 1279 ARG A CG    1 
ATOM   5719 C  CG    B ARG A 1 409 ? 48.159 -10.939 1.437   0.37 40.15  ? 1279 ARG A CG    1 
ATOM   5720 C  CD    A ARG A 1 409 ? 47.371 -10.655 0.150   0.63 37.17  ? 1279 ARG A CD    1 
ATOM   5721 C  CD    B ARG A 1 409 ? 47.320 -10.695 0.188   0.37 38.03  ? 1279 ARG A CD    1 
ATOM   5722 N  NE    A ARG A 1 409 ? 46.681 -11.818 -0.402  0.63 37.23  ? 1279 ARG A NE    1 
ATOM   5723 N  NE    B ARG A 1 409 ? 46.923 -11.944 -0.460  0.37 39.32  ? 1279 ARG A NE    1 
ATOM   5724 C  CZ    A ARG A 1 409 ? 47.228 -12.699 -1.236  0.63 38.68  ? 1279 ARG A CZ    1 
ATOM   5725 C  CZ    B ARG A 1 409 ? 45.694 -12.453 -0.441  0.37 35.36  ? 1279 ARG A CZ    1 
ATOM   5726 N  NH1   A ARG A 1 409 ? 48.488 -12.566 -1.632  0.63 26.91  ? 1279 ARG A NH1   1 
ATOM   5727 N  NH1   B ARG A 1 409 ? 44.707 -11.823 0.186   0.37 28.14  ? 1279 ARG A NH1   1 
ATOM   5728 N  NH2   A ARG A 1 409 ? 46.506 -13.719 -1.678  0.63 34.00  ? 1279 ARG A NH2   1 
ATOM   5729 N  NH2   B ARG A 1 409 ? 45.445 -13.598 -1.062  0.37 37.89  ? 1279 ARG A NH2   1 
ATOM   5730 H  H     A ARG A 1 409 ? 47.553 -10.193 4.269   0.63 37.22  ? 1279 ARG A H     1 
ATOM   5731 H  H     B ARG A 1 409 ? 47.550 -10.198 4.275   0.37 39.42  ? 1279 ARG A H     1 
ATOM   5732 H  HA    A ARG A 1 409 ? 50.026 -10.438 3.325   0.63 38.39  ? 1279 ARG A HA    1 
ATOM   5733 H  HA    B ARG A 1 409 ? 50.006 -10.436 3.306   0.37 40.77  ? 1279 ARG A HA    1 
ATOM   5734 H  HB2   A ARG A 1 409 ? 47.872 -8.990  2.190   0.63 50.77  ? 1279 ARG A HB2   1 
ATOM   5735 H  HB2   B ARG A 1 409 ? 47.714 -9.140  2.275   0.37 49.30  ? 1279 ARG A HB2   1 
ATOM   5736 H  HB3   A ARG A 1 409 ? 49.219 -9.334  1.432   0.63 50.77  ? 1279 ARG A HB3   1 
ATOM   5737 H  HB3   B ARG A 1 409 ? 49.093 -9.133  1.494   0.37 49.30  ? 1279 ARG A HB3   1 
ATOM   5738 H  HG2   A ARG A 1 409 ? 48.620 -11.607 1.471   0.63 47.71  ? 1279 ARG A HG2   1 
ATOM   5739 H  HG2   B ARG A 1 409 ? 48.966 -11.409 1.175   0.37 48.13  ? 1279 ARG A HG2   1 
ATOM   5740 H  HG3   A ARG A 1 409 ? 47.226 -11.195 2.125   0.63 47.71  ? 1279 ARG A HG3   1 
ATOM   5741 H  HG3   B ARG A 1 409 ? 47.639 -11.480 2.052   0.37 48.13  ? 1279 ARG A HG3   1 
ATOM   5742 H  HD2   A ARG A 1 409 ? 46.735 -9.925  0.203   0.63 44.55  ? 1279 ARG A HD2   1 
ATOM   5743 H  HD2   B ARG A 1 409 ? 46.515 -10.214 0.435   0.37 45.58  ? 1279 ARG A HD2   1 
ATOM   5744 H  HD3   A ARG A 1 409 ? 48.095 -10.421 -0.452  0.63 44.55  ? 1279 ARG A HD3   1 
ATOM   5745 H  HD3   B ARG A 1 409 ? 47.838 -10.176 -0.447  0.37 45.58  ? 1279 ARG A HD3   1 
ATOM   5746 H  HE    A ARG A 1 409 ? 45.862 -11.942 -0.172  0.63 44.62  ? 1279 ARG A HE    1 
ATOM   5747 H  HE    B ARG A 1 409 ? 47.529 -12.382 -0.886  0.37 47.13  ? 1279 ARG A HE    1 
ATOM   5748 H  HH11  A ARG A 1 409 ? 48.961 -11.906 -1.349  0.63 32.24  ? 1279 ARG A HH11  1 
ATOM   5749 H  HH11  B ARG A 1 409 ? 44.860 -11.080 0.591   0.37 33.72  ? 1279 ARG A HH11  1 
ATOM   5750 H  HH12  A ARG A 1 409 ? 48.832 -13.141 -2.172  0.63 32.24  ? 1279 ARG A HH12  1 
ATOM   5751 H  HH12  B ARG A 1 409 ? 43.916 -12.160 0.190   0.37 33.72  ? 1279 ARG A HH12  1 
ATOM   5752 H  HH21  A ARG A 1 409 ? 45.689 -13.809 -1.425  0.63 40.75  ? 1279 ARG A HH21  1 
ATOM   5753 H  HH21  B ARG A 1 409 ? 46.079 -14.011 -1.472  0.37 45.41  ? 1279 ARG A HH21  1 
ATOM   5754 H  HH22  A ARG A 1 409 ? 46.855 -14.291 -2.217  0.63 40.75  ? 1279 ARG A HH22  1 
ATOM   5755 H  HH22  B ARG A 1 409 ? 44.651 -13.928 -1.054  0.37 45.41  ? 1279 ARG A HH22  1 
ATOM   5756 N  N     . ASN A 1 410 ? 49.119 -7.577  4.433   1.00 39.60  ? 1280 ASN A N     1 
ATOM   5757 C  CA    . ASN A 1 410 ? 49.493 -6.172  4.613   1.00 44.57  ? 1280 ASN A CA    1 
ATOM   5758 C  C     . ASN A 1 410 ? 50.072 -5.766  5.968   1.00 39.84  ? 1280 ASN A C     1 
ATOM   5759 O  O     . ASN A 1 410 ? 50.910 -4.869  6.043   1.00 54.02  ? 1280 ASN A O     1 
ATOM   5760 C  CB    . ASN A 1 410 ? 48.266 -5.289  4.341   1.00 38.49  ? 1280 ASN A CB    1 
ATOM   5761 C  CG    . ASN A 1 410 ? 47.669 -5.524  2.969   1.00 40.39  ? 1280 ASN A CG    1 
ATOM   5762 O  OD1   . ASN A 1 410 ? 48.343 -6.030  2.071   1.00 45.03  ? 1280 ASN A OD1   1 
ATOM   5763 N  ND2   . ASN A 1 410 ? 46.398 -5.156  2.796   1.00 44.72  ? 1280 ASN A ND2   1 
ATOM   5764 H  H     A ASN A 1 410 ? 48.355 -7.781  4.771   0.50 47.46  ? 1280 ASN A H     1 
ATOM   5765 H  H     B ASN A 1 410 ? 48.352 -7.779  4.766   0.50 47.46  ? 1280 ASN A H     1 
ATOM   5766 H  HA    . ASN A 1 410 ? 50.165 -5.949  3.936   1.00 53.43  ? 1280 ASN A HA    1 
ATOM   5767 H  HB2   . ASN A 1 410 ? 47.584 -5.483  5.003   1.00 46.14  ? 1280 ASN A HB2   1 
ATOM   5768 H  HB3   . ASN A 1 410 ? 48.528 -4.357  4.399   1.00 46.14  ? 1280 ASN A HB3   1 
ATOM   5769 H  HD21  . ASN A 1 410 ? 46.017 -5.271  2.034   1.00 53.61  ? 1280 ASN A HD21  1 
ATOM   5770 H  HD22  . ASN A 1 410 ? 45.960 -4.805  3.448   1.00 53.61  ? 1280 ASN A HD22  1 
ATOM   5771 N  N     . ILE A 1 411 ? 49.621 -6.415  7.035   1.00 34.25  ? 1281 ILE A N     1 
ATOM   5772 C  CA    . ILE A 1 411 ? 49.826 -5.899  8.384   1.00 36.01  ? 1281 ILE A CA    1 
ATOM   5773 C  C     . ILE A 1 411 ? 50.800 -6.733  9.210   1.00 45.18  ? 1281 ILE A C     1 
ATOM   5774 O  O     . ILE A 1 411 ? 50.683 -7.956  9.285   1.00 42.32  ? 1281 ILE A O     1 
ATOM   5775 C  CB    . ILE A 1 411 ? 48.486 -5.831  9.145   1.00 29.10  ? 1281 ILE A CB    1 
ATOM   5776 C  CG1   . ILE A 1 411 ? 47.450 -5.059  8.324   1.00 29.43  ? 1281 ILE A CG1   1 
ATOM   5777 C  CG2   . ILE A 1 411 ? 48.681 -5.190  10.512  1.00 36.90  ? 1281 ILE A CG2   1 
ATOM   5778 C  CD1   . ILE A 1 411 ? 46.136 -4.831  9.043   1.00 36.87  ? 1281 ILE A CD1   1 
ATOM   5779 H  H     . ILE A 1 411 ? 49.191 -7.159  7.005   1.00 41.04  ? 1281 ILE A H     1 
ATOM   5780 H  HA    . ILE A 1 411 ? 50.185 -4.989  8.324   1.00 43.16  ? 1281 ILE A HA    1 
ATOM   5781 H  HB    . ILE A 1 411 ? 48.161 -6.736  9.276   1.00 34.86  ? 1281 ILE A HB    1 
ATOM   5782 H  HG12  . ILE A 1 411 ? 47.817 -4.191  8.096   1.00 35.26  ? 1281 ILE A HG12  1 
ATOM   5783 H  HG13  . ILE A 1 411 ? 47.261 -5.558  7.513   1.00 35.26  ? 1281 ILE A HG13  1 
ATOM   5784 H  HG21  . ILE A 1 411 ? 47.835 -5.158  10.965  1.00 44.22  ? 1281 ILE A HG21  1 
ATOM   5785 H  HG22  . ILE A 1 411 ? 49.305 -5.715  11.018  1.00 44.22  ? 1281 ILE A HG22  1 
ATOM   5786 H  HG23  . ILE A 1 411 ? 49.022 -4.300  10.393  1.00 44.22  ? 1281 ILE A HG23  1 
ATOM   5787 H  HD11  . ILE A 1 411 ? 45.544 -4.344  8.465   1.00 44.18  ? 1281 ILE A HD11  1 
ATOM   5788 H  HD12  . ILE A 1 411 ? 45.750 -5.682  9.265   1.00 44.18  ? 1281 ILE A HD12  1 
ATOM   5789 H  HD13  . ILE A 1 411 ? 46.301 -4.327  9.843   1.00 44.18  ? 1281 ILE A HD13  1 
ATOM   5790 N  N     . LYS A 1 412 ? 51.757 -6.054  9.835   1.00 41.23  ? 1282 LYS A N     1 
ATOM   5791 C  CA    . LYS A 1 412 ? 52.648 -6.687  10.795  1.00 38.98  ? 1282 LYS A CA    1 
ATOM   5792 C  C     . LYS A 1 412 ? 52.022 -6.586  12.179  1.00 47.34  ? 1282 LYS A C     1 
ATOM   5793 O  O     . LYS A 1 412 ? 52.094 -5.546  12.834  1.00 41.32  ? 1282 LYS A O     1 
ATOM   5794 C  CB    . LYS A 1 412 ? 54.030 -6.025  10.777  1.00 44.38  ? 1282 LYS A CB    1 
ATOM   5795 C  CG    . LYS A 1 412 ? 54.811 -6.246  9.487   1.00 55.11  ? 1282 LYS A CG    1 
ATOM   5796 C  CD    . LYS A 1 412 ? 55.010 -7.729  9.202   1.00 62.81  ? 1282 LYS A CD    1 
ATOM   5797 C  CE    . LYS A 1 412 ? 56.086 -8.337  10.091  1.00 69.39  ? 1282 LYS A CE    1 
ATOM   5798 N  NZ    . LYS A 1 412 ? 55.790 -9.754  10.443  1.00 61.09  ? 1282 LYS A NZ    1 
ATOM   5799 H  H     . LYS A 1 412 ? 51.910 -5.216  9.717   1.00 49.42  ? 1282 LYS A H     1 
ATOM   5800 H  HA    . LYS A 1 412 ? 52.754 -7.635  10.569  1.00 46.72  ? 1282 LYS A HA    1 
ATOM   5801 H  HB2   . LYS A 1 412 ? 53.918 -5.068  10.894  1.00 53.20  ? 1282 LYS A HB2   1 
ATOM   5802 H  HB3   . LYS A 1 412 ? 54.557 -6.385  11.507  1.00 53.20  ? 1282 LYS A HB3   1 
ATOM   5803 H  HG2   . LYS A 1 412 ? 54.322 -5.857  8.745   1.00 66.07  ? 1282 LYS A HG2   1 
ATOM   5804 H  HG3   . LYS A 1 412 ? 55.685 -5.832  9.566   1.00 66.07  ? 1282 LYS A HG3   1 
ATOM   5805 H  HD2   . LYS A 1 412 ? 54.178 -8.200  9.369   1.00 75.32  ? 1282 LYS A HD2   1 
ATOM   5806 H  HD3   . LYS A 1 412 ? 55.280 -7.843  8.278   1.00 75.32  ? 1282 LYS A HD3   1 
ATOM   5807 H  HE2   . LYS A 1 412 ? 56.936 -8.313  9.624   1.00 83.21  ? 1282 LYS A HE2   1 
ATOM   5808 H  HE3   . LYS A 1 412 ? 56.144 -7.828  10.915  1.00 83.21  ? 1282 LYS A HE3   1 
ATOM   5809 H  HZ1   . LYS A 1 412 ? 55.737 -10.245 9.703   1.00 73.25  ? 1282 LYS A HZ1   1 
ATOM   5810 H  HZ2   . LYS A 1 412 ? 56.435 -10.080 10.961  1.00 73.25  ? 1282 LYS A HZ2   1 
ATOM   5811 H  HZ3   . LYS A 1 412 ? 55.016 -9.803  10.879  1.00 73.25  ? 1282 LYS A HZ3   1 
ATOM   5812 N  N     . VAL A 1 413 ? 51.397 -7.676  12.610  1.00 34.09  ? 1283 VAL A N     1 
ATOM   5813 C  CA    . VAL A 1 413 ? 50.666 -7.707  13.868  1.00 34.02  ? 1283 VAL A CA    1 
ATOM   5814 C  C     . VAL A 1 413 ? 51.596 -8.060  15.022  1.00 39.16  ? 1283 VAL A C     1 
ATOM   5815 O  O     . VAL A 1 413 ? 52.140 -9.162  15.075  1.00 38.62  ? 1283 VAL A O     1 
ATOM   5816 C  CB    . VAL A 1 413 ? 49.517 -8.732  13.799  1.00 31.14  ? 1283 VAL A CB    1 
ATOM   5817 C  CG1   . VAL A 1 413 ? 48.780 -8.801  15.124  1.00 32.67  ? 1283 VAL A CG1   1 
ATOM   5818 C  CG2   . VAL A 1 413 ? 48.564 -8.374  12.670  1.00 34.21  ? 1283 VAL A CG2   1 
ATOM   5819 H  H     . VAL A 1 413 ? 51.383 -8.422  12.183  1.00 40.86  ? 1283 VAL A H     1 
ATOM   5820 H  HA    . VAL A 1 413 ? 50.281 -6.823  14.041  1.00 40.76  ? 1283 VAL A HA    1 
ATOM   5821 H  HB    . VAL A 1 413 ? 49.890 -9.619  13.612  1.00 37.31  ? 1283 VAL A HB    1 
ATOM   5822 H  HG11  . VAL A 1 413 ? 48.072 -9.444  15.055  1.00 39.15  ? 1283 VAL A HG11  1 
ATOM   5823 H  HG12  . VAL A 1 413 ? 49.397 -9.065  15.811  1.00 39.15  ? 1283 VAL A HG12  1 
ATOM   5824 H  HG13  . VAL A 1 413 ? 48.418 -7.935  15.325  1.00 39.15  ? 1283 VAL A HG13  1 
ATOM   5825 H  HG21  . VAL A 1 413 ? 47.856 -9.022  12.643  1.00 41.00  ? 1283 VAL A HG21  1 
ATOM   5826 H  HG22  . VAL A 1 413 ? 48.202 -7.500  12.832  1.00 41.00  ? 1283 VAL A HG22  1 
ATOM   5827 H  HG23  . VAL A 1 413 ? 49.047 -8.380  11.840  1.00 41.00  ? 1283 VAL A HG23  1 
ATOM   5828 N  N     . SER A 1 414 ? 51.768 -7.120  15.948  1.00 36.88  ? 1284 SER A N     1 
ATOM   5829 C  CA    . SER A 1 414 ? 52.706 -7.288  17.053  1.00 47.74  ? 1284 SER A CA    1 
ATOM   5830 C  C     . SER A 1 414 ? 52.043 -7.809  18.329  1.00 48.64  ? 1284 SER A C     1 
ATOM   5831 O  O     . SER A 1 414 ? 52.719 -8.335  19.210  1.00 42.76  ? 1284 SER A O     1 
ATOM   5832 C  CB    . SER A 1 414 ? 53.410 -5.961  17.345  1.00 49.67  ? 1284 SER A CB    1 
ATOM   5833 O  OG    . SER A 1 414 ? 52.477 -4.951  17.693  1.00 48.20  ? 1284 SER A OG    1 
ATOM   5834 H  H     . SER A 1 414 ? 51.349 -6.369  15.957  1.00 44.20  ? 1284 SER A H     1 
ATOM   5835 H  HA    . SER A 1 414 ? 53.391 -7.937  16.788  1.00 57.23  ? 1284 SER A HA    1 
ATOM   5836 H  HB2   . SER A 1 414 ? 54.027 -6.088  18.083  1.00 59.54  ? 1284 SER A HB2   1 
ATOM   5837 H  HB3   . SER A 1 414 ? 53.895 -5.681  16.553  1.00 59.54  ? 1284 SER A HB3   1 
ATOM   5838 H  HG    . SER A 1 414 ? 52.870 -4.248  17.846  1.00 57.78  ? 1284 SER A HG    1 
ATOM   5839 N  N     . ASP A 1 415 ? 50.726 -7.665  18.432  1.00 39.25  ? 1285 ASP A N     1 
ATOM   5840 C  CA    . ASP A 1 415 ? 50.008 -8.129  19.615  1.00 39.28  ? 1285 ASP A CA    1 
ATOM   5841 C  C     . ASP A 1 415 ? 49.705 -9.616  19.497  1.00 32.70  ? 1285 ASP A C     1 
ATOM   5842 O  O     . ASP A 1 415 ? 49.016 -10.034 18.570  1.00 32.87  ? 1285 ASP A O     1 
ATOM   5843 C  CB    . ASP A 1 415 ? 48.697 -7.371  19.793  1.00 33.91  ? 1285 ASP A CB    1 
ATOM   5844 C  CG    . ASP A 1 415 ? 47.876 -7.907  20.949  1.00 57.52  ? 1285 ASP A CG    1 
ATOM   5845 O  OD1   . ASP A 1 415 ? 48.437 -8.053  22.056  1.00 54.97  ? 1285 ASP A OD1   1 
ATOM   5846 O  OD2   . ASP A 1 415 ? 46.680 -8.206  20.752  1.00 41.65  ? 1285 ASP A OD2   1 
ATOM   5847 H  H     . ASP A 1 415 ? 50.225 -7.303  17.833  1.00 47.05  ? 1285 ASP A H     1 
ATOM   5848 H  HA    . ASP A 1 415 ? 50.561 -7.986  20.411  1.00 47.08  ? 1285 ASP A HA    1 
ATOM   5849 H  HB2   . ASP A 1 415 ? 48.891 -6.437  19.968  1.00 40.64  ? 1285 ASP A HB2   1 
ATOM   5850 H  HB3   . ASP A 1 415 ? 48.168 -7.456  18.984  1.00 40.64  ? 1285 ASP A HB3   1 
ATOM   5851 N  N     . PRO A 1 416 ? 50.209 -10.421 20.444  1.00 39.81  ? 1286 PRO A N     1 
ATOM   5852 C  CA    . PRO A 1 416 ? 50.053 -11.879 20.380  1.00 37.78  ? 1286 PRO A CA    1 
ATOM   5853 C  C     . PRO A 1 416 ? 48.601 -12.347 20.275  1.00 29.43  ? 1286 PRO A C     1 
ATOM   5854 O  O     . PRO A 1 416 ? 48.311 -13.254 19.499  1.00 32.74  ? 1286 PRO A O     1 
ATOM   5855 C  CB    . PRO A 1 416 ? 50.667 -12.352 21.701  1.00 37.79  ? 1286 PRO A CB    1 
ATOM   5856 C  CG    . PRO A 1 416 ? 51.640 -11.289 22.062  1.00 52.55  ? 1286 PRO A CG    1 
ATOM   5857 C  CD    . PRO A 1 416 ? 51.022 -10.005 21.599  1.00 43.56  ? 1286 PRO A CD    1 
ATOM   5858 H  HA    . PRO A 1 416 ? 50.569 -12.246 19.632  1.00 45.28  ? 1286 PRO A HA    1 
ATOM   5859 H  HB2   . PRO A 1 416 ? 49.975 -12.430 22.376  1.00 45.29  ? 1286 PRO A HB2   1 
ATOM   5860 H  HB3   . PRO A 1 416 ? 51.118 -13.201 21.569  1.00 45.29  ? 1286 PRO A HB3   1 
ATOM   5861 H  HG2   . PRO A 1 416 ? 51.770 -11.279 23.023  1.00 63.01  ? 1286 PRO A HG2   1 
ATOM   5862 H  HG3   . PRO A 1 416 ? 52.481 -11.448 21.604  1.00 63.01  ? 1286 PRO A HG3   1 
ATOM   5863 H  HD2   . PRO A 1 416 ? 50.458 -9.632  22.294  1.00 52.21  ? 1286 PRO A HD2   1 
ATOM   5864 H  HD3   . PRO A 1 416 ? 51.709 -9.379  21.323  1.00 52.21  ? 1286 PRO A HD3   1 
ATOM   5865 N  N     . LYS A 1 417 ? 47.705 -11.747 21.050  1.00 29.90  ? 1287 LYS A N     1 
ATOM   5866 C  CA    . LYS A 1 417 ? 46.315 -12.190 21.088  1.00 28.74  ? 1287 LYS A CA    1 
ATOM   5867 C  C     . LYS A 1 417 ? 45.620 -11.960 19.745  1.00 33.60  ? 1287 LYS A C     1 
ATOM   5868 O  O     . LYS A 1 417 ? 44.913 -12.833 19.245  1.00 29.51  ? 1287 LYS A O     1 
ATOM   5869 C  CB    . LYS A 1 417 ? 45.562 -11.470 22.209  1.00 30.51  ? 1287 LYS A CB    1 
ATOM   5870 C  CG    . LYS A 1 417 ? 44.122 -11.934 22.408  1.00 45.50  ? 1287 LYS A CG    1 
ATOM   5871 C  CD    . LYS A 1 417 ? 43.490 -11.246 23.617  1.00 61.61  ? 1287 LYS A CD    1 
ATOM   5872 C  CE    . LYS A 1 417 ? 41.970 -11.290 23.583  1.00 76.22  ? 1287 LYS A CE    1 
ATOM   5873 N  NZ    . LYS A 1 417 ? 41.388 -12.514 24.204  1.00 67.45  ? 1287 LYS A NZ    1 
ATOM   5874 H  H     . LYS A 1 417 ? 47.876 -11.080 21.565  1.00 35.82  ? 1287 LYS A H     1 
ATOM   5875 H  HA    . LYS A 1 417 ? 46.292 -13.151 21.278  1.00 34.43  ? 1287 LYS A HA    1 
ATOM   5876 H  HB2   . LYS A 1 417 ? 46.035 -11.615 23.043  1.00 36.56  ? 1287 LYS A HB2   1 
ATOM   5877 H  HB3   . LYS A 1 417 ? 45.539 -10.521 22.007  1.00 36.56  ? 1287 LYS A HB3   1 
ATOM   5878 H  HG2   . LYS A 1 417 ? 43.599 -11.711 21.622  1.00 54.54  ? 1287 LYS A HG2   1 
ATOM   5879 H  HG3   . LYS A 1 417 ? 44.110 -12.892 22.561  1.00 54.54  ? 1287 LYS A HG3   1 
ATOM   5880 H  HD2   . LYS A 1 417 ? 43.786 -11.692 24.426  1.00 73.88  ? 1287 LYS A HD2   1 
ATOM   5881 H  HD3   . LYS A 1 417 ? 43.764 -10.316 23.630  1.00 73.88  ? 1287 LYS A HD3   1 
ATOM   5882 H  HE2   . LYS A 1 417 ? 41.625 -10.521 24.063  1.00 91.41  ? 1287 LYS A HE2   1 
ATOM   5883 H  HE3   . LYS A 1 417 ? 41.677 -11.259 22.659  1.00 91.41  ? 1287 LYS A HE3   1 
ATOM   5884 H  HZ1   . LYS A 1 417 ? 40.499 -12.486 24.156  1.00 80.88  ? 1287 LYS A HZ1   1 
ATOM   5885 H  HZ2   . LYS A 1 417 ? 41.677 -13.239 23.777  1.00 80.88  ? 1287 LYS A HZ2   1 
ATOM   5886 H  HZ3   . LYS A 1 417 ? 41.630 -12.565 25.059  1.00 80.88  ? 1287 LYS A HZ3   1 
ATOM   5887 N  N     . LEU A 1 418 ? 45.821 -10.782 19.163  1.00 30.63  ? 1288 LEU A N     1 
ATOM   5888 C  CA    . LEU A 1 418 ? 45.226 -10.473 17.869  1.00 25.09  ? 1288 LEU A CA    1 
ATOM   5889 C  C     . LEU A 1 418 ? 45.850 -11.336 16.780  1.00 28.25  ? 1288 LEU A C     1 
ATOM   5890 O  O     . LEU A 1 418 ? 45.151 -11.841 15.899  1.00 25.27  ? 1288 LEU A O     1 
ATOM   5891 C  CB    . LEU A 1 418 ? 45.403 -8.991  17.531  1.00 23.65  ? 1288 LEU A CB    1 
ATOM   5892 C  CG    . LEU A 1 418 ? 45.010 -8.610  16.100  1.00 28.28  ? 1288 LEU A CG    1 
ATOM   5893 C  CD1   . LEU A 1 418 ? 43.552 -8.960  15.820  1.00 27.55  ? 1288 LEU A CD1   1 
ATOM   5894 C  CD2   . LEU A 1 418 ? 45.263 -7.132  15.851  1.00 32.31  ? 1288 LEU A CD2   1 
ATOM   5895 H  H     . LEU A 1 418 ? 46.296 -10.147 19.496  1.00 36.70  ? 1288 LEU A H     1 
ATOM   5896 H  HA    . LEU A 1 418 ? 44.266 -10.667 17.901  1.00 30.05  ? 1288 LEU A HA    1 
ATOM   5897 H  HB2   . LEU A 1 418 ? 44.853 -8.467  18.135  1.00 28.33  ? 1288 LEU A HB2   1 
ATOM   5898 H  HB3   . LEU A 1 418 ? 46.336 -8.755  17.652  1.00 28.33  ? 1288 LEU A HB3   1 
ATOM   5899 H  HG    . LEU A 1 418 ? 45.560 -9.114  15.480  1.00 33.88  ? 1288 LEU A HG    1 
ATOM   5900 H  HD11  . LEU A 1 418 ? 43.339 -8.710  14.919  1.00 33.00  ? 1288 LEU A HD11  1 
ATOM   5901 H  HD12  . LEU A 1 418 ? 43.430 -9.905  15.936  1.00 33.00  ? 1288 LEU A HD12  1 
ATOM   5902 H  HD13  . LEU A 1 418 ? 42.992 -8.480  16.435  1.00 33.00  ? 1288 LEU A HD13  1 
ATOM   5903 H  HD21  . LEU A 1 418 ? 45.009 -6.920  14.950  1.00 38.72  ? 1288 LEU A HD21  1 
ATOM   5904 H  HD22  . LEU A 1 418 ? 44.739 -6.617  16.469  1.00 38.72  ? 1288 LEU A HD22  1 
ATOM   5905 H  HD23  . LEU A 1 418 ? 46.196 -6.949  15.980  1.00 38.72  ? 1288 LEU A HD23  1 
ATOM   5906 N  N     . PHE A 1 419 ? 47.167 -11.511 16.844  1.00 24.03  ? 1289 PHE A N     1 
ATOM   5907 C  CA    . PHE A 1 419 ? 47.866 -12.324 15.857  1.00 31.39  ? 1289 PHE A CA    1 
ATOM   5908 C  C     . PHE A 1 419 ? 47.315 -13.741 15.845  1.00 29.07  ? 1289 PHE A C     1 
ATOM   5909 O  O     . PHE A 1 419 ? 47.085 -14.304 14.783  1.00 28.39  ? 1289 PHE A O     1 
ATOM   5910 C  CB    . PHE A 1 419 ? 49.370 -12.371 16.129  1.00 27.25  ? 1289 PHE A CB    1 
ATOM   5911 C  CG    . PHE A 1 419 ? 50.083 -13.440 15.351  1.00 33.29  ? 1289 PHE A CG    1 
ATOM   5912 C  CD1   . PHE A 1 419 ? 50.470 -13.220 14.039  1.00 35.60  ? 1289 PHE A CD1   1 
ATOM   5913 C  CD2   . PHE A 1 419 ? 50.350 -14.676 15.925  1.00 36.11  ? 1289 PHE A CD2   1 
ATOM   5914 C  CE1   . PHE A 1 419 ? 51.118 -14.209 13.314  1.00 32.53  ? 1289 PHE A CE1   1 
ATOM   5915 C  CE2   . PHE A 1 419 ? 50.997 -15.666 15.208  1.00 32.84  ? 1289 PHE A CE2   1 
ATOM   5916 C  CZ    . PHE A 1 419 ? 51.381 -15.433 13.901  1.00 29.99  ? 1289 PHE A CZ    1 
ATOM   5917 H  H     . PHE A 1 419 ? 47.676 -11.170 17.447  1.00 28.78  ? 1289 PHE A H     1 
ATOM   5918 H  HA    . PHE A 1 419 ? 47.730 -11.936 14.967  1.00 37.61  ? 1289 PHE A HA    1 
ATOM   5919 H  HB2   . PHE A 1 419 ? 49.760 -11.516 15.888  1.00 32.64  ? 1289 PHE A HB2   1 
ATOM   5920 H  HB3   . PHE A 1 419 ? 49.513 -12.544 17.073  1.00 32.64  ? 1289 PHE A HB3   1 
ATOM   5921 H  HD1   . PHE A 1 419 ? 50.295 -12.398 13.639  1.00 42.66  ? 1289 PHE A HD1   1 
ATOM   5922 H  HD2   . PHE A 1 419 ? 50.092 -14.838 16.804  1.00 43.28  ? 1289 PHE A HD2   1 
ATOM   5923 H  HE1   . PHE A 1 419 ? 51.377 -14.049 12.435  1.00 38.98  ? 1289 PHE A HE1   1 
ATOM   5924 H  HE2   . PHE A 1 419 ? 51.172 -16.489 15.605  1.00 39.35  ? 1289 PHE A HE2   1 
ATOM   5925 H  HZ    . PHE A 1 419 ? 51.817 -16.097 13.418  1.00 35.94  ? 1289 PHE A HZ    1 
ATOM   5926 N  N     . GLU A 1 420 ? 47.105 -14.314 17.026  1.00 27.08  ? 1290 GLU A N     1 
ATOM   5927 C  CA    . GLU A 1 420 ? 46.619 -15.688 17.123  1.00 35.82  ? 1290 GLU A CA    1 
ATOM   5928 C  C     . GLU A 1 420 ? 45.217 -15.828 16.543  1.00 30.93  ? 1290 GLU A C     1 
ATOM   5929 O  O     . GLU A 1 420 ? 44.899 -16.842 15.926  1.00 25.83  ? 1290 GLU A O     1 
ATOM   5930 C  CB    . GLU A 1 420 ? 46.627 -16.171 18.574  1.00 29.56  ? 1290 GLU A CB    1 
ATOM   5931 C  CG    . GLU A 1 420 ? 48.016 -16.336 19.145  1.00 31.31  ? 1290 GLU A CG    1 
ATOM   5932 C  CD    . GLU A 1 420 ? 48.015 -17.027 20.493  1.00 46.56  ? 1290 GLU A CD    1 
ATOM   5933 O  OE1   . GLU A 1 420 ? 46.946 -17.510 20.920  1.00 34.02  ? 1290 GLU A OE1   1 
ATOM   5934 O  OE2   . GLU A 1 420 ? 49.089 -17.088 21.122  1.00 38.96  ? 1290 GLU A OE2   1 
ATOM   5935 H  H     . GLU A 1 420 ? 47.235 -13.931 17.785  1.00 32.44  ? 1290 GLU A H     1 
ATOM   5936 H  HA    . GLU A 1 420 ? 47.216 -16.271 16.610  1.00 42.92  ? 1290 GLU A HA    1 
ATOM   5937 H  HB2   . GLU A 1 420 ? 46.155 -15.525 19.123  1.00 35.41  ? 1290 GLU A HB2   1 
ATOM   5938 H  HB3   . GLU A 1 420 ? 46.182 -17.031 18.621  1.00 35.41  ? 1290 GLU A HB3   1 
ATOM   5939 H  HG2   . GLU A 1 420 ? 48.547 -16.870 18.534  1.00 37.52  ? 1290 GLU A HG2   1 
ATOM   5940 H  HG3   . GLU A 1 420 ? 48.418 -15.460 19.257  1.00 37.52  ? 1290 GLU A HG3   1 
ATOM   5941 N  N     . MET A 1 421 ? 44.378 -14.817 16.746  1.00 27.74  ? 1291 MET A N     1 
ATOM   5942 C  CA    . MET A 1 421 ? 43.012 -14.862 16.229  1.00 25.06  ? 1291 MET A CA    1 
ATOM   5943 C  C     . MET A 1 421 ? 43.016 -14.870 14.709  1.00 22.54  ? 1291 MET A C     1 
ATOM   5944 O  O     . MET A 1 421 ? 42.276 -15.629 14.085  1.00 24.94  ? 1291 MET A O     1 
ATOM   5945 C  CB    . MET A 1 421 ? 42.198 -13.665 16.714  1.00 21.90  ? 1291 MET A CB    1 
ATOM   5946 C  CG    . MET A 1 421 ? 41.884 -13.665 18.196  1.00 25.17  ? 1291 MET A CG    1 
ATOM   5947 S  SD    . MET A 1 421 ? 41.029 -12.135 18.638  1.00 32.68  ? 1291 MET A SD    1 
ATOM   5948 C  CE    . MET A 1 421 ? 40.723 -12.390 20.383  1.00 31.86  ? 1291 MET A CE    1 
ATOM   5949 H  H     . MET A 1 421 ? 44.571 -14.098 17.176  1.00 33.24  ? 1291 MET A H     1 
ATOM   5950 H  HA    . MET A 1 421 ? 42.575 -15.677 16.552  1.00 30.01  ? 1291 MET A HA    1 
ATOM   5951 H  HB2   . MET A 1 421 ? 42.695 -12.855 16.520  1.00 26.23  ? 1291 MET A HB2   1 
ATOM   5952 H  HB3   . MET A 1 421 ? 41.355 -13.651 16.236  1.00 26.23  ? 1291 MET A HB3   1 
ATOM   5953 H  HG2   . MET A 1 421 ? 41.305 -14.415 18.406  1.00 30.15  ? 1291 MET A HG2   1 
ATOM   5954 H  HG3   . MET A 1 421 ? 42.708 -13.717 18.704  1.00 30.15  ? 1291 MET A HG3   1 
ATOM   5955 H  HE1   . MET A 1 421 ? 40.263 -11.624 20.734  1.00 38.17  ? 1291 MET A HE1   1 
ATOM   5956 H  HE2   . MET A 1 421 ? 40.183 -13.176 20.493  1.00 38.17  ? 1291 MET A HE2   1 
ATOM   5957 H  HE3   . MET A 1 421 ? 41.563 -12.504 20.834  1.00 38.17  ? 1291 MET A HE3   1 
ATOM   5958 N  N     . ILE A 1 422 ? 43.839 -14.015 14.111  1.00 26.94  ? 1292 ILE A N     1 
ATOM   5959 C  CA    . ILE A 1 422 ? 43.903 -13.927 12.656  1.00 27.43  ? 1292 ILE A CA    1 
ATOM   5960 C  C     . ILE A 1 422 ? 44.477 -15.213 12.066  1.00 27.69  ? 1292 ILE A C     1 
ATOM   5961 O  O     . ILE A 1 422 ? 43.897 -15.801 11.157  1.00 28.73  ? 1292 ILE A O     1 
ATOM   5962 C  CB    . ILE A 1 422 ? 44.766 -12.744 12.207  1.00 21.62  ? 1292 ILE A CB    1 
ATOM   5963 C  CG1   . ILE A 1 422 ? 44.164 -11.427 12.706  1.00 20.15  ? 1292 ILE A CG1   1 
ATOM   5964 C  CG2   . ILE A 1 422 ? 44.879 -12.723 10.687  1.00 25.12  ? 1292 ILE A CG2   1 
ATOM   5965 C  CD1   . ILE A 1 422 ? 45.135 -10.260 12.663  1.00 27.24  ? 1292 ILE A CD1   1 
ATOM   5966 H  H     . ILE A 1 422 ? 44.369 -13.477 14.522  1.00 32.27  ? 1292 ILE A H     1 
ATOM   5967 H  HA    . ILE A 1 422 ? 42.999 -13.801 12.299  1.00 32.86  ? 1292 ILE A HA    1 
ATOM   5968 H  HB    . ILE A 1 422 ? 45.654 -12.844 12.584  1.00 25.89  ? 1292 ILE A HB    1 
ATOM   5969 H  HG12  . ILE A 1 422 ? 43.402 -11.201 12.151  1.00 24.13  ? 1292 ILE A HG12  1 
ATOM   5970 H  HG13  . ILE A 1 422 ? 43.879 -11.542 13.626  1.00 24.13  ? 1292 ILE A HG13  1 
ATOM   5971 H  HG21  . ILE A 1 422 ? 45.422 -11.976 10.425  1.00 30.08  ? 1292 ILE A HG21  1 
ATOM   5972 H  HG22  . ILE A 1 422 ? 45.284 -13.542 10.393  1.00 30.08  ? 1292 ILE A HG22  1 
ATOM   5973 H  HG23  . ILE A 1 422 ? 44.000 -12.637 10.310  1.00 30.08  ? 1292 ILE A HG23  1 
ATOM   5974 H  HD11  . ILE A 1 422 ? 44.691 -9.473  12.989  1.00 32.63  ? 1292 ILE A HD11  1 
ATOM   5975 H  HD12  . ILE A 1 422 ? 45.892 -10.462 13.217  1.00 32.63  ? 1292 ILE A HD12  1 
ATOM   5976 H  HD13  . ILE A 1 422 ? 45.419 -10.124 11.756  1.00 32.63  ? 1292 ILE A HD13  1 
ATOM   5977 N  N     . LYS A 1 423 ? 45.620 -15.644 12.592  1.00 25.28  ? 1293 LYS A N     1 
ATOM   5978 C  CA    . LYS A 1 423 ? 46.283 -16.851 12.103  1.00 28.81  ? 1293 LYS A CA    1 
ATOM   5979 C  C     . LYS A 1 423 ? 45.363 -18.060 12.237  1.00 21.26  ? 1293 LYS A C     1 
ATOM   5980 O  O     . LYS A 1 423 ? 45.392 -18.965 11.405  1.00 25.99  ? 1293 LYS A O     1 
ATOM   5981 C  CB    . LYS A 1 423 ? 47.589 -17.103 12.864  1.00 30.21  ? 1293 LYS A CB    1 
ATOM   5982 C  CG    . LYS A 1 423 ? 48.390 -18.300 12.354  1.00 42.14  ? 1293 LYS A CG    1 
ATOM   5983 C  CD    . LYS A 1 423 ? 49.504 -17.878 11.412  1.00 31.39  ? 1293 LYS A CD    1 
ATOM   5984 C  CE    . LYS A 1 423 ? 50.313 -19.076 10.936  1.00 37.79  ? 1293 LYS A CE    1 
ATOM   5985 N  NZ    . LYS A 1 423 ? 51.630 -18.676 10.376  1.00 37.22  ? 1293 LYS A NZ    1 
ATOM   5986 H  H     . LYS A 1 423 ? 46.034 -15.254 13.237  1.00 30.28  ? 1293 LYS A H     1 
ATOM   5987 H  HA    . LYS A 1 423 ? 46.500 -16.737 11.154  1.00 34.51  ? 1293 LYS A HA    1 
ATOM   5988 H  HB2   . LYS A 1 423 ? 48.151 -16.316 12.785  1.00 36.19  ? 1293 LYS A HB2   1 
ATOM   5989 H  HB3   . LYS A 1 423 ? 47.379 -17.263 13.797  1.00 36.19  ? 1293 LYS A HB3   1 
ATOM   5990 H  HG2   . LYS A 1 423 ? 48.789 -18.760 13.109  1.00 50.51  ? 1293 LYS A HG2   1 
ATOM   5991 H  HG3   . LYS A 1 423 ? 47.797 -18.898 11.873  1.00 50.51  ? 1293 LYS A HG3   1 
ATOM   5992 H  HD2   . LYS A 1 423 ? 49.119 -17.442 10.636  1.00 37.62  ? 1293 LYS A HD2   1 
ATOM   5993 H  HD3   . LYS A 1 423 ? 50.103 -17.271 11.876  1.00 37.62  ? 1293 LYS A HD3   1 
ATOM   5994 H  HE2   . LYS A 1 423 ? 50.471 -19.671 11.685  1.00 45.29  ? 1293 LYS A HE2   1 
ATOM   5995 H  HE3   . LYS A 1 423 ? 49.817 -19.538 10.241  1.00 45.29  ? 1293 LYS A HE3   1 
ATOM   5996 H  HZ1   . LYS A 1 423 ? 52.077 -19.397 10.107  1.00 44.61  ? 1293 LYS A HZ1   1 
ATOM   5997 H  HZ2   . LYS A 1 423 ? 51.513 -18.133 9.681   1.00 44.61  ? 1293 LYS A HZ2   1 
ATOM   5998 H  HZ3   . LYS A 1 423 ? 52.108 -18.254 10.996  1.00 44.61  ? 1293 LYS A HZ3   1 
ATOM   5999 N  N     . TYR A 1 424 ? 44.553 -18.077 13.291  1.00 24.50  ? 1294 TYR A N     1 
ATOM   6000 C  CA    . TYR A 1 424 ? 43.587 -19.154 13.495  1.00 26.01  ? 1294 TYR A CA    1 
ATOM   6001 C  C     . TYR A 1 424 ? 42.549 -19.135 12.378  1.00 36.60  ? 1294 TYR A C     1 
ATOM   6002 O  O     . TYR A 1 424 ? 42.212 -20.171 11.807  1.00 28.88  ? 1294 TYR A O     1 
ATOM   6003 C  CB    . TYR A 1 424 ? 42.896 -18.997 14.850  1.00 27.34  ? 1294 TYR A CB    1 
ATOM   6004 C  CG    . TYR A 1 424 ? 41.955 -20.127 15.214  1.00 34.05  ? 1294 TYR A CG    1 
ATOM   6005 C  CD1   . TYR A 1 424 ? 42.137 -21.407 14.705  1.00 32.89  ? 1294 TYR A CD1   1 
ATOM   6006 C  CD2   . TYR A 1 424 ? 40.882 -19.910 16.067  1.00 55.60  ? 1294 TYR A CD2   1 
ATOM   6007 C  CE1   . TYR A 1 424 ? 41.276 -22.438 15.040  1.00 38.81  ? 1294 TYR A CE1   1 
ATOM   6008 C  CE2   . TYR A 1 424 ? 40.016 -20.934 16.405  1.00 52.74  ? 1294 TYR A CE2   1 
ATOM   6009 C  CZ    . TYR A 1 424 ? 40.217 -22.195 15.888  1.00 42.48  ? 1294 TYR A CZ    1 
ATOM   6010 O  OH    . TYR A 1 424 ? 39.358 -23.217 16.224  1.00 59.04  ? 1294 TYR A OH    1 
ATOM   6011 H  H     . TYR A 1 424 ? 44.542 -17.475 13.905  1.00 29.35  ? 1294 TYR A H     1 
ATOM   6012 H  HA    . TYR A 1 424 ? 44.049 -20.018 13.479  1.00 31.16  ? 1294 TYR A HA    1 
ATOM   6013 H  HB2   . TYR A 1 424 ? 43.575 -18.946 15.541  1.00 32.76  ? 1294 TYR A HB2   1 
ATOM   6014 H  HB3   . TYR A 1 424 ? 42.379 -18.176 14.841  1.00 32.76  ? 1294 TYR A HB3   1 
ATOM   6015 H  HD1   . TYR A 1 424 ? 42.850 -21.574 14.132  1.00 39.41  ? 1294 TYR A HD1   1 
ATOM   6016 H  HD2   . TYR A 1 424 ? 40.742 -19.060 16.418  1.00 66.66  ? 1294 TYR A HD2   1 
ATOM   6017 H  HE1   . TYR A 1 424 ? 41.410 -23.290 14.691  1.00 46.52  ? 1294 TYR A HE1   1 
ATOM   6018 H  HE2   . TYR A 1 424 ? 39.302 -20.772 16.979  1.00 63.23  ? 1294 TYR A HE2   1 
ATOM   6019 H  HH    . TYR A 1 424 ? 38.595 -23.031 15.988  1.00 70.80  ? 1294 TYR A HH    1 
ATOM   6020 N  N     . CYS A 1 425 ? 42.037 -17.948 12.070  1.00 28.67  ? 1295 CYS A N     1 
ATOM   6021 C  CA    . CYS A 1 425 ? 41.101 -17.799 10.965  1.00 22.58  ? 1295 CYS A CA    1 
ATOM   6022 C  C     . CYS A 1 425 ? 41.728 -18.275 9.660   1.00 26.02  ? 1295 CYS A C     1 
ATOM   6023 O  O     . CYS A 1 425 ? 41.073 -18.947 8.868   1.00 26.36  ? 1295 CYS A O     1 
ATOM   6024 C  CB    . CYS A 1 425 ? 40.651 -16.346 10.822  1.00 24.28  ? 1295 CYS A CB    1 
ATOM   6025 S  SG    . CYS A 1 425 ? 39.837 -16.007 9.245   1.00 35.72  ? 1295 CYS A SG    1 
ATOM   6026 H  H     . CYS A 1 425 ? 42.215 -17.216 12.485  1.00 34.35  ? 1295 CYS A H     1 
ATOM   6027 H  HA    . CYS A 1 425 ? 40.308 -18.348 11.140  1.00 27.05  ? 1295 CYS A HA    1 
ATOM   6028 H  HB2   . CYS A 1 425 ? 40.024 -16.139 11.533  1.00 29.08  ? 1295 CYS A HB2   1 
ATOM   6029 H  HB3   . CYS A 1 425 ? 41.428 -15.768 10.888  1.00 29.08  ? 1295 CYS A HB3   1 
ATOM   6030 H  HG    . CYS A 1 425 ? 40.602 -16.246 8.352   1.00 42.81  ? 1295 CYS A HG    1 
ATOM   6031 N  N     . LEU A 1 426 ? 42.993 -17.926 9.436   1.00 23.23  ? 1296 LEU A N     1 
ATOM   6032 C  CA    . LEU A 1 426 ? 43.684 -18.322 8.212   1.00 23.39  ? 1296 LEU A CA    1 
ATOM   6033 C  C     . LEU A 1 426 ? 43.798 -19.840 8.152   1.00 29.87  ? 1296 LEU A C     1 
ATOM   6034 O  O     . LEU A 1 426 ? 43.669 -20.441 7.091   1.00 26.48  ? 1296 LEU A O     1 
ATOM   6035 C  CB    . LEU A 1 426 ? 45.087 -17.716 8.150   1.00 26.53  ? 1296 LEU A CB    1 
ATOM   6036 C  CG    . LEU A 1 426 ? 45.224 -16.192 8.163   1.00 32.80  ? 1296 LEU A CG    1 
ATOM   6037 C  CD1   . LEU A 1 426 ? 46.684 -15.817 7.981   1.00 30.31  ? 1296 LEU A CD1   1 
ATOM   6038 C  CD2   . LEU A 1 426 ? 44.360 -15.542 7.085   1.00 25.35  ? 1296 LEU A CD2   1 
ATOM   6039 H  H     . LEU A 1 426 ? 43.473 -17.461 9.976   1.00 27.81  ? 1296 LEU A H     1 
ATOM   6040 H  HA    . LEU A 1 426 ? 43.175 -18.015 7.433   1.00 28.01  ? 1296 LEU A HA    1 
ATOM   6041 H  HB2   . LEU A 1 426 ? 45.588 -18.049 8.911   1.00 31.79  ? 1296 LEU A HB2   1 
ATOM   6042 H  HB3   . LEU A 1 426 ? 45.508 -18.028 7.334   1.00 31.79  ? 1296 LEU A HB3   1 
ATOM   6043 H  HG    . LEU A 1 426 ? 44.932 -15.856 9.024   1.00 39.31  ? 1296 LEU A HG    1 
ATOM   6044 H  HD11  . LEU A 1 426 ? 46.764 -14.860 7.990   1.00 36.32  ? 1296 LEU A HD11  1 
ATOM   6045 H  HD12  . LEU A 1 426 ? 47.195 -16.195 8.700   1.00 36.32  ? 1296 LEU A HD12  1 
ATOM   6046 H  HD13  . LEU A 1 426 ? 46.993 -16.164 7.141   1.00 36.32  ? 1296 LEU A HD13  1 
ATOM   6047 H  HD21  . LEU A 1 426 ? 44.473 -14.590 7.126   1.00 30.36  ? 1296 LEU A HD21  1 
ATOM   6048 H  HD22  . LEU A 1 426 ? 44.635 -15.868 6.225   1.00 30.36  ? 1296 LEU A HD22  1 
ATOM   6049 H  HD23  . LEU A 1 426 ? 43.440 -15.769 7.243   1.00 30.36  ? 1296 LEU A HD23  1 
ATOM   6050 N  N     . LEU A 1 427 ? 44.049 -20.452 9.302   1.00 28.07  ? 1297 LEU A N     1 
ATOM   6051 C  CA    . LEU A 1 427 ? 44.205 -21.897 9.378   1.00 29.78  ? 1297 LEU A CA    1 
ATOM   6052 C  C     . LEU A 1 427 ? 42.900 -22.609 9.038   1.00 25.34  ? 1297 LEU A C     1 
ATOM   6053 O  O     . LEU A 1 427 ? 42.884 -23.546 8.243   1.00 28.16  ? 1297 LEU A O     1 
ATOM   6054 C  CB    . LEU A 1 427 ? 44.672 -22.301 10.776  1.00 27.38  ? 1297 LEU A CB    1 
ATOM   6055 C  CG    . LEU A 1 427 ? 44.637 -23.800 11.074  1.00 25.68  ? 1297 LEU A CG    1 
ATOM   6056 C  CD1   . LEU A 1 427 ? 45.498 -24.572 10.081  1.00 28.98  ? 1297 LEU A CD1   1 
ATOM   6057 C  CD2   . LEU A 1 427 ? 45.096 -24.055 12.500  1.00 30.13  ? 1297 LEU A CD2   1 
ATOM   6058 H  H     . LEU A 1 427 ? 44.134 -20.049 10.057  1.00 33.62  ? 1297 LEU A H     1 
ATOM   6059 H  HA    . LEU A 1 427 ? 44.886 -22.182 8.733   1.00 35.69  ? 1297 LEU A HA    1 
ATOM   6060 H  HB2   . LEU A 1 427 ? 45.587 -22.002 10.892  1.00 32.80  ? 1297 LEU A HB2   1 
ATOM   6061 H  HB3   . LEU A 1 427 ? 44.103 -21.862 11.428  1.00 32.80  ? 1297 LEU A HB3   1 
ATOM   6062 H  HG    . LEU A 1 427 ? 43.725 -24.118 10.991  1.00 30.76  ? 1297 LEU A HG    1 
ATOM   6063 H  HD11  . LEU A 1 427 ? 45.456 -25.508 10.293  1.00 34.72  ? 1297 LEU A HD11  1 
ATOM   6064 H  HD12  . LEU A 1 427 ? 45.161 -24.422 9.194   1.00 34.72  ? 1297 LEU A HD12  1 
ATOM   6065 H  HD13  . LEU A 1 427 ? 46.404 -24.261 10.145  1.00 34.72  ? 1297 LEU A HD13  1 
ATOM   6066 H  HD21  . LEU A 1 427 ? 45.070 -24.999 12.673  1.00 36.10  ? 1297 LEU A HD21  1 
ATOM   6067 H  HD22  . LEU A 1 427 ? 45.993 -23.728 12.603  1.00 36.10  ? 1297 LEU A HD22  1 
ATOM   6068 H  HD23  . LEU A 1 427 ? 44.509 -23.595 13.104  1.00 36.10  ? 1297 LEU A HD23  1 
ATOM   6069 N  N     . ARG A 1 428 ? 41.806 -22.168 9.650   1.00 25.90  ? 1298 ARG A N     1 
ATOM   6070 C  CA    . ARG A 1 428 ? 40.508 -22.795 9.437   1.00 28.32  ? 1298 ARG A CA    1 
ATOM   6071 C  C     . ARG A 1 428 ? 40.086 -22.698 7.975   1.00 26.75  ? 1298 ARG A C     1 
ATOM   6072 O  O     . ARG A 1 428 ? 39.566 -23.657 7.405   1.00 28.67  ? 1298 ARG A O     1 
ATOM   6073 C  CB    . ARG A 1 428 ? 39.445 -22.155 10.333  1.00 29.53  ? 1298 ARG A CB    1 
ATOM   6074 C  CG    . ARG A 1 428 ? 39.601 -22.492 11.807  1.00 42.66  ? 1298 ARG A CG    1 
ATOM   6075 C  CD    . ARG A 1 428 ? 38.411 -22.028 12.631  1.00 42.84  ? 1298 ARG A CD    1 
ATOM   6076 N  NE    . ARG A 1 428 ? 38.502 -20.618 13.005  1.00 61.73  ? 1298 ARG A NE    1 
ATOM   6077 C  CZ    . ARG A 1 428 ? 37.763 -19.644 12.479  1.00 66.62  ? 1298 ARG A CZ    1 
ATOM   6078 N  NH1   . ARG A 1 428 ? 36.857 -19.910 11.543  1.00 59.36  ? 1298 ARG A NH1   1 
ATOM   6079 N  NH2   . ARG A 1 428 ? 37.930 -18.395 12.899  1.00 51.68  ? 1298 ARG A NH2   1 
ATOM   6080 H  H     . ARG A 1 428 ? 41.790 -21.504 10.195  1.00 31.02  ? 1298 ARG A H     1 
ATOM   6081 H  HA    . ARG A 1 428 ? 40.570 -23.745 9.671   1.00 33.93  ? 1298 ARG A HA    1 
ATOM   6082 H  HB2   . ARG A 1 428 ? 39.499 -21.191 10.242  1.00 35.38  ? 1298 ARG A HB2   1 
ATOM   6083 H  HB3   . ARG A 1 428 ? 38.570 -22.464 10.050  1.00 35.38  ? 1298 ARG A HB3   1 
ATOM   6084 H  HG2   . ARG A 1 428 ? 39.681 -23.454 11.906  1.00 51.13  ? 1298 ARG A HG2   1 
ATOM   6085 H  HG3   . ARG A 1 428 ? 40.395 -22.054 12.150  1.00 51.13  ? 1298 ARG A HG3   1 
ATOM   6086 H  HD2   . ARG A 1 428 ? 37.600 -22.150 12.113  1.00 51.35  ? 1298 ARG A HD2   1 
ATOM   6087 H  HD3   . ARG A 1 428 ? 38.366 -22.553 13.446  1.00 51.35  ? 1298 ARG A HD3   1 
ATOM   6088 H  HE    . ARG A 1 428 ? 39.074 -20.402 13.610  1.00 74.02  ? 1298 ARG A HE    1 
ATOM   6089 H  HH11  . ARG A 1 428 ? 36.746 -20.718 11.269  1.00 71.18  ? 1298 ARG A HH11  1 
ATOM   6090 H  HH12  . ARG A 1 428 ? 36.384 -19.274 11.209  1.00 71.18  ? 1298 ARG A HH12  1 
ATOM   6091 H  HH21  . ARG A 1 428 ? 38.514 -18.220 13.504  1.00 61.96  ? 1298 ARG A HH21  1 
ATOM   6092 H  HH22  . ARG A 1 428 ? 37.455 -17.762 12.562  1.00 61.96  ? 1298 ARG A HH22  1 
ATOM   6093 N  N     . THR A 1 429 ? 40.318 -21.545 7.360   1.00 23.04  ? 1299 THR A N     1 
ATOM   6094 C  CA    . THR A 1 429 ? 39.883 -21.340 5.983   1.00 21.56  ? 1299 THR A CA    1 
ATOM   6095 C  C     . THR A 1 429 ? 40.841 -21.975 4.971   1.00 30.16  ? 1299 THR A C     1 
ATOM   6096 O  O     . THR A 1 429 ? 40.414 -22.447 3.919   1.00 30.05  ? 1299 THR A O     1 
ATOM   6097 C  CB    . THR A 1 429 ? 39.664 -19.838 5.668   1.00 25.31  ? 1299 THR A CB    1 
ATOM   6098 O  OG1   . THR A 1 429 ? 40.866 -19.102 5.928   1.00 29.75  ? 1299 THR A OG1   1 
ATOM   6099 C  CG2   . THR A 1 429 ? 38.532 -19.282 6.525   1.00 22.69  ? 1299 THR A CG2   1 
ATOM   6100 H  H     . THR A 1 429 ? 40.720 -20.871 7.713   1.00 27.59  ? 1299 THR A H     1 
ATOM   6101 H  HA    . THR A 1 429 ? 39.017 -21.784 5.872   1.00 25.82  ? 1299 THR A HA    1 
ATOM   6102 H  HB    . THR A 1 429 ? 39.420 -19.737 4.735   1.00 30.32  ? 1299 THR A HB    1 
ATOM   6103 H  HG1   . THR A 1 429 ? 41.476 -19.386 5.459   1.00 35.65  ? 1299 THR A HG1   1 
ATOM   6104 H  HG21  . THR A 1 429 ? 38.398 -18.352 6.328   1.00 27.17  ? 1299 THR A HG21  1 
ATOM   6105 H  HG22  . THR A 1 429 ? 37.719 -19.759 6.344   1.00 27.17  ? 1299 THR A HG22  1 
ATOM   6106 H  HG23  . THR A 1 429 ? 38.748 -19.376 7.456   1.00 27.17  ? 1299 THR A HG23  1 
ATOM   6107 N  N     . LEU A 1 430 ? 42.129 -22.000 5.286   1.00 31.74  ? 1300 LEU A N     1 
ATOM   6108 C  CA    . LEU A 1 430 ? 43.090 -22.669 4.420   1.00 30.84  ? 1300 LEU A CA    1 
ATOM   6109 C  C     . LEU A 1 430 ? 42.732 -24.146 4.365   1.00 31.74  ? 1300 LEU A C     1 
ATOM   6110 O  O     . LEU A 1 430 ? 42.722 -24.754 3.296   1.00 30.68  ? 1300 LEU A O     1 
ATOM   6111 C  CB    . LEU A 1 430 ? 44.522 -22.490 4.932   1.00 28.73  ? 1300 LEU A CB    1 
ATOM   6112 C  CG    . LEU A 1 430 ? 45.611 -23.167 4.091   1.00 35.09  ? 1300 LEU A CG    1 
ATOM   6113 C  CD1   . LEU A 1 430 ? 45.678 -22.566 2.696   1.00 32.12  ? 1300 LEU A CD1   1 
ATOM   6114 C  CD2   . LEU A 1 430 ? 46.971 -23.073 4.774   1.00 30.91  ? 1300 LEU A CD2   1 
ATOM   6115 H  H     . LEU A 1 430 ? 42.471 -21.641 5.989   1.00 38.03  ? 1300 LEU A H     1 
ATOM   6116 H  HA    . LEU A 1 430 ? 43.032 -22.298 3.514   1.00 36.95  ? 1300 LEU A HA    1 
ATOM   6117 H  HB2   . LEU A 1 430 ? 44.722 -21.541 4.958   1.00 34.42  ? 1300 LEU A HB2   1 
ATOM   6118 H  HB3   . LEU A 1 430 ? 44.575 -22.856 5.828   1.00 34.42  ? 1300 LEU A HB3   1 
ATOM   6119 H  HG    . LEU A 1 430 ? 45.392 -24.107 3.997   1.00 42.06  ? 1300 LEU A HG    1 
ATOM   6120 H  HD11  . LEU A 1 430 ? 46.367 -23.010 2.197   1.00 38.49  ? 1300 LEU A HD11  1 
ATOM   6121 H  HD12  . LEU A 1 430 ? 44.830 -22.686 2.263   1.00 38.49  ? 1300 LEU A HD12  1 
ATOM   6122 H  HD13  . LEU A 1 430 ? 45.879 -21.630 2.769   1.00 38.49  ? 1300 LEU A HD13  1 
ATOM   6123 H  HD21  . LEU A 1 430 ? 47.628 -23.506 4.224   1.00 37.04  ? 1300 LEU A HD21  1 
ATOM   6124 H  HD22  . LEU A 1 430 ? 47.198 -22.148 4.891   1.00 37.04  ? 1300 LEU A HD22  1 
ATOM   6125 H  HD23  . LEU A 1 430 ? 46.921 -23.509 5.629   1.00 37.04  ? 1300 LEU A HD23  1 
ATOM   6126 N  N     . LYS A 1 431 ? 42.418 -24.710 5.527   1.00 29.77  ? 1301 LYS A N     1 
ATOM   6127 C  CA    . LYS A 1 431 ? 42.049 -26.117 5.631   1.00 30.54  ? 1301 LYS A CA    1 
ATOM   6128 C  C     . LYS A 1 431 ? 40.746 -26.408 4.896   1.00 35.05  ? 1301 LYS A C     1 
ATOM   6129 O  O     . LYS A 1 431 ? 40.626 -27.415 4.202   1.00 37.84  ? 1301 LYS A O     1 
ATOM   6130 C  CB    . LYS A 1 431 ? 41.917 -26.522 7.101   1.00 37.73  ? 1301 LYS A CB    1 
ATOM   6131 C  CG    . LYS A 1 431 ? 41.422 -27.948 7.309   1.00 43.41  ? 1301 LYS A CG    1 
ATOM   6132 C  CD    . LYS A 1 431 ? 41.893 -28.509 8.642   1.00 53.06  ? 1301 LYS A CD    1 
ATOM   6133 C  CE    . LYS A 1 431 ? 41.563 -29.990 8.783   1.00 76.33  ? 1301 LYS A CE    1 
ATOM   6134 N  NZ    . LYS A 1 431 ? 40.128 -30.234 9.104   1.00 64.70  ? 1301 LYS A NZ    1 
ATOM   6135 H  H     . LYS A 1 431 ? 42.411 -24.293 6.279   1.00 35.67  ? 1301 LYS A H     1 
ATOM   6136 H  HA    . LYS A 1 431 ? 42.755 -26.664 5.227   1.00 36.59  ? 1301 LYS A HA    1 
ATOM   6137 H  HB2   . LYS A 1 431 ? 42.787 -26.447 7.525   1.00 45.22  ? 1301 LYS A HB2   1 
ATOM   6138 H  HB3   . LYS A 1 431 ? 41.288 -25.924 7.534   1.00 45.22  ? 1301 LYS A HB3   1 
ATOM   6139 H  HG2   . LYS A 1 431 ? 40.452 -27.954 7.301   1.00 52.04  ? 1301 LYS A HG2   1 
ATOM   6140 H  HG3   . LYS A 1 431 ? 41.768 -28.514 6.601   1.00 52.04  ? 1301 LYS A HG3   1 
ATOM   6141 H  HD2   . LYS A 1 431 ? 42.855 -28.405 8.710   1.00 63.62  ? 1301 LYS A HD2   1 
ATOM   6142 H  HD3   . LYS A 1 431 ? 41.453 -28.031 9.363   1.00 63.62  ? 1301 LYS A HD3   1 
ATOM   6143 H  HE2   . LYS A 1 431 ? 41.764 -30.439 7.947   1.00 91.54  ? 1301 LYS A HE2   1 
ATOM   6144 H  HE3   . LYS A 1 431 ? 42.099 -30.367 9.499   1.00 91.54  ? 1301 LYS A HE3   1 
ATOM   6145 H  HZ1   . LYS A 1 431 ? 39.917 -29.838 9.873   1.00 77.59  ? 1301 LYS A HZ1   1 
ATOM   6146 H  HZ2   . LYS A 1 431 ? 39.612 -29.905 8.458   1.00 77.59  ? 1301 LYS A HZ2   1 
ATOM   6147 H  HZ3   . LYS A 1 431 ? 39.977 -31.108 9.178   1.00 77.59  ? 1301 LYS A HZ3   1 
ATOM   6148 N  N     . GLN A 1 432 ? 39.768 -25.526 5.054   1.00 36.75  ? 1302 GLN A N     1 
ATOM   6149 C  CA    . GLN A 1 432 ? 38.482 -25.688 4.387   1.00 38.90  ? 1302 GLN A CA    1 
ATOM   6150 C  C     . GLN A 1 432 ? 38.638 -25.653 2.870   1.00 31.12  ? 1302 GLN A C     1 
ATOM   6151 O  O     . GLN A 1 432 ? 37.981 -26.409 2.158   1.00 35.34  ? 1302 GLN A O     1 
ATOM   6152 C  CB    . GLN A 1 432 ? 37.505 -24.604 4.846   1.00 38.38  ? 1302 GLN A CB    1 
ATOM   6153 C  CG    . GLN A 1 432 ? 37.002 -24.802 6.272   1.00 40.70  ? 1302 GLN A CG    1 
ATOM   6154 C  CD    . GLN A 1 432 ? 36.447 -23.529 6.885   1.00 62.49  ? 1302 GLN A CD    1 
ATOM   6155 O  OE1   . GLN A 1 432 ? 36.456 -22.468 6.257   1.00 47.55  ? 1302 GLN A OE1   1 
ATOM   6156 N  NE2   . GLN A 1 432 ? 35.966 -23.627 8.121   1.00 53.40  ? 1302 GLN A NE2   1 
ATOM   6157 H  H     . GLN A 1 432 ? 39.824 -24.821 5.544   1.00 44.04  ? 1302 GLN A H     1 
ATOM   6158 H  HA    . GLN A 1 432 ? 38.105 -26.559 4.632   1.00 46.62  ? 1302 GLN A HA    1 
ATOM   6159 H  HB2   . GLN A 1 432 ? 37.949 -23.743 4.804   1.00 46.00  ? 1302 GLN A HB2   1 
ATOM   6160 H  HB3   . GLN A 1 432 ? 36.734 -24.606 4.256   1.00 46.00  ? 1302 GLN A HB3   1 
ATOM   6161 H  HG2   . GLN A 1 432 ? 36.294 -25.465 6.268   1.00 48.78  ? 1302 GLN A HG2   1 
ATOM   6162 H  HG3   . GLN A 1 432 ? 37.738 -25.105 6.826   1.00 48.78  ? 1302 GLN A HG3   1 
ATOM   6163 H  HE21  . GLN A 1 432 ? 35.641 -22.933 8.512   1.00 64.03  ? 1302 GLN A HE21  1 
ATOM   6164 H  HE22  . GLN A 1 432 ? 35.981 -24.383 8.530   1.00 64.03  ? 1302 GLN A HE22  1 
ATOM   6165 N  N     . CYS A 1 433 ? 39.511 -24.778 2.377   1.00 35.48  ? 1303 CYS A N     1 
ATOM   6166 C  CA    . CYS A 1 433 ? 39.711 -24.634 0.939   1.00 31.82  ? 1303 CYS A CA    1 
ATOM   6167 C  C     . CYS A 1 433 ? 40.371 -25.869 0.344   1.00 38.89  ? 1303 CYS A C     1 
ATOM   6168 O  O     . CYS A 1 433 ? 39.956 -26.339 -0.709  1.00 38.63  ? 1303 CYS A O     1 
ATOM   6169 C  CB    . CYS A 1 433 ? 40.563 -23.406 0.624   1.00 35.29  ? 1303 CYS A CB    1 
ATOM   6170 S  SG    . CYS A 1 433 ? 39.709 -21.835 0.857   1.00 39.48  ? 1303 CYS A SG    1 
ATOM   6171 H  H     . CYS A 1 433 ? 39.999 -24.256 2.855   1.00 42.53  ? 1303 CYS A H     1 
ATOM   6172 H  HA    . CYS A 1 433 ? 38.840 -24.517 0.505   1.00 38.12  ? 1303 CYS A HA    1 
ATOM   6173 H  HB2   . CYS A 1 433 ? 41.339 -23.409 1.206   1.00 42.29  ? 1303 CYS A HB2   1 
ATOM   6174 H  HB3   . CYS A 1 433 ? 40.847 -23.453 -0.302  1.00 42.29  ? 1303 CYS A HB3   1 
ATOM   6175 H  HG    . CYS A 1 433 ? 38.752 -21.799 0.134   1.00 47.32  ? 1303 CYS A HG    1 
ATOM   6176 N  N     . GLN A 1 434 ? 41.403 -26.385 1.009   1.00 38.30  ? 1304 GLN A N     1 
ATOM   6177 C  CA    . GLN A 1 434 ? 42.128 -27.552 0.502   1.00 41.33  ? 1304 GLN A CA    1 
ATOM   6178 C  C     . GLN A 1 434 ? 41.282 -28.814 0.625   1.00 36.13  ? 1304 GLN A C     1 
ATOM   6179 O  O     . GLN A 1 434 ? 41.377 -29.715 -0.203  1.00 38.18  ? 1304 GLN A O     1 
ATOM   6180 C  CB    . GLN A 1 434 ? 43.464 -27.734 1.232   1.00 38.27  ? 1304 GLN A CB    1 
ATOM   6181 C  CG    . GLN A 1 434 ? 44.363 -26.504 1.179   1.00 64.03  ? 1304 GLN A CG    1 
ATOM   6182 C  CD    . GLN A 1 434 ? 45.830 -26.822 1.417   1.00 76.77  ? 1304 GLN A CD    1 
ATOM   6183 O  OE1   . GLN A 1 434 ? 46.577 -27.089 0.475   1.00 87.87  ? 1304 GLN A OE1   1 
ATOM   6184 N  NE2   . GLN A 1 434 ? 46.252 -26.781 2.676   1.00 67.70  ? 1304 GLN A NE2   1 
ATOM   6185 H  H     . GLN A 1 434 ? 41.704 -26.080 1.754   1.00 45.91  ? 1304 GLN A H     1 
ATOM   6186 H  HA    . GLN A 1 434 ? 42.323 -27.413 -0.449  1.00 49.54  ? 1304 GLN A HA    1 
ATOM   6187 H  HB2   . GLN A 1 434 ? 43.286 -27.932 2.165   1.00 45.87  ? 1304 GLN A HB2   1 
ATOM   6188 H  HB3   . GLN A 1 434 ? 43.945 -28.471 0.825   1.00 45.87  ? 1304 GLN A HB3   1 
ATOM   6189 H  HG2   . GLN A 1 434 ? 44.285 -26.094 0.304   1.00 76.77  ? 1304 GLN A HG2   1 
ATOM   6190 H  HG3   . GLN A 1 434 ? 44.080 -25.877 1.864   1.00 76.77  ? 1304 GLN A HG3   1 
ATOM   6191 H  HE21  . GLN A 1 434 ? 45.703 -26.582 3.307   1.00 81.19  ? 1304 GLN A HE21  1 
ATOM   6192 H  HE22  . GLN A 1 434 ? 47.074 -26.954 2.860   1.00 81.19  ? 1304 GLN A HE22  1 
ATOM   6193 N  N     . THR A 1 435 ? 40.455 -28.871 1.661   1.00 37.16  ? 1305 THR A N     1 
ATOM   6194 C  CA    . THR A 1 435 ? 39.543 -29.988 1.850   1.00 39.41  ? 1305 THR A CA    1 
ATOM   6195 C  C     . THR A 1 435 ? 38.541 -30.030 0.703   1.00 43.87  ? 1305 THR A C     1 
ATOM   6196 O  O     . THR A 1 435 ? 38.307 -31.084 0.115   1.00 40.02  ? 1305 THR A O     1 
ATOM   6197 C  CB    . THR A 1 435 ? 38.792 -29.872 3.185   1.00 44.92  ? 1305 THR A CB    1 
ATOM   6198 O  OG1   . THR A 1 435 ? 39.719 -30.019 4.268   1.00 41.72  ? 1305 THR A OG1   1 
ATOM   6199 C  CG2   . THR A 1 435 ? 37.715 -30.940 3.296   1.00 56.08  ? 1305 THR A CG2   1 
ATOM   6200 H  H     . THR A 1 435 ? 40.402 -28.270 2.273   1.00 44.54  ? 1305 THR A H     1 
ATOM   6201 H  HA    . THR A 1 435 ? 40.050 -30.827 1.850   1.00 47.24  ? 1305 THR A HA    1 
ATOM   6202 H  HB    . THR A 1 435 ? 38.367 -29.002 3.241   1.00 53.85  ? 1305 THR A HB    1 
ATOM   6203 H  HG1   . THR A 1 435 ? 40.084 -30.752 4.226   1.00 50.01  ? 1305 THR A HG1   1 
ATOM   6204 H  HG21  . THR A 1 435 ? 37.255 -30.856 4.134   1.00 67.24  ? 1305 THR A HG21  1 
ATOM   6205 H  HG22  . THR A 1 435 ? 37.082 -30.843 2.581   1.00 67.24  ? 1305 THR A HG22  1 
ATOM   6206 H  HG23  . THR A 1 435 ? 38.113 -31.813 3.245   1.00 67.24  ? 1305 THR A HG23  1 
ATOM   6207 N  N     . LEU A 1 436 ? 37.958 -28.877 0.381   1.00 36.79  ? 1306 LEU A N     1 
ATOM   6208 C  CA    . LEU A 1 436 ? 37.013 -28.779 -0.726  1.00 34.27  ? 1306 LEU A CA    1 
ATOM   6209 C  C     . LEU A 1 436 ? 37.688 -29.129 -2.048  1.00 39.64  ? 1306 LEU A C     1 
ATOM   6210 O  O     . LEU A 1 436 ? 37.135 -29.877 -2.851  1.00 39.78  ? 1306 LEU A O     1 
ATOM   6211 C  CB    . LEU A 1 436 ? 36.410 -27.372 -0.801  1.00 34.51  ? 1306 LEU A CB    1 
ATOM   6212 C  CG    . LEU A 1 436 ? 35.418 -27.125 -1.942  1.00 39.28  ? 1306 LEU A CG    1 
ATOM   6213 C  CD1   . LEU A 1 436 ? 34.399 -28.251 -2.035  1.00 44.21  ? 1306 LEU A CD1   1 
ATOM   6214 C  CD2   . LEU A 1 436 ? 34.718 -25.782 -1.763  1.00 35.14  ? 1306 LEU A CD2   1 
ATOM   6215 H  H     . LEU A 1 436 ? 38.095 -28.134 0.792   1.00 44.09  ? 1306 LEU A H     1 
ATOM   6216 H  HA    . LEU A 1 436 ? 36.282 -29.415 -0.581  1.00 41.07  ? 1306 LEU A HA    1 
ATOM   6217 H  HB2   . LEU A 1 436 ? 35.944 -27.196 0.031   1.00 41.35  ? 1306 LEU A HB2   1 
ATOM   6218 H  HB3   . LEU A 1 436 ? 37.135 -26.735 -0.905  1.00 41.35  ? 1306 LEU A HB3   1 
ATOM   6219 H  HG    . LEU A 1 436 ? 35.906 -27.096 -2.780  1.00 47.08  ? 1306 LEU A HG    1 
ATOM   6220 H  HD11  . LEU A 1 436 ? 33.794 -28.066 -2.757  1.00 53.00  ? 1306 LEU A HD11  1 
ATOM   6221 H  HD12  . LEU A 1 436 ? 34.860 -29.077 -2.197  1.00 53.00  ? 1306 LEU A HD12  1 
ATOM   6222 H  HD13  . LEU A 1 436 ? 33.915 -28.303 -1.207  1.00 53.00  ? 1306 LEU A HD13  1 
ATOM   6223 H  HD21  . LEU A 1 436 ? 34.104 -25.652 -2.489  1.00 42.11  ? 1306 LEU A HD21  1 
ATOM   6224 H  HD22  . LEU A 1 436 ? 34.244 -25.786 -0.928  1.00 42.11  ? 1306 LEU A HD22  1 
ATOM   6225 H  HD23  . LEU A 1 436 ? 35.377 -25.084 -1.762  1.00 42.11  ? 1306 LEU A HD23  1 
ATOM   6226 N  N     . ARG A 1 437 ? 38.885 -28.592 -2.266  1.00 35.51  ? 1307 ARG A N     1 
ATOM   6227 C  CA    . ARG A 1 437 ? 39.612 -28.823 -3.509  1.00 42.90  ? 1307 ARG A CA    1 
ATOM   6228 C  C     . ARG A 1 437 ? 39.869 -30.310 -3.717  1.00 45.78  ? 1307 ARG A C     1 
ATOM   6229 O  O     . ARG A 1 437 ? 39.716 -30.823 -4.823  1.00 42.22  ? 1307 ARG A O     1 
ATOM   6230 C  CB    . ARG A 1 437 ? 40.942 -28.064 -3.514  1.00 45.38  ? 1307 ARG A CB    1 
ATOM   6231 C  CG    . ARG A 1 437 ? 40.803 -26.552 -3.615  1.00 55.12  ? 1307 ARG A CG    1 
ATOM   6232 C  CD    . ARG A 1 437 ? 42.114 -25.898 -4.016  1.00 66.98  ? 1307 ARG A CD    1 
ATOM   6233 N  NE    . ARG A 1 437 ? 42.489 -26.269 -5.379  1.00 75.94  ? 1307 ARG A NE    1 
ATOM   6234 C  CZ    . ARG A 1 437 ? 43.485 -27.094 -5.700  1.00 87.05  ? 1307 ARG A CZ    1 
ATOM   6235 N  NH1   . ARG A 1 437 ? 44.253 -27.643 -4.758  1.00 85.84  ? 1307 ARG A NH1   1 
ATOM   6236 N  NH2   . ARG A 1 437 ? 43.723 -27.360 -6.979  1.00 78.71  ? 1307 ARG A NH2   1 
ATOM   6237 H  H     . ARG A 1 437 ? 39.299 -28.088 -1.706  1.00 42.55  ? 1307 ARG A H     1 
ATOM   6238 H  HA    . ARG A 1 437 ? 39.073 -28.499 -4.261  1.00 51.42  ? 1307 ARG A HA    1 
ATOM   6239 H  HB2   . ARG A 1 437 ? 41.416 -28.262 -2.692  1.00 54.40  ? 1307 ARG A HB2   1 
ATOM   6240 H  HB3   . ARG A 1 437 ? 41.467 -28.362 -4.274  1.00 54.40  ? 1307 ARG A HB3   1 
ATOM   6241 H  HG2   . ARG A 1 437 ? 40.137 -26.336 -4.287  1.00 66.09  ? 1307 ARG A HG2   1 
ATOM   6242 H  HG3   . ARG A 1 437 ? 40.537 -26.197 -2.752  1.00 66.09  ? 1307 ARG A HG3   1 
ATOM   6243 H  HD2   . ARG A 1 437 ? 42.017 -24.933 -3.978  1.00 80.32  ? 1307 ARG A HD2   1 
ATOM   6244 H  HD3   . ARG A 1 437 ? 42.816 -26.190 -3.415  1.00 80.32  ? 1307 ARG A HD3   1 
ATOM   6245 H  HE    . ARG A 1 437 ? 42.032 -25.930 -6.023  1.00 91.07  ? 1307 ARG A HE    1 
ATOM   6246 H  HH11  . ARG A 1 437 ? 44.102 -27.475 -3.928  1.00 102.95 ? 1307 ARG A HH11  1 
ATOM   6247 H  HH12  . ARG A 1 437 ? 44.894 -28.171 -4.980  1.00 102.95 ? 1307 ARG A HH12  1 
ATOM   6248 H  HH21  . ARG A 1 437 ? 43.233 -27.005 -7.590  1.00 94.40  ? 1307 ARG A HH21  1 
ATOM   6249 H  HH22  . ARG A 1 437 ? 44.368 -27.886 -7.196  1.00 94.40  ? 1307 ARG A HH22  1 
ATOM   6250 N  N     . GLU A 1 438 ? 40.254 -30.998 -2.647  1.00 41.61  ? 1308 GLU A N     1 
ATOM   6251 C  CA    . GLU A 1 438 ? 40.569 -32.420 -2.717  1.00 52.86  ? 1308 GLU A CA    1 
ATOM   6252 C  C     . GLU A 1 438 ? 39.322 -33.244 -3.020  1.00 65.20  ? 1308 GLU A C     1 
ATOM   6253 O  O     . GLU A 1 438 ? 39.391 -34.245 -3.731  1.00 62.07  ? 1308 GLU A O     1 
ATOM   6254 C  CB    . GLU A 1 438 ? 41.201 -32.890 -1.405  1.00 54.62  ? 1308 GLU A CB    1 
ATOM   6255 C  CG    . GLU A 1 438 ? 42.587 -32.315 -1.145  1.00 63.69  ? 1308 GLU A CG    1 
ATOM   6256 C  CD    . GLU A 1 438 ? 43.663 -32.979 -1.982  1.00 81.33  ? 1308 GLU A CD    1 
ATOM   6257 O  OE1   . GLU A 1 438 ? 43.929 -34.180 -1.763  1.00 92.85  ? 1308 GLU A OE1   1 
ATOM   6258 O  OE2   . GLU A 1 438 ? 44.241 -32.302 -2.859  1.00 81.68  ? 1308 GLU A OE2   1 
ATOM   6259 H  H     . GLU A 1 438 ? 40.341 -30.660 -1.860  1.00 49.88  ? 1308 GLU A H     1 
ATOM   6260 H  HA    . GLU A 1 438 ? 41.215 -32.570 -3.438  1.00 63.37  ? 1308 GLU A HA    1 
ATOM   6261 H  HB2   . GLU A 1 438 ? 40.628 -32.625 -0.669  1.00 65.49  ? 1308 GLU A HB2   1 
ATOM   6262 H  HB3   . GLU A 1 438 ? 41.282 -33.857 -1.426  1.00 65.49  ? 1308 GLU A HB3   1 
ATOM   6263 H  HG2   . GLU A 1 438 ? 42.581 -31.369 -1.360  1.00 76.37  ? 1308 GLU A HG2   1 
ATOM   6264 H  HG3   . GLU A 1 438 ? 42.812 -32.442 -0.210  1.00 76.37  ? 1308 GLU A HG3   1 
ATOM   6265 N  N     . ALA A 1 439 ? 38.183 -32.818 -2.484  1.00 42.58  ? 1309 ALA A N     1 
ATOM   6266 C  CA    . ALA A 1 439 ? 36.931 -33.534 -2.698  1.00 51.90  ? 1309 ALA A CA    1 
ATOM   6267 C  C     . ALA A 1 439 ? 36.478 -33.413 -4.150  1.00 59.69  ? 1309 ALA A C     1 
ATOM   6268 O  O     . ALA A 1 439 ? 36.035 -34.388 -4.752  1.00 52.68  ? 1309 ALA A O     1 
ATOM   6269 C  CB    . ALA A 1 439 ? 35.854 -33.014 -1.758  1.00 45.09  ? 1309 ALA A CB    1 
ATOM   6270 H  H     . ALA A 1 439 ? 38.108 -32.116 -1.993  1.00 51.04  ? 1309 ALA A H     1 
ATOM   6271 H  HA    . ALA A 1 439 ? 37.070 -34.484 -2.502  1.00 62.22  ? 1309 ALA A HA    1 
ATOM   6272 H  HB1   . ALA A 1 439 ? 35.041 -33.499 -1.916  1.00 54.05  ? 1309 ALA A HB1   1 
ATOM   6273 H  HB2   . ALA A 1 439 ? 36.142 -33.144 -0.852  1.00 54.05  ? 1309 ALA A HB2   1 
ATOM   6274 H  HB3   . ALA A 1 439 ? 35.717 -32.079 -1.928  1.00 54.05  ? 1309 ALA A HB3   1 
ATOM   6275 N  N     . LEU A 1 440 ? 36.594 -32.212 -4.709  1.00 45.91  ? 1310 LEU A N     1 
ATOM   6276 C  CA    . LEU A 1 440 ? 36.230 -31.981 -6.102  1.00 53.43  ? 1310 LEU A CA    1 
ATOM   6277 C  C     . LEU A 1 440 ? 37.117 -32.812 -7.028  1.00 66.03  ? 1310 LEU A C     1 
ATOM   6278 O  O     . LEU A 1 440 ? 36.627 -33.457 -7.952  1.00 62.06  ? 1310 LEU A O     1 
ATOM   6279 C  CB    . LEU A 1 440 ? 36.345 -30.494 -6.452  1.00 39.59  ? 1310 LEU A CB    1 
ATOM   6280 C  CG    . LEU A 1 440 ? 35.369 -29.555 -5.733  1.00 46.49  ? 1310 LEU A CG    1 
ATOM   6281 C  CD1   . LEU A 1 440 ? 35.687 -28.099 -6.048  1.00 52.80  ? 1310 LEU A CD1   1 
ATOM   6282 C  CD2   . LEU A 1 440 ? 33.927 -29.879 -6.101  1.00 39.79  ? 1310 LEU A CD2   1 
ATOM   6283 H  H     . LEU A 1 440 ? 36.882 -31.512 -4.301  1.00 55.04  ? 1310 LEU A H     1 
ATOM   6284 H  HA    . LEU A 1 440 ? 35.300 -32.256 -6.241  1.00 64.06  ? 1310 LEU A HA    1 
ATOM   6285 H  HB2   . LEU A 1 440 ? 37.243 -30.198 -6.234  1.00 47.45  ? 1310 LEU A HB2   1 
ATOM   6286 H  HB3   . LEU A 1 440 ? 36.195 -30.392 -7.405  1.00 47.45  ? 1310 LEU A HB3   1 
ATOM   6287 H  HG    . LEU A 1 440 ? 35.465 -29.679 -4.776  1.00 55.73  ? 1310 LEU A HG    1 
ATOM   6288 H  HD11  . LEU A 1 440 ? 35.061 -27.536 -5.586  1.00 63.30  ? 1310 LEU A HD11  1 
ATOM   6289 H  HD12  . LEU A 1 440 ? 36.581 -27.904 -5.757  1.00 63.30  ? 1310 LEU A HD12  1 
ATOM   6290 H  HD13  . LEU A 1 440 ? 35.613 -27.961 -6.996  1.00 63.30  ? 1310 LEU A HD13  1 
ATOM   6291 H  HD21  . LEU A 1 440 ? 33.343 -29.276 -5.636  1.00 47.69  ? 1310 LEU A HD21  1 
ATOM   6292 H  HD22  . LEU A 1 440 ? 33.817 -29.777 -7.049  1.00 47.69  ? 1310 LEU A HD22  1 
ATOM   6293 H  HD23  . LEU A 1 440 ? 33.735 -30.784 -5.845  1.00 47.69  ? 1310 LEU A HD23  1 
ATOM   6294 N  N     . ILE A 1 441 ? 38.421 -32.801 -6.770  1.00 58.06  ? 1311 ILE A N     1 
ATOM   6295 C  CA    . ILE A 1 441 ? 39.366 -33.564 -7.578  1.00 71.36  ? 1311 ILE A CA    1 
ATOM   6296 C  C     . ILE A 1 441 ? 39.068 -35.060 -7.514  1.00 74.94  ? 1311 ILE A C     1 
ATOM   6297 O  O     . ILE A 1 441 ? 39.231 -35.776 -8.502  1.00 78.04  ? 1311 ILE A O     1 
ATOM   6298 C  CB    . ILE A 1 441 ? 40.818 -33.318 -7.128  1.00 68.36  ? 1311 ILE A CB    1 
ATOM   6299 C  CG1   . ILE A 1 441 ? 41.274 -31.920 -7.552  1.00 70.05  ? 1311 ILE A CG1   1 
ATOM   6300 C  CG2   . ILE A 1 441 ? 41.747 -34.367 -7.722  1.00 67.96  ? 1311 ILE A CG2   1 
ATOM   6301 C  CD1   . ILE A 1 441 ? 42.688 -31.582 -7.128  1.00 72.57  ? 1311 ILE A CD1   1 
ATOM   6302 H  H     . ILE A 1 441 ? 38.785 -32.357 -6.130  1.00 69.62  ? 1311 ILE A H     1 
ATOM   6303 H  HA    . ILE A 1 441 ? 39.287 -33.280 -8.513  1.00 85.57  ? 1311 ILE A HA    1 
ATOM   6304 H  HB    . ILE A 1 441 ? 40.859 -33.378 -6.161  1.00 81.97  ? 1311 ILE A HB    1 
ATOM   6305 H  HG12  . ILE A 1 441 ? 41.232 -31.858 -8.519  1.00 84.00  ? 1311 ILE A HG12  1 
ATOM   6306 H  HG13  . ILE A 1 441 ? 40.680 -31.264 -7.155  1.00 84.00  ? 1311 ILE A HG13  1 
ATOM   6307 H  HG21  . ILE A 1 441 ? 42.644 -34.193 -7.428  1.00 81.50  ? 1311 ILE A HG21  1 
ATOM   6308 H  HG22  . ILE A 1 441 ? 41.467 -35.236 -7.425  1.00 81.50  ? 1311 ILE A HG22  1 
ATOM   6309 H  HG23  . ILE A 1 441 ? 41.701 -34.318 -8.680  1.00 81.50  ? 1311 ILE A HG23  1 
ATOM   6310 H  HD11  . ILE A 1 441 ? 42.900 -30.695 -7.429  1.00 87.03  ? 1311 ILE A HD11  1 
ATOM   6311 H  HD12  . ILE A 1 441 ? 42.745 -31.626 -6.171  1.00 87.03  ? 1311 ILE A HD12  1 
ATOM   6312 H  HD13  . ILE A 1 441 ? 43.292 -32.215 -7.523  1.00 87.03  ? 1311 ILE A HD13  1 
ATOM   6313 N  N     . ALA A 1 442 ? 38.626 -35.526 -6.350  1.00 69.19  ? 1312 ALA A N     1 
ATOM   6314 C  CA    . ALA A 1 442 ? 38.336 -36.941 -6.154  1.00 69.81  ? 1312 ALA A CA    1 
ATOM   6315 C  C     . ALA A 1 442 ? 37.005 -37.323 -6.794  1.00 73.99  ? 1312 ALA A C     1 
ATOM   6316 O  O     . ALA A 1 442 ? 36.790 -38.479 -7.154  1.00 64.56  ? 1312 ALA A O     1 
ATOM   6317 C  CB    . ALA A 1 442 ? 38.324 -37.276 -4.673  1.00 64.35  ? 1312 ALA A CB    1 
ATOM   6318 H  H     . ALA A 1 442 ? 38.485 -35.040 -5.655  1.00 82.97  ? 1312 ALA A H     1 
ATOM   6319 H  HA    . ALA A 1 442 ? 39.040 -37.474 -6.579  1.00 83.72  ? 1312 ALA A HA    1 
ATOM   6320 H  HB1   . ALA A 1 442 ? 38.131 -38.210 -4.565  1.00 77.16  ? 1312 ALA A HB1   1 
ATOM   6321 H  HB2   . ALA A 1 442 ? 39.185 -37.074 -4.300  1.00 77.16  ? 1312 ALA A HB2   1 
ATOM   6322 H  HB3   . ALA A 1 442 ? 37.647 -36.750 -4.240  1.00 77.16  ? 1312 ALA A HB3   1 
ATOM   6323 N  N     . ALA A 1 443 ? 36.114 -36.345 -6.931  1.00 67.71  ? 1313 ALA A N     1 
ATOM   6324 C  CA    . ALA A 1 443 ? 34.825 -36.566 -7.577  1.00 69.99  ? 1313 ALA A CA    1 
ATOM   6325 C  C     . ALA A 1 443 ? 34.944 -36.341 -9.082  1.00 68.61  ? 1313 ALA A C     1 
ATOM   6326 O  O     . ALA A 1 443 ? 33.957 -36.424 -9.813  1.00 65.27  ? 1313 ALA A O     1 
ATOM   6327 C  CB    . ALA A 1 443 ? 33.769 -35.645 -6.981  1.00 56.63  ? 1313 ALA A CB    1 
ATOM   6328 H  H     . ALA A 1 443 ? 36.234 -35.539 -6.657  1.00 81.20  ? 1313 ALA A H     1 
ATOM   6329 H  HA    . ALA A 1 443 ? 34.544 -37.492 -7.427  1.00 83.94  ? 1313 ALA A HA    1 
ATOM   6330 H  HB1   . ALA A 1 443 ? 32.931 -35.807 -7.420  1.00 67.90  ? 1313 ALA A HB1   1 
ATOM   6331 H  HB2   . ALA A 1 443 ? 33.689 -35.828 -6.043  1.00 67.90  ? 1313 ALA A HB2   1 
ATOM   6332 H  HB3   . ALA A 1 443 ? 34.039 -34.733 -7.115  1.00 67.90  ? 1313 ALA A HB3   1 
