data_3B93
# 
_entry.id   3B93 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3B93         
RCSB  RCSB045232   
WWPDB D_1000045232 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3B94 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3B93 
_pdbx_database_status.recvd_initial_deposition_date   2007-11-02 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Song, X.M.' 1 
'Zhou, Z.C.' 2 
# 
_citation.id                        primary 
_citation.title                     'crystal structure of human GITRL' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Song, X.M.'   1 
primary 'Zhou, Z.C.'   2 
primary 'Greene, M.I.' 3 
# 
_cell.entry_id           3B93 
_cell.length_a           104.413 
_cell.length_b           46.384 
_cell.length_c           76.460 
_cell.angle_alpha        90.00 
_cell.angle_beta         91.56 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3B93 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Tumor necrosis factor ligand superfamily member 18' 14933.038 3  ? ? 'TNF domain' ? 
2 water   nat water                                                18.015    95 ? ? ?            ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Glucocorticoid-induced TNF-related ligand, hGITRL, Activation-inducible TNF-related ligand, AITRL' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GAMASQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMI
QTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GAMASQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMI
QTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   ALA n 
1 5   SER n 
1 6   GLN n 
1 7   LEU n 
1 8   GLU n 
1 9   THR n 
1 10  ALA n 
1 11  LYS n 
1 12  GLU n 
1 13  PRO n 
1 14  CYS n 
1 15  MET n 
1 16  ALA n 
1 17  LYS n 
1 18  PHE n 
1 19  GLY n 
1 20  PRO n 
1 21  LEU n 
1 22  PRO n 
1 23  SER n 
1 24  LYS n 
1 25  TRP n 
1 26  GLN n 
1 27  MET n 
1 28  ALA n 
1 29  SER n 
1 30  SER n 
1 31  GLU n 
1 32  PRO n 
1 33  PRO n 
1 34  CYS n 
1 35  VAL n 
1 36  ASN n 
1 37  LYS n 
1 38  VAL n 
1 39  SER n 
1 40  ASP n 
1 41  TRP n 
1 42  LYS n 
1 43  LEU n 
1 44  GLU n 
1 45  ILE n 
1 46  LEU n 
1 47  GLN n 
1 48  ASN n 
1 49  GLY n 
1 50  LEU n 
1 51  TYR n 
1 52  LEU n 
1 53  ILE n 
1 54  TYR n 
1 55  GLY n 
1 56  GLN n 
1 57  VAL n 
1 58  ALA n 
1 59  PRO n 
1 60  ASN n 
1 61  ALA n 
1 62  ASN n 
1 63  TYR n 
1 64  ASN n 
1 65  ASP n 
1 66  VAL n 
1 67  ALA n 
1 68  PRO n 
1 69  PHE n 
1 70  GLU n 
1 71  VAL n 
1 72  ARG n 
1 73  LEU n 
1 74  TYR n 
1 75  LYS n 
1 76  ASN n 
1 77  LYS n 
1 78  ASP n 
1 79  MET n 
1 80  ILE n 
1 81  GLN n 
1 82  THR n 
1 83  LEU n 
1 84  THR n 
1 85  ASN n 
1 86  LYS n 
1 87  SER n 
1 88  LYS n 
1 89  ILE n 
1 90  GLN n 
1 91  ASN n 
1 92  VAL n 
1 93  GLY n 
1 94  GLY n 
1 95  THR n 
1 96  TYR n 
1 97  GLU n 
1 98  LEU n 
1 99  HIS n 
1 100 VAL n 
1 101 GLY n 
1 102 ASP n 
1 103 THR n 
1 104 ILE n 
1 105 ASP n 
1 106 LEU n 
1 107 ILE n 
1 108 PHE n 
1 109 ASN n 
1 110 SER n 
1 111 GLU n 
1 112 HIS n 
1 113 GLN n 
1 114 VAL n 
1 115 LEU n 
1 116 LYS n 
1 117 ASN n 
1 118 ASN n 
1 119 THR n 
1 120 TYR n 
1 121 TRP n 
1 122 GLY n 
1 123 ILE n 
1 124 ILE n 
1 125 LEU n 
1 126 LEU n 
1 127 ALA n 
1 128 ASN n 
1 129 PRO n 
1 130 GLN n 
1 131 PHE n 
1 132 ILE n 
1 133 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'TNFSF18, AITRL, GITRL, TL6' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET21a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TNF18_HUMAN 
_struct_ref.pdbx_db_accession          Q9UNG2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;KEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQ
NVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
;
_struct_ref.pdbx_align_begin           55 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3B93 A 6 ? 133 ? Q9UNG2 50 ? 177 ? 50 177 
2 1 3B93 B 6 ? 133 ? Q9UNG2 50 ? 177 ? 50 177 
3 1 3B93 C 6 ? 133 ? Q9UNG2 50 ? 177 ? 50 177 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3B93 GLY A 1 ? UNP Q9UNG2 ? ? 'EXPRESSION TAG' 45 1  
1 3B93 ALA A 2 ? UNP Q9UNG2 ? ? 'EXPRESSION TAG' 46 2  
1 3B93 MET A 3 ? UNP Q9UNG2 ? ? 'EXPRESSION TAG' 47 3  
1 3B93 ALA A 4 ? UNP Q9UNG2 ? ? 'EXPRESSION TAG' 48 4  
1 3B93 SER A 5 ? UNP Q9UNG2 ? ? 'EXPRESSION TAG' 49 5  
2 3B93 GLY B 1 ? UNP Q9UNG2 ? ? 'EXPRESSION TAG' 45 6  
2 3B93 ALA B 2 ? UNP Q9UNG2 ? ? 'EXPRESSION TAG' 46 7  
2 3B93 MET B 3 ? UNP Q9UNG2 ? ? 'EXPRESSION TAG' 47 8  
2 3B93 ALA B 4 ? UNP Q9UNG2 ? ? 'EXPRESSION TAG' 48 9  
2 3B93 SER B 5 ? UNP Q9UNG2 ? ? 'EXPRESSION TAG' 49 10 
3 3B93 GLY C 1 ? UNP Q9UNG2 ? ? 'EXPRESSION TAG' 45 11 
3 3B93 ALA C 2 ? UNP Q9UNG2 ? ? 'EXPRESSION TAG' 46 12 
3 3B93 MET C 3 ? UNP Q9UNG2 ? ? 'EXPRESSION TAG' 47 13 
3 3B93 ALA C 4 ? UNP Q9UNG2 ? ? 'EXPRESSION TAG' 48 14 
3 3B93 SER C 5 ? UNP Q9UNG2 ? ? 'EXPRESSION TAG' 49 15 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3B93 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.07 
_exptl_crystal.density_percent_sol   40.46 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
'0.2M Lithium sulfate, 0.1M Tris, 30% PEG4000, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2006-07-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU MICROMAX-007' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     3B93 
_reflns.observed_criterion_sigma_F   5.0 
_reflns.observed_criterion_sigma_I   3.0 
_reflns.d_resolution_high            2.2 
_reflns.d_resolution_low             75 
_reflns.number_all                   16716 
_reflns.number_obs                   16198 
_reflns.percent_possible_obs         96.9 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              0.08 
_reflns.pdbx_netI_over_sigmaI        127.9 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.28 
_reflns_shell.percent_possible_all   87.8 
_reflns_shell.Rmerge_I_obs           0.547 
_reflns_shell.pdbx_Rsym_value        0.547 
_reflns_shell.meanI_over_sigI_obs    5.8 
_reflns_shell.pdbx_redundancy        3.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1627 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3B93 
_refine.ls_number_reflns_obs                     16198 
_refine.ls_number_reflns_all                     16716 
_refine.pdbx_ls_sigma_I                          0.00 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             75 
_refine.ls_d_res_high                            2.2 
_refine.ls_percent_reflns_obs                    90.76 
_refine.ls_R_factor_obs                          0.20872 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20394 
_refine.ls_R_factor_R_free                       0.27992 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.9 
_refine.ls_number_reflns_R_free                  1012 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.944 
_refine.correlation_coeff_Fo_to_Fc_free          0.897 
_refine.B_iso_mean                               42.022 
_refine.aniso_B[1][1]                            -1.68 
_refine.aniso_B[2][2]                            2.71 
_refine.aniso_B[3][3]                            -1.06 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.38 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'mouse GITRL' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.318 
_refine.pdbx_overall_ESU_R_Free                  0.260 
_refine.overall_SU_ML                            0.179 
_refine.overall_SU_B                             13.771 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2515 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             95 
_refine_hist.number_atoms_total               2610 
_refine_hist.d_res_high                       2.2 
_refine_hist.d_res_low                        75 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.025  0.022  ? 2577 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      2.521  1.958  ? 3500 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   10.364 5.000  ? 309  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   35.060 25.888 ? 107  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   21.583 15.000 ? 433  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   13.064 15.000 ? 3    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.180  0.200  ? 391  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.011  0.020  ? 1900 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.266  0.200  ? 1243 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.326  0.200  ? 1669 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.219  0.200  ? 128  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.239  0.200  ? 33   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.182  0.200  ? 6    'X-RAY DIFFRACTION' ? 
r_mcbond_it              1.347  1.500  ? 1641 'X-RAY DIFFRACTION' ? 
r_mcangle_it             2.091  2.000  ? 2560 'X-RAY DIFFRACTION' ? 
r_scbond_it              3.067  3.000  ? 1118 'X-RAY DIFFRACTION' ? 
r_scangle_it             4.256  4.500  ? 940  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.2 
_refine_ls_shell.d_res_low                        2.252 
_refine_ls_shell.number_reflns_R_work             935 
_refine_ls_shell.R_factor_R_work                  0.243 
_refine_ls_shell.percent_reflns_obs               71.81 
_refine_ls_shell.R_factor_R_free                  0.331 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             43 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3B93 
_struct.title                     'crystal structure of human GITRL' 
_struct.pdbx_descriptor           'Tumor necrosis factor ligand superfamily member 18' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3B93 
_struct_keywords.pdbx_keywords   CYTOKINE 
_struct_keywords.text            
'open trimer, asymmetric, C2 spacegroup, Cytokine, Glycoprotein, Membrane, Signal-anchor, Transmembrane' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 58 A CYS 78 1_555 ? ? ? ? ? ? ? 2.000 ? 
disulf2 disulf ? ? B CYS 14 SG ? ? ? 1_555 B CYS 34 SG ? ? B CYS 58 B CYS 78 1_555 ? ? ? ? ? ? ? 2.078 ? 
disulf3 disulf ? ? C CYS 14 SG ? ? ? 1_555 C CYS 34 SG ? ? C CYS 58 C CYS 78 1_555 ? ? ? ? ? ? ? 1.996 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLU 12  A . ? GLU 56  A PRO 13  A ? PRO 57  A 1 -9.94  
2  GLY 19  A . ? GLY 63  A PRO 20  A ? PRO 64  A 1 -3.08  
3  LEU 21  A . ? LEU 65  A PRO 22  A ? PRO 66  A 1 5.51   
4  GLU 31  A . ? GLU 75  A PRO 32  A ? PRO 76  A 1 -0.54  
5  ILE 132 A . ? ILE 176 A SER 133 A ? SER 177 A 1 5.00   
6  GLY 19  B . ? GLY 63  B PRO 20  B ? PRO 64  B 1 -5.70  
7  LEU 21  B . ? LEU 65  B PRO 22  B ? PRO 66  B 1 8.84   
8  LEU 21  C . ? LEU 65  C PRO 22  C ? PRO 66  C 1 14.66  
9  GLU 31  C . ? GLU 75  C PRO 32  C ? PRO 76  C 1 -15.50 
10 ALA 58  C . ? ALA 102 C PRO 59  C ? PRO 103 C 1 21.76  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
C ? 5 ? 
D ? 5 ? 
E ? 5 ? 
F ? 5 ? 
G ? 5 ? 
H ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TRP A 25  ? ALA A 28  ? TRP A 69  ALA A 72  
A 2 MET A 15  ? PHE A 18  ? MET A 59  PHE A 62  
A 3 TYR A 120 ? ALA A 127 ? TYR A 164 ALA A 171 
A 4 GLY A 49  ? VAL A 57  ? GLY A 93  VAL A 101 
A 5 GLN A 90  ? ASN A 91  ? GLN A 134 ASN A 135 
B 1 TRP A 25  ? ALA A 28  ? TRP A 69  ALA A 72  
B 2 MET A 15  ? PHE A 18  ? MET A 59  PHE A 62  
B 3 TYR A 120 ? ALA A 127 ? TYR A 164 ALA A 171 
B 4 GLY A 49  ? VAL A 57  ? GLY A 93  VAL A 101 
B 5 GLY A 94  ? LEU A 98  ? GLY A 138 LEU A 142 
C 1 VAL A 35  ? SER A 39  ? VAL A 79  SER A 83  
C 2 LYS A 42  ? ILE A 45  ? LYS A 86  ILE A 89  
C 3 THR A 103 ? PHE A 108 ? THR A 147 PHE A 152 
C 4 VAL A 71  ? LYS A 75  ? VAL A 115 LYS A 119 
C 5 ASP A 78  ? LEU A 83  ? ASP A 122 LEU A 127 
D 1 TRP B 25  ? MET B 27  ? TRP B 69  MET B 71  
D 2 MET B 15  ? PHE B 18  ? MET B 59  PHE B 62  
D 3 TYR B 120 ? ALA B 127 ? TYR B 164 ALA B 171 
D 4 GLY B 49  ? VAL B 57  ? GLY B 93  VAL B 101 
D 5 GLN B 90  ? ASN B 91  ? GLN B 134 ASN B 135 
E 1 TRP B 25  ? MET B 27  ? TRP B 69  MET B 71  
E 2 MET B 15  ? PHE B 18  ? MET B 59  PHE B 62  
E 3 TYR B 120 ? ALA B 127 ? TYR B 164 ALA B 171 
E 4 GLY B 49  ? VAL B 57  ? GLY B 93  VAL B 101 
E 5 GLY B 94  ? LEU B 98  ? GLY B 138 LEU B 142 
F 1 VAL B 35  ? SER B 39  ? VAL B 79  SER B 83  
F 2 LYS B 42  ? ILE B 45  ? LYS B 86  ILE B 89  
F 3 THR B 103 ? ILE B 107 ? THR B 147 ILE B 151 
F 4 ARG B 72  ? LYS B 75  ? ARG B 116 LYS B 119 
F 5 ASP B 78  ? THR B 82  ? ASP B 122 THR B 126 
G 1 TRP C 25  ? ALA C 28  ? TRP C 69  ALA C 72  
G 2 MET C 15  ? PHE C 18  ? MET C 59  PHE C 62  
G 3 THR C 103 ? ALA C 127 ? THR C 147 ALA C 171 
G 4 GLY C 49  ? LYS C 75  ? GLY C 93  LYS C 119 
G 5 ASP C 78  ? GLN C 81  ? ASP C 122 GLN C 125 
H 1 VAL C 35  ? LYS C 37  ? VAL C 79  LYS C 81  
H 2 LEU C 43  ? ILE C 45  ? LEU C 87  ILE C 89  
H 3 THR C 103 ? ALA C 127 ? THR C 147 ALA C 171 
H 4 GLY C 49  ? LYS C 75  ? GLY C 93  LYS C 119 
H 5 GLY C 94  ? LEU C 98  ? GLY C 138 LEU C 142 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ALA A 28  ? O ALA A 72  N MET A 15  ? N MET A 59  
A 2 3 N PHE A 18  ? N PHE A 62  O TRP A 121 ? O TRP A 165 
A 3 4 O ALA A 127 ? O ALA A 171 N LEU A 50  ? N LEU A 94  
A 4 5 N VAL A 57  ? N VAL A 101 O GLN A 90  ? O GLN A 134 
B 1 2 O ALA A 28  ? O ALA A 72  N MET A 15  ? N MET A 59  
B 2 3 N PHE A 18  ? N PHE A 62  O TRP A 121 ? O TRP A 165 
B 3 4 O ALA A 127 ? O ALA A 171 N LEU A 50  ? N LEU A 94  
B 4 5 N ILE A 53  ? N ILE A 97  O GLY A 94  ? O GLY A 138 
C 1 2 N ASN A 36  ? N ASN A 80  O GLU A 44  ? O GLU A 88  
C 2 3 N LEU A 43  ? N LEU A 87  O ILE A 104 ? O ILE A 148 
C 3 4 O ILE A 107 ? O ILE A 151 N ARG A 72  ? N ARG A 116 
C 4 5 N LYS A 75  ? N LYS A 119 O ASP A 78  ? O ASP A 122 
D 1 2 O GLN B 26  ? O GLN B 70  N LYS B 17  ? N LYS B 61  
D 2 3 N PHE B 18  ? N PHE B 62  O TRP B 121 ? O TRP B 165 
D 3 4 O ILE B 124 ? O ILE B 168 N LEU B 52  ? N LEU B 96  
D 4 5 N VAL B 57  ? N VAL B 101 O GLN B 90  ? O GLN B 134 
E 1 2 O GLN B 26  ? O GLN B 70  N LYS B 17  ? N LYS B 61  
E 2 3 N PHE B 18  ? N PHE B 62  O TRP B 121 ? O TRP B 165 
E 3 4 O ILE B 124 ? O ILE B 168 N LEU B 52  ? N LEU B 96  
E 4 5 N GLY B 49  ? N GLY B 93  O LEU B 98  ? O LEU B 142 
F 1 2 N ASN B 36  ? N ASN B 80  O GLU B 44  ? O GLU B 88  
F 2 3 N LEU B 43  ? N LEU B 87  O ILE B 104 ? O ILE B 148 
F 3 4 O ILE B 107 ? O ILE B 151 N ARG B 72  ? N ARG B 116 
F 4 5 N LEU B 73  ? N LEU B 117 O ILE B 80  ? O ILE B 124 
G 1 2 O ALA C 28  ? O ALA C 72  N MET C 15  ? N MET C 59  
G 2 3 N ALA C 16  ? N ALA C 60  O ILE C 123 ? O ILE C 167 
G 3 4 O ILE C 107 ? O ILE C 151 N ARG C 72  ? N ARG C 116 
G 4 5 N LEU C 73  ? N LEU C 117 O GLN C 81  ? O GLN C 125 
H 1 2 N ASN C 36  ? N ASN C 80  O GLU C 44  ? O GLU C 88  
H 2 3 N LEU C 43  ? N LEU C 87  O ILE C 104 ? O ILE C 148 
H 3 4 O ILE C 107 ? O ILE C 151 N ARG C 72  ? N ARG C 116 
H 4 5 N TYR C 51  ? N TYR C 95  O TYR C 96  ? O TYR C 140 
# 
_database_PDB_matrix.entry_id          3B93 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3B93 
_atom_sites.fract_transf_matrix[1][1]   0.009577 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000261 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021559 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013084 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LYS A 1 11  ? 14.570  -38.542 -11.679 1.00 62.35 ? 55  LYS A N   1 
ATOM   2    C CA  . LYS A 1 11  ? 15.947  -37.985 -11.914 1.00 62.16 ? 55  LYS A CA  1 
ATOM   3    C C   . LYS A 1 11  ? 15.959  -36.526 -12.378 1.00 61.51 ? 55  LYS A C   1 
ATOM   4    O O   . LYS A 1 11  ? 15.320  -36.172 -13.375 1.00 61.90 ? 55  LYS A O   1 
ATOM   5    C CB  . LYS A 1 11  ? 16.733  -38.832 -12.934 1.00 62.36 ? 55  LYS A CB  1 
ATOM   6    C CG  . LYS A 1 11  ? 18.207  -38.384 -13.158 1.00 62.35 ? 55  LYS A CG  1 
ATOM   7    C CD  . LYS A 1 11  ? 18.547  -38.226 -14.644 1.00 61.03 ? 55  LYS A CD  1 
ATOM   8    C CE  . LYS A 1 11  ? 17.658  -37.165 -15.320 1.00 62.10 ? 55  LYS A CE  1 
ATOM   9    N NZ  . LYS A 1 11  ? 18.187  -35.745 -15.187 1.00 59.37 ? 55  LYS A NZ  1 
ATOM   10   N N   . GLU A 1 12  ? 16.726  -35.711 -11.642 1.00 60.84 ? 56  GLU A N   1 
ATOM   11   C CA  . GLU A 1 12  ? 17.090  -34.324 -11.991 1.00 58.61 ? 56  GLU A CA  1 
ATOM   12   C C   . GLU A 1 12  ? 15.975  -33.590 -12.676 1.00 56.22 ? 56  GLU A C   1 
ATOM   13   O O   . GLU A 1 12  ? 14.841  -34.114 -12.746 1.00 58.52 ? 56  GLU A O   1 
ATOM   14   C CB  . GLU A 1 12  ? 18.345  -34.302 -12.872 1.00 59.40 ? 56  GLU A CB  1 
ATOM   15   C CG  . GLU A 1 12  ? 19.666  -34.147 -12.151 1.00 62.45 ? 56  GLU A CG  1 
ATOM   16   C CD  . GLU A 1 12  ? 20.815  -34.620 -13.005 1.00 65.70 ? 56  GLU A CD  1 
ATOM   17   O OE1 . GLU A 1 12  ? 21.608  -35.485 -12.529 1.00 68.27 ? 56  GLU A OE1 1 
ATOM   18   O OE2 . GLU A 1 12  ? 20.885  -34.145 -14.165 1.00 67.18 ? 56  GLU A OE2 1 
ATOM   19   N N   . PRO A 1 13  ? 16.244  -32.359 -13.154 1.00 52.06 ? 57  PRO A N   1 
ATOM   20   C CA  . PRO A 1 13  ? 17.422  -31.510 -12.950 1.00 48.99 ? 57  PRO A CA  1 
ATOM   21   C C   . PRO A 1 13  ? 17.805  -31.313 -11.452 1.00 45.59 ? 57  PRO A C   1 
ATOM   22   O O   . PRO A 1 13  ? 16.956  -31.467 -10.582 1.00 45.70 ? 57  PRO A O   1 
ATOM   23   C CB  . PRO A 1 13  ? 16.996  -30.180 -13.557 1.00 49.45 ? 57  PRO A CB  1 
ATOM   24   C CG  . PRO A 1 13  ? 15.856  -30.498 -14.478 1.00 50.11 ? 57  PRO A CG  1 
ATOM   25   C CD  . PRO A 1 13  ? 15.210  -31.729 -13.996 1.00 51.38 ? 57  PRO A CD  1 
ATOM   26   N N   . CYS A 1 14  ? 19.074  -31.026 -11.156 1.00 41.85 ? 58  CYS A N   1 
ATOM   27   C CA  . CYS A 1 14  ? 19.476  -30.616 -9.811  1.00 38.07 ? 58  CYS A CA  1 
ATOM   28   C C   . CYS A 1 14  ? 18.863  -29.249 -9.447  1.00 35.82 ? 58  CYS A C   1 
ATOM   29   O O   . CYS A 1 14  ? 18.996  -28.285 -10.170 1.00 35.82 ? 58  CYS A O   1 
ATOM   30   C CB  . CYS A 1 14  ? 21.014  -30.609 -9.645  1.00 38.15 ? 58  CYS A CB  1 
ATOM   31   S SG  . CYS A 1 14  ? 21.645  -30.294 -7.899  1.00 42.21 ? 58  CYS A SG  1 
ATOM   32   N N   . MET A 1 15  ? 18.170  -29.189 -8.328  1.00 33.73 ? 59  MET A N   1 
ATOM   33   C CA  . MET A 1 15  ? 17.631  -27.959 -7.881  1.00 33.80 ? 59  MET A CA  1 
ATOM   34   C C   . MET A 1 15  ? 17.425  -27.851 -6.383  1.00 31.73 ? 59  MET A C   1 
ATOM   35   O O   . MET A 1 15  ? 17.600  -28.842 -5.610  1.00 27.82 ? 59  MET A O   1 
ATOM   36   C CB  . MET A 1 15  ? 16.399  -27.613 -8.715  1.00 34.71 ? 59  MET A CB  1 
ATOM   37   C CG  . MET A 1 15  ? 15.080  -28.215 -8.394  1.00 39.98 ? 59  MET A CG  1 
ATOM   38   S SD  . MET A 1 15  ? 13.896  -28.257 -9.836  1.00 40.76 ? 59  MET A SD  1 
ATOM   39   C CE  . MET A 1 15  ? 14.376  -29.855 -10.392 1.00 47.87 ? 59  MET A CE  1 
ATOM   40   N N   . ALA A 1 16  ? 17.156  -26.600 -5.968  1.00 28.88 ? 60  ALA A N   1 
ATOM   41   C CA  . ALA A 1 16  ? 16.931  -26.246 -4.559  1.00 27.11 ? 60  ALA A CA  1 
ATOM   42   C C   . ALA A 1 16  ? 15.915  -25.095 -4.398  1.00 25.34 ? 60  ALA A C   1 
ATOM   43   O O   . ALA A 1 16  ? 15.671  -24.345 -5.319  1.00 25.47 ? 60  ALA A O   1 
ATOM   44   C CB  . ALA A 1 16  ? 18.237  -25.916 -3.852  1.00 25.96 ? 60  ALA A CB  1 
ATOM   45   N N   . LYS A 1 17  ? 15.241  -25.054 -3.269  1.00 24.58 ? 61  LYS A N   1 
ATOM   46   C CA  . LYS A 1 17  ? 14.261  -24.011 -2.968  1.00 24.94 ? 61  LYS A CA  1 
ATOM   47   C C   . LYS A 1 17  ? 14.441  -23.609 -1.496  1.00 25.51 ? 61  LYS A C   1 
ATOM   48   O O   . LYS A 1 17  ? 14.532  -24.454 -0.662  1.00 25.17 ? 61  LYS A O   1 
ATOM   49   C CB  . LYS A 1 17  ? 12.844  -24.539 -3.186  1.00 22.55 ? 61  LYS A CB  1 
ATOM   50   C CG  . LYS A 1 17  ? 11.733  -23.516 -3.030  1.00 22.11 ? 61  LYS A CG  1 
ATOM   51   C CD  . LYS A 1 17  ? 10.342  -24.177 -3.091  1.00 24.88 ? 61  LYS A CD  1 
ATOM   52   C CE  . LYS A 1 17  ? 9.253   -23.058 -3.185  1.00 24.63 ? 61  LYS A CE  1 
ATOM   53   N NZ  . LYS A 1 17  ? 7.878   -23.749 -3.223  1.00 27.58 ? 61  LYS A NZ  1 
ATOM   54   N N   . PHE A 1 18  ? 14.487  -22.309 -1.196  1.00 25.22 ? 62  PHE A N   1 
ATOM   55   C CA  . PHE A 1 18  ? 14.230  -21.894 0.151   1.00 23.98 ? 62  PHE A CA  1 
ATOM   56   C C   . PHE A 1 18  ? 12.768  -21.340 0.408   1.00 24.76 ? 62  PHE A C   1 
ATOM   57   O O   . PHE A 1 18  ? 12.340  -20.437 -0.256  1.00 24.86 ? 62  PHE A O   1 
ATOM   58   C CB  . PHE A 1 18  ? 15.359  -20.963 0.679   1.00 23.18 ? 62  PHE A CB  1 
ATOM   59   C CG  . PHE A 1 18  ? 15.322  -20.791 2.160   1.00 24.68 ? 62  PHE A CG  1 
ATOM   60   C CD1 . PHE A 1 18  ? 16.045  -21.626 2.997   1.00 26.51 ? 62  PHE A CD1 1 
ATOM   61   C CD2 . PHE A 1 18  ? 14.467  -19.821 2.732   1.00 24.54 ? 62  PHE A CD2 1 
ATOM   62   C CE1 . PHE A 1 18  ? 15.944  -21.462 4.424   1.00 27.24 ? 62  PHE A CE1 1 
ATOM   63   C CE2 . PHE A 1 18  ? 14.306  -19.745 4.056   1.00 24.09 ? 62  PHE A CE2 1 
ATOM   64   C CZ  . PHE A 1 18  ? 15.054  -20.518 4.910   1.00 25.57 ? 62  PHE A CZ  1 
ATOM   65   N N   . GLY A 1 19  ? 12.085  -21.858 1.448   1.00 24.66 ? 63  GLY A N   1 
ATOM   66   C CA  . GLY A 1 19  ? 10.801  -21.348 1.905   1.00 24.94 ? 63  GLY A CA  1 
ATOM   67   C C   . GLY A 1 19  ? 9.719   -21.897 0.980   1.00 24.81 ? 63  GLY A C   1 
ATOM   68   O O   . GLY A 1 19  ? 10.018  -22.820 0.267   1.00 24.79 ? 63  GLY A O   1 
ATOM   69   N N   . PRO A 1 20  ? 8.464   -21.340 1.023   1.00 24.71 ? 64  PRO A N   1 
ATOM   70   C CA  . PRO A 1 20  ? 8.130   -20.265 1.998   1.00 25.02 ? 64  PRO A CA  1 
ATOM   71   C C   . PRO A 1 20  ? 8.166   -20.835 3.462   1.00 26.36 ? 64  PRO A C   1 
ATOM   72   O O   . PRO A 1 20  ? 8.014   -22.070 3.654   1.00 25.81 ? 64  PRO A O   1 
ATOM   73   C CB  . PRO A 1 20  ? 6.672   -19.881 1.613   1.00 25.48 ? 64  PRO A CB  1 
ATOM   74   C CG  . PRO A 1 20  ? 6.129   -20.947 0.846   1.00 23.25 ? 64  PRO A CG  1 
ATOM   75   C CD  . PRO A 1 20  ? 7.288   -21.736 0.216   1.00 23.86 ? 64  PRO A CD  1 
ATOM   76   N N   . LEU A 1 21  ? 8.335   -19.989 4.483   1.00 24.93 ? 65  LEU A N   1 
ATOM   77   C CA  . LEU A 1 21  ? 8.262   -20.528 5.857   1.00 26.72 ? 65  LEU A CA  1 
ATOM   78   C C   . LEU A 1 21  ? 6.930   -21.242 6.097   1.00 27.50 ? 65  LEU A C   1 
ATOM   79   O O   . LEU A 1 21  ? 5.920   -20.747 5.657   1.00 25.54 ? 65  LEU A O   1 
ATOM   80   C CB  . LEU A 1 21  ? 8.488   -19.434 6.898   1.00 25.19 ? 65  LEU A CB  1 
ATOM   81   C CG  . LEU A 1 21  ? 9.947   -18.886 6.886   1.00 28.82 ? 65  LEU A CG  1 
ATOM   82   C CD1 . LEU A 1 21  ? 10.243  -18.019 8.089   1.00 23.44 ? 65  LEU A CD1 1 
ATOM   83   C CD2 . LEU A 1 21  ? 11.029  -19.979 6.665   1.00 26.07 ? 65  LEU A CD2 1 
ATOM   84   N N   . PRO A 1 22  ? 6.931   -22.404 6.834   1.00 29.89 ? 66  PRO A N   1 
ATOM   85   C CA  . PRO A 1 22  ? 8.037   -23.084 7.572   1.00 30.63 ? 66  PRO A CA  1 
ATOM   86   C C   . PRO A 1 22  ? 9.089   -23.933 6.817   1.00 31.87 ? 66  PRO A C   1 
ATOM   87   O O   . PRO A 1 22  ? 9.966   -24.480 7.466   1.00 31.08 ? 66  PRO A O   1 
ATOM   88   C CB  . PRO A 1 22  ? 7.285   -23.993 8.562   1.00 29.64 ? 66  PRO A CB  1 
ATOM   89   C CG  . PRO A 1 22  ? 6.112   -24.366 7.834   1.00 28.48 ? 66  PRO A CG  1 
ATOM   90   C CD  . PRO A 1 22  ? 5.666   -23.129 7.063   1.00 28.92 ? 66  PRO A CD  1 
ATOM   91   N N   . SER A 1 23  ? 8.966   -24.086 5.499   1.00 31.47 ? 67  SER A N   1 
ATOM   92   C CA  . SER A 1 23  ? 9.970   -24.820 4.758   1.00 31.58 ? 67  SER A CA  1 
ATOM   93   C C   . SER A 1 23  ? 11.260  -23.998 4.785   1.00 30.10 ? 67  SER A C   1 
ATOM   94   O O   . SER A 1 23  ? 11.248  -22.776 4.683   1.00 28.16 ? 67  SER A O   1 
ATOM   95   C CB  . SER A 1 23  ? 9.525   -25.018 3.293   1.00 31.51 ? 67  SER A CB  1 
ATOM   96   O OG  . SER A 1 23  ? 8.498   -25.965 3.232   1.00 38.10 ? 67  SER A OG  1 
ATOM   97   N N   . LYS A 1 24  ? 12.367  -24.709 4.906   1.00 29.92 ? 68  LYS A N   1 
ATOM   98   C CA  . LYS A 1 24  ? 13.699  -24.114 4.843   1.00 30.16 ? 68  LYS A CA  1 
ATOM   99   C C   . LYS A 1 24  ? 14.233  -24.504 3.470   1.00 28.72 ? 68  LYS A C   1 
ATOM   100  O O   . LYS A 1 24  ? 13.507  -24.320 2.489   1.00 29.96 ? 68  LYS A O   1 
ATOM   101  C CB  . LYS A 1 24  ? 14.604  -24.603 6.032   1.00 28.81 ? 68  LYS A CB  1 
ATOM   102  C CG  . LYS A 1 24  ? 13.982  -24.281 7.381   1.00 32.11 ? 68  LYS A CG  1 
ATOM   103  C CD  . LYS A 1 24  ? 13.849  -22.788 7.586   1.00 32.64 ? 68  LYS A CD  1 
ATOM   104  C CE  . LYS A 1 24  ? 13.515  -22.494 9.005   1.00 39.86 ? 68  LYS A CE  1 
ATOM   105  N NZ  . LYS A 1 24  ? 14.739  -22.859 9.816   1.00 39.55 ? 68  LYS A NZ  1 
ATOM   106  N N   . TRP A 1 25  ? 15.469  -24.986 3.405   1.00 28.64 ? 69  TRP A N   1 
ATOM   107  C CA  . TRP A 1 25  ? 16.145  -25.423 2.157   1.00 29.93 ? 69  TRP A CA  1 
ATOM   108  C C   . TRP A 1 25  ? 15.650  -26.803 1.878   1.00 30.50 ? 69  TRP A C   1 
ATOM   109  O O   . TRP A 1 25  ? 15.759  -27.687 2.716   1.00 30.35 ? 69  TRP A O   1 
ATOM   110  C CB  . TRP A 1 25  ? 17.708  -25.514 2.276   1.00 27.08 ? 69  TRP A CB  1 
ATOM   111  C CG  . TRP A 1 25  ? 18.328  -24.167 2.030   1.00 28.27 ? 69  TRP A CG  1 
ATOM   112  C CD1 . TRP A 1 25  ? 18.974  -23.341 2.941   1.00 23.13 ? 69  TRP A CD1 1 
ATOM   113  C CD2 . TRP A 1 25  ? 18.266  -23.440 0.787   1.00 26.66 ? 69  TRP A CD2 1 
ATOM   114  N NE1 . TRP A 1 25  ? 19.331  -22.149 2.314   1.00 22.58 ? 69  TRP A NE1 1 
ATOM   115  C CE2 . TRP A 1 25  ? 18.904  -22.187 1.003   1.00 25.67 ? 69  TRP A CE2 1 
ATOM   116  C CE3 . TRP A 1 25  ? 17.707  -23.726 -0.485  1.00 24.63 ? 69  TRP A CE3 1 
ATOM   117  C CZ2 . TRP A 1 25  ? 19.020  -21.234 -0.019  1.00 23.39 ? 69  TRP A CZ2 1 
ATOM   118  C CZ3 . TRP A 1 25  ? 17.794  -22.779 -1.500  1.00 21.40 ? 69  TRP A CZ3 1 
ATOM   119  C CH2 . TRP A 1 25  ? 18.446  -21.550 -1.264  1.00 25.25 ? 69  TRP A CH2 1 
ATOM   120  N N   . GLN A 1 26  ? 15.112  -26.970 0.689   1.00 31.68 ? 70  GLN A N   1 
ATOM   121  C CA  . GLN A 1 26  ? 14.736  -28.286 0.171   1.00 32.17 ? 70  GLN A CA  1 
ATOM   122  C C   . GLN A 1 26  ? 15.578  -28.464 -1.082  1.00 33.06 ? 70  GLN A C   1 
ATOM   123  O O   . GLN A 1 26  ? 15.821  -27.502 -1.875  1.00 31.20 ? 70  GLN A O   1 
ATOM   124  C CB  . GLN A 1 26  ? 13.209  -28.289 -0.137  1.00 32.60 ? 70  GLN A CB  1 
ATOM   125  C CG  . GLN A 1 26  ? 12.297  -27.620 0.950   1.00 31.59 ? 70  GLN A CG  1 
ATOM   126  C CD  . GLN A 1 26  ? 11.327  -26.448 0.456   1.00 35.40 ? 70  GLN A CD  1 
ATOM   127  O OE1 . GLN A 1 26  ? 11.599  -25.169 0.566   1.00 25.84 ? 70  GLN A OE1 1 
ATOM   128  N NE2 . GLN A 1 26  ? 10.168  -26.887 -0.028  1.00 34.18 ? 70  GLN A NE2 1 
ATOM   129  N N   . MET A 1 27  ? 16.007  -29.698 -1.289  1.00 35.61 ? 71  MET A N   1 
ATOM   130  C CA  . MET A 1 27  ? 16.833  -30.086 -2.387  1.00 37.86 ? 71  MET A CA  1 
ATOM   131  C C   . MET A 1 27  ? 16.272  -31.241 -3.257  1.00 40.12 ? 71  MET A C   1 
ATOM   132  O O   . MET A 1 27  ? 15.733  -32.209 -2.738  1.00 40.20 ? 71  MET A O   1 
ATOM   133  C CB  . MET A 1 27  ? 18.179  -30.485 -1.806  1.00 39.43 ? 71  MET A CB  1 
ATOM   134  C CG  . MET A 1 27  ? 19.268  -29.483 -2.049  1.00 41.08 ? 71  MET A CG  1 
ATOM   135  S SD  . MET A 1 27  ? 19.398  -28.326 -0.678  1.00 51.43 ? 71  MET A SD  1 
ATOM   136  C CE  . MET A 1 27  ? 21.121  -28.572 -0.324  1.00 46.73 ? 71  MET A CE  1 
ATOM   137  N N   . ALA A 1 28  ? 16.365  -31.147 -4.586  1.00 40.29 ? 72  ALA A N   1 
ATOM   138  C CA  . ALA A 1 28  ? 16.110  -32.340 -5.413  1.00 41.58 ? 72  ALA A CA  1 
ATOM   139  C C   . ALA A 1 28  ? 17.276  -32.608 -6.327  1.00 42.45 ? 72  ALA A C   1 
ATOM   140  O O   . ALA A 1 28  ? 17.987  -31.683 -6.724  1.00 40.80 ? 72  ALA A O   1 
ATOM   141  C CB  . ALA A 1 28  ? 14.813  -32.209 -6.244  1.00 41.32 ? 72  ALA A CB  1 
ATOM   142  N N   . SER A 1 29  ? 17.443  -33.890 -6.678  1.00 45.02 ? 73  SER A N   1 
ATOM   143  C CA  . SER A 1 29  ? 18.526  -34.429 -7.547  1.00 46.58 ? 73  SER A CA  1 
ATOM   144  C C   . SER A 1 29  ? 19.961  -34.143 -7.119  1.00 47.44 ? 73  SER A C   1 
ATOM   145  O O   . SER A 1 29  ? 20.889  -33.942 -7.937  1.00 47.76 ? 73  SER A O   1 
ATOM   146  C CB  . SER A 1 29  ? 18.309  -34.109 -9.009  1.00 47.14 ? 73  SER A CB  1 
ATOM   147  O OG  . SER A 1 29  ? 17.629  -35.182 -9.630  1.00 48.67 ? 73  SER A OG  1 
ATOM   148  N N   . SER A 1 30  ? 20.129  -34.197 -5.812  1.00 48.57 ? 74  SER A N   1 
ATOM   149  C CA  . SER A 1 30  ? 21.405  -33.843 -5.158  1.00 49.63 ? 74  SER A CA  1 
ATOM   150  C C   . SER A 1 30  ? 22.532  -34.873 -5.372  1.00 48.80 ? 74  SER A C   1 
ATOM   151  O O   . SER A 1 30  ? 23.607  -34.782 -4.769  1.00 49.75 ? 74  SER A O   1 
ATOM   152  C CB  . SER A 1 30  ? 21.135  -33.578 -3.677  1.00 48.83 ? 74  SER A CB  1 
ATOM   153  O OG  . SER A 1 30  ? 19.925  -32.842 -3.605  1.00 51.77 ? 74  SER A OG  1 
ATOM   154  N N   . GLU A 1 31  ? 22.340  -35.854 -6.234  1.00 47.50 ? 75  GLU A N   1 
ATOM   155  C CA  . GLU A 1 31  ? 23.490  -36.750 -6.390  1.00 45.90 ? 75  GLU A CA  1 
ATOM   156  C C   . GLU A 1 31  ? 24.070  -36.844 -7.805  1.00 43.06 ? 75  GLU A C   1 
ATOM   157  O O   . GLU A 1 31  ? 23.481  -37.492 -8.629  1.00 43.83 ? 75  GLU A O   1 
ATOM   158  C CB  . GLU A 1 31  ? 23.230  -38.132 -5.748  1.00 46.21 ? 75  GLU A CB  1 
ATOM   159  C CG  . GLU A 1 31  ? 24.392  -39.244 -5.921  1.00 47.22 ? 75  GLU A CG  1 
ATOM   160  C CD  . GLU A 1 31  ? 25.906  -38.790 -5.694  1.00 48.27 ? 75  GLU A CD  1 
ATOM   161  O OE1 . GLU A 1 31  ? 26.814  -39.502 -6.243  1.00 47.80 ? 75  GLU A OE1 1 
ATOM   162  O OE2 . GLU A 1 31  ? 26.207  -37.763 -4.996  1.00 43.20 ? 75  GLU A OE2 1 
ATOM   163  N N   . PRO A 1 32  ? 25.259  -36.264 -8.055  1.00 40.87 ? 76  PRO A N   1 
ATOM   164  C CA  . PRO A 1 32  ? 26.155  -35.501 -7.168  1.00 39.99 ? 76  PRO A CA  1 
ATOM   165  C C   . PRO A 1 32  ? 25.741  -34.014 -7.032  1.00 39.19 ? 76  PRO A C   1 
ATOM   166  O O   . PRO A 1 32  ? 25.303  -33.436 -7.997  1.00 40.10 ? 76  PRO A O   1 
ATOM   167  C CB  . PRO A 1 32  ? 27.473  -35.552 -7.909  1.00 40.66 ? 76  PRO A CB  1 
ATOM   168  C CG  . PRO A 1 32  ? 26.999  -35.380 -9.408  1.00 37.87 ? 76  PRO A CG  1 
ATOM   169  C CD  . PRO A 1 32  ? 25.830  -36.373 -9.417  1.00 39.95 ? 76  PRO A CD  1 
ATOM   170  N N   . PRO A 1 33  ? 25.873  -33.426 -5.833  1.00 37.94 ? 77  PRO A N   1 
ATOM   171  C CA  . PRO A 1 33  ? 25.313  -32.113 -5.455  1.00 36.93 ? 77  PRO A CA  1 
ATOM   172  C C   . PRO A 1 33  ? 25.727  -30.931 -6.324  1.00 36.47 ? 77  PRO A C   1 
ATOM   173  O O   . PRO A 1 33  ? 26.874  -30.791 -6.671  1.00 38.27 ? 77  PRO A O   1 
ATOM   174  C CB  . PRO A 1 33  ? 25.888  -31.872 -4.041  1.00 37.33 ? 77  PRO A CB  1 
ATOM   175  C CG  . PRO A 1 33  ? 27.010  -32.845 -3.859  1.00 38.34 ? 77  PRO A CG  1 
ATOM   176  C CD  . PRO A 1 33  ? 26.622  -34.055 -4.729  1.00 36.09 ? 77  PRO A CD  1 
ATOM   177  N N   . CYS A 1 34  ? 24.820  -30.033 -6.633  1.00 34.17 ? 78  CYS A N   1 
ATOM   178  C CA  . CYS A 1 34  ? 25.244  -28.901 -7.404  1.00 32.16 ? 78  CYS A CA  1 
ATOM   179  C C   . CYS A 1 34  ? 25.317  -27.667 -6.542  1.00 32.15 ? 78  CYS A C   1 
ATOM   180  O O   . CYS A 1 34  ? 25.940  -26.673 -6.941  1.00 31.45 ? 78  CYS A O   1 
ATOM   181  C CB  . CYS A 1 34  ? 24.312  -28.731 -8.605  1.00 32.48 ? 78  CYS A CB  1 
ATOM   182  S SG  . CYS A 1 34  ? 22.547  -28.523 -8.125  1.00 34.46 ? 78  CYS A SG  1 
ATOM   183  N N   . VAL A 1 35  ? 24.733  -27.768 -5.335  1.00 32.42 ? 79  VAL A N   1 
ATOM   184  C CA  . VAL A 1 35  ? 24.525  -26.629 -4.401  1.00 32.98 ? 79  VAL A CA  1 
ATOM   185  C C   . VAL A 1 35  ? 24.708  -27.071 -2.918  1.00 34.09 ? 79  VAL A C   1 
ATOM   186  O O   . VAL A 1 35  ? 24.526  -28.224 -2.559  1.00 33.69 ? 79  VAL A O   1 
ATOM   187  C CB  . VAL A 1 35  ? 23.152  -25.770 -4.642  1.00 32.04 ? 79  VAL A CB  1 
ATOM   188  C CG1 . VAL A 1 35  ? 23.138  -25.051 -6.019  1.00 31.90 ? 79  VAL A CG1 1 
ATOM   189  C CG2 . VAL A 1 35  ? 21.847  -26.604 -4.461  1.00 32.31 ? 79  VAL A CG2 1 
ATOM   190  N N   . ASN A 1 36  ? 25.013  -26.112 -2.075  1.00 34.23 ? 80  ASN A N   1 
ATOM   191  C CA  . ASN A 1 36  ? 25.221  -26.348 -0.657  1.00 35.21 ? 80  ASN A CA  1 
ATOM   192  C C   . ASN A 1 36  ? 24.493  -25.264 0.066   1.00 34.16 ? 80  ASN A C   1 
ATOM   193  O O   . ASN A 1 36  ? 24.632  -24.099 -0.259  1.00 35.26 ? 80  ASN A O   1 
ATOM   194  C CB  . ASN A 1 36  ? 26.755  -26.236 -0.311  1.00 33.30 ? 80  ASN A CB  1 
ATOM   195  C CG  . ASN A 1 36  ? 27.063  -26.338 1.190   1.00 37.75 ? 80  ASN A CG  1 
ATOM   196  O OD1 . ASN A 1 36  ? 26.562  -27.223 1.905   1.00 41.97 ? 80  ASN A OD1 1 
ATOM   197  N ND2 . ASN A 1 36  ? 27.938  -25.447 1.666   1.00 38.49 ? 80  ASN A ND2 1 
ATOM   198  N N   . LYS A 1 37  ? 23.787  -25.630 1.106   1.00 34.73 ? 81  LYS A N   1 
ATOM   199  C CA  . LYS A 1 37  ? 23.065  -24.635 1.817   1.00 35.43 ? 81  LYS A CA  1 
ATOM   200  C C   . LYS A 1 37  ? 24.035  -23.949 2.683   1.00 34.66 ? 81  LYS A C   1 
ATOM   201  O O   . LYS A 1 37  ? 24.880  -24.596 3.275   1.00 34.95 ? 81  LYS A O   1 
ATOM   202  C CB  . LYS A 1 37  ? 21.940  -25.265 2.613   1.00 36.29 ? 81  LYS A CB  1 
ATOM   203  C CG  . LYS A 1 37  ? 22.293  -25.786 3.952   1.00 39.92 ? 81  LYS A CG  1 
ATOM   204  C CD  . LYS A 1 37  ? 21.076  -26.523 4.483   1.00 45.11 ? 81  LYS A CD  1 
ATOM   205  C CE  . LYS A 1 37  ? 20.746  -27.655 3.558   1.00 45.03 ? 81  LYS A CE  1 
ATOM   206  N NZ  . LYS A 1 37  ? 20.636  -28.884 4.440   1.00 51.08 ? 81  LYS A NZ  1 
ATOM   207  N N   . VAL A 1 38  ? 23.959  -22.623 2.757   1.00 35.10 ? 82  VAL A N   1 
ATOM   208  C CA  . VAL A 1 38  ? 24.794  -21.982 3.722   1.00 33.18 ? 82  VAL A CA  1 
ATOM   209  C C   . VAL A 1 38  ? 24.082  -21.463 4.951   1.00 33.62 ? 82  VAL A C   1 
ATOM   210  O O   . VAL A 1 38  ? 24.608  -21.618 6.033   1.00 34.45 ? 82  VAL A O   1 
ATOM   211  C CB  . VAL A 1 38  ? 25.866  -21.047 3.161   1.00 35.74 ? 82  VAL A CB  1 
ATOM   212  C CG1 . VAL A 1 38  ? 25.898  -20.973 1.621   1.00 29.82 ? 82  VAL A CG1 1 
ATOM   213  C CG2 . VAL A 1 38  ? 25.978  -19.649 3.961   1.00 34.19 ? 82  VAL A CG2 1 
