data_3B84
# 
_entry.id   3B84 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3B84         
RCSB  RCSB045197   
WWPDB D_1000045197 
# 
_pdbx_database_status.entry_id                        3B84 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-10-31 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Filippakopoulos, P.'                  1  
'Bullock, A.'                          2  
'Cooper, C.'                           3  
'Keates, T.'                           4  
'Salah, E.'                            5  
'Pilka, E.'                            6  
'Pike, A.C.W.'                         7  
'von Delft, F.'                        8  
'Arrowsmith, C.H.'                     9  
'Edwards, A.M.'                        10 
'Weigelt, J.'                          11 
'Knapp, S.'                            12 
'Structural Genomics Consortium (SGC)' 13 
# 
_citation.id                        primary 
_citation.title                     
'Crystal Structure of the Human BTB domain of the Krueppel related Zinc Finger Protein 3 (HKR3).' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Filippakopoulos, P.' 1  
primary 'Bullock, A.'         2  
primary 'Cooper, C.'          3  
primary 'Keates, T.'          4  
primary 'Salah, E.'           5  
primary 'Pilka, E.'           6  
primary 'Pike, A.C.W.'        7  
primary 'von Delft, F.'       8  
primary 'Arrowsmith, C.H.'    9  
primary 'Edwards, A.M.'       10 
primary 'Weigelt, J.'         11 
primary 'Knapp, S.'           12 
# 
_cell.length_a           50.375 
_cell.length_b           50.375 
_cell.length_c           86.093 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           3B84 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              6 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.entry_id                         3B84 
_symmetry.Int_Tables_number                152 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Zinc finger and BTB domain-containing protein 48' 13055.898 1  ? ? 'Residues 4-120' ? 
2 non-polymer syn UNKNOWN                                            103.120   2  ? ? ?                ? 
3 non-polymer syn 1,2-ETHANEDIOL                                     62.068    2  ? ? ?                ? 
4 water       nat water                                              18.015    64 ? ? ?                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Krueppel-related zinc finger protein 3, Protein HKR3' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHFFQSLYGDGSGGSVVLPAGFAEIFGLLLDFFY
TGHLALTSGNRDQVLLAARELRVPEAVELCQSFKPKTSV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHFFQSLYGDGSGGSVVLPAGFAEIFGLLLDFFY
TGHLALTSGNRDQVLLAARELRVPEAVELCQSFKPKTSV
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   SER n 
1 4   PHE n 
1 5   VAL n 
1 6   GLN n 
1 7   HIS n 
1 8   SER n 
1 9   VAL n 
1 10  ARG n 
1 11  VAL n 
1 12  LEU n 
1 13  GLN n 
1 14  GLU n 
1 15  LEU n 
1 16  ASN n 
1 17  LYS n 
1 18  GLN n 
1 19  ARG n 
1 20  GLU n 
1 21  LYS n 
1 22  GLY n 
1 23  GLN n 
1 24  TYR n 
1 25  CYS n 
1 26  ASP n 
1 27  ALA n 
1 28  THR n 
1 29  LEU n 
1 30  ASP n 
1 31  VAL n 
1 32  GLY n 
1 33  GLY n 
1 34  LEU n 
1 35  VAL n 
1 36  PHE n 
1 37  LYS n 
1 38  ALA n 
1 39  HIS n 
1 40  TRP n 
1 41  SER n 
1 42  VAL n 
1 43  LEU n 
1 44  ALA n 
1 45  CYS n 
1 46  CYS n 
1 47  SER n 
1 48  HIS n 
1 49  PHE n 
1 50  PHE n 
1 51  GLN n 
1 52  SER n 
1 53  LEU n 
1 54  TYR n 
1 55  GLY n 
1 56  ASP n 
1 57  GLY n 
1 58  SER n 
1 59  GLY n 
1 60  GLY n 
1 61  SER n 
1 62  VAL n 
1 63  VAL n 
1 64  LEU n 
1 65  PRO n 
1 66  ALA n 
1 67  GLY n 
1 68  PHE n 
1 69  ALA n 
1 70  GLU n 
1 71  ILE n 
1 72  PHE n 
1 73  GLY n 
1 74  LEU n 
1 75  LEU n 
1 76  LEU n 
1 77  ASP n 
1 78  PHE n 
1 79  PHE n 
1 80  TYR n 
1 81  THR n 
1 82  GLY n 
1 83  HIS n 
1 84  LEU n 
1 85  ALA n 
1 86  LEU n 
1 87  THR n 
1 88  SER n 
1 89  GLY n 
1 90  ASN n 
1 91  ARG n 
1 92  ASP n 
1 93  GLN n 
1 94  VAL n 
1 95  LEU n 
1 96  LEU n 
1 97  ALA n 
1 98  ALA n 
1 99  ARG n 
1 100 GLU n 
1 101 LEU n 
1 102 ARG n 
1 103 VAL n 
1 104 PRO n 
1 105 GLU n 
1 106 ALA n 
1 107 VAL n 
1 108 GLU n 
1 109 LEU n 
1 110 CYS n 
1 111 GLN n 
1 112 SER n 
1 113 PHE n 
1 114 LYS n 
1 115 PRO n 
1 116 LYS n 
1 117 THR n 
1 118 SER n 
1 119 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'ZBTB48, HKR3' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)(R3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC28-Bsa4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ZBT48_HUMAN 
_struct_ref.pdbx_db_accession          P10074 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHFFQSLYGDGSGGSVVLPAGFAEIFGLLLDFFYTG
HLALTSGNRDQVLLAARELRVPEAVELCQSFKPKTSV
;
_struct_ref.pdbx_align_begin           4 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3B84 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 119 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P10074 
_struct_ref_seq.db_align_beg                  4 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  120 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       4 
_struct_ref_seq.pdbx_auth_seq_align_end       120 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3B84 SER A 1 ? UNP P10074 ? ? 'EXPRESSION TAG' 2 1 
1 3B84 MET A 2 ? UNP P10074 ? ? 'EXPRESSION TAG' 3 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL  'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE       ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                 'C9 H11 N O3'    181.189 
UNK 'L-peptide linking' . UNKNOWN         ?                 'C4 H9 N O2'     103.120 
VAL 'L-peptide linking' y VALINE          ?                 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3B84 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.38 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   48.34 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'0.2M MgCl2, 0.1M Bis-tris pH 6.5, 25% PEG 3350, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2007-10-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98248 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SRS BEAMLINE PX10.1' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.98248 
_diffrn_source.pdbx_synchrotron_site       SRS 
_diffrn_source.pdbx_synchrotron_beamline   PX10.1 
# 
_reflns.entry_id                     3B84 
_reflns.d_resolution_high            1.740 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   13630 
_reflns.pdbx_Rmerge_I_obs            0.084 
_reflns.pdbx_netI_over_sigmaI        10.600 
_reflns.pdbx_chi_squared             1.027 
_reflns.pdbx_redundancy              9.300 
_reflns.percent_possible_obs         100.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.number_all                   13630 
_reflns.pdbx_Rsym_value              0.084 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.74 
_reflns_shell.d_res_low              1.80 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.761 
_reflns_shell.meanI_over_sigI_obs    2.075 
_reflns_shell.pdbx_Rsym_value        0.761 
_reflns_shell.pdbx_chi_squared       1.064 
_reflns_shell.pdbx_redundancy        7.10 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1336 
_reflns_shell.percent_possible_all   100.00 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3B84 
_refine.ls_d_res_high                            1.740 
_refine.ls_d_res_low                             43.640 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    99.950 
_refine.ls_number_reflns_obs                     13592 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.188 
_refine.ls_R_factor_R_work                       0.186 
_refine.ls_R_factor_R_free                       0.216 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  673 
_refine.B_iso_mean                               28.351 
_refine.aniso_B[1][1]                            1.020 
_refine.aniso_B[2][2]                            1.020 
_refine.aniso_B[3][3]                            -1.530 
_refine.aniso_B[1][2]                            0.510 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.959 
_refine.correlation_coeff_Fo_to_Fc_free          0.951 
_refine.pdbx_overall_ESU_R                       0.106 
_refine.pdbx_overall_ESU_R_Free                  0.103 
_refine.overall_SU_ML                            0.070 
_refine.overall_SU_B                             4.431 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     13592 
_refine.ls_R_factor_all                          0.188 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      'PDB entry 2NN2' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        852 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             64 
_refine_hist.number_atoms_total               926 
_refine_hist.d_res_high                       1.740 
_refine_hist.d_res_low                        43.640 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         901  0.016  0.022  ? 'X-RAY DIFFRACTION' ? 
r_bond_other_d           606  0.002  0.020  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1209 1.548  1.941  ? 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        1464 2.295  3.004  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   112  5.717  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   40   32.761 23.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   141  14.701 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   5    21.970 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           134  0.084  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     1009 0.006  0.020  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       209  0.002  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            185  0.232  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbd_other              617  0.192  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          446  0.192  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_other            460  0.100  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    42   0.149  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   9    0.193  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     36   0.293  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 10   0.156  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              566  3.506  3.000  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_other           234  1.058  3.000  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             885  4.729  5.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              370  6.613  8.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             324  9.084  11.000 ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.74 
_refine_ls_shell.d_res_low                        1.78 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               99.800 
_refine_ls_shell.number_reflns_R_work             935 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.229 
_refine_ls_shell.R_factor_R_free                  0.397 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             50 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                985 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3B84 
_struct.title                     'Crystal structure of the human BTB domain of the Krueppel related Zinc Finger Protein 3 (HKR3)' 
_struct.pdbx_descriptor           'Zinc finger and BTB domain-containing protein 48, Water' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3B84 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            
;BTB, Krueppel related zinc finger protein 3, HKR3, ZBTB48, zinc finger, oncogene, Structural Genomics Consortium, SGC, Activator, DNA-binding, Metal-binding, Nucleus, Transcription, Transcription regulation, Zinc-finger
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 3   ? GLY A 22  ? SER A 4   GLY A 23  1 ? 20 
HELX_P HELX_P2 2 HIS A 39  ? SER A 47  ? HIS A 40  SER A 48  1 ? 9  
HELX_P HELX_P3 3 SER A 47  ? GLY A 55  ? SER A 48  GLY A 56  1 ? 9  
HELX_P HELX_P4 4 PRO A 65  ? GLY A 67  ? PRO A 66  GLY A 68  5 ? 3  
HELX_P HELX_P5 5 PHE A 68  ? GLY A 82  ? PHE A 69  GLY A 83  1 ? 15 
HELX_P HELX_P6 6 ASN A 90  ? LEU A 101 ? ASN A 91  LEU A 102 1 ? 12 
HELX_P HELX_P7 7 VAL A 103 ? PHE A 113 ? VAL A 104 PHE A 114 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A CYS 45 SG A ? ? 1_555 B UNK . S A ? A CYS 46 A UNK 900 1_555 ? ? ? ? ? ? ? 2.036 ? 
covale2 covale ? ? A CYS 45 SG B ? ? 1_555 B UNK . S B ? A CYS 46 A UNK 900 1_555 ? ? ? ? ? ? ? 2.001 ? 
covale3 covale ? ? A CYS 46 SG ? ? ? 1_555 C UNK . S ? ? A CYS 47 A UNK 901 1_555 ? ? ? ? ? ? ? 2.090 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 34 ? ALA A 38 ? LEU A 35 ALA A 39 
A 2 ALA A 27 ? VAL A 31 ? ALA A 28 VAL A 32 
A 3 VAL A 62 ? LEU A 64 ? VAL A 63 LEU A 65 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 34 ? O LEU A 35 N VAL A 31 ? N VAL A 32 
A 2 3 N ASP A 30 ? N ASP A 31 O VAL A 62 ? O VAL A 63 
# 
_atom_sites.entry_id                    3B84 
_atom_sites.fract_transf_matrix[1][1]   0.019851 