ATOM   6333 N  N     . GLY A 1 444 ? 36.159 -36.054 -9.537  1.00 61.40  ? 1314 GLY A N     1 
ATOM   6334 C  CA    . GLY A 1 444 ? 36.422 -35.853 -10.950 1.00 61.36  ? 1314 GLY A CA    1 
ATOM   6335 C  C     . GLY A 1 444 ? 35.865 -34.545 -11.481 1.00 76.40  ? 1314 GLY A C     1 
ATOM   6336 O  O     . GLY A 1 444 ? 35.782 -34.348 -12.692 1.00 61.44  ? 1314 GLY A O     1 
ATOM   6337 H  H     . GLY A 1 444 ? 36.855 -35.969 -9.038  1.00 73.63  ? 1314 GLY A H     1 
ATOM   6338 H  HA2   . GLY A 1 444 ? 37.380 -35.859 -11.102 1.00 73.58  ? 1314 GLY A HA2   1 
ATOM   6339 H  HA3   . GLY A 1 444 ? 36.028 -36.580 -11.456 1.00 73.58  ? 1314 GLY A HA3   1 
ATOM   6340 N  N     . LYS A 1 445 ? 35.470 -33.653 -10.578 1.00 60.97  ? 1315 LYS A N     1 
ATOM   6341 C  CA    . LYS A 1 445 ? 35.015 -32.326 -10.974 1.00 67.34  ? 1315 LYS A CA    1 
ATOM   6342 C  C     . LYS A 1 445 ? 36.212 -31.411 -11.206 1.00 60.72  ? 1315 LYS A C     1 
ATOM   6343 O  O     . LYS A 1 445 ? 37.063 -31.260 -10.332 1.00 72.14  ? 1315 LYS A O     1 
ATOM   6344 C  CB    . LYS A 1 445 ? 34.103 -31.724 -9.905  1.00 59.85  ? 1315 LYS A CB    1 
ATOM   6345 C  CG    . LYS A 1 445 ? 33.374 -30.478 -10.374 1.00 62.34  ? 1315 LYS A CG    1 
ATOM   6346 C  CD    . LYS A 1 445 ? 32.287 -30.838 -11.365 1.00 55.84  ? 1315 LYS A CD    1 
ATOM   6347 C  CE    . LYS A 1 445 ? 31.843 -29.640 -12.175 1.00 62.39  ? 1315 LYS A CE    1 
ATOM   6348 N  NZ    . LYS A 1 445 ? 30.460 -29.843 -12.654 1.00 63.79  ? 1315 LYS A NZ    1 
ATOM   6349 H  H     . LYS A 1 445 ? 35.457 -33.791 -9.730  1.00 73.11  ? 1315 LYS A H     1 
ATOM   6350 H  HA    . LYS A 1 445 ? 34.509 -32.391 -11.811 1.00 80.75  ? 1315 LYS A HA    1 
ATOM   6351 H  HB2   . LYS A 1 445 ? 33.436 -32.382 -9.653  1.00 71.76  ? 1315 LYS A HB2   1 
ATOM   6352 H  HB3   . LYS A 1 445 ? 34.639 -31.483 -9.134  1.00 71.76  ? 1315 LYS A HB3   1 
ATOM   6353 H  HG2   . LYS A 1 445 ? 32.963 -30.039 -9.613  1.00 74.75  ? 1315 LYS A HG2   1 
ATOM   6354 H  HG3   . LYS A 1 445 ? 34.002 -29.882 -10.810 1.00 74.75  ? 1315 LYS A HG3   1 
ATOM   6355 H  HD2   . LYS A 1 445 ? 32.624 -31.510 -11.978 1.00 66.95  ? 1315 LYS A HD2   1 
ATOM   6356 H  HD3   . LYS A 1 445 ? 31.518 -31.180 -10.884 1.00 66.95  ? 1315 LYS A HD3   1 
ATOM   6357 H  HE2   . LYS A 1 445 ? 31.865 -28.846 -11.619 1.00 74.81  ? 1315 LYS A HE2   1 
ATOM   6358 H  HE3   . LYS A 1 445 ? 32.425 -29.534 -12.944 1.00 74.81  ? 1315 LYS A HE3   1 
ATOM   6359 H  HZ1   . LYS A 1 445 ? 30.419 -30.571 -13.165 1.00 76.50  ? 1315 LYS A HZ1   1 
ATOM   6360 H  HZ2   . LYS A 1 445 ? 29.910 -29.945 -11.962 1.00 76.50  ? 1315 LYS A HZ2   1 
ATOM   6361 H  HZ3   . LYS A 1 445 ? 30.197 -29.139 -13.131 1.00 76.50  ? 1315 LYS A HZ3   1 
ATOM   6362 N  N     . GLU A 1 446 ? 36.273 -30.796 -12.383 1.00 48.32  ? 1316 GLU A N     1 
ATOM   6363 C  CA    . GLU A 1 446 ? 37.415 -29.961 -12.738 1.00 70.61  ? 1316 GLU A CA    1 
ATOM   6364 C  C     . GLU A 1 446 ? 37.294 -28.562 -12.145 1.00 62.01  ? 1316 GLU A C     1 
ATOM   6365 O  O     . GLU A 1 446 ? 36.194 -28.087 -11.859 1.00 45.69  ? 1316 GLU A O     1 
ATOM   6366 C  CB    . GLU A 1 446 ? 37.555 -29.857 -14.255 1.00 73.51  ? 1316 GLU A CB    1 
ATOM   6367 C  CG    . GLU A 1 446 ? 36.825 -28.675 -14.863 1.00 74.50  ? 1316 GLU A CG    1 
ATOM   6368 C  CD    . GLU A 1 446 ? 37.041 -28.577 -16.357 1.00 88.16  ? 1316 GLU A CD    1 
ATOM   6369 O  OE1   . GLU A 1 446 ? 37.329 -29.619 -16.983 1.00 100.53 ? 1316 GLU A OE1   1 
ATOM   6370 O  OE2   . GLU A 1 446 ? 36.933 -27.460 -16.904 1.00 80.38  ? 1316 GLU A OE2   1 
ATOM   6371 H  H     . GLU A 1 446 ? 35.669 -30.847 -12.992 1.00 57.93  ? 1316 GLU A H     1 
ATOM   6372 H  HA    . GLU A 1 446 ? 38.233 -30.371 -12.385 1.00 84.68  ? 1316 GLU A HA    1 
ATOM   6373 H  HB2   . GLU A 1 446 ? 38.496 -29.769 -14.476 1.00 88.15  ? 1316 GLU A HB2   1 
ATOM   6374 H  HB3   . GLU A 1 446 ? 37.198 -30.664 -14.658 1.00 88.15  ? 1316 GLU A HB3   1 
ATOM   6375 H  HG2   . GLU A 1 446 ? 35.874 -28.772 -14.701 1.00 89.35  ? 1316 GLU A HG2   1 
ATOM   6376 H  HG3   . GLU A 1 446 ? 37.152 -27.857 -14.456 1.00 89.35  ? 1316 GLU A HG3   1 
ATOM   6377 N  N     . ILE A 1 447 ? 38.439 -27.907 -11.979 1.00 46.91  ? 1317 ILE A N     1 
ATOM   6378 C  CA    . ILE A 1 447 ? 38.493 -26.566 -11.412 1.00 51.99  ? 1317 ILE A CA    1 
ATOM   6379 C  C     . ILE A 1 447 ? 39.075 -25.593 -12.432 1.00 55.33  ? 1317 ILE A C     1 
ATOM   6380 O  O     . ILE A 1 447 ? 40.231 -25.720 -12.839 1.00 63.23  ? 1317 ILE A O     1 
ATOM   6381 C  CB    . ILE A 1 447 ? 39.349 -26.541 -10.127 1.00 60.21  ? 1317 ILE A CB    1 
ATOM   6382 C  CG1   . ILE A 1 447 ? 38.663 -27.343 -9.019  1.00 55.03  ? 1317 ILE A CG1   1 
ATOM   6383 C  CG2   . ILE A 1 447 ? 39.588 -25.108 -9.663  1.00 57.45  ? 1317 ILE A CG2   1 
ATOM   6384 C  CD1   . ILE A 1 447 ? 39.569 -27.669 -7.852  1.00 65.19  ? 1317 ILE A CD1   1 
ATOM   6385 H  H     . ILE A 1 447 ? 39.209 -28.223 -12.192 1.00 56.24  ? 1317 ILE A H     1 
ATOM   6386 H  HA    . ILE A 1 447 ? 37.587 -26.271 -11.186 1.00 62.33  ? 1317 ILE A HA    1 
ATOM   6387 H  HB    . ILE A 1 447 ? 40.207 -26.950 -10.319 1.00 72.20  ? 1317 ILE A HB    1 
ATOM   6388 H  HG12  . ILE A 1 447 ? 37.914 -26.829 -8.678  1.00 65.98  ? 1317 ILE A HG12  1 
ATOM   6389 H  HG13  . ILE A 1 447 ? 38.345 -28.181 -9.390  1.00 65.98  ? 1317 ILE A HG13  1 
ATOM   6390 H  HG21  . ILE A 1 447 ? 40.121 -25.123 -8.865  1.00 68.89  ? 1317 ILE A HG21  1 
ATOM   6391 H  HG22  . ILE A 1 447 ? 40.049 -24.629 -10.356 1.00 68.89  ? 1317 ILE A HG22  1 
ATOM   6392 H  HG23  . ILE A 1 447 ? 38.742 -24.692 -9.484  1.00 68.89  ? 1317 ILE A HG23  1 
ATOM   6393 H  HD11  . ILE A 1 447 ? 39.072 -28.171 -7.201  1.00 78.17  ? 1317 ILE A HD11  1 
ATOM   6394 H  HD12  . ILE A 1 447 ? 40.311 -28.189 -8.169  1.00 78.17  ? 1317 ILE A HD12  1 
ATOM   6395 H  HD13  . ILE A 1 447 ? 39.884 -26.850 -7.463  1.00 78.17  ? 1317 ILE A HD13  1 
ATOM   6396 N  N     . ILE A 1 448 ? 38.262 -24.626 -12.846 1.00 41.23  ? 1318 ILE A N     1 
ATOM   6397 C  CA    . ILE A 1 448 ? 38.676 -23.643 -13.838 1.00 40.76  ? 1318 ILE A CA    1 
ATOM   6398 C  C     . ILE A 1 448 ? 39.394 -22.474 -13.191 1.00 48.65  ? 1318 ILE A C     1 
ATOM   6399 O  O     . ILE A 1 448 ? 38.843 -21.815 -12.313 1.00 52.96  ? 1318 ILE A O     1 
ATOM   6400 C  CB    . ILE A 1 448 ? 37.465 -23.061 -14.585 1.00 46.78  ? 1318 ILE A CB    1 
ATOM   6401 C  CG1   . ILE A 1 448 ? 36.702 -24.164 -15.316 1.00 63.00  ? 1318 ILE A CG1   1 
ATOM   6402 C  CG2   . ILE A 1 448 ? 37.913 -21.983 -15.562 1.00 38.31  ? 1318 ILE A CG2   1 
ATOM   6403 C  CD1   . ILE A 1 448 ? 35.563 -23.639 -16.156 1.00 67.03  ? 1318 ILE A CD1   1 
ATOM   6404 H  H     . ILE A 1 448 ? 37.457 -24.518 -12.563 1.00 49.42  ? 1318 ILE A H     1 
ATOM   6405 H  HA    . ILE A 1 448 ? 39.277 -24.061 -14.489 1.00 48.86  ? 1318 ILE A HA    1 
ATOM   6406 H  HB    . ILE A 1 448 ? 36.869 -22.657 -13.935 1.00 56.08  ? 1318 ILE A HB    1 
ATOM   6407 H  HG12  . ILE A 1 448 ? 37.315 -24.634 -15.904 1.00 75.55  ? 1318 ILE A HG12  1 
ATOM   6408 H  HG13  . ILE A 1 448 ? 36.334 -24.779 -14.663 1.00 75.55  ? 1318 ILE A HG13  1 
ATOM   6409 H  HG21  . ILE A 1 448 ? 37.143 -21.634 -16.017 1.00 45.92  ? 1318 ILE A HG21  1 
ATOM   6410 H  HG22  . ILE A 1 448 ? 38.351 -21.282 -15.073 1.00 45.92  ? 1318 ILE A HG22  1 
ATOM   6411 H  HG23  . ILE A 1 448 ? 38.522 -22.369 -16.196 1.00 45.92  ? 1318 ILE A HG23  1 
ATOM   6412 H  HD11  . ILE A 1 448 ? 35.127 -24.378 -16.587 1.00 80.38  ? 1318 ILE A HD11  1 
ATOM   6413 H  HD12  . ILE A 1 448 ? 34.942 -23.179 -15.587 1.00 80.38  ? 1318 ILE A HD12  1 
ATOM   6414 H  HD13  . ILE A 1 448 ? 35.913 -23.035 -16.815 1.00 80.38  ? 1318 ILE A HD13  1 
ATOM   6415 N  N     . TRP A 1 449 ? 40.618 -22.202 -13.628 1.00 50.01  ? 1319 TRP A N     1 
ATOM   6416 C  CA    . TRP A 1 449 ? 41.294 -20.996 -13.181 1.00 49.47  ? 1319 TRP A CA    1 
ATOM   6417 C  C     . TRP A 1 449 ? 40.514 -19.784 -13.657 1.00 53.72  ? 1319 TRP A C     1 
ATOM   6418 O  O     . TRP A 1 449 ? 40.254 -19.628 -14.849 1.00 47.36  ? 1319 TRP A O     1 
ATOM   6419 C  CB    . TRP A 1 449 ? 42.727 -20.908 -13.704 1.00 55.53  ? 1319 TRP A CB    1 
ATOM   6420 C  CG    . TRP A 1 449 ? 43.375 -19.624 -13.289 1.00 56.12  ? 1319 TRP A CG    1 
ATOM   6421 C  CD1   . TRP A 1 449 ? 43.819 -18.624 -14.105 1.00 54.84  ? 1319 TRP A CD1   1 
ATOM   6422 C  CD2   . TRP A 1 449 ? 43.619 -19.186 -11.947 1.00 49.46  ? 1319 TRP A CD2   1 
ATOM   6423 N  NE1   . TRP A 1 449 ? 44.337 -17.596 -13.353 1.00 53.30  ? 1319 TRP A NE1   1 
ATOM   6424 C  CE2   . TRP A 1 449 ? 44.227 -17.917 -12.025 1.00 56.07  ? 1319 TRP A CE2   1 
ATOM   6425 C  CE3   . TRP A 1 449 ? 43.388 -19.748 -10.686 1.00 52.06  ? 1319 TRP A CE3   1 
ATOM   6426 C  CZ2   . TRP A 1 449 ? 44.608 -17.200 -10.891 1.00 49.38  ? 1319 TRP A CZ2   1 
ATOM   6427 C  CZ3   . TRP A 1 449 ? 43.767 -19.035 -9.560  1.00 49.52  ? 1319 TRP A CZ3   1 
ATOM   6428 C  CH2   . TRP A 1 449 ? 44.369 -17.774 -9.670  1.00 53.75  ? 1319 TRP A CH2   1 
ATOM   6429 H  H     . TRP A 1 449 ? 41.070 -22.690 -14.172 1.00 59.96  ? 1319 TRP A H     1 
ATOM   6430 H  HA    . TRP A 1 449 ? 41.321 -20.981 -12.202 1.00 59.31  ? 1319 TRP A HA    1 
ATOM   6431 H  HB2   . TRP A 1 449 ? 43.246 -21.643 -13.342 1.00 66.58  ? 1319 TRP A HB2   1 
ATOM   6432 H  HB3   . TRP A 1 449 ? 42.718 -20.947 -14.673 1.00 66.58  ? 1319 TRP A HB3   1 
ATOM   6433 H  HD1   . TRP A 1 449 ? 43.781 -18.638 -15.034 1.00 65.76  ? 1319 TRP A HD1   1 
ATOM   6434 H  HE1   . TRP A 1 449 ? 44.677 -16.871 -13.666 1.00 63.90  ? 1319 TRP A HE1   1 
ATOM   6435 H  HE3   . TRP A 1 449 ? 42.989 -20.584 -10.605 1.00 62.42  ? 1319 TRP A HE3   1 
ATOM   6436 H  HZ2   . TRP A 1 449 ? 45.008 -16.363 -10.961 1.00 59.20  ? 1319 TRP A HZ2   1 
ATOM   6437 H  HZ3   . TRP A 1 449 ? 43.619 -19.399 -8.717  1.00 59.37  ? 1319 TRP A HZ3   1 
ATOM   6438 H  HH2   . TRP A 1 449 ? 44.615 -17.318 -8.897  1.00 64.44  ? 1319 TRP A HH2   1 
ATOM   6439 N  N     . HIS A 1 450 ? 40.141 -18.929 -12.713 1.00 34.77  ? 1320 HIS A N     1 
ATOM   6440 C  CA    . HIS A 1 450 ? 39.411 -17.710 -13.023 1.00 43.13  ? 1320 HIS A CA    1 
ATOM   6441 C  C     . HIS A 1 450 ? 40.234 -16.506 -12.592 1.00 51.87  ? 1320 HIS A C     1 
ATOM   6442 O  O     . HIS A 1 450 ? 40.351 -15.525 -13.323 1.00 48.47  ? 1320 HIS A O     1 
ATOM   6443 C  CB    . HIS A 1 450 ? 38.057 -17.705 -12.312 1.00 50.03  ? 1320 HIS A CB    1 
ATOM   6444 C  CG    . HIS A 1 450 ? 37.198 -16.530 -12.657 1.00 64.25  ? 1320 HIS A CG    1 
ATOM   6445 N  ND1   . HIS A 1 450 ? 37.098 -16.030 -13.937 1.00 63.40  ? 1320 HIS A ND1   1 
ATOM   6446 C  CD2   . HIS A 1 450 ? 36.393 -15.759 -11.888 1.00 68.39  ? 1320 HIS A CD2   1 
ATOM   6447 C  CE1   . HIS A 1 450 ? 36.272 -15.000 -13.942 1.00 65.10  ? 1320 HIS A CE1   1 
ATOM   6448 N  NE2   . HIS A 1 450 ? 35.829 -14.815 -12.712 1.00 74.59  ? 1320 HIS A NE2   1 
ATOM   6449 H  H     . HIS A 1 450 ? 40.301 -19.035 -11.875 1.00 41.67  ? 1320 HIS A H     1 
ATOM   6450 H  HA    . HIS A 1 450 ? 39.257 -17.655 -13.990 1.00 51.70  ? 1320 HIS A HA    1 
ATOM   6451 H  HB2   . HIS A 1 450 ? 37.572 -18.509 -12.557 1.00 59.97  ? 1320 HIS A HB2   1 
ATOM   6452 H  HB3   . HIS A 1 450 ? 38.208 -17.691 -11.354 1.00 59.97  ? 1320 HIS A HB3   1 
ATOM   6453 H  HD1   . HIS A 1 450 ? 37.511 -16.340 -14.625 1.00 76.02  ? 1320 HIS A HD1   1 
ATOM   6454 H  HD2   . HIS A 1 450 ? 36.249 -15.851 -10.974 1.00 82.01  ? 1320 HIS A HD2   1 
ATOM   6455 H  HE1   . HIS A 1 450 ? 36.040 -14.492 -14.686 1.00 78.07  ? 1320 HIS A HE1   1 
ATOM   6456 H  HE2   . HIS A 1 450 ? 35.278 -14.202 -12.466 1.00 89.46  ? 1320 HIS A HE2   1 
ATOM   6457 N  N     . GLY A 1 451 ? 40.805 -16.591 -11.396 1.00 45.46  ? 1321 GLY A N     1 
ATOM   6458 C  CA    . GLY A 1 451 ? 41.602 -15.512 -10.853 1.00 46.13  ? 1321 GLY A CA    1 
ATOM   6459 C  C     . GLY A 1 451 ? 40.721 -14.355 -10.438 1.00 38.94  ? 1321 GLY A C     1 
ATOM   6460 O  O     . GLY A 1 451 ? 39.502 -14.492 -10.348 1.00 35.12  ? 1321 GLY A O     1 
ATOM   6461 H  H     . GLY A 1 451 ? 40.741 -17.274 -10.877 1.00 54.50  ? 1321 GLY A H     1 
ATOM   6462 H  HA2   . GLY A 1 451 ? 42.094 -15.824 -10.078 1.00 55.31  ? 1321 GLY A HA2   1 
ATOM   6463 H  HA3   . GLY A 1 451 ? 42.234 -15.201 -11.520 1.00 55.31  ? 1321 GLY A HA3   1 
ATOM   6464 N  N     . ARG A 1 452 ? 41.338 -13.210 -10.180 1.00 35.31  ? 1322 ARG A N     1 
ATOM   6465 C  CA    . ARG A 1 452 ? 40.593 -12.010 -9.830  1.00 45.42  ? 1322 ARG A CA    1 
ATOM   6466 C  C     . ARG A 1 452 ? 41.470 -10.780 -9.987  1.00 49.01  ? 1322 ARG A C     1 
ATOM   6467 O  O     . ARG A 1 452 ? 42.695 -10.878 -9.995  1.00 50.49  ? 1322 ARG A O     1 
ATOM   6468 C  CB    . ARG A 1 452 ? 40.074 -12.099 -8.391  1.00 37.73  ? 1322 ARG A CB    1 
ATOM   6469 C  CG    . ARG A 1 452 ? 41.162 -12.316 -7.347  1.00 46.29  ? 1322 ARG A CG    1 
ATOM   6470 C  CD    . ARG A 1 452 ? 40.588 -12.382 -5.931  1.00 39.34  ? 1322 ARG A CD    1 
ATOM   6471 N  NE    . ARG A 1 452 ? 40.153 -11.075 -5.445  1.00 34.53  ? 1322 ARG A NE    1 
ATOM   6472 C  CZ    . ARG A 1 452 ? 40.978 -10.116 -5.029  1.00 47.69  ? 1322 ARG A CZ    1 
ATOM   6473 N  NH1   . ARG A 1 452 ? 42.293 -10.305 -5.045  1.00 41.85  ? 1322 ARG A NH1   1 
ATOM   6474 N  NH2   . ARG A 1 452 ? 40.490 -8.960  -4.603  1.00 38.43  ? 1322 ARG A NH2   1 
ATOM   6475 H  H     . ARG A 1 452 ? 42.191 -13.101 -10.202 1.00 42.31  ? 1322 ARG A H     1 
ATOM   6476 H  HA    . ARG A 1 452 ? 39.824 -11.919 -10.430 1.00 54.45  ? 1322 ARG A HA    1 
ATOM   6477 H  HB2   . ARG A 1 452 ? 39.617 -11.271 -8.173  1.00 45.22  ? 1322 ARG A HB2   1 
ATOM   6478 H  HB3   . ARG A 1 452 ? 39.454 -12.842 -8.329  1.00 45.22  ? 1322 ARG A HB3   1 
ATOM   6479 H  HG2   . ARG A 1 452 ? 41.616 -13.154 -7.529  1.00 55.49  ? 1322 ARG A HG2   1 
ATOM   6480 H  HG3   . ARG A 1 452 ? 41.791 -11.579 -7.384  1.00 55.49  ? 1322 ARG A HG3   1 
ATOM   6481 H  HD2   . ARG A 1 452 ? 39.821 -12.976 -5.927  1.00 47.15  ? 1322 ARG A HD2   1 
ATOM   6482 H  HD3   . ARG A 1 452 ? 41.270 -12.716 -5.328  1.00 47.15  ? 1322 ARG A HD3   1 
ATOM   6483 H  HE    . ARG A 1 452 ? 39.309 -10.914 -5.426  1.00 41.39  ? 1322 ARG A HE    1 
ATOM   6484 H  HH11  . ARG A 1 452 ? 42.616 -11.053 -5.320  1.00 50.16  ? 1322 ARG A HH11  1 
ATOM   6485 H  HH12  . ARG A 1 452 ? 42.820 -9.682  -4.776  1.00 50.16  ? 1322 ARG A HH12  1 
ATOM   6486 H  HH21  . ARG A 1 452 ? 39.640 -8.830  -4.591  1.00 46.07  ? 1322 ARG A HH21  1 
ATOM   6487 H  HH22  . ARG A 1 452 ? 41.023 -8.340  -4.336  1.00 46.07  ? 1322 ARG A HH22  1 
ATOM   6488 N  N     . THR A 1 453 ? 40.835 -9.622  -10.119 1.00 48.15  ? 1323 THR A N     1 
ATOM   6489 C  CA    . THR A 1 453 ? 41.560 -8.363  -10.109 1.00 54.39  ? 1323 THR A CA    1 
ATOM   6490 C  C     . THR A 1 453 ? 41.835 -8.036  -8.646  1.00 69.15  ? 1323 THR A C     1 
ATOM   6491 O  O     . THR A 1 453 ? 41.122 -8.507  -7.759  1.00 60.92  ? 1323 THR A O     1 
ATOM   6492 C  CB    . THR A 1 453 ? 40.753 -7.226  -10.763 1.00 55.14  ? 1323 THR A CB    1 
ATOM   6493 O  OG1   . THR A 1 453 ? 40.008 -6.521  -9.763  1.00 77.93  ? 1323 THR A OG1   1 
ATOM   6494 C  CG2   . THR A 1 453 ? 39.798 -7.774  -11.821 1.00 64.00  ? 1323 THR A CG2   1 
ATOM   6495 H  H     . THR A 1 453 ? 39.985 -9.540  -10.216 1.00 57.73  ? 1323 THR A H     1 
ATOM   6496 H  HA    . THR A 1 453 ? 42.413 -8.463  -10.581 1.00 65.21  ? 1323 THR A HA    1 
ATOM   6497 H  HB    . THR A 1 453 ? 41.364 -6.611  -11.197 1.00 66.11  ? 1323 THR A HB    1 
ATOM   6498 H  HG1   . THR A 1 453 ? 40.519 -6.200  -9.207  1.00 93.46  ? 1323 THR A HG1   1 
ATOM   6499 H  HG21  . THR A 1 453 ? 39.302 -7.055  -12.219 1.00 76.74  ? 1323 THR A HG21  1 
ATOM   6500 H  HG22  . THR A 1 453 ? 40.293 -8.228  -12.506 1.00 76.74  ? 1323 THR A HG22  1 
ATOM   6501 H  HG23  . THR A 1 453 ? 39.183 -8.392  -11.419 1.00 76.74  ? 1323 THR A HG23  1 
ATOM   6502 N  N     . LYS A 1 454 ? 42.869 -7.242  -8.389  1.00 69.29  ? 1324 LYS A N     1 
ATOM   6503 C  CA    . LYS A 1 454 ? 43.279 -6.947  -7.018  1.00 60.00  ? 1324 LYS A CA    1 
ATOM   6504 C  C     . LYS A 1 454 ? 42.211 -6.177  -6.236  1.00 56.88  ? 1324 LYS A C     1 
ATOM   6505 O  O     . LYS A 1 454 ? 42.079 -6.351  -5.022  1.00 52.72  ? 1324 LYS A O     1 
ATOM   6506 C  CB    . LYS A 1 454 ? 44.585 -6.156  -7.019  1.00 74.35  ? 1324 LYS A CB    1 
ATOM   6507 C  CG    . LYS A 1 454 ? 45.053 -5.740  -5.636  1.00 76.90  ? 1324 LYS A CG    1 
ATOM   6508 C  CD    . LYS A 1 454 ? 46.087 -4.629  -5.710  1.00 80.88  ? 1324 LYS A CD    1 
ATOM   6509 C  CE    . LYS A 1 454 ? 45.512 -3.371  -6.350  1.00 81.65  ? 1324 LYS A CE    1 
ATOM   6510 N  NZ    . LYS A 1 454 ? 45.851 -3.251  -7.797  1.00 77.88  ? 1324 LYS A NZ    1 
ATOM   6511 H  H     . LYS A 1 454 ? 43.351 -6.861  -8.991  1.00 83.10  ? 1324 LYS A H     1 
ATOM   6512 H  HA    . LYS A 1 454 ? 43.441 -7.792  -6.550  1.00 71.94  ? 1324 LYS A HA    1 
ATOM   6513 H  HB2   . LYS A 1 454 ? 45.281 -6.702  -7.416  1.00 89.17  ? 1324 LYS A HB2   1 
ATOM   6514 H  HB3   . LYS A 1 454 ? 44.461 -5.350  -7.545  1.00 89.17  ? 1324 LYS A HB3   1 
ATOM   6515 H  HG2   . LYS A 1 454 ? 44.295 -5.416  -5.125  1.00 92.22  ? 1324 LYS A HG2   1 
ATOM   6516 H  HG3   . LYS A 1 454 ? 45.457 -6.502  -5.192  1.00 92.22  ? 1324 LYS A HG3   1 
ATOM   6517 H  HD2   . LYS A 1 454 ? 46.382 -4.406  -4.813  1.00 97.00  ? 1324 LYS A HD2   1 
ATOM   6518 H  HD3   . LYS A 1 454 ? 46.839 -4.926  -6.246  1.00 97.00  ? 1324 LYS A HD3   1 
ATOM   6519 H  HE2   . LYS A 1 454 ? 44.546 -3.389  -6.268  1.00 97.93  ? 1324 LYS A HE2   1 
ATOM   6520 H  HE3   . LYS A 1 454 ? 45.869 -2.593  -5.893  1.00 97.93  ? 1324 LYS A HE3   1 
ATOM   6521 H  HZ1   . LYS A 1 454 ? 46.734 -3.224  -7.902  1.00 93.39  ? 1324 LYS A HZ1   1 
ATOM   6522 H  HZ2   . LYS A 1 454 ? 45.528 -3.950  -8.244  1.00 93.39  ? 1324 LYS A HZ2   1 
ATOM   6523 H  HZ3   . LYS A 1 454 ? 45.498 -2.506  -8.131  1.00 93.39  ? 1324 LYS A HZ3   1 
ATOM   6524 N  N     . GLU A 1 455 ? 41.460 -5.323  -6.927  1.00 49.44  ? 1325 GLU A N     1 
ATOM   6525 C  CA    . GLU A 1 455 ? 40.404 -4.537  -6.289  1.00 51.62  ? 1325 GLU A CA    1 
ATOM   6526 C  C     . GLU A 1 455 ? 39.044 -5.228  -6.341  1.00 44.33  ? 1325 GLU A C     1 
ATOM   6527 O  O     . GLU A 1 455 ? 38.027 -4.644  -5.973  1.00 40.85  ? 1325 GLU A O     1 
ATOM   6528 C  CB    . GLU A 1 455 ? 40.287 -3.160  -6.943  1.00 51.97  ? 1325 GLU A CB    1 
ATOM   6529 C  CG    . GLU A 1 455 ? 41.337 -2.161  -6.485  1.00 66.20  ? 1325 GLU A CG    1 
ATOM   6530 C  CD    . GLU A 1 455 ? 40.897 -0.718  -6.676  1.00 72.35  ? 1325 GLU A CD    1 
ATOM   6531 O  OE1   . GLU A 1 455 ? 41.765 0.179   -6.636  1.00 77.66  ? 1325 GLU A OE1   1 
ATOM   6532 O  OE2   . GLU A 1 455 ? 39.683 -0.480  -6.861  1.00 69.31  ? 1325 GLU A OE2   1 
ATOM   6533 H  H     . GLU A 1 455 ? 41.542 -5.178  -7.771  1.00 59.28  ? 1325 GLU A H     1 
ATOM   6534 H  HA    . GLU A 1 455 ? 40.636 -4.403  -5.346  1.00 61.88  ? 1325 GLU A HA    1 
ATOM   6535 H  HB2   . GLU A 1 455 ? 40.378 -3.263  -7.904  1.00 62.30  ? 1325 GLU A HB2   1 
ATOM   6536 H  HB3   . GLU A 1 455 ? 39.416 -2.789  -6.734  1.00 62.30  ? 1325 GLU A HB3   1 
ATOM   6537 H  HG2   . GLU A 1 455 ? 41.514 -2.298  -5.541  1.00 79.38  ? 1325 GLU A HG2   1 
ATOM   6538 H  HG3   . GLU A 1 455 ? 42.149 -2.298  -6.998  1.00 79.38  ? 1325 GLU A HG3   1 
ATOM   6539 N  N     . GLU A 1 456 ? 39.022 -6.471  -6.799  1.00 34.95  ? 1326 GLU A N     1 
ATOM   6540 C  CA    . GLU A 1 456 ? 37.764 -7.184  -6.959  1.00 45.88  ? 1326 GLU A CA    1 
ATOM   6541 C  C     . GLU A 1 456 ? 37.119 -7.445  -5.598  1.00 31.80  ? 1326 GLU A C     1 
ATOM   6542 O  O     . GLU A 1 456 ? 37.770 -7.959  -4.695  1.00 37.68  ? 1326 GLU A O     1 
ATOM   6543 C  CB    . GLU A 1 456 ? 37.997 -8.501  -7.691  1.00 43.06  ? 1326 GLU A CB    1 
ATOM   6544 C  CG    . GLU A 1 456 ? 36.734 -9.087  -8.272  1.00 38.70  ? 1326 GLU A CG    1 
ATOM   6545 C  CD    . GLU A 1 456 ? 36.987 -10.356 -9.052  1.00 49.25  ? 1326 GLU A CD    1 
ATOM   6546 O  OE1   . GLU A 1 456 ? 37.942 -10.392 -9.857  1.00 39.26  ? 1326 GLU A OE1   1 
ATOM   6547 O  OE2   . GLU A 1 456 ? 36.226 -11.322 -8.859  1.00 37.89  ? 1326 GLU A OE2   1 
ATOM   6548 H  H     . GLU A 1 456 ? 39.719 -6.923  -7.023  1.00 41.88  ? 1326 GLU A H     1 
ATOM   6549 H  HA    . GLU A 1 456 ? 37.148 -6.639  -7.493  1.00 55.00  ? 1326 GLU A HA    1 
ATOM   6550 H  HB2   . GLU A 1 456 ? 38.619 -8.350  -8.420  1.00 51.62  ? 1326 GLU A HB2   1 
ATOM   6551 H  HB3   . GLU A 1 456 ? 38.367 -9.146  -7.069  1.00 51.62  ? 1326 GLU A HB3   1 
ATOM   6552 H  HG2   . GLU A 1 456 ? 36.120 -9.295  -7.550  1.00 46.38  ? 1326 GLU A HG2   1 
ATOM   6553 H  HG3   . GLU A 1 456 ? 36.332 -8.440  -8.873  1.00 46.38  ? 1326 GLU A HG3   1 
ATOM   6554 N  N     . PRO A 1 457 ? 35.837 -7.076  -5.445  1.00 34.37  ? 1327 PRO A N     1 
ATOM   6555 C  CA    . PRO A 1 457 ? 35.110 -7.314  -4.191  1.00 40.26  ? 1327 PRO A CA    1 
ATOM   6556 C  C     . PRO A 1 457 ? 35.016 -8.793  -3.843  1.00 40.88  ? 1327 PRO A C     1 
ATOM   6557 O  O     . PRO A 1 457 ? 35.198 -9.644  -4.714  1.00 29.81  ? 1327 PRO A O     1 
ATOM   6558 C  CB    . PRO A 1 457 ? 33.710 -6.769  -4.487  1.00 36.10  ? 1327 PRO A CB    1 
ATOM   6559 C  CG    . PRO A 1 457 ? 33.902 -5.791  -5.597  1.00 39.39  ? 1327 PRO A CG    1 
ATOM   6560 C  CD    . PRO A 1 457 ? 35.028 -6.326  -6.421  1.00 34.91  ? 1327 PRO A CD    1 
ATOM   6561 H  HA    . PRO A 1 457 ? 35.514 -6.817  -3.450  1.00 48.26  ? 1327 PRO A HA    1 
ATOM   6562 H  HB2   . PRO A 1 457 ? 33.129 -7.494  -4.766  1.00 43.26  ? 1327 PRO A HB2   1 
ATOM   6563 H  HB3   . PRO A 1 457 ? 33.357 -6.329  -3.699  1.00 43.26  ? 1327 PRO A HB3   1 
ATOM   6564 H  HG2   . PRO A 1 457 ? 33.090 -5.734  -6.125  1.00 47.21  ? 1327 PRO A HG2   1 
ATOM   6565 H  HG3   . PRO A 1 457 ? 34.132 -4.923  -5.229  1.00 47.21  ? 1327 PRO A HG3   1 
ATOM   6566 H  HD2   . PRO A 1 457 ? 34.690 -6.921  -7.109  1.00 41.83  ? 1327 PRO A HD2   1 
ATOM   6567 H  HD3   . PRO A 1 457 ? 35.545 -5.599  -6.802  1.00 41.83  ? 1327 PRO A HD3   1 
ATOM   6568 N  N     . ALA A 1 458 ? 34.739 -9.094  -2.578  1.00 29.27  ? 1328 ALA A N     1 
ATOM   6569 C  CA    . ALA A 1 458 ? 34.430 -10.458 -2.177  1.00 28.38  ? 1328 ALA A CA    1 
ATOM   6570 C  C     . ALA A 1 458 ? 33.082 -10.829 -2.781  1.00 25.79  ? 1328 ALA A C     1 
ATOM   6571 O  O     . ALA A 1 458 ? 32.257 -9.958  -3.030  1.00 32.32  ? 1328 ALA A O     1 
ATOM   6572 C  CB    . ALA A 1 458 ? 34.393 -10.573 -0.655  1.00 29.22  ? 1328 ALA A CB    1 
ATOM   6573 H  H     . ALA A 1 458 ? 34.723 -8.524  -1.934  1.00 35.07  ? 1328 ALA A H     1 
ATOM   6574 H  HA    . ALA A 1 458 ? 35.112 -11.070 -2.524  1.00 34.00  ? 1328 ALA A HA    1 
ATOM   6575 H  HB1   . ALA A 1 458 ? 34.188 -11.480 -0.416  1.00 35.01  ? 1328 ALA A HB1   1 
ATOM   6576 H  HB2   . ALA A 1 458 ? 35.251 -10.327 -0.303  1.00 35.01  ? 1328 ALA A HB2   1 
ATOM   6577 H  HB3   . ALA A 1 458 ? 33.716 -9.983  -0.314  1.00 35.01  ? 1328 ALA A HB3   1 
ATOM   6578 N  N     . HIS A 1 459 ? 32.863 -12.117 -3.029  1.00 28.45  ? 1329 HIS A N     1 
ATOM   6579 C  CA    . HIS A 1 459 ? 31.598 -12.576 -3.594  1.00 31.02  ? 1329 HIS A CA    1 
ATOM   6580 C  C     . HIS A 1 459 ? 30.772 -13.271 -2.531  1.00 27.19  ? 1329 HIS A C     1 
ATOM   6581 O  O     . HIS A 1 459 ? 31.314 -13.874 -1.609  1.00 27.48  ? 1329 HIS A O     1 
ATOM   6582 C  CB    . HIS A 1 459 ? 31.841 -13.536 -4.757  1.00 33.56  ? 1329 HIS A CB    1 
ATOM   6583 C  CG    . HIS A 1 459 ? 32.582 -12.918 -5.896  1.00 35.99  ? 1329 HIS A CG    1 
ATOM   6584 N  ND1   . HIS A 1 459 ? 33.908 -13.190 -6.152  1.00 48.51  ? 1329 HIS A ND1   1 
ATOM   6585 C  CD2   . HIS A 1 459 ? 32.191 -12.028 -6.838  1.00 51.49  ? 1329 HIS A CD2   1 
ATOM   6586 C  CE1   . HIS A 1 459 ? 34.300 -12.500 -7.207  1.00 44.76  ? 1329 HIS A CE1   1 
ATOM   6587 N  NE2   . HIS A 1 459 ? 33.277 -11.787 -7.643  1.00 52.55  ? 1329 HIS A NE2   1 
ATOM   6588 H  H     . HIS A 1 459 ? 33.431 -12.745 -2.880  1.00 34.08  ? 1329 HIS A H     1 
ATOM   6589 H  HA    . HIS A 1 459 ? 31.091 -11.807 -3.928  1.00 37.17  ? 1329 HIS A HA    1 
ATOM   6590 H  HB2   . HIS A 1 459 ? 32.361 -14.290 -4.438  1.00 40.22  ? 1329 HIS A HB2   1 
ATOM   6591 H  HB3   . HIS A 1 459 ? 30.984 -13.845 -5.092  1.00 40.22  ? 1329 HIS A HB3   1 
ATOM   6592 H  HD1   . HIS A 1 459 ? 34.402 -13.727 -5.697  1.00 58.16  ? 1329 HIS A HD1   1 
ATOM   6593 H  HD2   . HIS A 1 459 ? 31.344 -11.653 -6.926  1.00 61.73  ? 1329 HIS A HD2   1 
ATOM   6594 H  HE1   . HIS A 1 459 ? 35.151 -12.514 -7.580  1.00 53.66  ? 1329 HIS A HE1   1 
ATOM   6595 H  HE2   . HIS A 1 459 ? 33.289 -11.258 -8.321  1.00 63.00  ? 1329 HIS A HE2   1 
ATOM   6596 N  N     . TYR A 1 460 ? 29.455 -13.177 -2.672  1.00 26.08  ? 1330 TYR A N     1 
ATOM   6597 C  CA    . TYR A 1 460 ? 28.532 -13.801 -1.742  1.00 28.48  ? 1330 TYR A CA    1 
ATOM   6598 C  C     . TYR A 1 460 ? 27.583 -14.705 -2.514  1.00 33.34  ? 1330 TYR A C     1 
ATOM   6599 O  O     . TYR A 1 460 ? 27.364 -14.515 -3.709  1.00 29.67  ? 1330 TYR A O     1 
ATOM   6600 C  CB    . TYR A 1 460 ? 27.727 -12.736 -1.004  1.00 27.81  ? 1330 TYR A CB    1 
ATOM   6601 C  CG    . TYR A 1 460 ? 28.548 -11.815 -0.129  1.00 29.06  ? 1330 TYR A CG    1 
ATOM   6602 C  CD1   . TYR A 1 460 ? 28.673 -12.053 1.233   1.00 23.83  ? 1330 TYR A CD1   1 
ATOM   6603 C  CD2   . TYR A 1 460 ? 29.184 -10.697 -0.660  1.00 33.12  ? 1330 TYR A CD2   1 
ATOM   6604 C  CE1   . TYR A 1 460 ? 29.410 -11.211 2.044   1.00 26.80  ? 1330 TYR A CE1   1 
ATOM   6605 C  CE2   . TYR A 1 460 ? 29.925 -9.847  0.144   1.00 23.91  ? 1330 TYR A CE2   1 
ATOM   6606 C  CZ    . TYR A 1 460 ? 30.034 -10.111 1.497   1.00 29.33  ? 1330 TYR A CZ    1 
ATOM   6607 O  OH    . TYR A 1 460 ? 30.766 -9.274  2.312   1.00 33.56  ? 1330 TYR A OH    1 
ATOM   6608 H  H     . TYR A 1 460 ? 29.068 -12.750 -3.310  1.00 31.24  ? 1330 TYR A H     1 
ATOM   6609 H  HA    . TYR A 1 460 ? 29.026 -14.339 -1.089  1.00 34.12  ? 1330 TYR A HA    1 
ATOM   6610 H  HB2   . TYR A 1 460 ? 27.268 -12.187 -1.658  1.00 33.31  ? 1330 TYR A HB2   1 
ATOM   6611 H  HB3   . TYR A 1 460 ? 27.078 -13.178 -0.435  1.00 33.31  ? 1330 TYR A HB3   1 
ATOM   6612 H  HD1   . TYR A 1 460 ? 28.252 -12.793 1.606   1.00 28.54  ? 1330 TYR A HD1   1 
ATOM   6613 H  HD2   . TYR A 1 460 ? 29.110 -10.517 -1.570  1.00 39.69  ? 1330 TYR A HD2   1 
ATOM   6614 H  HE1   . TYR A 1 460 ? 29.485 -11.386 2.955   1.00 32.10  ? 1330 TYR A HE1   1 
ATOM   6615 H  HE2   . TYR A 1 460 ? 30.347 -9.104  -0.223  1.00 28.63  ? 1330 TYR A HE2   1 
ATOM   6616 H  HH    . TYR A 1 460 ? 30.454 -8.516  2.287   1.00 40.22  ? 1330 TYR A HH    1 
ATOM   6617 N  N     . CYS A 1 461 ? 27.008 -15.680 -1.825  1.00 29.20  ? 1331 CYS A N     1 
ATOM   6618 C  CA    . CYS A 1 461 ? 26.076 -16.599 -2.452  1.00 28.66  ? 1331 CYS A CA    1 
ATOM   6619 C  C     . CYS A 1 461 ? 24.775 -15.881 -2.786  1.00 28.71  ? 1331 CYS A C     1 
ATOM   6620 O  O     . CYS A 1 461 ? 24.201 -15.194 -1.944  1.00 32.45  ? 1331 CYS A O     1 
ATOM   6621 C  CB    . CYS A 1 461 ? 25.792 -17.775 -1.530  1.00 30.40  ? 1331 CYS A CB    1 
ATOM   6622 S  SG    . CYS A 1 461 ? 24.590 -18.915 -2.230  1.00 32.80  ? 1331 CYS A SG    1 
ATOM   6623 H  H     . CYS A 1 461 ? 27.141 -15.830 -0.988  1.00 34.98  ? 1331 CYS A H     1 
ATOM   6624 H  HA    . CYS A 1 461 ? 26.465 -16.943 -3.284  1.00 34.33  ? 1331 CYS A HA    1 
ATOM   6625 H  HB2   . CYS A 1 461 ? 26.615 -18.264 -1.374  1.00 36.43  ? 1331 CYS A HB2   1 
ATOM   6626 H  HB3   . CYS A 1 461 ? 25.438 -17.442 -0.690  1.00 36.43  ? 1331 CYS A HB3   1 
ATOM   6627 N  N     . SER A 1 462 ? 24.309 -16.048 -4.016  1.00 32.49  ? 1332 SER A N     1 
ATOM   6628 C  CA    . SER A 1 462 ? 23.096 -15.384 -4.473  1.00 35.94  ? 1332 SER A CA    1 
ATOM   6629 C  C     . SER A 1 462 ? 21.860 -15.934 -3.765  1.00 36.41  ? 1332 SER A C     1 
ATOM   6630 O  O     . SER A 1 462 ? 20.795 -15.321 -3.800  1.00 45.16  ? 1332 SER A O     1 
ATOM   6631 C  CB    . SER A 1 462 ? 22.945 -15.550 -5.983  1.00 33.94  ? 1332 SER A CB    1 
ATOM   6632 O  OG    . SER A 1 462 ? 22.911 -16.921 -6.330  1.00 43.48  ? 1332 SER A OG    1 
ATOM   6633 H  H     . SER A 1 462 ? 24.680 -16.546 -4.611  1.00 38.93  ? 1332 SER A H     1 
ATOM   6634 H  HA    . SER A 1 462 ? 23.160 -14.426 -4.276  1.00 43.07  ? 1332 SER A HA    1 
ATOM   6635 H  HB2   . SER A 1 462 ? 22.118 -15.131 -6.267  1.00 40.67  ? 1332 SER A HB2   1 
ATOM   6636 H  HB3   . SER A 1 462 ? 23.700 -15.130 -6.425  1.00 40.67  ? 1332 SER A HB3   1 
ATOM   6637 H  HG    . SER A 1 462 ? 22.979 -17.383 -5.656  1.00 52.12  ? 1332 SER A HG    1 
ATOM   6638 N  N     . ILE A 1 463 ? 22.008 -17.089 -3.123  1.00 34.00  ? 1333 ILE A N     1 
ATOM   6639 C  CA    . ILE A 1 463 ? 20.896 -17.717 -2.415  1.00 39.52  ? 1333 ILE A CA    1 
ATOM   6640 C  C     . ILE A 1 463 ? 20.883 -17.372 -0.929  1.00 41.61  ? 1333 ILE A C     1 
ATOM   6641 O  O     . ILE A 1 463 ? 19.919 -16.789 -0.436  1.00 44.20  ? 1333 ILE A O     1 
ATOM   6642 C  CB    . ILE A 1 463 ? 20.934 -19.250 -2.544  1.00 45.02  ? 1333 ILE A CB    1 
ATOM   6643 C  CG1   . ILE A 1 463 ? 21.080 -19.665 -4.008  1.00 48.43  ? 1333 ILE A CG1   1 
ATOM   6644 C  CG2   . ILE A 1 463 ? 19.677 -19.859 -1.942  1.00 42.10  ? 1333 ILE A CG2   1 
ATOM   6645 C  CD1   . ILE A 1 463 ? 19.953 -19.187 -4.898  1.00 59.30  ? 1333 ILE A CD1   1 
ATOM   6646 H  H     . ILE A 1 463 ? 22.744 -17.532 -3.083  1.00 40.75  ? 1333 ILE A H     1 
ATOM   6647 H  HA    . ILE A 1 463 ? 20.054 -17.403 -2.805  1.00 47.37  ? 1333 ILE A HA    1 
ATOM   6648 H  HB    . ILE A 1 463 ? 21.702 -19.581 -2.053  1.00 53.97  ? 1333 ILE A HB    1 
ATOM   6649 H  HG12  . ILE A 1 463 ? 21.907 -19.297 -4.356  1.00 58.06  ? 1333 ILE A HG12  1 
ATOM   6650 H  HG13  . ILE A 1 463 ? 21.105 -20.633 -4.057  1.00 58.06  ? 1333 ILE A HG13  1 
ATOM   6651 H  HG21  . ILE A 1 463 ? 19.720 -20.814 -2.032  1.00 50.47  ? 1333 ILE A HG21  1 
ATOM   6652 H  HG22  . ILE A 1 463 ? 19.629 -19.620 -1.013  1.00 50.47  ? 1333 ILE A HG22  1 
ATOM   6653 H  HG23  . ILE A 1 463 ? 18.911 -19.520 -2.409  1.00 50.47  ? 1333 ILE A HG23  1 
ATOM   6654 H  HD11  . ILE A 1 463 ? 20.116 -19.486 -5.795  1.00 71.10  ? 1333 ILE A HD11  1 
ATOM   6655 H  HD12  . ILE A 1 463 ? 19.125 -19.552 -4.576  1.00 71.10  ? 1333 ILE A HD12  1 
ATOM   6656 H  HD13  . ILE A 1 463 ? 19.921 -18.228 -4.872  1.00 71.10  ? 1333 ILE A HD13  1 
ATOM   6657 N  N     . CYS A 1 464 ? 21.943 -17.743 -0.215  1.00 31.19  ? 1334 CYS A N     1 
ATOM   6658 C  CA    . CYS A 1 464 ? 21.974 -17.588 1.238   1.00 35.91  ? 1334 CYS A CA    1 
ATOM   6659 C  C     . CYS A 1 464 ? 22.818 -16.389 1.684   1.00 40.34  ? 1334 CYS A C     1 
ATOM   6660 O  O     . CYS A 1 464 ? 22.831 -16.032 2.861   1.00 42.99  ? 1334 CYS A O     1 
ATOM   6661 C  CB    . CYS A 1 464 ? 22.502 -18.865 1.890   1.00 31.98  ? 1334 CYS A CB    1 
ATOM   6662 S  SG    . CYS A 1 464 ? 24.275 -19.109 1.688   1.00 33.36  ? 1334 CYS A SG    1 
ATOM   6663 H  H     . CYS A 1 464 ? 22.657 -18.088 -0.548  1.00 37.37  ? 1334 CYS A H     1 
ATOM   6664 H  HA    . CYS A 1 464 ? 21.059 -17.444 1.559   1.00 43.04  ? 1334 CYS A HA    1 
ATOM   6665 H  HB2   . CYS A 1 464 ? 22.314 -18.831 2.841   1.00 38.32  ? 1334 CYS A HB2   1 
ATOM   6666 H  HB3   . CYS A 1 464 ? 22.051 -19.627 1.494   1.00 38.32  ? 1334 CYS A HB3   1 
ATOM   6667 N  N     . GLU A 1 465 ? 23.533 -15.789 0.738   1.00 39.99  ? 1335 GLU A N     1 
ATOM   6668 C  CA    . GLU A 1 465 ? 24.293 -14.562 0.981   1.00 34.98  ? 1335 GLU A CA    1 
ATOM   6669 C  C     . GLU A 1 465 ? 25.528 -14.759 1.863   1.00 29.66  ? 1335 GLU A C     1 
ATOM   6670 O  O     . GLU A 1 465 ? 26.108 -13.788 2.355   1.00 31.83  ? 1335 GLU A O     1 
ATOM   6671 C  CB    . GLU A 1 465 ? 23.384 -13.483 1.576   1.00 42.87  ? 1335 GLU A CB    1 
ATOM   6672 C  CG    . GLU A 1 465 ? 22.239 -13.082 0.660   1.00 49.97  ? 1335 GLU A CG    1 
ATOM   6673 C  CD    . GLU A 1 465 ? 21.507 -11.851 1.150   1.00 45.97  ? 1335 GLU A CD    1 
ATOM   6674 O  OE1   . GLU A 1 465 ? 20.725 -11.968 2.115   1.00 58.52  ? 1335 GLU A OE1   1 
ATOM   6675 O  OE2   . GLU A 1 465 ? 21.722 -10.766 0.573   1.00 52.10  ? 1335 GLU A OE2   1 
ATOM   6676 H  H     . GLU A 1 465 ? 23.597 -16.078 -0.070  1.00 47.93  ? 1335 GLU A H     1 
ATOM   6677 H  HA    . GLU A 1 465 ? 24.610 -14.227 0.116   1.00 41.92  ? 1335 GLU A HA    1 
ATOM   6678 H  HB2   . GLU A 1 465 ? 23.001 -13.816 2.402   1.00 51.39  ? 1335 GLU A HB2   1 
ATOM   6679 H  HB3   . GLU A 1 465 ? 23.914 -12.690 1.754   1.00 51.39  ? 1335 GLU A HB3   1 
ATOM   6680 H  HG2   . GLU A 1 465 ? 22.592 -12.890 -0.223  1.00 59.90  ? 1335 GLU A HG2   1 
ATOM   6681 H  HG3   . GLU A 1 465 ? 21.601 -13.811 0.612   1.00 59.90  ? 1335 GLU A HG3   1 
ATOM   6682 N  N     . VAL A 1 466 ? 25.944 -16.008 2.050   1.00 30.52  ? 1336 VAL A N     1 
ATOM   6683 C  CA    . VAL A 1 466 ? 27.180 -16.291 2.768   1.00 30.63  ? 1336 VAL A CA    1 
ATOM   6684 C  C     . VAL A 1 466 ? 28.365 -15.848 1.910   1.00 23.91  ? 1336 VAL A C     1 
ATOM   6685 O  O     . VAL A 1 466 ? 28.293 -15.888 0.685   1.00 26.93  ? 1336 VAL A O     1 
ATOM   6686 C  CB    . VAL A 1 466 ? 27.314 -17.797 3.081   1.00 31.30  ? 1336 VAL A CB    1 
ATOM   6687 C  CG1   . VAL A 1 466 ? 27.594 -18.590 1.803   1.00 29.98  ? 1336 VAL A CG1   1 
ATOM   6688 C  CG2   . VAL A 1 466 ? 28.408 -18.034 4.105   1.00 30.55  ? 1336 VAL A CG2   1 
ATOM   6689 H  H     . VAL A 1 466 ? 25.529 -16.707 1.770   1.00 36.57  ? 1336 VAL A H     1 
ATOM   6690 H  HA    . VAL A 1 466 ? 27.196 -15.791 3.611   1.00 36.70  ? 1336 VAL A HA    1 
ATOM   6691 H  HB    . VAL A 1 466 ? 26.470 -18.120 3.460   1.00 37.51  ? 1336 VAL A HB    1 
ATOM   6692 H  HG11  . VAL A 1 466 ? 27.673 -19.521 2.024   1.00 35.92  ? 1336 VAL A HG11  1 
ATOM   6693 H  HG12  . VAL A 1 466 ? 26.868 -18.459 1.189   1.00 35.92  ? 1336 VAL A HG12  1 
ATOM   6694 H  HG13  . VAL A 1 466 ? 28.413 -18.276 1.413   1.00 35.92  ? 1336 VAL A HG13  1 
ATOM   6695 H  HG21  . VAL A 1 466 ? 28.471 -18.975 4.282   1.00 36.61  ? 1336 VAL A HG21  1 
ATOM   6696 H  HG22  . VAL A 1 466 ? 29.240 -17.710 3.753   1.00 36.61  ? 1336 VAL A HG22  1 
ATOM   6697 H  HG23  . VAL A 1 466 ? 28.188 -17.562 4.912   1.00 36.61  ? 1336 VAL A HG23  1 
ATOM   6698 N  N     . GLU A 1 467 ? 29.451 -15.413 2.541   1.00 24.55  ? 1337 GLU A N     1 
ATOM   6699 C  CA    . GLU A 1 467 ? 30.664 -15.109 1.789   1.00 22.28  ? 1337 GLU A CA    1 
ATOM   6700 C  C     . GLU A 1 467 ? 31.179 -16.393 1.150   1.00 34.44  ? 1337 GLU A C     1 
ATOM   6701 O  O     . GLU A 1 467 ? 31.200 -17.442 1.789   1.00 27.21  ? 1337 GLU A O     1 
ATOM   6702 C  CB    . GLU A 1 467 ? 31.746 -14.522 2.694   1.00 24.88  ? 1337 GLU A CB    1 
ATOM   6703 C  CG    . GLU A 1 467 ? 33.012 -14.147 1.938   1.00 21.82  ? 1337 GLU A CG    1 
ATOM   6704 C  CD    . GLU A 1 467 ? 34.109 -13.609 2.840   1.00 26.96  ? 1337 GLU A CD    1 
ATOM   6705 O  OE1   . GLU A 1 467 ? 33.886 -13.490 4.063   1.00 26.78  ? 1337 GLU A OE1   1 
ATOM   6706 O  OE2   . GLU A 1 467 ? 35.203 -13.309 2.321   1.00 21.60  ? 1337 GLU A OE2   1 
ATOM   6707 H  H     . GLU A 1 467 ? 29.513 -15.287 3.389   1.00 29.40  ? 1337 GLU A H     1 
ATOM   6708 H  HA    . GLU A 1 467 ? 30.461 -14.464 1.080   1.00 26.68  ? 1337 GLU A HA    1 
ATOM   6709 H  HB2   . GLU A 1 467 ? 31.402 -13.720 3.118   1.00 29.80  ? 1337 GLU A HB2   1 
ATOM   6710 H  HB3   . GLU A 1 467 ? 31.984 -15.178 3.368   1.00 29.80  ? 1337 GLU A HB3   1 
ATOM   6711 H  HG2   . GLU A 1 467 ? 33.355 -14.935 1.489   1.00 26.13  ? 1337 GLU A HG2   1 
ATOM   6712 H  HG3   . GLU A 1 467 ? 32.798 -13.461 1.287   1.00 26.13  ? 1337 GLU A HG3   1 
ATOM   6713 N  N     . VAL A 1 468 ? 31.588 -16.306 -0.111  1.00 26.02  ? 1338 VAL A N     1 
ATOM   6714 C  CA    . VAL A 1 468 ? 32.155 -17.445 -0.818  1.00 29.44  ? 1338 VAL A CA    1 
ATOM   6715 C  C     . VAL A 1 468 ? 33.588 -17.110 -1.219  1.00 28.08  ? 1338 VAL A C     1 
ATOM   6716 O  O     . VAL A 1 468 ? 33.829 -16.229 -2.045  1.00 29.84  ? 1338 VAL A O     1 
ATOM   6717 C  CB    . VAL A 1 468 ? 31.324 -17.806 -2.062  1.00 28.48  ? 1338 VAL A CB    1 
ATOM   6718 C  CG1   . VAL A 1 468 ? 31.902 -19.039 -2.742  1.00 32.55  ? 1338 VAL A CG1   1 
ATOM   6719 C  CG2   . VAL A 1 468 ? 29.868 -18.037 -1.671  1.00 31.27  ? 1338 VAL A CG2   1 
ATOM   6720 H  H     . VAL A 1 468 ? 31.546 -15.589 -0.584  1.00 31.17  ? 1338 VAL A H     1 
ATOM   6721 H  HA    . VAL A 1 468 ? 32.173 -18.223 -0.222  1.00 35.27  ? 1338 VAL A HA    1 
ATOM   6722 H  HB    . VAL A 1 468 ? 31.356 -17.062 -2.698  1.00 34.12  ? 1338 VAL A HB    1 
ATOM   6723 H  HG11  . VAL A 1 468 ? 31.371 -19.247 -3.514  1.00 39.00  ? 1338 VAL A HG11  1 
ATOM   6724 H  HG12  . VAL A 1 468 ? 32.806 -18.854 -3.006  1.00 39.00  ? 1338 VAL A HG12  1 
ATOM   6725 H  HG13  . VAL A 1 468 ? 31.884 -19.773 -2.124  1.00 39.00  ? 1338 VAL A HG13  1 
ATOM   6726 H  HG21  . VAL A 1 468 ? 29.366 -18.261 -2.458  1.00 37.47  ? 1338 VAL A HG21  1 
ATOM   6727 H  HG22  . VAL A 1 468 ? 29.826 -18.758 -1.039  1.00 37.47  ? 1338 VAL A HG22  1 
ATOM   6728 H  HG23  . VAL A 1 468 ? 29.520 -17.234 -1.277  1.00 37.47  ? 1338 VAL A HG23  1 
ATOM   6729 N  N     . PHE A 1 469 ? 34.533 -17.823 -0.619  1.00 29.32  ? 1339 PHE A N     1 
ATOM   6730 C  CA    . PHE A 1 469 ? 35.949 -17.504 -0.745  1.00 31.27  ? 1339 PHE A CA    1 
ATOM   6731 C  C     . PHE A 1 469 ? 36.699 -18.534 -1.584  1.00 32.98  ? 1339 PHE A C     1 
ATOM   6732 O  O     . PHE A 1 469 ? 36.648 -19.731 -1.305  1.00 33.44  ? 1339 PHE A O     1 
ATOM   6733 C  CB    . PHE A 1 469 ? 36.572 -17.434 0.652   1.00 31.75  ? 1339 PHE A CB    1 
ATOM   6734 C  CG    . PHE A 1 469 ? 38.034 -17.092 0.653   1.00 27.41  ? 1339 PHE A CG    1 
ATOM   6735 C  CD1   . PHE A 1 469 ? 38.461 -15.816 0.335   1.00 29.58  ? 1339 PHE A CD1   1 
ATOM   6736 C  CD2   . PHE A 1 469 ? 38.981 -18.045 0.989   1.00 29.20  ? 1339 PHE A CD2   1 
ATOM   6737 C  CE1   . PHE A 1 469 ? 39.806 -15.497 0.341   1.00 38.81  ? 1339 PHE A CE1   1 
ATOM   6738 C  CE2   . PHE A 1 469 ? 40.327 -17.732 0.997   1.00 32.46  ? 1339 PHE A CE2   1 
ATOM   6739 C  CZ    . PHE A 1 469 ? 40.740 -16.457 0.674   1.00 29.88  ? 1339 PHE A CZ    1 
ATOM   6740 H  H     . PHE A 1 469 ? 34.377 -18.509 -0.125  1.00 35.13  ? 1339 PHE A H     1 
ATOM   6741 H  HA    . PHE A 1 469 ? 36.048 -16.627 -1.172  1.00 37.47  ? 1339 PHE A HA    1 
ATOM   6742 H  HB2   . PHE A 1 469 ? 36.109 -16.754 1.166   1.00 38.04  ? 1339 PHE A HB2   1 
ATOM   6743 H  HB3   . PHE A 1 469 ? 36.470 -18.297 1.082   1.00 38.04  ? 1339 PHE A HB3   1 
ATOM   6744 H  HD1   . PHE A 1 469 ? 37.836 -15.165 0.110   1.00 35.44  ? 1339 PHE A HD1   1 
ATOM   6745 H  HD2   . PHE A 1 469 ? 38.708 -18.907 1.207   1.00 34.99  ? 1339 PHE A HD2   1 
ATOM   6746 H  HE1   . PHE A 1 469 ? 40.082 -14.636 0.123   1.00 46.51  ? 1339 PHE A HE1   1 
ATOM   6747 H  HE2   . PHE A 1 469 ? 40.954 -18.381 1.221   1.00 38.90  ? 1339 PHE A HE2   1 
ATOM   6748 H  HZ    . PHE A 1 469 ? 41.645 -16.244 0.678   1.00 35.80  ? 1339 PHE A HZ    1 
ATOM   6749 N  N     . ASP A 1 470 ? 37.383 -18.055 -2.618  1.00 33.25  ? 1340 ASP A N     1 
ATOM   6750 C  CA    . ASP A 1 470 ? 38.345 -18.861 -3.372  1.00 35.20  ? 1340 ASP A CA    1 
ATOM   6751 C  C     . ASP A 1 470 ? 37.730 -19.819 -4.396  1.00 43.80  ? 1340 ASP A C     1 
ATOM   6752 O  O     . ASP A 1 470 ? 38.290 -20.010 -5.468  1.00 59.27  ? 1340 ASP A O     1 
ATOM   6753 C  CB    . ASP A 1 470 ? 39.250 -19.646 -2.418  1.00 32.51  ? 1340 ASP A CB    1 
ATOM   6754 C  CG    . ASP A 1 470 ? 40.361 -20.380 -3.145  1.00 52.40  ? 1340 ASP A CG    1 
ATOM   6755 O  OD1   . ASP A 1 470 ? 40.889 -19.827 -4.131  1.00 46.18  ? 1340 ASP A OD1   1 
ATOM   6756 O  OD2   . ASP A 1 470 ? 40.700 -21.509 -2.736  1.00 43.42  ? 1340 ASP A OD2   1 
ATOM   6757 H  H     . ASP A 1 470 ? 37.307 -17.249 -2.910  1.00 39.84  ? 1340 ASP A H     1 
ATOM   6758 H  HA    . ASP A 1 470 ? 38.922 -18.246 -3.872  1.00 42.18  ? 1340 ASP A HA    1 
ATOM   6759 H  HB2   . ASP A 1 470 ? 39.658 -19.030 -1.789  1.00 38.95  ? 1340 ASP A HB2   1 
ATOM   6760 H  HB3   . ASP A 1 470 ? 38.717 -20.303 -1.943  1.00 38.95  ? 1340 ASP A HB3   1 
ATOM   6761 N  N     . LEU A 1 471 ? 36.597 -20.431 -4.075  1.00 34.74  ? 1341 LEU A N     1 
ATOM   6762 C  CA    . LEU A 1 471 ? 35.965 -21.364 -5.004  1.00 36.80  ? 1341 LEU A CA    1 
ATOM   6763 C  C     . LEU A 1 471 ? 34.500 -20.989 -5.214  1.00 27.24  ? 1341 LEU A C     1 
ATOM   6764 O  O     . LEU A 1 471 ? 33.679 -21.118 -4.311  1.00 29.88  ? 1341 LEU A O     1 
ATOM   6765 C  CB    . LEU A 1 471 ? 36.099 -22.800 -4.494  1.00 32.87  ? 1341 LEU A CB    1 
ATOM   6766 C  CG    . LEU A 1 471 ? 37.540 -23.294 -4.325  1.00 45.74  ? 1341 LEU A CG    1 
ATOM   6767 C  CD1   . LEU A 1 471 ? 37.582 -24.583 -3.519  1.00 52.18  ? 1341 LEU A CD1   1 
ATOM   6768 C  CD2   . LEU A 1 471 ? 38.215 -23.485 -5.675  1.00 41.21  ? 1341 LEU A CD2   1 
ATOM   6769 H  H     . LEU A 1 471 ? 36.174 -20.325 -3.334  1.00 41.64  ? 1341 LEU A H     1 
ATOM   6770 H  HA    . LEU A 1 471 ? 36.419 -21.307 -5.871  1.00 44.11  ? 1341 LEU A HA    1 
ATOM   6771 H  HB2   . LEU A 1 471 ? 35.665 -22.862 -3.629  1.00 39.39  ? 1341 LEU A HB2   1 
ATOM   6772 H  HB3   . LEU A 1 471 ? 35.659 -23.393 -5.123  1.00 39.39  ? 1341 LEU A HB3   1 
ATOM   6773 H  HG    . LEU A 1 471 ? 38.043 -22.623 -3.837  1.00 54.83  ? 1341 LEU A HG    1 
ATOM   6774 H  HD11  . LEU A 1 471 ? 38.495 -24.866 -3.430  1.00 62.56  ? 1341 LEU A HD11  1 
ATOM   6775 H  HD12  . LEU A 1 471 ? 37.203 -24.421 -2.652  1.00 62.56  ? 1341 LEU A HD12  1 
ATOM   6776 H  HD13  . LEU A 1 471 ? 37.073 -25.255 -3.979  1.00 62.56  ? 1341 LEU A HD13  1 
ATOM   6777 H  HD21  . LEU A 1 471 ? 39.113 -23.794 -5.534  1.00 49.39  ? 1341 LEU A HD21  1 
ATOM   6778 H  HD22  . LEU A 1 471 ? 37.721 -24.134 -6.182  1.00 49.39  ? 1341 LEU A HD22  1 
ATOM   6779 H  HD23  . LEU A 1 471 ? 38.226 -22.646 -6.141  1.00 49.39  ? 1341 LEU A HD23  1 
ATOM   6780 N  N     . LEU A 1 472 ? 34.189 -20.520 -6.416  1.00 27.66  ? 1342 LEU A N     1 
ATOM   6781 C  CA    . LEU A 1 472 ? 32.859 -20.034 -6.745  1.00 31.54  ? 1342 LEU A CA    1 
ATOM   6782 C  C     . LEU A 1 472 ? 32.096 -21.077 -7.549  1.00 34.27  ? 1342 LEU A C     1 
ATOM   6783 O  O     . LEU A 1 472 ? 32.642 -21.682 -8.468  1.00 33.32  ? 1342 LEU A O     1 
ATOM   6784 C  CB    . LEU A 1 472 ? 32.967 -18.747 -7.565  1.00 31.30  ? 1342 LEU A CB    1 
ATOM   6785 C  CG    . LEU A 1 472 ? 33.996 -17.717 -7.092  1.00 31.30  ? 1342 LEU A CG    1 
ATOM   6786 C  CD1   . LEU A 1 472 ? 33.993 -16.499 -8.015  1.00 32.89  ? 1342 LEU A CD1   1 
ATOM   6787 C  CD2   . LEU A 1 472 ? 33.732 -17.308 -5.652  1.00 29.59  ? 1342 LEU A CD2   1 
ATOM   6788 H  H     . LEU A 1 472 ? 34.745 -20.472 -7.071  1.00 33.14  ? 1342 LEU A H     1 
ATOM   6789 H  HA    . LEU A 1 472 ? 32.362 -19.844 -5.922  1.00 37.79  ? 1342 LEU A HA    1 
ATOM   6790 H  HB2   . LEU A 1 472 ? 33.198 -18.986 -8.476  1.00 37.50  ? 1342 LEU A HB2   1 
ATOM   6791 H  HB3   . LEU A 1 472 ? 32.101 -18.310 -7.559  1.00 37.50  ? 1342 LEU A HB3   1 
ATOM   6792 H  HG    . LEU A 1 472 ? 34.879 -18.117 -7.130  1.00 37.50  ? 1342 LEU A HG    1 
ATOM   6793 H  HD11  . LEU A 1 472 ? 34.644 -15.867 -7.700  1.00 39.41  ? 1342 LEU A HD11  1 
ATOM   6794 H  HD12  . LEU A 1 472 ? 34.214 -16.781 -8.905  1.00 39.41  ? 1342 LEU A HD12  1 
ATOM   6795 H  HD13  . LEU A 1 472 ? 33.119 -16.101 -8.004  1.00 39.41  ? 1342 LEU A HD13  1 
ATOM   6796 H  HD21  . LEU A 1 472 ? 34.391 -16.663 -5.384  1.00 35.46  ? 1342 LEU A HD21  1 
ATOM   6797 H  HD22  . LEU A 1 472 ? 32.854 -16.923 -5.593  1.00 35.46  ? 1342 LEU A HD22  1 
ATOM   6798 H  HD23  . LEU A 1 472 ? 33.787 -18.085 -5.091  1.00 35.46  ? 1342 LEU A HD23  1 
ATOM   6799 N  N     . PHE A 1 473 ? 30.831 -21.285 -7.205  1.00 31.94  ? 1343 PHE A N     1 
ATOM   6800 C  CA    . PHE A 1 473 ? 29.980 -22.186 -7.967  1.00 28.00  ? 1343 PHE A CA    1 
ATOM   6801 C  C     . PHE A 1 473 ? 29.004 -21.376 -8.808  1.00 30.08  ? 1343 PHE A C     1 
ATOM   6802 O  O     . PHE A 1 473 ? 28.228 -20.576 -8.293  1.00 35.38  ? 1343 PHE A O     1 
ATOM   6803 C  CB    . PHE A 1 473 ? 29.249 -23.150 -7.035  1.00 30.36  ? 1343 PHE A CB    1 
ATOM   6804 C  CG    . PHE A 1 473 ? 30.174 -24.020 -6.239  1.00 27.14  ? 1343 PHE A CG    1 
ATOM   6805 C  CD1   . PHE A 1 473 ? 30.360 -25.351 -6.577  1.00 33.43  ? 1343 PHE A CD1   1 
ATOM   6806 C  CD2   . PHE A 1 473 ? 30.881 -23.499 -5.166  1.00 28.16  ? 1343 PHE A CD2   1 
ATOM   6807 C  CE1   . PHE A 1 473 ? 31.219 -26.153 -5.849  1.00 33.85  ? 1343 PHE A CE1   1 
ATOM   6808 C  CE2   . PHE A 1 473 ? 31.744 -24.295 -4.435  1.00 38.47  ? 1343 PHE A CE2   1 
ATOM   6809 C  CZ    . PHE A 1 473 ? 31.913 -25.625 -4.778  1.00 50.27  ? 1343 PHE A CZ    1 
ATOM   6810 H  H     . PHE A 1 473 ? 30.441 -20.915 -6.533  1.00 38.27  ? 1343 PHE A H     1 
ATOM   6811 H  HA    . PHE A 1 473 ? 30.538 -22.716 -8.574  1.00 33.55  ? 1343 PHE A HA    1 
ATOM   6812 H  HB2   . PHE A 1 473 ? 28.711 -22.637 -6.412  1.00 36.38  ? 1343 PHE A HB2   1 
ATOM   6813 H  HB3   . PHE A 1 473 ? 28.678 -23.728 -7.565  1.00 36.38  ? 1343 PHE A HB3   1 
ATOM   6814 H  HD1   . PHE A 1 473 ? 29.894 -25.711 -7.297  1.00 40.06  ? 1343 PHE A HD1   1 
ATOM   6815 H  HD2   . PHE A 1 473 ? 30.769 -22.606 -4.932  1.00 33.74  ? 1343 PHE A HD2   1 
ATOM   6816 H  HE1   . PHE A 1 473 ? 31.332 -27.046 -6.082  1.00 40.56  ? 1343 PHE A HE1   1 
ATOM   6817 H  HE2   . PHE A 1 473 ? 32.210 -23.937 -3.714  1.00 46.10  ? 1343 PHE A HE2   1 
ATOM   6818 H  HZ    . PHE A 1 473 ? 32.492 -26.162 -4.287  1.00 60.26  ? 1343 PHE A HZ    1 
ATOM   6819 N  N     . VAL A 1 474 ? 29.061 -21.590 -10.115 1.00 30.04  ? 1344 VAL A N     1 
ATOM   6820 C  CA    . VAL A 1 474 ? 28.295 -20.804 -11.064 1.00 36.82  ? 1344 VAL A CA    1 
ATOM   6821 C  C     . VAL A 1 474 ? 27.641 -21.760 -12.053 1.00 47.90  ? 1344 VAL A C     1 
ATOM   6822 O  O     . VAL A 1 474 ? 28.292 -22.671 -12.548 1.00 37.58  ? 1344 VAL A O     1 
ATOM   6823 C  CB    . VAL A 1 474 ? 29.225 -19.829 -11.811 1.00 49.28  ? 1344 VAL A CB    1 
ATOM   6824 C  CG1   . VAL A 1 474 ? 28.482 -19.099 -12.917 1.00 45.75  ? 1344 VAL A CG1   1 
ATOM   6825 C  CG2   . VAL A 1 474 ? 29.853 -18.843 -10.829 1.00 37.72  ? 1344 VAL A CG2   1 
ATOM   6826 H  H     . VAL A 1 474 ? 29.548 -22.197 -10.481 1.00 36.00  ? 1344 VAL A H     1 
ATOM   6827 H  HA    . VAL A 1 474 ? 27.599 -20.295 -10.599 1.00 44.12  ? 1344 VAL A HA    1 
ATOM   6828 H  HB    . VAL A 1 474 ? 29.951 -20.341 -12.225 1.00 59.08  ? 1344 VAL A HB    1 
ATOM   6829 H  HG11  . VAL A 1 474 ? 29.090 -18.502 -13.360 1.00 54.85  ? 1344 VAL A HG11  1 
ATOM   6830 H  HG12  . VAL A 1 474 ? 28.142 -19.744 -13.542 1.00 54.85  ? 1344 VAL A HG12  1 
ATOM   6831 H  HG13  . VAL A 1 474 ? 27.757 -18.602 -12.530 1.00 54.85  ? 1344 VAL A HG13  1 
ATOM   6832 H  HG21  . VAL A 1 474 ? 30.428 -18.245 -11.311 1.00 45.20  ? 1344 VAL A HG21  1 
ATOM   6833 H  HG22  . VAL A 1 474 ? 29.154 -18.348 -10.395 1.00 45.20  ? 1344 VAL A HG22  1 
ATOM   6834 H  HG23  . VAL A 1 474 ? 30.361 -19.332 -10.177 1.00 45.20  ? 1344 VAL A HG23  1 
ATOM   6835 N  N     . THR A 1 475 ? 26.357 -21.574 -12.333 1.00 38.35  ? 1345 THR A N     1 
ATOM   6836 C  CA    . THR A 1 475 ? 25.676 -22.456 -13.276 1.00 55.02  ? 1345 THR A CA    1 
ATOM   6837 C  C     . THR A 1 475 ? 26.310 -22.314 -14.655 1.00 50.24  ? 1345 THR A C     1 
ATOM   6838 O  O     . THR A 1 475 ? 26.948 -21.306 -14.952 1.00 38.87  ? 1345 THR A O     1 
ATOM   6839 C  CB    . THR A 1 475 ? 24.168 -22.156 -13.377 1.00 50.15  ? 1345 THR A CB    1 
ATOM   6840 O  OG1   . THR A 1 475 ? 23.971 -20.858 -13.948 1.00 43.76  ? 1345 THR A OG1   1 
ATOM   6841 C  CG2   . THR A 1 475 ? 23.509 -22.220 -12.004 1.00 41.95  ? 1345 THR A CG2   1 
ATOM   6842 H  H     . THR A 1 475 ? 25.862 -20.955 -11.998 1.00 45.96  ? 1345 THR A H     1 
ATOM   6843 H  HA    . THR A 1 475 ? 25.784 -23.385 -12.984 1.00 65.96  ? 1345 THR A HA    1 
ATOM   6844 H  HB    . THR A 1 475 ? 23.748 -22.821 -13.945 1.00 60.13  ? 1345 THR A HB    1 
ATOM   6845 H  HG1   . THR A 1 475 ? 24.301 -20.829 -14.698 1.00 52.46  ? 1345 THR A HG1   1 
ATOM   6846 H  HG21  . THR A 1 475 ? 22.571 -22.031 -12.082 1.00 50.28  ? 1345 THR A HG21  1 
ATOM   6847 H  HG22  . THR A 1 475 ? 23.621 -23.095 -11.627 1.00 50.28  ? 1345 THR A HG22  1 
ATOM   6848 H  HG23  . THR A 1 475 ? 23.910 -21.574 -11.418 1.00 50.28  ? 1345 THR A HG23  1 
ATOM   6849 N  N     . ASN A 1 476 ? 26.140 -23.327 -15.495 1.00 47.66  ? 1346 ASN A N     1 
ATOM   6850 C  CA    . ASN A 1 476 ? 26.725 -23.315 -16.830 1.00 59.21  ? 1346 ASN A CA    1 
ATOM   6851 C  C     . ASN A 1 476 ? 26.237 -22.124 -17.649 1.00 43.34  ? 1346 ASN A C     1 
ATOM   6852 O  O     . ASN A 1 476 ? 27.024 -21.450 -18.310 1.00 47.01  ? 1346 ASN A O     1 
ATOM   6853 C  CB    . ASN A 1 476 ? 26.403 -24.621 -17.555 1.00 50.73  ? 1346 ASN A CB    1 
ATOM   6854 C  CG    . ASN A 1 476 ? 26.921 -25.838 -16.813 1.00 60.69  ? 1346 ASN A CG    1 
ATOM   6855 O  OD1   . ASN A 1 476 ? 28.029 -25.825 -16.278 1.00 47.71  ? 1346 ASN A OD1   1 
ATOM   6856 N  ND2   . ASN A 1 476 ? 26.114 -26.892 -16.767 1.00 48.88  ? 1346 ASN A ND2   1 
ATOM   6857 H  H     . ASN A 1 476 ? 25.688 -24.037 -15.316 1.00 57.14  ? 1346 ASN A H     1 
ATOM   6858 H  HA    . ASN A 1 476 ? 27.699 -23.247 -16.750 1.00 71.00  ? 1346 ASN A HA    1 
ATOM   6859 H  HB2   . ASN A 1 476 ? 25.441 -24.708 -17.640 1.00 60.82  ? 1346 ASN A HB2   1 
ATOM   6860 H  HB3   . ASN A 1 476 ? 26.815 -24.607 -18.433 1.00 60.82  ? 1346 ASN A HB3   1 
ATOM   6861 H  HD21  . ASN A 1 476 ? 26.363 -27.606 -16.358 1.00 58.60  ? 1346 ASN A HD21  1 
ATOM   6862 H  HD22  . ASN A 1 476 ? 25.343 -26.860 -17.146 1.00 58.60  ? 1346 ASN A HD22  1 
ATOM   6863 N  N     . GLU A 1 477 ? 24.934 -21.869 -17.595 1.00 48.90  ? 1347 GLU A N     1 
ATOM   6864 C  CA    . GLU A 1 477 ? 24.335 -20.748 -18.309 1.00 56.55  ? 1347 GLU A CA    1 
ATOM   6865 C  C     . GLU A 1 477 ? 24.946 -19.429 -17.850 1.00 47.11  ? 1347 GLU A C     1 
ATOM   6866 O  O     . GLU A 1 477 ? 25.258 -18.557 -18.660 1.00 40.73  ? 1347 GLU A O     1 
ATOM   6867 C  CB    . GLU A 1 477 ? 22.821 -20.724 -18.078 1.00 62.72  ? 1347 GLU A CB    1 
ATOM   6868 C  CG    . GLU A 1 477 ? 22.138 -19.442 -18.543 1.00 76.20  ? 1347 GLU A CG    1 
ATOM   6869 C  CD    . GLU A 1 477 ? 20.630 -19.480 -18.361 1.00 83.27  ? 1347 GLU A CD    1 
ATOM   6870 O  OE1   . GLU A 1 477 ? 20.096 -20.558 -18.023 1.00 81.02  ? 1347 GLU A OE1   1 
ATOM   6871 O  OE2   . GLU A 1 477 ? 19.977 -18.432 -18.557 1.00 79.62  ? 1347 GLU A OE2   1 
ATOM   6872 H  H     . GLU A 1 477 ? 24.369 -22.337 -17.145 1.00 58.62  ? 1347 GLU A H     1 
ATOM   6873 H  HA    . GLU A 1 477 ? 24.500 -20.848 -19.270 1.00 67.80  ? 1347 GLU A HA    1 
ATOM   6874 H  HB2   . GLU A 1 477 ? 22.421 -21.464 -18.562 1.00 75.21  ? 1347 GLU A HB2   1 
ATOM   6875 H  HB3   . GLU A 1 477 ? 22.649 -20.823 -17.129 1.00 75.21  ? 1347 GLU A HB3   1 
ATOM   6876 H  HG2   . GLU A 1 477 ? 22.483 -18.696 -18.028 1.00 91.39  ? 1347 GLU A HG2   1 
ATOM   6877 H  HG3   . GLU A 1 477 ? 22.323 -19.309 -19.486 1.00 91.39  ? 1347 GLU A HG3   1 
ATOM   6878 N  N     . SER A 1 478 ? 25.122 -19.297 -16.541 1.00 45.15  ? 1348 SER A N     1 
ATOM   6879 C  CA    . SER A 1 478 ? 25.616 -18.064 -15.948 1.00 42.74  ? 1348 SER A CA    1 
ATOM   6880 C  C     . SER A 1 478 ? 27.082 -17.816 -16.297 1.00 55.44  ? 1348 SER A C     1 
ATOM   6881 O  O     . SER A 1 478 ? 27.495 -16.671 -16.493 1.00 46.79  ? 1348 SER A O     1 
ATOM   6882 C  CB    . SER A 1 478 ? 25.446 -18.114 -14.434 1.00 42.17  ? 1348 SER A CB    1 
ATOM   6883 O  OG    . SER A 1 478 ? 25.965 -16.943 -13.839 1.00 40.28  ? 1348 SER A OG    1 
ATOM   6884 H  H     . SER A 1 478 ? 24.959 -19.918 -15.968 1.00 54.12  ? 1348 SER A H     1 
ATOM   6885 H  HA    . SER A 1 478 ? 25.090 -17.310 -16.289 1.00 51.23  ? 1348 SER A HA    1 
ATOM   6886 H  HB2   . SER A 1 478 ? 24.502 -18.184 -14.223 1.00 50.55  ? 1348 SER A HB2   1 
ATOM   6887 H  HB3   . SER A 1 478 ? 25.923 -18.884 -14.086 1.00 50.55  ? 1348 SER A HB3   1 
ATOM   6888 H  HG    . SER A 1 478 ? 26.266 -16.444 -14.417 1.00 48.28  ? 1348 SER A HG    1 
ATOM   6889 N  N     . ASN A 1 479 ? 27.863 -18.890 -16.370 1.00 38.30  ? 1349 ASN A N     1 
ATOM   6890 C  CA    . ASN A 1 479 ? 29.272 -18.786 -16.726 1.00 53.49  ? 1349 ASN A CA    1 
ATOM   6891 C  C     . ASN A 1 479 ? 29.441 -18.306 -18.160 1.00 45.81  ? 1349 ASN A C     1 
ATOM   6892 O  O     . ASN A 1 479 ? 30.249 -17.425 -18.437 1.00 55.57  ? 1349 ASN A O     1 
ATOM   6893 C  CB    . ASN A 1 479 ? 29.978 -20.133 -16.566 1.00 53.95  ? 1349 ASN A CB    1 
ATOM   6894 C  CG    . ASN A 1 479 ? 31.475 -20.037 -16.816 1.00 56.21  ? 1349 ASN A CG    1 
ATOM   6895 O  OD1   . ASN A 1 479 ? 32.151 -19.166 -16.268 1.00 50.22  ? 1349 ASN A OD1   1 
ATOM   6896 N  ND2   . ASN A 1 479 ? 31.996 -20.922 -17.658 1.00 54.83  ? 1349 ASN A ND2   1 
ATOM   6897 H  H     . ASN A 1 479 ? 27.599 -19.693 -16.216 1.00 45.91  ? 1349 ASN A H     1 
ATOM   6898 H  HA    . ASN A 1 479 ? 29.708 -18.139 -16.133 1.00 64.13  ? 1349 ASN A HA    1 
ATOM   6899 H  HB2   . ASN A 1 479 ? 29.844 -20.456 -15.662 1.00 64.68  ? 1349 ASN A HB2   1 
ATOM   6900 H  HB3   . ASN A 1 479 ? 29.606 -20.763 -17.203 1.00 64.68  ? 1349 ASN A HB3   1 
ATOM   6901 H  HD21  . ASN A 1 479 ? 32.838 -20.907 -17.831 1.00 65.74  ? 1349 ASN A HD21  1 
ATOM   6902 H  HD22  . ASN A 1 479 ? 31.491 -21.510 -18.031 1.00 65.74  ? 1349 ASN A HD22  1 
ATOM   6903 N  N     . SER A 1 480 ? 28.672 -18.897 -19.068 1.00 47.96  ? 1350 SER A N     1 
ATOM   6904 C  CA    . SER A 1 480 ? 28.767 -18.580 -20.489 1.00 55.88  ? 1350 SER A CA    1 
ATOM   6905 C  C     . SER A 1 480 ? 28.403 -17.126 -20.757 1.00 64.28  ? 1350 SER A C     1 
ATOM   6906 O  O     . SER A 1 480 ? 29.010 -16.467 -21.600 1.00 57.34  ? 1350 SER A O     1 
ATOM   6907 C  CB    . SER A 1 480 ? 27.837 -19.486 -21.297 1.00 58.42  ? 1350 SER A CB    1 
ATOM   6908 O  OG    . SER A 1 480 ? 27.949 -20.836 -20.887 1.00 69.60  ? 1350 SER A OG    1 
ATOM   6909 H  H     . SER A 1 480 ? 28.080 -19.492 -18.884 1.00 57.50  ? 1350 SER A H     1 
ATOM   6910 H  HA    . SER A 1 480 ? 29.687 -18.730 -20.794 1.00 67.00  ? 1350 SER A HA    1 
ATOM   6911 H  HB2   . SER A 1 480 ? 26.922 -19.192 -21.167 1.00 70.05  ? 1350 SER A HB2   1 
ATOM   6912 H  HB3   . SER A 1 480 ? 28.074 -19.422 -22.236 1.00 70.05  ? 1350 SER A HB3   1 
ATOM   6913 H  HG    . SER A 1 480 ? 28.498 -20.900 -20.281 1.00 83.46  ? 1350 SER A HG    1 
ATOM   6914 N  N     . ARG A 1 481 ? 27.402 -16.634 -20.035 1.00 45.28  ? 1351 ARG A N     1 
ATOM   6915 C  CA    . ARG A 1 481 ? 26.908 -15.281 -20.237 1.00 43.85  ? 1351 ARG A CA    1 
ATOM   6916 C  C     . ARG A 1 481 ? 27.701 -14.255 -19.431 1.00 50.98  ? 1351 ARG A C     1 
ATOM   6917 O  O     . ARG A 1 481 ? 27.412 -13.059 -19.485 1.00 41.82  ? 1351 ARG A O     1 
ATOM   6918 C  CB    . ARG A 1 481 ? 25.429 -15.223 -19.864 1.00 53.23  ? 1351 ARG A CB    1 
ATOM   6919 C  CG    . ARG A 1 481 ? 24.580 -16.197 -20.664 1.00 64.57  ? 1351 ARG A CG    1 
ATOM   6920 C  CD    . ARG A 1 481 ? 23.195 -16.301 -20.096 1.00 62.54  ? 1351 ARG A CD    1 
ATOM   6921 N  NE    . ARG A 1 481 ? 22.462 -15.056 -20.262 1.00 55.60  ? 1351 ARG A NE    1 
ATOM   6922 C  CZ    . ARG A 1 481 ? 21.356 -14.756 -19.597 1.00 57.55  ? 1351 ARG A CZ    1 
ATOM   6923 N  NH1   . ARG A 1 481 ? 20.866 -15.613 -18.720 1.00 45.38  ? 1351 ARG A NH1   1 
ATOM   6924 N  NH2   . ARG A 1 481 ? 20.742 -13.604 -19.801 1.00 50.47  ? 1351 ARG A NH2   1 
ATOM   6925 H  H     . ARG A 1 481 ? 26.991 -17.069 -19.418 1.00 54.28  ? 1351 ARG A H     1 
ATOM   6926 H  HA    . ARG A 1 481 ? 26.990 -15.049 -21.185 1.00 52.56  ? 1351 ARG A HA    1 
ATOM   6927 H  HB2   . ARG A 1 481 ? 25.331 -15.442 -18.924 1.00 63.82  ? 1351 ARG A HB2   1 
ATOM   6928 H  HB3   . ARG A 1 481 ? 25.096 -14.327 -20.032 1.00 63.82  ? 1351 ARG A HB3   1 
ATOM   6929 H  HG2   . ARG A 1 481 ? 24.511 -15.887 -21.580 1.00 77.43  ? 1351 ARG A HG2   1 
ATOM   6930 H  HG3   . ARG A 1 481 ? 24.988 -17.077 -20.636 1.00 77.43  ? 1351 ARG A HG3   1 
ATOM   6931 H  HD2   . ARG A 1 481 ? 22.711 -17.004 -20.557 1.00 75.00  ? 1351 ARG A HD2   1 
ATOM   6932 H  HD3   . ARG A 1 481 ? 23.252 -16.498 -19.147 1.00 75.00  ? 1351 ARG A HD3   1 
ATOM   6933 H  HE    . ARG A 1 481 ? 22.712 -14.523 -20.889 1.00 66.67  ? 1351 ARG A HE    1 
ATOM   6934 H  HH11  . ARG A 1 481 ? 21.263 -16.364 -18.585 1.00 54.40  ? 1351 ARG A HH11  1 
ATOM   6935 H  HH12  . ARG A 1 481 ? 20.149 -15.421 -18.286 1.00 54.40  ? 1351 ARG A HH12  1 
ATOM   6936 H  HH21  . ARG A 1 481 ? 21.059 -13.043 -20.370 1.00 60.51  ? 1351 ARG A HH21  1 
ATOM   6937 H  HH22  . ARG A 1 481 ? 20.026 -13.415 -19.365 1.00 60.51  ? 1351 ARG A HH22  1 
ATOM   6938 N  N     . LYS A 1 482 ? 28.703 -14.728 -18.691 1.00 48.04  ? 1352 LYS A N     1 
ATOM   6939 C  CA    . LYS A 1 482 ? 29.552 -13.858 -17.878 1.00 28.82  ? 1352 LYS A CA    1 
ATOM   6940 C  C     . LYS A 1 482 ? 28.719 -13.032 -16.912 1.00 56.53  ? 1352 LYS A C     1 
ATOM   6941 O  O     . LYS A 1 482 ? 29.100 -11.926 -16.531 1.00 62.04  ? 1352 LYS A O     1 
ATOM   6942 C  CB    . LYS A 1 482 ? 30.397 -12.932 -18.758 1.00 49.22  ? 1352 LYS A CB    1 
ATOM   6943 C  CG    . LYS A 1 482 ? 31.573 -13.614 -19.451 1.00 64.31  ? 1352 LYS A CG    1 
ATOM   6944 C  CD    . LYS A 1 482 ? 31.294 -15.084 -19.720 1.00 75.07  ? 1352 LYS A CD    1 
ATOM   6945 C  CE    . LYS A 1 482 ? 32.378 -15.726 -20.574 1.00 77.63  ? 1352 LYS A CE    1 
ATOM   6946 N  NZ    . LYS A 1 482 ? 32.633 -17.139 -20.169 1.00 70.03  ? 1352 LYS A NZ    1 