ATOM   214  N N   . SER A 1 39  ? 22.965  -20.771 4.792   1.00 30.48 ? 83  SER A N   1 
ATOM   215  C CA  . SER A 1 39  ? 22.202  -20.344 5.884   1.00 30.02 ? 83  SER A CA  1 
ATOM   216  C C   . SER A 1 39  ? 20.845  -20.056 5.324   1.00 30.23 ? 83  SER A C   1 
ATOM   217  O O   . SER A 1 39  ? 20.591  -20.255 4.115   1.00 32.57 ? 83  SER A O   1 
ATOM   218  C CB  . SER A 1 39  ? 22.826  -19.118 6.613   1.00 30.89 ? 83  SER A CB  1 
ATOM   219  O OG  . SER A 1 39  ? 22.951  -17.954 5.813   1.00 28.91 ? 83  SER A OG  1 
ATOM   220  N N   . ASP A 1 40  ? 19.959  -19.527 6.142   1.00 29.53 ? 84  ASP A N   1 
ATOM   221  C CA  . ASP A 1 40  ? 18.618  -19.277 5.655   1.00 27.73 ? 84  ASP A CA  1 
ATOM   222  C C   . ASP A 1 40  ? 18.739  -18.259 4.524   1.00 28.28 ? 84  ASP A C   1 
ATOM   223  O O   . ASP A 1 40  ? 19.386  -17.220 4.697   1.00 28.95 ? 84  ASP A O   1 
ATOM   224  C CB  . ASP A 1 40  ? 17.712  -18.719 6.762   1.00 27.35 ? 84  ASP A CB  1 
ATOM   225  C CG  . ASP A 1 40  ? 17.251  -19.755 7.792   1.00 26.54 ? 84  ASP A CG  1 
ATOM   226  O OD1 . ASP A 1 40  ? 17.659  -20.928 7.815   1.00 24.42 ? 84  ASP A OD1 1 
ATOM   227  O OD2 . ASP A 1 40  ? 16.435  -19.351 8.631   1.00 27.16 ? 84  ASP A OD2 1 
ATOM   228  N N   . TRP A 1 41  ? 18.057  -18.521 3.410   1.00 28.35 ? 85  TRP A N   1 
ATOM   229  C CA  . TRP A 1 41  ? 17.947  -17.616 2.227   1.00 27.41 ? 85  TRP A CA  1 
ATOM   230  C C   . TRP A 1 41  ? 19.229  -17.497 1.359   1.00 26.79 ? 85  TRP A C   1 
ATOM   231  O O   . TRP A 1 41  ? 19.287  -16.691 0.483   1.00 27.05 ? 85  TRP A O   1 
ATOM   232  C CB  . TRP A 1 41  ? 17.362  -16.221 2.549   1.00 27.21 ? 85  TRP A CB  1 
ATOM   233  C CG  . TRP A 1 41  ? 16.099  -16.152 3.333   1.00 26.80 ? 85  TRP A CG  1 
ATOM   234  C CD1 . TRP A 1 41  ? 15.989  -15.851 4.692   1.00 25.41 ? 85  TRP A CD1 1 
ATOM   235  C CD2 . TRP A 1 41  ? 14.755  -16.358 2.859   1.00 24.44 ? 85  TRP A CD2 1 
ATOM   236  N NE1 . TRP A 1 41  ? 14.658  -15.864 5.062   1.00 25.16 ? 85  TRP A NE1 1 
ATOM   237  C CE2 . TRP A 1 41  ? 13.887  -16.201 3.968   1.00 28.89 ? 85  TRP A CE2 1 
ATOM   238  C CE3 . TRP A 1 41  ? 14.199  -16.706 1.628   1.00 28.44 ? 85  TRP A CE3 1 
ATOM   239  C CZ2 . TRP A 1 41  ? 12.486  -16.361 3.850   1.00 24.93 ? 85  TRP A CZ2 1 
ATOM   240  C CZ3 . TRP A 1 41  ? 12.842  -16.865 1.521   1.00 23.09 ? 85  TRP A CZ3 1 
ATOM   241  C CH2 . TRP A 1 41  ? 11.992  -16.707 2.634   1.00 27.47 ? 85  TRP A CH2 1 
ATOM   242  N N   . LYS A 1 42  ? 20.225  -18.318 1.631   1.00 26.98 ? 86  LYS A N   1 
ATOM   243  C CA  . LYS A 1 42  ? 21.560  -18.205 1.071   1.00 26.56 ? 86  LYS A CA  1 
ATOM   244  C C   . LYS A 1 42  ? 22.141  -19.522 0.710   1.00 26.34 ? 86  LYS A C   1 
ATOM   245  O O   . LYS A 1 42  ? 22.198  -20.437 1.510   1.00 24.80 ? 86  LYS A O   1 
ATOM   246  C CB  . LYS A 1 42  ? 22.544  -17.571 2.049   1.00 25.76 ? 86  LYS A CB  1 
ATOM   247  C CG  . LYS A 1 42  ? 23.899  -17.534 1.460   1.00 25.97 ? 86  LYS A CG  1 
ATOM   248  C CD  . LYS A 1 42  ? 24.712  -16.242 1.888   1.00 28.22 ? 86  LYS A CD  1 
ATOM   249  C CE  . LYS A 1 42  ? 26.206  -16.446 1.668   1.00 25.21 ? 86  LYS A CE  1 
ATOM   250  N NZ  . LYS A 1 42  ? 26.834  -15.408 2.487   1.00 38.26 ? 86  LYS A NZ  1 
ATOM   251  N N   . LEU A 1 43  ? 22.656  -19.588 -0.497  1.00 26.80 ? 87  LEU A N   1 
ATOM   252  C CA  . LEU A 1 43  ? 23.145  -20.865 -0.965  1.00 28.23 ? 87  LEU A CA  1 
ATOM   253  C C   . LEU A 1 43  ? 24.510  -20.673 -1.601  1.00 27.00 ? 87  LEU A C   1 
ATOM   254  O O   . LEU A 1 43  ? 24.818  -19.634 -2.020  1.00 28.15 ? 87  LEU A O   1 
ATOM   255  C CB  . LEU A 1 43  ? 22.081  -21.458 -1.907  1.00 28.18 ? 87  LEU A CB  1 
ATOM   256  C CG  . LEU A 1 43  ? 22.021  -22.873 -2.441  1.00 32.89 ? 87  LEU A CG  1 
ATOM   257  C CD1 . LEU A 1 43  ? 21.538  -23.793 -1.369  1.00 33.01 ? 87  LEU A CD1 1 
ATOM   258  C CD2 . LEU A 1 43  ? 21.112  -22.864 -3.641  1.00 32.49 ? 87  LEU A CD2 1 
ATOM   259  N N   . GLU A 1 44  ? 25.298  -21.732 -1.658  1.00 28.63 ? 88  GLU A N   1 
ATOM   260  C CA  . GLU A 1 44  ? 26.554  -21.849 -2.348  1.00 29.91 ? 88  GLU A CA  1 
ATOM   261  C C   . GLU A 1 44  ? 26.469  -22.771 -3.551  1.00 28.33 ? 88  GLU A C   1 
ATOM   262  O O   . GLU A 1 44  ? 25.857  -23.852 -3.496  1.00 28.83 ? 88  GLU A O   1 
ATOM   263  C CB  . GLU A 1 44  ? 27.616  -22.431 -1.349  1.00 29.58 ? 88  GLU A CB  1 
ATOM   264  C CG  . GLU A 1 44  ? 29.067  -22.422 -1.892  1.00 31.61 ? 88  GLU A CG  1 
ATOM   265  C CD  . GLU A 1 44  ? 30.128  -22.975 -0.910  1.00 35.32 ? 88  GLU A CD  1 
ATOM   266  O OE1 . GLU A 1 44  ? 29.877  -23.131 0.335   1.00 43.89 ? 88  GLU A OE1 1 
ATOM   267  O OE2 . GLU A 1 44  ? 31.249  -23.231 -1.386  1.00 42.63 ? 88  GLU A OE2 1 
ATOM   268  N N   . ILE A 1 45  ? 27.136  -22.376 -4.624  1.00 27.54 ? 89  ILE A N   1 
ATOM   269  C CA  . ILE A 1 45  ? 27.244  -23.182 -5.831  1.00 27.97 ? 89  ILE A CA  1 
ATOM   270  C C   . ILE A 1 45  ? 28.399  -24.210 -5.640  1.00 28.21 ? 89  ILE A C   1 
ATOM   271  O O   . ILE A 1 45  ? 29.470  -23.815 -5.220  1.00 29.05 ? 89  ILE A O   1 
ATOM   272  C CB  . ILE A 1 45  ? 27.401  -22.295 -7.106  1.00 26.50 ? 89  ILE A CB  1 
ATOM   273  C CG1 . ILE A 1 45  ? 26.050  -21.763 -7.561  1.00 26.56 ? 89  ILE A CG1 1 
ATOM   274  C CG2 . ILE A 1 45  ? 27.852  -23.108 -8.299  1.00 26.04 ? 89  ILE A CG2 1 
ATOM   275  C CD1 . ILE A 1 45  ? 25.512  -20.812 -6.714  1.00 37.09 ? 89  ILE A CD1 1 
ATOM   276  N N   . LEU A 1 46  ? 28.144  -25.493 -5.897  1.00 29.71 ? 90  LEU A N   1 
ATOM   277  C CA  . LEU A 1 46  ? 29.184  -26.523 -5.806  1.00 31.80 ? 90  LEU A CA  1 
ATOM   278  C C   . LEU A 1 46  ? 29.699  -26.768 -7.220  1.00 32.78 ? 90  LEU A C   1 
ATOM   279  O O   . LEU A 1 46  ? 30.849  -27.139 -7.423  1.00 33.35 ? 90  LEU A O   1 
ATOM   280  C CB  . LEU A 1 46  ? 28.709  -27.828 -5.085  1.00 31.25 ? 90  LEU A CB  1 
ATOM   281  C CG  . LEU A 1 46  ? 28.512  -27.593 -3.569  1.00 33.10 ? 90  LEU A CG  1 
ATOM   282  C CD1 . LEU A 1 46  ? 28.291  -28.882 -2.795  1.00 32.28 ? 90  LEU A CD1 1 
ATOM   283  C CD2 . LEU A 1 46  ? 29.661  -26.749 -2.972  1.00 32.53 ? 90  LEU A CD2 1 
ATOM   284  N N   . GLN A 1 47  ? 28.880  -26.443 -8.199  1.00 32.67 ? 91  GLN A N   1 
ATOM   285  C CA  . GLN A 1 47  ? 29.168  -26.882 -9.535  1.00 33.35 ? 91  GLN A CA  1 
ATOM   286  C C   . GLN A 1 47  ? 29.072  -25.747 -10.563 1.00 32.54 ? 91  GLN A C   1 
ATOM   287  O O   . GLN A 1 47  ? 28.044  -25.064 -10.616 1.00 28.68 ? 91  GLN A O   1 
ATOM   288  C CB  . GLN A 1 47  ? 28.165  -27.934 -9.877  1.00 34.12 ? 91  GLN A CB  1 
ATOM   289  C CG  . GLN A 1 47  ? 28.694  -29.288 -9.702  1.00 42.60 ? 91  GLN A CG  1 
ATOM   290  C CD  . GLN A 1 47  ? 29.112  -29.795 -11.022 1.00 48.03 ? 91  GLN A CD  1 
ATOM   291  O OE1 . GLN A 1 47  ? 28.265  -29.940 -11.916 1.00 53.19 ? 91  GLN A OE1 1 
ATOM   292  N NE2 . GLN A 1 47  ? 30.424  -30.032 -11.198 1.00 51.45 ? 91  GLN A NE2 1 
ATOM   293  N N   . ASN A 1 48  ? 30.148  -25.541 -11.345 1.00 30.76 ? 92  ASN A N   1 
ATOM   294  C CA  . ASN A 1 48  ? 30.065  -24.604 -12.469 1.00 31.66 ? 92  ASN A CA  1 
ATOM   295  C C   . ASN A 1 48  ? 28.827  -24.887 -13.353 1.00 30.90 ? 92  ASN A C   1 
ATOM   296  O O   . ASN A 1 48  ? 28.484  -26.051 -13.655 1.00 28.26 ? 92  ASN A O   1 
ATOM   297  C CB  . ASN A 1 48  ? 31.287  -24.754 -13.387 1.00 32.64 ? 92  ASN A CB  1 
ATOM   298  C CG  . ASN A 1 48  ? 32.560  -24.280 -12.780 1.00 35.48 ? 92  ASN A CG  1 
ATOM   299  O OD1 . ASN A 1 48  ? 33.599  -24.819 -13.090 1.00 41.91 ? 92  ASN A OD1 1 
ATOM   300  N ND2 . ASN A 1 48  ? 32.504  -23.289 -11.943 1.00 35.42 ? 92  ASN A ND2 1 
ATOM   301  N N   . GLY A 1 49  ? 28.164  -23.844 -13.823 1.00 29.78 ? 93  GLY A N   1 
ATOM   302  C CA  . GLY A 1 49  ? 27.005  -24.170 -14.576 1.00 28.56 ? 93  GLY A CA  1 
ATOM   303  C C   . GLY A 1 49  ? 26.186  -23.013 -15.011 1.00 28.62 ? 93  GLY A C   1 
ATOM   304  O O   . GLY A 1 49  ? 26.376  -21.863 -14.556 1.00 29.61 ? 93  GLY A O   1 
ATOM   305  N N   . LEU A 1 50  ? 25.242  -23.352 -15.885 1.00 25.89 ? 94  LEU A N   1 
ATOM   306  C CA  . LEU A 1 50  ? 24.185  -22.457 -16.304 1.00 25.90 ? 94  LEU A CA  1 
ATOM   307  C C   . LEU A 1 50  ? 22.987  -22.760 -15.417 1.00 24.97 ? 94  LEU A C   1 
ATOM   308  O O   . LEU A 1 50  ? 22.439  -23.886 -15.400 1.00 25.93 ? 94  LEU A O   1 
ATOM   309  C CB  . LEU A 1 50  ? 23.879  -22.643 -17.793 1.00 24.59 ? 94  LEU A CB  1 
ATOM   310  C CG  . LEU A 1 50  ? 23.200  -21.517 -18.628 1.00 29.22 ? 94  LEU A CG  1 
ATOM   311  C CD1 . LEU A 1 50  ? 21.820  -21.828 -19.286 1.00 29.76 ? 94  LEU A CD1 1 
ATOM   312  C CD2 . LEU A 1 50  ? 23.339  -20.106 -18.137 1.00 22.56 ? 94  LEU A CD2 1 
ATOM   313  N N   . TYR A 1 51  ? 22.635  -21.797 -14.586 1.00 24.45 ? 95  TYR A N   1 
ATOM   314  C CA  . TYR A 1 51  ? 21.515  -22.038 -13.616 1.00 25.02 ? 95  TYR A CA  1 
ATOM   315  C C   . TYR A 1 51  ? 20.394  -21.014 -13.871 1.00 25.05 ? 95  TYR A C   1 
ATOM   316  O O   . TYR A 1 51  ? 20.672  -19.844 -14.260 1.00 23.97 ? 95  TYR A O   1 
ATOM   317  C CB  . TYR A 1 51  ? 21.942  -21.856 -12.138 1.00 24.56 ? 95  TYR A CB  1 
ATOM   318  C CG  . TYR A 1 51  ? 22.915  -22.844 -11.646 1.00 25.11 ? 95  TYR A CG  1 
ATOM   319  C CD1 . TYR A 1 51  ? 24.277  -22.702 -11.897 1.00 26.79 ? 95  TYR A CD1 1 
ATOM   320  C CD2 . TYR A 1 51  ? 22.484  -23.914 -10.802 1.00 26.61 ? 95  TYR A CD2 1 
ATOM   321  C CE1 . TYR A 1 51  ? 25.232  -23.709 -11.396 1.00 32.72 ? 95  TYR A CE1 1 
ATOM   322  C CE2 . TYR A 1 51  ? 23.374  -24.849 -10.321 1.00 25.86 ? 95  TYR A CE2 1 
ATOM   323  C CZ  . TYR A 1 51  ? 24.754  -24.761 -10.615 1.00 29.34 ? 95  TYR A CZ  1 
ATOM   324  O OH  . TYR A 1 51  ? 25.598  -25.771 -10.113 1.00 27.89 ? 95  TYR A OH  1 
ATOM   325  N N   . LEU A 1 52  ? 19.167  -21.423 -13.574 1.00 22.42 ? 96  LEU A N   1 
ATOM   326  C CA  . LEU A 1 52  ? 18.078  -20.474 -13.646 1.00 22.79 ? 96  LEU A CA  1 
ATOM   327  C C   . LEU A 1 52  ? 17.601  -20.247 -12.217 1.00 22.23 ? 96  LEU A C   1 
ATOM   328  O O   . LEU A 1 52  ? 17.364  -21.197 -11.499 1.00 22.84 ? 96  LEU A O   1 
ATOM   329  C CB  . LEU A 1 52  ? 16.980  -21.043 -14.563 1.00 22.79 ? 96  LEU A CB  1 
ATOM   330  C CG  . LEU A 1 52  ? 15.466  -20.665 -14.673 1.00 23.71 ? 96  LEU A CG  1 
ATOM   331  C CD1 . LEU A 1 52  ? 14.905  -19.537 -13.962 1.00 30.30 ? 96  LEU A CD1 1 
ATOM   332  C CD2 . LEU A 1 52  ? 14.953  -20.601 -16.171 1.00 21.51 ? 96  LEU A CD2 1 
ATOM   333  N N   . ILE A 1 53  ? 17.562  -19.002 -11.775 1.00 22.58 ? 97  ILE A N   1 
ATOM   334  C CA  . ILE A 1 53  ? 17.121  -18.655 -10.425 1.00 21.94 ? 97  ILE A CA  1 
ATOM   335  C C   . ILE A 1 53  ? 15.681  -18.118 -10.590 1.00 23.61 ? 97  ILE A C   1 
ATOM   336  O O   . ILE A 1 53  ? 15.381  -17.430 -11.609 1.00 23.98 ? 97  ILE A O   1 
ATOM   337  C CB  . ILE A 1 53  ? 18.035  -17.598 -9.825  1.00 23.14 ? 97  ILE A CB  1 
ATOM   338  C CG1 . ILE A 1 53  ? 19.476  -18.047 -9.715  1.00 23.62 ? 97  ILE A CG1 1 
ATOM   339  C CG2 . ILE A 1 53  ? 17.494  -17.146 -8.466  1.00 22.67 ? 97  ILE A CG2 1 
ATOM   340  C CD1 . ILE A 1 53  ? 20.394  -16.941 -9.214  1.00 18.64 ? 97  ILE A CD1 1 
ATOM   341  N N   . TYR A 1 54  ? 14.770  -18.501 -9.667  1.00 23.09 ? 98  TYR A N   1 
ATOM   342  C CA  . TYR A 1 54  ? 13.383  -18.111 -9.779  1.00 23.53 ? 98  TYR A CA  1 
ATOM   343  C C   . TYR A 1 54  ? 12.883  -17.796 -8.398  1.00 24.22 ? 98  TYR A C   1 
ATOM   344  O O   . TYR A 1 54  ? 13.536  -18.157 -7.432  1.00 25.58 ? 98  TYR A O   1 
ATOM   345  C CB  . TYR A 1 54  ? 12.488  -19.206 -10.370 1.00 23.54 ? 98  TYR A CB  1 
ATOM   346  C CG  . TYR A 1 54  ? 12.260  -20.360 -9.527  1.00 23.30 ? 98  TYR A CG  1 
ATOM   347  C CD1 . TYR A 1 54  ? 11.098  -20.490 -8.776  1.00 25.10 ? 98  TYR A CD1 1 
ATOM   348  C CD2 . TYR A 1 54  ? 13.171  -21.414 -9.537  1.00 27.55 ? 98  TYR A CD2 1 
ATOM   349  C CE1 . TYR A 1 54  ? 10.917  -21.672 -7.932  1.00 23.71 ? 98  TYR A CE1 1 
ATOM   350  C CE2 . TYR A 1 54  ? 12.997  -22.548 -8.764  1.00 24.87 ? 98  TYR A CE2 1 
ATOM   351  C CZ  . TYR A 1 54  ? 11.872  -22.655 -7.953  1.00 28.37 ? 98  TYR A CZ  1 
ATOM   352  O OH  . TYR A 1 54  ? 11.713  -23.809 -7.219  1.00 26.69 ? 98  TYR A OH  1 
ATOM   353  N N   . GLY A 1 55  ? 11.693  -17.235 -8.267  1.00 23.63 ? 99  GLY A N   1 
ATOM   354  C CA  . GLY A 1 55  ? 11.209  -16.982 -6.902  1.00 22.14 ? 99  GLY A CA  1 
ATOM   355  C C   . GLY A 1 55  ? 10.074  -16.034 -6.775  1.00 24.32 ? 99  GLY A C   1 
ATOM   356  O O   . GLY A 1 55  ? 9.669   -15.385 -7.731  1.00 24.26 ? 99  GLY A O   1 
ATOM   357  N N   . GLN A 1 56  ? 9.639   -15.816 -5.543  1.00 23.55 ? 100 GLN A N   1 
ATOM   358  C CA  . GLN A 1 56  ? 8.550   -14.915 -5.314  1.00 25.66 ? 100 GLN A CA  1 
ATOM   359  C C   . GLN A 1 56  ? 8.873   -14.115 -4.040  1.00 25.17 ? 100 GLN A C   1 
ATOM   360  O O   . GLN A 1 56  ? 9.180   -14.677 -3.002  1.00 23.46 ? 100 GLN A O   1 
ATOM   361  C CB  . GLN A 1 56  ? 7.250   -15.698 -5.111  1.00 25.32 ? 100 GLN A CB  1 
ATOM   362  C CG  . GLN A 1 56  ? 6.032   -14.781 -4.883  1.00 29.98 ? 100 GLN A CG  1 
ATOM   363  C CD  . GLN A 1 56  ? 4.819   -15.613 -4.715  1.00 33.15 ? 100 GLN A CD  1 
ATOM   364  O OE1 . GLN A 1 56  ? 4.303   -15.775 -3.612  1.00 38.41 ? 100 GLN A OE1 1 
ATOM   365  N NE2 . GLN A 1 56  ? 4.408   -16.252 -5.793  1.00 33.84 ? 100 GLN A NE2 1 
ATOM   366  N N   . VAL A 1 57  ? 8.886   -12.808 -4.161  1.00 23.94 ? 101 VAL A N   1 
ATOM   367  C CA  . VAL A 1 57  ? 8.928   -12.036 -2.996  1.00 24.38 ? 101 VAL A CA  1 
ATOM   368  C C   . VAL A 1 57  ? 7.495   -11.494 -2.723  1.00 25.20 ? 101 VAL A C   1 
ATOM   369  O O   . VAL A 1 57  ? 6.949   -10.696 -3.498  1.00 26.00 ? 101 VAL A O   1 
ATOM   370  C CB  . VAL A 1 57  ? 9.900   -10.892 -3.137  1.00 25.52 ? 101 VAL A CB  1 
ATOM   371  C CG1 . VAL A 1 57  ? 9.653   -9.840  -2.053  1.00 20.04 ? 101 VAL A CG1 1 
ATOM   372  C CG2 . VAL A 1 57  ? 11.434  -11.454 -3.109  1.00 26.29 ? 101 VAL A CG2 1 
ATOM   373  N N   . ALA A 1 58  ? 6.978   -11.825 -1.567  1.00 24.52 ? 102 ALA A N   1 
ATOM   374  C CA  . ALA A 1 58  ? 5.707   -11.192 -1.083  1.00 24.73 ? 102 ALA A CA  1 
ATOM   375  C C   . ALA A 1 58  ? 5.940   -10.132 -0.001  1.00 24.33 ? 102 ALA A C   1 
ATOM   376  O O   . ALA A 1 58  ? 6.122   -10.442 1.190   1.00 26.29 ? 102 ALA A O   1 
ATOM   377  C CB  . ALA A 1 58  ? 4.748   -12.296 -0.613  1.00 22.67 ? 102 ALA A CB  1 
ATOM   378  N N   . PRO A 1 59  ? 5.985   -8.844  -0.395  1.00 24.05 ? 103 PRO A N   1 
ATOM   379  C CA  . PRO A 1 59  ? 6.228   -7.751  0.532   1.00 22.96 ? 103 PRO A CA  1 
ATOM   380  C C   . PRO A 1 59  ? 5.106   -7.560  1.550   1.00 24.27 ? 103 PRO A C   1 
ATOM   381  O O   . PRO A 1 59  ? 3.956   -7.886  1.266   1.00 23.75 ? 103 PRO A O   1 
ATOM   382  C CB  . PRO A 1 59  ? 6.231   -6.550  -0.378  1.00 23.38 ? 103 PRO A CB  1 
ATOM   383  C CG  . PRO A 1 59  ? 6.670   -7.182  -1.731  1.00 25.47 ? 103 PRO A CG  1 
ATOM   384  C CD  . PRO A 1 59  ? 5.797   -8.355  -1.755  1.00 22.84 ? 103 PRO A CD  1 
ATOM   385  N N   . ASN A 1 60  ? 5.477   -7.092  2.736   1.00 23.36 ? 104 ASN A N   1 
ATOM   386  C CA  . ASN A 1 60  ? 4.571   -6.640  3.694   1.00 25.94 ? 104 ASN A CA  1 
ATOM   387  C C   . ASN A 1 60  ? 4.119   -5.228  3.302   1.00 27.60 ? 104 ASN A C   1 
ATOM   388  O O   . ASN A 1 60  ? 4.824   -4.211  3.538   1.00 27.08 ? 104 ASN A O   1 
ATOM   389  C CB  . ASN A 1 60  ? 5.214   -6.733  5.109   1.00 24.52 ? 104 ASN A CB  1 
ATOM   390  C CG  . ASN A 1 60  ? 4.354   -6.137  6.196   1.00 27.23 ? 104 ASN A CG  1 
ATOM   391  O OD1 . ASN A 1 60  ? 4.818   -5.815  7.303   1.00 29.65 ? 104 ASN A OD1 1 
ATOM   392  N ND2 . ASN A 1 60  ? 3.128   -5.921  5.877   1.00 17.50 ? 104 ASN A ND2 1 
ATOM   393  N N   . ALA A 1 61  ? 2.922   -5.152  2.705   1.00 29.19 ? 105 ALA A N   1 
ATOM   394  C CA  . ALA A 1 61  ? 2.429   -3.857  2.135   1.00 28.90 ? 105 ALA A CA  1 
ATOM   395  C C   . ALA A 1 61  ? 2.030   -2.893  3.211   1.00 29.06 ? 105 ALA A C   1 
ATOM   396  O O   . ALA A 1 61  ? 1.745   -1.718  2.957   1.00 29.30 ? 105 ALA A O   1 
ATOM   397  C CB  . ALA A 1 61  ? 1.268   -4.098  1.227   1.00 28.97 ? 105 ALA A CB  1 
ATOM   398  N N   . ASN A 1 62  ? 1.940   -3.420  4.424   1.00 29.91 ? 106 ASN A N   1 
ATOM   399  C CA  . ASN A 1 62  ? 1.649   -2.628  5.635   1.00 29.14 ? 106 ASN A CA  1 
ATOM   400  C C   . ASN A 1 62  ? 2.902   -2.281  6.431   1.00 30.17 ? 106 ASN A C   1 
ATOM   401  O O   . ASN A 1 62  ? 2.825   -1.804  7.602   1.00 28.58 ? 106 ASN A O   1 
ATOM   402  C CB  . ASN A 1 62  ? 0.783   -3.454  6.552   1.00 28.97 ? 106 ASN A CB  1 
ATOM   403  C CG  . ASN A 1 62  ? 0.027   -2.587  7.529   1.00 32.36 ? 106 ASN A CG  1 
ATOM   404  O OD1 . ASN A 1 62  ? -0.454  -1.523  7.163   1.00 37.12 ? 106 ASN A OD1 1 
ATOM   405  N ND2 . ASN A 1 62  ? -0.070  -3.019  8.774   1.00 33.69 ? 106 ASN A ND2 1 
ATOM   406  N N   . TYR A 1 63  ? 4.067   -2.570  5.841   1.00 31.02 ? 107 TYR A N   1 
ATOM   407  C CA  . TYR A 1 63  ? 5.341   -2.312  6.515   1.00 32.35 ? 107 TYR A CA  1 
ATOM   408  C C   . TYR A 1 63  ? 5.473   -0.832  6.671   1.00 34.13 ? 107 TYR A C   1 
ATOM   409  O O   . TYR A 1 63  ? 5.242   -0.100  5.710   1.00 34.68 ? 107 TYR A O   1 
ATOM   410  C CB  . TYR A 1 63  ? 6.520   -2.852  5.725   1.00 29.07 ? 107 TYR A CB  1 
ATOM   411  C CG  . TYR A 1 63  ? 7.826   -2.341  6.262   1.00 28.09 ? 107 TYR A CG  1 
ATOM   412  C CD1 . TYR A 1 63  ? 8.473   -1.273  5.617   1.00 24.65 ? 107 TYR A CD1 1 
ATOM   413  C CD2 . TYR A 1 63  ? 8.404   -2.885  7.413   1.00 24.78 ? 107 TYR A CD2 1 
ATOM   414  C CE1 . TYR A 1 63  ? 9.661   -0.770  6.084   1.00 21.71 ? 107 TYR A CE1 1 
ATOM   415  C CE2 . TYR A 1 63  ? 9.637   -2.367  7.921   1.00 26.77 ? 107 TYR A CE2 1 
ATOM   416  C CZ  . TYR A 1 63  ? 10.233  -1.279  7.213   1.00 27.64 ? 107 TYR A CZ  1 
ATOM   417  O OH  . TYR A 1 63  ? 11.408  -0.701  7.583   1.00 28.57 ? 107 TYR A OH  1 
ATOM   418  N N   . ASN A 1 64  ? 5.741   -0.367  7.897   1.00 37.16 ? 108 ASN A N   1 
ATOM   419  C CA  . ASN A 1 64  ? 6.131   1.027   8.002   1.00 40.09 ? 108 ASN A CA  1 
ATOM   420  C C   . ASN A 1 64  ? 7.079   1.497   9.146   1.00 40.15 ? 108 ASN A C   1 
ATOM   421  O O   . ASN A 1 64  ? 7.107   2.681   9.527   1.00 41.82 ? 108 ASN A O   1 
ATOM   422  C CB  . ASN A 1 64  ? 4.958   1.959   7.716   1.00 41.28 ? 108 ASN A CB  1 
ATOM   423  C CG  . ASN A 1 64  ? 4.310   2.433   8.927   1.00 45.75 ? 108 ASN A CG  1 
ATOM   424  O OD1 . ASN A 1 64  ? 4.133   3.650   9.115   1.00 54.98 ? 108 ASN A OD1 1 
ATOM   425  N ND2 . ASN A 1 64  ? 3.942   1.500   9.797   1.00 53.56 ? 108 ASN A ND2 1 
ATOM   426  N N   . ASP A 1 65  ? 7.923   0.588   9.596   1.00 39.04 ? 109 ASP A N   1 
ATOM   427  C CA  . ASP A 1 65  ? 9.075   0.950   10.395  1.00 38.93 ? 109 ASP A CA  1 
ATOM   428  C C   . ASP A 1 65  ? 10.056  1.908   9.739   1.00 37.49 ? 109 ASP A C   1 
ATOM   429  O O   . ASP A 1 65  ? 9.876   2.385   8.622   1.00 38.37 ? 109 ASP A O   1 
ATOM   430  C CB  . ASP A 1 65  ? 9.855   -0.268  10.817  1.00 38.87 ? 109 ASP A CB  1 
ATOM   431  C CG  . ASP A 1 65  ? 9.045   -1.254  11.568  1.00 43.31 ? 109 ASP A CG  1 
ATOM   432  O OD1 . ASP A 1 65  ? 7.969   -0.894  12.128  1.00 53.75 ? 109 ASP A OD1 1 
ATOM   433  O OD2 . ASP A 1 65  ? 9.483   -2.423  11.616  1.00 47.00 ? 109 ASP A OD2 1 
ATOM   434  N N   . VAL A 1 66  ? 11.095  2.172   10.517  1.00 37.10 ? 110 VAL A N   1 
ATOM   435  C CA  . VAL A 1 66  ? 12.233  3.060   10.251  1.00 35.97 ? 110 VAL A CA  1 
ATOM   436  C C   . VAL A 1 66  ? 13.015  2.772   8.952   1.00 34.25 ? 110 VAL A C   1 
ATOM   437  O O   . VAL A 1 66  ? 13.114  3.612   8.043   1.00 35.39 ? 110 VAL A O   1 
ATOM   438  C CB  . VAL A 1 66  ? 13.216  3.016   11.528  1.00 35.88 ? 110 VAL A CB  1 
ATOM   439  C CG1 . VAL A 1 66  ? 14.408  3.872   11.310  1.00 35.74 ? 110 VAL A CG1 1 
ATOM   440  C CG2 . VAL A 1 66  ? 12.471  3.430   12.841  1.00 38.04 ? 110 VAL A CG2 1 
ATOM   441  N N   . ALA A 1 67  ? 13.563  1.586   8.866   1.00 32.29 ? 111 ALA A N   1 
ATOM   442  C CA  . ALA A 1 67  ? 14.465  1.232   7.790   1.00 31.04 ? 111 ALA A CA  1 
ATOM   443  C C   . ALA A 1 67  ? 13.744  1.394   6.431   1.00 30.51 ? 111 ALA A C   1 
ATOM   444  O O   . ALA A 1 67  ? 12.529  1.032   6.315   1.00 29.80 ? 111 ALA A O   1 
ATOM   445  C CB  . ALA A 1 67  ? 14.954  -0.173  8.010   1.00 29.46 ? 111 ALA A CB  1 
ATOM   446  N N   . PRO A 1 68  ? 14.434  1.980   5.422   1.00 28.63 ? 112 PRO A N   1 
ATOM   447  C CA  . PRO A 1 68  ? 13.723  2.083   4.131   1.00 28.37 ? 112 PRO A CA  1 
ATOM   448  C C   . PRO A 1 68  ? 13.473  0.687   3.547   1.00 28.61 ? 112 PRO A C   1 
ATOM   449  O O   . PRO A 1 68  ? 14.238  -0.261  3.827   1.00 27.83 ? 112 PRO A O   1 
ATOM   450  C CB  . PRO A 1 68  ? 14.683  2.920   3.229   1.00 28.60 ? 112 PRO A CB  1 
ATOM   451  C CG  . PRO A 1 68  ? 15.978  2.953   3.970   1.00 27.08 ? 112 PRO A CG  1 
ATOM   452  C CD  . PRO A 1 68  ? 15.793  2.555   5.379   1.00 27.89 ? 112 PRO A CD  1 
ATOM   453  N N   . PHE A 1 69  ? 12.371  0.553   2.787   1.00 27.44 ? 113 PHE A N   1 
ATOM   454  C CA  . PHE A 1 69  ? 12.039  -0.687  2.149   1.00 25.55 ? 113 PHE A CA  1 
ATOM   455  C C   . PHE A 1 69  ? 12.963  -1.094  0.962   1.00 25.80 ? 113 PHE A C   1 
ATOM   456  O O   . PHE A 1 69  ? 13.090  -0.381  -0.015  1.00 24.85 ? 113 PHE A O   1 
ATOM   457  C CB  . PHE A 1 69  ? 10.530  -0.749  1.785   1.00 25.54 ? 113 PHE A CB  1 
ATOM   458  C CG  . PHE A 1 69  ? 10.140  -2.027  1.126   1.00 26.17 ? 113 PHE A CG  1 
ATOM   459  C CD1 . PHE A 1 69  ? 9.704   -3.098  1.877   1.00 27.12 ? 113 PHE A CD1 1 
ATOM   460  C CD2 . PHE A 1 69  ? 10.258  -2.176  -0.257  1.00 22.49 ? 113 PHE A CD2 1 
ATOM   461  C CE1 . PHE A 1 69  ? 9.339   -4.314  1.265   1.00 27.98 ? 113 PHE A CE1 1 
ATOM   462  C CE2 . PHE A 1 69  ? 9.878   -3.387  -0.881  1.00 29.10 ? 113 PHE A CE2 1 
ATOM   463  C CZ  . PHE A 1 69  ? 9.483   -4.469  -0.121  1.00 31.45 ? 113 PHE A CZ  1 
ATOM   464  N N   . GLU A 1 70  ? 13.570  -2.282  1.010   1.00 24.86 ? 114 GLU A N   1 
ATOM   465  C CA  . GLU A 1 70  ? 14.248  -2.729  -0.187  1.00 26.90 ? 114 GLU A CA  1 
ATOM   466  C C   . GLU A 1 70  ? 14.502  -4.207  0.052   1.00 26.71 ? 114 GLU A C   1 
ATOM   467  O O   . GLU A 1 70  ? 14.830  -4.538  1.151   1.00 26.33 ? 114 GLU A O   1 
ATOM   468  C CB  . GLU A 1 70  ? 15.613  -2.020  -0.443  1.00 26.42 ? 114 GLU A CB  1 
ATOM   469  C CG  . GLU A 1 70  ? 16.156  -2.453  -1.820  1.00 24.33 ? 114 GLU A CG  1 
ATOM   470  C CD  . GLU A 1 70  ? 17.331  -1.612  -2.301  1.00 29.97 ? 114 GLU A CD  1 
ATOM   471  O OE1 . GLU A 1 70  ? 17.644  -0.589  -1.682  1.00 34.89 ? 114 GLU A OE1 1 
ATOM   472  O OE2 . GLU A 1 70  ? 17.950  -1.947  -3.330  1.00 37.23 ? 114 GLU A OE2 1 
ATOM   473  N N   . VAL A 1 71  ? 14.410  -5.030  -0.997  1.00 25.70 ? 115 VAL A N   1 
ATOM   474  C CA  . VAL A 1 71  ? 14.669  -6.478  -0.928  1.00 24.36 ? 115 VAL A CA  1 
ATOM   475  C C   . VAL A 1 71  ? 15.653  -6.743  -2.114  1.00 25.46 ? 115 VAL A C   1 
ATOM   476  O O   . VAL A 1 71  ? 15.483  -6.167  -3.176  1.00 23.39 ? 115 VAL A O   1 
ATOM   477  C CB  . VAL A 1 71  ? 13.334  -7.280  -1.085  1.00 24.70 ? 115 VAL A CB  1 
ATOM   478  C CG1 . VAL A 1 71  ? 13.661  -8.721  -1.327  1.00 23.42 ? 115 VAL A CG1 1 
ATOM   479  C CG2 . VAL A 1 71  ? 12.392  -7.147  0.114   1.00 21.56 ? 115 VAL A CG2 1 
ATOM   480  N N   . ARG A 1 72  ? 16.748  -7.489  -1.892  1.00 25.17 ? 116 ARG A N   1 
ATOM   481  C CA  . ARG A 1 72  ? 17.759  -7.651  -2.912  1.00 24.69 ? 116 ARG A CA  1 
ATOM   482  C C   . ARG A 1 72  ? 18.230  -9.107  -3.124  1.00 24.12 ? 116 ARG A C   1 
ATOM   483  O O   . ARG A 1 72  ? 18.383  -9.851  -2.183  1.00 22.97 ? 116 ARG A O   1 
ATOM   484  C CB  . ARG A 1 72  ? 19.002  -6.854  -2.603  1.00 23.87 ? 116 ARG A CB  1 
ATOM   485  C CG  . ARG A 1 72  ? 18.907  -5.417  -2.920  1.00 28.79 ? 116 ARG A CG  1 
ATOM   486  C CD  . ARG A 1 72  ? 19.045  -4.835  -1.543  1.00 34.81 ? 116 ARG A CD  1 
ATOM   487  N NE  . ARG A 1 72  ? 19.944  -3.790  -1.722  1.00 34.46 ? 116 ARG A NE  1 
ATOM   488  C CZ  . ARG A 1 72  ? 20.358  -2.939  -0.810  1.00 32.73 ? 116 ARG A CZ  1 
ATOM   489  N NH1 . ARG A 1 72  ? 19.973  -2.990  0.457   1.00 33.18 ? 116 ARG A NH1 1 
ATOM   490  N NH2 . ARG A 1 72  ? 21.171  -1.997  -1.241  1.00 28.25 ? 116 ARG A NH2 1 
ATOM   491  N N   . LEU A 1 73  ? 18.582  -9.437  -4.355  1.00 24.41 ? 117 LEU A N   1 
ATOM   492  C CA  . LEU A 1 73  ? 19.115  -10.752 -4.600  1.00 26.53 ? 117 LEU A CA  1 
ATOM   493  C C   . LEU A 1 73  ? 20.520  -10.426 -4.822  1.00 26.41 ? 117 LEU A C   1 
ATOM   494  O O   . LEU A 1 73  ? 20.771  -9.418  -5.476  1.00 24.63 ? 117 LEU A O   1 
ATOM   495  C CB  . LEU A 1 73  ? 18.551  -11.278 -5.894  1.00 28.39 ? 117 LEU A CB  1 
ATOM   496  C CG  . LEU A 1 73  ? 18.067  -12.693 -6.229  1.00 31.43 ? 117 LEU A CG  1 
ATOM   497  C CD1 . LEU A 1 73  ? 18.365  -12.963 -7.693  1.00 30.01 ? 117 LEU A CD1 1 
ATOM   498  C CD2 . LEU A 1 73  ? 18.458  -13.873 -5.269  1.00 29.21 ? 117 LEU A CD2 1 
ATOM   499  N N   . TYR A 1 74  ? 21.417  -11.279 -4.301  1.00 26.26 ? 118 TYR A N   1 
ATOM   500  C CA  . TYR A 1 74  ? 22.847  -11.080 -4.456  1.00 28.42 ? 118 TYR A CA  1 
ATOM   501  C C   . TYR A 1 74  ? 23.489  -12.289 -5.065  1.00 28.47 ? 118 TYR A C   1 
ATOM   502  O O   . TYR A 1 74  ? 23.062  -13.410 -4.784  1.00 28.43 ? 118 TYR A O   1 
ATOM   503  C CB  . TYR A 1 74  ? 23.553  -10.868 -3.090  1.00 28.43 ? 118 TYR A CB  1 
ATOM   504  C CG  . TYR A 1 74  ? 23.397  -9.483  -2.591  1.00 30.17 ? 118 TYR A CG  1 
ATOM   505  C CD1 . TYR A 1 74  ? 22.251  -9.099  -1.851  1.00 26.35 ? 118 TYR A CD1 1 
ATOM   506  C CD2 . TYR A 1 74  ? 24.345  -8.535  -2.873  1.00 28.81 ? 118 TYR A CD2 1 
ATOM   507  C CE1 . TYR A 1 74  ? 22.126  -7.796  -1.407  1.00 27.05 ? 118 TYR A CE1 1 
ATOM   508  C CE2 . TYR A 1 74  ? 24.209  -7.247  -2.460  1.00 25.62 ? 118 TYR A CE2 1 
ATOM   509  C CZ  . TYR A 1 74  ? 23.097  -6.878  -1.761  1.00 29.54 ? 118 TYR A CZ  1 
ATOM   510  O OH  . TYR A 1 74  ? 23.008  -5.563  -1.320  1.00 31.96 ? 118 TYR A OH  1 
ATOM   511  N N   . LYS A 1 75  ? 24.512  -12.025 -5.864  1.00 26.98 ? 119 LYS A N   1 
ATOM   512  C CA  . LYS A 1 75  ? 25.414  -12.997 -6.313  1.00 29.16 ? 119 LYS A CA  1 
ATOM   513  C C   . LYS A 1 75  ? 26.750  -12.534 -5.729  1.00 30.45 ? 119 LYS A C   1 
ATOM   514  O O   . LYS A 1 75  ? 27.301  -11.535 -6.186  1.00 31.09 ? 119 LYS A O   1 
ATOM   515  C CB  . LYS A 1 75  ? 25.524  -13.021 -7.833  1.00 29.90 ? 119 LYS A CB  1 
ATOM   516  C CG  . LYS A 1 75  ? 26.685  -13.876 -8.317  1.00 31.11 ? 119 LYS A CG  1 
ATOM   517  C CD  . LYS A 1 75  ? 26.832  -13.892 -9.833  1.00 38.05 ? 119 LYS A CD  1 
ATOM   518  C CE  . LYS A 1 75  ? 28.305  -14.172 -10.135 1.00 39.06 ? 119 LYS A CE  1 
ATOM   519  N NZ  . LYS A 1 75  ? 28.671  -14.202 -11.587 1.00 40.39 ? 119 LYS A NZ  1 
ATOM   520  N N   . ASN A 1 76  ? 27.260  -13.272 -4.752  1.00 30.17 ? 120 ASN A N   1 
ATOM   521  C CA  . ASN A 1 76  ? 28.436  -12.846 -3.970  1.00 31.69 ? 120 ASN A CA  1 
ATOM   522  C C   . ASN A 1 76  ? 28.109  -11.483 -3.432  1.00 31.66 ? 120 ASN A C   1 
ATOM   523  O O   . ASN A 1 76  ? 27.096  -11.342 -2.778  1.00 31.79 ? 120 ASN A O   1 
ATOM   524  C CB  . ASN A 1 76  ? 29.770  -12.937 -4.773  1.00 30.50 ? 120 ASN A CB  1 
ATOM   525  C CG  . ASN A 1 76  ? 30.035  -14.347 -5.322  1.00 28.49 ? 120 ASN A CG  1 
ATOM   526  O OD1 . ASN A 1 76  ? 30.373  -14.546 -6.493  1.00 30.15 ? 120 ASN A OD1 1 
ATOM   527  N ND2 . ASN A 1 76  ? 29.810  -15.307 -4.505  1.00 24.40 ? 120 ASN A ND2 1 
ATOM   528  N N   . LYS A 1 77  ? 28.904  -10.473 -3.746  1.00 33.07 ? 121 LYS A N   1 
ATOM   529  C CA  . LYS A 1 77  ? 28.738  -9.140  -3.105  1.00 34.73 ? 121 LYS A CA  1 
ATOM   530  C C   . LYS A 1 77  ? 28.095  -8.210  -4.083  1.00 33.57 ? 121 LYS A C   1 
ATOM   531  O O   . LYS A 1 77  ? 27.928  -7.022  -3.817  1.00 34.90 ? 121 LYS A O   1 
ATOM   532  C CB  . LYS A 1 77  ? 30.088  -8.625  -2.587  1.00 33.56 ? 121 LYS A CB  1 
ATOM   533  C CG  . LYS A 1 77  ? 30.553  -9.432  -1.369  1.00 37.26 ? 121 LYS A CG  1 
ATOM   534  C CD  . LYS A 1 77  ? 31.953  -9.029  -0.826  1.00 39.18 ? 121 LYS A CD  1 
ATOM   535  C CE  . LYS A 1 77  ? 33.217  -9.709  -1.462  1.00 45.86 ? 121 LYS A CE  1 
ATOM   536  N NZ  . LYS A 1 77  ? 34.007  -10.611 -0.505  1.00 47.38 ? 121 LYS A NZ  1 
ATOM   537  N N   . ASP A 1 78  ? 27.718  -8.760  -5.232  1.00 33.86 ? 122 ASP A N   1 
ATOM   538  C CA  . ASP A 1 78  ? 26.947  -8.003  -6.208  1.00 33.92 ? 122 ASP A CA  1 
ATOM   539  C C   . ASP A 1 78  ? 25.426  -8.165  -6.170  1.00 33.98 ? 122 ASP A C   1 
ATOM   540  O O   . ASP A 1 78  ? 24.898  -9.291  -6.234  1.00 31.43 ? 122 ASP A O   1 
ATOM   541  C CB  . ASP A 1 78  ? 27.476  -8.301  -7.580  1.00 35.68 ? 122 ASP A CB  1 
ATOM   542  C CG  . ASP A 1 78  ? 28.995  -8.084  -7.638  1.00 39.32 ? 122 ASP A CG  1 
ATOM   543  O OD1 . ASP A 1 78  ? 29.450  -6.953  -7.298  1.00 38.30 ? 122 ASP A OD1 1 
ATOM   544  O OD2 . ASP A 1 78  ? 29.689  -9.083  -7.892  1.00 40.67 ? 122 ASP A OD2 1 
ATOM   545  N N   . MET A 1 79  ? 24.761  -7.011  -6.075  1.00 33.00 ? 123 MET A N   1 
ATOM   546  C CA  . MET A 1 79  ? 23.341  -6.914  -6.219  1.00 33.95 ? 123 MET A CA  1 
ATOM   547  C C   . MET A 1 79  ? 22.979  -7.254  -7.668  1.00 33.39 ? 123 MET A C   1 
ATOM   548  O O   . MET A 1 79  ? 23.460  -6.587  -8.556  1.00 34.93 ? 123 MET A O   1 
ATOM   549  C CB  . MET A 1 79  ? 22.891  -5.466  -5.873  1.00 35.67 ? 123 MET A CB  1 
ATOM   550  C CG  . MET A 1 79  ? 21.358  -5.274  -5.713  1.00 34.38 ? 123 MET A CG  1 
ATOM   551  S SD  . MET A 1 79  ? 20.728  -4.886  -7.325  1.00 44.71 ? 123 MET A SD  1 
ATOM   552  C CE  . MET A 1 79  ? 21.252  -3.127  -7.495  1.00 36.56 ? 123 MET A CE  1 
ATOM   553  N N   . ILE A 1 80  ? 22.137  -8.271  -7.890  1.00 31.00 ? 124 ILE A N   1 
ATOM   554  C CA  . ILE A 1 80  ? 21.655  -8.641  -9.222  1.00 29.60 ? 124 ILE A CA  1 
ATOM   555  C C   . ILE A 1 80  ? 20.142  -8.406  -9.423  1.00 29.55 ? 124 ILE A C   1 
ATOM   556  O O   . ILE A 1 80  ? 19.645  -8.425  -10.541 1.00 31.37 ? 124 ILE A O   1 
ATOM   557  C CB  . ILE A 1 80  ? 22.032  -10.099 -9.624  1.00 29.75 ? 124 ILE A CB  1 
ATOM   558  C CG1 . ILE A 1 80  ? 21.591  -11.082 -8.573  1.00 25.05 ? 124 ILE A CG1 1 
ATOM   559  C CG2 . ILE A 1 80  ? 23.521  -10.185 -9.778  1.00 28.93 ? 124 ILE A CG2 1 
ATOM   560  C CD1 . ILE A 1 80  ? 21.597  -12.551 -9.012  1.00 27.35 ? 124 ILE A CD1 1 
ATOM   561  N N   . GLN A 1 81  ? 19.421  -8.123  -8.345  1.00 30.26 ? 125 GLN A N   1 
ATOM   562  C CA  . GLN A 1 81  ? 18.063  -7.697  -8.505  1.00 30.00 ? 125 GLN A CA  1 
ATOM   563  C C   . GLN A 1 81  ? 17.630  -6.952  -7.280  1.00 28.78 ? 125 GLN A C   1 
ATOM   564  O O   . GLN A 1 81  ? 18.005  -7.306  -6.156  1.00 29.83 ? 125 GLN A O   1 
ATOM   565  C CB  . GLN A 1 81  ? 17.142  -8.858  -8.843  1.00 29.54 ? 125 GLN A CB  1 
ATOM   566  C CG  . GLN A 1 81  ? 15.828  -8.350  -9.312  1.00 31.98 ? 125 GLN A CG  1 
ATOM   567  C CD  . GLN A 1 81  ? 14.817  -9.440  -9.601  1.00 36.79 ? 125 GLN A CD  1 
ATOM   568  O OE1 . GLN A 1 81  ? 13.657  -9.139  -9.860  1.00 37.00 ? 125 GLN A OE1 1 
ATOM   569  N NE2 . GLN A 1 81  ? 15.236  -10.706 -9.531  1.00 31.95 ? 125 GLN A NE2 1 
ATOM   570  N N   . THR A 1 82  ? 16.897  -5.869  -7.484  1.00 29.35 ? 126 THR A N   1 
ATOM   571  C CA  . THR A 1 82  ? 16.527  -4.979  -6.350  1.00 29.63 ? 126 THR A CA  1 
ATOM   572  C C   . THR A 1 82  ? 15.040  -4.768  -6.469  1.00 28.65 ? 126 THR A C   1 
ATOM   573  O O   . THR A 1 82  ? 14.530  -4.576  -7.612  1.00 27.56 ? 126 THR A O   1 
ATOM   574  C CB  . THR A 1 82  ? 17.269  -3.583  -6.347  1.00 30.68 ? 126 THR A CB  1 
ATOM   575  O OG1 . THR A 1 82  ? 16.553  -2.623  -5.534  1.00 30.14 ? 126 THR A OG1 1 
ATOM   576  C CG2 . THR A 1 82  ? 17.325  -2.979  -7.731  1.00 32.56 ? 126 THR A CG2 1 
ATOM   577  N N   . LEU A 1 83  ? 14.361  -4.747  -5.315  1.00 27.95 ? 127 LEU A N   1 
ATOM   578  C CA  . LEU A 1 83  ? 12.903  -4.623  -5.260  1.00 28.27 ? 127 LEU A CA  1 
ATOM   579  C C   . LEU A 1 83  ? 12.608  -3.526  -4.250  1.00 29.06 ? 127 LEU A C   1 
ATOM   580  O O   . LEU A 1 83  ? 12.964  -3.668  -3.109  1.00 30.64 ? 127 LEU A O   1 
ATOM   581  C CB  . LEU A 1 83  ? 12.212  -5.946  -4.807  1.00 29.92 ? 127 LEU A CB  1 
ATOM   582  C CG  . LEU A 1 83  ? 12.129  -7.253  -5.603  1.00 32.85 ? 127 LEU A CG  1 
ATOM   583  C CD1 . LEU A 1 83  ? 11.173  -8.269  -5.080  1.00 40.60 ? 127 LEU A CD1 1 
ATOM   584  C CD2 . LEU A 1 83  ? 11.678  -7.029  -6.979  1.00 37.54 ? 127 LEU A CD2 1 
ATOM   585  N N   . THR A 1 84  ? 11.958  -2.434  -4.650  1.00 28.07 ? 128 THR A N   1 
ATOM   586  C CA  . THR A 1 84  ? 11.573  -1.426  -3.701  1.00 29.42 ? 128 THR A CA  1 
ATOM   587  C C   . THR A 1 84  ? 10.070  -1.106  -3.686  1.00 28.13 ? 128 THR A C   1 
ATOM   588  O O   . THR A 1 84  ? 9.653   -0.146  -3.060  1.00 27.07 ? 128 THR A O   1 
ATOM   589  C CB  . THR A 1 84  ? 12.268  -0.069  -4.057  1.00 30.57 ? 128 THR A CB  1 
ATOM   590  O OG1 . THR A 1 84  ? 11.960  0.186   -5.415  1.00 34.20 ? 128 THR A OG1 1 
ATOM   591  C CG2 . THR A 1 84  ? 13.844  -0.162  -3.996  1.00 33.09 ? 128 THR A CG2 1 
ATOM   592  N N   . ASN A 1 85  ? 9.264   -1.800  -4.478  1.00 28.51 ? 129 ASN A N   1 
ATOM   593  C CA  . ASN A 1 85  ? 7.819   -1.608  -4.447  1.00 27.20 ? 129 ASN A CA  1 
ATOM   594  C C   . ASN A 1 85  ? 7.193   -2.610  -3.467  1.00 26.84 ? 129 ASN A C   1 
ATOM   595  O O   . ASN A 1 85  ? 7.268   -3.814  -3.647  1.00 28.44 ? 129 ASN A O   1 
ATOM   596  C CB  . ASN A 1 85  ? 7.303   -1.739  -5.855  1.00 26.71 ? 129 ASN A CB  1 
ATOM   597  C CG  . ASN A 1 85  ? 5.786   -1.515  -5.995  1.00 30.24 ? 129 ASN A CG  1 
ATOM   598  O OD1 . ASN A 1 85  ? 5.330   -1.178  -7.097  1.00 34.02 ? 129 ASN A OD1 1 