_atom_sites.fract_transf_matrix[1][2]   0.011461 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.022922 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011615 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . MET A 1 2   ? 40.455 30.032 23.149  1.00 60.86 ? 3   MET A N   1 
ATOM   2   C CA  . MET A 1 2   ? 39.498 30.428 24.224  1.00 60.43 ? 3   MET A CA  1 
ATOM   3   C C   . MET A 1 2   ? 38.168 29.674 24.059  1.00 58.13 ? 3   MET A C   1 
ATOM   4   O O   . MET A 1 2   ? 37.833 28.786 24.866  1.00 58.52 ? 3   MET A O   1 
ATOM   5   C CB  . MET A 1 2   ? 39.258 31.944 24.222  1.00 63.36 ? 3   MET A CB  1 
ATOM   6   N N   . SER A 1 3   ? 37.417 30.014 23.014  1.00 41.92 ? 4   SER A N   1 
ATOM   7   C CA  . SER A 1 3   ? 36.136 29.394 22.816  1.00 29.81 ? 4   SER A CA  1 
ATOM   8   C C   . SER A 1 3   ? 36.370 28.031 22.177  1.00 27.65 ? 4   SER A C   1 
ATOM   9   O O   . SER A 1 3   ? 37.462 27.711 21.619  1.00 29.28 ? 4   SER A O   1 
ATOM   10  C CB  . SER A 1 3   ? 35.183 30.252 21.975  1.00 35.54 ? 4   SER A CB  1 
ATOM   11  O OG  . SER A 1 3   ? 35.546 30.246 20.600  1.00 33.68 ? 4   SER A OG  1 
ATOM   12  N N   . PHE A 1 4   ? 35.338 27.228 22.226  1.00 28.76 ? 5   PHE A N   1 
ATOM   13  C CA  . PHE A 1 4   ? 35.388 25.944 21.567  1.00 26.90 ? 5   PHE A CA  1 
ATOM   14  C C   . PHE A 1 4   ? 35.474 26.127 20.051  1.00 28.00 ? 5   PHE A C   1 
ATOM   15  O O   . PHE A 1 4   ? 36.186 25.367 19.346  1.00 30.97 ? 5   PHE A O   1 
ATOM   16  C CB  . PHE A 1 4   ? 34.152 25.133 21.933  1.00 24.90 ? 5   PHE A CB  1 
ATOM   17  C CG  . PHE A 1 4   ? 34.163 23.753 21.384  1.00 28.76 ? 5   PHE A CG  1 
ATOM   18  C CD1 . PHE A 1 4   ? 34.827 22.723 22.047  1.00 32.68 ? 5   PHE A CD1 1 
ATOM   19  C CD2 . PHE A 1 4   ? 33.543 23.456 20.182  1.00 27.48 ? 5   PHE A CD2 1 
ATOM   20  C CE1 . PHE A 1 4   ? 34.815 21.439 21.544  1.00 31.18 ? 5   PHE A CE1 1 
ATOM   21  C CE2 . PHE A 1 4   ? 33.568 22.184 19.662  1.00 27.86 ? 5   PHE A CE2 1 
ATOM   22  C CZ  . PHE A 1 4   ? 34.194 21.162 20.363  1.00 29.12 ? 5   PHE A CZ  1 
ATOM   23  N N   . VAL A 1 5   ? 34.824 27.166 19.531  1.00 28.16 ? 6   VAL A N   1 
ATOM   24  C CA  . VAL A 1 5   ? 34.877 27.425 18.066  1.00 27.30 ? 6   VAL A CA  1 
ATOM   25  C C   . VAL A 1 5   ? 36.313 27.773 17.668  1.00 27.75 ? 6   VAL A C   1 
ATOM   26  O O   . VAL A 1 5   ? 36.850 27.203 16.706  1.00 31.68 ? 6   VAL A O   1 
ATOM   27  C CB  . VAL A 1 5   ? 33.872 28.508 17.590  1.00 29.67 ? 6   VAL A CB  1 
ATOM   28  C CG1 . VAL A 1 5   ? 33.989 28.740 16.048  1.00 30.44 ? 6   VAL A CG1 1 
ATOM   29  C CG2 . VAL A 1 5   ? 32.471 28.104 17.937  1.00 31.23 ? 6   VAL A CG2 1 
ATOM   30  N N   . GLN A 1 6   ? 36.967 28.628 18.452  1.00 29.80 ? 7   GLN A N   1 
ATOM   31  C CA  . GLN A 1 6   ? 38.344 29.024 18.205  1.00 32.68 ? 7   GLN A CA  1 
ATOM   32  C C   . GLN A 1 6   ? 39.263 27.821 18.228  1.00 34.72 ? 7   GLN A C   1 
ATOM   33  O O   . GLN A 1 6   ? 40.070 27.612 17.315  1.00 32.80 ? 7   GLN A O   1 
ATOM   34  C CB  . GLN A 1 6   ? 38.798 30.026 19.218  1.00 33.97 ? 7   GLN A CB  1 
ATOM   35  C CG  . GLN A 1 6   ? 38.070 31.357 19.062  1.00 43.15 ? 7   GLN A CG  1 
ATOM   36  C CD  . GLN A 1 6   ? 38.406 32.319 20.186  1.00 58.45 ? 7   GLN A CD  1 
ATOM   37  O OE1 . GLN A 1 6   ? 39.534 32.331 20.685  1.00 75.54 ? 7   GLN A OE1 1 
ATOM   38  N NE2 . GLN A 1 6   ? 37.423 33.123 20.598  1.00 64.75 ? 7   GLN A NE2 1 
ATOM   39  N N   . HIS A 1 7   ? 39.093 26.986 19.254  1.00 29.53 ? 8   HIS A N   1 
ATOM   40  C CA  . HIS A 1 7   ? 39.827 25.728 19.311  1.00 27.44 ? 8   HIS A CA  1 
ATOM   41  C C   . HIS A 1 7   ? 39.568 24.760 18.164  1.00 28.66 ? 8   HIS A C   1 
ATOM   42  O O   . HIS A 1 7   ? 40.529 24.106 17.663  1.00 30.72 ? 8   HIS A O   1 
ATOM   43  C CB  . HIS A 1 7   ? 39.569 25.027 20.654  1.00 28.81 ? 8   HIS A CB  1 
ATOM   44  C CG  . HIS A 1 7   ? 40.575 23.967 20.974  1.00 31.25 ? 8   HIS A CG  1 
ATOM   45  N ND1 . HIS A 1 7   ? 41.900 24.248 21.206  1.00 35.62 ? 8   HIS A ND1 1 
ATOM   46  C CD2 . HIS A 1 7   ? 40.441 22.620 21.116  1.00 33.38 ? 8   HIS A CD2 1 
ATOM   47  C CE1 . HIS A 1 7   ? 42.540 23.122 21.467  1.00 37.77 ? 8   HIS A CE1 1 
ATOM   48  N NE2 . HIS A 1 7   ? 41.690 22.119 21.373  1.00 30.18 ? 8   HIS A NE2 1 
ATOM   49  N N   . SER A 1 8   ? 38.303 24.640 17.720  1.00 28.88 ? 9   SER A N   1 
ATOM   50  C CA  . SER A 1 8   ? 37.933 23.790 16.591  1.00 27.16 ? 9   SER A CA  1 
ATOM   51  C C   . SER A 1 8   ? 38.703 24.187 15.344  1.00 28.15 ? 9   SER A C   1 
ATOM   52  O O   . SER A 1 8   ? 39.267 23.365 14.625  1.00 30.18 ? 9   SER A O   1 
ATOM   53  C CB  . SER A 1 8   ? 36.430 23.939 16.278  1.00 31.08 ? 9   SER A CB  1 
ATOM   54  O OG  . SER A 1 8   ? 35.637 23.411 17.374  1.00 36.34 ? 9   SER A OG  1 
ATOM   55  N N   . VAL A 1 9   ? 38.744 25.505 15.103  1.00 27.99 ? 10  VAL A N   1 
ATOM   56  C CA  . VAL A 1 9   ? 39.461 26.026 13.910  1.00 27.49 ? 10  VAL A CA  1 
ATOM   57  C C   . VAL A 1 9   ? 40.946 25.691 14.029  1.00 28.32 ? 10  VAL A C   1 
ATOM   58  O O   . VAL A 1 9   ? 41.595 25.200 13.089  1.00 30.86 ? 10  VAL A O   1 
ATOM   59  C CB  . VAL A 1 9   ? 39.194 27.495 13.749  1.00 31.27 ? 10  VAL A CB  1 
ATOM   60  C CG1 . VAL A 1 9   ? 40.213 28.131 12.713  1.00 30.12 ? 10  VAL A CG1 1 
ATOM   61  C CG2 . VAL A 1 9   ? 37.763 27.676 13.291  1.00 29.69 ? 10  VAL A CG2 1 
ATOM   62  N N   . ARG A 1 10  ? 41.492 25.909 15.215  1.00 29.57 ? 11  ARG A N   1 
ATOM   63  C CA  . ARG A 1 10  ? 42.891 25.636 15.450  1.00 29.32 ? 11  ARG A CA  1 
ATOM   64  C C   . ARG A 1 10  ? 43.248 24.188 15.198  0.50 21.01 ? 11  ARG A C   1 
ATOM   65  O O   . ARG A 1 10  ? 44.233 23.898 14.485  1.00 29.35 ? 11  ARG A O   1 
ATOM   66  C CB  . ARG A 1 10  ? 43.241 26.063 16.845  1.00 37.84 ? 11  ARG A CB  1 
ATOM   67  C CG  A ARG A 1 10  ? 44.617 25.774 17.202  0.50 40.94 ? 11  ARG A CG  1 
ATOM   68  C CG  B ARG A 1 10  ? 44.700 25.906 17.250  0.50 44.42 ? 11  ARG A CG  1 
ATOM   69  C CD  A ARG A 1 10  ? 44.937 26.531 18.428  0.50 60.61 ? 11  ARG A CD  1 
ATOM   70  C CD  B ARG A 1 10  ? 45.000 26.658 18.574  0.50 39.34 ? 11  ARG A CD  1 
ATOM   71  N NE  A ARG A 1 10  ? 46.240 26.154 18.907  0.50 62.25 ? 11  ARG A NE  1 
ATOM   72  N NE  B ARG A 1 10  ? 43.848 27.429 19.031  0.50 43.35 ? 11  ARG A NE  1 
ATOM   73  C CZ  A ARG A 1 10  ? 46.692 26.498 20.093  0.50 60.03 ? 11  ARG A CZ  1 
ATOM   74  N NH1 A ARG A 1 10  ? 45.910 27.199 20.912  0.50 38.21 ? 11  ARG A NH1 1 
ATOM   75  N NH2 A ARG A 1 10  ? 47.906 26.113 20.442  0.50 57.75 ? 11  ARG A NH2 1 
ATOM   76  N N   . VAL A 1 11  ? 42.441 23.287 15.719  1.00 29.74 ? 12  VAL A N   1 
ATOM   77  C CA  . VAL A 1 11  ? 42.640 21.848 15.504  1.00 30.53 ? 12  VAL A CA  1 
ATOM   78  C C   . VAL A 1 11  ? 42.541 21.510 14.024  1.00 30.28 ? 12  VAL A C   1 
ATOM   79  O O   . VAL A 1 11  ? 43.389 20.762 13.490  1.00 29.11 ? 12  VAL A O   1 
ATOM   80  C CB  . VAL A 1 11  ? 41.695 21.021 16.412  1.00 29.53 ? 12  VAL A CB  1 
ATOM   81  C CG1 . VAL A 1 11  ? 41.731 19.514 16.068  1.00 29.98 ? 12  VAL A CG1 1 
ATOM   82  C CG2 . VAL A 1 11  ? 42.069 21.175 17.914  1.00 29.78 ? 12  VAL A CG2 1 
ATOM   83  N N   . LEU A 1 12  ? 41.502 21.987 13.344  1.00 29.39 ? 13  LEU A N   1 
ATOM   84  C CA  . LEU A 1 12  ? 41.342 21.611 11.919  1.00 32.65 ? 13  LEU A CA  1 
ATOM   85  C C   . LEU A 1 12  ? 42.463 22.176 11.051  1.00 30.55 ? 13  LEU A C   1 
ATOM   86  O O   . LEU A 1 12  ? 42.976 21.516 10.120  1.00 29.53 ? 13  LEU A O   1 
ATOM   87  C CB  . LEU A 1 12  ? 39.954 21.979 11.392  1.00 31.77 ? 13  LEU A CB  1 
ATOM   88  C CG  . LEU A 1 12  ? 39.717 21.402 9.995   1.00 31.74 ? 13  LEU A CG  1 
ATOM   89  C CD1 . LEU A 1 12  ? 39.866 19.878 9.922   1.00 30.84 ? 13  LEU A CD1 1 
ATOM   90  C CD2 . LEU A 1 12  ? 38.297 21.799 9.473   1.00 32.62 ? 13  LEU A CD2 1 
ATOM   91  N N   . GLN A 1 13  ? 42.929 23.381 11.360  1.00 28.75 ? 14  GLN A N   1 
ATOM   92  C CA  . GLN A 1 13  ? 44.062 23.953 10.614  1.00 30.37 ? 14  GLN A CA  1 
ATOM   93  C C   . GLN A 1 13  ? 45.302 23.064 10.818  1.00 27.26 ? 14  GLN A C   1 
ATOM   94  O O   . GLN A 1 13  ? 46.047 22.831 9.855   1.00 31.57 ? 14  GLN A O   1 
ATOM   95  C CB  . GLN A 1 13  ? 44.410 25.375 11.065  1.00 32.12 ? 14  GLN A CB  1 
ATOM   96  C CG  . GLN A 1 13  ? 43.300 26.429 10.847  1.00 31.67 ? 14  GLN A CG  1 
ATOM   97  C CD  . GLN A 1 13  ? 43.081 26.881 9.420   1.00 34.35 ? 14  GLN A CD  1 
ATOM   98  O OE1 . GLN A 1 13  ? 43.324 26.157 8.444   1.00 35.43 ? 14  GLN A OE1 1 
ATOM   99  N NE2 . GLN A 1 13  ? 42.484 28.070 9.285   1.00 29.81 ? 14  GLN A NE2 1 
ATOM   100 N N   . GLU A 1 14  ? 45.497 22.593 12.024  1.00 28.60 ? 15  GLU A N   1 
ATOM   101 C CA  . GLU A 1 14  ? 46.667 21.744 12.346  1.00 29.12 ? 15  GLU A CA  1 
ATOM   102 C C   . GLU A 1 14  ? 46.523 20.376 11.685  1.00 28.80 ? 15  GLU A C   1 
ATOM   103 O O   . GLU A 1 14  ? 47.491 19.877 11.109  1.00 30.43 ? 15  GLU A O   1 
ATOM   104 C CB  . GLU A 1 14  ? 46.864 21.562 13.815  1.00 32.59 ? 15  GLU A CB  1 
ATOM   105 C CG  . GLU A 1 14  ? 47.932 20.613 14.182  1.00 41.51 ? 15  GLU A CG  1 
ATOM   106 C CD  . GLU A 1 14  ? 49.318 21.104 13.940  1.00 49.13 ? 15  GLU A CD  1 
ATOM   107 O OE1 . GLU A 1 14  ? 49.538 22.359 13.725  1.00 40.87 ? 15  GLU A OE1 1 
ATOM   108 O OE2 . GLU A 1 14  ? 50.205 20.180 14.034  1.00 43.64 ? 15  GLU A OE2 1 
ATOM   109 N N   . LEU A 1 15  ? 45.322 19.808 11.710  1.00 31.43 ? 16  LEU A N   1 
ATOM   110 C CA  . LEU A 1 15  ? 45.084 18.543 10.973  1.00 29.60 ? 16  LEU A CA  1 
ATOM   111 C C   . LEU A 1 15  ? 45.387 18.666 9.490   1.00 31.17 ? 16  LEU A C   1 
ATOM   112 O O   . LEU A 1 15  ? 45.986 17.775 8.893   1.00 28.34 ? 16  LEU A O   1 
ATOM   113 C CB  . LEU A 1 15  ? 43.655 18.013 11.232  1.00 28.58 ? 16  LEU A CB  1 
ATOM   114 C CG  . LEU A 1 15  ? 43.335 17.507 12.624  1.00 33.82 ? 16  LEU A CG  1 
ATOM   115 C CD1 . LEU A 1 15  ? 41.851 17.215 12.723  1.00 31.45 ? 16  LEU A CD1 1 
ATOM   116 C CD2 . LEU A 1 15  ? 44.152 16.268 13.021  1.00 38.33 ? 16  LEU A CD2 1 
ATOM   117 N N   . ASN A 1 16  ? 45.022 19.791 8.870   1.00 28.66 ? 17  ASN A N   1 
ATOM   118 C CA  . ASN A 1 16  ? 45.289 20.003 7.472   1.00 27.86 ? 17  ASN A CA  1 
ATOM   119 C C   . ASN A 1 16  ? 46.772 20.095 7.230   1.00 31.39 ? 17  ASN A C   1 
ATOM   120 O O   . ASN A 1 16  ? 47.293 19.469 6.324   1.00 30.55 ? 17  ASN A O   1 
ATOM   121 C CB  . ASN A 1 16  ? 44.620 21.273 6.993   1.00 28.64 ? 17  ASN A CB  1 
ATOM   122 C CG  . ASN A 1 16  ? 43.178 21.040 6.552   1.00 27.41 ? 17  ASN A CG  1 
ATOM   123 O OD1 . ASN A 1 16  ? 42.961 20.788 5.353   1.00 32.31 ? 17  ASN A OD1 1 
ATOM   124 N ND2 . ASN A 1 16  ? 42.222 21.044 7.484   1.00 28.66 ? 17  ASN A ND2 1 
ATOM   125 N N   . LYS A 1 17  ? 47.460 20.870 8.069   1.00 30.99 ? 18  LYS A N   1 
ATOM   126 C CA  . LYS A 1 17  ? 48.911 21.011 7.962   1.00 30.60 ? 18  LYS A CA  1 
ATOM   127 C C   . LYS A 1 17  ? 49.584 19.638 8.132   1.00 28.60 ? 18  LYS A C   1 
ATOM   128 O O   . LYS A 1 17  ? 50.494 19.259 7.313   1.00 29.45 ? 18  LYS A O   1 
ATOM   129 C CB  . LYS A 1 17  ? 49.425 21.997 8.997   1.00 31.34 ? 18  LYS A CB  1 
ATOM   130 C CG  A LYS A 1 17  ? 50.939 22.211 8.963   0.50 36.60 ? 18  LYS A CG  1 
ATOM   131 C CG  B LYS A 1 17  ? 50.921 22.261 8.916   0.50 34.94 ? 18  LYS A CG  1 
ATOM   132 C CD  A LYS A 1 17  ? 51.548 22.185 10.372  0.50 45.26 ? 18  LYS A CD  1 
ATOM   133 C CD  B LYS A 1 17  ? 51.286 23.580 9.600   0.50 36.02 ? 18  LYS A CD  1 
ATOM   134 C CE  A LYS A 1 17  ? 51.439 20.815 11.015  0.50 37.78 ? 18  LYS A CE  1 
ATOM   135 N NZ  A LYS A 1 17  ? 52.501 20.508 11.988  0.50 28.92 ? 18  LYS A NZ  1 
ATOM   136 N N   . GLN A 1 18  ? 49.153 18.888 9.145   1.00 26.85 ? 19  GLN A N   1 
ATOM   137 C CA  . GLN A 1 18  ? 49.722 17.549 9.395   1.00 27.58 ? 19  GLN A CA  1 
ATOM   138 C C   . GLN A 1 18  ? 49.539 16.621 8.182   1.00 28.58 ? 19  GLN A C   1 
ATOM   139 O O   . GLN A 1 18  ? 50.471 15.938 7.791   1.00 27.98 ? 19  GLN A O   1 
ATOM   140 C CB  . GLN A 1 18  ? 49.101 16.889 10.599  1.00 28.23 ? 19  GLN A CB  1 
ATOM   141 C CG  . GLN A 1 18  ? 49.495 17.469 11.980  1.00 27.76 ? 19  GLN A CG  1 
ATOM   142 C CD  . GLN A 1 18  ? 48.762 16.841 13.125  1.00 29.60 ? 19  GLN A CD  1 
ATOM   143 O OE1 . GLN A 1 18  ? 48.114 15.805 12.979  1.00 31.25 ? 19  GLN A OE1 1 
ATOM   144 N NE2 . GLN A 1 18  ? 48.882 17.449 14.321  1.00 30.92 ? 19  GLN A NE2 1 
ATOM   145 N N   . ARG A 1 19  ? 48.348 16.599 7.606   1.00 28.57 ? 20  ARG A N   1 
ATOM   146 C CA  . ARG A 1 19  ? 48.117 15.731 6.436   1.00 31.41 ? 20  ARG A CA  1 
ATOM   147 C C   . ARG A 1 19  ? 49.032 16.089 5.282   1.00 30.67 ? 20  ARG A C   1 
ATOM   148 O O   . ARG A 1 19  ? 49.590 15.219 4.607   1.00 33.10 ? 20  ARG A O   1 
ATOM   149 C CB  . ARG A 1 19  ? 46.662 15.855 5.984   1.00 33.71 ? 20  ARG A CB  1 
ATOM   150 C CG  . ARG A 1 19  ? 46.438 15.359 4.596   1.00 48.23 ? 20  ARG A CG  1 
ATOM   151 C CD  . ARG A 1 19  ? 45.014 15.340 4.326   1.00 62.28 ? 20  ARG A CD  1 
ATOM   152 N NE  . ARG A 1 19  ? 44.587 16.522 3.595   1.00 62.37 ? 20  ARG A NE  1 
ATOM   153 C CZ  . ARG A 1 19  ? 44.504 16.582 2.268   1.00 41.19 ? 20  ARG A CZ  1 
ATOM   154 N NH1 . ARG A 1 19  ? 44.870 15.550 1.515   1.00 43.30 ? 20  ARG A NH1 1 