ATOM   6947 H  H     . LYS A 1 482 ? 28.913 -15.560 -18.643 1.00 57.60  ? 1352 LYS A H     1 
ATOM   6948 H  HA    . LYS A 1 482 ? 30.163 -14.413 -17.351 1.00 34.53  ? 1352 LYS A HA    1 
ATOM   6949 H  HB2   . LYS A 1 482 ? 29.829 -12.554 -19.447 1.00 59.01  ? 1352 LYS A HB2   1 
ATOM   6950 H  HB3   . LYS A 1 482 ? 30.755 -12.220 -18.204 1.00 59.01  ? 1352 LYS A HB3   1 
ATOM   6951 H  HG2   . LYS A 1 482 ? 31.741 -13.177 -20.300 1.00 77.11  ? 1352 LYS A HG2   1 
ATOM   6952 H  HG3   . LYS A 1 482 ? 32.357 -13.554 -18.882 1.00 77.11  ? 1352 LYS A HG3   1 
ATOM   6953 H  HD2   . LYS A 1 482 ? 31.253 -15.561 -18.876 1.00 90.03  ? 1352 LYS A HD2   1 
ATOM   6954 H  HD3   . LYS A 1 482 ? 30.451 -15.167 -20.192 1.00 90.03  ? 1352 LYS A HD3   1 
ATOM   6955 H  HE2   . LYS A 1 482 ? 32.098 -15.722 -21.503 1.00 93.10  ? 1352 LYS A HE2   1 
ATOM   6956 H  HE3   . LYS A 1 482 ? 33.204 -15.228 -20.471 1.00 93.10  ? 1352 LYS A HE3   1 
ATOM   6957 H  HZ1   . LYS A 1 482 ? 32.895 -17.169 -19.320 1.00 83.98  ? 1352 LYS A HZ1   1 
ATOM   6958 H  HZ2   . LYS A 1 482 ? 31.889 -17.620 -20.259 1.00 83.98  ? 1352 LYS A HZ2   1 
ATOM   6959 H  HZ3   . LYS A 1 482 ? 33.269 -17.492 -20.682 1.00 83.98  ? 1352 LYS A HZ3   1 
ATOM   6960 N  N     . THR A 1 483 ? 27.574 -13.574 -16.521 1.00 51.23  ? 1353 THR A N     1 
ATOM   6961 C  CA    . THR A 1 483 ? 26.757 -12.942 -15.501 1.00 58.32  ? 1353 THR A CA    1 
ATOM   6962 C  C     . THR A 1 483 ? 27.279 -13.391 -14.135 1.00 57.92  ? 1353 THR A C     1 
ATOM   6963 O  O     . THR A 1 483 ? 27.045 -12.732 -13.122 1.00 51.61  ? 1353 THR A O     1 
ATOM   6964 C  CB    . THR A 1 483 ? 25.265 -13.291 -15.677 1.00 50.50  ? 1353 THR A CB    1 
ATOM   6965 O  OG1   . THR A 1 483 ? 24.472 -12.533 -14.757 1.00 65.29  ? 1353 THR A OG1   1 
ATOM   6966 C  CG2   . THR A 1 483 ? 25.032 -14.764 -15.452 1.00 28.35  ? 1353 THR A CG2   1 
ATOM   6967 H  H     . THR A 1 483 ? 27.249 -14.308 -16.831 1.00 61.42  ? 1353 THR A H     1 
ATOM   6968 H  HA    . THR A 1 483 ? 26.856 -11.969 -15.564 1.00 69.93  ? 1353 THR A HA    1 
ATOM   6969 H  HB    . THR A 1 483 ? 24.993 -13.077 -16.583 1.00 60.54  ? 1353 THR A HB    1 
ATOM   6970 H  HG1   . THR A 1 483 ? 23.679 -12.719 -14.851 1.00 78.29  ? 1353 THR A HG1   1 
ATOM   6971 H  HG21  . THR A 1 483 ? 24.101 -14.970 -15.564 1.00 33.96  ? 1353 THR A HG21  1 
ATOM   6972 H  HG22  . THR A 1 483 ? 25.543 -15.277 -16.082 1.00 33.96  ? 1353 THR A HG22  1 
ATOM   6973 H  HG23  . THR A 1 483 ? 25.300 -15.006 -14.562 1.00 33.96  ? 1353 THR A HG23  1 
ATOM   6974 N  N     . TYR A 1 484 ? 28.004 -14.509 -14.131 1.00 35.39  ? 1354 TYR A N     1 
ATOM   6975 C  CA    . TYR A 1 484 ? 28.683 -15.018 -12.936 1.00 52.20  ? 1354 TYR A CA    1 
ATOM   6976 C  C     . TYR A 1 484 ? 27.874 -14.833 -11.656 1.00 51.86  ? 1354 TYR A C     1 
ATOM   6977 O  O     . TYR A 1 484 ? 28.274 -14.096 -10.757 1.00 48.48  ? 1354 TYR A O     1 
ATOM   6978 C  CB    . TYR A 1 484 ? 30.045 -14.341 -12.767 1.00 45.21  ? 1354 TYR A CB    1 
ATOM   6979 C  CG    . TYR A 1 484 ? 31.017 -14.612 -13.893 1.00 57.54  ? 1354 TYR A CG    1 
ATOM   6980 C  CD1   . TYR A 1 484 ? 31.462 -15.900 -14.154 1.00 45.33  ? 1354 TYR A CD1   1 
ATOM   6981 C  CD2   . TYR A 1 484 ? 31.501 -13.577 -14.688 1.00 48.57  ? 1354 TYR A CD2   1 
ATOM   6982 C  CE1   . TYR A 1 484 ? 32.354 -16.154 -15.181 1.00 57.66  ? 1354 TYR A CE1   1 
ATOM   6983 C  CE2   . TYR A 1 484 ? 32.394 -13.822 -15.714 1.00 47.65  ? 1354 TYR A CE2   1 
ATOM   6984 C  CZ    . TYR A 1 484 ? 32.817 -15.113 -15.956 1.00 50.83  ? 1354 TYR A CZ    1 
ATOM   6985 O  OH    . TYR A 1 484 ? 33.707 -15.368 -16.975 1.00 51.81  ? 1354 TYR A OH    1 
ATOM   6986 H  H     . TYR A 1 484 ? 28.120 -15.004 -14.825 1.00 42.42  ? 1354 TYR A H     1 
ATOM   6987 H  HA    . TYR A 1 484 ? 28.840 -15.978 -13.052 1.00 62.59  ? 1354 TYR A HA    1 
ATOM   6988 H  HB2   . TYR A 1 484 ? 29.911 -13.382 -12.718 1.00 54.19  ? 1354 TYR A HB2   1 
ATOM   6989 H  HB3   . TYR A 1 484 ? 30.450 -14.658 -11.945 1.00 54.19  ? 1354 TYR A HB3   1 
ATOM   6990 H  HD1   . TYR A 1 484 ? 31.151 -16.606 -13.634 1.00 54.34  ? 1354 TYR A HD1   1 
ATOM   6991 H  HD2   . TYR A 1 484 ? 31.217 -12.706 -14.527 1.00 58.22  ? 1354 TYR A HD2   1 
ATOM   6992 H  HE1   . TYR A 1 484 ? 32.642 -17.023 -15.345 1.00 69.14  ? 1354 TYR A HE1   1 
ATOM   6993 H  HE2   . TYR A 1 484 ? 32.708 -13.121 -16.239 1.00 57.13  ? 1354 TYR A HE2   1 
ATOM   6994 H  HH    . TYR A 1 484 ? 34.405 -14.956 -16.848 1.00 62.11  ? 1354 TYR A HH    1 
ATOM   6995 N  N     . ILE A 1 485 ? 26.738 -15.513 -11.579 1.00 37.20  ? 1355 ILE A N     1 
ATOM   6996 C  CA    . ILE A 1 485 ? 25.911 -15.500 -10.384 1.00 44.63  ? 1355 ILE A CA    1 
ATOM   6997 C  C     . ILE A 1 485 ? 26.430 -16.575 -9.433  1.00 38.81  ? 1355 ILE A C     1 
ATOM   6998 O  O     . ILE A 1 485 ? 26.255 -17.770 -9.665  1.00 38.08  ? 1355 ILE A O     1 
ATOM   6999 C  CB    . ILE A 1 485 ? 24.434 -15.739 -10.741 1.00 43.99  ? 1355 ILE A CB    1 
ATOM   7000 C  CG1   . ILE A 1 485 ? 23.953 -14.644 -11.698 1.00 48.09  ? 1355 ILE A CG1   1 
ATOM   7001 C  CG2   . ILE A 1 485 ? 23.572 -15.762 -9.495  1.00 37.62  ? 1355 ILE A CG2   1 
ATOM   7002 C  CD1   . ILE A 1 485 ? 24.110 -13.232 -11.147 1.00 45.30  ? 1355 ILE A CD1   1 
ATOM   7003 H  H     . ILE A 1 485 ? 26.421 -15.996 -12.216 1.00 44.58  ? 1355 ILE A H     1 
ATOM   7004 H  HA    . ILE A 1 485 ? 25.988 -14.629 -9.942  1.00 53.50  ? 1355 ILE A HA    1 
ATOM   7005 H  HB    . ILE A 1 485 ? 24.358 -16.597 -11.187 1.00 52.73  ? 1355 ILE A HB    1 
ATOM   7006 H  HG12  . ILE A 1 485 ? 24.465 -14.700 -12.520 1.00 57.65  ? 1355 ILE A HG12  1 
ATOM   7007 H  HG13  . ILE A 1 485 ? 23.012 -14.786 -11.887 1.00 57.65  ? 1355 ILE A HG13  1 
ATOM   7008 H  HG21  . ILE A 1 485 ? 22.659 -15.913 -9.750  1.00 45.09  ? 1355 ILE A HG21  1 
ATOM   7009 H  HG22  . ILE A 1 485 ? 23.873 -16.470 -8.920  1.00 45.09  ? 1355 ILE A HG22  1 
ATOM   7010 H  HG23  . ILE A 1 485 ? 23.652 -14.918 -9.044  1.00 45.09  ? 1355 ILE A HG23  1 
ATOM   7011 H  HD11  . ILE A 1 485 ? 23.789 -12.605 -11.799 1.00 54.31  ? 1355 ILE A HD11  1 
ATOM   7012 H  HD12  . ILE A 1 485 ? 23.599 -13.154 -10.338 1.00 54.31  ? 1355 ILE A HD12  1 
ATOM   7013 H  HD13  . ILE A 1 485 ? 25.038 -13.069 -10.965 1.00 54.31  ? 1355 ILE A HD13  1 
ATOM   7014 N  N     . VAL A 1 486 ? 27.082 -16.136 -8.363  1.00 39.54  ? 1356 VAL A N     1 
ATOM   7015 C  CA    . VAL A 1 486 ? 27.807 -17.038 -7.479  1.00 29.04  ? 1356 VAL A CA    1 
ATOM   7016 C  C     . VAL A 1 486 ? 26.884 -17.788 -6.523  1.00 36.61  ? 1356 VAL A C     1 
ATOM   7017 O  O     . VAL A 1 486 ? 25.888 -17.245 -6.055  1.00 35.60  ? 1356 VAL A O     1 
ATOM   7018 C  CB    . VAL A 1 486 ? 28.855 -16.259 -6.662  1.00 32.59  ? 1356 VAL A CB    1 
ATOM   7019 C  CG1   . VAL A 1 486 ? 29.522 -17.161 -5.637  1.00 32.74  ? 1356 VAL A CG1   1 
ATOM   7020 C  CG2   . VAL A 1 486 ? 29.890 -15.644 -7.590  1.00 28.71  ? 1356 VAL A CG2   1 
ATOM   7021 H  H     . VAL A 1 486 ? 27.120 -15.311 -8.126  1.00 47.40  ? 1356 VAL A H     1 
ATOM   7022 H  HA    . VAL A 1 486 ? 28.281 -17.702 -8.022  1.00 34.79  ? 1356 VAL A HA    1 
ATOM   7023 H  HB    . VAL A 1 486 ? 28.408 -15.531 -6.181  1.00 39.05  ? 1356 VAL A HB    1 
ATOM   7024 H  HG11  . VAL A 1 486 ? 30.168 -16.649 -5.144  1.00 39.24  ? 1356 VAL A HG11  1 
ATOM   7025 H  HG12  . VAL A 1 486 ? 28.853 -17.504 -5.041  1.00 39.24  ? 1356 VAL A HG12  1 
ATOM   7026 H  HG13  . VAL A 1 486 ? 29.957 -17.884 -6.094  1.00 39.24  ? 1356 VAL A HG13  1 
ATOM   7027 H  HG21  . VAL A 1 486 ? 30.534 -15.163 -7.064  1.00 34.40  ? 1356 VAL A HG21  1 
ATOM   7028 H  HG22  . VAL A 1 486 ? 30.325 -16.345 -8.080  1.00 34.40  ? 1356 VAL A HG22  1 
ATOM   7029 H  HG23  . VAL A 1 486 ? 29.449 -15.045 -8.196  1.00 34.40  ? 1356 VAL A HG23  1 
ATOM   7030 N  N     . HIS A 1 487 ? 27.234 -19.042 -6.249  1.00 33.87  ? 1357 HIS A N     1 
ATOM   7031 C  CA    . HIS A 1 487 ? 26.572 -19.857 -5.238  1.00 34.29  ? 1357 HIS A CA    1 
ATOM   7032 C  C     . HIS A 1 487 ? 27.658 -20.402 -4.327  1.00 29.52  ? 1357 HIS A C     1 
ATOM   7033 O  O     . HIS A 1 487 ? 28.790 -20.603 -4.766  1.00 30.66  ? 1357 HIS A O     1 
ATOM   7034 C  CB    . HIS A 1 487 ? 25.841 -21.051 -5.864  1.00 30.92  ? 1357 HIS A CB    1 
ATOM   7035 C  CG    . HIS A 1 487 ? 24.682 -20.682 -6.734  1.00 44.92  ? 1357 HIS A CG    1 
ATOM   7036 N  ND1   . HIS A 1 487 ? 24.832 -20.027 -7.939  1.00 45.96  ? 1357 HIS A ND1   1 
ATOM   7037 C  CD2   . HIS A 1 487 ? 23.354 -20.901 -6.589  1.00 48.85  ? 1357 HIS A CD2   1 
ATOM   7038 C  CE1   . HIS A 1 487 ? 23.645 -19.845 -8.488  1.00 45.00  ? 1357 HIS A CE1   1 
ATOM   7039 N  NE2   . HIS A 1 487 ? 22.731 -20.365 -7.690  1.00 47.03  ? 1357 HIS A NE2   1 
ATOM   7040 H  H     . HIS A 1 487 ? 27.874 -19.454 -6.650  1.00 40.59  ? 1357 HIS A H     1 
ATOM   7041 H  HA    . HIS A 1 487 ? 25.941 -19.319 -4.716  1.00 41.09  ? 1357 HIS A HA    1 
ATOM   7042 H  HB2   . HIS A 1 487 ? 26.471 -21.550 -6.408  1.00 37.04  ? 1357 HIS A HB2   1 
ATOM   7043 H  HB3   . HIS A 1 487 ? 25.505 -21.618 -5.152  1.00 37.04  ? 1357 HIS A HB3   1 
ATOM   7044 H  HD1   . HIS A 1 487 ? 25.581 -19.771 -8.275  1.00 55.10  ? 1357 HIS A HD1   1 
ATOM   7045 H  HD2   . HIS A 1 487 ? 22.939 -21.326 -5.873  1.00 58.57  ? 1357 HIS A HD2   1 
ATOM   7046 H  HE1   . HIS A 1 487 ? 23.481 -19.423 -9.301  1.00 53.95  ? 1357 HIS A HE1   1 
ATOM   7047 H  HE2   . HIS A 1 487 ? 21.884 -20.369 -7.836  1.00 56.38  ? 1357 HIS A HE2   1 
ATOM   7048 N  N     . CYS A 1 488 ? 27.327 -20.646 -3.065  1.00 29.41  ? 1358 CYS A N     1 
ATOM   7049 C  CA    . CYS A 1 488 ? 28.228 -21.386 -2.194  1.00 29.18  ? 1358 CYS A CA    1 
ATOM   7050 C  C     . CYS A 1 488 ? 28.083 -22.859 -2.546  1.00 38.24  ? 1358 CYS A C     1 
ATOM   7051 O  O     . CYS A 1 488 ? 27.212 -23.227 -3.335  1.00 32.55  ? 1358 CYS A O     1 
ATOM   7052 C  CB    . CYS A 1 488 ? 27.899 -21.149 -0.720  1.00 36.63  ? 1358 CYS A CB    1 
ATOM   7053 S  SG    . CYS A 1 488 ? 26.290 -21.784 -0.189  1.00 32.23  ? 1358 CYS A SG    1 
ATOM   7054 H  H     . CYS A 1 488 ? 26.594 -20.396 -2.692  1.00 35.23  ? 1358 CYS A H     1 
ATOM   7055 H  HA    . CYS A 1 488 ? 29.154 -21.110 -2.360  1.00 34.96  ? 1358 CYS A HA    1 
ATOM   7056 H  HB2   . CYS A 1 488 ? 28.577 -21.582 -0.178  1.00 43.90  ? 1358 CYS A HB2   1 
ATOM   7057 H  HB3   . CYS A 1 488 ? 27.908 -20.194 -0.551  1.00 43.90  ? 1358 CYS A HB3   1 
ATOM   7058 N  N     . GLN A 1 489 ? 28.932 -23.700 -1.969  1.00 32.06  ? 1359 GLN A N     1 
ATOM   7059 C  CA    . GLN A 1 489 ? 28.915 -25.124 -2.280  1.00 40.30  ? 1359 GLN A CA    1 
ATOM   7060 C  C     . GLN A 1 489 ? 27.559 -25.732 -1.953  1.00 39.62  ? 1359 GLN A C     1 
ATOM   7061 O  O     . GLN A 1 489 ? 26.976 -26.442 -2.768  1.00 41.08  ? 1359 GLN A O     1 
ATOM   7062 C  CB    . GLN A 1 489 ? 29.997 -25.862 -1.491  1.00 36.61  ? 1359 GLN A CB    1 
ATOM   7063 C  CG    . GLN A 1 489 ? 30.217 -27.298 -1.956  1.00 40.61  ? 1359 GLN A CG    1 
ATOM   7064 C  CD    . GLN A 1 489 ? 30.926 -28.166 -0.927  1.00 43.45  ? 1359 GLN A CD    1 
ATOM   7065 O  OE1   . GLN A 1 489 ? 30.948 -29.390 -1.049  1.00 46.56  ? 1359 GLN A OE1   1 
ATOM   7066 N  NE2   . GLN A 1 489 ? 31.511 -27.537 0.090   1.00 36.21  ? 1359 GLN A NE2   1 
ATOM   7067 H  H     . GLN A 1 489 ? 29.529 -23.472 -1.393  1.00 38.42  ? 1359 GLN A H     1 
ATOM   7068 H  HA    . GLN A 1 489 ? 29.089 -25.250 -3.236  1.00 48.31  ? 1359 GLN A HA    1 
ATOM   7069 H  HB2   . GLN A 1 489 ? 30.836 -25.385 -1.588  1.00 43.88  ? 1359 GLN A HB2   1 
ATOM   7070 H  HB3   . GLN A 1 489 ? 29.740 -25.888 -0.556  1.00 43.88  ? 1359 GLN A HB3   1 
ATOM   7071 H  HG2   . GLN A 1 489 ? 29.356 -27.703 -2.144  1.00 48.68  ? 1359 GLN A HG2   1 
ATOM   7072 H  HG3   . GLN A 1 489 ? 30.759 -27.288 -2.761  1.00 48.68  ? 1359 GLN A HG3   1 
ATOM   7073 H  HE21  . GLN A 1 489 ? 31.923 -27.988 0.695   1.00 43.39  ? 1359 GLN A HE21  1 
ATOM   7074 H  HE22  . GLN A 1 489 ? 31.476 -26.679 0.142   1.00 43.39  ? 1359 GLN A HE22  1 
ATOM   7075 N  N     . ASP A 1 490 ? 27.062 -25.443 -0.756  1.00 39.38  ? 1360 ASP A N     1 
ATOM   7076 C  CA    . ASP A 1 490 ? 25.837 -26.062 -0.262  1.00 39.11  ? 1360 ASP A CA    1 
ATOM   7077 C  C     . ASP A 1 490 ? 24.617 -25.720 -1.110  1.00 51.79  ? 1360 ASP A C     1 
ATOM   7078 O  O     . ASP A 1 490 ? 23.806 -26.591 -1.416  1.00 44.74  ? 1360 ASP A O     1 
ATOM   7079 C  CB    . ASP A 1 490 ? 25.590 -25.648 1.187   1.00 43.83  ? 1360 ASP A CB    1 
ATOM   7080 C  CG    . ASP A 1 490 ? 26.713 -26.071 2.110   1.00 60.29  ? 1360 ASP A CG    1 
ATOM   7081 O  OD1   . ASP A 1 490 ? 27.430 -27.040 1.776   1.00 49.53  ? 1360 ASP A OD1   1 
ATOM   7082 O  OD2   . ASP A 1 490 ? 26.875 -25.439 3.174   1.00 66.14  ? 1360 ASP A OD2   1 
ATOM   7083 H  H     . ASP A 1 490 ? 27.419 -24.887 -0.205  1.00 47.20  ? 1360 ASP A H     1 
ATOM   7084 H  HA    . ASP A 1 490 ? 25.949 -27.036 -0.279  1.00 46.87  ? 1360 ASP A HA    1 
ATOM   7085 H  HB2   . ASP A 1 490 ? 25.512 -24.682 1.231   1.00 52.54  ? 1360 ASP A HB2   1 
ATOM   7086 H  HB3   . ASP A 1 490 ? 24.771 -26.063 1.500   1.00 52.54  ? 1360 ASP A HB3   1 
ATOM   7087 N  N     . CYS A 1 491 ? 24.485 -24.451 -1.482  1.00 38.72  ? 1361 CYS A N     1 
ATOM   7088 C  CA    . CYS A 1 491 ? 23.327 -24.006 -2.247  1.00 35.58  ? 1361 CYS A CA    1 
ATOM   7089 C  C     . CYS A 1 491 ? 23.359 -24.543 -3.674  1.00 45.62  ? 1361 CYS A C     1 
ATOM   7090 O  O     . CYS A 1 491 ? 22.313 -24.775 -4.283  1.00 45.48  ? 1361 CYS A O     1 
ATOM   7091 C  CB    . CYS A 1 491 ? 23.239 -22.480 -2.239  1.00 40.19  ? 1361 CYS A CB    1 
ATOM   7092 S  SG    . CYS A 1 491 ? 22.578 -21.824 -0.684  1.00 35.70  ? 1361 CYS A SG    1 
ATOM   7093 H  H     . CYS A 1 491 ? 25.052 -23.829 -1.305  1.00 46.41  ? 1361 CYS A H     1 
ATOM   7094 H  HA    . CYS A 1 491 ? 22.517 -24.352 -1.818  1.00 42.64  ? 1361 CYS A HA    1 
ATOM   7095 H  HB2   . CYS A 1 491 ? 24.127 -22.112 -2.367  1.00 48.17  ? 1361 CYS A HB2   1 
ATOM   7096 H  HB3   . CYS A 1 491 ? 22.654 -22.194 -2.958  1.00 48.17  ? 1361 CYS A HB3   1 
ATOM   7097 N  N     . ALA A 1 492 ? 24.562 -24.744 -4.201  1.00 40.70  ? 1362 ALA A N     1 
ATOM   7098 C  CA    . ALA A 1 492 ? 24.727 -25.354 -5.514  1.00 42.59  ? 1362 ALA A CA    1 
ATOM   7099 C  C     . ALA A 1 492 ? 24.245 -26.799 -5.477  1.00 48.84  ? 1362 ALA A C     1 
ATOM   7100 O  O     . ALA A 1 492 ? 23.442 -27.221 -6.307  1.00 38.95  ? 1362 ALA A O     1 
ATOM   7101 C  CB    . ALA A 1 492 ? 26.188 -25.297 -5.948  1.00 32.51  ? 1362 ALA A CB    1 
ATOM   7102 H  H     . ALA A 1 492 ? 25.302 -24.536 -3.815  1.00 48.79  ? 1362 ALA A H     1 
ATOM   7103 H  HA    . ALA A 1 492 ? 24.189 -24.864 -6.170  1.00 51.06  ? 1362 ALA A HA    1 
ATOM   7104 H  HB1   . ALA A 1 492 ? 26.272 -25.703 -6.813  1.00 38.96  ? 1362 ALA A HB1   1 
ATOM   7105 H  HB2   . ALA A 1 492 ? 26.466 -24.380 -5.987  1.00 38.96  ? 1362 ALA A HB2   1 
ATOM   7106 H  HB3   . ALA A 1 492 ? 26.722 -25.775 -5.308  1.00 38.96  ? 1362 ALA A HB3   1 
ATOM   7107 N  N     . ARG A 1 493 ? 24.738 -27.549 -4.499  1.00 37.15  ? 1363 ARG A N     1 
ATOM   7108 C  CA    . ARG A 1 493 ? 24.443 -28.972 -4.401  1.00 58.17  ? 1363 ARG A CA    1 
ATOM   7109 C  C     . ARG A 1 493 ? 22.958 -29.247 -4.176  1.00 67.99  ? 1363 ARG A C     1 
ATOM   7110 O  O     . ARG A 1 493 ? 22.453 -30.296 -4.575  1.00 65.89  ? 1363 ARG A O     1 
ATOM   7111 C  CB    . ARG A 1 493 ? 25.273 -29.613 -3.288  1.00 57.10  ? 1363 ARG A CB    1 
ATOM   7112 C  CG    . ARG A 1 493 ? 26.774 -29.519 -3.512  1.00 57.14  ? 1363 ARG A CG    1 
ATOM   7113 C  CD    . ARG A 1 493 ? 27.526 -30.561 -2.704  1.00 56.65  ? 1363 ARG A CD    1 
ATOM   7114 N  NE    . ARG A 1 493 ? 28.133 -31.579 -3.560  1.00 78.13  ? 1363 ARG A NE    1 
ATOM   7115 C  CZ    . ARG A 1 493 ? 29.421 -31.623 -3.891  1.00 72.61  ? 1363 ARG A CZ    1 
ATOM   7116 N  NH1   . ARG A 1 493 ? 30.270 -30.711 -3.435  1.00 61.77  ? 1363 ARG A NH1   1 
ATOM   7117 N  NH2   . ARG A 1 493 ? 29.865 -32.593 -4.680  1.00 79.88  ? 1363 ARG A NH2   1 
ATOM   7118 H  H     . ARG A 1 493 ? 25.250 -27.255 -3.875  1.00 44.53  ? 1363 ARG A H     1 
ATOM   7119 H  HA    . ARG A 1 493 ? 24.698 -29.401 -5.245  1.00 69.75  ? 1363 ARG A HA    1 
ATOM   7120 H  HB2   . ARG A 1 493 ? 25.070 -29.168 -2.450  1.00 68.46  ? 1363 ARG A HB2   1 
ATOM   7121 H  HB3   . ARG A 1 493 ? 25.041 -30.553 -3.226  1.00 68.46  ? 1363 ARG A HB3   1 
ATOM   7122 H  HG2   . ARG A 1 493 ? 26.967 -29.666 -4.451  1.00 68.51  ? 1363 ARG A HG2   1 
ATOM   7123 H  HG3   . ARG A 1 493 ? 27.084 -28.642 -3.240  1.00 68.51  ? 1363 ARG A HG3   1 
ATOM   7124 H  HD2   . ARG A 1 493 ? 28.234 -30.126 -2.203  1.00 67.93  ? 1363 ARG A HD2   1 
ATOM   7125 H  HD3   . ARG A 1 493 ? 26.910 -31.002 -2.099  1.00 67.93  ? 1363 ARG A HD3   1 
ATOM   7126 H  HE    . ARG A 1 493 ? 27.619 -32.194 -3.873  1.00 93.70  ? 1363 ARG A HE    1 
ATOM   7127 H  HH11  . ARG A 1 493 ? 29.989 -30.080 -2.924  1.00 74.07  ? 1363 ARG A HH11  1 
ATOM   7128 H  HH12  . ARG A 1 493 ? 31.101 -30.750 -3.654  1.00 74.07  ? 1363 ARG A HH12  1 
ATOM   7129 H  HH21  . ARG A 1 493 ? 29.321 -33.188 -4.977  1.00 95.80  ? 1363 ARG A HH21  1 
ATOM   7130 H  HH22  . ARG A 1 493 ? 30.698 -32.626 -4.893  1.00 95.80  ? 1363 ARG A HH22  1 
ATOM   7131 N  N     . LYS A 1 494 ? 22.260 -28.312 -3.539  1.00 57.80  ? 1364 LYS A N     1 
ATOM   7132 C  CA    . LYS A 1 494 ? 20.831 -28.479 -3.287  1.00 66.21  ? 1364 LYS A CA    1 
ATOM   7133 C  C     . LYS A 1 494 ? 20.038 -28.589 -4.589  1.00 67.89  ? 1364 LYS A C     1 
ATOM   7134 O  O     . LYS A 1 494 ? 19.016 -29.272 -4.641  1.00 76.47  ? 1364 LYS A O     1 
ATOM   7135 C  CB    . LYS A 1 494 ? 20.288 -27.329 -2.435  1.00 53.31  ? 1364 LYS A CB    1 
ATOM   7136 C  CG    . LYS A 1 494 ? 20.658 -27.422 -0.962  1.00 50.06  ? 1364 LYS A CG    1 
ATOM   7137 C  CD    . LYS A 1 494 ? 20.073 -26.267 -0.160  1.00 60.27  ? 1364 LYS A CD    1 
ATOM   7138 C  CE    . LYS A 1 494 ? 20.675 -26.195 1.237   1.00 60.59  ? 1364 LYS A CE    1 
ATOM   7139 N  NZ    . LYS A 1 494 ? 20.079 -25.103 2.058   1.00 52.59  ? 1364 LYS A NZ    1 
ATOM   7140 H  H     . LYS A 1 494 ? 22.588 -27.574 -3.243  1.00 69.31  ? 1364 LYS A H     1 
ATOM   7141 H  HA    . LYS A 1 494 ? 20.696 -29.311 -2.785  1.00 79.39  ? 1364 LYS A HA    1 
ATOM   7142 H  HB2   . LYS A 1 494 ? 20.643 -26.493 -2.777  1.00 63.91  ? 1364 LYS A HB2   1 
ATOM   7143 H  HB3   . LYS A 1 494 ? 19.320 -27.324 -2.497  1.00 63.91  ? 1364 LYS A HB3   1 
ATOM   7144 H  HG2   . LYS A 1 494 ? 20.311 -28.251 -0.597  1.00 60.01  ? 1364 LYS A HG2   1 
ATOM   7145 H  HG3   . LYS A 1 494 ? 21.624 -27.395 -0.872  1.00 60.01  ? 1364 LYS A HG3   1 
ATOM   7146 H  HD2   . LYS A 1 494 ? 20.263 -25.432 -0.616  1.00 72.27  ? 1364 LYS A HD2   1 
ATOM   7147 H  HD3   . LYS A 1 494 ? 19.115 -26.391 -0.072  1.00 72.27  ? 1364 LYS A HD3   1 
ATOM   7148 H  HE2   . LYS A 1 494 ? 20.516 -27.036 1.694   1.00 72.66  ? 1364 LYS A HE2   1 
ATOM   7149 H  HE3   . LYS A 1 494 ? 21.628 -26.031 1.164   1.00 72.66  ? 1364 LYS A HE3   1 
ATOM   7150 H  HZ1   . LYS A 1 494 ? 20.453 -25.091 2.865   1.00 63.06  ? 1364 LYS A HZ1   1 
ATOM   7151 H  HZ2   . LYS A 1 494 ? 20.216 -24.317 1.664   1.00 63.06  ? 1364 LYS A HZ2   1 
ATOM   7152 H  HZ3   . LYS A 1 494 ? 19.203 -25.233 2.147   1.00 63.06  ? 1364 LYS A HZ3   1 
ATOM   7153 N  N     . THR A 1 495 ? 20.506 -27.912 -5.634  1.00 52.09  ? 1365 THR A N     1 
ATOM   7154 C  CA    . THR A 1 495 ? 19.848 -27.974 -6.937  1.00 71.63  ? 1365 THR A CA    1 
ATOM   7155 C  C     . THR A 1 495 ? 20.497 -29.007 -7.859  1.00 79.05  ? 1365 THR A C     1 
ATOM   7156 O  O     . THR A 1 495 ? 19.877 -29.461 -8.819  1.00 92.11  ? 1365 THR A O     1 
ATOM   7157 C  CB    . THR A 1 495 ? 19.833 -26.600 -7.639  1.00 73.33  ? 1365 THR A CB    1 
ATOM   7158 O  OG1   . THR A 1 495 ? 21.168 -26.090 -7.748  1.00 68.90  ? 1365 THR A OG1   1 
ATOM   7159 C  CG2   . THR A 1 495 ? 18.978 -25.615 -6.858  1.00 70.83  ? 1365 THR A CG2   1 
ATOM   7160 H  H     . THR A 1 495 ? 21.203 -27.409 -5.616  1.00 62.45  ? 1365 THR A H     1 
ATOM   7161 H  HA    . THR A 1 495 ? 18.916 -28.245 -6.801  1.00 85.90  ? 1365 THR A HA    1 
ATOM   7162 H  HB    . THR A 1 495 ? 19.452 -26.696 -8.526  1.00 87.94  ? 1365 THR A HB    1 
ATOM   7163 H  HG1   . THR A 1 495 ? 21.497 -26.005 -7.002  1.00 82.63  ? 1365 THR A HG1   1 
ATOM   7164 H  HG21  . THR A 1 495 ? 18.973 -24.762 -7.300  1.00 84.94  ? 1365 THR A HG21  1 
ATOM   7165 H  HG22  . THR A 1 495 ? 18.077 -25.939 -6.797  1.00 84.94  ? 1365 THR A HG22  1 
ATOM   7166 H  HG23  . THR A 1 495 ? 19.331 -25.505 -5.972  1.00 84.94  ? 1365 THR A HG23  1 
ATOM   7167 N  N     . SER A 1 496 ? 21.744 -29.371 -7.571  1.00 68.58  ? 1366 SER A N     1 
ATOM   7168 C  CA    . SER A 1 496 ? 22.415 -30.454 -8.289  1.00 71.64  ? 1366 SER A CA    1 
ATOM   7169 C  C     . SER A 1 496 ? 23.368 -31.191 -7.359  1.00 73.81  ? 1366 SER A C     1 
ATOM   7170 O  O     . SER A 1 496 ? 24.414 -30.662 -6.990  1.00 72.76  ? 1366 SER A O     1 
ATOM   7171 C  CB    . SER A 1 496 ? 23.193 -29.916 -9.490  1.00 76.71  ? 1366 SER A CB    1 
ATOM   7172 O  OG    . SER A 1 496 ? 22.456 -28.923 -10.178 1.00 81.61  ? 1366 SER A OG    1 
ATOM   7173 H  H     . SER A 1 496 ? 22.227 -29.004 -6.961  1.00 82.24  ? 1366 SER A H     1 
ATOM   7174 H  HA    . SER A 1 496 ? 21.745 -31.092 -8.615  1.00 85.92  ? 1366 SER A HA    1 
ATOM   7175 H  HB2   . SER A 1 496 ? 24.026 -29.529 -9.176  1.00 92.00  ? 1366 SER A HB2   1 
ATOM   7176 H  HB3   . SER A 1 496 ? 23.378 -30.649 -10.098 1.00 92.00  ? 1366 SER A HB3   1 
ATOM   7177 H  HG    . SER A 1 496 ? 22.887 -28.646 -10.818 1.00 97.88  ? 1366 SER A HG    1 
ATOM   7178 N  N     . GLY A 1 497 ? 23.009 -32.417 -6.993  1.00 77.58  ? 1367 GLY A N     1 
ATOM   7179 C  CA    . GLY A 1 497 ? 23.796 -33.193 -6.053  1.00 72.11  ? 1367 GLY A CA    1 
ATOM   7180 C  C     . GLY A 1 497 ? 25.238 -33.379 -6.486  1.00 73.12  ? 1367 GLY A C     1 
ATOM   7181 O  O     . GLY A 1 497 ? 26.159 -33.211 -5.686  1.00 65.78  ? 1367 GLY A O     1 
ATOM   7182 H  H     . GLY A 1 497 ? 22.307 -32.822 -7.280  1.00 93.04  ? 1367 GLY A H     1 
ATOM   7183 H  HA2   . GLY A 1 497 ? 23.792 -32.750 -5.190  1.00 86.47  ? 1367 GLY A HA2   1 
ATOM   7184 H  HA3   . GLY A 1 497 ? 23.394 -34.070 -5.948  1.00 86.47  ? 1367 GLY A HA3   1 
ATOM   7185 N  N     . ASN A 1 498 ? 25.436 -33.726 -7.754  1.00 72.19  ? 1368 ASN A N     1 
ATOM   7186 C  CA    . ASN A 1 498 ? 26.772 -33.988 -8.276  1.00 84.76  ? 1368 ASN A CA    1 
ATOM   7187 C  C     . ASN A 1 498 ? 27.335 -32.792 -9.038  1.00 77.54  ? 1368 ASN A C     1 
ATOM   7188 O  O     . ASN A 1 498 ? 28.355 -32.903 -9.719  1.00 67.47  ? 1368 ASN A O     1 
ATOM   7189 C  CB    . ASN A 1 498 ? 26.748 -35.215 -9.186  1.00 92.47  ? 1368 ASN A CB    1 
ATOM   7190 C  CG    . ASN A 1 498 ? 25.895 -36.336 -8.628  1.00 109.05 ? 1368 ASN A CG    1 
ATOM   7191 O  OD1   . ASN A 1 498 ? 26.372 -37.171 -7.860  1.00 115.26 ? 1368 ASN A OD1   1 
ATOM   7192 N  ND2   . ASN A 1 498 ? 24.623 -36.358 -9.011  1.00 110.85 ? 1368 ASN A ND2   1 
ATOM   7193 H  H     . ASN A 1 498 ? 24.809 -33.816 -8.335  1.00 86.57  ? 1368 ASN A H     1 
ATOM   7194 H  HA    . ASN A 1 498 ? 27.374 -34.179 -7.527  1.00 101.65 ? 1368 ASN A HA    1 
ATOM   7195 H  HB2   . ASN A 1 498 ? 26.386 -34.962 -10.049 1.00 110.91 ? 1368 ASN A HB2   1 
ATOM   7196 H  HB3   . ASN A 1 498 ? 27.653 -35.549 -9.290  1.00 110.91 ? 1368 ASN A HB3   1 
ATOM   7197 H  HD21  . ASN A 1 498 ? 24.098 -36.974 -8.722  1.00 132.96 ? 1368 ASN A HD21  1 
ATOM   7198 H  HD22  . ASN A 1 498 ? 24.326 -35.755 -9.548  1.00 132.96 ? 1368 ASN A HD22  1 
ATOM   7199 N  N     . LEU A 1 499 ? 26.655 -31.656 -8.925  1.00 70.66  ? 1369 LEU A N     1 
ATOM   7200 C  CA    . LEU A 1 499 ? 27.133 -30.401 -9.497  1.00 71.21  ? 1369 LEU A CA    1 
ATOM   7201 C  C     . LEU A 1 499 ? 27.138 -30.412 -11.024 1.00 71.91  ? 1369 LEU A C     1 
ATOM   7202 O  O     . LEU A 1 499 ? 27.908 -29.688 -11.650 1.00 51.93  ? 1369 LEU A O     1 
ATOM   7203 C  CB    . LEU A 1 499 ? 28.536 -30.083 -8.970  1.00 66.90  ? 1369 LEU A CB    1 
ATOM   7204 C  CG    . LEU A 1 499 ? 28.621 -29.896 -7.453  1.00 62.89  ? 1369 LEU A CG    1 
ATOM   7205 C  CD1   . LEU A 1 499 ? 30.066 -29.761 -6.996  1.00 44.59  ? 1369 LEU A CD1   1 
ATOM   7206 C  CD2   . LEU A 1 499 ? 27.800 -28.689 -7.024  1.00 58.37  ? 1369 LEU A CD2   1 
ATOM   7207 H  H     . LEU A 1 499 ? 25.902 -31.584 -8.516  1.00 84.73  ? 1369 LEU A H     1 
ATOM   7208 H  HA    . LEU A 1 499 ? 26.537 -29.679 -9.208  1.00 85.40  ? 1369 LEU A HA    1 
ATOM   7209 H  HB2   . LEU A 1 499 ? 29.129 -30.813 -9.210  1.00 80.23  ? 1369 LEU A HB2   1 
ATOM   7210 H  HB3   . LEU A 1 499 ? 28.845 -29.263 -9.385  1.00 80.23  ? 1369 LEU A HB3   1 
ATOM   7211 H  HG    . LEU A 1 499 ? 28.246 -30.679 -7.020  1.00 75.41  ? 1369 LEU A HG    1 
ATOM   7212 H  HD11  . LEU A 1 499 ? 30.082 -29.646 -6.043  1.00 53.45  ? 1369 LEU A HD11  1 
ATOM   7213 H  HD12  . LEU A 1 499 ? 30.546 -30.557 -7.238  1.00 53.45  ? 1369 LEU A HD12  1 
ATOM   7214 H  HD13  . LEU A 1 499 ? 30.459 -28.998 -7.425  1.00 53.45  ? 1369 LEU A HD13  1 
ATOM   7215 H  HD21  . LEU A 1 499 ? 27.866 -28.589 -6.071  1.00 69.98  ? 1369 LEU A HD21  1 
ATOM   7216 H  HD22  . LEU A 1 499 ? 28.145 -27.906 -7.460  1.00 69.98  ? 1369 LEU A HD22  1 
ATOM   7217 H  HD23  . LEU A 1 499 ? 26.884 -28.828 -7.276  1.00 69.98  ? 1369 LEU A HD23  1 
ATOM   7218 N  N     . GLU A 1 500 ? 26.267 -31.220 -11.619 1.00 70.14  ? 1370 GLU A N     1 
ATOM   7219 C  CA    . GLU A 1 500 ? 26.175 -31.310 -13.072 1.00 69.09  ? 1370 GLU A CA    1 
ATOM   7220 C  C     . GLU A 1 500 ? 25.980 -29.937 -13.704 1.00 60.57  ? 1370 GLU A C     1 
ATOM   7221 O  O     . GLU A 1 500 ? 26.602 -29.617 -14.716 1.00 54.23  ? 1370 GLU A O     1 
ATOM   7222 C  CB    . GLU A 1 500 ? 25.014 -32.221 -13.486 1.00 86.23  ? 1370 GLU A CB    1 
ATOM   7223 C  CG    . GLU A 1 500 ? 25.331 -33.710 -13.458 1.00 99.24  ? 1370 GLU A CG    1 
ATOM   7224 C  CD    . GLU A 1 500 ? 25.126 -34.343 -12.093 1.00 105.29 ? 1370 GLU A CD    1 
ATOM   7225 O  OE1   . GLU A 1 500 ? 24.635 -33.654 -11.173 1.00 97.32  ? 1370 GLU A OE1   1 
ATOM   7226 O  OE2   . GLU A 1 500 ? 25.453 -35.540 -11.943 1.00 104.89 ? 1370 GLU A OE2   1 
ATOM   7227 H  H     . GLU A 1 500 ? 25.714 -31.729 -11.201 1.00 84.12  ? 1370 GLU A H     1 
ATOM   7228 H  HA    . GLU A 1 500 ? 27.005 -31.694 -13.424 1.00 82.85  ? 1370 GLU A HA    1 
ATOM   7229 H  HB2   . GLU A 1 500 ? 24.271 -32.068 -12.881 1.00 103.42 ? 1370 GLU A HB2   1 
ATOM   7230 H  HB3   . GLU A 1 500 ? 24.750 -31.993 -14.391 1.00 103.42 ? 1370 GLU A HB3   1 
ATOM   7231 H  HG2   . GLU A 1 500 ? 24.751 -34.166 -14.088 1.00 119.03 ? 1370 GLU A HG2   1 
ATOM   7232 H  HG3   . GLU A 1 500 ? 26.258 -33.839 -13.711 1.00 119.03 ? 1370 GLU A HG3   1 
ATOM   7233 N  N     . ASN A 1 501 ? 25.116 -29.130 -13.096 1.00 59.30  ? 1371 ASN A N     1 
ATOM   7234 C  CA    . ASN A 1 501 ? 24.714 -27.852 -13.674 1.00 64.94  ? 1371 ASN A CA    1 
ATOM   7235 C  C     . ASN A 1 501 ? 25.669 -26.706 -13.342 1.00 56.10  ? 1371 ASN A C     1 
ATOM   7236 O  O     . ASN A 1 501 ? 25.390 -25.554 -13.665 1.00 57.74  ? 1371 ASN A O     1 
ATOM   7237 C  CB    . ASN A 1 501 ? 23.304 -27.487 -13.193 1.00 61.28  ? 1371 ASN A CB    1 
ATOM   7238 C  CG    . ASN A 1 501 ? 22.679 -26.359 -14.002 1.00 66.92  ? 1371 ASN A CG    1 
ATOM   7239 O  OD1   . ASN A 1 501 ? 22.956 -26.203 -15.192 1.00 66.72  ? 1371 ASN A OD1   1 
ATOM   7240 N  ND2   . ASN A 1 501 ? 21.831 -25.568 -13.355 1.00 68.82  ? 1371 ASN A ND2   1 
ATOM   7241 H  H     . ASN A 1 501 ? 24.745 -29.302 -12.339 1.00 71.11  ? 1371 ASN A H     1 
ATOM   7242 H  HA    . ASN A 1 501 ? 24.684 -27.943 -14.649 1.00 77.87  ? 1371 ASN A HA    1 
ATOM   7243 H  HB2   . ASN A 1 501 ? 22.731 -28.266 -13.273 1.00 73.48  ? 1371 ASN A HB2   1 
ATOM   7244 H  HB3   . ASN A 1 501 ? 23.349 -27.202 -12.267 1.00 73.48  ? 1371 ASN A HB3   1 
ATOM   7245 H  HD21  . ASN A 1 501 ? 21.451 -24.916 -13.768 1.00 82.53  ? 1371 ASN A HD21  1 
ATOM   7246 H  HD22  . ASN A 1 501 ? 21.662 -25.708 -12.524 1.00 82.53  ? 1371 ASN A HD22  1 
ATOM   7247 N  N     . PHE A 1 502 ? 26.795 -27.018 -12.707 1.00 46.95  ? 1372 PHE A N     1 
ATOM   7248 C  CA    . PHE A 1 502 ? 27.690 -25.979 -12.206 1.00 54.61  ? 1372 PHE A CA    1 
ATOM   7249 C  C     . PHE A 1 502 ? 29.128 -26.111 -12.697 1.00 51.33  ? 1372 PHE A C     1 
ATOM   7250 O  O     . PHE A 1 502 ? 29.607 -27.202 -12.982 1.00 47.87  ? 1372 PHE A O     1 
ATOM   7251 C  CB    . PHE A 1 502 ? 27.690 -25.982 -10.674 1.00 35.24  ? 1372 PHE A CB    1 
ATOM   7252 C  CG    . PHE A 1 502 ? 26.412 -25.488 -10.068 1.00 36.48  ? 1372 PHE A CG    1 
ATOM   7253 C  CD1   . PHE A 1 502 ? 26.274 -24.159 -9.702  1.00 45.91  ? 1372 PHE A CD1   1 
ATOM   7254 C  CD2   . PHE A 1 502 ? 25.348 -26.349 -9.865  1.00 52.62  ? 1372 PHE A CD2   1 
ATOM   7255 C  CE1   . PHE A 1 502 ? 25.096 -23.698 -9.143  1.00 41.41  ? 1372 PHE A CE1   1 
ATOM   7256 C  CE2   . PHE A 1 502 ? 24.167 -25.894 -9.306  1.00 57.91  ? 1372 PHE A CE2   1 
ATOM   7257 C  CZ    . PHE A 1 502 ? 24.041 -24.567 -8.944  1.00 47.05  ? 1372 PHE A CZ    1 
ATOM   7258 H  H     . PHE A 1 502 ? 27.063 -27.821 -12.554 1.00 56.28  ? 1372 PHE A H     1 
ATOM   7259 H  HA    . PHE A 1 502 ? 27.354 -25.108 -12.502 1.00 65.48  ? 1372 PHE A HA    1 
ATOM   7260 H  HB2   . PHE A 1 502 ? 27.834 -26.890 -10.364 1.00 42.23  ? 1372 PHE A HB2   1 
ATOM   7261 H  HB3   . PHE A 1 502 ? 28.408 -25.410 -10.361 1.00 42.23  ? 1372 PHE A HB3   1 
ATOM   7262 H  HD1   . PHE A 1 502 ? 26.982 -23.570 -9.834  1.00 55.03  ? 1372 PHE A HD1   1 
ATOM   7263 H  HD2   . PHE A 1 502 ? 25.427 -27.243 -10.106 1.00 63.09  ? 1372 PHE A HD2   1 
ATOM   7264 H  HE1   . PHE A 1 502 ? 25.014 -22.803 -8.900  1.00 49.64  ? 1372 PHE A HE1   1 
ATOM   7265 H  HE2   . PHE A 1 502 ? 23.458 -26.481 -9.173  1.00 69.43  ? 1372 PHE A HE2   1 
ATOM   7266 H  HZ    . PHE A 1 502 ? 23.248 -24.259 -8.568  1.00 56.40  ? 1372 PHE A HZ    1 
ATOM   7267 N  N     . VAL A 1 503 ? 29.804 -24.974 -12.791 1.00 39.25  ? 1373 VAL A N     1 
ATOM   7268 C  CA    . VAL A 1 503 ? 31.241 -24.939 -12.990 1.00 49.30  ? 1373 VAL A CA    1 
ATOM   7269 C  C     . VAL A 1 503 ? 31.855 -24.378 -11.709 1.00 53.41  ? 1373 VAL A C     1 
ATOM   7270 O  O     . VAL A 1 503 ? 31.183 -23.683 -10.947 1.00 39.76  ? 1373 VAL A O     1 
ATOM   7271 C  CB    . VAL A 1 503 ? 31.617 -24.069 -14.208 1.00 59.10  ? 1373 VAL A CB    1 
ATOM   7272 C  CG1   . VAL A 1 503 ? 31.542 -22.585 -13.868 1.00 38.47  ? 1373 VAL A CG1   1 
ATOM   7273 C  CG2   . VAL A 1 503 ? 32.998 -24.428 -14.706 1.00 76.13  ? 1373 VAL A CG2   1 
ATOM   7274 H  H     . VAL A 1 503 ? 29.443 -24.195 -12.741 1.00 47.04  ? 1373 VAL A H     1 
ATOM   7275 H  HA    . VAL A 1 503 ? 31.579 -25.847 -13.133 1.00 59.10  ? 1373 VAL A HA    1 
ATOM   7276 H  HB    . VAL A 1 503 ? 30.981 -24.244 -14.932 1.00 70.86  ? 1373 VAL A HB    1 
ATOM   7277 H  HG11  . VAL A 1 503 ? 31.272 -22.488 -12.952 1.00 46.11  ? 1373 VAL A HG11  1 
ATOM   7278 H  HG12  . VAL A 1 503 ? 32.408 -22.191 -13.998 1.00 46.11  ? 1373 VAL A HG12  1 
ATOM   7279 H  HG13  . VAL A 1 503 ? 30.901 -22.165 -14.445 1.00 46.11  ? 1373 VAL A HG13  1 
ATOM   7280 H  HG21  . VAL A 1 503 ? 33.210 -23.875 -15.462 1.00 91.29  ? 1373 VAL A HG21  1 
ATOM   7281 H  HG22  . VAL A 1 503 ? 33.633 -24.278 -14.002 1.00 91.29  ? 1373 VAL A HG22  1 
ATOM   7282 H  HG23  . VAL A 1 503 ? 33.006 -25.353 -14.963 1.00 91.29  ? 1373 VAL A HG23  1 
ATOM   7283 N  N     . VAL A 1 504 ? 33.119 -24.695 -11.460 1.00 40.14  ? 1374 VAL A N     1 
ATOM   7284 C  CA    . VAL A 1 504 ? 33.792 -24.240 -10.250 1.00 39.76  ? 1374 VAL A CA    1 
ATOM   7285 C  C     . VAL A 1 504 ? 34.962 -23.337 -10.618 1.00 43.95  ? 1374 VAL A C     1 
ATOM   7286 O  O     . VAL A 1 504 ? 35.925 -23.779 -11.234 1.00 43.05  ? 1374 VAL A O     1 
ATOM   7287 C  CB    . VAL A 1 504 ? 34.302 -25.426 -9.416  1.00 31.65  ? 1374 VAL A CB    1 
ATOM   7288 C  CG1   . VAL A 1 504 ? 34.892 -24.939 -8.102  1.00 44.19  ? 1374 VAL A CG1   1 
ATOM   7289 C  CG2   . VAL A 1 504 ? 33.172 -26.411 -9.155  1.00 39.00  ? 1374 VAL A CG2   1 
ATOM   7290 H  H     . VAL A 1 504 ? 33.612 -25.174 -11.978 1.00 48.12  ? 1374 VAL A H     1 
ATOM   7291 H  HA    . VAL A 1 504 ? 33.164 -23.724 -9.703  1.00 47.65  ? 1374 VAL A HA    1 
ATOM   7292 H  HB    . VAL A 1 504 ? 35.005 -25.892 -9.914  1.00 37.92  ? 1374 VAL A HB    1 
ATOM   7293 H  HG11  . VAL A 1 504 ? 35.203 -25.696 -7.600  1.00 52.97  ? 1374 VAL A HG11  1 
ATOM   7294 H  HG12  . VAL A 1 504 ? 35.625 -24.347 -8.290  1.00 52.97  ? 1374 VAL A HG12  1 
ATOM   7295 H  HG13  . VAL A 1 504 ? 34.213 -24.474 -7.608  1.00 52.97  ? 1374 VAL A HG13  1 
ATOM   7296 H  HG21  . VAL A 1 504 ? 33.509 -27.143 -8.634  1.00 46.74  ? 1374 VAL A HG21  1 
ATOM   7297 H  HG22  . VAL A 1 504 ? 32.471 -25.962 -8.676  1.00 46.74  ? 1374 VAL A HG22  1 
ATOM   7298 H  HG23  . VAL A 1 504 ? 32.839 -26.733 -9.996  1.00 46.74  ? 1374 VAL A HG23  1 
ATOM   7299 N  N     . LEU A 1 505 ? 34.862 -22.068 -10.242 1.00 32.72  ? 1375 LEU A N     1 
ATOM   7300 C  CA    . LEU A 1 505 ? 35.881 -21.080 -10.567 1.00 35.93  ? 1375 LEU A CA    1 
ATOM   7301 C  C     . LEU A 1 505 ? 36.810 -20.878 -9.375  1.00 42.28  ? 1375 LEU A C     1 
ATOM   7302 O  O     . LEU A 1 505 ? 36.355 -20.754 -8.244  1.00 38.64  ? 1375 LEU A O     1 
ATOM   7303 C  CB    . LEU A 1 505 ? 35.215 -19.753 -10.942 1.00 31.48  ? 1375 LEU A CB    1 
ATOM   7304 C  CG    . LEU A 1 505 ? 34.172 -19.824 -12.062 1.00 32.08  ? 1375 LEU A CG    1 
ATOM   7305 C  CD1   . LEU A 1 505 ? 33.502 -18.474 -12.265 1.00 41.76  ? 1375 LEU A CD1   1 
ATOM   7306 C  CD2   . LEU A 1 505 ? 34.809 -20.303 -13.356 1.00 33.42  ? 1375 LEU A CD2   1 
ATOM   7307 H  H     . LEU A 1 505 ? 34.203 -21.750 -9.791  1.00 39.21  ? 1375 LEU A H     1 
ATOM   7308 H  HA    . LEU A 1 505 ? 36.411 -21.391 -11.330 1.00 43.06  ? 1375 LEU A HA    1 
ATOM   7309 H  HB2   . LEU A 1 505 ? 34.771 -19.401 -10.155 1.00 37.72  ? 1375 LEU A HB2   1 
ATOM   7310 H  HB3   . LEU A 1 505 ? 35.905 -19.134 -11.227 1.00 37.72  ? 1375 LEU A HB3   1 
ATOM   7311 H  HG    . LEU A 1 505 ? 33.486 -20.463 -11.813 1.00 38.44  ? 1375 LEU A HG    1 
ATOM   7312 H  HD11  . LEU A 1 505 ? 32.856 -18.550 -12.971 1.00 50.06  ? 1375 LEU A HD11  1 
ATOM   7313 H  HD12  . LEU A 1 505 ? 33.067 -18.216 -11.449 1.00 50.06  ? 1375 LEU A HD12  1 
ATOM   7314 H  HD13  . LEU A 1 505 ? 34.170 -17.826 -12.499 1.00 50.06  ? 1375 LEU A HD13  1 
ATOM   7315 H  HD21  . LEU A 1 505 ? 34.137 -20.338 -14.040 1.00 40.05  ? 1375 LEU A HD21  1 
ATOM   7316 H  HD22  . LEU A 1 505 ? 35.502 -19.689 -13.609 1.00 40.05  ? 1375 LEU A HD22  1 
ATOM   7317 H  HD23  . LEU A 1 505 ? 35.181 -21.177 -13.216 1.00 40.05  ? 1375 LEU A HD23  1 
ATOM   7318 N  N     . GLU A 1 506 ? 38.114 -20.846 -9.634  1.00 34.30  ? 1376 GLU A N     1 
ATOM   7319 C  CA    . GLU A 1 506 ? 39.105 -20.660 -8.578  1.00 35.18  ? 1376 GLU A CA    1 
ATOM   7320 C  C     . GLU A 1 506 ? 39.694 -19.259 -8.671  1.00 31.04  ? 1376 GLU A C     1 
ATOM   7321 O  O     . GLU A 1 506 ? 40.149 -18.849 -9.734  1.00 32.89  ? 1376 GLU A O     1 
ATOM   7322 C  CB    . GLU A 1 506 ? 40.208 -21.711 -8.702  1.00 40.14  ? 1376 GLU A CB    1 
ATOM   7323 C  CG    . GLU A 1 506 ? 41.265 -21.633 -7.616  1.00 41.15  ? 1376 GLU A CG    1 
ATOM   7324 C  CD    . GLU A 1 506 ? 42.163 -22.855 -7.593  1.00 63.13  ? 1376 GLU A CD    1 
ATOM   7325 O  OE1   . GLU A 1 506 ? 42.604 -23.286 -8.678  1.00 56.02  ? 1376 GLU A OE1   1 
ATOM   7326 O  OE2   . GLU A 1 506 ? 42.421 -23.388 -6.493  1.00 57.11  ? 1376 GLU A OE2   1 
ATOM   7327 H  H     . GLU A 1 506 ? 38.453 -20.930 -10.420 1.00 41.11  ? 1376 GLU A H     1 
ATOM   7328 H  HA    . GLU A 1 506 ? 38.675 -20.761 -7.703  1.00 42.16  ? 1376 GLU A HA    1 
ATOM   7329 H  HB2   . GLU A 1 506 ? 39.806 -22.592 -8.659  1.00 48.11  ? 1376 GLU A HB2   1 
ATOM   7330 H  HB3   . GLU A 1 506 ? 40.654 -21.596 -9.556  1.00 48.11  ? 1376 GLU A HB3   1 
ATOM   7331 H  HG2   . GLU A 1 506 ? 41.822 -20.853 -7.771  1.00 49.33  ? 1376 GLU A HG2   1 
ATOM   7332 H  HG3   . GLU A 1 506 ? 40.828 -21.564 -6.753  1.00 49.33  ? 1376 GLU A HG3   1 
ATOM   7333 N  N     A GLN A 1 507 ? 39.657 -18.533 -7.555  0.48 34.28  ? 1377 GLN A N     1 
ATOM   7334 N  N     B GLN A 1 507 ? 39.706 -18.530 -7.559  0.52 33.70  ? 1377 GLN A N     1 
ATOM   7335 C  CA    A GLN A 1 507 ? 40.134 -17.153 -7.488  0.48 38.22  ? 1377 GLN A CA    1 
ATOM   7336 C  CA    B GLN A 1 507 ? 40.161 -17.142 -7.570  0.52 37.12  ? 1377 GLN A CA    1 
ATOM   7337 C  C     A GLN A 1 507 ? 41.629 -17.092 -7.199  0.48 42.23  ? 1377 GLN A C     1 
ATOM   7338 C  C     B GLN A 1 507 ? 41.596 -16.960 -7.070  0.52 42.45  ? 1377 GLN A C     1 
ATOM   7339 O  O     A GLN A 1 507 ? 42.376 -16.372 -7.859  0.48 44.38  ? 1377 GLN A O     1 
ATOM   7340 O  O     B GLN A 1 507 ? 42.280 -16.021 -7.475  0.52 35.24  ? 1377 GLN A O     1 
ATOM   7341 C  CB    A GLN A 1 507 ? 39.407 -16.391 -6.375  0.48 43.76  ? 1377 GLN A CB    1 
ATOM   7342 C  CB    B GLN A 1 507 ? 39.209 -16.268 -6.754  0.52 44.78  ? 1377 GLN A CB    1 
ATOM   7343 C  CG    A GLN A 1 507 ? 37.891 -16.352 -6.484  0.48 41.53  ? 1377 GLN A CG    1 
ATOM   7344 C  CG    B GLN A 1 507 ? 37.847 -16.095 -7.399  0.52 43.57  ? 1377 GLN A CG    1 
ATOM   7345 C  CD    A GLN A 1 507 ? 37.276 -15.309 -5.562  0.48 32.73  ? 1377 GLN A CD    1 
ATOM   7346 C  CD    B GLN A 1 507 ? 37.374 -14.661 -7.365  0.52 38.90  ? 1377 GLN A CD    1 
ATOM   7347 O  OE1   A GLN A 1 507 ? 37.215 -15.493 -4.345  0.48 33.05  ? 1377 GLN A OE1   1 
ATOM   7348 O  OE1   B GLN A 1 507 ? 37.169 -14.085 -6.295  0.52 28.18  ? 1377 GLN A OE1   1 
ATOM   7349 N  NE2   A GLN A 1 507 ? 36.830 -14.202 -6.141  0.48 32.08  ? 1377 GLN A NE2   1 
ATOM   7350 N  NE2   B GLN A 1 507 ? 37.208 -14.069 -8.542  0.52 24.03  ? 1377 GLN A NE2   1 
ATOM   7351 H  H     A GLN A 1 507 ? 39.353 -18.825 -6.805  0.48 41.08  ? 1377 GLN A H     1 
ATOM   7352 H  H     B GLN A 1 507 ? 39.456 -18.815 -6.787  0.52 40.38  ? 1377 GLN A H     1 
ATOM   7353 H  HA    A GLN A 1 507 ? 39.961 -16.703 -8.341  0.48 45.81  ? 1377 GLN A HA    1 
ATOM   7354 H  HA    B GLN A 1 507 ? 40.133 -16.818 -8.494  0.52 44.49  ? 1377 GLN A HA    1 
ATOM   7355 H  HB2   A GLN A 1 507 ? 39.627 -16.807 -5.526  0.48 52.45  ? 1377 GLN A HB2   1 
ATOM   7356 H  HB2   B GLN A 1 507 ? 39.077 -16.675 -5.884  0.52 53.68  ? 1377 GLN A HB2   1 
ATOM   7357 H  HB3   A GLN A 1 507 ? 39.722 -15.474 -6.376  0.48 52.45  ? 1377 GLN A HB3   1 
ATOM   7358 H  HB3   B GLN A 1 507 ? 39.603 -15.387 -6.649  0.52 53.68  ? 1377 GLN A HB3   1 
ATOM   7359 H  HG2   A GLN A 1 507 ? 37.644 -16.132 -7.396  0.48 49.78  ? 1377 GLN A HG2   1 
ATOM   7360 H  HG2   B GLN A 1 507 ? 37.897 -16.373 -8.327  0.52 52.23  ? 1377 GLN A HG2   1 
ATOM   7361 H  HG3   A GLN A 1 507 ? 37.533 -17.219 -6.240  0.48 49.78  ? 1377 GLN A HG3   1 
ATOM   7362 H  HG3   B GLN A 1 507 ? 37.199 -16.637 -6.923  0.52 52.23  ? 1377 GLN A HG3   1 
ATOM   7363 H  HE21  A GLN A 1 507 ? 36.473 -13.582 -5.664  0.48 38.43  ? 1377 GLN A HE21  1 
ATOM   7364 H  HE21  B GLN A 1 507 ? 36.940 -13.252 -8.578  0.52 28.79  ? 1377 GLN A HE21  1 
ATOM   7365 H  HE22  A GLN A 1 507 ? 36.898 -14.104 -6.992  0.48 38.43  ? 1377 GLN A HE22  1 
ATOM   7366 H  HE22  B GLN A 1 507 ? 37.369 -14.501 -9.267  0.52 28.79  ? 1377 GLN A HE22  1 
ATOM   7367 N  N     . TYR A 1 508 ? 42.050 -17.852 -6.194  1.00 35.76  ? 1378 TYR A N     1 
ATOM   7368 C  CA    . TYR A 1 508 ? 43.412 -17.777 -5.675  1.00 33.22  ? 1378 TYR A CA    1 
ATOM   7369 C  C     . TYR A 1 508 ? 44.183 -19.060 -5.947  1.00 39.61  ? 1378 TYR A C     1 
ATOM   7370 O  O     . TYR A 1 508 ? 43.623 -20.151 -5.885  1.00 38.92  ? 1378 TYR A O     1 
ATOM   7371 C  CB    . TYR A 1 508 ? 43.392 -17.534 -4.160  1.00 34.61  ? 1378 TYR A CB    1 
ATOM   7372 C  CG    . TYR A 1 508 ? 42.736 -16.241 -3.725  1.00 29.21  ? 1378 TYR A CG    1 
ATOM   7373 C  CD1   . TYR A 1 508 ? 43.455 -15.052 -3.688  1.00 34.35  ? 1378 TYR A CD1   1 
ATOM   7374 C  CD2   . TYR A 1 508 ? 41.404 -16.214 -3.331  1.00 36.02  ? 1378 TYR A CD2   1 
ATOM   7375 C  CE1   . TYR A 1 508 ? 42.864 -13.868 -3.284  1.00 42.80  ? 1378 TYR A CE1   1 
ATOM   7376 C  CE2   . TYR A 1 508 ? 40.802 -15.034 -2.924  1.00 44.54  ? 1378 TYR A CE2   1 
ATOM   7377 C  CZ    . TYR A 1 508 ? 41.537 -13.865 -2.903  1.00 33.64  ? 1378 TYR A CZ    1 
ATOM   7378 O  OH    . TYR A 1 508 ? 40.946 -12.692 -2.499  1.00 47.38  ? 1378 TYR A OH    1 
ATOM   7379 H  H     A TYR A 1 508 ? 41.557 -18.429 -5.789  0.50 42.85  ? 1378 TYR A H     1 
ATOM   7380 H  H     B TYR A 1 508 ? 41.590 -18.509 -5.885  0.50 42.85  ? 1378 TYR A H     1 
ATOM   7381 H  HA    . TYR A 1 508 ? 43.885 -17.033 -6.103  1.00 39.81  ? 1378 TYR A HA    1 
ATOM   7382 H  HB2   . TYR A 1 508 ? 42.911 -18.262 -3.737  1.00 41.48  ? 1378 TYR A HB2   1 
ATOM   7383 H  HB3   . TYR A 1 508 ? 44.308 -17.519 -3.838  1.00 41.48  ? 1378 TYR A HB3   1 
ATOM   7384 H  HD1   . TYR A 1 508 ? 44.349 -15.051 -3.945  1.00 41.16  ? 1378 TYR A HD1   1 
ATOM   7385 H  HD2   . TYR A 1 508 ? 40.907 -17.000 -3.346  1.00 43.17  ? 1378 TYR A HD2   1 
ATOM   7386 H  HE1   . TYR A 1 508 ? 43.357 -13.080 -3.268  1.00 51.30  ? 1378 TYR A HE1   1 
ATOM   7387 H  HE2   . TYR A 1 508 ? 39.908 -15.029 -2.667  1.00 53.39  ? 1378 TYR A HE2   1 
ATOM   7388 H  HH    . TYR A 1 508 ? 40.673 -12.766 -1.729  1.00 56.79  ? 1378 TYR A HH    1 
ATOM   7389 N  N     . LYS A 1 509 ? 45.469 -18.924 -6.252  1.00 36.11  ? 1379 LYS A N     1 
ATOM   7390 C  CA    . LYS A 1 509 ? 46.365 -20.071 -6.311  1.00 40.93  ? 1379 LYS A CA    1 
ATOM   7391 C  C     . LYS A 1 509 ? 46.571 -20.591 -4.897  1.00 33.64  ? 1379 LYS A C     1 
ATOM   7392 O  O     . LYS A 1 509 ? 46.787 -19.813 -3.973  1.00 35.88  ? 1379 LYS A O     1 
ATOM   7393 C  CB    . LYS A 1 509 ? 47.713 -19.677 -6.919  1.00 44.80  ? 1379 LYS A CB    1 
ATOM   7394 C  CG    . LYS A 1 509 ? 47.690 -19.460 -8.424  1.00 67.33  ? 1379 LYS A CG    1 
ATOM   7395 C  CD    . LYS A 1 509 ? 47.175 -20.689 -9.155  1.00 67.77  ? 1379 LYS A CD    1 
ATOM   7396 C  CE    . LYS A 1 509 ? 47.619 -20.704 -10.611 1.00 79.22  ? 1379 LYS A CE    1 
ATOM   7397 N  NZ    . LYS A 1 509 ? 47.271 -19.447 -11.330 1.00 71.25  ? 1379 LYS A NZ    1 
ATOM   7398 H  H     . LYS A 1 509 ? 45.849 -18.173 -6.429  1.00 43.27  ? 1379 LYS A H     1 
ATOM   7399 H  HA    . LYS A 1 509 ? 45.965 -20.781 -6.857  1.00 49.05  ? 1379 LYS A HA    1 
ATOM   7400 H  HB2   . LYS A 1 509 ? 48.007 -18.849 -6.507  1.00 53.70  ? 1379 LYS A HB2   1 
ATOM   7401 H  HB3   . LYS A 1 509 ? 48.354 -20.380 -6.733  1.00 53.70  ? 1379 LYS A HB3   1 
ATOM   7402 H  HG2   . LYS A 1 509 ? 47.105 -18.715 -8.632  1.00 80.74  ? 1379 LYS A HG2   1 
ATOM   7403 H  HG3   . LYS A 1 509 ? 48.591 -19.276 -8.735  1.00 80.74  ? 1379 LYS A HG3   1 
ATOM   7404 H  HD2   . LYS A 1 509 ? 47.522 -21.486 -8.725  1.00 81.27  ? 1379 LYS A HD2   1 
ATOM   7405 H  HD3   . LYS A 1 509 ? 46.206 -20.692 -9.134  1.00 81.27  ? 1379 LYS A HD3   1 
ATOM   7406 H  HE2   . LYS A 1 509 ? 48.582 -20.814 -10.647 1.00 95.01  ? 1379 LYS A HE2   1 
ATOM   7407 H  HE3   . LYS A 1 509 ? 47.183 -21.441 -11.067 1.00 95.01  ? 1379 LYS A HE3   1 
ATOM   7408 H  HZ1   . LYS A 1 509 ? 47.665 -18.753 -10.936 1.00 85.44  ? 1379 LYS A HZ1   1 
ATOM   7409 H  HZ2   . LYS A 1 509 ? 47.546 -19.495 -12.175 1.00 85.44  ? 1379 LYS A HZ2   1 
ATOM   7410 H  HZ3   . LYS A 1 509 ? 46.390 -19.325 -11.319 1.00 85.44  ? 1379 LYS A HZ3   1 
ATOM   7411 N  N     . MET A 1 510 ? 46.496 -21.904 -4.723  1.00 36.88  ? 1380 MET A N     1 
ATOM   7412 C  CA    . MET A 1 510 ? 46.694 -22.498 -3.409  1.00 40.53  ? 1380 MET A CA    1 
ATOM   7413 C  C     . MET A 1 510 ? 48.102 -22.192 -2.912  1.00 40.74  ? 1380 MET A C     1 
ATOM   7414 O  O     . MET A 1 510 ? 48.310 -21.964 -1.725  1.00 41.45  ? 1380 MET A O     1 
ATOM   7415 C  CB    . MET A 1 510 ? 46.461 -24.008 -3.465  1.00 34.65  ? 1380 MET A CB    1 
ATOM   7416 C  CG    . MET A 1 510 ? 46.502 -24.696 -2.111  1.00 40.35  ? 1380 MET A CG    1 
ATOM   7417 S  SD    . MET A 1 510 ? 45.487 -23.886 -0.853  1.00 47.73  ? 1380 MET A SD    1 
ATOM   7418 C  CE    . MET A 1 510 ? 43.860 -23.997 -1.591  1.00 35.26  ? 1380 MET A CE    1 
ATOM   7419 H  H     . MET A 1 510 ? 46.332 -22.471 -5.348  1.00 44.20  ? 1380 MET A H     1 
ATOM   7420 H  HA    . MET A 1 510 ? 46.044 -22.114 -2.784  1.00 48.59  ? 1380 MET A HA    1 
ATOM   7421 H  HB2   . MET A 1 510 ? 45.588 -24.174 -3.854  1.00 41.52  ? 1380 MET A HB2   1 
ATOM   7422 H  HB3   . MET A 1 510 ? 47.148 -24.408 -4.020  1.00 41.52  ? 1380 MET A HB3   1 
ATOM   7423 H  HG2   . MET A 1 510 ? 46.180 -25.605 -2.213  1.00 48.36  ? 1380 MET A HG2   1 
ATOM   7424 H  HG3   . MET A 1 510 ? 47.418 -24.705 -1.793  1.00 48.36  ? 1380 MET A HG3   1 
ATOM   7425 H  HE1   . MET A 1 510 ? 43.221 -23.591 -1.000  1.00 42.26  ? 1380 MET A HE1   1 
ATOM   7426 H  HE2   . MET A 1 510 ? 43.867 -23.537 -2.433  1.00 42.26  ? 1380 MET A HE2   1 
ATOM   7427 H  HE3   . MET A 1 510 ? 43.641 -24.922 -1.724  1.00 42.26  ? 1380 MET A HE3   1 
ATOM   7428 N  N     . GLU A 1 511 ? 49.065 -22.183 -3.830  1.00 32.68  ? 1381 GLU A N     1 
ATOM   7429 C  CA    . GLU A 1 511 ? 50.445 -21.850 -3.495  1.00 40.36  ? 1381 GLU A CA    1 
ATOM   7430 C  C     . GLU A 1 511 ? 50.507 -20.456 -2.887  1.00 43.60  ? 1381 GLU A C     1 
ATOM   7431 O  O     . GLU A 1 511 ? 51.292 -20.196 -1.977  1.00 38.33  ? 1381 GLU A O     1 
ATOM   7432 C  CB    . GLU A 1 511 ? 51.333 -21.893 -4.743  1.00 49.64  ? 1381 GLU A CB    1 
ATOM   7433 C  CG    . GLU A 1 511 ? 51.228 -23.175 -5.560  1.00 71.88  ? 1381 GLU A CG    1 
ATOM   7434 C  CD    . GLU A 1 511 ? 50.163 -23.098 -6.641  1.00 80.42  ? 1381 GLU A CD    1 
ATOM   7435 O  OE1   . GLU A 1 511 ? 49.098 -23.733 -6.479  1.00 51.93  ? 1381 GLU A OE1   1 
ATOM   7436 O  OE2   . GLU A 1 511 ? 50.393 -22.407 -7.657  1.00 90.76  ? 1381 GLU A OE2   1 
ATOM   7437 H  H     . GLU A 1 511 ? 48.942 -22.368 -4.661  1.00 39.16  ? 1381 GLU A H     1 
ATOM   7438 H  HA    . GLU A 1 511 ? 50.791 -22.493 -2.841  1.00 48.38  ? 1381 GLU A HA    1 
ATOM   7439 H  HB2   . GLU A 1 511 ? 51.088 -21.155 -5.322  1.00 59.51  ? 1381 GLU A HB2   1 
ATOM   7440 H  HB3   . GLU A 1 511 ? 52.258 -21.797 -4.467  1.00 59.51  ? 1381 GLU A HB3   1 
ATOM   7441 H  HG2   . GLU A 1 511 ? 52.081 -23.346 -5.990  1.00 86.20  ? 1381 GLU A HG2   1 
ATOM   7442 H  HG3   . GLU A 1 511 ? 51.002 -23.910 -4.968  1.00 86.20  ? 1381 GLU A HG3   1 
ATOM   7443 N  N     . ASP A 1 512 ? 49.673 -19.563 -3.413  1.00 38.65  ? 1382 ASP A N     1 
ATOM   7444 C  CA    . ASP A 1 512 ? 49.610 -18.179 -2.962  1.00 37.53  ? 1382 ASP A CA    1 
ATOM   7445 C  C     . ASP A 1 512 ? 49.078 -18.091 -1.531  1.00 34.57  ? 1382 ASP A C     1 
ATOM   7446 O  O     . ASP A 1 512 ? 49.663 -17.419 -0.682  1.00 30.79  ? 1382 ASP A O     1 
ATOM   7447 C  CB    . ASP A 1 512 ? 48.726 -17.374 -3.923  1.00 46.68  ? 1382 ASP A CB    1 
ATOM   7448 C  CG    . ASP A 1 512 ? 48.528 -15.939 -3.481  1.00 50.29  ? 1382 ASP A CG    1 
ATOM   7449 O  OD1   . ASP A 1 512 ? 49.383 -15.412 -2.739  1.00 44.72  ? 1382 ASP A OD1   1 
ATOM   7450 O  OD2   . ASP A 1 512 ? 47.513 -15.333 -3.888  1.00 46.51  ? 1382 ASP A OD2   1 
ATOM   7451 H  H     . ASP A 1 512 ? 49.121 -19.742 -4.048  1.00 46.32  ? 1382 ASP A H     1 
ATOM   7452 H  HA    . ASP A 1 512 ? 50.510 -17.793 -2.978  1.00 44.98  ? 1382 ASP A HA    1 
ATOM   7453 H  HB2   . ASP A 1 512 ? 49.142 -17.362 -4.799  1.00 55.96  ? 1382 ASP A HB2   1 
ATOM   7454 H  HB3   . ASP A 1 512 ? 47.853 -17.794 -3.976  1.00 55.96  ? 1382 ASP A HB3   1 
ATOM   7455 N  N     . LEU A 1 513 ? 47.974 -18.780 -1.264  1.00 35.40  ? 1383 LEU A N     1 
ATOM   7456 C  CA    . LEU A 1 513 ? 47.391 -18.797 0.073   1.00 31.95  ? 1383 LEU A CA    1 
ATOM   7457 C  C     . LEU A 1 513 ? 48.351 -19.429 1.075   1.00 30.26  ? 1383 LEU A C     1 
ATOM   7458 O  O     . LEU A 1 513 ? 48.451 -18.989 2.219   1.00 26.25  ? 1383 LEU A O     1 
ATOM   7459 C  CB    . LEU A 1 513 ? 46.073 -19.570 0.066   1.00 38.85  ? 1383 LEU A CB    1 
ATOM   7460 C  CG    . LEU A 1 513 ? 44.962 -18.965 -0.790  1.00 34.77  ? 1383 LEU A CG    1 
ATOM   7461 C  CD1   . LEU A 1 513 ? 43.724 -19.847 -0.748  1.00 35.49  ? 1383 LEU A CD1   1 
ATOM   7462 C  CD2   . LEU A 1 513 ? 44.639 -17.555 -0.324  1.00 32.55  ? 1383 LEU A CD2   1 
ATOM   7463 H  H     . LEU A 1 513 ? 47.541 -19.247 -1.842  1.00 42.42  ? 1383 LEU A H     1 
ATOM   7464 H  HA    . LEU A 1 513 ? 47.208 -17.878 0.359   1.00 38.29  ? 1383 LEU A HA    1 
ATOM   7465 H  HB2   . LEU A 1 513 ? 46.244 -20.465 -0.268  1.00 46.57  ? 1383 LEU A HB2   1 
ATOM   7466 H  HB3   . LEU A 1 513 ? 45.743 -19.623 0.977   1.00 46.57  ? 1383 LEU A HB3   1 
ATOM   7467 H  HG    . LEU A 1 513 ? 45.264 -18.915 -1.710  1.00 41.67  ? 1383 LEU A HG    1 
ATOM   7468 H  HD11  . LEU A 1 513 ? 43.040 -19.450 -1.291  1.00 42.54  ? 1383 LEU A HD11  1 
ATOM   7469 H  HD12  . LEU A 1 513 ? 43.949 -20.716 -1.088  1.00 42.54  ? 1383 LEU A HD12  1 
ATOM   7470 H  HD13  . LEU A 1 513 ? 43.422 -19.918 0.160   1.00 42.54  ? 1383 LEU A HD13  1 
ATOM   7471 H  HD21  . LEU A 1 513 ? 43.939 -17.196 -0.876  1.00 39.01  ? 1383 LEU A HD21  1 
ATOM   7472 H  HD22  . LEU A 1 513 ? 44.350 -17.586 0.591   1.00 39.01  ? 1383 LEU A HD22  1 
ATOM   7473 H  HD23  . LEU A 1 513 ? 45.427 -17.012 -0.401  1.00 39.01  ? 1383 LEU A HD23  1 
ATOM   7474 N  N     . MET A 1 514 ? 49.061 -20.461 0.633   1.00 29.21  ? 1384 MET A N     1 
ATOM   7475 C  CA    . MET A 1 514 ? 49.985 -21.184 1.494   1.00 32.96  ? 1384 MET A CA    1 
ATOM   7476 C  C     . MET A 1 514 ? 51.140 -20.283 1.905   1.00 32.92  ? 1384 MET A C     1 
ATOM   7477 O  O     . MET A 1 514 ? 51.580 -20.316 3.053   1.00 30.07  ? 1384 MET A O     1 
ATOM   7478 C  CB    . MET A 1 514 ? 50.505 -22.429 0.774   1.00 32.67  ? 1384 MET A CB    1 
ATOM   7479 C  CG    . MET A 1 514 ? 49.530 -23.593 0.804   1.00 30.08  ? 1384 MET A CG    1 
ATOM   7480 S  SD    . MET A 1 514 ? 49.889 -24.871 -0.414  1.00 46.82  ? 1384 MET A SD    1 
ATOM   7481 C  CE    . MET A 1 514 ? 51.676 -24.783 -0.505  1.00 68.44  ? 1384 MET A CE    1 
ATOM   7482 H  H     . MET A 1 514 ? 49.024 -20.764 -0.171  1.00 35.00  ? 1384 MET A H     1 
ATOM   7483 H  HA    . MET A 1 514 ? 49.508 -21.477 2.298   1.00 39.50  ? 1384 MET A HA    1 
ATOM   7484 H  HB2   . MET A 1 514 ? 50.676 -22.207 -0.154  1.00 39.15  ? 1384 MET A HB2   1 
ATOM   7485 H  HB3   . MET A 1 514 ? 51.327 -22.718 1.201   1.00 39.15  ? 1384 MET A HB3   1 
ATOM   7486 H  HG2   . MET A 1 514 ? 49.560 -24.003 1.682   1.00 36.04  ? 1384 MET A HG2   1 
ATOM   7487 H  HG3   . MET A 1 514 ? 48.637 -23.257 0.627   1.00 36.04  ? 1384 MET A HG3   1 
ATOM   7488 H  HE1   . MET A 1 514 ? 51.988 -25.434 -1.137  1.00 82.07  ? 1384 MET A HE1   1 
ATOM   7489 H  HE2   . MET A 1 514 ? 51.931 -23.902 -0.788  1.00 82.07  ? 1384 MET A HE2   1 
ATOM   7490 H  HE3   . MET A 1 514 ? 52.041 -24.967 0.364   1.00 82.07  ? 1384 MET A HE3   1 
ATOM   7491 N  N     . GLN A 1 515 ? 51.612 -19.465 0.969   1.00 30.86  ? 1385 GLN A N     1 
ATOM   7492 C  CA    . GLN A 1 515 ? 52.704 -18.538 1.242   1.00 29.28  ? 1385 GLN A CA    1 
ATOM   7493 C  C     . GLN A 1 515 ? 52.268 -17.428 2.198   1.00 29.92  ? 1385 GLN A C     1 
ATOM   7494 O  O     . GLN A 1 515 ? 52.989 -17.103 3.138   1.00 33.37  ? 1385 GLN A O     1 
ATOM   7495 C  CB    . GLN A 1 515 ? 53.246 -17.938 -0.059  1.00 32.57  ? 1385 GLN A CB    1 
ATOM   7496 C  CG    . GLN A 1 515 ? 54.121 -18.894 -0.863  1.00 47.95  ? 1385 GLN A CG    1 
ATOM   7497 C  CD    . GLN A 1 515 ? 54.528 -18.332 -2.216  1.00 68.14  ? 1385 GLN A CD    1 
ATOM   7498 O  OE1   . GLN A 1 515 ? 53.858 -17.460 -2.770  1.00 49.99  ? 1385 GLN A OE1   1 
ATOM   7499 N  NE2   . GLN A 1 515 ? 55.633 -18.834 -2.753  1.00 67.01  ? 1385 GLN A NE2   1 
ATOM   7500 H  H     . GLN A 1 515 ? 51.315 -19.427 0.163   1.00 36.98  ? 1385 GLN A H     1 
ATOM   7501 H  HA    . GLN A 1 515 ? 53.435 -19.031 1.671   1.00 35.08  ? 1385 GLN A HA    1 
ATOM   7502 H  HB2   . GLN A 1 515 ? 52.497 -17.680 -0.619  1.00 39.03  ? 1385 GLN A HB2   1 
ATOM   7503 H  HB3   . GLN A 1 515 ? 53.780 -17.157 0.156   1.00 39.03  ? 1385 GLN A HB3   1 
ATOM   7504 H  HG2   . GLN A 1 515 ? 54.929 -19.079 -0.360  1.00 57.48  ? 1385 GLN A HG2   1 
ATOM   7505 H  HG3   . GLN A 1 515 ? 53.630 -19.716 -1.016  1.00 57.48  ? 1385 GLN A HG3   1 
ATOM   7506 H  HE21  . GLN A 1 515 ? 55.906 -18.550 -3.518  1.00 80.35  ? 1385 GLN A HE21  1 
ATOM   7507 H  HE22  . GLN A 1 515 ? 56.075 -19.443 -2.337  1.00 80.35  ? 1385 GLN A HE22  1 
ATOM   7508 N  N     . VAL A 1 516 ? 51.092 -16.849 1.963   1.00 32.36  ? 1386 VAL A N     1 
ATOM   7509 C  CA    . VAL A 1 516 ? 50.593 -15.787 2.832   1.00 26.53  ? 1386 VAL A CA    1 
ATOM   7510 C  C     . VAL A 1 516 ? 50.482 -16.316 4.256   1.00 33.08  ? 1386 VAL A C     1 
ATOM   7511 O  O     . VAL A 1 516 ? 50.846 -15.633 5.213   1.00 31.47  ? 1386 VAL A O     1 
ATOM   7512 C  CB    . VAL A 1 516 ? 49.214 -15.262 2.384   1.00 28.12  ? 1386 VAL A CB    1 
ATOM   7513 C  CG1   . VAL A 1 516 ? 48.628 -14.321 3.442   1.00 25.39  ? 1386 VAL A CG1   1 
ATOM   7514 C  CG2   . VAL A 1 516 ? 49.324 -14.560 1.038   1.00 25.32  ? 1386 VAL A CG2   1 
ATOM   7515 H  H     . VAL A 1 516 ? 50.569 -17.050 1.311   1.00 38.77  ? 1386 VAL A H     1 
ATOM   7516 H  HA    . VAL A 1 516 ? 51.225 -15.038 2.828   1.00 31.78  ? 1386 VAL A HA    1 
ATOM   7517 H  HB    . VAL A 1 516 ? 48.602 -16.021 2.282   1.00 33.69  ? 1386 VAL A HB    1 
ATOM   7518 H  HG11  . VAL A 1 516 ? 47.772 -14.008 3.142   1.00 30.41  ? 1386 VAL A HG11  1 
ATOM   7519 H  HG12  . VAL A 1 516 ? 48.530 -14.802 4.268   1.00 30.41  ? 1386 VAL A HG12  1 
ATOM   7520 H  HG13  . VAL A 1 516 ? 49.224 -13.579 3.564   1.00 30.41  ? 1386 VAL A HG13  1 
ATOM   7521 H  HG21  . VAL A 1 516 ? 48.455 -14.242 0.780   1.00 30.32  ? 1386 VAL A HG21  1 
ATOM   7522 H  HG22  . VAL A 1 516 ? 49.932 -13.821 1.119   1.00 30.32  ? 1386 VAL A HG22  1 
ATOM   7523 H  HG23  . VAL A 1 516 ? 49.651 -15.184 0.386   1.00 30.32  ? 1386 VAL A HG23  1 
ATOM   7524 N  N     . TYR A 1 517 ? 49.989 -17.544 4.383   1.00 25.37  ? 1387 TYR A N     1 
ATOM   7525 C  CA    . TYR A 1 517 ? 49.806 -18.174 5.686   1.00 29.73  ? 1387 TYR A CA    1 
ATOM   7526 C  C     . TYR A 1 517 ? 51.146 -18.333 6.412   1.00 28.90  ? 1387 TYR A C     1 
ATOM   7527 O  O     . TYR A 1 517 ? 51.284 -17.933 7.567   1.00 29.98  ? 1387 TYR A O     1 
ATOM   7528 C  CB    . TYR A 1 517 ? 49.117 -19.533 5.517   1.00 26.21  ? 1387 TYR A CB    1 
ATOM   7529 C  CG    . TYR A 1 517 ? 49.022 -20.349 6.790   1.00 23.79  ? 1387 TYR A CG    1 
ATOM   7530 C  CD1   . TYR A 1 517 ? 47.961 -20.178 7.672   1.00 31.25  ? 1387 TYR A CD1   1 
ATOM   7531 C  CD2   . TYR A 1 517 ? 49.989 -21.295 7.105   1.00 34.35  ? 1387 TYR A CD2   1 
ATOM   7532 C  CE1   . TYR A 1 517 ? 47.871 -20.924 8.835   1.00 37.30  ? 1387 TYR A CE1   1 
ATOM   7533 C  CE2   . TYR A 1 517 ? 49.907 -22.043 8.266   1.00 31.52  ? 1387 TYR A CE2   1 
ATOM   7534 C  CZ    . TYR A 1 517 ? 48.845 -21.856 9.126   1.00 30.88  ? 1387 TYR A CZ    1 
ATOM   7535 O  OH    . TYR A 1 517 ? 48.760 -22.599 10.284  1.00 29.92  ? 1387 TYR A OH    1 
ATOM   7536 H  H     . TYR A 1 517 ? 49.751 -18.039 3.721   1.00 30.38  ? 1387 TYR A H     1 
ATOM   7537 H  HA    . TYR A 1 517 ? 49.228 -17.606 6.237   1.00 35.62  ? 1387 TYR A HA    1 
ATOM   7538 H  HB2   . TYR A 1 517 ? 48.214 -19.386 5.193   1.00 31.39  ? 1387 TYR A HB2   1 
ATOM   7539 H  HB3   . TYR A 1 517 ? 49.615 -20.056 4.869   1.00 31.39  ? 1387 TYR A HB3   1 
ATOM   7540 H  HD1   . TYR A 1 517 ? 47.303 -19.551 7.478   1.00 37.44  ? 1387 TYR A HD1   1 
ATOM   7541 H  HD2   . TYR A 1 517 ? 50.706 -21.424 6.528   1.00 41.17  ? 1387 TYR A HD2   1 
ATOM   7542 H  HE1   . TYR A 1 517 ? 47.156 -20.798 9.417   1.00 44.70  ? 1387 TYR A HE1   1 
ATOM   7543 H  HE2   . TYR A 1 517 ? 50.563 -22.672 8.464   1.00 37.77  ? 1387 TYR A HE2   1 
ATOM   7544 H  HH    . TYR A 1 517 ? 49.419 -22.465 10.753  1.00 35.85  ? 1387 TYR A HH    1 
ATOM   7545 N  N     . ASP A 1 518 ? 52.134 -18.900 5.726   1.00 32.15  ? 1388 ASP A N     1 
ATOM   7546 C  CA    . ASP A 1 518 ? 53.438 -19.164 6.332   1.00 32.23  ? 1388 ASP A CA    1 
ATOM   7547 C  C     . ASP A 1 518 ? 54.210 -17.882 6.633   1.00 37.13  ? 1388 ASP A C     1 
ATOM   7548 O  O     . ASP A 1 518 ? 55.031 -17.847 7.547   1.00 37.61  ? 1388 ASP A O     1 
ATOM   7549 C  CB    . ASP A 1 518 ? 54.284 -20.061 5.421   1.00 32.13  ? 1388 ASP A CB    1 
ATOM   7550 C  CG    . ASP A 1 518 ? 53.837 -21.511 5.445   1.00 46.30  ? 1388 ASP A CG    1 
ATOM   7551 O  OD1   . ASP A 1 518 ? 53.245 -21.938 6.457   1.00 38.88  ? 1388 ASP A OD1   1 
ATOM   7552 O  OD2   . ASP A 1 518 ? 54.088 -22.227 4.453   1.00 36.76  ? 1388 ASP A OD2   1 
ATOM   7553 H  H     . ASP A 1 518 ? 52.075 -19.144 4.903   1.00 38.52  ? 1388 ASP A H     1 
ATOM   7554 H  HA    . ASP A 1 518 ? 53.303 -19.639 7.179   1.00 38.62  ? 1388 ASP A HA    1 
ATOM   7555 H  HB2   . ASP A 1 518 ? 54.213 -19.741 4.508   1.00 38.50  ? 1388 ASP A HB2   1 
ATOM   7556 H  HB3   . ASP A 1 518 ? 55.208 -20.027 5.714   1.00 38.50  ? 1388 ASP A HB3   1 
ATOM   7557 N  N     . GLN A 1 519 ? 53.948 -16.828 5.868   1.00 31.32  ? 1389 GLN A N     1 
ATOM   7558 C  CA    . GLN A 1 519 ? 54.695 -15.583 6.015   1.00 34.50  ? 1389 GLN A CA    1 
ATOM   7559 C  C     . GLN A 1 519 ? 54.047 -14.656 7.038   1.00 38.08  ? 1389 GLN A C     1 
ATOM   7560 O  O     . GLN A 1 519 ? 54.610 -13.622 7.393   1.00 41.12  ? 1389 GLN A O     1 
ATOM   7561 C  CB    . GLN A 1 519 ? 54.829 -14.880 4.663   1.00 35.54  ? 1389 GLN A CB    1 