ATOM   599  N ND2 . ASN A 1 85  ? 4.997   -1.797  -4.942  1.00 28.30 ? 129 ASN A ND2 1 
ATOM   600  N N   . LYS A 1 86  ? 6.624   -2.107  -2.400  1.00 28.40 ? 130 LYS A N   1 
ATOM   601  C CA  . LYS A 1 86  ? 6.057   -2.946  -1.358  1.00 29.07 ? 130 LYS A CA  1 
ATOM   602  C C   . LYS A 1 86  ? 4.552   -3.344  -1.541  1.00 29.36 ? 130 LYS A C   1 
ATOM   603  O O   . LYS A 1 86  ? 3.920   -4.028  -0.655  1.00 27.21 ? 130 LYS A O   1 
ATOM   604  C CB  . LYS A 1 86  ? 6.330   -2.313  -0.011  1.00 29.11 ? 130 LYS A CB  1 
ATOM   605  C CG  . LYS A 1 86  ? 5.272   -1.361  0.477   1.00 31.82 ? 130 LYS A CG  1 
ATOM   606  C CD  . LYS A 1 86  ? 5.709   -0.680  1.719   1.00 29.47 ? 130 LYS A CD  1 
ATOM   607  C CE  . LYS A 1 86  ? 4.865   0.589   1.948   1.00 39.74 ? 130 LYS A CE  1 
ATOM   608  N NZ  . LYS A 1 86  ? 5.242   1.143   3.301   1.00 45.12 ? 130 LYS A NZ  1 
ATOM   609  N N   . SER A 1 87  ? 3.994   -2.926  -2.675  1.00 29.14 ? 131 SER A N   1 
ATOM   610  C CA  . SER A 1 87  ? 2.574   -3.098  -2.875  1.00 29.47 ? 131 SER A CA  1 
ATOM   611  C C   . SER A 1 87  ? 2.252   -4.387  -3.686  1.00 30.33 ? 131 SER A C   1 
ATOM   612  O O   . SER A 1 87  ? 1.099   -4.849  -3.667  1.00 30.15 ? 131 SER A O   1 
ATOM   613  C CB  . SER A 1 87  ? 1.925   -1.827  -3.390  1.00 28.86 ? 131 SER A CB  1 
ATOM   614  O OG  . SER A 1 87  ? 2.153   -1.629  -4.783  1.00 33.39 ? 131 SER A OG  1 
ATOM   615  N N   . LYS A 1 88  ? 3.242   -4.981  -4.353  1.00 29.28 ? 132 LYS A N   1 
ATOM   616  C CA  . LYS A 1 88  ? 2.930   -6.214  -5.122  1.00 30.54 ? 132 LYS A CA  1 
ATOM   617  C C   . LYS A 1 88  ? 3.903   -7.380  -4.958  1.00 29.86 ? 132 LYS A C   1 
ATOM   618  O O   . LYS A 1 88  ? 5.034   -7.206  -4.600  1.00 30.66 ? 132 LYS A O   1 
ATOM   619  C CB  . LYS A 1 88  ? 2.641   -5.903  -6.605  1.00 30.85 ? 132 LYS A CB  1 
ATOM   620  C CG  . LYS A 1 88  ? 3.744   -5.232  -7.282  1.00 32.70 ? 132 LYS A CG  1 
ATOM   621  C CD  . LYS A 1 88  ? 3.325   -4.703  -8.631  1.00 37.87 ? 132 LYS A CD  1 
ATOM   622  C CE  . LYS A 1 88  ? 4.604   -4.656  -9.506  1.00 41.12 ? 132 LYS A CE  1 
ATOM   623  N NZ  . LYS A 1 88  ? 4.435   -4.280  -10.964 1.00 44.39 ? 132 LYS A NZ  1 
ATOM   624  N N   . ILE A 1 89  ? 3.406   -8.578  -5.214  1.00 29.98 ? 133 ILE A N   1 
ATOM   625  C CA  . ILE A 1 89  ? 4.144   -9.792  -5.174  1.00 29.58 ? 133 ILE A CA  1 
ATOM   626  C C   . ILE A 1 89  ? 4.894   -9.888  -6.520  1.00 29.12 ? 133 ILE A C   1 
ATOM   627  O O   . ILE A 1 89  ? 4.299   -9.752  -7.587  1.00 28.11 ? 133 ILE A O   1 
ATOM   628  C CB  . ILE A 1 89  ? 3.146   -10.987 -5.010  1.00 30.29 ? 133 ILE A CB  1 
ATOM   629  C CG1 . ILE A 1 89  ? 2.436   -10.899 -3.683  1.00 29.82 ? 133 ILE A CG1 1 
ATOM   630  C CG2 . ILE A 1 89  ? 3.841   -12.245 -5.007  1.00 31.95 ? 133 ILE A CG2 1 
ATOM   631  C CD1 . ILE A 1 89  ? 1.470   -12.100 -3.388  1.00 28.99 ? 133 ILE A CD1 1 
ATOM   632  N N   . GLN A 1 90  ? 6.210   -10.039 -6.438  1.00 27.61 ? 134 GLN A N   1 
ATOM   633  C CA  . GLN A 1 90  ? 7.111   -9.902  -7.592  1.00 28.45 ? 134 GLN A CA  1 
ATOM   634  C C   . GLN A 1 90  ? 7.931   -11.189 -7.679  1.00 26.31 ? 134 GLN A C   1 
ATOM   635  O O   . GLN A 1 90  ? 8.365   -11.724 -6.685  1.00 23.26 ? 134 GLN A O   1 
ATOM   636  C CB  . GLN A 1 90  ? 8.032   -8.661  -7.426  1.00 28.95 ? 134 GLN A CB  1 
ATOM   637  C CG  . GLN A 1 90  ? 7.151   -7.346  -7.226  1.00 31.65 ? 134 GLN A CG  1 
ATOM   638  C CD  . GLN A 1 90  ? 7.887   -6.170  -6.526  1.00 33.59 ? 134 GLN A CD  1 
ATOM   639  O OE1 . GLN A 1 90  ? 8.735   -5.511  -7.151  1.00 38.54 ? 134 GLN A OE1 1 
ATOM   640  N NE2 . GLN A 1 90  ? 7.490   -5.849  -5.273  1.00 33.08 ? 134 GLN A NE2 1 
ATOM   641  N N   . ASN A 1 91  ? 8.031   -11.696 -8.876  1.00 25.39 ? 135 ASN A N   1 
ATOM   642  C CA  . ASN A 1 91  ? 9.099   -12.657 -9.231  1.00 27.20 ? 135 ASN A CA  1 
ATOM   643  C C   . ASN A 1 91  ? 10.533  -12.188 -9.068  1.00 27.38 ? 135 ASN A C   1 
ATOM   644  O O   . ASN A 1 91  ? 10.852  -11.029 -9.292  1.00 28.38 ? 135 ASN A O   1 
ATOM   645  C CB  . ASN A 1 91  ? 8.892   -13.140 -10.676 1.00 27.90 ? 135 ASN A CB  1 
ATOM   646  C CG  . ASN A 1 91  ? 7.771   -14.099 -10.775 1.00 30.01 ? 135 ASN A CG  1 
ATOM   647  O OD1 . ASN A 1 91  ? 6.890   -14.115 -9.876  1.00 30.84 ? 135 ASN A OD1 1 
ATOM   648  N ND2 . ASN A 1 91  ? 7.814   -15.007 -11.812 1.00 35.93 ? 135 ASN A ND2 1 
ATOM   649  N N   . VAL A 1 92  ? 11.397  -13.101 -8.650  1.00 29.89 ? 136 VAL A N   1 
ATOM   650  C CA  . VAL A 1 92  ? 12.853  -12.839 -8.644  1.00 28.87 ? 136 VAL A CA  1 
ATOM   651  C C   . VAL A 1 92  ? 13.589  -13.851 -9.467  1.00 29.48 ? 136 VAL A C   1 
ATOM   652  O O   . VAL A 1 92  ? 13.022  -14.909 -9.713  1.00 31.35 ? 136 VAL A O   1 
ATOM   653  C CB  . VAL A 1 92  ? 13.429  -12.747 -7.200  1.00 30.83 ? 136 VAL A CB  1 
ATOM   654  C CG1 . VAL A 1 92  ? 12.765  -11.508 -6.492  1.00 31.21 ? 136 VAL A CG1 1 
ATOM   655  C CG2 . VAL A 1 92  ? 13.242  -14.008 -6.337  1.00 24.57 ? 136 VAL A CG2 1 
ATOM   656  N N   . GLY A 1 93  ? 14.845  -13.555 -9.843  1.00 28.47 ? 137 GLY A N   1 
ATOM   657  C CA  . GLY A 1 93  ? 15.743  -14.486 -10.502 1.00 28.50 ? 137 GLY A CA  1 
ATOM   658  C C   . GLY A 1 93  ? 16.107  -14.109 -11.942 1.00 27.91 ? 137 GLY A C   1 
ATOM   659  O O   . GLY A 1 93  ? 16.007  -12.949 -12.362 1.00 32.07 ? 137 GLY A O   1 
ATOM   660  N N   . GLY A 1 94  ? 16.504  -15.086 -12.705 1.00 26.27 ? 138 GLY A N   1 
ATOM   661  C CA  . GLY A 1 94  ? 17.063  -14.891 -13.999 1.00 26.05 ? 138 GLY A CA  1 
ATOM   662  C C   . GLY A 1 94  ? 17.948  -16.093 -14.261 1.00 25.93 ? 138 GLY A C   1 
ATOM   663  O O   . GLY A 1 94  ? 18.002  -17.002 -13.416 1.00 25.28 ? 138 GLY A O   1 
ATOM   664  N N   . THR A 1 95  ? 18.627  -16.097 -15.406 1.00 24.93 ? 139 THR A N   1 
ATOM   665  C CA  . THR A 1 95  ? 19.559  -17.168 -15.779 1.00 26.98 ? 139 THR A CA  1 
ATOM   666  C C   . THR A 1 95  ? 20.937  -16.628 -15.715 1.00 25.95 ? 139 THR A C   1 
ATOM   667  O O   . THR A 1 95  ? 21.184  -15.529 -16.224 1.00 26.21 ? 139 THR A O   1 
ATOM   668  C CB  . THR A 1 95  ? 19.195  -17.690 -17.151 1.00 26.49 ? 139 THR A CB  1 
ATOM   669  O OG1 . THR A 1 95  ? 17.967  -18.352 -16.938 1.00 32.35 ? 139 THR A OG1 1 
ATOM   670  C CG2 . THR A 1 95  ? 20.163  -18.792 -17.676 1.00 28.46 ? 139 THR A CG2 1 
ATOM   671  N N   . TYR A 1 96  ? 21.814  -17.375 -15.035 1.00 25.85 ? 140 TYR A N   1 
ATOM   672  C CA  . TYR A 1 96  ? 23.155  -16.956 -14.739 1.00 26.57 ? 140 TYR A CA  1 
ATOM   673  C C   . TYR A 1 96  ? 24.196  -18.101 -14.912 1.00 28.50 ? 140 TYR A C   1 
ATOM   674  O O   . TYR A 1 96  ? 23.932  -19.245 -14.551 1.00 26.08 ? 140 TYR A O   1 
ATOM   675  C CB  . TYR A 1 96  ? 23.232  -16.480 -13.301 1.00 27.32 ? 140 TYR A CB  1 
ATOM   676  C CG  . TYR A 1 96  ? 22.350  -15.279 -13.006 1.00 27.85 ? 140 TYR A CG  1 
ATOM   677  C CD1 . TYR A 1 96  ? 21.044  -15.453 -12.595 1.00 28.23 ? 140 TYR A CD1 1 
ATOM   678  C CD2 . TYR A 1 96  ? 22.810  -14.015 -13.202 1.00 30.41 ? 140 TYR A CD2 1 
ATOM   679  C CE1 . TYR A 1 96  ? 20.229  -14.374 -12.347 1.00 31.46 ? 140 TYR A CE1 1 
ATOM   680  C CE2 . TYR A 1 96  ? 21.960  -12.869 -12.960 1.00 30.66 ? 140 TYR A CE2 1 
ATOM   681  C CZ  . TYR A 1 96  ? 20.705  -13.094 -12.552 1.00 28.57 ? 140 TYR A CZ  1 
ATOM   682  O OH  . TYR A 1 96  ? 19.880  -12.060 -12.276 1.00 34.99 ? 140 TYR A OH  1 
ATOM   683  N N   . GLU A 1 97  ? 25.373  -17.741 -15.447 1.00 28.35 ? 141 GLU A N   1 
ATOM   684  C CA  . GLU A 1 97  ? 26.589  -18.577 -15.293 1.00 32.87 ? 141 GLU A CA  1 
ATOM   685  C C   . GLU A 1 97  ? 27.186  -18.499 -13.932 1.00 29.46 ? 141 GLU A C   1 
ATOM   686  O O   . GLU A 1 97  ? 27.528  -17.454 -13.476 1.00 29.80 ? 141 GLU A O   1 
ATOM   687  C CB  . GLU A 1 97  ? 27.679  -18.249 -16.345 1.00 31.17 ? 141 GLU A CB  1 
ATOM   688  C CG  . GLU A 1 97  ? 27.331  -19.007 -17.665 1.00 39.21 ? 141 GLU A CG  1 
ATOM   689  C CD  . GLU A 1 97  ? 28.304  -18.720 -18.831 1.00 41.24 ? 141 GLU A CD  1 
ATOM   690  O OE1 . GLU A 1 97  ? 28.408  -19.587 -19.751 1.00 52.11 ? 141 GLU A OE1 1 
ATOM   691  O OE2 . GLU A 1 97  ? 28.943  -17.627 -18.820 1.00 50.29 ? 141 GLU A OE2 1 
ATOM   692  N N   . LEU A 1 98  ? 27.350  -19.634 -13.281 1.00 29.62 ? 142 LEU A N   1 
ATOM   693  C CA  . LEU A 1 98  ? 27.681  -19.602 -11.871 1.00 28.57 ? 142 LEU A CA  1 
ATOM   694  C C   . LEU A 1 98  ? 28.863  -20.580 -11.619 1.00 30.15 ? 142 LEU A C   1 
ATOM   695  O O   . LEU A 1 98  ? 29.032  -21.549 -12.352 1.00 28.44 ? 142 LEU A O   1 
ATOM   696  C CB  . LEU A 1 98  ? 26.402  -19.906 -11.058 1.00 28.30 ? 142 LEU A CB  1 
ATOM   697  C CG  . LEU A 1 98  ? 25.195  -18.939 -10.996 1.00 24.84 ? 142 LEU A CG  1 
ATOM   698  C CD1 . LEU A 1 98  ? 24.302  -19.473 -9.904  1.00 19.98 ? 142 LEU A CD1 1 
ATOM   699  C CD2 . LEU A 1 98  ? 25.633  -17.451 -10.653 1.00 17.56 ? 142 LEU A CD2 1 
ATOM   700  N N   . HIS A 1 99  ? 29.706  -20.280 -10.631 1.00 30.22 ? 143 HIS A N   1 
ATOM   701  C CA  . HIS A 1 99  ? 30.961  -21.028 -10.444 1.00 29.38 ? 143 HIS A CA  1 
ATOM   702  C C   . HIS A 1 99  ? 31.089  -21.459 -9.054  1.00 28.79 ? 143 HIS A C   1 
ATOM   703  O O   . HIS A 1 99  ? 30.445  -20.866 -8.224  1.00 27.62 ? 143 HIS A O   1 
ATOM   704  C CB  . HIS A 1 99  ? 32.149  -20.155 -10.795 1.00 29.27 ? 143 HIS A CB  1 
ATOM   705  C CG  . HIS A 1 99  ? 32.190  -19.848 -12.252 1.00 32.94 ? 143 HIS A CG  1 
ATOM   706  N ND1 . HIS A 1 99  ? 31.844  -18.624 -12.765 1.00 28.61 ? 143 HIS A ND1 1 
ATOM   707  C CD2 . HIS A 1 99  ? 32.452  -20.653 -13.317 1.00 32.39 ? 143 HIS A CD2 1 
ATOM   708  C CE1 . HIS A 1 99  ? 31.943  -18.665 -14.080 1.00 31.21 ? 143 HIS A CE1 1 
ATOM   709  N NE2 . HIS A 1 99  ? 32.333  -19.879 -14.434 1.00 36.03 ? 143 HIS A NE2 1 
ATOM   710  N N   . VAL A 1 100 ? 31.908  -22.503 -8.823  1.00 27.82 ? 144 VAL A N   1 
ATOM   711  C CA  . VAL A 1 100 ? 32.083  -23.078 -7.512  1.00 26.48 ? 144 VAL A CA  1 
ATOM   712  C C   . VAL A 1 100 ? 32.453  -21.965 -6.574  1.00 26.54 ? 144 VAL A C   1 
ATOM   713  O O   . VAL A 1 100 ? 33.216  -21.066 -6.948  1.00 27.80 ? 144 VAL A O   1 
ATOM   714  C CB  . VAL A 1 100 ? 33.205  -24.163 -7.492  1.00 28.27 ? 144 VAL A CB  1 
ATOM   715  C CG1 . VAL A 1 100 ? 33.143  -24.920 -6.214  1.00 24.40 ? 144 VAL A CG1 1 
ATOM   716  C CG2 . VAL A 1 100 ? 33.027  -25.106 -8.658  1.00 24.24 ? 144 VAL A CG2 1 
ATOM   717  N N   . GLY A 1 101 ? 31.864  -22.006 -5.374  1.00 26.03 ? 145 GLY A N   1 
ATOM   718  C CA  . GLY A 1 101 ? 31.994  -20.951 -4.377  1.00 25.46 ? 145 GLY A CA  1 
ATOM   719  C C   . GLY A 1 101 ? 31.115  -19.738 -4.612  1.00 26.00 ? 145 GLY A C   1 
ATOM   720  O O   . GLY A 1 101 ? 31.036  -18.940 -3.724  1.00 27.17 ? 145 GLY A O   1 
ATOM   721  N N   . ASP A 1 102 ? 30.420  -19.566 -5.753  1.00 25.52 ? 146 ASP A N   1 
ATOM   722  C CA  . ASP A 1 102 ? 29.506  -18.384 -5.867  1.00 26.36 ? 146 ASP A CA  1 
ATOM   723  C C   . ASP A 1 102 ? 28.422  -18.575 -4.806  1.00 24.83 ? 146 ASP A C   1 
ATOM   724  O O   . ASP A 1 102 ? 27.970  -19.715 -4.533  1.00 22.40 ? 146 ASP A O   1 
ATOM   725  C CB  . ASP A 1 102 ? 28.853  -18.234 -7.266  1.00 25.47 ? 146 ASP A CB  1 
ATOM   726  C CG  . ASP A 1 102 ? 29.840  -17.761 -8.304  1.00 30.24 ? 146 ASP A CG  1 
ATOM   727  O OD1 . ASP A 1 102 ? 30.880  -17.180 -7.841  1.00 30.55 ? 146 ASP A OD1 1 
ATOM   728  O OD2 . ASP A 1 102 ? 29.611  -18.002 -9.558  1.00 23.55 ? 146 ASP A OD2 1 
ATOM   729  N N   . THR A 1 103 ? 28.025  -17.478 -4.172  1.00 23.99 ? 147 THR A N   1 
ATOM   730  C CA  . THR A 1 103 ? 26.835  -17.580 -3.375  1.00 25.65 ? 147 THR A CA  1 
ATOM   731  C C   . THR A 1 103 ? 25.696  -16.718 -3.993  1.00 26.44 ? 147 THR A C   1 
ATOM   732  O O   . THR A 1 103 ? 25.934  -15.725 -4.685  1.00 28.13 ? 147 THR A O   1 
ATOM   733  C CB  . THR A 1 103 ? 27.077  -17.221 -1.904  1.00 24.57 ? 147 THR A CB  1 
ATOM   734  O OG1 . THR A 1 103 ? 27.544  -15.882 -1.844  1.00 23.48 ? 147 THR A OG1 1 
ATOM   735  C CG2 . THR A 1 103 ? 28.131  -18.171 -1.225  1.00 21.72 ? 147 THR A CG2 1 
ATOM   736  N N   . ILE A 1 104 ? 24.474  -17.116 -3.662  1.00 27.28 ? 148 ILE A N   1 
ATOM   737  C CA  . ILE A 1 104 ? 23.257  -16.407 -4.007  1.00 23.73 ? 148 ILE A CA  1 
ATOM   738  C C   . ILE A 1 104 ? 22.516  -16.232 -2.711  1.00 25.25 ? 148 ILE A C   1 
ATOM   739  O O   . ILE A 1 104 ? 22.439  -17.131 -1.903  1.00 23.59 ? 148 ILE A O   1 
ATOM   740  C CB  . ILE A 1 104 ? 22.428  -17.119 -5.076  1.00 25.47 ? 148 ILE A CB  1 
ATOM   741  C CG1 . ILE A 1 104 ? 23.107  -16.919 -6.470  1.00 27.32 ? 148 ILE A CG1 1 
ATOM   742  C CG2 . ILE A 1 104 ? 21.002  -16.370 -5.228  1.00 21.04 ? 148 ILE A CG2 1 
ATOM   743  C CD1 . ILE A 1 104 ? 24.084  -17.961 -6.746  1.00 38.46 ? 148 ILE A CD1 1 
ATOM   744  N N   . ASP A 1 105 ? 22.078  -15.000 -2.457  1.00 24.57 ? 149 ASP A N   1 
ATOM   745  C CA  . ASP A 1 105 ? 21.443  -14.726 -1.220  1.00 25.28 ? 149 ASP A CA  1 
ATOM   746  C C   . ASP A 1 105 ? 20.304  -13.751 -1.499  1.00 23.73 ? 149 ASP A C   1 
ATOM   747  O O   . ASP A 1 105 ? 20.414  -12.892 -2.351  1.00 23.01 ? 149 ASP A O   1 
ATOM   748  C CB  . ASP A 1 105 ? 22.487  -14.048 -0.299  1.00 26.47 ? 149 ASP A CB  1 
ATOM   749  C CG  . ASP A 1 105 ? 22.009  -13.943 1.111   1.00 29.45 ? 149 ASP A CG  1 
ATOM   750  O OD1 . ASP A 1 105 ? 22.794  -13.447 1.958   1.00 33.31 ? 149 ASP A OD1 1 
ATOM   751  O OD2 . ASP A 1 105 ? 20.845  -14.424 1.397   1.00 32.07 ? 149 ASP A OD2 1 
ATOM   752  N N   . LEU A 1 106 ? 19.266  -13.814 -0.681  1.00 23.89 ? 150 LEU A N   1 
ATOM   753  C CA  . LEU A 1 106 ? 18.115  -12.919 -0.836  1.00 23.57 ? 150 LEU A CA  1 
ATOM   754  C C   . LEU A 1 106 ? 17.982  -12.178 0.473   1.00 24.13 ? 150 LEU A C   1 
ATOM   755  O O   . LEU A 1 106 ? 17.792  -12.783 1.546   1.00 25.79 ? 150 LEU A O   1 
ATOM   756  C CB  . LEU A 1 106 ? 16.835  -13.717 -1.208  1.00 22.95 ? 150 LEU A CB  1 
ATOM   757  C CG  . LEU A 1 106 ? 15.528  -12.884 -1.289  1.00 23.35 ? 150 LEU A CG  1 
ATOM   758  C CD1 . LEU A 1 106 ? 15.599  -12.153 -2.630  1.00 21.04 ? 150 LEU A CD1 1 
ATOM   759  C CD2 . LEU A 1 106 ? 14.185  -13.697 -1.222  1.00 21.96 ? 150 LEU A CD2 1 
ATOM   760  N N   . ILE A 1 107 ? 18.101  -10.861 0.399   1.00 23.98 ? 151 ILE A N   1 
ATOM   761  C CA  . ILE A 1 107 ? 18.351  -10.072 1.585   1.00 23.64 ? 151 ILE A CA  1 
ATOM   762  C C   . ILE A 1 107 ? 17.295  -8.951  1.771   1.00 24.52 ? 151 ILE A C   1 
ATOM   763  O O   . ILE A 1 107 ? 17.121  -8.101  0.882   1.00 24.24 ? 151 ILE A O   1 
ATOM   764  C CB  . ILE A 1 107 ? 19.752  -9.531  1.475   1.00 23.12 ? 151 ILE A CB  1 
ATOM   765  C CG1 . ILE A 1 107 ? 20.773  -10.702 1.822   1.00 26.93 ? 151 ILE A CG1 1 
ATOM   766  C CG2 . ILE A 1 107 ? 20.020  -8.355  2.508   1.00 25.01 ? 151 ILE A CG2 1 
ATOM   767  C CD1 . ILE A 1 107 ? 22.232  -10.223 1.971   1.00 26.04 ? 151 ILE A CD1 1 
ATOM   768  N N   . PHE A 1 108 ? 16.673  -8.930  2.952   1.00 25.39 ? 152 PHE A N   1 
ATOM   769  C CA  . PHE A 1 108 ? 15.613  -7.972  3.325   1.00 25.99 ? 152 PHE A CA  1 
ATOM   770  C C   . PHE A 1 108 ? 16.184  -6.869  4.180   1.00 26.25 ? 152 PHE A C   1 
ATOM   771  O O   . PHE A 1 108 ? 16.906  -7.142  5.134   1.00 27.39 ? 152 PHE A O   1 
ATOM   772  C CB  . PHE A 1 108 ? 14.490  -8.721  4.106   1.00 24.93 ? 152 PHE A CB  1 
ATOM   773  C CG  . PHE A 1 108 ? 14.237  -10.122 3.599   1.00 23.69 ? 152 PHE A CG  1 
ATOM   774  C CD1 . PHE A 1 108 ? 14.529  -11.230 4.381   1.00 24.54 ? 152 PHE A CD1 1 
ATOM   775  C CD2 . PHE A 1 108 ? 13.781  -10.323 2.326   1.00 20.29 ? 152 PHE A CD2 1 
ATOM   776  C CE1 . PHE A 1 108 ? 14.394  -12.527 3.855   1.00 23.88 ? 152 PHE A CE1 1 
ATOM   777  C CE2 . PHE A 1 108 ? 13.639  -11.566 1.774   1.00 23.15 ? 152 PHE A CE2 1 
ATOM   778  C CZ  . PHE A 1 108 ? 13.948  -12.706 2.543   1.00 24.45 ? 152 PHE A CZ  1 
ATOM   779  N N   . ASN A 1 109 ? 15.904  -5.608  3.872   1.00 27.24 ? 153 ASN A N   1 
ATOM   780  C CA  . ASN A 1 109 ? 16.428  -4.488  4.718   1.00 27.15 ? 153 ASN A CA  1 
ATOM   781  C C   . ASN A 1 109 ? 16.067  -4.539  6.223   1.00 27.77 ? 153 ASN A C   1 
ATOM   782  O O   . ASN A 1 109 ? 16.804  -4.039  7.090   1.00 29.74 ? 153 ASN A O   1 
ATOM   783  C CB  . ASN A 1 109 ? 15.961  -3.143  4.130   1.00 27.88 ? 153 ASN A CB  1 
ATOM   784  C CG  . ASN A 1 109 ? 16.934  -2.572  3.159   1.00 26.86 ? 153 ASN A CG  1 
ATOM   785  O OD1 . ASN A 1 109 ? 17.798  -3.276  2.639   1.00 31.34 ? 153 ASN A OD1 1 
ATOM   786  N ND2 . ASN A 1 109 ? 16.784  -1.311  2.878   1.00 22.39 ? 153 ASN A ND2 1 
ATOM   787  N N   . SER A 1 110 ? 14.886  -5.063  6.539   1.00 28.45 ? 154 SER A N   1 
ATOM   788  C CA  . SER A 1 110 ? 14.523  -5.477  7.889   1.00 29.13 ? 154 SER A CA  1 
ATOM   789  C C   . SER A 1 110 ? 13.573  -6.647  7.700   1.00 29.62 ? 154 SER A C   1 
ATOM   790  O O   . SER A 1 110 ? 12.978  -6.770  6.652   1.00 29.79 ? 154 SER A O   1 
ATOM   791  C CB  . SER A 1 110 ? 13.900  -4.351  8.691   1.00 29.14 ? 154 SER A CB  1 
ATOM   792  O OG  . SER A 1 110 ? 12.560  -4.225  8.347   1.00 30.63 ? 154 SER A OG  1 
ATOM   793  N N   . GLU A 1 111 ? 13.498  -7.523  8.703   1.00 32.16 ? 155 GLU A N   1 
ATOM   794  C CA  . GLU A 1 111 ? 12.887  -8.845  8.592   1.00 34.62 ? 155 GLU A CA  1 
ATOM   795  C C   . GLU A 1 111 ? 11.348  -8.866  8.486   1.00 34.24 ? 155 GLU A C   1 
ATOM   796  O O   . GLU A 1 111 ? 10.824  -9.913  8.055   1.00 33.55 ? 155 GLU A O   1 
ATOM   797  C CB  . GLU A 1 111 ? 13.416  -9.839  9.675   1.00 36.34 ? 155 GLU A CB  1 
ATOM   798  C CG  . GLU A 1 111 ? 14.993  -10.131 9.568   1.00 38.00 ? 155 GLU A CG  1 
ATOM   799  C CD  . GLU A 1 111 ? 15.506  -10.453 8.118   1.00 42.59 ? 155 GLU A CD  1 
ATOM   800  O OE1 . GLU A 1 111 ? 16.259  -9.627  7.481   1.00 46.70 ? 155 GLU A OE1 1 
ATOM   801  O OE2 . GLU A 1 111 ? 15.168  -11.537 7.611   1.00 41.37 ? 155 GLU A OE2 1 
ATOM   802  N N   . HIS A 1 112 ? 10.672  -7.736  8.815   1.00 31.17 ? 156 HIS A N   1 
ATOM   803  C CA  . HIS A 1 112 ? 9.229   -7.566  8.569   1.00 31.69 ? 156 HIS A CA  1 
ATOM   804  C C   . HIS A 1 112 ? 8.844   -6.804  7.300   1.00 30.99 ? 156 HIS A C   1 
ATOM   805  O O   . HIS A 1 112 ? 7.678   -6.431  7.111   1.00 30.43 ? 156 HIS A O   1 
ATOM   806  C CB  . HIS A 1 112 ? 8.528   -6.934  9.774   1.00 32.97 ? 156 HIS A CB  1 
ATOM   807  C CG  . HIS A 1 112 ? 8.817   -7.660  11.056  1.00 40.85 ? 156 HIS A CG  1 
ATOM   808  N ND1 . HIS A 1 112 ? 8.991   -9.033  11.098  1.00 48.21 ? 156 HIS A ND1 1 
ATOM   809  C CD2 . HIS A 1 112 ? 8.993   -7.215  12.324  1.00 44.78 ? 156 HIS A CD2 1 
ATOM   810  C CE1 . HIS A 1 112 ? 9.305   -9.395  12.330  1.00 49.98 ? 156 HIS A CE1 1 
ATOM   811  N NE2 . HIS A 1 112 ? 9.302   -8.313  13.093  1.00 50.06 ? 156 HIS A NE2 1 
ATOM   812  N N   . GLN A 1 113 ? 9.817   -6.575  6.426   1.00 29.34 ? 157 GLN A N   1 
ATOM   813  C CA  . GLN A 1 113 ? 9.535   -5.983  5.110   1.00 27.84 ? 157 GLN A CA  1 
ATOM   814  C C   . GLN A 1 113 ? 8.879   -7.034  4.152   1.00 27.30 ? 157 GLN A C   1 
ATOM   815  O O   . GLN A 1 113 ? 8.270   -6.678  3.130   1.00 27.41 ? 157 GLN A O   1 
ATOM   816  C CB  . GLN A 1 113 ? 10.857  -5.459  4.538   1.00 25.92 ? 157 GLN A CB  1 
ATOM   817  C CG  . GLN A 1 113 ? 11.305  -4.185  5.304   1.00 27.44 ? 157 GLN A CG  1 
ATOM   818  C CD  . GLN A 1 113 ? 12.401  -3.383  4.655   1.00 25.44 ? 157 GLN A CD  1 
ATOM   819  O OE1 . GLN A 1 113 ? 12.902  -3.745  3.583   1.00 25.32 ? 157 GLN A OE1 1 
ATOM   820  N NE2 . GLN A 1 113 ? 12.810  -2.308  5.326   1.00 27.86 ? 157 GLN A NE2 1 
ATOM   821  N N   . VAL A 1 114 ? 9.093   -8.307  4.443   1.00 25.94 ? 158 VAL A N   1 
ATOM   822  C CA  . VAL A 1 114 ? 8.513   -9.377  3.634   1.00 26.28 ? 158 VAL A CA  1 
ATOM   823  C C   . VAL A 1 114 ? 7.641   -10.212 4.465   1.00 24.44 ? 158 VAL A C   1 
ATOM   824  O O   . VAL A 1 114 ? 7.843   -10.292 5.646   1.00 22.93 ? 158 VAL A O   1 
ATOM   825  C CB  . VAL A 1 114 ? 9.563   -10.269 2.837   1.00 25.58 ? 158 VAL A CB  1 
ATOM   826  C CG1 . VAL A 1 114 ? 10.369  -9.397  1.922   1.00 28.91 ? 158 VAL A CG1 1 
ATOM   827  C CG2 . VAL A 1 114 ? 10.517  -11.091 3.716   1.00 26.18 ? 158 VAL A CG2 1 
ATOM   828  N N   . LEU A 1 115 ? 6.646   -10.775 3.811   1.00 26.12 ? 159 LEU A N   1 
ATOM   829  C CA  . LEU A 1 115 ? 5.876   -11.867 4.359   1.00 26.31 ? 159 LEU A CA  1 
ATOM   830  C C   . LEU A 1 115 ? 6.566   -13.212 4.001   1.00 27.34 ? 159 LEU A C   1 
ATOM   831  O O   . LEU A 1 115 ? 6.511   -13.625 2.846   1.00 25.20 ? 159 LEU A O   1 
ATOM   832  C CB  . LEU A 1 115 ? 4.443   -11.775 3.802   1.00 26.26 ? 159 LEU A CB  1 
ATOM   833  C CG  . LEU A 1 115 ? 3.729   -10.479 4.183   1.00 27.42 ? 159 LEU A CG  1 
ATOM   834  C CD1 . LEU A 1 115 ? 2.301   -10.420 3.670   1.00 26.06 ? 159 LEU A CD1 1 
ATOM   835  C CD2 . LEU A 1 115 ? 3.694   -10.443 5.696   1.00 24.52 ? 159 LEU A CD2 1 
ATOM   836  N N   . LYS A 1 116 ? 7.191   -13.873 4.992   1.00 26.77 ? 160 LYS A N   1 
ATOM   837  C CA  . LYS A 1 116 ? 7.959   -15.095 4.773   1.00 26.45 ? 160 LYS A CA  1 
ATOM   838  C C   . LYS A 1 116 ? 7.186   -16.341 4.601   1.00 26.54 ? 160 LYS A C   1 
ATOM   839  O O   . LYS A 1 116 ? 7.738   -17.337 4.116   1.00 23.98 ? 160 LYS A O   1 
ATOM   840  C CB  . LYS A 1 116 ? 9.030   -15.295 5.870   1.00 28.45 ? 160 LYS A CB  1 
ATOM   841  C CG  . LYS A 1 116 ? 10.123  -14.266 5.738   1.00 28.90 ? 160 LYS A CG  1 
ATOM   842  C CD  . LYS A 1 116 ? 10.850  -14.069 6.985   1.00 31.75 ? 160 LYS A CD  1 
ATOM   843  C CE  . LYS A 1 116 ? 12.072  -13.242 6.688   1.00 31.81 ? 160 LYS A CE  1 
ATOM   844  N NZ  . LYS A 1 116 ? 13.049  -13.415 7.830   1.00 38.34 ? 160 LYS A NZ  1 
ATOM   845  N N   . ASN A 1 117 ? 5.893   -16.275 4.918   1.00 26.35 ? 161 ASN A N   1 
ATOM   846  C CA  . ASN A 1 117 ? 5.019   -17.361 4.663   1.00 27.13 ? 161 ASN A CA  1 
ATOM   847  C C   . ASN A 1 117 ? 4.577   -17.412 3.245   1.00 26.53 ? 161 ASN A C   1 
ATOM   848  O O   . ASN A 1 117 ? 3.953   -18.358 2.887   1.00 28.16 ? 161 ASN A O   1 
ATOM   849  C CB  . ASN A 1 117 ? 3.767   -17.347 5.540   1.00 29.69 ? 161 ASN A CB  1 
ATOM   850  C CG  . ASN A 1 117 ? 4.098   -17.569 7.049   1.00 31.30 ? 161 ASN A CG  1 
ATOM   851  O OD1 . ASN A 1 117 ? 5.258   -17.929 7.453   1.00 32.76 ? 161 ASN A OD1 1 
ATOM   852  N ND2 . ASN A 1 117 ? 3.112   -17.321 7.874   1.00 26.95 ? 161 ASN A ND2 1 
ATOM   853  N N   . ASN A 1 118 ? 4.886   -16.414 2.458   1.00 25.75 ? 162 ASN A N   1 
ATOM   854  C CA  . ASN A 1 118 ? 4.548   -16.408 1.008   1.00 25.28 ? 162 ASN A CA  1 
ATOM   855  C C   . ASN A 1 118 ? 5.767   -15.981 0.117   1.00 23.56 ? 162 ASN A C   1 
ATOM   856  O O   . ASN A 1 118 ? 5.543   -15.605 -1.030  1.00 24.89 ? 162 ASN A O   1 
ATOM   857  C CB  . ASN A 1 118 ? 3.330   -15.453 0.711   1.00 25.78 ? 162 ASN A CB  1 
ATOM   858  C CG  . ASN A 1 118 ? 2.614   -15.812 -0.608  1.00 27.81 ? 162 ASN A CG  1 
ATOM   859  O OD1 . ASN A 1 118 ? 1.993   -14.949 -1.295  1.00 33.69 ? 162 ASN A OD1 1 
ATOM   860  N ND2 . ASN A 1 118 ? 2.748   -17.095 -0.998  1.00 24.40 ? 162 ASN A ND2 1 
ATOM   861  N N   . THR A 1 119 ? 7.011   -16.034 0.659   1.00 21.83 ? 163 THR A N   1 
ATOM   862  C CA  . THR A 1 119 ? 8.247   -15.620 -0.022  1.00 20.86 ? 163 THR A CA  1 
ATOM   863  C C   . THR A 1 119 ? 9.135   -16.815 -0.156  1.00 22.19 ? 163 THR A C   1 
ATOM   864  O O   . THR A 1 119 ? 9.214   -17.599 0.760   1.00 23.46 ? 163 THR A O   1 
ATOM   865  C CB  . THR A 1 119 ? 8.925   -14.494 0.730   1.00 20.64 ? 163 THR A CB  1 
ATOM   866  O OG1 . THR A 1 119 ? 8.045   -13.371 0.723   1.00 20.03 ? 163 THR A OG1 1 
ATOM   867  C CG2 . THR A 1 119 ? 10.260  -14.044 0.051   1.00 19.41 ? 163 THR A CG2 1 
ATOM   868  N N   . TYR A 1 120 ? 9.742   -17.029 -1.342  1.00 23.11 ? 164 TYR A N   1 
ATOM   869  C CA  . TYR A 1 120 ? 10.677  -18.083 -1.552  1.00 22.31 ? 164 TYR A CA  1 
ATOM   870  C C   . TYR A 1 120 ? 11.520  -17.806 -2.814  1.00 24.64 ? 164 TYR A C   1 
ATOM   871  O O   . TYR A 1 120 ? 11.248  -16.869 -3.588  1.00 22.06 ? 164 TYR A O   1 
ATOM   872  C CB  . TYR A 1 120 ? 9.882   -19.378 -1.734  1.00 23.02 ? 164 TYR A CB  1 
ATOM   873  C CG  . TYR A 1 120 ? 8.870   -19.371 -2.853  1.00 24.12 ? 164 TYR A CG  1 
ATOM   874  C CD1 . TYR A 1 120 ? 7.577   -18.907 -2.633  1.00 21.40 ? 164 TYR A CD1 1 
ATOM   875  C CD2 . TYR A 1 120 ? 9.220   -19.760 -4.160  1.00 22.21 ? 164 TYR A CD2 1 
ATOM   876  C CE1 . TYR A 1 120 ? 6.580   -18.951 -3.664  1.00 24.82 ? 164 TYR A CE1 1 
ATOM   877  C CE2 . TYR A 1 120 ? 8.225   -19.757 -5.254  1.00 21.73 ? 164 TYR A CE2 1 
ATOM   878  C CZ  . TYR A 1 120 ? 6.914   -19.371 -4.979  1.00 27.45 ? 164 TYR A CZ  1 
ATOM   879  O OH  . TYR A 1 120 ? 5.911   -19.391 -6.019  1.00 27.71 ? 164 TYR A OH  1 
ATOM   880  N N   . TRP A 1 121 ? 12.590  -18.590 -2.977  1.00 24.27 ? 165 TRP A N   1 
ATOM   881  C CA  . TRP A 1 121 ? 13.349  -18.536 -4.205  1.00 23.36 ? 165 TRP A CA  1 
ATOM   882  C C   . TRP A 1 121 ? 13.961  -19.900 -4.408  1.00 22.53 ? 165 TRP A C   1 
ATOM   883  O O   . TRP A 1 121 ? 14.231  -20.615 -3.445  1.00 21.68 ? 165 TRP A O   1 
ATOM   884  C CB  . TRP A 1 121 ? 14.408  -17.394 -4.275  1.00 22.35 ? 165 TRP A CB  1 
ATOM   885  C CG  . TRP A 1 121 ? 15.651  -17.568 -3.481  1.00 24.45 ? 165 TRP A CG  1 
ATOM   886  C CD1 . TRP A 1 121 ? 15.858  -17.163 -2.158  1.00 26.45 ? 165 TRP A CD1 1 
ATOM   887  C CD2 . TRP A 1 121 ? 16.897  -18.191 -3.898  1.00 22.80 ? 165 TRP A CD2 1 
ATOM   888  N NE1 . TRP A 1 121 ? 17.135  -17.458 -1.761  1.00 23.86 ? 165 TRP A NE1 1 
ATOM   889  C CE2 . TRP A 1 121 ? 17.819  -18.041 -2.817  1.00 27.63 ? 165 TRP A CE2 1 
ATOM   890  C CE3 . TRP A 1 121 ? 17.333  -18.827 -5.074  1.00 22.81 ? 165 TRP A CE3 1 
ATOM   891  C CZ2 . TRP A 1 121 ? 19.126  -18.604 -2.854  1.00 24.24 ? 165 TRP A CZ2 1 
ATOM   892  C CZ3 . TRP A 1 121 ? 18.672  -19.320 -5.119  1.00 22.84 ? 165 TRP A CZ3 1 
ATOM   893  C CH2 . TRP A 1 121 ? 19.531  -19.194 -4.040  1.00 25.88 ? 165 TRP A CH2 1 
ATOM   894  N N   . GLY A 1 122 ? 14.209  -20.250 -5.656  1.00 22.24 ? 166 GLY A N   1 
ATOM   895  C CA  . GLY A 1 122 ? 14.937  -21.522 -5.872  1.00 21.58 ? 166 GLY A CA  1 
ATOM   896  C C   . GLY A 1 122 ? 15.763  -21.422 -7.127  1.00 22.44 ? 166 GLY A C   1 
ATOM   897  O O   . GLY A 1 122 ? 15.907  -20.342 -7.710  1.00 23.46 ? 166 GLY A O   1 
ATOM   898  N N   . ILE A 1 123 ? 16.321  -22.539 -7.559  1.00 22.46 ? 167 ILE A N   1 
ATOM   899  C CA  . ILE A 1 123 ? 17.369  -22.491 -8.523  1.00 24.59 ? 167 ILE A CA  1 
ATOM   900  C C   . ILE A 1 123 ? 17.315  -23.833 -9.191  1.00 27.45 ? 167 ILE A C   1 
ATOM   901  O O   . ILE A 1 123 ? 17.008  -24.858 -8.544  1.00 27.95 ? 167 ILE A O   1 
ATOM   902  C CB  . ILE A 1 123 ? 18.793  -22.196 -7.829  1.00 25.52 ? 167 ILE A CB  1 
ATOM   903  C CG1 . ILE A 1 123 ? 19.849  -21.978 -8.907  1.00 21.76 ? 167 ILE A CG1 1 
ATOM   904  C CG2 . ILE A 1 123 ? 19.260  -23.350 -6.994  1.00 26.93 ? 167 ILE A CG2 1 
ATOM   905  C CD1 . ILE A 1 123 ? 21.157  -21.491 -8.406  1.00 23.03 ? 167 ILE A CD1 1 
ATOM   906  N N   . ILE A 1 124 ? 17.582  -23.856 -10.497 1.00 29.10 ? 168 ILE A N   1 
ATOM   907  C CA  . ILE A 1 124 ? 17.698  -25.143 -11.195 1.00 27.49 ? 168 ILE A CA  1 
ATOM   908  C C   . ILE A 1 124 ? 18.970  -25.129 -12.073 1.00 28.01 ? 168 ILE A C   1 
ATOM   909  O O   . ILE A 1 124 ? 19.258  -24.147 -12.725 1.00 27.51 ? 168 ILE A O   1 
ATOM   910  C CB  . ILE A 1 124 ? 16.372  -25.500 -11.995 1.00 27.88 ? 168 ILE A CB  1 
ATOM   911  C CG1 . ILE A 1 124 ? 16.535  -26.790 -12.856 1.00 25.89 ? 168 ILE A CG1 1 
ATOM   912  C CG2 . ILE A 1 124 ? 16.038  -24.394 -12.909 1.00 23.36 ? 168 ILE A CG2 1 
ATOM   913  C CD1 . ILE A 1 124 ? 15.387  -27.113 -13.743 1.00 27.60 ? 168 ILE A CD1 1 
ATOM   914  N N   . LEU A 1 125 ? 19.703  -26.250 -12.077 1.00 29.13 ? 169 LEU A N   1 
ATOM   915  C CA  . LEU A 1 125 ? 20.796  -26.461 -13.050 1.00 29.80 ? 169 LEU A CA  1 
ATOM   916  C C   . LEU A 1 125 ? 20.307  -26.840 -14.468 1.00 28.32 ? 169 LEU A C   1 
ATOM   917  O O   . LEU A 1 125 ? 19.774  -27.962 -14.689 1.00 27.79 ? 169 LEU A O   1 
ATOM   918  C CB  . LEU A 1 125 ? 21.910  -27.391 -12.508 1.00 29.59 ? 169 LEU A CB  1 
ATOM   919  C CG  . LEU A 1 125 ? 23.066  -27.744 -13.474 1.00 30.00 ? 169 LEU A CG  1 
ATOM   920  C CD1 . LEU A 1 125 ? 24.053  -26.643 -13.558 1.00 20.66 ? 169 LEU A CD1 1 
ATOM   921  C CD2 . LEU A 1 125 ? 23.827  -29.044 -13.040 1.00 29.78 ? 169 LEU A CD2 1 
ATOM   922  N N   . LEU A 1 126 ? 20.509  -25.903 -15.411 1.00 28.86 ? 170 LEU A N   1 
ATOM   923  C CA  . LEU A 1 126 ? 20.143  -26.084 -16.831 1.00 31.14 ? 170 LEU A CA  1 
ATOM   924  C C   . LEU A 1 126 ? 21.169  -26.858 -17.651 1.00 33.51 ? 170 LEU A C   1 
ATOM   925  O O   . LEU A 1 126 ? 20.768  -27.570 -18.533 1.00 35.09 ? 170 LEU A O   1 
ATOM   926  C CB  . LEU A 1 126 ? 19.836  -24.776 -17.588 1.00 30.95 ? 170 LEU A CB  1 
ATOM   927  C CG  . LEU A 1 126 ? 18.821  -23.872 -16.941 1.00 28.98 ? 170 LEU A CG  1 
ATOM   928  C CD1 . LEU A 1 126 ? 18.757  -22.574 -17.669 1.00 31.72 ? 170 LEU A CD1 1 
ATOM   929  C CD2 . LEU A 1 126 ? 17.497  -24.606 -16.960 1.00 32.41 ? 170 LEU A CD2 1 
ATOM   930  N N   . ALA A 1 127 ? 22.473  -26.719 -17.370 1.00 35.47 ? 171 ALA A N   1 
ATOM   931  C CA  . ALA A 1 127 ? 23.551  -27.232 -18.227 1.00 36.56 ? 171 ALA A CA  1 
ATOM   932  C C   . ALA A 1 127 ? 24.896  -26.917 -17.552 1.00 39.67 ? 171 ALA A C   1 
ATOM   933  O O   . ALA A 1 127 ? 25.024  -25.912 -16.834 1.00 39.70 ? 171 ALA A O   1 
ATOM   934  C CB  . ALA A 1 127 ? 23.489  -26.566 -19.598 1.00 34.84 ? 171 ALA A CB  1 
ATOM   935  N N   . ASN A 1 128 ? 25.884  -27.799 -17.710 1.00 43.97 ? 172 ASN A N   1 
ATOM   936  C CA  . ASN A 1 128 ? 27.277  -27.374 -17.515 1.00 46.73 ? 172 ASN A CA  1 
ATOM   937  C C   . ASN A 1 128 ? 27.989  -27.360 -18.850 1.00 49.90 ? 172 ASN A C   1 
ATOM   938  O O   . ASN A 1 128 ? 28.520  -28.405 -19.278 1.00 50.03 ? 172 ASN A O   1 
ATOM   939  C CB  . ASN A 1 128 ? 28.084  -28.235 -16.517 1.00 46.73 ? 172 ASN A CB  1 
ATOM   940  C CG  . ASN A 1 128 ? 29.497  -27.614 -16.206 1.00 47.12 ? 172 ASN A CG  1 
ATOM   941  O OD1 . ASN A 1 128 ? 30.381  -28.270 -15.614 1.00 46.85 ? 172 ASN A OD1 1 
ATOM   942  N ND2 . ASN A 1 128 ? 29.685  -26.316 -16.590 1.00 48.07 ? 172 ASN A ND2 1 
ATOM   943  N N   . PRO A 1 129 ? 27.991  -26.207 -19.549 1.00 52.86 ? 173 PRO A N   1 
ATOM   944  C CA  . PRO A 1 129 ? 28.921  -26.326 -20.652 1.00 55.45 ? 173 PRO A CA  1 
ATOM   945  C C   . PRO A 1 129 ? 30.362  -26.326 -20.118 1.00 58.06 ? 173 PRO A C   1 
ATOM   946  O O   . PRO A 1 129 ? 30.881  -25.301 -19.671 1.00 58.23 ? 173 PRO A O   1 
ATOM   947  C CB  . PRO A 1 129 ? 28.585  -25.136 -21.566 1.00 55.08 ? 173 PRO A CB  1 
ATOM   948  C CG  . PRO A 1 129 ? 27.846  -24.201 -20.758 1.00 54.00 ? 173 PRO A CG  1 
ATOM   949  C CD  . PRO A 1 129 ? 27.281  -24.916 -19.547 1.00 53.56 ? 173 PRO A CD  1 
ATOM   950  N N   . GLN A 1 130 ? 30.899  -27.534 -20.002 1.00 61.35 ? 174 GLN A N   1 
ATOM   951  C CA  . GLN A 1 130 ? 32.233  -27.854 -20.500 1.00 64.58 ? 174 GLN A CA  1 
ATOM   952  C C   . GLN A 1 130 ? 32.809  -26.699 -21.378 1.00 65.76 ? 174 GLN A C   1 
ATOM   953  O O   . GLN A 1 130 ? 33.539  -26.966 -22.336 1.00 66.41 ? 174 GLN A O   1 
ATOM   954  C CB  . GLN A 1 130 ? 32.134  -29.177 -21.328 1.00 64.79 ? 174 GLN A CB  1 
ATOM   955  C CG  . GLN A 1 130 ? 30.638  -29.631 -21.818 1.00 65.75 ? 174 GLN A CG  1 
ATOM   956  C CD  . GLN A 1 130 ? 30.080  -29.016 -23.175 1.00 67.10 ? 174 GLN A CD  1 
ATOM   957  O OE1 . GLN A 1 130 ? 30.755  -28.237 -23.876 1.00 66.84 ? 174 GLN A OE1 1 
ATOM   958  N NE2 . GLN A 1 130 ? 28.834  -29.396 -23.525 1.00 64.99 ? 174 GLN A NE2 1 
ATOM   959  N N   . PHE A 1 131 ? 32.404  -25.445 -21.075 1.00 67.26 ? 175 PHE A N   1 
ATOM   960  C CA  . PHE A 1 131 ? 33.076  -24.194 -21.507 1.00 68.24 ? 175 PHE A CA  1 
ATOM   961  C C   . PHE A 1 131 ? 33.309  -23.123 -20.392 1.00 68.71 ? 175 PHE A C   1 
ATOM   962  O O   . PHE A 1 131 ? 34.456  -22.698 -20.210 1.00 68.95 ? 175 PHE A O   1 
ATOM   963  C CB  . PHE A 1 131 ? 32.678  -23.667 -22.952 1.00 68.47 ? 175 PHE A CB  1 
ATOM   964  C CG  . PHE A 1 131 ? 31.321  -22.917 -23.089 1.00 68.72 ? 175 PHE A CG  1 
ATOM   965  C CD1 . PHE A 1 131 ? 30.439  -23.265 -24.121 1.00 68.80 ? 175 PHE A CD1 1 
ATOM   966  C CD2 . PHE A 1 131 ? 30.982  -21.816 -22.294 1.00 68.50 ? 175 PHE A CD2 1 
ATOM   967  C CE1 . PHE A 1 131 ? 29.212  -22.572 -24.305 1.00 69.22 ? 175 PHE A CE1 1 
ATOM   968  C CE2 . PHE A 1 131 ? 29.743  -21.129 -22.464 1.00 68.94 ? 175 PHE A CE2 1 
ATOM   969  C CZ  . PHE A 1 131 ? 28.862  -21.512 -23.467 1.00 68.10 ? 175 PHE A CZ  1 
ATOM   970  N N   . ILE A 1 132 ? 32.272  -22.721 -19.635 1.00 69.18 ? 176 ILE A N   1 
ATOM   971  C CA  . ILE A 1 132 ? 32.439  -21.916 -18.364 1.00 69.29 ? 176 ILE A CA  1 
ATOM   972  C C   . ILE A 1 132 ? 33.073  -22.738 -17.168 1.00 69.64 ? 176 ILE A C   1 
ATOM   973  O O   . ILE A 1 132 ? 32.590  -23.866 -16.864 1.00 68.36 ? 176 ILE A O   1 
ATOM   974  C CB  . ILE A 1 132 ? 31.072  -21.339 -17.836 1.00 69.86 ? 176 ILE A CB  1 
ATOM   975  C CG1 . ILE A 1 132 ? 29.896  -21.776 -18.719 1.00 69.98 ? 176 ILE A CG1 1 
ATOM   976  C CG2 . ILE A 1 132 ? 31.167  -19.818 -17.562 1.00 69.07 ? 176 ILE A CG2 1 
ATOM   977  C CD1 . ILE A 1 132 ? 28.688  -22.240 -17.927 1.00 72.42 ? 176 ILE A CD1 1 
ATOM   978  N N   . SER A 1 133 ? 34.099  -22.209 -16.461 1.00 69.90 ? 177 SER A N   1 
ATOM   979  C CA  . SER A 1 133 ? 34.691  -20.853 -16.586 1.00 70.34 ? 177 SER A CA  1 
ATOM   980  C C   . SER A 1 133 ? 35.066  -20.442 -18.029 1.00 71.68 ? 177 SER A C   1 
ATOM   981  O O   . SER A 1 133 ? 35.959  -19.595 -18.275 1.00 73.30 ? 177 SER A O   1 
ATOM   982  C CB  . SER A 1 133 ? 35.928  -20.706 -15.648 1.00 70.34 ? 177 SER A CB  1 