ATOM   155 N NH2 . ARG A 1 19  ? 44.060 17.693 1.694   1.00 50.39 ? 20  ARG A NH2 1 
ATOM   156 N N   . GLU A 1 20  ? 49.228 17.391 5.055   1.00 32.93 ? 21  GLU A N   1 
ATOM   157 C CA  . GLU A 1 20  ? 50.047 17.842 3.948   1.00 33.07 ? 21  GLU A CA  1 
ATOM   158 C C   . GLU A 1 20  ? 51.481 17.405 4.152   1.00 31.45 ? 21  GLU A C   1 
ATOM   159 O O   . GLU A 1 20  ? 52.165 17.016 3.188   1.00 34.14 ? 21  GLU A O   1 
ATOM   160 C CB  . GLU A 1 20  ? 49.920 19.361 3.717   1.00 34.28 ? 21  GLU A CB  1 
ATOM   161 C CG  A GLU A 1 20  ? 51.141 20.017 3.108   0.50 33.45 ? 21  GLU A CG  1 
ATOM   162 C CG  B GLU A 1 20  ? 48.447 19.803 3.745   0.50 37.76 ? 21  GLU A CG  1 
ATOM   163 C CD  A GLU A 1 20  ? 50.874 21.482 2.790   0.50 36.21 ? 21  GLU A CD  1 
ATOM   164 C CD  B GLU A 1 20  ? 48.245 21.205 3.188   0.50 43.04 ? 21  GLU A CD  1 
ATOM   165 O OE1 A GLU A 1 20  ? 50.681 22.256 3.747   0.50 46.89 ? 21  GLU A OE1 1 
ATOM   166 O OE1 B GLU A 1 20  ? 49.252 21.931 2.996   0.50 55.43 ? 21  GLU A OE1 1 
ATOM   167 O OE2 A GLU A 1 20  ? 50.866 21.862 1.596   0.50 43.89 ? 21  GLU A OE2 1 
ATOM   168 O OE2 B GLU A 1 20  ? 47.072 21.577 2.965   0.50 57.56 ? 21  GLU A OE2 1 
ATOM   169 N N   . LYS A 1 21  ? 51.940 17.473 5.392   1.00 31.88 ? 22  LYS A N   1 
ATOM   170 C CA  . LYS A 1 21  ? 53.312 17.117 5.731   1.00 31.28 ? 22  LYS A CA  1 
ATOM   171 C C   . LYS A 1 21  ? 53.491 15.639 6.093   1.00 32.71 ? 22  LYS A C   1 
ATOM   172 O O   . LYS A 1 21  ? 54.606 15.204 6.313   1.00 29.49 ? 22  LYS A O   1 
ATOM   173 C CB  . LYS A 1 21  ? 53.812 18.022 6.866   1.00 35.57 ? 22  LYS A CB  1 
ATOM   174 C CG  . LYS A 1 21  ? 53.761 19.497 6.478   1.00 43.40 ? 22  LYS A CG  1 
ATOM   175 C CD  . LYS A 1 21  ? 54.462 20.415 7.445   1.00 51.44 ? 22  LYS A CD  1 
ATOM   176 C CE  . LYS A 1 21  ? 54.582 21.806 6.819   1.00 61.20 ? 22  LYS A CE  1 
ATOM   177 N N   . GLY A 1 22  ? 52.427 14.846 6.097   1.00 30.10 ? 23  GLY A N   1 
ATOM   178 C CA  . GLY A 1 22  ? 52.529 13.437 6.482   1.00 27.63 ? 23  GLY A CA  1 
ATOM   179 C C   . GLY A 1 22  ? 52.918 13.219 7.943   1.00 35.94 ? 23  GLY A C   1 
ATOM   180 O O   . GLY A 1 22  ? 53.625 12.272 8.261   1.00 36.83 ? 23  GLY A O   1 
ATOM   181 N N   . GLN A 1 23  ? 52.461 14.102 8.829   1.00 30.23 ? 24  GLN A N   1 
ATOM   182 C CA  . GLN A 1 23  ? 52.782 14.040 10.277  1.00 30.90 ? 24  GLN A CA  1 
ATOM   183 C C   . GLN A 1 23  ? 51.616 13.528 11.112  1.00 31.03 ? 24  GLN A C   1 
ATOM   184 O O   . GLN A 1 23  ? 50.478 13.894 10.883  1.00 31.53 ? 24  GLN A O   1 
ATOM   185 C CB  . GLN A 1 23  ? 53.087 15.436 10.791  1.00 37.73 ? 24  GLN A CB  1 
ATOM   186 C CG  . GLN A 1 23  ? 54.208 16.151 10.087  1.00 36.44 ? 24  GLN A CG  1 
ATOM   187 C CD  . GLN A 1 23  ? 54.241 17.605 10.490  1.00 54.45 ? 24  GLN A CD  1 
ATOM   188 O OE1 . GLN A 1 23  ? 53.198 18.231 10.780  1.00 45.10 ? 24  GLN A OE1 1 
ATOM   189 N NE2 . GLN A 1 23  ? 55.437 18.155 10.522  1.00 43.69 ? 24  GLN A NE2 1 
ATOM   190 N N   . TYR A 1 24  ? 51.901 12.691 12.099  1.00 30.41 ? 25  TYR A N   1 
ATOM   191 C CA  . TYR A 1 24  ? 50.866 12.149 12.998  1.00 30.22 ? 25  TYR A CA  1 
ATOM   192 C C   . TYR A 1 24  ? 49.711 11.539 12.256  1.00 34.45 ? 25  TYR A C   1 
ATOM   193 O O   . TYR A 1 24  ? 48.567 11.540 12.739  1.00 33.11 ? 25  TYR A O   1 
ATOM   194 C CB  . TYR A 1 24  ? 50.411 13.205 14.011  1.00 28.83 ? 25  TYR A CB  1 
ATOM   195 C CG  . TYR A 1 24  ? 51.575 13.905 14.603  1.00 28.41 ? 25  TYR A CG  1 
ATOM   196 C CD1 . TYR A 1 24  ? 52.361 13.283 15.563  1.00 31.57 ? 25  TYR A CD1 1 
ATOM   197 C CD2 . TYR A 1 24  ? 51.920 15.175 14.186  1.00 39.55 ? 25  TYR A CD2 1 
ATOM   198 C CE1 . TYR A 1 24  ? 53.460 13.896 16.072  1.00 29.14 ? 25  TYR A CE1 1 
ATOM   199 C CE2 . TYR A 1 24  ? 53.020 15.809 14.683  1.00 36.95 ? 25  TYR A CE2 1 
ATOM   200 C CZ  . TYR A 1 24  ? 53.799 15.161 15.636  1.00 32.69 ? 25  TYR A CZ  1 
ATOM   201 O OH  . TYR A 1 24  ? 54.908 15.763 16.140  1.00 38.64 ? 25  TYR A OH  1 
ATOM   202 N N   . CYS A 1 25  ? 50.022 10.967 11.090  1.00 30.95 ? 26  CYS A N   1 
ATOM   203 C CA  . CYS A 1 25  ? 49.008 10.346 10.239  1.00 28.91 ? 26  CYS A CA  1 
ATOM   204 C C   . CYS A 1 25  ? 48.994 8.853  10.408  1.00 29.81 ? 26  CYS A C   1 
ATOM   205 O O   . CYS A 1 25  ? 49.986 8.189  10.066  1.00 32.16 ? 26  CYS A O   1 
ATOM   206 C CB  . CYS A 1 25  ? 49.282 10.699 8.791   1.00 27.67 ? 26  CYS A CB  1 
ATOM   207 S SG  . CYS A 1 25  ? 48.820 12.378 8.387   1.00 32.81 ? 26  CYS A SG  1 
ATOM   208 N N   . ASP A 1 26  ? 47.904 8.317  10.954  1.00 27.42 ? 27  ASP A N   1 
ATOM   209 C CA  . ASP A 1 26  ? 47.741 6.881  11.094  1.00 28.09 ? 27  ASP A CA  1 
ATOM   210 C C   . ASP A 1 26  ? 47.221 6.151  9.870   1.00 27.46 ? 27  ASP A C   1 
ATOM   211 O O   . ASP A 1 26  ? 47.195 4.946  9.881   1.00 28.69 ? 27  ASP A O   1 
ATOM   212 C CB  . ASP A 1 26  ? 46.910 6.520  12.334  1.00 31.55 ? 27  ASP A CB  1 
ATOM   213 C CG  . ASP A 1 26  ? 45.542 7.147  12.362  1.00 28.84 ? 27  ASP A CG  1 
ATOM   214 O OD1 . ASP A 1 26  ? 45.256 8.139  11.633  1.00 27.79 ? 27  ASP A OD1 1 
ATOM   215 O OD2 . ASP A 1 26  ? 44.730 6.603  13.157  1.00 31.19 ? 27  ASP A OD2 1 
ATOM   216 N N   . ALA A 1 27  ? 46.787 6.894  8.834   1.00 27.64 ? 28  ALA A N   1 
ATOM   217 C CA  . ALA A 1 27  ? 46.347 6.277  7.572   1.00 28.37 ? 28  ALA A CA  1 
ATOM   218 C C   . ALA A 1 27  ? 47.364 6.574  6.469   1.00 25.92 ? 28  ALA A C   1 
ATOM   219 O O   . ALA A 1 27  ? 47.753 7.713  6.269   1.00 29.37 ? 28  ALA A O   1 
ATOM   220 C CB  . ALA A 1 27  ? 44.963 6.773  7.162   1.00 27.24 ? 28  ALA A CB  1 
ATOM   221 N N   . THR A 1 28  ? 47.771 5.521  5.797   1.00 28.96 ? 29  THR A N   1 
ATOM   222 C CA  . THR A 1 28  ? 48.581 5.622  4.571   1.00 26.61 ? 29  THR A CA  1 
ATOM   223 C C   . THR A 1 28  ? 47.744 4.987  3.461   1.00 29.74 ? 29  THR A C   1 
ATOM   224 O O   . THR A 1 28  ? 47.349 3.815  3.557   1.00 28.21 ? 29  THR A O   1 
ATOM   225 C CB  . THR A 1 28  ? 49.937 4.946  4.754   1.00 35.79 ? 29  THR A CB  1 
ATOM   226 O OG1 . THR A 1 28  ? 50.566 5.467  5.927   1.00 29.86 ? 29  THR A OG1 1 
ATOM   227 C CG2 . THR A 1 28  ? 50.853 5.199  3.556   1.00 34.14 ? 29  THR A CG2 1 
ATOM   228 N N   . LEU A 1 29  ? 47.443 5.781  2.431   1.00 30.95 ? 30  LEU A N   1 
ATOM   229 C CA  . LEU A 1 29  ? 46.593 5.344  1.336   1.00 29.04 ? 30  LEU A CA  1 
ATOM   230 C C   . LEU A 1 29  ? 47.432 5.371  0.046   1.00 29.96 ? 30  LEU A C   1 
ATOM   231 O O   . LEU A 1 29  ? 47.923 6.417  -0.380  1.00 34.35 ? 30  LEU A O   1 
ATOM   232 C CB  . LEU A 1 29  ? 45.370 6.249  1.235   1.00 32.61 ? 30  LEU A CB  1 
ATOM   233 C CG  . LEU A 1 29  ? 44.676 6.549  2.595   1.00 33.93 ? 30  LEU A CG  1 
ATOM   234 C CD1 . LEU A 1 29  ? 43.779 7.722  2.461   1.00 44.60 ? 30  LEU A CD1 1 
ATOM   235 C CD2 . LEU A 1 29  ? 43.912 5.306  3.055   1.00 37.35 ? 30  LEU A CD2 1 
ATOM   236 N N   . ASP A 1 30  ? 47.652 4.199  -0.500  1.00 31.57 ? 31  ASP A N   1 
ATOM   237 C CA  . ASP A 1 30  ? 48.451 4.022  -1.720  1.00 25.81 ? 31  ASP A CA  1 
ATOM   238 C C   . ASP A 1 30  ? 47.469 3.970  -2.882  1.00 29.63 ? 31  ASP A C   1 
ATOM   239 O O   . ASP A 1 30  ? 46.762 3.001  -3.027  1.00 32.19 ? 31  ASP A O   1 
ATOM   240 C CB  . ASP A 1 30  ? 49.264 2.735  -1.615  1.00 33.60 ? 31  ASP A CB  1 
ATOM   241 N N   . VAL A 1 31  ? 47.368 5.055  -3.651  1.00 33.82 ? 32  VAL A N   1 
ATOM   242 C CA  . VAL A 1 31  ? 46.494 5.094  -4.821  1.00 32.48 ? 32  VAL A CA  1 
ATOM   243 C C   . VAL A 1 31  ? 47.371 5.002  -6.062  1.00 35.74 ? 32  VAL A C   1 
ATOM   244 O O   . VAL A 1 31  ? 47.918 6.007  -6.541  1.00 39.65 ? 32  VAL A O   1 
ATOM   245 C CB  . VAL A 1 31  ? 45.627 6.366  -4.889  1.00 38.00 ? 32  VAL A CB  1 
ATOM   246 C CG1 . VAL A 1 31  ? 44.644 6.244  -6.042  1.00 40.72 ? 32  VAL A CG1 1 
ATOM   247 C CG2 . VAL A 1 31  ? 44.914 6.583  -3.590  1.00 35.15 ? 32  VAL A CG2 1 
ATOM   248 N N   . GLY A 1 32  ? 47.559 3.774  -6.536  1.00 35.31 ? 33  GLY A N   1 
ATOM   249 C CA  . GLY A 1 32  ? 48.380 3.520  -7.697  1.00 34.15 ? 33  GLY A CA  1 
ATOM   250 C C   . GLY A 1 32  ? 49.764 4.129  -7.592  1.00 35.57 ? 33  GLY A C   1 
ATOM   251 O O   . GLY A 1 32  ? 50.189 4.859  -8.490  1.00 42.97 ? 33  GLY A O   1 
ATOM   252 N N   . GLY A 1 33  ? 50.456 3.877  -6.482  1.00 34.94 ? 34  GLY A N   1 
ATOM   253 C CA  . GLY A 1 33  ? 51.830 4.397  -6.315  1.00 34.92 ? 34  GLY A CA  1 
ATOM   254 C C   . GLY A 1 33  ? 51.893 5.859  -5.863  1.00 25.42 ? 34  GLY A C   1 
ATOM   255 O O   . GLY A 1 33  ? 52.939 6.398  -5.471  1.00 24.63 ? 34  GLY A O   1 
ATOM   256 N N   . LEU A 1 34  ? 50.753 6.525  -5.891  1.00 34.89 ? 35  LEU A N   1 
ATOM   257 C CA  . LEU A 1 34  ? 50.655 7.873  -5.313  1.00 27.08 ? 35  LEU A CA  1 
ATOM   258 C C   . LEU A 1 34  ? 50.192 7.758  -3.855  1.00 40.26 ? 35  LEU A C   1 
ATOM   259 O O   . LEU A 1 34  ? 49.112 7.255  -3.604  1.00 41.65 ? 35  LEU A O   1 
ATOM   260 C CB  . LEU A 1 34  ? 49.661 8.681  -6.156  1.00 33.75 ? 35  LEU A CB  1 
ATOM   261 C CG  . LEU A 1 34  ? 49.623 10.191 -5.971  1.00 43.63 ? 35  LEU A CG  1 
ATOM   262 N N   . VAL A 1 35  ? 50.998 8.271  -2.914  1.00 33.23 ? 36  VAL A N   1 
ATOM   263 C CA  . VAL A 1 35  ? 50.799 8.012  -1.480  1.00 37.97 ? 36  VAL A CA  1 
ATOM   264 C C   . VAL A 1 35  ? 50.238 9.236  -0.794  1.00 32.19 ? 36  VAL A C   1 
ATOM   265 O O   . VAL A 1 35  ? 50.815 10.315 -0.839  1.00 34.86 ? 36  VAL A O   1 
ATOM   266 C CB  . VAL A 1 35  ? 52.118 7.533  -0.790  1.00 34.62 ? 36  VAL A CB  1 
ATOM   267 C CG1 . VAL A 1 35  ? 51.946 7.441  0.757   1.00 37.97 ? 36  VAL A CG1 1 
ATOM   268 C CG2 . VAL A 1 35  ? 52.528 6.202  -1.357  1.00 41.17 ? 36  VAL A CG2 1 
ATOM   269 N N   . PHE A 1 36  ? 49.086 9.041  -0.150  1.00 33.71 ? 37  PHE A N   1 
ATOM   270 C CA  . PHE A 1 36  ? 48.402 10.038 0.597   1.00 32.31 ? 37  PHE A CA  1 
ATOM   271 C C   . PHE A 1 36  ? 48.487 9.644  2.072   1.00 31.42 ? 37  PHE A C   1 
ATOM   272 O O   . PHE A 1 36  ? 48.309 8.488  2.431   1.00 32.37 ? 37  PHE A O   1 
ATOM   273 C CB  . PHE A 1 36  ? 46.929 10.051 0.212   1.00 34.34 ? 37  PHE A CB  1 
ATOM   274 C CG  . PHE A 1 36  ? 46.680 10.510 -1.206  1.00 30.63 ? 37  PHE A CG  1 
ATOM   275 C CD1 . PHE A 1 36  ? 46.389 11.863 -1.443  1.00 36.63 ? 37  PHE A CD1 1 
ATOM   276 C CD2 . PHE A 1 36  ? 46.728 9.634  -2.260  1.00 34.67 ? 37  PHE A CD2 1 
ATOM   277 C CE1 . PHE A 1 36  ? 46.130 12.314 -2.723  1.00 35.03 ? 37  PHE A CE1 1 
ATOM   278 C CE2 . PHE A 1 36  ? 46.488 10.074 -3.544  1.00 34.41 ? 37  PHE A CE2 1 
ATOM   279 C CZ  . PHE A 1 36  ? 46.189 11.419 -3.776  1.00 34.65 ? 37  PHE A CZ  1 
ATOM   280 N N   . LYS A 1 37  ? 48.801 10.613 2.897   1.00 30.69 ? 38  LYS A N   1 
ATOM   281 C CA  . LYS A 1 37  ? 48.787 10.396 4.338   1.00 30.69 ? 38  LYS A CA  1 
ATOM   282 C C   . LYS A 1 37  ? 47.548 11.072 4.865   1.00 29.62 ? 38  LYS A C   1 
ATOM   283 O O   . LYS A 1 37  ? 47.189 12.162 4.425   1.00 33.40 ? 38  LYS A O   1 
ATOM   284 C CB  . LYS A 1 37  ? 50.050 10.962 4.987   1.00 29.79 ? 38  LYS A CB  1 
ATOM   285 C CG  . LYS A 1 37  ? 51.295 10.117 4.711   1.00 28.73 ? 38  LYS A CG  1 
ATOM   286 C CD  . LYS A 1 37  ? 51.428 9.000  5.756   1.00 37.74 ? 38  LYS A CD  1 
ATOM   287 C CE  . LYS A 1 37  ? 52.474 7.993  5.402   1.00 50.66 ? 38  LYS A CE  1 
ATOM   288 N NZ  . LYS A 1 37  ? 52.528 6.888  6.416   1.00 43.60 ? 38  LYS A NZ  1 
ATOM   289 N N   . ALA A 1 38  ? 46.908 10.462 5.846   1.00 28.54 ? 39  ALA A N   1 
ATOM   290 C CA  . ALA A 1 38  ? 45.718 11.037 6.439   1.00 27.47 ? 39  ALA A CA  1 
ATOM   291 C C   . ALA A 1 38  ? 45.472 10.500 7.847   1.00 26.67 ? 39  ALA A C   1 
ATOM   292 O O   . ALA A 1 38  ? 46.260 9.704  8.370   1.00 27.30 ? 39  ALA A O   1 
ATOM   293 C CB  . ALA A 1 38  ? 44.473 10.824 5.513   1.00 30.22 ? 39  ALA A CB  1 
ATOM   294 N N   . HIS A 1 39  ? 44.405 10.979 8.468   1.00 27.60 ? 40  HIS A N   1 
ATOM   295 C CA  . HIS A 1 39  ? 44.007 10.579 9.799   1.00 24.90 ? 40  HIS A CA  1 
ATOM   296 C C   . HIS A 1 39  ? 42.730 9.727  9.738   1.00 23.86 ? 40  HIS A C   1 
ATOM   297 O O   . HIS A 1 39  ? 41.703 10.155 9.187   1.00 27.24 ? 40  HIS A O   1 
ATOM   298 C CB  . HIS A 1 39  ? 43.700 11.812 10.664  1.00 28.89 ? 40  HIS A CB  1 
ATOM   299 C CG  . HIS A 1 39  ? 44.822 12.798 10.736  1.00 27.56 ? 40  HIS A CG  1 
ATOM   300 N ND1 . HIS A 1 39  ? 44.969 13.844 9.852   1.00 30.09 ? 40  HIS A ND1 1 
ATOM   301 C CD2 . HIS A 1 39  ? 45.849 12.892 11.623  1.00 28.91 ? 40  HIS A CD2 1 
ATOM   302 C CE1 . HIS A 1 39  ? 46.032 14.551 10.201  1.00 28.79 ? 40  HIS A CE1 1 
ATOM   303 N NE2 . HIS A 1 39  ? 46.618 13.964 11.233  1.00 29.81 ? 40  HIS A NE2 1 
ATOM   304 N N   . TRP A 1 40  ? 42.793 8.520  10.272  1.00 25.31 ? 41  TRP A N   1 
ATOM   305 C CA  . TRP A 1 40  ? 41.572 7.632  10.249  1.00 25.89 ? 41  TRP A CA  1 
ATOM   306 C C   . TRP A 1 40  ? 40.387 8.270  10.904  1.00 28.51 ? 41  TRP A C   1 
ATOM   307 O O   . TRP A 1 40  ? 39.228 8.097  10.479  1.00 30.53 ? 41  TRP A O   1 
ATOM   308 C CB  . TRP A 1 40  ? 41.832 6.303  10.920  1.00 26.68 ? 41  TRP A CB  1 
ATOM   309 C CG  . TRP A 1 40  ? 42.597 5.331  10.091  1.00 28.87 ? 41  TRP A CG  1 