ATOM   7562 C  CG    . GLN A 1 519 ? 55.686 -15.649 3.665   1.00 38.37  ? 1389 GLN A CG    1 
ATOM   7563 C  CD    . GLN A 1 519 ? 55.636 -15.056 2.271   1.00 48.43  ? 1389 GLN A CD    1 
ATOM   7564 O  OE1   . GLN A 1 519 ? 55.066 -13.987 2.059   1.00 44.94  ? 1389 GLN A OE1   1 
ATOM   7565 N  NE2   . GLN A 1 519 ? 56.229 -15.752 1.309   1.00 53.51  ? 1389 GLN A NE2   1 
ATOM   7566 H  H     . GLN A 1 519 ? 53.344 -16.807 5.257   1.00 37.52  ? 1389 GLN A H     1 
ATOM   7567 H  HA    . GLN A 1 519 ? 55.598 -15.794 6.333   1.00 41.34  ? 1389 GLN A HA    1 
ATOM   7568 H  HB2   . GLN A 1 519 ? 53.946 -14.772 4.276   1.00 42.59  ? 1389 GLN A HB2   1 
ATOM   7569 H  HB3   . GLN A 1 519 ? 55.238 -14.012 4.800   1.00 42.59  ? 1389 GLN A HB3   1 
ATOM   7570 H  HG2   . GLN A 1 519 ? 56.608 -15.635 3.964   1.00 45.98  ? 1389 GLN A HG2   1 
ATOM   7571 H  HG3   . GLN A 1 519 ? 55.367 -16.563 3.613   1.00 45.98  ? 1389 GLN A HG3   1 
ATOM   7572 H  HE21  . GLN A 1 519 ? 56.227 -15.457 0.501   1.00 64.16  ? 1389 GLN A HE21  1 
ATOM   7573 H  HE22  . GLN A 1 519 ? 56.615 -16.498 1.494   1.00 64.16  ? 1389 GLN A HE22  1 
ATOM   7574 N  N     . PHE A 1 520 ? 52.865 -15.034 7.512   1.00 33.56  ? 1390 PHE A N     1 
ATOM   7575 C  CA    . PHE A 1 520 ? 52.187 -14.274 8.552   1.00 30.18  ? 1390 PHE A CA    1 
ATOM   7576 C  C     . PHE A 1 520 ? 52.696 -14.727 9.917   1.00 36.79  ? 1390 PHE A C     1 
ATOM   7577 O  O     . PHE A 1 520 ? 52.289 -15.771 10.429  1.00 33.99  ? 1390 PHE A O     1 
ATOM   7578 C  CB    . PHE A 1 520 ? 50.671 -14.462 8.452   1.00 30.10  ? 1390 PHE A CB    1 
ATOM   7579 C  CG    . PHE A 1 520 ? 49.889 -13.595 9.400   1.00 27.24  ? 1390 PHE A CG    1 
ATOM   7580 C  CD1   . PHE A 1 520 ? 49.895 -12.215 9.260   1.00 35.48  ? 1390 PHE A CD1   1 
ATOM   7581 C  CD2   . PHE A 1 520 ? 49.146 -14.158 10.424  1.00 35.88  ? 1390 PHE A CD2   1 
ATOM   7582 C  CE1   . PHE A 1 520 ? 49.178 -11.413 10.129  1.00 33.70  ? 1390 PHE A CE1   1 
ATOM   7583 C  CE2   . PHE A 1 520 ? 48.426 -13.359 11.298  1.00 32.11  ? 1390 PHE A CE2   1 
ATOM   7584 C  CZ    . PHE A 1 520 ? 48.442 -11.985 11.149  1.00 27.92  ? 1390 PHE A CZ    1 
ATOM   7585 H  H     . PHE A 1 520 ? 52.435 -15.729 7.247   1.00 40.21  ? 1390 PHE A H     1 
ATOM   7586 H  HA    . PHE A 1 520 ? 52.389 -13.322 8.446   1.00 36.16  ? 1390 PHE A HA    1 
ATOM   7587 H  HB2   . PHE A 1 520 ? 50.388 -14.245 7.550   1.00 36.06  ? 1390 PHE A HB2   1 
ATOM   7588 H  HB3   . PHE A 1 520 ? 50.456 -15.386 8.651   1.00 36.06  ? 1390 PHE A HB3   1 
ATOM   7589 H  HD1   . PHE A 1 520 ? 50.389 -11.824 8.576   1.00 42.52  ? 1390 PHE A HD1   1 
ATOM   7590 H  HD2   . PHE A 1 520 ? 49.133 -15.082 10.529  1.00 43.00  ? 1390 PHE A HD2   1 
ATOM   7591 H  HE1   . PHE A 1 520 ? 49.190 -10.489 10.026  1.00 40.38  ? 1390 PHE A HE1   1 
ATOM   7592 H  HE2   . PHE A 1 520 ? 47.931 -13.748 11.983  1.00 38.47  ? 1390 PHE A HE2   1 
ATOM   7593 H  HZ    . PHE A 1 520 ? 47.959 -11.447 11.734  1.00 33.45  ? 1390 PHE A HZ    1 
ATOM   7594 N  N     . THR A 1 521 ? 53.592 -13.935 10.496  1.00 35.02  ? 1391 THR A N     1 
ATOM   7595 C  CA    . THR A 1 521 ? 54.223 -14.276 11.765  1.00 42.83  ? 1391 THR A CA    1 
ATOM   7596 C  C     . THR A 1 521 ? 54.143 -13.100 12.730  1.00 41.57  ? 1391 THR A C     1 
ATOM   7597 O  O     . THR A 1 521 ? 54.054 -11.950 12.308  1.00 33.06  ? 1391 THR A O     1 
ATOM   7598 C  CB    . THR A 1 521 ? 55.704 -14.645 11.564  1.00 50.55  ? 1391 THR A CB    1 
ATOM   7599 O  OG1   . THR A 1 521 ? 56.365 -13.605 10.832  1.00 45.57  ? 1391 THR A OG1   1 
ATOM   7600 C  CG2   . THR A 1 521 ? 55.833 -15.949 10.799  1.00 44.90  ? 1391 THR A CG2   1 
ATOM   7601 H  H     . THR A 1 521 ? 53.854 -13.185 10.169  1.00 41.97  ? 1391 THR A H     1 
ATOM   7602 H  HA    . THR A 1 521 ? 53.762 -15.041 12.166  1.00 51.34  ? 1391 THR A HA    1 
ATOM   7603 H  HB    . THR A 1 521 ? 56.131 -14.752 12.429  1.00 60.60  ? 1391 THR A HB    1 
ATOM   7604 H  HG1   . THR A 1 521 ? 56.010 -13.509 10.099  1.00 54.63  ? 1391 THR A HG1   1 
ATOM   7605 H  HG21  . THR A 1 521 ? 56.760 -16.169 10.680  1.00 53.82  ? 1391 THR A HG21  1 
ATOM   7606 H  HG22  . THR A 1 521 ? 55.404 -16.657 11.284  1.00 53.82  ? 1391 THR A HG22  1 
ATOM   7607 H  HG23  . THR A 1 521 ? 55.419 -15.865 9.937   1.00 53.82  ? 1391 THR A HG23  1 
ATOM   7608 N  N     . LEU A 1 522 ? 54.177 -13.396 14.026  1.00 38.53  ? 1392 LEU A N     1 
ATOM   7609 C  CA    . LEU A 1 522 ? 54.161 -12.356 15.047  1.00 53.58  ? 1392 LEU A CA    1 
ATOM   7610 C  C     . LEU A 1 522 ? 55.295 -11.368 14.803  1.00 45.89  ? 1392 LEU A C     1 
ATOM   7611 O  O     . LEU A 1 522 ? 56.460 -11.755 14.726  1.00 43.21  ? 1392 LEU A O     1 
ATOM   7612 C  CB    . LEU A 1 522 ? 54.294 -12.976 16.441  1.00 46.54  ? 1392 LEU A CB    1 
ATOM   7613 C  CG    . LEU A 1 522 ? 54.094 -12.034 17.631  1.00 53.14  ? 1392 LEU A CG    1 
ATOM   7614 C  CD1   . LEU A 1 522 ? 52.722 -11.378 17.582  1.00 37.38  ? 1392 LEU A CD1   1 
ATOM   7615 C  CD2   . LEU A 1 522 ? 54.278 -12.785 18.941  1.00 59.25  ? 1392 LEU A CD2   1 
ATOM   7616 H  H     . LEU A 1 522 ? 54.209 -14.196 14.340  1.00 46.17  ? 1392 LEU A H     1 
ATOM   7617 H  HA    . LEU A 1 522 ? 53.311 -11.870 15.004  1.00 64.24  ? 1392 LEU A HA    1 
ATOM   7618 H  HB2   . LEU A 1 522 ? 53.636 -13.684 16.521  1.00 55.79  ? 1392 LEU A HB2   1 
ATOM   7619 H  HB3   . LEU A 1 522 ? 55.183 -13.354 16.520  1.00 55.79  ? 1392 LEU A HB3   1 
ATOM   7620 H  HG    . LEU A 1 522 ? 54.762 -11.331 17.592  1.00 63.71  ? 1392 LEU A HG    1 
ATOM   7621 H  HD11  . LEU A 1 522 ? 52.628 -10.796 18.339  1.00 44.80  ? 1392 LEU A HD11  1 
ATOM   7622 H  HD12  . LEU A 1 522 ? 52.646 -10.874 16.769  1.00 44.80  ? 1392 LEU A HD12  1 
ATOM   7623 H  HD13  . LEU A 1 522 ? 52.049 -12.062 17.608  1.00 44.80  ? 1392 LEU A HD13  1 
ATOM   7624 H  HD21  . LEU A 1 522 ? 54.148 -12.175 19.671  1.00 71.05  ? 1392 LEU A HD21  1 
ATOM   7625 H  HD22  . LEU A 1 522 ? 53.633 -13.494 18.987  1.00 71.05  ? 1392 LEU A HD22  1 
ATOM   7626 H  HD23  . LEU A 1 522 ? 55.166 -13.148 18.971  1.00 71.05  ? 1392 LEU A HD23  1 
ATOM   7627 N  N     . ALA A 1 523 ? 54.941 -10.094 14.674  1.00 50.31  ? 1393 ALA A N     1 
ATOM   7628 C  CA    . ALA A 1 523 ? 55.909 -9.042  14.393  1.00 56.80  ? 1393 ALA A CA    1 
ATOM   7629 C  C     . ALA A 1 523 ? 56.506 -8.518  15.694  1.00 60.61  ? 1393 ALA A C     1 
ATOM   7630 O  O     . ALA A 1 523 ? 55.836 -8.511  16.727  1.00 59.60  ? 1393 ALA A O     1 
ATOM   7631 C  CB    . ALA A 1 523 ? 55.244 -7.913  13.631  1.00 49.87  ? 1393 ALA A CB    1 
ATOM   7632 H  H     . ALA A 1 523 ? 54.133 -9.809  14.747  1.00 60.31  ? 1393 ALA A H     1 
ATOM   7633 H  HA    . ALA A 1 523 ? 56.635 -9.404  13.843  1.00 68.11  ? 1393 ALA A HA    1 
ATOM   7634 H  HB1   . ALA A 1 523 ? 55.895 -7.229  13.455  1.00 59.79  ? 1393 ALA A HB1   1 
ATOM   7635 H  HB2   . ALA A 1 523 ? 54.898 -8.256  12.804  1.00 59.79  ? 1393 ALA A HB2   1 
ATOM   7636 H  HB3   . ALA A 1 523 ? 54.530 -7.555  14.163  1.00 59.79  ? 1393 ALA A HB3   1 
ATOM   7637 N  N     . PRO A 1 524 ? 57.774 -8.081  15.650  1.00 63.67  ? 1394 PRO A N     1 
ATOM   7638 C  CA    . PRO A 1 524 ? 58.426 -7.497  16.828  1.00 74.70  ? 1394 PRO A CA    1 
ATOM   7639 C  C     . PRO A 1 524 ? 57.664 -6.281  17.355  1.00 72.39  ? 1394 PRO A C     1 
ATOM   7640 O  O     . PRO A 1 524 ? 57.090 -5.536  16.560  1.00 67.36  ? 1394 PRO A O     1 
ATOM   7641 C  CB    . PRO A 1 524 ? 59.797 -7.067  16.293  1.00 75.51  ? 1394 PRO A CB    1 
ATOM   7642 C  CG    . PRO A 1 524 ? 60.019 -7.891  15.075  1.00 75.46  ? 1394 PRO A CG    1 
ATOM   7643 C  CD    . PRO A 1 524 ? 58.668 -8.118  14.481  1.00 68.18  ? 1394 PRO A CD    1 
ATOM   7644 H  HA    . PRO A 1 524 ? 58.536 -8.163  17.539  1.00 89.59  ? 1394 PRO A HA    1 
ATOM   7645 H  HB2   . PRO A 1 524 ? 59.779 -6.123  16.070  1.00 90.56  ? 1394 PRO A HB2   1 
ATOM   7646 H  HB3   . PRO A 1 524 ? 60.479 -7.249  16.959  1.00 90.56  ? 1394 PRO A HB3   1 
ATOM   7647 H  HG2   . PRO A 1 524 ? 60.587 -7.407  14.454  1.00 90.49  ? 1394 PRO A HG2   1 
ATOM   7648 H  HG3   . PRO A 1 524 ? 60.428 -8.735  15.323  1.00 90.49  ? 1394 PRO A HG3   1 
ATOM   7649 H  HD2   . PRO A 1 524 ? 58.446 -7.404  13.862  1.00 81.76  ? 1394 PRO A HD2   1 
ATOM   7650 H  HD3   . PRO A 1 524 ? 58.628 -8.987  14.052  1.00 81.76  ? 1394 PRO A HD3   1 
ATOM   7651 N  N     . PRO A 1 525 ? 57.658 -6.078  18.682  1.00 60.51  ? 1395 PRO A N     1 
ATOM   7652 C  CA    . PRO A 1 525 ? 56.965 -4.922  19.266  1.00 62.49  ? 1395 PRO A CA    1 
ATOM   7653 C  C     . PRO A 1 525 ? 57.567 -3.593  18.816  1.00 65.63  ? 1395 PRO A C     1 
ATOM   7654 O  O     . PRO A 1 525 ? 58.497 -3.113  19.464  1.00 73.67  ? 1395 PRO A O     1 
ATOM   7655 C  CB    . PRO A 1 525 ? 57.163 -5.116  20.774  1.00 52.56  ? 1395 PRO A CB    1 
ATOM   7656 C  CG    . PRO A 1 525 ? 58.370 -5.991  20.896  1.00 60.48  ? 1395 PRO A CG    1 
ATOM   7657 C  CD    . PRO A 1 525 ? 58.319 -6.902  19.708  1.00 57.06  ? 1395 PRO A CD    1 
ATOM   7658 H  HA    . PRO A 1 525 ? 56.009 -4.945  19.052  1.00 74.94  ? 1395 PRO A HA    1 
ATOM   7659 H  HB2   . PRO A 1 525 ? 57.317 -4.257  21.197  1.00 63.01  ? 1395 PRO A HB2   1 
ATOM   7660 H  HB3   . PRO A 1 525 ? 56.384 -5.552  21.154  1.00 63.01  ? 1395 PRO A HB3   1 
ATOM   7661 H  HG2   . PRO A 1 525 ? 59.172 -5.445  20.875  1.00 72.52  ? 1395 PRO A HG2   1 
ATOM   7662 H  HG3   . PRO A 1 525 ? 58.323 -6.500  21.720  1.00 72.52  ? 1395 PRO A HG3   1 
ATOM   7663 H  HD2   . PRO A 1 525 ? 59.216 -7.141  19.425  1.00 68.41  ? 1395 PRO A HD2   1 
ATOM   7664 H  HD3   . PRO A 1 525 ? 57.787 -7.688  19.906  1.00 68.41  ? 1395 PRO A HD3   1 
HETATM 7665 C  C1    . OGA B 2 .   ? 25.736 5.938   13.609  1.00 33.58  ? 1501 OGA A C1    1 
HETATM 7666 C  C2    . OGA B 2 .   ? 24.234 5.968   13.480  1.00 26.98  ? 1501 OGA A C2    1 
HETATM 7667 C  C4    . OGA B 2 .   ? 22.153 7.208   12.977  1.00 32.90  ? 1501 OGA A C4    1 
HETATM 7668 C  C5    . OGA B 2 .   ? 21.718 8.626   12.788  1.00 30.70  ? 1501 OGA A C5    1 
HETATM 7669 O  O1    . OGA B 2 .   ? 26.400 6.956   13.274  1.00 26.26  ? 1501 OGA A O1    1 
HETATM 7670 O  O2    . OGA B 2 .   ? 26.330 4.921   14.049  1.00 26.76  ? 1501 OGA A O2    1 
HETATM 7671 O  "O2'" . OGA B 2 .   ? 23.546 4.975   13.699  1.00 24.42  ? 1501 OGA A "O2'" 1 
HETATM 7672 O  O3    . OGA B 2 .   ? 22.578 9.552   12.710  1.00 28.41  ? 1501 OGA A O3    1 
HETATM 7673 N  N1    . OGA B 2 .   ? 23.589 7.188   13.099  1.00 28.98  ? 1501 OGA A N1    1 
HETATM 7674 O  O4    . OGA B 2 .   ? 20.494 8.880   12.707  1.00 31.40  ? 1501 OGA A O4    1 
HETATM 7675 H  H4C1  . OGA B 2 .   ? 21.881 6.672   12.206  1.00 39.43  ? 1501 OGA A H4C1  1 
HETATM 7676 H  H4C2  . OGA B 2 .   ? 21.746 6.845   13.792  1.00 39.43  ? 1501 OGA A H4C2  1 
HETATM 7677 H  H1    . OGA B 2 .   ? 24.080 7.941   12.932  1.00 34.72  ? 1501 OGA A H1    1 
HETATM 7678 ZN ZN    . ZN  C 3 .   ? 24.479 -20.356 -0.326  1.00 36.26  ? 1502 ZN  A ZN    1 
HETATM 7679 NI NI    . NI  D 4 .   ? 24.897 3.203   13.952  1.00 27.04  ? 1503 NI  A NI    1 
HETATM 7680 NI NI    . NI  E 4 .   ? 36.263 -12.109 -12.710 1.00 76.62  ? 1504 NI  A NI    1 
HETATM 7681 NI NI    . NI  F 4 .   ? 45.229 20.202  2.710   1.00 105.75 ? 1505 NI  A NI    1 
HETATM 7682 CL CL    . CL  G 5 .   ? 10.974 -0.614  -1.161  1.00 69.41  ? 1506 CL  A CL    1 
HETATM 7683 C  C1    . EDO H 6 .   ? 46.560 1.794   4.271   1.00 58.58  ? 1507 EDO A C1    1 
HETATM 7684 O  O1    . EDO H 6 .   ? 45.603 2.762   3.822   1.00 66.01  ? 1507 EDO A O1    1 
HETATM 7685 C  C2    . EDO H 6 .   ? 45.959 0.393   4.212   1.00 41.49  ? 1507 EDO A C2    1 
HETATM 7686 O  O2    . EDO H 6 .   ? 46.170 -0.177  2.914   1.00 57.17  ? 1507 EDO A O2    1 
HETATM 7687 H  H11   . EDO H 6 .   ? 46.860 2.021   5.296   1.00 70.24  ? 1507 EDO A H11   1 
HETATM 7688 H  H12   . EDO H 6 .   ? 47.451 1.838   3.640   1.00 70.24  ? 1507 EDO A H12   1 
HETATM 7689 H  HO1   . EDO H 6 .   ? 45.995 3.645   3.864   1.00 79.15  ? 1507 EDO A HO1   1 
HETATM 7690 H  H21   . EDO H 6 .   ? 46.424 -0.239  4.971   1.00 49.73  ? 1507 EDO A H21   1 
HETATM 7691 H  H22   . EDO H 6 .   ? 44.889 0.444   4.421   1.00 49.73  ? 1507 EDO A H22   1 
HETATM 7692 H  HO2   . EDO H 6 .   ? 45.786 -1.065  2.886   1.00 68.54  ? 1507 EDO A HO2   1 
HETATM 7693 C  C1    . EDO I 6 .   ? 35.563 -16.804 10.010  1.00 48.58  ? 1508 EDO A C1    1 
HETATM 7694 O  O1    . EDO I 6 .   ? 35.553 -17.226 11.377  1.00 56.00  ? 1508 EDO A O1    1 
HETATM 7695 C  C2    . EDO I 6 .   ? 36.970 -16.347 9.656   1.00 57.89  ? 1508 EDO A C2    1 
HETATM 7696 O  O2    . EDO I 6 .   ? 37.071 -14.938 9.897   1.00 62.85  ? 1508 EDO A O2    1 
HETATM 7697 H  H11   . EDO I 6 .   ? 34.856 -15.984 9.867   1.00 58.24  ? 1508 EDO A H11   1 
HETATM 7698 H  H12   . EDO I 6 .   ? 35.265 -17.632 9.362   1.00 58.24  ? 1508 EDO A H12   1 
HETATM 7699 H  HO1   . EDO I 6 .   ? 34.664 -17.520 11.617  1.00 67.14  ? 1508 EDO A HO1   1 
HETATM 7700 H  H21   . EDO I 6 .   ? 37.700 -16.882 10.266  1.00 69.41  ? 1508 EDO A H21   1 
HETATM 7701 H  H22   . EDO I 6 .   ? 37.177 -16.560 8.605   1.00 69.41  ? 1508 EDO A H22   1 
HETATM 7702 H  HO2   . EDO I 6 .   ? 37.962 -14.636 9.675   1.00 75.36  ? 1508 EDO A HO2   1 
HETATM 7703 C  C1    . EDO J 6 .   ? 31.751 -14.750 43.780  1.00 77.84  ? 1509 EDO A C1    1 
HETATM 7704 O  O1    . EDO J 6 .   ? 32.241 -13.410 43.650  1.00 73.36  ? 1509 EDO A O1    1 
HETATM 7705 C  C2    . EDO J 6 .   ? 30.708 -15.016 42.702  1.00 69.92  ? 1509 EDO A C2    1 
HETATM 7706 O  O2    . EDO J 6 .   ? 30.577 -13.856 41.872  1.00 52.17  ? 1509 EDO A O2    1 
HETATM 7707 H  H11   . EDO J 6 .   ? 32.577 -15.457 43.677  1.00 93.35  ? 1509 EDO A H11   1 
HETATM 7708 H  H12   . EDO J 6 .   ? 31.306 -14.886 44.767  1.00 93.35  ? 1509 EDO A H12   1 
HETATM 7709 H  HO1   . EDO J 6 .   ? 32.903 -13.241 44.334  1.00 87.98  ? 1509 EDO A HO1   1 
HETATM 7710 H  H21   . EDO J 6 .   ? 31.011 -15.872 42.096  1.00 83.85  ? 1509 EDO A H21   1 
HETATM 7711 H  H22   . EDO J 6 .   ? 29.747 -15.249 43.166  1.00 83.85  ? 1509 EDO A H22   1 
HETATM 7712 H  HO2   . EDO J 6 .   ? 29.915 -14.023 41.187  1.00 62.54  ? 1509 EDO A HO2   1 
HETATM 7713 C  C1    . EDO K 6 .   ? 10.914 14.657  -0.633  1.00 61.36  ? 1510 EDO A C1    1 
HETATM 7714 O  O1    . EDO K 6 .   ? 11.928 14.854  -1.619  1.00 58.30  ? 1510 EDO A O1    1 
HETATM 7715 C  C2    . EDO K 6 .   ? 10.783 13.171  -0.327  1.00 56.11  ? 1510 EDO A C2    1 
HETATM 7716 O  O2    . EDO K 6 .   ? 9.506  12.705  -0.775  1.00 77.23  ? 1510 EDO A O2    1 
HETATM 7717 H  H11   . EDO K 6 .   ? 11.173 15.200  0.278   1.00 73.58  ? 1510 EDO A H11   1 
HETATM 7718 H  H12   . EDO K 6 .   ? 9.961  15.043  -1.001  1.00 73.58  ? 1510 EDO A H12   1 
HETATM 7719 H  HO1   . EDO K 6 .   ? 12.010 15.798  -1.812  1.00 69.91  ? 1510 EDO A HO1   1 
HETATM 7720 H  H21   . EDO K 6 .   ? 11.578 12.618  -0.833  1.00 67.27  ? 1510 EDO A H21   1 
HETATM 7721 H  H22   . EDO K 6 .   ? 10.882 13.004  0.748   1.00 67.27  ? 1510 EDO A H22   1 
HETATM 7722 H  HO2   . EDO K 6 .   ? 9.421  11.761  -0.582  1.00 92.63  ? 1510 EDO A HO2   1 
HETATM 7723 C  C1    . EDO L 6 .   ? 28.823 23.561  19.012  1.00 58.20  ? 1511 EDO A C1    1 
HETATM 7724 O  O1    . EDO L 6 .   ? 27.416 23.538  18.750  1.00 51.86  ? 1511 EDO A O1    1 
HETATM 7725 C  C2    . EDO L 6 .   ? 29.079 23.783  20.497  1.00 52.82  ? 1511 EDO A C2    1 
HETATM 7726 O  O2    . EDO L 6 .   ? 30.464 23.543  20.777  1.00 54.18  ? 1511 EDO A O2    1 
HETATM 7727 H  H11   . EDO L 6 .   ? 29.269 22.614  18.700  1.00 69.79  ? 1511 EDO A H11   1 
HETATM 7728 H  H12   . EDO L 6 .   ? 29.291 24.361  18.435  1.00 69.79  ? 1511 EDO A H12   1 
HETATM 7729 H  HO1   . EDO L 6 .   ? 27.265 23.396  17.806  1.00 62.18  ? 1511 EDO A HO1   1 
HETATM 7730 H  H21   . EDO L 6 .   ? 28.459 23.104  21.086  1.00 63.33  ? 1511 EDO A H21   1 
HETATM 7731 H  H22   . EDO L 6 .   ? 28.818 24.808  20.769  1.00 63.33  ? 1511 EDO A H22   1 
HETATM 7732 H  HO2   . EDO L 6 .   ? 30.631 23.683  21.720  1.00 64.96  ? 1511 EDO A HO2   1 
HETATM 7733 C  C1    . EDO M 6 .   ? 37.992 -14.488 16.915  1.00 42.31  ? 1512 EDO A C1    1 
HETATM 7734 O  O1    . EDO M 6 .   ? 38.952 -15.529 16.708  1.00 51.84  ? 1512 EDO A O1    1 
HETATM 7735 C  C2    . EDO M 6 .   ? 36.757 -15.079 17.581  1.00 46.37  ? 1512 EDO A C2    1 
HETATM 7736 O  O2    . EDO M 6 .   ? 37.140 -15.593 18.861  1.00 52.31  ? 1512 EDO A O2    1 
HETATM 7737 H  H11   . EDO M 6 .   ? 38.419 -13.709 17.549  1.00 50.72  ? 1512 EDO A H11   1 
HETATM 7738 H  H12   . EDO M 6 .   ? 37.718 -14.040 15.958  1.00 50.72  ? 1512 EDO A H12   1 
HETATM 7739 H  HO1   . EDO M 6 .   ? 39.740 -15.160 16.284  1.00 62.16  ? 1512 EDO A HO1   1 
HETATM 7740 H  H21   . EDO M 6 .   ? 36.347 -15.881 16.964  1.00 55.58  ? 1512 EDO A H21   1 
HETATM 7741 H  H22   . EDO M 6 .   ? 35.992 -14.309 17.701  1.00 55.58  ? 1512 EDO A H22   1 
HETATM 7742 H  HO2   . EDO M 6 .   ? 36.367 -15.973 19.300  1.00 62.72  ? 1512 EDO A HO2   1 
HETATM 7743 C  C1    . EDO N 6 .   ? 26.489 23.954  8.789   1.00 49.56  ? 1513 EDO A C1    1 
HETATM 7744 O  O1    . EDO N 6 .   ? 26.843 25.294  8.433   1.00 61.61  ? 1513 EDO A O1    1 
HETATM 7745 C  C2    . EDO N 6 .   ? 25.082 23.940  9.374   1.00 55.84  ? 1513 EDO A C2    1 
HETATM 7746 O  O2    . EDO N 6 .   ? 24.120 24.089  8.323   1.00 52.32  ? 1513 EDO A O2    1 
HETATM 7747 H  H11   . EDO N 6 .   ? 26.528 23.314  7.904   1.00 59.41  ? 1513 EDO A H11   1 
HETATM 7748 H  H12   . EDO N 6 .   ? 27.199 23.566  9.522   1.00 59.41  ? 1513 EDO A H12   1 
HETATM 7749 H  HO1   . EDO N 6 .   ? 27.736 25.304  8.061   1.00 73.87  ? 1513 EDO A HO1   1 
HETATM 7750 H  H21   . EDO N 6 .   ? 24.973 24.756  10.092  1.00 66.95  ? 1513 EDO A H21   1 
HETATM 7751 H  H22   . EDO N 6 .   ? 24.911 22.999  9.900   1.00 66.95  ? 1513 EDO A H22   1 
HETATM 7752 H  HO2   . EDO N 6 .   ? 23.229 24.080  8.698   1.00 62.72  ? 1513 EDO A HO2   1 
HETATM 7753 C  C1    . EDO O 6 .   ? 21.430 21.068  7.762   1.00 41.08  ? 1514 EDO A C1    1 
HETATM 7754 O  O1    . EDO O 6 .   ? 20.223 20.735  8.449   1.00 64.57  ? 1514 EDO A O1    1 
HETATM 7755 C  C2    . EDO O 6 .   ? 21.275 22.389  7.025   1.00 28.92  ? 1514 EDO A C2    1 
HETATM 7756 O  O2    . EDO O 6 .   ? 22.574 22.797  6.583   1.00 33.02  ? 1514 EDO A O2    1 
HETATM 7757 H  H11   . EDO O 6 .   ? 21.676 20.278  7.050   1.00 49.24  ? 1514 EDO A H11   1 
HETATM 7758 H  H12   . EDO O 6 .   ? 22.251 21.143  8.479   1.00 49.24  ? 1514 EDO A H12   1 
HETATM 7759 H  HO1   . EDO O 6 .   ? 20.337 19.894  8.913   1.00 77.42  ? 1514 EDO A HO1   1 
HETATM 7760 H  H21   . EDO O 6 .   ? 20.850 23.143  7.691   1.00 34.64  ? 1514 EDO A H21   1 
HETATM 7761 H  H22   . EDO O 6 .   ? 20.608 22.265  6.169   1.00 34.64  ? 1514 EDO A H22   1 
HETATM 7762 H  HO2   . EDO O 6 .   ? 22.503 23.638  6.110   1.00 39.57  ? 1514 EDO A HO2   1 
HETATM 7763 C  C1    . EDO P 6 .   ? 26.977 14.457  30.621  1.00 34.75  ? 1515 EDO A C1    1 
HETATM 7764 O  O1    . EDO P 6 .   ? 27.488 13.742  31.750  1.00 49.29  ? 1515 EDO A O1    1 
HETATM 7765 C  C2    . EDO P 6 .   ? 26.789 13.482  29.467  1.00 56.61  ? 1515 EDO A C2    1 
HETATM 7766 O  O2    . EDO P 6 .   ? 25.998 14.100  28.446  1.00 62.68  ? 1515 EDO A O2    1 
HETATM 7767 H  H11   . EDO P 6 .   ? 27.675 15.246  30.333  1.00 41.65  ? 1515 EDO A H11   1 
HETATM 7768 H  H12   . EDO P 6 .   ? 26.021 14.921  30.876  1.00 41.65  ? 1515 EDO A H12   1 
HETATM 7769 H  HO1   . EDO P 6 .   ? 27.611 14.353  32.490  1.00 59.09  ? 1515 EDO A HO1   1 
HETATM 7770 H  H21   . EDO P 6 .   ? 27.762 13.199  29.061  1.00 67.87  ? 1515 EDO A H21   1 
HETATM 7771 H  H22   . EDO P 6 .   ? 26.291 12.578  29.824  1.00 67.87  ? 1515 EDO A H22   1 
HETATM 7772 H  HO2   . EDO P 6 .   ? 25.878 13.481  27.712  1.00 75.16  ? 1515 EDO A HO2   1 
HETATM 7773 C  C1    . EDO Q 6 .   ? 48.102 7.435   8.888   1.00 64.62  ? 1516 EDO A C1    1 
HETATM 7774 O  O1    . EDO Q 6 .   ? 47.700 6.754   10.083  1.00 65.47  ? 1516 EDO A O1    1 
HETATM 7775 C  C2    . EDO Q 6 .   ? 47.342 6.876   7.689   1.00 52.99  ? 1516 EDO A C2    1 
HETATM 7776 O  O2    . EDO Q 6 .   ? 47.973 5.682   7.215   1.00 53.40  ? 1516 EDO A O2    1 
HETATM 7777 H  H11   . EDO Q 6 .   ? 47.898 8.503   8.987   1.00 77.49  ? 1516 EDO A H11   1 
HETATM 7778 H  H12   . EDO Q 6 .   ? 49.175 7.307   8.735   1.00 77.49  ? 1516 EDO A H12   1 
HETATM 7779 H  HO1   . EDO Q 6 .   ? 48.186 7.115   10.838  1.00 78.51  ? 1516 EDO A HO1   1 
HETATM 7780 H  H21   . EDO Q 6 .   ? 47.320 7.621   6.890   1.00 63.53  ? 1516 EDO A H21   1 
HETATM 7781 H  H22   . EDO Q 6 .   ? 46.312 6.657   7.976   1.00 63.53  ? 1516 EDO A H22   1 
HETATM 7782 H  HO2   . EDO Q 6 .   ? 47.483 5.338   6.456   1.00 64.02  ? 1516 EDO A HO2   1 
HETATM 7783 O  O     . HOH R 7 .   ? 28.556 -14.092 7.709   1.00 22.72  ? 1    HOH A O     1 
HETATM 7784 O  O     . HOH R 7 .   ? 33.884 4.582   23.636  1.00 20.13  ? 2    HOH A O     1 
HETATM 7785 O  O     . HOH R 7 .   ? 18.907 5.555   9.341   1.00 30.03  ? 3    HOH A O     1 
HETATM 7786 O  O     . HOH R 7 .   ? 15.971 -1.684  14.181  1.00 24.66  ? 4    HOH A O     1 
HETATM 7787 O  O     . HOH R 7 .   ? 23.131 -9.943  26.651  1.00 23.40  ? 5    HOH A O     1 
HETATM 7788 O  O     . HOH R 7 .   ? 39.394 -6.385  -2.918  1.00 31.29  ? 6    HOH A O     1 
HETATM 7789 O  O     . HOH R 7 .   ? 18.529 10.342  13.764  1.00 24.75  ? 7    HOH A O     1 
HETATM 7790 O  O     . HOH R 7 .   ? 36.559 2.900   7.183   1.00 24.47  ? 8    HOH A O     1 
HETATM 7791 O  O     . HOH R 7 .   ? 40.727 5.161   11.013  1.00 24.68  ? 9    HOH A O     1 
HETATM 7792 O  O     . HOH R 7 .   ? 27.441 -1.641  17.193  1.00 23.13  ? 10   HOH A O     1 
HETATM 7793 O  O     . HOH R 7 .   ? 49.758 -26.091 18.828  1.00 28.44  ? 11   HOH A O     1 
HETATM 7794 O  O     . HOH R 7 .   ? 24.178 15.341  26.726  1.00 28.65  ? 12   HOH A O     1 
HETATM 7795 O  O     . HOH R 7 .   ? 27.336 -13.172 4.675   1.00 26.50  ? 13   HOH A O     1 
HETATM 7796 O  O     . HOH R 7 .   ? 20.019 -12.008 16.563  1.00 28.58  ? 14   HOH A O     1 
HETATM 7797 O  O     . HOH R 7 .   ? 29.679 -1.585  24.418  1.00 24.98  ? 15   HOH A O     1 
HETATM 7798 O  O     . HOH R 7 .   ? 25.720 -6.562  13.272  1.00 26.50  ? 16   HOH A O     1 
HETATM 7799 O  O     . HOH R 7 .   ? 29.027 9.930   -4.130  1.00 24.80  ? 17   HOH A O     1 
HETATM 7800 O  O     . HOH R 7 .   ? 9.068  1.275   22.331  1.00 33.80  ? 18   HOH A O     1 
HETATM 7801 O  O     . HOH R 7 .   ? 38.953 2.832   4.511   1.00 28.50  ? 19   HOH A O     1 
HETATM 7802 O  O     . HOH R 7 .   ? 27.268 -12.100 17.307  1.00 27.81  ? 20   HOH A O     1 
HETATM 7803 O  O     . HOH R 7 .   ? 9.496  6.780   2.125   1.00 31.59  ? 21   HOH A O     1 
HETATM 7804 O  O     . HOH R 7 .   ? 29.784 -4.643  27.132  1.00 29.46  ? 22   HOH A O     1 
HETATM 7805 O  O     . HOH R 7 .   ? 46.499 -16.227 -6.126  1.00 42.82  ? 23   HOH A O     1 
HETATM 7806 O  O     . HOH R 7 .   ? 29.907 -0.884  16.864  1.00 24.89  ? 24   HOH A O     1 
HETATM 7807 O  O     . HOH R 7 .   ? 18.077 21.274  18.168  1.00 29.43  ? 25   HOH A O     1 
HETATM 7808 O  O     . HOH R 7 .   ? 17.239 23.087  14.646  1.00 32.69  ? 26   HOH A O     1 
HETATM 7809 O  O     . HOH R 7 .   ? 28.982 6.204   0.985   1.00 24.41  ? 27   HOH A O     1 
HETATM 7810 O  O     . HOH R 7 .   ? 16.295 -11.834 16.755  1.00 36.12  ? 28   HOH A O     1 
HETATM 7811 O  O     . HOH R 7 .   ? 26.583 -7.683  10.675  1.00 31.63  ? 29   HOH A O     1 
HETATM 7812 O  O     . HOH R 7 .   ? 24.306 9.049   29.550  1.00 31.33  ? 30   HOH A O     1 
HETATM 7813 O  O     . HOH R 7 .   ? 31.873 14.067  31.920  1.00 32.02  ? 31   HOH A O     1 
HETATM 7814 O  O     . HOH R 7 .   ? 34.773 20.910  24.530  1.00 30.66  ? 32   HOH A O     1 
HETATM 7815 O  O     . HOH R 7 .   ? 13.939 4.555   23.580  1.00 29.65  ? 33   HOH A O     1 
HETATM 7816 O  O     . HOH R 7 .   ? 51.690 -13.089 5.073   1.00 35.02  ? 34   HOH A O     1 
HETATM 7817 O  O     . HOH R 7 .   ? 30.803 21.008  19.200  1.00 30.52  ? 35   HOH A O     1 
HETATM 7818 O  O     . HOH R 7 .   ? 33.627 8.651   1.243   1.00 28.06  ? 36   HOH A O     1 
HETATM 7819 O  O     . HOH R 7 .   ? 23.705 -11.484 36.118  1.00 32.55  ? 37   HOH A O     1 
HETATM 7820 O  O     . HOH R 7 .   ? 38.165 11.719  3.680   1.00 35.56  ? 38   HOH A O     1 
HETATM 7821 O  O     . HOH R 7 .   ? 10.378 10.381  -4.091  1.00 36.25  ? 39   HOH A O     1 
HETATM 7822 O  O     . HOH R 7 .   ? 38.922 11.013  6.786   1.00 34.91  ? 40   HOH A O     1 
HETATM 7823 O  O     . HOH R 7 .   ? 22.321 -5.642  34.613  1.00 32.95  ? 41   HOH A O     1 
HETATM 7824 O  O     . HOH R 7 .   ? 31.025 -20.332 1.355   1.00 30.43  ? 42   HOH A O     1 
HETATM 7825 O  O     . HOH R 7 .   ? 22.813 5.474   36.897  1.00 36.20  ? 43   HOH A O     1 
HETATM 7826 O  O     . HOH R 7 .   ? 27.061 -4.801  39.942  1.00 28.85  ? 44   HOH A O     1 
HETATM 7827 O  O     . HOH R 7 .   ? 39.518 -1.029  1.906   1.00 31.38  ? 45   HOH A O     1 
HETATM 7828 O  O     . HOH R 7 .   ? 26.055 -14.780 6.498   1.00 30.46  ? 46   HOH A O     1 
HETATM 7829 O  O     . HOH R 7 .   ? 25.107 -19.133 -11.401 1.00 35.84  ? 47   HOH A O     1 
HETATM 7830 O  O     . HOH R 7 .   ? 27.127 -0.638  10.105  1.00 30.29  ? 48   HOH A O     1 
HETATM 7831 O  O     . HOH R 7 .   ? 26.302 -7.059  8.106   1.00 29.45  ? 49   HOH A O     1 
HETATM 7832 O  O     . HOH R 7 .   ? 11.274 -7.797  11.978  1.00 36.62  ? 50   HOH A O     1 
HETATM 7833 O  O     . HOH R 7 .   ? 8.318  3.618   23.961  1.00 40.14  ? 51   HOH A O     1 
HETATM 7834 O  O     . HOH R 7 .   ? 44.028 0.916   15.024  1.00 29.78  ? 52   HOH A O     1 
HETATM 7835 O  O     . HOH R 7 .   ? 31.359 -22.506 -0.589  1.00 31.44  ? 53   HOH A O     1 
HETATM 7836 O  O     . HOH R 7 .   ? 35.799 -13.851 -0.305  1.00 33.71  ? 54   HOH A O     1 
HETATM 7837 O  O     . HOH R 7 .   ? 46.766 23.130  19.431  1.00 41.91  ? 55   HOH A O     1 
HETATM 7838 O  O     . HOH R 7 .   ? 35.732 -0.745  -4.770  1.00 34.29  ? 56   HOH A O     1 
HETATM 7839 O  O     . HOH R 7 .   ? 23.587 16.654  -9.413  1.00 42.67  ? 57   HOH A O     1 
HETATM 7840 O  O     . HOH R 7 .   ? 32.563 22.237  17.610  1.00 30.79  ? 58   HOH A O     1 
HETATM 7841 O  O     . HOH R 7 .   ? 32.312 -1.352  24.722  1.00 38.45  ? 59   HOH A O     1 
HETATM 7842 O  O     . HOH R 7 .   ? 18.233 -11.663 14.611  1.00 33.61  ? 60   HOH A O     1 
HETATM 7843 O  O     . HOH R 7 .   ? 32.363 -7.155  -0.281  1.00 37.82  ? 61   HOH A O     1 
HETATM 7844 O  O     . HOH R 7 .   ? 27.304 1.398   8.021   1.00 32.72  ? 62   HOH A O     1 
HETATM 7845 O  O     . HOH R 7 .   ? 9.588  17.491  12.071  1.00 38.33  ? 63   HOH A O     1 
HETATM 7846 O  O     . HOH R 7 .   ? 29.276 -1.611  -1.130  1.00 35.76  ? 64   HOH A O     1 
HETATM 7847 O  O     . HOH R 7 .   ? 48.966 -5.846  17.019  1.00 45.30  ? 65   HOH A O     1 
HETATM 7848 O  O     . HOH R 7 .   ? 5.614  -4.200  20.754  1.00 40.55  ? 66   HOH A O     1 
HETATM 7849 O  O     . HOH R 7 .   ? 28.740 23.246  -3.292  1.00 37.99  ? 67   HOH A O     1 
HETATM 7850 O  O     . HOH R 7 .   ? 13.339 13.374  23.656  1.00 34.59  ? 68   HOH A O     1 
HETATM 7851 O  O     . HOH R 7 .   ? 27.343 -14.536 18.798  1.00 31.36  ? 69   HOH A O     1 
HETATM 7852 O  O     . HOH R 7 .   ? 53.013 -18.196 21.303  1.00 35.58  ? 70   HOH A O     1 
HETATM 7853 O  O     . HOH R 7 .   ? 17.627 1.648   31.948  1.00 32.37  ? 71   HOH A O     1 
HETATM 7854 O  O     . HOH R 7 .   ? 22.987 8.586   -2.520  1.00 27.89  ? 72   HOH A O     1 
HETATM 7855 O  O     . HOH R 7 .   ? 14.614 3.103   8.912   1.00 34.82  ? 73   HOH A O     1 
HETATM 7856 O  O     . HOH R 7 .   ? 16.112 8.064   29.981  1.00 42.06  ? 74   HOH A O     1 
HETATM 7857 O  O     . HOH R 7 .   ? 24.182 20.650  -8.481  1.00 42.11  ? 75   HOH A O     1 
HETATM 7858 O  O     . HOH R 7 .   ? 18.297 -2.056  42.673  1.00 45.62  ? 76   HOH A O     1 
HETATM 7859 O  O     . HOH R 7 .   ? 22.862 -7.841  6.202   1.00 38.06  ? 77   HOH A O     1 
HETATM 7860 O  O     . HOH R 7 .   ? 26.917 -4.321  33.077  1.00 41.35  ? 78   HOH A O     1 
HETATM 7861 O  O     . HOH R 7 .   ? 33.666 -22.261 -1.906  1.00 31.78  ? 79   HOH A O     1 
HETATM 7862 O  O     . HOH R 7 .   ? 33.666 -20.109 1.162   1.00 35.77  ? 80   HOH A O     1 
HETATM 7863 O  O     . HOH R 7 .   ? 38.921 -1.905  20.167  1.00 34.11  ? 81   HOH A O     1 
HETATM 7864 O  O     . HOH R 7 .   ? 38.040 20.979  2.149   1.00 38.15  ? 82   HOH A O     1 
HETATM 7865 O  O     . HOH R 7 .   ? 28.590 -19.851 11.904  1.00 32.77  ? 83   HOH A O     1 
HETATM 7866 O  O     . HOH R 7 .   ? 53.853 -28.125 13.533  1.00 42.58  ? 84   HOH A O     1 
HETATM 7867 O  O     . HOH R 7 .   ? 21.930 7.600   31.077  1.00 37.14  ? 85   HOH A O     1 
HETATM 7868 O  O     . HOH R 7 .   ? 27.385 -10.262 27.831  1.00 32.38  ? 86   HOH A O     1 
HETATM 7869 O  O     . HOH R 7 .   ? 14.151 0.685   9.900   1.00 35.63  ? 87   HOH A O     1 
HETATM 7870 O  O     . HOH R 7 .   ? 38.403 16.067  28.382  1.00 31.10  ? 88   HOH A O     1 
HETATM 7871 O  O     . HOH R 7 .   ? 24.450 -16.678 5.123   1.00 33.54  ? 89   HOH A O     1 
HETATM 7872 O  O     . HOH R 7 .   ? 53.733 -11.150 8.861   1.00 40.75  ? 90   HOH A O     1 
HETATM 7873 O  O     . HOH R 7 .   ? 50.596 -32.968 8.563   1.00 35.94  ? 91   HOH A O     1 
HETATM 7874 O  O     . HOH R 7 .   ? 10.794 6.058   -4.725  1.00 33.42  ? 92   HOH A O     1 
HETATM 7875 O  O     . HOH R 7 .   ? 31.653 -24.713 0.988   1.00 41.09  ? 93   HOH A O     1 
HETATM 7876 O  O     . HOH R 7 .   ? 8.647  8.914   28.147  1.00 36.24  ? 94   HOH A O     1 
HETATM 7877 O  O     . HOH R 7 .   ? 18.903 0.935   12.122  1.00 38.03  ? 95   HOH A O     1 
HETATM 7878 O  O     . HOH R 7 .   ? 43.926 18.726  11.630  1.00 35.74  ? 96   HOH A O     1 
HETATM 7879 O  O     . HOH R 7 .   ? 42.882 -22.181 -4.375  1.00 43.03  ? 97   HOH A O     1 
HETATM 7880 O  O     . HOH R 7 .   ? 20.707 -10.186 4.953   1.00 40.95  ? 98   HOH A O     1 
HETATM 7881 O  O     . HOH R 7 .   ? 10.016 5.158   16.231  1.00 38.57  ? 99   HOH A O     1 
HETATM 7882 O  O     . HOH R 7 .   ? 27.910 -8.296  19.843  1.00 34.00  ? 100  HOH A O     1 
HETATM 7883 O  O     . HOH R 7 .   ? 22.687 -23.625 1.846   1.00 45.99  ? 101  HOH A O     1 
HETATM 7884 O  O     . HOH R 7 .   ? 25.043 12.545  -8.405  1.00 35.83  ? 102  HOH A O     1 
HETATM 7885 O  O     . HOH R 7 .   ? 52.142 -15.264 -2.168  1.00 50.06  ? 103  HOH A O     1 
HETATM 7886 O  O     . HOH R 7 .   ? 26.272 1.791   35.074  1.00 41.54  ? 104  HOH A O     1 
HETATM 7887 O  O     . HOH R 7 .   ? 28.161 4.378   10.324  1.00 43.49  ? 105  HOH A O     1 
HETATM 7888 O  O     . HOH R 7 .   ? 26.848 0.700   32.344  1.00 40.94  ? 106  HOH A O     1 
HETATM 7889 O  O     . HOH R 7 .   ? 21.666 24.974  4.573   1.00 39.64  ? 107  HOH A O     1 
HETATM 7890 O  O     . HOH R 7 .   ? 24.051 -8.571  11.328  1.00 35.35  ? 108  HOH A O     1 
HETATM 7891 O  O     . HOH R 7 .   ? 32.003 25.097  10.880  1.00 37.74  ? 109  HOH A O     1 
HETATM 7892 O  O     . HOH R 7 .   ? 45.013 8.702   16.008  1.00 38.38  ? 110  HOH A O     1 
HETATM 7893 O  O     . HOH R 7 .   ? 38.951 14.658  -1.811  1.00 43.05  ? 111  HOH A O     1 
HETATM 7894 O  O     . HOH R 7 .   ? 15.490 -1.793  43.526  1.00 42.22  ? 112  HOH A O     1 
HETATM 7895 O  O     . HOH R 7 .   ? 40.616 3.500   15.237  1.00 31.24  ? 113  HOH A O     1 
HETATM 7896 O  O     . HOH R 7 .   ? 45.121 -6.118  20.592  1.00 35.30  ? 114  HOH A O     1 
HETATM 7897 O  O     . HOH R 7 .   ? 45.638 -23.560 -6.916  1.00 42.27  ? 115  HOH A O     1 
HETATM 7898 O  O     . HOH R 7 .   ? 52.279 -9.986  1.999   1.00 43.59  ? 116  HOH A O     1 
HETATM 7899 O  O     . HOH R 7 .   ? 52.103 -10.143 11.530  1.00 40.05  ? 117  HOH A O     1 
HETATM 7900 O  O     . HOH R 7 .   ? 18.034 -13.602 12.811  1.00 44.36  ? 118  HOH A O     1 
HETATM 7901 O  O     . HOH R 7 .   ? 22.427 -8.327  34.205  1.00 35.66  ? 119  HOH A O     1 
HETATM 7902 O  O     . HOH R 7 .   ? 50.222 -4.600  15.166  1.00 48.02  ? 120  HOH A O     1 
HETATM 7903 O  O     . HOH R 7 .   ? 34.968 -13.973 -2.877  1.00 41.93  ? 121  HOH A O     1 
HETATM 7904 O  O     . HOH R 7 .   ? 6.488  3.906   14.745  1.00 43.22  ? 122  HOH A O     1 
HETATM 7905 O  O     . HOH R 7 .   ? 17.205 22.723  4.845   1.00 42.59  ? 123  HOH A O     1 
HETATM 7906 O  O     . HOH R 7 .   ? 14.796 0.859   43.330  1.00 46.00  ? 124  HOH A O     1 
HETATM 7907 O  O     . HOH R 7 .   ? 9.896  10.494  15.995  1.00 43.86  ? 125  HOH A O     1 
HETATM 7908 O  O     . HOH R 7 .   ? 23.179 -21.193 18.728  1.00 43.04  ? 126  HOH A O     1 
HETATM 7909 O  O     . HOH R 7 .   ? 44.545 -12.210 -5.994  1.00 38.65  ? 127  HOH A O     1 
HETATM 7910 O  O     . HOH R 7 .   ? 12.197 17.771  18.595  1.00 45.11  ? 128  HOH A O     1 
HETATM 7911 O  O     . HOH R 7 .   ? 36.122 8.033   -5.739  1.00 45.84  ? 129  HOH A O     1 
HETATM 7912 O  O     . HOH R 7 .   ? 54.995 -24.928 4.592   1.00 42.68  ? 130  HOH A O     1 
HETATM 7913 O  O     . HOH R 7 .   ? 27.818 8.529   -6.328  1.00 43.20  ? 131  HOH A O     1 
HETATM 7914 O  O     . HOH R 7 .   ? 26.719 0.501   5.487   1.00 44.58  ? 132  HOH A O     1 
HETATM 7915 O  O     . HOH R 7 .   ? 10.052 0.004   3.094   1.00 47.19  ? 133  HOH A O     1 
HETATM 7916 O  O     . HOH R 7 .   ? 28.183 -6.093  34.810  1.00 41.79  ? 134  HOH A O     1 
HETATM 7917 O  O     . HOH R 7 .   ? 29.160 -3.781  38.398  1.00 48.39  ? 135  HOH A O     1 
HETATM 7918 O  O     . HOH R 7 .   ? 40.714 9.576   5.312   1.00 37.69  ? 136  HOH A O     1 
HETATM 7919 O  O     . HOH R 7 .   ? 32.591 -17.761 4.421   1.00 43.71  ? 137  HOH A O     1 
HETATM 7920 O  O     . HOH R 7 .   ? 8.900  17.970  9.314   1.00 52.76  ? 138  HOH A O     1 
HETATM 7921 O  O     . HOH R 7 .   ? 48.755 -34.878 13.769  1.00 34.50  ? 139  HOH A O     1 
HETATM 7922 O  O     . HOH R 7 .   ? 7.097  5.585   1.622   1.00 43.27  ? 140  HOH A O     1 
HETATM 7923 O  O     . HOH R 7 .   ? 13.533 -3.568  8.937   1.00 45.13  ? 141  HOH A O     1 
HETATM 7924 O  O     . HOH R 7 .   ? 19.073 4.896   37.502  1.00 35.25  ? 142  HOH A O     1 
HETATM 7925 O  O     . HOH R 7 .   ? 32.991 -3.246  22.890  1.00 36.11  ? 143  HOH A O     1 
HETATM 7926 O  O     . HOH R 7 .   ? 44.510 -14.577 -7.477  1.00 40.16  ? 144  HOH A O     1 
HETATM 7927 O  O     . HOH R 7 .   ? 41.609 -11.851 0.376   1.00 35.72  ? 145  HOH A O     1 
HETATM 7928 O  O     . HOH R 7 .   ? 38.372 0.919   0.087   1.00 44.80  ? 146  HOH A O     1 
HETATM 7929 O  O     . HOH R 7 .   ? 22.282 -18.346 -12.073 1.00 49.60  ? 147  HOH A O     1 
HETATM 7930 O  O     . HOH R 7 .   ? 10.518 4.657   25.464  1.00 35.56  ? 148  HOH A O     1 
HETATM 7931 O  O     . HOH R 7 .   ? 10.924 -5.781  31.013  1.00 42.89  ? 149  HOH A O     1 
HETATM 7932 O  O     . HOH R 7 .   ? 36.273 24.295  27.379  1.00 43.94  ? 150  HOH A O     1 
HETATM 7933 O  O     . HOH R 7 .   ? 10.998 12.148  18.412  1.00 38.22  ? 151  HOH A O     1 
HETATM 7934 O  O     . HOH R 7 .   ? 30.014 -6.019  1.209   1.00 38.72  ? 152  HOH A O     1 
HETATM 7935 O  O     . HOH R 7 .   ? 34.331 19.493  -4.254  1.00 42.29  ? 153  HOH A O     1 
HETATM 7936 O  O     . HOH R 7 .   ? 43.262 -1.839  0.962   1.00 46.34  ? 154  HOH A O     1 
HETATM 7937 O  O     . HOH R 7 .   ? 27.290 4.970   7.934   1.00 49.73  ? 155  HOH A O     1 
HETATM 7938 O  O     . HOH R 7 .   ? 7.677  5.801   12.942  1.00 38.91  ? 156  HOH A O     1 
HETATM 7939 O  O     . HOH R 7 .   ? 31.241 22.051  -2.174  1.00 34.31  ? 157  HOH A O     1 
HETATM 7940 O  O     . HOH R 7 .   ? 38.293 1.322   32.465  1.00 46.75  ? 158  HOH A O     1 
HETATM 7941 O  O     . HOH R 7 .   ? 23.756 7.363   -5.062  1.00 42.63  ? 159  HOH A O     1 
HETATM 7942 O  O     . HOH R 7 .   ? 42.135 -31.795 11.804  1.00 52.00  ? 160  HOH A O     1 
HETATM 7943 O  O     . HOH R 7 .   ? 41.220 2.958   12.842  1.00 48.96  ? 161  HOH A O     1 
HETATM 7944 O  O     . HOH R 7 .   ? 29.719 -14.875 5.281   1.00 43.42  ? 162  HOH A O     1 
HETATM 7945 O  O     . HOH R 7 .   ? 31.336 23.623  15.462  1.00 44.39  ? 163  HOH A O     1 
HETATM 7946 O  O     . HOH R 7 .   ? 34.877 -19.206 3.787   1.00 43.50  ? 164  HOH A O     1 
HETATM 7947 O  O     . HOH R 7 .   ? 23.932 13.151  29.079  1.00 42.03  ? 165  HOH A O     1 
HETATM 7948 O  O     . HOH R 7 .   ? 26.138 14.952  -9.353  1.00 40.37  ? 166  HOH A O     1 
HETATM 7949 O  O     . HOH R 7 .   ? 44.285 -4.463  1.017   1.00 43.64  ? 167  HOH A O     1 
HETATM 7950 O  O     . HOH R 7 .   ? 15.789 2.973   30.512  1.00 40.47  ? 168  HOH A O     1 
HETATM 7951 O  O     . HOH R 7 .   ? 43.390 10.290  5.139   1.00 45.43  ? 169  HOH A O     1 
HETATM 7952 O  O     . HOH R 7 .   ? 24.687 -1.582  5.268   1.00 51.98  ? 170  HOH A O     1 
HETATM 7953 O  O     . HOH R 7 .   ? 56.678 -27.893 7.444   1.00 39.81  ? 171  HOH A O     1 
HETATM 7954 O  O     . HOH R 7 .   ? 42.948 21.110  11.771  1.00 49.61  ? 172  HOH A O     1 
HETATM 7955 O  O     . HOH R 7 .   ? 16.107 5.007   9.835   1.00 38.34  ? 173  HOH A O     1 
HETATM 7956 O  O     . HOH R 7 .   ? 8.788  -6.050  25.712  1.00 45.09  ? 174  HOH A O     1 
HETATM 7957 O  O     . HOH R 7 .   ? 36.821 -2.635  -6.361  1.00 51.53  ? 175  HOH A O     1 
HETATM 7958 O  O     . HOH R 7 .   ? 39.551 -16.579 14.282  1.00 38.45  ? 176  HOH A O     1 
HETATM 7959 O  O     . HOH R 7 .   ? 51.733 -9.661  7.561   1.00 42.85  ? 177  HOH A O     1 
HETATM 7960 O  O     . HOH R 7 .   ? 29.030 -10.520 18.712  1.00 37.83  ? 178  HOH A O     1 
HETATM 7961 O  O     . HOH R 7 .   ? 35.467 -27.015 2.781   1.00 43.42  ? 179  HOH A O     1 
HETATM 7962 O  O     . HOH R 7 .   ? 46.867 -4.514  18.492  1.00 47.48  ? 180  HOH A O     1 
HETATM 7963 O  O     . HOH R 7 .   ? 46.865 0.851   15.338  1.00 40.81  ? 181  HOH A O     1 
HETATM 7964 O  O     . HOH R 7 .   ? 32.721 -3.029  -3.708  1.00 43.13  ? 182  HOH A O     1 
HETATM 7965 O  O     . HOH R 7 .   ? 15.318 17.064  -8.245  1.00 39.78  ? 183  HOH A O     1 
HETATM 7966 O  O     . HOH R 7 .   ? 28.514 -11.277 -4.757  1.00 44.14  ? 184  HOH A O     1 
HETATM 7967 O  O     . HOH R 7 .   ? 25.510 5.530   37.210  1.00 40.99  ? 185  HOH A O     1 
HETATM 7968 O  O     . HOH R 7 .   ? 18.848 24.786  3.881   1.00 49.19  ? 186  HOH A O     1 
HETATM 7969 O  O     . HOH R 7 .   ? 20.108 -21.516 -8.827  1.00 51.27  ? 187  HOH A O     1 
HETATM 7970 O  O     . HOH R 7 .   ? 24.572 4.927   0.208   1.00 51.11  ? 188  HOH A O     1 
HETATM 7971 O  O     . HOH R 7 .   ? 34.404 -24.605 2.418   1.00 49.74  ? 189  HOH A O     1 
HETATM 7972 O  O     . HOH R 7 .   ? 25.941 26.851  6.800   1.00 46.74  ? 190  HOH A O     1 
HETATM 7973 O  O     . HOH R 7 .   ? 36.222 25.387  3.741   1.00 47.30  ? 191  HOH A O     1 
HETATM 7974 O  O     . HOH R 7 .   ? 56.539 -24.493 18.593  1.00 45.74  ? 192  HOH A O     1 
HETATM 7975 O  O     . HOH R 7 .   ? 10.135 18.188  -1.761  1.00 45.28  ? 193  HOH A O     1 
HETATM 7976 O  O     . HOH R 7 .   ? 52.286 -30.974 2.064   1.00 39.89  ? 194  HOH A O     1 
HETATM 7977 O  O     . HOH R 7 .   ? 29.828 -21.536 3.398   1.00 44.40  ? 195  HOH A O     1 
HETATM 7978 O  O     . HOH R 7 .   ? 26.355 26.793  4.058   1.00 48.34  ? 196  HOH A O     1 
HETATM 7979 O  O     . HOH R 7 .   ? 11.670 24.868  0.573   1.00 43.10  ? 197  HOH A O     1 
HETATM 7980 O  O     . HOH R 7 .   ? 23.067 9.549   -7.256  1.00 38.23  ? 198  HOH A O     1 
HETATM 7981 O  O     . HOH R 7 .   ? 41.742 -7.233  -2.079  1.00 38.19  ? 199  HOH A O     1 
HETATM 7982 O  O     . HOH R 7 .   ? 50.713 -6.416  22.968  1.00 47.11  ? 200  HOH A O     1 
HETATM 7983 O  O     . HOH R 7 .   ? 44.277 11.381  19.126  1.00 54.48  ? 201  HOH A O     1 
HETATM 7984 O  O     . HOH R 7 .   ? 26.968 -1.394  2.276   1.00 45.46  ? 202  HOH A O     1 
HETATM 7985 O  O     . HOH R 7 .   ? 41.693 0.991   25.370  1.00 47.63  ? 203  HOH A O     1 
HETATM 7986 O  O     . HOH R 7 .   ? 45.334 -7.903  23.464  1.00 50.71  ? 204  HOH A O     1 
HETATM 7987 O  O     . HOH R 7 .   ? 44.469 -19.279 19.409  1.00 51.72  ? 205  HOH A O     1 
HETATM 7988 O  O     . HOH R 7 .   ? 37.266 27.077  15.786  1.00 51.16  ? 206  HOH A O     1 
HETATM 7989 O  O     . HOH R 7 .   ? 31.000 -2.254  27.986  1.00 42.83  ? 207  HOH A O     1 
HETATM 7990 O  O     . HOH R 7 .   ? 27.232 23.912  12.598  1.00 50.77  ? 208  HOH A O     1 
HETATM 7991 O  O     . HOH R 7 .   ? 30.709 -9.683  -15.979 1.00 49.44  ? 209  HOH A O     1 
HETATM 7992 O  O     . HOH R 7 .   ? 37.497 -11.447 -4.875  1.00 40.82  ? 210  HOH A O     1 
HETATM 7993 O  O     . HOH R 7 .   ? 26.018 23.937  20.525  1.00 45.81  ? 211  HOH A O     1 
HETATM 7994 O  O     . HOH R 7 .   ? 57.280 -18.401 2.079   1.00 48.31  ? 212  HOH A O     1 
HETATM 7995 O  O     . HOH R 7 .   ? 55.569 -20.759 2.060   1.00 45.60  ? 213  HOH A O     1 
HETATM 7996 O  O     . HOH R 7 .   ? 33.647 -28.962 1.783   1.00 44.03  ? 214  HOH A O     1 
HETATM 7997 O  O     . HOH R 7 .   ? 34.834 -12.539 -10.019 1.00 47.79  ? 215  HOH A O     1 
HETATM 7998 O  O     . HOH R 7 .   ? 19.517 -23.544 -4.305  1.00 54.83  ? 216  HOH A O     1 
HETATM 7999 O  O     . HOH R 7 .   ? 42.245 21.244  26.625  1.00 50.79  ? 217  HOH A O     1 
HETATM 8000 O  O     . HOH R 7 .   ? 42.961 -3.060  -3.430  1.00 50.59  ? 218  HOH A O     1 
HETATM 8001 O  O     . HOH R 7 .   ? 29.747 12.487  31.811  1.00 33.72  ? 219  HOH A O     1 
HETATM 8002 O  O     . HOH R 7 .   ? 9.124  15.132  21.162  1.00 51.87  ? 220  HOH A O     1 
HETATM 8003 O  O     . HOH R 7 .   ? 31.688 18.377  -8.226  1.00 51.85  ? 221  HOH A O     1 
HETATM 8004 O  O     . HOH R 7 .   ? 9.768  5.809   28.016  1.00 48.98  ? 222  HOH A O     1 
HETATM 8005 O  O     . HOH R 7 .   ? 20.885 -11.560 36.516  1.00 42.38  ? 223  HOH A O     1 
HETATM 8006 O  O     . HOH R 7 .   ? 19.692 -9.000  35.812  1.00 58.46  ? 224  HOH A O     1 
HETATM 8007 O  O     . HOH R 7 .   ? 14.256 -3.919  42.435  1.00 44.85  ? 225  HOH A O     1 
HETATM 8008 O  O     . HOH R 7 .   ? 29.935 17.337  -9.028  1.00 48.75  ? 226  HOH A O     1 
HETATM 8009 O  O     . HOH R 7 .   ? 34.089 17.313  -6.527  1.00 41.30  ? 227  HOH A O     1 
HETATM 8010 O  O     . HOH R 7 .   ? 52.345 -3.185  9.578   1.00 49.33  ? 228  HOH A O     1 
HETATM 8011 O  O     . HOH R 7 .   ? 39.358 2.798   1.812   1.00 50.43  ? 229  HOH A O     1 
HETATM 8012 O  O     . HOH R 7 .   ? 43.458 -33.279 10.085  1.00 54.84  ? 230  HOH A O     1 
HETATM 8013 O  O     . HOH R 7 .   ? 55.319 -22.575 0.417   1.00 53.81  ? 231  HOH A O     1 
HETATM 8014 O  O     . HOH R 7 .   ? 16.324 5.061   30.497  1.00 57.93  ? 232  HOH A O     1 
HETATM 8015 O  O     . HOH R 7 .   ? 44.131 2.965   1.319   1.00 55.55  ? 233  HOH A O     1 
HETATM 8016 O  O     . HOH R 7 .   ? 29.123 8.615   -8.681  1.00 52.38  ? 234  HOH A O     1 
HETATM 8017 O  O     . HOH R 7 .   ? 21.433 4.112   9.044   1.00 48.85  ? 235  HOH A O     1 
HETATM 8018 O  O     . HOH R 7 .   ? 19.277 23.822  18.623  1.00 53.78  ? 236  HOH A O     1 
HETATM 8019 O  O     . HOH R 7 .   ? 43.826 -41.083 8.168   1.00 52.54  ? 237  HOH A O     1 
HETATM 8020 O  O     . HOH R 7 .   ? 56.312 -30.242 6.351   1.00 47.16  ? 238  HOH A O     1 
HETATM 8021 O  O     . HOH R 7 .   ? 44.469 22.201  9.275   1.00 56.78  ? 239  HOH A O     1 
HETATM 8022 O  O     . HOH R 7 .   ? 48.155 -10.264 23.765  1.00 49.77  ? 240  HOH A O     1 
HETATM 8023 O  O     . HOH R 7 .   ? 23.512 25.662  15.811  1.00 42.48  ? 241  HOH A O     1 
HETATM 8024 O  O     . HOH R 7 .   ? 37.032 -20.957 3.826   1.00 52.42  ? 242  HOH A O     1 
HETATM 8025 O  O     . HOH R 7 .   ? 52.693 -21.723 11.345  1.00 50.80  ? 243  HOH A O     1 
HETATM 8026 O  O     . HOH R 7 .   ? 27.915 -7.562  -1.936  1.00 51.84  ? 244  HOH A O     1 
HETATM 8027 O  O     . HOH R 7 .   ? 42.509 -23.843 -11.122 1.00 55.52  ? 245  HOH A O     1 
HETATM 8028 O  O     . HOH R 7 .   ? 42.329 1.689   1.390   1.00 54.37  ? 246  HOH A O     1 
HETATM 8029 O  O     . HOH R 7 .   ? 12.847 -8.307  9.735   1.00 45.18  ? 247  HOH A O     1 
HETATM 8030 O  O     . HOH R 7 .   ? 35.583 7.559   -1.103  1.00 51.87  ? 248  HOH A O     1 
HETATM 8031 O  O     . HOH R 7 .   ? 36.763 8.673   1.361   1.00 52.95  ? 249  HOH A O     1 
HETATM 8032 O  O     . HOH R 7 .   ? 36.226 17.128  -8.424  1.00 47.93  ? 250  HOH A O     1 
HETATM 8033 O  O     . HOH R 7 .   ? 17.678 4.239   41.364  1.00 48.46  ? 251  HOH A O     1 
HETATM 8034 O  O     . HOH R 7 .   ? 45.104 -10.290 -8.171  1.00 50.23  ? 252  HOH A O     1 
HETATM 8035 O  O     . HOH R 7 .   ? 17.000 2.696   43.432  1.00 48.01  ? 253  HOH A O     1 
HETATM 8036 O  O     . HOH R 7 .   ? 7.486  21.354  10.836  1.00 47.44  ? 254  HOH A O     1 
HETATM 8037 O  O     . HOH R 7 .   ? 41.676 -35.535 -4.065  1.00 57.94  ? 255  HOH A O     1 
HETATM 8038 O  O     . HOH R 7 .   ? 13.346 -5.532  38.396  1.00 53.68  ? 256  HOH A O     1 
HETATM 8039 O  O     . HOH R 7 .   ? 40.877 19.032  27.299  1.00 46.90  ? 257  HOH A O     1 
HETATM 8040 O  O     . HOH R 7 .   ? 19.505 0.880   43.699  1.00 51.73  ? 258  HOH A O     1 
HETATM 8041 O  O     . HOH R 7 .   ? 10.629 -5.038  11.545  1.00 42.62  ? 259  HOH A O     1 
HETATM 8042 O  O     . HOH R 7 .   ? 40.121 -15.685 -16.414 1.00 47.39  ? 260  HOH A O     1 
HETATM 8043 O  O     . HOH R 7 .   ? 17.474 -8.710  35.208  1.00 59.46  ? 261  HOH A O     1 
HETATM 8044 O  O     . HOH R 7 .   ? 41.260 23.519  9.677   1.00 53.18  ? 262  HOH A O     1 
HETATM 8045 O  O     . HOH R 7 .   ? 48.052 -1.547  10.461  1.00 46.00  ? 263  HOH A O     1 
HETATM 8046 O  O     . HOH R 7 .   ? 19.500 -21.359 12.532  1.00 55.63  ? 264  HOH A O     1 
HETATM 8047 O  O     . HOH R 7 .   ? 25.113 8.238   38.315  1.00 46.42  ? 265  HOH A O     1 
HETATM 8048 O  O     . HOH R 7 .   ? 17.796 0.626   2.512   1.00 57.88  ? 266  HOH A O     1 
HETATM 8049 O  O     . HOH R 7 .   ? 18.148 20.554  21.633  1.00 52.12  ? 267  HOH A O     1 
HETATM 8050 O  O     . HOH R 7 .   ? 42.152 -7.894  24.079  1.00 52.17  ? 268  HOH A O     1 
HETATM 8051 O  O     . HOH R 7 .   ? 41.988 -5.645  22.546  1.00 44.36  ? 269  HOH A O     1 
HETATM 8052 O  O     . HOH R 7 .   ? 34.165 -31.082 1.093   1.00 52.38  ? 270  HOH A O     1 
HETATM 8053 O  O     . HOH R 7 .   ? 52.697 -29.012 0.231   1.00 50.52  ? 271  HOH A O     1 
HETATM 8054 O  O     . HOH R 7 .   ? 38.854 11.093  -0.906  1.00 54.63  ? 272  HOH A O     1 
HETATM 8055 O  O     . HOH R 7 .   ? 54.639 -32.128 3.236   1.00 50.15  ? 273  HOH A O     1 
HETATM 8056 O  O     . HOH R 7 .   ? 22.487 11.865  -9.981  1.00 58.41  ? 274  HOH A O     1 
HETATM 8057 O  O     . HOH R 7 .   ? 45.164 12.593  6.898   1.00 55.36  ? 275  HOH A O     1 
HETATM 8058 O  O     . HOH R 7 .   ? 25.119 3.127   11.767  1.00 25.67  ? 276  HOH A O     1 
HETATM 8059 O  O     . HOH R 7 .   ? 18.373 -3.488  11.316  1.00 45.17  ? 277  HOH A O     1 
HETATM 8060 O  O     . HOH R 7 .   ? 18.578 22.334  7.935   1.00 57.39  ? 278  HOH A O     1 
HETATM 8061 O  O     . HOH R 7 .   ? 56.491 -11.943 8.431   1.00 53.89  ? 279  HOH A O     1 
HETATM 8062 O  O     . HOH R 7 .   ? 23.330 27.060  5.272   1.00 54.85  ? 280  HOH A O     1 
HETATM 8063 O  O     . HOH R 7 .   ? 43.207 6.800   27.711  1.00 51.29  ? 281  HOH A O     1 
HETATM 8064 O  O     . HOH R 7 .   ? 54.704 -16.402 14.834  1.00 42.30  ? 282  HOH A O     1 
HETATM 8065 O  O     . HOH R 7 .   ? 33.599 24.201  13.184  1.00 41.56  ? 283  HOH A O     1 
HETATM 8066 O  O     . HOH R 7 .   ? 9.863  7.797   13.915  1.00 52.74  ? 284  HOH A O     1 
HETATM 8067 O  O     . HOH R 7 .   ? 35.360 26.412  25.430  1.00 42.18  ? 285  HOH A O     1 
HETATM 8068 O  O     . HOH R 7 .   ? 22.270 23.312  18.204  1.00 46.20  ? 286  HOH A O     1 
HETATM 8069 O  O     . HOH R 7 .   ? 22.501 -23.561 -16.605 1.00 43.78  ? 287  HOH A O     1 
HETATM 8070 O  O     . HOH R 7 .   ? 19.048 -3.712  13.834  1.00 37.04  ? 288  HOH A O     1 
HETATM 8071 O  O     . HOH R 7 .   ? 58.773 -19.204 -0.169  1.00 45.35  ? 289  HOH A O     1 
HETATM 8072 O  O     . HOH R 7 .   ? 54.930 -19.468 9.818   1.00 53.86  ? 290  HOH A O     1 
HETATM 8073 O  O     . HOH R 7 .   ? 5.620  0.089   29.282  1.00 52.70  ? 291  HOH A O     1 
HETATM 8074 O  O     . HOH R 7 .   ? 22.035 25.752  -2.669  1.00 45.77  ? 292  HOH A O     1 
HETATM 8075 O  O     . HOH R 7 .   ? 36.612 -18.340 -15.865 1.00 54.71  ? 293  HOH A O     1 
HETATM 8076 O  O     . HOH R 7 .   ? 38.343 -33.610 1.215   1.00 48.61  ? 294  HOH A O     1 
HETATM 8077 O  O     . HOH R 7 .   ? 29.811 -4.156  36.080  1.00 49.56  ? 295  HOH A O     1 
HETATM 8078 O  O     . HOH R 7 .   ? 40.695 4.440   29.004  1.00 56.05  ? 296  HOH A O     1 
HETATM 8079 O  O     . HOH R 7 .   ? 52.899 -18.955 13.601  1.00 50.03  ? 297  HOH A O     1 
HETATM 8080 O  O     . HOH R 7 .   ? 54.465 -21.766 8.844   1.00 49.83  ? 298  HOH A O     1 
HETATM 8081 O  O     . HOH R 7 .   ? 27.329 3.404   36.315  1.00 59.04  ? 299  HOH A O     1 
HETATM 8082 O  O     . HOH R 7 .   ? 33.579 25.584  23.834  1.00 53.49  ? 300  HOH A O     1 
HETATM 8083 O  O     . HOH R 7 .   ? 52.289 -37.018 1.160   1.00 57.73  ? 301  HOH A O     1 
HETATM 8084 O  O     . HOH R 7 .   ? 49.355 -36.402 11.316  1.00 50.72  ? 302  HOH A O     1 
HETATM 8085 O  O     . HOH R 7 .   ? 52.962 -2.818  16.038  1.00 57.09  ? 303  HOH A O     1 
HETATM 8086 O  O     . HOH R 7 .   ? 26.835 25.886  22.659  1.00 54.71  ? 304  HOH A O     1 
HETATM 8087 O  O     . HOH R 7 .   ? 20.112 -12.902 34.017  1.00 54.15  ? 305  HOH A O     1 
HETATM 8088 O  O     . HOH R 7 .   ? 34.590 -15.807 19.961  1.00 52.93  ? 306  HOH A O     1 
HETATM 8089 O  O     . HOH R 7 .   ? 57.551 -25.774 5.819   1.00 41.08  ? 307  HOH A O     1 
HETATM 8090 O  O     . HOH R 7 .   ? 33.229 24.650  19.482  1.00 50.58  ? 308  HOH A O     1 
HETATM 8091 O  O     . HOH R 7 .   ? 44.958 8.341   6.577   1.00 48.58  ? 309  HOH A O     1 
HETATM 8092 O  O     . HOH R 7 .   ? 33.447 -2.010  -5.983  1.00 55.22  ? 310  HOH A O     1 
HETATM 8093 O  O     . HOH R 7 .   ? 4.790  5.988   3.281   1.00 52.62  ? 311  HOH A O     1 
HETATM 8094 O  O     . HOH R 7 .   ? 46.971 -6.839  -0.115  1.00 56.21  ? 312  HOH A O     1 
HETATM 8095 O  O     . HOH R 7 .   ? 27.118 -22.337 3.007   1.00 49.41  ? 313  HOH A O     1 
HETATM 8096 O  O     . HOH R 7 .   ? 28.809 25.929  -2.779  1.00 54.75  ? 314  HOH A O     1 
HETATM 8097 O  O     . HOH R 7 .   ? 46.534 -19.258 23.089  1.00 30.44  ? 315  HOH A O     1 
HETATM 8098 O  O     . HOH R 7 .   ? 14.260 19.987  -8.222  1.00 47.73  ? 316  HOH A O     1 
HETATM 8099 O  O     . HOH R 7 .   ? 9.992  10.181  -1.248  1.00 43.00  ? 317  HOH A O     1 
HETATM 8100 O  O     . HOH R 7 .   ? 46.963 11.451  13.464  1.00 46.84  ? 318  HOH A O     1 
HETATM 8101 O  O     . HOH R 7 .   ? 36.073 -8.190  22.224  1.00 48.92  ? 319  HOH A O     1 
HETATM 8102 O  O     . HOH R 7 .   ? 5.688  -3.943  18.117  1.00 46.43  ? 320  HOH A O     1 
HETATM 8103 O  O     . HOH R 7 .   ? 28.758 -11.825 32.066  1.00 43.36  ? 321  HOH A O     1 
HETATM 8104 O  O     . HOH R 7 .   ? 55.699 -8.617  18.849  1.00 49.78  ? 322  HOH A O     1 
HETATM 8105 O  O     . HOH R 7 .   ? 11.036 -4.486  9.341   1.00 59.66  ? 323  HOH A O     1 
HETATM 8106 O  O     . HOH R 7 .   ? 56.219 -19.575 11.834  1.00 57.83  ? 324  HOH A O     1 
HETATM 8107 O  O     . HOH R 7 .   ? 37.999 -6.898  26.442  1.00 52.66  ? 325  HOH A O     1 
HETATM 8108 O  O     . HOH R 7 .   ? 16.986 -9.727  31.316  1.00 49.87  ? 326  HOH A O     1 
HETATM 8109 O  O     . HOH R 7 .   ? 33.724 -26.731 6.276   1.00 53.21  ? 327  HOH A O     1 
HETATM 8110 O  O     . HOH R 7 .   ? 12.021 2.631   -3.591  1.00 52.95  ? 328  HOH A O     1 
HETATM 8111 O  O     . HOH R 7 .   ? 19.272 -7.838  31.893  1.00 51.77  ? 329  HOH A O     1 
HETATM 8112 O  O     . HOH R 7 .   ? 24.000 -14.119 35.308  1.00 45.27  ? 330  HOH A O     1 
HETATM 8113 O  O     . HOH R 7 .   ? 25.917 5.373   10.515  1.00 51.74  ? 331  HOH A O     1 
HETATM 8114 O  O     . HOH R 7 .   ? 23.095 22.731  20.970  1.00 43.44  ? 332  HOH A O     1 
HETATM 8115 O  O     . HOH R 7 .   ? 31.083 -0.380  31.319  1.00 52.29  ? 333  HOH A O     1 
HETATM 8116 O  O     . HOH R 7 .   ? 52.005 -18.840 16.757  1.00 54.00  ? 334  HOH A O     1 
HETATM 8117 O  O     . HOH R 7 .   ? 29.798 -22.300 -19.008 1.00 55.50  ? 335  HOH A O     1 
HETATM 8118 O  O     . HOH R 7 .   ? 14.500 -9.848  27.899  1.00 47.66  ? 336  HOH A O     1 
HETATM 8119 O  O     . HOH R 7 .   ? 15.038 23.163  16.686  1.00 51.56  ? 337  HOH A O     1 
HETATM 8120 O  O     . HOH R 7 .   ? 22.577 6.986   40.950  1.00 53.44  ? 338  HOH A O     1 
HETATM 8121 O  O     . HOH R 7 .   ? 51.341 -16.697 19.479  1.00 48.31  ? 339  HOH A O     1 
HETATM 8122 O  O     . HOH R 7 .   ? 35.743 -28.346 5.429   1.00 51.38  ? 340  HOH A O     1 
HETATM 8123 O  O     . HOH R 7 .   ? 30.440 -33.571 -6.934  1.00 54.00  ? 341  HOH A O     1 
HETATM 8124 O  O     . HOH R 7 .   ? 16.323 22.566  -3.135  1.00 49.09  ? 342  HOH A O     1 
HETATM 8125 O  O     . HOH R 7 .   ? 40.556 26.073  17.690  1.00 49.95  ? 343  HOH A O     1 
HETATM 8126 O  O     . HOH R 7 .   ? 53.988 -3.753  13.788  1.00 51.87  ? 344  HOH A O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 16  ? 1.3355 0.8804 0.8487 0.0575  -0.0512 0.0157  886  SER A N   
2    C CA  . SER A 16  ? 1.3787 0.9263 0.8941 0.0628  -0.0462 0.0150  886  SER A CA  
3    C C   . SER A 16  ? 1.2940 0.8449 0.8144 0.0674  -0.0539 0.0160  886  SER A C   
4    O O   . SER A 16  ? 1.3460 0.9014 0.8741 0.0728  -0.0593 0.0164  886  SER A O   
5    C CB  . SER A 16  ? 1.2762 0.8292 0.7984 0.0703  -0.0378 0.0137  886  SER A CB  
6    O OG  . SER A 16  ? 1.4010 0.9599 0.9324 0.0770  -0.0418 0.0142  886  SER A OG  
11   N N   . VAL A 17  ? 1.0330 0.5815 0.5490 0.0651  -0.0540 0.0162  887  VAL A N   
12   C CA  . VAL A 17  ? 1.1341 0.6843 0.6533 0.0677  -0.0617 0.0172  887  VAL A CA  
13   C C   . VAL A 17  ? 0.9635 0.5182 0.4872 0.0749  -0.0571 0.0163  887  VAL A C   
14   O O   . VAL A 17  ? 1.1951 0.7480 0.7143 0.0732  -0.0499 0.0158  887  VAL A O   
15   C CB  . VAL A 17  ? 1.0423 0.5862 0.5530 0.0591  -0.0664 0.0186  887  VAL A CB  
16   C CG1 . VAL A 17  ? 0.9562 0.5016 0.4706 0.0619  -0.0742 0.0197  887  VAL A CG1 
17   C CG2 . VAL A 17  ? 0.9947 0.5340 0.5001 0.0513  -0.0712 0.0198  887  VAL A CG2 
27   N N   . SER A 18  ? 0.9052 0.4660 0.4378 0.0828  -0.0611 0.0161  888  SER A N   
28   C CA  . SER A 18  ? 0.9515 0.5170 0.4886 0.0895  -0.0578 0.0153  888  SER A CA  
29   C C   . SER A 18  ? 0.7990 0.3619 0.3333 0.0869  -0.0632 0.0162  888  SER A C   
30   O O   . SER A 18  ? 0.8744 0.4359 0.4097 0.0853  -0.0723 0.0172  888  SER A O   
31   C CB  . SER A 18  ? 1.0060 0.5794 0.5536 0.0989  -0.0599 0.0146  888  SER A CB  
32   O OG  . SER A 18  ? 0.9931 0.5715 0.5448 0.1053  -0.0567 0.0138  888  SER A OG  
38   N N   . ILE A 19  ? 0.7951 0.3572 0.3261 0.0864  -0.0575 0.0160  889  ILE A N   
39   C CA  . ILE A 19  ? 0.8450 0.4044 0.3728 0.0836  -0.0618 0.0170  889  ILE A CA  
40   C C   . ILE A 19  ? 0.7418 0.3070 0.2763 0.0913  -0.0616 0.0164  889  ILE A C   
41   O O   . ILE A 19  ? 0.7655 0.3291 0.2982 0.0899  -0.0644 0.0171  889  ILE A O   
42   C CB  . ILE A 19  ? 0.7524 0.3058 0.2704 0.0760  -0.0563 0.0176  889  ILE A CB  
43   C CG1 . ILE A 19  ? 0.7489 0.3048 0.2674 0.0795  -0.0452 0.0165  889  ILE A CG1 
44   C CG2 . ILE A 19  ? 0.7603 0.3080 0.2712 0.0679  -0.0568 0.0180  889  ILE A CG2 
45   C CD1 . ILE A 19  ? 0.7651 0.3158 0.2749 0.0730  -0.0395 0.0168  889  ILE A CD1 
57   N N   . TYR A 20  ? 0.7302 0.3021 0.2721 0.0993  -0.0583 0.0151  890  TYR A N   
58   C CA  . TYR A 20  ? 0.7231 0.3012 0.2713 0.1068  -0.0575 0.0143  890  TYR A CA  
59   C C   . TYR A 20  ? 0.8305 0.4141 0.3875 0.1134  -0.0646 0.0134  890  TYR A C   
60   O O   . TYR A 20  ? 0.7279 0.3130 0.2878 0.1147  -0.0663 0.0131  890  TYR A O   
61   C CB  . TYR A 20  ? 0.7240 0.3065 0.2740 0.1113  -0.0470 0.0137  890  TYR A CB  
62   C CG  . TYR A 20  ? 0.7305 0.3080 0.2728 0.1055  -0.0393 0.0143  890  TYR A CG  
63   C CD1 . TYR A 20  ? 0.8777 0.4537 0.4170 0.1039  -0.0383 0.0149  890  TYR A CD1 
64   C CD2 . TYR A 20  ? 0.8358 0.4102 0.3740 0.1016  -0.0331 0.0142  890  TYR A CD2 
65   C CE1 . TYR A 20  ? 0.8505 0.4220 0.3829 0.0987  -0.0311 0.0155  890  TYR A CE1 
66   C CE2 . TYR A 20  ? 0.8283 0.3980 0.3595 0.0963  -0.0259 0.0145  890  TYR A CE2 
67   C CZ  . TYR A 20  ? 0.9305 0.4989 0.4589 0.0950  -0.0248 0.0151  890  TYR A CZ  
68   O OH  . TYR A 20  ? 0.8354 0.3993 0.3569 0.0898  -0.0175 0.0154  890  TYR A OH  
78   N N   . PRO A 21  ? 0.7509 0.3378 0.3121 0.1176  -0.0687 0.0129  891  PRO A N   
79   C CA  . PRO A 21  ? 0.7764 0.3687 0.3462 0.1242  -0.0752 0.0117  891  PRO A CA  
80   C C   . PRO A 21  ? 0.8042 0.4045 0.3804 0.1321  -0.0698 0.0103  891  PRO A C   
81   O O   . PRO A 21  ? 0.7370 0.3393 0.3119 0.1334  -0.0610 0.0104  891  PRO A O   
82   C CB  . PRO A 21  ? 0.7644 0.3579 0.3362 0.1262  -0.0792 0.0113  891  PRO A CB  
83   C CG  . PRO A 21  ? 0.7087 0.3006 0.2752 0.1239  -0.0718 0.0121  891  PRO A CG  
84   C CD  . PRO A 21  ? 0.8328 0.4188 0.3915 0.1168  -0.0668 0.0134  891  PRO A CD  
92   N N   . SER A 22  ? 0.7433 0.3482 0.3266 0.1371  -0.0749 0.0092  892  SER A N   
93   C CA  . SER A 22  ? 0.7197 0.3330 0.3097 0.1451  -0.0705 0.0079  892  SER A CA  
94   C C   . SER A 22  ? 0.6844 0.3039 0.2784 0.1513  -0.0686 0.0068  892  SER A C   
95   O O   . SER A 22  ? 0.7504 0.3679 0.3433 0.1500  -0.0727 0.0067  892  SER A O   
96   C CB  . SER A 22  ? 0.7238 0.3401 0.3201 0.1486  -0.0769 0.0070  892  SER A CB  
97   O OG  . SER A 22  ? 0.7389 0.3568 0.3397 0.1514  -0.0849 0.0058  892  SER A OG  
103  N N   . SER A 23  ? 0.6868 0.3142 0.2856 0.1579  -0.0625 0.0061  893  SER A N   