ATOM   983  O OG  . SER A 1 133 ? 35.612  -20.751 -14.257 1.00 67.53 ? 177 SER A OG  1 
ATOM   984  N N   . PRO B 1 13  ? 9.502   -33.556 -23.895 1.00 51.47 ? 57  PRO B N   1 
ATOM   985  C CA  . PRO B 1 13  ? 9.344   -32.538 -22.855 1.00 51.63 ? 57  PRO B CA  1 
ATOM   986  C C   . PRO B 1 13  ? 8.019   -31.753 -22.970 1.00 50.45 ? 57  PRO B C   1 
ATOM   987  O O   . PRO B 1 13  ? 7.769   -31.113 -23.998 1.00 51.09 ? 57  PRO B O   1 
ATOM   988  C CB  . PRO B 1 13  ? 10.551  -31.608 -23.059 1.00 51.21 ? 57  PRO B CB  1 
ATOM   989  C CG  . PRO B 1 13  ? 11.223  -32.039 -24.307 1.00 52.52 ? 57  PRO B CG  1 
ATOM   990  C CD  . PRO B 1 13  ? 10.353  -33.080 -24.989 1.00 52.60 ? 57  PRO B CD  1 
ATOM   991  N N   . CYS B 1 14  ? 7.214   -31.781 -21.908 1.00 48.81 ? 58  CYS B N   1 
ATOM   992  C CA  . CYS B 1 14  ? 5.838   -31.296 -21.945 1.00 47.25 ? 58  CYS B CA  1 
ATOM   993  C C   . CYS B 1 14  ? 5.682   -29.800 -22.131 1.00 46.62 ? 58  CYS B C   1 
ATOM   994  O O   . CYS B 1 14  ? 6.104   -29.040 -21.288 1.00 45.87 ? 58  CYS B O   1 
ATOM   995  C CB  . CYS B 1 14  ? 5.178   -31.661 -20.640 1.00 47.47 ? 58  CYS B CB  1 
ATOM   996  S SG  . CYS B 1 14  ? 3.421   -31.405 -20.682 1.00 48.98 ? 58  CYS B SG  1 
ATOM   997  N N   . MET B 1 15  ? 5.066   -29.365 -23.223 1.00 46.35 ? 59  MET B N   1 
ATOM   998  C CA  . MET B 1 15  ? 4.805   -27.945 -23.417 1.00 46.02 ? 59  MET B CA  1 
ATOM   999  C C   . MET B 1 15  ? 3.599   -27.748 -24.291 1.00 44.48 ? 59  MET B C   1 
ATOM   1000 O O   . MET B 1 15  ? 3.124   -28.689 -24.887 1.00 44.11 ? 59  MET B O   1 
ATOM   1001 C CB  . MET B 1 15  ? 6.044   -27.193 -23.938 1.00 46.59 ? 59  MET B CB  1 
ATOM   1002 C CG  . MET B 1 15  ? 6.478   -27.453 -25.324 1.00 47.44 ? 59  MET B CG  1 
ATOM   1003 S SD  . MET B 1 15  ? 8.169   -26.807 -25.715 1.00 49.55 ? 59  MET B SD  1 
ATOM   1004 C CE  . MET B 1 15  ? 7.737   -25.132 -26.251 1.00 45.99 ? 59  MET B CE  1 
ATOM   1005 N N   . ALA B 1 16  ? 3.058   -26.532 -24.287 1.00 42.74 ? 60  ALA B N   1 
ATOM   1006 C CA  . ALA B 1 16  ? 1.885   -26.177 -25.071 1.00 40.57 ? 60  ALA B CA  1 
ATOM   1007 C C   . ALA B 1 16  ? 2.047   -24.754 -25.521 1.00 39.31 ? 60  ALA B C   1 
ATOM   1008 O O   . ALA B 1 16  ? 2.692   -23.979 -24.847 1.00 38.88 ? 60  ALA B O   1 
ATOM   1009 C CB  . ALA B 1 16  ? 0.613   -26.305 -24.222 1.00 39.90 ? 60  ALA B CB  1 
ATOM   1010 N N   . LYS B 1 17  ? 1.463   -24.403 -26.656 1.00 39.66 ? 61  LYS B N   1 
ATOM   1011 C CA  . LYS B 1 17  ? 1.440   -23.007 -27.144 1.00 39.86 ? 61  LYS B CA  1 
ATOM   1012 C C   . LYS B 1 17  ? 0.071   -22.655 -27.706 1.00 40.90 ? 61  LYS B C   1 
ATOM   1013 O O   . LYS B 1 17  ? -0.585  -23.510 -28.341 1.00 39.05 ? 61  LYS B O   1 
ATOM   1014 C CB  . LYS B 1 17  ? 2.436   -22.856 -28.298 1.00 40.01 ? 61  LYS B CB  1 
ATOM   1015 C CG  . LYS B 1 17  ? 2.526   -21.450 -28.942 1.00 38.55 ? 61  LYS B CG  1 
ATOM   1016 C CD  . LYS B 1 17  ? 3.080   -21.618 -30.329 1.00 35.27 ? 61  LYS B CD  1 
ATOM   1017 C CE  . LYS B 1 17  ? 3.714   -20.336 -30.790 1.00 39.75 ? 61  LYS B CE  1 
ATOM   1018 N NZ  . LYS B 1 17  ? 4.436   -20.547 -32.047 1.00 39.12 ? 61  LYS B NZ  1 
ATOM   1019 N N   . PHE B 1 18  ? -0.330  -21.394 -27.524 1.00 41.10 ? 62  PHE B N   1 
ATOM   1020 C CA  . PHE B 1 18  ? -1.568  -20.910 -28.141 1.00 41.37 ? 62  PHE B CA  1 
ATOM   1021 C C   . PHE B 1 18  ? -1.277  -19.787 -29.113 1.00 41.68 ? 62  PHE B C   1 
ATOM   1022 O O   . PHE B 1 18  ? -0.545  -18.851 -28.798 1.00 40.91 ? 62  PHE B O   1 
ATOM   1023 C CB  . PHE B 1 18  ? -2.636  -20.431 -27.138 1.00 41.48 ? 62  PHE B CB  1 
ATOM   1024 C CG  . PHE B 1 18  ? -3.976  -20.139 -27.802 1.00 42.05 ? 62  PHE B CG  1 
ATOM   1025 C CD1 . PHE B 1 18  ? -5.002  -21.078 -27.778 1.00 40.88 ? 62  PHE B CD1 1 
ATOM   1026 C CD2 . PHE B 1 18  ? -4.200  -18.941 -28.477 1.00 40.79 ? 62  PHE B CD2 1 
ATOM   1027 C CE1 . PHE B 1 18  ? -6.221  -20.829 -28.437 1.00 39.81 ? 62  PHE B CE1 1 
ATOM   1028 C CE2 . PHE B 1 18  ? -5.433  -18.695 -29.127 1.00 39.68 ? 62  PHE B CE2 1 
ATOM   1029 C CZ  . PHE B 1 18  ? -6.419  -19.642 -29.107 1.00 39.02 ? 62  PHE B CZ  1 
ATOM   1030 N N   . GLY B 1 19  ? -1.880  -19.872 -30.299 1.00 42.51 ? 63  GLY B N   1 
ATOM   1031 C CA  . GLY B 1 19  ? -1.675  -18.860 -31.337 1.00 42.56 ? 63  GLY B CA  1 
ATOM   1032 C C   . GLY B 1 19  ? -0.353  -19.151 -32.042 1.00 43.61 ? 63  GLY B C   1 
ATOM   1033 O O   . GLY B 1 19  ? 0.157   -20.278 -31.938 1.00 43.11 ? 63  GLY B O   1 
ATOM   1034 N N   . PRO B 1 20  ? 0.159   -18.167 -32.823 1.00 43.59 ? 64  PRO B N   1 
ATOM   1035 C CA  . PRO B 1 20  ? -0.584  -16.953 -33.070 1.00 44.64 ? 64  PRO B CA  1 
ATOM   1036 C C   . PRO B 1 20  ? -1.817  -17.301 -33.942 1.00 46.91 ? 64  PRO B C   1 
ATOM   1037 O O   . PRO B 1 20  ? -1.790  -18.280 -34.678 1.00 46.98 ? 64  PRO B O   1 
ATOM   1038 C CB  . PRO B 1 20  ? 0.400   -16.080 -33.839 1.00 43.86 ? 64  PRO B CB  1 
ATOM   1039 C CG  . PRO B 1 20  ? 1.338   -17.020 -34.490 1.00 44.09 ? 64  PRO B CG  1 
ATOM   1040 C CD  . PRO B 1 20  ? 1.448   -18.189 -33.533 1.00 44.17 ? 64  PRO B CD  1 
ATOM   1041 N N   . LEU B 1 21  ? -2.912  -16.553 -33.808 1.00 48.48 ? 65  LEU B N   1 
ATOM   1042 C CA  . LEU B 1 21  ? -4.034  -16.773 -34.702 1.00 50.15 ? 65  LEU B CA  1 
ATOM   1043 C C   . LEU B 1 21  ? -3.557  -16.875 -36.159 1.00 50.78 ? 65  LEU B C   1 
ATOM   1044 O O   . LEU B 1 21  ? -2.680  -16.119 -36.604 1.00 51.49 ? 65  LEU B O   1 
ATOM   1045 C CB  . LEU B 1 21  ? -5.161  -15.742 -34.482 1.00 50.24 ? 65  LEU B CB  1 
ATOM   1046 C CG  . LEU B 1 21  ? -5.875  -15.978 -33.134 1.00 49.27 ? 65  LEU B CG  1 
ATOM   1047 C CD1 . LEU B 1 21  ? -6.794  -14.859 -32.833 1.00 51.80 ? 65  LEU B CD1 1 
ATOM   1048 C CD2 . LEU B 1 21  ? -6.654  -17.259 -33.095 1.00 46.91 ? 65  LEU B CD2 1 
ATOM   1049 N N   . PRO B 1 22  ? -4.154  -17.796 -36.919 1.00 51.43 ? 66  PRO B N   1 
ATOM   1050 C CA  . PRO B 1 22  ? -5.328  -18.572 -36.535 1.00 51.12 ? 66  PRO B CA  1 
ATOM   1051 C C   . PRO B 1 22  ? -4.999  -19.947 -35.991 1.00 50.72 ? 66  PRO B C   1 
ATOM   1052 O O   . PRO B 1 22  ? -5.911  -20.786 -35.830 1.00 49.97 ? 66  PRO B O   1 
ATOM   1053 C CB  . PRO B 1 22  ? -6.129  -18.646 -37.847 1.00 51.33 ? 66  PRO B CB  1 
ATOM   1054 C CG  . PRO B 1 22  ? -5.167  -18.016 -38.947 1.00 51.58 ? 66  PRO B CG  1 
ATOM   1055 C CD  . PRO B 1 22  ? -3.815  -18.039 -38.329 1.00 51.93 ? 66  PRO B CD  1 
ATOM   1056 N N   . SER B 1 23  ? -3.725  -20.159 -35.650 1.00 49.94 ? 67  SER B N   1 
ATOM   1057 C CA  . SER B 1 23  ? -3.386  -21.320 -34.828 1.00 50.25 ? 67  SER B CA  1 
ATOM   1058 C C   . SER B 1 23  ? -4.092  -21.243 -33.453 1.00 49.85 ? 67  SER B C   1 
ATOM   1059 O O   . SER B 1 23  ? -4.410  -20.167 -32.970 1.00 49.65 ? 67  SER B O   1 
ATOM   1060 C CB  . SER B 1 23  ? -1.867  -21.522 -34.706 1.00 50.34 ? 67  SER B CB  1 
ATOM   1061 O OG  . SER B 1 23  ? -1.358  -22.102 -35.903 1.00 50.89 ? 67  SER B OG  1 
ATOM   1062 N N   . LYS B 1 24  ? -4.413  -22.390 -32.883 1.00 49.83 ? 68  LYS B N   1 
ATOM   1063 C CA  . LYS B 1 24  ? -4.993  -22.425 -31.545 1.00 50.72 ? 68  LYS B CA  1 
ATOM   1064 C C   . LYS B 1 24  ? -4.036  -23.097 -30.515 1.00 50.67 ? 68  LYS B C   1 
ATOM   1065 O O   . LYS B 1 24  ? -2.822  -22.839 -30.518 1.00 49.61 ? 68  LYS B O   1 
ATOM   1066 C CB  . LYS B 1 24  ? -6.363  -23.089 -31.587 1.00 50.64 ? 68  LYS B CB  1 
ATOM   1067 C CG  . LYS B 1 24  ? -7.579  -22.126 -31.429 1.00 52.30 ? 68  LYS B CG  1 
ATOM   1068 C CD  . LYS B 1 24  ? -7.497  -20.871 -32.359 1.00 51.87 ? 68  LYS B CD  1 
ATOM   1069 C CE  . LYS B 1 24  ? -8.746  -19.999 -32.292 1.00 50.22 ? 68  LYS B CE  1 
ATOM   1070 N NZ  . LYS B 1 24  ? -9.935  -20.676 -32.804 1.00 48.79 ? 68  LYS B NZ  1 
ATOM   1071 N N   . TRP B 1 25  ? -4.577  -23.970 -29.678 1.00 51.19 ? 69  TRP B N   1 
ATOM   1072 C CA  . TRP B 1 25  ? -3.774  -24.723 -28.742 1.00 52.91 ? 69  TRP B CA  1 
ATOM   1073 C C   . TRP B 1 25  ? -2.972  -25.812 -29.451 1.00 54.14 ? 69  TRP B C   1 
ATOM   1074 O O   . TRP B 1 25  ? -3.537  -26.768 -30.016 1.00 54.27 ? 69  TRP B O   1 
ATOM   1075 C CB  . TRP B 1 25  ? -4.614  -25.311 -27.608 1.00 52.71 ? 69  TRP B CB  1 
ATOM   1076 C CG  . TRP B 1 25  ? -4.810  -24.370 -26.490 1.00 54.06 ? 69  TRP B CG  1 
ATOM   1077 C CD1 . TRP B 1 25  ? -6.006  -23.909 -25.996 1.00 54.33 ? 69  TRP B CD1 1 
ATOM   1078 C CD2 . TRP B 1 25  ? -3.782  -23.759 -25.686 1.00 55.10 ? 69  TRP B CD2 1 
ATOM   1079 N NE1 . TRP B 1 25  ? -5.783  -23.057 -24.939 1.00 54.40 ? 69  TRP B NE1 1 
ATOM   1080 C CE2 . TRP B 1 25  ? -4.431  -22.946 -24.728 1.00 53.37 ? 69  TRP B CE2 1 
ATOM   1081 C CE3 . TRP B 1 25  ? -2.377  -23.852 -25.659 1.00 54.54 ? 69  TRP B CE3 1 
ATOM   1082 C CZ2 . TRP B 1 25  ? -3.733  -22.217 -23.781 1.00 53.59 ? 69  TRP B CZ2 1 
ATOM   1083 C CZ3 . TRP B 1 25  ? -1.679  -23.100 -24.723 1.00 53.87 ? 69  TRP B CZ3 1 
ATOM   1084 C CH2 . TRP B 1 25  ? -2.361  -22.293 -23.804 1.00 54.37 ? 69  TRP B CH2 1 
ATOM   1085 N N   . GLN B 1 26  ? -1.654  -25.648 -29.409 1.00 54.55 ? 70  GLN B N   1 
ATOM   1086 C CA  . GLN B 1 26  ? -0.738  -26.575 -30.005 1.00 55.96 ? 70  GLN B CA  1 
ATOM   1087 C C   . GLN B 1 26  ? -0.110  -27.250 -28.800 1.00 56.90 ? 70  GLN B C   1 
ATOM   1088 O O   . GLN B 1 26  ? 0.266   -26.579 -27.838 1.00 56.82 ? 70  GLN B O   1 
ATOM   1089 C CB  . GLN B 1 26  ? 0.278   -25.824 -30.899 1.00 56.13 ? 70  GLN B CB  1 
ATOM   1090 C CG  . GLN B 1 26  ? -0.388  -24.936 -32.010 1.00 56.62 ? 70  GLN B CG  1 
ATOM   1091 C CD  . GLN B 1 26  ? 0.269   -23.536 -32.222 1.00 59.07 ? 70  GLN B CD  1 
ATOM   1092 O OE1 . GLN B 1 26  ? -0.152  -22.536 -31.607 1.00 53.81 ? 70  GLN B OE1 1 
ATOM   1093 N NE2 . GLN B 1 26  ? 1.291   -23.469 -33.122 1.00 59.12 ? 70  GLN B NE2 1 
ATOM   1094 N N   . MET B 1 27  ? -0.056  -28.573 -28.824 1.00 57.74 ? 71  MET B N   1 
ATOM   1095 C CA  . MET B 1 27  ? 0.441   -29.326 -27.695 1.00 59.12 ? 71  MET B CA  1 
ATOM   1096 C C   . MET B 1 27  ? 1.499   -30.377 -28.024 1.00 60.00 ? 71  MET B C   1 
ATOM   1097 O O   . MET B 1 27  ? 1.404   -31.073 -29.035 1.00 60.05 ? 71  MET B O   1 
ATOM   1098 C CB  . MET B 1 27  ? -0.720  -29.972 -26.962 1.00 59.77 ? 71  MET B CB  1 
ATOM   1099 C CG  . MET B 1 27  ? -1.554  -28.952 -26.203 1.00 60.05 ? 71  MET B CG  1 
ATOM   1100 S SD  . MET B 1 27  ? -2.127  -29.616 -24.673 1.00 59.08 ? 71  MET B SD  1 
ATOM   1101 C CE  . MET B 1 27  ? -3.597  -28.582 -24.536 1.00 59.42 ? 71  MET B CE  1 
ATOM   1102 N N   . ALA B 1 28  ? 2.483   -30.505 -27.141 1.00 60.55 ? 72  ALA B N   1 
ATOM   1103 C CA  . ALA B 1 28  ? 3.597   -31.406 -27.353 1.00 62.34 ? 72  ALA B CA  1 
ATOM   1104 C C   . ALA B 1 28  ? 3.751   -32.471 -26.245 1.00 63.29 ? 72  ALA B C   1 
ATOM   1105 O O   . ALA B 1 28  ? 4.620   -33.363 -26.340 1.00 64.26 ? 72  ALA B O   1 
ATOM   1106 C CB  . ALA B 1 28  ? 4.912   -30.592 -27.545 1.00 62.32 ? 72  ALA B CB  1 
ATOM   1107 N N   . PRO B 1 32  ? 1.800   -38.809 -19.693 1.00 53.56 ? 76  PRO B N   1 
ATOM   1108 C CA  . PRO B 1 32  ? 0.607   -38.012 -19.360 1.00 52.70 ? 76  PRO B CA  1 
ATOM   1109 C C   . PRO B 1 32  ? 0.814   -36.500 -19.581 1.00 51.73 ? 76  PRO B C   1 
ATOM   1110 O O   . PRO B 1 32  ? 1.948   -36.013 -19.438 1.00 51.47 ? 76  PRO B O   1 
ATOM   1111 C CB  . PRO B 1 32  ? 0.399   -38.318 -17.870 1.00 53.24 ? 76  PRO B CB  1 
ATOM   1112 C CG  . PRO B 1 32  ? 1.849   -38.516 -17.348 1.00 52.70 ? 76  PRO B CG  1 
ATOM   1113 C CD  . PRO B 1 32  ? 2.580   -39.194 -18.494 1.00 53.37 ? 76  PRO B CD  1 
ATOM   1114 N N   . PRO B 1 33  ? -0.278  -35.766 -19.932 1.00 50.75 ? 77  PRO B N   1 
ATOM   1115 C CA  . PRO B 1 33  ? -0.191  -34.315 -20.144 1.00 49.36 ? 77  PRO B CA  1 
ATOM   1116 C C   . PRO B 1 33  ? 0.089   -33.597 -18.860 1.00 47.71 ? 77  PRO B C   1 
ATOM   1117 O O   . PRO B 1 33  ? -0.235  -34.072 -17.780 1.00 48.01 ? 77  PRO B O   1 
ATOM   1118 C CB  . PRO B 1 33  ? -1.598  -33.921 -20.657 1.00 50.07 ? 77  PRO B CB  1 
ATOM   1119 C CG  . PRO B 1 33  ? -2.525  -35.010 -20.224 1.00 49.20 ? 77  PRO B CG  1 
ATOM   1120 C CD  . PRO B 1 33  ? -1.662  -36.274 -20.111 1.00 51.01 ? 77  PRO B CD  1 
ATOM   1121 N N   . CYS B 1 34  ? 0.705   -32.438 -18.970 1.00 46.89 ? 78  CYS B N   1 
ATOM   1122 C CA  . CYS B 1 34  ? 0.957   -31.630 -17.780 1.00 45.56 ? 78  CYS B CA  1 
ATOM   1123 C C   . CYS B 1 34  ? -0.027  -30.444 -17.783 1.00 44.70 ? 78  CYS B C   1 
ATOM   1124 O O   . CYS B 1 34  ? -0.174  -29.739 -16.788 1.00 44.23 ? 78  CYS B O   1 
ATOM   1125 C CB  . CYS B 1 34  ? 2.441   -31.207 -17.742 1.00 44.67 ? 78  CYS B CB  1 
ATOM   1126 S SG  . CYS B 1 34  ? 2.935   -30.172 -19.082 1.00 43.98 ? 78  CYS B SG  1 
ATOM   1127 N N   . VAL B 1 35  ? -0.679  -30.249 -18.931 1.00 43.93 ? 79  VAL B N   1 
ATOM   1128 C CA  . VAL B 1 35  ? -1.629  -29.176 -19.151 1.00 43.97 ? 79  VAL B CA  1 
ATOM   1129 C C   . VAL B 1 35  ? -2.766  -29.635 -20.018 1.00 45.33 ? 79  VAL B C   1 
ATOM   1130 O O   . VAL B 1 35  ? -2.622  -30.568 -20.778 1.00 44.18 ? 79  VAL B O   1 
ATOM   1131 C CB  . VAL B 1 35  ? -0.989  -27.997 -19.855 1.00 45.18 ? 79  VAL B CB  1 
ATOM   1132 C CG1 . VAL B 1 35  ? 0.054   -27.279 -18.929 1.00 42.57 ? 79  VAL B CG1 1 
ATOM   1133 C CG2 . VAL B 1 35  ? -0.391  -28.435 -21.198 1.00 43.04 ? 79  VAL B CG2 1 
ATOM   1134 N N   . ASN B 1 36  ? -3.893  -28.934 -19.890 1.00 47.08 ? 80  ASN B N   1 
ATOM   1135 C CA  . ASN B 1 36  ? -5.172  -29.214 -20.536 1.00 48.28 ? 80  ASN B CA  1 
ATOM   1136 C C   . ASN B 1 36  ? -5.738  -27.880 -20.948 1.00 48.98 ? 80  ASN B C   1 
ATOM   1137 O O   . ASN B 1 36  ? -5.907  -26.989 -20.077 1.00 48.49 ? 80  ASN B O   1 
ATOM   1138 C CB  . ASN B 1 36  ? -6.130  -29.839 -19.507 1.00 48.88 ? 80  ASN B CB  1 
ATOM   1139 C CG  . ASN B 1 36  ? -7.610  -29.814 -19.961 1.00 51.92 ? 80  ASN B CG  1 
ATOM   1140 O OD1 . ASN B 1 36  ? -7.934  -30.225 -21.081 1.00 54.48 ? 80  ASN B OD1 1 
ATOM   1141 N ND2 . ASN B 1 36  ? -8.506  -29.330 -19.082 1.00 49.81 ? 80  ASN B ND2 1 
ATOM   1142 N N   . LYS B 1 37  ? -6.042  -27.716 -22.240 1.00 49.27 ? 81  LYS B N   1 
ATOM   1143 C CA  . LYS B 1 37  ? -6.674  -26.465 -22.696 1.00 49.88 ? 81  LYS B CA  1 
ATOM   1144 C C   . LYS B 1 37  ? -8.052  -26.296 -22.055 1.00 50.24 ? 81  LYS B C   1 
ATOM   1145 O O   . LYS B 1 37  ? -8.699  -27.276 -21.648 1.00 50.27 ? 81  LYS B O   1 
ATOM   1146 C CB  . LYS B 1 37  ? -6.765  -26.364 -24.226 1.00 50.47 ? 81  LYS B CB  1 
ATOM   1147 C CG  . LYS B 1 37  ? -7.920  -27.102 -24.891 1.00 51.51 ? 81  LYS B CG  1 
ATOM   1148 C CD  . LYS B 1 37  ? -8.640  -26.201 -25.923 1.00 57.37 ? 81  LYS B CD  1 
ATOM   1149 C CE  . LYS B 1 37  ? -8.192  -26.422 -27.378 1.00 60.32 ? 81  LYS B CE  1 
ATOM   1150 N NZ  . LYS B 1 37  ? -8.606  -27.754 -27.950 1.00 60.44 ? 81  LYS B NZ  1 
ATOM   1151 N N   . VAL B 1 38  ? -8.478  -25.045 -21.933 1.00 50.09 ? 82  VAL B N   1 
ATOM   1152 C CA  . VAL B 1 38  ? -9.785  -24.737 -21.377 1.00 50.29 ? 82  VAL B CA  1 
ATOM   1153 C C   . VAL B 1 38  ? -10.621 -24.088 -22.494 1.00 50.86 ? 82  VAL B C   1 
ATOM   1154 O O   . VAL B 1 38  ? -11.801 -24.415 -22.703 1.00 51.27 ? 82  VAL B O   1 
ATOM   1155 C CB  . VAL B 1 38  ? -9.642  -23.845 -20.118 1.00 50.26 ? 82  VAL B CB  1 
ATOM   1156 C CG1 . VAL B 1 38  ? -10.951 -23.289 -19.710 1.00 50.56 ? 82  VAL B CG1 1 
ATOM   1157 C CG2 . VAL B 1 38  ? -9.002  -24.631 -18.944 1.00 48.39 ? 82  VAL B CG2 1 
ATOM   1158 N N   . SER B 1 39  ? -9.966  -23.216 -23.251 1.00 50.84 ? 83  SER B N   1 
ATOM   1159 C CA  . SER B 1 39  ? -10.582 -22.420 -24.331 1.00 50.68 ? 83  SER B CA  1 
ATOM   1160 C C   . SER B 1 39  ? -9.502  -21.483 -24.868 1.00 50.09 ? 83  SER B C   1 
ATOM   1161 O O   . SER B 1 39  ? -8.320  -21.586 -24.470 1.00 50.06 ? 83  SER B O   1 
ATOM   1162 C CB  . SER B 1 39  ? -11.818 -21.630 -23.849 1.00 50.64 ? 83  SER B CB  1 
ATOM   1163 O OG  . SER B 1 39  ? -11.480 -20.442 -23.150 1.00 52.12 ? 83  SER B OG  1 
ATOM   1164 N N   . ASP B 1 40  ? -9.875  -20.593 -25.785 1.00 49.13 ? 84  ASP B N   1 
ATOM   1165 C CA  . ASP B 1 40  ? -8.880  -19.743 -26.420 1.00 48.11 ? 84  ASP B CA  1 
ATOM   1166 C C   . ASP B 1 40  ? -8.136  -18.982 -25.344 1.00 47.21 ? 84  ASP B C   1 
ATOM   1167 O O   . ASP B 1 40  ? -8.760  -18.396 -24.460 1.00 45.98 ? 84  ASP B O   1 
ATOM   1168 C CB  . ASP B 1 40  ? -9.490  -18.828 -27.471 1.00 47.94 ? 84  ASP B CB  1 
ATOM   1169 C CG  . ASP B 1 40  ? -10.016 -19.601 -28.663 1.00 49.60 ? 84  ASP B CG  1 
ATOM   1170 O OD1 . ASP B 1 40  ? -9.759  -20.839 -28.750 1.00 48.85 ? 84  ASP B OD1 1 
ATOM   1171 O OD2 . ASP B 1 40  ? -10.698 -18.971 -29.497 1.00 49.59 ? 84  ASP B OD2 1 
ATOM   1172 N N   . TRP B 1 41  ? -6.808  -19.070 -25.421 1.00 45.47 ? 85  TRP B N   1 
ATOM   1173 C CA  . TRP B 1 41  ? -5.874  -18.303 -24.580 1.00 45.20 ? 85  TRP B CA  1 
ATOM   1174 C C   . TRP B 1 41  ? -5.722  -18.787 -23.127 1.00 43.62 ? 85  TRP B C   1 
ATOM   1175 O O   . TRP B 1 41  ? -5.031  -18.150 -22.343 1.00 44.46 ? 85  TRP B O   1 
ATOM   1176 C CB  . TRP B 1 41  ? -6.186  -16.790 -24.608 1.00 45.89 ? 85  TRP B CB  1 
ATOM   1177 C CG  . TRP B 1 41  ? -6.221  -16.215 -25.970 1.00 47.93 ? 85  TRP B CG  1 
ATOM   1178 C CD1 . TRP B 1 41  ? -7.339  -15.877 -26.681 1.00 47.02 ? 85  TRP B CD1 1 
ATOM   1179 C CD2 . TRP B 1 41  ? -5.088  -15.928 -26.825 1.00 47.64 ? 85  TRP B CD2 1 
ATOM   1180 N NE1 . TRP B 1 41  ? -6.973  -15.403 -27.922 1.00 49.28 ? 85  TRP B NE1 1 
ATOM   1181 C CE2 . TRP B 1 41  ? -5.607  -15.419 -28.041 1.00 48.20 ? 85  TRP B CE2 1 
ATOM   1182 C CE3 . TRP B 1 41  ? -3.698  -16.052 -26.677 1.00 48.16 ? 85  TRP B CE3 1 
ATOM   1183 C CZ2 . TRP B 1 41  ? -4.787  -15.019 -29.105 1.00 46.81 ? 85  TRP B CZ2 1 
ATOM   1184 C CZ3 . TRP B 1 41  ? -2.880  -15.660 -27.714 1.00 47.21 ? 85  TRP B CZ3 1 
ATOM   1185 C CH2 . TRP B 1 41  ? -3.431  -15.159 -28.938 1.00 49.43 ? 85  TRP B CH2 1 
ATOM   1186 N N   . LYS B 1 42  ? -6.296  -19.937 -22.808 1.00 42.22 ? 86  LYS B N   1 
ATOM   1187 C CA  . LYS B 1 42  ? -6.524  -20.337 -21.455 1.00 42.09 ? 86  LYS B CA  1 
ATOM   1188 C C   . LYS B 1 42  ? -6.253  -21.794 -21.156 1.00 42.35 ? 86  LYS B C   1 
ATOM   1189 O O   . LYS B 1 42  ? -6.851  -22.679 -21.782 1.00 41.33 ? 86  LYS B O   1 
ATOM   1190 C CB  . LYS B 1 42  ? -7.976  -20.096 -21.134 1.00 43.03 ? 86  LYS B CB  1 
ATOM   1191 C CG  . LYS B 1 42  ? -8.117  -19.403 -19.833 1.00 44.17 ? 86  LYS B CG  1 
ATOM   1192 C CD  . LYS B 1 42  ? -8.356  -20.348 -18.697 1.00 45.40 ? 86  LYS B CD  1 
ATOM   1193 C CE  . LYS B 1 42  ? -9.833  -20.231 -18.302 1.00 47.85 ? 86  LYS B CE  1 
ATOM   1194 N NZ  . LYS B 1 42  ? -10.243 -19.563 -16.986 1.00 44.78 ? 86  LYS B NZ  1 
ATOM   1195 N N   . LEU B 1 43  ? -5.374  -22.082 -20.192 1.00 40.84 ? 87  LEU B N   1 
ATOM   1196 C CA  . LEU B 1 43  ? -5.211  -23.490 -19.912 1.00 41.58 ? 87  LEU B CA  1 
ATOM   1197 C C   . LEU B 1 43  ? -5.175  -23.839 -18.476 1.00 39.72 ? 87  LEU B C   1 
ATOM   1198 O O   . LEU B 1 43  ? -4.983  -23.005 -17.659 1.00 39.53 ? 87  LEU B O   1 
ATOM   1199 C CB  . LEU B 1 43  ? -4.044  -24.135 -20.683 1.00 41.60 ? 87  LEU B CB  1 
ATOM   1200 C CG  . LEU B 1 43  ? -2.592  -23.786 -20.550 1.00 46.65 ? 87  LEU B CG  1 
ATOM   1201 C CD1 . LEU B 1 43  ? -2.150  -23.492 -19.155 1.00 48.94 ? 87  LEU B CD1 1 
ATOM   1202 C CD2 . LEU B 1 43  ? -1.933  -25.030 -21.049 1.00 51.60 ? 87  LEU B CD2 1 
ATOM   1203 N N   . GLU B 1 44  ? -5.351  -25.106 -18.194 1.00 39.06 ? 88  GLU B N   1 
ATOM   1204 C CA  . GLU B 1 44  ? -5.343  -25.579 -16.833 1.00 38.84 ? 88  GLU B CA  1 
ATOM   1205 C C   . GLU B 1 44  ? -4.095  -26.384 -16.586 1.00 36.98 ? 88  GLU B C   1 
ATOM   1206 O O   . GLU B 1 44  ? -3.704  -27.181 -17.473 1.00 35.62 ? 88  GLU B O   1 
ATOM   1207 C CB  . GLU B 1 44  ? -6.553  -26.501 -16.634 1.00 38.32 ? 88  GLU B CB  1 
ATOM   1208 C CG  . GLU B 1 44  ? -6.721  -26.978 -15.142 1.00 41.72 ? 88  GLU B CG  1 
ATOM   1209 C CD  . GLU B 1 44  ? -7.779  -28.035 -14.984 1.00 43.30 ? 88  GLU B CD  1 
ATOM   1210 O OE1 . GLU B 1 44  ? -8.645  -28.154 -15.900 1.00 48.47 ? 88  GLU B OE1 1 
ATOM   1211 O OE2 . GLU B 1 44  ? -7.729  -28.769 -13.951 1.00 52.08 ? 88  GLU B OE2 1 
ATOM   1212 N N   . ILE B 1 45  ? -3.521  -26.278 -15.378 1.00 34.76 ? 89  ILE B N   1 
ATOM   1213 C CA  . ILE B 1 45  ? -2.319  -27.061 -15.071 1.00 33.67 ? 89  ILE B CA  1 
ATOM   1214 C C   . ILE B 1 45  ? -2.679  -28.461 -14.501 1.00 34.82 ? 89  ILE B C   1 
ATOM   1215 O O   . ILE B 1 45  ? -3.395  -28.552 -13.519 1.00 35.36 ? 89  ILE B O   1 
ATOM   1216 C CB  . ILE B 1 45  ? -1.322  -26.280 -14.140 1.00 32.81 ? 89  ILE B CB  1 
ATOM   1217 C CG1 . ILE B 1 45  ? -0.834  -24.955 -14.810 1.00 33.65 ? 89  ILE B CG1 1 
ATOM   1218 C CG2 . ILE B 1 45  ? -0.207  -27.163 -13.680 1.00 28.76 ? 89  ILE B CG2 1 
ATOM   1219 C CD1 . ILE B 1 45  ? -0.019  -25.133 -16.175 1.00 34.26 ? 89  ILE B CD1 1 
ATOM   1220 N N   . LEU B 1 46  ? -2.156  -29.539 -15.081 1.00 34.88 ? 90  LEU B N   1 
ATOM   1221 C CA  . LEU B 1 46  ? -2.514  -30.898 -14.612 1.00 36.32 ? 90  LEU B CA  1 
ATOM   1222 C C   . LEU B 1 46  ? -1.410  -31.534 -13.790 1.00 37.32 ? 90  LEU B C   1 
ATOM   1223 O O   . LEU B 1 46  ? -1.524  -32.727 -13.416 1.00 38.40 ? 90  LEU B O   1 
ATOM   1224 C CB  . LEU B 1 46  ? -2.900  -31.870 -15.774 1.00 33.30 ? 90  LEU B CB  1 
ATOM   1225 C CG  . LEU B 1 46  ? -4.012  -31.548 -16.739 1.00 33.69 ? 90  LEU B CG  1 
ATOM   1226 C CD1 . LEU B 1 46  ? -3.942  -32.624 -17.862 1.00 35.19 ? 90  LEU B CD1 1 
ATOM   1227 C CD2 . LEU B 1 46  ? -5.503  -31.495 -16.116 1.00 30.75 ? 90  LEU B CD2 1 
ATOM   1228 N N   . GLN B 1 47  ? -0.331  -30.773 -13.562 1.00 38.32 ? 91  GLN B N   1 
ATOM   1229 C CA  . GLN B 1 47  ? 0.882   -31.284 -12.920 1.00 39.05 ? 91  GLN B CA  1 
ATOM   1230 C C   . GLN B 1 47  ? 1.596   -30.166 -12.150 1.00 38.14 ? 91  GLN B C   1 
ATOM   1231 O O   . GLN B 1 47  ? 1.799   -29.081 -12.676 1.00 38.38 ? 91  GLN B O   1 
ATOM   1232 C CB  . GLN B 1 47  ? 1.833   -31.820 -13.979 1.00 37.36 ? 91  GLN B CB  1 
ATOM   1233 C CG  . GLN B 1 47  ? 1.709   -33.246 -14.333 1.00 42.35 ? 91  GLN B CG  1 
ATOM   1234 C CD  . GLN B 1 47  ? 2.901   -33.731 -15.231 1.00 43.93 ? 91  GLN B CD  1 
ATOM   1235 O OE1 . GLN B 1 47  ? 2.727   -34.066 -16.420 1.00 51.28 ? 91  GLN B OE1 1 
ATOM   1236 N NE2 . GLN B 1 47  ? 4.106   -33.776 -14.644 1.00 47.42 ? 91  GLN B NE2 1 
ATOM   1237 N N   . ASN B 1 48  ? 1.942   -30.446 -10.907 1.00 37.65 ? 92  ASN B N   1 
ATOM   1238 C CA  . ASN B 1 48  ? 2.775   -29.606 -10.113 1.00 37.17 ? 92  ASN B CA  1 
ATOM   1239 C C   . ASN B 1 48  ? 4.156   -29.521 -10.788 1.00 36.48 ? 92  ASN B C   1 
ATOM   1240 O O   . ASN B 1 48  ? 4.691   -30.498 -11.281 1.00 37.25 ? 92  ASN B O   1 
ATOM   1241 C CB  . ASN B 1 48  ? 2.949   -30.258 -8.750  1.00 37.58 ? 92  ASN B CB  1 
ATOM   1242 C CG  . ASN B 1 48  ? 1.653   -30.337 -7.935  1.00 40.42 ? 92  ASN B CG  1 
ATOM   1243 O OD1 . ASN B 1 48  ? 0.611   -29.749 -8.257  1.00 47.97 ? 92  ASN B OD1 1 
ATOM   1244 N ND2 . ASN B 1 48  ? 1.737   -31.041 -6.847  1.00 41.41 ? 92  ASN B ND2 1 
ATOM   1245 N N   . GLY B 1 49  ? 4.767   -28.369 -10.802 1.00 34.55 ? 93  GLY B N   1 
ATOM   1246 C CA  . GLY B 1 49  ? 6.081   -28.308 -11.364 1.00 32.87 ? 93  GLY B CA  1 
ATOM   1247 C C   . GLY B 1 49  ? 6.475   -26.893 -11.473 1.00 33.56 ? 93  GLY B C   1 
ATOM   1248 O O   . GLY B 1 49  ? 5.707   -26.000 -11.049 1.00 34.68 ? 93  GLY B O   1 
ATOM   1249 N N   . LEU B 1 50  ? 7.678   -26.709 -12.020 1.00 31.98 ? 94  LEU B N   1 
ATOM   1250 C CA  . LEU B 1 50  ? 8.283   -25.454 -12.252 1.00 31.34 ? 94  LEU B CA  1 
ATOM   1251 C C   . LEU B 1 50  ? 8.122   -25.277 -13.756 1.00 31.71 ? 94  LEU B C   1 
ATOM   1252 O O   . LEU B 1 50  ? 8.635   -26.102 -14.533 1.00 30.37 ? 94  LEU B O   1 
ATOM   1253 C CB  . LEU B 1 50  ? 9.804   -25.528 -11.865 1.00 31.24 ? 94  LEU B CB  1 
ATOM   1254 C CG  . LEU B 1 50  ? 10.581  -24.255 -12.159 1.00 31.94 ? 94  LEU B CG  1 
ATOM   1255 C CD1 . LEU B 1 50  ? 9.924   -23.090 -11.314 1.00 26.09 ? 94  LEU B CD1 1 
ATOM   1256 C CD2 . LEU B 1 50  ? 12.106  -24.372 -11.934 1.00 29.21 ? 94  LEU B CD2 1 
ATOM   1257 N N   . TYR B 1 51  ? 7.480   -24.187 -14.162 1.00 30.12 ? 95  TYR B N   1 
ATOM   1258 C CA  . TYR B 1 51  ? 7.107   -24.006 -15.558 1.00 31.87 ? 95  TYR B CA  1 
ATOM   1259 C C   . TYR B 1 51  ? 7.636   -22.665 -16.015 1.00 32.51 ? 95  TYR B C   1 
ATOM   1260 O O   . TYR B 1 51  ? 7.720   -21.723 -15.253 1.00 32.94 ? 95  TYR B O   1 
ATOM   1261 C CB  . TYR B 1 51  ? 5.564   -23.951 -15.752 1.00 31.39 ? 95  TYR B CB  1 
ATOM   1262 C CG  . TYR B 1 51  ? 4.807   -25.230 -15.542 1.00 30.96 ? 95  TYR B CG  1 
ATOM   1263 C CD1 . TYR B 1 51  ? 4.411   -25.653 -14.252 1.00 30.03 ? 95  TYR B CD1 1 
ATOM   1264 C CD2 . TYR B 1 51  ? 4.495   -26.046 -16.618 1.00 30.52 ? 95  TYR B CD2 1 
ATOM   1265 C CE1 . TYR B 1 51  ? 3.753   -26.854 -14.079 1.00 28.46 ? 95  TYR B CE1 1 
ATOM   1266 C CE2 . TYR B 1 51  ? 3.772   -27.247 -16.445 1.00 29.04 ? 95  TYR B CE2 1 
ATOM   1267 C CZ  . TYR B 1 51  ? 3.426   -27.637 -15.196 1.00 31.58 ? 95  TYR B CZ  1 
ATOM   1268 O OH  . TYR B 1 51  ? 2.740   -28.822 -15.087 1.00 30.46 ? 95  TYR B OH  1 
ATOM   1269 N N   . LEU B 1 52  ? 7.910   -22.577 -17.301 1.00 33.44 ? 96  LEU B N   1 
ATOM   1270 C CA  . LEU B 1 52  ? 8.376   -21.366 -17.918 1.00 33.77 ? 96  LEU B CA  1 
ATOM   1271 C C   . LEU B 1 52  ? 7.301   -20.948 -18.863 1.00 31.92 ? 96  LEU B C   1 
ATOM   1272 O O   . LEU B 1 52  ? 6.908   -21.693 -19.724 1.00 30.77 ? 96  LEU B O   1 
ATOM   1273 C CB  . LEU B 1 52  ? 9.661   -21.639 -18.683 1.00 35.07 ? 96  LEU B CB  1 
ATOM   1274 C CG  . LEU B 1 52  ? 10.623  -20.528 -18.996 1.00 40.90 ? 96  LEU B CG  1 
ATOM   1275 C CD1 . LEU B 1 52  ? 9.879   -19.237 -19.575 1.00 41.93 ? 96  LEU B CD1 1 
ATOM   1276 C CD2 . LEU B 1 52  ? 11.307  -20.242 -17.673 1.00 41.82 ? 96  LEU B CD2 1 
ATOM   1277 N N   . ILE B 1 53  ? 6.805   -19.740 -18.680 1.00 31.48 ? 97  ILE B N   1 
ATOM   1278 C CA  . ILE B 1 53  ? 5.748   -19.222 -19.533 1.00 31.12 ? 97  ILE B CA  1 
ATOM   1279 C C   . ILE B 1 53  ? 6.462   -18.236 -20.466 1.00 30.73 ? 97  ILE B C   1 
ATOM   1280 O O   . ILE B 1 53  ? 7.288   -17.451 -20.075 1.00 32.64 ? 97  ILE B O   1 
ATOM   1281 C CB  . ILE B 1 53  ? 4.607   -18.556 -18.702 1.00 30.84 ? 97  ILE B CB  1 
ATOM   1282 C CG1 . ILE B 1 53  ? 3.939   -19.600 -17.824 1.00 29.32 ? 97  ILE B CG1 1 
ATOM   1283 C CG2 . ILE B 1 53  ? 3.555   -17.760 -19.617 1.00 30.37 ? 97  ILE B CG2 1 
ATOM   1284 C CD1 . ILE B 1 53  ? 2.901   -19.028 -16.933 1.00 29.38 ? 97  ILE B CD1 1 
ATOM   1285 N N   . TYR B 1 54  ? 6.126   -18.259 -21.718 1.00 30.95 ? 98  TYR B N   1 
ATOM   1286 C CA  . TYR B 1 54  ? 6.764   -17.373 -22.659 1.00 31.63 ? 98  TYR B CA  1 
ATOM   1287 C C   . TYR B 1 54  ? 5.681   -16.838 -23.628 1.00 32.63 ? 98  TYR B C   1 
ATOM   1288 O O   . TYR B 1 54  ? 4.546   -17.270 -23.579 1.00 32.92 ? 98  TYR B O   1 
ATOM   1289 C CB  . TYR B 1 54  ? 7.855   -18.152 -23.395 1.00 30.27 ? 98  TYR B CB  1 
ATOM   1290 C CG  . TYR B 1 54  ? 7.375   -19.169 -24.356 1.00 28.16 ? 98  TYR B CG  1 
ATOM   1291 C CD1 . TYR B 1 54  ? 7.179   -18.831 -25.715 1.00 31.29 ? 98  TYR B CD1 1 
ATOM   1292 C CD2 . TYR B 1 54  ? 7.160   -20.474 -23.951 1.00 31.00 ? 98  TYR B CD2 1 
ATOM   1293 C CE1 . TYR B 1 54  ? 6.738   -19.773 -26.620 1.00 30.07 ? 98  TYR B CE1 1 
ATOM   1294 C CE2 . TYR B 1 54  ? 6.730   -21.430 -24.825 1.00 28.19 ? 98  TYR B CE2 1 
ATOM   1295 C CZ  . TYR B 1 54  ? 6.501   -21.079 -26.168 1.00 32.82 ? 98  TYR B CZ  1 
ATOM   1296 O OH  . TYR B 1 54  ? 6.037   -22.035 -27.077 1.00 32.52 ? 98  TYR B OH  1 
ATOM   1297 N N   . GLY B 1 55  ? 6.055   -15.894 -24.487 1.00 34.29 ? 99  GLY B N   1 
ATOM   1298 C CA  . GLY B 1 55  ? 5.208   -15.480 -25.585 1.00 34.77 ? 99  GLY B CA  1 
ATOM   1299 C C   . GLY B 1 55  ? 5.386   -14.029 -25.933 1.00 36.95 ? 99  GLY B C   1 
ATOM   1300 O O   . GLY B 1 55  ? 6.288   -13.365 -25.483 1.00 36.79 ? 99  GLY B O   1 
ATOM   1301 N N   . GLN B 1 56  ? 4.468   -13.517 -26.724 1.00 38.44 ? 100 GLN B N   1 
ATOM   1302 C CA  . GLN B 1 56  ? 4.688   -12.253 -27.312 1.00 40.95 ? 100 GLN B CA  1 
ATOM   1303 C C   . GLN B 1 56  ? 3.327   -11.642 -27.587 1.00 41.66 ? 100 GLN B C   1 
ATOM   1304 O O   . GLN B 1 56  ? 2.374   -12.321 -27.951 1.00 40.89 ? 100 GLN B O   1 
ATOM   1305 C CB  . GLN B 1 56  ? 5.544   -12.430 -28.575 1.00 41.64 ? 100 GLN B CB  1 
ATOM   1306 C CG  . GLN B 1 56  ? 5.184   -11.582 -29.709 1.00 44.18 ? 100 GLN B CG  1 
ATOM   1307 C CD  . GLN B 1 56  ? 6.097   -11.807 -30.882 1.00 49.07 ? 100 GLN B CD  1 
ATOM   1308 O OE1 . GLN B 1 56  ? 5.681   -11.614 -32.035 1.00 47.91 ? 100 GLN B OE1 1 
ATOM   1309 N NE2 . GLN B 1 56  ? 7.364   -12.212 -30.607 1.00 47.21 ? 100 GLN B NE2 1 
ATOM   1310 N N   . VAL B 1 57  ? 3.268   -10.357 -27.298 1.00 43.16 ? 101 VAL B N   1 
ATOM   1311 C CA  . VAL B 1 57  ? 2.088   -9.548  -27.476 1.00 44.34 ? 101 VAL B CA  1 
ATOM   1312 C C   . VAL B 1 57  ? 2.546   -8.510  -28.475 1.00 46.72 ? 101 VAL B C   1 
ATOM   1313 O O   . VAL B 1 57  ? 3.478   -7.755  -28.195 1.00 47.11 ? 101 VAL B O   1 
ATOM   1314 C CB  . VAL B 1 57  ? 1.602   -8.945  -26.099 1.00 43.75 ? 101 VAL B CB  1 
ATOM   1315 C CG1 . VAL B 1 57  ? 0.890   -7.554  -26.250 1.00 43.44 ? 101 VAL B CG1 1 
ATOM   1316 C CG2 . VAL B 1 57  ? 0.718   -9.940  -25.378 1.00 37.24 ? 101 VAL B CG2 1 
ATOM   1317 N N   . ALA B 1 58  ? 1.943   -8.539  -29.669 1.00 49.61 ? 102 ALA B N   1 
ATOM   1318 C CA  . ALA B 1 58  ? 2.220   -7.582  -30.767 1.00 51.36 ? 102 ALA B CA  1 
ATOM   1319 C C   . ALA B 1 58  ? 1.068   -6.570  -30.911 1.00 53.05 ? 102 ALA B C   1 
ATOM   1320 O O   . ALA B 1 58  ? 0.009   -6.914  -31.464 1.00 54.00 ? 102 ALA B O   1 
ATOM   1321 C CB  . ALA B 1 58  ? 2.412   -8.336  -32.052 1.00 51.02 ? 102 ALA B CB  1 
ATOM   1322 N N   . PRO B 1 59  ? 1.220   -5.347  -30.346 1.00 54.16 ? 103 PRO B N   1 
ATOM   1323 C CA  . PRO B 1 59  ? 0.131   -4.337  -30.382 1.00 54.85 ? 103 PRO B CA  1 
ATOM   1324 C C   . PRO B 1 59  ? -0.018  -3.548  -31.686 1.00 55.60 ? 103 PRO B C   1 
ATOM   1325 O O   . PRO B 1 59  ? -1.139  -3.097  -31.996 1.00 56.83 ? 103 PRO B O   1 
ATOM   1326 C CB  . PRO B 1 59  ? 0.487   -3.389  -29.210 1.00 55.13 ? 103 PRO B CB  1 
ATOM   1327 C CG  . PRO B 1 59  ? 1.566   -4.138  -28.404 1.00 54.94 ? 103 PRO B CG  1 
ATOM   1328 C CD  . PRO B 1 59  ? 2.330   -4.862  -29.517 1.00 54.31 ? 103 PRO B CD  1 
ATOM   1329 N N   . VAL B 1 71  ? -2.927  -7.695  -23.134 1.00 49.68 ? 115 VAL B N   1 
ATOM   1330 C CA  . VAL B 1 71  ? -2.767  -6.764  -21.971 1.00 48.83 ? 115 VAL B CA  1 
ATOM   1331 C C   . VAL B 1 71  ? -2.512  -7.422  -20.568 1.00 47.93 ? 115 VAL B C   1 
ATOM   1332 O O   . VAL B 1 71  ? -1.682  -6.945  -19.809 1.00 48.78 ? 115 VAL B O   1 
ATOM   1333 C CB  . VAL B 1 71  ? -3.779  -5.510  -21.915 1.00 48.08 ? 115 VAL B CB  1 
ATOM   1334 C CG1 . VAL B 1 71  ? -3.171  -4.267  -22.578 1.00 48.82 ? 115 VAL B CG1 1 
ATOM   1335 C CG2 . VAL B 1 71  ? -5.118  -5.793  -22.515 1.00 47.01 ? 115 VAL B CG2 1 
ATOM   1336 N N   . ARG B 1 72  ? -3.158  -8.525  -20.224 1.00 45.77 ? 116 ARG B N   1 
ATOM   1337 C CA  . ARG B 1 72  ? -2.741  -9.106  -18.969 1.00 44.06 ? 116 ARG B CA  1 
ATOM   1338 C C   . ARG B 1 72  ? -2.795  -10.617 -18.714 1.00 42.15 ? 116 ARG B C   1 
ATOM   1339 O O   . ARG B 1 72  ? -3.738  -11.345 -19.081 1.00 40.87 ? 116 ARG B O   1 
ATOM   1340 C CB  . ARG B 1 72  ? -3.217  -8.271  -17.771 1.00 44.70 ? 116 ARG B CB  1 
ATOM   1341 C CG  . ARG B 1 72  ? -4.691  -8.181  -17.548 1.00 47.47 ? 116 ARG B CG  1 
ATOM   1342 C CD  . ARG B 1 72  ? -5.148  -6.768  -17.719 1.00 52.82 ? 116 ARG B CD  1 
ATOM   1343 N NE  . ARG B 1 72  ? -4.735  -5.892  -16.630 1.00 57.62 ? 116 ARG B NE  1 
ATOM   1344 C CZ  . ARG B 1 72  ? -4.671  -4.553  -16.713 1.00 62.03 ? 116 ARG B CZ  1 
ATOM   1345 N NH1 . ARG B 1 72  ? -4.972  -3.897  -17.860 1.00 60.69 ? 116 ARG B NH1 1 
ATOM   1346 N NH2 . ARG B 1 72  ? -4.272  -3.860  -15.641 1.00 60.91 ? 116 ARG B NH2 1 
ATOM   1347 N N   . LEU B 1 73  ? -1.741  -11.066 -18.034 1.00 39.20 ? 117 LEU B N   1 
ATOM   1348 C CA  . LEU B 1 73  ? -1.575  -12.489 -17.719 1.00 37.73 ? 117 LEU B CA  1 
ATOM   1349 C C   . LEU B 1 73  ? -2.113  -12.773 -16.322 1.00 35.05 ? 117 LEU B C   1 
ATOM   1350 O O   . LEU B 1 73  ? -1.844  -11.988 -15.392 1.00 36.00 ? 117 LEU B O   1 
ATOM   1351 C CB  . LEU B 1 73  ? -0.091  -12.817 -17.806 1.00 36.50 ? 117 LEU B CB  1 
ATOM   1352 C CG  . LEU B 1 73  ? 0.483   -14.064 -18.444 1.00 38.91 ? 117 LEU B CG  1 
ATOM   1353 C CD1 . LEU B 1 73  ? 1.738   -14.326 -17.682 1.00 34.68 ? 117 LEU B CD1 1 
ATOM   1354 C CD2 . LEU B 1 73  ? -0.344  -15.303 -18.436 1.00 38.69 ? 117 LEU B CD2 1 
ATOM   1355 N N   . TYR B 1 74  ? -2.895  -13.846 -16.181 1.00 32.51 ? 118 TYR B N   1 
ATOM   1356 C CA  . TYR B 1 74  ? -3.483  -14.248 -14.908 1.00 31.45 ? 118 TYR B CA  1 
ATOM   1357 C C   . TYR B 1 74  ? -3.146  -15.696 -14.500 1.00 31.37 ? 118 TYR B C   1 
ATOM   1358 O O   . TYR B 1 74  ? -3.100  -16.598 -15.339 1.00 29.90 ? 118 TYR B O   1 
ATOM   1359 C CB  . TYR B 1 74  ? -5.005  -14.162 -15.007 1.00 32.95 ? 118 TYR B CB  1 
ATOM   1360 C CG  . TYR B 1 74  ? -5.583  -12.775 -15.043 1.00 32.66 ? 118 TYR B CG  1 
ATOM   1361 C CD1 . TYR B 1 74  ? -5.538  -12.012 -16.200 1.00 37.28 ? 118 TYR B CD1 1 
ATOM   1362 C CD2 . TYR B 1 74  ? -6.209  -12.229 -13.921 1.00 34.73 ? 118 TYR B CD2 1 
ATOM   1363 C CE1 . TYR B 1 74  ? -6.087  -10.756 -16.251 1.00 35.02 ? 118 TYR B CE1 1 
ATOM   1364 C CE2 . TYR B 1 74  ? -6.725  -10.922 -13.928 1.00 28.29 ? 118 TYR B CE2 1 
ATOM   1365 C CZ  . TYR B 1 74  ? -6.680  -10.202 -15.115 1.00 34.91 ? 118 TYR B CZ  1 
ATOM   1366 O OH  . TYR B 1 74  ? -7.246  -8.893  -15.185 1.00 37.38 ? 118 TYR B OH  1 
ATOM   1367 N N   . LYS B 1 75  ? -2.992  -15.899 -13.197 1.00 31.98 ? 119 LYS B N   1 