ATOM   310 C CD1 . TRP A 1 40  ? 43.907 5.039  10.164  1.00 27.71 ? 41  TRP A CD1 1 
ATOM   311 C CD2 . TRP A 1 40  ? 42.060 4.518  9.033   1.00 28.02 ? 41  TRP A CD2 1 
ATOM   312 N NE1 . TRP A 1 40  ? 44.238 4.071  9.224   1.00 27.45 ? 41  TRP A NE1 1 
ATOM   313 C CE2 . TRP A 1 40  ? 43.111 3.736  8.535   1.00 28.04 ? 41  TRP A CE2 1 
ATOM   314 C CE3 . TRP A 1 40  ? 40.766 4.347  8.492   1.00 30.70 ? 41  TRP A CE3 1 
ATOM   315 C CZ2 . TRP A 1 40  ? 42.932 2.844  7.490   1.00 30.00 ? 41  TRP A CZ2 1 
ATOM   316 C CZ3 . TRP A 1 40  ? 40.596 3.447  7.463   1.00 28.93 ? 41  TRP A CZ3 1 
ATOM   317 C CH2 . TRP A 1 40  ? 41.671 2.702  6.986   1.00 29.06 ? 41  TRP A CH2 1 
ATOM   318 N N   . SER A 1 41  ? 40.654 9.029  11.954  1.00 28.08 ? 42  SER A N   1 
ATOM   319 C CA  . SER A 1 41  ? 39.597 9.755  12.655  1.00 28.97 ? 42  SER A CA  1 
ATOM   320 C C   . SER A 1 41  ? 38.788 10.628 11.712  1.00 29.29 ? 42  SER A C   1 
ATOM   321 O O   . SER A 1 41  ? 37.548 10.630 11.759  1.00 34.13 ? 42  SER A O   1 
ATOM   322 C CB  . SER A 1 41  ? 40.231 10.600 13.741  1.00 32.38 ? 42  SER A CB  1 
ATOM   323 O OG  . SER A 1 41  ? 41.145 11.525 13.208  1.00 32.91 ? 42  SER A OG  1 
ATOM   324 N N   . VAL A 1 42  ? 39.489 11.313 10.818  1.00 28.62 ? 43  VAL A N   1 
ATOM   325 C CA  . VAL A 1 42  ? 38.883 12.238 9.858   1.00 28.59 ? 43  VAL A CA  1 
ATOM   326 C C   . VAL A 1 42  ? 38.279 11.462 8.698   1.00 33.02 ? 43  VAL A C   1 
ATOM   327 O O   . VAL A 1 42  ? 37.159 11.766 8.278   1.00 33.97 ? 43  VAL A O   1 
ATOM   328 C CB  . VAL A 1 42  ? 39.904 13.254 9.319   1.00 31.56 ? 43  VAL A CB  1 
ATOM   329 C CG1 . VAL A 1 42  ? 39.342 14.057 8.183   1.00 34.18 ? 43  VAL A CG1 1 
ATOM   330 C CG2 . VAL A 1 42  ? 40.396 14.160 10.460  1.00 34.18 ? 43  VAL A CG2 1 
ATOM   331 N N   . LEU A 1 43  ? 39.004 10.442 8.200   1.00 28.29 ? 44  LEU A N   1 
ATOM   332 C CA  . LEU A 1 43  ? 38.423 9.576  7.119   1.00 28.66 ? 44  LEU A CA  1 
ATOM   333 C C   . LEU A 1 43  ? 37.070 8.973  7.547   1.00 36.28 ? 44  LEU A C   1 
ATOM   334 O O   . LEU A 1 43  ? 36.102 8.997  6.779   1.00 37.03 ? 44  LEU A O   1 
ATOM   335 C CB  . LEU A 1 43  ? 39.339 8.426  6.745   1.00 30.42 ? 44  LEU A CB  1 
ATOM   336 C CG  . LEU A 1 43  ? 40.725 8.792  6.250   1.00 29.93 ? 44  LEU A CG  1 
ATOM   337 C CD1 . LEU A 1 43  ? 41.575 7.546  5.999   1.00 28.38 ? 44  LEU A CD1 1 
ATOM   338 C CD2 . LEU A 1 43  ? 40.541 9.718  5.038   1.00 34.26 ? 44  LEU A CD2 1 
ATOM   339 N N   . ALA A 1 44  ? 37.008 8.488  8.794   1.00 33.44 ? 45  ALA A N   1 
ATOM   340 C CA  . ALA A 1 44  ? 35.833 7.798  9.354   1.00 37.54 ? 45  ALA A CA  1 
ATOM   341 C C   . ALA A 1 44  ? 34.708 8.767  9.629   1.00 36.95 ? 45  ALA A C   1 
ATOM   342 O O   . ALA A 1 44  ? 33.533 8.397  9.658   1.00 48.10 ? 45  ALA A O   1 
ATOM   343 C CB  . ALA A 1 44  ? 36.211 7.082  10.605  1.00 39.11 ? 45  ALA A CB  1 
ATOM   344 N N   . CYS A 1 45  ? 35.036 10.016 9.807   1.00 35.54 ? 46  CYS A N   1 
ATOM   345 C CA  . CYS A 1 45  ? 34.007 11.009 9.911   1.00 44.76 ? 46  CYS A CA  1 
ATOM   346 C C   . CYS A 1 45  ? 33.108 11.047 8.670   1.00 46.68 ? 46  CYS A C   1 
ATOM   347 O O   . CYS A 1 45  ? 31.898 11.213 8.776   1.00 47.17 ? 46  CYS A O   1 
ATOM   348 C CB  . CYS A 1 45  ? 34.590 12.369 9.994   1.00 48.82 ? 46  CYS A CB  1 
ATOM   349 S SG  A CYS A 1 45  ? 35.065 13.184 11.607  0.50 39.18 ? 46  CYS A SG  1 
ATOM   350 S SG  B CYS A 1 45  ? 33.351 13.377 10.704  0.50 42.99 ? 46  CYS A SG  1 
ATOM   351 N N   . CYS A 1 46  ? 33.719 10.969 7.495   1.00 39.80 ? 47  CYS A N   1 
ATOM   352 C CA  . CYS A 1 46  ? 33.000 11.289 6.257   1.00 37.47 ? 47  CYS A CA  1 
ATOM   353 C C   . CYS A 1 46  ? 32.661 10.088 5.404   1.00 36.52 ? 47  CYS A C   1 
ATOM   354 O O   . CYS A 1 46  ? 31.738 10.145 4.608   1.00 38.02 ? 47  CYS A O   1 
ATOM   355 C CB  . CYS A 1 46  ? 33.832 12.187 5.372   1.00 41.54 ? 47  CYS A CB  1 
ATOM   356 S SG  . CYS A 1 46  ? 34.085 13.792 6.047   1.00 46.85 ? 47  CYS A SG  1 
ATOM   357 N N   . SER A 1 47  ? 33.430 9.019  5.566   1.00 31.15 ? 48  SER A N   1 
ATOM   358 C CA  . SER A 1 47  ? 33.352 7.856  4.690   1.00 30.79 ? 48  SER A CA  1 
ATOM   359 C C   . SER A 1 47  ? 32.966 6.602  5.425   1.00 32.46 ? 48  SER A C   1 
ATOM   360 O O   . SER A 1 47  ? 33.664 6.139  6.304   1.00 30.11 ? 48  SER A O   1 
ATOM   361 C CB  . SER A 1 47  ? 34.710 7.663  4.006   1.00 31.79 ? 48  SER A CB  1 
ATOM   362 O OG  . SER A 1 47  ? 34.846 6.401  3.378   1.00 29.99 ? 48  SER A OG  1 
ATOM   363 N N   . HIS A 1 48  ? 31.862 5.980  5.021   1.00 29.09 ? 49  HIS A N   1 
ATOM   364 C CA  . HIS A 1 48  ? 31.514 4.690  5.613   1.00 27.46 ? 49  HIS A CA  1 
ATOM   365 C C   . HIS A 1 48  ? 32.493 3.566  5.181   1.00 28.25 ? 49  HIS A C   1 
ATOM   366 O O   . HIS A 1 48  ? 32.678 2.570  5.902   1.00 32.04 ? 49  HIS A O   1 
ATOM   367 C CB  . HIS A 1 48  ? 30.083 4.337  5.265   1.00 30.87 ? 49  HIS A CB  1 
ATOM   368 C CG  . HIS A 1 48  ? 29.065 5.282  5.825   1.00 36.18 ? 49  HIS A CG  1 
ATOM   369 N ND1 . HIS A 1 48  ? 28.697 5.270  7.154   1.00 54.12 ? 49  HIS A ND1 1 
ATOM   370 C CD2 . HIS A 1 48  ? 28.248 6.180  5.224   1.00 60.18 ? 49  HIS A CD2 1 
ATOM   371 C CE1 . HIS A 1 48  ? 27.752 6.171  7.360   1.00 53.39 ? 49  HIS A CE1 1 
ATOM   372 N NE2 . HIS A 1 48  ? 27.454 6.731  6.203   1.00 53.83 ? 49  HIS A NE2 1 
ATOM   373 N N   . PHE A 1 49  ? 33.106 3.720  4.003   1.00 29.31 ? 50  PHE A N   1 
ATOM   374 C CA  . PHE A 1 49  ? 34.077 2.758  3.516   1.00 28.12 ? 50  PHE A CA  1 
ATOM   375 C C   . PHE A 1 49  ? 35.267 2.725  4.485   1.00 26.03 ? 50  PHE A C   1 
ATOM   376 O O   . PHE A 1 49  ? 35.725 1.668  4.887   1.00 30.13 ? 50  PHE A O   1 
ATOM   377 C CB  . PHE A 1 49  ? 34.530 3.110  2.089   1.00 30.92 ? 50  PHE A CB  1 
ATOM   378 C CG  . PHE A 1 49  ? 35.671 2.302  1.606   1.00 26.00 ? 50  PHE A CG  1 
ATOM   379 C CD1 . PHE A 1 49  ? 35.467 1.064  1.018   1.00 35.45 ? 50  PHE A CD1 1 
ATOM   380 C CD2 . PHE A 1 49  ? 36.969 2.786  1.704   1.00 36.17 ? 50  PHE A CD2 1 
ATOM   381 C CE1 . PHE A 1 49  ? 36.534 0.335  0.566   1.00 38.43 ? 50  PHE A CE1 1 
ATOM   382 C CE2 . PHE A 1 49  ? 38.035 2.057  1.255   1.00 35.04 ? 50  PHE A CE2 1 
ATOM   383 C CZ  . PHE A 1 49  ? 37.828 0.832  0.699   1.00 34.48 ? 50  PHE A CZ  1 
ATOM   384 N N   . PHE A 1 50  ? 35.749 3.890  4.876   1.00 30.00 ? 51  PHE A N   1 
ATOM   385 C CA  . PHE A 1 50  ? 36.924 3.913  5.758   1.00 28.30 ? 51  PHE A CA  1 
ATOM   386 C C   . PHE A 1 50  ? 36.571 3.504  7.190   1.00 29.59 ? 51  PHE A C   1 
ATOM   387 O O   . PHE A 1 50  ? 37.409 2.888  7.895   1.00 33.27 ? 51  PHE A O   1 
ATOM   388 C CB  . PHE A 1 50  ? 37.605 5.266  5.690   1.00 28.66 ? 51  PHE A CB  1 
ATOM   389 C CG  . PHE A 1 50  ? 38.386 5.460  4.451   1.00 26.13 ? 51  PHE A CG  1 
ATOM   390 C CD1 . PHE A 1 50  ? 39.382 4.594  4.098   1.00 29.65 ? 51  PHE A CD1 1 
ATOM   391 C CD2 . PHE A 1 50  ? 38.126 6.522  3.632   1.00 29.11 ? 51  PHE A CD2 1 
ATOM   392 C CE1 . PHE A 1 50  ? 40.104 4.777  2.945   1.00 35.69 ? 51  PHE A CE1 1 
ATOM   393 C CE2 . PHE A 1 50  ? 38.844 6.697  2.487   1.00 30.22 ? 51  PHE A CE2 1 
ATOM   394 C CZ  . PHE A 1 50  ? 39.838 5.825  2.160   1.00 28.51 ? 51  PHE A CZ  1 
ATOM   395 N N   . GLN A 1 51  ? 35.360 3.853  7.638   1.00 31.18 ? 52  GLN A N   1 
ATOM   396 C CA  . GLN A 1 51  ? 34.856 3.340  8.932   1.00 32.33 ? 52  GLN A CA  1 
ATOM   397 C C   . GLN A 1 51  ? 34.956 1.848  8.960   1.00 33.87 ? 52  GLN A C   1 
ATOM   398 O O   . GLN A 1 51  ? 35.399 1.275  9.947   1.00 36.91 ? 52  GLN A O   1 
ATOM   399 C CB  . GLN A 1 51  ? 33.387 3.710  9.193   1.00 34.65 ? 52  GLN A CB  1 
ATOM   400 C CG  . GLN A 1 51  ? 33.139 5.134  9.388   1.00 34.59 ? 52  GLN A CG  1 
ATOM   401 C CD  . GLN A 1 51  ? 31.673 5.492  9.472   1.00 35.43 ? 52  GLN A CD  1 
ATOM   402 O OE1 . GLN A 1 51  ? 30.820 4.611  9.605   1.00 41.87 ? 52  GLN A OE1 1 
ATOM   403 N NE2 . GLN A 1 51  ? 31.368 6.798  9.375   1.00 41.88 ? 52  GLN A NE2 1 
ATOM   404 N N   . SER A 1 52  ? 34.500 1.194  7.888   1.00 33.62 ? 53  SER A N   1 
ATOM   405 C CA  . SER A 1 52  ? 34.474 -0.274 7.816   1.00 37.85 ? 53  SER A CA  1 
ATOM   406 C C   . SER A 1 52  ? 35.865 -0.879 7.738   1.00 40.07 ? 53  SER A C   1 
ATOM   407 O O   . SER A 1 52  ? 36.131 -1.935 8.287   1.00 38.35 ? 53  SER A O   1 
ATOM   408 C CB  . SER A 1 52  ? 33.670 -0.735 6.599   1.00 41.52 ? 53  SER A CB  1 
ATOM   409 O OG  . SER A 1 52  ? 32.295 -0.499 6.811   1.00 58.64 ? 53  SER A OG  1 
ATOM   410 N N   . LEU A 1 53  ? 36.755 -0.201 7.033   1.00 33.98 ? 54  LEU A N   1 
ATOM   411 C CA  . LEU A 1 53  ? 38.069 -0.741 6.763   1.00 33.04 ? 54  LEU A CA  1 
ATOM   412 C C   . LEU A 1 53  ? 38.933 -0.666 8.027   1.00 31.18 ? 54  LEU A C   1 
ATOM   413 O O   . LEU A 1 53  ? 39.810 -1.493 8.235   1.00 32.75 ? 54  LEU A O   1 
ATOM   414 C CB  . LEU A 1 53  ? 38.681 0.069  5.640   1.00 35.03 ? 54  LEU A CB  1 
ATOM   415 C CG  . LEU A 1 53  ? 39.789 -0.524 4.810   1.00 32.57 ? 54  LEU A CG  1 
ATOM   416 C CD1 . LEU A 1 53  ? 39.331 -1.840 4.203   1.00 37.49 ? 54  LEU A CD1 1 
ATOM   417 C CD2 . LEU A 1 53  ? 40.149 0.509  3.755   1.00 33.16 ? 54  LEU A CD2 1 
ATOM   418 N N   . TYR A 1 54  ? 38.656 0.318  8.876   1.00 33.47 ? 55  TYR A N   1 
ATOM   419 C CA  . TYR A 1 54  ? 39.425 0.527  10.112  1.00 31.78 ? 55  TYR A CA  1 
ATOM   420 C C   . TYR A 1 54  ? 39.428 -0.731 10.972  1.00 32.16 ? 55  TYR A C   1 
ATOM   421 O O   . TYR A 1 54  ? 40.474 -1.171 11.461  1.00 33.78 ? 55  TYR A O   1 
ATOM   422 C CB  . TYR A 1 54  ? 38.828 1.656  10.948  1.00 31.32 ? 55  TYR A CB  1 
ATOM   423 C CG  . TYR A 1 54  ? 39.717 2.048  12.080  1.00 24.09 ? 55  TYR A CG  1 
ATOM   424 C CD1 . TYR A 1 54  ? 40.859 2.795  11.854  1.00 34.00 ? 55  TYR A CD1 1 
ATOM   425 C CD2 . TYR A 1 54  ? 39.456 1.646  13.385  1.00 30.78 ? 55  TYR A CD2 1 
ATOM   426 C CE1 . TYR A 1 54  ? 41.707 3.150  12.894  1.00 34.39 ? 55  TYR A CE1 1 
ATOM   427 C CE2 . TYR A 1 54  ? 40.289 2.002  14.435  1.00 30.80 ? 55  TYR A CE2 1 
ATOM   428 C CZ  . TYR A 1 54  ? 41.414 2.762  14.186  1.00 28.92 ? 55  TYR A CZ  1 
ATOM   429 O OH  . TYR A 1 54  ? 42.271 3.123  15.217  1.00 34.39 ? 55  TYR A OH  1 
ATOM   430 N N   . GLY A 1 55  ? 38.241 -1.305 11.147  1.00 41.50 ? 56  GLY A N   1 
ATOM   431 C CA  . GLY A 1 55  ? 38.075 -2.501 11.983  1.00 46.32 ? 56  GLY A CA  1 
ATOM   432 C C   . GLY A 1 55  ? 38.545 -2.256 13.415  1.00 50.21 ? 56  GLY A C   1 
ATOM   433 O O   . GLY A 1 55  ? 38.030 -1.366 14.100  1.00 52.92 ? 56  GLY A O   1 
ATOM   434 N N   . ASP A 1 56  ? 39.526 -3.041 13.861  1.00 52.61 ? 57  ASP A N   1 
ATOM   435 C CA  . ASP A 1 56  ? 40.090 -2.934 15.217  1.00 51.59 ? 57  ASP A CA  1 
ATOM   436 C C   . ASP A 1 56  ? 41.252 -1.945 15.272  1.00 51.60 ? 57  ASP A C   1 
ATOM   437 O O   . ASP A 1 56  ? 41.810 -1.710 16.343  1.00 55.97 ? 57  ASP A O   1 
ATOM   438 C CB  . ASP A 1 56  ? 40.594 -4.305 15.694  1.00 51.20 ? 57  ASP A CB  1 
ATOM   439 N N   . GLY A 1 57  ? 41.625 -1.388 14.116  1.00 47.84 ? 58  GLY A N   1 
ATOM   440 C CA  . GLY A 1 57  ? 42.807 -0.526 13.994  1.00 48.17 ? 58  GLY A CA  1 
ATOM   441 C C   . GLY A 1 57  ? 44.092 -1.274 13.660  1.00 50.06 ? 58  GLY A C   1 
ATOM   442 O O   . GLY A 1 57  ? 45.090 -0.637 13.318  1.00 51.26 ? 58  GLY A O   1 
ATOM   443 N N   . SER A 1 58  ? 44.044 -2.612 13.728  1.00 48.02 ? 59  SER A N   1 
ATOM   444 C CA  . SER A 1 58  ? 45.212 -3.504 13.647  1.00 53.40 ? 59  SER A CA  1 
ATOM   445 C C   . SER A 1 58  ? 45.859 -3.465 12.272  1.00 57.47 ? 59  SER A C   1 
ATOM   446 O O   . SER A 1 58  ? 47.048 -3.779 12.122  1.00 58.71 ? 59  SER A O   1 
ATOM   447 C CB  . SER A 1 58  ? 44.794 -4.948 13.962  1.00 43.35 ? 59  SER A CB  1 
ATOM   448 N N   . GLY A 1 59  ? 45.017 -3.195 11.277  1.00 55.60 ? 60  GLY A N   1 
ATOM   449 C CA  . GLY A 1 59  ? 45.391 -2.663 9.968   1.00 55.98 ? 60  GLY A CA  1 
ATOM   450 C C   . GLY A 1 59  ? 46.625 -2.957 9.130   1.00 53.18 ? 60  GLY A C   1 
ATOM   451 O O   . GLY A 1 59  ? 46.899 -4.102 8.765   1.00 63.48 ? 60  GLY A O   1 
ATOM   452 N N   . GLY A 1 60  ? 47.353 -1.885 8.815   1.00 52.86 ? 61  GLY A N   1 
ATOM   453 C CA  . GLY A 1 60  ? 48.241 -1.820 7.643   1.00 53.26 ? 61  GLY A CA  1 
ATOM   454 C C   . GLY A 1 60  ? 47.872 -0.632 6.746   1.00 52.01 ? 61  GLY A C   1 
ATOM   455 O O   . GLY A 1 60  ? 46.919 0.097  7.030   1.00 45.87 ? 61  GLY A O   1 
ATOM   456 N N   . SER A 1 61  ? 48.639 -0.415 5.677   1.00 50.79 ? 62  SER A N   1 
ATOM   457 C CA  . SER A 1 61  ? 48.316 0.635  4.707   1.00 49.52 ? 62  SER A CA  1 
ATOM   458 C C   . SER A 1 61  ? 47.126 0.169  3.871   1.00 45.70 ? 62  SER A C   1 
ATOM   459 O O   . SER A 1 61  ? 46.819 -1.030 3.850   1.00 53.92 ? 62  SER A O   1 
ATOM   460 C CB  . SER A 1 61  ? 49.515 0.921  3.802   1.00 47.16 ? 62  SER A CB  1 
ATOM   461 O OG  . SER A 1 61  ? 50.642 1.306  4.563   1.00 49.60 ? 62  SER A OG  1 
ATOM   462 N N   . VAL A 1 62  ? 46.472 1.109  3.193   1.00 44.61 ? 63  VAL A N   1 
ATOM   463 C CA  . VAL A 1 62  ? 45.352 0.818  2.278   1.00 42.24 ? 63  VAL A CA  1 
ATOM   464 C C   . VAL A 1 62  ? 45.821 1.050  0.843   1.00 40.75 ? 63  VAL A C   1 