104  C CA  . SER A 23  ? 0.7474 0.3816 0.3502 0.1639  -0.0603 0.0051  893  SER A CA  
105  C C   . SER A 23  ? 0.7687 0.4060 0.3770 0.1680  -0.0691 0.0032  893  SER A C   
106  O O   . SER A 23  ? 0.7812 0.4203 0.3905 0.1699  -0.0705 0.0024  893  SER A O   
107  C CB  . SER A 23  ? 0.7381 0.3807 0.3454 0.1703  -0.0524 0.0050  893  SER A CB  
108  O OG  . SER A 23  ? 0.7013 0.3493 0.3148 0.1753  -0.0554 0.0038  893  SER A OG  
114  N N   . ALA A 24  ? 0.7294 0.3671 0.3414 0.1692  -0.0749 0.0023  894  ALA A N   
115  C CA  . ALA A 24  ? 0.7532 0.3933 0.3708 0.1728  -0.0835 0.0003  894  ALA A CA  
116  C C   . ALA A 24  ? 0.7379 0.3707 0.3519 0.1673  -0.0899 0.0008  894  ALA A C   
117  O O   . ALA A 24  ? 0.7392 0.3741 0.3568 0.1701  -0.0949 -0.0008 894  ALA A O   
118  C CB  . ALA A 24  ? 0.7808 0.4219 0.4027 0.1743  -0.0881 -0.0003 894  ALA A CB  
124  N N   . GLU A 25  ? 0.7329 0.3573 0.3397 0.1592  -0.0899 0.0030  895  GLU A N   
125  C CA  . GLU A 25  ? 0.8767 0.4939 0.4795 0.1532  -0.0956 0.0040  895  GLU A CA  
126  C C   . GLU A 25  ? 0.8206 0.4383 0.4208 0.1533  -0.0917 0.0042  895  GLU A C   
127  O O   . GLU A 25  ? 0.7144 0.3305 0.3154 0.1526  -0.0971 0.0039  895  GLU A O   
128  C CB  . GLU A 25  ? 0.8168 0.4255 0.4123 0.1445  -0.0960 0.0064  895  GLU A CB  
129  C CG  . GLU A 25  ? 0.8253 0.4318 0.4232 0.1429  -0.1031 0.0066  895  GLU A CG  
130  C CD  . GLU A 25  ? 0.9726 0.5713 0.5629 0.1342  -0.1029 0.0090  895  GLU A CD  
131  O OE1 . GLU A 25  ? 0.8013 0.3981 0.3856 0.1310  -0.0952 0.0099  895  GLU A OE1 
132  O OE2 . GLU A 25  ? 0.8621 0.4568 0.4527 0.1305  -0.1104 0.0099  895  GLU A OE2 
139  N N   . VAL A 26  ? 0.7854 0.4055 0.3831 0.1541  -0.0824 0.0048  896  VAL A N   
140  C CA  . VAL A 26  ? 0.8119 0.4330 0.4075 0.1544  -0.0780 0.0053  896  VAL A CA  
141  C C   . VAL A 26  ? 0.7624 0.3910 0.3651 0.1618  -0.0807 0.0031  896  VAL A C   
142  O O   . VAL A 26  ? 0.7711 0.3987 0.3734 0.1612  -0.0832 0.0030  896  VAL A O   
143  C CB  . VAL A 26  ? 0.7831 0.4063 0.3759 0.1548  -0.0671 0.0063  896  VAL A CB  
144  C CG1 . VAL A 26  ? 0.7214 0.3467 0.3133 0.1560  -0.0626 0.0068  896  VAL A CG1 
145  C CG2 . VAL A 26  ? 0.7183 0.3337 0.3036 0.1470  -0.0641 0.0082  896  VAL A CG2 
155  N N   . LEU A 27  ? 0.7359 0.3720 0.3450 0.1686  -0.0803 0.0013  897  LEU A N   
156  C CA  . LEU A 27  ? 0.8193 0.4635 0.4352 0.1760  -0.0824 -0.0011 897  LEU A CA  
157  C C   . LEU A 27  ? 0.8696 0.5112 0.4884 0.1756  -0.0926 -0.0027 897  LEU A C   
158  O O   . LEU A 27  ? 0.7935 0.4372 0.4144 0.1777  -0.0949 -0.0038 897  LEU A O   
159  C CB  . LEU A 27  ? 0.8513 0.5039 0.4732 0.1830  -0.0799 -0.0026 897  LEU A CB  
160  C CG  . LEU A 27  ? 1.1332 0.7949 0.7626 0.1911  -0.0826 -0.0055 897  LEU A CG  
161  C CD1 . LEU A 27  ? 1.1471 0.8117 0.7763 0.1926  -0.0807 -0.0058 897  LEU A CD1 
162  C CD2 . LEU A 27  ? 0.9706 0.6412 0.6047 0.1975  -0.0777 -0.0063 897  LEU A CD2 
174  N N   . LYS A 28  ? 0.7210 0.3578 0.3400 0.1726  -0.0986 -0.0026 898  LYS A N   
175  C CA  . LYS A 28  ? 0.8239 0.4578 0.4462 0.1720  -0.1085 -0.0038 898  LYS A CA  
176  C C   . LYS A 28  ? 0.8769 0.5047 0.4949 0.1665  -0.1110 -0.0023 898  LYS A C   
177  O O   . LYS A 28  ? 0.8159 0.4440 0.4375 0.1680  -0.1171 -0.0037 898  LYS A O   
178  C CB  . LYS A 28  ? 0.9227 0.5521 0.5455 0.1688  -0.1139 -0.0031 898  LYS A CB  
179  C CG  . LYS A 28  ? 1.0091 0.6370 0.6376 0.1696  -0.1242 -0.0047 898  LYS A CG  
180  C CD  . LYS A 28  ? 1.1278 0.7521 0.7573 0.1670  -0.1289 -0.0038 898  LYS A CD  
181  C CE  . LYS A 28  ? 1.1357 0.7574 0.7707 0.1668  -0.1392 -0.0048 898  LYS A CE  
182  N NZ  . LYS A 28  ? 0.9988 0.6279 0.6424 0.1750  -0.1419 -0.0087 898  LYS A NZ  
196  N N   . ALA A 29  ? 0.8814 0.5038 0.4917 0.1603  -0.1061 0.0005  899  ALA A N   
197  C CA  . ALA A 29  ? 0.9549 0.5714 0.5603 0.1547  -0.1077 0.0022  899  ALA A CA  
198  C C   . ALA A 29  ? 0.9502 0.5717 0.5574 0.1587  -0.1048 0.0013  899  ALA A C   
199  O O   . ALA A 29  ? 0.9246 0.5434 0.5317 0.1568  -0.1092 0.0015  899  ALA A O   
200  C CB  . ALA A 29  ? 1.0016 0.6118 0.5983 0.1474  -0.1023 0.0052  899  ALA A CB  
206  N N   . CYS A 30  ? 0.7305 0.3593 0.3396 0.1642  -0.0974 0.0004  900  CYS A N   
207  C CA  . CYS A 30  ? 0.9478 0.5820 0.5587 0.1682  -0.0941 -0.0003 900  CYS A CA  
208  C C   . CYS A 30  ? 1.1017 0.7412 0.7201 0.1741  -0.1008 -0.0035 900  CYS A C   
209  O O   . CYS A 30  ? 0.9664 0.6090 0.5864 0.1762  -0.1008 -0.0041 900  CYS A O   
210  C CB  . CYS A 30  ? 0.9753 0.6163 0.5865 0.1724  -0.0843 -0.0001 900  CYS A CB  
211  S SG  . CYS A 30  ? 0.8750 0.5104 0.4778 0.1660  -0.0751 0.0033  900  CYS A SG  
217  N N   . ARG A 31  ? 1.1157 0.7564 0.7389 0.1766  -0.1064 -0.0055 901  ARG A N   
218  C CA  . ARG A 31  ? 1.3087 0.9548 0.9395 0.1826  -0.1123 -0.0089 901  ARG A CA  
219  C C   . ARG A 31  ? 1.3454 0.9860 0.9774 0.1795  -0.1211 -0.0094 901  ARG A C   
220  O O   . ARG A 31  ? 1.4726 1.1171 1.1109 0.1840  -0.1263 -0.0124 901  ARG A O   
221  C CB  . ARG A 31  ? 1.3208 0.9709 0.9568 0.1870  -0.1144 -0.0111 901  ARG A CB  
222  C CG  . ARG A 31  ? 1.4131 1.0712 1.0501 0.1921  -0.1062 -0.0113 901  ARG A CG  
223  C CD  . ARG A 31  ? 1.5063 1.1705 1.1499 0.1981  -0.1087 -0.0141 901  ARG A CD  
224  N NE  . ARG A 31  ? 1.4301 1.1017 1.0745 0.2026  -0.1008 -0.0138 901  ARG A NE  
225  C CZ  . ARG A 31  ? 1.5153 1.1955 1.1618 0.2080  -0.0956 -0.0147 901  ARG A CZ  
226  N NH1 . ARG A 31  ? 1.5377 1.2201 1.1855 0.2096  -0.0976 -0.0161 901  ARG A NH1 
227  N NH2 . ARG A 31  ? 1.4148 1.1016 1.0623 0.2116  -0.0886 -0.0140 901  ARG A NH2 
241  N N   . ASN A 32  ? 1.3251 0.9570 0.9515 0.1719  -0.1228 -0.0064 902  ASN A N   
242  C CA  . ASN A 32  ? 1.5020 1.1285 1.1292 0.1684  -0.1306 -0.0061 902  ASN A CA  
243  C C   . ASN A 32  ? 1.5826 1.2134 1.2123 0.1718  -0.1305 -0.0076 902  ASN A C   
244  O O   . ASN A 32  ? 1.5559 1.1842 1.1811 0.1682  -0.1276 -0.0054 902  ASN A O   
245  C CB  . ASN A 32  ? 1.4925 1.1099 1.1120 0.1594  -0.1306 -0.0021 902  ASN A CB  
246  C CG  . ASN A 32  ? 1.6161 1.2281 1.2337 0.1551  -0.1337 -0.0007 902  ASN A CG  
247  O OD1 . ASN A 32  ? 1.5199 1.1254 1.1306 0.1480  -0.1324 0.0025  902  ASN A OD1 
248  N ND2 . ASN A 32  ? 1.5901 1.2050 1.2138 0.1592  -0.1377 -0.0029 902  ASN A ND2 
255  N N   . ASN A 40  ? 1.2274 0.8070 0.8348 0.1248  -0.1614 0.0111  910  ASN A N   
256  C CA  . ASN A 40  ? 1.3837 0.9628 0.9880 0.1235  -0.1584 0.0116  910  ASN A CA  
257  C C   . ASN A 40  ? 1.1950 0.7703 0.7889 0.1170  -0.1514 0.0146  910  ASN A C   
258  O O   . ASN A 40  ? 0.9189 0.4933 0.5083 0.1150  -0.1473 0.0157  910  ASN A O   
259  C CB  . ASN A 40  ? 1.4631 1.0496 1.0719 0.1316  -0.1539 0.0081  910  ASN A CB  
260  C CG  . ASN A 40  ? 1.5534 1.1449 1.1721 0.1388  -0.1592 0.0045  910  ASN A CG  
261  O OD1 . ASN A 40  ? 1.6069 1.2053 1.2290 0.1457  -0.1549 0.0015  910  ASN A OD1 
262  N ND2 . ASN A 40  ? 1.5373 1.1254 1.1607 0.1372  -0.1684 0.0048  910  ASN A ND2 
268  N N   . SER A 41  ? 1.0639 0.6370 0.6541 0.1138  -0.1499 0.0157  911  SER A N   
269  C CA  . SER A 41  ? 1.1466 0.7158 0.7268 0.1074  -0.1434 0.0182  911  SER A CA  
270  C C   . SER A 41  ? 1.0904 0.6640 0.6680 0.1112  -0.1327 0.0166  911  SER A C   
271  O O   . SER A 41  ? 0.8508 0.4305 0.4340 0.1185  -0.1303 0.0139  911  SER A O   
272  C CB  . SER A 41  ? 0.8431 0.4085 0.4203 0.1025  -0.1457 0.0198  911  SER A CB  
273  O OG  . SER A 41  ? 0.8228 0.3926 0.4054 0.1082  -0.1451 0.0175  911  SER A OG  
279  N N   . SER A 42  ? 0.8429 0.4134 0.4123 0.1062  -0.1264 0.0185  912  SER A N   
280  C CA  . SER A 42  ? 0.9716 0.5456 0.5383 0.1089  -0.1159 0.0176  912  SER A CA  
281  C C   . SER A 42  ? 1.0228 0.5965 0.5864 0.1079  -0.1110 0.0174  912  SER A C   
282  O O   . SER A 42  ? 1.0172 0.5863 0.5776 0.1025  -0.1146 0.0189  912  SER A O   
283  C CB  . SER A 42  ? 1.1663 0.7368 0.7257 0.1037  -0.1112 0.0197  912  SER A CB  
284  O OG  . SER A 42  ? 1.1500 0.7196 0.7116 0.1032  -0.1167 0.0205  912  SER A OG  
290  N N   . ILE A 43  ? 0.8297 0.4084 0.3944 0.1129  -0.1029 0.0159  913  ILE A N   
291  C CA  . ILE A 43  ? 1.0079 0.5861 0.5693 0.1115  -0.0971 0.0159  913  ILE A CA  
292  C C   . ILE A 43  ? 1.0498 0.6240 0.6023 0.1058  -0.0891 0.0175  913  ILE A C   
293  O O   . ILE A 43  ? 0.8452 0.4152 0.3920 0.1004  -0.0869 0.0184  913  ILE A O   
294  C CB  . ILE A 43  ? 1.0113 0.5971 0.5789 0.1198  -0.0927 0.0135  913  ILE A CB  
295  C CG1 . ILE A 43  ? 1.2217 0.8132 0.7917 0.1252  -0.0865 0.0126  913  ILE A CG1 
296  C CG2 . ILE A 43  ? 1.0972 0.6864 0.6729 0.1247  -0.1006 0.0119  913  ILE A CG2 
297  C CD1 . ILE A 43  ? 1.2323 0.8314 0.8077 0.1328  -0.0811 0.0108  913  ILE A CD1 
309  N N   . LEU A 44  ? 0.8165 0.3919 0.3680 0.1068  -0.0847 0.0178  914  LEU A N   
310  C CA  . LEU A 44  ? 1.1465 0.7178 0.6897 0.1010  -0.0776 0.0194  914  LEU A CA  
311  C C   . LEU A 44  ? 1.1624 0.7334 0.7045 0.1003  -0.0769 0.0204  914  LEU A C   
312  O O   . LEU A 44  ? 1.1373 0.7126 0.6855 0.1055  -0.0801 0.0196  914  LEU A O   
313  C CB  . LEU A 44  ? 1.2164 0.7904 0.7587 0.1034  -0.0671 0.0185  914  LEU A CB  
314  C CG  . LEU A 44  ? 1.2050 0.7872 0.7543 0.1122  -0.0622 0.0169  914  LEU A CG  
315  C CD1 . LEU A 44  ? 1.2515 0.8369 0.8044 0.1157  -0.0643 0.0169  914  LEU A CD1 
316  C CD2 . LEU A 44  ? 1.3049 0.8879 0.8513 0.1122  -0.0510 0.0171  914  LEU A CD2 
328  N N   . LEU A 45  ? 1.0711 0.6369 0.6051 0.0936  -0.0726 0.0222  915  LEU A N   
329  C CA  . LEU A 45  ? 1.1909 0.7561 0.7230 0.0923  -0.0707 0.0235  915  LEU A CA  
330  C C   . LEU A 45  ? 1.4910 1.0613 1.0251 0.0975  -0.0611 0.0227  915  LEU A C   
331  O O   . LEU A 45  ? 1.4844 1.0536 1.0143 0.0956  -0.0526 0.0229  915  LEU A O   
332  C CB  . LEU A 45  ? 1.1467 0.7047 0.6693 0.0830  -0.0696 0.0258  915  LEU A CB  
333  C CG  . LEU A 45  ? 1.1363 0.6928 0.6557 0.0803  -0.0673 0.0276  915  LEU A CG  
334  C CD1 . LEU A 45  ? 1.1805 0.7391 0.7057 0.0832  -0.0752 0.0280  915  LEU A CD1 
335  C CD2 . LEU A 45  ? 1.1917 0.7411 0.7014 0.0708  -0.0669 0.0296  915  LEU A CD2 
347  N N   . ASP A 46  ? 1.6191 1.1952 1.1601 0.1040  -0.0625 0.0220  916  ASP A N   
348  C CA  . ASP A 46  ? 1.7678 1.3499 1.3119 0.1097  -0.0540 0.0214  916  ASP A CA  
349  C C   . ASP A 46  ? 1.8018 1.3822 1.3419 0.1068  -0.0489 0.0233  916  ASP A C   
350  O O   . ASP A 46  ? 1.8035 1.3874 1.3445 0.1097  -0.0405 0.0234  916  ASP A O   
351  C CB  . ASP A 46  ? 1.8039 1.3937 1.3572 0.1182  -0.0574 0.0195  916  ASP A CB  
352  C CG  . ASP A 46  ? 1.8927 1.4819 1.4491 0.1184  -0.0674 0.0194  916  ASP A CG  
353  O OD1 . ASP A 46  ? 1.9010 1.4865 1.4540 0.1140  -0.0690 0.0212  916  ASP A OD1 
354  O OD2 . ASP A 46  ? 1.8616 1.4542 1.4241 0.1229  -0.0736 0.0175  916  ASP A OD2 
359  N N   . LYS A 47  ? 1.8918 1.4669 1.4278 0.1010  -0.0541 0.0249  917  LYS A N   
360  C CA  . LYS A 47  ? 1.8181 1.3902 1.3486 0.0965  -0.0489 0.0270  917  LYS A CA  
361  C C   . LYS A 47  ? 1.7114 1.2797 1.2352 0.0920  -0.0408 0.0272  917  LYS A C   
362  O O   . LYS A 47  ? 1.6910 1.2551 1.2109 0.0877  -0.0433 0.0269  917  LYS A O   
363  C CB  . LYS A 47  ? 1.7374 1.3041 1.2642 0.0903  -0.0563 0.0289  917  LYS A CB  
364  C CG  . LYS A 47  ? 1.7268 1.2959 1.2602 0.0937  -0.0661 0.0285  917  LYS A CG  
365  C CD  . LYS A 47  ? 1.7818 1.3574 1.3214 0.1003  -0.0638 0.0280  917  LYS A CD  
366  C CE  . LYS A 47  ? 1.8289 1.4029 1.3686 0.0980  -0.0686 0.0299  917  LYS A CE  
367  N NZ  . LYS A 47  ? 1.7733 1.3539 1.3197 0.1047  -0.0678 0.0292  917  LYS A NZ  
381  N N   . CYS A 48  ? 1.6458 1.2157 1.1685 0.0930  -0.0310 0.0276  918  CYS A N   
382  C CA  . CYS A 48  ? 1.5458 1.1123 1.0627 0.0892  -0.0226 0.0275  918  CYS A CA  
383  C C   . CYS A 48  ? 1.5034 1.0667 1.0146 0.0846  -0.0159 0.0292  918  CYS A C   
384  O O   . CYS A 48  ? 1.5567 1.1232 1.0709 0.0874  -0.0140 0.0303  918  CYS A O   
385  C CB  . CYS A 48  ? 1.4764 1.0485 0.9986 0.0955  -0.0158 0.0260  918  CYS A CB  
386  S SG  . CYS A 48  ? 1.7563 1.3279 1.2793 0.0961  -0.0188 0.0240  918  CYS A SG  
392  N N   . PRO A 49  ? 1.4173 0.9745 0.9205 0.0775  -0.0123 0.0294  919  PRO A N   
393  C CA  . PRO A 49  ? 1.4020 0.9559 0.8994 0.0728  -0.0056 0.0309  919  PRO A CA  
394  C C   . PRO A 49  ? 1.4323 0.9907 0.9337 0.0778  0.0049  0.0307  919  PRO A C   
395  O O   . PRO A 49  ? 1.2726 0.8322 0.7753 0.0799  0.0108  0.0293  919  PRO A O   
396  C CB  . PRO A 49  ? 1.2632 0.8104 0.7517 0.0649  -0.0035 0.0304  919  PRO A CB  
397  C CG  . PRO A 49  ? 1.2653 0.8120 0.7549 0.0652  -0.0102 0.0290  919  PRO A CG  
398  C CD  . PRO A 49  ? 1.3918 0.9454 0.8911 0.0740  -0.0128 0.0281  919  PRO A CD  
406  N N   . PRO A 50  ? 1.4372 0.9981 0.9407 0.0797  0.0070  0.0324  920  PRO A N   
407  C CA  . PRO A 50  ? 1.3602 0.9261 0.8686 0.0849  0.0163  0.0327  920  PRO A CA  
408  C C   . PRO A 50  ? 1.3111 0.8732 0.8141 0.0807  0.0271  0.0328  920  PRO A C   
409  O O   . PRO A 50  ? 1.1557 0.7117 0.6509 0.0735  0.0275  0.0335  920  PRO A O   
410  C CB  . PRO A 50  ? 1.3844 0.9534 0.8960 0.0871  0.0137  0.0347  920  PRO A CB  
411  C CG  . PRO A 50  ? 1.5046 1.0677 1.0099 0.0802  0.0068  0.0358  920  PRO A CG  
412  C CD  . PRO A 50  ? 1.4878 1.0472 0.9899 0.0770  0.0004  0.0343  920  PRO A CD  
420  N N   . PRO A 51  ? 1.1322 0.6980 0.6395 0.0852  0.0358  0.0323  921  PRO A N   
421  C CA  . PRO A 51  ? 1.1812 0.7435 0.6845 0.0818  0.0465  0.0320  921  PRO A CA  
422  C C   . PRO A 51  ? 1.3233 0.8834 0.8231 0.0783  0.0515  0.0339  921  PRO A C   
423  O O   . PRO A 51  ? 1.2578 0.8215 0.7612 0.0811  0.0494  0.0358  921  PRO A O   
424  C CB  . PRO A 51  ? 1.0573 0.6260 0.5687 0.0891  0.0534  0.0316  921  PRO A CB  
425  C CG  . PRO A 51  ? 0.9694 0.5455 0.4886 0.0962  0.0479  0.0325  921  PRO A CG  
426  C CD  . PRO A 51  ? 1.1810 0.7550 0.6979 0.0940  0.0360  0.0320  921  PRO A CD  
434  N N   . ARG A 52  ? 1.1256 0.6799 0.6184 0.0722  0.0582  0.0333  922  ARG A N   
435  C CA  . ARG A 52  ? 1.1676 0.7195 0.6568 0.0685  0.0642  0.0349  922  ARG A CA  
436  C C   . ARG A 52  ? 1.2244 0.7720 0.7093 0.0648  0.0748  0.0334  922  ARG A C   
437  O O   . ARG A 52  ? 1.1673 0.7117 0.6489 0.0622  0.0750  0.0312  922  ARG A O   
438  C CB  . ARG A 52  ? 0.9562 0.5034 0.4381 0.0620  0.0567  0.0360  922  ARG A CB  
439  C CG  . ARG A 52  ? 1.2944 0.8400 0.7733 0.0588  0.0617  0.0381  922  ARG A CG  
440  C CD  . ARG A 52  ? 1.5194 1.0614 0.9923 0.0530  0.0535  0.0396  922  ARG A CD  
441  N NE  . ARG A 52  ? 1.6024 1.1386 1.0674 0.0464  0.0489  0.0380  922  ARG A NE  
442  C CZ  . ARG A 52  ? 1.5818 1.1169 1.0454 0.0446  0.0379  0.0384  922  ARG A CZ  
443  N NH1 . ARG A 52  ? 1.5494 1.0885 1.0189 0.0488  0.0302  0.0399  922  ARG A NH1 
444  N NH2 . ARG A 52  ? 1.5494 1.0795 1.0058 0.0383  0.0346  0.0372  922  ARG A NH2 
458  N N   . PRO A 53  ? 1.1016 0.6492 0.5867 0.0644  0.0838  0.0346  923  PRO A N   
459  C CA  . PRO A 53  ? 0.9869 0.5304 0.4685 0.0610  0.0943  0.0330  923  PRO A CA  
460  C C   . PRO A 53  ? 1.0356 0.5712 0.5058 0.0517  0.0931  0.0316  923  PRO A C   
461  O O   . PRO A 53  ? 1.0224 0.5559 0.4877 0.0475  0.0890  0.0331  923  PRO A O   
462  C CB  . PRO A 53  ? 0.9654 0.5115 0.4510 0.0634  0.1032  0.0351  923  PRO A CB  
463  C CG  . PRO A 53  ? 0.9574 0.5099 0.4495 0.0689  0.0971  0.0378  923  PRO A CG  
464  C CD  . PRO A 53  ? 1.0205 0.5716 0.5091 0.0668  0.0847  0.0375  923  PRO A CD  
472  N N   . PRO A 54  ? 1.0487 0.5803 0.5149 0.0483  0.0967  0.0288  924  PRO A N   
473  C CA  . PRO A 54  ? 0.9954 0.5198 0.4505 0.0392  0.0946  0.0273  924  PRO A CA  
474  C C   . PRO A 54  ? 0.8548 0.3755 0.3038 0.0338  0.1013  0.0279  924  PRO A C   
475  O O   . PRO A 54  ? 1.0566 0.5789 0.5096 0.0365  0.1106  0.0284  924  PRO A O   
476  C CB  . PRO A 54  ? 0.9445 0.4664 0.3985 0.0381  0.0993  0.0241  924  PRO A CB  
477  C CG  . PRO A 54  ? 0.9017 0.4279 0.3648 0.0450  0.1084  0.0242  924  PRO A CG  
478  C CD  . PRO A 54  ? 0.8519 0.3852 0.3235 0.0523  0.1038  0.0271  924  PRO A CD  
486  N N   . SER A 55  ? 0.9512 0.4671 0.3907 0.0262  0.0965  0.0279  925  SER A N   
487  C CA  . SER A 55  ? 0.9576 0.4695 0.3901 0.0201  0.1030  0.0281  925  SER A CA  
488  C C   . SER A 55  ? 1.0077 0.5153 0.4361 0.0166  0.1126  0.0246  925  SER A C   
489  O O   . SER A 55  ? 0.9080 0.4153 0.3381 0.0180  0.1128  0.0224  925  SER A O   
490  C CB  . SER A 55  ? 1.1613 0.6697 0.5847 0.0128  0.0948  0.0292  925  SER A CB  
491  O OG  . SER A 55  ? 1.2050 0.7096 0.6221 0.0078  0.0897  0.0271  925  SER A OG  
497  N N   . SER A 56  ? 0.9628 0.4670 0.3859 0.0119  0.1207  0.0242  926  SER A N   
498  C CA  . SER A 56  ? 0.9487 0.4486 0.3680 0.0083  0.1306  0.0206  926  SER A CA  
499  C C   . SER A 56  ? 0.9508 0.4463 0.3623 0.0025  0.1258  0.0178  926  SER A C   
500  O O   . SER A 56  ? 0.9987 0.4920 0.4027 -0.0031 0.1176  0.0185  926  SER A O   
501  C CB  . SER A 56  ? 1.1743 0.6708 0.5875 0.0031  0.1386  0.0205  926  SER A CB  
502  O OG  . SER A 56  ? 1.0608 0.5542 0.4733 0.0016  0.1500  0.0171  926  SER A OG  
508  N N   . PRO A 57  ? 0.9611 0.4555 0.3748 0.0038  0.1308  0.0147  927  PRO A N   
509  C CA  . PRO A 57  ? 0.8686 0.3593 0.2761 -0.0011 0.1263  0.0120  927  PRO A CA  
510  C C   . PRO A 57  ? 0.9324 0.4174 0.3268 -0.0113 0.1247  0.0108  927  PRO A C   
511  O O   . PRO A 57  ? 0.9163 0.3991 0.3059 -0.0152 0.1309  0.0106  927  PRO A O   
512  C CB  . PRO A 57  ? 0.8753 0.3650 0.2867 0.0009  0.1359  0.0088  927  PRO A CB  
513  C CG  . PRO A 57  ? 0.9304 0.4256 0.3535 0.0099  0.1410  0.0109  927  PRO A CG  
514  C CD  . PRO A 57  ? 1.0014 0.4983 0.4243 0.0101  0.1407  0.0140  927  PRO A CD  
522  N N   . TYR A 58  ? 0.5801 0.3785 0.3923 -0.0463 -0.0029 0.0352  928  TYR A N   
523  C CA  . TYR A 58  ? 0.5931 0.3691 0.3809 -0.0468 -0.0072 0.0387  928  TYR A CA  
524  C C   . TYR A 58  ? 0.6938 0.4728 0.4892 -0.0371 -0.0198 0.0416  928  TYR A C   
525  O O   . TYR A 58  ? 0.6901 0.4770 0.5022 -0.0292 -0.0264 0.0430  928  TYR A O   
526  C CB  . TYR A 58  ? 0.6554 0.4028 0.4203 -0.0481 -0.0075 0.0422  928  TYR A CB  
527  C CG  . TYR A 58  ? 0.6693 0.3907 0.4055 -0.0490 -0.0117 0.0459  928  TYR A CG  
528  C CD1 . TYR A 58  ? 0.6256 0.3313 0.3376 -0.0598 -0.0026 0.0450  928  TYR A CD1 
529  C CD2 . TYR A 58  ? 0.7346 0.4473 0.4677 -0.0394 -0.0249 0.0500  928  TYR A CD2 
530  C CE1 . TYR A 58  ? 0.6766 0.3566 0.3599 -0.0609 -0.0062 0.0485  928  TYR A CE1 
531  C CE2 . TYR A 58  ? 0.8483 0.5359 0.5536 -0.0400 -0.0296 0.0534  928  TYR A CE2 
532  C CZ  . TYR A 58  ? 0.7870 0.4573 0.4664 -0.0507 -0.0201 0.0527  928  TYR A CZ  
533  O OH  . TYR A 58  ? 0.7501 0.3936 0.3993 -0.0515 -0.0245 0.0562  928  TYR A OH  
543  N N   . PRO A 59  ? 0.7598 0.5328 0.5430 -0.0380 -0.0230 0.0423  929  PRO A N   
544  C CA  . PRO A 59  ? 0.7217 0.4845 0.4837 -0.0469 -0.0150 0.0406  929  PRO A CA  
545  C C   . PRO A 59  ? 0.5800 0.3662 0.3562 -0.0524 -0.0053 0.0348  929  PRO A C   
546  O O   . PRO A 59  ? 0.5663 0.3745 0.3660 -0.0479 -0.0078 0.0328  929  PRO A O   
547  C CB  . PRO A 59  ? 0.6886 0.4392 0.4366 -0.0432 -0.0245 0.0435  929  PRO A CB  
548  C CG  . PRO A 59  ? 0.8904 0.6590 0.6627 -0.0344 -0.0346 0.0440  929  PRO A CG  
549  C CD  . PRO A 59  ? 0.8033 0.5797 0.5932 -0.0301 -0.0353 0.0447  929  PRO A CD  
557  N N   . PRO A 60  ? 0.6711 0.4525 0.4329 -0.0619 0.0057  0.0320  930  PRO A N   
558  C CA  . PRO A 60  ? 0.4532 0.2570 0.2276 -0.0666 0.0149  0.0259  930  PRO A CA  
559  C C   . PRO A 60  ? 0.5315 0.3430 0.3084 -0.0625 0.0105  0.0247  930  PRO A C   
560  O O   . PRO A 60  ? 0.5407 0.3355 0.3019 -0.0595 0.0029  0.0283  930  PRO A O   
561  C CB  . PRO A 60  ? 0.5440 0.3362 0.2980 -0.0778 0.0267  0.0239  930  PRO A CB  
562  C CG  . PRO A 60  ? 0.6368 0.3971 0.3618 -0.0782 0.0220  0.0294  930  PRO A CG  
563  C CD  . PRO A 60  ? 0.7187 0.4727 0.4508 -0.0688 0.0101  0.0342  930  PRO A CD  
571  N N   . LEU A 61  ? 0.5189 0.3543 0.3143 -0.0621 0.0147  0.0197  931  LEU A N   
572  C CA  . LEU A 61  ? 0.4618 0.3046 0.2600 -0.0580 0.0109  0.0180  931  LEU A CA  
573  C C   . LEU A 61  ? 0.5110 0.3557 0.2979 -0.0641 0.0211  0.0132  931  LEU A C   
574  O O   . LEU A 61  ? 0.5026 0.3584 0.2947 -0.0702 0.0318  0.0088  931  LEU A O   
575  C CB  . LEU A 61  ? 0.4423 0.3090 0.2675 -0.0523 0.0079  0.0155  931  LEU A CB  
576  C CG  . LEU A 61  ? 0.4762 0.3455 0.3162 -0.0458 -0.0016 0.0195  931  LEU A CG  
577  C CD1 . LEU A 61  ? 0.4739 0.3659 0.3377 -0.0417 -0.0025 0.0164  931  LEU A CD1 
578  C CD2 . LEU A 61  ? 0.4709 0.3250 0.3011 -0.0411 -0.0132 0.0244  931  LEU A CD2 
590  N N   . PRO A 62  ? 0.5242 0.3587 0.2960 -0.0626 0.0180  0.0137  932  PRO A N   
591  C CA  . PRO A 62  ? 0.4426 0.2799 0.2041 -0.0673 0.0280  0.0086  932  PRO A CA  
592  C C   . PRO A 62  ? 0.6211 0.4844 0.4040 -0.0636 0.0307  0.0026  932  PRO A C   
593  O O   . PRO A 62  ? 0.5071 0.3824 0.3092 -0.0572 0.0235  0.0032  932  PRO A O   
594  C CB  . PRO A 62  ? 0.5347 0.3505 0.2727 -0.0654 0.0215  0.0117  932  PRO A CB  
595  C CG  . PRO A 62  ? 0.5245 0.3387 0.2720 -0.0572 0.0068  0.0161  932  PRO A CG  
596  C CD  . PRO A 62  ? 0.5768 0.3970 0.3403 -0.0564 0.0050  0.0186  932  PRO A CD  
604  N N   . LYS A 63  ? 0.5628 0.4341 0.3418 -0.0673 0.0411  -0.0032 933  LYS A N   
605  C CA  . LYS A 63  ? 0.5699 0.4656 0.3679 -0.0633 0.0443  -0.0096 933  LYS A CA  
606  C C   . LYS A 63  ? 0.5520 0.4486 0.3553 -0.0541 0.0336  -0.0086 933  LYS A C   
607  O O   . LYS A 63  ? 0.5131 0.4278 0.3358 -0.0489 0.0318  -0.0117 933  LYS A O   
608  C CB  . LYS A 63  ? 0.5761 0.4774 0.3654 -0.0679 0.0567  -0.0160 933  LYS A CB  
609  C CG  . LYS A 63  ? 0.6101 0.5135 0.3958 -0.0785 0.0689  -0.0180 933  LYS A CG  
610  C CD  . LYS A 63  ? 0.7126 0.6353 0.5222 -0.0796 0.0702  -0.0198 933  LYS A CD  
611  C CE  . LYS A 63  ? 0.7734 0.7013 0.5809 -0.0910 0.0832  -0.0233 933  LYS A CE  
612  N NZ  . LYS A 63  ? 0.7590 0.7046 0.5886 -0.0925 0.0839  -0.0252 933  LYS A NZ  
626  N N   . ASP A 64  ? 0.5018 0.3778 0.2866 -0.0524 0.0262  -0.0045 934  ASP A N   
627  C CA  . ASP A 64  ? 0.4935 0.3682 0.2803 -0.0450 0.0161  -0.0038 934  ASP A CA  
628  C C   . ASP A 64  ? 0.5075 0.3866 0.3115 -0.0403 0.0051  0.0005  934  ASP A C   
629  O O   . ASP A 64  ? 0.4701 0.3493 0.2781 -0.0351 -0.0034 0.0011  934  ASP A O   
630  C CB  . ASP A 64  ? 0.6142 0.4651 0.3747 -0.0454 0.0115  -0.0011 934  ASP A CB  
631  C CG  . ASP A 64  ? 0.7599 0.5908 0.5069 -0.0483 0.0057  0.0056  934  ASP A CG  
632  O OD1 . ASP A 64  ? 0.6263 0.4510 0.3767 -0.0441 -0.0067 0.0103  934  ASP A OD1 
633  O OD2 . ASP A 64  ? 0.7146 0.5357 0.4473 -0.0547 0.0135  0.0061  934  ASP A OD2 
638  N N   . LYS A 65  ? 0.4719 0.3540 0.2854 -0.0425 0.0056  0.0031  935  LYS A N   
639  C CA  . LYS A 65  ? 0.5383 0.4260 0.3689 -0.0383 -0.0033 0.0067  935  LYS A CA  
640  C C   . LYS A 65  ? 0.4866 0.3948 0.3392 -0.0380 0.0018  0.0038  935  LYS A C   
641  O O   . LYS A 65  ? 0.4645 0.3770 0.3305 -0.0358 -0.0031 0.0067  935  LYS A O   
642  C CB  . LYS A 65  ? 0.4836 0.3550 0.3060 -0.0393 -0.0095 0.0130  935  LYS A CB  
643  C CG  . LYS A 65  ? 0.5806 0.4329 0.3850 -0.0376 -0.0188 0.0166  935  LYS A CG  
644  C CD  . LYS A 65  ? 0.7096 0.5482 0.5095 -0.0365 -0.0272 0.0227  935  LYS A CD  
645  C CE  . LYS A 65  ? 0.8260 0.6452 0.6066 -0.0349 -0.0370 0.0259  935  LYS A CE  
646  N NZ  . LYS A 65  ? 0.9752 0.7846 0.7560 -0.0316 -0.0481 0.0315  935  LYS A NZ  
660  N N   . LEU A 66  ? 0.3835 0.3045 0.2398 -0.0400 0.0113  -0.0021 936  LEU A N   
661  C CA  . LEU A 66  ? 0.4308 0.3708 0.3065 -0.0402 0.0160  -0.0053 936  LEU A CA  
662  C C   . LEU A 66  ? 0.4423 0.3975 0.3334 -0.0338 0.0128  -0.0084 936  LEU A C   
663  O O   . LEU A 66  ? 0.3591 0.3295 0.2658 -0.0329 0.0154  -0.0110 936  LEU A O   
664  C CB  . LEU A 66  ? 0.4454 0.3929 0.3186 -0.0466 0.0280  -0.0103 936  LEU A CB  
665  C CG  . LEU A 66  ? 0.5005 0.4325 0.3571 -0.0545 0.0331  -0.0078 936  LEU A CG  
666  C CD1 . LEU A 66  ? 0.4036 0.3474 0.2618 -0.0616 0.0456  -0.0137 936  LEU A CD1 
667  C CD2 . LEU A 66  ? 0.3735 0.2967 0.2325 -0.0553 0.0283  -0.0022 936  LEU A CD2 
679  N N   . ASN A 67  ? 0.3420 0.2915 0.2272 -0.0293 0.0070  -0.0082 937  ASN A N   
680  C CA  . ASN A 67  ? 0.4413 0.4009 0.3380 -0.0232 0.0030  -0.0104 937  ASN A CA  
681  C C   . ASN A 67  ? 0.3846 0.3337 0.2795 -0.0200 -0.0079 -0.0056 937  ASN A C   
682  O O   . ASN A 67  ? 0.4143 0.3585 0.3025 -0.0168 -0.0118 -0.0068 937  ASN A O   
683  C CB  . ASN A 67  ? 0.4346 0.4001 0.3267 -0.0204 0.0078  -0.0168 937  ASN A CB  
684  C CG  . ASN A 67  ? 0.6308 0.6124 0.5302 -0.0230 0.0183  -0.0227 937  ASN A CG  
685  O OD1 . ASN A 67  ? 0.6216 0.6187 0.5366 -0.0207 0.0193  -0.0255 937  ASN A OD1 
686  N ND2 . ASN A 67  ? 0.6397 0.6176 0.5273 -0.0281 0.0260  -0.0247 937  ASN A ND2 
693  N N   . PRO A 68  ? 0.4268 0.3728 0.3281 -0.0211 -0.0128 -0.0004 938  PRO A N   
694  C CA  . PRO A 68  ? 0.3950 0.3326 0.2962 -0.0192 -0.0231 0.0042  938  PRO A CA  
695  C C   . PRO A 68  ? 0.3904 0.3352 0.3021 -0.0152 -0.0274 0.0032  938  PRO A C   
696  O O   . PRO A 68  ? 0.3632 0.3204 0.2862 -0.0135 -0.0234 0.0003  938  PRO A O   
697  C CB  . PRO A 68  ? 0.4222 0.3591 0.3310 -0.0208 -0.0251 0.0088  938  PRO A CB  
698  C CG  . PRO A 68  ? 0.4031 0.3518 0.3214 -0.0223 -0.0166 0.0060  938  PRO A CG  
699  C CD  . PRO A 68  ? 0.4046 0.3558 0.3143 -0.0241 -0.0087 0.0008  938  PRO A CD  
707  N N   . PRO A 69  ? 0.4567 0.3926 0.3637 -0.0141 -0.0358 0.0055  939  PRO A N   
708  C CA  . PRO A 69  ? 0.3870 0.3270 0.3023 -0.0115 -0.0403 0.0052  939  PRO A CA  
709  C C   . PRO A 69  ? 0.4096 0.3583 0.3420 -0.0120 -0.0419 0.0083  939  PRO A C   
710  O O   . PRO A 69  ? 0.3654 0.3138 0.3018 -0.0138 -0.0425 0.0116  939  PRO A O   
711  C CB  . PRO A 69  ? 0.4115 0.3381 0.3158 -0.0120 -0.0490 0.0073  939  PRO A CB  
712  C CG  . PRO A 69  ? 0.4516 0.3698 0.3489 -0.0146 -0.0516 0.0109  939  PRO A CG  
713  C CD  . PRO A 69  ? 0.4611 0.3818 0.3540 -0.0157 -0.0421 0.0087  939  PRO A CD  
721  N N   . THR A 70  ? 0.3867 0.3418 0.3278 -0.0100 -0.0424 0.0072  940  THR A N   
722  C CA  . THR A 70  ? 0.3852 0.3488 0.3418 -0.0105 -0.0425 0.0096  940  THR A CA  
723  C C   . THR A 70  ? 0.3323 0.2921 0.2935 -0.0123 -0.0504 0.0139  940  THR A C   
724  O O   . THR A 70  ? 0.3621 0.3154 0.3176 -0.0126 -0.0557 0.0139  940  THR A O   
725  C CB  . THR A 70  ? 0.5313 0.5024 0.4938 -0.0079 -0.0396 0.0066  940  THR A CB  
726  O OG1 . THR A 70  ? 0.5032 0.4804 0.4636 -0.0061 -0.0328 0.0020  940  THR A OG1 
727  C CG2 . THR A 70  ? 0.3718 0.3505 0.3485 -0.0087 -0.0390 0.0090  940  THR A CG2 
735  N N   . PRO A 71  ? 0.3174 0.2815 0.2891 -0.0135 -0.0513 0.0172  941  PRO A N   
736  C CA  . PRO A 71  ? 0.2812 0.2456 0.2610 -0.0151 -0.0583 0.0207  941  PRO A CA  
737  C C   . PRO A 71  ? 0.3603 0.3283 0.3460 -0.0158 -0.0588 0.0201  941  PRO A C   
738  O O   . PRO A 71  ? 0.3015 0.2764 0.2935 -0.0146 -0.0532 0.0187  941  PRO A O   
739  C CB  . PRO A 71  ? 0.3324 0.3039 0.3245 -0.0147 -0.0566 0.0232  941  PRO A CB  
740  C CG  . PRO A 71  ? 0.3490 0.3173 0.3329 -0.0138 -0.0513 0.0220  941  PRO A CG  
741  C CD  . PRO A 71  ? 0.3262 0.2947 0.3023 -0.0133 -0.0460 0.0177  941  PRO A CD  
749  N N   . SER A 72  ? 0.3440 0.3059 0.3261 -0.0180 -0.0656 0.0210  942  SER A N   
750  C CA  . SER A 72  ? 0.3682 0.3294 0.3512 -0.0193 -0.0662 0.0203  942  SER A CA  
751  C C   . SER A 72  ? 0.4107 0.3736 0.4029 -0.0238 -0.0723 0.0232  942  SER A C   
752  O O   . SER A 72  ? 0.3477 0.3084 0.3404 -0.0258 -0.0789 0.0251  942  SER A O   
753  C CB  . SER A 72  ? 0.4293 0.3789 0.3953 -0.0178 -0.0678 0.0173  942  SER A CB  
754  O OG  . SER A 72  ? 0.3499 0.2999 0.3086 -0.0138 -0.0621 0.0139  942  SER A OG  
760  N N   . ILE A 73  ? 0.4104 0.3771 0.4095 -0.0258 -0.0700 0.0235  943  ILE A N   
761  C CA  . ILE A 73  ? 0.3628 0.3313 0.3701 -0.0314 -0.0747 0.0257  943  ILE A CA  
762  C C   . ILE A 73  ? 0.3521 0.3103 0.3484 -0.0335 -0.0752 0.0244  943  ILE A C   
763  O O   . ILE A 73  ? 0.3337 0.2909 0.3265 -0.0309 -0.0697 0.0228  943  ILE A O   
764  C CB  . ILE A 73  ? 0.4396 0.4221 0.4657 -0.0327 -0.0704 0.0275  943  ILE A CB  
765  C CG1 . ILE A 73  ? 0.3755 0.3665 0.4117 -0.0300 -0.0707 0.0289  943  ILE A CG1 
766  C CG2 . ILE A 73  ? 0.3799 0.3653 0.4147 -0.0395 -0.0736 0.0292  943  ILE A CG2 
767  C CD1 . ILE A 73  ? 0.4839 0.4884 0.5381 -0.0300 -0.0659 0.0302  943  ILE A CD1 
779  N N   . TYR A 74  ? 0.3601 0.3095 0.3499 -0.0380 -0.0823 0.0249  944  TYR A N   
780  C CA  . TYR A 74  ? 0.3721 0.3081 0.3484 -0.0400 -0.0836 0.0236  944  TYR A CA  
781  C C   . TYR A 74  ? 0.3820 0.3201 0.3670 -0.0481 -0.0850 0.0257  944  TYR A C   
782  O O   . TYR A 74  ? 0.4792 0.4163 0.4671 -0.0541 -0.0917 0.0270  944  TYR A O   
783  C CB  . TYR A 74  ? 0.4275 0.3485 0.3862 -0.0396 -0.0902 0.0220  944  TYR A CB  
784  C CG  . TYR A 74  ? 0.4253 0.3444 0.3750 -0.0325 -0.0882 0.0197  944  TYR A CG  
785  C CD1 . TYR A 74  ? 0.3685 0.2819 0.3066 -0.0265 -0.0835 0.0163  944  TYR A CD1 
786  C CD2 . TYR A 74  ? 0.4433 0.3664 0.3961 -0.0320 -0.0908 0.0208  944  TYR A CD2 
787  C CE1 . TYR A 74  ? 0.3896 0.3031 0.3207 -0.0209 -0.0807 0.0138  944  TYR A CE1 
788  C CE2 . TYR A 74  ? 0.4437 0.3642 0.3871 -0.0267 -0.0880 0.0187  944  TYR A CE2 
789  C CZ  . TYR A 74  ? 0.4432 0.3597 0.3765 -0.0216 -0.0825 0.0151  944  TYR A CZ  
790  O OH  . TYR A 74  ? 0.3951 0.3108 0.3204 -0.0172 -0.0788 0.0127  944  TYR A OH  
800  N N   . LEU A 75  ? 0.3332 0.2743 0.3220 -0.0485 -0.0786 0.0260  945  LEU A N   
801  C CA  . LEU A 75  ? 0.3582 0.3020 0.3554 -0.0568 -0.0779 0.0280  945  LEU A CA  
802  C C   . LEU A 75  ? 0.4226 0.3476 0.4022 -0.0613 -0.0811 0.0275  945  LEU A C   
803  O O   . LEU A 75  ? 0.4042 0.3150 0.3658 -0.0561 -0.0807 0.0253  945  LEU A O   
804  C CB  . LEU A 75  ? 0.3559 0.3093 0.3627 -0.0555 -0.0691 0.0286  945  LEU A CB  
805  C CG  . LEU A 75  ? 0.4173 0.3885 0.4417 -0.0516 -0.0650 0.0292  945  LEU A CG  
806  C CD1 . LEU A 75  ? 0.3488 0.3271 0.3810 -0.0519 -0.0566 0.0297  945  LEU A CD1 
807  C CD2 . LEU A 75  ? 0.3770 0.3599 0.4174 -0.0553 -0.0700 0.0309  945  LEU A CD2 
819  N N   . GLU A 76  ? 0.4475 0.3725 0.4325 -0.0712 -0.0841 0.0292  946  GLU A N   
820  C CA  . GLU A 76  ? 0.5071 0.4127 0.4750 -0.0774 -0.0872 0.0290  946  GLU A CA  
821  C C   . GLU A 76  ? 0.5603 0.4696 0.5365 -0.0871 -0.0828 0.0310  946  GLU A C   
822  O O   . GLU A 76  ? 0.5723 0.4664 0.5337 -0.0891 -0.0799 0.0311  946  GLU A O   
823  C CB  . GLU A 76  ? 0.4764 0.3738 0.4378 -0.0819 -0.0969 0.0286  946  GLU A CB  
824  C CG  . GLU A 76  ? 0.9308 0.8234 0.8824 -0.0731 -0.1008 0.0266  946  GLU A CG  
825  C CD  . GLU A 76  ? 0.9686 0.8513 0.9117 -0.0776 -0.1107 0.0261  946  GLU A CD  
826  O OE1 . GLU A 76  ? 1.0059 0.9004 0.9642 -0.0839 -0.1155 0.0276  946  GLU A OE1 
827  O OE2 . GLU A 76  ? 0.7712 0.6344 0.6922 -0.0745 -0.1139 0.0240  946  GLU A OE2 
834  N N   . ASN A 77  ? 0.5141 0.4433 0.5135 -0.0928 -0.0822 0.0326  947  ASN A N   
835  C CA  . ASN A 77  ? 0.7524 0.6886 0.7629 -0.1029 -0.0772 0.0342  947  ASN A CA  
836  C C   . ASN A 77  ? 0.5991 0.5549 0.6284 -0.0995 -0.0683 0.0350  947  ASN A C   
837  O O   . ASN A 77  ? 0.4589 0.4266 0.4978 -0.0910 -0.0678 0.0345  947  ASN A O   
838  C CB  . ASN A 77  ? 0.6259 0.5712 0.6502 -0.1135 -0.0836 0.0349  947  ASN A CB  
839  C CG  . ASN A 77  ? 0.7732 0.7004 0.7800 -0.1162 -0.0937 0.0339  947  ASN A CG  
840  O OD1 . ASN A 77  ? 0.8456 0.7528 0.8342 -0.1226 -0.0950 0.0338  947  ASN A OD1 
841  N ND2 . ASN A 77  ? 0.6843 0.6168 0.6951 -0.1114 -0.1010 0.0331  947  ASN A ND2 
848  N N   . LYS A 78  ? 0.5698 0.5272 0.6025 -0.1063 -0.0610 0.0361  948  LYS A N   
849  C CA  . LYS A 78  ? 0.6198 0.5948 0.6695 -0.1041 -0.0518 0.0366  948  LYS A CA  
850  C C   . LYS A 78  ? 0.5403 0.5402 0.6168 -0.1029 -0.0538 0.0366  948  LYS A C   
851  O O   . LYS A 78  ? 0.4821 0.4946 0.5696 -0.0952 -0.0494 0.0363  948  LYS A O   
852  C CB  . LYS A 78  ? 0.6697 0.6431 0.7199 -0.1145 -0.0442 0.0379  948  LYS A CB  
853  C CG  . LYS A 78  ? 0.6889 0.6809 0.7571 -0.1133 -0.0340 0.0382  948  LYS A CG  
854  C CD  . LYS A 78  ? 0.8584 0.8488 0.9268 -0.1251 -0.0261 0.0394  948  LYS A CD  
855  C CE  . LYS A 78  ? 0.9795 0.9973 1.0772 -0.1293 -0.0197 0.0393  948  LYS A CE  
856  N NZ  . LYS A 78  ? 0.9573 0.9850 1.0620 -0.1207 -0.0110 0.0389  948  LYS A NZ  
870  N N   . ARG A 79  ? 0.4917 0.4975 0.5776 -0.1103 -0.0609 0.0367  949  ARG A N   
871  C CA  . ARG A 79  ? 0.6606 0.6899 0.7722 -0.1095 -0.0643 0.0366  949  ARG A CA  
872  C C   . ARG A 79  ? 0.5113 0.5420 0.6219 -0.0977 -0.0696 0.0361  949  ARG A C   
873  O O   . ARG A 79  ? 0.4391 0.4875 0.5683 -0.0928 -0.0695 0.0360  949  ARG A O   
874  C CB  . ARG A 79  ? 0.8207 0.8542 0.9404 -0.1203 -0.0724 0.0365  949  ARG A CB  
875  C CG  . ARG A 79  ? 1.0641 1.0771 1.1627 -0.1209 -0.0826 0.0361  949  ARG A CG  
876  C CD  . ARG A 79  ? 1.2878 1.3003 1.3897 -0.1341 -0.0895 0.0360  949  ARG A CD  
877  N NE  . ARG A 79  ? 1.3935 1.3860 1.4748 -0.1339 -0.0999 0.0353  949  ARG A NE  
878  C CZ  . ARG A 79  ? 1.4212 1.4159 1.5034 -0.1272 -0.1087 0.0347  949  ARG A CZ  
879  N NH1 . ARG A 79  ? 1.3577 1.3727 1.4597 -0.1201 -0.1088 0.0348  949  ARG A NH1 
880  N NH2 . ARG A 79  ? 1.4517 1.4266 1.5131 -0.1275 -0.1173 0.0339  949  ARG A NH2 
894  N N   . ASP A 80  ? 0.3927 0.4039 0.4808 -0.0933 -0.0740 0.0355  950  ASP A N   
895  C CA  . ASP A 80  ? 0.4761 0.4862 0.5600 -0.0831 -0.0779 0.0349  950  ASP A CA  
896  C C   . ASP A 80  ? 0.4624 0.4814 0.5530 -0.0746 -0.0697 0.0348  950  ASP A C   
897  O O   . ASP A 80  ? 0.4264 0.4532 0.5241 -0.0679 -0.0716 0.0347  950  ASP A O   
898  C CB  . ASP A 80  ? 0.6055 0.5933 0.6633 -0.0799 -0.0817 0.0337  950  ASP A CB  
899  C CG  . ASP A 80  ? 0.6255 0.6017 0.6737 -0.0873 -0.0907 0.0336  950  ASP A CG  
900  O OD1 . ASP A 80  ? 0.7299 0.7170 0.7931 -0.0945 -0.0956 0.0342  950  ASP A OD1 
901  O OD2 . ASP A 80  ? 0.4979 0.4542 0.5237 -0.0857 -0.0932 0.0324  950  ASP A OD2 
906  N N   . ALA A 81  ? 0.5005 0.5165 0.5869 -0.0751 -0.0609 0.0347  951  ALA A N   
907  C CA  . ALA A 81  ? 0.4666 0.4887 0.5567 -0.0677 -0.0531 0.0343  951  ALA A CA  
908  C C   . ALA A 81  ? 0.3862 0.4293 0.5005 -0.0671 -0.0496 0.0349  951  ALA A C   
909  O O   . ALA A 81  ? 0.4049 0.4541 0.5241 -0.0598 -0.0458 0.0345  951  ALA A O   
910  C CB  . ALA A 81  ? 0.4691 0.4812 0.5470 -0.0688 -0.0455 0.0341  951  ALA A CB  
916  N N   . PHE A 82  ? 0.4090 0.4632 0.5385 -0.0750 -0.0509 0.0356  952  PHE A N   
917  C CA  . PHE A 82  ? 0.4577 0.5335 0.6119 -0.0744 -0.0473 0.0356  952  PHE A CA  
918  C C   . PHE A 82  ? 0.5264 0.6138 0.6949 -0.0722 -0.0568 0.0356  952  PHE A C   
919  O O   . PHE A 82  ? 0.5109 0.6174 0.7016 -0.0712 -0.0558 0.0354  952  PHE A O   
920  C CB  . PHE A 82  ? 0.3366 0.4205 0.5012 -0.0845 -0.0411 0.0359  952  PHE A CB  
921  C CG  . PHE A 82  ? 0.4738 0.5479 0.6258 -0.0856 -0.0307 0.0360  952  PHE A CG  
922  C CD1 . PHE A 82  ? 0.4723 0.5567 0.6341 -0.0818 -0.0210 0.0355  952  PHE A CD1 
923  C CD2 . PHE A 82  ? 0.4473 0.5005 0.5765 -0.0897 -0.0311 0.0364  952  PHE A CD2 
924  C CE1 . PHE A 82  ? 0.4243 0.4985 0.5730 -0.0826 -0.0121 0.0356  952  PHE A CE1 
925  C CE2 . PHE A 82  ? 0.4393 0.4821 0.5554 -0.0900 -0.0225 0.0365  952  PHE A CE2 
926  C CZ  . PHE A 82  ? 0.4164 0.4697 0.5421 -0.0867 -0.0131 0.0362  952  PHE A CZ  
936  N N   . PHE A 83  ? 0.5210 0.5962 0.6761 -0.0708 -0.0660 0.0358  953  PHE A N   
937  C CA  . PHE A 83  ? 0.4349 0.5171 0.5989 -0.0678 -0.0761 0.0359  953  PHE A CA  
938  C C   . PHE A 83  ? 0.4753 0.5651 0.6469 -0.0574 -0.0737 0.0359  953  PHE A C   
939  O O   . PHE A 83  ? 0.4099 0.4889 0.5672 -0.0513 -0.0700 0.0358  953  PHE A O   
940  C CB  . PHE A 83  ? 0.5566 0.6202 0.6994 -0.0678 -0.0849 0.0359  953  PHE A CB  
941  C CG  . PHE A 83  ? 0.5607 0.6281 0.7088 -0.0660 -0.0965 0.0361  953  PHE A CG  
942  C CD1 . PHE A 83  ? 0.6918 0.7754 0.8603 -0.0712 -0.1023 0.0361  953  PHE A CD1 
943  C CD2 . PHE A 83  ? 0.5137 0.5682 0.6458 -0.0595 -0.1016 0.0363  953  PHE A CD2 
944  C CE1 . PHE A 83  ? 0.6267 0.7132 0.7992 -0.0690 -0.1142 0.0362  953  PHE A CE1 
945  C CE2 . PHE A 83  ? 0.7497 0.8053 0.8839 -0.0577 -0.1127 0.0366  953  PHE A CE2 
946  C CZ  . PHE A 83  ? 0.7136 0.7849 0.8678 -0.0621 -0.1195 0.0366  953  PHE A CZ  
956  N N   . PRO A 84  ? 0.5787 0.6873 0.7729 -0.0553 -0.0757 0.0358  954  PRO A N   
957  C CA  . PRO A 84  ? 0.5438 0.6596 0.7461 -0.0453 -0.0727 0.0357  954  PRO A CA  
958  C C   . PRO A 84  ? 0.5475 0.6486 0.7327 -0.0374 -0.0771 0.0363  954  PRO A C   
959  O O   . PRO A 84  ? 0.4982 0.5961 0.6789 -0.0310 -0.0707 0.0362  954  PRO A O   
960  C CB  . PRO A 84  ? 0.5579 0.6948 0.7859 -0.0448 -0.0782 0.0353  954  PRO A CB  
961  C CG  . PRO A 84  ? 0.6930 0.8389 0.9312 -0.0561 -0.0775 0.0348  954  PRO A CG  
962  C CD  . PRO A 84  ? 0.5851 0.7104 0.7996 -0.0625 -0.0800 0.0354  954  PRO A CD  
970  N N   . PRO A 85  ? 0.5930 0.6847 0.7677 -0.0383 -0.0876 0.0369  955  PRO A N   
971  C CA  . PRO A 85  ? 0.5640 0.6409 0.7210 -0.0317 -0.0907 0.0374  955  PRO A CA  
972  C C   . PRO A 85  ? 0.6217 0.6845 0.7595 -0.0306 -0.0825 0.0368  955  PRO A C   
973  O O   . PRO A 85  ? 0.4534 0.5061 0.5784 -0.0253 -0.0825 0.0369  955  PRO A O   
974  C CB  . PRO A 85  ? 0.5382 0.6064 0.6856 -0.0349 -0.1025 0.0378  955  PRO A CB  
975  C CG  . PRO A 85  ? 0.6148 0.6991 0.7826 -0.0405 -0.1079 0.0376  955  PRO A CG  
976  C CD  . PRO A 85  ? 0.3695 0.4646 0.5494 -0.0452 -0.0973 0.0369  955  PRO A CD  
984  N N   . LEU A 86  ? 0.3824 0.4444 0.5181 -0.0356 -0.0758 0.0361  956  LEU A N   
985  C CA  . LEU A 86  ? 0.4796 0.5300 0.5987 -0.0340 -0.0687 0.0351  956  LEU A CA  
986  C C   . LEU A 86  ? 0.4018 0.4551 0.5234 -0.0274 -0.0618 0.0347  956  LEU A C   
987  O O   . LEU A 86  ? 0.3419 0.3854 0.4497 -0.0237 -0.0603 0.0341  956  LEU A O   
988  C CB  . LEU A 86  ? 0.6088 0.6584 0.7265 -0.0398 -0.0629 0.0345  956  LEU A CB  
989  C CG  . LEU A 86  ? 0.5110 0.5441 0.6077 -0.0416 -0.0640 0.0335  956  LEU A CG  
990  C CD1 . LEU A 86  ? 0.7471 0.7743 0.8389 -0.0461 -0.0737 0.0340  956  LEU A CD1 
991  C CD2 . LEU A 86  ? 0.3431 0.3731 0.4357 -0.0453 -0.0571 0.0330  956  LEU A CD2 
1003 N N   . HIS A 87  ? 0.3537 0.4205 0.4926 -0.0264 -0.0572 0.0349  957  HIS A N   
1004 C CA  . HIS A 87  ? 0.4253 0.4946 0.5671 -0.0203 -0.0504 0.0344  957  HIS A CA  
1005 C C   . HIS A 87  ? 0.4775 0.5400 0.6123 -0.0143 -0.0551 0.0350  957  HIS A C   
1006 O O   . HIS A 87  ? 0.3898 0.4444 0.5139 -0.0110 -0.0506 0.0343  957  HIS A O   
1007 C CB  . HIS A 87  ? 0.4979 0.5837 0.6611 -0.0196 -0.0467 0.0345  957  HIS A CB  
1008 C CG  . HIS A 87  ? 0.6274 0.7150 0.7926 -0.0145 -0.0378 0.0336  957  HIS A CG  
1009 N ND1 . HIS A 87  ? 0.7465 0.8478 0.9292 -0.0123 -0.0329 0.0331  957  HIS A ND1 
1010 C CD2 . HIS A 87  ? 0.5994 0.6767 0.7509 -0.0112 -0.0330 0.0327  957  HIS A CD2 
1011 C CE1 . HIS A 87  ? 0.7254 0.8231 0.9038 -0.0078 -0.0255 0.0322  957  HIS A CE1 
1012 N NE2 . HIS A 87  ? 0.6774 0.7608 0.8371 -0.0075 -0.0257 0.0319  957  HIS A NE2 
1021 N N   . GLN A 88  ? 0.4248 0.4896 0.5648 -0.0135 -0.0643 0.0361  958  GLN A N   
1022 C CA  . GLN A 88  ? 0.4023 0.4596 0.5354 -0.0077 -0.0695 0.0370  958  GLN A CA  
1023 C C   . GLN A 88  ? 0.3857 0.4261 0.4960 -0.0084 -0.0707 0.0369  958  GLN A C   
1024 O O   . GLN A 88  ? 0.3514 0.3828 0.4514 -0.0044 -0.0698 0.0371  958  GLN A O   
1025 C CB  . GLN A 88  ? 0.5702 0.6340 0.7139 -0.0066 -0.0803 0.0382  958  GLN A CB  
1026 C CG  . GLN A 88  ? 0.7521 0.8358 0.9208 -0.0071 -0.0797 0.0378  958  GLN A CG  
1027 C CD  . GLN A 88  ? 0.9443 1.0353 1.1227 -0.0020 -0.0704 0.0371  958  GLN A CD  
1028 O OE1 . GLN A 88  ? 0.9899 1.0740 1.1624 0.0048  -0.0697 0.0374  958  GLN A OE1 
1029 N NE2 . GLN A 88  ? 0.9558 1.0592 1.1474 -0.0056 -0.0629 0.0360  958  GLN A NE2 
1038 N N   . PHE A 89  ? 0.3498 0.3854 0.4518 -0.0137 -0.0725 0.0363  959  PHE A N   
1039 C CA  . PHE A 89  ? 0.3370 0.3578 0.4181 -0.0143 -0.0729 0.0355  959  PHE A CA  
1040 C C   . PHE A 89  ? 0.3393 0.3571 0.4133 -0.0127 -0.0631 0.0338  959  PHE A C   
1041 O O   . PHE A 89  ? 0.3791 0.3877 0.4399 -0.0109 -0.0617 0.0332  959  PHE A O   
1042 C CB  . PHE A 89  ? 0.3322 0.3488 0.4066 -0.0197 -0.0766 0.0348  959  PHE A CB  
1043 C CG  . PHE A 89  ? 0.3785 0.3806 0.4319 -0.0197 -0.0774 0.0336  959  PHE A CG  
1044 C CD1 . PHE A 89  ? 0.3915 0.3842 0.4343 -0.0198 -0.0857 0.0344  959  PHE A CD1 
1045 C CD2 . PHE A 89  ? 0.3240 0.3221 0.3682 -0.0195 -0.0700 0.0314  959  PHE A CD2 
1046 C CE1 . PHE A 89  ? 0.4554 0.4348 0.4784 -0.0199 -0.0855 0.0329  959  PHE A CE1 
1047 C CE2 . PHE A 89  ? 0.3659 0.3526 0.3922 -0.0191 -0.0701 0.0297  959  PHE A CE2 
1048 C CZ  . PHE A 89  ? 0.3347 0.3120 0.3503 -0.0194 -0.0774 0.0304  959  PHE A CZ  
1058 N N   . CYS A 90  ? 0.2873 0.3129 0.3699 -0.0139 -0.0565 0.0329  960  CYS A N   
1059 C CA  . CYS A 90  ? 0.2541 0.2777 0.3306 -0.0127 -0.0480 0.0309  960  CYS A CA  
1060 C C   . CYS A 90  ? 0.2871 0.3110 0.3656 -0.0085 -0.0442 0.0311  960  CYS A C   
1061 O O   . CYS A 90  ? 0.3449 0.3629 0.4133 -0.0076 -0.0399 0.0295  960  CYS A O   
1062 C CB  . CYS A 90  ? 0.2795 0.3097 0.3630 -0.0150 -0.0426 0.0301  960  CYS A CB  
1063 S SG  . CYS A 90  ? 0.3453 0.3699 0.4203 -0.0199 -0.0453 0.0294  960  CYS A SG  
1069 N N   . THR A 91  ? 0.3116 0.3424 0.4032 -0.0059 -0.0461 0.0327  961  THR A N   
1070 C CA  . THR A 91  ? 0.3798 0.4099 0.4734 -0.0013 -0.0426 0.0328  961  THR A CA  
1071 C C   . THR A 91  ? 0.3910 0.4102 0.4738 0.0014  -0.0478 0.0341  961  THR A C   
1072 O O   . THR A 91  ? 0.3771 0.3907 0.4557 0.0046  -0.0449 0.0341  961  THR A O   
1073 C CB  . THR A 91  ? 0.4475 0.4897 0.5599 0.0015  -0.0418 0.0335  961  THR A CB  
1074 O OG1 . THR A 91  ? 0.4257 0.4734 0.5473 0.0019  -0.0504 0.0352  961  THR A OG1 
1075 C CG2 . THR A 91  ? 0.3745 0.4257 0.4952 -0.0015 -0.0350 0.0323  961  THR A CG2 
1083 N N   . ASN A 92  ? 0.3477 0.3621 0.4244 -0.0003 -0.0555 0.0351  962  ASN A N   
1084 C CA  . ASN A 92  ? 0.4083 0.4100 0.4715 0.0017  -0.0608 0.0365  962  ASN A CA  
1085 C C   . ASN A 92  ? 0.3269 0.3179 0.3745 0.0011  -0.0542 0.0351  962  ASN A C   
1086 O O   . ASN A 92  ? 0.3180 0.3075 0.3579 -0.0024 -0.0498 0.0331  962  ASN A O   
1087 C CB  . ASN A 92  ? 0.4091 0.4056 0.4642 -0.0012 -0.0686 0.0370  962  ASN A CB  
1088 C CG  . ASN A 92  ? 0.6178 0.6010 0.6594 0.0010  -0.0756 0.0389  962  ASN A CG  
1089 O OD1 . ASN A 92  ? 0.5040 0.4778 0.5360 0.0033  -0.0728 0.0393  962  ASN A OD1 
1090 N ND2 . ASN A 92  ? 0.5840 0.5647 0.6231 -0.0001 -0.0849 0.0399  962  ASN A ND2 
1097 N N   . PRO A 93  ? 0.3360 0.3195 0.3790 0.0046  -0.0533 0.0361  963  PRO A N   
1098 C CA  . PRO A 93  ? 0.4312 0.4047 0.4598 0.0028  -0.0465 0.0347  963  PRO A CA  
1099 C C   . PRO A 93  ? 0.4380 0.4015 0.4490 -0.0013 -0.0468 0.0339  963  PRO A C   
1100 O O   . PRO A 93  ? 0.3731 0.3338 0.3757 -0.0045 -0.0398 0.0316  963  PRO A O   
1101 C CB  . PRO A 93  ? 0.4786 0.4422 0.5030 0.0074  -0.0483 0.0367  963  PRO A CB  
1102 C CG  . PRO A 93  ? 0.6444 0.6188 0.6871 0.0126  -0.0529 0.0380  963  PRO A CG  
1103 C CD  . PRO A 93  ? 0.4152 0.3995 0.4666 0.0104  -0.0585 0.0382  963  PRO A CD  
1111 N N   . ASN A 94  ? 0.3477 0.3065 0.3535 -0.0013 -0.0548 0.0356  964  ASN A N   
1112 C CA  . ASN A 94  ? 0.4131 0.3618 0.4013 -0.0048 -0.0550 0.0347  964  ASN A CA  
1113 C C   . ASN A 94  ? 0.4641 0.4205 0.4540 -0.0081 -0.0515 0.0317  964  ASN A C   
1114 O O   . ASN A 94  ? 0.3806 0.3305 0.3569 -0.0107 -0.0498 0.0300  964  ASN A O   
1115 C CB  . ASN A 94  ? 0.4212 0.3605 0.4014 -0.0035 -0.0653 0.0373  964  ASN A CB  
1116 C CG  . ASN A 94  ? 0.5910 0.5192 0.5650 0.0004  -0.0696 0.0402  964  ASN A CG  
1117 O OD1 . ASN A 94  ? 0.6887 0.6086 0.6539 0.0002  -0.0638 0.0401  964  ASN A OD1 
1118 N ND2 . ASN A 94  ? 0.6500 0.5776 0.6284 0.0040  -0.0800 0.0426  964  ASN A ND2 
1125 N N   . ASN A 95  ? 0.3291 0.2984 0.3348 -0.0076 -0.0505 0.0310  965  ASN A N   
1126 C CA  . ASN A 95  ? 0.3375 0.3129 0.3443 -0.0099 -0.0471 0.0282  965  ASN A CA  
1127 C C   . ASN A 95  ? 0.3336 0.3162 0.3459 -0.0100 -0.0385 0.0257  965  ASN A C   
1128 O O   . ASN A 95  ? 0.3158 0.3069 0.3411 -0.0088 -0.0370 0.0261  965  ASN A O   
1129 C CB  . ASN A 95  ? 0.2934 0.2758 0.3111 -0.0101 -0.0525 0.0292  965  ASN A CB  
1130 C CG  . ASN A 95  ? 0.4505 0.4261 0.4624 -0.0107 -0.0617 0.0310  965  ASN A CG  
1131 O OD1 . ASN A 95  ? 0.4063 0.3710 0.4026 -0.0113 -0.0634 0.0307  965  ASN A OD1 
1132 N ND2 . ASN A 95  ? 0.3404 0.3226 0.3647 -0.0108 -0.0677 0.0328  965  ASN A ND2 
1139 N N   . PRO A 96  ? 0.3216 0.3014 0.3241 -0.0117 -0.0328 0.0229  966  PRO A N   
1140 C CA  . PRO A 96  ? 0.2553 0.2417 0.2623 -0.0122 -0.0253 0.0202  966  PRO A CA  
1141 C C   . PRO A 96  ? 0.2812 0.2769 0.2965 -0.0116 -0.0242 0.0183  966  PRO A C   
1142 O O   . PRO A 96  ? 0.2719 0.2737 0.2943 -0.0110 -0.0200 0.0172  966  PRO A O   
1143 C CB  . PRO A 96  ? 0.3353 0.3177 0.3300 -0.0149 -0.0205 0.0171  966  PRO A CB  
1144 C CG  . PRO A 96  ? 0.5363 0.5071 0.5186 -0.0157 -0.0247 0.0192  966  PRO A CG  
1145 C CD  . PRO A 96  ? 0.3458 0.3163 0.3324 -0.0136 -0.0328 0.0218  966  PRO A CD  
1153 N N   . VAL A 97  ? 0.2724 0.2673 0.2847 -0.0117 -0.0282 0.0180  967  VAL A N   
1154 C CA  . VAL A 97  ? 0.2477 0.2481 0.2646 -0.0111 -0.0280 0.0165  967  VAL A CA  
1155 C C   . VAL A 97  ? 0.3309 0.3275 0.3467 -0.0116 -0.0348 0.0184  967  VAL A C   
1156 O O   . VAL A 97  ? 0.2742 0.2638 0.2821 -0.0122 -0.0391 0.0194  967  VAL A O   
1157 C CB  . VAL A 97  ? 0.2012 0.2035 0.2115 -0.0106 -0.0240 0.0120  967  VAL A CB  
1158 C CG1 . VAL A 97  ? 0.2604 0.2563 0.2587 -0.0109 -0.0258 0.0106  967  VAL A CG1 
1159 C CG2 . VAL A 97  ? 0.2228 0.2288 0.2361 -0.0091 -0.0242 0.0105  967  VAL A CG2 
1169 N N   . THR A 98  ? 0.2377 0.2380 0.2605 -0.0120 -0.0359 0.0191  968  THR A N   
1170 C CA  . THR A 98  ? 0.2192 0.2155 0.2401 -0.0136 -0.0420 0.0203  968  THR A CA  
1171 C C   . THR A 98  ? 0.2905 0.2864 0.3085 -0.0134 -0.0405 0.0183  968  THR A C   
1172 O O   . THR A 98  ? 0.2863 0.2872 0.3100 -0.0129 -0.0362 0.0178  968  THR A O   
1173 C CB  . THR A 98  ? 0.3050 0.3056 0.3382 -0.0155 -0.0457 0.0239  968  THR A CB  
1174 O OG1 . THR A 98  ? 0.3301 0.3300 0.3652 -0.0145 -0.0484 0.0258  968  THR A OG1 
1175 C CG2 . THR A 98  ? 0.2979 0.2946 0.3293 -0.0185 -0.0521 0.0249  968  THR A CG2 
1183 N N   . VAL A 99  ? 0.2709 0.2591 0.2781 -0.0133 -0.0441 0.0169  969  VAL A N   
1184 C CA  . VAL A 99  ? 0.2347 0.2196 0.2373 -0.0127 -0.0440 0.0153  969  VAL A CA  
1185 C C   . VAL A 99  ? 0.2749 0.2548 0.2783 -0.0168 -0.0495 0.0180  969  VAL A C   
1186 O O   . VAL A 99  ? 0.2890 0.2634 0.2880 -0.0186 -0.0550 0.0190  969  VAL A O   
1187 C CB  . VAL A 99  ? 0.2699 0.2492 0.2592 -0.0090 -0.0438 0.0113  969  VAL A CB  
1188 C CG1 . VAL A 99  ? 0.3279 0.2985 0.3073 -0.0097 -0.0488 0.0114  969  VAL A CG1 
1189 C CG2 . VAL A 99  ? 0.2551 0.2296 0.2388 -0.0073 -0.0442 0.0097  969  VAL A CG2 
1199 N N   . ILE A 100 ? 0.2485 0.2302 0.2571 -0.0188 -0.0478 0.0191  970  ILE A N   
1200 C CA  . ILE A 100 ? 0.2996 0.2774 0.3099 -0.0240 -0.0519 0.0214  970  ILE A CA  
1201 C C   . ILE A 100 ? 0.3308 0.2963 0.3266 -0.0237 -0.0534 0.0197  970  ILE A C   
1202 O O   . ILE A 100 ? 0.2933 0.2572 0.2868 -0.0228 -0.0498 0.0191  970  ILE A O   
1203 C CB  . ILE A 100 ? 0.2919 0.2790 0.3167 -0.0273 -0.0482 0.0237  970  ILE A CB  
1204 C CG1 . ILE A 100 ? 0.3023 0.3007 0.3403 -0.0258 -0.0463 0.0248  970  ILE A CG1 
1205 C CG2 . ILE A 100 ? 0.3248 0.3098 0.3531 -0.0341 -0.0522 0.0260  970  ILE A CG2 
1206 C CD1 . ILE A 100 ? 0.3010 0.3098 0.3552 -0.0289 -0.0437 0.0271  970  ILE A CD1 
1218 N N   . ARG A 101 ? 0.3237 0.2791 0.3082 -0.0238 -0.0589 0.0189  971  ARG A N   
1219 C CA  . ARG A 101 ? 0.3053 0.2465 0.2736 -0.0225 -0.0612 0.0169  971  ARG A CA  
1220 C C   . ARG A 101 ? 0.3454 0.2798 0.3128 -0.0288 -0.0628 0.0192  971  ARG A C   
1221 O O   . ARG A 101 ? 0.3531 0.2909 0.3292 -0.0355 -0.0655 0.0219  971  ARG A O   
1222 C CB  . ARG A 101 ? 0.4012 0.3325 0.3571 -0.0212 -0.0666 0.0154  971  ARG A CB  
1223 C CG  . ARG A 101 ? 0.3684 0.3053 0.3237 -0.0161 -0.0644 0.0131  971  ARG A CG  
1224 C CD  . ARG A 101 ? 0.3524 0.2925 0.3044 -0.0094 -0.0590 0.0094  971  ARG A CD  
1225 N NE  . ARG A 101 ? 0.3517 0.2962 0.3015 -0.0056 -0.0566 0.0067  971  ARG A NE  
1226 C CZ  . ARG A 101 ? 0.3329 0.2816 0.2800 0.0002  -0.0523 0.0025  971  ARG A CZ  
1227 N NH1 . ARG A 101 ? 0.3391 0.2876 0.2849 0.0037  -0.0510 0.0007  971  ARG A NH1 
1228 N NH2 . ARG A 101 ? 0.3186 0.2718 0.2640 0.0023  -0.0495 0.0001  971  ARG A NH2 
1242 N N   . GLY A 102 ? 0.3310 0.2557 0.2874 -0.0268 -0.0613 0.0179  972  GLY A N   
1243 C CA  . GLY A 102 ? 0.4109 0.3248 0.3613 -0.0332 -0.0627 0.0199  972  GLY A CA  
1244 C C   . GLY A 102 ? 0.4715 0.3955 0.4366 -0.0395 -0.0582 0.0229  972  GLY A C   
1245 O O   . GLY A 102 ? 0.4021 0.3211 0.3672 -0.0476 -0.0593 0.0251  972  GLY A O   
1249 N N   . LEU A 103 ? 0.3980 0.3362 0.3754 -0.0362 -0.0526 0.0228  973  LEU A N   
1250 C CA  . LEU A 103 ? 0.3068 0.2559 0.2990 -0.0414 -0.0476 0.0253  973  LEU A CA  
1251 C C   . LEU A 103 ? 0.3030 0.2420 0.2864 -0.0451 -0.0442 0.0262  973  LEU A C   
1252 O O   . LEU A 103 ? 0.4108 0.3512 0.4003 -0.0534 -0.0427 0.0286  973  LEU A O   
1253 C CB  . LEU A 103 ? 0.3491 0.3126 0.3532 -0.0363 -0.0422 0.0246  973  LEU A CB  
1254 C CG  . LEU A 103 ? 0.4409 0.4143 0.4588 -0.0409 -0.0363 0.0268  973  LEU A CG  
1255 C CD1 . LEU A 103 ? 0.5749 0.5637 0.6119 -0.0427 -0.0367 0.0282  973  LEU A CD1 
1256 C CD2 . LEU A 103 ? 0.3986 0.3737 0.4146 -0.0365 -0.0298 0.0255  973  LEU A CD2 
1268 N N   . ALA A 104 ? 0.3493 0.2782 0.3181 -0.0390 -0.0431 0.0242  974  ALA A N   
1269 C CA  . ALA A 104 ? 0.3899 0.3068 0.3473 -0.0415 -0.0401 0.0251  974  ALA A CA  
1270 C C   . ALA A 104 ? 0.4040 0.3049 0.3498 -0.0493 -0.0439 0.0267  974  ALA A C   
1271 O O   . ALA A 104 ? 0.4047 0.3012 0.3496 -0.0572 -0.0404 0.0291  974  ALA A O   
1272 C CB  . ALA A 104 ? 0.3599 0.2679 0.3024 -0.0323 -0.0402 0.0222  974  ALA A CB  
1278 N N   . GLY A 105 ? 0.4220 0.3134 0.3582 -0.0475 -0.0507 0.0254  975  GLY A N   
1279 C CA  . GLY A 105 ? 0.4361 0.3099 0.3590 -0.0547 -0.0551 0.0266  975  GLY A CA  
1280 C C   . GLY A 105 ? 0.6008 0.4842 0.5391 -0.0665 -0.0549 0.0294  975  GLY A C   
1281 O O   . GLY A 105 ? 0.4914 0.3645 0.4234 -0.0758 -0.0543 0.0313  975  GLY A O   
1285 N N   . ALA A 106 ? 0.4418 0.3449 0.4002 -0.0662 -0.0554 0.0296  976  ALA A N   
1286 C CA  . ALA A 106 ? 0.4116 0.3271 0.3875 -0.0759 -0.0563 0.0317  976  ALA A CA  
1287 C C   . ALA A 106 ? 0.4437 0.3682 0.4311 -0.0828 -0.0484 0.0336  976  ALA A C   
1288 O O   . ALA A 106 ? 0.4455 0.3729 0.4403 -0.0935 -0.0484 0.0352  976  ALA A O   
1289 C CB  . ALA A 106 ? 0.4012 0.3348 0.3946 -0.0719 -0.0589 0.0312  976  ALA A CB  
1295 N N   . LEU A 107 ? 0.4283 0.3578 0.4175 -0.0770 -0.0416 0.0333  977  LEU A N   
1296 C CA  . LEU A 107 ? 0.4250 0.3622 0.4232 -0.0825 -0.0331 0.0349  977  LEU A CA  
1297 C C   . LEU A 107 ? 0.4884 0.4045 0.4647 -0.0853 -0.0299 0.0355  977  LEU A C   
1298 O O   . LEU A 107 ? 0.4820 0.3997 0.4605 -0.0905 -0.0223 0.0368  977  LEU A O   
1299 C CB  . LEU A 107 ? 0.4383 0.3914 0.4495 -0.0749 -0.0273 0.0341  977  LEU A CB  
1300 C CG  . LEU A 107 ? 0.4125 0.3851 0.4441 -0.0712 -0.0297 0.0336  977  LEU A CG  
1301 C CD1 . LEU A 107 ? 0.4689 0.4512 0.5069 -0.0629 -0.0243 0.0325  977  LEU A CD1 
1302 C CD2 . LEU A 107 ? 0.4002 0.3884 0.4525 -0.0796 -0.0292 0.0351  977  LEU A CD2 
1314 N N   . LYS A 108 ? 0.4275 0.3227 0.3814 -0.0814 -0.0357 0.0344  978  LYS A N   
1315 C CA  . LYS A 108 ? 0.4896 0.3616 0.4192 -0.0817 -0.0341 0.0347  978  LYS A CA  
1316 C C   . LYS A 108 ? 0.4954 0.3711 0.4247 -0.0767 -0.0268 0.0346  978  LYS A C   
1317 O O   . LYS A 108 ? 0.5067 0.3722 0.4263 -0.0822 -0.0213 0.0362  978  LYS A O   
1318 C CB  . LYS A 108 ? 0.7199 0.5800 0.6426 -0.0955 -0.0329 0.0372  978  LYS A CB  
1319 C CG  . LYS A 108 ? 0.7876 0.6368 0.7031 -0.1003 -0.0414 0.0370  978  LYS A CG  
1320 C CD  . LYS A 108 ? 0.9939 0.8306 0.9019 -0.1153 -0.0399 0.0393  978  LYS A CD  
1321 C CE  . LYS A 108 ? 1.1330 0.9860 1.0617 -0.1255 -0.0428 0.0398  978  LYS A CE  
1322 N NZ  . LYS A 108 ? 1.1261 0.9670 1.0444 -0.1250 -0.0532 0.0385  978  LYS A NZ  
1336 N N   . LEU A 109 ? 0.4799 0.3692 0.4188 -0.0668 -0.0265 0.0326  979  LEU A N   
1337 C CA  . LEU A 109 ? 0.4985 0.3891 0.4341 -0.0604 -0.0213 0.0316  979  LEU A CA  
1338 C C   . LEU A 109 ? 0.5235 0.3907 0.4324 -0.0545 -0.0247 0.0304  979  LEU A C   
1339 O O   . LEU A 109 ? 0.7597 0.6167 0.6576 -0.0495 -0.0318 0.0287  979  LEU A O   
1340 C CB  . LEU A 109 ? 0.4361 0.3448 0.3863 -0.0514 -0.0216 0.0293  979  LEU A CB  
1341 C CG  . LEU A 109 ? 0.5150 0.4468 0.4909 -0.0538 -0.0189 0.0300  979  LEU A CG  
1342 C CD1 . LEU A 109 ? 0.4733 0.4169 0.4568 -0.0446 -0.0178 0.0277  979  LEU A CD1 
1343 C CD2 . LEU A 109 ? 0.5134 0.4530 0.5003 -0.0621 -0.0112 0.0323  979  LEU A CD2 
1355 N N   . ASP A 110 ? 0.4771 0.3352 0.3747 -0.0545 -0.0199 0.0311  980  ASP A N   
1356 C CA  . ASP A 110 ? 0.5767 0.4129 0.4487 -0.0473 -0.0237 0.0297  980  ASP A CA  
1357 C C   . ASP A 110 ? 0.5638 0.4097 0.4392 -0.0352 -0.0248 0.0263  980  ASP A C   
1358 O O   . ASP A 110 ? 0.6023 0.4528 0.4793 -0.0338 -0.0197 0.0262  980  ASP A O   
1359 C CB  . ASP A 110 ? 0.5551 0.3734 0.4099 -0.0538 -0.0185 0.0323  980  ASP A CB  
1360 C CG  . ASP A 110 ? 0.6044 0.3975 0.4304 -0.0458 -0.0233 0.0311  980  ASP A CG  
1361 O OD1 . ASP A 110 ? 0.6683 0.4562 0.4872 -0.0365 -0.0312 0.0283  980  ASP A OD1 
1362 O OD2 . ASP A 110 ? 0.6336 0.4115 0.4434 -0.0487 -0.0193 0.0329  980  ASP A OD2 
1367 N N   . LEU A 111 ? 0.4896 0.3389 0.3660 -0.0270 -0.0312 0.0232  981  LEU A N   
1368 C CA  . LEU A 111 ? 0.4992 0.3589 0.3796 -0.0161 -0.0327 0.0194  981  LEU A CA  
1369 C C   . LEU A 111 ? 0.4933 0.3362 0.3524 -0.0090 -0.0351 0.0178  981  LEU A C   
1370 O O   . LEU A 111 ? 0.4775 0.3286 0.3391 -0.0010 -0.0356 0.0146  981  LEU A O   
1371 C CB  . LEU A 111 ? 0.4932 0.3593 0.3782 -0.0099 -0.0385 0.0163  981  LEU A CB  
1372 C CG  . LEU A 111 ? 0.6633 0.5442 0.5669 -0.0157 -0.0377 0.0176  981  LEU A CG  
1373 C CD1 . LEU A 111 ? 0.4861 0.3676 0.3882 -0.0098 -0.0436 0.0147  981  LEU A CD1 
1374 C CD2 . LEU A 111 ? 0.6099 0.5125 0.5347 -0.0170 -0.0319 0.0179  981  LEU A CD2 
1386 N N   . GLY A 112 ? 0.4725 0.2913 0.3100 -0.0119 -0.0370 0.0198  982  GLY A N   
1387 C CA  . GLY A 112 ? 0.5432 0.3423 0.3573 -0.0055 -0.0398 0.0188  982  GLY A CA  
1388 C C   . GLY A 112 ? 0.5500 0.3541 0.3660 -0.0064 -0.0338 0.0195  982  GLY A C   
1389 O O   . GLY A 112 ? 0.5248 0.3217 0.3282 0.0020  -0.0368 0.0172  982  GLY A O   
1393 N N   . LEU A 113 ? 0.5028 0.3194 0.3344 -0.0161 -0.0256 0.0223  983  LEU A N   
1394 C CA  . LEU A 113 ? 0.5173 0.3397 0.3519 -0.0174 -0.0189 0.0228  983  LEU A CA  
1395 C C   . LEU A 113 ? 0.4944 0.3338 0.3401 -0.0078 -0.0207 0.0186  983  LEU A C   
1396 O O   . LEU A 113 ? 0.4642 0.3039 0.3064 -0.0059 -0.0177 0.0179  983  LEU A O   
1397 C CB  . LEU A 113 ? 0.4867 0.3227 0.3396 -0.0287 -0.0098 0.0259  983  LEU A CB  
1398 C CG  . LEU A 113 ? 0.5573 0.3774 0.3991 -0.0402 -0.0055 0.0300  983  LEU A CG  
1399 C CD1 . LEU A 113 ? 0.4965 0.3356 0.3618 -0.0504 0.0025  0.0322  983  LEU A CD1 
1400 C CD2 . LEU A 113 ? 0.6992 0.4983 0.5168 -0.0407 -0.0024 0.0312  983  LEU A CD2 
1412 N N   . PHE A 114 ? 0.5233 0.3760 0.3814 -0.0025 -0.0254 0.0158  984  PHE A N   
1413 C CA  . PHE A 114 ? 0.4617 0.3320 0.3319 0.0052  -0.0267 0.0116  984  PHE A CA  
1414 C C   . PHE A 114 ? 0.4985 0.3644 0.3589 0.0164  -0.0353 0.0071  984  PHE A C   
1415 O O   . PHE A 114 ? 0.4503 0.3323 0.3221 0.0223  -0.0371 0.0030  984  PHE A O   
1416 C CB  . PHE A 114 ? 0.4019 0.2943 0.2967 0.0020  -0.0238 0.0115  984  PHE A CB  
1417 C CG  . PHE A 114 ? 0.3568 0.2570 0.2643 -0.0072 -0.0158 0.0151  984  PHE A CG  
1418 C CD1 . PHE A 114 ? 0.3501 0.2606 0.2661 -0.0073 -0.0102 0.0145  984  PHE A CD1 
1419 C CD2 . PHE A 114 ? 0.3976 0.2950 0.3086 -0.0155 -0.0140 0.0187  984  PHE A CD2 
1420 C CE1 . PHE A 114 ? 0.4257 0.3438 0.3537 -0.0147 -0.0025 0.0174  984  PHE A CE1 
1421 C CE2 . PHE A 114 ? 0.4313 0.3381 0.3559 -0.0233 -0.0066 0.0214  984  PHE A CE2 
1422 C CZ  . PHE A 114 ? 0.3522 0.2695 0.2854 -0.0224 -0.0007 0.0207  984  PHE A CZ  
1432 N N   . SER A 115 ? 0.4718 0.3159 0.3110 0.0191  -0.0406 0.0075  985  SER A N   
1433 C CA  . SER A 115 ? 0.4930 0.3318 0.3217 0.0311  -0.0491 0.0029  985  SER A CA  
1434 C C   . SER A 115 ? 0.5006 0.3395 0.3228 0.0379  -0.0508 0.0001  985  SER A C   
1435 O O   . SER A 115 ? 0.4511 0.2838 0.2674 0.0331  -0.0464 0.0027  985  SER A O   
1436 C CB  . SER A 115 ? 0.4941 0.3064 0.2992 0.0329  -0.0545 0.0043  985  SER A CB  
1437 O OG  . SER A 115 ? 0.5531 0.3430 0.3364 0.0310  -0.0541 0.0070  985  SER A OG  
1443 N N   . THR A 116 ? 0.4926 0.3390 0.3159 0.0490  -0.0574 -0.0054 986  THR A N   
1444 C CA  . THR A 116 ? 0.5039 0.3523 0.3223 0.0561  -0.0606 -0.0089 986  THR A CA  
1445 C C   . THR A 116 ? 0.4921 0.3124 0.2825 0.0579  -0.0638 -0.0066 986  THR A C   
1446 O O   . THR A 116 ? 0.5650 0.3821 0.3492 0.0574  -0.0624 -0.0063 986  THR A O   
1447 C CB  . THR A 116 ? 0.4803 0.3417 0.3050 0.0680  -0.0679 -0.0157 986  THR A CB  
1448 O OG1 . THR A 116 ? 0.4555 0.3431 0.3054 0.0651  -0.0638 -0.0178 986  THR A OG1 
1449 C CG2 . THR A 116 ? 0.4571 0.3188 0.2746 0.0762  -0.0732 -0.0197 986  THR A CG2 
1457 N N   . LYS A 117 ? 0.5533 0.3515 0.3251 0.0596  -0.0679 -0.0048 987  LYS A N   
1458 C CA  . LYS A 117 ? 0.6549 0.4224 0.3967 0.0605  -0.0708 -0.0021 987  LYS A CA  
1459 C C   . LYS A 117 ? 0.6761 0.4365 0.4141 0.0480  -0.0615 0.0034  987  LYS A C   
1460 O O   . LYS A 117 ? 0.5890 0.3369 0.3113 0.0490  -0.0616 0.0040  987  LYS A O   