ATOM   1368 C CA  . LYS B 1 75  ? -3.011  -17.211 -12.587 1.00 31.93 ? 119 LYS B CA  1 
ATOM   1369 C C   . LYS B 1 75  ? -4.201  -17.310 -11.595 1.00 33.90 ? 119 LYS B C   1 
ATOM   1370 O O   . LYS B 1 75  ? -4.265  -16.605 -10.574 1.00 32.23 ? 119 LYS B O   1 
ATOM   1371 C CB  . LYS B 1 75  ? -1.665  -17.412 -11.893 1.00 32.10 ? 119 LYS B CB  1 
ATOM   1372 C CG  . LYS B 1 75  ? -1.541  -18.639 -11.010 1.00 30.61 ? 119 LYS B CG  1 
ATOM   1373 C CD  . LYS B 1 75  ? -0.274  -18.704 -10.252 1.00 28.29 ? 119 LYS B CD  1 
ATOM   1374 C CE  . LYS B 1 75  ? -0.439  -19.874 -9.335  1.00 39.08 ? 119 LYS B CE  1 
ATOM   1375 N NZ  . LYS B 1 75  ? 0.661   -20.105 -8.306  1.00 41.64 ? 119 LYS B NZ  1 
ATOM   1376 N N   . ASN B 1 76  ? -5.171  -18.188 -11.825 1.00 35.18 ? 120 ASN B N   1 
ATOM   1377 C CA  . ASN B 1 76  ? -6.323  -18.221 -10.858 1.00 35.89 ? 120 ASN B CA  1 
ATOM   1378 C C   . ASN B 1 76  ? -6.796  -16.822 -10.356 1.00 36.37 ? 120 ASN B C   1 
ATOM   1379 O O   . ASN B 1 76  ? -6.894  -16.484 -9.056  1.00 36.76 ? 120 ASN B O   1 
ATOM   1380 C CB  . ASN B 1 76  ? -6.042  -19.051 -9.636  1.00 35.95 ? 120 ASN B CB  1 
ATOM   1381 C CG  . ASN B 1 76  ? -5.570  -20.342 -9.973  1.00 33.73 ? 120 ASN B CG  1 
ATOM   1382 O OD1 . ASN B 1 76  ? -6.007  -20.921 -10.967 1.00 30.78 ? 120 ASN B OD1 1 
ATOM   1383 N ND2 . ASN B 1 76  ? -4.642  -20.836 -9.188  1.00 31.95 ? 120 ASN B ND2 1 
ATOM   1384 N N   . LYS B 1 77  ? -7.169  -16.099 -11.409 1.00 34.50 ? 121 LYS B N   1 
ATOM   1385 C CA  . LYS B 1 77  ? -7.898  -14.886 -11.371 1.00 33.01 ? 121 LYS B CA  1 
ATOM   1386 C C   . LYS B 1 77  ? -7.085  -13.727 -10.820 1.00 30.99 ? 121 LYS B C   1 
ATOM   1387 O O   . LYS B 1 77  ? -7.592  -12.631 -10.663 1.00 31.75 ? 121 LYS B O   1 
ATOM   1388 C CB  . LYS B 1 77  ? -9.256  -15.151 -10.731 1.00 34.63 ? 121 LYS B CB  1 
ATOM   1389 C CG  . LYS B 1 77  ? -10.145 -16.078 -11.650 1.00 36.53 ? 121 LYS B CG  1 
ATOM   1390 C CD  . LYS B 1 77  ? -11.651 -15.803 -11.367 1.00 41.10 ? 121 LYS B CD  1 
ATOM   1391 C CE  . LYS B 1 77  ? -12.607 -16.654 -12.241 1.00 39.72 ? 121 LYS B CE  1 
ATOM   1392 N NZ  . LYS B 1 77  ? -13.891 -16.926 -11.488 1.00 44.68 ? 121 LYS B NZ  1 
ATOM   1393 N N   . ASP B 1 78  ? -5.820  -13.946 -10.501 1.00 28.57 ? 122 ASP B N   1 
ATOM   1394 C CA  . ASP B 1 78  ? -5.046  -12.802 -10.019 1.00 29.92 ? 122 ASP B CA  1 
ATOM   1395 C C   . ASP B 1 78  ? -4.095  -12.392 -11.158 1.00 30.83 ? 122 ASP B C   1 
ATOM   1396 O O   . ASP B 1 78  ? -3.483  -13.240 -11.822 1.00 29.26 ? 122 ASP B O   1 
ATOM   1397 C CB  . ASP B 1 78  ? -4.225  -13.046 -8.739  1.00 27.03 ? 122 ASP B CB  1 
ATOM   1398 C CG  . ASP B 1 78  ? -5.022  -13.452 -7.522  1.00 29.84 ? 122 ASP B CG  1 
ATOM   1399 O OD1 . ASP B 1 78  ? -4.338  -13.768 -6.527  1.00 28.84 ? 122 ASP B OD1 1 
ATOM   1400 O OD2 . ASP B 1 78  ? -6.280  -13.482 -7.469  1.00 33.40 ? 122 ASP B OD2 1 
ATOM   1401 N N   . MET B 1 79  ? -3.902  -11.084 -11.313 1.00 31.98 ? 123 MET B N   1 
ATOM   1402 C CA  . MET B 1 79  ? -2.965  -10.610 -12.366 1.00 32.08 ? 123 MET B CA  1 
ATOM   1403 C C   . MET B 1 79  ? -1.486  -10.783 -11.929 1.00 31.25 ? 123 MET B C   1 
ATOM   1404 O O   . MET B 1 79  ? -1.064  -10.416 -10.769 1.00 32.91 ? 123 MET B O   1 
ATOM   1405 C CB  . MET B 1 79  ? -3.299  -9.200  -12.863 1.00 31.59 ? 123 MET B CB  1 
ATOM   1406 C CG  . MET B 1 79  ? -2.325  -8.705  -14.014 1.00 33.50 ? 123 MET B CG  1 
ATOM   1407 S SD  . MET B 1 79  ? -0.828  -7.890  -13.333 1.00 41.08 ? 123 MET B SD  1 
ATOM   1408 C CE  . MET B 1 79  ? -1.562  -6.489  -12.431 1.00 34.98 ? 123 MET B CE  1 
ATOM   1409 N N   . ILE B 1 80  ? -0.749  -11.433 -12.817 1.00 29.95 ? 124 ILE B N   1 
ATOM   1410 C CA  . ILE B 1 80  ? 0.683   -11.690 -12.660 1.00 29.97 ? 124 ILE B CA  1 
ATOM   1411 C C   . ILE B 1 80  ? 1.582   -10.835 -13.626 1.00 31.49 ? 124 ILE B C   1 
ATOM   1412 O O   . ILE B 1 80  ? 2.720   -10.524 -13.312 1.00 29.07 ? 124 ILE B O   1 
ATOM   1413 C CB  . ILE B 1 80  ? 1.035   -13.255 -12.726 1.00 31.54 ? 124 ILE B CB  1 
ATOM   1414 C CG1 . ILE B 1 80  ? 0.580   -13.925 -14.054 1.00 26.17 ? 124 ILE B CG1 1 
ATOM   1415 C CG2 . ILE B 1 80  ? 0.394   -14.015 -11.498 1.00 27.03 ? 124 ILE B CG2 1 
ATOM   1416 C CD1 . ILE B 1 80  ? 1.023   -15.385 -14.158 1.00 27.24 ? 124 ILE B CD1 1 
ATOM   1417 N N   . GLN B 1 81  ? 1.083   -10.478 -14.802 1.00 33.55 ? 125 GLN B N   1 
ATOM   1418 C CA  . GLN B 1 81  ? 1.813   -9.533  -15.627 1.00 36.05 ? 125 GLN B CA  1 
ATOM   1419 C C   . GLN B 1 81  ? 0.824   -8.597  -16.283 1.00 36.98 ? 125 GLN B C   1 
ATOM   1420 O O   . GLN B 1 81  ? -0.258  -9.033  -16.669 1.00 35.83 ? 125 GLN B O   1 
ATOM   1421 C CB  . GLN B 1 81  ? 2.604   -10.318 -16.672 1.00 36.19 ? 125 GLN B CB  1 
ATOM   1422 C CG  . GLN B 1 81  ? 3.746   -9.555  -17.275 1.00 39.35 ? 125 GLN B CG  1 
ATOM   1423 C CD  . GLN B 1 81  ? 4.308   -10.287 -18.441 1.00 45.81 ? 125 GLN B CD  1 
ATOM   1424 O OE1 . GLN B 1 81  ? 3.893   -11.424 -18.736 1.00 45.38 ? 125 GLN B OE1 1 
ATOM   1425 N NE2 . GLN B 1 81  ? 5.249   -9.645  -19.148 1.00 46.56 ? 125 GLN B NE2 1 
ATOM   1426 N N   . THR B 1 82  ? 1.158   -7.310  -16.410 1.00 40.00 ? 126 THR B N   1 
ATOM   1427 C CA  . THR B 1 82  ? 0.286   -6.476  -17.282 1.00 44.68 ? 126 THR B CA  1 
ATOM   1428 C C   . THR B 1 82  ? 1.099   -5.787  -18.366 1.00 45.99 ? 126 THR B C   1 
ATOM   1429 O O   . THR B 1 82  ? 2.048   -5.066  -18.061 1.00 46.63 ? 126 THR B O   1 
ATOM   1430 C CB  . THR B 1 82  ? -0.620  -5.451  -16.518 1.00 44.84 ? 126 THR B CB  1 
ATOM   1431 O OG1 . THR B 1 82  ? 0.174   -4.418  -15.909 1.00 48.91 ? 126 THR B OG1 1 
ATOM   1432 C CG2 . THR B 1 82  ? -1.371  -6.107  -15.439 1.00 44.75 ? 126 THR B CG2 1 
ATOM   1433 N N   . LEU B 1 83  ? 0.772   -6.046  -19.627 1.00 48.26 ? 127 LEU B N   1 
ATOM   1434 C CA  . LEU B 1 83  ? 1.421   -5.310  -20.724 1.00 50.91 ? 127 LEU B CA  1 
ATOM   1435 C C   . LEU B 1 83  ? 0.688   -4.020  -21.118 1.00 52.18 ? 127 LEU B C   1 
ATOM   1436 O O   . LEU B 1 83  ? -0.530  -3.923  -20.989 1.00 52.67 ? 127 LEU B O   1 
ATOM   1437 C CB  . LEU B 1 83  ? 1.661   -6.207  -21.949 1.00 51.30 ? 127 LEU B CB  1 
ATOM   1438 C CG  . LEU B 1 83  ? 2.607   -7.408  -21.799 1.00 51.67 ? 127 LEU B CG  1 
ATOM   1439 C CD1 . LEU B 1 83  ? 3.761   -7.079  -20.849 1.00 49.90 ? 127 LEU B CD1 1 
ATOM   1440 C CD2 . LEU B 1 83  ? 1.818   -8.632  -21.314 1.00 52.65 ? 127 LEU B CD2 1 
ATOM   1441 N N   . THR B 1 84  ? 1.457   -3.017  -21.551 1.00 54.44 ? 128 THR B N   1 
ATOM   1442 C CA  . THR B 1 84  ? 0.924   -1.810  -22.232 1.00 54.94 ? 128 THR B CA  1 
ATOM   1443 C C   . THR B 1 84  ? 1.793   -1.396  -23.450 1.00 55.30 ? 128 THR B C   1 
ATOM   1444 O O   . THR B 1 84  ? 2.703   -0.556  -23.366 1.00 55.26 ? 128 THR B O   1 
ATOM   1445 C CB  . THR B 1 84  ? 0.679   -0.614  -21.263 1.00 55.21 ? 128 THR B CB  1 
ATOM   1446 O OG1 . THR B 1 84  ? 0.044   -1.073  -20.054 1.00 54.80 ? 128 THR B OG1 1 
ATOM   1447 C CG2 . THR B 1 84  ? -0.221  0.445   -21.947 1.00 55.74 ? 128 THR B CG2 1 
ATOM   1448 N N   . LYS B 1 88  ? 4.779   -1.204  -28.771 1.00 64.37 ? 132 LYS B N   1 
ATOM   1449 C CA  . LYS B 1 88  ? 5.861   -2.146  -29.103 1.00 64.19 ? 132 LYS B CA  1 
ATOM   1450 C C   . LYS B 1 88  ? 5.501   -3.562  -28.660 1.00 63.92 ? 132 LYS B C   1 
ATOM   1451 O O   . LYS B 1 88  ? 4.730   -3.749  -27.705 1.00 63.41 ? 132 LYS B O   1 
ATOM   1452 C CB  . LYS B 1 88  ? 7.200   -1.711  -28.465 1.00 64.21 ? 132 LYS B CB  1 
ATOM   1453 N N   . ILE B 1 89  ? 6.056   -4.547  -29.371 1.00 63.45 ? 133 ILE B N   1 
ATOM   1454 C CA  . ILE B 1 89  ? 5.874   -5.962  -29.020 1.00 62.46 ? 133 ILE B CA  1 
ATOM   1455 C C   . ILE B 1 89  ? 6.582   -6.276  -27.700 1.00 61.52 ? 133 ILE B C   1 
ATOM   1456 O O   . ILE B 1 89  ? 7.771   -6.023  -27.548 1.00 62.32 ? 133 ILE B O   1 
ATOM   1457 C CB  . ILE B 1 89  ? 6.307   -6.915  -30.180 1.00 62.80 ? 133 ILE B CB  1 
ATOM   1458 C CG1 . ILE B 1 89  ? 5.342   -6.773  -31.383 1.00 62.38 ? 133 ILE B CG1 1 
ATOM   1459 C CG2 . ILE B 1 89  ? 6.427   -8.371  -29.685 1.00 62.83 ? 133 ILE B CG2 1 
ATOM   1460 C CD1 . ILE B 1 89  ? 5.769   -7.484  -32.678 1.00 61.90 ? 133 ILE B CD1 1 
ATOM   1461 N N   . GLN B 1 90  ? 5.835   -6.794  -26.738 1.00 60.17 ? 134 GLN B N   1 
ATOM   1462 C CA  . GLN B 1 90  ? 6.404   -7.131  -25.442 1.00 58.76 ? 134 GLN B CA  1 
ATOM   1463 C C   . GLN B 1 90  ? 6.421   -8.645  -25.167 1.00 56.47 ? 134 GLN B C   1 
ATOM   1464 O O   . GLN B 1 90  ? 5.724   -9.434  -25.836 1.00 54.99 ? 134 GLN B O   1 
ATOM   1465 C CB  . GLN B 1 90  ? 5.689   -6.371  -24.312 1.00 59.68 ? 134 GLN B CB  1 
ATOM   1466 C CG  . GLN B 1 90  ? 5.547   -4.852  -24.525 1.00 62.95 ? 134 GLN B CG  1 
ATOM   1467 C CD  . GLN B 1 90  ? 4.080   -4.402  -24.715 1.00 67.08 ? 134 GLN B CD  1 
ATOM   1468 O OE1 . GLN B 1 90  ? 3.457   -3.886  -23.775 1.00 69.83 ? 134 GLN B OE1 1 
ATOM   1469 N NE2 . GLN B 1 90  ? 3.533   -4.596  -25.921 1.00 65.97 ? 134 GLN B NE2 1 
ATOM   1470 N N   . ASN B 1 91  ? 7.255   -9.013  -24.188 1.00 53.96 ? 135 ASN B N   1 
ATOM   1471 C CA  . ASN B 1 91  ? 7.432   -10.383 -23.717 1.00 52.55 ? 135 ASN B CA  1 
ATOM   1472 C C   . ASN B 1 91  ? 6.413   -10.785 -22.681 1.00 49.86 ? 135 ASN B C   1 
ATOM   1473 O O   . ASN B 1 91  ? 6.269   -10.111 -21.675 1.00 50.06 ? 135 ASN B O   1 
ATOM   1474 C CB  . ASN B 1 91  ? 8.754   -10.498 -22.989 1.00 53.58 ? 135 ASN B CB  1 
ATOM   1475 C CG  . ASN B 1 91  ? 9.927   -10.336 -23.887 1.00 57.67 ? 135 ASN B CG  1 
ATOM   1476 O OD1 . ASN B 1 91  ? 9.848   -9.683  -24.953 1.00 62.87 ? 135 ASN B OD1 1 
ATOM   1477 N ND2 . ASN B 1 91  ? 11.064  -10.923 -23.463 1.00 61.41 ? 135 ASN B ND2 1 
ATOM   1478 N N   . VAL B 1 92  ? 5.746   -11.902 -22.896 1.00 46.75 ? 136 VAL B N   1 
ATOM   1479 C CA  . VAL B 1 92  ? 4.858   -12.448 -21.880 1.00 43.45 ? 136 VAL B CA  1 
ATOM   1480 C C   . VAL B 1 92  ? 5.557   -13.537 -21.018 1.00 40.49 ? 136 VAL B C   1 
ATOM   1481 O O   . VAL B 1 92  ? 6.332   -14.352 -21.529 1.00 39.95 ? 136 VAL B O   1 
ATOM   1482 C CB  . VAL B 1 92  ? 3.417   -12.774 -22.463 1.00 42.86 ? 136 VAL B CB  1 
ATOM   1483 C CG1 . VAL B 1 92  ? 3.424   -12.798 -23.917 1.00 45.25 ? 136 VAL B CG1 1 
ATOM   1484 C CG2 . VAL B 1 92  ? 2.820   -14.052 -21.908 1.00 44.75 ? 136 VAL B CG2 1 
ATOM   1485 N N   . GLY B 1 93  ? 5.299   -13.507 -19.706 1.00 37.14 ? 137 GLY B N   1 
ATOM   1486 C CA  . GLY B 1 93  ? 5.772   -14.538 -18.779 1.00 33.16 ? 137 GLY B CA  1 
ATOM   1487 C C   . GLY B 1 93  ? 6.919   -14.346 -17.807 1.00 31.15 ? 137 GLY B C   1 
ATOM   1488 O O   . GLY B 1 93  ? 7.242   -13.235 -17.369 1.00 31.84 ? 137 GLY B O   1 
ATOM   1489 N N   . GLY B 1 94  ? 7.544   -15.466 -17.455 1.00 30.30 ? 138 GLY B N   1 
ATOM   1490 C CA  . GLY B 1 94  ? 8.565   -15.549 -16.412 1.00 28.45 ? 138 GLY B CA  1 
ATOM   1491 C C   . GLY B 1 94  ? 8.498   -17.024 -16.009 1.00 28.14 ? 138 GLY B C   1 
ATOM   1492 O O   . GLY B 1 94  ? 7.980   -17.790 -16.781 1.00 26.96 ? 138 GLY B O   1 
ATOM   1493 N N   . THR B 1 95  ? 9.042   -17.385 -14.836 1.00 27.20 ? 139 THR B N   1 
ATOM   1494 C CA  . THR B 1 95  ? 9.167   -18.751 -14.293 1.00 29.20 ? 139 THR B CA  1 
ATOM   1495 C C   . THR B 1 95  ? 8.267   -18.795 -13.073 1.00 29.53 ? 139 THR B C   1 
ATOM   1496 O O   . THR B 1 95  ? 8.313   -17.875 -12.226 1.00 27.45 ? 139 THR B O   1 
ATOM   1497 C CB  . THR B 1 95  ? 10.622  -19.048 -13.750 1.00 29.58 ? 139 THR B CB  1 
ATOM   1498 O OG1 . THR B 1 95  ? 11.572  -18.707 -14.734 1.00 32.74 ? 139 THR B OG1 1 
ATOM   1499 C CG2 . THR B 1 95  ? 10.858  -20.502 -13.402 1.00 30.88 ? 139 THR B CG2 1 
ATOM   1500 N N   . TYR B 1 96  ? 7.490   -19.884 -12.959 1.00 30.57 ? 140 TYR B N   1 
ATOM   1501 C CA  . TYR B 1 96  ? 6.420   -20.005 -11.964 1.00 30.21 ? 140 TYR B CA  1 
ATOM   1502 C C   . TYR B 1 96  ? 6.289   -21.421 -11.591 1.00 30.37 ? 140 TYR B C   1 
ATOM   1503 O O   . TYR B 1 96  ? 6.159   -22.212 -12.489 1.00 31.51 ? 140 TYR B O   1 
ATOM   1504 C CB  . TYR B 1 96  ? 5.071   -19.598 -12.586 1.00 29.80 ? 140 TYR B CB  1 
ATOM   1505 C CG  . TYR B 1 96  ? 5.005   -18.139 -12.929 1.00 31.69 ? 140 TYR B CG  1 
ATOM   1506 C CD1 . TYR B 1 96  ? 5.306   -17.693 -14.204 1.00 27.64 ? 140 TYR B CD1 1 
ATOM   1507 C CD2 . TYR B 1 96  ? 4.647   -17.200 -11.970 1.00 31.97 ? 140 TYR B CD2 1 
ATOM   1508 C CE1 . TYR B 1 96  ? 5.318   -16.303 -14.500 1.00 26.71 ? 140 TYR B CE1 1 
ATOM   1509 C CE2 . TYR B 1 96  ? 4.610   -15.822 -12.281 1.00 31.76 ? 140 TYR B CE2 1 
ATOM   1510 C CZ  . TYR B 1 96  ? 4.950   -15.398 -13.536 1.00 27.06 ? 140 TYR B CZ  1 
ATOM   1511 O OH  . TYR B 1 96  ? 4.902   -14.061 -13.865 1.00 30.30 ? 140 TYR B OH  1 
ATOM   1512 N N   . GLU B 1 97  ? 6.262   -21.722 -10.283 1.00 31.09 ? 141 GLU B N   1 
ATOM   1513 C CA  . GLU B 1 97  ? 5.771   -22.971 -9.778  1.00 33.20 ? 141 GLU B CA  1 
ATOM   1514 C C   . GLU B 1 97  ? 4.249   -23.045 -9.877  1.00 33.68 ? 141 GLU B C   1 
ATOM   1515 O O   . GLU B 1 97  ? 3.560   -22.133 -9.405  1.00 35.25 ? 141 GLU B O   1 
ATOM   1516 C CB  . GLU B 1 97  ? 6.128   -23.136 -8.308  1.00 34.51 ? 141 GLU B CB  1 
ATOM   1517 C CG  . GLU B 1 97  ? 7.512   -23.296 -8.027  1.00 31.93 ? 141 GLU B CG  1 
ATOM   1518 C CD  . GLU B 1 97  ? 7.800   -23.692 -6.567  1.00 33.96 ? 141 GLU B CD  1 
ATOM   1519 O OE1 . GLU B 1 97  ? 6.869   -24.029 -5.769  1.00 35.22 ? 141 GLU B OE1 1 
ATOM   1520 O OE2 . GLU B 1 97  ? 9.014   -23.727 -6.264  1.00 33.74 ? 141 GLU B OE2 1 
ATOM   1521 N N   . LEU B 1 98  ? 3.720   -24.110 -10.495 1.00 33.60 ? 142 LEU B N   1 
ATOM   1522 C CA  . LEU B 1 98  ? 2.281   -24.186 -10.710 1.00 33.41 ? 142 LEU B CA  1 
ATOM   1523 C C   . LEU B 1 98  ? 1.775   -25.488 -10.160 1.00 33.81 ? 142 LEU B C   1 
ATOM   1524 O O   . LEU B 1 98  ? 2.527   -26.466 -10.155 1.00 35.31 ? 142 LEU B O   1 
ATOM   1525 C CB  . LEU B 1 98  ? 1.950   -24.015 -12.217 1.00 34.00 ? 142 LEU B CB  1 
ATOM   1526 C CG  . LEU B 1 98  ? 2.370   -22.656 -12.852 1.00 33.67 ? 142 LEU B CG  1 
ATOM   1527 C CD1 . LEU B 1 98  ? 2.061   -22.673 -14.310 1.00 27.07 ? 142 LEU B CD1 1 
ATOM   1528 C CD2 . LEU B 1 98  ? 1.779   -21.398 -12.166 1.00 28.88 ? 142 LEU B CD2 1 
ATOM   1529 N N   . HIS B 1 99  ? 0.525   -25.510 -9.669  1.00 32.61 ? 143 HIS B N   1 
ATOM   1530 C CA  . HIS B 1 99  ? -0.033  -26.684 -8.997  1.00 31.58 ? 143 HIS B CA  1 
ATOM   1531 C C   . HIS B 1 99  ? -1.237  -27.229 -9.732  1.00 32.64 ? 143 HIS B C   1 
ATOM   1532 O O   . HIS B 1 99  ? -1.892  -26.482 -10.435 1.00 29.99 ? 143 HIS B O   1 
ATOM   1533 C CB  . HIS B 1 99  ? -0.397  -26.303 -7.543  1.00 30.66 ? 143 HIS B CB  1 
ATOM   1534 C CG  . HIS B 1 99  ? 0.788   -25.875 -6.777  1.00 29.46 ? 143 HIS B CG  1 
ATOM   1535 N ND1 . HIS B 1 99  ? 1.219   -24.570 -6.744  1.00 33.84 ? 143 HIS B ND1 1 
ATOM   1536 C CD2 . HIS B 1 99  ? 1.741   -26.603 -6.163  1.00 31.88 ? 143 HIS B CD2 1 
ATOM   1537 C CE1 . HIS B 1 99  ? 2.362   -24.497 -6.099  1.00 30.43 ? 143 HIS B CE1 1 
ATOM   1538 N NE2 . HIS B 1 99  ? 2.707   -25.722 -5.748  1.00 34.38 ? 143 HIS B NE2 1 
ATOM   1539 N N   . VAL B 1 100 ? -1.518  -28.534 -9.567  1.00 34.84 ? 144 VAL B N   1 
ATOM   1540 C CA  . VAL B 1 100 ? -2.710  -29.161 -10.186 1.00 35.94 ? 144 VAL B CA  1 
ATOM   1541 C C   . VAL B 1 100 ? -3.925  -28.222 -9.913  1.00 36.93 ? 144 VAL B C   1 
ATOM   1542 O O   . VAL B 1 100 ? -4.106  -27.712 -8.784  1.00 37.40 ? 144 VAL B O   1 
ATOM   1543 C CB  . VAL B 1 100 ? -2.994  -30.537 -9.584  1.00 37.11 ? 144 VAL B CB  1 
ATOM   1544 C CG1 . VAL B 1 100 ? -3.755  -31.404 -10.534 1.00 37.97 ? 144 VAL B CG1 1 
ATOM   1545 C CG2 . VAL B 1 100 ? -1.721  -31.245 -9.261  1.00 37.06 ? 144 VAL B CG2 1 
ATOM   1546 N N   . GLY B 1 101 ? -4.711  -27.953 -10.951 1.00 35.92 ? 145 GLY B N   1 
ATOM   1547 C CA  . GLY B 1 101 ? -5.811  -27.048 -10.849 1.00 34.58 ? 145 GLY B CA  1 
ATOM   1548 C C   . GLY B 1 101 ? -5.545  -25.623 -11.337 1.00 33.88 ? 145 GLY B C   1 
ATOM   1549 O O   . GLY B 1 101 ? -6.473  -24.973 -11.729 1.00 33.81 ? 145 GLY B O   1 
ATOM   1550 N N   . ASP B 1 102 ? -4.314  -25.115 -11.296 1.00 32.74 ? 146 ASP B N   1 
ATOM   1551 C CA  . ASP B 1 102 ? -4.084  -23.708 -11.624 1.00 32.78 ? 146 ASP B CA  1 
ATOM   1552 C C   . ASP B 1 102 ? -4.527  -23.439 -13.053 1.00 33.15 ? 146 ASP B C   1 
ATOM   1553 O O   . ASP B 1 102 ? -4.401  -24.308 -13.882 1.00 31.93 ? 146 ASP B O   1 
ATOM   1554 C CB  . ASP B 1 102 ? -2.581  -23.390 -11.508 1.00 32.52 ? 146 ASP B CB  1 
ATOM   1555 C CG  . ASP B 1 102 ? -2.156  -23.129 -10.076 1.00 38.09 ? 146 ASP B CG  1 
ATOM   1556 O OD1 . ASP B 1 102 ? -3.025  -22.742 -9.216  1.00 38.66 ? 146 ASP B OD1 1 
ATOM   1557 O OD2 . ASP B 1 102 ? -0.952  -23.283 -9.801  1.00 35.81 ? 146 ASP B OD2 1 
ATOM   1558 N N   . THR B 1 103 ? -5.031  -22.248 -13.345 1.00 34.44 ? 147 THR B N   1 
ATOM   1559 C CA  . THR B 1 103 ? -5.232  -21.854 -14.738 1.00 34.74 ? 147 THR B CA  1 
ATOM   1560 C C   . THR B 1 103 ? -4.376  -20.672 -15.099 1.00 35.64 ? 147 THR B C   1 
ATOM   1561 O O   . THR B 1 103 ? -4.023  -19.834 -14.239 1.00 35.45 ? 147 THR B O   1 
ATOM   1562 C CB  . THR B 1 103 ? -6.689  -21.430 -15.117 1.00 35.19 ? 147 THR B CB  1 
ATOM   1563 O OG1 . THR B 1 103 ? -7.083  -20.294 -14.337 1.00 39.10 ? 147 THR B OG1 1 
ATOM   1564 C CG2 . THR B 1 103 ? -7.693  -22.584 -15.049 1.00 31.66 ? 147 THR B CG2 1 
ATOM   1565 N N   . ILE B 1 104 ? -4.041  -20.630 -16.382 1.00 35.13 ? 148 ILE B N   1 
ATOM   1566 C CA  . ILE B 1 104 ? -3.300  -19.534 -16.962 1.00 36.45 ? 148 ILE B CA  1 
ATOM   1567 C C   . ILE B 1 104 ? -4.050  -18.939 -18.142 1.00 36.70 ? 148 ILE B C   1 
ATOM   1568 O O   . ILE B 1 104 ? -4.474  -19.639 -19.027 1.00 36.68 ? 148 ILE B O   1 
ATOM   1569 C CB  . ILE B 1 104 ? -1.881  -19.930 -17.383 1.00 34.35 ? 148 ILE B CB  1 
ATOM   1570 C CG1 . ILE B 1 104 ? -1.120  -20.474 -16.173 1.00 34.61 ? 148 ILE B CG1 1 
ATOM   1571 C CG2 . ILE B 1 104 ? -1.178  -18.702 -17.905 1.00 35.18 ? 148 ILE B CG2 1 
ATOM   1572 C CD1 . ILE B 1 104 ? -0.752  -19.387 -15.052 1.00 25.34 ? 148 ILE B CD1 1 
ATOM   1573 N N   . ASP B 1 105 ? -4.239  -17.632 -18.084 1.00 37.82 ? 149 ASP B N   1 
ATOM   1574 C CA  . ASP B 1 105 ? -5.027  -16.889 -19.062 1.00 39.27 ? 149 ASP B CA  1 
ATOM   1575 C C   . ASP B 1 105 ? -4.294  -15.599 -19.493 1.00 38.85 ? 149 ASP B C   1 
ATOM   1576 O O   . ASP B 1 105 ? -3.676  -14.913 -18.650 1.00 38.84 ? 149 ASP B O   1 
ATOM   1577 C CB  . ASP B 1 105 ? -6.336  -16.461 -18.396 1.00 38.79 ? 149 ASP B CB  1 
ATOM   1578 C CG  . ASP B 1 105 ? -7.533  -16.517 -19.332 1.00 44.85 ? 149 ASP B CG  1 
ATOM   1579 O OD1 . ASP B 1 105 ? -7.420  -16.460 -20.605 1.00 46.31 ? 149 ASP B OD1 1 
ATOM   1580 O OD2 . ASP B 1 105 ? -8.631  -16.609 -18.746 1.00 53.80 ? 149 ASP B OD2 1 
ATOM   1581 N N   . LEU B 1 106 ? -4.401  -15.276 -20.784 1.00 38.56 ? 150 LEU B N   1 
ATOM   1582 C CA  . LEU B 1 106 ? -3.948  -14.002 -21.315 1.00 37.97 ? 150 LEU B CA  1 
ATOM   1583 C C   . LEU B 1 106 ? -5.174  -13.246 -21.828 1.00 38.32 ? 150 LEU B C   1 
ATOM   1584 O O   . LEU B 1 106 ? -5.818  -13.695 -22.778 1.00 35.80 ? 150 LEU B O   1 
ATOM   1585 C CB  . LEU B 1 106 ? -2.893  -14.174 -22.431 1.00 36.91 ? 150 LEU B CB  1 
ATOM   1586 C CG  . LEU B 1 106 ? -2.275  -12.869 -22.978 1.00 39.02 ? 150 LEU B CG  1 
ATOM   1587 C CD1 . LEU B 1 106 ? -1.388  -12.207 -21.893 1.00 35.68 ? 150 LEU B CD1 1 
ATOM   1588 C CD2 . LEU B 1 106 ? -1.416  -13.046 -24.264 1.00 36.94 ? 150 LEU B CD2 1 
ATOM   1589 N N   . ILE B 1 107 ? -5.442  -12.084 -21.201 1.00 39.90 ? 151 ILE B N   1 
ATOM   1590 C CA  . ILE B 1 107 ? -6.687  -11.299 -21.412 1.00 41.88 ? 151 ILE B CA  1 
ATOM   1591 C C   . ILE B 1 107 ? -6.422  -10.011 -22.136 1.00 43.82 ? 151 ILE B C   1 
ATOM   1592 O O   . ILE B 1 107 ? -5.456  -9.308  -21.818 1.00 43.63 ? 151 ILE B O   1 
ATOM   1593 C CB  . ILE B 1 107 ? -7.458  -10.930 -20.057 1.00 41.08 ? 151 ILE B CB  1 
ATOM   1594 C CG1 . ILE B 1 107 ? -7.936  -12.177 -19.324 1.00 41.47 ? 151 ILE B CG1 1 
ATOM   1595 C CG2 . ILE B 1 107 ? -8.695  -10.030 -20.324 1.00 40.33 ? 151 ILE B CG2 1 
ATOM   1596 C CD1 . ILE B 1 107 ? -8.269  -13.351 -20.230 1.00 41.29 ? 151 ILE B CD1 1 
ATOM   1597 N N   . PHE B 1 108 ? -7.308  -9.700  -23.091 1.00 46.77 ? 152 PHE B N   1 
ATOM   1598 C CA  . PHE B 1 108 ? -7.281  -8.430  -23.822 1.00 49.93 ? 152 PHE B CA  1 
ATOM   1599 C C   . PHE B 1 108 ? -8.427  -7.531  -23.448 1.00 52.08 ? 152 PHE B C   1 
ATOM   1600 O O   . PHE B 1 108 ? -9.570  -7.990  -23.340 1.00 52.64 ? 152 PHE B O   1 
ATOM   1601 C CB  . PHE B 1 108 ? -7.336  -8.706  -25.320 1.00 49.93 ? 152 PHE B CB  1 
ATOM   1602 C CG  . PHE B 1 108 ? -6.347  -9.732  -25.765 1.00 50.76 ? 152 PHE B CG  1 
ATOM   1603 C CD1 . PHE B 1 108 ? -6.759  -11.027 -26.061 1.00 51.90 ? 152 PHE B CD1 1 
ATOM   1604 C CD2 . PHE B 1 108 ? -5.000  -9.421  -25.847 1.00 51.56 ? 152 PHE B CD2 1 
ATOM   1605 C CE1 . PHE B 1 108 ? -5.856  -11.992 -26.468 1.00 50.52 ? 152 PHE B CE1 1 
ATOM   1606 C CE2 . PHE B 1 108 ? -4.080  -10.383 -26.246 1.00 53.79 ? 152 PHE B CE2 1 
ATOM   1607 C CZ  . PHE B 1 108 ? -4.514  -11.673 -26.561 1.00 51.96 ? 152 PHE B CZ  1 
ATOM   1608 N N   . ASN B 1 109 ? -8.144  -6.251  -23.247 1.00 55.58 ? 153 ASN B N   1 
ATOM   1609 C CA  . ASN B 1 109 ? -9.229  -5.273  -23.054 1.00 59.40 ? 153 ASN B CA  1 
ATOM   1610 C C   . ASN B 1 109 ? -10.252 -5.322  -24.190 1.00 61.07 ? 153 ASN B C   1 
ATOM   1611 O O   . ASN B 1 109 ? -11.458 -5.455  -23.946 1.00 62.18 ? 153 ASN B O   1 
ATOM   1612 C CB  . ASN B 1 109 ? -8.690  -3.855  -22.867 1.00 59.97 ? 153 ASN B CB  1 
ATOM   1613 C CG  . ASN B 1 109 ? -8.214  -3.603  -21.454 1.00 62.92 ? 153 ASN B CG  1 
ATOM   1614 O OD1 . ASN B 1 109 ? -7.740  -4.521  -20.769 1.00 67.74 ? 153 ASN B OD1 1 
ATOM   1615 N ND2 . ASN B 1 109 ? -8.335  -2.348  -20.998 1.00 65.94 ? 153 ASN B ND2 1 
ATOM   1616 N N   . SER B 1 110 ? -9.775  -5.225  -25.427 1.00 62.99 ? 154 SER B N   1 
ATOM   1617 C CA  . SER B 1 110 ? -10.645 -5.454  -26.570 1.00 64.69 ? 154 SER B CA  1 
ATOM   1618 C C   . SER B 1 110 ? -9.933  -6.271  -27.624 1.00 65.80 ? 154 SER B C   1 
ATOM   1619 O O   . SER B 1 110 ? -8.727  -6.108  -27.864 1.00 66.31 ? 154 SER B O   1 
ATOM   1620 C CB  . SER B 1 110 ? -11.192 -4.119  -27.165 1.00 64.52 ? 154 SER B CB  1 
ATOM   1621 N N   . GLU B 1 111 ? -10.693 -7.183  -28.214 1.00 66.91 ? 155 GLU B N   1 
ATOM   1622 C CA  . GLU B 1 111 ? -10.320 -7.836  -29.454 1.00 67.79 ? 155 GLU B CA  1 
ATOM   1623 C C   . GLU B 1 111 ? -9.507  -6.846  -30.291 1.00 68.23 ? 155 GLU B C   1 
ATOM   1624 O O   . GLU B 1 111 ? -8.302  -7.052  -30.511 1.00 68.70 ? 155 GLU B O   1 
ATOM   1625 C CB  . GLU B 1 111 ? -11.596 -8.281  -30.209 1.00 67.58 ? 155 GLU B CB  1 
ATOM   1626 N N   . HIS B 1 112 ? -10.186 -5.767  -30.713 1.00 68.65 ? 156 HIS B N   1 
ATOM   1627 C CA  . HIS B 1 112 ? -9.628  -4.662  -31.512 1.00 68.31 ? 156 HIS B CA  1 
ATOM   1628 C C   . HIS B 1 112 ? -8.198  -4.267  -31.119 1.00 68.17 ? 156 HIS B C   1 
ATOM   1629 O O   . HIS B 1 112 ? -7.234  -4.709  -31.745 1.00 67.64 ? 156 HIS B O   1 
ATOM   1630 C CB  . HIS B 1 112 ? -10.562 -3.446  -31.433 1.00 68.26 ? 156 HIS B CB  1 
ATOM   1631 N N   . ASN B 1 117 ? -2.621  -9.236  -33.665 1.00 60.47 ? 161 ASN B N   1 
ATOM   1632 C CA  . ASN B 1 117 ? -2.228  -10.634 -33.437 1.00 60.07 ? 161 ASN B CA  1 
ATOM   1633 C C   . ASN B 1 117 ? -0.948  -11.248 -34.114 1.00 59.43 ? 161 ASN B C   1 
ATOM   1634 O O   . ASN B 1 117 ? -1.030  -12.248 -34.850 1.00 60.77 ? 161 ASN B O   1 
ATOM   1635 C CB  . ASN B 1 117 ? -3.431  -11.546 -33.686 1.00 60.05 ? 161 ASN B CB  1 
ATOM   1636 C CG  . ASN B 1 117 ? -3.031  -13.017 -33.748 1.00 61.27 ? 161 ASN B CG  1 
ATOM   1637 O OD1 . ASN B 1 117 ? -2.667  -13.644 -32.726 1.00 62.31 ? 161 ASN B OD1 1 
ATOM   1638 N ND2 . ASN B 1 117 ? -3.056  -13.565 -34.954 1.00 60.32 ? 161 ASN B ND2 1 
ATOM   1639 N N   . ASN B 1 118 ? 0.233   -10.669 -33.896 1.00 57.65 ? 162 ASN B N   1 
ATOM   1640 C CA  . ASN B 1 118 ? 1.443   -11.516 -33.873 1.00 54.84 ? 162 ASN B CA  1 
ATOM   1641 C C   . ASN B 1 118 ? 1.642   -11.816 -32.372 1.00 51.79 ? 162 ASN B C   1 
ATOM   1642 O O   . ASN B 1 118 ? 2.670   -11.531 -31.780 1.00 51.62 ? 162 ASN B O   1 
ATOM   1643 C CB  . ASN B 1 118 ? 2.691   -10.821 -34.517 1.00 55.40 ? 162 ASN B CB  1 
ATOM   1644 N N   . THR B 1 119 ? 0.590   -12.377 -31.787 1.00 48.88 ? 163 THR B N   1 
ATOM   1645 C CA  . THR B 1 119 ? 0.418   -12.548 -30.362 1.00 44.91 ? 163 THR B CA  1 
ATOM   1646 C C   . THR B 1 119 ? 0.193   -14.015 -30.082 1.00 43.87 ? 163 THR B C   1 
ATOM   1647 O O   . THR B 1 119 ? -0.658  -14.649 -30.684 1.00 43.44 ? 163 THR B O   1 
ATOM   1648 C CB  . THR B 1 119 ? -0.727  -11.677 -29.829 1.00 44.76 ? 163 THR B CB  1 
ATOM   1649 O OG1 . THR B 1 119 ? -0.368  -10.306 -30.010 1.00 42.24 ? 163 THR B OG1 1 
ATOM   1650 C CG2 . THR B 1 119 ? -1.026  -11.922 -28.270 1.00 44.09 ? 163 THR B CG2 1 
ATOM   1651 N N   . TYR B 1 120 ? 1.009   -14.552 -29.176 1.00 41.38 ? 164 TYR B N   1 
ATOM   1652 C CA  . TYR B 1 120 ? 0.939   -15.953 -28.772 1.00 39.59 ? 164 TYR B CA  1 
ATOM   1653 C C   . TYR B 1 120 ? 1.498   -16.060 -27.322 1.00 38.70 ? 164 TYR B C   1 
ATOM   1654 O O   . TYR B 1 120 ? 2.036   -15.098 -26.805 1.00 39.24 ? 164 TYR B O   1 
ATOM   1655 C CB  . TYR B 1 120 ? 1.678   -16.877 -29.789 1.00 39.02 ? 164 TYR B CB  1 
ATOM   1656 C CG  . TYR B 1 120 ? 3.160   -16.588 -29.950 1.00 38.02 ? 164 TYR B CG  1 
ATOM   1657 C CD1 . TYR B 1 120 ? 3.601   -15.700 -30.920 1.00 39.76 ? 164 TYR B CD1 1 
ATOM   1658 C CD2 . TYR B 1 120 ? 4.106   -17.132 -29.067 1.00 36.66 ? 164 TYR B CD2 1 
ATOM   1659 C CE1 . TYR B 1 120 ? 4.973   -15.382 -31.041 1.00 41.77 ? 164 TYR B CE1 1 
ATOM   1660 C CE2 . TYR B 1 120 ? 5.454   -16.828 -29.164 1.00 37.82 ? 164 TYR B CE2 1 
ATOM   1661 C CZ  . TYR B 1 120 ? 5.897   -15.960 -30.148 1.00 40.64 ? 164 TYR B CZ  1 
ATOM   1662 O OH  . TYR B 1 120 ? 7.249   -15.674 -30.269 1.00 38.08 ? 164 TYR B OH  1 
ATOM   1663 N N   . TRP B 1 121 ? 1.277   -17.189 -26.657 1.00 37.06 ? 165 TRP B N   1 
ATOM   1664 C CA  . TRP B 1 121 ? 2.001   -17.505 -25.429 1.00 36.57 ? 165 TRP B CA  1 
ATOM   1665 C C   . TRP B 1 121 ? 2.115   -19.038 -25.304 1.00 35.75 ? 165 TRP B C   1 
ATOM   1666 O O   . TRP B 1 121 ? 1.353   -19.807 -25.921 1.00 35.37 ? 165 TRP B O   1 
ATOM   1667 C CB  . TRP B 1 121 ? 1.404   -16.828 -24.200 1.00 36.68 ? 165 TRP B CB  1 
ATOM   1668 C CG  . TRP B 1 121 ? 0.161   -17.462 -23.618 1.00 37.69 ? 165 TRP B CG  1 
ATOM   1669 C CD1 . TRP B 1 121 ? -1.144  -17.156 -23.947 1.00 36.61 ? 165 TRP B CD1 1 
ATOM   1670 C CD2 . TRP B 1 121 ? 0.089   -18.499 -22.621 1.00 35.67 ? 165 TRP B CD2 1 
ATOM   1671 N NE1 . TRP B 1 121 ? -1.997  -17.948 -23.240 1.00 37.48 ? 165 TRP B NE1 1 
ATOM   1672 C CE2 . TRP B 1 121 ? -1.283  -18.767 -22.402 1.00 38.35 ? 165 TRP B CE2 1 
ATOM   1673 C CE3 . TRP B 1 121 ? 1.042   -19.215 -21.872 1.00 37.58 ? 165 TRP B CE3 1 
ATOM   1674 C CZ2 . TRP B 1 121 ? -1.730  -19.723 -21.443 1.00 36.45 ? 165 TRP B CZ2 1 
ATOM   1675 C CZ3 . TRP B 1 121 ? 0.595   -20.204 -20.948 1.00 36.17 ? 165 TRP B CZ3 1 
ATOM   1676 C CH2 . TRP B 1 121 ? -0.775  -20.454 -20.769 1.00 37.99 ? 165 TRP B CH2 1 
ATOM   1677 N N   . GLY B 1 122 ? 3.131   -19.480 -24.596 1.00 33.89 ? 166 GLY B N   1 
ATOM   1678 C CA  . GLY B 1 122 ? 3.275   -20.905 -24.398 1.00 32.59 ? 166 GLY B CA  1 
ATOM   1679 C C   . GLY B 1 122 ? 3.901   -21.205 -23.047 1.00 30.75 ? 166 GLY B C   1 
ATOM   1680 O O   . GLY B 1 122 ? 4.214   -20.304 -22.293 1.00 28.72 ? 166 GLY B O   1 
ATOM   1681 N N   . ILE B 1 123 ? 3.989   -22.486 -22.736 1.00 30.49 ? 167 ILE B N   1 
ATOM   1682 C CA  . ILE B 1 123 ? 4.435   -22.911 -21.428 1.00 31.09 ? 167 ILE B CA  1 
ATOM   1683 C C   . ILE B 1 123 ? 5.326   -24.078 -21.729 1.00 32.04 ? 167 ILE B C   1 
ATOM   1684 O O   . ILE B 1 123 ? 5.041   -24.834 -22.617 1.00 32.81 ? 167 ILE B O   1 
ATOM   1685 C CB  . ILE B 1 123 ? 3.235   -23.327 -20.499 1.00 31.58 ? 167 ILE B CB  1 
ATOM   1686 C CG1 . ILE B 1 123 ? 3.673   -23.353 -19.019 1.00 31.32 ? 167 ILE B CG1 1 
ATOM   1687 C CG2 . ILE B 1 123 ? 2.575   -24.726 -20.922 1.00 30.23 ? 167 ILE B CG2 1 
ATOM   1688 C CD1 . ILE B 1 123 ? 2.500   -23.479 -18.025 1.00 30.77 ? 167 ILE B CD1 1 
ATOM   1689 N N   . ILE B 1 124 ? 6.382   -24.247 -20.954 1.00 33.42 ? 168 ILE B N   1 
ATOM   1690 C CA  . ILE B 1 124 ? 7.163   -25.491 -20.952 1.00 33.02 ? 168 ILE B CA  1 
ATOM   1691 C C   . ILE B 1 124 ? 7.322   -25.934 -19.495 1.00 33.15 ? 168 ILE B C   1 
ATOM   1692 O O   . ILE B 1 124 ? 7.597   -25.086 -18.611 1.00 32.93 ? 168 ILE B O   1 
ATOM   1693 C CB  . ILE B 1 124 ? 8.506   -25.247 -21.711 1.00 31.91 ? 168 ILE B CB  1 
ATOM   1694 C CG1 . ILE B 1 124 ? 9.181   -26.539 -22.204 1.00 38.72 ? 168 ILE B CG1 1 
ATOM   1695 C CG2 . ILE B 1 124 ? 9.407   -24.227 -21.076 1.00 31.89 ? 168 ILE B CG2 1 
ATOM   1696 C CD1 . ILE B 1 124 ? 10.192  -27.190 -21.335 1.00 43.60 ? 168 ILE B CD1 1 
ATOM   1697 N N   . LEU B 1 125 ? 7.092   -27.213 -19.229 1.00 31.30 ? 169 LEU B N   1 
ATOM   1698 C CA  . LEU B 1 125 ? 7.479   -27.794 -17.965 1.00 31.66 ? 169 LEU B CA  1 
ATOM   1699 C C   . LEU B 1 125 ? 9.006   -28.059 -17.833 1.00 34.33 ? 169 LEU B C   1 
ATOM   1700 O O   . LEU B 1 125 ? 9.578   -28.908 -18.589 1.00 33.03 ? 169 LEU B O   1 
ATOM   1701 C CB  . LEU B 1 125 ? 6.743   -29.107 -17.756 1.00 31.22 ? 169 LEU B CB  1 
ATOM   1702 C CG  . LEU B 1 125 ? 7.091   -29.929 -16.501 1.00 29.87 ? 169 LEU B CG  1 
ATOM   1703 C CD1 . LEU B 1 125 ? 6.808   -29.112 -15.133 1.00 23.18 ? 169 LEU B CD1 1 
ATOM   1704 C CD2 . LEU B 1 125 ? 6.320   -31.182 -16.553 1.00 34.68 ? 169 LEU B CD2 1 
ATOM   1705 N N   . LEU B 1 126 ? 9.624   -27.392 -16.849 1.00 35.71 ? 170 LEU B N   1 
ATOM   1706 C CA  . LEU B 1 126 ? 11.071  -27.468 -16.566 1.00 36.73 ? 170 LEU B CA  1 
ATOM   1707 C C   . LEU B 1 126 ? 11.433  -28.593 -15.653 1.00 37.34 ? 170 LEU B C   1 
ATOM   1708 O O   . LEU B 1 126 ? 12.421  -29.264 -15.912 1.00 38.04 ? 170 LEU B O   1 
ATOM   1709 C CB  . LEU B 1 126 ? 11.635  -26.173 -15.940 1.00 36.27 ? 170 LEU B CB  1 
ATOM   1710 C CG  . LEU B 1 126 ? 11.907  -24.988 -16.849 1.00 39.25 ? 170 LEU B CG  1 
ATOM   1711 C CD1 . LEU B 1 126 ? 12.908  -23.955 -16.226 1.00 35.88 ? 170 LEU B CD1 1 
ATOM   1712 C CD2 . LEU B 1 126 ? 12.411  -25.467 -18.259 1.00 43.45 ? 170 LEU B CD2 1 
ATOM   1713 N N   . ALA B 1 127 ? 10.688  -28.789 -14.559 1.00 37.41 ? 171 ALA B N   1 
ATOM   1714 C CA  . ALA B 1 127 ? 10.984  -29.917 -13.691 1.00 37.08 ? 171 ALA B CA  1 
ATOM   1715 C C   . ALA B 1 127 ? 9.812   -30.240 -12.803 1.00 38.20 ? 171 ALA B C   1 
ATOM   1716 O O   . ALA B 1 127 ? 8.863   -29.483 -12.722 1.00 37.70 ? 171 ALA B O   1 
ATOM   1717 C CB  . ALA B 1 127 ? 12.190  -29.616 -12.845 1.00 34.93 ? 171 ALA B CB  1 
ATOM   1718 N N   . ASN B 1 128 ? 9.888   -31.353 -12.096 1.00 39.91 ? 172 ASN B N   1 
ATOM   1719 C CA  . ASN B 1 128 ? 8.943   -31.544 -11.012 1.00 41.98 ? 172 ASN B CA  1 
ATOM   1720 C C   . ASN B 1 128 ? 9.642   -32.087 -9.808  1.00 41.20 ? 172 ASN B C   1 
ATOM   1721 O O   . ASN B 1 128 ? 9.511   -33.262 -9.488  1.00 42.51 ? 172 ASN B O   1 
ATOM   1722 C CB  . ASN B 1 128 ? 7.733   -32.443 -11.357 1.00 43.58 ? 172 ASN B CB  1 
ATOM   1723 C CG  . ASN B 1 128 ? 6.746   -32.590 -10.140 1.00 50.00 ? 172 ASN B CG  1 
ATOM   1724 O OD1 . ASN B 1 128 ? 6.969   -32.010 -9.019  1.00 55.78 ? 172 ASN B OD1 1 
ATOM   1725 N ND2 . ASN B 1 128 ? 5.634   -33.320 -10.364 1.00 53.33 ? 172 ASN B ND2 1 
ATOM   1726 N N   . PRO B 1 129 ? 10.306  -31.214 -9.065  1.00 40.96 ? 173 PRO B N   1 
ATOM   1727 C CA  . PRO B 1 129 ? 10.932  -31.755 -7.875  1.00 40.86 ? 173 PRO B CA  1 
ATOM   1728 C C   . PRO B 1 129 ? 9.789   -32.044 -6.883  1.00 41.43 ? 173 PRO B C   1 
ATOM   1729 O O   . PRO B 1 129 ? 8.781   -31.349 -6.943  1.00 41.91 ? 173 PRO B O   1 
ATOM   1730 C CB  . PRO B 1 129 ? 11.823  -30.593 -7.406  1.00 41.14 ? 173 PRO B CB  1 
ATOM   1731 C CG  . PRO B 1 129 ? 11.040  -29.317 -7.891  1.00 40.00 ? 173 PRO B CG  1 
ATOM   1732 C CD  . PRO B 1 129 ? 10.444  -29.739 -9.208  1.00 40.07 ? 173 PRO B CD  1 
ATOM   1733 N N   . GLN B 1 130 ? 9.917   -33.039 -5.993  1.00 41.89 ? 174 GLN B N   1 
ATOM   1734 C CA  . GLN B 1 130 ? 8.817   -33.363 -5.065  1.00 41.88 ? 174 GLN B CA  1 
ATOM   1735 C C   . GLN B 1 130 ? 8.479   -32.233 -4.134  1.00 42.43 ? 174 GLN B C   1 
ATOM   1736 O O   . GLN B 1 130 ? 7.379   -32.213 -3.571  1.00 43.15 ? 174 GLN B O   1 
ATOM   1737 C CB  . GLN B 1 130 ? 9.043   -34.689 -4.277  1.00 41.74 ? 174 GLN B CB  1 
ATOM   1738 N N   . PHE B 1 131 ? 9.384   -31.256 -4.006  1.00 42.52 ? 175 PHE B N   1 
ATOM   1739 C CA  . PHE B 1 131 ? 9.136   -30.077 -3.149  1.00 42.74 ? 175 PHE B CA  1 
ATOM   1740 C C   . PHE B 1 131 ? 8.217   -28.988 -3.773  1.00 43.83 ? 175 PHE B C   1 
ATOM   1741 O O   . PHE B 1 131 ? 7.889   -28.010 -3.112  1.00 45.23 ? 175 PHE B O   1 
ATOM   1742 C CB  . PHE B 1 131 ? 10.443  -29.507 -2.536  1.00 41.62 ? 175 PHE B CB  1 
ATOM   1743 C CG  . PHE B 1 131 ? 11.390  -28.908 -3.542  1.00 39.64 ? 175 PHE B CG  1 
ATOM   1744 C CD1 . PHE B 1 131 ? 12.650  -29.471 -3.735  1.00 38.90 ? 175 PHE B CD1 1 
ATOM   1745 C CD2 . PHE B 1 131 ? 11.022  -27.786 -4.274  1.00 33.90 ? 175 PHE B CD2 1 
ATOM   1746 C CE1 . PHE B 1 131 ? 13.529  -28.945 -4.661  1.00 33.09 ? 175 PHE B CE1 1 
ATOM   1747 C CE2 . PHE B 1 131 ? 11.873  -27.220 -5.189  1.00 35.01 ? 175 PHE B CE2 1 
ATOM   1748 C CZ  . PHE B 1 131 ? 13.163  -27.840 -5.391  1.00 38.23 ? 175 PHE B CZ  1 
ATOM   1749 N N   . ILE B 1 132 ? 7.811   -29.174 -5.025  1.00 44.35 ? 176 ILE B N   1 
ATOM   1750 C CA  . ILE B 1 132 ? 6.700   -28.399 -5.602  1.00 45.88 ? 176 ILE B CA  1 
ATOM   1751 C C   . ILE B 1 132 ? 5.404   -29.230 -5.413  1.00 46.95 ? 176 ILE B C   1 
ATOM   1752 O O   . ILE B 1 132 ? 5.184   -30.221 -6.115  1.00 46.85 ? 176 ILE B O   1 