ATOM   465 O O   . VAL A 1 62  ? 46.251 2.156  0.485   1.00 37.08 ? 63  VAL A O   1 
ATOM   466 C CB  . VAL A 1 62  ? 44.133 1.770  2.520   1.00 43.73 ? 63  VAL A CB  1 
ATOM   467 C CG1 . VAL A 1 62  ? 42.994 1.456  1.568   1.00 43.41 ? 63  VAL A CG1 1 
ATOM   468 C CG2 . VAL A 1 62  ? 43.641 1.674  3.935   1.00 43.64 ? 63  VAL A CG2 1 
ATOM   469 N N   . VAL A 1 63  ? 45.727 0.015  0.021   1.00 39.18 ? 64  VAL A N   1 
ATOM   470 C CA  . VAL A 1 63  ? 46.031 0.133  -1.391  1.00 36.22 ? 64  VAL A CA  1 
ATOM   471 C C   . VAL A 1 63  ? 44.680 0.331  -2.075  1.00 37.23 ? 64  VAL A C   1 
ATOM   472 O O   . VAL A 1 63  ? 43.800 -0.507 -1.937  1.00 43.42 ? 64  VAL A O   1 
ATOM   473 C CB  . VAL A 1 63  ? 46.718 -1.123 -1.945  1.00 35.49 ? 64  VAL A CB  1 
ATOM   474 C CG1 . VAL A 1 63  ? 46.949 -0.970 -3.433  1.00 32.53 ? 64  VAL A CG1 1 
ATOM   475 C CG2 . VAL A 1 63  ? 48.045 -1.398 -1.247  1.00 31.41 ? 64  VAL A CG2 1 
ATOM   476 N N   . LEU A 1 64  ? 44.502 1.458  -2.758  1.00 37.39 ? 65  LEU A N   1 
ATOM   477 C CA  . LEU A 1 64  ? 43.243 1.749  -3.461  1.00 44.14 ? 65  LEU A CA  1 
ATOM   478 C C   . LEU A 1 64  ? 43.449 1.628  -4.976  1.00 46.25 ? 65  LEU A C   1 
ATOM   479 O O   . LEU A 1 64  ? 44.573 1.778  -5.458  1.00 40.72 ? 65  LEU A O   1 
ATOM   480 C CB  . LEU A 1 64  ? 42.732 3.153  -3.109  1.00 49.11 ? 65  LEU A CB  1 
ATOM   481 C CG  . LEU A 1 64  ? 42.152 3.391  -1.710  1.00 50.42 ? 65  LEU A CG  1 
ATOM   482 C CD1 . LEU A 1 64  ? 42.019 4.871  -1.448  1.00 50.82 ? 65  LEU A CD1 1 
ATOM   483 C CD2 . LEU A 1 64  ? 40.812 2.716  -1.544  1.00 46.91 ? 65  LEU A CD2 1 
ATOM   484 N N   . PRO A 1 65  ? 42.356 1.374  -5.736  1.00 53.32 ? 66  PRO A N   1 
ATOM   485 C CA  . PRO A 1 65  ? 42.498 1.226  -7.186  1.00 50.20 ? 66  PRO A CA  1 
ATOM   486 C C   . PRO A 1 65  ? 43.162 2.451  -7.804  1.00 47.23 ? 66  PRO A C   1 
ATOM   487 O O   . PRO A 1 65  ? 42.807 3.582  -7.453  1.00 48.55 ? 66  PRO A O   1 
ATOM   488 C CB  . PRO A 1 65  ? 41.049 1.101  -7.669  1.00 54.06 ? 66  PRO A CB  1 
ATOM   489 C CG  . PRO A 1 65  ? 40.289 0.609  -6.481  1.00 59.55 ? 66  PRO A CG  1 
ATOM   490 C CD  . PRO A 1 65  ? 40.950 1.238  -5.303  1.00 52.52 ? 66  PRO A CD  1 
ATOM   491 N N   . ALA A 1 66  ? 44.118 2.233  -8.700  1.00 42.66 ? 67  ALA A N   1 
ATOM   492 C CA  . ALA A 1 66  ? 44.860 3.334  -9.320  1.00 49.66 ? 67  ALA A CA  1 
ATOM   493 C C   . ALA A 1 66  ? 43.937 4.413  -9.900  1.00 51.85 ? 67  ALA A C   1 
ATOM   494 O O   . ALA A 1 66  ? 44.281 5.599  -9.896  1.00 56.69 ? 67  ALA A O   1 
ATOM   495 C CB  . ALA A 1 66  ? 45.811 2.808  -10.402 1.00 46.94 ? 67  ALA A CB  1 
ATOM   496 N N   . GLY A 1 67  ? 42.758 4.002  -10.371 1.00 52.54 ? 68  GLY A N   1 
ATOM   497 C CA  . GLY A 1 67  ? 41.792 4.915  -10.989 1.00 50.78 ? 68  GLY A CA  1 
ATOM   498 C C   . GLY A 1 67  ? 41.412 6.130  -10.160 1.00 52.51 ? 68  GLY A C   1 
ATOM   499 O O   . GLY A 1 67  ? 41.004 7.143  -10.718 1.00 55.77 ? 68  GLY A O   1 
ATOM   500 N N   . PHE A 1 68  ? 41.548 6.026  -8.836  1.00 47.93 ? 69  PHE A N   1 
ATOM   501 C CA  . PHE A 1 68  ? 41.204 7.116  -7.915  1.00 49.12 ? 69  PHE A CA  1 
ATOM   502 C C   . PHE A 1 68  ? 42.239 8.250  -7.931  1.00 48.54 ? 69  PHE A C   1 
ATOM   503 O O   . PHE A 1 68  ? 41.962 9.338  -7.430  1.00 35.09 ? 69  PHE A O   1 
ATOM   504 C CB  A PHE A 1 68  ? 40.966 6.570  -6.502  0.50 48.72 ? 69  PHE A CB  1 
ATOM   505 C CB  B PHE A 1 68  ? 41.161 6.605  -6.462  0.50 48.32 ? 69  PHE A CB  1 
ATOM   506 C CG  A PHE A 1 68  ? 39.707 5.727  -6.365  0.50 54.70 ? 69  PHE A CG  1 
ATOM   507 C CG  B PHE A 1 68  ? 39.891 5.917  -6.070  0.50 48.23 ? 69  PHE A CG  1 
ATOM   508 C CD1 A PHE A 1 68  ? 38.909 5.395  -7.475  0.50 57.21 ? 69  PHE A CD1 1 
ATOM   509 C CD1 B PHE A 1 68  ? 38.933 6.583  -5.314  0.50 34.19 ? 69  PHE A CD1 1 
ATOM   510 C CD2 A PHE A 1 68  ? 39.338 5.235  -5.119  0.50 56.92 ? 69  PHE A CD2 1 
ATOM   511 C CD2 B PHE A 1 68  ? 39.676 4.582  -6.405  0.50 62.44 ? 69  PHE A CD2 1 
ATOM   512 C CE1 A PHE A 1 68  ? 37.762 4.610  -7.328  0.50 55.96 ? 69  PHE A CE1 1 
ATOM   513 C CE1 B PHE A 1 68  ? 37.764 5.946  -4.929  0.50 53.44 ? 69  PHE A CE1 1 
ATOM   514 C CE2 A PHE A 1 68  ? 38.197 4.443  -4.964  0.50 53.85 ? 69  PHE A CE2 1 
ATOM   515 C CE2 B PHE A 1 68  ? 38.505 3.930  -6.022  0.50 64.77 ? 69  PHE A CE2 1 
ATOM   516 C CZ  A PHE A 1 68  ? 37.408 4.132  -6.068  0.50 58.24 ? 69  PHE A CZ  1 
ATOM   517 C CZ  B PHE A 1 68  ? 37.547 4.614  -5.285  0.50 55.91 ? 69  PHE A CZ  1 
ATOM   518 N N   . ALA A 1 69  ? 43.425 8.025  -8.489  1.00 43.36 ? 70  ALA A N   1 
ATOM   519 C CA  . ALA A 1 69  ? 44.513 8.988  -8.285  1.00 43.72 ? 70  ALA A CA  1 
ATOM   520 C C   . ALA A 1 69  ? 44.109 10.401 -8.703  1.00 45.72 ? 70  ALA A C   1 
ATOM   521 O O   . ALA A 1 69  ? 44.454 11.375 -8.039  1.00 46.59 ? 70  ALA A O   1 
ATOM   522 C CB  . ALA A 1 69  ? 45.785 8.534  -9.030  1.00 48.01 ? 70  ALA A CB  1 
ATOM   523 N N   . GLU A 1 70  ? 43.338 10.509 -9.781  1.00 47.44 ? 71  GLU A N   1 
ATOM   524 C CA  . GLU A 1 70  ? 42.966 11.820 -10.328 1.00 51.33 ? 71  GLU A CA  1 
ATOM   525 C C   . GLU A 1 70  ? 42.230 12.720 -9.314  1.00 50.81 ? 71  GLU A C   1 
ATOM   526 O O   . GLU A 1 70  ? 42.564 13.900 -9.168  1.00 56.70 ? 71  GLU A O   1 
ATOM   527 C CB  . GLU A 1 70  ? 42.111 11.637 -11.591 1.00 54.20 ? 71  GLU A CB  1 
ATOM   528 N N   . ILE A 1 71  ? 41.270 12.124 -8.605  1.00 37.14 ? 72  ILE A N   1 
ATOM   529 C CA  . ILE A 1 71  ? 40.229 12.836 -7.863  1.00 32.58 ? 72  ILE A CA  1 
ATOM   530 C C   . ILE A 1 71  ? 40.182 12.445 -6.368  1.00 35.06 ? 72  ILE A C   1 
ATOM   531 O O   . ILE A 1 71  ? 39.504 13.087 -5.587  1.00 36.64 ? 72  ILE A O   1 
ATOM   532 C CB  . ILE A 1 71  ? 38.810 12.621 -8.484  1.00 43.61 ? 72  ILE A CB  1 
ATOM   533 C CG1 . ILE A 1 71  ? 38.428 11.163 -8.420  1.00 42.97 ? 72  ILE A CG1 1 
ATOM   534 C CG2 . ILE A 1 71  ? 38.685 13.161 -9.960  1.00 38.91 ? 72  ILE A CG2 1 
ATOM   535 C CD1 . ILE A 1 71  ? 37.817 10.781 -7.181  1.00 44.69 ? 72  ILE A CD1 1 
ATOM   536 N N   . PHE A 1 72  ? 40.873 11.382 -5.960  1.00 36.35 ? 73  PHE A N   1 
ATOM   537 C CA  . PHE A 1 72  ? 41.003 11.089 -4.528  1.00 34.00 ? 73  PHE A CA  1 
ATOM   538 C C   . PHE A 1 72  ? 41.450 12.316 -3.709  1.00 33.08 ? 73  PHE A C   1 
ATOM   539 O O   . PHE A 1 72  ? 40.914 12.586 -2.634  1.00 33.84 ? 73  PHE A O   1 
ATOM   540 C CB  . PHE A 1 72  ? 41.948 9.902  -4.288  1.00 38.46 ? 73  PHE A CB  1 
ATOM   541 C CG  . PHE A 1 72  ? 41.929 9.407  -2.884  1.00 35.16 ? 73  PHE A CG  1 
ATOM   542 C CD1 . PHE A 1 72  ? 40.786 8.817  -2.375  1.00 43.42 ? 73  PHE A CD1 1 
ATOM   543 C CD2 . PHE A 1 72  ? 43.015 9.591  -2.040  1.00 35.23 ? 73  PHE A CD2 1 
ATOM   544 C CE1 . PHE A 1 72  ? 40.727 8.382  -1.065  1.00 51.03 ? 73  PHE A CE1 1 
ATOM   545 C CE2 . PHE A 1 72  ? 42.972 9.162  -0.727  1.00 40.29 ? 73  PHE A CE2 1 
ATOM   546 C CZ  . PHE A 1 72  ? 41.818 8.545  -0.237  1.00 49.65 ? 73  PHE A CZ  1 
ATOM   547 N N   . GLY A 1 73  ? 42.397 13.089 -4.198  1.00 31.90 ? 74  GLY A N   1 
ATOM   548 C CA  . GLY A 1 73  ? 42.808 14.276 -3.467  1.00 36.50 ? 74  GLY A CA  1 
ATOM   549 C C   . GLY A 1 73  ? 41.674 15.267 -3.243  1.00 33.39 ? 74  GLY A C   1 
ATOM   550 O O   . GLY A 1 73  ? 41.617 15.921 -2.186  1.00 34.46 ? 74  GLY A O   1 
ATOM   551 N N   . LEU A 1 74  ? 40.760 15.373 -4.219  1.00 35.85 ? 75  LEU A N   1 
ATOM   552 C CA  . LEU A 1 74  ? 39.591 16.253 -4.064  1.00 35.15 ? 75  LEU A CA  1 
ATOM   553 C C   . LEU A 1 74  ? 38.728 15.762 -2.938  1.00 32.93 ? 75  LEU A C   1 
ATOM   554 O O   . LEU A 1 74  ? 38.163 16.545 -2.169  1.00 32.19 ? 75  LEU A O   1 
ATOM   555 C CB  . LEU A 1 74  ? 38.737 16.348 -5.365  1.00 35.75 ? 75  LEU A CB  1 
ATOM   556 C CG  . LEU A 1 74  ? 39.452 16.871 -6.582  1.00 40.61 ? 75  LEU A CG  1 
ATOM   557 C CD1 . LEU A 1 74  ? 38.400 17.023 -7.683  1.00 41.45 ? 75  LEU A CD1 1 
ATOM   558 C CD2 . LEU A 1 74  ? 40.193 18.174 -6.326  1.00 49.99 ? 75  LEU A CD2 1 
ATOM   559 N N   . LEU A 1 75  ? 38.579 14.448 -2.845  1.00 31.72 ? 76  LEU A N   1 
ATOM   560 C CA  . LEU A 1 75  ? 37.721 13.901 -1.797  1.00 31.83 ? 76  LEU A CA  1 
ATOM   561 C C   . LEU A 1 75  ? 38.363 14.146 -0.453  1.00 32.70 ? 76  LEU A C   1 
ATOM   562 O O   . LEU A 1 75  ? 37.691 14.539 0.473   1.00 30.07 ? 76  LEU A O   1 
ATOM   563 C CB  . LEU A 1 75  ? 37.398 12.426 -2.008  1.00 34.06 ? 76  LEU A CB  1 
ATOM   564 C CG  . LEU A 1 75  ? 36.091 12.080 -2.740  1.00 41.01 ? 76  LEU A CG  1 
ATOM   565 C CD1 . LEU A 1 75  ? 34.879 12.556 -1.966  1.00 36.80 ? 76  LEU A CD1 1 
ATOM   566 C CD2 . LEU A 1 75  ? 36.128 12.665 -4.109  1.00 40.80 ? 76  LEU A CD2 1 
ATOM   567 N N   . LEU A 1 76  ? 39.675 13.933 -0.344  1.00 31.60 ? 77  LEU A N   1 
ATOM   568 C CA  . LEU A 1 76  ? 40.377 14.194 0.920   1.00 33.02 ? 77  LEU A CA  1 
ATOM   569 C C   . LEU A 1 76  ? 40.269 15.637 1.324   1.00 30.48 ? 77  LEU A C   1 
ATOM   570 O O   . LEU A 1 76  ? 40.020 15.926 2.479   1.00 34.61 ? 77  LEU A O   1 
ATOM   571 C CB  . LEU A 1 76  ? 41.852 13.854 0.809   1.00 34.79 ? 77  LEU A CB  1 
ATOM   572 C CG  . LEU A 1 76  ? 42.142 12.385 0.773   1.00 33.24 ? 77  LEU A CG  1 
ATOM   573 C CD1 . LEU A 1 76  ? 43.668 12.150 0.713   1.00 38.24 ? 77  LEU A CD1 1 
ATOM   574 C CD2 . LEU A 1 76  ? 41.537 11.677 2.010   1.00 39.42 ? 77  LEU A CD2 1 
ATOM   575 N N   . ASP A 1 77  ? 40.374 16.530 0.350   1.00 29.79 ? 78  ASP A N   1 
ATOM   576 C CA  . ASP A 1 77  ? 40.179 17.933 0.587   1.00 30.93 ? 78  ASP A CA  1 
ATOM   577 C C   . ASP A 1 77  ? 38.815 18.193 1.210   1.00 32.21 ? 78  ASP A C   1 
ATOM   578 O O   . ASP A 1 77  ? 38.667 19.047 2.095   1.00 32.58 ? 78  ASP A O   1 
ATOM   579 C CB  . ASP A 1 77  ? 40.297 18.750 -0.696  1.00 33.38 ? 78  ASP A CB  1 
ATOM   580 C CG  . ASP A 1 77  ? 41.726 18.878 -1.212  1.00 42.25 ? 78  ASP A CG  1 
ATOM   581 O OD1 . ASP A 1 77  ? 42.672 18.467 -0.520  1.00 38.41 ? 78  ASP A OD1 1 
ATOM   582 O OD2 . ASP A 1 77  ? 41.910 19.422 -2.325  1.00 38.77 ? 78  ASP A OD2 1 
ATOM   583 N N   . PHE A 1 78  ? 37.797 17.520 0.695   1.00 29.83 ? 79  PHE A N   1 
ATOM   584 C CA  . PHE A 1 78  ? 36.450 17.648 1.239   1.00 28.93 ? 79  PHE A CA  1 
ATOM   585 C C   . PHE A 1 78  ? 36.403 17.195 2.705   1.00 31.24 ? 79  PHE A C   1 
ATOM   586 O O   . PHE A 1 78  ? 35.774 17.819 3.566   1.00 30.83 ? 79  PHE A O   1 
ATOM   587 C CB  . PHE A 1 78  ? 35.493 16.826 0.402   1.00 29.36 ? 79  PHE A CB  1 
ATOM   588 C CG  . PHE A 1 78  ? 34.089 16.818 0.887   1.00 28.65 ? 79  PHE A CG  1 
ATOM   589 C CD1 . PHE A 1 78  ? 33.399 17.980 1.099   1.00 34.84 ? 79  PHE A CD1 1 
ATOM   590 C CD2 . PHE A 1 78  ? 33.438 15.604 1.145   1.00 30.17 ? 79  PHE A CD2 1 
ATOM   591 C CE1 . PHE A 1 78  ? 32.079 17.933 1.516   1.00 30.05 ? 79  PHE A CE1 1 
ATOM   592 C CE2 . PHE A 1 78  ? 32.152 15.576 1.594   1.00 33.04 ? 79  PHE A CE2 1 
ATOM   593 C CZ  . PHE A 1 78  ? 31.460 16.739 1.753   1.00 35.82 ? 79  PHE A CZ  1 
ATOM   594 N N   . PHE A 1 79  ? 37.032 16.048 2.991   1.00 31.08 ? 80  PHE A N   1 
ATOM   595 C CA  . PHE A 1 79  ? 37.056 15.539 4.349   1.00 30.79 ? 80  PHE A CA  1 
ATOM   596 C C   . PHE A 1 79  ? 37.710 16.544 5.332   1.00 27.43 ? 80  PHE A C   1 
ATOM   597 O O   . PHE A 1 79  ? 37.272 16.618 6.480   1.00 30.86 ? 80  PHE A O   1 
ATOM   598 C CB  . PHE A 1 79  ? 37.817 14.230 4.447   1.00 30.73 ? 80  PHE A CB  1 
ATOM   599 C CG  . PHE A 1 79  ? 37.228 13.070 3.605   1.00 31.41 ? 80  PHE A CG  1 
ATOM   600 C CD1 . PHE A 1 79  ? 35.987 13.153 3.019   1.00 31.11 ? 80  PHE A CD1 1 
ATOM   601 C CD2 . PHE A 1 79  ? 37.958 11.901 3.479   1.00 36.35 ? 80  PHE A CD2 1 
ATOM   602 C CE1 . PHE A 1 79  ? 35.512 12.090 2.241   1.00 31.13 ? 80  PHE A CE1 1 
ATOM   603 C CE2 . PHE A 1 79  ? 37.495 10.865 2.745   1.00 38.06 ? 80  PHE A CE2 1 
ATOM   604 C CZ  . PHE A 1 79  ? 36.272 10.944 2.146   1.00 31.11 ? 80  PHE A CZ  1 
ATOM   605 N N   . TYR A 1 80  ? 38.742 17.228 4.854   1.00 30.27 ? 81  TYR A N   1 
ATOM   606 C CA  . TYR A 1 80  ? 39.547 18.112 5.687   1.00 29.21 ? 81  TYR A CA  1 
ATOM   607 C C   . TYR A 1 80  ? 39.048 19.538 5.743   1.00 31.71 ? 81  TYR A C   1 
ATOM   608 O O   . TYR A 1 80  ? 39.484 20.290 6.610   1.00 31.01 ? 81  TYR A O   1 
ATOM   609 C CB  . TYR A 1 80  ? 41.016 18.040 5.281   1.00 32.51 ? 81  TYR A CB  1 
ATOM   610 C CG  . TYR A 1 80  ? 41.689 16.851 5.909   1.00 29.36 ? 81  TYR A CG  1 
ATOM   611 C CD1 . TYR A 1 80  ? 41.688 15.602 5.280   1.00 31.82 ? 81  TYR A CD1 1 
ATOM   612 C CD2 . TYR A 1 80  ? 42.337 16.959 7.146   1.00 29.41 ? 81  TYR A CD2 1 
ATOM   613 C CE1 . TYR A 1 80  ? 42.322 14.493 5.860   1.00 32.24 ? 81  TYR A CE1 1 
ATOM   614 C CE2 . TYR A 1 80  ? 42.965 15.843 7.744   1.00 33.30 ? 81  TYR A CE2 1 
ATOM   615 C CZ  . TYR A 1 80  ? 42.941 14.605 7.094   1.00 34.54 ? 81  TYR A CZ  1 
ATOM   616 O OH  . TYR A 1 80  ? 43.557 13.510 7.652   1.00 29.18 ? 81  TYR A OH  1 
ATOM   617 N N   . THR A 1 81  ? 38.171 19.934 4.825   1.00 30.99 ? 82  THR A N   1 
ATOM   618 C CA  . THR A 1 81  ? 37.727 21.339 4.724   1.00 27.94 ? 82  THR A CA  1 
ATOM   619 C C   . THR A 1 81  ? 36.244 21.568 4.620   1.00 31.81 ? 82  THR A C   1 