1461 C CB  . LYS A 117 ? 0.8291 0.5734 0.5526 0.0620  -0.0754 -0.0006 987  LYS A CB  
1462 C CG  . LYS A 117 ? 0.8877 0.5967 0.5785 0.0595  -0.0767 0.0036  987  LYS A CG  
1463 C CD  . LYS A 117 ? 1.1549 0.8405 0.8277 0.0604  -0.0813 0.0049  987  LYS A CD  
1464 C CE  . LYS A 117 ? 1.2189 0.8661 0.8559 0.0583  -0.0831 0.0089  987  LYS A CE  
1465 N NZ  . LYS A 117 ? 1.2471 0.8879 0.8819 0.0418  -0.0724 0.0150  987  LYS A NZ  
1479 N N   . THR A 118 ? 0.5683 0.3369 0.3208 0.0364  -0.0535 0.0070  988  THR A N   
1480 C CA  . THR A 118 ? 0.5791 0.3440 0.3312 0.0242  -0.0437 0.0119  988  THR A CA  
1481 C C   . THR A 118 ? 0.5908 0.3728 0.3554 0.0243  -0.0391 0.0103  988  THR A C   
1482 O O   . THR A 118 ? 0.5492 0.3210 0.3029 0.0194  -0.0337 0.0127  988  THR A O   
1483 C CB  . THR A 118 ? 0.5447 0.3198 0.3142 0.0129  -0.0371 0.0152  988  THR A CB  
1484 O OG1 . THR A 118 ? 0.5923 0.3499 0.3488 0.0118  -0.0415 0.0167  988  THR A OG1 
1485 C CG2 . THR A 118 ? 0.6076 0.3809 0.3784 0.0007  -0.0265 0.0197  988  THR A CG2 
1493 N N   . LEU A 119 ? 0.5461 0.3529 0.3323 0.0296  -0.0409 0.0061  989  LEU A N   
1494 C CA  . LEU A 119 ? 0.5626 0.3858 0.3612 0.0296  -0.0370 0.0041  989  LEU A CA  
1495 C C   . LEU A 119 ? 0.5614 0.3718 0.3404 0.0370  -0.0422 0.0017  989  LEU A C   
1496 O O   . LEU A 119 ? 0.5475 0.3560 0.3225 0.0337  -0.0373 0.0025  989  LEU A O   
1497 C CB  . LEU A 119 ? 0.5016 0.3522 0.3256 0.0333  -0.0384 -0.0001 989  LEU A CB  
1498 C CG  . LEU A 119 ? 0.5481 0.4126 0.3922 0.0262  -0.0334 0.0021  989  LEU A CG  
1499 C CD1 . LEU A 119 ? 0.6450 0.5319 0.5087 0.0309  -0.0361 -0.0023 989  LEU A CD1 
1500 C CD2 . LEU A 119 ? 0.5036 0.3739 0.3577 0.0163  -0.0233 0.0058  989  LEU A CD2 
1512 N N   . VAL A 120 ? 0.5595 0.3608 0.3256 0.0475  -0.0526 -0.0016 990  VAL A N   
1513 C CA  . VAL A 120 ? 0.6302 0.4184 0.3764 0.0560  -0.0596 -0.0042 990  VAL A CA  
1514 C C   . VAL A 120 ? 0.6673 0.4265 0.3860 0.0505  -0.0560 0.0008  990  VAL A C   
1515 O O   . VAL A 120 ? 0.7099 0.4620 0.4170 0.0515  -0.0557 0.0003  990  VAL A O   
1516 C CB  . VAL A 120 ? 0.7308 0.5130 0.4674 0.0692  -0.0718 -0.0085 990  VAL A CB  
1517 C CG1 . VAL A 120 ? 0.8607 0.6234 0.5717 0.0779  -0.0800 -0.0103 990  VAL A CG1 
1518 C CG2 . VAL A 120 ? 0.6421 0.4543 0.4050 0.0752  -0.0751 -0.0144 990  VAL A CG2 
1528 N N   . GLU A 121 ? 0.6398 0.3814 0.3473 0.0443  -0.0532 0.0054  991  GLU A N   
1529 C CA  . GLU A 121 ? 0.7313 0.4441 0.4117 0.0375  -0.0488 0.0104  991  GLU A CA  
1530 C C   . GLU A 121 ? 0.7379 0.4587 0.4272 0.0265  -0.0364 0.0132  991  GLU A C   
1531 O O   . GLU A 121 ? 0.6951 0.3978 0.3636 0.0239  -0.0332 0.0151  991  GLU A O   
1532 C CB  . GLU A 121 ? 0.6871 0.3813 0.3559 0.0319  -0.0482 0.0144  991  GLU A CB  
1533 C CG  . GLU A 121 ? 1.1040 0.7832 0.7570 0.0435  -0.0605 0.0119  991  GLU A CG  
1534 C CD  . GLU A 121 ? 1.3421 1.0055 0.9868 0.0378  -0.0601 0.0153  991  GLU A CD  
1535 O OE1 . GLU A 121 ? 1.4291 1.0982 1.0852 0.0245  -0.0506 0.0191  991  GLU A OE1 
1536 O OE2 . GLU A 121 ? 1.2937 0.9390 0.9205 0.0468  -0.0696 0.0138  991  GLU A OE2 
1543 N N   . ALA A 122 ? 0.6385 0.3856 0.3577 0.0205  -0.0295 0.0132  992  ALA A N   
1544 C CA  . ALA A 122 ? 0.6252 0.3822 0.3557 0.0108  -0.0176 0.0155  992  ALA A CA  
1545 C C   . ALA A 122 ? 0.7131 0.4770 0.4439 0.0153  -0.0174 0.0123  992  ALA A C   
1546 O O   . ALA A 122 ? 0.6867 0.4376 0.4024 0.0112  -0.0114 0.0141  992  ALA A O   
1547 C CB  . ALA A 122 ? 0.5701 0.3529 0.3320 0.0050  -0.0119 0.0160  992  ALA A CB  
1553 N N   . ASN A 123 ? 0.6510 0.4350 0.3985 0.0230  -0.0235 0.0073  993  ASN A N   
1554 C CA  . ASN A 123 ? 0.6459 0.4381 0.3954 0.0268  -0.0241 0.0037  993  ASN A CA  
1555 C C   . ASN A 123 ? 0.6566 0.4585 0.4098 0.0383  -0.0360 -0.0022 993  ASN A C   
1556 O O   . ASN A 123 ? 0.5364 0.3627 0.3135 0.0397  -0.0365 -0.0056 993  ASN A O   
1557 C CB  . ASN A 123 ? 0.6259 0.4409 0.4012 0.0203  -0.0145 0.0037  993  ASN A CB  
1558 C CG  . ASN A 123 ? 0.5598 0.3696 0.3354 0.0095  -0.0023 0.0089  993  ASN A CG  
1559 O OD1 . ASN A 123 ? 0.6999 0.5002 0.4640 0.0059  0.0044  0.0101  993  ASN A OD1 
1560 N ND2 . ASN A 123 ? 0.4981 0.3147 0.2872 0.0042  0.0007  0.0116  993  ASN A ND2 
1567 N N   . ASN A 124 ? 0.6081 0.3911 0.3376 0.0464  -0.0455 -0.0037 994  ASN A N   
1568 C CA  . ASN A 124 ? 0.7045 0.4971 0.4381 0.0581  -0.0576 -0.0096 994  ASN A CA  
1569 C C   . ASN A 124 ? 0.5846 0.3959 0.3303 0.0616  -0.0603 -0.0151 994  ASN A C   
1570 O O   . ASN A 124 ? 0.5938 0.4226 0.3530 0.0690  -0.0679 -0.0206 994  ASN A O   
1571 C CB  . ASN A 124 ? 0.8070 0.5728 0.5108 0.0669  -0.0679 -0.0098 994  ASN A CB  
1572 C CG  . ASN A 124 ? 0.8977 0.6456 0.5774 0.0696  -0.0709 -0.0103 994  ASN A CG  
1573 O OD1 . ASN A 124 ? 0.9081 0.6416 0.5748 0.0613  -0.0623 -0.0061 994  ASN A OD1 
1574 N ND2 . ASN A 124 ? 0.9121 0.6606 0.5851 0.0815  -0.0834 -0.0157 994  ASN A ND2 
1581 N N   . GLU A 125 ? 0.5472 0.3552 0.2884 0.0559  -0.0536 -0.0139 995  GLU A N   
1582 C CA  . GLU A 125 ? 0.5348 0.3584 0.2857 0.0580  -0.0558 -0.0190 995  GLU A CA  
1583 C C   . GLU A 125 ? 0.5538 0.4012 0.3325 0.0504  -0.0465 -0.0191 995  GLU A C   
1584 O O   . GLU A 125 ? 0.5191 0.3791 0.3067 0.0501  -0.0465 -0.0229 995  GLU A O   
1585 C CB  . GLU A 125 ? 0.6591 0.4629 0.3857 0.0573  -0.0552 -0.0183 995  GLU A CB  
1586 C CG  . GLU A 125 ? 0.9253 0.7011 0.6199 0.0644  -0.0641 -0.0176 995  GLU A CG  
1587 C CD  . GLU A 125 ? 1.1227 0.9047 0.8166 0.0770  -0.0794 -0.0239 995  GLU A CD  
1588 O OE1 . GLU A 125 ? 0.9589 0.7642 0.6764 0.0806  -0.0830 -0.0275 995  GLU A OE1 
1589 O OE2 . GLU A 125 ? 1.3579 1.1215 1.0272 0.0836  -0.0878 -0.0254 995  GLU A OE2 
1596 N N   . HIS A 126 ? 0.5052 0.3577 0.2965 0.0444  -0.0391 -0.0151 996  HIS A N   
1597 C CA  . HIS A 126 ? 0.5047 0.3774 0.3207 0.0377  -0.0306 -0.0148 996  HIS A CA  
1598 C C   . HIS A 126 ? 0.5524 0.4485 0.3882 0.0416  -0.0359 -0.0205 996  HIS A C   
1599 O O   . HIS A 126 ? 0.4510 0.3521 0.2886 0.0485  -0.0445 -0.0237 996  HIS A O   
1600 C CB  . HIS A 126 ? 0.4858 0.3601 0.3115 0.0319  -0.0242 -0.0099 996  HIS A CB  
1601 C CG  . HIS A 126 ? 0.5143 0.4017 0.3585 0.0242  -0.0139 -0.0080 996  HIS A CG  
1602 N ND1 . HIS A 126 ? 0.5538 0.4334 0.3923 0.0183  -0.0047 -0.0051 996  HIS A ND1 
1603 C CD2 . HIS A 126 ? 0.4731 0.3802 0.3407 0.0220  -0.0113 -0.0086 996  HIS A CD2 
1604 C CE1 . HIS A 126 ? 0.5340 0.4286 0.3925 0.0136  0.0027  -0.0042 996  HIS A CE1 
1605 N NE2 . HIS A 126 ? 0.5013 0.4119 0.3769 0.0155  -0.0015 -0.0061 996  HIS A NE2 
1614 N N   . MET A 127 ? 0.4577 0.3678 0.3082 0.0371  -0.0304 -0.0220 997  MET A N   
1615 C CA  . MET A 127 ? 0.3839 0.3150 0.2515 0.0393  -0.0347 -0.0277 997  MET A CA  
1616 C C   . MET A 127 ? 0.3284 0.2753 0.2156 0.0384  -0.0337 -0.0275 997  MET A C   
1617 O O   . MET A 127 ? 0.4060 0.3520 0.2994 0.0334  -0.0270 -0.0228 997  MET A O   
1618 C CB  . MET A 127 ? 0.4738 0.4118 0.3481 0.0343  -0.0291 -0.0293 997  MET A CB  
1619 C CG  . MET A 127 ? 0.6210 0.5790 0.5105 0.0355  -0.0337 -0.0356 997  MET A CG  
1620 S SD  . MET A 127 ? 0.8252 0.7872 0.7184 0.0294  -0.0281 -0.0378 997  MET A SD  
1621 C CE  . MET A 127 ? 0.4940 0.4310 0.3607 0.0299  -0.0263 -0.0352 997  MET A CE  
1631 N N   . VAL A 128 ? 0.3596 0.3214 0.2565 0.0432  -0.0405 -0.0329 998  VAL A N   
1632 C CA  . VAL A 128 ? 0.3455 0.3230 0.2599 0.0427  -0.0399 -0.0337 998  VAL A CA  
1633 C C   . VAL A 128 ? 0.3740 0.3720 0.3040 0.0418  -0.0410 -0.0396 998  VAL A C   
1634 O O   . VAL A 128 ? 0.3776 0.3806 0.3051 0.0466  -0.0480 -0.0451 998  VAL A O   
1635 C CB  . VAL A 128 ? 0.3641 0.3387 0.2734 0.0505  -0.0474 -0.0350 998  VAL A CB  
1636 C CG1 . VAL A 128 ? 0.3198 0.3104 0.2464 0.0499  -0.0463 -0.0363 998  VAL A CG1 
1637 C CG2 . VAL A 128 ? 0.4397 0.3916 0.3310 0.0508  -0.0469 -0.0294 998  VAL A CG2 
1647 N N   . GLU A 129 ? 0.2875 0.2967 0.2328 0.0356  -0.0344 -0.0386 999  GLU A N   
1648 C CA  . GLU A 129 ? 0.3095 0.3377 0.2693 0.0337  -0.0350 -0.0441 999  GLU A CA  
1649 C C   . GLU A 129 ? 0.4112 0.4520 0.3796 0.0385  -0.0396 -0.0476 999  GLU A C   
1650 O O   . GLU A 129 ? 0.3849 0.4224 0.3541 0.0393  -0.0382 -0.0443 999  GLU A O   
1651 C CB  . GLU A 129 ? 0.3213 0.3543 0.2918 0.0254  -0.0264 -0.0418 999  GLU A CB  
1652 C CG  . GLU A 129 ? 0.3572 0.4082 0.3415 0.0221  -0.0262 -0.0471 999  GLU A CG  
1653 C CD  . GLU A 129 ? 0.5108 0.5637 0.5032 0.0144  -0.0181 -0.0444 999  GLU A CD  
1654 O OE1 . GLU A 129 ? 0.4307 0.4720 0.4178 0.0116  -0.0131 -0.0401 999  GLU A OE1 
1655 O OE2 . GLU A 129 ? 0.5508 0.6162 0.5545 0.0113  -0.0166 -0.0467 999  GLU A OE2 
1662 N N   . VAL A 130 ? 0.3120 0.3673 0.2867 0.0417  -0.0450 -0.0545 1000 VAL A N   
1663 C CA  . VAL A 130 ? 0.3712 0.4401 0.3545 0.0473  -0.0493 -0.0589 1000 VAL A CA  
1664 C C   . VAL A 130 ? 0.4306 0.5208 0.4318 0.0417  -0.0456 -0.0633 1000 VAL A C   
1665 O O   . VAL A 130 ? 0.3402 0.4388 0.3465 0.0372  -0.0451 -0.0669 1000 VAL A O   
1666 C CB  . VAL A 130 ? 0.3942 0.4642 0.3705 0.0573  -0.0597 -0.0642 1000 VAL A CB  
1667 C CG1 . VAL A 130 ? 0.3973 0.4844 0.3847 0.0637  -0.0637 -0.0699 1000 VAL A CG1 
1668 C CG2 . VAL A 130 ? 0.3808 0.4267 0.3365 0.0627  -0.0632 -0.0594 1000 VAL A CG2 
1678 N N   . ARG A 131 ? 0.3396 0.4373 0.3493 0.0412  -0.0426 -0.0630 1001 ARG A N   
1679 C CA  . ARG A 131 ? 0.3242 0.4417 0.3496 0.0363  -0.0390 -0.0676 1001 ARG A CA  
1680 C C   . ARG A 131 ? 0.2894 0.4218 0.3215 0.0442  -0.0441 -0.0739 1001 ARG A C   
1681 O O   . ARG A 131 ? 0.3339 0.4612 0.3623 0.0498  -0.0452 -0.0722 1001 ARG A O   
1682 C CB  . ARG A 131 ? 0.2659 0.3801 0.2950 0.0290  -0.0307 -0.0624 1001 ARG A CB  
1683 C CG  . ARG A 131 ? 0.2939 0.3971 0.3195 0.0213  -0.0251 -0.0573 1001 ARG A CG  
1684 C CD  . ARG A 131 ? 0.2848 0.3981 0.3169 0.0147  -0.0232 -0.0617 1001 ARG A CD  
1685 N NE  . ARG A 131 ? 0.4329 0.5336 0.4595 0.0089  -0.0185 -0.0572 1001 ARG A NE  
1686 C CZ  . ARG A 131 ? 0.5347 0.6388 0.5649 0.0014  -0.0147 -0.0590 1001 ARG A CZ  
1687 N NH1 . ARG A 131 ? 0.3937 0.5141 0.4336 -0.0025 -0.0147 -0.0651 1001 ARG A NH1 
1688 N NH2 . ARG A 131 ? 0.4376 0.5285 0.4616 -0.0024 -0.0106 -0.0549 1001 ARG A NH2 
1702 N N   . THR A 132 ? 0.3085 0.4597 0.3506 0.0448  -0.0474 -0.0815 1002 THR A N   
1703 C CA  . THR A 132 ? 0.2804 0.4495 0.3317 0.0527  -0.0520 -0.0888 1002 THR A CA  
1704 C C   . THR A 132 ? 0.2879 0.4747 0.3541 0.0459  -0.0445 -0.0915 1002 THR A C   
1705 O O   . THR A 132 ? 0.2861 0.4821 0.3605 0.0359  -0.0393 -0.0931 1002 THR A O   
1706 C CB  . THR A 132 ? 0.3768 0.5593 0.4326 0.0574  -0.0603 -0.0963 1002 THR A CB  
1707 O OG1 . THR A 132 ? 0.3843 0.5475 0.4231 0.0642  -0.0675 -0.0934 1002 THR A OG1 
1708 C CG2 . THR A 132 ? 0.3433 0.5477 0.4114 0.0660  -0.0649 -0.1046 1002 THR A CG2 
1716 N N   . GLN A 133 ? 0.2560 0.4454 0.3237 0.0512  -0.0436 -0.0921 1003 GLN A N   
1717 C CA  . GLN A 133 ? 0.3012 0.5032 0.3795 0.0449  -0.0355 -0.0936 1003 GLN A CA  
1718 C C   . GLN A 133 ? 0.3307 0.5500 0.4174 0.0539  -0.0380 -0.1009 1003 GLN A C   
1719 O O   . GLN A 133 ? 0.4034 0.6224 0.4865 0.0657  -0.0464 -0.1039 1003 GLN A O   
1720 C CB  . GLN A 133 ? 0.2986 0.4815 0.3674 0.0407  -0.0299 -0.0852 1003 GLN A CB  
1721 C CG  . GLN A 133 ? 0.3343 0.4989 0.3942 0.0339  -0.0277 -0.0777 1003 GLN A CG  
1722 C CD  . GLN A 133 ? 0.3472 0.4938 0.3985 0.0316  -0.0239 -0.0697 1003 GLN A CD  
1723 O OE1 . GLN A 133 ? 0.3419 0.4841 0.3891 0.0372  -0.0253 -0.0688 1003 GLN A OE1 
1724 N NE2 . GLN A 133 ? 0.2888 0.4250 0.3371 0.0237  -0.0195 -0.0641 1003 GLN A NE2 
1733 N N   . LEU A 134 ? 0.3460 0.5794 0.4428 0.0486  -0.0305 -0.1037 1004 LEU A N   
1734 C CA  . LEU A 134 ? 0.4218 0.6704 0.5259 0.0568  -0.0309 -0.1101 1004 LEU A CA  
1735 C C   . LEU A 134 ? 0.4727 0.7041 0.5653 0.0597  -0.0282 -0.1047 1004 LEU A C   
1736 O O   . LEU A 134 ? 0.4157 0.6350 0.5028 0.0507  -0.0217 -0.0984 1004 LEU A O   
1737 C CB  . LEU A 134 ? 0.4693 0.7444 0.5909 0.0488  -0.0235 -0.1171 1004 LEU A CB  
1738 C CG  . LEU A 134 ? 0.5497 0.8444 0.6846 0.0443  -0.0258 -0.1234 1004 LEU A CG  
1739 C CD1 . LEU A 134 ? 0.5662 0.8845 0.7170 0.0333  -0.0166 -0.1293 1004 LEU A CD1 
1740 C CD2 . LEU A 134 ? 0.4324 0.7390 0.5723 0.0580  -0.0368 -0.1303 1004 LEU A CD2 
1752 N N   . LEU A 135 ? 0.3720 0.6012 0.4600 0.0726  -0.0338 -0.1073 1005 LEU A N   
1753 C CA  . LEU A 135 ? 0.4468 0.6613 0.5242 0.0759  -0.0316 -0.1035 1005 LEU A CA  
1754 C C   . LEU A 135 ? 0.6107 0.8400 0.6974 0.0692  -0.0219 -0.1067 1005 LEU A C   
1755 O O   . LEU A 135 ? 0.5799 0.8329 0.6801 0.0724  -0.0202 -0.1153 1005 LEU A O   
1756 C CB  . LEU A 135 ? 0.5271 0.7375 0.5978 0.0917  -0.0398 -0.1070 1005 LEU A CB  
1757 C CG  . LEU A 135 ? 0.5991 0.7916 0.6563 0.0964  -0.0390 -0.1036 1005 LEU A CG  
1758 C CD1 . LEU A 135 ? 0.5430 0.7108 0.5870 0.0875  -0.0365 -0.0933 1005 LEU A CD1 
1759 C CD2 . LEU A 135 ? 0.6907 0.8738 0.7378 0.1121  -0.0487 -0.1062 1005 LEU A CD2 
1771 N N   . GLN A 136 ? 0.4280 0.6432 0.5073 0.0599  -0.0156 -0.0999 1006 GLN A N   
1772 C CA  . GLN A 136 ? 0.2981 0.5230 0.3827 0.0520  -0.0058 -0.1016 1006 GLN A CA  
1773 C C   . GLN A 136 ? 0.3898 0.6016 0.4630 0.0570  -0.0047 -0.0996 1006 GLN A C   
1774 O O   . GLN A 136 ? 0.4246 0.6149 0.4842 0.0618  -0.0100 -0.0939 1006 GLN A O   
1775 C CB  . GLN A 136 ? 0.2929 0.5102 0.3759 0.0376  0.0002  -0.0956 1006 GLN A CB  
1776 C CG  . GLN A 136 ? 0.3971 0.6273 0.4909 0.0310  0.0004  -0.0982 1006 GLN A CG  
1777 C CD  . GLN A 136 ? 0.4924 0.7496 0.6019 0.0259  0.0066  -0.1068 1006 GLN A CD  
1778 O OE1 . GLN A 136 ? 0.4359 0.7021 0.5481 0.0266  0.0121  -0.1105 1006 GLN A OE1 
1779 N NE2 . GLN A 136 ? 0.4222 0.6925 0.5418 0.0203  0.0061  -0.1102 1006 GLN A NE2 
1788 N N   . PRO A 137 ? 0.4458 0.6704 0.5239 0.0554  0.0026  -0.1045 1007 PRO A N   
1789 C CA  . PRO A 137 ? 0.4518 0.6642 0.5182 0.0604  0.0040  -0.1035 1007 PRO A CA  
1790 C C   . PRO A 137 ? 0.3962 0.5870 0.4495 0.0509  0.0077  -0.0946 1007 PRO A C   
1791 O O   . PRO A 137 ? 0.3659 0.5597 0.4222 0.0393  0.0145  -0.0927 1007 PRO A O   
1792 C CB  . PRO A 137 ? 0.5375 0.7736 0.6150 0.0608  0.0118  -0.1125 1007 PRO A CB  
1793 C CG  . PRO A 137 ? 0.5109 0.7647 0.6021 0.0488  0.0179  -0.1145 1007 PRO A CG  
1794 C CD  . PRO A 137 ? 0.4941 0.7449 0.5883 0.0485  0.0103  -0.1117 1007 PRO A CD  
1802 N N   . ALA A 138 ? 0.3508 0.5195 0.3892 0.0560  0.0027  -0.0895 1008 ALA A N   
1803 C CA  . ALA A 138 ? 0.5833 0.7318 0.6090 0.0487  0.0049  -0.0818 1008 ALA A CA  
1804 C C   . ALA A 138 ? 0.3590 0.5035 0.3871 0.0370  0.0074  -0.0757 1008 ALA A C   
1805 O O   . ALA A 138 ? 0.4043 0.5459 0.4352 0.0368  0.0029  -0.0728 1008 ALA A O   
1806 C CB  . ALA A 138 ? 0.6124 0.7636 0.6340 0.0469  0.0122  -0.0848 1008 ALA A CB  
1812 N N   . ASP A 139 ? 0.3585 0.5016 0.3842 0.0277  0.0146  -0.0739 1009 ASP A N   
1813 C CA  . ASP A 139 ? 0.3953 0.5311 0.4205 0.0172  0.0168  -0.0677 1009 ASP A CA  
1814 C C   . ASP A 139 ? 0.3469 0.5003 0.3836 0.0093  0.0235  -0.0720 1009 ASP A C   
1815 O O   . ASP A 139 ? 0.4414 0.5892 0.4766 -0.0001 0.0271  -0.0679 1009 ASP A O   
1816 C CB  . ASP A 139 ? 0.3894 0.5083 0.4017 0.0118  0.0195  -0.0622 1009 ASP A CB  
1817 C CG  . ASP A 139 ? 0.6089 0.7348 0.6184 0.0096  0.0272  -0.0671 1009 ASP A CG  
1818 O OD1 . ASP A 139 ? 0.5327 0.6782 0.5528 0.0073  0.0331  -0.0737 1009 ASP A OD1 
1819 O OD2 . ASP A 139 ? 0.4752 0.5873 0.4718 0.0098  0.0275  -0.0646 1009 ASP A OD2 
1824 N N   . GLU A 140 ? 0.3960 0.5707 0.4442 0.0135  0.0249  -0.0803 1010 GLU A N   
1825 C CA  . GLU A 140 ? 0.3028 0.4971 0.3629 0.0054  0.0319  -0.0858 1010 GLU A CA  
1826 C C   . GLU A 140 ? 0.3265 0.5316 0.3980 0.0056  0.0277  -0.0879 1010 GLU A C   
1827 O O   . GLU A 140 ? 0.3846 0.5866 0.4562 0.0143  0.0196  -0.0873 1010 GLU A O   
1828 C CB  . GLU A 140 ? 0.4412 0.6556 0.5087 0.0090  0.0371  -0.0948 1010 GLU A CB  
1829 C CG  . GLU A 140 ? 0.3523 0.5569 0.4077 0.0081  0.0426  -0.0937 1010 GLU A CG  
1830 C CD  . GLU A 140 ? 0.5798 0.8021 0.6410 0.0156  0.0462  -0.1027 1010 GLU A CD  
1831 O OE1 . GLU A 140 ? 0.3623 0.6055 0.4382 0.0224  0.0436  -0.1099 1010 GLU A OE1 
1832 O OE2 . GLU A 140 ? 0.5148 0.7300 0.5657 0.0152  0.0514  -0.1028 1010 GLU A OE2 
1839 N N   . ASN A 141 ? 0.2972 0.5135 0.3765 -0.0047 0.0333  -0.0902 1011 ASN A N   
1840 C CA  . ASN A 141 ? 0.2933 0.5228 0.3842 -0.0055 0.0300  -0.0938 1011 ASN A CA  
1841 C C   . ASN A 141 ? 0.4177 0.6728 0.5228 -0.0122 0.0368  -0.1025 1011 ASN A C   
1842 O O   . ASN A 141 ? 0.3439 0.5984 0.4472 -0.0242 0.0452  -0.1019 1011 ASN A O   
1843 C CB  . ASN A 141 ? 0.2881 0.5017 0.3733 -0.0128 0.0289  -0.0869 1011 ASN A CB  
1844 C CG  . ASN A 141 ? 0.3556 0.5797 0.4501 -0.0129 0.0246  -0.0903 1011 ASN A CG  
1845 O OD1 . ASN A 141 ? 0.3763 0.6018 0.4726 -0.0032 0.0167  -0.0914 1011 ASN A OD1 
1846 N ND2 . ASN A 141 ? 0.3124 0.5424 0.4115 -0.0241 0.0296  -0.0919 1011 ASN A ND2 
1853 N N   . TRP A 142 ? 0.4357 0.7129 0.5546 -0.0046 0.0330  -0.1107 1012 TRP A N   
1854 C CA  . TRP A 142 ? 0.5088 0.8146 0.6444 -0.0102 0.0387  -0.1201 1012 TRP A CA  
1855 C C   . TRP A 142 ? 0.4017 0.7199 0.5485 -0.0130 0.0339  -0.1236 1012 TRP A C   
1856 O O   . TRP A 142 ? 0.3201 0.6293 0.4636 -0.0057 0.0246  -0.1209 1012 TRP A O   
1857 C CB  . TRP A 142 ? 0.3272 0.6529 0.4724 0.0014  0.0379  -0.1283 1012 TRP A CB  
1858 C CG  . TRP A 142 ? 0.5086 0.8247 0.6433 0.0041  0.0433  -0.1266 1012 TRP A CG  
1859 C CD1 . TRP A 142 ? 0.4225 0.7158 0.5417 0.0128  0.0386  -0.1204 1012 TRP A CD1 
1860 C CD2 . TRP A 142 ? 0.5151 0.8439 0.6532 -0.0022 0.0547  -0.1314 1012 TRP A CD2 
1861 N NE1 . TRP A 142 ? 0.4827 0.7730 0.5950 0.0125  0.0457  -0.1211 1012 TRP A NE1 
1862 C CE2 . TRP A 142 ? 0.5142 0.8258 0.6374 0.0036  0.0559  -0.1277 1012 TRP A CE2 
1863 C CE3 . TRP A 142 ? 0.6279 0.9807 0.7797 -0.0129 0.0642  -0.1385 1012 TRP A CE3 
1864 C CZ2 . TRP A 142 ? 0.6615 0.9780 0.7818 -0.0003 0.0664  -0.1308 1012 TRP A CZ2 
1865 C CZ3 . TRP A 142 ? 0.6664 1.0249 0.8161 -0.0173 0.0752  -0.1416 1012 TRP A CZ3 
1866 C CH2 . TRP A 142 ? 0.6644 1.0044 0.7979 -0.0107 0.0763  -0.1377 1012 TRP A CH2 
1877 N N   . ASP A 143 ? 0.4742 0.8126 0.6335 -0.0240 0.0403  -0.1298 1013 ASP A N   
1878 C CA  . ASP A 143 ? 0.5584 0.9127 0.7304 -0.0265 0.0353  -0.1349 1013 ASP A CA  
1879 C C   . ASP A 143 ? 0.5220 0.8930 0.7047 -0.0106 0.0256  -0.1414 1013 ASP A C   
1880 O O   . ASP A 143 ? 0.4253 0.7991 0.6076 0.0001  0.0252  -0.1431 1013 ASP A O   
1881 C CB  . ASP A 143 ? 0.6538 1.0282 0.8377 -0.0410 0.0441  -0.1414 1013 ASP A CB  
1882 C CG  . ASP A 143 ? 0.6829 1.0782 0.8780 -0.0358 0.0446  -0.1493 1013 ASP A CG  
1883 O OD1 . ASP A 143 ? 0.5086 0.9048 0.7012 -0.0336 0.0508  -0.1499 1013 ASP A OD1 
1884 O OD2 . ASP A 143 ? 0.6231 1.0337 0.8291 -0.0339 0.0388  -0.1552 1013 ASP A OD2 
1889 N N   . PRO A 144 ? 0.4768 0.8571 0.6674 -0.0085 0.0174  -0.1449 1014 PRO A N   
1890 C CA  . PRO A 144 ? 0.5974 0.9864 0.7931 0.0080  0.0060  -0.1494 1014 PRO A CA  
1891 C C   . PRO A 144 ? 0.6514 1.0590 0.8566 0.0144  0.0066  -0.1570 1014 PRO A C   
1892 O O   . PRO A 144 ? 0.5949 1.0045 0.8001 0.0297  -0.0017 -0.1596 1014 PRO A O   
1893 C CB  . PRO A 144 ? 0.5726 0.9636 0.7712 0.0055  -0.0018 -0.1507 1014 PRO A CB  
1894 C CG  . PRO A 144 ? 0.5643 0.9412 0.7558 -0.0106 0.0048  -0.1449 1014 PRO A CG  
1895 C CD  . PRO A 144 ? 0.4288 0.8090 0.6214 -0.0209 0.0175  -0.1446 1014 PRO A CD  
1903 N N   . THR A 145 ? 0.4874 0.9072 0.6995 0.0030  0.0162  -0.1605 1015 THR A N   
1904 C CA  . THR A 145 ? 0.7686 1.2078 0.9911 0.0080  0.0177  -0.1681 1015 THR A CA  
1905 C C   . THR A 145 ? 0.8030 1.2383 1.0202 0.0134  0.0238  -0.1671 1015 THR A C   
1906 O O   . THR A 145 ? 0.8505 1.2995 1.0746 0.0206  0.0242  -0.1730 1015 THR A O   
1907 C CB  . THR A 145 ? 0.7199 1.1752 0.9528 -0.0069 0.0253  -0.1729 1015 THR A CB  
1908 O OG1 . THR A 145 ? 0.7001 1.1477 0.9267 -0.0200 0.0379  -0.1692 1015 THR A OG1 
1909 C CG2 . THR A 145 ? 0.6482 1.1040 0.8839 -0.0148 0.0208  -0.1730 1015 THR A CG2 
1917 N N   . GLY A 146 ? 0.6611 1.0775 0.8658 0.0100  0.0286  -0.1599 1016 GLY A N   
1918 C CA  . GLY A 146 ? 0.6125 1.0221 0.8096 0.0151  0.0342  -0.1585 1016 GLY A CA  
1919 C C   . GLY A 146 ? 0.6793 1.0955 0.8779 0.0027  0.0472  -0.1602 1016 GLY A C   
1920 O O   . GLY A 146 ? 0.4627 0.8797 0.6583 0.0074  0.0521  -0.1618 1016 GLY A O   
1924 N N   . THR A 147 ? 0.6150 1.0341 0.8166 -0.0132 0.0527  -0.1599 1017 THR A N   
1925 C CA  . THR A 147 ? 0.6755 1.0999 0.8777 -0.0264 0.0648  -0.1616 1017 THR A CA  
1926 C C   . THR A 147 ? 0.7154 1.1184 0.9010 -0.0358 0.0740  -0.1542 1017 THR A C   
1927 O O   . THR A 147 ? 0.5363 0.9382 0.7168 -0.0388 0.0829  -0.1548 1017 THR A O   
1928 C CB  . THR A 147 ? 0.7313 1.1672 0.9427 -0.0397 0.0666  -0.1650 1017 THR A CB  
1929 O OG1 . THR A 147 ? 0.6710 1.1280 0.8978 -0.0311 0.0585  -0.1724 1017 THR A OG1 
1930 C CG2 . THR A 147 ? 0.8092 1.2490 1.0198 -0.0537 0.0794  -0.1666 1017 THR A CG2 
1938 N N   . LYS A 148 ? 0.5919 0.9775 0.7684 -0.0402 0.0719  -0.1474 1018 LYS A N   
1939 C CA  . LYS A 148 ? 0.6767 1.0410 0.8366 -0.0501 0.0802  -0.1402 1018 LYS A CA  
1940 C C   . LYS A 148 ? 0.5814 0.9218 0.7288 -0.0463 0.0735  -0.1315 1018 LYS A C   
1941 O O   . LYS A 148 ? 0.3724 0.7124 0.5243 -0.0410 0.0640  -0.1307 1018 LYS A O   
1942 C CB  . LYS A 148 ? 0.6427 1.0043 0.8003 -0.0684 0.0882  -0.1396 1018 LYS A CB  
1943 C CG  . LYS A 148 ? 0.6725 1.0346 0.8351 -0.0746 0.0830  -0.1391 1018 LYS A CG  
1944 C CD  . LYS A 148 ? 0.7867 1.1413 0.9430 -0.0928 0.0913  -0.1379 1018 LYS A CD  
1945 C CE  . LYS A 148 ? 0.8617 1.2046 1.0142 -0.0999 0.0874  -0.1340 1018 LYS A CE  
1946 N NZ  . LYS A 148 ? 0.9017 1.2622 1.0686 -0.0998 0.0810  -0.1402 1018 LYS A NZ  
1960 N N   . LYS A 149 ? 0.5400 0.8540 0.6680 -0.0487 0.0768  -0.1234 1019 LYS A N   
1961 C CA  . LYS A 149 ? 0.6434 0.9277 0.7557 -0.0462 0.0697  -0.1131 1019 LYS A CA  
1962 C C   . LYS A 149 ? 0.5948 0.8705 0.7049 -0.0582 0.0705  -0.1094 1019 LYS A C   
1963 O O   . LYS A 149 ? 0.5097 0.7855 0.6172 -0.0717 0.0795  -0.1101 1019 LYS A O   
1964 C CB  . LYS A 149 ? 0.5997 0.8601 0.6928 -0.0464 0.0731  -0.1062 1019 LYS A CB  
1965 C CG  . LYS A 149 ? 0.7001 0.9609 0.7904 -0.0333 0.0705  -0.1078 1019 LYS A CG  
1966 C CD  . LYS A 149 ? 0.7429 0.9904 0.8179 -0.0378 0.0785  -0.1053 1019 LYS A CD  
1967 C CE  . LYS A 149 ? 0.7789 1.0101 0.8417 -0.0260 0.0727  -0.1015 1019 LYS A CE  
1968 N NZ  . LYS A 149 ? 0.7507 0.9515 0.7945 -0.0296 0.0703  -0.0912 1019 LYS A NZ  
1982 N N   . ILE A 150 ? 0.3664 0.6333 0.4761 -0.0534 0.0615  -0.1057 1020 ILE A N   
1983 C CA  . ILE A 150 ? 0.2800 0.5352 0.3853 -0.0632 0.0615  -0.1017 1020 ILE A CA  
1984 C C   . ILE A 150 ? 0.2883 0.5166 0.3802 -0.0578 0.0548  -0.0921 1020 ILE A C   
1985 O O   . ILE A 150 ? 0.3030 0.5248 0.3915 -0.0465 0.0488  -0.0894 1020 ILE A O   
1986 C CB  . ILE A 150 ? 0.3672 0.6421 0.4878 -0.0648 0.0578  -0.1083 1020 ILE A CB  
1987 C CG1 . ILE A 150 ? 0.3090 0.5909 0.4364 -0.0496 0.0470  -0.1101 1020 ILE A CG1 
1988 C CG2 . ILE A 150 ? 0.5237 0.8262 0.6589 -0.0731 0.0653  -0.1179 1020 ILE A CG2 
1989 C CD1 . ILE A 150 ? 0.4102 0.7062 0.5491 -0.0500 0.0412  -0.1152 1020 ILE A CD1 
2001 N N   . TRP A 151 ? 0.3514 0.5642 0.4356 -0.0662 0.0560  -0.0873 1021 TRP A N   
2002 C CA  . TRP A 151 ? 0.3545 0.5437 0.4276 -0.0617 0.0505  -0.0787 1021 TRP A CA  
2003 C C   . TRP A 151 ? 0.4104 0.6026 0.4896 -0.0556 0.0425  -0.0793 1021 TRP A C   
2004 O O   . TRP A 151 ? 0.2970 0.4760 0.3706 -0.0476 0.0366  -0.0740 1021 TRP A O   
2005 C CB  . TRP A 151 ? 0.3474 0.5164 0.4078 -0.0722 0.0554  -0.0730 1021 TRP A CB  
2006 C CG  . TRP A 151 ? 0.5220 0.6771 0.5699 -0.0744 0.0600  -0.0686 1021 TRP A CG  
2007 C CD1 . TRP A 151 ? 0.5957 0.7593 0.6432 -0.0783 0.0667  -0.0723 1021 TRP A CD1 
2008 C CD2 . TRP A 151 ? 0.4307 0.5609 0.4644 -0.0727 0.0579  -0.0598 1021 TRP A CD2 
2009 N NE1 . TRP A 151 ? 0.5114 0.6551 0.5433 -0.0792 0.0688  -0.0662 1021 TRP A NE1 
2010 C CE2 . TRP A 151 ? 0.3786 0.5021 0.4024 -0.0756 0.0629  -0.0585 1021 TRP A CE2 
2011 C CE3 . TRP A 151 ? 0.3755 0.4891 0.4040 -0.0687 0.0524  -0.0533 1021 TRP A CE3 
2012 C CZ2 . TRP A 151 ? 0.3238 0.4244 0.3328 -0.0746 0.0615  -0.0509 1021 TRP A CZ2 
2013 C CZ3 . TRP A 151 ? 0.3012 0.3940 0.3170 -0.0676 0.0514  -0.0460 1021 TRP A CZ3 
2014 C CH2 . TRP A 151 ? 0.2877 0.3741 0.2938 -0.0704 0.0554  -0.0448 1021 TRP A CH2 
2025 N N   . HIS A 152 ? 0.3624 0.5719 0.4525 -0.0594 0.0423  -0.0861 1022 HIS A N   
2026 C CA  . HIS A 152 ? 0.3303 0.5405 0.4238 -0.0543 0.0347  -0.0867 1022 HIS A CA  
2027 C C   . HIS A 152 ? 0.3977 0.6134 0.4947 -0.0402 0.0268  -0.0877 1022 HIS A C   
2028 O O   . HIS A 152 ? 0.3467 0.5810 0.4532 -0.0352 0.0260  -0.0940 1022 HIS A O   
2029 C CB  . HIS A 152 ? 0.4170 0.6448 0.5211 -0.0616 0.0352  -0.0941 1022 HIS A CB  
2030 C CG  . HIS A 152 ? 0.4918 0.7187 0.5973 -0.0564 0.0271  -0.0948 1022 HIS A CG  
2031 N ND1 . HIS A 152 ? 0.5297 0.7733 0.6450 -0.0472 0.0198  -0.1005 1022 HIS A ND1 
2032 C CD2 . HIS A 152 ? 0.5204 0.7300 0.6171 -0.0584 0.0251  -0.0903 1022 HIS A CD2 
2033 C CE1 . HIS A 152 ? 0.5474 0.7834 0.6590 -0.0445 0.0136  -0.0994 1022 HIS A CE1 
2034 N NE2 . HIS A 152 ? 0.6761 0.8919 0.7767 -0.0513 0.0170  -0.0933 1022 HIS A NE2 
2043 N N   . CYS A 153 ? 0.3123 0.5113 0.4013 -0.0338 0.0212  -0.0818 1023 CYS A N   
2044 C CA  . CYS A 153 ? 0.3476 0.5461 0.4361 -0.0211 0.0136  -0.0815 1023 CYS A CA  
2045 C C   . CYS A 153 ? 0.3886 0.5925 0.4806 -0.0173 0.0068  -0.0848 1023 CYS A C   
2046 O O   . CYS A 153 ? 0.3566 0.5473 0.4422 -0.0196 0.0055  -0.0808 1023 CYS A O   
2047 C CB  . CYS A 153 ? 0.2778 0.4534 0.3541 -0.0174 0.0123  -0.0726 1023 CYS A CB  
2048 S SG  . CYS A 153 ? 0.4957 0.6650 0.5676 -0.0036 0.0032  -0.0710 1023 CYS A SG  
2054 N N   . GLU A 154 ? 0.3639 0.5869 0.4656 -0.0111 0.0024  -0.0922 1024 GLU A N   
2055 C CA  . GLU A 154 ? 0.4501 0.6788 0.5546 -0.0068 -0.0052 -0.0960 1024 GLU A CA  
2056 C C   . GLU A 154 ? 0.2672 0.4775 0.3598 0.0031  -0.0119 -0.0906 1024 GLU A C   
2057 O O   . GLU A 154 ? 0.3903 0.5981 0.4800 0.0124  -0.0152 -0.0898 1024 GLU A O   
2058 C CB  . GLU A 154 ? 0.4712 0.7264 0.5900 -0.0017 -0.0090 -0.1058 1024 GLU A CB  
2059 C CG  . GLU A 154 ? 0.7939 1.0543 0.9143 0.0047  -0.0186 -0.1099 1024 GLU A CG  
2060 C CD  . GLU A 154 ? 0.8254 1.1094 0.9584 0.0142  -0.0246 -0.1188 1024 GLU A CD  
2061 O OE1 . GLU A 154 ? 0.6869 0.9942 0.8348 0.0095  -0.0202 -0.1257 1024 GLU A OE1 
2062 O OE2 . GLU A 154 ? 0.7377 1.0165 0.8650 0.0266  -0.0336 -0.1190 1024 GLU A OE2 
2069 N N   . SER A 155 ? 0.3639 0.5608 0.4489 0.0008  -0.0136 -0.0869 1025 SER A N   
2070 C CA  . SER A 155 ? 0.3148 0.4933 0.3877 0.0084  -0.0188 -0.0815 1025 SER A CA  
2071 C C   . SER A 155 ? 0.4175 0.5908 0.4858 0.0072  -0.0225 -0.0822 1025 SER A C   
2072 O O   . SER A 155 ? 0.4747 0.6367 0.5380 0.0001  -0.0183 -0.0783 1025 SER A O   
2073 C CB  . SER A 155 ? 0.3136 0.4729 0.3777 0.0055  -0.0137 -0.0728 1025 SER A CB  
2074 O OG  . SER A 155 ? 0.4741 0.6170 0.5274 0.0123  -0.0178 -0.0677 1025 SER A OG  
2080 N N   . ASN A 156 ? 0.3927 0.5734 0.4616 0.0147  -0.0307 -0.0873 1026 ASN A N   
2081 C CA  . ASN A 156 ? 0.3737 0.5517 0.4384 0.0136  -0.0351 -0.0893 1026 ASN A CA  
2082 C C   . ASN A 156 ? 0.3267 0.4830 0.3750 0.0201  -0.0394 -0.0839 1026 ASN A C   
2083 O O   . ASN A 156 ? 0.3506 0.5003 0.3927 0.0291  -0.0435 -0.0821 1026 ASN A O   
2084 C CB  . ASN A 156 ? 0.4270 0.6272 0.5025 0.0172  -0.0422 -0.0988 1026 ASN A CB  
2085 C CG  . ASN A 156 ? 0.5852 0.8085 0.6777 0.0095  -0.0370 -0.1047 1026 ASN A CG  
2086 O OD1 . ASN A 156 ? 0.6191 0.8621 0.7232 0.0147  -0.0397 -0.1110 1026 ASN A OD1 
2087 N ND2 . ASN A 156 ? 0.4289 0.6491 0.5223 -0.0027 -0.0292 -0.1028 1026 ASN A ND2 
2094 N N   . ARG A 157 ? 0.3413 0.4856 0.3815 0.0152  -0.0380 -0.0816 1027 ARG A N   
2095 C CA  . ARG A 157 ? 0.4300 0.5521 0.4539 0.0191  -0.0393 -0.0757 1027 ARG A CA  
2096 C C   . ARG A 157 ? 0.4881 0.6069 0.5028 0.0262  -0.0486 -0.0791 1027 ARG A C   
2097 O O   . ARG A 157 ? 0.3871 0.5164 0.4057 0.0245  -0.0529 -0.0852 1027 ARG A O   
2098 C CB  . ARG A 157 ? 0.4135 0.5227 0.4322 0.0107  -0.0321 -0.0710 1027 ARG A CB  
2099 C CG  . ARG A 157 ? 0.3684 0.4557 0.3716 0.0137  -0.0313 -0.0647 1027 ARG A CG  
2100 C CD  . ARG A 157 ? 0.5212 0.5972 0.5205 0.0064  -0.0238 -0.0608 1027 ARG A CD  
2101 N NE  . ARG A 157 ? 0.5449 0.6194 0.5391 0.0035  -0.0258 -0.0648 1027 ARG A NE  
2102 C CZ  . ARG A 157 ? 0.4487 0.5078 0.4321 0.0011  -0.0221 -0.0620 1027 ARG A CZ  
2103 N NH1 . ARG A 157 ? 0.4752 0.5208 0.4534 0.0013  -0.0160 -0.0552 1027 ARG A NH1 
2104 N NH2 . ARG A 157 ? 0.6074 0.6649 0.5852 -0.0015 -0.0245 -0.0662 1027 ARG A NH2 
2118 N N   . SER A 158 ? 0.3969 0.4999 0.3983 0.0338  -0.0520 -0.0750 1028 SER A N   
2119 C CA  . SER A 158 ? 0.3941 0.4863 0.3809 0.0404  -0.0600 -0.0763 1028 SER A CA  
2120 C C   . SER A 158 ? 0.4141 0.4815 0.3837 0.0423  -0.0573 -0.0683 1028 SER A C   
2121 O O   . SER A 158 ? 0.3494 0.4111 0.3210 0.0379  -0.0495 -0.0626 1028 SER A O   
2122 C CB  . SER A 158 ? 0.3693 0.4728 0.3589 0.0508  -0.0703 -0.0823 1028 SER A CB  
2123 O OG  . SER A 158 ? 0.4248 0.5237 0.4124 0.0571  -0.0705 -0.0793 1028 SER A OG  
2129 N N   . HIS A 159 ? 0.3983 0.4509 0.3507 0.0483  -0.0636 -0.0679 1029 HIS A N   
2130 C CA  . HIS A 159 ? 0.4147 0.4435 0.3497 0.0493  -0.0605 -0.0606 1029 HIS A CA  
2131 C C   . HIS A 159 ? 0.4776 0.4935 0.3957 0.0593  -0.0698 -0.0611 1029 HIS A C   
2132 O O   . HIS A 159 ? 0.4615 0.4810 0.3754 0.0649  -0.0789 -0.0666 1029 HIS A O   
2133 C CB  . HIS A 159 ? 0.3695 0.3853 0.2952 0.0427  -0.0544 -0.0576 1029 HIS A CB  
2134 C CG  . HIS A 159 ? 0.4375 0.4605 0.3764 0.0335  -0.0446 -0.0556 1029 HIS A CG  
2135 N ND1 . HIS A 159 ? 0.4435 0.4817 0.3947 0.0284  -0.0439 -0.0605 1029 HIS A ND1 
2136 C CD2 . HIS A 159 ? 0.4655 0.4820 0.4066 0.0287  -0.0356 -0.0495 1029 HIS A CD2 
2137 C CE1 . HIS A 159 ? 0.3918 0.4306 0.3505 0.0213  -0.0348 -0.0571 1029 HIS A CE1 
2138 N NE2 . HIS A 159 ? 0.4231 0.4497 0.3767 0.0218  -0.0299 -0.0506 1029 HIS A NE2 
2147 N N   . THR A 160 ? 0.4840 0.4842 0.3918 0.0614  -0.0679 -0.0554 1030 THR A N   
2148 C CA  . THR A 160 ? 0.4939 0.4774 0.3826 0.0705  -0.0761 -0.0550 1030 THR A CA  
2149 C C   . THR A 160 ? 0.4515 0.4103 0.3230 0.0671  -0.0700 -0.0469 1030 THR A C   
2150 O O   . THR A 160 ? 0.4152 0.3712 0.2896 0.0585  -0.0603 -0.0427 1030 THR A O   
2151 C CB  . THR A 160 ? 0.4384 0.4319 0.3346 0.0788  -0.0823 -0.0582 1030 THR A CB  
2152 O OG1 . THR A 160 ? 0.4735 0.4495 0.3494 0.0889  -0.0916 -0.0584 1030 THR A OG1 
2153 C CG2 . THR A 160 ? 0.4299 0.4243 0.3346 0.0745  -0.0748 -0.0535 1030 THR A CG2 
2161 N N   . THR A 161 ? 0.4144 0.3549 0.2674 0.0739  -0.0757 -0.0451 1031 THR A N   
2162 C CA  . THR A 161 ? 0.4768 0.3939 0.3132 0.0700  -0.0700 -0.0377 1031 THR A CA  
2163 C C   . THR A 161 ? 0.4410 0.3573 0.2818 0.0711  -0.0692 -0.0351 1031 THR A C   
2164 O O   . THR A 161 ? 0.4828 0.4125 0.3340 0.0772  -0.0748 -0.0393 1031 THR A O   
2165 C CB  . THR A 161 ? 0.5144 0.4058 0.3218 0.0756  -0.0764 -0.0367 1031 THR A CB  
2166 O OG1 . THR A 161 ? 0.5150 0.4054 0.3164 0.0872  -0.0883 -0.0408 1031 THR A OG1 
2167 C CG2 . THR A 161 ? 0.5140 0.4035 0.3142 0.0742  -0.0773 -0.0391 1031 THR A CG2 
2175 N N   . ILE A 162 ? 0.4619 0.3626 0.2944 0.0649  -0.0622 -0.0285 1032 ILE A N   
2176 C CA  . ILE A 162 ? 0.4541 0.3506 0.2876 0.0651  -0.0618 -0.0257 1032 ILE A CA  
2177 C C   . ILE A 162 ? 0.5394 0.4226 0.3561 0.0760  -0.0725 -0.0279 1032 ILE A C   
2178 O O   . ILE A 162 ? 0.4817 0.3706 0.3046 0.0807  -0.0761 -0.0297 1032 ILE A O   
2179 C CB  . ILE A 162 ? 0.4998 0.3797 0.3247 0.0561  -0.0532 -0.0184 1032 ILE A CB  
2180 C CG1 . ILE A 162 ? 0.5691 0.4648 0.4146 0.0466  -0.0429 -0.0162 1032 ILE A CG1 
2181 C CG2 . ILE A 162 ? 0.6535 0.5223 0.4718 0.0575  -0.0555 -0.0158 1032 ILE A CG2 
2182 C CD1 . ILE A 162 ? 0.5430 0.4276 0.3853 0.0378  -0.0345 -0.0096 1032 ILE A CD1 
2194 N N   . ALA A 163 ? 0.5523 0.4162 0.3460 0.0804  -0.0778 -0.0279 1033 ALA A N   
2195 C CA  . ALA A 163 ? 0.5927 0.4400 0.3668 0.0916  -0.0886 -0.0297 1033 ALA A CA  
2196 C C   . ALA A 163 ? 0.5876 0.4568 0.3770 0.1021  -0.0975 -0.0375 1033 ALA A C   
2197 O O   . ALA A 163 ? 0.5553 0.4215 0.3418 0.1102  -0.1034 -0.0392 1033 ALA A O   
2198 C CB  . ALA A 163 ? 0.6275 0.4513 0.3743 0.0946  -0.0932 -0.0288 1033 ALA A CB  
2204 N N   . LYS A 164 ? 0.5172 0.4086 0.3232 0.1018  -0.0979 -0.0423 1034 LYS A N   
2205 C CA  . LYS A 164 ? 0.4900 0.4044 0.3116 0.1110  -0.1060 -0.0504 1034 LYS A CA  
2206 C C   . LYS A 164 ? 0.5480 0.4848 0.3942 0.1085  -0.1010 -0.0519 1034 LYS A C   
2207 O O   . LYS A 164 ? 0.4509 0.3997 0.3049 0.1175  -0.1071 -0.0573 1034 LYS A O   
2208 C CB  . LYS A 164 ? 0.5974 0.5270 0.4270 0.1107  -0.1087 -0.0554 1034 LYS A CB  
2209 C CG  . LYS A 164 ? 0.5970 0.5081 0.4026 0.1189  -0.1189 -0.0569 1034 LYS A CG  
2210 C CD  . LYS A 164 ? 0.8428 0.7696 0.6566 0.1185  -0.1226 -0.0625 1034 LYS A CD  
2211 C CE  . LYS A 164 ? 0.8929 0.8016 0.6822 0.1281  -0.1347 -0.0647 1034 LYS A CE  
2212 N NZ  . LYS A 164 ? 0.7514 0.6748 0.5478 0.1276  -0.1393 -0.0705 1034 LYS A NZ  
2226 N N   . TYR A 165 ? 0.4187 0.3607 0.2764 0.0968  -0.0900 -0.0475 1035 TYR A N   
2227 C CA  . TYR A 165 ? 0.3653 0.3248 0.2427 0.0944  -0.0856 -0.0484 1035 TYR A CA  
2228 C C   . TYR A 165 ? 0.3942 0.3376 0.2603 0.0982  -0.0873 -0.0454 1035 TYR A C   
2229 O O   . TYR A 165 ? 0.4256 0.3800 0.3013 0.1028  -0.0890 -0.0487 1035 TYR A O   
2230 C CB  . TYR A 165 ? 0.4516 0.4208 0.3441 0.0817  -0.0744 -0.0446 1035 TYR A CB  
2231 C CG  . TYR A 165 ? 0.4112 0.3984 0.3225 0.0801  -0.0710 -0.0464 1035 TYR A CG  
2232 C CD1 . TYR A 165 ? 0.3094 0.3218 0.2396 0.0810  -0.0714 -0.0527 1035 TYR A CD1 
2233 C CD2 . TYR A 165 ? 0.3423 0.3206 0.2513 0.0778  -0.0679 -0.0420 1035 TYR A CD2 
2234 C CE1 . TYR A 165 ? 0.3859 0.4133 0.3312 0.0795  -0.0680 -0.0543 1035 TYR A CE1 
2235 C CE2 . TYR A 165 ? 0.4148 0.4077 0.3385 0.0769  -0.0653 -0.0436 1035 TYR A CE2 
2236 C CZ  . TYR A 165 ? 0.3776 0.3946 0.3189 0.0778  -0.0650 -0.0497 1035 TYR A CZ  
2237 O OH  . TYR A 165 ? 0.3851 0.4153 0.3392 0.0764  -0.0617 -0.0514 1035 TYR A OH  
2247 N N   . ALA A 166 ? 0.4382 0.3549 0.2830 0.0958  -0.0865 -0.0394 1036 ALA A N   
2248 C CA  . ALA A 166 ? 0.4186 0.3162 0.2494 0.0983  -0.0882 -0.0362 1036 ALA A CA  
2249 C C   . ALA A 166 ? 0.4974 0.3919 0.3196 0.1130  -0.0994 -0.0419 1036 ALA A C   
2250 O O   . ALA A 166 ? 0.4848 0.3775 0.3069 0.1174  -0.1013 -0.0428 1036 ALA A O   
2251 C CB  . ALA A 166 ? 0.4821 0.3510 0.2899 0.0926  -0.0857 -0.0294 1036 ALA A CB  
2257 N N   . GLN A 167 ? 0.5281 0.4216 0.3425 0.1209  -0.1070 -0.0458 1037 GLN A N   
2258 C CA  . GLN A 167 ? 0.6610 0.5534 0.4683 0.1363  -0.1187 -0.0519 1037 GLN A CA  
2259 C C   . GLN A 167 ? 0.5950 0.5182 0.4282 0.1410  -0.1190 -0.0589 1037 GLN A C   
2260 O O   . GLN A 167 ? 0.5498 0.4718 0.3805 0.1512  -0.1244 -0.0623 1037 GLN A O   
2261 C CB  . GLN A 167 ? 0.7447 0.6331 0.5412 0.1430  -0.1269 -0.0551 1037 GLN A CB  
2262 C CG  . GLN A 167 ? 1.0458 0.9416 0.8417 0.1597  -0.1397 -0.0631 1037 GLN A CG  
2263 C CD  . GLN A 167 ? 1.2644 1.1557 1.0489 0.1657  -0.1485 -0.0660 1037 GLN A CD  
2264 O OE1 . GLN A 167 ? 1.0000 0.8861 0.7799 0.1566  -0.1442 -0.0627 1037 GLN A OE1 
2265 N NE2 . GLN A 167 ? 1.4093 1.3025 1.1949 0.1777  -0.1558 -0.0722 1037 GLN A NE2 
2274 N N   . TYR A 168 ? 0.5063 0.4558 0.3633 0.1333  -0.1128 -0.0609 1038 TYR A N   
2275 C CA  . TYR A 168 ? 0.5036 0.4831 0.3856 0.1355  -0.1114 -0.0673 1038 TYR A CA  
2276 C C   . TYR A 168 ? 0.6225 0.6014 0.5094 0.1319  -0.1052 -0.0647 1038 TYR A C   
2277 O O   . TYR A 168 ? 0.4875 0.4779 0.3822 0.1397  -0.1075 -0.0698 1038 TYR A O   
2278 C CB  . TYR A 168 ? 0.4612 0.4651 0.3645 0.1261  -0.1053 -0.0692 1038 TYR A CB  
2279 C CG  . TYR A 168 ? 0.3808 0.4129 0.3089 0.1238  -0.1004 -0.0739 1038 TYR A CG  
2280 C CD1 . TYR A 168 ? 0.4904 0.5447 0.4316 0.1334  -0.1060 -0.0828 1038 TYR A CD1 
2281 C CD2 . TYR A 168 ? 0.4630 0.4995 0.4013 0.1122  -0.0900 -0.0695 1038 TYR A CD2 
2282 C CE1 . TYR A 168 ? 0.6730 0.7528 0.6361 0.1305  -0.1004 -0.0872 1038 TYR A CE1 
2283 C CE2 . TYR A 168 ? 0.4245 0.4844 0.3828 0.1097  -0.0851 -0.0736 1038 TYR A CE2 
2284 C CZ  . TYR A 168 ? 0.6078 0.6891 0.5782 0.1185  -0.0899 -0.0823 1038 TYR A CZ  
2285 O OH  . TYR A 168 ? 0.4385 0.5429 0.4281 0.1153  -0.0841 -0.0865 1038 TYR A OH  
2295 N N   . GLN A 169 ? 0.4424 0.4086 0.3250 0.1203  -0.0973 -0.0570 1039 GLN A N   
2296 C CA  . GLN A 169 ? 0.4199 0.3842 0.3063 0.1156  -0.0917 -0.0540 1039 GLN A CA  
2297 C C   . GLN A 169 ? 0.5097 0.4548 0.3785 0.1258  -0.0983 -0.0546 1039 GLN A C   
2298 O O   . GLN A 169 ? 0.4955 0.4476 0.3704 0.1295  -0.0980 -0.0573 1039 GLN A O   
2299 C CB  . GLN A 169 ? 0.4105 0.3623 0.2934 0.1022  -0.0837 -0.0457 1039 GLN A CB  
2300 C CG  . GLN A 169 ? 0.4182 0.3737 0.3102 0.0950  -0.0772 -0.0427 1039 GLN A CG  
2301 C CD  . GLN A 169 ? 0.5183 0.4581 0.4036 0.0838  -0.0713 -0.0346 1039 GLN A CD  
2302 O OE1 . GLN A 169 ? 0.4699 0.3883 0.3371 0.0834  -0.0732 -0.0309 1039 GLN A OE1 
2303 N NE2 . GLN A 169 ? 0.3534 0.3036 0.2531 0.0746  -0.0642 -0.0319 1039 GLN A NE2 
2312 N N   . ALA A 170 ? 0.5484 0.4679 0.3936 0.1302  -0.1042 -0.0519 1040 ALA A N   
2313 C CA  . ALA A 170 ? 0.6986 0.5940 0.5222 0.1394  -0.1109 -0.0517 1040 ALA A CA  
2314 C C   . ALA A 170 ? 0.6742 0.5812 0.5015 0.1555  -0.1193 -0.0604 1040 ALA A C   
2315 O O   . ALA A 170 ? 0.7044 0.6036 0.5251 0.1627  -0.1221 -0.0621 1040 ALA A O   
2316 C CB  . ALA A 170 ? 0.6002 0.4643 0.3961 0.1395  -0.1149 -0.0468 1040 ALA A CB  
2322 N N   . SER A 171 ? 0.5900 0.5159 0.4279 0.1614  -0.1236 -0.0661 1041 SER A N   
2323 C CA  . SER A 171 ? 0.9032 0.8431 0.7468 0.1773  -0.1321 -0.0751 1041 SER A CA  
2324 C C   . SER A 171 ? 0.8711 0.8415 0.7409 0.1766  -0.1264 -0.0804 1041 SER A C   
2325 O O   . SER A 171 ? 0.7948 0.7725 0.6674 0.1887  -0.1308 -0.0867 1041 SER A O   
2326 C CB  . SER A 171 ? 0.9282 0.8791 0.7749 0.1833  -0.1394 -0.0798 1041 SER A CB  
2327 O OG  . SER A 171 ? 0.9946 0.9772 0.8680 0.1754  -0.1337 -0.0830 1041 SER A OG  
2333 N N   . SER A 172 ? 0.5324 0.5193 0.4201 0.1625  -0.1165 -0.0780 1042 SER A N   
2334 C CA  . SER A 172 ? 0.5603 0.5732 0.4705 0.1595  -0.1096 -0.0819 1042 SER A CA  
2335 C C   . SER A 172 ? 0.6612 0.6598 0.5617 0.1624  -0.1084 -0.0804 1042 SER A C   
2336 O O   . SER A 172 ? 0.6656 0.6791 0.5759 0.1693  -0.1079 -0.0865 1042 SER A O   
2337 C CB  . SER A 172 ? 0.7252 0.7501 0.6503 0.1430  -0.0993 -0.0777 1042 SER A CB  
2338 O OG  . SER A 172 ? 0.6934 0.7362 0.6348 0.1387  -0.0920 -0.0798 1042 SER A OG  
2344 N N   . PHE A 173 ? 0.4938 0.4633 0.3746 0.1567  -0.1075 -0.0724 1043 PHE A N   
2345 C CA  . PHE A 173 ? 0.7043 0.6567 0.5734 0.1578  -0.1067 -0.0702 1043 PHE A CA  
2346 C C   . PHE A 173 ? 0.9799 0.9191 0.8333 0.1748  -0.1161 -0.0752 1043 PHE A C   
2347 O O   . PHE A 173 ? 0.8701 0.8125 0.7250 0.1810  -0.1157 -0.0791 1043 PHE A O   
2348 C CB  . PHE A 173 ? 0.6129 0.5381 0.4655 0.1465  -0.1038 -0.0606 1043 PHE A CB  
2349 C CG  . PHE A 173 ? 0.8374 0.7410 0.6744 0.1475  -0.1045 -0.0582 1043 PHE A CG  
2350 C CD1 . PHE A 173 ? 0.9445 0.8589 0.7924 0.1440  -0.0991 -0.0593 1043 PHE A CD1 
2351 C CD2 . PHE A 173 ? 1.0076 0.8785 0.8175 0.1515  -0.1106 -0.0550 1043 PHE A CD2 
2352 C CE1 . PHE A 173 ? 1.0229 0.9166 0.8555 0.1447  -0.1002 -0.0574 1043 PHE A CE1 
2353 C CE2 . PHE A 173 ? 1.0694 0.9192 0.8640 0.1518  -0.1115 -0.0530 1043 PHE A CE2 
2354 C CZ  . PHE A 173 ? 1.0147 0.8763 0.8210 0.1485  -0.1065 -0.0543 1043 PHE A CZ  
2364 N N   . GLN A 174 ? 0.9008 0.8237 0.7376 0.1827  -0.1246 -0.0751 1044 GLN A N   
2365 C CA  . GLN A 174 ? 1.0618 0.9699 0.8816 0.2002  -0.1348 -0.0799 1044 GLN A CA  
2366 C C   . GLN A 174 ? 1.0615 1.0006 0.9019 0.2126  -0.1368 -0.0903 1044 GLN A C   
2367 O O   . GLN A 174 ? 1.1133 1.0476 0.9475 0.2228  -0.1392 -0.0951 1044 GLN A O   
2368 C CB  . GLN A 174 ? 1.0447 0.9325 0.8449 0.2055  -0.1430 -0.0785 1044 GLN A CB  
2369 C CG  . GLN A 174 ? 1.0453 0.8975 0.8195 0.1961  -0.1423 -0.0687 1044 GLN A CG  
2370 C CD  . GLN A 174 ? 1.1869 1.0116 0.9414 0.1967  -0.1422 -0.0658 1044 GLN A CD  
2371 O OE1 . GLN A 174 ? 1.2488 1.0657 0.9949 0.2076  -0.1462 -0.0715 1044 GLN A OE1 
2372 N NE2 . GLN A 174 ? 1.0816 0.8930 0.8308 0.1819  -0.1354 -0.0579 1044 GLN A NE2 
2381 N N   . GLU A 175 ? 1.0045 0.9755 0.8698 0.2087  -0.1337 -0.0941 1045 GLU A N   
2382 C CA  . GLU A 175 ? 1.1221 1.1269 1.0106 0.2172  -0.1339 -0.1043 1045 GLU A CA  
2383 C C   . GLU A 175 ? 1.2002 1.2160 1.0990 0.2156  -0.1261 -0.1064 1045 GLU A C   
2384 O O   . GLU A 175 ? 1.2754 1.3071 1.1829 0.2255  -0.1267 -0.1144 1045 GLU A O   
2385 C CB  . GLU A 175 ? 1.1501 1.1854 1.0627 0.2098  -0.1310 -0.1068 1045 GLU A CB  
2386 C CG  . GLU A 175 ? 1.2828 1.3552 1.2215 0.2139  -0.1285 -0.1171 1045 GLU A CG  
2387 C CD  . GLU A 175 ? 1.4259 1.5282 1.3894 0.2036  -0.1236 -0.1186 1045 GLU A CD  
2388 O OE1 . GLU A 175 ? 1.4177 1.5350 1.3961 0.1923  -0.1129 -0.1179 1045 GLU A OE1 
2389 O OE2 . GLU A 175 ? 1.4350 1.5415 1.4001 0.2026  -0.1280 -0.1200 1045 GLU A OE2 
2396 N N   . SER A 176 ? 0.9964 1.0032 0.8935 0.2005  -0.1174 -0.0989 1046 SER A N   
2397 C CA  . SER A 176 ? 1.1173 1.1319 1.0220 0.1967  -0.1095 -0.1000 1046 SER A CA  
2398 C C   . SER A 176 ? 1.2181 1.2082 1.1017 0.2076  -0.1139 -0.1007 1046 SER A C   
2399 O O   . SER A 176 ? 1.2108 1.2109 1.1004 0.2126  -0.1106 -0.1058 1046 SER A O   
2400 C CB  . SER A 176 ? 1.0049 1.0156 0.9127 0.1780  -0.1002 -0.0917 1046 SER A CB  
2401 O OG  . SER A 176 ? 1.0050 0.9820 0.8896 0.1737  -0.1019 -0.0838 1046 SER A OG  
2407 N N   . LEU A 177 ? 1.1287 1.0853 0.9864 0.2107  -0.1210 -0.0956 1047 LEU A N   
2408 C CA  . LEU A 177 ? 1.2691 1.1984 1.1034 0.2215  -0.1264 -0.0963 1047 LEU A CA  
2409 C C   . LEU A 177 ? 1.4244 1.3672 1.2623 0.2379  -0.1315 -0.1063 1047 LEU A C   
2410 O O   . LEU A 177 ? 1.4078 1.3355 1.2303 0.2453  -0.1339 -0.1086 1047 LEU A O   
2411 C CB  . LEU A 177 ? 1.2218 1.1125 1.0267 0.2206  -0.1330 -0.0890 1047 LEU A CB  
2412 C CG  . LEU A 177 ? 1.2248 1.0998 1.0235 0.2014  -0.1270 -0.0787 1047 LEU A CG  
2413 C CD1 . LEU A 177 ? 1.2224 1.0554 0.9884 0.2018  -0.1327 -0.0727 1047 LEU A CD1 
2414 C CD2 . LEU A 177 ? 1.1673 1.0532 0.9788 0.1898  -0.1175 -0.0768 1047 LEU A CD2 
2426 N N   . ARG A 178 ? 1.4518 1.4239 1.3099 0.2398  -0.1320 -0.1120 1048 ARG A N   
2427 C CA  . ARG A 178 ? 1.4894 1.4787 1.3538 0.2509  -0.1357 -0.1213 1048 ARG A CA  
2428 C C   . ARG A 178 ? 1.4361 1.4669 1.3321 0.2491  -0.1282 -0.1282 1048 ARG A C   
2429 O O   . ARG A 178 ? 1.2640 1.3023 1.1684 0.2442  -0.1202 -0.1275 1048 ARG A O   
2430 C CB  . ARG A 178 ? 1.5658 1.5529 1.4256 0.2546  -0.1433 -0.1229 1048 ARG A CB  
2431 C CG  . ARG A 178 ? 1.6908 1.7036 1.5643 0.2645  -0.1468 -0.1331 1048 ARG A CG  
2432 C CD  . ARG A 178 ? 1.7510 1.7707 1.6292 0.2642  -0.1518 -0.1347 1048 ARG A CD  
2433 N NE  . ARG A 178 ? 1.7269 1.7764 1.6319 0.2536  -0.1456 -0.1347 1048 ARG A NE  
2434 C CZ  . ARG A 178 ? 1.7322 1.8112 1.6582 0.2540  -0.1464 -0.1414 1048 ARG A CZ  
2435 N NH1 . ARG A 178 ? 1.7646 1.8487 1.6891 0.2651  -0.1534 -0.1487 1048 ARG A NH1 
2436 N NH2 . ARG A 178 ? 1.6063 1.7094 1.5544 0.2429  -0.1403 -0.1408 1048 ARG A NH2 
2450 N N   . PRO A 208 ? 0.9401 1.3553 1.1418 0.0711  -0.0132 -0.1687 1078 PRO A N   
2451 C CA  . PRO A 208 ? 0.9752 1.3828 1.1695 0.0896  -0.0236 -0.1701 1078 PRO A CA  
2452 C C   . PRO A 208 ? 0.9816 1.3628 1.1586 0.0965  -0.0278 -0.1624 1078 PRO A C   
2453 O O   . PRO A 208 ? 0.9848 1.3551 1.1522 0.1084  -0.0303 -0.1619 1078 PRO A O   
2454 C CB  . PRO A 208 ? 1.0526 1.4713 1.2514 0.0943  -0.0178 -0.1752 1078 PRO A CB  
2455 C CG  . PRO A 208 ? 0.9997 1.4208 1.2005 0.0792  -0.0037 -0.1729 1078 PRO A CG  
2456 C CD  . PRO A 208 ? 0.8762 1.2928 1.0773 0.0646  -0.0011 -0.1681 1078 PRO A CD  
2464 N N   . PHE A 209 ? 0.8364 1.2069 1.0093 0.0889  -0.0286 -0.1565 1079 PHE A N   
2465 C CA  . PHE A 209 ? 0.7798 1.1204 0.9334 0.0927  -0.0322 -0.1474 1079 PHE A CA  
2466 C C   . PHE A 209 ? 0.7696 1.0979 0.9145 0.1024  -0.0452 -0.1459 1079 PHE A C   
2467 O O   . PHE A 209 ? 0.7096 1.0512 0.8640 0.1008  -0.0501 -0.1497 1079 PHE A O   
2468 C CB  . PHE A 209 ? 0.6774 1.0020 0.8234 0.0759  -0.0243 -0.1386 1079 PHE A CB  
2469 C CG  . PHE A 209 ? 0.5915 0.9241 0.7426 0.0652  -0.0116 -0.1391 1079 PHE A CG  
2470 C CD1 . PHE A 209 ? 0.5760 0.8999 0.7188 0.0698  -0.0074 -0.1378 1079 PHE A CD1 
2471 C CD2 . PHE A 209 ? 0.5202 0.8670 0.6823 0.0503  -0.0038 -0.1408 1079 PHE A CD2 
2472 C CE1 . PHE A 209 ? 0.6009 0.9303 0.7460 0.0599  0.0042  -0.1382 1079 PHE A CE1 
2473 C CE2 . PHE A 209 ? 0.5976 0.9494 0.7618 0.0401  0.0080  -0.1410 1079 PHE A CE2 
2474 C CZ  . PHE A 209 ? 0.5525 0.8956 0.7080 0.0450  0.0121  -0.1397 1079 PHE A CZ  
2484 N N   . LYS A 210 ? 0.5929 0.8946 0.7186 0.1119  -0.0508 -0.1403 1080 LYS A N   
2485 C CA  . LYS A 210 ? 0.6908 0.9754 0.8037 0.1205  -0.0624 -0.1376 1080 LYS A CA  
2486 C C   . LYS A 210 ? 0.6052 0.8706 0.7081 0.1083  -0.0609 -0.1287 1080 LYS A C   
2487 O O   . LYS A 210 ? 0.5974 0.8516 0.6956 0.0973  -0.0525 -0.1221 1080 LYS A O   
2488 C CB  . LYS A 210 ? 0.8235 1.0846 0.9177 0.1339  -0.0682 -0.1347 1080 LYS A CB  
2489 C CG  . LYS A 210 ? 1.0101 1.2359 1.0813 0.1311  -0.0708 -0.1239 1080 LYS A CG  
2490 C CD  . LYS A 210 ? 1.1582 1.3610 1.2110 0.1426  -0.0752 -0.1213 1080 LYS A CD  
2491 C CE  . LYS A 210 ? 1.1398 1.3304 1.1801 0.1568  -0.0880 -0.1229 1080 LYS A CE  
2492 N NZ  . LYS A 210 ? 1.1369 1.2943 1.1547 0.1536  -0.0911 -0.1132 1080 LYS A NZ  
2506 N N   . THR A 211 ? 0.5512 0.8131 0.6507 0.1109  -0.0692 -0.1289 1081 THR A N   
2507 C CA  . THR A 211 ? 0.4520 0.6961 0.5417 0.1006  -0.0679 -0.1212 1081 THR A CA  
2508 C C   . THR A 211 ? 0.5363 0.7468 0.6026 0.1046  -0.0713 -0.1123 1081 THR A C   
2509 O O   . THR A 211 ? 0.5064 0.7063 0.5617 0.1175  -0.0798 -0.1133 1081 THR A O   
2510 C CB  . THR A 211 ? 0.5911 0.8457 0.6864 0.1005  -0.0749 -0.1256 1081 THR A CB  
2511 O OG1 . THR A 211 ? 0.6321 0.9103 0.7458 0.0885  -0.0683 -0.1300 1081 THR A OG1 
2512 C CG2 . THR A 211 ? 0.5565 0.7845 0.6335 0.0974  -0.0779 -0.1178 1081 THR A CG2 
2520 N N   . ILE A 212 ? 0.4398 0.6334 0.4984 0.0936  -0.0646 -0.1039 1082 ILE A N   
2521 C CA  . ILE A 212 ? 0.2919 0.4554 0.3302 0.0951  -0.0665 -0.0953 1082 ILE A CA  
2522 C C   . ILE A 212 ? 0.3655 0.5169 0.3979 0.0855  -0.0644 -0.0894 1082 ILE A C   
2523 O O   . ILE A 212 ? 0.3985 0.5630 0.4419 0.0766  -0.0602 -0.0910 1082 ILE A O   
2524 C CB  . ILE A 212 ? 0.3784 0.5304 0.4115 0.0920  -0.0603 -0.0901 1082 ILE A CB  
2525 C CG1 . ILE A 212 ? 0.4233 0.5842 0.4671 0.0785  -0.0500 -0.0879 1082 ILE A CG1 
2526 C CG2 . ILE A 212 ? 0.4446 0.6037 0.4794 0.1027  -0.0626 -0.0955 1082 ILE A CG2 
2527 C CD1 . ILE A 212 ? 0.3683 0.5138 0.4044 0.0741  -0.0446 -0.0812 1082 ILE A CD1 
2539 N N   . LYS A 213 ? 0.3989 0.5249 0.4134 0.0872  -0.0670 -0.0826 1083 LYS A N   
2540 C CA  . LYS A 213 ? 0.3444 0.4575 0.3518 0.0791  -0.0646 -0.0770 1083 LYS A CA  
2541 C C   . LYS A 213 ? 0.4667 0.5586 0.4633 0.0739  -0.0595 -0.0681 1083 LYS A C   
2542 O O   . LYS A 213 ? 0.3942 0.4722 0.3802 0.0793  -0.0620 -0.0655 1083 LYS A O   
2543 C CB  . LYS A 213 ? 0.3151 0.4191 0.3108 0.0858  -0.0732 -0.0783 1083 LYS A CB  
2544 C CG  . LYS A 213 ? 0.4879 0.6141 0.4953 0.0902  -0.0791 -0.0873 1083 LYS A CG  
2545 C CD  . LYS A 213 ? 0.6629 0.7780 0.6564 0.0976  -0.0888 -0.0886 1083 LYS A CD  
2546 C CE  . LYS A 213 ? 0.8402 0.9378 0.8170 0.1102  -0.0965 -0.0876 1083 LYS A CE  
2547 N NZ  . LYS A 213 ? 0.9098 0.9973 0.8724 0.1187  -0.1072 -0.0897 1083 LYS A NZ  
2561 N N   . PHE A 214 ? 0.3898 0.4794 0.3894 0.0634  -0.0527 -0.0636 1084 PHE A N   
2562 C CA  . PHE A 214 ? 0.3050 0.3802 0.2997 0.0570  -0.0468 -0.0559 1084 PHE A CA  
2563 C C   . PHE A 214 ? 0.3573 0.4180 0.3429 0.0526  -0.0453 -0.0509 1084 PHE A C   
2564 O O   . PHE A 214 ? 0.3144 0.3813 0.3052 0.0474  -0.0427 -0.0520 1084 PHE A O   
2565 C CB  . PHE A 214 ? 0.3184 0.4062 0.3268 0.0488  -0.0393 -0.0558 1084 PHE A CB  
2566 C CG  . PHE A 214 ? 0.3322 0.4081 0.3382 0.0416  -0.0334 -0.0483 1084 PHE A CG  
2567 C CD1 . PHE A 214 ? 0.2791 0.3363 0.2732 0.0425  -0.0346 -0.0425 1084 PHE A CD1 
2568 C CD2 . PHE A 214 ? 0.3149 0.3986 0.3305 0.0335  -0.0269 -0.0473 1084 PHE A CD2 
2569 C CE1 . PHE A 214 ? 0.3161 0.3652 0.3104 0.0359  -0.0296 -0.0361 1084 PHE A CE1 
2570 C CE2 . PHE A 214 ? 0.3101 0.3837 0.3242 0.0278  -0.0224 -0.0408 1084 PHE A CE2 
2571 C CZ  . PHE A 214 ? 0.3132 0.3709 0.3179 0.0291  -0.0239 -0.0354 1084 PHE A CZ  
2581 N N   . GLY A 215 ? 0.3155 0.3564 0.2867 0.0545  -0.0468 -0.0458 1085 GLY A N   
2582 C CA  . GLY A 215 ? 0.3119 0.3385 0.2739 0.0500  -0.0442 -0.0409 1085 GLY A CA  
2583 C C   . GLY A 215 ? 0.3467 0.3723 0.3155 0.0409  -0.0359 -0.0355 1085 GLY A C   
2584 O O   . GLY A 215 ? 0.3356 0.3560 0.3044 0.0392  -0.0340 -0.0317 1085 GLY A O   
2588 N N   . THR A 216 ? 0.3526 0.3823 0.3265 0.0352  -0.0313 -0.0352 1086 THR A N   
2589 C CA  . THR A 216 ? 0.2884 0.3196 0.2707 0.0276  -0.0239 -0.0311 1086 THR A CA  
2590 C C   . THR A 216 ? 0.3853 0.4077 0.3632 0.0233  -0.0192 -0.0277 1086 THR A C   
2591 O O   . THR A 216 ? 0.4369 0.4547 0.4067 0.0251  -0.0212 -0.0296 1086 THR A O   
2592 C CB  . THR A 216 ? 0.3855 0.4332 0.3814 0.0243  -0.0214 -0.0347 1086 THR A CB  
2593 O OG1 . THR A 216 ? 0.5346 0.5818 0.5369 0.0183  -0.0155 -0.0304 1086 THR A OG1 
2594 C CG2 . THR A 216 ? 0.3096 0.3638 0.3076 0.0224  -0.0212 -0.0389 1086 THR A CG2 
2602 N N   . ASN A 217 ? 0.4286 0.4487 0.4117 0.0180  -0.0133 -0.0230 1087 ASN A N   
2603 C CA  . ASN A 217 ? 0.4192 0.4332 0.4006 0.0140  -0.0077 -0.0202 1087 ASN A CA  
2604 C C   . ASN A 217 ? 0.5017 0.5020 0.4688 0.0160  -0.0084 -0.0188 1087 ASN A C   
2605 O O   . ASN A 217 ? 0.5756 0.5720 0.5378 0.0148  -0.0059 -0.0195 1087 ASN A O   
2606 C CB  . ASN A 217 ? 0.5195 0.5414 0.5062 0.0116  -0.0056 -0.0239 1087 ASN A CB  
2607 C CG  . ASN A 217 ? 0.7663 0.7996 0.7653 0.0085  -0.0038 -0.0250 1087 ASN A CG  
2608 O OD1 . ASN A 217 ? 0.5308 0.5650 0.5347 0.0075  -0.0028 -0.0220 1087 ASN A OD1 
2609 N ND2 . ASN A 217 ? 0.6905 0.7315 0.6932 0.0063  -0.0034 -0.0293 1087 ASN A ND2 
2616 N N   . ILE A 218 ? 0.3171 0.3085 0.2758 0.0186  -0.0116 -0.0167 1088 ILE A N   
2617 C CA  . ILE A 218 ? 0.3696 0.3452 0.3122 0.0197  -0.0119 -0.0147 1088 ILE A CA  
2618 C C   . ILE A 218 ? 0.4563 0.4256 0.3996 0.0139  -0.0039 -0.0095 1088 ILE A C   
2619 O O   . ILE A 218 ? 0.3220 0.2933 0.2732 0.0107  -0.0014 -0.0061 1088 ILE A O   
2620 C CB  . ILE A 218 ? 0.4180 0.3842 0.3494 0.0243  -0.0183 -0.0144 1088 ILE A CB  
2621 C CG1 . ILE A 218 ? 0.4027 0.3767 0.3342 0.0314  -0.0262 -0.0203 1088 ILE A CG1 
2622 C CG2 . ILE A 218 ? 0.4083 0.3554 0.3207 0.0245  -0.0180 -0.0118 1088 ILE A CG2 
2623 C CD1 . ILE A 218 ? 0.3797 0.3502 0.3070 0.0364  -0.0320 -0.0208 1088 ILE A CD1 
2635 N N   . ASP A 219 ? 0.4009 0.3629 0.3360 0.0126  -0.0001 -0.0093 1089 ASP A N   
2636 C CA  . ASP A 219 ? 0.3548 0.3144 0.2934 0.0074  0.0088  -0.0056 1089 ASP A CA  
2637 C C   . ASP A 219 ? 0.5016 0.4486 0.4308 0.0047  0.0116  -0.0011 1089 ASP A C   
2638 O O   . ASP A 219 ? 0.4498 0.3827 0.3615 0.0056  0.0112  -0.0009 1089 ASP A O   
2639 C CB  . ASP A 219 ? 0.3671 0.3237 0.2997 0.0073  0.0123  -0.0077 1089 ASP A CB  
2640 C CG  . ASP A 219 ? 0.4431 0.3970 0.3784 0.0030  0.0220  -0.0046 1089 ASP A CG  
2641 O OD1 . ASP A 219 ? 0.5041 0.4624 0.4500 0.0000  0.0259  -0.0011 1089 ASP A OD1 
2642 O OD2 . ASP A 219 ? 0.4989 0.4466 0.4257 0.0029  0.0257  -0.0059 1089 ASP A OD2 
2647 N N   . LEU A 220 ? 0.3539 0.3056 0.2941 0.0010  0.0144  0.0023  1090 LEU A N   
2648 C CA  . LEU A 220 ? 0.3760 0.3176 0.3097 -0.0033 0.0178  0.0065  1090 LEU A CA  
2649 C C   . LEU A 220 ? 0.3724 0.3178 0.3147 -0.0086 0.0277  0.0090  1090 LEU A C   
2650 O O   . LEU A 220 ? 0.4120 0.3585 0.3605 -0.0134 0.0312  0.0124  1090 LEU A O   
2651 C CB  . LEU A 220 ? 0.3673 0.3111 0.3066 -0.0043 0.0134  0.0083  1090 LEU A CB  
2652 C CG  . LEU A 220 ? 0.4882 0.4174 0.4099 -0.0016 0.0065  0.0082  1090 LEU A CG  
2653 C CD1 . LEU A 220 ? 0.4322 0.3599 0.3451 0.0059  -0.0002 0.0036  1090 LEU A CD1 
2654 C CD2 . LEU A 220 ? 0.4428 0.3738 0.3700 -0.0027 0.0024  0.0096  1090 LEU A CD2 
2666 N N   . SER A 221 ? 0.3318 0.2795 0.2747 -0.0075 0.0322  0.0072  1091 SER A N   
2667 C CA  . SER A 221 ? 0.3827 0.3354 0.3351 -0.0110 0.0418  0.0088  1091 SER A CA  
2668 C C   . SER A 221 ? 0.4593 0.4000 0.3988 -0.0149 0.0490  0.0109  1091 SER A C   
2669 O O   . SER A 221 ? 0.4816 0.4274 0.4306 -0.0190 0.0572  0.0129  1091 SER A O   
2670 C CB  . SER A 221 ? 0.3863 0.3445 0.3431 -0.0082 0.0441  0.0057  1091 SER A CB  
2671 O OG  . SER A 221 ? 0.4243 0.3715 0.3636 -0.0059 0.0428  0.0030  1091 SER A OG  
2677 N N   . ASP A 222 ? 0.4709 0.3956 0.3886 -0.0136 0.0460  0.0102  1092 ASP A N   
2678 C CA  . ASP A 222 ? 0.4718 0.3820 0.3732 -0.0173 0.0532  0.0120  1092 ASP A CA  
2679 C C   . ASP A 222 ? 0.4870 0.3906 0.3847 -0.0233 0.0550  0.0159  1092 ASP A C   
2680 O O   . ASP A 222 ? 0.4932 0.3852 0.3776 -0.0225 0.0479  0.0166  1092 ASP A O   
2681 C CB  . ASP A 222 ? 0.4937 0.3873 0.3708 -0.0133 0.0487  0.0097  1092 ASP A CB  
2682 C CG  . ASP A 222 ? 0.7654 0.6434 0.6240 -0.0168 0.0573  0.0110  1092 ASP A CG  
2683 O OD1 . ASP A 222 ? 0.6269 0.5062 0.4906 -0.0231 0.0666  0.0140  1092 ASP A OD1 
2684 O OD2 . ASP A 222 ? 0.6268 0.4914 0.4657 -0.0135 0.0546  0.0090  1092 ASP A OD2 
2689 N N   . ASP A 223 ? 0.4965 0.4073 0.4059 -0.0294 0.0645  0.0182  1093 ASP A N   
2690 C CA  . ASP A 223 ? 0.6305 0.5376 0.5396 -0.0368 0.0671  0.0217  1093 ASP A CA  
2691 C C   . ASP A 223 ? 0.6772 0.5605 0.5584 -0.0403 0.0691  0.0234  1093 ASP A C   
2692 O O   . ASP A 223 ? 0.5711 0.4462 0.4462 -0.0465 0.0693  0.0263  1093 ASP A O   
2693 C CB  . ASP A 223 ? 0.7478 0.6706 0.6778 -0.0424 0.0775  0.0230  1093 ASP A CB  
2694 C CG  . ASP A 223 ? 0.9958 0.9176 0.9285 -0.0512 0.0800  0.0263  1093 ASP A CG  
2695 O OD1 . ASP A 223 ? 0.9024 0.8349 0.8504 -0.0522 0.0745  0.0271  1093 ASP A OD1 
2696 O OD2 . ASP A 223 ? 1.0704 0.9800 0.9889 -0.0576 0.0875  0.0280  1093 ASP A OD2 
2701 N N   . LYS A 224 ? 0.5564 0.4272 0.4190 -0.0368 0.0703  0.0217  1094 LYS A N   
2702 C CA  . LYS A 224 ? 0.7997 0.6451 0.6323 -0.0395 0.0717  0.0233  1094 LYS A CA  
2703 C C   . LYS A 224 ? 0.7668 0.5966 0.5805 -0.0337 0.0588  0.0227  1094 LYS A C   
2704 O O   . LYS A 224 ? 0.8294 0.6365 0.6180 -0.0359 0.0576  0.0247  1094 LYS A O   
2705 C CB  . LYS A 224 ? 0.8988 0.7361 0.7179 -0.0384 0.0790  0.0217  1094 LYS A CB  
2706 C CG  . LYS A 224 ? 1.0184 0.8637 0.8478 -0.0456 0.0940  0.0230  1094 LYS A CG  
2707 C CD  . LYS A 224 ? 1.1657 1.0114 0.9915 -0.0423 0.1006  0.0202  1094 LYS A CD  
2708 C CE  . LYS A 224 ? 1.2836 1.1366 1.1184 -0.0490 0.1163  0.0211  1094 LYS A CE  
2709 N NZ  . LYS A 224 ? 1.2669 1.1426 1.1283 -0.0453 0.1205  0.0186  1094 LYS A NZ  
2723 N N   . LYS A 225 ? 0.4824 0.3240 0.3076 -0.0261 0.0493  0.0197  1095 LYS A N   
2724 C CA  . LYS A 225 ? 0.5432 0.3740 0.3547 -0.0195 0.0368  0.0184  1095 LYS A CA  
2725 C C   . LYS A 225 ? 0.5276 0.3652 0.3511 -0.0206 0.0315  0.0198  1095 LYS A C   
2726 O O   . LYS A 225 ? 0.5771 0.4010 0.3858 -0.0174 0.0232  0.0199  1095 LYS A O   
2727 C CB  . LYS A 225 ? 0.5190 0.3582 0.3340 -0.0105 0.0294  0.0137  1095 LYS A CB  
2728 C CG  . LYS A 225 ? 0.6345 0.4648 0.4348 -0.0089 0.0328  0.0119  1095 LYS A CG  
2729 C CD  . LYS A 225 ? 0.6668 0.5089 0.4747 -0.0016 0.0262  0.0069  1095 LYS A CD  
2730 C CE  . LYS A 225 ? 0.8174 0.6480 0.6076 0.0000  0.0282  0.0048  1095 LYS A CE  
2731 N NZ  . LYS A 225 ? 0.8264 0.6678 0.6231 0.0061  0.0213  -0.0004 1095 LYS A NZ  
2745 N N   . TRP A 226 ? 0.5317 0.3891 0.3808 -0.0248 0.0362  0.0207  1096 TRP A N   
2746 C CA  . TRP A 226 ? 0.4338 0.2999 0.2963 -0.0254 0.0308  0.0214  1096 TRP A CA  
2747 C C   . TRP A 226 ? 0.5559 0.4274 0.4302 -0.0352 0.0380  0.0250  1096 TRP A C   
2748 O O   . TRP A 226 ? 0.4626 0.3495 0.3570 -0.0365 0.0363  0.0253  1096 TRP A O   
2749 C CB  . TRP A 226 ? 0.4277 0.3150 0.3118 -0.0198 0.0268  0.0183  1096 TRP A CB  
2750 C CG  . TRP A 226 ? 0.4202 0.3058 0.2962 -0.0112 0.0203  0.0143  1096 TRP A CG  
2751 C CD1 . TRP A 226 ? 0.4187 0.3120 0.2993 -0.0085 0.0228  0.0116  1096 TRP A CD1 
2752 C CD2 . TRP A 226 ? 0.4678 0.3440 0.3301 -0.0043 0.0100  0.0121  1096 TRP A CD2 
2753 N NE1 . TRP A 226 ? 0.4047 0.2950 0.2761 -0.0010 0.0145  0.0078  1096 TRP A NE1 
2754 C CE2 . TRP A 226 ? 0.4045 0.2852 0.2654 0.0021  0.0065  0.0079  1096 TRP A CE2 
2755 C CE3 . TRP A 226 ? 0.5226 0.3869 0.3736 -0.0027 0.0032  0.0130  1096 TRP A CE3 
2756 C CZ2 . TRP A 226 ? 0.4386 0.3146 0.2891 0.0103  -0.0035 0.0044  1096 TRP A CZ2 
2757 C CZ3 . TRP A 226 ? 0.4821 0.3403 0.3218 0.0063  -0.0066 0.0095  1096 TRP A CZ3 
2758 C CH2 . TRP A 226 ? 0.5365 0.4018 0.3770 0.0128  -0.0099 0.0052  1096 TRP A CH2 
2769 N N   . LYS A 227 ? 0.5410 0.3998 0.4026 -0.0425 0.0459  0.0276  1097 LYS A N   
2770 C CA  . LYS A 227 ? 0.5036 0.3706 0.3788 -0.0527 0.0543  0.0304  1097 LYS A CA  
2771 C C   . LYS A 227 ? 0.5501 0.4197 0.4332 -0.0565 0.0486  0.0320  1097 LYS A C   
2772 O O   . LYS A 227 ? 0.5365 0.4252 0.4436 -0.0603 0.0509  0.0325  1097 LYS A O   
2773 C CB  . LYS A 227 ? 0.5657 0.4152 0.4216 -0.0606 0.0635  0.0328  1097 LYS A CB  
2774 C CG  . LYS A 227 ? 0.8649 0.7257 0.7369 -0.0719 0.0734  0.0351  1097 LYS A CG  
2775 C CD  . LYS A 227 ? 1.0875 0.9306 0.9394 -0.0808 0.0835  0.0374  1097 LYS A CD  
2776 C CE  . LYS A 227 ? 1.1365 0.9946 1.0079 -0.0924 0.0939  0.0390  1097 LYS A CE  
2777 N NZ  . LYS A 227 ? 1.3432 1.1814 1.1931 -0.1036 0.1026  0.0418  1097 LYS A NZ  