ATOM   1753 C CB  . ILE B 1 132 ? 6.857   -28.127 -7.134  1.00 44.08 ? 176 ILE B CB  1 
ATOM   1754 C CG1 . ILE B 1 132 ? 7.841   -27.029 -7.449  1.00 44.86 ? 176 ILE B CG1 1 
ATOM   1755 C CG2 . ILE B 1 132 ? 5.562   -27.613 -7.708  1.00 45.50 ? 176 ILE B CG2 1 
ATOM   1756 C CD1 . ILE B 1 132 ? 9.078   -27.178 -6.818  1.00 45.09 ? 176 ILE B CD1 1 
ATOM   1757 N N   . SER B 1 133 ? 4.557   -28.836 -4.472  1.00 48.66 ? 177 SER B N   1 
ATOM   1758 C CA  . SER B 1 133 ? 3.289   -29.567 -4.268  1.00 50.46 ? 177 SER B CA  1 
ATOM   1759 C C   . SER B 1 133 ? 2.252   -28.628 -3.628  1.00 51.16 ? 177 SER B C   1 
ATOM   1760 O O   . SER B 1 133 ? 2.568   -27.456 -3.376  1.00 52.91 ? 177 SER B O   1 
ATOM   1761 C CB  . SER B 1 133 ? 3.515   -30.864 -3.456  1.00 49.48 ? 177 SER B CB  1 
ATOM   1762 O OG  . SER B 1 133 ? 3.813   -30.606 -2.082  1.00 51.91 ? 177 SER B OG  1 
ATOM   1763 O OXT . SER B 1 133 ? 1.086   -28.949 -3.360  1.00 51.57 ? 177 SER B OXT 1 
ATOM   1764 N N   . PRO C 1 13  ? 23.701  -30.761 -25.243 1.00 54.85 ? 57  PRO C N   1 
ATOM   1765 C CA  . PRO C 1 13  ? 22.769  -29.610 -25.148 1.00 53.86 ? 57  PRO C CA  1 
ATOM   1766 C C   . PRO C 1 13  ? 23.289  -28.377 -25.900 1.00 53.21 ? 57  PRO C C   1 
ATOM   1767 O O   . PRO C 1 13  ? 24.263  -27.725 -25.424 1.00 53.47 ? 57  PRO C O   1 
ATOM   1768 C CB  . PRO C 1 13  ? 22.698  -29.300 -23.633 1.00 53.87 ? 57  PRO C CB  1 
ATOM   1769 C CG  . PRO C 1 13  ? 23.218  -30.532 -22.944 1.00 55.53 ? 57  PRO C CG  1 
ATOM   1770 C CD  . PRO C 1 13  ? 24.143  -31.264 -23.928 1.00 55.29 ? 57  PRO C CD  1 
ATOM   1771 N N   . CYS C 1 14  ? 22.635  -28.040 -27.027 1.00 51.03 ? 58  CYS C N   1 
ATOM   1772 C CA  . CYS C 1 14  ? 23.065  -26.905 -27.855 1.00 48.81 ? 58  CYS C CA  1 
ATOM   1773 C C   . CYS C 1 14  ? 23.079  -25.541 -27.131 1.00 47.99 ? 58  CYS C C   1 
ATOM   1774 O O   . CYS C 1 14  ? 22.021  -25.043 -26.708 1.00 45.67 ? 58  CYS C O   1 
ATOM   1775 C CB  . CYS C 1 14  ? 22.229  -26.828 -29.119 1.00 48.87 ? 58  CYS C CB  1 
ATOM   1776 S SG  . CYS C 1 14  ? 23.004  -25.856 -30.391 1.00 51.16 ? 58  CYS C SG  1 
ATOM   1777 N N   . MET C 1 15  ? 24.301  -24.992 -26.981 1.00 46.99 ? 59  MET C N   1 
ATOM   1778 C CA  . MET C 1 15  ? 24.594  -23.698 -26.402 1.00 47.99 ? 59  MET C CA  1 
ATOM   1779 C C   . MET C 1 15  ? 25.711  -22.955 -27.084 1.00 46.64 ? 59  MET C C   1 
ATOM   1780 O O   . MET C 1 15  ? 26.588  -23.553 -27.694 1.00 46.81 ? 59  MET C O   1 
ATOM   1781 C CB  . MET C 1 15  ? 25.042  -23.798 -24.946 1.00 46.64 ? 59  MET C CB  1 
ATOM   1782 C CG  . MET C 1 15  ? 24.525  -24.933 -24.239 1.00 49.29 ? 59  MET C CG  1 
ATOM   1783 S SD  . MET C 1 15  ? 24.874  -24.789 -22.501 1.00 53.28 ? 59  MET C SD  1 
ATOM   1784 C CE  . MET C 1 15  ? 24.705  -23.011 -22.216 1.00 43.83 ? 59  MET C CE  1 
ATOM   1785 N N   . ALA C 1 16  ? 25.694  -21.633 -26.917 1.00 45.84 ? 60  ALA C N   1 
ATOM   1786 C CA  . ALA C 1 16  ? 26.768  -20.741 -27.376 1.00 45.36 ? 60  ALA C CA  1 
ATOM   1787 C C   . ALA C 1 16  ? 26.861  -19.524 -26.458 1.00 45.20 ? 60  ALA C C   1 
ATOM   1788 O O   . ALA C 1 16  ? 25.904  -19.132 -25.827 1.00 46.06 ? 60  ALA C O   1 
ATOM   1789 C CB  . ALA C 1 16  ? 26.498  -20.293 -28.824 1.00 45.39 ? 60  ALA C CB  1 
ATOM   1790 N N   . LYS C 1 17  ? 28.021  -18.905 -26.432 1.00 46.48 ? 61  LYS C N   1 
ATOM   1791 C CA  . LYS C 1 17  ? 28.292  -17.719 -25.648 1.00 46.14 ? 61  LYS C CA  1 
ATOM   1792 C C   . LYS C 1 17  ? 29.311  -16.824 -26.399 1.00 47.70 ? 61  LYS C C   1 
ATOM   1793 O O   . LYS C 1 17  ? 30.284  -17.326 -26.967 1.00 48.16 ? 61  LYS C O   1 
ATOM   1794 C CB  . LYS C 1 17  ? 28.858  -18.166 -24.319 1.00 44.61 ? 61  LYS C CB  1 
ATOM   1795 C CG  . LYS C 1 17  ? 29.037  -17.056 -23.391 1.00 43.22 ? 61  LYS C CG  1 
ATOM   1796 C CD  . LYS C 1 17  ? 29.804  -17.521 -22.273 1.00 45.86 ? 61  LYS C CD  1 
ATOM   1797 C CE  . LYS C 1 17  ? 30.172  -16.412 -21.387 1.00 46.48 ? 61  LYS C CE  1 
ATOM   1798 N NZ  . LYS C 1 17  ? 31.001  -17.173 -20.401 1.00 47.99 ? 61  LYS C NZ  1 
ATOM   1799 N N   . PHE C 1 18  ? 29.068  -15.516 -26.424 1.00 49.28 ? 62  PHE C N   1 
ATOM   1800 C CA  . PHE C 1 18  ? 30.072  -14.508 -26.800 1.00 50.20 ? 62  PHE C CA  1 
ATOM   1801 C C   . PHE C 1 18  ? 30.304  -13.438 -25.725 1.00 51.63 ? 62  PHE C C   1 
ATOM   1802 O O   . PHE C 1 18  ? 29.375  -12.752 -25.317 1.00 52.66 ? 62  PHE C O   1 
ATOM   1803 C CB  . PHE C 1 18  ? 29.646  -13.736 -28.037 1.00 50.10 ? 62  PHE C CB  1 
ATOM   1804 C CG  . PHE C 1 18  ? 30.725  -12.780 -28.569 1.00 51.42 ? 62  PHE C CG  1 
ATOM   1805 C CD1 . PHE C 1 18  ? 31.438  -13.091 -29.721 1.00 49.48 ? 62  PHE C CD1 1 
ATOM   1806 C CD2 . PHE C 1 18  ? 31.049  -11.598 -27.880 1.00 51.48 ? 62  PHE C CD2 1 
ATOM   1807 C CE1 . PHE C 1 18  ? 32.422  -12.226 -30.214 1.00 52.23 ? 62  PHE C CE1 1 
ATOM   1808 C CE2 . PHE C 1 18  ? 32.047  -10.746 -28.348 1.00 51.57 ? 62  PHE C CE2 1 
ATOM   1809 C CZ  . PHE C 1 18  ? 32.736  -11.064 -29.518 1.00 51.74 ? 62  PHE C CZ  1 
ATOM   1810 N N   . GLY C 1 19  ? 31.494  -13.348 -25.158 1.00 53.35 ? 63  GLY C N   1 
ATOM   1811 C CA  . GLY C 1 19  ? 32.227  -14.500 -24.729 1.00 54.50 ? 63  GLY C CA  1 
ATOM   1812 C C   . GLY C 1 19  ? 32.859  -14.270 -23.361 1.00 55.35 ? 63  GLY C C   1 
ATOM   1813 O O   . GLY C 1 19  ? 33.131  -15.262 -22.666 1.00 56.06 ? 63  GLY C O   1 
ATOM   1814 N N   . PRO C 1 20  ? 32.991  -12.980 -22.920 1.00 55.90 ? 64  PRO C N   1 
ATOM   1815 C CA  . PRO C 1 20  ? 33.748  -11.803 -22.450 1.00 56.15 ? 64  PRO C CA  1 
ATOM   1816 C C   . PRO C 1 20  ? 35.045  -11.468 -23.195 1.00 56.47 ? 64  PRO C C   1 
ATOM   1817 O O   . PRO C 1 20  ? 35.931  -12.302 -23.288 1.00 55.95 ? 64  PRO C O   1 
ATOM   1818 C CB  . PRO C 1 20  ? 34.020  -12.143 -20.987 1.00 55.57 ? 64  PRO C CB  1 
ATOM   1819 C CG  . PRO C 1 20  ? 32.751  -12.953 -20.601 1.00 56.23 ? 64  PRO C CG  1 
ATOM   1820 C CD  . PRO C 1 20  ? 31.928  -13.123 -21.925 1.00 56.34 ? 64  PRO C CD  1 
ATOM   1821 N N   . LEU C 1 21  ? 35.133  -10.246 -23.718 1.00 57.29 ? 65  LEU C N   1 
ATOM   1822 C CA  . LEU C 1 21  ? 36.360  -9.767  -24.386 1.00 58.99 ? 65  LEU C CA  1 
ATOM   1823 C C   . LEU C 1 21  ? 37.587  -10.005 -23.493 1.00 59.41 ? 65  LEU C C   1 
ATOM   1824 O O   . LEU C 1 21  ? 37.575  -9.611  -22.323 1.00 59.91 ? 65  LEU C O   1 
ATOM   1825 C CB  . LEU C 1 21  ? 36.206  -8.300  -24.804 1.00 58.97 ? 65  LEU C CB  1 
ATOM   1826 C CG  . LEU C 1 21  ? 35.007  -8.223  -25.774 1.00 58.33 ? 65  LEU C CG  1 
ATOM   1827 C CD1 . LEU C 1 21  ? 34.325  -6.879  -25.722 1.00 57.80 ? 65  LEU C CD1 1 
ATOM   1828 C CD2 . LEU C 1 21  ? 35.413  -8.624  -27.224 1.00 58.09 ? 65  LEU C CD2 1 
ATOM   1829 N N   . PRO C 1 22  ? 38.620  -10.706 -24.013 1.00 59.51 ? 66  PRO C N   1 
ATOM   1830 C CA  . PRO C 1 22  ? 38.919  -11.064 -25.406 1.00 59.57 ? 66  PRO C CA  1 
ATOM   1831 C C   . PRO C 1 22  ? 38.415  -12.441 -25.862 1.00 59.20 ? 66  PRO C C   1 
ATOM   1832 O O   . PRO C 1 22  ? 38.950  -13.007 -26.828 1.00 58.84 ? 66  PRO C O   1 
ATOM   1833 C CB  . PRO C 1 22  ? 40.457  -11.056 -25.425 1.00 59.77 ? 66  PRO C CB  1 
ATOM   1834 C CG  . PRO C 1 22  ? 40.876  -11.391 -23.959 1.00 59.82 ? 66  PRO C CG  1 
ATOM   1835 C CD  . PRO C 1 22  ? 39.625  -11.286 -23.093 1.00 59.66 ? 66  PRO C CD  1 
ATOM   1836 N N   . SER C 1 23  ? 37.420  -12.983 -25.157 1.00 58.72 ? 67  SER C N   1 
ATOM   1837 C CA  . SER C 1 23  ? 36.703  -14.169 -25.644 1.00 58.36 ? 67  SER C CA  1 
ATOM   1838 C C   . SER C 1 23  ? 35.790  -13.754 -26.778 1.00 57.75 ? 67  SER C C   1 
ATOM   1839 O O   . SER C 1 23  ? 35.228  -12.643 -26.779 1.00 58.05 ? 67  SER C O   1 
ATOM   1840 C CB  . SER C 1 23  ? 35.883  -14.869 -24.554 1.00 57.96 ? 67  SER C CB  1 
ATOM   1841 O OG  . SER C 1 23  ? 36.693  -15.616 -23.675 1.00 58.34 ? 67  SER C OG  1 
ATOM   1842 N N   . LYS C 1 24  ? 35.676  -14.668 -27.733 1.00 56.91 ? 68  LYS C N   1 
ATOM   1843 C CA  . LYS C 1 24  ? 34.885  -14.523 -28.940 1.00 56.63 ? 68  LYS C CA  1 
ATOM   1844 C C   . LYS C 1 24  ? 33.768  -15.583 -28.763 1.00 56.25 ? 68  LYS C C   1 
ATOM   1845 O O   . LYS C 1 24  ? 33.460  -15.950 -27.626 1.00 56.18 ? 68  LYS C O   1 
ATOM   1846 C CB  . LYS C 1 24  ? 35.813  -14.793 -30.165 1.00 56.68 ? 68  LYS C CB  1 
ATOM   1847 C CG  . LYS C 1 24  ? 35.368  -14.287 -31.540 1.00 56.64 ? 68  LYS C CG  1 
ATOM   1848 C CD  . LYS C 1 24  ? 34.864  -15.410 -32.497 1.00 54.24 ? 68  LYS C CD  1 
ATOM   1849 C CE  . LYS C 1 24  ? 34.622  -14.862 -33.945 1.00 55.58 ? 68  LYS C CE  1 
ATOM   1850 N NZ  . LYS C 1 24  ? 33.308  -14.145 -34.210 1.00 49.50 ? 68  LYS C NZ  1 
ATOM   1851 N N   . TRP C 1 25  ? 33.165  -16.046 -29.863 1.00 55.33 ? 69  TRP C N   1 
ATOM   1852 C CA  . TRP C 1 25  ? 32.151  -17.107 -29.862 1.00 54.32 ? 69  TRP C CA  1 
ATOM   1853 C C   . TRP C 1 25  ? 32.696  -18.457 -29.327 1.00 55.24 ? 69  TRP C C   1 
ATOM   1854 O O   . TRP C 1 25  ? 33.751  -18.921 -29.742 1.00 55.22 ? 69  TRP C O   1 
ATOM   1855 C CB  . TRP C 1 25  ? 31.540  -17.245 -31.272 1.00 51.83 ? 69  TRP C CB  1 
ATOM   1856 C CG  . TRP C 1 25  ? 30.458  -16.197 -31.562 1.00 50.57 ? 69  TRP C CG  1 
ATOM   1857 C CD1 . TRP C 1 25  ? 30.518  -15.159 -32.459 1.00 46.76 ? 69  TRP C CD1 1 
ATOM   1858 C CD2 . TRP C 1 25  ? 29.177  -16.083 -30.911 1.00 48.31 ? 69  TRP C CD2 1 
ATOM   1859 N NE1 . TRP C 1 25  ? 29.354  -14.437 -32.427 1.00 45.86 ? 69  TRP C NE1 1 
ATOM   1860 C CE2 . TRP C 1 25  ? 28.513  -14.975 -31.486 1.00 48.28 ? 69  TRP C CE2 1 
ATOM   1861 C CE3 . TRP C 1 25  ? 28.524  -16.815 -29.896 1.00 47.53 ? 69  TRP C CE3 1 
ATOM   1862 C CZ2 . TRP C 1 25  ? 27.242  -14.564 -31.057 1.00 47.81 ? 69  TRP C CZ2 1 
ATOM   1863 C CZ3 . TRP C 1 25  ? 27.253  -16.402 -29.479 1.00 46.44 ? 69  TRP C CZ3 1 
ATOM   1864 C CH2 . TRP C 1 25  ? 26.637  -15.301 -30.063 1.00 48.36 ? 69  TRP C CH2 1 
ATOM   1865 N N   . GLN C 1 26  ? 31.987  -19.057 -28.378 1.00 56.22 ? 70  GLN C N   1 
ATOM   1866 C CA  . GLN C 1 26  ? 32.284  -20.402 -27.909 1.00 57.25 ? 70  GLN C CA  1 
ATOM   1867 C C   . GLN C 1 26  ? 31.047  -21.223 -28.169 1.00 59.04 ? 70  GLN C C   1 
ATOM   1868 O O   . GLN C 1 26  ? 29.969  -20.653 -28.299 1.00 58.94 ? 70  GLN C O   1 
ATOM   1869 C CB  . GLN C 1 26  ? 32.578  -20.411 -26.417 1.00 57.38 ? 70  GLN C CB  1 
ATOM   1870 C CG  . GLN C 1 26  ? 33.611  -19.411 -25.961 1.00 56.60 ? 70  GLN C CG  1 
ATOM   1871 C CD  . GLN C 1 26  ? 34.035  -19.652 -24.532 1.00 57.55 ? 70  GLN C CD  1 
ATOM   1872 O OE1 . GLN C 1 26  ? 33.878  -18.768 -23.675 1.00 55.70 ? 70  GLN C OE1 1 
ATOM   1873 N NE2 . GLN C 1 26  ? 34.572  -20.862 -24.253 1.00 56.14 ? 70  GLN C NE2 1 
ATOM   1874 N N   . MET C 1 27  ? 31.179  -22.548 -28.242 1.00 60.48 ? 71  MET C N   1 
ATOM   1875 C CA  . MET C 1 27  ? 30.062  -23.371 -28.675 1.00 62.53 ? 71  MET C CA  1 
ATOM   1876 C C   . MET C 1 27  ? 30.077  -24.770 -28.109 1.00 63.00 ? 71  MET C C   1 
ATOM   1877 O O   . MET C 1 27  ? 31.109  -25.403 -28.042 1.00 63.06 ? 71  MET C O   1 
ATOM   1878 C CB  . MET C 1 27  ? 29.930  -23.357 -30.202 1.00 61.84 ? 71  MET C CB  1 
ATOM   1879 C CG  . MET C 1 27  ? 28.760  -22.488 -30.684 1.00 63.34 ? 71  MET C CG  1 
ATOM   1880 S SD  . MET C 1 27  ? 28.979  -21.625 -32.253 1.00 66.73 ? 71  MET C SD  1 
ATOM   1881 C CE  . MET C 1 27  ? 29.719  -20.070 -31.730 1.00 63.79 ? 71  MET C CE  1 
ATOM   1882 N N   . ALA C 1 28  ? 28.913  -25.225 -27.677 1.00 64.36 ? 72  ALA C N   1 
ATOM   1883 C CA  . ALA C 1 28  ? 28.748  -26.504 -27.017 1.00 66.62 ? 72  ALA C CA  1 
ATOM   1884 C C   . ALA C 1 28  ? 27.639  -27.291 -27.725 1.00 68.53 ? 72  ALA C C   1 
ATOM   1885 O O   . ALA C 1 28  ? 26.766  -26.702 -28.390 1.00 68.70 ? 72  ALA C O   1 
ATOM   1886 C CB  . ALA C 1 28  ? 28.439  -26.316 -25.514 1.00 66.24 ? 72  ALA C CB  1 
ATOM   1887 N N   . SER C 1 29  ? 27.640  -28.606 -27.500 1.00 70.69 ? 73  SER C N   1 
ATOM   1888 C CA  . SER C 1 29  ? 27.470  -29.573 -28.592 1.00 72.42 ? 73  SER C CA  1 
ATOM   1889 C C   . SER C 1 29  ? 26.461  -29.239 -29.701 1.00 72.92 ? 73  SER C C   1 
ATOM   1890 O O   . SER C 1 29  ? 25.263  -29.595 -29.654 1.00 73.38 ? 73  SER C O   1 
ATOM   1891 C CB  . SER C 1 29  ? 27.391  -31.020 -28.099 1.00 72.86 ? 73  SER C CB  1 
ATOM   1892 O OG  . SER C 1 29  ? 28.104  -31.849 -29.007 1.00 74.11 ? 73  SER C OG  1 
ATOM   1893 N N   . SER C 1 30  ? 27.004  -28.559 -30.707 1.00 73.22 ? 74  SER C N   1 
ATOM   1894 C CA  . SER C 1 30  ? 26.275  -28.203 -31.918 1.00 73.25 ? 74  SER C CA  1 
ATOM   1895 C C   . SER C 1 30  ? 26.331  -29.371 -32.936 1.00 72.33 ? 74  SER C C   1 
ATOM   1896 O O   . SER C 1 30  ? 26.963  -29.237 -33.994 1.00 72.72 ? 74  SER C O   1 
ATOM   1897 C CB  . SER C 1 30  ? 26.855  -26.909 -32.540 1.00 73.43 ? 74  SER C CB  1 
ATOM   1898 O OG  . SER C 1 30  ? 27.538  -26.093 -31.586 1.00 75.58 ? 74  SER C OG  1 
ATOM   1899 N N   . GLU C 1 31  ? 25.706  -30.515 -32.624 1.00 70.56 ? 75  GLU C N   1 
ATOM   1900 C CA  . GLU C 1 31  ? 25.571  -31.555 -33.652 1.00 68.97 ? 75  GLU C CA  1 
ATOM   1901 C C   . GLU C 1 31  ? 24.237  -32.272 -33.781 1.00 67.92 ? 75  GLU C C   1 
ATOM   1902 O O   . GLU C 1 31  ? 23.886  -33.084 -32.908 1.00 68.45 ? 75  GLU C O   1 
ATOM   1903 C CB  . GLU C 1 31  ? 26.697  -32.585 -33.620 1.00 69.01 ? 75  GLU C CB  1 
ATOM   1904 C CG  . GLU C 1 31  ? 26.711  -33.409 -34.918 1.00 67.46 ? 75  GLU C CG  1 
ATOM   1905 C CD  . GLU C 1 31  ? 27.441  -32.709 -36.051 1.00 65.13 ? 75  GLU C CD  1 
ATOM   1906 O OE1 . GLU C 1 31  ? 28.647  -32.455 -35.866 1.00 64.76 ? 75  GLU C OE1 1 
ATOM   1907 O OE2 . GLU C 1 31  ? 26.837  -32.427 -37.118 1.00 63.88 ? 75  GLU C OE2 1 
ATOM   1908 N N   . PRO C 1 32  ? 23.509  -32.010 -34.897 1.00 66.49 ? 76  PRO C N   1 
ATOM   1909 C CA  . PRO C 1 32  ? 23.751  -30.858 -35.814 1.00 65.05 ? 76  PRO C CA  1 
ATOM   1910 C C   . PRO C 1 32  ? 23.553  -29.492 -35.104 1.00 63.45 ? 76  PRO C C   1 
ATOM   1911 O O   . PRO C 1 32  ? 22.678  -29.360 -34.229 1.00 63.65 ? 76  PRO C O   1 
ATOM   1912 C CB  . PRO C 1 32  ? 22.719  -31.049 -36.932 1.00 64.82 ? 76  PRO C CB  1 
ATOM   1913 C CG  . PRO C 1 32  ? 22.267  -32.487 -36.811 1.00 66.11 ? 76  PRO C CG  1 
ATOM   1914 C CD  . PRO C 1 32  ? 22.437  -32.901 -35.383 1.00 66.17 ? 76  PRO C CD  1 
ATOM   1915 N N   . PRO C 1 33  ? 24.371  -28.491 -35.470 1.00 61.20 ? 77  PRO C N   1 
ATOM   1916 C CA  . PRO C 1 33  ? 24.361  -27.155 -34.885 1.00 59.37 ? 77  PRO C CA  1 
ATOM   1917 C C   . PRO C 1 33  ? 22.982  -26.556 -34.852 1.00 57.26 ? 77  PRO C C   1 
ATOM   1918 O O   . PRO C 1 33  ? 22.223  -26.699 -35.805 1.00 57.25 ? 77  PRO C O   1 
ATOM   1919 C CB  . PRO C 1 33  ? 25.218  -26.345 -35.853 1.00 59.78 ? 77  PRO C CB  1 
ATOM   1920 C CG  . PRO C 1 33  ? 26.134  -27.362 -36.454 1.00 60.64 ? 77  PRO C CG  1 
ATOM   1921 C CD  . PRO C 1 33  ? 25.379  -28.629 -36.531 1.00 60.93 ? 77  PRO C CD  1 
ATOM   1922 N N   . CYS C 1 34  ? 22.659  -25.877 -33.770 1.00 54.86 ? 78  CYS C N   1 
ATOM   1923 C CA  . CYS C 1 34  ? 21.383  -25.181 -33.697 1.00 53.43 ? 78  CYS C CA  1 
ATOM   1924 C C   . CYS C 1 34  ? 21.614  -23.731 -34.072 1.00 52.39 ? 78  CYS C C   1 
ATOM   1925 O O   . CYS C 1 34  ? 20.694  -23.012 -34.448 1.00 53.21 ? 78  CYS C O   1 
ATOM   1926 C CB  . CYS C 1 34  ? 20.752  -25.299 -32.297 1.00 52.96 ? 78  CYS C CB  1 
ATOM   1927 S SG  . CYS C 1 34  ? 21.666  -24.479 -30.936 1.00 51.11 ? 78  CYS C SG  1 
ATOM   1928 N N   . VAL C 1 35  ? 22.858  -23.320 -33.993 1.00 51.06 ? 79  VAL C N   1 
ATOM   1929 C CA  . VAL C 1 35  ? 23.225  -21.915 -34.014 1.00 50.82 ? 79  VAL C CA  1 
ATOM   1930 C C   . VAL C 1 35  ? 24.520  -21.745 -34.789 1.00 51.90 ? 79  VAL C C   1 
ATOM   1931 O O   . VAL C 1 35  ? 25.360  -22.662 -34.810 1.00 52.07 ? 79  VAL C O   1 
ATOM   1932 C CB  . VAL C 1 35  ? 23.351  -21.452 -32.556 1.00 50.83 ? 79  VAL C CB  1 
ATOM   1933 C CG1 . VAL C 1 35  ? 24.687  -20.913 -32.239 1.00 47.22 ? 79  VAL C CG1 1 
ATOM   1934 C CG2 . VAL C 1 35  ? 22.178  -20.555 -32.195 1.00 49.44 ? 79  VAL C CG2 1 
ATOM   1935 N N   . ASN C 1 36  ? 24.675  -20.606 -35.454 1.00 52.94 ? 80  ASN C N   1 
ATOM   1936 C CA  . ASN C 1 36  ? 25.880  -20.330 -36.217 1.00 54.21 ? 80  ASN C CA  1 
ATOM   1937 C C   . ASN C 1 36  ? 26.244  -18.865 -36.061 1.00 55.09 ? 80  ASN C C   1 
ATOM   1938 O O   . ASN C 1 36  ? 25.393  -17.992 -36.234 1.00 54.81 ? 80  ASN C O   1 
ATOM   1939 C CB  . ASN C 1 36  ? 25.627  -20.649 -37.697 1.00 54.78 ? 80  ASN C CB  1 
ATOM   1940 C CG  . ASN C 1 36  ? 26.897  -21.092 -38.463 1.00 56.53 ? 80  ASN C CG  1 
ATOM   1941 O OD1 . ASN C 1 36  ? 26.965  -22.233 -38.952 1.00 57.93 ? 80  ASN C OD1 1 
ATOM   1942 N ND2 . ASN C 1 36  ? 27.885  -20.183 -38.594 1.00 56.80 ? 80  ASN C ND2 1 
ATOM   1943 N N   . LYS C 1 37  ? 27.505  -18.585 -35.761 1.00 56.37 ? 81  LYS C N   1 
ATOM   1944 C CA  . LYS C 1 37  ? 27.929  -17.203 -35.593 1.00 58.17 ? 81  LYS C CA  1 
ATOM   1945 C C   . LYS C 1 37  ? 27.956  -16.426 -36.912 1.00 58.43 ? 81  LYS C C   1 
ATOM   1946 O O   . LYS C 1 37  ? 28.268  -16.951 -37.999 1.00 58.50 ? 81  LYS C O   1 
ATOM   1947 C CB  . LYS C 1 37  ? 29.289  -17.107 -34.897 1.00 58.74 ? 81  LYS C CB  1 
ATOM   1948 C CG  . LYS C 1 37  ? 30.502  -17.209 -35.832 1.00 58.61 ? 81  LYS C CG  1 
ATOM   1949 C CD  . LYS C 1 37  ? 31.798  -17.144 -35.064 1.00 59.79 ? 81  LYS C CD  1 
ATOM   1950 C CE  . LYS C 1 37  ? 32.075  -18.470 -34.362 1.00 63.46 ? 81  LYS C CE  1 
ATOM   1951 N NZ  . LYS C 1 37  ? 33.525  -18.504 -33.992 1.00 66.64 ? 81  LYS C NZ  1 
ATOM   1952 N N   . VAL C 1 38  ? 27.635  -15.152 -36.778 1.00 59.33 ? 82  VAL C N   1 
ATOM   1953 C CA  . VAL C 1 38  ? 27.557  -14.243 -37.904 1.00 59.67 ? 82  VAL C CA  1 
ATOM   1954 C C   . VAL C 1 38  ? 28.789  -13.295 -37.802 1.00 60.63 ? 82  VAL C C   1 
ATOM   1955 O O   . VAL C 1 38  ? 29.766  -13.456 -38.549 1.00 60.80 ? 82  VAL C O   1 
ATOM   1956 C CB  . VAL C 1 38  ? 26.166  -13.553 -37.892 1.00 59.68 ? 82  VAL C CB  1 
ATOM   1957 C CG1 . VAL C 1 38  ? 26.155  -12.289 -38.701 1.00 59.33 ? 82  VAL C CG1 1 
ATOM   1958 C CG2 . VAL C 1 38  ? 25.112  -14.518 -38.368 1.00 57.25 ? 82  VAL C CG2 1 
ATOM   1959 N N   . SER C 1 39  ? 28.776  -12.361 -36.853 1.00 60.97 ? 83  SER C N   1 
ATOM   1960 C CA  . SER C 1 39  ? 29.957  -11.532 -36.587 1.00 61.09 ? 83  SER C CA  1 
ATOM   1961 C C   . SER C 1 39  ? 30.269  -11.647 -35.114 1.00 61.01 ? 83  SER C C   1 
ATOM   1962 O O   . SER C 1 39  ? 30.144  -12.716 -34.526 1.00 61.27 ? 83  SER C O   1 
ATOM   1963 C CB  . SER C 1 39  ? 29.729  -10.060 -36.994 1.00 61.27 ? 83  SER C CB  1 
ATOM   1964 O OG  . SER C 1 39  ? 28.631  -9.454  -36.320 1.00 61.93 ? 83  SER C OG  1 
ATOM   1965 N N   . ASP C 1 40  ? 30.651  -10.536 -34.515 1.00 60.72 ? 84  ASP C N   1 
ATOM   1966 C CA  . ASP C 1 40  ? 30.799  -10.470 -33.087 1.00 59.85 ? 84  ASP C CA  1 
ATOM   1967 C C   . ASP C 1 40  ? 29.487  -10.048 -32.477 1.00 59.74 ? 84  ASP C C   1 
ATOM   1968 O O   . ASP C 1 40  ? 28.832  -9.116  -32.984 1.00 59.60 ? 84  ASP C O   1 
ATOM   1969 C CB  . ASP C 1 40  ? 31.900  -9.487  -32.734 1.00 60.21 ? 84  ASP C CB  1 
ATOM   1970 C CG  . ASP C 1 40  ? 33.277  -10.055 -33.006 1.00 60.07 ? 84  ASP C CG  1 
ATOM   1971 O OD1 . ASP C 1 40  ? 34.266  -9.423  -32.584 1.00 57.73 ? 84  ASP C OD1 1 
ATOM   1972 O OD2 . ASP C 1 40  ? 33.350  -11.143 -33.632 1.00 60.02 ? 84  ASP C OD2 1 
ATOM   1973 N N   . TRP C 1 41  ? 29.089  -10.765 -31.410 1.00 58.84 ? 85  TRP C N   1 
ATOM   1974 C CA  . TRP C 1 41  ? 27.888  -10.448 -30.624 1.00 57.63 ? 85  TRP C CA  1 
ATOM   1975 C C   . TRP C 1 41  ? 26.635  -10.909 -31.319 1.00 56.17 ? 85  TRP C C   1 
ATOM   1976 O O   . TRP C 1 41  ? 25.547  -10.868 -30.729 1.00 56.99 ? 85  TRP C O   1 
ATOM   1977 C CB  . TRP C 1 41  ? 27.794  -8.944  -30.320 1.00 58.39 ? 85  TRP C CB  1 
ATOM   1978 C CG  . TRP C 1 41  ? 28.978  -8.456  -29.541 1.00 59.29 ? 85  TRP C CG  1 
ATOM   1979 C CD1 . TRP C 1 41  ? 30.070  -7.784  -30.041 1.00 59.37 ? 85  TRP C CD1 1 
ATOM   1980 C CD2 . TRP C 1 41  ? 29.225  -8.637  -28.132 1.00 58.51 ? 85  TRP C CD2 1 
ATOM   1981 N NE1 . TRP C 1 41  ? 30.958  -7.526  -29.026 1.00 59.64 ? 85  TRP C NE1 1 
ATOM   1982 C CE2 . TRP C 1 41  ? 30.464  -8.033  -27.847 1.00 59.15 ? 85  TRP C CE2 1 
ATOM   1983 C CE3 . TRP C 1 41  ? 28.507  -9.235  -27.081 1.00 59.91 ? 85  TRP C CE3 1 
ATOM   1984 C CZ2 . TRP C 1 41  ? 31.013  -8.019  -26.551 1.00 59.39 ? 85  TRP C CZ2 1 
ATOM   1985 C CZ3 . TRP C 1 41  ? 29.039  -9.221  -25.804 1.00 58.66 ? 85  TRP C CZ3 1 
ATOM   1986 C CH2 . TRP C 1 41  ? 30.285  -8.614  -25.545 1.00 59.78 ? 85  TRP C CH2 1 
ATOM   1987 N N   . LYS C 1 42  ? 26.805  -11.367 -32.561 1.00 54.10 ? 86  LYS C N   1 
ATOM   1988 C CA  . LYS C 1 42  ? 25.732  -11.764 -33.449 1.00 51.33 ? 86  LYS C CA  1 
ATOM   1989 C C   . LYS C 1 42  ? 25.846  -13.272 -33.840 1.00 50.64 ? 86  LYS C C   1 
ATOM   1990 O O   . LYS C 1 42  ? 26.926  -13.781 -34.184 1.00 50.04 ? 86  LYS C O   1 
ATOM   1991 C CB  . LYS C 1 42  ? 25.743  -10.836 -34.666 1.00 51.34 ? 86  LYS C CB  1 
ATOM   1992 C CG  . LYS C 1 42  ? 24.465  -10.803 -35.485 1.00 51.19 ? 86  LYS C CG  1 
ATOM   1993 C CD  . LYS C 1 42  ? 24.487  -9.714  -36.525 1.00 50.44 ? 86  LYS C CD  1 
ATOM   1994 C CE  . LYS C 1 42  ? 23.088  -9.322  -36.942 1.00 53.03 ? 86  LYS C CE  1 
ATOM   1995 N NZ  . LYS C 1 42  ? 22.966  -8.967  -38.405 1.00 51.80 ? 86  LYS C NZ  1 
ATOM   1996 N N   . LEU C 1 43  ? 24.738  -13.999 -33.729 1.00 48.29 ? 87  LEU C N   1 
ATOM   1997 C CA  . LEU C 1 43  ? 24.652  -15.312 -34.367 1.00 48.14 ? 87  LEU C CA  1 
ATOM   1998 C C   . LEU C 1 43  ? 23.356  -15.401 -35.157 1.00 46.29 ? 87  LEU C C   1 
ATOM   1999 O O   . LEU C 1 43  ? 22.558  -14.471 -35.157 1.00 46.13 ? 87  LEU C O   1 
ATOM   2000 C CB  . LEU C 1 43  ? 24.767  -16.483 -33.368 1.00 48.39 ? 87  LEU C CB  1 
ATOM   2001 C CG  . LEU C 1 43  ? 24.073  -16.548 -32.009 1.00 49.96 ? 87  LEU C CG  1 
ATOM   2002 C CD1 . LEU C 1 43  ? 22.594  -16.577 -32.096 1.00 53.07 ? 87  LEU C CD1 1 
ATOM   2003 C CD2 . LEU C 1 43  ? 24.538  -17.808 -31.304 1.00 49.98 ? 87  LEU C CD2 1 
ATOM   2004 N N   . GLU C 1 44  ? 23.162  -16.541 -35.784 1.00 44.28 ? 88  GLU C N   1 
ATOM   2005 C CA  . GLU C 1 44  ? 22.040  -16.821 -36.617 1.00 44.93 ? 88  GLU C CA  1 
ATOM   2006 C C   . GLU C 1 44  ? 21.453  -18.118 -36.103 1.00 42.16 ? 88  GLU C C   1 
ATOM   2007 O O   . GLU C 1 44  ? 22.182  -19.040 -35.744 1.00 40.37 ? 88  GLU C O   1 
ATOM   2008 C CB  . GLU C 1 44  ? 22.551  -17.053 -38.055 1.00 44.27 ? 88  GLU C CB  1 
ATOM   2009 C CG  . GLU C 1 44  ? 21.513  -16.974 -39.177 1.00 48.51 ? 88  GLU C CG  1 
ATOM   2010 C CD  . GLU C 1 44  ? 21.887  -17.850 -40.410 1.00 49.79 ? 88  GLU C CD  1 
ATOM   2011 O OE1 . GLU C 1 44  ? 22.479  -18.958 -40.209 1.00 59.81 ? 88  GLU C OE1 1 
ATOM   2012 O OE2 . GLU C 1 44  ? 21.569  -17.462 -41.557 1.00 51.39 ? 88  GLU C OE2 1 
ATOM   2013 N N   . ILE C 1 45  ? 20.141  -18.240 -36.156 1.00 41.42 ? 89  ILE C N   1 
ATOM   2014 C CA  . ILE C 1 45  ? 19.488  -19.511 -35.750 1.00 41.41 ? 89  ILE C CA  1 
ATOM   2015 C C   . ILE C 1 45  ? 19.443  -20.515 -36.917 1.00 41.10 ? 89  ILE C C   1 
ATOM   2016 O O   . ILE C 1 45  ? 19.090  -20.159 -38.030 1.00 40.06 ? 89  ILE C O   1 
ATOM   2017 C CB  . ILE C 1 45  ? 18.087  -19.219 -35.089 1.00 41.03 ? 89  ILE C CB  1 
ATOM   2018 C CG1 . ILE C 1 45  ? 18.294  -18.278 -33.905 1.00 40.55 ? 89  ILE C CG1 1 
ATOM   2019 C CG2 . ILE C 1 45  ? 17.373  -20.463 -34.679 1.00 39.66 ? 89  ILE C CG2 1 
ATOM   2020 C CD1 . ILE C 1 45  ? 19.148  -18.868 -32.721 1.00 40.78 ? 89  ILE C CD1 1 
ATOM   2021 N N   . LEU C 1 46  ? 19.856  -21.750 -36.661 1.00 42.59 ? 90  LEU C N   1 
ATOM   2022 C CA  . LEU C 1 46  ? 19.853  -22.803 -37.680 1.00 44.41 ? 90  LEU C CA  1 
ATOM   2023 C C   . LEU C 1 46  ? 18.716  -23.805 -37.479 1.00 45.20 ? 90  LEU C C   1 
ATOM   2024 O O   . LEU C 1 46  ? 18.431  -24.631 -38.358 1.00 46.07 ? 90  LEU C O   1 
ATOM   2025 C CB  . LEU C 1 46  ? 21.198  -23.540 -37.709 1.00 44.34 ? 90  LEU C CB  1 
ATOM   2026 C CG  . LEU C 1 46  ? 22.518  -22.769 -37.865 1.00 44.84 ? 90  LEU C CG  1 
ATOM   2027 C CD1 . LEU C 1 46  ? 23.667  -23.767 -37.897 1.00 44.20 ? 90  LEU C CD1 1 
ATOM   2028 C CD2 . LEU C 1 46  ? 22.521  -21.945 -39.171 1.00 41.35 ? 90  LEU C CD2 1 
ATOM   2029 N N   . GLN C 1 47  ? 18.051  -23.724 -36.339 1.00 45.36 ? 91  GLN C N   1 
ATOM   2030 C CA  . GLN C 1 47  ? 17.123  -24.761 -35.937 1.00 47.04 ? 91  GLN C CA  1 
ATOM   2031 C C   . GLN C 1 47  ? 15.983  -24.145 -35.070 1.00 46.02 ? 91  GLN C C   1 
ATOM   2032 O O   . GLN C 1 47  ? 16.233  -23.516 -34.038 1.00 47.17 ? 91  GLN C O   1 
ATOM   2033 C CB  . GLN C 1 47  ? 17.932  -25.917 -35.266 1.00 46.57 ? 91  GLN C CB  1 
ATOM   2034 C CG  . GLN C 1 47  ? 17.260  -26.695 -34.096 1.00 49.51 ? 91  GLN C CG  1 
ATOM   2035 C CD  . GLN C 1 47  ? 18.200  -27.722 -33.394 1.00 50.70 ? 91  GLN C CD  1 
ATOM   2036 O OE1 . GLN C 1 47  ? 19.450  -27.580 -33.380 1.00 54.62 ? 91  GLN C OE1 1 
ATOM   2037 N NE2 . GLN C 1 47  ? 17.596  -28.761 -32.810 1.00 53.52 ? 91  GLN C NE2 1 
ATOM   2038 N N   . ASN C 1 48  ? 14.754  -24.310 -35.533 1.00 43.87 ? 92  ASN C N   1 
ATOM   2039 C CA  . ASN C 1 48  ? 13.567  -23.796 -34.890 1.00 43.08 ? 92  ASN C CA  1 
ATOM   2040 C C   . ASN C 1 48  ? 13.538  -24.348 -33.460 1.00 41.03 ? 92  ASN C C   1 
ATOM   2041 O O   . ASN C 1 48  ? 14.002  -25.470 -33.222 1.00 40.07 ? 92  ASN C O   1 
ATOM   2042 C CB  . ASN C 1 48  ? 12.300  -24.295 -35.588 1.00 42.76 ? 92  ASN C CB  1 
ATOM   2043 C CG  . ASN C 1 48  ? 12.169  -23.860 -37.045 1.00 45.72 ? 92  ASN C CG  1 
ATOM   2044 O OD1 . ASN C 1 48  ? 11.823  -24.683 -37.883 1.00 49.36 ? 92  ASN C OD1 1 
ATOM   2045 N ND2 . ASN C 1 48  ? 12.328  -22.581 -37.335 1.00 47.38 ? 92  ASN C ND2 1 
ATOM   2046 N N   . GLY C 1 49  ? 13.038  -23.558 -32.518 1.00 39.25 ? 93  GLY C N   1 
ATOM   2047 C CA  . GLY C 1 49  ? 13.000  -24.008 -31.119 1.00 37.22 ? 93  GLY C CA  1 
ATOM   2048 C C   . GLY C 1 49  ? 12.644  -22.939 -30.141 1.00 36.19 ? 93  GLY C C   1 
ATOM   2049 O O   . GLY C 1 49  ? 12.516  -21.751 -30.478 1.00 36.26 ? 93  GLY C O   1 
ATOM   2050 N N   . LEU C 1 50  ? 12.486  -23.374 -28.901 1.00 35.32 ? 94  LEU C N   1 
ATOM   2051 C CA  . LEU C 1 50  ? 12.413  -22.484 -27.742 1.00 33.84 ? 94  LEU C CA  1 
ATOM   2052 C C   . LEU C 1 50  ? 13.829  -22.336 -27.182 1.00 33.21 ? 94  LEU C C   1 
ATOM   2053 O O   . LEU C 1 50  ? 14.399  -23.274 -26.739 1.00 31.42 ? 94  LEU C O   1 
ATOM   2054 C CB  . LEU C 1 50  ? 11.544  -23.132 -26.641 1.00 33.98 ? 94  LEU C CB  1 
ATOM   2055 C CG  . LEU C 1 50  ? 10.438  -22.378 -25.931 1.00 34.40 ? 94  LEU C CG  1 
ATOM   2056 C CD1 . LEU C 1 50  ? 10.376  -22.818 -24.472 1.00 32.65 ? 94  LEU C CD1 1 
ATOM   2057 C CD2 . LEU C 1 50  ? 10.545  -20.909 -26.060 1.00 31.35 ? 94  LEU C CD2 1 
ATOM   2058 N N   . TYR C 1 51  ? 14.347  -21.124 -27.155 1.00 35.20 ? 95  TYR C N   1 
ATOM   2059 C CA  . TYR C 1 51  ? 15.688  -20.850 -26.674 1.00 37.22 ? 95  TYR C CA  1 
ATOM   2060 C C   . TYR C 1 51  ? 15.603  -19.963 -25.416 1.00 36.79 ? 95  TYR C C   1 
ATOM   2061 O O   . TYR C 1 51  ? 14.601  -19.292 -25.234 1.00 37.91 ? 95  TYR C O   1 
ATOM   2062 C CB  . TYR C 1 51  ? 16.401  -20.126 -27.768 1.00 37.31 ? 95  TYR C CB  1 
ATOM   2063 C CG  . TYR C 1 51  ? 16.776  -21.005 -28.959 1.00 41.11 ? 95  TYR C CG  1 
ATOM   2064 C CD1 . TYR C 1 51  ? 15.917  -21.152 -30.061 1.00 37.79 ? 95  TYR C CD1 1 
ATOM   2065 C CD2 . TYR C 1 51  ? 18.021  -21.683 -28.989 1.00 39.34 ? 95  TYR C CD2 1 
ATOM   2066 C CE1 . TYR C 1 51  ? 16.295  -21.923 -31.161 1.00 37.20 ? 95  TYR C CE1 1 
ATOM   2067 C CE2 . TYR C 1 51  ? 18.372  -22.448 -30.047 1.00 37.15 ? 95  TYR C CE2 1 
ATOM   2068 C CZ  . TYR C 1 51  ? 17.506  -22.568 -31.135 1.00 39.99 ? 95  TYR C CZ  1 
ATOM   2069 O OH  . TYR C 1 51  ? 17.865  -23.356 -32.208 1.00 42.76 ? 95  TYR C OH  1 
ATOM   2070 N N   . LEU C 1 52  ? 16.617  -20.010 -24.547 1.00 35.06 ? 96  LEU C N   1 
ATOM   2071 C CA  . LEU C 1 52  ? 16.790  -19.060 -23.470 1.00 33.62 ? 96  LEU C CA  1 
ATOM   2072 C C   . LEU C 1 52  ? 18.022  -18.233 -23.756 1.00 34.73 ? 96  LEU C C   1 
ATOM   2073 O O   . LEU C 1 52  ? 19.124  -18.767 -23.769 1.00 34.07 ? 96  LEU C O   1 
ATOM   2074 C CB  . LEU C 1 52  ? 16.987  -19.803 -22.145 1.00 33.98 ? 96  LEU C CB  1 
ATOM   2075 C CG  . LEU C 1 52  ? 17.239  -19.201 -20.751 1.00 35.62 ? 96  LEU C CG  1 
ATOM   2076 C CD1 . LEU C 1 52  ? 16.834  -17.711 -20.490 1.00 36.68 ? 96  LEU C CD1 1 
ATOM   2077 C CD2 . LEU C 1 52  ? 16.449  -20.115 -19.791 1.00 38.01 ? 96  LEU C CD2 1 
ATOM   2078 N N   . ILE C 1 53  ? 17.852  -16.942 -24.002 1.00 33.80 ? 97  ILE C N   1 
ATOM   2079 C CA  . ILE C 1 53  ? 18.981  -16.024 -24.059 1.00 36.26 ? 97  ILE C CA  1 
ATOM   2080 C C   . ILE C 1 53  ? 19.307  -15.554 -22.664 1.00 35.97 ? 97  ILE C C   1 
ATOM   2081 O O   . ILE C 1 53  ? 18.475  -15.060 -21.987 1.00 37.69 ? 97  ILE C O   1 
ATOM   2082 C CB  . ILE C 1 53  ? 18.643  -14.757 -24.910 1.00 36.67 ? 97  ILE C CB  1 
ATOM   2083 C CG1 . ILE C 1 53  ? 18.047  -15.151 -26.248 1.00 38.92 ? 97  ILE C CG1 1 
ATOM   2084 C CG2 . ILE C 1 53  ? 19.852  -13.931 -25.206 1.00 38.16 ? 97  ILE C CG2 1 
ATOM   2085 C CD1 . ILE C 1 53  ? 19.049  -15.452 -27.152 1.00 46.30 ? 97  ILE C CD1 1 
ATOM   2086 N N   . TYR C 1 54  ? 20.554  -15.672 -22.248 1.00 36.72 ? 98  TYR C N   1 
ATOM   2087 C CA  . TYR C 1 54  ? 20.996  -15.108 -21.005 1.00 36.53 ? 98  TYR C CA  1 
ATOM   2088 C C   . TYR C 1 54  ? 22.216  -14.196 -21.275 1.00 38.47 ? 98  TYR C C   1 
ATOM   2089 O O   . TYR C 1 54  ? 22.772  -14.159 -22.353 1.00 36.77 ? 98  TYR C O   1 
ATOM   2090 C CB  . TYR C 1 54  ? 21.314  -16.233 -20.073 1.00 34.45 ? 98  TYR C CB  1 
ATOM   2091 C CG  . TYR C 1 54  ? 22.493  -17.007 -20.482 1.00 34.91 ? 98  TYR C CG  1 
ATOM   2092 C CD1 . TYR C 1 54  ? 23.767  -16.661 -19.993 1.00 29.64 ? 98  TYR C CD1 1 
ATOM   2093 C CD2 . TYR C 1 54  ? 22.372  -18.115 -21.358 1.00 30.71 ? 98  TYR C CD2 1 
ATOM   2094 C CE1 . TYR C 1 54  ? 24.905  -17.358 -20.358 1.00 25.60 ? 98  TYR C CE1 1 
ATOM   2095 C CE2 . TYR C 1 54  ? 23.542  -18.790 -21.749 1.00 29.31 ? 98  TYR C CE2 1 
ATOM   2096 C CZ  . TYR C 1 54  ? 24.771  -18.377 -21.239 1.00 30.59 ? 98  TYR C CZ  1 
ATOM   2097 O OH  . TYR C 1 54  ? 25.879  -19.060 -21.562 1.00 36.57 ? 98  TYR C OH  1 
ATOM   2098 N N   . GLY C 1 55  ? 22.639  -13.436 -20.296 1.00 41.10 ? 99  GLY C N   1 
ATOM   2099 C CA  . GLY C 1 55  ? 23.808  -12.631 -20.534 1.00 42.79 ? 99  GLY C CA  1 
ATOM   2100 C C   . GLY C 1 55  ? 23.930  -11.695 -19.384 1.00 44.75 ? 99  GLY C C   1 
ATOM   2101 O O   . GLY C 1 55  ? 23.051  -11.685 -18.497 1.00 44.95 ? 99  GLY C O   1 
ATOM   2102 N N   . GLN C 1 56  ? 24.985  -10.883 -19.433 1.00 46.49 ? 100 GLN C N   1 
ATOM   2103 C CA  . GLN C 1 56  ? 25.259  -9.831  -18.429 1.00 48.59 ? 100 GLN C CA  1 
ATOM   2104 C C   . GLN C 1 56  ? 26.037  -8.625  -18.964 1.00 49.75 ? 100 GLN C C   1 
ATOM   2105 O O   . GLN C 1 56  ? 26.899  -8.752  -19.826 1.00 48.34 ? 100 GLN C O   1 
ATOM   2106 C CB  . GLN C 1 56  ? 26.012  -10.456 -17.272 1.00 48.35 ? 100 GLN C CB  1 
ATOM   2107 C CG  . GLN C 1 56  ? 27.047  -9.612  -16.626 1.00 48.11 ? 100 GLN C CG  1 
ATOM   2108 C CD  . GLN C 1 56  ? 27.639  -10.286 -15.397 1.00 48.95 ? 100 GLN C CD  1 
ATOM   2109 O OE1 . GLN C 1 56  ? 28.855  -10.284 -15.226 1.00 52.74 ? 100 GLN C OE1 1 
ATOM   2110 N NE2 . GLN C 1 56  ? 26.783  -10.863 -14.537 1.00 48.93 ? 100 GLN C NE2 1 
ATOM   2111 N N   . VAL C 1 57  ? 25.725  -7.454  -18.425 1.00 52.35 ? 101 VAL C N   1 
ATOM   2112 C CA  . VAL C 1 57  ? 26.358  -6.215  -18.869 1.00 54.61 ? 101 VAL C CA  1 
ATOM   2113 C C   . VAL C 1 57  ? 26.955  -5.445  -17.704 1.00 55.06 ? 101 VAL C C   1 
ATOM   2114 O O   . VAL C 1 57  ? 26.829  -4.224  -17.676 1.00 56.59 ? 101 VAL C O   1 
ATOM   2115 C CB  . VAL C 1 57  ? 25.326  -5.302  -19.565 1.00 54.74 ? 101 VAL C CB  1 
ATOM   2116 C CG1 . VAL C 1 57  ? 25.344  -5.507  -21.080 1.00 56.85 ? 101 VAL C CG1 1 
ATOM   2117 C CG2 . VAL C 1 57  ? 23.917  -5.561  -18.997 1.00 56.52 ? 101 VAL C CG2 1 
ATOM   2118 N N   . ALA C 1 58  ? 27.590  -6.140  -16.755 1.00 55.42 ? 102 ALA C N   1 
ATOM   2119 C CA  . ALA C 1 58  ? 27.935  -5.603  -15.392 1.00 56.13 ? 102 ALA C CA  1 
ATOM   2120 C C   . ALA C 1 58  ? 27.962  -6.789  -14.393 1.00 56.33 ? 102 ALA C C   1 
ATOM   2121 O O   . ALA C 1 58  ? 27.368  -7.799  -14.681 1.00 56.01 ? 102 ALA C O   1 
ATOM   2122 C CB  . ALA C 1 58  ? 26.921  -4.521  -14.931 1.00 55.82 ? 102 ALA C CB  1 
ATOM   2123 N N   . PRO C 1 59  ? 28.559  -6.668  -13.182 1.00 57.55 ? 103 PRO C N   1 
ATOM   2124 C CA  . PRO C 1 59  ? 28.975  -5.648  -12.212 1.00 58.15 ? 103 PRO C CA  1 
ATOM   2125 C C   . PRO C 1 59  ? 29.098  -4.244  -12.758 1.00 59.03 ? 103 PRO C C   1 
ATOM   2126 O O   . PRO C 1 59  ? 29.744  -4.058  -13.783 1.00 60.80 ? 103 PRO C O   1 
ATOM   2127 C CB  . PRO C 1 59  ? 30.335  -6.180  -11.724 1.00 58.30 ? 103 PRO C CB  1 
ATOM   2128 C CG  . PRO C 1 59  ? 30.302  -7.722  -12.045 1.00 57.54 ? 103 PRO C CG  1 
ATOM   2129 C CD  . PRO C 1 59  ? 28.962  -7.996  -12.682 1.00 57.12 ? 103 PRO C CD  1 
ATOM   2130 N N   . VAL C 1 71  ? 22.244  -0.375  -23.974 1.00 62.06 ? 115 VAL C N   1 
ATOM   2131 C CA  . VAL C 1 71  ? 22.545  -1.684  -24.602 1.00 61.42 ? 115 VAL C CA  1 
ATOM   2132 C C   . VAL C 1 71  ? 21.278  -2.260  -25.213 1.00 60.91 ? 115 VAL C C   1 
ATOM   2133 O O   . VAL C 1 71  ? 20.205  -2.145  -24.612 1.00 60.44 ? 115 VAL C O   1 
ATOM   2134 C CB  . VAL C 1 71  ? 23.134  -2.663  -23.570 1.00 61.35 ? 115 VAL C CB  1 
ATOM   2135 N N   . ARG C 1 72  ? 21.401  -2.879  -26.397 1.00 60.38 ? 116 ARG C N   1 
ATOM   2136 C CA  . ARG C 1 72  ? 20.226  -3.358  -27.145 1.00 59.49 ? 116 ARG C CA  1 