ATOM   620 O O   . THR A 1 81  ? 35.792 22.689 4.827   1.00 31.38 ? 82  THR A O   1 
ATOM   621 C CB  . THR A 1 81  ? 38.397 22.057 3.556   1.00 31.16 ? 82  THR A CB  1 
ATOM   622 O OG1 . THR A 1 81  ? 37.846 21.646 2.294   1.00 29.64 ? 82  THR A OG1 1 
ATOM   623 C CG2 . THR A 1 81  ? 39.940 21.884 3.534   1.00 31.07 ? 82  THR A CG2 1 
ATOM   624 N N   . GLY A 1 82  ? 35.486 20.521 4.254   1.00 31.31 ? 83  GLY A N   1 
ATOM   625 C CA  . GLY A 1 82  ? 34.067 20.696 4.066   1.00 29.15 ? 83  GLY A CA  1 
ATOM   626 C C   . GLY A 1 82  ? 33.659 21.159 2.673   1.00 32.70 ? 83  GLY A C   1 
ATOM   627 O O   . GLY A 1 82  ? 32.460 21.263 2.403   1.00 33.66 ? 83  GLY A O   1 
ATOM   628 N N   . HIS A 1 83  ? 34.631 21.428 1.791   1.00 30.78 ? 84  HIS A N   1 
ATOM   629 C CA  . HIS A 1 83  ? 34.350 21.909 0.454   1.00 30.64 ? 84  HIS A CA  1 
ATOM   630 C C   . HIS A 1 83  ? 34.686 20.834 -0.575  1.00 30.68 ? 84  HIS A C   1 
ATOM   631 O O   . HIS A 1 83  ? 35.779 20.289 -0.570  1.00 30.75 ? 84  HIS A O   1 
ATOM   632 C CB  . HIS A 1 83  ? 35.145 23.155 0.104   1.00 29.93 ? 84  HIS A CB  1 
ATOM   633 C CG  . HIS A 1 83  ? 34.885 23.609 -1.292  1.00 30.76 ? 84  HIS A CG  1 
ATOM   634 N ND1 . HIS A 1 83  ? 33.667 24.113 -1.677  1.00 33.15 ? 84  HIS A ND1 1 
ATOM   635 C CD2 . HIS A 1 83  ? 35.651 23.553 -2.408  1.00 35.14 ? 84  HIS A CD2 1 
ATOM   636 C CE1 . HIS A 1 83  ? 33.695 24.366 -2.977  1.00 30.88 ? 84  HIS A CE1 1 
ATOM   637 N NE2 . HIS A 1 83  ? 34.894 24.044 -3.440  1.00 33.57 ? 84  HIS A NE2 1 
ATOM   638 N N   . LEU A 1 84  ? 33.741 20.560 -1.471  1.00 29.92 ? 85  LEU A N   1 
ATOM   639 C CA  . LEU A 1 84  ? 33.949 19.617 -2.558  1.00 27.98 ? 85  LEU A CA  1 
ATOM   640 C C   . LEU A 1 84  ? 34.072 20.379 -3.871  1.00 29.09 ? 85  LEU A C   1 
ATOM   641 O O   . LEU A 1 84  ? 33.086 20.986 -4.326  1.00 28.46 ? 85  LEU A O   1 
ATOM   642 C CB  . LEU A 1 84  ? 32.769 18.632 -2.639  1.00 27.38 ? 85  LEU A CB  1 
ATOM   643 C CG  . LEU A 1 84  ? 32.972 17.434 -3.576  1.00 30.04 ? 85  LEU A CG  1 
ATOM   644 C CD1 . LEU A 1 84  ? 34.153 16.528 -3.167  1.00 33.18 ? 85  LEU A CD1 1 
ATOM   645 C CD2 . LEU A 1 84  ? 31.659 16.657 -3.592  1.00 28.27 ? 85  LEU A CD2 1 
ATOM   646 N N   . ALA A 1 85  ? 35.276 20.349 -4.450  1.00 30.26 ? 86  ALA A N   1 
ATOM   647 C CA  . ALA A 1 85  ? 35.648 21.160 -5.615  1.00 30.98 ? 86  ALA A CA  1 
ATOM   648 C C   . ALA A 1 85  ? 35.143 20.548 -6.935  1.00 32.08 ? 86  ALA A C   1 
ATOM   649 O O   . ALA A 1 85  ? 35.928 20.092 -7.766  1.00 33.03 ? 86  ALA A O   1 
ATOM   650 C CB  . ALA A 1 85  ? 37.167 21.321 -5.646  1.00 32.54 ? 86  ALA A CB  1 
ATOM   651 N N   . LEU A 1 86  ? 33.834 20.600 -7.138  1.00 29.44 ? 87  LEU A N   1 
ATOM   652 C CA  . LEU A 1 86  ? 33.203 20.020 -8.304  1.00 28.28 ? 87  LEU A CA  1 
ATOM   653 C C   . LEU A 1 86  ? 33.285 20.940 -9.508  1.00 30.46 ? 87  LEU A C   1 
ATOM   654 O O   . LEU A 1 86  ? 33.212 22.189 -9.385  1.00 32.16 ? 87  LEU A O   1 
ATOM   655 C CB  . LEU A 1 86  ? 31.749 19.704 -8.016  1.00 30.64 ? 87  LEU A CB  1 
ATOM   656 C CG  . LEU A 1 86  ? 31.453 18.657 -6.973  1.00 32.56 ? 87  LEU A CG  1 
ATOM   657 C CD1 . LEU A 1 86  ? 29.965 18.552 -6.733  1.00 33.98 ? 87  LEU A CD1 1 
ATOM   658 C CD2 . LEU A 1 86  ? 32.062 17.333 -7.418  1.00 34.45 ? 87  LEU A CD2 1 
ATOM   659 N N   . THR A 1 87  ? 33.469 20.331 -10.675 1.00 29.95 ? 88  THR A N   1 
ATOM   660 C CA  . THR A 1 87  ? 33.386 21.001 -11.949 1.00 33.10 ? 88  THR A CA  1 
ATOM   661 C C   . THR A 1 87  ? 32.584 20.129 -12.903 1.00 34.05 ? 88  THR A C   1 
ATOM   662 O O   . THR A 1 87  ? 32.357 18.939 -12.648 1.00 34.15 ? 88  THR A O   1 
ATOM   663 C CB  . THR A 1 87  ? 34.769 21.205 -12.563 1.00 34.35 ? 88  THR A CB  1 
ATOM   664 O OG1 . THR A 1 87  ? 35.355 19.926 -12.850 1.00 33.96 ? 88  THR A OG1 1 
ATOM   665 C CG2 . THR A 1 87  ? 35.680 21.984 -11.645 1.00 32.42 ? 88  THR A CG2 1 
ATOM   666 N N   . SER A 1 88  ? 32.151 20.692 -14.025 1.00 33.05 ? 89  SER A N   1 
ATOM   667 C CA  . SER A 1 88  ? 31.413 19.885 -15.004 1.00 26.32 ? 89  SER A CA  1 
ATOM   668 C C   . SER A 1 88  ? 32.281 18.708 -15.444 1.00 31.25 ? 89  SER A C   1 
ATOM   669 O O   . SER A 1 88  ? 31.784 17.587 -15.607 1.00 35.27 ? 89  SER A O   1 
ATOM   670 C CB  . SER A 1 88  ? 31.006 20.719 -16.232 1.00 36.89 ? 89  SER A CB  1 
ATOM   671 O OG  . SER A 1 88  ? 30.208 21.825 -15.854 1.00 50.14 ? 89  SER A OG  1 
ATOM   672 N N   . GLY A 1 89  ? 33.579 18.964 -15.604 1.00 28.73 ? 90  GLY A N   1 
ATOM   673 C CA  . GLY A 1 89  ? 34.539 17.955 -16.039 1.00 32.11 ? 90  GLY A CA  1 
ATOM   674 C C   . GLY A 1 89  ? 34.820 16.832 -15.049 1.00 35.48 ? 90  GLY A C   1 
ATOM   675 O O   . GLY A 1 89  ? 35.097 15.697 -15.459 1.00 35.92 ? 90  GLY A O   1 
ATOM   676 N N   . ASN A 1 90  ? 34.723 17.111 -13.752 1.00 33.06 ? 91  ASN A N   1 
ATOM   677 C CA  . ASN A 1 90  ? 35.064 16.075 -12.761 1.00 32.42 ? 91  ASN A CA  1 
ATOM   678 C C   . ASN A 1 90  ? 33.887 15.465 -12.025 1.00 29.51 ? 91  ASN A C   1 
ATOM   679 O O   . ASN A 1 90  ? 34.071 14.488 -11.309 1.00 29.92 ? 91  ASN A O   1 
ATOM   680 C CB  . ASN A 1 90  ? 36.113 16.573 -11.766 1.00 31.84 ? 91  ASN A CB  1 
ATOM   681 C CG  . ASN A 1 90  ? 35.562 17.530 -10.720 1.00 32.88 ? 91  ASN A CG  1 
ATOM   682 O OD1 . ASN A 1 90  ? 34.340 17.641 -10.501 1.00 31.01 ? 91  ASN A OD1 1 
ATOM   683 N ND2 . ASN A 1 90  ? 36.484 18.249 -10.053 1.00 30.37 ? 91  ASN A ND2 1 
ATOM   684 N N   . ARG A 1 91  ? 32.695 16.029 -12.203 1.00 32.02 ? 92  ARG A N   1 
ATOM   685 C CA  . ARG A 1 91  ? 31.559 15.638 -11.353 1.00 31.73 ? 92  ARG A CA  1 
ATOM   686 C C   . ARG A 1 91  ? 31.297 14.138 -11.378 1.00 29.63 ? 92  ARG A C   1 
ATOM   687 O O   . ARG A 1 91  ? 31.113 13.512 -10.340 1.00 28.35 ? 92  ARG A O   1 
ATOM   688 C CB  . ARG A 1 91  ? 30.310 16.394 -11.763 1.00 34.04 ? 92  ARG A CB  1 
ATOM   689 C CG  . ARG A 1 91  ? 29.117 16.143 -10.870 1.00 35.09 ? 92  ARG A CG  1 
ATOM   690 C CD  . ARG A 1 91  ? 28.066 15.318 -11.574 1.00 53.52 ? 92  ARG A CD  1 
ATOM   691 N NE  . ARG A 1 91  ? 26.914 16.165 -11.855 1.00 50.88 ? 92  ARG A NE  1 
ATOM   692 C CZ  . ARG A 1 91  ? 25.653 15.849 -11.558 1.00 79.94 ? 92  ARG A CZ  1 
ATOM   693 N NH1 . ARG A 1 91  ? 25.341 14.665 -11.009 1.00 75.20 ? 92  ARG A NH1 1 
ATOM   694 N NH2 . ARG A 1 91  ? 24.684 16.716 -11.835 1.00 78.99 ? 92  ARG A NH2 1 
ATOM   695 N N   . ASP A 1 92  ? 31.277 13.552 -12.566 1.00 31.53 ? 93  ASP A N   1 
ATOM   696 C CA  . ASP A 1 92  ? 30.968 12.109 -12.661 1.00 28.72 ? 93  ASP A CA  1 
ATOM   697 C C   . ASP A 1 92  ? 32.038 11.263 -11.978 1.00 31.37 ? 93  ASP A C   1 
ATOM   698 O O   . ASP A 1 92  ? 31.730 10.262 -11.331 1.00 26.83 ? 93  ASP A O   1 
ATOM   699 C CB  . ASP A 1 92  ? 30.804 11.670 -14.118 1.00 29.32 ? 93  ASP A CB  1 
ATOM   700 C CG  . ASP A 1 92  ? 29.567 12.272 -14.786 1.00 43.77 ? 93  ASP A CG  1 
ATOM   701 O OD1 . ASP A 1 92  ? 28.679 12.806 -14.077 1.00 42.13 ? 93  ASP A OD1 1 
ATOM   702 O OD2 . ASP A 1 92  ? 29.492 12.200 -16.031 1.00 49.19 ? 93  ASP A OD2 1 
ATOM   703 N N   . GLN A 1 93  ? 33.295 11.680 -12.087 1.00 26.13 ? 94  GLN A N   1 
ATOM   704 C CA  . GLN A 1 93  ? 34.380 10.958 -11.433 1.00 28.09 ? 94  GLN A CA  1 
ATOM   705 C C   . GLN A 1 93  ? 34.310 11.085 -9.919  1.00 27.07 ? 94  GLN A C   1 
ATOM   706 O O   . GLN A 1 93  ? 34.543 10.140 -9.187  1.00 26.73 ? 94  GLN A O   1 
ATOM   707 C CB  . GLN A 1 93  ? 35.724 11.484 -11.917 1.00 32.10 ? 94  GLN A CB  1 
ATOM   708 C CG  . GLN A 1 93  ? 36.092 11.077 -13.313 1.00 40.75 ? 94  GLN A CG  1 
ATOM   709 C CD  . GLN A 1 93  ? 37.160 11.971 -13.854 1.00 42.18 ? 94  GLN A CD  1 
ATOM   710 O OE1 . GLN A 1 93  ? 38.341 11.680 -13.720 1.00 56.35 ? 94  GLN A OE1 1 
ATOM   711 N NE2 . GLN A 1 93  ? 36.756 13.097 -14.410 1.00 46.79 ? 94  GLN A NE2 1 
ATOM   712 N N   . VAL A 1 94  ? 34.016 12.292 -9.447  1.00 29.76 ? 95  VAL A N   1 
ATOM   713 C CA  . VAL A 1 94  ? 33.865 12.517 -8.045  1.00 29.93 ? 95  VAL A CA  1 
ATOM   714 C C   . VAL A 1 94  ? 32.641 11.729 -7.509  1.00 25.89 ? 95  VAL A C   1 
ATOM   715 O O   . VAL A 1 94  ? 32.750 11.112 -6.465  1.00 27.87 ? 95  VAL A O   1 
ATOM   716 C CB  . VAL A 1 94  ? 33.794 14.015 -7.720  1.00 32.05 ? 95  VAL A CB  1 
ATOM   717 C CG1 . VAL A 1 94  ? 33.466 14.249 -6.236  1.00 27.77 ? 95  VAL A CG1 1 
ATOM   718 C CG2 . VAL A 1 94  ? 35.100 14.659 -8.091  1.00 30.40 ? 95  VAL A CG2 1 
ATOM   719 N N   . LEU A 1 95  ? 31.537 11.729 -8.241  1.00 25.90 ? 96  LEU A N   1 
ATOM   720 C CA  . LEU A 1 95  ? 30.356 10.987 -7.825  1.00 28.15 ? 96  LEU A CA  1 
ATOM   721 C C   . LEU A 1 95  ? 30.668 9.497  -7.659  1.00 27.14 ? 96  LEU A C   1 
ATOM   722 O O   . LEU A 1 95  ? 30.203 8.847  -6.735  1.00 26.33 ? 96  LEU A O   1 
ATOM   723 C CB  . LEU A 1 95  ? 29.215 11.221 -8.783  1.00 27.88 ? 96  LEU A CB  1 
ATOM   724 C CG  . LEU A 1 95  ? 27.878 10.505 -8.518  1.00 26.88 ? 96  LEU A CG  1 
ATOM   725 C CD1 . LEU A 1 95  ? 27.329 10.747 -7.104  1.00 27.40 ? 96  LEU A CD1 1 
ATOM   726 C CD2 . LEU A 1 95  ? 26.894 10.922 -9.578  1.00 31.13 ? 96  LEU A CD2 1 
ATOM   727 N N   . LEU A 1 96  ? 31.402 8.938  -8.617  1.00 25.93 ? 97  LEU A N   1 
ATOM   728 C CA  . LEU A 1 96  ? 31.790 7.530  -8.525  1.00 24.37 ? 97  LEU A CA  1 
ATOM   729 C C   . LEU A 1 96  ? 32.680 7.284  -7.287  1.00 25.87 ? 97  LEU A C   1 
ATOM   730 O O   . LEU A 1 96  ? 32.516 6.327  -6.560  1.00 26.28 ? 97  LEU A O   1 
ATOM   731 C CB  . LEU A 1 96  ? 32.495 7.084  -9.792  1.00 20.91 ? 97  LEU A CB  1 
ATOM   732 C CG  . LEU A 1 96  ? 33.020 5.650  -9.785  1.00 23.60 ? 97  LEU A CG  1 
ATOM   733 C CD1 . LEU A 1 96  ? 31.866 4.604  -9.474  1.00 22.40 ? 97  LEU A CD1 1 
ATOM   734 C CD2 . LEU A 1 96  ? 33.657 5.252  -11.098 1.00 32.47 ? 97  LEU A CD2 1 
ATOM   735 N N   . ALA A 1 97  ? 33.662 8.136  -7.060  1.00 25.39 ? 98  ALA A N   1 
ATOM   736 C CA  . ALA A 1 97  ? 34.501 7.969  -5.862  1.00 26.80 ? 98  ALA A CA  1 
ATOM   737 C C   . ALA A 1 97  ? 33.696 8.086  -4.561  1.00 28.36 ? 98  ALA A C   1 
ATOM   738 O O   . ALA A 1 97  ? 33.891 7.335  -3.605  1.00 29.57 ? 98  ALA A O   1 
ATOM   739 C CB  . ALA A 1 97  ? 35.623 9.031  -5.847  1.00 32.20 ? 98  ALA A CB  1 
ATOM   740 N N   . ALA A 1 98  ? 32.749 9.020  -4.545  1.00 28.96 ? 99  ALA A N   1 
ATOM   741 C CA  . ALA A 1 98  ? 31.844 9.214  -3.403  1.00 30.36 ? 99  ALA A CA  1 
ATOM   742 C C   . ALA A 1 98  ? 30.984 7.979  -3.151  1.00 29.06 ? 99  ALA A C   1 
ATOM   743 O O   . ALA A 1 98  ? 30.783 7.585  -2.002  1.00 28.94 ? 99  ALA A O   1 
ATOM   744 C CB  . ALA A 1 98  ? 30.985 10.480 -3.592  1.00 29.98 ? 99  ALA A CB  1 
ATOM   745 N N   . ARG A 1 99  ? 30.537 7.299  -4.210  1.00 26.67 ? 100 ARG A N   1 
ATOM   746 C CA  . ARG A 1 99  ? 29.850 6.050  -4.064  1.00 24.58 ? 100 ARG A CA  1 
ATOM   747 C C   . ARG A 1 99  ? 30.702 4.945  -3.548  1.00 26.77 ? 100 ARG A C   1 
ATOM   748 O O   . ARG A 1 99  ? 30.314 4.271  -2.630  1.00 30.49 ? 100 ARG A O   1 
ATOM   749 C CB  . ARG A 1 99  ? 29.361 5.546  -5.396  1.00 29.17 ? 100 ARG A CB  1 
ATOM   750 C CG  . ARG A 1 99  ? 28.228 6.245  -5.796  1.00 38.02 ? 100 ARG A CG  1 
ATOM   751 C CD  . ARG A 1 99  ? 26.965 5.720  -5.116  1.00 28.20 ? 100 ARG A CD  1 
ATOM   752 N NE  . ARG A 1 99  ? 25.971 6.524  -5.762  1.00 30.42 ? 100 ARG A NE  1 
ATOM   753 C CZ  . ARG A 1 99  ? 24.796 6.854  -5.287  1.00 27.61 ? 100 ARG A CZ  1 
ATOM   754 N NH1 . ARG A 1 99  ? 24.446 6.543  -4.067  1.00 26.38 ? 100 ARG A NH1 1 
ATOM   755 N NH2 . ARG A 1 99  ? 24.023 7.595  -6.046  1.00 26.55 ? 100 ARG A NH2 1 
ATOM   756 N N   . GLU A 1 100 ? 31.888 4.798  -4.128  1.00 26.90 ? 101 GLU A N   1 
ATOM   757 C CA  . GLU A 1 100 ? 32.808 3.723  -3.746  1.00 28.04 ? 101 GLU A CA  1 
ATOM   758 C C   . GLU A 1 100 ? 33.276 3.922  -2.311  1.00 30.56 ? 101 GLU A C   1 
ATOM   759 O O   . GLU A 1 100 ? 33.346 2.948  -1.531  1.00 30.14 ? 101 GLU A O   1 
ATOM   760 C CB  . GLU A 1 100 ? 34.023 3.692  -4.685  1.00 35.14 ? 101 GLU A CB  1 
ATOM   761 C CG  . GLU A 1 100 ? 33.696 3.349  -6.139  1.00 32.38 ? 101 GLU A CG  1 
ATOM   762 C CD  . GLU A 1 100 ? 33.352 1.897  -6.356  1.00 32.55 ? 101 GLU A CD  1 
ATOM   763 O OE1 . GLU A 1 100 ? 32.995 1.179  -5.389  1.00 29.19 ? 101 GLU A OE1 1 
ATOM   764 O OE2 . GLU A 1 100 ? 33.417 1.440  -7.537  1.00 35.18 ? 101 GLU A OE2 1 
ATOM   765 N N   . LEU A 1 101 ? 33.556 5.172  -1.945  1.00 29.48 ? 102 LEU A N   1 
ATOM   766 C CA  . LEU A 1 101 ? 33.972 5.472  -0.557  1.00 26.23 ? 102 LEU A CA  1 
ATOM   767 C C   . LEU A 1 101 ? 32.795 5.666  0.426   1.00 29.77 ? 102 LEU A C   1 
ATOM   768 O O   . LEU A 1 101 ? 32.996 5.866  1.629   1.00 29.78 ? 102 LEU A O   1 
ATOM   769 C CB  . LEU A 1 101 ? 34.904 6.670  -0.523  1.00 30.00 ? 102 LEU A CB  1 
ATOM   770 C CG  . LEU A 1 101 ? 36.192 6.516  -1.361  1.00 32.19 ? 102 LEU A CG  1 
ATOM   771 C CD1 . LEU A 1 101 ? 36.981 7.812  -1.339  1.00 39.13 ? 102 LEU A CD1 1 
ATOM   772 C CD2 . LEU A 1 101 ? 37.048 5.373  -0.858  1.00 37.46 ? 102 LEU A CD2 1 
ATOM   773 N N   . ARG A 1 102 ? 31.572 5.549  -0.081  1.00 30.65 ? 103 ARG A N   1 
ATOM   774 C CA  . ARG A 1 102 ? 30.351 5.667  0.725   1.00 27.14 ? 103 ARG A CA  1 