2791 N N   . LEU A 228 ? 0.5302 0.3797 0.3924 -0.0553 0.0410  0.0327  1098 LEU A N   
2792 C CA  . LEU A 228 ? 0.4749 0.3230 0.3405 -0.0591 0.0354  0.0341  1098 LEU A CA  
2793 C C   . LEU A 228 ? 0.5249 0.3914 0.4105 -0.0524 0.0279  0.0318  1098 LEU A C   
2794 O O   . LEU A 228 ? 0.5297 0.4069 0.4309 -0.0567 0.0265  0.0328  1098 LEU A O   
2795 C CB  . LEU A 228 ? 0.6239 0.4434 0.4595 -0.0579 0.0286  0.0350  1098 LEU A CB  
2796 C CG  . LEU A 228 ? 0.8864 0.6831 0.6991 -0.0672 0.0353  0.0382  1098 LEU A CG  
2797 C CD1 . LEU A 228 ? 0.9075 0.6737 0.6880 -0.0634 0.0270  0.0388  1098 LEU A CD1 
2798 C CD2 . LEU A 228 ? 0.7410 0.5451 0.5670 -0.0808 0.0422  0.0410  1098 LEU A CD2 
2810 N N   . GLN A 229 ? 0.4661 0.3359 0.3505 -0.0421 0.0232  0.0287  1099 GLN A N   
2811 C CA  . GLN A 229 ? 0.4985 0.3849 0.3998 -0.0358 0.0170  0.0262  1099 GLN A CA  
2812 C C   . GLN A 229 ? 0.4803 0.3897 0.4088 -0.0394 0.0223  0.0267  1099 GLN A C   
2813 O O   . GLN A 229 ? 0.4519 0.3712 0.3943 -0.0409 0.0190  0.0272  1099 GLN A O   
2814 C CB  . GLN A 229 ? 0.3900 0.2775 0.2862 -0.0256 0.0127  0.0225  1099 GLN A CB  
2815 C CG  . GLN A 229 ? 0.4816 0.3514 0.3561 -0.0188 0.0038  0.0208  1099 GLN A CG  
2816 C CD  . GLN A 229 ? 0.5314 0.3773 0.3798 -0.0208 0.0055  0.0226  1099 GLN A CD  
2817 O OE1 . GLN A 229 ? 0.5029 0.3468 0.3484 -0.0251 0.0134  0.0239  1099 GLN A OE1 
2818 N NE2 . GLN A 229 ? 0.5010 0.3275 0.3291 -0.0175 -0.0018 0.0226  1099 GLN A NE2 
2827 N N   . LEU A 230 ? 0.4602 0.3770 0.3952 -0.0402 0.0303  0.0264  1100 LEU A N   
2828 C CA  . LEU A 230 ? 0.4370 0.3750 0.3970 -0.0419 0.0353  0.0265  1100 LEU A CA  
2829 C C   . LEU A 230 ? 0.4257 0.3699 0.3976 -0.0511 0.0389  0.0293  1100 LEU A C   
2830 O O   . LEU A 230 ? 0.4216 0.3826 0.4144 -0.0518 0.0382  0.0294  1100 LEU A O   
2831 C CB  . LEU A 230 ? 0.3896 0.3318 0.3513 -0.0402 0.0434  0.0253  1100 LEU A CB  
2832 C CG  . LEU A 230 ? 0.4229 0.3622 0.3763 -0.0317 0.0395  0.0221  1100 LEU A CG  
2833 C CD1 . LEU A 230 ? 0.4322 0.3751 0.3874 -0.0307 0.0476  0.0208  1100 LEU A CD1 
2834 C CD2 . LEU A 230 ? 0.4223 0.3737 0.3886 -0.0265 0.0323  0.0201  1100 LEU A CD2 
2846 N N   . HIS A 231 ? 0.4704 0.4005 0.4284 -0.0583 0.0425  0.0315  1101 HIS A N   
2847 C CA  . HIS A 231 ? 0.4647 0.4010 0.4339 -0.0684 0.0461  0.0338  1101 HIS A CA  
2848 C C   . HIS A 231 ? 0.4617 0.3994 0.4360 -0.0694 0.0368  0.0343  1101 HIS A C   
2849 O O   . HIS A 231 ? 0.4030 0.3545 0.3957 -0.0750 0.0373  0.0353  1101 HIS A O   
2850 C CB  . HIS A 231 ? 0.6716 0.5900 0.6220 -0.0772 0.0522  0.0360  1101 HIS A CB  
2851 C CG  . HIS A 231 ? 0.8314 0.7564 0.7934 -0.0890 0.0559  0.0381  1101 HIS A CG  
2852 N ND1 . HIS A 231 ? 0.8864 0.8008 0.8408 -0.0946 0.0495  0.0397  1101 HIS A ND1 
2853 C CD2 . HIS A 231 ? 0.9704 0.9128 0.9522 -0.0962 0.0652  0.0386  1101 HIS A CD2 
2854 C CE1 . HIS A 231 ? 0.9752 0.8999 0.9440 -0.1056 0.0545  0.0410  1101 HIS A CE1 
2855 N NE2 . HIS A 231 ? 1.0928 1.0357 1.0793 -0.1066 0.0641  0.0403  1101 HIS A NE2 
2864 N N   . GLU A 232 ? 0.4355 0.3591 0.3934 -0.0635 0.0282  0.0334  1102 GLU A N   
2865 C CA  . GLU A 232 ? 0.4257 0.3484 0.3855 -0.0637 0.0194  0.0335  1102 GLU A CA  
2866 C C   . GLU A 232 ? 0.4576 0.4023 0.4417 -0.0605 0.0169  0.0325  1102 GLU A C   
2867 O O   . GLU A 232 ? 0.4039 0.3536 0.3969 -0.0640 0.0122  0.0332  1102 GLU A O   
2868 C CB  . GLU A 232 ? 0.5251 0.4304 0.4636 -0.0559 0.0112  0.0319  1102 GLU A CB  
2869 C CG  . GLU A 232 ? 0.4745 0.3724 0.4083 -0.0570 0.0029  0.0321  1102 GLU A CG  
2870 C CD  . GLU A 232 ? 0.5813 0.4639 0.5037 -0.0676 0.0040  0.0349  1102 GLU A CD  
2871 O OE1 . GLU A 232 ? 0.5614 0.4368 0.4763 -0.0737 0.0114  0.0366  1102 GLU A OE1 
2872 O OE2 . GLU A 232 ? 0.5520 0.4291 0.4720 -0.0704 -0.0022 0.0353  1102 GLU A OE2 
2879 N N   . LEU A 233 ? 0.3429 0.2992 0.3365 -0.0542 0.0198  0.0307  1103 LEU A N   
2880 C CA  . LEU A 233 ? 0.3176 0.2916 0.3308 -0.0501 0.0170  0.0297  1103 LEU A CA  
2881 C C   . LEU A 233 ? 0.3746 0.3663 0.4104 -0.0552 0.0218  0.0310  1103 LEU A C   
2882 O O   . LEU A 233 ? 0.3519 0.3570 0.4036 -0.0524 0.0188  0.0305  1103 LEU A O   
2883 C CB  . LEU A 233 ? 0.3068 0.2845 0.3194 -0.0415 0.0178  0.0271  1103 LEU A CB  
2884 C CG  . LEU A 233 ? 0.3384 0.3025 0.3320 -0.0354 0.0122  0.0251  1103 LEU A CG  
2885 C CD1 . LEU A 233 ? 0.3060 0.2755 0.3007 -0.0282 0.0130  0.0222  1103 LEU A CD1 
2886 C CD2 . LEU A 233 ? 0.3984 0.3596 0.3898 -0.0341 0.0037  0.0247  1103 LEU A CD2 
2898 N N   . THR A 234 ? 0.3167 0.3084 0.3539 -0.0626 0.0293  0.0324  1104 THR A N   
2899 C CA  . THR A 234 ? 0.3511 0.3614 0.4115 -0.0677 0.0337  0.0332  1104 THR A CA  
2900 C C   . THR A 234 ? 0.3876 0.4015 0.4558 -0.0738 0.0271  0.0345  1104 THR A C   
2901 O O   . THR A 234 ? 0.3812 0.4124 0.4706 -0.0776 0.0283  0.0348  1104 THR A O   
2902 C CB  . THR A 234 ? 0.5528 0.5639 0.6135 -0.0744 0.0450  0.0339  1104 THR A CB  
2903 O OG1 . THR A 234 ? 0.5263 0.5217 0.5711 -0.0833 0.0454  0.0357  1104 THR A OG1 
2904 C CG2 . THR A 234 ? 0.4214 0.4268 0.4718 -0.0686 0.0514  0.0326  1104 THR A CG2 
2912 N N   . LYS A 235 ? 0.3892 0.3870 0.4404 -0.0744 0.0197  0.0348  1105 LYS A N   
2913 C CA  . LYS A 235 ? 0.4677 0.4660 0.5231 -0.0799 0.0124  0.0358  1105 LYS A CA  
2914 C C   . LYS A 235 ? 0.4548 0.4645 0.5230 -0.0737 0.0048  0.0348  1105 LYS A C   
2915 O O   . LYS A 235 ? 0.4022 0.4169 0.4788 -0.0778 -0.0012 0.0354  1105 LYS A O   
2916 C CB  . LYS A 235 ? 0.4126 0.3873 0.4431 -0.0820 0.0071  0.0363  1105 LYS A CB  
2917 C CG  . LYS A 235 ? 0.4398 0.3995 0.4548 -0.0899 0.0132  0.0377  1105 LYS A CG  
2918 C CD  . LYS A 235 ? 0.6893 0.6233 0.6776 -0.0901 0.0069  0.0381  1105 LYS A CD  
2919 C CE  . LYS A 235 ? 0.7398 0.6553 0.7094 -0.0983 0.0126  0.0399  1105 LYS A CE  
2920 N NZ  . LYS A 235 ? 0.7078 0.5957 0.6487 -0.0965 0.0061  0.0400  1105 LYS A NZ  
2934 N N   . LEU A 236 ? 0.3945 0.4070 0.4627 -0.0642 0.0048  0.0333  1106 LEU A N   
2935 C CA  . LEU A 236 ? 0.3250 0.3458 0.4022 -0.0583 -0.0017 0.0325  1106 LEU A CA  
2936 C C   . LEU A 236 ? 0.3215 0.3619 0.4229 -0.0600 -0.0011 0.0331  1106 LEU A C   
2937 O O   . LEU A 236 ? 0.3351 0.3856 0.4482 -0.0627 0.0063  0.0334  1106 LEU A O   
2938 C CB  . LEU A 236 ? 0.3169 0.3366 0.3889 -0.0490 -0.0004 0.0307  1106 LEU A CB  
2939 C CG  . LEU A 236 ? 0.3310 0.3343 0.3814 -0.0454 -0.0020 0.0293  1106 LEU A CG  
2940 C CD1 . LEU A 236 ? 0.3210 0.3264 0.3693 -0.0378 0.0008  0.0272  1106 LEU A CD1 
2941 C CD2 . LEU A 236 ? 0.3025 0.2973 0.3436 -0.0445 -0.0106 0.0289  1106 LEU A CD2 
2953 N N   . PRO A 237 ? 0.2759 0.3215 0.3845 -0.0579 -0.0091 0.0332  1107 PRO A N   
2954 C CA  . PRO A 237 ? 0.3159 0.3800 0.4471 -0.0572 -0.0098 0.0334  1107 PRO A CA  
2955 C C   . PRO A 237 ? 0.2614 0.3334 0.4001 -0.0498 -0.0036 0.0325  1107 PRO A C   
2956 O O   . PRO A 237 ? 0.2463 0.3094 0.3723 -0.0445 -0.0016 0.0315  1107 PRO A O   
2957 C CB  . PRO A 237 ? 0.3318 0.3944 0.4624 -0.0549 -0.0203 0.0336  1107 PRO A CB  
2958 C CG  . PRO A 237 ? 0.3631 0.4079 0.4714 -0.0522 -0.0233 0.0329  1107 PRO A CG  
2959 C CD  . PRO A 237 ? 0.3157 0.3499 0.4113 -0.0561 -0.0178 0.0329  1107 PRO A CD  
2967 N N   . ALA A 238 ? 0.2405 0.3293 0.3997 -0.0494 -0.0009 0.0324  1108 ALA A N   
2968 C CA  . ALA A 238 ? 0.2552 0.3509 0.4214 -0.0429 0.0060  0.0313  1108 ALA A CA  
2969 C C   . ALA A 238 ? 0.2775 0.3661 0.4348 -0.0344 0.0030  0.0306  1108 ALA A C   
2970 O O   . ALA A 238 ? 0.3388 0.4235 0.4900 -0.0302 0.0089  0.0295  1108 ALA A O   
2971 C CB  . ALA A 238 ? 0.3205 0.4362 0.5114 -0.0422 0.0074  0.0311  1108 ALA A CB  
2977 N N   . PHE A 239 ? 0.2881 0.3743 0.4437 -0.0325 -0.0061 0.0311  1109 PHE A N   
2978 C CA  . PHE A 239 ? 0.2919 0.3730 0.4414 -0.0252 -0.0085 0.0305  1109 PHE A CA  
2979 C C   . PHE A 239 ? 0.2817 0.3492 0.4119 -0.0237 -0.0065 0.0293  1109 PHE A C   
2980 O O   . PHE A 239 ? 0.2566 0.3205 0.3817 -0.0186 -0.0061 0.0284  1109 PHE A O   
2981 C CB  . PHE A 239 ? 0.2818 0.3634 0.4338 -0.0237 -0.0185 0.0315  1109 PHE A CB  
2982 C CG  . PHE A 239 ? 0.3953 0.4645 0.5314 -0.0262 -0.0246 0.0317  1109 PHE A CG  
2983 C CD1 . PHE A 239 ? 0.2973 0.3565 0.4196 -0.0222 -0.0264 0.0309  1109 PHE A CD1 
2984 C CD2 . PHE A 239 ? 0.3912 0.4590 0.5262 -0.0328 -0.0285 0.0324  1109 PHE A CD2 
2985 C CE1 . PHE A 239 ? 0.3329 0.3817 0.4411 -0.0238 -0.0314 0.0306  1109 PHE A CE1 
2986 C CE2 . PHE A 239 ? 0.3763 0.4317 0.4957 -0.0343 -0.0341 0.0322  1109 PHE A CE2 
2987 C CZ  . PHE A 239 ? 0.3902 0.4366 0.4966 -0.0294 -0.0354 0.0312  1109 PHE A CZ  
2997 N N   . VAL A 240 ? 0.2631 0.3229 0.3824 -0.0281 -0.0053 0.0292  1110 VAL A N   
2998 C CA  . VAL A 240 ? 0.2315 0.2800 0.3338 -0.0259 -0.0036 0.0275  1110 VAL A CA  
2999 C C   . VAL A 240 ? 0.2601 0.3057 0.3573 -0.0272 0.0041  0.0268  1110 VAL A C   
3000 O O   . VAL A 240 ? 0.2747 0.3115 0.3582 -0.0252 0.0052  0.0252  1110 VAL A O   
3001 C CB  . VAL A 240 ? 0.2602 0.2981 0.3487 -0.0276 -0.0098 0.0273  1110 VAL A CB  
3002 C CG1 . VAL A 240 ? 0.3279 0.3659 0.4171 -0.0258 -0.0170 0.0276  1110 VAL A CG1 
3003 C CG2 . VAL A 240 ? 0.2797 0.3145 0.3667 -0.0343 -0.0106 0.0286  1110 VAL A CG2 
3013 N N   . ARG A 241 ? 0.2480 0.3011 0.3559 -0.0305 0.0095  0.0278  1111 ARG A N   
3014 C CA  . ARG A 241 ? 0.2765 0.3253 0.3778 -0.0323 0.0173  0.0273  1111 ARG A CA  
3015 C C   . ARG A 241 ? 0.2667 0.3141 0.3640 -0.0267 0.0223  0.0253  1111 ARG A C   
3016 O O   . ARG A 241 ? 0.2508 0.3040 0.3558 -0.0221 0.0219  0.0247  1111 ARG A O   
3017 C CB  . ARG A 241 ? 0.3071 0.3657 0.4218 -0.0376 0.0230  0.0285  1111 ARG A CB  
3018 C CG  . ARG A 241 ? 0.4276 0.4844 0.5420 -0.0456 0.0199  0.0301  1111 ARG A CG  
3019 C CD  . ARG A 241 ? 0.3678 0.4300 0.4889 -0.0524 0.0283  0.0308  1111 ARG A CD  
3020 N NE  . ARG A 241 ? 0.6042 0.6860 0.7494 -0.0528 0.0305  0.0307  1111 ARG A NE  
3021 C CZ  . ARG A 241 ? 0.5897 0.6817 0.7488 -0.0588 0.0271  0.0316  1111 ARG A CZ  
3022 N NH1 . ARG A 241 ? 0.6389 0.7219 0.7889 -0.0655 0.0216  0.0329  1111 ARG A NH1 
3023 N NH2 . ARG A 241 ? 0.5009 0.6123 0.6832 -0.0578 0.0288  0.0311  1111 ARG A NH2 
3037 N N   . VAL A 242 ? 0.2526 0.2908 0.3364 -0.0273 0.0266  0.0244  1112 VAL A N   
3038 C CA  . VAL A 242 ? 0.3453 0.3808 0.4235 -0.0227 0.0313  0.0223  1112 VAL A CA  
3039 C C   . VAL A 242 ? 0.3529 0.3980 0.4444 -0.0216 0.0385  0.0223  1112 VAL A C   
3040 O O   . VAL A 242 ? 0.2493 0.2957 0.3424 -0.0168 0.0405  0.0207  1112 VAL A O   
3041 C CB  . VAL A 242 ? 0.4108 0.4340 0.4713 -0.0239 0.0341  0.0214  1112 VAL A CB  
3042 C CG1 . VAL A 242 ? 0.3906 0.4108 0.4447 -0.0193 0.0376  0.0189  1112 VAL A CG1 
3043 C CG2 . VAL A 242 ? 0.3937 0.4071 0.4410 -0.0243 0.0269  0.0213  1112 VAL A CG2 
3053 N N   . VAL A 243 ? 0.2658 0.3174 0.3665 -0.0263 0.0428  0.0237  1113 VAL A N   
3054 C CA  . VAL A 243 ? 0.3105 0.3735 0.4262 -0.0251 0.0502  0.0234  1113 VAL A CA  
3055 C C   . VAL A 243 ? 0.3338 0.4113 0.4693 -0.0277 0.0478  0.0248  1113 VAL A C   
3056 O O   . VAL A 243 ? 0.2840 0.3619 0.4203 -0.0343 0.0457  0.0264  1113 VAL A O   
3057 C CB  . VAL A 243 ? 0.3645 0.4237 0.4737 -0.0287 0.0601  0.0230  1113 VAL A CB  
3058 C CG1 . VAL A 243 ? 0.3580 0.4300 0.4833 -0.0267 0.0685  0.0221  1113 VAL A CG1 
3059 C CG2 . VAL A 243 ? 0.4478 0.4918 0.5361 -0.0263 0.0615  0.0215  1113 VAL A CG2 
3069 N N   A SER A 244 ? 0.2572 0.3458 0.4081 -0.0224 0.0475  0.0242  1114 SER A N   
3070 N N   B SER A 244 ? 0.2603 0.3489 0.4112 -0.0224 0.0477  0.0242  1114 SER A N   
3071 C CA  A SER A 244 ? 0.2680 0.3727 0.4400 -0.0238 0.0455  0.0250  1114 SER A CA  
3072 C CA  B SER A 244 ? 0.2760 0.3803 0.4477 -0.0234 0.0447  0.0251  1114 SER A CA  
3073 C C   A SER A 244 ? 0.4462 0.5614 0.6329 -0.0159 0.0475  0.0237  1114 SER A C   
3074 C C   B SER A 244 ? 0.4551 0.5703 0.6418 -0.0158 0.0476  0.0237  1114 SER A C   
3075 O O   A SER A 244 ? 0.3136 0.4212 0.4924 -0.0096 0.0479  0.0226  1114 SER A O   
3076 O O   B SER A 244 ? 0.3378 0.4457 0.5167 -0.0095 0.0488  0.0225  1114 SER A O   
3077 C CB  A SER A 244 ? 0.3483 0.4524 0.5211 -0.0258 0.0344  0.0266  1114 SER A CB  
3078 C CB  B SER A 244 ? 0.3423 0.4445 0.5131 -0.0239 0.0332  0.0265  1114 SER A CB  
3079 O OG  A SER A 244 ? 0.2465 0.3465 0.4161 -0.0192 0.0280  0.0264  1114 SER A OG  
3080 O OG  B SER A 244 ? 0.3428 0.4598 0.5333 -0.0239 0.0289  0.0271  1114 SER A OG  
3091 N N   . ALA A 245 ? 0.3508 0.4833 0.5588 -0.0164 0.0486  0.0236  1115 ALA A N   
3092 C CA  . ALA A 245 ? 0.3385 0.4821 0.5620 -0.0080 0.0503  0.0221  1115 ALA A CA  
3093 C C   . ALA A 245 ? 0.3617 0.5003 0.5831 -0.0011 0.0404  0.0227  1115 ALA A C   
3094 O O   . ALA A 245 ? 0.3626 0.5009 0.5865 0.0073  0.0414  0.0215  1115 ALA A O   
3095 C CB  . ALA A 245 ? 0.4147 0.5801 0.6633 -0.0101 0.0522  0.0216  1115 ALA A CB  
3102 N N   . GLY A 246 ? 0.2604 0.3937 0.4757 -0.0046 0.0310  0.0245  1116 GLY A N   
3103 C CA  . GLY A 246 ? 0.3001 0.4274 0.5115 0.0008  0.0216  0.0253  1116 GLY A CA  
3104 C C   . GLY A 246 ? 0.3300 0.4391 0.5194 0.0020  0.0209  0.0252  1116 GLY A C   
3105 O O   . GLY A 246 ? 0.3345 0.4361 0.5166 0.0041  0.0135  0.0260  1116 GLY A O   
3109 N N   . ASN A 247 ? 0.2549 0.3571 0.4335 0.0004  0.0288  0.0239  1117 ASN A N   
3110 C CA  . ASN A 247 ? 0.2407 0.3278 0.4000 0.0011  0.0286  0.0232  1117 ASN A CA  
3111 C C   . ASN A 247 ? 0.2387 0.3214 0.3945 0.0068  0.0349  0.0212  1117 ASN A C   
3112 O O   . ASN A 247 ? 0.2496 0.3350 0.4075 0.0068  0.0432  0.0199  1117 ASN A O   
3113 C CB  . ASN A 247 ? 0.2695 0.3499 0.4163 -0.0052 0.0308  0.0231  1117 ASN A CB  
3114 C CG  . ASN A 247 ? 0.2915 0.3586 0.4200 -0.0043 0.0303  0.0217  1117 ASN A CG  
3115 O OD1 . ASN A 247 ? 0.2660 0.3287 0.3907 -0.0002 0.0288  0.0208  1117 ASN A OD1 
3116 N ND2 . ASN A 247 ? 0.2353 0.2961 0.3524 -0.0084 0.0313  0.0214  1117 ASN A ND2 
3123 N N   . LEU A 248 ? 0.2496 0.3248 0.3993 0.0113  0.0312  0.0209  1118 LEU A N   
3124 C CA  . LEU A 248 ? 0.1937 0.2623 0.3382 0.0165  0.0363  0.0190  1118 LEU A CA  
3125 C C   . LEU A 248 ? 0.2392 0.3009 0.3716 0.0138  0.0434  0.0170  1118 LEU A C   
3126 O O   . LEU A 248 ? 0.2490 0.3094 0.3812 0.0170  0.0504  0.0152  1118 LEU A O   
3127 C CB  . LEU A 248 ? 0.2365 0.2941 0.3711 0.0192  0.0309  0.0191  1118 LEU A CB  
3128 C CG  . LEU A 248 ? 0.3137 0.3739 0.4562 0.0232  0.0234  0.0210  1118 LEU A CG  
3129 C CD1 . LEU A 248 ? 0.2788 0.3247 0.4080 0.0258  0.0203  0.0209  1118 LEU A CD1 
3130 C CD2 . LEU A 248 ? 0.3420 0.4134 0.5017 0.0290  0.0255  0.0209  1118 LEU A CD2 
3142 N N   . LEU A 249 ? 0.2163 0.2729 0.3378 0.0086  0.0412  0.0171  1119 LEU A N   
3143 C CA  . LEU A 249 ? 0.2187 0.2676 0.3270 0.0066  0.0462  0.0150  1119 LEU A CA  
3144 C C   . LEU A 249 ? 0.3014 0.3546 0.4131 0.0047  0.0537  0.0149  1119 LEU A C   
3145 O O   . LEU A 249 ? 0.2529 0.2992 0.3540 0.0044  0.0591  0.0131  1119 LEU A O   
3146 C CB  . LEU A 249 ? 0.2274 0.2705 0.3239 0.0026  0.0411  0.0149  1119 LEU A CB  
3147 C CG  . LEU A 249 ? 0.2853 0.3238 0.3767 0.0035  0.0351  0.0145  1119 LEU A CG  
3148 C CD1 . LEU A 249 ? 0.2505 0.2860 0.3326 0.0000  0.0306  0.0139  1119 LEU A CD1 
3149 C CD2 . LEU A 249 ? 0.2375 0.2687 0.3220 0.0061  0.0381  0.0122  1119 LEU A CD2 
3161 N N   . SER A 250 ? 0.2386 0.3028 0.3643 0.0031  0.0539  0.0167  1120 SER A N   
3162 C CA  . SER A 250 ? 0.2617 0.3313 0.3922 0.0006  0.0621  0.0165  1120 SER A CA  
3163 C C   . SER A 250 ? 0.3159 0.3901 0.4546 0.0061  0.0697  0.0148  1120 SER A C   
3164 O O   . SER A 250 ? 0.2658 0.3442 0.4077 0.0048  0.0783  0.0140  1120 SER A O   
3165 C CB  . SER A 250 ? 0.2757 0.3567 0.4196 -0.0042 0.0600  0.0187  1120 SER A CB  
3166 O OG  . SER A 250 ? 0.3156 0.3907 0.4505 -0.0091 0.0533  0.0202  1120 SER A OG  
3172 N N   . HIS A 251 ? 0.2140 0.2865 0.3549 0.0125  0.0668  0.0140  1121 HIS A N   
3173 C CA  . HIS A 251 ? 0.2671 0.3425 0.4150 0.0192  0.0731  0.0121  1121 HIS A CA  
3174 C C   . HIS A 251 ? 0.2929 0.3533 0.4240 0.0222  0.0765  0.0097  1121 HIS A C   
3175 O O   . HIS A 251 ? 0.3091 0.3682 0.4422 0.0282  0.0816  0.0078  1121 HIS A O   
3176 C CB  . HIS A 251 ? 0.2185 0.3018 0.3812 0.0253  0.0673  0.0129  1121 HIS A CB  
3177 C CG  . HIS A 251 ? 0.2668 0.3681 0.4501 0.0238  0.0659  0.0143  1121 HIS A CG  
3178 N ND1 . HIS A 251 ? 0.4118 0.5171 0.5988 0.0190  0.0576  0.0167  1121 HIS A ND1 
3179 C CD2 . HIS A 251 ? 0.2849 0.4016 0.4863 0.0261  0.0717  0.0133  1121 HIS A CD2 
3180 C CE1 . HIS A 251 ? 0.2022 0.3244 0.4087 0.0178  0.0578  0.0172  1121 HIS A CE1 
3181 N NE2 . HIS A 251 ? 0.3079 0.4384 0.5244 0.0220  0.0665  0.0151  1121 HIS A NE2 
3190 N N   . VAL A 252 ? 0.3028 0.3521 0.4174 0.0180  0.0734  0.0095  1122 VAL A N   
3191 C CA  . VAL A 252 ? 0.2554 0.2908 0.3537 0.0194  0.0758  0.0069  1122 VAL A CA  
3192 C C   . VAL A 252 ? 0.3736 0.4062 0.4666 0.0199  0.0857  0.0048  1122 VAL A C   
3193 O O   . VAL A 252 ? 0.3370 0.3607 0.4217 0.0235  0.0897  0.0023  1122 VAL A O   
3194 C CB  . VAL A 252 ? 0.2758 0.3028 0.3595 0.0146  0.0700  0.0066  1122 VAL A CB  
3195 C CG1 . VAL A 252 ? 0.3678 0.3820 0.4352 0.0150  0.0728  0.0034  1122 VAL A CG1 
3196 C CG2 . VAL A 252 ? 0.2377 0.2656 0.3244 0.0145  0.0613  0.0081  1122 VAL A CG2 
3206 N N   . GLY A 253 ? 0.4003 0.4392 0.4966 0.0158  0.0898  0.0059  1123 GLY A N   
3207 C CA  . GLY A 253 ? 0.3860 0.4226 0.4774 0.0156  0.1001  0.0042  1123 GLY A CA  
3208 C C   . GLY A 253 ? 0.3501 0.3731 0.4202 0.0114  0.1012  0.0032  1123 GLY A C   
3209 O O   . GLY A 253 ? 0.4603 0.4792 0.5228 0.0101  0.1095  0.0021  1123 GLY A O   
3213 N N   . HIS A 254 ? 0.4094 0.4255 0.4696 0.0094  0.0928  0.0033  1124 HIS A N   
3214 C CA  . HIS A 254 ? 0.4091 0.4131 0.4498 0.0061  0.0918  0.0020  1124 HIS A CA  
3215 C C   . HIS A 254 ? 0.4625 0.4660 0.4997 0.0032  0.0818  0.0031  1124 HIS A C   
3216 O O   . HIS A 254 ? 0.2993 0.3101 0.3475 0.0036  0.0761  0.0045  1124 HIS A O   
3217 C CB  . HIS A 254 ? 0.3574 0.3496 0.3844 0.0089  0.0939  -0.0015 1124 HIS A CB  
3218 C CG  . HIS A 254 ? 0.2942 0.2853 0.3239 0.0116  0.0885  -0.0026 1124 HIS A CG  
3219 N ND1 . HIS A 254 ? 0.3018 0.2961 0.3417 0.0165  0.0911  -0.0028 1124 HIS A ND1 
3220 C CD2 . HIS A 254 ? 0.3634 0.3501 0.3861 0.0100  0.0810  -0.0038 1124 HIS A CD2 
3221 C CE1 . HIS A 254 ? 0.2973 0.2870 0.3346 0.0173  0.0854  -0.0036 1124 HIS A CE1 
3222 N NE2 . HIS A 254 ? 0.3437 0.3297 0.3713 0.0130  0.0796  -0.0043 1124 HIS A NE2 
3231 N N   . THR A 255 ? 0.3577 0.3519 0.3788 0.0008  0.0797  0.0020  1125 THR A N   
3232 C CA  . THR A 255 ? 0.3435 0.3373 0.3606 -0.0013 0.0708  0.0026  1125 THR A CA  
3233 C C   . THR A 255 ? 0.3681 0.3615 0.3841 0.0002  0.0645  0.0003  1125 THR A C   
3234 O O   . THR A 255 ? 0.4070 0.3938 0.4144 0.0014  0.0656  -0.0027 1125 THR A O   
3235 C CB  . THR A 255 ? 0.4051 0.3886 0.4045 -0.0034 0.0701  0.0019  1125 THR A CB  
3236 O OG1 . THR A 255 ? 0.4024 0.3856 0.4020 -0.0063 0.0756  0.0045  1125 THR A OG1 
3237 C CG2 . THR A 255 ? 0.3587 0.3415 0.3533 -0.0040 0.0604  0.0016  1125 THR A CG2 
3245 N N   . ILE A 256 ? 0.2758 0.2759 0.3001 -0.0004 0.0581  0.0017  1126 ILE A N   
3246 C CA  . ILE A 256 ? 0.2842 0.2843 0.3064 -0.0003 0.0519  -0.0004 1126 ILE A CA  
3247 C C   . ILE A 256 ? 0.2582 0.2595 0.2764 -0.0018 0.0453  -0.0002 1126 ILE A C   
3248 O O   . ILE A 256 ? 0.2822 0.2890 0.3080 -0.0026 0.0421  0.0021  1126 ILE A O   
3249 C CB  . ILE A 256 ? 0.2739 0.2798 0.3080 0.0008  0.0505  0.0009  1126 ILE A CB  
3250 C CG1 . ILE A 256 ? 0.3736 0.3779 0.4121 0.0037  0.0568  0.0009  1126 ILE A CG1 
3251 C CG2 . ILE A 256 ? 0.2693 0.2745 0.3000 -0.0002 0.0453  -0.0013 1126 ILE A CG2 
3252 C CD1 . ILE A 256 ? 0.4675 0.4747 0.5153 0.0057  0.0549  0.0021  1126 ILE A CD1 
3264 N N   . LEU A 257 ? 0.3155 0.3112 0.3211 -0.0019 0.0429  -0.0030 1127 LEU A N   
3265 C CA  . LEU A 257 ? 0.4073 0.4023 0.4070 -0.0020 0.0369  -0.0032 1127 LEU A CA  
3266 C C   . LEU A 257 ? 0.3849 0.3875 0.3925 -0.0021 0.0311  -0.0030 1127 LEU A C   
3267 O O   . LEU A 257 ? 0.4331 0.4397 0.4442 -0.0023 0.0295  -0.0051 1127 LEU A O   
3268 C CB  . LEU A 257 ? 0.4247 0.4136 0.4107 -0.0009 0.0340  -0.0071 1127 LEU A CB  
3269 C CG  . LEU A 257 ? 0.4667 0.4450 0.4397 -0.0007 0.0383  -0.0071 1127 LEU A CG  
3270 C CD1 . LEU A 257 ? 0.5695 0.5423 0.5291 0.0007  0.0336  -0.0114 1127 LEU A CD1 
3271 C CD2 . LEU A 257 ? 0.4479 0.4216 0.4171 -0.0017 0.0393  -0.0036 1127 LEU A CD2 
3283 N N   . GLY A 258 ? 0.3065 0.3099 0.3155 -0.0025 0.0282  -0.0006 1128 GLY A N   
3284 C CA  . GLY A 258 ? 0.3709 0.3799 0.3851 -0.0024 0.0227  -0.0006 1128 GLY A CA  
3285 C C   . GLY A 258 ? 0.3669 0.3815 0.3935 -0.0036 0.0237  0.0023  1128 GLY A C   
3286 O O   . GLY A 258 ? 0.3122 0.3300 0.3424 -0.0038 0.0195  0.0031  1128 GLY A O   
3290 N N   . MET A 259 ? 0.2560 0.2713 0.2884 -0.0038 0.0291  0.0036  1129 MET A N   
3291 C CA  . MET A 259 ? 0.2689 0.2892 0.3132 -0.0039 0.0295  0.0063  1129 MET A CA  
3292 C C   . MET A 259 ? 0.3013 0.3236 0.3522 -0.0050 0.0325  0.0095  1129 MET A C   
3293 O O   . MET A 259 ? 0.2581 0.2838 0.3148 -0.0064 0.0292  0.0118  1129 MET A O   
3294 C CB  . MET A 259 ? 0.2072 0.2273 0.2545 -0.0026 0.0326  0.0052  1129 MET A CB  
3295 C CG  . MET A 259 ? 0.2206 0.2393 0.2619 -0.0031 0.0300  0.0020  1129 MET A CG  
3296 S SD  . MET A 259 ? 0.2999 0.3161 0.3440 -0.0026 0.0323  0.0016  1129 MET A SD  
3297 C CE  . MET A 259 ? 0.2881 0.3083 0.3417 -0.0020 0.0286  0.0055  1129 MET A CE  
3307 N N   . ASN A 260 ? 0.2423 0.2628 0.2924 -0.0048 0.0390  0.0094  1130 ASN A N   
3308 C CA  . ASN A 260 ? 0.2384 0.2619 0.2950 -0.0069 0.0427  0.0121  1130 ASN A CA  
3309 C C   . ASN A 260 ? 0.2256 0.2416 0.2700 -0.0093 0.0442  0.0121  1130 ASN A C   
3310 O O   . ASN A 260 ? 0.3082 0.3242 0.3540 -0.0118 0.0497  0.0136  1130 ASN A O   
3311 C CB  . ASN A 260 ? 0.2532 0.2812 0.3193 -0.0051 0.0498  0.0123  1130 ASN A CB  
3312 C CG  . ASN A 260 ? 0.2933 0.3144 0.3498 -0.0033 0.0555  0.0097  1130 ASN A CG  
3313 O OD1 . ASN A 260 ? 0.2822 0.2953 0.3247 -0.0042 0.0550  0.0081  1130 ASN A OD1 
3314 N ND2 . ASN A 260 ? 0.3349 0.3585 0.3982 -0.0002 0.0605  0.0091  1130 ASN A ND2 
3321 N N   . THR A 261 ? 0.2725 0.2819 0.3044 -0.0086 0.0394  0.0103  1131 THR A N   
3322 C CA  . THR A 261 ? 0.2785 0.2789 0.2971 -0.0102 0.0382  0.0106  1131 THR A CA  
3323 C C   . THR A 261 ? 0.3270 0.3258 0.3407 -0.0091 0.0298  0.0098  1131 THR A C   
3324 O O   . THR A 261 ? 0.2479 0.2518 0.2659 -0.0070 0.0259  0.0080  1131 THR A O   
3325 C CB  . THR A 261 ? 0.2769 0.2682 0.2811 -0.0088 0.0412  0.0082  1131 THR A CB  
3326 O OG1 . THR A 261 ? 0.3660 0.3577 0.3664 -0.0057 0.0369  0.0047  1131 THR A OG1 
3327 C CG2 . THR A 261 ? 0.3389 0.3309 0.3465 -0.0094 0.0503  0.0085  1131 THR A CG2 
3335 N N   . VAL A 262 ? 0.2554 0.2462 0.2593 -0.0105 0.0273  0.0109  1132 VAL A N   
3336 C CA  . VAL A 262 ? 0.2757 0.2644 0.2749 -0.0089 0.0196  0.0102  1132 VAL A CA  
3337 C C   . VAL A 262 ? 0.3343 0.3195 0.3229 -0.0043 0.0153  0.0062  1132 VAL A C   
3338 O O   . VAL A 262 ? 0.3450 0.3230 0.3225 -0.0031 0.0168  0.0049  1132 VAL A O   
3339 C CB  . VAL A 262 ? 0.3082 0.2874 0.2989 -0.0118 0.0180  0.0127  1132 VAL A CB  
3340 C CG1 . VAL A 262 ? 0.3044 0.2795 0.2881 -0.0089 0.0099  0.0114  1132 VAL A CG1 
3341 C CG2 . VAL A 262 ? 0.3170 0.3018 0.3201 -0.0172 0.0214  0.0162  1132 VAL A CG2 
3351 N N   . GLN A 263 ? 0.2839 0.2748 0.2760 -0.0018 0.0099  0.0041  1133 GLN A N   
3352 C CA  A GLN A 263 ? 0.2794 0.2704 0.2645 0.0026  0.0051  -0.0002 1133 GLN A CA  
3353 C CA  B GLN A 263 ? 0.2656 0.2561 0.2502 0.0026  0.0051  -0.0002 1133 GLN A CA  
3354 C C   . GLN A 263 ? 0.2882 0.2752 0.2671 0.0052  -0.0014 -0.0007 1133 GLN A C   
3355 O O   . GLN A 263 ? 0.2849 0.2739 0.2694 0.0035  -0.0026 0.0013  1133 GLN A O   
3356 C CB  A GLN A 263 ? 0.3643 0.3667 0.3597 0.0030  0.0054  -0.0029 1133 GLN A CB  
3357 C CB  B GLN A 263 ? 0.3871 0.3886 0.3809 0.0033  0.0054  -0.0032 1133 GLN A CB  
3358 C CG  A GLN A 263 ? 0.3137 0.3205 0.3062 0.0067  0.0002  -0.0077 1133 GLN A CG  
3359 C CG  B GLN A 263 ? 0.4594 0.4605 0.4485 0.0044  0.0069  -0.0065 1133 GLN A CG  
3360 C CD  A GLN A 263 ? 0.5260 0.5435 0.5284 0.0053  0.0015  -0.0101 1133 GLN A CD  
3361 C CD  B GLN A 263 ? 0.3779 0.3885 0.3759 0.0034  0.0082  -0.0092 1133 GLN A CD  
3362 O OE1 A GLN A 263 ? 0.4713 0.4905 0.4800 0.0024  0.0061  -0.0085 1133 GLN A OE1 
3363 O OE1 B GLN A 263 ? 0.4771 0.4944 0.4831 0.0025  0.0071  -0.0091 1133 GLN A OE1 
3364 N NE2 A GLN A 263 ? 0.5078 0.5321 0.5112 0.0075  -0.0025 -0.0141 1133 GLN A NE2 
3365 N NE2 B GLN A 263 ? 0.4421 0.4516 0.4369 0.0030  0.0105  -0.0115 1133 GLN A NE2 
3382 N N   . LEU A 264 ? 0.2910 0.2717 0.2576 0.0097  -0.0059 -0.0035 1134 LEU A N   
3383 C CA  . LEU A 264 ? 0.3066 0.2824 0.2659 0.0136  -0.0124 -0.0045 1134 LEU A CA  
3384 C C   . LEU A 264 ? 0.3568 0.3414 0.3176 0.0193  -0.0173 -0.0102 1134 LEU A C   
3385 O O   . LEU A 264 ? 0.2936 0.2832 0.2549 0.0209  -0.0172 -0.0134 1134 LEU A O   
3386 C CB  . LEU A 264 ? 0.3865 0.3450 0.3281 0.0148  -0.0144 -0.0029 1134 LEU A CB  
3387 C CG  . LEU A 264 ? 0.3884 0.3386 0.3197 0.0196  -0.0215 -0.0040 1134 LEU A CG  
3388 C CD1 . LEU A 264 ? 0.4267 0.3594 0.3452 0.0162  -0.0212 0.0004  1134 LEU A CD1 
3389 C CD2 . LEU A 264 ? 0.5805 0.5291 0.5024 0.0278  -0.0277 -0.0089 1134 LEU A CD2 
3401 N N   . TYR A 265 ? 0.2939 0.2809 0.2558 0.0222  -0.0215 -0.0115 1135 TYR A N   
3402 C CA  . TYR A 265 ? 0.2720 0.2687 0.2364 0.0279  -0.0259 -0.0172 1135 TYR A CA  
3403 C C   . TYR A 265 ? 0.2939 0.2803 0.2451 0.0347  -0.0325 -0.0187 1135 TYR A C   
3404 O O   . TYR A 265 ? 0.3120 0.2871 0.2566 0.0337  -0.0335 -0.0153 1135 TYR A O   
3405 C CB  . TYR A 265 ? 0.2690 0.2773 0.2456 0.0259  -0.0243 -0.0179 1135 TYR A CB  
3406 C CG  . TYR A 265 ? 0.2512 0.2680 0.2395 0.0197  -0.0183 -0.0164 1135 TYR A CG  
3407 C CD1 . TYR A 265 ? 0.3310 0.3598 0.3267 0.0192  -0.0168 -0.0205 1135 TYR A CD1 
3408 C CD2 . TYR A 265 ? 0.3104 0.3230 0.3023 0.0144  -0.0145 -0.0111 1135 TYR A CD2 
3409 C CE1 . TYR A 265 ? 0.4634 0.4973 0.4676 0.0138  -0.0116 -0.0190 1135 TYR A CE1 
3410 C CE2 . TYR A 265 ? 0.4903 0.5094 0.4921 0.0100  -0.0097 -0.0099 1135 TYR A CE2 
3411 C CZ  . TYR A 265 ? 0.5849 0.6133 0.5916 0.0098  -0.0082 -0.0137 1135 TYR A CZ  
3412 O OH  . TYR A 265 ? 0.5500 0.5822 0.5642 0.0055  -0.0036 -0.0124 1135 TYR A OH  
3422 N N   . MET A 266 ? 0.3261 0.3161 0.2736 0.0418  -0.0376 -0.0239 1136 MET A N   
3423 C CA  . MET A 266 ? 0.3782 0.3600 0.3141 0.0502  -0.0447 -0.0264 1136 MET A CA  
3424 C C   . MET A 266 ? 0.3350 0.3345 0.2815 0.0556  -0.0473 -0.0329 1136 MET A C   
3425 O O   . MET A 266 ? 0.3631 0.3768 0.3182 0.0564  -0.0473 -0.0372 1136 MET A O   
3426 C CB  . MET A 266 ? 0.2939 0.2630 0.2142 0.0551  -0.0493 -0.0272 1136 MET A CB  
3427 C CG  . MET A 266 ? 0.3554 0.3067 0.2641 0.0490  -0.0455 -0.0209 1136 MET A CG  
3428 S SD  . MET A 266 ? 0.4704 0.4060 0.3593 0.0534  -0.0496 -0.0216 1136 MET A SD  
3429 C CE  . MET A 266 ? 0.4379 0.3561 0.3077 0.0634  -0.0591 -0.0230 1136 MET A CE  
3439 N N   . LYS A 267 ? 0.3216 0.3204 0.2675 0.0588  -0.0492 -0.0337 1137 LYS A N   
3440 C CA  . LYS A 267 ? 0.2454 0.2625 0.2034 0.0620  -0.0493 -0.0394 1137 LYS A CA  
3441 C C   . LYS A 267 ? 0.3748 0.3901 0.3258 0.0730  -0.0560 -0.0443 1137 LYS A C   
3442 O O   . LYS A 267 ? 0.3568 0.3535 0.2925 0.0771  -0.0601 -0.0421 1137 LYS A O   
3443 C CB  . LYS A 267 ? 0.2389 0.2603 0.2053 0.0551  -0.0438 -0.0366 1137 LYS A CB  
3444 C CG  . LYS A 267 ? 0.2634 0.2850 0.2362 0.0452  -0.0376 -0.0315 1137 LYS A CG  
3445 C CD  . LYS A 267 ? 0.3345 0.3612 0.3154 0.0396  -0.0333 -0.0296 1137 LYS A CD  
3446 C CE  . LYS A 267 ? 0.2599 0.2864 0.2471 0.0310  -0.0279 -0.0246 1137 LYS A CE  
3447 N NZ  . LYS A 267 ? 0.2907 0.3187 0.2828 0.0265  -0.0253 -0.0221 1137 LYS A NZ  
3461 N N   . VAL A 268 ? 0.3274 0.3624 0.2899 0.0777  -0.0568 -0.0513 1138 VAL A N   
3462 C CA  . VAL A 268 ? 0.3875 0.4257 0.3479 0.0878  -0.0613 -0.0567 1138 VAL A CA  
3463 C C   . VAL A 268 ? 0.3910 0.4450 0.3646 0.0841  -0.0554 -0.0589 1138 VAL A C   
3464 O O   . VAL A 268 ? 0.3100 0.3743 0.2948 0.0748  -0.0491 -0.0574 1138 VAL A O   
3465 C CB  . VAL A 268 ? 0.3616 0.4115 0.3247 0.0979  -0.0677 -0.0641 1138 VAL A CB  
3466 C CG1 . VAL A 268 ? 0.4045 0.4357 0.3510 0.1023  -0.0742 -0.0618 1138 VAL A CG1 
3467 C CG2 . VAL A 268 ? 0.3241 0.3989 0.3060 0.0929  -0.0639 -0.0684 1138 VAL A CG2 
3477 N N   . PRO A 269 ? 0.3541 0.4082 0.3248 0.0913  -0.0573 -0.0624 1139 PRO A N   
3478 C CA  . PRO A 269 ? 0.3847 0.4522 0.3658 0.0877  -0.0512 -0.0646 1139 PRO A CA  
3479 C C   . PRO A 269 ? 0.3831 0.4760 0.3825 0.0831  -0.0464 -0.0693 1139 PRO A C   
3480 O O   . PRO A 269 ? 0.3375 0.4440 0.3436 0.0888  -0.0497 -0.0752 1139 PRO A O   
3481 C CB  . PRO A 269 ? 0.4188 0.4854 0.3941 0.0995  -0.0552 -0.0700 1139 PRO A CB  
3482 C CG  . PRO A 269 ? 0.4077 0.4498 0.3641 0.1058  -0.0627 -0.0668 1139 PRO A CG  
3483 C CD  . PRO A 269 ? 0.3614 0.4007 0.3170 0.1030  -0.0648 -0.0642 1139 PRO A CD  
3491 N N   . GLY A 270 ? 0.3428 0.4408 0.3494 0.0727  -0.0390 -0.0665 1140 GLY A N   
3492 C CA  . GLY A 270 ? 0.3715 0.4907 0.3935 0.0665  -0.0335 -0.0704 1140 GLY A CA  
3493 C C   . GLY A 270 ? 0.4147 0.5329 0.4400 0.0580  -0.0315 -0.0665 1140 GLY A C   
3494 O O   . GLY A 270 ? 0.3091 0.4415 0.3454 0.0510  -0.0265 -0.0687 1140 GLY A O   
3498 N N   . SER A 271 ? 0.3061 0.4069 0.3213 0.0582  -0.0350 -0.0610 1141 SER A N   
3499 C CA  . SER A 271 ? 0.2992 0.3972 0.3160 0.0510  -0.0330 -0.0573 1141 SER A CA  
3500 C C   . SER A 271 ? 0.3470 0.4438 0.3680 0.0407  -0.0259 -0.0527 1141 SER A C   
3501 O O   . SER A 271 ? 0.2708 0.3551 0.2858 0.0387  -0.0249 -0.0474 1141 SER A O   
3502 C CB  . SER A 271 ? 0.2871 0.3656 0.2909 0.0534  -0.0373 -0.0522 1141 SER A CB  
3503 O OG  . SER A 271 ? 0.3509 0.4282 0.3487 0.0630  -0.0445 -0.0563 1141 SER A OG  
3509 N N   . ARG A 272 ? 0.2880 0.3969 0.3186 0.0341  -0.0214 -0.0547 1142 ARG A N   
3510 C CA  . ARG A 272 ? 0.2867 0.3946 0.3205 0.0250  -0.0148 -0.0511 1142 ARG A CA  
3511 C C   . ARG A 272 ? 0.2038 0.3058 0.2378 0.0185  -0.0122 -0.0470 1142 ARG A C   
3512 O O   . ARG A 272 ? 0.2432 0.3503 0.2799 0.0180  -0.0132 -0.0496 1142 ARG A O   
3513 C CB  . ARG A 272 ? 0.2524 0.3774 0.2954 0.0215  -0.0102 -0.0567 1142 ARG A CB  
3514 C CG  . ARG A 272 ? 0.3003 0.4287 0.3422 0.0258  -0.0099 -0.0593 1142 ARG A CG  
3515 C CD  . ARG A 272 ? 0.2873 0.4337 0.3386 0.0216  -0.0042 -0.0653 1142 ARG A CD  
3516 N NE  . ARG A 272 ? 0.2854 0.4329 0.3340 0.0248  -0.0025 -0.0671 1142 ARG A NE  
3517 C CZ  . ARG A 272 ? 0.4324 0.5946 0.4874 0.0220  0.0032  -0.0724 1142 ARG A CZ  
3518 N NH1 . ARG A 272 ? 0.2520 0.4296 0.3172 0.0153  0.0075  -0.0766 1142 ARG A NH1 
3519 N NH2 . ARG A 272 ? 0.3118 0.4726 0.3622 0.0254  0.0048  -0.0738 1142 ARG A NH2 
3533 N N   . THR A 273 ? 0.2350 0.3262 0.2662 0.0138  -0.0093 -0.0408 1143 THR A N   
3534 C CA  . THR A 273 ? 0.2438 0.3308 0.2766 0.0072  -0.0054 -0.0374 1143 THR A CA  
3535 C C   . THR A 273 ? 0.2461 0.3379 0.2827 0.0007  -0.0002 -0.0379 1143 THR A C   
3536 O O   . THR A 273 ? 0.2558 0.3422 0.2898 -0.0004 0.0009  -0.0349 1143 THR A O   
3537 C CB  . THR A 273 ? 0.2773 0.3496 0.3051 0.0067  -0.0058 -0.0303 1143 THR A CB  
3538 O OG1 . THR A 273 ? 0.2769 0.3429 0.2992 0.0117  -0.0100 -0.0296 1143 THR A OG1 
3539 C CG2 . THR A 273 ? 0.2907 0.3591 0.3206 0.0009  -0.0015 -0.0271 1143 THR A CG2 
3547 N N   . PRO A 274 ? 0.2355 0.3364 0.2770 -0.0040 0.0030  -0.0418 1144 PRO A N   
3548 C CA  . PRO A 274 ? 0.2778 0.3826 0.3213 -0.0109 0.0084  -0.0428 1144 PRO A CA  
3549 C C   . PRO A 274 ? 0.2772 0.3684 0.3162 -0.0159 0.0115  -0.0365 1144 PRO A C   
3550 O O   . PRO A 274 ? 0.2503 0.3314 0.2868 -0.0140 0.0097  -0.0317 1144 PRO A O   
3551 C CB  . PRO A 274 ? 0.2918 0.4091 0.3414 -0.0151 0.0104  -0.0488 1144 PRO A CB  
3552 C CG  . PRO A 274 ? 0.3607 0.4750 0.4095 -0.0119 0.0065  -0.0486 1144 PRO A CG  
3553 C CD  . PRO A 274 ? 0.3467 0.4542 0.3911 -0.0036 0.0014  -0.0458 1144 PRO A CD  
3561 N N   . GLY A 275 ? 0.2277 0.3187 0.2653 -0.0220 0.0161  -0.0366 1145 GLY A N   
3562 C CA  . GLY A 275 ? 0.3005 0.3778 0.3325 -0.0257 0.0182  -0.0308 1145 GLY A CA  
3563 C C   . GLY A 275 ? 0.2950 0.3637 0.3262 -0.0271 0.0186  -0.0276 1145 GLY A C   
3564 O O   . GLY A 275 ? 0.2719 0.3446 0.3052 -0.0299 0.0202  -0.0307 1145 GLY A O   
3568 N N   . HIS A 276 ? 0.2645 0.3216 0.2928 -0.0253 0.0172  -0.0216 1146 HIS A N   
3569 C CA  . HIS A 276 ? 0.2861 0.3347 0.3137 -0.0259 0.0182  -0.0186 1146 HIS A CA  
3570 C C   . HIS A 276 ? 0.3354 0.3732 0.3611 -0.0239 0.0167  -0.0124 1146 HIS A C   
3571 O O   . HIS A 276 ? 0.2633 0.3001 0.2884 -0.0216 0.0138  -0.0102 1146 HIS A O   
3572 C CB  . HIS A 276 ? 0.2557 0.3076 0.2867 -0.0220 0.0162  -0.0197 1146 HIS A CB  
3573 C CG  . HIS A 276 ? 0.3337 0.3848 0.3658 -0.0163 0.0122  -0.0171 1146 HIS A CG  
3574 N ND1 . HIS A 276 ? 0.4839 0.5406 0.5161 -0.0135 0.0092  -0.0190 1146 HIS A ND1 
3575 C CD2 . HIS A 276 ? 0.3906 0.4355 0.4234 -0.0134 0.0109  -0.0129 1146 HIS A CD2 
3576 C CE1 . HIS A 276 ? 0.3301 0.3824 0.3617 -0.0094 0.0060  -0.0158 1146 HIS A CE1 
3577 N NE2 . HIS A 276 ? 0.3592 0.4053 0.3918 -0.0098 0.0072  -0.0121 1146 HIS A NE2 
3585 N N   . GLN A 277 ? 0.2730 0.3028 0.2976 -0.0246 0.0184  -0.0099 1147 GLN A N   
3586 C CA  . GLN A 277 ? 0.2322 0.2545 0.2581 -0.0212 0.0165  -0.0046 1147 GLN A CA  
3587 C C   . GLN A 277 ? 0.2441 0.2681 0.2746 -0.0180 0.0167  -0.0044 1147 GLN A C   
3588 O O   . GLN A 277 ? 0.2572 0.2836 0.2871 -0.0193 0.0189  -0.0078 1147 GLN A O   
3589 C CB  . GLN A 277 ? 0.2194 0.2305 0.2402 -0.0232 0.0183  -0.0021 1147 GLN A CB  
3590 C CG  . GLN A 277 ? 0.2711 0.2774 0.2848 -0.0265 0.0181  -0.0014 1147 GLN A CG  
3591 C CD  . GLN A 277 ? 0.3149 0.3079 0.3203 -0.0292 0.0202  0.0005  1147 GLN A CD  
3592 O OE1 . GLN A 277 ? 0.3242 0.3141 0.3259 -0.0331 0.0241  -0.0020 1147 GLN A OE1 
3593 N NE2 . GLN A 277 ? 0.2894 0.2731 0.2907 -0.0271 0.0171  0.0047  1147 GLN A NE2 
3602 N N   . GLU A 278 ? 0.2543 0.2772 0.2891 -0.0143 0.0145  -0.0008 1148 GLU A N   
3603 C CA  . GLU A 278 ? 0.2381 0.2618 0.2766 -0.0117 0.0157  -0.0002 1148 GLU A CA  
3604 C C   . GLU A 278 ? 0.3939 0.4120 0.4309 -0.0122 0.0197  -0.0006 1148 GLU A C   
3605 O O   . GLU A 278 ? 0.2783 0.2902 0.3121 -0.0138 0.0207  0.0001  1148 GLU A O   
3606 C CB  . GLU A 278 ? 0.2309 0.2544 0.2752 -0.0089 0.0135  0.0040  1148 GLU A CB  
3607 C CG  . GLU A 278 ? 0.2239 0.2506 0.2684 -0.0085 0.0092  0.0046  1148 GLU A CG  
3608 C CD  . GLU A 278 ? 0.3086 0.3391 0.3498 -0.0081 0.0086  0.0012  1148 GLU A CD  
3609 O OE1 . GLU A 278 ? 0.2847 0.3154 0.3258 -0.0071 0.0103  0.0005  1148 GLU A OE1 
3610 O OE2 . GLU A 278 ? 0.3190 0.3519 0.3570 -0.0085 0.0064  -0.0008 1148 GLU A OE2 
3617 N N   . ASN A 279 ? 0.2453 0.2639 0.2828 -0.0108 0.0219  -0.0018 1149 ASN A N   
3618 C CA  . ASN A 279 ? 0.2497 0.2619 0.2853 -0.0104 0.0259  -0.0021 1149 ASN A CA  
3619 C C   . ASN A 279 ? 0.2147 0.2219 0.2540 -0.0076 0.0262  0.0018  1149 ASN A C   
3620 O O   . ASN A 279 ? 0.2463 0.2569 0.2927 -0.0048 0.0247  0.0048  1149 ASN A O   
3621 C CB  . ASN A 279 ? 0.2552 0.2682 0.2905 -0.0085 0.0281  -0.0032 1149 ASN A CB  
3622 C CG  . ASN A 279 ? 0.3124 0.3288 0.3426 -0.0106 0.0270  -0.0076 1149 ASN A CG  
3623 O OD1 . ASN A 279 ? 0.4160 0.4326 0.4425 -0.0139 0.0271  -0.0109 1149 ASN A OD1 
3624 N ND2 . ASN A 279 ? 0.3516 0.3707 0.3814 -0.0086 0.0258  -0.0077 1149 ASN A ND2 
3631 N N   . ASN A 280 ? 0.2477 0.2463 0.2819 -0.0085 0.0279  0.0016  1150 ASN A N   
3632 C CA  . ASN A 280 ? 0.2452 0.2375 0.2815 -0.0049 0.0276  0.0049  1150 ASN A CA  
3633 C C   . ASN A 280 ? 0.2801 0.2761 0.3220 -0.0033 0.0228  0.0084  1150 ASN A C   
3634 O O   . ASN A 280 ? 0.2486 0.2445 0.2970 0.0011  0.0214  0.0113  1150 ASN A O   
3635 C CB  . ASN A 280 ? 0.2923 0.2840 0.3334 -0.0002 0.0311  0.0054  1150 ASN A CB  
3636 C CG  . ASN A 280 ? 0.3672 0.3505 0.3998 -0.0012 0.0356  0.0022  1150 ASN A CG  
3637 O OD1 . ASN A 280 ? 0.4231 0.3956 0.4500 -0.0001 0.0368  0.0024  1150 ASN A OD1 
3638 N ND2 . ASN A 280 ? 0.2336 0.2203 0.2639 -0.0032 0.0376  -0.0007 1150 ASN A ND2 
3645 N N   . ASN A 281 ? 0.2197 0.2192 0.2591 -0.0068 0.0201  0.0077  1151 ASN A N   
3646 C CA  . ASN A 281 ? 0.2395 0.2401 0.2809 -0.0061 0.0152  0.0106  1151 ASN A CA  
3647 C C   . ASN A 281 ? 0.1929 0.2008 0.2450 -0.0028 0.0125  0.0132  1151 ASN A C   
3648 O O   . ASN A 281 ? 0.2322 0.2396 0.2874 -0.0011 0.0081  0.0161  1151 ASN A O   
3649 C CB  . ASN A 281 ? 0.2655 0.2553 0.3013 -0.0053 0.0137  0.0128  1151 ASN A CB  
3650 C CG  . ASN A 281 ? 0.3775 0.3600 0.4012 -0.0107 0.0153  0.0109  1151 ASN A CG  
3651 O OD1 . ASN A 281 ? 0.3422 0.3304 0.3639 -0.0147 0.0160  0.0081  1151 ASN A OD1 
3652 N ND2 . ASN A 281 ? 0.3173 0.2869 0.3326 -0.0107 0.0158  0.0120  1151 ASN A ND2 
3659 N N   . PHE A 282 ? 0.2353 0.2492 0.2921 -0.0023 0.0149  0.0121  1152 PHE A N   
3660 C CA  . PHE A 282 ? 0.1736 0.1943 0.2399 -0.0007 0.0132  0.0143  1152 PHE A CA  
3661 C C   . PHE A 282 ? 0.1931 0.2169 0.2579 -0.0029 0.0088  0.0147  1152 PHE A C   
3662 O O   . PHE A 282 ? 0.2644 0.2874 0.3219 -0.0051 0.0085  0.0122  1152 PHE A O   
3663 C CB  . PHE A 282 ? 0.1786 0.2026 0.2483 0.0002  0.0180  0.0133  1152 PHE A CB  
3664 C CG  . PHE A 282 ? 0.2135 0.2363 0.2883 0.0037  0.0218  0.0139  1152 PHE A CG  
3665 C CD1 . PHE A 282 ? 0.1999 0.2288 0.2865 0.0065  0.0215  0.0162  1152 PHE A CD1 
3666 C CD2 . PHE A 282 ? 0.2396 0.2551 0.3075 0.0045  0.0256  0.0118  1152 PHE A CD2 
3667 C CE1 . PHE A 282 ? 0.3059 0.3346 0.3981 0.0109  0.0251  0.0163  1152 PHE A CE1 
3668 C CE2 . PHE A 282 ? 0.3303 0.3433 0.4018 0.0087  0.0291  0.0121  1152 PHE A CE2 
3669 C CZ  . PHE A 282 ? 0.2367 0.2566 0.3207 0.0124  0.0290  0.0143  1152 PHE A CZ  
3679 N N   . CYS A 283 ? 0.2329 0.2604 0.3049 -0.0023 0.0051  0.0174  1153 CYS A N   
3680 C CA  . CYS A 283 ? 0.1755 0.2042 0.2454 -0.0044 0.0006  0.0178  1153 CYS A CA  
3681 C C   . CYS A 283 ? 0.2160 0.2464 0.2826 -0.0057 0.0027  0.0158  1153 CYS A C   
3682 O O   . CYS A 283 ? 0.2005 0.2322 0.2689 -0.0052 0.0071  0.0151  1153 CYS A O   
3683 C CB  . CYS A 283 ? 0.2070 0.2395 0.2860 -0.0041 -0.0037 0.0209  1153 CYS A CB  
3684 S SG  . CYS A 283 ? 0.2512 0.2806 0.3326 -0.0016 -0.0083 0.0233  1153 CYS A SG  
3690 N N   . SER A 284 ? 0.1969 0.2261 0.2574 -0.0069 -0.0007 0.0148  1154 SER A N   
3691 C CA  . SER A 284 ? 0.2379 0.2668 0.2934 -0.0072 0.0000  0.0130  1154 SER A CA  
3692 C C   . SER A 284 ? 0.2436 0.2711 0.2983 -0.0085 -0.0043 0.0146  1154 SER A C   
3693 O O   . SER A 284 ? 0.2146 0.2410 0.2695 -0.0091 -0.0086 0.0159  1154 SER A O   
3694 C CB  . SER A 284 ? 0.2620 0.2903 0.3094 -0.0067 0.0002  0.0091  1154 SER A CB  
3695 O OG  . SER A 284 ? 0.5235 0.5513 0.5659 -0.0058 0.0004  0.0070  1154 SER A OG  
3701 N N   . VAL A 285 ? 0.1869 0.2127 0.2389 -0.0090 -0.0033 0.0144  1155 VAL A N   
3702 C CA  . VAL A 285 ? 0.1885 0.2105 0.2372 -0.0108 -0.0070 0.0157  1155 VAL A CA  
3703 C C   . VAL A 285 ? 0.2165 0.2331 0.2537 -0.0090 -0.0077 0.0130  1155 VAL A C   
3704 O O   . VAL A 285 ? 0.2230 0.2393 0.2573 -0.0077 -0.0042 0.0114  1155 VAL A O   
3705 C CB  . VAL A 285 ? 0.2832 0.3068 0.3391 -0.0138 -0.0047 0.0185  1155 VAL A CB  
3706 C CG1 . VAL A 285 ? 0.3159 0.3335 0.3662 -0.0168 -0.0082 0.0197  1155 VAL A CG1 
3707 C CG2 . VAL A 285 ? 0.2939 0.3246 0.3630 -0.0145 -0.0048 0.0208  1155 VAL A CG2 
3717 N N   . ASN A 286 ? 0.2210 0.2330 0.2508 -0.0083 -0.0124 0.0122  1156 ASN A N   
3718 C CA  . ASN A 286 ? 0.2008 0.2076 0.2194 -0.0051 -0.0140 0.0091  1156 ASN A CA  
3719 C C   . ASN A 286 ? 0.2741 0.2718 0.2846 -0.0058 -0.0187 0.0102  1156 ASN A C   
3720 O O   . ASN A 286 ? 0.2595 0.2559 0.2701 -0.0069 -0.0222 0.0110  1156 ASN A O   
3721 C CB  . ASN A 286 ? 0.2227 0.2341 0.2396 -0.0018 -0.0146 0.0052  1156 ASN A CB  
3722 C CG  . ASN A 286 ? 0.2645 0.2733 0.2719 0.0028  -0.0167 0.0012  1156 ASN A CG  
3723 O OD1 . ASN A 286 ? 0.2775 0.2784 0.2765 0.0043  -0.0205 0.0012  1156 ASN A OD1 
3724 N ND2 . ASN A 286 ? 0.2473 0.2623 0.2557 0.0050  -0.0147 -0.0024 1156 ASN A ND2 
3731 N N   . ILE A 287 ? 0.2508 0.2402 0.2524 -0.0055 -0.0189 0.0102  1157 ILE A N   
3732 C CA  . ILE A 287 ? 0.2568 0.2346 0.2476 -0.0059 -0.0235 0.0108  1157 ILE A CA  
3733 C C   . ILE A 287 ? 0.2673 0.2384 0.2449 0.0005  -0.0263 0.0071  1157 ILE A C   
3734 O O   . ILE A 287 ? 0.2601 0.2305 0.2340 0.0031  -0.0245 0.0056  1157 ILE A O   
3735 C CB  . ILE A 287 ? 0.3207 0.2913 0.3095 -0.0115 -0.0219 0.0144  1157 ILE A CB  
3736 C CG1 . ILE A 287 ? 0.3506 0.3300 0.3545 -0.0173 -0.0197 0.0177  1157 ILE A CG1 
3737 C CG2 . ILE A 287 ? 0.3042 0.2599 0.2790 -0.0124 -0.0268 0.0149  1157 ILE A CG2 
3738 C CD1 . ILE A 287 ? 0.2988 0.2758 0.3048 -0.0234 -0.0159 0.0206  1157 ILE A CD1 
3750 N N   . ASN A 288 ? 0.2779 0.2441 0.2484 0.0034  -0.0310 0.0052  1158 ASN A N   
3751 C CA  . ASN A 288 ? 0.3007 0.2606 0.2590 0.0107  -0.0343 0.0013  1158 ASN A CA  
3752 C C   . ASN A 288 ? 0.3050 0.2472 0.2483 0.0103  -0.0371 0.0030  1158 ASN A C   
3753 O O   . ASN A 288 ? 0.3181 0.2507 0.2566 0.0061  -0.0393 0.0056  1158 ASN A O   
3754 C CB  . ASN A 288 ? 0.2488 0.2106 0.2053 0.0145  -0.0375 -0.0018 1158 ASN A CB  
3755 C CG  . ASN A 288 ? 0.4077 0.3660 0.3540 0.0234  -0.0408 -0.0068 1158 ASN A CG  
3756 O OD1 . ASN A 288 ? 0.3618 0.3156 0.3016 0.0270  -0.0418 -0.0080 1158 ASN A OD1 
3757 N ND2 . ASN A 288 ? 0.3330 0.2937 0.2777 0.0273  -0.0427 -0.0101 1158 ASN A ND2 
3764 N N   . ILE A 289 ? 0.3105 0.2476 0.2455 0.0144  -0.0373 0.0015  1159 ILE A N   
3765 C CA  . ILE A 289 ? 0.3445 0.2623 0.2622 0.0143  -0.0398 0.0032  1159 ILE A CA  
3766 C C   . ILE A 289 ? 0.3993 0.3046 0.3022 0.0211  -0.0463 0.0003  1159 ILE A C   
3767 O O   . ILE A 289 ? 0.4375 0.3241 0.3254 0.0194  -0.0492 0.0024  1159 ILE A O   
3768 C CB  . ILE A 289 ? 0.3198 0.2343 0.2312 0.0168  -0.0382 0.0025  1159 ILE A CB  
3769 C CG1 . ILE A 289 ? 0.3433 0.2694 0.2684 0.0106  -0.0312 0.0049  1159 ILE A CG1 
3770 C CG2 . ILE A 289 ? 0.3635 0.2550 0.2541 0.0163  -0.0406 0.0046  1159 ILE A CG2 
3771 C CD1 . ILE A 289 ? 0.3411 0.2656 0.2722 0.0010  -0.0275 0.0098  1159 ILE A CD1 
3783 N N   . GLY A 290 ? 0.3790 0.2944 0.2857 0.0289  -0.0483 -0.0046 1160 GLY A N   
3784 C CA  . GLY A 290 ? 0.4352 0.3410 0.3290 0.0373  -0.0541 -0.0083 1160 GLY A CA  
3785 C C   . GLY A 290 ? 0.3935 0.2940 0.2767 0.0465  -0.0576 -0.0118 1160 GLY A C   
3786 O O   . GLY A 290 ? 0.3838 0.2893 0.2703 0.0459  -0.0554 -0.0115 1160 GLY A O   
3790 N N   . PRO A 291 ? 0.4357 0.3251 0.3050 0.0556  -0.0635 -0.0153 1161 PRO A N   
3791 C CA  . PRO A 291 ? 0.4086 0.2882 0.2705 0.0565  -0.0664 -0.0157 1161 PRO A CA  
3792 C C   . PRO A 291 ? 0.4780 0.3757 0.3532 0.0592  -0.0649 -0.0197 1161 PRO A C   
3793 O O   . PRO A 291 ? 0.4581 0.3490 0.3286 0.0582  -0.0662 -0.0194 1161 PRO A O   
3794 C CB  . PRO A 291 ? 0.4654 0.3255 0.3060 0.0670  -0.0733 -0.0185 1161 PRO A CB  
3795 C CG  . PRO A 291 ? 0.4788 0.3490 0.3227 0.0750  -0.0745 -0.0223 1161 PRO A CG  
3796 C CD  . PRO A 291 ? 0.4778 0.3605 0.3354 0.0660  -0.0685 -0.0190 1161 PRO A CD  
3804 N N   . GLY A 292 ? 0.4159 0.3352 0.3063 0.0619  -0.0619 -0.0232 1162 GLY A N   
3805 C CA  . GLY A 292 ? 0.4013 0.3376 0.3032 0.0641  -0.0597 -0.0274 1162 GLY A CA  
3806 C C   . GLY A 292 ? 0.3563 0.3042 0.2727 0.0539  -0.0540 -0.0240 1162 GLY A C   
3807 O O   . GLY A 292 ? 0.3629 0.3080 0.2825 0.0458  -0.0518 -0.0188 1162 GLY A O   
3811 N N   . ASP A 293 ? 0.3500 0.3104 0.2743 0.0547  -0.0515 -0.0271 1163 ASP A N   
3812 C CA  . ASP A 293 ? 0.2938 0.2631 0.2293 0.0460  -0.0468 -0.0241 1163 ASP A CA  
3813 C C   . ASP A 293 ? 0.3269 0.3161 0.2776 0.0444  -0.0418 -0.0263 1163 ASP A C   
3814 O O   . ASP A 293 ? 0.3405 0.3396 0.2943 0.0505  -0.0419 -0.0314 1163 ASP A O   
3815 C CB  . ASP A 293 ? 0.3146 0.2826 0.2467 0.0466  -0.0468 -0.0259 1163 ASP A CB  
3816 C CG  . ASP A 293 ? 0.4890 0.4364 0.4052 0.0474  -0.0518 -0.0240 1163 ASP A CG  
3817 O OD1 . ASP A 293 ? 0.4007 0.3355 0.3117 0.0426  -0.0541 -0.0191 1163 ASP A OD1 
3818 O OD2 . ASP A 293 ? 0.5110 0.4546 0.4196 0.0524  -0.0532 -0.0275 1163 ASP A OD2 
3823 N N   . CYS A 294 ? 0.3323 0.3269 0.2920 0.0363  -0.0378 -0.0226 1164 CYS A N   
3824 C CA  . CYS A 294 ? 0.2555 0.2668 0.2280 0.0336  -0.0327 -0.0244 1164 CYS A CA  
3825 C C   . CYS A 294 ? 0.2829 0.2983 0.2582 0.0298  -0.0296 -0.0244 1164 CYS A C   
3826 O O   . CYS A 294 ? 0.3545 0.3598 0.3242 0.0272  -0.0315 -0.0210 1164 CYS A O   
3827 C CB  . CYS A 294 ? 0.2679 0.2803 0.2472 0.0276  -0.0303 -0.0201 1164 CYS A CB  
3828 S SG  . CYS A 294 ? 0.3393 0.3483 0.3150 0.0314  -0.0324 -0.0207 1164 CYS A SG  
3834 N N   . GLU A 295 ? 0.2627 0.2924 0.2459 0.0292  -0.0251 -0.0282 1165 GLU A N   
3835 C CA  . GLU A 295 ? 0.2818 0.3146 0.2663 0.0247  -0.0214 -0.0280 1165 GLU A CA  
3836 C C   . GLU A 295 ? 0.2984 0.3374 0.2918 0.0178  -0.0170 -0.0255 1165 GLU A C   
3837 O O   . GLU A 295 ? 0.3000 0.3490 0.3006 0.0176  -0.0147 -0.0279 1165 GLU A O   
3838 C CB  . GLU A 295 ? 0.2955 0.3388 0.2804 0.0289  -0.0187 -0.0348 1165 GLU A CB  
3839 C CG  . GLU A 295 ? 0.3671 0.4118 0.3506 0.0242  -0.0142 -0.0349 1165 GLU A CG  
3840 C CD  . GLU A 295 ? 0.3367 0.3906 0.3191 0.0287  -0.0112 -0.0419 1165 GLU A CD  
3841 O OE1 . GLU A 295 ? 0.3671 0.4340 0.3562 0.0336  -0.0106 -0.0475 1165 GLU A OE1 
3842 O OE2 . GLU A 295 ? 0.3411 0.3894 0.3157 0.0278  -0.0096 -0.0420 1165 GLU A OE2 
3849 N N   . TRP A 296 ? 0.2452 0.2774 0.2371 0.0125  -0.0165 -0.0208 1166 TRP A N   
3850 C CA  . TRP A 296 ? 0.2594 0.2941 0.2576 0.0066  -0.0130 -0.0178 1166 TRP A CA  
3851 C C   . TRP A 296 ? 0.2487 0.2853 0.2450 0.0027  -0.0089 -0.0186 1166 TRP A C   
3852 O O   . TRP A 296 ? 0.2630 0.2938 0.2516 0.0030  -0.0099 -0.0187 1166 TRP A O   
3853 C CB  . TRP A 296 ? 0.2085 0.2336 0.2070 0.0039  -0.0162 -0.0113 1166 TRP A CB  
3854 C CG  . TRP A 296 ? 0.2265 0.2498 0.2274 0.0056  -0.0183 -0.0099 1166 TRP A CG  
3855 C CD1 . TRP A 296 ? 0.2941 0.3123 0.2894 0.0098  -0.0221 -0.0109 1166 TRP A CD1 
3856 C CD2 . TRP A 296 ? 0.2144 0.2392 0.2221 0.0032  -0.0165 -0.0071 1166 TRP A CD2 
3857 N NE1 . TRP A 296 ? 0.2789 0.2951 0.2765 0.0095  -0.0225 -0.0087 1166 TRP A NE1 
3858 C CE2 . TRP A 296 ? 0.2422 0.2631 0.2480 0.0056  -0.0189 -0.0065 1166 TRP A CE2 
3859 C CE3 . TRP A 296 ? 0.2441 0.2720 0.2581 -0.0005 -0.0130 -0.0052 1166 TRP A CE3 
3860 C CZ2 . TRP A 296 ? 0.2875 0.3085 0.2978 0.0040  -0.0172 -0.0042 1166 TRP A CZ2 
3861 C CZ3 . TRP A 296 ? 0.1929 0.2210 0.2120 -0.0013 -0.0117 -0.0031 1166 TRP A CZ3 
3862 C CH2 . TRP A 296 ? 0.2307 0.2559 0.2482 0.0008  -0.0135 -0.0027 1166 TRP A CH2 
3873 N N   . PHE A 297 ? 0.2151 0.2583 0.2169 -0.0014 -0.0042 -0.0193 1167 PHE A N   
3874 C CA  . PHE A 297 ? 0.2457 0.2884 0.2444 -0.0065 0.0003  -0.0195 1167 PHE A CA  
3875 C C   . PHE A 297 ? 0.2721 0.3090 0.2729 -0.0109 0.0009  -0.0145 1167 PHE A C   
3876 O O   . PHE A 297 ? 0.2845 0.3252 0.2921 -0.0113 0.0018  -0.0143 1167 PHE A O   
3877 C CB  . PHE A 297 ? 0.1920 0.2481 0.1946 -0.0079 0.0060  -0.0258 1167 PHE A CB  
3878 C CG  . PHE A 297 ? 0.2788 0.3431 0.2815 -0.0022 0.0054  -0.0316 1167 PHE A CG  
3879 C CD1 . PHE A 297 ? 0.3042 0.3694 0.3008 -0.0023 0.0084  -0.0345 1167 PHE A CD1 
3880 C CD2 . PHE A 297 ? 0.2755 0.3457 0.2831 0.0038  0.0019  -0.0341 1167 PHE A CD2 
3881 C CE1 . PHE A 297 ? 0.3565 0.4295 0.3534 0.0040  0.0080  -0.0403 1167 PHE A CE1 
3882 C CE2 . PHE A 297 ? 0.3074 0.3843 0.3144 0.0103  0.0007  -0.0396 1167 PHE A CE2 
3883 C CZ  . PHE A 297 ? 0.4162 0.4951 0.4186 0.0107  0.0038  -0.0428 1167 PHE A CZ  
3893 N N   . VAL A 298 ? 0.2203 0.2471 0.2145 -0.0136 0.0001  -0.0107 1168 VAL A N   
3894 C CA  . VAL A 298 ? 0.2796 0.2992 0.2752 -0.0160 -0.0009 -0.0056 1168 VAL A CA  
3895 C C   . VAL A 298 ? 0.3363 0.3482 0.3236 -0.0206 0.0019  -0.0042 1168 VAL A C   
3896 O O   . VAL A 298 ? 0.3419 0.3485 0.3198 -0.0214 0.0018  -0.0045 1168 VAL A O   
3897 C CB  . VAL A 298 ? 0.3063 0.3190 0.3028 -0.0134 -0.0075 -0.0009 1168 VAL A CB  
3898 C CG1 . VAL A 298 ? 0.2893 0.2937 0.2851 -0.0153 -0.0093 0.0041  1168 VAL A CG1 
3899 C CG2 . VAL A 298 ? 0.2782 0.2962 0.2831 -0.0105 -0.0092 -0.0009 1168 VAL A CG2 
3909 N N   . VAL A 299 ? 0.2748 0.2844 0.2638 -0.0235 0.0045  -0.0027 1169 VAL A N   
3910 C CA  . VAL A 299 ? 0.2804 0.2796 0.2597 -0.0279 0.0070  -0.0008 1169 VAL A CA  
3911 C C   . VAL A 299 ? 0.3526 0.3431 0.3335 -0.0266 0.0035  0.0044  1169 VAL A C   
3912 O O   . VAL A 299 ? 0.2908 0.2861 0.2812 -0.0248 0.0035  0.0047  1169 VAL A O   
3913 C CB  . VAL A 299 ? 0.3001 0.3041 0.2781 -0.0334 0.0146  -0.0050 1169 VAL A CB  
3914 C CG1 . VAL A 299 ? 0.3515 0.3416 0.3184 -0.0384 0.0171  -0.0022 1169 VAL A CG1 
3915 C CG2 . VAL A 299 ? 0.3142 0.3276 0.2906 -0.0346 0.0184  -0.0104 1169 VAL A CG2 
3925 N N   . PRO A 300 ? 0.3063 0.2837 0.2777 -0.0270 0.0003  0.0083  1170 PRO A N   
3926 C CA  . PRO A 300 ? 0.2689 0.2391 0.2431 -0.0243 -0.0039 0.0129  1170 PRO A CA  
3927 C C   . PRO A 300 ? 0.3205 0.2886 0.2961 -0.0260 0.0006  0.0127  1170 PRO A C   
3928 O O   . PRO A 300 ? 0.3194 0.2860 0.2885 -0.0310 0.0066  0.0100  1170 PRO A O   
3929 C CB  . PRO A 300 ? 0.3426 0.2982 0.3033 -0.0247 -0.0080 0.0163  1170 PRO A CB  
3930 C CG  . PRO A 300 ? 0.3533 0.3102 0.3067 -0.0263 -0.0075 0.0139  1170 PRO A CG  
3931 C CD  . PRO A 300 ? 0.2621 0.2308 0.2197 -0.0291 -0.0001 0.0085  1170 PRO A CD  
3939 N N   . GLU A 301 ? 0.2843 0.2522 0.2681 -0.0220 -0.0022 0.0154  1171 GLU A N   
3940 C CA  . GLU A 301 ? 0.2904 0.2554 0.2757 -0.0224 0.0015  0.0152  1171 GLU A CA  
3941 C C   . GLU A 301 ? 0.3315 0.2818 0.3017 -0.0267 0.0046  0.0157  1171 GLU A C   
3942 O O   . GLU A 301 ? 0.3333 0.2822 0.3009 -0.0306 0.0102  0.0133  1171 GLU A O   
3943 C CB  . GLU A 301 ? 0.3046 0.2691 0.2991 -0.0164 -0.0027 0.0186  1171 GLU A CB  
3944 C CG  . GLU A 301 ? 0.3159 0.2774 0.3126 -0.0155 0.0010  0.0182  1171 GLU A CG  
3945 C CD  . GLU A 301 ? 0.3942 0.3386 0.3780 -0.0160 0.0011  0.0203  1171 GLU A CD  
3946 O OE1 . GLU A 301 ? 0.3861 0.3213 0.3630 -0.0141 -0.0041 0.0235  1171 GLU A OE1 
3947 O OE2 . GLU A 301 ? 0.4325 0.3712 0.4118 -0.0182 0.0059  0.0187  1171 GLU A OE2 
3954 N N   . GLY A 302 ? 0.3977 0.3358 0.3567 -0.0265 0.0007  0.0187  1172 GLY A N   
3955 C CA  . GLY A 302 ? 0.4284 0.3488 0.3703 -0.0302 0.0029  0.0201  1172 GLY A CA  
3956 C C   . GLY A 302 ? 0.4396 0.3600 0.3725 -0.0388 0.0109  0.0161  1172 GLY A C   
3957 O O   . GLY A 302 ? 0.4191 0.3251 0.3379 -0.0436 0.0146  0.0165  1172 GLY A O   
3961 N N   . TYR A 303 ? 0.3311 0.2675 0.2720 -0.0407 0.0137  0.0120  1173 TYR A N   
3962 C CA  . TYR A 303 ? 0.3463 0.2869 0.2818 -0.0485 0.0214  0.0074  1173 TYR A CA  
3963 C C   . TYR A 303 ? 0.3410 0.2938 0.2868 -0.0513 0.0264  0.0031  1173 TYR A C   
3964 O O   . TYR A 303 ? 0.3447 0.3058 0.2903 -0.0575 0.0324  -0.0017 1173 TYR A O   
3965 C CB  . TYR A 303 ? 0.3573 0.3081 0.2942 -0.0485 0.0215  0.0049  1173 TYR A CB  
3966 C CG  . TYR A 303 ? 0.3718 0.3086 0.2936 -0.0486 0.0186  0.0080  1173 TYR A CG  
3967 C CD1 . TYR A 303 ? 0.3999 0.3281 0.3060 -0.0557 0.0245  0.0067  1173 TYR A CD1 
3968 C CD2 . TYR A 303 ? 0.3473 0.2793 0.2699 -0.0421 0.0101  0.0121  1173 TYR A CD2 
3969 C CE1 . TYR A 303 ? 0.4554 0.3689 0.3453 -0.0558 0.0219  0.0095  1173 TYR A CE1 
3970 C CE2 . TYR A 303 ? 0.4165 0.3349 0.3242 -0.0421 0.0066  0.0148  1173 TYR A CE2 
3971 C CZ  . TYR A 303 ? 0.4628 0.3712 0.3534 -0.0487 0.0125  0.0136  1173 TYR A CZ  
3972 O OH  . TYR A 303 ? 0.4613 0.3544 0.3349 -0.0487 0.0090  0.0164  1173 TYR A OH  
3982 N N   . TRP A 304 ? 0.3373 0.2915 0.2919 -0.0470 0.0241  0.0043  1174 TRP A N   
3983 C CA  . TRP A 304 ? 0.3441 0.3095 0.3079 -0.0490 0.0279  0.0001  1174 TRP A CA  
3984 C C   . TRP A 304 ? 0.3134 0.2713 0.2677 -0.0576 0.0343  -0.0023 1174 TRP A C   
3985 O O   . TRP A 304 ? 0.3674 0.3366 0.3274 -0.0621 0.0383  -0.0072 1174 TRP A O   
3986 C CB  . TRP A 304 ? 0.3455 0.3129 0.3194 -0.0424 0.0246  0.0018  1174 TRP A CB  
3987 C CG  . TRP A 304 ? 0.3724 0.3245 0.3401 -0.0414 0.0247  0.0047  1174 TRP A CG  
3988 C CD1 . TRP A 304 ? 0.3744 0.3142 0.3382 -0.0361 0.0201  0.0097  1174 TRP A CD1 
3989 C CD2 . TRP A 304 ? 0.3502 0.2975 0.3149 -0.0452 0.0290  0.0025  1174 TRP A CD2 
3990 N NE1 . TRP A 304 ? 0.3943 0.3215 0.3525 -0.0356 0.0216  0.0107  1174 TRP A NE1 
3991 C CE2 . TRP A 304 ? 0.4113 0.3420 0.3692 -0.0414 0.0272  0.0064  1174 TRP A CE2 
3992 C CE3 . TRP A 304 ? 0.3127 0.2681 0.2796 -0.0512 0.0338  -0.0026 1174 TRP A CE3 
3993 C CZ2 . TRP A 304 ? 0.3923 0.3125 0.3442 -0.0435 0.0304  0.0054  1174 TRP A CZ2 
3994 C CZ3 . TRP A 304 ? 0.4207 0.3661 0.3819 -0.0541 0.0367  -0.0036 1174 TRP A CZ3 
3995 C CH2 . TRP A 304 ? 0.3781 0.3054 0.3313 -0.0503 0.0352  0.0004  1174 TRP A CH2 
4006 N N   . GLY A 305 ? 0.4109 0.3491 0.3500 -0.0601 0.0347  0.0012  1175 GLY A N   
4007 C CA  . GLY A 305 ? 0.4359 0.3636 0.3628 -0.0695 0.0410  -0.0007 1175 GLY A CA  
4008 C C   . GLY A 305 ? 0.4324 0.3697 0.3571 -0.0781 0.0470  -0.0052 1175 GLY A C   
4009 O O   . GLY A 305 ? 0.4419 0.3851 0.3675 -0.0862 0.0528  -0.0098 1175 GLY A O   
4013 N N   . VAL A 306 ? 0.4659 0.4053 0.3882 -0.0762 0.0455  -0.0042 1176 VAL A N   
4014 C CA  . VAL A 306 ? 0.3985 0.3483 0.3194 -0.0831 0.0515  -0.0088 1176 VAL A CA  
4015 C C   . VAL A 306 ? 0.4753 0.4508 0.4148 -0.0828 0.0532  -0.0151 1176 VAL A C   
4016 O O   . VAL A 306 ? 0.4019 0.3881 0.3435 -0.0908 0.0598  -0.0205 1176 VAL A O   
4017 C CB  . VAL A 306 ? 0.3994 0.3463 0.3140 -0.0796 0.0489  -0.0066 1176 VAL A CB  
4018 C CG1 . VAL A 306 ? 0.4740 0.4339 0.3889 -0.0857 0.0558  -0.0121 1176 VAL A CG1 
4019 C CG2 . VAL A 306 ? 0.4128 0.3334 0.3072 -0.0801 0.0468  -0.0006 1176 VAL A CG2 
4029 N N   . LEU A 307 ? 0.4327 0.4180 0.3854 -0.0737 0.0472  -0.0145 1177 LEU A N   
4030 C CA  . LEU A 307 ? 0.3481 0.3555 0.3168 -0.0719 0.0474  -0.0200 1177 LEU A CA  
4031 C C   . LEU A 307 ? 0.3610 0.3718 0.3338 -0.0771 0.0503  -0.0233 1177 LEU A C   
4032 O O   . LEU A 307 ? 0.3540 0.3819 0.3359 -0.0805 0.0531  -0.0294 1177 LEU A O   
4033 C CB  . LEU A 307 ? 0.3425 0.3557 0.3212 -0.0614 0.0402  -0.0180 1177 LEU A CB  
4034 C CG  . LEU A 307 ? 0.3933 0.4135 0.3738 -0.0568 0.0378  -0.0185 1177 LEU A CG  
4035 C CD1 . LEU A 307 ? 0.3967 0.4018 0.3628 -0.0586 0.0381  -0.0147 1177 LEU A CD1 
4036 C CD2 . LEU A 307 ? 0.5146 0.5386 0.5036 -0.0477 0.0309  -0.0164 1177 LEU A CD2 
4048 N N   . ASN A 308 ? 0.3310 0.3253 0.2966 -0.0775 0.0494  -0.0194 1178 ASN A N   
4049 C CA  . ASN A 308 ? 0.3695 0.3634 0.3361 -0.0828 0.0522  -0.0223 1178 ASN A CA  
4050 C C   . ASN A 308 ? 0.3441 0.3400 0.3049 -0.0951 0.0595  -0.0268 1178 ASN A C   
4051 O O   . ASN A 308 ? 0.4921 0.5001 0.4599 -0.1007 0.0622  -0.0323 1178 ASN A O   
4052 C CB  . ASN A 308 ? 0.4057 0.3783 0.3628 -0.0807 0.0503  -0.0172 1178 ASN A CB  
4053 C CG  . ASN A 308 ? 0.5263 0.4945 0.4806 -0.0872 0.0536  -0.0202 1178 ASN A CG  
4054 O OD1 . ASN A 308 ? 0.4577 0.4358 0.4218 -0.0846 0.0521  -0.0229 1178 ASN A OD1 
4055 N ND2 . ASN A 308 ? 0.5386 0.4904 0.4779 -0.0960 0.0582  -0.0197 1178 ASN A ND2 
4062 N N   A ASP A 309 ? 0.3868 0.3707 0.3343 -0.0998 0.0628  -0.0245 1179 ASP A N   
4063 N N   B ASP A 309 ? 0.5370 0.5208 0.4845 -0.0996 0.0627  -0.0244 1179 ASP A N   
4064 C CA  A ASP A 309 ? 0.5194 0.5035 0.4596 -0.1126 0.0709  -0.0284 1179 ASP A CA  
4065 C CA  B ASP A 309 ? 0.5937 0.5771 0.5333 -0.1122 0.0707  -0.0280 1179 ASP A CA  
4066 C C   A ASP A 309 ? 0.4293 0.4406 0.3838 -0.1150 0.0742  -0.0354 1179 ASP A C   
4067 C C   B ASP A 309 ? 0.5711 0.5819 0.5253 -0.1148 0.0741  -0.0352 1179 ASP A C   
4068 O O   A ASP A 309 ? 0.4870 0.5096 0.4459 -0.1245 0.0797  -0.0413 1179 ASP A O   
4069 O O   B ASP A 309 ? 0.6346 0.6563 0.5931 -0.1244 0.0795  -0.0410 1179 ASP A O   
4070 C CB  A ASP A 309 ? 0.5105 0.4728 0.4304 -0.1167 0.0737  -0.0238 1179 ASP A CB  
4071 C CB  B ASP A 309 ? 0.6477 0.6107 0.5682 -0.1150 0.0728  -0.0233 1179 ASP A CB  
4072 C CG  A ASP A 309 ? 0.6719 0.6061 0.5759 -0.1158 0.0712  -0.0178 1179 ASP A CG  
4073 C CG  B ASP A 309 ? 0.7469 0.7064 0.6564 -0.1291 0.0822  -0.0266 1179 ASP A CG  
4074 O OD1 A ASP A 309 ? 0.6027 0.5346 0.5107 -0.1142 0.0692  -0.0181 1179 ASP A OD1 
4075 O OD1 B ASP A 309 ? 0.7967 0.7393 0.6938 -0.1373 0.0854  -0.0257 1179 ASP A OD1 
4076 O OD2 A ASP A 309 ? 0.7479 0.6616 0.6344 -0.1163 0.0711  -0.0131 1179 ASP A OD2 
4077 O OD2 B ASP A 309 ? 0.7717 0.7450 0.6845 -0.1323 0.0867  -0.0302 1179 ASP A OD2 
4086 N N   . PHE A 310 ? 0.4267 0.4486 0.3887 -0.1061 0.0705  -0.0351 1180 PHE A N   
4087 C CA  . PHE A 310 ? 0.3704 0.4183 0.3467 -0.1058 0.0726  -0.0420 1180 PHE A CA  
4088 C C   . PHE A 310 ? 0.5943 0.6601 0.5863 -0.1053 0.0706  -0.0473 1180 PHE A C   
4089 O O   . PHE A 310 ? 0.5122 0.5970 0.5136 -0.1115 0.0749  -0.0544 1180 PHE A O   
4090 C CB  . PHE A 310 ? 0.4033 0.4566 0.3839 -0.0947 0.0675  -0.0404 1180 PHE A CB  
4091 C CG  . PHE A 310 ? 0.5532 0.6010 0.5230 -0.0969 0.0715  -0.0395 1180 PHE A CG  
4092 C CD1 . PHE A 310 ? 0.5659 0.6261 0.5367 -0.1051 0.0799  -0.0455 1180 PHE A CD1 
4093 C CD2 . PHE A 310 ? 0.3739 0.4047 0.3328 -0.0908 0.0669  -0.0331 1180 PHE A CD2 
4094 C CE1 . PHE A 310 ? 0.5604 0.6147 0.5199 -0.1072 0.0843  -0.0449 1180 PHE A CE1 
4095 C CE2 . PHE A 310 ? 0.3631 0.3874 0.3102 -0.0927 0.0703  -0.0324 1180 PHE A CE2 
4096 C CZ  . PHE A 310 ? 0.4913 0.5266 0.4380 -0.1009 0.0793  -0.0382 1180 PHE A CZ  
4107 N N   . CYS A 311 ? 0.5133 0.5735 0.5082 -0.0980 0.0642  -0.0442 1181 CYS A N   
4108 C CA  . CYS A 311 ? 0.3420 0.4166 0.3495 -0.0967 0.0614  -0.0488 1181 CYS A CA  
4109 C C   . CYS A 311 ? 0.4357 0.5116 0.4416 -0.1092 0.0669  -0.0532 1181 CYS A C   
4110 O O   . CYS A 311 ? 0.4443 0.5411 0.4621 -0.1130 0.0682  -0.0603 1181 CYS A O   
4111 C CB  . CYS A 311 ? 0.3237 0.3876 0.3308 -0.0880 0.0549  -0.0440 1181 CYS A CB  
4112 S SG  . CYS A 311 ? 0.3787 0.4488 0.3931 -0.0739 0.0477  -0.0413 1181 CYS A SG  