ATOM   2137 C C   . ARG C 1 72  ? 20.301  -4.821  -27.564 1.00 58.46 ? 116 ARG C C   1 
ATOM   2138 O O   . ARG C 1 72  ? 21.199  -5.188  -28.332 1.00 57.96 ? 116 ARG C O   1 
ATOM   2139 C CB  . ARG C 1 72  ? 20.008  -2.541  -28.427 1.00 60.34 ? 116 ARG C CB  1 
ATOM   2140 C CG  . ARG C 1 72  ? 20.159  -1.015  -28.344 1.00 62.44 ? 116 ARG C CG  1 
ATOM   2141 C CD  . ARG C 1 72  ? 19.002  -0.385  -27.628 1.00 66.48 ? 116 ARG C CD  1 
ATOM   2142 N NE  . ARG C 1 72  ? 17.751  -0.413  -28.397 1.00 70.26 ? 116 ARG C NE  1 
ATOM   2143 C CZ  . ARG C 1 72  ? 17.433  0.430   -29.379 1.00 70.07 ? 116 ARG C CZ  1 
ATOM   2144 N NH1 . ARG C 1 72  ? 18.292  1.359   -29.772 1.00 70.17 ? 116 ARG C NH1 1 
ATOM   2145 N NH2 . ARG C 1 72  ? 16.256  0.323   -29.988 1.00 70.46 ? 116 ARG C NH2 1 
ATOM   2146 N N   . LEU C 1 73  ? 19.334  -5.630  -27.108 1.00 56.97 ? 117 LEU C N   1 
ATOM   2147 C CA  . LEU C 1 73  ? 19.172  -6.970  -27.625 1.00 56.99 ? 117 LEU C CA  1 
ATOM   2148 C C   . LEU C 1 73  ? 18.201  -6.915  -28.789 1.00 57.36 ? 117 LEU C C   1 
ATOM   2149 O O   . LEU C 1 73  ? 17.100  -6.360  -28.682 1.00 58.32 ? 117 LEU C O   1 
ATOM   2150 C CB  . LEU C 1 73  ? 18.745  -7.976  -26.540 1.00 56.89 ? 117 LEU C CB  1 
ATOM   2151 C CG  . LEU C 1 73  ? 18.753  -9.487  -26.852 1.00 56.65 ? 117 LEU C CG  1 
ATOM   2152 C CD1 . LEU C 1 73  ? 20.166  -10.096 -26.996 1.00 55.94 ? 117 LEU C CD1 1 
ATOM   2153 C CD2 . LEU C 1 73  ? 17.960  -10.235 -25.780 1.00 55.31 ? 117 LEU C CD2 1 
ATOM   2154 N N   . TYR C 1 74  ? 18.641  -7.443  -29.922 1.00 57.35 ? 118 TYR C N   1 
ATOM   2155 C CA  . TYR C 1 74  ? 17.842  -7.461  -31.131 1.00 57.60 ? 118 TYR C CA  1 
ATOM   2156 C C   . TYR C 1 74  ? 17.623  -8.891  -31.641 1.00 57.42 ? 118 TYR C C   1 
ATOM   2157 O O   . TYR C 1 74  ? 18.562  -9.679  -31.736 1.00 56.87 ? 118 TYR C O   1 
ATOM   2158 C CB  . TYR C 1 74  ? 18.524  -6.613  -32.206 1.00 58.61 ? 118 TYR C CB  1 
ATOM   2159 C CG  . TYR C 1 74  ? 18.298  -5.118  -32.092 1.00 59.77 ? 118 TYR C CG  1 
ATOM   2160 C CD1 . TYR C 1 74  ? 17.113  -4.556  -32.545 1.00 61.74 ? 118 TYR C CD1 1 
ATOM   2161 C CD2 . TYR C 1 74  ? 19.265  -4.265  -31.563 1.00 59.96 ? 118 TYR C CD2 1 
ATOM   2162 C CE1 . TYR C 1 74  ? 16.862  -3.194  -32.458 1.00 61.46 ? 118 TYR C CE1 1 
ATOM   2163 C CE2 . TYR C 1 74  ? 19.036  -2.873  -31.491 1.00 60.58 ? 118 TYR C CE2 1 
ATOM   2164 C CZ  . TYR C 1 74  ? 17.816  -2.356  -31.940 1.00 62.02 ? 118 TYR C CZ  1 
ATOM   2165 O OH  . TYR C 1 74  ? 17.506  -1.002  -31.902 1.00 62.36 ? 118 TYR C OH  1 
ATOM   2166 N N   . LYS C 1 75  ? 16.367  -9.221  -31.924 1.00 57.79 ? 119 LYS C N   1 
ATOM   2167 C CA  . LYS C 1 75  ? 15.997  -10.367 -32.736 1.00 58.36 ? 119 LYS C CA  1 
ATOM   2168 C C   . LYS C 1 75  ? 15.703  -9.781  -34.106 1.00 59.48 ? 119 LYS C C   1 
ATOM   2169 O O   . LYS C 1 75  ? 14.817  -8.921  -34.255 1.00 60.29 ? 119 LYS C O   1 
ATOM   2170 C CB  . LYS C 1 75  ? 14.748  -11.056 -32.201 1.00 58.06 ? 119 LYS C CB  1 
ATOM   2171 C CG  . LYS C 1 75  ? 14.186  -12.148 -33.105 1.00 57.42 ? 119 LYS C CG  1 
ATOM   2172 C CD  . LYS C 1 75  ? 13.064  -12.880 -32.365 1.00 59.91 ? 119 LYS C CD  1 
ATOM   2173 C CE  . LYS C 1 75  ? 11.888  -13.249 -33.258 1.00 58.95 ? 119 LYS C CE  1 
ATOM   2174 N NZ  . LYS C 1 75  ? 12.015  -14.537 -34.039 1.00 60.14 ? 119 LYS C NZ  1 
ATOM   2175 N N   . ASN C 1 76  ? 16.461  -10.235 -35.098 1.00 59.92 ? 120 ASN C N   1 
ATOM   2176 C CA  . ASN C 1 76  ? 16.412  -9.707  -36.442 1.00 59.95 ? 120 ASN C CA  1 
ATOM   2177 C C   . ASN C 1 76  ? 16.517  -8.204  -36.426 1.00 61.48 ? 120 ASN C C   1 
ATOM   2178 O O   . ASN C 1 76  ? 17.445  -7.659  -35.840 1.00 61.67 ? 120 ASN C O   1 
ATOM   2179 C CB  . ASN C 1 76  ? 15.175  -10.195 -37.178 1.00 59.23 ? 120 ASN C CB  1 
ATOM   2180 C CG  . ASN C 1 76  ? 15.200  -11.692 -37.438 1.00 57.01 ? 120 ASN C CG  1 
ATOM   2181 O OD1 . ASN C 1 76  ? 16.208  -12.249 -37.904 1.00 54.41 ? 120 ASN C OD1 1 
ATOM   2182 N ND2 . ASN C 1 76  ? 14.079  -12.357 -37.133 1.00 52.88 ? 120 ASN C ND2 1 
ATOM   2183 N N   . LYS C 1 77  ? 15.564  -7.527  -37.049 1.00 63.38 ? 121 LYS C N   1 
ATOM   2184 C CA  . LYS C 1 77  ? 15.704  -6.086  -37.268 1.00 65.34 ? 121 LYS C CA  1 
ATOM   2185 C C   . LYS C 1 77  ? 15.280  -5.192  -36.085 1.00 66.03 ? 121 LYS C C   1 
ATOM   2186 O O   . LYS C 1 77  ? 15.764  -4.056  -35.948 1.00 66.24 ? 121 LYS C O   1 
ATOM   2187 C CB  . LYS C 1 77  ? 15.032  -5.678  -38.587 1.00 65.45 ? 121 LYS C CB  1 
ATOM   2188 C CG  . LYS C 1 77  ? 15.622  -6.400  -39.839 1.00 67.04 ? 121 LYS C CG  1 
ATOM   2189 C CD  . LYS C 1 77  ? 17.096  -6.046  -40.123 1.00 66.96 ? 121 LYS C CD  1 
ATOM   2190 C CE  . LYS C 1 77  ? 17.218  -4.737  -40.899 1.00 67.84 ? 121 LYS C CE  1 
ATOM   2191 N NZ  . LYS C 1 77  ? 16.678  -3.567  -40.127 1.00 66.71 ? 121 LYS C NZ  1 
ATOM   2192 N N   . ASP C 1 78  ? 14.434  -5.723  -35.212 1.00 67.05 ? 122 ASP C N   1 
ATOM   2193 C CA  . ASP C 1 78  ? 13.877  -4.935  -34.124 1.00 68.36 ? 122 ASP C CA  1 
ATOM   2194 C C   . ASP C 1 78  ? 14.207  -5.486  -32.734 1.00 69.11 ? 122 ASP C C   1 
ATOM   2195 O O   . ASP C 1 78  ? 14.579  -6.664  -32.586 1.00 68.48 ? 122 ASP C O   1 
ATOM   2196 C CB  . ASP C 1 78  ? 12.377  -4.738  -34.342 1.00 69.06 ? 122 ASP C CB  1 
ATOM   2197 C CG  . ASP C 1 78  ? 11.855  -5.499  -35.583 1.00 70.38 ? 122 ASP C CG  1 
ATOM   2198 O OD1 . ASP C 1 78  ? 11.419  -4.835  -36.560 1.00 71.55 ? 122 ASP C OD1 1 
ATOM   2199 O OD2 . ASP C 1 78  ? 11.905  -6.758  -35.588 1.00 71.18 ? 122 ASP C OD2 1 
ATOM   2200 N N   . MET C 1 79  ? 14.089  -4.595  -31.740 1.00 69.84 ? 123 MET C N   1 
ATOM   2201 C CA  . MET C 1 79  ? 14.571  -4.780  -30.364 1.00 70.87 ? 123 MET C CA  1 
ATOM   2202 C C   . MET C 1 79  ? 13.622  -5.579  -29.478 1.00 70.51 ? 123 MET C C   1 
ATOM   2203 O O   . MET C 1 79  ? 12.401  -5.343  -29.460 1.00 70.77 ? 123 MET C O   1 
ATOM   2204 C CB  . MET C 1 79  ? 14.851  -3.412  -29.714 1.00 70.37 ? 123 MET C CB  1 
ATOM   2205 C CG  . MET C 1 79  ? 14.791  -3.414  -28.183 1.00 70.84 ? 123 MET C CG  1 
ATOM   2206 S SD  . MET C 1 79  ? 14.557  -1.833  -27.297 1.00 74.62 ? 123 MET C SD  1 
ATOM   2207 C CE  . MET C 1 79  ? 13.300  -0.957  -28.287 1.00 72.66 ? 123 MET C CE  1 
ATOM   2208 N N   . ILE C 1 80  ? 14.202  -6.487  -28.701 1.00 70.11 ? 124 ILE C N   1 
ATOM   2209 C CA  . ILE C 1 80  ? 13.429  -7.357  -27.832 1.00 69.67 ? 124 ILE C CA  1 
ATOM   2210 C C   . ILE C 1 80  ? 13.700  -7.110  -26.339 1.00 69.82 ? 124 ILE C C   1 
ATOM   2211 O O   . ILE C 1 80  ? 12.932  -7.559  -25.487 1.00 70.01 ? 124 ILE C O   1 
ATOM   2212 C CB  . ILE C 1 80  ? 13.623  -8.856  -28.206 1.00 69.79 ? 124 ILE C CB  1 
ATOM   2213 C CG1 . ILE C 1 80  ? 15.111  -9.219  -28.316 1.00 68.99 ? 124 ILE C CG1 1 
ATOM   2214 C CG2 . ILE C 1 80  ? 12.909  -9.162  -29.505 1.00 69.89 ? 124 ILE C CG2 1 
ATOM   2215 C CD1 . ILE C 1 80  ? 15.390  -10.716 -28.350 1.00 68.83 ? 124 ILE C CD1 1 
ATOM   2216 N N   . GLN C 1 81  ? 14.781  -6.382  -26.047 1.00 69.74 ? 125 GLN C N   1 
ATOM   2217 C CA  . GLN C 1 81  ? 15.160  -5.982  -24.689 1.00 69.83 ? 125 GLN C CA  1 
ATOM   2218 C C   . GLN C 1 81  ? 16.133  -4.819  -24.728 1.00 69.54 ? 125 GLN C C   1 
ATOM   2219 O O   . GLN C 1 81  ? 17.006  -4.767  -25.571 1.00 69.62 ? 125 GLN C O   1 
ATOM   2220 C CB  . GLN C 1 81  ? 15.782  -7.147  -23.907 1.00 69.80 ? 125 GLN C CB  1 
ATOM   2221 C CG  . GLN C 1 81  ? 15.624  -7.046  -22.393 1.00 69.39 ? 125 GLN C CG  1 
ATOM   2222 C CD  . GLN C 1 81  ? 16.381  -8.150  -21.652 1.00 71.08 ? 125 GLN C CD  1 
ATOM   2223 O OE1 . GLN C 1 81  ? 16.212  -9.343  -21.946 1.00 73.85 ? 125 GLN C OE1 1 
ATOM   2224 N NE2 . GLN C 1 81  ? 17.215  -7.757  -20.682 1.00 70.18 ? 125 GLN C NE2 1 
ATOM   2225 N N   . THR C 1 82  ? 15.988  -3.895  -23.789 1.00 70.28 ? 126 THR C N   1 
ATOM   2226 C CA  . THR C 1 82  ? 16.749  -2.649  -23.815 1.00 71.04 ? 126 THR C CA  1 
ATOM   2227 C C   . THR C 1 82  ? 17.281  -2.278  -22.409 1.00 71.60 ? 126 THR C C   1 
ATOM   2228 O O   . THR C 1 82  ? 16.711  -1.445  -21.709 1.00 71.64 ? 126 THR C O   1 
ATOM   2229 C CB  . THR C 1 82  ? 15.904  -1.531  -24.499 1.00 71.32 ? 126 THR C CB  1 
ATOM   2230 O OG1 . THR C 1 82  ? 16.628  -0.290  -24.541 1.00 71.42 ? 126 THR C OG1 1 
ATOM   2231 C CG2 . THR C 1 82  ? 14.521  -1.369  -23.818 1.00 70.54 ? 126 THR C CG2 1 
ATOM   2232 N N   . LEU C 1 83  ? 18.378  -2.938  -22.010 1.00 72.40 ? 127 LEU C N   1 
ATOM   2233 C CA  . LEU C 1 83  ? 18.955  -2.848  -20.651 1.00 72.28 ? 127 LEU C CA  1 
ATOM   2234 C C   . LEU C 1 83  ? 19.604  -1.497  -20.376 1.00 72.55 ? 127 LEU C C   1 
ATOM   2235 O O   . LEU C 1 83  ? 20.370  -0.979  -21.188 1.00 72.39 ? 127 LEU C O   1 
ATOM   2236 C CB  . LEU C 1 83  ? 19.945  -3.977  -20.412 1.00 72.30 ? 127 LEU C CB  1 
ATOM   2237 N N   . THR C 1 84  ? 19.284  -0.947  -19.209 1.00 73.16 ? 128 THR C N   1 
ATOM   2238 C CA  . THR C 1 84  ? 19.615  0.425   -18.843 1.00 73.39 ? 128 THR C CA  1 
ATOM   2239 C C   . THR C 1 84  ? 19.923  0.511   -17.345 1.00 73.52 ? 128 THR C C   1 
ATOM   2240 O O   . THR C 1 84  ? 20.136  1.600   -16.791 1.00 73.87 ? 128 THR C O   1 
ATOM   2241 C CB  . THR C 1 84  ? 18.458  1.408   -19.260 1.00 73.63 ? 128 THR C CB  1 
ATOM   2242 O OG1 . THR C 1 84  ? 18.784  2.750   -18.880 1.00 73.67 ? 128 THR C OG1 1 
ATOM   2243 C CG2 . THR C 1 84  ? 17.108  1.010   -18.636 1.00 73.46 ? 128 THR C CG2 1 
ATOM   2244 N N   . SER C 1 87  ? 18.298  -0.077  -13.649 1.00 57.01 ? 131 SER C N   1 
ATOM   2245 C CA  . SER C 1 87  ? 17.119  -0.805  -14.118 1.00 57.51 ? 131 SER C CA  1 
ATOM   2246 C C   . SER C 1 87  ? 17.057  -2.184  -13.461 1.00 57.77 ? 131 SER C C   1 
ATOM   2247 O O   . SER C 1 87  ? 17.740  -3.120  -13.884 1.00 57.90 ? 131 SER C O   1 
ATOM   2248 C CB  . SER C 1 87  ? 17.098  -0.911  -15.647 1.00 57.56 ? 131 SER C CB  1 
ATOM   2249 N N   . LYS C 1 88  ? 16.145  -2.277  -12.491 1.00 57.67 ? 132 LYS C N   1 
ATOM   2250 C CA  . LYS C 1 88  ? 16.111  -3.197  -11.332 1.00 57.43 ? 132 LYS C CA  1 
ATOM   2251 C C   . LYS C 1 88  ? 16.853  -4.568  -11.280 1.00 57.66 ? 132 LYS C C   1 
ATOM   2252 O O   . LYS C 1 88  ? 17.042  -5.107  -10.181 1.00 56.31 ? 132 LYS C O   1 
ATOM   2253 C CB  . LYS C 1 88  ? 14.662  -3.251  -10.769 1.00 57.69 ? 132 LYS C CB  1 
ATOM   2254 C CG  . LYS C 1 88  ? 14.120  -1.858  -10.284 1.00 55.52 ? 132 LYS C CG  1 
ATOM   2255 C CD  . LYS C 1 88  ? 12.659  -1.900  -9.782  1.00 56.78 ? 132 LYS C CD  1 
ATOM   2256 C CE  . LYS C 1 88  ? 12.549  -1.848  -8.216  1.00 53.78 ? 132 LYS C CE  1 
ATOM   2257 N NZ  . LYS C 1 88  ? 10.963  -2.383  -7.757  1.00 51.32 ? 132 LYS C NZ  1 
ATOM   2258 N N   . ILE C 1 89  ? 17.269  -5.098  -12.447 1.00 58.18 ? 133 ILE C N   1 
ATOM   2259 C CA  . ILE C 1 89  ? 18.130  -6.291  -12.601 1.00 58.44 ? 133 ILE C CA  1 
ATOM   2260 C C   . ILE C 1 89  ? 19.189  -6.058  -13.716 1.00 58.76 ? 133 ILE C C   1 
ATOM   2261 O O   . ILE C 1 89  ? 19.043  -5.150  -14.501 1.00 59.48 ? 133 ILE C O   1 
ATOM   2262 C CB  . ILE C 1 89  ? 17.262  -7.546  -12.930 1.00 58.96 ? 133 ILE C CB  1 
ATOM   2263 N N   . GLN C 1 90  ? 20.244  -6.861  -13.807 1.00 58.61 ? 134 GLN C N   1 
ATOM   2264 C CA  . GLN C 1 90  ? 21.229  -6.654  -14.886 1.00 58.86 ? 134 GLN C CA  1 
ATOM   2265 C C   . GLN C 1 90  ? 21.446  -7.902  -15.832 1.00 58.67 ? 134 GLN C C   1 
ATOM   2266 O O   . GLN C 1 90  ? 22.504  -8.054  -16.494 1.00 58.61 ? 134 GLN C O   1 
ATOM   2267 C CB  . GLN C 1 90  ? 22.524  -5.992  -14.331 1.00 59.12 ? 134 GLN C CB  1 
ATOM   2268 C CG  . GLN C 1 90  ? 23.781  -6.851  -14.132 1.00 60.66 ? 134 GLN C CG  1 
ATOM   2269 C CD  . GLN C 1 90  ? 23.594  -8.070  -13.213 1.00 63.98 ? 134 GLN C CD  1 
ATOM   2270 O OE1 . GLN C 1 90  ? 23.334  -7.907  -12.028 1.00 65.37 ? 134 GLN C OE1 1 
ATOM   2271 N NE2 . GLN C 1 90  ? 23.752  -9.294  -13.763 1.00 62.59 ? 134 GLN C NE2 1 
ATOM   2272 N N   . ASN C 1 91  ? 20.404  -8.738  -15.915 1.00 57.20 ? 135 ASN C N   1 
ATOM   2273 C CA  . ASN C 1 91  ? 20.413  -9.994  -16.669 1.00 56.56 ? 135 ASN C CA  1 
ATOM   2274 C C   . ASN C 1 91  ? 19.811  -9.676  -18.059 1.00 55.51 ? 135 ASN C C   1 
ATOM   2275 O O   . ASN C 1 91  ? 18.774  -9.042  -18.141 1.00 55.67 ? 135 ASN C O   1 
ATOM   2276 C CB  . ASN C 1 91  ? 19.621  -11.072 -15.849 1.00 56.17 ? 135 ASN C CB  1 
ATOM   2277 C CG  . ASN C 1 91  ? 19.497  -12.473 -16.537 1.00 57.94 ? 135 ASN C CG  1 
ATOM   2278 O OD1 . ASN C 1 91  ? 20.453  -13.040 -17.127 1.00 60.15 ? 135 ASN C OD1 1 
ATOM   2279 N ND2 . ASN C 1 91  ? 18.293  -13.044 -16.431 1.00 55.22 ? 135 ASN C ND2 1 
ATOM   2280 N N   . VAL C 1 92  ? 20.487  -10.079 -19.140 1.00 54.60 ? 136 VAL C N   1 
ATOM   2281 C CA  . VAL C 1 92  ? 19.948  -9.951  -20.498 1.00 52.33 ? 136 VAL C CA  1 
ATOM   2282 C C   . VAL C 1 92  ? 19.171  -11.208 -20.919 1.00 51.56 ? 136 VAL C C   1 
ATOM   2283 O O   . VAL C 1 92  ? 19.383  -12.296 -20.383 1.00 52.19 ? 136 VAL C O   1 
ATOM   2284 C CB  . VAL C 1 92  ? 21.017  -9.560  -21.592 1.00 52.57 ? 136 VAL C CB  1 
ATOM   2285 C CG1 . VAL C 1 92  ? 22.328  -9.140  -21.017 1.00 50.58 ? 136 VAL C CG1 1 
ATOM   2286 C CG2 . VAL C 1 92  ? 21.236  -10.655 -22.662 1.00 53.57 ? 136 VAL C CG2 1 
ATOM   2287 N N   . GLY C 1 93  ? 18.252  -11.032 -21.871 1.00 50.50 ? 137 GLY C N   1 
ATOM   2288 C CA  . GLY C 1 93  ? 17.501  -12.115 -22.469 1.00 47.82 ? 137 GLY C CA  1 
ATOM   2289 C C   . GLY C 1 93  ? 16.239  -12.552 -21.795 1.00 46.46 ? 137 GLY C C   1 
ATOM   2290 O O   . GLY C 1 93  ? 15.634  -11.838 -21.007 1.00 47.03 ? 137 GLY C O   1 
ATOM   2291 N N   . GLY C 1 94  ? 15.841  -13.759 -22.123 1.00 45.24 ? 138 GLY C N   1 
ATOM   2292 C CA  . GLY C 1 94  ? 14.520  -14.285 -21.728 1.00 44.63 ? 138 GLY C CA  1 
ATOM   2293 C C   . GLY C 1 94  ? 14.349  -15.533 -22.562 1.00 43.33 ? 138 GLY C C   1 
ATOM   2294 O O   . GLY C 1 94  ? 15.337  -16.022 -23.121 1.00 43.27 ? 138 GLY C O   1 
ATOM   2295 N N   . THR C 1 95  ? 13.122  -16.018 -22.668 1.00 41.76 ? 139 THR C N   1 
ATOM   2296 C CA  . THR C 1 95  ? 12.779  -17.235 -23.403 1.00 42.16 ? 139 THR C CA  1 
ATOM   2297 C C   . THR C 1 95  ? 12.093  -16.813 -24.703 1.00 42.39 ? 139 THR C C   1 
ATOM   2298 O O   . THR C 1 95  ? 11.120  -16.041 -24.654 1.00 41.78 ? 139 THR C O   1 
ATOM   2299 C CB  . THR C 1 95  ? 11.731  -18.105 -22.608 1.00 42.19 ? 139 THR C CB  1 
ATOM   2300 O OG1 . THR C 1 95  ? 12.227  -18.391 -21.301 1.00 42.75 ? 139 THR C OG1 1 
ATOM   2301 C CG2 . THR C 1 95  ? 11.482  -19.423 -23.301 1.00 42.30 ? 139 THR C CG2 1 
ATOM   2302 N N   . TYR C 1 96  ? 12.537  -17.360 -25.839 1.00 42.00 ? 140 TYR C N   1 
ATOM   2303 C CA  . TYR C 1 96  ? 11.930  -17.037 -27.133 1.00 41.86 ? 140 TYR C CA  1 
ATOM   2304 C C   . TYR C 1 96  ? 11.924  -18.226 -28.081 1.00 41.64 ? 140 TYR C C   1 
ATOM   2305 O O   . TYR C 1 96  ? 12.906  -18.992 -28.161 1.00 40.71 ? 140 TYR C O   1 
ATOM   2306 C CB  . TYR C 1 96  ? 12.692  -15.921 -27.825 1.00 42.88 ? 140 TYR C CB  1 
ATOM   2307 C CG  . TYR C 1 96  ? 12.984  -14.661 -27.024 1.00 45.87 ? 140 TYR C CG  1 
ATOM   2308 C CD1 . TYR C 1 96  ? 14.116  -14.571 -26.185 1.00 46.00 ? 140 TYR C CD1 1 
ATOM   2309 C CD2 . TYR C 1 96  ? 12.154  -13.508 -27.164 1.00 44.68 ? 140 TYR C CD2 1 
ATOM   2310 C CE1 . TYR C 1 96  ? 14.384  -13.370 -25.460 1.00 45.86 ? 140 TYR C CE1 1 
ATOM   2311 C CE2 . TYR C 1 96  ? 12.408  -12.311 -26.470 1.00 43.89 ? 140 TYR C CE2 1 
ATOM   2312 C CZ  . TYR C 1 96  ? 13.517  -12.246 -25.611 1.00 47.89 ? 140 TYR C CZ  1 
ATOM   2313 O OH  . TYR C 1 96  ? 13.761  -11.046 -24.944 1.00 50.55 ? 140 TYR C OH  1 
ATOM   2314 N N   . GLU C 1 97  ? 10.823  -18.365 -28.811 1.00 41.12 ? 141 GLU C N   1 
ATOM   2315 C CA  . GLU C 1 97  ? 10.770  -19.219 -29.982 1.00 42.12 ? 141 GLU C CA  1 
ATOM   2316 C C   . GLU C 1 97  ? 11.509  -18.510 -31.093 1.00 41.16 ? 141 GLU C C   1 
ATOM   2317 O O   . GLU C 1 97  ? 11.274  -17.339 -31.358 1.00 41.11 ? 141 GLU C O   1 
ATOM   2318 C CB  . GLU C 1 97  ? 9.319   -19.478 -30.408 1.00 42.70 ? 141 GLU C CB  1 
ATOM   2319 C CG  . GLU C 1 97  ? 8.828   -20.836 -29.947 1.00 45.07 ? 141 GLU C CG  1 
ATOM   2320 C CD  . GLU C 1 97  ? 7.346   -21.032 -30.146 1.00 45.12 ? 141 GLU C CD  1 
ATOM   2321 O OE1 . GLU C 1 97  ? 6.884   -20.581 -31.217 1.00 42.69 ? 141 GLU C OE1 1 
ATOM   2322 O OE2 . GLU C 1 97  ? 6.691   -21.656 -29.239 1.00 42.57 ? 141 GLU C OE2 1 
ATOM   2323 N N   . LEU C 1 98  ? 12.480  -19.184 -31.653 1.00 40.66 ? 142 LEU C N   1 
ATOM   2324 C CA  . LEU C 1 98  ? 13.210  -18.626 -32.773 1.00 41.49 ? 142 LEU C CA  1 
ATOM   2325 C C   . LEU C 1 98  ? 13.081  -19.640 -33.883 1.00 41.00 ? 142 LEU C C   1 
ATOM   2326 O O   . LEU C 1 98  ? 12.802  -20.828 -33.627 1.00 40.53 ? 142 LEU C O   1 
ATOM   2327 C CB  . LEU C 1 98  ? 14.685  -18.337 -32.424 1.00 40.16 ? 142 LEU C CB  1 
ATOM   2328 C CG  . LEU C 1 98  ? 14.888  -17.562 -31.155 1.00 40.75 ? 142 LEU C CG  1 
ATOM   2329 C CD1 . LEU C 1 98  ? 16.355  -17.706 -30.692 1.00 41.07 ? 142 LEU C CD1 1 
ATOM   2330 C CD2 . LEU C 1 98  ? 14.439  -16.105 -31.305 1.00 39.13 ? 142 LEU C CD2 1 
ATOM   2331 N N   . HIS C 1 99  ? 13.277  -19.155 -35.098 1.00 41.91 ? 143 HIS C N   1 
ATOM   2332 C CA  . HIS C 1 99  ? 13.206  -19.995 -36.294 1.00 43.22 ? 143 HIS C CA  1 
ATOM   2333 C C   . HIS C 1 99  ? 14.469  -19.890 -37.152 1.00 43.06 ? 143 HIS C C   1 
ATOM   2334 O O   . HIS C 1 99  ? 15.196  -18.936 -37.038 1.00 42.78 ? 143 HIS C O   1 
ATOM   2335 C CB  . HIS C 1 99  ? 11.938  -19.646 -37.108 1.00 43.08 ? 143 HIS C CB  1 
ATOM   2336 C CG  . HIS C 1 99  ? 10.704  -19.503 -36.266 1.00 45.61 ? 143 HIS C CG  1 
ATOM   2337 N ND1 . HIS C 1 99  ? 9.938   -20.588 -35.871 1.00 48.50 ? 143 HIS C ND1 1 
ATOM   2338 C CD2 . HIS C 1 99  ? 10.122  -18.408 -35.714 1.00 45.84 ? 143 HIS C CD2 1 
ATOM   2339 C CE1 . HIS C 1 99  ? 8.943   -20.165 -35.108 1.00 48.50 ? 143 HIS C CE1 1 
ATOM   2340 N NE2 . HIS C 1 99  ? 9.023   -18.847 -35.010 1.00 47.88 ? 143 HIS C NE2 1 
ATOM   2341 N N   . VAL C 1 100 ? 14.712  -20.880 -38.004 1.00 44.10 ? 144 VAL C N   1 
ATOM   2342 C CA  . VAL C 1 100 ? 15.796  -20.826 -39.004 1.00 45.51 ? 144 VAL C CA  1 
ATOM   2343 C C   . VAL C 1 100 ? 15.988  -19.445 -39.673 1.00 45.95 ? 144 VAL C C   1 
ATOM   2344 O O   . VAL C 1 100 ? 15.022  -18.806 -40.157 1.00 47.04 ? 144 VAL C O   1 
ATOM   2345 C CB  . VAL C 1 100 ? 15.647  -21.948 -40.089 1.00 45.18 ? 144 VAL C CB  1 
ATOM   2346 C CG1 . VAL C 1 100 ? 16.985  -22.236 -40.793 1.00 45.31 ? 144 VAL C CG1 1 
ATOM   2347 C CG2 . VAL C 1 100 ? 15.108  -23.275 -39.452 1.00 46.52 ? 144 VAL C CG2 1 
ATOM   2348 N N   . GLY C 1 101 ? 17.239  -18.998 -39.710 1.00 45.64 ? 145 GLY C N   1 
ATOM   2349 C CA  . GLY C 1 101 ? 17.606  -17.723 -40.341 1.00 45.56 ? 145 GLY C CA  1 
ATOM   2350 C C   . GLY C 1 101 ? 17.391  -16.526 -39.462 1.00 47.03 ? 145 GLY C C   1 
ATOM   2351 O O   . GLY C 1 101 ? 17.693  -15.418 -39.850 1.00 47.99 ? 145 GLY C O   1 
ATOM   2352 N N   . ASP C 1 102 ? 16.856  -16.750 -38.266 1.00 47.84 ? 146 ASP C N   1 
ATOM   2353 C CA  . ASP C 1 102 ? 16.641  -15.692 -37.265 1.00 48.85 ? 146 ASP C CA  1 
ATOM   2354 C C   . ASP C 1 102 ? 17.990  -15.189 -36.743 1.00 48.76 ? 146 ASP C C   1 
ATOM   2355 O O   . ASP C 1 102 ? 18.883  -15.991 -36.455 1.00 48.58 ? 146 ASP C O   1 
ATOM   2356 C CB  . ASP C 1 102 ? 15.828  -16.257 -36.076 1.00 48.36 ? 146 ASP C CB  1 
ATOM   2357 C CG  . ASP C 1 102 ? 14.332  -16.011 -36.211 1.00 49.81 ? 146 ASP C CG  1 
ATOM   2358 O OD1 . ASP C 1 102 ? 13.936  -15.159 -37.050 1.00 46.42 ? 146 ASP C OD1 1 
ATOM   2359 O OD2 . ASP C 1 102 ? 13.559  -16.641 -35.448 1.00 49.76 ? 146 ASP C OD2 1 
ATOM   2360 N N   . THR C 1 103 ? 18.169  -13.878 -36.611 1.00 49.12 ? 147 THR C N   1 
ATOM   2361 C CA  . THR C 1 103 ? 19.413  -13.447 -35.990 1.00 49.69 ? 147 THR C CA  1 
ATOM   2362 C C   . THR C 1 103 ? 19.165  -12.831 -34.602 1.00 50.54 ? 147 THR C C   1 
ATOM   2363 O O   . THR C 1 103 ? 18.115  -12.232 -34.340 1.00 49.86 ? 147 THR C O   1 
ATOM   2364 C CB  . THR C 1 103 ? 20.258  -12.482 -36.853 1.00 49.76 ? 147 THR C CB  1 
ATOM   2365 O OG1 . THR C 1 103 ? 19.626  -11.184 -36.898 1.00 51.08 ? 147 THR C OG1 1 
ATOM   2366 C CG2 . THR C 1 103 ? 20.541  -13.033 -38.286 1.00 48.79 ? 147 THR C CG2 1 
ATOM   2367 N N   . ILE C 1 104 ? 20.144  -13.031 -33.717 1.00 50.94 ? 148 ILE C N   1 
ATOM   2368 C CA  . ILE C 1 104 ? 20.255  -12.276 -32.467 1.00 51.32 ? 148 ILE C CA  1 
ATOM   2369 C C   . ILE C 1 104 ? 21.591  -11.529 -32.444 1.00 51.38 ? 148 ILE C C   1 
ATOM   2370 O O   . ILE C 1 104 ? 22.638  -12.085 -32.778 1.00 50.05 ? 148 ILE C O   1 
ATOM   2371 C CB  . ILE C 1 104 ? 20.072  -13.159 -31.216 1.00 51.25 ? 148 ILE C CB  1 
ATOM   2372 C CG1 . ILE C 1 104 ? 18.653  -13.713 -31.182 1.00 50.91 ? 148 ILE C CG1 1 
ATOM   2373 C CG2 . ILE C 1 104 ? 20.270  -12.351 -29.934 1.00 50.78 ? 148 ILE C CG2 1 
ATOM   2374 C CD1 . ILE C 1 104 ? 18.655  -15.134 -31.425 1.00 51.70 ? 148 ILE C CD1 1 
ATOM   2375 N N   . ASP C 1 105 ? 21.487  -10.255 -32.085 1.00 53.35 ? 149 ASP C N   1 
ATOM   2376 C CA  . ASP C 1 105 ? 22.590  -9.312  -31.994 1.00 56.27 ? 149 ASP C CA  1 
ATOM   2377 C C   . ASP C 1 105 ? 22.503  -8.577  -30.647 1.00 57.01 ? 149 ASP C C   1 
ATOM   2378 O O   . ASP C 1 105 ? 21.421  -8.358  -30.139 1.00 57.29 ? 149 ASP C O   1 
ATOM   2379 C CB  . ASP C 1 105 ? 22.501  -8.297  -33.143 1.00 56.22 ? 149 ASP C CB  1 
ATOM   2380 C CG  . ASP C 1 105 ? 23.858  -7.630  -33.484 1.00 59.12 ? 149 ASP C CG  1 
ATOM   2381 O OD1 . ASP C 1 105 ? 24.837  -7.680  -32.681 1.00 59.97 ? 149 ASP C OD1 1 
ATOM   2382 O OD2 . ASP C 1 105 ? 23.924  -7.025  -34.586 1.00 61.44 ? 149 ASP C OD2 1 
ATOM   2383 N N   . LEU C 1 106 ? 23.655  -8.224  -30.075 1.00 58.65 ? 150 LEU C N   1 
ATOM   2384 C CA  . LEU C 1 106 ? 23.732  -7.384  -28.893 1.00 59.73 ? 150 LEU C CA  1 
ATOM   2385 C C   . LEU C 1 106 ? 24.540  -6.122  -29.265 1.00 60.57 ? 150 LEU C C   1 
ATOM   2386 O O   . LEU C 1 106 ? 25.733  -6.180  -29.579 1.00 60.68 ? 150 LEU C O   1 
ATOM   2387 C CB  . LEU C 1 106 ? 24.361  -8.153  -27.713 1.00 60.10 ? 150 LEU C CB  1 
ATOM   2388 C CG  . LEU C 1 106 ? 23.732  -7.924  -26.337 1.00 61.46 ? 150 LEU C CG  1 
ATOM   2389 C CD1 . LEU C 1 106 ? 24.430  -8.704  -25.219 1.00 62.35 ? 150 LEU C CD1 1 
ATOM   2390 C CD2 . LEU C 1 106 ? 23.707  -6.434  -26.027 1.00 62.25 ? 150 LEU C CD2 1 
ATOM   2391 N N   . ILE C 1 107 ? 23.870  -4.980  -29.229 1.00 61.40 ? 151 ILE C N   1 
ATOM   2392 C CA  . ILE C 1 107 ? 24.387  -3.746  -29.832 1.00 61.65 ? 151 ILE C CA  1 
ATOM   2393 C C   . ILE C 1 107 ? 24.798  -2.694  -28.784 1.00 61.49 ? 151 ILE C C   1 
ATOM   2394 O O   . ILE C 1 107 ? 24.155  -2.530  -27.744 1.00 61.49 ? 151 ILE C O   1 
ATOM   2395 C CB  . ILE C 1 107 ? 23.373  -3.226  -30.950 1.00 61.55 ? 151 ILE C CB  1 
ATOM   2396 C CG1 . ILE C 1 107 ? 23.736  -3.832  -32.314 1.00 61.38 ? 151 ILE C CG1 1 
ATOM   2397 C CG2 . ILE C 1 107 ? 23.307  -1.714  -31.039 1.00 62.25 ? 151 ILE C CG2 1 
ATOM   2398 C CD1 . ILE C 1 107 ? 22.540  -4.155  -33.212 1.00 62.80 ? 151 ILE C CD1 1 
ATOM   2399 N N   . THR C 1 119 ? 30.698  -8.884  -19.290 1.00 48.05 ? 163 THR C N   1 
ATOM   2400 C CA  . THR C 1 119 ? 29.854  -8.515  -20.466 1.00 49.28 ? 163 THR C CA  1 
ATOM   2401 C C   . THR C 1 119 ? 29.811  -9.545  -21.633 1.00 48.49 ? 163 THR C C   1 
ATOM   2402 O O   . THR C 1 119 ? 30.744  -9.637  -22.496 1.00 47.39 ? 163 THR C O   1 
ATOM   2403 C CB  . THR C 1 119 ? 30.138  -7.121  -21.013 1.00 48.78 ? 163 THR C CB  1 
ATOM   2404 O OG1 . THR C 1 119 ? 30.587  -6.285  -19.929 1.00 51.99 ? 163 THR C OG1 1 
ATOM   2405 C CG2 . THR C 1 119 ? 28.888  -6.569  -21.647 1.00 48.01 ? 163 THR C CG2 1 
ATOM   2406 N N   . TYR C 1 120 ? 28.698  -10.281 -21.619 1.00 46.02 ? 164 TYR C N   1 
ATOM   2407 C CA  . TYR C 1 120 ? 28.517  -11.433 -22.446 1.00 46.72 ? 164 TYR C CA  1 
ATOM   2408 C C   . TYR C 1 120 ? 27.039  -11.760 -22.579 1.00 45.66 ? 164 TYR C C   1 
ATOM   2409 O O   . TYR C 1 120 ? 26.175  -11.144 -21.945 1.00 46.47 ? 164 TYR C O   1 
ATOM   2410 C CB  . TYR C 1 120 ? 29.284  -12.662 -21.889 1.00 46.18 ? 164 TYR C CB  1 
ATOM   2411 C CG  . TYR C 1 120 ? 28.820  -13.098 -20.518 1.00 46.74 ? 164 TYR C CG  1 
ATOM   2412 C CD1 . TYR C 1 120 ? 29.314  -12.481 -19.383 1.00 43.79 ? 164 TYR C CD1 1 
ATOM   2413 C CD2 . TYR C 1 120 ? 27.886  -14.118 -20.359 1.00 46.95 ? 164 TYR C CD2 1 
ATOM   2414 C CE1 . TYR C 1 120 ? 28.886  -12.837 -18.147 1.00 44.30 ? 164 TYR C CE1 1 
ATOM   2415 C CE2 . TYR C 1 120 ? 27.467  -14.508 -19.105 1.00 45.61 ? 164 TYR C CE2 1 
ATOM   2416 C CZ  . TYR C 1 120 ? 27.971  -13.848 -17.990 1.00 46.31 ? 164 TYR C CZ  1 
ATOM   2417 O OH  . TYR C 1 120 ? 27.594  -14.198 -16.698 1.00 44.68 ? 164 TYR C OH  1 
ATOM   2418 N N   . TRP C 1 121 ? 26.763  -12.712 -23.459 1.00 44.20 ? 165 TRP C N   1 
ATOM   2419 C CA  . TRP C 1 121 ? 25.427  -13.250 -23.613 1.00 40.98 ? 165 TRP C CA  1 
ATOM   2420 C C   . TRP C 1 121 ? 25.633  -14.581 -24.216 1.00 39.03 ? 165 TRP C C   1 
ATOM   2421 O O   . TRP C 1 121 ? 26.660  -14.802 -24.839 1.00 38.18 ? 165 TRP C O   1 
ATOM   2422 C CB  . TRP C 1 121 ? 24.517  -12.343 -24.457 1.00 41.50 ? 165 TRP C CB  1 
ATOM   2423 C CG  . TRP C 1 121 ? 24.700  -12.273 -25.983 1.00 41.07 ? 165 TRP C CG  1 
ATOM   2424 C CD1 . TRP C 1 121 ? 25.464  -11.369 -26.682 1.00 40.34 ? 165 TRP C CD1 1 
ATOM   2425 C CD2 . TRP C 1 121 ? 24.016  -13.074 -26.972 1.00 40.67 ? 165 TRP C CD2 1 
ATOM   2426 N NE1 . TRP C 1 121 ? 25.323  -11.593 -28.051 1.00 43.96 ? 165 TRP C NE1 1 
ATOM   2427 C CE2 . TRP C 1 121 ? 24.450  -12.636 -28.250 1.00 43.89 ? 165 TRP C CE2 1 
ATOM   2428 C CE3 . TRP C 1 121 ? 23.139  -14.171 -26.901 1.00 44.23 ? 165 TRP C CE3 1 
ATOM   2429 C CZ2 . TRP C 1 121 ? 23.994  -13.232 -29.455 1.00 42.93 ? 165 TRP C CZ2 1 
ATOM   2430 C CZ3 . TRP C 1 121 ? 22.684  -14.765 -28.108 1.00 42.37 ? 165 TRP C CZ3 1 
ATOM   2431 C CH2 . TRP C 1 121 ? 23.138  -14.314 -29.357 1.00 42.77 ? 165 TRP C CH2 1 
ATOM   2432 N N   . GLY C 1 122 ? 24.681  -15.467 -23.992 1.00 36.94 ? 166 GLY C N   1 
ATOM   2433 C CA  . GLY C 1 122 ? 24.698  -16.755 -24.630 1.00 37.48 ? 166 GLY C CA  1 
ATOM   2434 C C   . GLY C 1 122 ? 23.304  -17.313 -24.785 1.00 36.21 ? 166 GLY C C   1 
ATOM   2435 O O   . GLY C 1 122 ? 22.316  -16.704 -24.415 1.00 34.45 ? 166 GLY C O   1 
ATOM   2436 N N   . ILE C 1 123 ? 23.232  -18.527 -25.264 1.00 36.71 ? 167 ILE C N   1 
ATOM   2437 C CA  . ILE C 1 123 ? 21.923  -19.007 -25.677 1.00 36.98 ? 167 ILE C CA  1 
ATOM   2438 C C   . ILE C 1 123 ? 21.921  -20.475 -25.368 1.00 36.51 ? 167 ILE C C   1 
ATOM   2439 O O   . ILE C 1 123 ? 22.972  -21.129 -25.442 1.00 34.11 ? 167 ILE C O   1 
ATOM   2440 C CB  . ILE C 1 123 ? 21.720  -18.771 -27.219 1.00 37.96 ? 167 ILE C CB  1 
ATOM   2441 C CG1 . ILE C 1 123 ? 20.318  -19.110 -27.736 1.00 40.16 ? 167 ILE C CG1 1 
ATOM   2442 C CG2 . ILE C 1 123 ? 22.657  -19.683 -28.029 1.00 39.45 ? 167 ILE C CG2 1 
ATOM   2443 C CD1 . ILE C 1 123 ? 19.190  -18.567 -26.958 1.00 46.85 ? 167 ILE C CD1 1 
ATOM   2444 N N   . ILE C 1 124 ? 20.726  -21.018 -25.101 1.00 35.36 ? 168 ILE C N   1 
ATOM   2445 C CA  . ILE C 1 124 ? 20.628  -22.417 -24.953 1.00 35.12 ? 168 ILE C CA  1 
ATOM   2446 C C   . ILE C 1 124 ? 19.311  -22.821 -25.548 1.00 36.63 ? 168 ILE C C   1 
ATOM   2447 O O   . ILE C 1 124 ? 18.291  -22.244 -25.208 1.00 36.96 ? 168 ILE C O   1 
ATOM   2448 C CB  . ILE C 1 124 ? 20.665  -22.827 -23.439 1.00 35.98 ? 168 ILE C CB  1 
ATOM   2449 C CG1 . ILE C 1 124 ? 20.372  -24.315 -23.305 1.00 33.79 ? 168 ILE C CG1 1 
ATOM   2450 C CG2 . ILE C 1 124 ? 19.698  -21.911 -22.632 1.00 35.14 ? 168 ILE C CG2 1 
ATOM   2451 C CD1 . ILE C 1 124 ? 21.159  -24.959 -22.290 1.00 36.03 ? 168 ILE C CD1 1 
ATOM   2452 N N   . LEU C 1 125 ? 19.338  -23.873 -26.364 1.00 36.95 ? 169 LEU C N   1 
ATOM   2453 C CA  . LEU C 1 125 ? 18.145  -24.516 -26.855 1.00 38.40 ? 169 LEU C CA  1 
ATOM   2454 C C   . LEU C 1 125 ? 17.499  -25.257 -25.702 1.00 38.82 ? 169 LEU C C   1 
ATOM   2455 O O   . LEU C 1 125 ? 18.092  -26.217 -25.204 1.00 39.61 ? 169 LEU C O   1 
ATOM   2456 C CB  . LEU C 1 125 ? 18.523  -25.572 -27.899 1.00 35.85 ? 169 LEU C CB  1 
ATOM   2457 C CG  . LEU C 1 125 ? 17.721  -25.823 -29.181 1.00 38.82 ? 169 LEU C CG  1 
ATOM   2458 C CD1 . LEU C 1 125 ? 17.926  -27.296 -29.602 1.00 38.99 ? 169 LEU C CD1 1 
ATOM   2459 C CD2 . LEU C 1 125 ? 16.243  -25.393 -29.224 1.00 32.96 ? 169 LEU C CD2 1 
ATOM   2460 N N   . LEU C 1 126 ? 16.278  -24.881 -25.327 1.00 39.27 ? 170 LEU C N   1 
ATOM   2461 C CA  . LEU C 1 126 ? 15.483  -25.658 -24.329 1.00 40.95 ? 170 LEU C CA  1 
ATOM   2462 C C   . LEU C 1 126 ? 14.662  -26.818 -24.913 1.00 41.27 ? 170 LEU C C   1 
ATOM   2463 O O   . LEU C 1 126 ? 14.530  -27.878 -24.339 1.00 42.26 ? 170 LEU C O   1 
ATOM   2464 C CB  . LEU C 1 126 ? 14.529  -24.711 -23.575 1.00 40.72 ? 170 LEU C CB  1 
ATOM   2465 C CG  . LEU C 1 126 ? 15.068  -23.521 -22.798 1.00 40.36 ? 170 LEU C CG  1 
ATOM   2466 C CD1 . LEU C 1 126 ? 13.868  -22.730 -22.129 1.00 41.92 ? 170 LEU C CD1 1 
ATOM   2467 C CD2 . LEU C 1 126 ? 16.021  -24.013 -21.722 1.00 41.61 ? 170 LEU C CD2 1 
ATOM   2468 N N   . ALA C 1 127 ? 14.062  -26.599 -26.059 1.00 42.57 ? 171 ALA C N   1 
ATOM   2469 C CA  . ALA C 1 127 ? 13.158  -27.581 -26.618 1.00 44.71 ? 171 ALA C CA  1 
ATOM   2470 C C   . ALA C 1 127 ? 12.962  -27.300 -28.079 1.00 45.50 ? 171 ALA C C   1 
ATOM   2471 O O   . ALA C 1 127 ? 13.122  -26.179 -28.525 1.00 46.61 ? 171 ALA C O   1 
ATOM   2472 C CB  . ALA C 1 127 ? 11.761  -27.623 -25.851 1.00 43.69 ? 171 ALA C CB  1 
ATOM   2473 N N   . ASN C 1 128 ? 12.699  -28.346 -28.828 1.00 47.89 ? 172 ASN C N   1 
ATOM   2474 C CA  . ASN C 1 128 ? 12.140  -28.193 -30.149 1.00 50.84 ? 172 ASN C CA  1 
ATOM   2475 C C   . ASN C 1 128 ? 10.942  -29.104 -30.306 1.00 52.46 ? 172 ASN C C   1 
ATOM   2476 O O   . ASN C 1 128 ? 11.056  -30.228 -30.810 1.00 53.24 ? 172 ASN C O   1 
ATOM   2477 C CB  . ASN C 1 128 ? 13.153  -28.420 -31.263 1.00 52.05 ? 172 ASN C CB  1 
ATOM   2478 C CG  . ASN C 1 128 ? 14.430  -29.078 -30.792 1.00 54.67 ? 172 ASN C CG  1 
ATOM   2479 O OD1 . ASN C 1 128 ? 15.496  -28.763 -31.309 1.00 58.02 ? 172 ASN C OD1 1 
ATOM   2480 N ND2 . ASN C 1 128 ? 14.340  -30.013 -29.831 1.00 58.50 ? 172 ASN C ND2 1 
ATOM   2481 N N   . PRO C 1 129 ? 9.779   -28.615 -29.874 1.00 53.31 ? 173 PRO C N   1 
ATOM   2482 C CA  . PRO C 1 129 ? 8.561   -29.350 -30.028 1.00 54.68 ? 173 PRO C CA  1 
ATOM   2483 C C   . PRO C 1 129 ? 8.098   -29.363 -31.513 1.00 56.33 ? 173 PRO C C   1 
ATOM   2484 O O   . PRO C 1 129 ? 8.714   -28.730 -32.392 1.00 55.70 ? 173 PRO C O   1 
ATOM   2485 C CB  . PRO C 1 129 ? 7.582   -28.541 -29.176 1.00 54.71 ? 173 PRO C CB  1 
ATOM   2486 C CG  . PRO C 1 129 ? 8.085   -27.129 -29.323 1.00 53.75 ? 173 PRO C CG  1 
ATOM   2487 C CD  . PRO C 1 129 ? 9.559   -27.282 -29.282 1.00 53.56 ? 173 PRO C CD  1 
ATOM   2488 N N   . GLN C 1 130 ? 6.978   -30.044 -31.742 1.00 58.23 ? 174 GLN C N   1 
ATOM   2489 C CA  . GLN C 1 130 ? 6.388   -30.245 -33.062 1.00 60.05 ? 174 GLN C CA  1 
ATOM   2490 C C   . GLN C 1 130 ? 6.839   -29.226 -34.122 1.00 61.02 ? 174 GLN C C   1 
ATOM   2491 O O   . GLN C 1 130 ? 7.663   -29.627 -34.959 1.00 61.65 ? 174 GLN C O   1 
ATOM   2492 C CB  . GLN C 1 130 ? 4.895   -30.549 -32.936 1.00 60.25 ? 174 GLN C CB  1 
ATOM   2493 C CG  . GLN C 1 130 ? 4.664   -31.824 -32.081 1.00 61.81 ? 174 GLN C CG  1 
ATOM   2494 C CD  . GLN C 1 130 ? 5.910   -32.229 -31.226 1.00 63.29 ? 174 GLN C CD  1 
ATOM   2495 O OE1 . GLN C 1 130 ? 5.823   -32.329 -29.999 1.00 65.07 ? 174 GLN C OE1 1 
ATOM   2496 N NE2 . GLN C 1 130 ? 7.057   -32.471 -31.887 1.00 61.30 ? 174 GLN C NE2 1 
ATOM   2497 N N   . PHE C 1 131 ? 6.423   -27.942 -34.169 1.00 62.07 ? 175 PHE C N   1 
ATOM   2498 C CA  . PHE C 1 131 ? 5.126   -27.210 -33.916 1.00 62.17 ? 175 PHE C CA  1 
ATOM   2499 C C   . PHE C 1 131 ? 5.491   -25.697 -33.890 1.00 62.82 ? 175 PHE C C   1 
ATOM   2500 O O   . PHE C 1 131 ? 4.776   -24.850 -34.446 1.00 63.22 ? 175 PHE C O   1 
ATOM   2501 C CB  . PHE C 1 131 ? 4.097   -27.758 -32.847 1.00 61.79 ? 175 PHE C CB  1 
ATOM   2502 C CG  . PHE C 1 131 ? 4.146   -27.111 -31.464 1.00 60.42 ? 175 PHE C CG  1 
ATOM   2503 C CD1 . PHE C 1 131 ? 3.921   -27.898 -30.332 1.00 59.69 ? 175 PHE C CD1 1 
ATOM   2504 C CD2 . PHE C 1 131 ? 4.388   -25.752 -31.282 1.00 58.78 ? 175 PHE C CD2 1 
ATOM   2505 C CE1 . PHE C 1 131 ? 3.951   -27.351 -29.044 1.00 58.18 ? 175 PHE C CE1 1 
ATOM   2506 C CE2 . PHE C 1 131 ? 4.439   -25.210 -30.013 1.00 58.95 ? 175 PHE C CE2 1 
ATOM   2507 C CZ  . PHE C 1 131 ? 4.211   -26.015 -28.890 1.00 58.70 ? 175 PHE C CZ  1 
ATOM   2508 N N   . ILE C 1 132 ? 6.656   -25.388 -33.322 1.00 63.33 ? 176 ILE C N   1 
ATOM   2509 C CA  . ILE C 1 132 ? 7.367   -24.149 -33.666 1.00 64.00 ? 176 ILE C CA  1 
ATOM   2510 C C   . ILE C 1 132 ? 7.871   -24.215 -35.127 1.00 64.01 ? 176 ILE C C   1 
ATOM   2511 O O   . ILE C 1 132 ? 8.511   -25.202 -35.563 1.00 63.29 ? 176 ILE C O   1 
ATOM   2512 C CB  . ILE C 1 132 ? 8.559   -23.791 -32.673 1.00 64.83 ? 176 ILE C CB  1 
ATOM   2513 C CG1 . ILE C 1 132 ? 9.800   -23.369 -33.461 1.00 64.94 ? 176 ILE C CG1 1 
ATOM   2514 C CG2 . ILE C 1 132 ? 8.956   -24.966 -31.738 1.00 64.17 ? 176 ILE C CG2 1 
ATOM   2515 C CD1 . ILE C 1 132 ? 10.486  -22.161 -32.929 1.00 69.02 ? 176 ILE C CD1 1 
HETATM 2516 O O   . HOH D 2 .   ? 0.996   -6.945  7.001   1.00 41.98 ? 178 HOH A O   1 
HETATM 2517 O O   . HOH D 2 .   ? 17.901  -5.512  0.937   1.00 27.19 ? 179 HOH A O   1 
HETATM 2518 O O   . HOH D 2 .   ? 25.826  -13.639 -1.707  1.00 26.45 ? 180 HOH A O   1 
HETATM 2519 O O   . HOH D 2 .   ? 28.074  -5.561  -1.634  1.00 32.73 ? 181 HOH A O   1 
HETATM 2520 O O   . HOH D 2 .   ? 18.103  -12.845 4.319   1.00 27.10 ? 182 HOH A O   1 
HETATM 2521 O O   . HOH D 2 .   ? 6.625   -19.116 -8.597  1.00 33.39 ? 183 HOH A O   1 