ATOM   775 C C   . ARG A 1 102 ? 30.364 6.969  1.554   1.00 26.81 ? 103 ARG A C   1 
ATOM   776 O O   . ARG A 1 102 ? 30.370 6.960  2.785   1.00 29.70 ? 103 ARG A O   1 
ATOM   777 C CB  . ARG A 1 102 ? 30.140 4.400  1.531   1.00 28.68 ? 103 ARG A CB  1 
ATOM   778 C CG  . ARG A 1 102 ? 30.112 3.147  0.640   1.00 29.01 ? 103 ARG A CG  1 
ATOM   779 C CD  . ARG A 1 102 ? 29.510 1.955  1.322   1.00 28.20 ? 103 ARG A CD  1 
ATOM   780 N NE  . ARG A 1 102 ? 30.237 1.463  2.493   1.00 28.35 ? 103 ARG A NE  1 
ATOM   781 C CZ  . ARG A 1 102 ? 31.250 0.583  2.464   1.00 33.37 ? 103 ARG A CZ  1 
ATOM   782 N NH1 . ARG A 1 102 ? 31.746 0.137  1.319   1.00 40.16 ? 103 ARG A NH1 1 
ATOM   783 N NH2 . ARG A 1 102 ? 31.787 0.183  3.603   1.00 44.45 ? 103 ARG A NH2 1 
ATOM   784 N N   . VAL A 1 103 ? 30.366 8.079  0.819   1.00 26.87 ? 104 VAL A N   1 
ATOM   785 C CA  . VAL A 1 103 ? 30.383 9.442  1.346   1.00 27.56 ? 104 VAL A CA  1 
ATOM   786 C C   . VAL A 1 103 ? 29.067 10.134 0.965   1.00 28.69 ? 104 VAL A C   1 
ATOM   787 O O   . VAL A 1 103 ? 28.963 10.817 -0.089  1.00 28.85 ? 104 VAL A O   1 
ATOM   788 C CB  . VAL A 1 103 ? 31.577 10.252 0.799   1.00 30.58 ? 104 VAL A CB  1 
ATOM   789 C CG1 . VAL A 1 103 ? 31.630 11.597 1.480   1.00 33.53 ? 104 VAL A CG1 1 
ATOM   790 C CG2 . VAL A 1 103 ? 32.908 9.529  0.980   1.00 33.29 ? 104 VAL A CG2 1 
ATOM   791 N N   . PRO A 1 104 ? 28.017 9.915  1.773   1.00 31.96 ? 105 PRO A N   1 
ATOM   792 C CA  . PRO A 1 104 ? 26.684 10.356 1.406   1.00 27.80 ? 105 PRO A CA  1 
ATOM   793 C C   . PRO A 1 104 ? 26.602 11.850 1.121   1.00 27.81 ? 105 PRO A C   1 
ATOM   794 O O   . PRO A 1 104 ? 25.861 12.233 0.232   1.00 30.89 ? 105 PRO A O   1 
ATOM   795 C CB  . PRO A 1 104 ? 25.822 10.005 2.606   1.00 34.25 ? 105 PRO A CB  1 
ATOM   796 C CG  . PRO A 1 104 ? 26.633 9.242  3.487   1.00 37.36 ? 105 PRO A CG  1 
ATOM   797 C CD  . PRO A 1 104 ? 28.022 9.148  3.025   1.00 36.25 ? 105 PRO A CD  1 
ATOM   798 N N   . GLU A 1 105 ? 27.332 12.655 1.891   1.00 31.66 ? 106 GLU A N   1 
ATOM   799 C CA  . GLU A 1 105 ? 27.294 14.113 1.678   1.00 29.05 ? 106 GLU A CA  1 
ATOM   800 C C   . GLU A 1 105 ? 27.853 14.534 0.327   1.00 31.85 ? 106 GLU A C   1 
ATOM   801 O O   . GLU A 1 105 ? 27.334 15.451 -0.311  1.00 34.20 ? 106 GLU A O   1 
ATOM   802 C CB  . GLU A 1 105 ? 27.987 14.860 2.818   1.00 37.54 ? 106 GLU A CB  1 
ATOM   803 C CG  . GLU A 1 105 ? 27.160 14.712 4.046   1.00 45.46 ? 106 GLU A CG  1 
ATOM   804 C CD  . GLU A 1 105 ? 27.820 15.243 5.255   1.00 60.88 ? 106 GLU A CD  1 
ATOM   805 O OE1 . GLU A 1 105 ? 28.629 16.182 5.121   1.00 49.64 ? 106 GLU A OE1 1 
ATOM   806 O OE2 . GLU A 1 105 ? 27.486 14.732 6.342   1.00 63.99 ? 106 GLU A OE2 1 
ATOM   807 N N   . ALA A 1 106 ? 28.880 13.820 -0.128  1.00 30.48 ? 107 ALA A N   1 
ATOM   808 C CA  . ALA A 1 106 ? 29.470 14.079 -1.427  1.00 31.52 ? 107 ALA A CA  1 
ATOM   809 C C   . ALA A 1 106 ? 28.546 13.596 -2.539  1.00 29.67 ? 107 ALA A C   1 
ATOM   810 O O   . ALA A 1 106 ? 28.384 14.271 -3.532  1.00 28.50 ? 107 ALA A O   1 
ATOM   811 C CB  . ALA A 1 106 ? 30.864 13.411 -1.518  1.00 28.10 ? 107 ALA A CB  1 
ATOM   812 N N   . VAL A 1 107 ? 27.897 12.449 -2.372  1.00 29.55 ? 108 VAL A N   1 
ATOM   813 C CA  . VAL A 1 107 ? 26.860 12.042 -3.340  1.00 27.80 ? 108 VAL A CA  1 
ATOM   814 C C   . VAL A 1 107 ? 25.806 13.117 -3.538  1.00 30.03 ? 108 VAL A C   1 
ATOM   815 O O   . VAL A 1 107 ? 25.475 13.493 -4.663  1.00 29.38 ? 108 VAL A O   1 
ATOM   816 C CB  . VAL A 1 107 ? 26.216 10.718 -2.932  1.00 29.38 ? 108 VAL A CB  1 
ATOM   817 C CG1 . VAL A 1 107 ? 25.056 10.391 -3.848  1.00 27.81 ? 108 VAL A CG1 1 
ATOM   818 C CG2 . VAL A 1 107 ? 27.294 9.664  -2.978  1.00 28.51 ? 108 VAL A CG2 1 
ATOM   819 N N   . GLU A 1 108 ? 25.291 13.644 -2.440  1.00 30.38 ? 109 GLU A N   1 
ATOM   820 C CA  . GLU A 1 108 ? 24.232 14.654 -2.520  1.00 32.40 ? 109 GLU A CA  1 
ATOM   821 C C   . GLU A 1 108 ? 24.762 15.918 -3.215  1.00 28.00 ? 109 GLU A C   1 
ATOM   822 O O   . GLU A 1 108 ? 24.076 16.467 -4.066  1.00 34.33 ? 109 GLU A O   1 
ATOM   823 C CB  . GLU A 1 108 ? 23.684 15.002 -1.127  1.00 37.45 ? 109 GLU A CB  1 
ATOM   824 C CG  A GLU A 1 108 ? 22.711 13.980 -0.571  0.50 51.78 ? 109 GLU A CG  1 
ATOM   825 C CG  B GLU A 1 108 ? 22.713 13.975 -0.573  0.50 51.43 ? 109 GLU A CG  1 
ATOM   826 N N   . LEU A 1 109 ? 25.977 16.348 -2.903  1.00 31.64 ? 110 LEU A N   1 
ATOM   827 C CA  . LEU A 1 109 ? 26.545 17.550 -3.552  1.00 30.24 ? 110 LEU A CA  1 
ATOM   828 C C   . LEU A 1 109 ? 26.710 17.345 -5.083  1.00 31.74 ? 110 LEU A C   1 
ATOM   829 O O   . LEU A 1 109 ? 26.388 18.213 -5.882  1.00 30.65 ? 110 LEU A O   1 
ATOM   830 C CB  . LEU A 1 109 ? 27.866 17.944 -2.914  1.00 29.82 ? 110 LEU A CB  1 
ATOM   831 C CG  . LEU A 1 109 ? 27.812 18.517 -1.484  1.00 30.34 ? 110 LEU A CG  1 
ATOM   832 C CD1 . LEU A 1 109 ? 29.172 18.532 -0.849  1.00 31.28 ? 110 LEU A CD1 1 
ATOM   833 C CD2 . LEU A 1 109 ? 27.169 19.945 -1.518  1.00 33.69 ? 110 LEU A CD2 1 
ATOM   834 N N   . CYS A 1 110 ? 27.204 16.167 -5.471  1.00 31.20 ? 111 CYS A N   1 
ATOM   835 C CA  . CYS A 1 110 ? 27.303 15.799 -6.881  1.00 31.26 ? 111 CYS A CA  1 
ATOM   836 C C   . CYS A 1 110 ? 25.952 15.809 -7.609  1.00 32.33 ? 111 CYS A C   1 
ATOM   837 O O   . CYS A 1 110 ? 25.841 16.288 -8.736  1.00 32.85 ? 111 CYS A O   1 
ATOM   838 C CB  . CYS A 1 110 ? 27.943 14.418 -7.015  1.00 29.66 ? 111 CYS A CB  1 
ATOM   839 S SG  . CYS A 1 110 ? 29.678 14.377 -6.612  1.00 30.82 ? 111 CYS A SG  1 
ATOM   840 N N   . GLN A 1 111 ? 24.925 15.278 -6.965  1.00 32.62 ? 112 GLN A N   1 
ATOM   841 C CA  . GLN A 1 111 ? 23.600 15.232 -7.562  1.00 32.19 ? 112 GLN A CA  1 
ATOM   842 C C   . GLN A 1 111 ? 22.998 16.607 -7.748  1.00 32.10 ? 112 GLN A C   1 
ATOM   843 O O   . GLN A 1 111 ? 22.314 16.865 -8.730  1.00 33.82 ? 112 GLN A O   1 
ATOM   844 C CB  . GLN A 1 111 ? 22.672 14.381 -6.718  1.00 31.43 ? 112 GLN A CB  1 
ATOM   845 C CG  . GLN A 1 111 ? 22.970 12.922 -6.860  1.00 32.31 ? 112 GLN A CG  1 
ATOM   846 C CD  . GLN A 1 111 ? 22.072 12.051 -6.065  1.00 43.56 ? 112 GLN A CD  1 
ATOM   847 O OE1 . GLN A 1 111 ? 21.295 12.523 -5.227  1.00 42.95 ? 112 GLN A OE1 1 
ATOM   848 N NE2 . GLN A 1 111 ? 22.160 10.762 -6.313  1.00 30.80 ? 112 GLN A NE2 1 
ATOM   849 N N   . SER A 1 112 ? 23.253 17.484 -6.796  1.00 37.27 ? 113 SER A N   1 
ATOM   850 C CA  . SER A 1 112 ? 22.667 18.822 -6.801  1.00 36.50 ? 113 SER A CA  1 
ATOM   851 C C   . SER A 1 112 ? 23.484 19.808 -7.639  1.00 45.18 ? 113 SER A C   1 
ATOM   852 O O   . SER A 1 112 ? 23.050 20.945 -7.850  1.00 45.63 ? 113 SER A O   1 
ATOM   853 C CB  A SER A 1 112 ? 22.508 19.320 -5.359  0.50 37.63 ? 113 SER A CB  1 
ATOM   854 C CB  B SER A 1 112 ? 22.593 19.342 -5.366  0.50 35.65 ? 113 SER A CB  1 
ATOM   855 O OG  A SER A 1 112 ? 21.381 18.688 -4.765  0.50 36.50 ? 113 SER A OG  1 
ATOM   856 O OG  B SER A 1 112 ? 23.886 19.441 -4.825  0.50 40.71 ? 113 SER A OG  1 
ATOM   857 N N   . PHE A 1 113 ? 24.656 19.382 -8.116  1.00 40.16 ? 114 PHE A N   1 
ATOM   858 C CA  . PHE A 1 113 ? 25.559 20.251 -8.875  1.00 40.31 ? 114 PHE A CA  1 
ATOM   859 C C   . PHE A 1 113 ? 24.924 20.649 -10.207 1.00 40.15 ? 114 PHE A C   1 
ATOM   860 O O   . PHE A 1 113 ? 24.424 19.792 -10.934 1.00 43.36 ? 114 PHE A O   1 
ATOM   861 C CB  . PHE A 1 113 ? 26.882 19.532 -9.123  1.00 38.51 ? 114 PHE A CB  1 
ATOM   862 C CG  . PHE A 1 113 ? 27.921 20.380 -9.812  1.00 39.89 ? 114 PHE A CG  1 
ATOM   863 C CD1 . PHE A 1 113 ? 28.458 21.475 -9.177  1.00 39.50 ? 114 PHE A CD1 1 
ATOM   864 C CD2 . PHE A 1 113 ? 28.362 20.067 -11.087 1.00 54.84 ? 114 PHE A CD2 1 
ATOM   865 C CE1 . PHE A 1 113 ? 29.402 22.266 -9.807  1.00 38.82 ? 114 PHE A CE1 1 
ATOM   866 C CE2 . PHE A 1 113 ? 29.313 20.852 -11.724 1.00 53.80 ? 114 PHE A CE2 1 
ATOM   867 C CZ  . PHE A 1 113 ? 29.833 21.948 -11.079 1.00 34.70 ? 114 PHE A CZ  1 
ATOM   868 N N   . LYS A 1 114 ? 24.960 21.944 -10.513 1.00 44.91 ? 115 LYS A N   1 
ATOM   869 C CA  . LYS A 1 114 ? 24.347 22.482 -11.715 1.00 48.70 ? 115 LYS A CA  1 
ATOM   870 C C   . LYS A 1 114 ? 25.102 23.723 -12.204 1.00 53.44 ? 115 LYS A C   1 
ATOM   871 O O   . LYS A 1 114 ? 26.316 23.678 -12.434 1.00 53.80 ? 115 LYS A O   1 
ATOM   872 C CB  . LYS A 1 114 ? 22.883 22.824 -11.426 1.00 47.97 ? 115 LYS A CB  1 
HETATM 873 S S   A UNK B 2 .   ? 34.307 14.864 10.741  0.50 28.11 ? 900 UNK A S   1 
HETATM 874 S S   B UNK B 2 .   ? 34.910 14.599 10.990  0.50 27.77 ? 900 UNK A S   1 
HETATM 875 S S   . UNK C 2 .   ? 32.211 14.433 5.381   1.00 34.64 ? 901 UNK A S   1 
HETATM 876 C C1  . EDO D 3 .   ? 53.739 9.154  10.345  1.00 54.11 ? 1   EDO A C1  1 
HETATM 877 O O1  . EDO D 3 .   ? 52.791 10.192 10.045  1.00 40.22 ? 1   EDO A O1  1 
HETATM 878 C C2  . EDO D 3 .   ? 53.040 7.795  10.340  1.00 63.39 ? 1   EDO A C2  1 
HETATM 879 O O2  . EDO D 3 .   ? 52.375 7.556  9.084   1.00 49.11 ? 1   EDO A O2  1 
HETATM 880 C C1  . EDO E 3 .   ? 44.169 -0.150 8.405   1.00 64.24 ? 902 EDO A C1  1 
HETATM 881 O O1  . EDO E 3 .   ? 42.971 -0.810 7.965   1.00 60.40 ? 902 EDO A O1  1 
HETATM 882 C C2  . EDO E 3 .   ? 44.055 0.338  9.859   1.00 53.20 ? 902 EDO A C2  1 
HETATM 883 O O2  . EDO E 3 .   ? 43.203 -0.520 10.647  1.00 45.81 ? 902 EDO A O2  1 
HETATM 884 O O   . HOH F 4 .   ? 37.381 19.133 -2.843  1.00 25.04 ? 903 HOH A O   1 
HETATM 885 O O   . HOH F 4 .   ? 46.861 10.732 14.699  1.00 25.00 ? 904 HOH A O   1 
HETATM 886 O O   . HOH F 4 .   ? 46.328 25.453 14.469  1.00 36.29 ? 905 HOH A O   1 
HETATM 887 O O   . HOH F 4 .   ? 38.448 20.660 14.349  0.50 27.12 ? 906 HOH A O   1 
HETATM 888 O O   . HOH F 4 .   ? 31.099 21.862 -1.040  1.00 31.23 ? 907 HOH A O   1 
HETATM 889 O O   . HOH F 4 .   ? 44.493 4.187  14.401  1.00 29.04 ? 908 HOH A O   1 
HETATM 890 O O   . HOH F 4 .   ? 29.692 8.458  -11.511 1.00 26.08 ? 909 HOH A O   1 
HETATM 891 O O   . HOH F 4 .   ? 54.782 12.253 12.094  1.00 32.43 ? 910 HOH A O   1 
HETATM 892 O O   . HOH F 4 .   ? 46.839 25.052 8.412   1.00 25.02 ? 911 HOH A O   1 
HETATM 893 O O   . HOH F 4 .   ? 34.171 13.084 -14.584 1.00 29.85 ? 912 HOH A O   1 
HETATM 894 O O   . HOH F 4 .   ? 46.878 13.377 1.983   1.00 33.62 ? 913 HOH A O   1 
HETATM 895 O O   . HOH F 4 .   ? 43.073 26.761 21.580  1.00 34.30 ? 914 HOH A O   1 
HETATM 896 O O   . HOH F 4 .   ? 51.732 17.396 0.595   1.00 41.38 ? 915 HOH A O   1 
HETATM 897 O O   . HOH F 4 .   ? 26.122 5.323  -1.782  1.00 37.40 ? 916 HOH A O   1 
HETATM 898 O O   . HOH F 4 .   ? 39.786 20.517 -3.502  1.00 31.86 ? 917 HOH A O   1 
HETATM 899 O O   . HOH F 4 .   ? 30.488 20.572 4.144   1.00 45.20 ? 918 HOH A O   1 
HETATM 900 O O   . HOH F 4 .   ? 50.007 13.536 2.204   1.00 45.49 ? 919 HOH A O   1 
HETATM 901 O O   . HOH F 4 .   ? 41.569 29.608 16.032  1.00 33.65 ? 920 HOH A O   1 
HETATM 902 O O   . HOH F 4 .   ? 31.635 14.779 -15.365 1.00 42.58 ? 921 HOH A O   1 
HETATM 903 O O   . HOH F 4 .   ? 28.124 2.787  -2.575  1.00 41.65 ? 922 HOH A O   1 
HETATM 904 O O   . HOH F 4 .   ? 29.402 11.907 4.112   1.00 36.36 ? 923 HOH A O   1 
HETATM 905 O O   A HOH F 4 .   ? 47.870 25.500 16.895  0.50 36.18 ? 924 HOH A O   1 
HETATM 906 O O   B HOH F 4 .   ? 48.841 24.244 17.014  0.50 45.49 ? 924 HOH A O   1 
HETATM 907 O O   . HOH F 4 .   ? 52.124 20.085 15.885  1.00 45.02 ? 925 HOH A O   1 
HETATM 908 O O   . HOH F 4 .   ? 26.785 6.515  0.146   1.00 39.95 ? 926 HOH A O   1 
HETATM 909 O O   . HOH F 4 .   ? 40.516 21.699 -5.879  1.00 52.69 ? 927 HOH A O   1 
HETATM 910 O O   . HOH F 4 .   ? 44.556 19.616 3.600   1.00 37.47 ? 928 HOH A O   1 
HETATM 911 O O   . HOH F 4 .   ? 38.629 23.887 0.651   1.00 40.68 ? 929 HOH A O   1 
HETATM 912 O O   . HOH F 4 .   ? 51.747 1.134  -7.592  1.00 44.20 ? 930 HOH A O   1 
HETATM 913 O O   . HOH F 4 .   ? 43.516 29.039 14.142  1.00 35.89 ? 931 HOH A O   1 
HETATM 914 O O   . HOH F 4 .   ? 46.788 2.874  7.191   1.00 36.79 ? 932 HOH A O   1 
HETATM 915 O O   . HOH F 4 .   ? 48.011 3.093  11.627  1.00 45.89 ? 933 HOH A O   1 
HETATM 916 O O   . HOH F 4 .   ? 31.762 23.647 -6.956  1.00 51.56 ? 934 HOH A O   1 
HETATM 917 O O   . HOH F 4 .   ? 50.330 4.783  8.626   1.00 50.21 ? 935 HOH A O   1 
HETATM 918 O O   . HOH F 4 .   ? 25.460 17.160 1.145   1.00 49.60 ? 936 HOH A O   1 
HETATM 919 O O   . HOH F 4 .   ? 35.448 23.731 -8.523  1.00 42.88 ? 937 HOH A O   1 
HETATM 920 O O   . HOH F 4 .   ? 39.384 17.885 -11.039 1.00 49.03 ? 938 HOH A O   1 
HETATM 921 O O   . HOH F 4 .   ? 26.580 5.373  2.602   1.00 53.72 ? 939 HOH A O   1 
HETATM 922 O O   . HOH F 4 .   ? 26.577 10.180 -14.070 1.00 49.05 ? 940 HOH A O   1 
HETATM 923 O O   . HOH F 4 .   ? 44.242 -2.418 0.905   1.00 52.19 ? 941 HOH A O   1 
HETATM 924 O O   . HOH F 4 .   ? 54.854 10.707 6.259   1.00 50.43 ? 942 HOH A O   1 
HETATM 925 O O   . HOH F 4 .   ? 33.968 0.368  -2.938  1.00 49.23 ? 943 HOH A O   1 
HETATM 926 O O   . HOH F 4 .   ? 34.031 -1.964 2.833   1.00 53.19 ? 944 HOH A O   1 
HETATM 927 O O   . HOH F 4 .   ? 37.837 19.686 -13.714 1.00 50.80 ? 945 HOH A O   1 
HETATM 928 O O   . HOH F 4 .   ? 40.524 -4.441 11.209  1.00 59.77 ? 946 HOH A O   1 
HETATM 929 O O   . HOH F 4 .   ? 53.475 9.730  -3.895  1.00 45.26 ? 947 HOH A O   1 