4118 N N   . GLU A 312 ? 0.4852 0.5386 0.4760 -0.1157 0.0698  -0.0490 1182 GLU A N   
4119 C CA  . GLU A 312 ? 0.7434 0.7935 0.7295 -0.1286 0.0751  -0.0526 1182 GLU A CA  
4120 C C   . GLU A 312 ? 0.7203 0.7870 0.7108 -0.1396 0.0825  -0.0590 1182 GLU A C   
4121 O O   . GLU A 312 ? 0.6590 0.7392 0.6572 -0.1482 0.0850  -0.0654 1182 GLU A O   
4122 C CB  . GLU A 312 ? 0.7237 0.7430 0.6894 -0.1328 0.0771  -0.0464 1182 GLU A CB  
4123 C CG  . GLU A 312 ? 0.9661 0.9704 0.9284 -0.1247 0.0713  -0.0420 1182 GLU A CG  
4124 C CD  . GLU A 312 ? 1.0703 1.0846 1.0415 -0.1265 0.0695  -0.0470 1182 GLU A CD  
4125 O OE1 . GLU A 312 ? 0.8586 0.8698 0.8328 -0.1174 0.0642  -0.0449 1182 GLU A OE1 
4126 O OE2 . GLU A 312 ? 1.1630 1.1885 1.1378 -0.1374 0.0736  -0.0532 1182 GLU A OE2 
4133 N N   . LYS A 313 ? 0.5383 0.6044 0.5242 -0.1395 0.0860  -0.0575 1183 LYS A N   
4134 C CA  . LYS A 313 ? 0.7224 0.8040 0.7118 -0.1498 0.0943  -0.0635 1183 LYS A CA  
4135 C C   . LYS A 313 ? 0.7403 0.8557 0.7528 -0.1463 0.0927  -0.0717 1183 LYS A C   
4136 O O   . LYS A 313 ? 0.6926 0.8268 0.7136 -0.1560 0.0990  -0.0789 1183 LYS A O   
4137 C CB  . LYS A 313 ? 0.7207 0.7923 0.6982 -0.1489 0.0980  -0.0598 1183 LYS A CB  
4138 C CG  . LYS A 313 ? 1.0365 1.0756 0.9893 -0.1556 0.1013  -0.0531 1183 LYS A CG  
4139 C CD  . LYS A 313 ? 1.2020 1.2305 1.1420 -0.1539 0.1039  -0.0494 1183 LYS A CD  
4140 C CE  . LYS A 313 ? 1.2716 1.2721 1.1865 -0.1652 0.1102  -0.0454 1183 LYS A CE  
4141 N NZ  . LYS A 313 ? 1.1351 1.1082 1.0362 -0.1637 0.1054  -0.0391 1183 LYS A NZ  
4155 N N   . ASN A 314 ? 0.5113 0.6342 0.5336 -0.1325 0.0842  -0.0709 1184 ASN A N   
4156 C CA  . ASN A 314 ? 0.4213 0.5736 0.4640 -0.1270 0.0809  -0.0782 1184 ASN A CA  
4157 C C   . ASN A 314 ? 0.5023 0.6603 0.5528 -0.1269 0.0755  -0.0810 1184 ASN A C   
4158 O O   . ASN A 314 ? 0.4925 0.6696 0.5574 -0.1192 0.0697  -0.0855 1184 ASN A O   
4159 C CB  . ASN A 314 ? 0.4613 0.6177 0.5083 -0.1120 0.0748  -0.0761 1184 ASN A CB  
4160 C CG  . ASN A 314 ? 0.5768 0.7362 0.6204 -0.1119 0.0802  -0.0764 1184 ASN A CG  
4161 O OD1 . ASN A 314 ? 0.4853 0.6677 0.5406 -0.1130 0.0838  -0.0836 1184 ASN A OD1 
4162 N ND2 . ASN A 314 ? 0.4643 0.6006 0.4919 -0.1101 0.0804  -0.0689 1184 ASN A ND2 
4169 N N   . ASN A 315 ? 0.4804 0.6201 0.5199 -0.1353 0.0772  -0.0784 1185 ASN A N   
4170 C CA  . ASN A 315 ? 0.5614 0.7025 0.6048 -0.1367 0.0728  -0.0809 1185 ASN A CA  
4171 C C   . ASN A 315 ? 0.6288 0.7692 0.6765 -0.1221 0.0636  -0.0783 1185 ASN A C   
4172 O O   . ASN A 315 ? 0.5082 0.6631 0.5665 -0.1191 0.0585  -0.0831 1185 ASN A O   
4173 C CB  . ASN A 315 ? 0.7332 0.9017 0.7923 -0.1450 0.0746  -0.0908 1185 ASN A CB  
4174 C CG  . ASN A 315 ? 0.9287 1.0949 0.9881 -0.1504 0.0714  -0.0936 1185 ASN A CG  
4175 O OD1 . ASN A 315 ? 0.9774 1.1248 1.0237 -0.1610 0.0754  -0.0917 1185 ASN A OD1 
4176 N ND2 . ASN A 315 ? 0.7590 0.9430 0.8319 -0.1432 0.0639  -0.0983 1185 ASN A ND2 
4183 N N   . LEU A 316 ? 0.4667 0.5896 0.5054 -0.1134 0.0614  -0.0707 1186 LEU A N   
4184 C CA  . LEU A 316 ? 0.4105 0.5304 0.4515 -0.1004 0.0537  -0.0673 1186 LEU A CA  
4185 C C   . LEU A 316 ? 0.4746 0.5679 0.5018 -0.0984 0.0529  -0.0597 1186 LEU A C   
4186 O O   . LEU A 316 ? 0.4772 0.5537 0.4927 -0.1033 0.0571  -0.0555 1186 LEU A O   
4187 C CB  . LEU A 316 ? 0.3318 0.4597 0.3778 -0.0903 0.0511  -0.0660 1186 LEU A CB  
4188 C CG  . LEU A 316 ? 0.4202 0.5753 0.4811 -0.0881 0.0502  -0.0738 1186 LEU A CG  
4189 C CD1 . LEU A 316 ? 0.3846 0.5432 0.4460 -0.0815 0.0506  -0.0724 1186 LEU A CD1 
4190 C CD2 . LEU A 316 ? 0.4847 0.6503 0.5545 -0.0803 0.0425  -0.0770 1186 LEU A CD2 
4202 N N   . ASN A 317 ? 0.3534 0.4428 0.3818 -0.0909 0.0475  -0.0580 1187 ASN A N   
4203 C CA  . ASN A 317 ? 0.4252 0.4919 0.4428 -0.0874 0.0467  -0.0513 1187 ASN A CA  
4204 C C   . ASN A 317 ? 0.3772 0.4392 0.3948 -0.0771 0.0435  -0.0454 1187 ASN A C   
4205 O O   . ASN A 317 ? 0.3947 0.4678 0.4202 -0.0693 0.0392  -0.0463 1187 ASN A O   
4206 C CB  . ASN A 317 ? 0.4789 0.5425 0.4965 -0.0852 0.0435  -0.0526 1187 ASN A CB  
4207 C CG  . ASN A 317 ? 0.5158 0.5562 0.5219 -0.0831 0.0442  -0.0467 1187 ASN A CG  
4208 O OD1 . ASN A 317 ? 0.4148 0.4496 0.4211 -0.0739 0.0413  -0.0423 1187 ASN A OD1 
4209 N ND2 . ASN A 317 ? 0.5282 0.5548 0.5242 -0.0917 0.0483  -0.0469 1187 ASN A ND2 
4216 N N   . PHE A 318 ? 0.3263 0.3711 0.3342 -0.0772 0.0453  -0.0396 1188 PHE A N   
4217 C CA  . PHE A 318 ? 0.3473 0.3874 0.3550 -0.0687 0.0422  -0.0341 1188 PHE A CA  
4218 C C   . PHE A 318 ? 0.3889 0.4279 0.4008 -0.0596 0.0375  -0.0316 1188 PHE A C   
4219 O O   . PHE A 318 ? 0.3529 0.4000 0.3710 -0.0528 0.0339  -0.0310 1188 PHE A O   
4220 C CB  . PHE A 318 ? 0.3640 0.3845 0.3597 -0.0705 0.0442  -0.0285 1188 PHE A CB  
4221 C CG  . PHE A 318 ? 0.3792 0.3946 0.3749 -0.0622 0.0402  -0.0229 1188 PHE A CG  
4222 C CD1 . PHE A 318 ? 0.3104 0.3326 0.3077 -0.0608 0.0394  -0.0229 1188 PHE A CD1 
4223 C CD2 . PHE A 318 ? 0.3597 0.3640 0.3542 -0.0560 0.0374  -0.0181 1188 PHE A CD2 
4224 C CE1 . PHE A 318 ? 0.3612 0.3784 0.3580 -0.0538 0.0352  -0.0180 1188 PHE A CE1 
4225 C CE2 . PHE A 318 ? 0.3871 0.3884 0.3830 -0.0491 0.0334  -0.0133 1188 PHE A CE2 
4226 C CZ  . PHE A 318 ? 0.3296 0.3368 0.3263 -0.0483 0.0320  -0.0132 1188 PHE A CZ  
4236 N N   . LEU A 319 ? 0.3120 0.3399 0.3195 -0.0597 0.0380  -0.0303 1189 LEU A N   
4237 C CA  . LEU A 319 ? 0.3802 0.4049 0.3903 -0.0516 0.0349  -0.0275 1189 LEU A CA  
4238 C C   . LEU A 319 ? 0.4341 0.4718 0.4511 -0.0485 0.0320  -0.0316 1189 LEU A C   
4239 O O   . LEU A 319 ? 0.4014 0.4410 0.4218 -0.0414 0.0289  -0.0295 1189 LEU A O   
4240 C CB  . LEU A 319 ? 0.3355 0.3440 0.3380 -0.0523 0.0369  -0.0254 1189 LEU A CB  
4241 C CG  . LEU A 319 ? 0.3574 0.3495 0.3514 -0.0531 0.0387  -0.0207 1189 LEU A CG  
4242 C CD1 . LEU A 319 ? 0.3978 0.3740 0.3836 -0.0537 0.0408  -0.0199 1189 LEU A CD1 
4243 C CD2 . LEU A 319 ? 0.3317 0.3228 0.3294 -0.0455 0.0355  -0.0154 1189 LEU A CD2 
4255 N N   . MET A 320 ? 0.3550 0.4009 0.3733 -0.0541 0.0327  -0.0375 1190 MET A N   
4256 C CA  . MET A 320 ? 0.5053 0.5610 0.5280 -0.0512 0.0293  -0.0416 1190 MET A CA  
4257 C C   . MET A 320 ? 0.4058 0.4808 0.4368 -0.0521 0.0271  -0.0474 1190 MET A C   
4258 O O   . MET A 320 ? 0.4406 0.5248 0.4754 -0.0484 0.0229  -0.0510 1190 MET A O   
4259 C CB  . MET A 320 ? 0.4805 0.5295 0.4978 -0.0560 0.0307  -0.0444 1190 MET A CB  
4260 C CG  . MET A 320 ? 0.5532 0.5836 0.5625 -0.0536 0.0327  -0.0396 1190 MET A CG  
4261 S SD  . MET A 320 ? 0.7839 0.8120 0.7948 -0.0428 0.0299  -0.0356 1190 MET A SD  
4262 C CE  . MET A 320 ? 0.7010 0.7371 0.7117 -0.0424 0.0263  -0.0415 1190 MET A CE  
4272 N N   . GLY A 321 ? 0.3141 0.3950 0.3473 -0.0565 0.0298  -0.0485 1191 GLY A N   
4273 C CA  . GLY A 321 ? 0.3541 0.4547 0.3961 -0.0577 0.0288  -0.0547 1191 GLY A CA  
4274 C C   . GLY A 321 ? 0.4297 0.5376 0.4762 -0.0487 0.0249  -0.0537 1191 GLY A C   
4275 O O   . GLY A 321 ? 0.3504 0.4476 0.3930 -0.0429 0.0235  -0.0479 1191 GLY A O   
4279 N N   . SER A 322 ? 0.3263 0.4525 0.3813 -0.0474 0.0232  -0.0598 1192 SER A N   
4280 C CA  . SER A 322 ? 0.3450 0.4781 0.4034 -0.0385 0.0192  -0.0600 1192 SER A CA  
4281 C C   . SER A 322 ? 0.4285 0.5711 0.4905 -0.0413 0.0232  -0.0624 1192 SER A C   
4282 O O   . SER A 322 ? 0.3138 0.4736 0.3839 -0.0451 0.0248  -0.0692 1192 SER A O   
4283 C CB  . SER A 322 ? 0.3570 0.5031 0.4215 -0.0326 0.0131  -0.0655 1192 SER A CB  
4284 O OG  . SER A 322 ? 0.3717 0.5220 0.4376 -0.0233 0.0089  -0.0657 1192 SER A OG  
4290 N N   . TRP A 323 ? 0.2725 0.4044 0.3285 -0.0398 0.0247  -0.0570 1193 TRP A N   
4291 C CA  . TRP A 323 ? 0.3022 0.4395 0.3585 -0.0432 0.0293  -0.0586 1193 TRP A CA  
4292 C C   . TRP A 323 ? 0.3083 0.4406 0.3609 -0.0356 0.0268  -0.0553 1193 TRP A C   
4293 O O   . TRP A 323 ? 0.2565 0.3749 0.3035 -0.0311 0.0234  -0.0493 1193 TRP A O   
4294 C CB  . TRP A 323 ? 0.3260 0.4517 0.3747 -0.0533 0.0357  -0.0556 1193 TRP A CB  
4295 C CG  . TRP A 323 ? 0.3575 0.4625 0.3973 -0.0527 0.0345  -0.0482 1193 TRP A CG  
4296 C CD1 . TRP A 323 ? 0.3433 0.4409 0.3812 -0.0548 0.0340  -0.0470 1193 TRP A CD1 
4297 C CD2 . TRP A 323 ? 0.3316 0.4214 0.3636 -0.0496 0.0336  -0.0414 1193 TRP A CD2 
4298 N NE1 . TRP A 323 ? 0.3016 0.3812 0.3320 -0.0526 0.0333  -0.0401 1193 TRP A NE1 
4299 C CE2 . TRP A 323 ? 0.3022 0.3774 0.3295 -0.0495 0.0327  -0.0365 1193 TRP A CE2 
4300 C CE3 . TRP A 323 ? 0.3099 0.3970 0.3383 -0.0468 0.0333  -0.0392 1193 TRP A CE3 
4301 C CZ2 . TRP A 323 ? 0.2465 0.3066 0.2674 -0.0465 0.0311  -0.0298 1193 TRP A CZ2 
4302 C CZ3 . TRP A 323 ? 0.3687 0.4396 0.3897 -0.0444 0.0313  -0.0323 1193 TRP A CZ3 
4303 C CH2 . TRP A 323 ? 0.2973 0.3559 0.3155 -0.0442 0.0301  -0.0278 1193 TRP A CH2 
4314 N N   . TRP A 324 ? 0.2689 0.4132 0.3251 -0.0345 0.0287  -0.0598 1194 TRP A N   
4315 C CA  . TRP A 324 ? 0.2777 0.4177 0.3296 -0.0281 0.0270  -0.0578 1194 TRP A CA  
4316 C C   . TRP A 324 ? 0.3362 0.4754 0.3833 -0.0345 0.0338  -0.0582 1194 TRP A C   
4317 O O   . TRP A 324 ? 0.3690 0.5242 0.4223 -0.0374 0.0383  -0.0647 1194 TRP A O   
4318 C CB  . TRP A 324 ? 0.2149 0.3697 0.2739 -0.0191 0.0227  -0.0636 1194 TRP A CB  
4319 C CG  . TRP A 324 ? 0.2907 0.4393 0.3439 -0.0116 0.0201  -0.0618 1194 TRP A CG  
4320 C CD1 . TRP A 324 ? 0.2900 0.4437 0.3418 -0.0110 0.0237  -0.0648 1194 TRP A CD1 
4321 C CD2 . TRP A 324 ? 0.2977 0.4331 0.3447 -0.0041 0.0135  -0.0570 1194 TRP A CD2 
4322 N NE1 . TRP A 324 ? 0.2840 0.4276 0.3286 -0.0031 0.0192  -0.0621 1194 TRP A NE1 
4323 C CE2 . TRP A 324 ? 0.2170 0.3493 0.2587 0.0008  0.0129  -0.0573 1194 TRP A CE2 
4324 C CE3 . TRP A 324 ? 0.3081 0.4335 0.3529 -0.0015 0.0086  -0.0526 1194 TRP A CE3 
4325 C CZ2 . TRP A 324 ? 0.3651 0.4843 0.3994 0.0076  0.0070  -0.0532 1194 TRP A CZ2 
4326 C CZ3 . TRP A 324 ? 0.3027 0.4162 0.3409 0.0049  0.0035  -0.0487 1194 TRP A CZ3 
4327 C CH2 . TRP A 324 ? 0.3295 0.4397 0.3624 0.0091  0.0025  -0.0489 1194 TRP A CH2 
4338 N N   . PRO A 325 ? 0.2810 0.4019 0.3171 -0.0367 0.0346  -0.0515 1195 PRO A N   
4339 C CA  . PRO A 325 ? 0.2884 0.4045 0.3167 -0.0438 0.0412  -0.0511 1195 PRO A CA  
4340 C C   . PRO A 325 ? 0.2868 0.4144 0.3164 -0.0415 0.0442  -0.0563 1195 PRO A C   
4341 O O   . PRO A 325 ? 0.3664 0.4972 0.3977 -0.0324 0.0396  -0.0574 1195 PRO A O   
4342 C CB  . PRO A 325 ? 0.3289 0.4230 0.3452 -0.0426 0.0383  -0.0428 1195 PRO A CB  
4343 C CG  . PRO A 325 ? 0.3870 0.4756 0.4068 -0.0391 0.0328  -0.0391 1195 PRO A CG  
4344 C CD  . PRO A 325 ? 0.3513 0.4551 0.3815 -0.0329 0.0294  -0.0440 1195 PRO A CD  
4352 N N   . ASN A 326 ? 0.3964 0.5295 0.4243 -0.0500 0.0524  -0.0597 1196 ASN A N   
4353 C CA  . ASN A 326 ? 0.3628 0.5046 0.3896 -0.0489 0.0570  -0.0642 1196 ASN A CA  
4354 C C   . ASN A 326 ? 0.3270 0.4476 0.3369 -0.0490 0.0571  -0.0581 1196 ASN A C   
4355 O O   . ASN A 326 ? 0.3214 0.4276 0.3202 -0.0571 0.0609  -0.0540 1196 ASN A O   
4356 C CB  . ASN A 326 ? 0.4539 0.6108 0.4858 -0.0592 0.0667  -0.0706 1196 ASN A CB  
4357 C CG  . ASN A 326 ? 0.5572 0.7269 0.5904 -0.0577 0.0725  -0.0766 1196 ASN A CG  
4358 O OD1 . ASN A 326 ? 0.4131 0.5730 0.4369 -0.0516 0.0709  -0.0744 1196 ASN A OD1 
4359 N ND2 . ASN A 326 ? 0.4486 0.6408 0.4937 -0.0633 0.0794  -0.0847 1196 ASN A ND2 
4366 N N   . LEU A 327 ? 0.3752 0.4927 0.3820 -0.0398 0.0524  -0.0574 1197 LEU A N   
4367 C CA  . LEU A 327 ? 0.3580 0.4548 0.3487 -0.0390 0.0507  -0.0515 1197 LEU A CA  
4368 C C   . LEU A 327 ? 0.4124 0.5045 0.3915 -0.0470 0.0594  -0.0526 1197 LEU A C   
4369 O O   . LEU A 327 ? 0.4059 0.4780 0.3697 -0.0501 0.0589  -0.0468 1197 LEU A O   
4370 C CB  . LEU A 327 ? 0.3658 0.4614 0.3551 -0.0284 0.0446  -0.0520 1197 LEU A CB  
4371 C CG  . LEU A 327 ? 0.3397 0.4325 0.3348 -0.0207 0.0352  -0.0490 1197 LEU A CG  
4372 C CD1 . LEU A 327 ? 0.4581 0.5423 0.4459 -0.0124 0.0295  -0.0478 1197 LEU A CD1 
4373 C CD2 . LEU A 327 ? 0.2967 0.3758 0.2892 -0.0246 0.0319  -0.0417 1197 LEU A CD2 
4385 N N   . GLU A 328 ? 0.4407 0.5514 0.4270 -0.0504 0.0674  -0.0602 1198 GLU A N   
4386 C CA  . GLU A 328 ? 0.5853 0.6927 0.5605 -0.0591 0.0774  -0.0619 1198 GLU A CA  
4387 C C   . GLU A 328 ? 0.4558 0.5504 0.4227 -0.0709 0.0814  -0.0577 1198 GLU A C   
4388 O O   . GLU A 328 ? 0.4530 0.5301 0.4020 -0.0771 0.0857  -0.0543 1198 GLU A O   
4389 C CB  . GLU A 328 ? 0.5873 0.7209 0.5749 -0.0602 0.0856  -0.0718 1198 GLU A CB  
4390 C CG  . GLU A 328 ? 0.8205 0.9620 0.8100 -0.0489 0.0836  -0.0762 1198 GLU A CG  
4391 C CD  . GLU A 328 ? 0.9507 1.1220 0.9573 -0.0474 0.0898  -0.0867 1198 GLU A CD  
4392 O OE1 . GLU A 328 ? 0.8498 1.0347 0.8635 -0.0576 0.0983  -0.0908 1198 GLU A OE1 
4393 O OE2 . GLU A 328 ? 0.9234 1.1045 0.9361 -0.0358 0.0861  -0.0910 1198 GLU A OE2 
4400 N N   . ASP A 329 ? 0.4929 0.5942 0.4708 -0.0737 0.0798  -0.0579 1199 ASP A N   
4401 C CA  . ASP A 329 ? 0.4420 0.5291 0.4115 -0.0838 0.0825  -0.0537 1199 ASP A CA  
4402 C C   . ASP A 329 ? 0.4457 0.5055 0.3998 -0.0811 0.0758  -0.0445 1199 ASP A C   
4403 O O   . ASP A 329 ? 0.3945 0.4355 0.3323 -0.0885 0.0792  -0.0404 1199 ASP A O   
4404 C CB  . ASP A 329 ? 0.4026 0.5017 0.3870 -0.0857 0.0808  -0.0560 1199 ASP A CB  
4405 C CG  . ASP A 329 ? 0.5549 0.6798 0.5535 -0.0917 0.0882  -0.0652 1199 ASP A CG  
4406 O OD1 . ASP A 329 ? 0.5120 0.6427 0.5067 -0.0978 0.0970  -0.0691 1199 ASP A OD1 
4407 O OD2 . ASP A 329 ? 0.4708 0.6107 0.4845 -0.0904 0.0851  -0.0686 1199 ASP A OD2 
4412 N N   . LEU A 330 ? 0.3946 0.4521 0.3535 -0.0708 0.0663  -0.0412 1200 LEU A N   
4413 C CA  . LEU A 330 ? 0.3427 0.3777 0.2903 -0.0677 0.0593  -0.0330 1200 LEU A CA  
4414 C C   . LEU A 330 ? 0.3854 0.4043 0.3146 -0.0685 0.0602  -0.0302 1200 LEU A C   
4415 O O   . LEU A 330 ? 0.4171 0.4153 0.3313 -0.0720 0.0592  -0.0246 1200 LEU A O   
4416 C CB  . LEU A 330 ? 0.3156 0.3535 0.2731 -0.0572 0.0496  -0.0308 1200 LEU A CB  
4417 C CG  . LEU A 330 ? 0.3354 0.3853 0.3083 -0.0557 0.0476  -0.0325 1200 LEU A CG  
4418 C CD1 . LEU A 330 ? 0.3001 0.3484 0.2791 -0.0464 0.0385  -0.0292 1200 LEU A CD1 
4419 C CD2 . LEU A 330 ? 0.3557 0.3964 0.3250 -0.0630 0.0501  -0.0299 1200 LEU A CD2 
4431 N N   . TYR A 331 ? 0.3870 0.4145 0.3164 -0.0648 0.0619  -0.0343 1201 TYR A N   
4432 C CA  . TYR A 331 ? 0.3752 0.3876 0.2863 -0.0651 0.0629  -0.0324 1201 TYR A CA  
4433 C C   . TYR A 331 ? 0.4739 0.4746 0.3689 -0.0762 0.0718  -0.0319 1201 TYR A C   
4434 O O   . TYR A 331 ? 0.5048 0.4832 0.3802 -0.0781 0.0702  -0.0267 1201 TYR A O   
4435 C CB  . TYR A 331 ? 0.5031 0.5289 0.4179 -0.0596 0.0650  -0.0384 1201 TYR A CB  
4436 C CG  . TYR A 331 ? 0.5947 0.6048 0.4895 -0.0594 0.0661  -0.0371 1201 TYR A CG  
4437 C CD1 . TYR A 331 ? 0.5976 0.5930 0.4843 -0.0524 0.0565  -0.0323 1201 TYR A CD1 
4438 C CD2 . TYR A 331 ? 0.5852 0.5953 0.4691 -0.0666 0.0769  -0.0408 1201 TYR A CD2 
4439 C CE1 . TYR A 331 ? 0.6616 0.6417 0.5289 -0.0522 0.0568  -0.0312 1201 TYR A CE1 
4440 C CE2 . TYR A 331 ? 0.5918 0.5861 0.4556 -0.0663 0.0781  -0.0397 1201 TYR A CE2 
4441 C CZ  . TYR A 331 ? 0.6671 0.6460 0.5223 -0.0589 0.0676  -0.0349 1201 TYR A CZ  
4442 O OH  . TYR A 331 ? 0.7818 0.7441 0.6159 -0.0586 0.0681  -0.0339 1201 TYR A OH  
4452 N N   . GLU A 332 ? 0.5365 0.5517 0.4389 -0.0840 0.0810  -0.0373 1202 GLU A N   
4453 C CA  . GLU A 332 ? 0.7289 0.7332 0.6153 -0.0960 0.0908  -0.0373 1202 GLU A CA  
4454 C C   . GLU A 332 ? 0.5913 0.5739 0.4665 -0.1011 0.0880  -0.0305 1202 GLU A C   
4455 O O   . GLU A 332 ? 0.5846 0.5481 0.4395 -0.1093 0.0931  -0.0279 1202 GLU A O   
4456 C CB  . GLU A 332 ? 0.7449 0.7728 0.6437 -0.1038 0.1019  -0.0457 1202 GLU A CB  
4457 C CG  . GLU A 332 ? 1.1491 1.1698 1.0309 -0.1153 0.1141  -0.0477 1202 GLU A CG  
4458 C CD  . GLU A 332 ? 1.2724 1.2776 1.1350 -0.1116 0.1140  -0.0455 1202 GLU A CD  
4459 O OE1 . GLU A 332 ? 1.1875 1.2014 1.0571 -0.1010 0.1089  -0.0474 1202 GLU A OE1 
4460 O OE2 . GLU A 332 ? 1.1449 1.1275 0.9836 -0.1194 0.1187  -0.0419 1202 GLU A OE2 
4467 N N   . ALA A 333 ? 0.5418 0.5261 0.4289 -0.0959 0.0801  -0.0278 1203 ALA A N   
4468 C CA  . ALA A 333 ? 0.4818 0.4455 0.3592 -0.0985 0.0765  -0.0215 1203 ALA A CA  
4469 C C   . ALA A 333 ? 0.4756 0.4204 0.3437 -0.0900 0.0658  -0.0142 1203 ALA A C   
4470 O O   . ALA A 333 ? 0.4913 0.4213 0.3549 -0.0888 0.0606  -0.0089 1203 ALA A O   
4471 C CB  . ALA A 333 ? 0.4807 0.4563 0.3753 -0.0984 0.0749  -0.0229 1203 ALA A CB  
4477 N N   . ASN A 334 ? 0.4500 0.3957 0.3154 -0.0840 0.0625  -0.0143 1204 ASN A N   
4478 C CA  . ASN A 334 ? 0.4888 0.4178 0.3456 -0.0767 0.0521  -0.0080 1204 ASN A CA  
4479 C C   . ASN A 334 ? 0.3906 0.3241 0.2631 -0.0692 0.0429  -0.0049 1204 ASN A C   
4480 O O   . ASN A 334 ? 0.4234 0.3412 0.2896 -0.0661 0.0356  0.0010  1204 ASN A O   
4481 C CB  . ASN A 334 ? 0.5474 0.4487 0.3795 -0.0816 0.0520  -0.0026 1204 ASN A CB  
4482 C CG  . ASN A 334 ? 0.5954 0.4900 0.4094 -0.0902 0.0621  -0.0053 1204 ASN A CG  
4483 O OD1 . ASN A 334 ? 0.8583 0.7420 0.6599 -0.0995 0.0692  -0.0049 1204 ASN A OD1 
4484 N ND2 . ASN A 334 ? 0.6188 0.5190 0.4302 -0.0876 0.0633  -0.0082 1204 ASN A ND2 
4491 N N   . VAL A 335 ? 0.4206 0.3757 0.3133 -0.0661 0.0433  -0.0091 1205 VAL A N   
4492 C CA  . VAL A 335 ? 0.3772 0.3379 0.2849 -0.0590 0.0355  -0.0068 1205 VAL A CA  
4493 C C   . VAL A 335 ? 0.3441 0.3107 0.2573 -0.0511 0.0291  -0.0070 1205 VAL A C   
4494 O O   . VAL A 335 ? 0.3514 0.3315 0.2700 -0.0498 0.0321  -0.0121 1205 VAL A O   
4495 C CB  . VAL A 335 ? 0.3523 0.3310 0.2768 -0.0603 0.0392  -0.0112 1205 VAL A CB  
4496 C CG1 . VAL A 335 ? 0.2829 0.2672 0.2217 -0.0528 0.0318  -0.0091 1205 VAL A CG1 
4497 C CG2 . VAL A 335 ? 0.4028 0.3746 0.3214 -0.0688 0.0454  -0.0112 1205 VAL A CG2 
4507 N N   . PRO A 336 ? 0.3596 0.3162 0.2715 -0.0459 0.0201  -0.0016 1206 PRO A N   
4508 C CA  . PRO A 336 ? 0.3542 0.3151 0.2702 -0.0395 0.0140  -0.0019 1206 PRO A CA  
4509 C C   . PRO A 336 ? 0.3121 0.2900 0.2465 -0.0351 0.0126  -0.0045 1206 PRO A C   
4510 O O   . PRO A 336 ? 0.3147 0.2967 0.2591 -0.0349 0.0122  -0.0034 1206 PRO A O   
4511 C CB  . PRO A 336 ? 0.3384 0.2845 0.2489 -0.0365 0.0048  0.0045  1206 PRO A CB  
4512 C CG  . PRO A 336 ? 0.3545 0.2956 0.2674 -0.0382 0.0051  0.0076  1206 PRO A CG  
4513 C CD  . PRO A 336 ? 0.3817 0.3233 0.2888 -0.0453 0.0149  0.0044  1206 PRO A CD  
4521 N N   . VAL A 337 ? 0.3311 0.3171 0.2684 -0.0313 0.0118  -0.0080 1207 VAL A N   
4522 C CA  . VAL A 337 ? 0.2844 0.2839 0.2362 -0.0265 0.0098  -0.0105 1207 VAL A CA  
4523 C C   . VAL A 337 ? 0.3543 0.3496 0.3051 -0.0209 0.0022  -0.0087 1207 VAL A C   
4524 O O   . VAL A 337 ? 0.3225 0.3136 0.2641 -0.0195 0.0015  -0.0103 1207 VAL A O   
4525 C CB  . VAL A 337 ? 0.3400 0.3554 0.2974 -0.0264 0.0161  -0.0177 1207 VAL A CB  
4526 C CG1 . VAL A 337 ? 0.3096 0.3363 0.2796 -0.0205 0.0127  -0.0199 1207 VAL A CG1 
4527 C CG2 . VAL A 337 ? 0.4195 0.4404 0.3789 -0.0332 0.0238  -0.0199 1207 VAL A CG2 
4537 N N   . TYR A 338 ? 0.2781 0.2737 0.2377 -0.0184 -0.0032 -0.0054 1208 TYR A N   
4538 C CA  . TYR A 338 ? 0.3056 0.2990 0.2664 -0.0140 -0.0099 -0.0042 1208 TYR A CA  
4539 C C   . TYR A 338 ? 0.3537 0.3583 0.3212 -0.0101 -0.0085 -0.0089 1208 TYR A C   
4540 O O   . TYR A 338 ? 0.3367 0.3507 0.3139 -0.0099 -0.0059 -0.0104 1208 TYR A O   
4541 C CB  . TYR A 338 ? 0.2552 0.2455 0.2235 -0.0137 -0.0153 0.0011  1208 TYR A CB  
4542 C CG  . TYR A 338 ? 0.3344 0.3138 0.2969 -0.0161 -0.0184 0.0058  1208 TYR A CG  
4543 C CD1 . TYR A 338 ? 0.3049 0.2756 0.2630 -0.0152 -0.0259 0.0091  1208 TYR A CD1 
4544 C CD2 . TYR A 338 ? 0.3649 0.3417 0.3253 -0.0192 -0.0143 0.0067  1208 TYR A CD2 
4545 C CE1 . TYR A 338 ? 0.3463 0.3072 0.2991 -0.0166 -0.0299 0.0132  1208 TYR A CE1 
4546 C CE2 . TYR A 338 ? 0.3812 0.3463 0.3347 -0.0204 -0.0179 0.0110  1208 TYR A CE2 
4547 C CZ  . TYR A 338 ? 0.3940 0.3518 0.3442 -0.0187 -0.0260 0.0142  1208 TYR A CZ  
4548 O OH  . TYR A 338 ? 0.3852 0.3315 0.3284 -0.0191 -0.0306 0.0183  1208 TYR A OH  
4558 N N   . ARG A 339 ? 0.3312 0.3336 0.2924 -0.0065 -0.0106 -0.0114 1209 ARG A N   
4559 C CA  . ARG A 339 ? 0.2795 0.2909 0.2451 -0.0014 -0.0100 -0.0163 1209 ARG A CA  
4560 C C   . ARG A 339 ? 0.3490 0.3517 0.3095 0.0026  -0.0168 -0.0150 1209 ARG A C   
4561 O O   . ARG A 339 ? 0.3216 0.3139 0.2715 0.0027  -0.0197 -0.0141 1209 ARG A O   
4562 C CB  . ARG A 339 ? 0.3694 0.3885 0.3316 -0.0005 -0.0040 -0.0225 1209 ARG A CB  
4563 C CG  . ARG A 339 ? 0.3448 0.3741 0.3115 0.0060  -0.0039 -0.0283 1209 ARG A CG  
4564 C CD  . ARG A 339 ? 0.3720 0.4116 0.3376 0.0067  0.0028  -0.0350 1209 ARG A CD  
4565 N NE  . ARG A 339 ? 0.4326 0.4837 0.4040 0.0141  0.0024  -0.0411 1209 ARG A NE  
4566 C CZ  . ARG A 339 ? 0.4010 0.4667 0.3767 0.0160  0.0080  -0.0481 1209 ARG A CZ  
4567 N NH1 . ARG A 339 ? 0.3649 0.4350 0.3391 0.0098  0.0154  -0.0498 1209 ARG A NH1 
4568 N NH2 . ARG A 339 ? 0.3784 0.4543 0.3598 0.0240  0.0061  -0.0536 1209 ARG A NH2 
4582 N N   . PHE A 340 ? 0.3014 0.3067 0.2680 0.0056  -0.0195 -0.0149 1210 PHE A N   
4583 C CA  . PHE A 340 ? 0.2988 0.2942 0.2597 0.0084  -0.0258 -0.0133 1210 PHE A CA  
4584 C C   . PHE A 340 ? 0.3259 0.3249 0.2902 0.0131  -0.0270 -0.0155 1210 PHE A C   
4585 O O   . PHE A 340 ? 0.3120 0.3217 0.2846 0.0139  -0.0236 -0.0176 1210 PHE A O   
4586 C CB  . PHE A 340 ? 0.3262 0.3134 0.2885 0.0039  -0.0303 -0.0070 1210 PHE A CB  
4587 C CG  . PHE A 340 ? 0.2935 0.2868 0.2677 0.0018  -0.0293 -0.0041 1210 PHE A CG  
4588 C CD1 . PHE A 340 ? 0.3334 0.3250 0.3103 0.0030  -0.0318 -0.0030 1210 PHE A CD1 
4589 C CD2 . PHE A 340 ? 0.2985 0.2976 0.2796 -0.0014 -0.0254 -0.0027 1210 PHE A CD2 
4590 C CE1 . PHE A 340 ? 0.4086 0.4054 0.3954 0.0012  -0.0301 -0.0006 1210 PHE A CE1 
4591 C CE2 . PHE A 340 ? 0.3015 0.3054 0.2927 -0.0027 -0.0241 -0.0005 1210 PHE A CE2 
4592 C CZ  . PHE A 340 ? 0.2703 0.2735 0.2645 -0.0014 -0.0263 0.0005  1210 PHE A CZ  
4602 N N   . ILE A 341 ? 0.2805 0.2689 0.2368 0.0160  -0.0322 -0.0150 1211 ILE A N   
4603 C CA  . ILE A 341 ? 0.3177 0.3050 0.2733 0.0207  -0.0344 -0.0166 1211 ILE A CA  
4604 C C   . ILE A 341 ? 0.2984 0.2777 0.2554 0.0168  -0.0378 -0.0111 1211 ILE A C   
4605 O O   . ILE A 341 ? 0.3479 0.3177 0.3007 0.0129  -0.0413 -0.0075 1211 ILE A O   
4606 C CB  . ILE A 341 ? 0.3310 0.3094 0.2740 0.0274  -0.0377 -0.0204 1211 ILE A CB  
4607 C CG1 . ILE A 341 ? 0.4656 0.4535 0.4081 0.0318  -0.0335 -0.0265 1211 ILE A CG1 
4608 C CG2 . ILE A 341 ? 0.3295 0.3035 0.2694 0.0325  -0.0408 -0.0214 1211 ILE A CG2 
4609 C CD1 . ILE A 341 ? 0.3963 0.4009 0.3493 0.0350  -0.0296 -0.0310 1211 ILE A CD1 
4621 N N   . GLN A 342 ? 0.2467 0.2305 0.2096 0.0173  -0.0366 -0.0108 1212 GLN A N   
4622 C CA  . GLN A 342 ? 0.2697 0.2466 0.2333 0.0138  -0.0386 -0.0062 1212 GLN A CA  
4623 C C   . GLN A 342 ? 0.2715 0.2377 0.2241 0.0185  -0.0422 -0.0077 1212 GLN A C   
4624 O O   . GLN A 342 ? 0.2926 0.2626 0.2441 0.0240  -0.0415 -0.0113 1212 GLN A O   
4625 C CB  . GLN A 342 ? 0.2725 0.2593 0.2476 0.0114  -0.0344 -0.0049 1212 GLN A CB  
4626 C CG  . GLN A 342 ? 0.2306 0.2120 0.2071 0.0080  -0.0350 -0.0008 1212 GLN A CG  
4627 C CD  . GLN A 342 ? 0.2535 0.2431 0.2379 0.0077  -0.0306 -0.0009 1212 GLN A CD  
4628 O OE1 . GLN A 342 ? 0.2664 0.2632 0.2518 0.0116  -0.0288 -0.0049 1212 GLN A OE1 
4629 N NE2 . GLN A 342 ? 0.2621 0.2514 0.2525 0.0030  -0.0289 0.0031  1212 GLN A NE2 
4638 N N   . ARG A 343 ? 0.2618 0.2138 0.2053 0.0162  -0.0465 -0.0051 1213 ARG A N   
4639 C CA  . ARG A 343 ? 0.2875 0.2252 0.2173 0.0201  -0.0503 -0.0061 1213 ARG A CA  
4640 C C   . ARG A 343 ? 0.3688 0.3024 0.2996 0.0163  -0.0496 -0.0026 1213 ARG A C   
4641 O O   . ARG A 343 ? 0.3488 0.2901 0.2912 0.0101  -0.0464 0.0008  1213 ARG A O   
4642 C CB  . ARG A 343 ? 0.3357 0.2579 0.2533 0.0183  -0.0552 -0.0050 1213 ARG A CB  
4643 C CG  . ARG A 343 ? 0.3598 0.2843 0.2753 0.0205  -0.0556 -0.0077 1213 ARG A CG  
4644 C CD  . ARG A 343 ? 0.4030 0.3124 0.3083 0.0161  -0.0606 -0.0054 1213 ARG A CD  
4645 N NE  . ARG A 343 ? 0.3899 0.3000 0.3035 0.0067  -0.0613 0.0001  1213 ARG A NE  
4646 C CZ  . ARG A 343 ? 0.5347 0.4329 0.4423 0.0007  -0.0660 0.0030  1213 ARG A CZ  
4647 N NH1 . ARG A 343 ? 0.3976 0.2795 0.2884 0.0029  -0.0706 0.0011  1213 ARG A NH1 
4648 N NH2 . ARG A 343 ? 0.3652 0.2680 0.2837 -0.0075 -0.0662 0.0074  1213 ARG A NH2 
4662 N N   . PRO A 344 ? 0.3647 0.2850 0.2821 0.0201  -0.0524 -0.0035 1214 PRO A N   
4663 C CA  . PRO A 344 ? 0.3368 0.2503 0.2523 0.0154  -0.0513 0.0002  1214 PRO A CA  
4664 C C   . PRO A 344 ? 0.3776 0.2874 0.2972 0.0052  -0.0510 0.0053  1214 PRO A C   
4665 O O   . PRO A 344 ? 0.3984 0.2993 0.3117 0.0029  -0.0548 0.0060  1214 PRO A O   
4666 C CB  . PRO A 344 ? 0.4182 0.3129 0.3139 0.0212  -0.0557 -0.0015 1214 PRO A CB  
4667 C CG  . PRO A 344 ? 0.4020 0.3019 0.2953 0.0317  -0.0577 -0.0074 1214 PRO A CG  
4668 C CD  . PRO A 344 ? 0.4156 0.3268 0.3190 0.0295  -0.0563 -0.0081 1214 PRO A CD  
4676 N N   . GLY A 345 ? 0.2929 0.2104 0.2236 -0.0008 -0.0466 0.0085  1215 GLY A N   
4677 C CA  . GLY A 345 ? 0.3274 0.2446 0.2649 -0.0103 -0.0461 0.0129  1215 GLY A CA  
4678 C C   . GLY A 345 ? 0.3530 0.2855 0.3072 -0.0132 -0.0450 0.0139  1215 GLY A C   
4679 O O   . GLY A 345 ? 0.3530 0.2898 0.3170 -0.0204 -0.0442 0.0172  1215 GLY A O   
4683 N N   . ASP A 346 ? 0.2815 0.2220 0.2386 -0.0077 -0.0451 0.0110  1216 ASP A N   
4684 C CA  . ASP A 346 ? 0.2644 0.2170 0.2346 -0.0099 -0.0442 0.0120  1216 ASP A CA  
4685 C C   . ASP A 346 ? 0.3406 0.3067 0.3245 -0.0103 -0.0385 0.0127  1216 ASP A C   
4686 O O   . ASP A 346 ? 0.2986 0.2675 0.2812 -0.0062 -0.0354 0.0105  1216 ASP A O   
4687 C CB  . ASP A 346 ? 0.2746 0.2291 0.2408 -0.0047 -0.0456 0.0086  1216 ASP A CB  
4688 C CG  . ASP A 346 ? 0.3576 0.2990 0.3105 -0.0041 -0.0511 0.0077  1216 ASP A CG  
4689 O OD1 . ASP A 346 ? 0.3668 0.2985 0.3156 -0.0093 -0.0546 0.0103  1216 ASP A OD1 
4690 O OD2 . ASP A 346 ? 0.3244 0.2652 0.2709 0.0012  -0.0517 0.0041  1216 ASP A OD2 
4695 N N   . LEU A 347 ? 0.2603 0.2341 0.2566 -0.0148 -0.0376 0.0156  1217 LEU A N   
4696 C CA  . LEU A 347 ? 0.2572 0.2426 0.2662 -0.0149 -0.0324 0.0163  1217 LEU A CA  
4697 C C   . LEU A 347 ? 0.2462 0.2386 0.2599 -0.0128 -0.0324 0.0153  1217 LEU A C   
4698 O O   . LEU A 347 ? 0.2842 0.2751 0.2980 -0.0142 -0.0363 0.0164  1217 LEU A O   
4699 C CB  . LEU A 347 ? 0.2771 0.2670 0.2974 -0.0206 -0.0312 0.0199  1217 LEU A CB  
4700 C CG  . LEU A 347 ? 0.3039 0.3047 0.3370 -0.0204 -0.0254 0.0207  1217 LEU A CG  
4701 C CD1 . LEU A 347 ? 0.2661 0.2693 0.3067 -0.0254 -0.0223 0.0232  1217 LEU A CD1 
4702 C CD2 . LEU A 347 ? 0.2464 0.2548 0.2887 -0.0194 -0.0265 0.0213  1217 LEU A CD2 
4714 N N   . VAL A 348 ? 0.2143 0.2130 0.2306 -0.0097 -0.0280 0.0132  1218 VAL A N   
4715 C CA  . VAL A 348 ? 0.2153 0.2194 0.2352 -0.0087 -0.0269 0.0124  1218 VAL A CA  
4716 C C   . VAL A 348 ? 0.2458 0.2567 0.2772 -0.0102 -0.0233 0.0146  1218 VAL A C   
4717 O O   . VAL A 348 ? 0.2093 0.2234 0.2441 -0.0097 -0.0191 0.0141  1218 VAL A O   
4718 C CB  . VAL A 348 ? 0.2448 0.2513 0.2592 -0.0049 -0.0245 0.0080  1218 VAL A CB  
4719 C CG1 . VAL A 348 ? 0.2450 0.2567 0.2631 -0.0054 -0.0219 0.0074  1218 VAL A CG1 
4720 C CG2 . VAL A 348 ? 0.2532 0.2536 0.2567 -0.0022 -0.0281 0.0054  1218 VAL A CG2 
4730 N N   . TRP A 349 ? 0.2413 0.2535 0.2777 -0.0115 -0.0254 0.0168  1219 TRP A N   
4731 C CA  . TRP A 349 ? 0.2166 0.2344 0.2632 -0.0116 -0.0228 0.0186  1219 TRP A CA  
4732 C C   . TRP A 349 ? 0.1994 0.2169 0.2425 -0.0101 -0.0210 0.0171  1219 TRP A C   
4733 O O   . TRP A 349 ? 0.2659 0.2794 0.3035 -0.0103 -0.0242 0.0173  1219 TRP A O   
4734 C CB  . TRP A 349 ? 0.2222 0.2414 0.2767 -0.0136 -0.0272 0.0220  1219 TRP A CB  
4735 C CG  . TRP A 349 ? 0.2646 0.2889 0.3291 -0.0122 -0.0254 0.0236  1219 TRP A CG  
4736 C CD1 . TRP A 349 ? 0.3295 0.3514 0.3919 -0.0105 -0.0266 0.0240  1219 TRP A CD1 
4737 C CD2 . TRP A 349 ? 0.2339 0.2653 0.3105 -0.0121 -0.0220 0.0248  1219 TRP A CD2 
4738 N NE1 . TRP A 349 ? 0.2556 0.2821 0.3280 -0.0086 -0.0248 0.0254  1219 TRP A NE1 
4739 C CE2 . TRP A 349 ? 0.2605 0.2937 0.3424 -0.0094 -0.0217 0.0257  1219 TRP A CE2 
4740 C CE3 . TRP A 349 ? 0.1835 0.2191 0.2660 -0.0141 -0.0187 0.0251  1219 TRP A CE3 
4741 C CZ2 . TRP A 349 ? 0.2646 0.3048 0.3588 -0.0077 -0.0184 0.0266  1219 TRP A CZ2 
4742 C CZ3 . TRP A 349 ? 0.2618 0.3049 0.3565 -0.0133 -0.0147 0.0260  1219 TRP A CZ3 
4743 C CH2 . TRP A 349 ? 0.2584 0.3043 0.3594 -0.0097 -0.0146 0.0266  1219 TRP A CH2 
4754 N N   . ILE A 350 ? 0.2411 0.2617 0.2861 -0.0091 -0.0157 0.0156  1220 ILE A N   
4755 C CA  . ILE A 350 ? 0.2050 0.2247 0.2468 -0.0089 -0.0132 0.0142  1220 ILE A CA  
4756 C C   . ILE A 350 ? 0.2225 0.2420 0.2709 -0.0084 -0.0126 0.0169  1220 ILE A C   
4757 O O   . ILE A 350 ? 0.1935 0.2164 0.2490 -0.0075 -0.0094 0.0174  1220 ILE A O   
4758 C CB  . ILE A 350 ? 0.2170 0.2397 0.2562 -0.0085 -0.0083 0.0104  1220 ILE A CB  
4759 C CG1 . ILE A 350 ? 0.2777 0.3012 0.3106 -0.0076 -0.0096 0.0072  1220 ILE A CG1 
4760 C CG2 . ILE A 350 ? 0.2876 0.3092 0.3240 -0.0096 -0.0050 0.0090  1220 ILE A CG2 
4761 C CD1 . ILE A 350 ? 0.2978 0.3197 0.3236 -0.0082 -0.0105 0.0053  1220 ILE A CD1 
4773 N N   . ASN A 351 ? 0.2127 0.2274 0.2579 -0.0085 -0.0157 0.0186  1221 ASN A N   
4774 C CA  . ASN A 351 ? 0.2067 0.2199 0.2572 -0.0068 -0.0165 0.0212  1221 ASN A CA  
4775 C C   . ASN A 351 ? 0.2098 0.2209 0.2584 -0.0062 -0.0109 0.0198  1221 ASN A C   
4776 O O   . ASN A 351 ? 0.2536 0.2648 0.2965 -0.0080 -0.0068 0.0168  1221 ASN A O   
4777 C CB  . ASN A 351 ? 0.2220 0.2284 0.2670 -0.0066 -0.0224 0.0235  1221 ASN A CB  
4778 C CG  . ASN A 351 ? 0.3360 0.3439 0.3905 -0.0039 -0.0268 0.0267  1221 ASN A CG  
4779 O OD1 . ASN A 351 ? 0.3797 0.3946 0.4458 -0.0022 -0.0246 0.0271  1221 ASN A OD1 
4780 N ND2 . ASN A 351 ? 0.3121 0.3138 0.3618 -0.0033 -0.0332 0.0287  1221 ASN A ND2 
4787 N N   . ALA A 352 ? 0.2185 0.2278 0.2718 -0.0037 -0.0109 0.0218  1222 ALA A N   
4788 C CA  . ALA A 352 ? 0.2526 0.2588 0.3044 -0.0028 -0.0055 0.0206  1222 ALA A CA  
4789 C C   . ALA A 352 ? 0.2392 0.2370 0.2780 -0.0058 -0.0034 0.0188  1222 ALA A C   
4790 O O   . ALA A 352 ? 0.2581 0.2479 0.2892 -0.0063 -0.0065 0.0204  1222 ALA A O   
4791 C CB  . ALA A 352 ? 0.2312 0.2357 0.2897 0.0016  -0.0068 0.0230  1222 ALA A CB  
4797 N N   . GLY A 353 ? 0.2584 0.2580 0.2944 -0.0082 0.0019  0.0155  1223 GLY A N   
4798 C CA  . GLY A 353 ? 0.2837 0.2773 0.3090 -0.0122 0.0050  0.0132  1223 GLY A CA  
4799 C C   . GLY A 353 ? 0.2907 0.2861 0.3099 -0.0155 0.0041  0.0114  1223 GLY A C   
4800 O O   . GLY A 353 ? 0.2535 0.2450 0.2641 -0.0196 0.0071  0.0094  1223 GLY A O   
4804 N N   . THR A 354 ? 0.2586 0.2595 0.2816 -0.0140 0.0004  0.0120  1224 THR A N   
4805 C CA  . THR A 354 ? 0.1917 0.1942 0.2086 -0.0162 -0.0004 0.0100  1224 THR A CA  
4806 C C   . THR A 354 ? 0.2578 0.2678 0.2745 -0.0184 0.0042  0.0050  1224 THR A C   
4807 O O   . THR A 354 ? 0.2897 0.3063 0.3127 -0.0168 0.0051  0.0034  1224 THR A O   
4808 C CB  . THR A 354 ? 0.1983 0.2040 0.2187 -0.0138 -0.0056 0.0113  1224 THR A CB  
4809 O OG1 . THR A 354 ? 0.2373 0.2367 0.2574 -0.0125 -0.0106 0.0155  1224 THR A OG1 
4810 C CG2 . THR A 354 ? 0.2438 0.2512 0.2576 -0.0150 -0.0058 0.0084  1224 THR A CG2 
4818 N N   . VAL A 355 ? 0.2561 0.2654 0.2655 -0.0221 0.0070  0.0023  1225 VAL A N   
4819 C CA  . VAL A 355 ? 0.3208 0.3394 0.3314 -0.0244 0.0110  -0.0031 1225 VAL A CA  
4820 C C   . VAL A 355 ? 0.2826 0.3089 0.2948 -0.0216 0.0086  -0.0055 1225 VAL A C   
4821 O O   . VAL A 355 ? 0.2827 0.3053 0.2901 -0.0209 0.0061  -0.0043 1225 VAL A O   
4822 C CB  . VAL A 355 ? 0.3415 0.3573 0.3444 -0.0304 0.0158  -0.0054 1225 VAL A CB  
4823 C CG1 . VAL A 355 ? 0.2975 0.3257 0.3043 -0.0331 0.0198  -0.0115 1225 VAL A CG1 
4824 C CG2 . VAL A 355 ? 0.3187 0.3228 0.3167 -0.0329 0.0176  -0.0025 1225 VAL A CG2 
4834 N N   . HIS A 356 ? 0.2162 0.2518 0.2340 -0.0195 0.0088  -0.0090 1226 HIS A N   
4835 C CA  . HIS A 356 ? 0.2353 0.2764 0.2536 -0.0158 0.0059  -0.0113 1226 HIS A CA  
4836 C C   . HIS A 356 ? 0.2133 0.2657 0.2357 -0.0143 0.0071  -0.0169 1226 HIS A C   
4837 O O   . HIS A 356 ? 0.2132 0.2690 0.2392 -0.0157 0.0091  -0.0184 1226 HIS A O   
4838 C CB  . HIS A 356 ? 0.2499 0.2862 0.2697 -0.0119 0.0010  -0.0073 1226 HIS A CB  
4839 C CG  . HIS A 356 ? 0.2595 0.2959 0.2848 -0.0109 0.0013  -0.0057 1226 HIS A CG  
4840 N ND1 . HIS A 356 ? 0.2477 0.2797 0.2752 -0.0128 0.0031  -0.0027 1226 HIS A ND1 
4841 C CD2 . HIS A 356 ? 0.2999 0.3390 0.3275 -0.0081 0.0001  -0.0067 1226 HIS A CD2 
4842 C CE1 . HIS A 356 ? 0.2457 0.2788 0.2774 -0.0112 0.0037  -0.0022 1226 HIS A CE1 
4843 N NE2 . HIS A 356 ? 0.2852 0.3221 0.3165 -0.0088 0.0019  -0.0044 1226 HIS A NE2 
4851 N N   . TRP A 357 ? 0.2451 0.3029 0.2664 -0.0110 0.0054  -0.0202 1227 TRP A N   
4852 C CA  . TRP A 357 ? 0.2534 0.3217 0.2785 -0.0074 0.0046  -0.0256 1227 TRP A CA  
4853 C C   . TRP A 357 ? 0.2169 0.2835 0.2388 -0.0011 -0.0001 -0.0261 1227 TRP A C   
4854 O O   . TRP A 357 ? 0.2485 0.3081 0.2651 -0.0007 -0.0016 -0.0237 1227 TRP A O   
4855 C CB  . TRP A 357 ? 0.2360 0.3165 0.2644 -0.0108 0.0091  -0.0316 1227 TRP A CB  
4856 C CG  . TRP A 357 ? 0.2365 0.3177 0.2608 -0.0133 0.0122  -0.0329 1227 TRP A CG  
4857 C CD1 . TRP A 357 ? 0.2598 0.3498 0.2843 -0.0102 0.0127  -0.0379 1227 TRP A CD1 
4858 C CD2 . TRP A 357 ? 0.2787 0.3508 0.2969 -0.0192 0.0156  -0.0294 1227 TRP A CD2 
4859 N NE1 . TRP A 357 ? 0.2802 0.3673 0.2991 -0.0143 0.0168  -0.0377 1227 TRP A NE1 
4860 C CE2 . TRP A 357 ? 0.2746 0.3500 0.2888 -0.0200 0.0183  -0.0324 1227 TRP A CE2 
4861 C CE3 . TRP A 357 ? 0.2909 0.3518 0.3059 -0.0233 0.0164  -0.0242 1227 TRP A CE3 
4862 C CZ2 . TRP A 357 ? 0.3007 0.3671 0.3062 -0.0254 0.0218  -0.0300 1227 TRP A CZ2 
4863 C CZ3 . TRP A 357 ? 0.2825 0.3344 0.2893 -0.0279 0.0191  -0.0219 1227 TRP A CZ3 
4864 C CH2 . TRP A 357 ? 0.3055 0.3597 0.3070 -0.0292 0.0217  -0.0246 1227 TRP A CH2 
4875 N N   . VAL A 358 ? 0.2025 0.2738 0.2259 0.0039  -0.0030 -0.0291 1228 VAL A N   
4876 C CA  . VAL A 358 ? 0.2199 0.2851 0.2379 0.0101  -0.0081 -0.0285 1228 VAL A CA  
4877 C C   . VAL A 358 ? 0.2599 0.3342 0.2788 0.0165  -0.0105 -0.0349 1228 VAL A C   
4878 O O   . VAL A 358 ? 0.2169 0.3013 0.2415 0.0164  -0.0095 -0.0387 1228 VAL A O   
4879 C CB  . VAL A 358 ? 0.3062 0.3612 0.3222 0.0104  -0.0107 -0.0235 1228 VAL A CB  
4880 C CG1 . VAL A 358 ? 0.2343 0.2798 0.2427 0.0151  -0.0158 -0.0220 1228 VAL A CG1 
4881 C CG2 . VAL A 358 ? 0.1983 0.2474 0.2164 0.0047  -0.0083 -0.0180 1228 VAL A CG2 
4891 N N   . GLN A 359 ? 0.2561 0.3264 0.2690 0.0225  -0.0142 -0.0362 1229 GLN A N   
4892 C CA  . GLN A 359 ? 0.2883 0.3651 0.3008 0.0305  -0.0177 -0.0420 1229 GLN A CA  
4893 C C   . GLN A 359 ? 0.2586 0.3216 0.2603 0.0369  -0.0235 -0.0403 1229 GLN A C   
4894 O O   . GLN A 359 ? 0.3185 0.3711 0.3139 0.0357  -0.0241 -0.0370 1229 GLN A O   
4895 C CB  . GLN A 359 ? 0.2401 0.3321 0.2581 0.0322  -0.0148 -0.0487 1229 GLN A CB  
4896 C CG  . GLN A 359 ? 0.2865 0.3732 0.2982 0.0334  -0.0140 -0.0486 1229 GLN A CG  
4897 C CD  . GLN A 359 ? 0.4030 0.5058 0.4204 0.0347  -0.0097 -0.0557 1229 GLN A CD  
4898 O OE1 . GLN A 359 ? 0.3768 0.4961 0.4038 0.0360  -0.0087 -0.0614 1229 GLN A OE1 
4899 N NE2 . GLN A 359 ? 0.2869 0.3857 0.2987 0.0340  -0.0072 -0.0556 1229 GLN A NE2 
4908 N N   . ALA A 360 ? 0.2599 0.3214 0.2582 0.0434  -0.0281 -0.0425 1230 ALA A N   
4909 C CA  . ALA A 360 ? 0.2694 0.3161 0.2553 0.0500  -0.0338 -0.0415 1230 ALA A CA  
4910 C C   . ALA A 360 ? 0.3900 0.4414 0.3738 0.0571  -0.0351 -0.0470 1230 ALA A C   
4911 O O   . ALA A 360 ? 0.3229 0.3911 0.3151 0.0606  -0.0338 -0.0535 1230 ALA A O   
4912 C CB  . ALA A 360 ? 0.2650 0.3071 0.2458 0.0552  -0.0385 -0.0423 1230 ALA A CB  
4918 N N   . ILE A 361 ? 0.3391 0.3760 0.3122 0.0587  -0.0373 -0.0447 1231 ILE A N   
4919 C CA  . ILE A 361 ? 0.3136 0.3513 0.2816 0.0669  -0.0391 -0.0500 1231 ILE A CA  
4920 C C   . ILE A 361 ? 0.4355 0.4623 0.3925 0.0770  -0.0463 -0.0520 1231 ILE A C   
4921 O O   . ILE A 361 ? 0.4797 0.5139 0.4368 0.0868  -0.0486 -0.0586 1231 ILE A O   
4922 C CB  . ILE A 361 ? 0.4058 0.4316 0.3657 0.0636  -0.0382 -0.0469 1231 ILE A CB  
4923 C CG1 . ILE A 361 ? 0.4303 0.4658 0.3992 0.0546  -0.0315 -0.0454 1231 ILE A CG1 
4924 C CG2 . ILE A 361 ? 0.5308 0.5540 0.4827 0.0730  -0.0404 -0.0523 1231 ILE A CG2 
4925 C CD1 . ILE A 361 ? 0.3835 0.4409 0.3647 0.0552  -0.0263 -0.0517 1231 ILE A CD1 
4937 N N   . GLY A 362 ? 0.4042 0.4132 0.3512 0.0749  -0.0497 -0.0463 1232 GLY A N   
4938 C CA  . GLY A 362 ? 0.3988 0.3934 0.3321 0.0835  -0.0566 -0.0472 1232 GLY A CA  
4939 C C   . GLY A 362 ? 0.4555 0.4496 0.3895 0.0824  -0.0581 -0.0455 1232 GLY A C   
4940 O O   . GLY A 362 ? 0.4152 0.4245 0.3624 0.0773  -0.0541 -0.0458 1232 GLY A O   
4944 N N   . TRP A 363 ? 0.3806 0.3555 0.2986 0.0872  -0.0638 -0.0438 1233 TRP A N   
4945 C CA  . TRP A 363 ? 0.3874 0.3565 0.3014 0.0854  -0.0652 -0.0412 1233 TRP A CA  
4946 C C   . TRP A 363 ? 0.4307 0.3852 0.3397 0.0746  -0.0620 -0.0332 1233 TRP A C   
4947 O O   . TRP A 363 ? 0.4385 0.3751 0.3350 0.0734  -0.0639 -0.0300 1233 TRP A O   
4948 C CB  . TRP A 363 ? 0.3786 0.3327 0.2756 0.0965  -0.0732 -0.0436 1233 TRP A CB  
4949 C CG  . TRP A 363 ? 0.4144 0.3850 0.3182 0.1082  -0.0773 -0.0520 1233 TRP A CG  
4950 C CD1 . TRP A 363 ? 0.4637 0.4448 0.3723 0.1124  -0.0801 -0.0555 1233 TRP A CD1 
4951 C CD2 . TRP A 363 ? 0.3924 0.3718 0.2994 0.1172  -0.0790 -0.0582 1233 TRP A CD2 
4952 N NE1 . TRP A 363 ? 0.4816 0.4791 0.3978 0.1233  -0.0838 -0.0638 1233 TRP A NE1 
4953 C CE2 . TRP A 363 ? 0.4586 0.4557 0.3742 0.1266  -0.0827 -0.0656 1233 TRP A CE2 
4954 C CE3 . TRP A 363 ? 0.4160 0.3902 0.3193 0.1182  -0.0777 -0.0586 1233 TRP A CE3 
4955 C CZ2 . TRP A 363 ? 0.5425 0.5538 0.4646 0.1371  -0.0846 -0.0735 1233 TRP A CZ2 
4956 C CZ3 . TRP A 363 ? 0.5412 0.5276 0.4491 0.1287  -0.0792 -0.0662 1233 TRP A CZ3 
4957 C CH2 . TRP A 363 ? 0.5709 0.5765 0.4889 0.1382  -0.0824 -0.0737 1233 TRP A CH2 
4968 N N   . CYS A 364 ? 0.3649 0.3275 0.2839 0.0665  -0.0570 -0.0302 1234 CYS A N   
4969 C CA  . CYS A 364 ? 0.3843 0.3367 0.3017 0.0563  -0.0533 -0.0232 1234 CYS A CA  
4970 C C   . CYS A 364 ? 0.3939 0.3523 0.3182 0.0507  -0.0491 -0.0210 1234 CYS A C   
4971 O O   . CYS A 364 ? 0.3699 0.3426 0.3029 0.0531  -0.0483 -0.0248 1234 CYS A O   
4972 C CB  . CYS A 364 ? 0.3826 0.3416 0.3097 0.0500  -0.0497 -0.0213 1234 CYS A CB  
4973 S SG  . CYS A 364 ? 0.4067 0.3913 0.3545 0.0471  -0.0440 -0.0243 1234 CYS A SG  
4979 N N   . ASN A 365 ? 0.3693 0.3169 0.2899 0.0432  -0.0462 -0.0152 1235 ASN A N   
4980 C CA  . ASN A 365 ? 0.3366 0.2905 0.2654 0.0368  -0.0407 -0.0127 1235 ASN A CA  
4981 C C   . ASN A 365 ? 0.3485 0.3091 0.2898 0.0284  -0.0356 -0.0089 1235 ASN A C   
4982 O O   . ASN A 365 ? 0.3425 0.2976 0.2821 0.0263  -0.0369 -0.0069 1235 ASN A O   
4983 C CB  . ASN A 365 ? 0.3235 0.2605 0.2384 0.0348  -0.0405 -0.0092 1235 ASN A CB  
4984 C CG  . ASN A 365 ? 0.3857 0.3128 0.2852 0.0436  -0.0465 -0.0125 1235 ASN A CG  
4985 O OD1 . ASN A 365 ? 0.3710 0.3081 0.2737 0.0513  -0.0504 -0.0180 1235 ASN A OD1 
4986 N ND2 . ASN A 365 ? 0.3928 0.3002 0.2751 0.0424  -0.0473 -0.0094 1235 ASN A ND2 
4993 N N   . ASN A 366 ? 0.3074 0.2792 0.2607 0.0241  -0.0305 -0.0081 1236 ASN A N   
4994 C CA  . ASN A 366 ? 0.2930 0.2702 0.2577 0.0169  -0.0260 -0.0043 1236 ASN A CA  
4995 C C   . ASN A 366 ? 0.2804 0.2572 0.2482 0.0122  -0.0208 -0.0014 1236 ASN A C   
4996 O O   . ASN A 366 ? 0.2652 0.2415 0.2289 0.0146  -0.0201 -0.0032 1236 ASN A O   
4997 C CB  . ASN A 366 ? 0.2381 0.2304 0.2154 0.0168  -0.0243 -0.0067 1236 ASN A CB  
4998 C CG  . ASN A 366 ? 0.2826 0.2761 0.2576 0.0206  -0.0281 -0.0095 1236 ASN A CG  
4999 O OD1 . ASN A 366 ? 0.3403 0.3345 0.3190 0.0176  -0.0279 -0.0077 1236 ASN A OD1 
5000 N ND2 . ASN A 366 ? 0.3045 0.2984 0.2733 0.0277  -0.0317 -0.0143 1236 ASN A ND2 
5007 N N   . ILE A 367 ? 0.2632 0.2404 0.2382 0.0060  -0.0174 0.0029  1237 ILE A N   
5008 C CA  . ILE A 367 ? 0.2552 0.2355 0.2364 0.0020  -0.0114 0.0050  1237 ILE A CA  
5009 C C   . ILE A 367 ? 0.2491 0.2411 0.2456 -0.0009 -0.0086 0.0062  1237 ILE A C   
5010 O O   . ILE A 367 ? 0.2281 0.2222 0.2287 -0.0019 -0.0112 0.0070  1237 ILE A O   
5011 C CB  . ILE A 367 ? 0.3013 0.2712 0.2768 -0.0028 -0.0090 0.0090  1237 ILE A CB  
5012 C CG1 . ILE A 367 ? 0.2908 0.2578 0.2685 -0.0067 -0.0115 0.0118  1237 ILE A CG1 
5013 C CG2 . ILE A 367 ? 0.3201 0.2758 0.2776 0.0002  -0.0111 0.0080  1237 ILE A CG2 
5014 C CD1 . ILE A 367 ? 0.2548 0.2125 0.2278 -0.0130 -0.0089 0.0155  1237 ILE A CD1 
5026 N N   . ALA A 368 ? 0.2590 0.2571 0.2624 -0.0019 -0.0037 0.0061  1238 ALA A N   
5027 C CA  . ALA A 368 ? 0.2525 0.2600 0.2685 -0.0036 -0.0015 0.0068  1238 ALA A CA  
5028 C C   . ALA A 368 ? 0.2145 0.2249 0.2365 -0.0051 0.0045  0.0078  1238 ALA A C   
5029 O O   . ALA A 368 ? 0.2492 0.2559 0.2649 -0.0043 0.0071  0.0066  1238 ALA A O   
5030 C CB  . ALA A 368 ? 0.2259 0.2393 0.2428 -0.0008 -0.0036 0.0032  1238 ALA A CB  
5036 N N   . TRP A 369 ? 0.2186 0.2348 0.2518 -0.0069 0.0065  0.0099  1239 TRP A N   
5037 C CA  . TRP A 369 ? 0.2376 0.2570 0.2775 -0.0075 0.0122  0.0106  1239 TRP A CA  
5038 C C   . TRP A 369 ? 0.2117 0.2370 0.2620 -0.0075 0.0118  0.0119  1239 TRP A C   
5039 O O   . TRP A 369 ? 0.2346 0.2609 0.2859 -0.0077 0.0072  0.0123  1239 TRP A O   
5040 C CB  . TRP A 369 ? 0.2269 0.2443 0.2683 -0.0100 0.0163  0.0132  1239 TRP A CB  
5041 C CG  . TRP A 369 ? 0.2442 0.2632 0.2917 -0.0132 0.0139  0.0162  1239 TRP A CG  
5042 C CD1 . TRP A 369 ? 0.2026 0.2291 0.2636 -0.0147 0.0146  0.0184  1239 TRP A CD1 
5043 C CD2 . TRP A 369 ? 0.2648 0.2772 0.3046 -0.0152 0.0098  0.0171  1239 TRP A CD2 
5044 N NE1 . TRP A 369 ? 0.2590 0.2852 0.3221 -0.0182 0.0111  0.0206  1239 TRP A NE1 
5045 C CE2 . TRP A 369 ? 0.2632 0.2798 0.3126 -0.0189 0.0083  0.0199  1239 TRP A CE2 
5046 C CE3 . TRP A 369 ? 0.2330 0.2358 0.2581 -0.0140 0.0067  0.0157  1239 TRP A CE3 
5047 C CZ2 . TRP A 369 ? 0.2539 0.2645 0.2981 -0.0223 0.0043  0.0213  1239 TRP A CZ2 
5048 C CZ3 . TRP A 369 ? 0.2285 0.2243 0.2476 -0.0165 0.0028  0.0172  1239 TRP A CZ3 
5049 C CH2 . TRP A 369 ? 0.3231 0.3225 0.3515 -0.0210 0.0018  0.0200  1239 TRP A CH2 
5060 N N   . ASN A 370 ? 0.2176 0.2456 0.2744 -0.0070 0.0163  0.0123  1240 ASN A N   
5061 C CA  . ASN A 370 ? 0.1882 0.2200 0.2536 -0.0062 0.0154  0.0136  1240 ASN A CA  
5062 C C   . ASN A 370 ? 0.2116 0.2483 0.2886 -0.0066 0.0170  0.0165  1240 ASN A C   
5063 O O   . ASN A 370 ? 0.2326 0.2704 0.3117 -0.0078 0.0210  0.0172  1240 ASN A O   
5064 C CB  . ASN A 370 ? 0.1771 0.2073 0.2406 -0.0044 0.0187  0.0115  1240 ASN A CB  
5065 C CG  . ASN A 370 ? 0.2424 0.2703 0.2968 -0.0048 0.0169  0.0082  1240 ASN A CG  
5066 O OD1 . ASN A 370 ? 0.2845 0.3106 0.3324 -0.0046 0.0185  0.0056  1240 ASN A OD1 
5067 N ND2 . ASN A 370 ? 0.2433 0.2715 0.2970 -0.0053 0.0135  0.0080  1240 ASN A ND2 
5074 N N   . VAL A 371 ? 0.2099 0.2498 0.2945 -0.0057 0.0137  0.0182  1241 VAL A N   
5075 C CA  . VAL A 371 ? 0.1943 0.2410 0.2922 -0.0049 0.0147  0.0203  1241 VAL A CA  
5076 C C   . VAL A 371 ? 0.1852 0.2316 0.2867 -0.0012 0.0130  0.0207  1241 VAL A C   
5077 O O   . VAL A 371 ? 0.2208 0.2617 0.3146 -0.0010 0.0096  0.0201  1241 VAL A O   
5078 C CB  . VAL A 371 ? 0.2487 0.2999 0.3532 -0.0080 0.0100  0.0226  1241 VAL A CB  
5079 C CG1 . VAL A 371 ? 0.2431 0.2911 0.3407 -0.0121 0.0113  0.0224  1241 VAL A CG1 
5080 C CG2 . VAL A 371 ? 0.3376 0.3860 0.4389 -0.0080 0.0025  0.0233  1241 VAL A CG2 
5090 N N   . GLY A 372 ? 0.2626 0.3143 0.3750 0.0018  0.0157  0.0214  1242 GLY A N   
5091 C CA  . GLY A 372 ? 0.2160 0.2663 0.3317 0.0062  0.0132  0.0221  1242 GLY A CA  
5092 C C   . GLY A 372 ? 0.2011 0.2609 0.3320 0.0078  0.0094  0.0241  1242 GLY A C   
5093 O O   . GLY A 372 ? 0.2201 0.2886 0.3631 0.0096  0.0135  0.0240  1242 GLY A O   
5097 N N   . PRO A 373 ? 0.2247 0.2837 0.3553 0.0071  0.0015  0.0258  1243 PRO A N   
5098 C CA  . PRO A 373 ? 0.2781 0.3467 0.4237 0.0090  -0.0035 0.0275  1243 PRO A CA  
5099 C C   . PRO A 373 ? 0.2521 0.3230 0.4057 0.0162  -0.0019 0.0272  1243 PRO A C   
5100 O O   . PRO A 373 ? 0.2499 0.3104 0.3935 0.0195  -0.0001 0.0265  1243 PRO A O   
5101 C CB  . PRO A 373 ? 0.3261 0.3883 0.4643 0.0080  -0.0124 0.0290  1243 PRO A CB  
5102 C CG  . PRO A 373 ? 0.2702 0.3243 0.3935 0.0034  -0.0113 0.0280  1243 PRO A CG  
5103 C CD  . PRO A 373 ? 0.2459 0.2967 0.3634 0.0040  -0.0031 0.0259  1243 PRO A CD  
5111 N N   . LEU A 374 ? 0.2212 0.3057 0.3930 0.0185  -0.0024 0.0276  1244 LEU A N   
5112 C CA  . LEU A 374 ? 0.2765 0.3645 0.4576 0.0267  -0.0013 0.0270  1244 LEU A CA  
5113 C C   . LEU A 374 ? 0.2413 0.3238 0.4203 0.0315  -0.0112 0.0286  1244 LEU A C   
5114 O O   . LEU A 374 ? 0.2775 0.3707 0.4711 0.0345  -0.0173 0.0293  1244 LEU A O   
5115 C CB  . LEU A 374 ? 0.2686 0.3757 0.4717 0.0275  0.0020  0.0262  1244 LEU A CB  
5116 C CG  . LEU A 374 ? 0.4220 0.5359 0.6380 0.0371  0.0036  0.0249  1244 LEU A CG  
5117 C CD1 . LEU A 374 ? 0.3915 0.4962 0.5980 0.0406  0.0130  0.0230  1244 LEU A CD1 
5118 C CD2 . LEU A 374 ? 0.3625 0.4989 0.6032 0.0369  0.0053  0.0240  1244 LEU A CD2 
5130 N N   . THR A 375 ? 0.2429 0.3084 0.4033 0.0320  -0.0128 0.0291  1245 THR A N   
5131 C CA  . THR A 375 ? 0.3012 0.3575 0.4549 0.0357  -0.0218 0.0309  1245 THR A CA  
5132 C C   . THR A 375 ? 0.3591 0.3983 0.4974 0.0401  -0.0198 0.0306  1245 THR A C   
5133 O O   . THR A 375 ? 0.2280 0.2601 0.3564 0.0375  -0.0123 0.0290  1245 THR A O   
5134 C CB  . THR A 375 ? 0.2981 0.3478 0.4402 0.0293  -0.0276 0.0323  1245 THR A CB  
5135 O OG1 . THR A 375 ? 0.2636 0.3024 0.3892 0.0247  -0.0222 0.0312  1245 THR A OG1 
5136 C CG2 . THR A 375 ? 0.2885 0.3520 0.4426 0.0240  -0.0299 0.0326  1245 THR A CG2 
5144 N N   . ALA A 376 ? 0.2689 0.3005 0.4043 0.0465  -0.0269 0.0320  1246 ALA A N   
5145 C CA  . ALA A 376 ? 0.2919 0.3039 0.4098 0.0501  -0.0260 0.0322  1246 ALA A CA  
5146 C C   . ALA A 376 ? 0.2330 0.2315 0.3309 0.0420  -0.0233 0.0321  1246 ALA A C   
5147 O O   . ALA A 376 ? 0.3333 0.3203 0.4191 0.0411  -0.0173 0.0308  1246 ALA A O   
5148 C CB  . ALA A 376 ? 0.3285 0.3323 0.4434 0.0573  -0.0359 0.0343  1246 ALA A CB  
5154 N N   A CYS A 377 ? 0.2960 0.2963 0.3906 0.0362  -0.0275 0.0331  1247 CYS A N   
5155 N N   B CYS A 377 ? 0.2559 0.2561 0.3505 0.0362  -0.0275 0.0332  1247 CYS A N   
5156 C CA  A CYS A 377 ? 0.3284 0.3176 0.4052 0.0290  -0.0251 0.0327  1247 CYS A CA  
5157 C CA  B CYS A 377 ? 0.3326 0.3221 0.4096 0.0289  -0.0252 0.0327  1247 CYS A CA  
5158 C C   A CYS A 377 ? 0.3369 0.3298 0.4130 0.0244  -0.0159 0.0299  1247 CYS A C   
5159 C C   B CYS A 377 ? 0.3350 0.3280 0.4111 0.0244  -0.0160 0.0299  1247 CYS A C   
5160 O O   A CYS A 377 ? 0.3030 0.2850 0.3655 0.0215  -0.0115 0.0286  1247 CYS A O   
5161 O O   B CYS A 377 ? 0.2735 0.2555 0.3360 0.0215  -0.0117 0.0286  1247 CYS A O   
5162 C CB  A CYS A 377 ? 0.4242 0.4159 0.4988 0.0244  -0.0310 0.0339  1247 CYS A CB  
5163 C CB  B CYS A 377 ? 0.4098 0.4030 0.4859 0.0242  -0.0310 0.0338  1247 CYS A CB  
5164 S SG  A CYS A 377 ? 0.5190 0.4973 0.5717 0.0168  -0.0287 0.0331  1247 CYS A SG  
5165 S SG  B CYS A 377 ? 0.5778 0.5630 0.6491 0.0282  -0.0430 0.0370  1247 CYS A SG  
5176 N N   . GLN A 378 ? 0.2673 0.2751 0.3574 0.0233  -0.0131 0.0289  1248 GLN A N   
5177 C CA  . GLN A 378 ? 0.3049 0.3159 0.3937 0.0194  -0.0052 0.0263  1248 GLN A CA  
5178 C C   . GLN A 378 ? 0.2797 0.2846 0.3655 0.0228  0.0010  0.0247  1248 GLN A C   
5179 O O   . GLN A 378 ? 0.2446 0.2428 0.3199 0.0193  0.0058  0.0226  1248 GLN A O   
5180 C CB  . GLN A 378 ? 0.2849 0.3109 0.3877 0.0178  -0.0037 0.0261  1248 GLN A CB  
5181 C CG  . GLN A 378 ? 0.1973 0.2257 0.2984 0.0149  0.0042  0.0236  1248 GLN A CG  
5182 C CD  . GLN A 378 ? 0.3105 0.3337 0.3988 0.0094  0.0048  0.0220  1248 GLN A CD  
5183 O OE1 . GLN A 378 ? 0.2502 0.2786 0.3395 0.0059  0.0041  0.0218  1248 GLN A OE1 
5184 N NE2 . GLN A 378 ? 0.2255 0.2384 0.3017 0.0086  0.0063  0.0208  1248 GLN A NE2 
5194 N N   . TYR A 379 ? 0.2489 0.2565 0.3444 0.0297  0.0007  0.0253  1249 TYR A N   
5195 C CA  . TYR A 379 ? 0.2502 0.2515 0.3429 0.0338  0.0067  0.0235  1249 TYR A CA  
5196 C C   . TYR A 379 ? 0.2997 0.2817 0.3735 0.0331  0.0063  0.0234  1249 TYR A C   
5197 O O   . TYR A 379 ? 0.2733 0.2472 0.3376 0.0310  0.0121  0.0211  1249 TYR A O   
5198 C CB  . TYR A 379 ? 0.2223 0.2308 0.3296 0.0425  0.0059  0.0239  1249 TYR A CB  
5199 C CG  . TYR A 379 ? 0.2558 0.2579 0.3604 0.0476  0.0127  0.0217  1249 TYR A CG  
5200 C CD1 . TYR A 379 ? 0.2411 0.2500 0.3500 0.0460  0.0209  0.0193  1249 TYR A CD1 
5201 C CD2 . TYR A 379 ? 0.2742 0.2614 0.3700 0.0541  0.0107  0.0220  1249 TYR A CD2 
5202 C CE1 . TYR A 379 ? 0.2501 0.2519 0.3552 0.0508  0.0272  0.0170  1249 TYR A CE1 
5203 C CE2 . TYR A 379 ? 0.2907 0.2703 0.3826 0.0590  0.0168  0.0197  1249 TYR A CE2 
5204 C CZ  . TYR A 379 ? 0.2477 0.2349 0.3444 0.0573  0.0251  0.0172  1249 TYR A CZ  
5205 O OH  . TYR A 379 ? 0.2587 0.2370 0.3501 0.0623  0.0313  0.0147  1249 TYR A OH  
5215 N N   . LYS A 380 ? 0.2770 0.2508 0.3444 0.0342  -0.0006 0.0258  1250 LYS A N   
5216 C CA  . LYS A 380 ? 0.2726 0.2262 0.3205 0.0329  -0.0011 0.0261  1250 LYS A CA  
5217 C C   . LYS A 380 ? 0.3479 0.2976 0.3840 0.0235  0.0035  0.0241  1250 LYS A C   
5218 O O   . LYS A 380 ? 0.3380 0.2758 0.3620 0.0211  0.0079  0.0223  1250 LYS A O   
5219 C CB  . LYS A 380 ? 0.3311 0.2770 0.3733 0.0351  -0.0097 0.0293  1250 LYS A CB  
5220 C CG  . LYS A 380 ? 0.4100 0.3335 0.4296 0.0323  -0.0103 0.0300  1250 LYS A CG  
5221 C CD  . LYS A 380 ? 0.4157 0.3302 0.4291 0.0360  -0.0194 0.0334  1250 LYS A CD  
5222 C CE  . LYS A 380 ? 0.6715 0.5611 0.6601 0.0330  -0.0196 0.0346  1250 LYS A CE  
5223 N NZ  . LYS A 380 ? 0.8644 0.7415 0.8453 0.0394  -0.0290 0.0380  1250 LYS A NZ  
5237 N N   . LEU A 381 ? 0.2539 0.2139 0.2936 0.0183  0.0021  0.0240  1251 LEU A N   
5238 C CA  . LEU A 381 ? 0.2339 0.1933 0.2649 0.0103  0.0058  0.0216  1251 LEU A CA  
5239 C C   . LEU A 381 ? 0.3274 0.2915 0.3609 0.0086  0.0126  0.0183  1251 LEU A C   
5240 O O   . LEU A 381 ? 0.3044 0.2630 0.3280 0.0032  0.0164  0.0157  1251 LEU A O   
5241 C CB  . LEU A 381 ? 0.2629 0.2326 0.2982 0.0068  0.0025  0.0221  1251 LEU A CB  
5242 C CG  . LEU A 381 ? 0.4264 0.3880 0.4526 0.0056  -0.0032 0.0244  1251 LEU A CG  
5243 C CD1 . LEU A 381 ? 0.3642 0.3359 0.3962 0.0038  -0.0073 0.0250  1251 LEU A CD1 
5244 C CD2 . LEU A 381 ? 0.4376 0.3867 0.4468 -0.0004 0.0001  0.0229  1251 LEU A CD2 
5256 N N   . ALA A 382 ? 0.2486 0.2228 0.2949 0.0128  0.0142  0.0181  1252 ALA A N   
5257 C CA  . ALA A 382 ? 0.2564 0.2339 0.3038 0.0117  0.0205  0.0152  1252 ALA A CA  
5258 C C   . ALA A 382 ? 0.2769 0.2409 0.3148 0.0133  0.0243  0.0137  1252 ALA A C   
5259 O O   . ALA A 382 ? 0.3128 0.2731 0.3433 0.0092  0.0286  0.0106  1252 ALA A O   
5260 C CB  . ALA A 382 ? 0.2587 0.2490 0.3209 0.0155  0.0219  0.0156  1252 ALA A CB  
5266 N N   . VAL A 383 ? 0.2740 0.2298 0.3115 0.0195  0.0223  0.0156  1253 VAL A N   
5267 C CA  . VAL A 383 ? 0.2738 0.2139 0.3005 0.0219  0.0254  0.0143  1253 VAL A CA  
5268 C C   . VAL A 383 ? 0.3216 0.2469 0.3307 0.0148  0.0255  0.0136  1253 VAL A C   
5269 O O   . VAL A 383 ? 0.3427 0.2581 0.3415 0.0116  0.0298  0.0109  1253 VAL A O   
5270 C CB  . VAL A 383 ? 0.3428 0.2774 0.3734 0.0317  0.0225  0.0166  1253 VAL A CB  
5271 C CG1 . VAL A 383 ? 0.3990 0.3124 0.4139 0.0340  0.0245  0.0156  1253 VAL A CG1 
5272 C CG2 . VAL A 383 ? 0.3457 0.2956 0.3942 0.0381  0.0247  0.0162  1253 VAL A CG2 
5282 N N   . GLU A 384 ? 0.3606 0.2842 0.3657 0.0118  0.0210  0.0157  1254 GLU A N   
5283 C CA  . GLU A 384 ? 0.4044 0.3148 0.3928 0.0041  0.0217  0.0150  1254 GLU A CA  
5284 C C   . GLU A 384 ? 0.4507 0.3679 0.4375 -0.0042 0.0264  0.0109  1254 GLU A C   
5285 O O   . GLU A 384 ? 0.3712 0.2773 0.3459 -0.0098 0.0299  0.0086  1254 GLU A O   
5286 C CB  . GLU A 384 ? 0.3768 0.2860 0.3617 0.0022  0.0166  0.0178  1254 GLU A CB  
5287 C CG  . GLU A 384 ? 0.5085 0.4053 0.4889 0.0093  0.0110  0.0216  1254 GLU A CG  
5288 C CD  . GLU A 384 ? 0.7921 0.6885 0.7693 0.0078  0.0053  0.0243  1254 GLU A CD  
5289 O OE1 . GLU A 384 ? 0.5617 0.4679 0.5406 0.0014  0.0062  0.0232  1254 GLU A OE1 
5290 O OE2 . GLU A 384 ? 0.5673 0.4529 0.5394 0.0134  -0.0005 0.0275  1254 GLU A OE2 
5297 N N   . ARG A 385 ? 0.3002 0.2351 0.2989 -0.0051 0.0262  0.0099  1255 ARG A N   
5298 C CA  . ARG A 385 ? 0.3555 0.2982 0.3537 -0.0117 0.0295  0.0059  1255 ARG A CA  
5299 C C   . ARG A 385 ? 0.3267 0.2662 0.3234 -0.0109 0.0338  0.0031  1255 ARG A C   
5300 O O   . ARG A 385 ? 0.3436 0.2817 0.3340 -0.0171 0.0366  -0.0006 1255 ARG A O   
5301 C CB  . ARG A 385 ? 0.2583 0.2184 0.2679 -0.0116 0.0274  0.0058  1255 ARG A CB  
5302 C CG  . ARG A 385 ? 0.3005 0.2698 0.3103 -0.0171 0.0295  0.0014  1255 ARG A CG  
5303 C CD  . ARG A 385 ? 0.2849 0.2484 0.2842 -0.0249 0.0317  -0.0015 1255 ARG A CD  
5304 N NE  . ARG A 385 ? 0.3040 0.2630 0.2977 -0.0277 0.0300  0.0003  1255 ARG A NE  
5305 C CZ  . ARG A 385 ? 0.3122 0.2809 0.3088 -0.0299 0.0283  -0.0002 1255 ARG A CZ  
5306 N NH1 . ARG A 385 ? 0.2943 0.2773 0.2994 -0.0291 0.0275  -0.0025 1255 ARG A NH1 
5307 N NH2 . ARG A 385 ? 0.2946 0.2571 0.2841 -0.0325 0.0272  0.0015  1255 ARG A NH2 
5321 N N   . TYR A 386 ? 0.3116 0.2504 0.3142 -0.0034 0.0344  0.0045  1256 TYR A N   
5322 C CA  . TYR A 386 ? 0.2956 0.2292 0.2953 -0.0016 0.0389  0.0020  1256 TYR A CA  
5323 C C   . TYR A 386 ? 0.3652 0.2800 0.3490 -0.0051 0.0409  0.0004  1256 TYR A C   
5324 O O   . TYR A 386 ? 0.3590 0.2698 0.3360 -0.0096 0.0442  -0.0032 1256 TYR A O   
5325 C CB  . TYR A 386 ? 0.3084 0.2442 0.3175 0.0078  0.0396  0.0040  1256 TYR A CB  
5326 C CG  . TYR A 386 ? 0.2914 0.2218 0.2975 0.0107  0.0448  0.0014  1256 TYR A CG  
5327 C CD1 . TYR A 386 ? 0.2692 0.2093 0.2799 0.0099  0.0479  -0.0008 1256 TYR A CD1 
5328 C CD2 . TYR A 386 ? 0.3498 0.2638 0.3468 0.0148  0.0467  0.0011  1256 TYR A CD2 
5329 C CE1 . TYR A 386 ? 0.3749 0.3091 0.3813 0.0125  0.0530  -0.0032 1256 TYR A CE1 
5330 C CE2 . TYR A 386 ? 0.3615 0.2696 0.3547 0.0179  0.0518  -0.0016 1256 TYR A CE2 
5331 C CZ  . TYR A 386 ? 0.3695 0.2880 0.3675 0.0166  0.0551  -0.0038 1256 TYR A CZ  
5332 O OH  . TYR A 386 ? 0.3800 0.2914 0.3724 0.0195  0.0604  -0.0065 1256 TYR A OH  
5342 N N   . GLU A 387 ? 0.3767 0.2789 0.3535 -0.0036 0.0386  0.0032  1257 GLU A N   
5343 C CA  . GLU A 387 ? 0.4658 0.3469 0.4253 -0.0069 0.0403  0.0023  1257 GLU A CA  
5344 C C   . GLU A 387 ? 0.4295 0.3095 0.3801 -0.0189 0.0417  -0.0003 1257 GLU A C   
5345 O O   . GLU A 387 ? 0.4078 0.2768 0.3470 -0.0248 0.0449  -0.0034 1257 GLU A O   
5346 C CB  . GLU A 387 ? 0.3910 0.2576 0.3441 -0.0012 0.0367  0.0063  1257 GLU A CB  
5347 C CG  . GLU A 387 ? 0.4889 0.3538 0.4491 0.0109  0.0360  0.0079  1257 GLU A CG  
5348 C CD  . GLU A 387 ? 0.7766 0.6307 0.7298 0.0131  0.0409  0.0048  1257 GLU A CD  
5349 O OE1 . GLU A 387 ? 0.7435 0.5797 0.6795 0.0071  0.0430  0.0030  1257 GLU A OE1 
5350 O OE2 . GLU A 387 ? 0.6434 0.5063 0.6075 0.0203  0.0430  0.0040  1257 GLU A OE2 
5357 N N   . TRP A 388 ? 0.3748 0.2667 0.3310 -0.0225 0.0393  0.0006  1258 TRP A N   
5358 C CA  . TRP A 388 ? 0.4084 0.3031 0.3590 -0.0334 0.0410  -0.0023 1258 TRP A CA  
5359 C C   . TRP A 388 ? 0.4226 0.3287 0.3779 -0.0378 0.0435  -0.0073 1258 TRP A C   
5360 O O   . TRP A 388 ? 0.4194 0.3216 0.3668 -0.0466 0.0462  -0.0110 1258 TRP A O   
5361 C CB  . TRP A 388 ? 0.3274 0.2342 0.2845 -0.0345 0.0380  -0.0005 1258 TRP A CB  
5362 C CG  . TRP A 388 ? 0.3531 0.2659 0.3066 -0.0450 0.0403  -0.0039 1258 TRP A CG  
5363 C CD1 . TRP A 388 ? 0.3917 0.3241 0.3556 -0.0476 0.0400  -0.0068 1258 TRP A CD1 
5364 C CD2 . TRP A 388 ? 0.4950 0.3944 0.4338 -0.0543 0.0433  -0.0050 1258 TRP A CD2 
5365 N NE1 . TRP A 388 ? 0.4218 0.3560 0.3802 -0.0573 0.0428  -0.0099 1258 TRP A NE1 
5366 C CE2 . TRP A 388 ? 0.4395 0.3538 0.3824 -0.0623 0.0453  -0.0089 1258 TRP A CE2 
5367 C CE3 . TRP A 388 ? 0.4673 0.3429 0.3890 -0.0565 0.0447  -0.0032 1258 TRP A CE3 
5368 C CZ2 . TRP A 388 ? 0.4789 0.3869 0.4110 -0.0734 0.0493  -0.0111 1258 TRP A CZ2 
5369 C CZ3 . TRP A 388 ? 0.6176 0.4843 0.5263 -0.0679 0.0485  -0.0050 1258 TRP A CZ3 
5370 C CH2 . TRP A 388 ? 0.5917 0.4755 0.5063 -0.0767 0.0511  -0.0090 1258 TRP A CH2 
5381 N N   . ASN A 389 ? 0.3394 0.2591 0.3070 -0.0319 0.0426  -0.0075 1259 ASN A N   
5382 C CA  . ASN A 389 ? 0.4313 0.3606 0.4023 -0.0345 0.0441  -0.0120 1259 ASN A CA  
5383 C C   . ASN A 389 ? 0.4270 0.3416 0.3867 -0.0370 0.0473  -0.0148 1259 ASN A C   
5384 O O   . ASN A 389 ? 0.4284 0.3453 0.3844 -0.0443 0.0485  -0.0193 1259 ASN A O   
5385 C CB  . ASN A 389 ? 0.3451 0.2867 0.3280 -0.0270 0.0429  -0.0109 1259 ASN A CB  
5386 C CG  . ASN A 389 ? 0.3402 0.2982 0.3332 -0.0270 0.0397  -0.0102 1259 ASN A CG  
5387 O OD1 . ASN A 389 ? 0.3311 0.2941 0.3231 -0.0327 0.0387  -0.0117 1259 ASN A OD1 
5388 N ND2 . ASN A 389 ? 0.3237 0.2898 0.3259 -0.0207 0.0383  -0.0081 1259 ASN A ND2 
5395 N N   . LYS A 390 ? 0.4181 0.3178 0.3723 -0.0308 0.0484  -0.0124 1260 LYS A N   
5396 C CA  . LYS A 390 ? 0.4622 0.3451 0.4038 -0.0323 0.0515  -0.0149 1260 LYS A CA  
5397 C C   . LYS A 390 ? 0.4613 0.3331 0.3897 -0.0434 0.0526  -0.0173 1260 LYS A C   
5398 O O   . LYS A 390 ? 0.5378 0.4053 0.4591 -0.0498 0.0545  -0.0217 1260 LYS A O   
5399 C CB  . LYS A 390 ? 0.5007 0.3683 0.4381 -0.0227 0.0522  -0.0117 1260 LYS A CB  
5400 C CG  . LYS A 390 ? 0.7405 0.6134 0.6855 -0.0140 0.0540  -0.0121 1260 LYS A CG  
5401 C CD  . LYS A 390 ? 0.8447 0.7131 0.7944 -0.0028 0.0536  -0.0082 1260 LYS A CD  
5402 C CE  . LYS A 390 ? 0.8226 0.6670 0.7573 0.0005  0.0552  -0.0084 1260 LYS A CE  
5403 N NZ  . LYS A 390 ? 0.9346 0.7761 0.8718 0.0104  0.0586  -0.0092 1260 LYS A NZ  
5417 N N   . LEU A 391 ? 0.4592 0.3263 0.3839 -0.0462 0.0516  -0.0146 1261 LEU A N   
5418 C CA  . LEU A 391 ? 0.5232 0.3786 0.4344 -0.0575 0.0535  -0.0164 1261 LEU A CA  
5419 C C   . LEU A 391 ? 0.6731 0.5465 0.5906 -0.0676 0.0542  -0.0213 1261 LEU A C   
5420 O O   . LEU A 391 ? 0.5845 0.4515 0.4928 -0.0783 0.0567  -0.0249 1261 LEU A O   
5421 C CB  . LEU A 39