HETATM 2522 O O   . HOH D 2 .   ? -0.379  -7.158  -3.719  1.00 30.56 ? 184 HOH A O   1 
HETATM 2523 O O   . HOH D 2 .   ? 1.206   -12.538 0.425   1.00 28.25 ? 185 HOH A O   1 
HETATM 2524 O O   . HOH D 2 .   ? 2.469   -10.152 0.058   1.00 29.50 ? 186 HOH A O   1 
HETATM 2525 O O   . HOH D 2 .   ? 0.197   -8.702  -5.639  1.00 21.50 ? 187 HOH A O   1 
HETATM 2526 O O   . HOH D 2 .   ? 32.370  -27.323 -11.099 1.00 32.00 ? 188 HOH A O   1 
HETATM 2527 O O   . HOH D 2 .   ? 1.494   -0.751  0.131   1.00 46.17 ? 189 HOH A O   1 
HETATM 2528 O O   . HOH D 2 .   ? 8.036   -25.984 -1.314  1.00 33.13 ? 190 HOH A O   1 
HETATM 2529 O O   . HOH D 2 .   ? 10.907  -16.115 -11.035 1.00 35.62 ? 191 HOH A O   1 
HETATM 2530 O O   . HOH D 2 .   ? 14.960  -6.977  11.348  1.00 45.35 ? 192 HOH A O   1 
HETATM 2531 O O   . HOH D 2 .   ? 33.242  -18.223 -6.650  1.00 26.19 ? 193 HOH A O   1 
HETATM 2532 O O   . HOH D 2 .   ? 21.636  -30.833 -16.038 1.00 62.70 ? 194 HOH A O   1 
HETATM 2533 O O   . HOH D 2 .   ? 8.280   -0.244  -8.901  1.00 54.50 ? 195 HOH A O   1 
HETATM 2534 O O   . HOH D 2 .   ? 10.153  -14.613 -13.845 1.00 37.55 ? 196 HOH A O   1 
HETATM 2535 O O   . HOH D 2 .   ? 0.459   -5.977  9.428   1.00 37.31 ? 197 HOH A O   1 
HETATM 2536 O O   . HOH D 2 .   ? 35.145  -20.769 -9.313  1.00 32.15 ? 198 HOH A O   1 
HETATM 2537 O O   . HOH D 2 .   ? 5.675   -16.565 -8.650  1.00 45.57 ? 199 HOH A O   1 
HETATM 2538 O O   . HOH D 2 .   ? 9.682   -8.535  -10.480 1.00 43.50 ? 200 HOH A O   1 
HETATM 2539 O O   . HOH D 2 .   ? 13.057  -1.205  10.539  1.00 39.64 ? 201 HOH A O   1 
HETATM 2540 O O   . HOH D 2 .   ? 25.283  -12.959 0.952   1.00 35.10 ? 202 HOH A O   1 
HETATM 2541 O O   . HOH D 2 .   ? 11.272  3.489   1.929   1.00 50.30 ? 203 HOH A O   1 
HETATM 2542 O O   . HOH D 2 .   ? 20.267  -14.622 4.271   1.00 35.71 ? 204 HOH A O   1 
HETATM 2543 O O   . HOH D 2 .   ? 19.999  -30.180 -5.073  1.00 33.83 ? 205 HOH A O   1 
HETATM 2544 O O   . HOH D 2 .   ? 5.562   -22.163 -2.662  1.00 35.23 ? 206 HOH A O   1 
HETATM 2545 O O   . HOH D 2 .   ? 3.683   -18.993 -5.806  1.00 29.23 ? 207 HOH A O   1 
HETATM 2546 O O   . HOH D 2 .   ? 1.804   -10.685 -8.615  1.00 32.40 ? 208 HOH A O   1 
HETATM 2547 O O   . HOH D 2 .   ? 17.965  -10.621 5.381   1.00 22.21 ? 209 HOH A O   1 
HETATM 2548 O O   . HOH D 2 .   ? 13.758  -16.851 -13.354 1.00 29.63 ? 210 HOH A O   1 
HETATM 2549 O O   . HOH D 2 .   ? 31.431  -9.932  -5.606  1.00 52.19 ? 211 HOH A O   1 
HETATM 2550 O O   . HOH D 2 .   ? 6.232   0.755   -1.972  1.00 60.14 ? 212 HOH A O   1 
HETATM 2551 O O   . HOH D 2 .   ? 20.548  -18.596 9.075   1.00 37.07 ? 213 HOH A O   1 
HETATM 2552 O O   . HOH D 2 .   ? 17.734  -25.313 5.905   1.00 40.56 ? 214 HOH A O   1 
HETATM 2553 O O   . HOH D 2 .   ? 2.575   -6.647  -1.194  1.00 36.20 ? 215 HOH A O   1 
HETATM 2554 O O   . HOH D 2 .   ? 25.316  -31.860 -10.405 1.00 47.50 ? 216 HOH A O   1 
HETATM 2555 O O   . HOH D 2 .   ? 12.124  -15.291 -12.339 1.00 43.49 ? 217 HOH A O   1 
HETATM 2556 O O   . HOH D 2 .   ? 22.772  -2.618  -4.162  1.00 44.66 ? 218 HOH A O   1 
HETATM 2557 O O   . HOH D 2 .   ? 16.388  -13.653 6.710   1.00 39.65 ? 219 HOH A O   1 
HETATM 2558 O O   . HOH D 2 .   ? 19.162  -22.700 6.624   1.00 45.81 ? 220 HOH A O   1 
HETATM 2559 O O   . HOH D 2 .   ? 18.151  -36.302 -4.518  1.00 59.74 ? 221 HOH A O   1 
HETATM 2560 O O   . HOH D 2 .   ? 32.658  -15.690 -9.574  1.00 34.36 ? 222 HOH A O   1 
HETATM 2561 O O   . HOH D 2 .   ? 14.385  -32.470 -9.910  1.00 39.88 ? 223 HOH A O   1 
HETATM 2562 O O   . HOH D 2 .   ? 28.689  -37.269 -4.698  1.00 39.49 ? 224 HOH A O   1 
HETATM 2563 O O   . HOH D 2 .   ? 8.170   4.664   11.507  1.00 68.83 ? 225 HOH A O   1 
HETATM 2564 O O   . HOH D 2 .   ? 32.942  -12.341 -6.442  1.00 51.10 ? 226 HOH A O   1 
HETATM 2565 O O   . HOH D 2 .   ? 3.914   -19.380 -1.254  1.00 43.74 ? 227 HOH A O   1 
HETATM 2566 O O   . HOH D 2 .   ? 19.698  -6.161  5.559   1.00 43.78 ? 228 HOH A O   1 
HETATM 2567 O O   . HOH D 2 .   ? 18.843  -32.774 -16.328 1.00 46.95 ? 229 HOH A O   1 
HETATM 2568 O O   . HOH D 2 .   ? 6.145   -24.125 3.027   1.00 40.62 ? 230 HOH A O   1 
HETATM 2569 O O   . HOH D 2 .   ? 5.009   -6.607  10.652  1.00 37.22 ? 231 HOH A O   1 
HETATM 2570 O O   . HOH D 2 .   ? 30.400  -16.594 -11.462 1.00 43.68 ? 232 HOH A O   1 
HETATM 2571 O O   . HOH D 2 .   ? 34.913  -22.146 -11.239 1.00 37.83 ? 233 HOH A O   1 
HETATM 2572 O O   . HOH D 2 .   ? 8.575   -4.295  11.775  1.00 48.61 ? 234 HOH A O   1 
HETATM 2573 O O   . HOH D 2 .   ? 29.653  -21.527 -15.061 1.00 56.64 ? 235 HOH A O   1 
HETATM 2574 O O   . HOH D 2 .   ? 11.343  -12.081 9.737   1.00 55.93 ? 236 HOH A O   1 
HETATM 2575 O O   . HOH D 2 .   ? 23.232  -30.158 -4.467  1.00 54.30 ? 237 HOH A O   1 
HETATM 2576 O O   . HOH D 2 .   ? 4.912   -8.581  -10.118 1.00 48.27 ? 238 HOH A O   1 
HETATM 2577 O O   . HOH D 2 .   ? 6.652   -10.561 -10.890 1.00 38.19 ? 239 HOH A O   1 
HETATM 2578 O O   . HOH E 2 .   ? -2.555  -9.496  -8.886  1.00 21.92 ? 178 HOH B O   1 
HETATM 2579 O O   . HOH E 2 .   ? -4.870  -9.431  -9.492  1.00 33.05 ? 179 HOH B O   1 
HETATM 2580 O O   . HOH E 2 .   ? -8.921  -25.988 -12.386 1.00 49.73 ? 180 HOH B O   1 
HETATM 2581 O O   . HOH E 2 .   ? 0.006   -22.393 -7.664  1.00 53.87 ? 181 HOH B O   1 
HETATM 2582 O O   . HOH E 2 .   ? 8.488   -17.837 -9.320  1.00 35.88 ? 182 HOH B O   1 
HETATM 2583 O O   . HOH E 2 .   ? -9.253  -23.082 -27.615 1.00 52.90 ? 183 HOH B O   1 
HETATM 2584 O O   . HOH E 2 .   ? 3.604   -6.375  -15.244 1.00 40.36 ? 184 HOH B O   1 
HETATM 2585 O O   . HOH E 2 .   ? -6.961  -10.537 -8.361  1.00 42.18 ? 185 HOH B O   1 
HETATM 2586 O O   . HOH E 2 .   ? 5.110   -25.328 -4.470  1.00 38.19 ? 186 HOH B O   1 
HETATM 2587 O O   . HOH E 2 .   ? -13.722 -16.044 -8.011  1.00 40.52 ? 187 HOH B O   1 
HETATM 2588 O O   . HOH E 2 .   ? 1.385   -33.254 -10.092 1.00 42.81 ? 188 HOH B O   1 
HETATM 2589 O O   . HOH E 2 .   ? 10.067  -15.594 -20.282 1.00 53.99 ? 189 HOH B O   1 
HETATM 2590 O O   . HOH E 2 .   ? 8.839   -16.021 -28.331 1.00 42.04 ? 190 HOH B O   1 
HETATM 2591 O O   . HOH E 2 .   ? 6.037   -12.089 -15.544 1.00 46.88 ? 191 HOH B O   1 
HETATM 2592 O O   . HOH E 2 .   ? 0.950   -8.414  -10.324 1.00 50.33 ? 192 HOH B O   1 
HETATM 2593 O O   . HOH E 2 .   ? -14.627 -19.396 -13.371 1.00 56.72 ? 193 HOH B O   1 
HETATM 2594 O O   . HOH E 2 .   ? -2.294  -23.549 -5.994  1.00 42.65 ? 194 HOH B O   1 
HETATM 2595 O O   . HOH E 2 .   ? -8.612  -21.292 -10.676 1.00 34.47 ? 195 HOH B O   1 
HETATM 2596 O O   . HOH E 2 .   ? 4.639   -22.431 -5.080  1.00 46.48 ? 196 HOH B O   1 
HETATM 2597 O O   . HOH E 2 .   ? -3.827  -33.931 -12.572 1.00 47.90 ? 197 HOH B O   1 
HETATM 2598 O O   . HOH E 2 .   ? 7.840   -32.870 -19.556 1.00 59.07 ? 198 HOH B O   1 
HETATM 2599 O O   . HOH E 2 .   ? -2.815  -1.274  -32.698 1.00 65.44 ? 199 HOH B O   1 
HETATM 2600 O O   . HOH F 2 .   ? 25.571  -3.422  -12.708 1.00 62.98 ? 178 HOH C O   1 
HETATM 2601 O O   . HOH F 2 .   ? 25.596  -15.155 -16.141 1.00 26.24 ? 179 HOH C O   1 
HETATM 2602 O O   . HOH F 2 .   ? 23.192  -13.581 -16.789 1.00 37.03 ? 180 HOH C O   1 
HETATM 2603 O O   . HOH F 2 .   ? 33.529  -18.263 -20.890 1.00 48.31 ? 181 HOH C O   1 
HETATM 2604 O O   . HOH F 2 .   ? 17.746  -15.079 -19.007 1.00 53.16 ? 182 HOH C O   1 
HETATM 2605 O O   . HOH F 2 .   ? 25.390  -18.490 -39.547 1.00 63.10 ? 183 HOH C O   1 
HETATM 2606 O O   . HOH F 2 .   ? 20.730  -28.914 -31.405 1.00 71.55 ? 184 HOH C O   1 
HETATM 2607 O O   . HOH F 2 .   ? 26.458  -7.440  -10.883 1.00 55.17 ? 185 HOH C O   1 
HETATM 2608 O O   . HOH F 2 .   ? 29.630  -28.937 -34.110 1.00 51.08 ? 186 HOH C O   1 
HETATM 2609 O O   . HOH F 2 .   ? 33.029  -16.659 -25.369 1.00 51.27 ? 187 HOH C O   1 
HETATM 2610 O O   . HOH F 2 .   ? 35.894  -11.664 -29.690 1.00 68.72 ? 188 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   45  ?   ?   ?   A . n 
A 1 2   ALA 2   46  ?   ?   ?   A . n 
A 1 3   MET 3   47  ?   ?   ?   A . n 
A 1 4   ALA 4   48  ?   ?   ?   A . n 
A 1 5   SER 5   49  ?   ?   ?   A . n 
A 1 6   GLN 6   50  ?   ?   ?   A . n 
A 1 7   LEU 7   51  ?   ?   ?   A . n 
A 1 8   GLU 8   52  ?   ?   ?   A . n 
A 1 9   THR 9   53  ?   ?   ?   A . n 
A 1 10  ALA 10  54  ?   ?   ?   A . n 
A 1 11  LYS 11  55  55  LYS LYS A . n 
A 1 12  GLU 12  56  56  GLU GLU A . n 
A 1 13  PRO 13  57  57  PRO PRO A . n 
A 1 14  CYS 14  58  58  CYS CYS A . n 
A 1 15  MET 15  59  59  MET MET A . n 
A 1 16  ALA 16  60  60  ALA ALA A . n 
A 1 17  LYS 17  61  61  LYS LYS A . n 
A 1 18  PHE 18  62  62  PHE PHE A . n 
A 1 19  GLY 19  63  63  GLY GLY A . n 
A 1 20  PRO 20  64  64  PRO PRO A . n 
A 1 21  LEU 21  65  65  LEU LEU A . n 
A 1 22  PRO 22  66  66  PRO PRO A . n 
A 1 23  SER 23  67  67  SER SER A . n 
A 1 24  LYS 24  68  68  LYS LYS A . n 
A 1 25  TRP 25  69  69  TRP TRP A . n 
A 1 26  GLN 26  70  70  GLN GLN A . n 
A 1 27  MET 27  71  71  MET MET A . n 
A 1 28  ALA 28  72  72  ALA ALA A . n 
A 1 29  SER 29  73  73  SER SER A . n 
A 1 30  SER 30  74  74  SER SER A . n 
A 1 31  GLU 31  75  75  GLU GLU A . n 
A 1 32  PRO 32  76  76  PRO PRO A . n 
A 1 33  PRO 33  77  77  PRO PRO A . n 
A 1 34  CYS 34  78  78  CYS CYS A . n 
A 1 35  VAL 35  79  79  VAL VAL A . n 
A 1 36  ASN 36  80  80  ASN ASN A . n 
A 1 37  LYS 37  81  81  LYS LYS A . n 
A 1 38  VAL 38  82  82  VAL VAL A . n 
A 1 39  SER 39  83  83  SER SER A . n 
A 1 40  ASP 40  84  84  ASP ASP A . n 
A 1 41  TRP 41  85  85  TRP TRP A . n 
A 1 42  LYS 42  86  86  LYS LYS A . n 
A 1 43  LEU 43  87  87  LEU LEU A . n 
A 1 44  GLU 44  88  88  GLU GLU A . n 
A 1 45  ILE 45  89  89  ILE ILE A . n 
A 1 46  LEU 46  90  90  LEU LEU A . n 
A 1 47  GLN 47  91  91  GLN GLN A . n 
A 1 48  ASN 48  92  92  ASN ASN A . n 
A 1 49  GLY 49  93  93  GLY GLY A . n 
A 1 50  LEU 50  94  94  LEU LEU A . n 
A 1 51  TYR 51  95  95  TYR TYR A . n 
A 1 52  LEU 52  96  96  LEU LEU A . n 
A 1 53  ILE 53  97  97  ILE ILE A . n 
A 1 54  TYR 54  98  98  TYR TYR A . n 
A 1 55  GLY 55  99  99  GLY GLY A . n 
A 1 56  GLN 56  100 100 GLN GLN A . n 
A 1 57  VAL 57  101 101 VAL VAL A . n 
A 1 58  ALA 58  102 102 ALA ALA A . n 
A 1 59  PRO 59  103 103 PRO PRO A . n 
A 1 60  ASN 60  104 104 ASN ASN A . n 
A 1 61  ALA 61  105 105 ALA ALA A . n 
A 1 62  ASN 62  106 106 ASN ASN A . n 
A 1 63  TYR 63  107 107 TYR TYR A . n 
A 1 64  ASN 64  108 108 ASN ASN A . n 
A 1 65  ASP 65  109 109 ASP ASP A . n 
A 1 66  VAL 66  110 110 VAL VAL A . n 
A 1 67  ALA 67  111 111 ALA ALA A . n 
A 1 68  PRO 68  112 112 PRO PRO A . n 
A 1 69  PHE 69  113 113 PHE PHE A . n 
A 1 70  GLU 70  114 114 GLU GLU A . n 
A 1 71  VAL 71  115 115 VAL VAL A . n 
A 1 72  ARG 72  116 116 ARG ARG A . n 
A 1 73  LEU 73  117 117 LEU LEU A . n 
A 1 74  TYR 74  118 118 TYR TYR A . n 
A 1 75  LYS 75  119 119 LYS LYS A . n 
A 1 76  ASN 76  120 120 ASN ASN A . n 
A 1 77  LYS 77  121 121 LYS LYS A . n 
A 1 78  ASP 78  122 122 ASP ASP A . n 
A 1 79  MET 79  123 123 MET MET A . n 
A 1 80  ILE 80  124 124 ILE ILE A . n 
A 1 81  GLN 81  125 125 GLN GLN A . n 
A 1 82  THR 82  126 126 THR THR A . n 
A 1 83  LEU 83  127 127 LEU LEU A . n 
A 1 84  THR 84  128 128 THR THR A . n 
A 1 85  ASN 85  129 129 ASN ASN A . n 
A 1 86  LYS 86  130 130 LYS LYS A . n 
A 1 87  SER 87  131 131 SER SER A . n 
A 1 88  LYS 88  132 132 LYS LYS A . n 
A 1 89  ILE 89  133 133 ILE ILE A . n 
A 1 90  GLN 90  134 134 GLN GLN A . n 
A 1 91  ASN 91  135 135 ASN ASN A . n 
A 1 92  VAL 92  136 136 VAL VAL A . n 
A 1 93  GLY 93  137 137 GLY GLY A . n 
A 1 94  GLY 94  138 138 GLY GLY A . n 
A 1 95  THR 95  139 139 THR THR A . n 
A 1 96  TYR 96  140 140 TYR TYR A . n 
A 1 97  GLU 97  141 141 GLU GLU A . n 
A 1 98  LEU 98  142 142 LEU LEU A . n 
A 1 99  HIS 99  143 143 HIS HIS A . n 
A 1 100 VAL 100 144 144 VAL VAL A . n 
A 1 101 GLY 101 145 145 GLY GLY A . n 
A 1 102 ASP 102 146 146 ASP ASP A . n 
A 1 103 THR 103 147 147 THR THR A . n 
A 1 104 ILE 104 148 148 ILE ILE A . n 
A 1 105 ASP 105 149 149 ASP ASP A . n 
A 1 106 LEU 106 150 150 LEU LEU A . n 
A 1 107 ILE 107 151 151 ILE ILE A . n 
A 1 108 PHE 108 152 152 PHE PHE A . n 
A 1 109 ASN 109 153 153 ASN ASN A . n 
A 1 110 SER 110 154 154 SER SER A . n 
A 1 111 GLU 111 155 155 GLU GLU A . n 
A 1 112 HIS 112 156 156 HIS HIS A . n 
A 1 113 GLN 113 157 157 GLN GLN A . n 
A 1 114 VAL 114 158 158 VAL VAL A . n 
A 1 115 LEU 115 159 159 LEU LEU A . n 
A 1 116 LYS 116 160 160 LYS LYS A . n 
A 1 117 ASN 117 161 161 ASN ASN A . n 
A 1 118 ASN 118 162 162 ASN ASN A . n 
A 1 119 THR 119 163 163 THR THR A . n 
A 1 120 TYR 120 164 164 TYR TYR A . n 
A 1 121 TRP 121 165 165 TRP TRP A . n 
A 1 122 GLY 122 166 166 GLY GLY A . n 
A 1 123 ILE 123 167 167 ILE ILE A . n 
A 1 124 ILE 124 168 168 ILE ILE A . n 
A 1 125 LEU 125 169 169 LEU LEU A . n 
A 1 126 LEU 126 170 170 LEU LEU A . n 
A 1 127 ALA 127 171 171 ALA ALA A . n 
A 1 128 ASN 128 172 172 ASN ASN A . n 
A 1 129 PRO 129 173 173 PRO PRO A . n 
A 1 130 GLN 130 174 174 GLN GLN A . n 
A 1 131 PHE 131 175 175 PHE PHE A . n 
A 1 132 ILE 132 176 176 ILE ILE A . n 
A 1 133 SER 133 177 177 SER SER A . n 
B 1 1   GLY 1   45  ?   ?   ?   B . n 
B 1 2   ALA 2   46  ?   ?   ?   B . n 
B 1 3   MET 3   47  ?   ?   ?   B . n 
B 1 4   ALA 4   48  ?   ?   ?   B . n 
B 1 5   SER 5   49  ?   ?   ?   B . n 
B 1 6   GLN 6   50  ?   ?   ?   B . n 
B 1 7   LEU 7   51  ?   ?   ?   B . n 
B 1 8   GLU 8   52  ?   ?   ?   B . n 
B 1 9   THR 9   53  ?   ?   ?   B . n 
B 1 10  ALA 10  54  ?   ?   ?   B . n 
B 1 11  LYS 11  55  ?   ?   ?   B . n 
B 1 12  GLU 12  56  ?   ?   ?   B . n 
B 1 13  PRO 13  57  57  PRO PRO B . n 
B 1 14  CYS 14  58  58  CYS CYS B . n 
B 1 15  MET 15  59  59  MET MET B . n 
B 1 16  ALA 16  60  60  ALA ALA B . n 
B 1 17  LYS 17  61  61  LYS LYS B . n 
B 1 18  PHE 18  62  62  PHE PHE B . n 
B 1 19  GLY 19  63  63  GLY GLY B . n 
B 1 20  PRO 20  64  64  PRO PRO B . n 
B 1 21  LEU 21  65  65  LEU LEU B . n 
B 1 22  PRO 22  66  66  PRO PRO B . n 
B 1 23  SER 23  67  67  SER SER B . n 
B 1 24  LYS 24  68  68  LYS LYS B . n 
B 1 25  TRP 25  69  69  TRP TRP B . n 
B 1 26  GLN 26  70  70  GLN GLN B . n 
B 1 27  MET 27  71  71  MET MET B . n 
B 1 28  ALA 28  72  72  ALA ALA B . n 
B 1 29  SER 29  73  ?   ?   ?   B . n 
B 1 30  SER 30  74  ?   ?   ?   B . n 
B 1 31  GLU 31  75  ?   ?   ?   B . n 
B 1 32  PRO 32  76  76  PRO PRO B . n 
B 1 33  PRO 33  77  77  PRO PRO B . n 
B 1 34  CYS 34  78  78  CYS CYS B . n 
B 1 35  VAL 35  79  79  VAL VAL B . n 
B 1 36  ASN 36  80  80  ASN ASN B . n 
B 1 37  LYS 37  81  81  LYS LYS B . n 
B 1 38  VAL 38  82  82  VAL VAL B . n 
B 1 39  SER 39  83  83  SER SER B . n 
B 1 40  ASP 40  84  84  ASP ASP B . n 
B 1 41  TRP 41  85  85  TRP TRP B . n 
B 1 42  LYS 42  86  86  LYS LYS B . n 
B 1 43  LEU 43  87  87  LEU LEU B . n 
B 1 44  GLU 44  88  88  GLU GLU B . n 
B 1 45  ILE 45  89  89  ILE ILE B . n 
B 1 46  LEU 46  90  90  LEU LEU B . n 
B 1 47  GLN 47  91  91  GLN GLN B . n 
B 1 48  ASN 48  92  92  ASN ASN B . n 
B 1 49  GLY 49  93  93  GLY GLY B . n 
B 1 50  LEU 50  94  94  LEU LEU B . n 
B 1 51  TYR 51  95  95  TYR TYR B . n 
B 1 52  LEU 52  96  96  LEU LEU B . n 
B 1 53  ILE 53  97  97  ILE ILE B . n 
B 1 54  TYR 54  98  98  TYR TYR B . n 
B 1 55  GLY 55  99  99  GLY GLY B . n 
B 1 56  GLN 56  100 100 GLN GLN B . n 
B 1 57  VAL 57  101 101 VAL VAL B . n 
B 1 58  ALA 58  102 102 ALA ALA B . n 
B 1 59  PRO 59  103 103 PRO PRO B . n 
B 1 60  ASN 60  104 ?   ?   ?   B . n 
B 1 61  ALA 61  105 ?   ?   ?   B . n 
B 1 62  ASN 62  106 ?   ?   ?   B . n 
B 1 63  TYR 63  107 ?   ?   ?   B . n 
B 1 64  ASN 64  108 ?   ?   ?   B . n 
B 1 65  ASP 65  109 ?   ?   ?   B . n 
B 1 66  VAL 66  110 ?   ?   ?   B . n 
B 1 67  ALA 67  111 ?   ?   ?   B . n 
B 1 68  PRO 68  112 ?   ?   ?   B . n 
B 1 69  PHE 69  113 ?   ?   ?   B . n 
B 1 70  GLU 70  114 ?   ?   ?   B . n 
B 1 71  VAL 71  115 115 VAL VAL B . n 
B 1 72  ARG 72  116 116 ARG ARG B . n 
B 1 73  LEU 73  117 117 LEU LEU B . n 
B 1 74  TYR 74  118 118 TYR TYR B . n 
B 1 75  LYS 75  119 119 LYS LYS B . n 
B 1 76  ASN 76  120 120 ASN ASN B . n 
B 1 77  LYS 77  121 121 LYS LYS B . n 
B 1 78  ASP 78  122 122 ASP ASP B . n 
B 1 79  MET 79  123 123 MET MET B . n 
B 1 80  ILE 80  124 124 ILE ILE B . n 
B 1 81  GLN 81  125 125 GLN GLN B . n 
B 1 82  THR 82  126 126 THR THR B . n 
B 1 83  LEU 83  127 127 LEU LEU B . n 
B 1 84  THR 84  128 128 THR THR B . n 
B 1 85  ASN 85  129 ?   ?   ?   B . n 
B 1 86  LYS 86  130 ?   ?   ?   B . n 
B 1 87  SER 87  131 ?   ?   ?   B . n 
B 1 88  LYS 88  132 132 LYS ALA B . n 
B 1 89  ILE 89  133 133 ILE ILE B . n 
B 1 90  GLN 90  134 134 GLN GLN B . n 
B 1 91  ASN 91  135 135 ASN ASN B . n 
B 1 92  VAL 92  136 136 VAL VAL B . n 
B 1 93  GLY 93  137 137 GLY GLY B . n 
B 1 94  GLY 94  138 138 GLY GLY B . n 
B 1 95  THR 95  139 139 THR THR B . n 
B 1 96  TYR 96  140 140 TYR TYR B . n 
B 1 97  GLU 97  141 141 GLU GLU B . n 
B 1 98  LEU 98  142 142 LEU LEU B . n 
B 1 99  HIS 99  143 143 HIS HIS B . n 
B 1 100 VAL 100 144 144 VAL VAL B . n 
B 1 101 GLY 101 145 145 GLY GLY B . n 
B 1 102 ASP 102 146 146 ASP ASP B . n 
B 1 103 THR 103 147 147 THR THR B . n 
B 1 104 ILE 104 148 148 ILE ILE B . n 
B 1 105 ASP 105 149 149 ASP ASP B . n 
B 1 106 LEU 106 150 150 LEU LEU B . n 
B 1 107 ILE 107 151 151 ILE ILE B . n 
B 1 108 PHE 108 152 152 PHE PHE B . n 
B 1 109 ASN 109 153 153 ASN ASN B . n 
B 1 110 SER 110 154 154 SER ALA B . n 
B 1 111 GLU 111 155 155 GLU ALA B . n 
B 1 112 HIS 112 156 156 HIS ALA B . n 
B 1 113 GLN 113 157 ?   ?   ?   B . n 
B 1 114 VAL 114 158 ?   ?   ?   B . n 
B 1 115 LEU 115 159 ?   ?   ?   B . n 
B 1 116 LYS 116 160 ?   ?   ?   B . n 
B 1 117 ASN 117 161 161 ASN ASN B . n 
B 1 118 ASN 118 162 162 ASN ALA B . n 
B 1 119 THR 119 163 163 THR THR B . n 
B 1 120 TYR 120 164 164 TYR TYR B . n 
B 1 121 TRP 121 165 165 TRP TRP B . n 
B 1 122 GLY 122 166 166 GLY GLY B . n 
B 1 123 ILE 123 167 167 ILE ILE B . n 
B 1 124 ILE 124 168 168 ILE ILE B . n 
B 1 125 LEU 125 169 169 LEU LEU B . n 
B 1 126 LEU 126 170 170 LEU LEU B . n 
B 1 127 ALA 127 171 171 ALA ALA B . n 
B 1 128 ASN 128 172 172 ASN ASN B . n 
B 1 129 PRO 129 173 173 PRO PRO B . n 
B 1 130 GLN 130 174 174 GLN ALA B . n 
B 1 131 PHE 131 175 175 PHE PHE B . n 
B 1 132 ILE 132 176 176 ILE ILE B . n 
B 1 133 SER 133 177 177 SER SER B . n 
C 1 1   GLY 1   45  ?   ?   ?   C . n 
C 1 2   ALA 2   46  ?   ?   ?   C . n 
C 1 3   MET 3   47  ?   ?   ?   C . n 
C 1 4   ALA 4   48  ?   ?   ?   C . n 
C 1 5   SER 5   49  ?   ?   ?   C . n 
C 1 6   GLN 6   50  ?   ?   ?   C . n 
C 1 7   LEU 7   51  ?   ?   ?   C . n 
C 1 8   GLU 8   52  ?   ?   ?   C . n 
C 1 9   THR 9   53  ?   ?   ?   C . n 
C 1 10  ALA 10  54  ?   ?   ?   C . n 
C 1 11  LYS 11  55  ?   ?   ?   C . n 
C 1 12  GLU 12  56  ?   ?   ?   C . n 
C 1 13  PRO 13  57  57  PRO PRO C . n 
C 1 14  CYS 14  58  58  CYS CYS C . n 
C 1 15  MET 15  59  59  MET MET C . n 
C 1 16  ALA 16  60  60  ALA ALA C . n 
C 1 17  LYS 17  61  61  LYS LYS C . n 
C 1 18  PHE 18  62  62  PHE PHE C . n 
C 1 19  GLY 19  63  63  GLY GLY C . n 
C 1 20  PRO 20  64  64  PRO PRO C . n 
C 1 21  LEU 21  65  65  LEU LEU C . n 
C 1 22  PRO 22  66  66  PRO PRO C . n 
C 1 23  SER 23  67  67  SER SER C . n 
C 1 24  LYS 24  68  68  LYS LYS C . n 
C 1 25  TRP 25  69  69  TRP TRP C . n 
C 1 26  GLN 26  70  70  GLN GLN C . n 
C 1 27  MET 27  71  71  MET MET C . n 
C 1 28  ALA 28  72  72  ALA ALA C . n 
C 1 29  SER 29  73  73  SER SER C . n 
C 1 30  SER 30  74  74  SER SER C . n 
C 1 31  GLU 31  75  75  GLU GLU C . n 
C 1 32  PRO 32  76  76  PRO PRO C . n 
C 1 33  PRO 33  77  77  PRO PRO C . n 
C 1 34  CYS 34  78  78  CYS CYS C . n 
C 1 35  VAL 35  79  79  VAL VAL C . n 
C 1 36  ASN 36  80  80  ASN ASN C . n 
C 1 37  LYS 37  81  81  LYS LYS C . n 
C 1 38  VAL 38  82  82  VAL VAL C . n 
C 1 39  SER 39  83  83  SER SER C . n 
C 1 40  ASP 40  84  84  ASP ASP C . n 
C 1 41  TRP 41  85  85  TRP TRP C . n 
C 1 42  LYS 42  86  86  LYS LYS C . n 
C 1 43  LEU 43  87  87  LEU LEU C . n 
C 1 44  GLU 44  88  88  GLU GLU C . n 
C 1 45  ILE 45  89  89  ILE ILE C . n 
C 1 46  LEU 46  90  90  LEU LEU C . n 
C 1 47  GLN 47  91  91  GLN GLN C . n 
C 1 48  ASN 48  92  92  ASN ASN C . n 
C 1 49  GLY 49  93  93  GLY GLY C . n 
C 1 50  LEU 50  94  94  LEU LEU C . n 
C 1 51  TYR 51  95  95  TYR TYR C . n 
C 1 52  LEU 52  96  96  LEU LEU C . n 
C 1 53  ILE 53  97  97  ILE ILE C . n 
C 1 54  TYR 54  98  98  TYR TYR C . n 
C 1 55  GLY 55  99  99  GLY GLY C . n 
C 1 56  GLN 56  100 100 GLN GLN C . n 
C 1 57  VAL 57  101 101 VAL VAL C . n 
C 1 58  ALA 58  102 102 ALA ALA C . n 
C 1 59  PRO 59  103 103 PRO PRO C . n 
C 1 60  ASN 60  104 ?   ?   ?   C . n 
C 1 61  ALA 61  105 ?   ?   ?   C . n 
C 1 62  ASN 62  106 ?   ?   ?   C . n 
C 1 63  TYR 63  107 ?   ?   ?   C . n 
C 1 64  ASN 64  108 ?   ?   ?   C . n 
C 1 65  ASP 65  109 ?   ?   ?   C . n 
C 1 66  VAL 66  110 ?   ?   ?   C . n 
C 1 67  ALA 67  111 ?   ?   ?   C . n 
C 1 68  PRO 68  112 ?   ?   ?   C . n 
C 1 69  PHE 69  113 ?   ?   ?   C . n 
C 1 70  GLU 70  114 ?   ?   ?   C . n 
C 1 71  VAL 71  115 115 VAL ALA C . n 
C 1 72  ARG 72  116 116 ARG ARG C . n 
C 1 73  LEU 73  117 117 LEU LEU C . n 
C 1 74  TYR 74  118 118 TYR TYR C . n 
C 1 75  LYS 75  119 119 LYS LYS C . n 
C 1 76  ASN 76  120 120 ASN ASN C . n 
C 1 77  LYS 77  121 121 LYS LYS C . n 
C 1 78  ASP 78  122 122 ASP ASP C . n 
C 1 79  MET 79  123 123 MET MET C . n 
C 1 80  ILE 80  124 124 ILE ILE C . n 
C 1 81  GLN 81  125 125 GLN GLN C . n 
C 1 82  THR 82  126 126 THR THR C . n 
C 1 83  LEU 83  127 127 LEU ALA C . n 
C 1 84  THR 84  128 128 THR THR C . n 
C 1 85  ASN 85  129 ?   ?   ?   C . n 
C 1 86  LYS 86  130 ?   ?   ?   C . n 
C 1 87  SER 87  131 131 SER ALA C . n 
C 1 88  LYS 88  132 132 LYS LYS C . n 
C 1 89  ILE 89  133 133 ILE ALA C . n 
C 1 90  GLN 90  134 134 GLN GLN C . n 
C 1 91  ASN 91  135 135 ASN ASN C . n 
C 1 92  VAL 92  136 136 VAL VAL C . n 
C 1 93  GLY 93  137 137 GLY GLY C . n 
C 1 94  GLY 94  138 138 GLY GLY C . n 
C 1 95  THR 95  139 139 THR THR C . n 
C 1 96  TYR 96  140 140 TYR TYR C . n 
C 1 97  GLU 97  141 141 GLU GLU C . n 
C 1 98  LEU 98  142 142 LEU LEU C . n 
C 1 99  HIS 99  143 143 HIS HIS C . n 
C 1 100 VAL 100 144 144 VAL VAL C . n 
C 1 101 GLY 101 145 145 GLY GLY C . n 
C 1 102 ASP 102 146 146 ASP ASP C . n 
C 1 103 THR 103 147 147 THR THR C . n 
C 1 104 ILE 104 148 148 ILE ILE C . n 
C 1 105 ASP 105 149 149 ASP ASP C . n 
C 1 106 LEU 106 150 150 LEU LEU C . n 
C 1 107 ILE 107 151 151 ILE ILE C . n 
C 1 108 PHE 108 152 ?   ?   ?   C . n 
C 1 109 ASN 109 153 ?   ?   ?   C . n 
C 1 110 SER 110 154 ?   ?   ?   C . n 
C 1 111 GLU 111 155 ?   ?   ?   C . n 
C 1 112 HIS 112 156 ?   ?   ?   C . n 
C 1 113 GLN 113 157 ?   ?   ?   C . n 
C 1 114 VAL 114 158 ?   ?   ?   C . n 
C 1 115 LEU 115 159 ?   ?   ?   C . n 
C 1 116 LYS 116 160 ?   ?   ?   C . n 
C 1 117 ASN 117 161 ?   ?   ?   C . n 
C 1 118 ASN 118 162 ?   ?   ?   C . n 
C 1 119 THR 119 163 163 THR THR C . n 
C 1 120 TYR 120 164 164 TYR TYR C . n 
C 1 121 TRP 121 165 165 TRP TRP C . n 
C 1 122 GLY 122 166 166 GLY GLY C . n 
C 1 123 ILE 123 167 167 ILE ILE C . n 
C 1 124 ILE 124 168 168 ILE ILE C . n 
C 1 125 LEU 125 169 169 LEU LEU C . n 
C 1 126 LEU 126 170 170 LEU LEU C . n 
C 1 127 ALA 127 171 171 ALA ALA C . n 
C 1 128 ASN 128 172 172 ASN ASN C . n 
C 1 129 PRO 129 173 173 PRO PRO C . n 
C 1 130 GLN 130 174 174 GLN GLN C . n 
C 1 131 PHE 131 175 175 PHE PHE C . n 
C 1 132 ILE 132 176 176 ILE ILE C . n 
C 1 133 SER 133 177 ?   ?   ?   C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 HOH 1  178 1  HOH HOH A . 
D 2 HOH 2  179 2  HOH HOH A . 
D 2 HOH 3  180 3  HOH HOH A . 
D 2 HOH 4  181 4  HOH HOH A . 
D 2 HOH 5  182 5  HOH HOH A . 
D 2 HOH 6  183 7  HOH HOH A . 
D 2 HOH 7  184 8  HOH HOH A . 
D 2 HOH 8  185 9  HOH HOH A . 
D 2 HOH 9  186 10 HOH HOH A . 
D 2 HOH 10 187 11 HOH HOH A . 
D 2 HOH 11 188 12 HOH HOH A . 
D 2 HOH 12 189 13 HOH HOH A . 
D 2 HOH 13 190 14 HOH HOH A . 
D 2 HOH 14 191 15 HOH HOH A . 
D 2 HOH 15 192 17 HOH HOH A . 
D 2 HOH 16 193 18 HOH HOH A . 
D 2 HOH 17 194 22 HOH HOH A . 
D 2 HOH 18 195 23 HOH HOH A . 
D 2 HOH 19 196 24 HOH HOH A . 
D 2 HOH 20 197 25 HOH HOH A . 
D 2 HOH 21 198 26 HOH HOH A . 
D 2 HOH 22 199 30 HOH HOH A . 
D 2 HOH 23 200 31 HOH HOH A . 
D 2 HOH 24 201 32 HOH HOH A . 
D 2 HOH 25 202 33 HOH HOH A . 
D 2 HOH 26 203 34 HOH HOH A . 
D 2 HOH 27 204 35 HOH HOH A . 
D 2 HOH 28 205 37 HOH HOH A . 
D 2 HOH 29 206 40 HOH HOH A . 
D 2 HOH 30 207 41 HOH HOH A . 
D 2 HOH 31 208 43 HOH HOH A . 
D 2 HOH 32 209 44 HOH HOH A . 
D 2 HOH 33 210 46 HOH HOH A . 
D 2 HOH 34 211 47 HOH HOH A . 
D 2 HOH 35 212 48 HOH HOH A . 
D 2 HOH 36 213 49 HOH HOH A . 
D 2 HOH 37 214 52 HOH HOH A . 
D 2 HOH 38 215 53 HOH HOH A . 
D 2 HOH 39 216 54 HOH HOH A . 
D 2 HOH 40 217 56 HOH HOH A . 
D 2 HOH 41 218 57 HOH HOH A . 
D 2 HOH 42 219 59 HOH HOH A . 
D 2 HOH 43 220 61 HOH HOH A . 
D 2 HOH 44 221 62 HOH HOH A . 
D 2 HOH 45 222 63 HOH HOH A . 
D 2 HOH 46 223 64 HOH HOH A . 
D 2 HOH 47 224 65 HOH HOH A . 
D 2 HOH 48 225 67 HOH HOH A . 
D 2 HOH 49 226 68 HOH HOH A . 
D 2 HOH 50 227 70 HOH HOH A . 
D 2 HOH 51 228 72 HOH HOH A . 
D 2 HOH 52 229 73 HOH HOH A . 
D 2 HOH 53 230 74 HOH HOH A . 
D 2 HOH 54 231 75 HOH HOH A . 
D 2 HOH 55 232 76 HOH HOH A . 
D 2 HOH 56 233 79 HOH HOH A . 
D 2 HOH 57 234 81 HOH HOH A . 
D 2 HOH 58 235 83 HOH HOH A . 
D 2 HOH 59 236 84 HOH HOH A . 
D 2 HOH 60 237 87 HOH HOH A . 
D 2 HOH 61 238 88 HOH HOH A . 
D 2 HOH 62 239 92 HOH HOH A . 
E 2 HOH 1  178 6  HOH HOH B . 
E 2 HOH 2  179 16 HOH HOH B . 
E 2 HOH 3  180 19 HOH HOH B . 
E 2 HOH 4  181 21 HOH HOH B . 
E 2 HOH 5  182 28 HOH HOH B . 
E 2 HOH 6  183 29 HOH HOH B . 
E 2 HOH 7  184 38 HOH HOH B . 
E 2 HOH 8  185 39 HOH HOH B . 
E 2 HOH 9  186 42 HOH HOH B . 
E 2 HOH 10 187 45 HOH HOH B . 
E 2 HOH 11 188 50 HOH HOH B . 
E 2 HOH 12 189 51 HOH HOH B . 
E 2 HOH 13 190 58 HOH HOH B . 
E 2 HOH 14 191 60 HOH HOH B . 
E 2 HOH 15 192 66 HOH HOH B . 
E 2 HOH 16 193 69 HOH HOH B . 
E 2 HOH 17 194 71 HOH HOH B . 
E 2 HOH 18 195 77 HOH HOH B . 
E 2 HOH 19 196 78 HOH HOH B . 
E 2 HOH 20 197 80 HOH HOH B . 
E 2 HOH 21 198 90 HOH HOH B . 
E 2 HOH 22 199 95 HOH HOH B . 
F 2 HOH 1  178 20 HOH HOH C . 
F 2 HOH 2  179 27 HOH HOH C . 
F 2 HOH 3  180 36 HOH HOH C . 
F 2 HOH 4  181 55 HOH HOH C . 
F 2 HOH 5  182 82 HOH HOH C . 
F 2 HOH 6  183 85 HOH HOH C . 
F 2 HOH 7  184 86 HOH HOH C . 
F 2 HOH 8  185 89 HOH HOH C . 
F 2 HOH 9  186 91 HOH HOH C . 
F 2 HOH 10 187 93 HOH HOH C . 
F 2 HOH 11 188 94 HOH HOH C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_assembly_prop.biol_id   1 
_pdbx_struct_assembly_prop.type      'ABSA (A^2)' 
_pdbx_struct_assembly_prop.value     3430 
_pdbx_struct_assembly_prop.details   ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-02-12 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 17.4825 -16.7596 -4.0232  -0.0267 -0.0135 -0.0012 0.0107 -0.0040 -0.0037 0.7850 0.7406 0.6128 -0.3945 -0.0785 0.3061 
0.0535  -0.0245 0.0350  -0.0095 -0.0054 -0.0227 0.0857  0.0105  -0.0481 'X-RAY DIFFRACTION' 
2 ? refined 0.2759  -19.6045 -20.1800 -0.0565 0.1079  -0.0601 0.0013 0.0021  -0.0290 1.8518 0.7628 1.5348 -0.3352 -0.4168 0.1605 
0.0527  0.4603  -0.0748 0.0778  -0.0697 -0.0321 -0.0899 -0.2857 0.0170  'X-RAY DIFFRACTION' 
3 ? refined 21.2822 -15.5461 -28.2755 -0.0762 0.0840  -0.0837 0.0212 0.0053  0.0098  1.4441 2.6802 3.6721 0.0840  0.4025  0.4890 
-0.1818 0.1933  0.0605  -0.0534 0.1218  -0.0447 -0.1999 -0.0100 0.0600  'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 55 A 11 A 177 A 133 ? 'X-RAY DIFFRACTION' ? 
2 2 B 57 B 13 B 177 B 133 ? 'X-RAY DIFFRACTION' ? 
3 3 C 57 C 13 C 176 C 132 ? 'X-RAY DIFFRACTION' ? 
# 
_software.name             REFMAC 
_software.classification   refinement 
_software.version          5.2.0005 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 191 ? ? O A HOH 217 ? ? 1.96 
2 1 O   A PRO 173 ? ? N A PHE 175 ? ? 2.08 
3 1 OD2 A ASP 109 ? ? O A HOH 234 ? ? 2.09 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 C  B ASN 120 ? ? O  B ASN 120 ? ? 1.347 1.229 0.118 0.019 N 
2 1 CE C LYS 132 ? ? NZ C LYS 132 ? ? 1.736 1.486 0.250 0.025 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA A LEU 96  ? ? CB A LEU 96  ? ? CG  A LEU 96  ? ? 130.00 115.30 14.70  2.30 N 
2 1 CB A LEU 96  ? ? CG A LEU 96  ? ? CD1 A LEU 96  ? ? 121.95 111.00 10.95  1.70 N 
3 1 NE A ARG 116 ? ? CZ A ARG 116 ? ? NH2 A ARG 116 ? ? 115.50 120.30 -4.80  0.50 N 
4 1 C  A ASN 172 ? ? N  A PRO 173 ? ? CA  A PRO 173 ? ? 109.01 119.30 -10.29 1.50 Y 
5 1 CB B ASP 122 ? ? CG B ASP 122 ? ? OD2 B ASP 122 ? ? 124.57 118.30 6.27   0.90 N 
6 1 C  C GLY 63  ? ? N  C PRO 64  ? ? CA  C PRO 64  ? ? 154.53 119.30 35.23  1.50 Y 
7 1 C  C GLY 63  ? ? N  C PRO 64  ? ? CD  C PRO 64  ? ? 93.26  128.40 -35.14 2.10 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 56  ? ? 36.50   -173.72 
2  1 LYS A 68  ? ? -105.05 -133.07 
3  1 ASN A 108 ? ? -150.58 28.49   
4  1 ASP A 109 ? ? -58.95  -178.75 
5  1 ASN A 120 ? ? 54.19   -121.48 
6  1 ALA A 171 ? ? -178.29 145.99  
7  1 GLN A 174 ? ? -9.93   30.14   
8  1 PHE A 175 ? ? -132.70 -52.62  
9  1 LYS B 68  ? ? -113.64 -135.39 
10 1 SER B 83  ? ? 175.99  -174.77 
11 1 ASN B 120 ? ? 39.51   59.33   
12 1 ASN B 162 ? ? -95.21  56.15   
13 1 PRO C 64  ? ? 43.39   123.28  
14 1 LYS C 68  ? ? -113.61 -156.44 
15 1 SER C 73  ? ? -39.24  89.70   
16 1 VAL C 82  ? ? -107.76 -73.02  
17 1 SER C 83  ? ? -126.41 -140.33 
18 1 TRP C 85  ? ? 78.19   -7.49   
19 1 ALA C 102 ? ? 151.12  163.41  
20 1 ASN C 120 ? ? 49.93   -125.88 
21 1 LYS C 132 ? ? -23.10  -16.99  
22 1 VAL C 144 ? ? -39.31  131.47  
23 1 GLN C 174 ? ? -20.82  -73.95  
24 1 PHE C 175 ? ? 168.64  -37.53  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 PRO A 173 ? ? GLN A 174 ? ? 132.35  
2 1 ASN B 161 ? ? ASN B 162 ? ? 148.10  
3 1 PHE C 62  ? ? GLY C 63  ? ? -43.85  
4 1 GLY C 63  ? ? PRO C 64  ? ? -120.65 
5 1 ALA C 72  ? ? SER C 73  ? ? -134.66 
6 1 GLN C 174 ? ? PHE C 175 ? ? -38.10  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 B LYS 132 ? CG  ? B LYS 88  CG  
2  1 Y 1 B LYS 132 ? CD  ? B LYS 88  CD  
3  1 Y 1 B LYS 132 ? CE  ? B LYS 88  CE  
4  1 Y 1 B LYS 132 ? NZ  ? B LYS 88  NZ  
5  1 Y 1 B SER 154 ? OG  ? B SER 110 OG  
6  1 Y 1 B GLU 155 ? CG  ? B GLU 111 CG  
7  1 Y 1 B GLU 155 ? CD  ? B GLU 111 CD  
8  1 Y 1 B GLU 155 ? OE1 ? B GLU 111 OE1 
9  1 Y 1 B GLU 155 ? OE2 ? B GLU 111 OE2 
10 1 Y 1 B HIS 156 ? CG  ? B HIS 112 CG  
11 1 Y 1 B HIS 156 ? ND1 ? B HIS 112 ND1 
12 1 Y 1 B HIS 156 ? CD2 ? B HIS 112 CD2 
13 1 Y 1 B HIS 156 ? CE1 ? B HIS 112 CE1 
14 1 Y 1 B HIS 156 ? NE2 ? B HIS 112 NE2 
15 1 Y 1 B ASN 162 ? CG  ? B ASN 118 CG  
16 1 Y 1 B ASN 162 ? OD1 ? B ASN 118 OD1 
17 1 Y 1 B ASN 162 ? ND2 ? B ASN 118 ND2 
18 1 Y 1 B GLN 174 ? CG  ? B GLN 130 CG  
19 1 Y 1 B GLN 174 ? CD  ? B GLN 130 CD  
20 1 Y 1 B GLN 174 ? OE1 ? B GLN 130 OE1 
21 1 Y 1 B GLN 174 ? NE2 ? B GLN 130 NE2 
22 1 Y 1 C VAL 115 ? CG1 ? C VAL 71  CG1 
23 1 Y 1 C VAL 115 ? CG2 ? C VAL 71  CG2 
24 1 Y 1 C LEU 127 ? CG  ? C LEU 83  CG  
25 1 Y 1 C LEU 127 ? CD1 ? C LEU 83  CD1 
26 1 Y 1 C LEU 127 ? CD2 ? C LEU 83  CD2 
27 1 Y 1 C SER 131 ? OG  ? C SER 87  OG  
28 1 Y 1 C ILE 133 ? CG1 ? C ILE 89  CG1 
29 1 Y 1 C ILE 133 ? CG2 ? C ILE 89  CG2 
30 1 Y 1 C ILE 133 ? CD1 ? C ILE 89  CD1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 45  ? A GLY 1   
2  1 Y 1 A ALA 46  ? A ALA 2   
3  1 Y 1 A MET 47  ? A MET 3   
4  1 Y 1 A ALA 48  ? A ALA 4   
5  1 Y 1 A SER 49  ? A SER 5   
6  1 Y 1 A GLN 50  ? A GLN 6   
7  1 Y 1 A LEU 51  ? A LEU 7   
8  1 Y 1 A GLU 52  ? A GLU 8   
9  1 Y 1 A THR 53  ? A THR 9   
10 1 Y 1 A ALA 54  ? A ALA 10  
11 1 Y 1 B GLY 45  ? B GLY 1   
12 1 Y 1 B ALA 46  ? B ALA 2   
13 1 Y 1 B MET 47  ? B MET 3   
14 1 Y 1 B ALA 48  ? B ALA 4   
15 1 Y 1 B SER 49  ? B SER 5   
16 1 Y 1 B GLN 50  ? B GLN 6   
17 1 Y 1 B LEU 51  ? B LEU 7   
18 1 Y 1 B GLU 52  ? B GLU 8   
19 1 Y 1 B THR 53  ? B THR 9   
20 1 Y 1 B ALA 54  ? B ALA 10  
21 1 Y 1 B LYS 55  ? B LYS 11  
22 1 Y 1 B GLU 56  ? B GLU 12  
23 1 Y 1 B SER 73  ? B SER 29  
24 1 Y 1 B SER 74  ? B SER 30  
25 1 Y 1 B GLU 75  ? B GLU 31  
26 1 Y 1 B ASN 104 ? B ASN 60  
27 1 Y 1 B ALA 105 ? B ALA 61  
28 1 Y 1 B ASN 106 ? B ASN 62  
29 1 Y 1 B TYR 107 ? B TYR 63  
30 1 Y 1 B ASN 108 ? B ASN 64  
31 1 Y 1 B ASP 109 ? B ASP 65  
32 1 Y 1 B VAL 110 ? B VAL 66  
33 1 Y 1 B ALA 111 ? B ALA 67  
34 1 Y 1 B PRO 112 ? B PRO 68  
35 1 Y 1 B PHE 113 ? B PHE 69  
36 1 Y 1 B GLU 114 ? B GLU 70  
37 1 Y 1 B ASN 129 ? B ASN 85  
38 1 Y 1 B LYS 130 ? B LYS 86  
39 1 Y 1 B SER 131 ? B SER 87  
40 1 Y 1 B GLN 157 ? B GLN 113 
41 1 Y 1 B VAL 158 ? B VAL 114 
42 1 Y 1 B LEU 159 ? B LEU 115 
43 1 Y 1 B LYS 160 ? B LYS 116 
44 1 Y 1 C GLY 45  ? C GLY 1   
45 1 Y 1 C ALA 46  ? C ALA 2   
46 1 Y 1 C MET 47  ? C MET 3   
47 1 Y 1 C ALA 48  ? C ALA 4   
48 1 Y 1 C SER 49  ? C SER 5   
49 1 Y 1 C GLN 50  ? C GLN 6   
50 1 Y 1 C LEU 51  ? C LEU 7   
51 1 Y 1 C GLU 52  ? C GLU 8   
52 1 Y 1 C THR 53  ? C THR 9   
53 1 Y 1 C ALA 54  ? C ALA 10  
54 1 Y 1 C LYS 55  ? C LYS 11  
55 1 Y 1 C GLU 56  ? C GLU 12  
56 1 Y 1 C ASN 104 ? C ASN 60  
57 1 Y 1 C ALA 105 ? C ALA 61  
58 1 Y 1 C ASN 106 ? C ASN 62  
59 1 Y 1 C TYR 107 ? C TYR 63  
60 1 Y 1 C ASN 108 ? C ASN 64  
61 1 Y 1 C ASP 109 ? C ASP 65  
62 1 Y 1 C VAL 110 ? C VAL 66  
63 1 Y 1 C ALA 111 ? C ALA 67  
64 1 Y 1 C PRO 112 ? C PRO 68  
65 1 Y 1 C PHE 113 ? C PHE 69  
66 1 Y 1 C GLU 114 ? C GLU 70  
67 1 Y 1 C ASN 129 ? C ASN 85  
68 1 Y 1 C LYS 130 ? C LYS 86  
69 1 Y 1 C PHE 152 ? C PHE 108 
70 1 Y 1 C ASN 153 ? C ASN 109 
71 1 Y 1 C SER 154 ? C SER 110 
72 1 Y 1 C GLU 155 ? C GLU 111 
73 1 Y 1 C HIS 156 ? C HIS 112 
74 1 Y 1 C GLN 157 ? C GLN 113 
75 1 Y 1 C VAL 158 ? C VAL 114 
76 1 Y 1 C LEU 159 ? C LEU 115 
77 1 Y 1 C LYS 160 ? C LYS 116 
78 1 Y 1 C ASN 161 ? C ASN 117 
79 1 Y 1 C ASN 162 ? C ASN 118 
80 1 Y 1 C SER 177 ? C SER 133 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#