HETATM 930 O O   . HOH F 4 .   ? 44.256 12.718 -6.316  1.00 41.97 ? 948 HOH A O   1 
HETATM 931 O O   . HOH F 4 .   ? 38.452 20.976 -8.681  1.00 41.33 ? 949 HOH A O   1 
HETATM 932 O O   . HOH F 4 .   ? 46.406 15.057 -5.590  1.00 55.87 ? 950 HOH A O   1 
HETATM 933 O O   . HOH F 4 .   ? 34.960 21.573 -16.073 1.00 47.55 ? 951 HOH A O   1 
HETATM 934 O O   . HOH F 4 .   ? 32.522 24.577 -11.000 1.00 55.40 ? 952 HOH A O   1 
HETATM 935 O O   . HOH F 4 .   ? 52.031 23.559 13.589  1.00 41.43 ? 953 HOH A O   1 
HETATM 936 O O   . HOH F 4 .   ? 39.856 -4.274 7.674   1.00 58.57 ? 954 HOH A O   1 
HETATM 937 O O   . HOH F 4 .   ? 30.343 21.404 -4.049  1.00 47.90 ? 955 HOH A O   1 
HETATM 938 O O   . HOH F 4 .   ? 46.313 16.686 -3.219  1.00 61.39 ? 956 HOH A O   1 
HETATM 939 O O   . HOH F 4 .   ? 44.066 10.813 14.361  0.50 29.04 ? 957 HOH A O   1 
HETATM 940 O O   . HOH F 4 .   ? 42.911 12.990 14.313  0.50 38.84 ? 958 HOH A O   1 
HETATM 941 O O   . HOH F 4 .   ? 26.178 20.861 -5.361  1.00 42.15 ? 959 HOH A O   1 
HETATM 942 O O   . HOH F 4 .   ? 57.166 16.728 9.014   1.00 60.30 ? 960 HOH A O   1 
HETATM 943 O O   . HOH F 4 .   ? 28.696 18.092 3.582   1.00 49.12 ? 961 HOH A O   1 
HETATM 944 O O   . HOH F 4 .   ? 36.216 8.288  -10.001 1.00 48.01 ? 962 HOH A O   1 
HETATM 945 O O   . HOH F 4 .   ? 21.618 8.667  -4.940  1.00 35.59 ? 963 HOH A O   1 
HETATM 946 O O   . HOH F 4 .   ? 31.778 25.258 0.129   1.00 60.69 ? 964 HOH A O   1 
HETATM 947 O O   . HOH F 4 .   ? 44.294 15.977 -1.011  1.00 42.51 ? 965 HOH A O   1 
HETATM 948 O O   . HOH F 4 .   ? 19.922 15.349 -4.876  1.00 55.26 ? 966 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   2   ?   ?   ?   A . n 
A 1 2   MET 2   3   3   MET MET A . n 
A 1 3   SER 3   4   4   SER SER A . n 
A 1 4   PHE 4   5   5   PHE PHE A . n 
A 1 5   VAL 5   6   6   VAL VAL A . n 
A 1 6   GLN 6   7   7   GLN GLN A . n 
A 1 7   HIS 7   8   8   HIS HIS A . n 
A 1 8   SER 8   9   9   SER SER A . n 
A 1 9   VAL 9   10  10  VAL VAL A . n 
A 1 10  ARG 10  11  11  ARG ARG A . n 
A 1 11  VAL 11  12  12  VAL VAL A . n 
A 1 12  LEU 12  13  13  LEU LEU A . n 
A 1 13  GLN 13  14  14  GLN GLN A . n 
A 1 14  GLU 14  15  15  GLU GLU A . n 
A 1 15  LEU 15  16  16  LEU LEU A . n 
A 1 16  ASN 16  17  17  ASN ASN A . n 
A 1 17  LYS 17  18  18  LYS LYS A . n 
A 1 18  GLN 18  19  19  GLN GLN A . n 
A 1 19  ARG 19  20  20  ARG ARG A . n 
A 1 20  GLU 20  21  21  GLU GLU A . n 
A 1 21  LYS 21  22  22  LYS LYS A . n 
A 1 22  GLY 22  23  23  GLY GLY A . n 
A 1 23  GLN 23  24  24  GLN GLN A . n 
A 1 24  TYR 24  25  25  TYR TYR A . n 
A 1 25  CYS 25  26  26  CYS CYS A . n 
A 1 26  ASP 26  27  27  ASP ASP A . n 
A 1 27  ALA 27  28  28  ALA ALA A . n 
A 1 28  THR 28  29  29  THR THR A . n 
A 1 29  LEU 29  30  30  LEU LEU A . n 
A 1 30  ASP 30  31  31  ASP ASP A . n 
A 1 31  VAL 31  32  32  VAL VAL A . n 
A 1 32  GLY 32  33  33  GLY GLY A . n 
A 1 33  GLY 33  34  34  GLY GLY A . n 
A 1 34  LEU 34  35  35  LEU LEU A . n 
A 1 35  VAL 35  36  36  VAL VAL A . n 
A 1 36  PHE 36  37  37  PHE PHE A . n 
A 1 37  LYS 37  38  38  LYS LYS A . n 
A 1 38  ALA 38  39  39  ALA ALA A . n 
A 1 39  HIS 39  40  40  HIS HIS A . n 
A 1 40  TRP 40  41  41  TRP TRP A . n 
A 1 41  SER 41  42  42  SER SER A . n 
A 1 42  VAL 42  43  43  VAL VAL A . n 
A 1 43  LEU 43  44  44  LEU LEU A . n 
A 1 44  ALA 44  45  45  ALA ALA A . n 
A 1 45  CYS 45  46  46  CYS CYS A . n 
A 1 46  CYS 46  47  47  CYS CYS A . n 
A 1 47  SER 47  48  48  SER SER A . n 
A 1 48  HIS 48  49  49  HIS HIS A . n 
A 1 49  PHE 49  50  50  PHE PHE A . n 
A 1 50  PHE 50  51  51  PHE PHE A . n 
A 1 51  GLN 51  52  52  GLN GLN A . n 
A 1 52  SER 52  53  53  SER SER A . n 
A 1 53  LEU 53  54  54  LEU LEU A . n 
A 1 54  TYR 54  55  55  TYR TYR A . n 
A 1 55  GLY 55  56  56  GLY GLY A . n 
A 1 56  ASP 56  57  57  ASP ASP A . n 
A 1 57  GLY 57  58  58  GLY GLY A . n 
A 1 58  SER 58  59  59  SER SER A . n 
A 1 59  GLY 59  60  60  GLY GLY A . n 
A 1 60  GLY 60  61  61  GLY GLY A . n 
A 1 61  SER 61  62  62  SER SER A . n 
A 1 62  VAL 62  63  63  VAL VAL A . n 
A 1 63  VAL 63  64  64  VAL VAL A . n 
A 1 64  LEU 64  65  65  LEU LEU A . n 
A 1 65  PRO 65  66  66  PRO PRO A . n 
A 1 66  ALA 66  67  67  ALA ALA A . n 
A 1 67  GLY 67  68  68  GLY GLY A . n 
A 1 68  PHE 68  69  69  PHE PHE A . n 
A 1 69  ALA 69  70  70  ALA ALA A . n 
A 1 70  GLU 70  71  71  GLU GLU A . n 
A 1 71  ILE 71  72  72  ILE ILE A . n 
A 1 72  PHE 72  73  73  PHE PHE A . n 
A 1 73  GLY 73  74  74  GLY GLY A . n 
A 1 74  LEU 74  75  75  LEU LEU A . n 
A 1 75  LEU 75  76  76  LEU LEU A . n 
A 1 76  LEU 76  77  77  LEU LEU A . n 
A 1 77  ASP 77  78  78  ASP ASP A . n 
A 1 78  PHE 78  79  79  PHE PHE A . n 
A 1 79  PHE 79  80  80  PHE PHE A . n 
A 1 80  TYR 80  81  81  TYR TYR A . n 
A 1 81  THR 81  82  82  THR THR A . n 
A 1 82  GLY 82  83  83  GLY GLY A . n 
A 1 83  HIS 83  84  84  HIS HIS A . n 
A 1 84  LEU 84  85  85  LEU LEU A . n 
A 1 85  ALA 85  86  86  ALA ALA A . n 
A 1 86  LEU 86  87  87  LEU LEU A . n 
A 1 87  THR 87  88  88  THR THR A . n 
A 1 88  SER 88  89  89  SER SER A . n 
A 1 89  GLY 89  90  90  GLY GLY A . n 
A 1 90  ASN 90  91  91  ASN ASN A . n 
A 1 91  ARG 91  92  92  ARG ARG A . n 
A 1 92  ASP 92  93  93  ASP ASP A . n 
A 1 93  GLN 93  94  94  GLN GLN A . n 
A 1 94  VAL 94  95  95  VAL VAL A . n 
A 1 95  LEU 95  96  96  LEU LEU A . n 
A 1 96  LEU 96  97  97  LEU LEU A . n 
A 1 97  ALA 97  98  98  ALA ALA A . n 
A 1 98  ALA 98  99  99  ALA ALA A . n 
A 1 99  ARG 99  100 100 ARG ARG A . n 
A 1 100 GLU 100 101 101 GLU GLU A . n 
A 1 101 LEU 101 102 102 LEU LEU A . n 
A 1 102 ARG 102 103 103 ARG ARG A . n 
A 1 103 VAL 103 104 104 VAL VAL A . n 
A 1 104 PRO 104 105 105 PRO PRO A . n 
A 1 105 GLU 105 106 106 GLU GLU A . n 
A 1 106 ALA 106 107 107 ALA ALA A . n 
A 1 107 VAL 107 108 108 VAL VAL A . n 
A 1 108 GLU 108 109 109 GLU GLU A . n 
A 1 109 LEU 109 110 110 LEU LEU A . n 
A 1 110 CYS 110 111 111 CYS CYS A . n 
A 1 111 GLN 111 112 112 GLN GLN A . n 
A 1 112 SER 112 113 113 SER SER A . n 
A 1 113 PHE 113 114 114 PHE PHE A . n 
A 1 114 LYS 114 115 115 LYS LYS A . n 
A 1 115 PRO 115 116 ?   ?   ?   A . n 
A 1 116 LYS 116 117 ?   ?   ?   A . n 
A 1 117 THR 117 118 ?   ?   ?   A . n 
A 1 118 SER 118 119 ?   ?   ?   A . n 
A 1 119 VAL 119 120 ?   ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 UNK 1  900 900 UNK UNK A . 
C 2 UNK 1  901 901 UNK UNK A . 
D 3 EDO 1  1   1   EDO EDO A . 
E 3 EDO 1  902 2   EDO EDO A . 
F 4 HOH 1  903 1   HOH HOH A . 
F 4 HOH 2  904 2   HOH HOH A . 
F 4 HOH 3  905 3   HOH HOH A . 
F 4 HOH 4  906 5   HOH HOH A . 
F 4 HOH 5  907 6   HOH HOH A . 
F 4 HOH 6  908 7   HOH HOH A . 
F 4 HOH 7  909 8   HOH HOH A . 
F 4 HOH 8  910 9   HOH HOH A . 
F 4 HOH 9  911 10  HOH HOH A . 
F 4 HOH 10 912 11  HOH HOH A . 
F 4 HOH 11 913 13  HOH HOH A . 
F 4 HOH 12 914 14  HOH HOH A . 
F 4 HOH 13 915 15  HOH HOH A . 
F 4 HOH 14 916 17  HOH HOH A . 
F 4 HOH 15 917 18  HOH HOH A . 
F 4 HOH 16 918 19  HOH HOH A . 
F 4 HOH 17 919 20  HOH HOH A . 
F 4 HOH 18 920 22  HOH HOH A . 
F 4 HOH 19 921 23  HOH HOH A . 
F 4 HOH 20 922 24  HOH HOH A . 
F 4 HOH 21 923 25  HOH HOH A . 
F 4 HOH 22 924 27  HOH HOH A . 
F 4 HOH 23 925 28  HOH HOH A . 
F 4 HOH 24 926 30  HOH HOH A . 
F 4 HOH 25 927 32  HOH HOH A . 
F 4 HOH 26 928 33  HOH HOH A . 
F 4 HOH 27 929 34  HOH HOH A . 
F 4 HOH 28 930 35  HOH HOH A . 
F 4 HOH 29 931 36  HOH HOH A . 
F 4 HOH 30 932 38  HOH HOH A . 
F 4 HOH 31 933 39  HOH HOH A . 
F 4 HOH 32 934 40  HOH HOH A . 
F 4 HOH 33 935 41  HOH HOH A . 
F 4 HOH 34 936 42  HOH HOH A . 
F 4 HOH 35 937 43  HOH HOH A . 
F 4 HOH 36 938 46  HOH HOH A . 
F 4 HOH 37 939 47  HOH HOH A . 
F 4 HOH 38 940 48  HOH HOH A . 
F 4 HOH 39 941 50  HOH HOH A . 
F 4 HOH 40 942 52  HOH HOH A . 
F 4 HOH 41 943 53  HOH HOH A . 
F 4 HOH 42 944 54  HOH HOH A . 
F 4 HOH 43 945 55  HOH HOH A . 
F 4 HOH 44 946 56  HOH HOH A . 
F 4 HOH 45 947 58  HOH HOH A . 
F 4 HOH 46 948 60  HOH HOH A . 
F 4 HOH 47 949 61  HOH HOH A . 
F 4 HOH 48 950 63  HOH HOH A . 
F 4 HOH 49 951 64  HOH HOH A . 
F 4 HOH 50 952 66  HOH HOH A . 
F 4 HOH 51 953 67  HOH HOH A . 
F 4 HOH 52 954 68  HOH HOH A . 
F 4 HOH 53 955 69  HOH HOH A . 
F 4 HOH 54 956 74  HOH HOH A . 
F 4 HOH 55 957 75  HOH HOH A . 
F 4 HOH 56 958 77  HOH HOH A . 
F 4 HOH 57 959 78  HOH HOH A . 
F 4 HOH 58 960 80  HOH HOH A . 
F 4 HOH 59 961 81  HOH HOH A . 
F 4 HOH 60 962 82  HOH HOH A . 
F 4 HOH 61 963 83  HOH HOH A . 
F 4 HOH 62 964 84  HOH HOH A . 
F 4 HOH 63 965 85  HOH HOH A . 
F 4 HOH 64 966 86  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 906 ? F HOH . 
2 1 A HOH 957 ? F HOH . 
3 1 A HOH 958 ? F HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-11-20 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-10-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         38.9036 
_pdbx_refine_tls.origin_y         12.5079 
_pdbx_refine_tls.origin_z         2.6814 
_pdbx_refine_tls.T[1][1]          -0.1145 
_pdbx_refine_tls.T[2][2]          -0.1385 
_pdbx_refine_tls.T[3][3]          -0.1511 
_pdbx_refine_tls.T[1][2]          -0.0270 
_pdbx_refine_tls.T[1][3]          0.0185 
_pdbx_refine_tls.T[2][3]          0.0013 
_pdbx_refine_tls.L[1][1]          2.1408 
_pdbx_refine_tls.L[2][2]          2.1244 
_pdbx_refine_tls.L[3][3]          4.4200 
_pdbx_refine_tls.L[1][2]          1.2356 
_pdbx_refine_tls.L[1][3]          1.9973 
_pdbx_refine_tls.L[2][3]          1.1786 
_pdbx_refine_tls.S[1][1]          0.0270 
_pdbx_refine_tls.S[2][2]          0.0943 
_pdbx_refine_tls.S[3][3]          -0.1213 
_pdbx_refine_tls.S[1][2]          0.2655 
_pdbx_refine_tls.S[1][3]          -0.1898 
_pdbx_refine_tls.S[2][3]          -0.0183 
_pdbx_refine_tls.S[2][1]          -0.1654 
_pdbx_refine_tls.S[3][1]          0.3124 
_pdbx_refine_tls.S[3][2]          0.2309 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_label_asym_id   A 
_pdbx_refine_tls_group.beg_label_seq_id    2 
_pdbx_refine_tls_group.end_label_asym_id   A 
_pdbx_refine_tls_group.end_label_seq_id    114 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     3 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     115 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.selection_details   ? 
# 
_pdbx_phasing_MR.entry_id                     3B84 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          3.500 
_pdbx_phasing_MR.d_res_low_rotation           43.630 
_pdbx_phasing_MR.d_res_high_translation       1.740 
_pdbx_phasing_MR.d_res_low_translation        43.630 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO        .     ?                    package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu       'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK    .     ?                    package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu       'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
PHASER       .     ?                    other   'R. J. Read'         cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/      ?          ? 3 
REFMAC       .     ?                    program 'Murshudov, G.N.'    ccp4@dl.ac.uk               refinement        
http://www.ccp4.ac.uk/main.html                  Fortran_77 ? 4 
PDB_EXTRACT  3.004 'September 10, 2007' package PDB                  sw-help@rcsb.rutgers.edu    'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 5 
CrystalClear .     ?                    ?       ?                    ?                           'data collection' ? ?          ? 
6 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ALA 
_pdbx_validate_close_contact.auth_seq_id_1    70 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    948 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA A CYS 46 ? ? CB A CYS 46 ? ? SG A CYS 46 ? A 123.27 114.20 9.07  1.10 N 
2 1 N  A GLY 60 ? ? CA A GLY 60 ? ? C  A GLY 60 ? ? 129.12 113.10 16.02 2.50 N 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A MET 3   ? CG  ? A MET 2   CG  
2  1 Y 1 A MET 3   ? SD  ? A MET 2   SD  
3  1 Y 1 A MET 3   ? CE  ? A MET 2   CE  
4  1 Y 1 A LYS 22  ? NZ  ? A LYS 21  NZ  
5  1 Y 1 A ASP 31  ? CG  ? A ASP 30  CG  
6  1 Y 1 A ASP 31  ? OD1 ? A ASP 30  OD1 
7  1 Y 1 A ASP 31  ? OD2 ? A ASP 30  OD2 
8  1 Y 1 A LEU 35  ? CD1 ? A LEU 34  CD1 
9  1 Y 1 A LEU 35  ? CD2 ? A LEU 34  CD2 
10 1 Y 1 A ASP 57  ? CG  ? A ASP 56  CG  
11 1 Y 1 A ASP 57  ? OD1 ? A ASP 56  OD1 
12 1 Y 1 A ASP 57  ? OD2 ? A ASP 56  OD2 
13 1 Y 1 A SER 59  ? OG  ? A SER 58  OG  
14 1 Y 1 A GLU 71  ? CG  ? A GLU 70  CG  
15 1 Y 1 A GLU 71  ? CD  ? A GLU 70  CD  
16 1 Y 1 A GLU 71  ? OE1 ? A GLU 70  OE1 
17 1 Y 1 A GLU 71  ? OE2 ? A GLU 70  OE2 
18 1 Y 1 A GLU 109 ? CD  ? A GLU 108 CD  
19 1 Y 1 A GLU 109 ? OE1 ? A GLU 108 OE1 
20 1 Y 1 A GLU 109 ? OE2 ? A GLU 108 OE2 
21 1 Y 1 A LYS 115 ? CG  ? A LYS 114 CG  
22 1 Y 1 A LYS 115 ? CD  ? A LYS 114 CD  
23 1 Y 1 A LYS 115 ? CE  ? A LYS 114 CE  
24 1 Y 1 A LYS 115 ? NZ  ? A LYS 114 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A SER 2   ? A SER 1   
2 1 Y 1 A PRO 116 ? A PRO 115 
3 1 Y 1 A LYS 117 ? A LYS 116 
4 1 Y 1 A THR 118 ? A THR 117 
5 1 Y 1 A SER 119 ? A SER 118 
6 1 Y 1 A VAL 120 ? A VAL 119 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 UNKNOWN        UNK 
3 1,2-ETHANEDIOL EDO 
4 water          HOH 
#