data_3BB2
# 
_entry.id   3BB2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3BB2         
RCSB  RCSB045302   
WWPDB D_1000045302 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1JQZ 
_pdbx_database_related.details        'Human acidic fibroblast growth factor. 141 amino acid form with amino terminal his tag' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3BB2 
_pdbx_database_status.recvd_initial_deposition_date   2007-11-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lee, J.'    1 
'Blaber, M.' 2 
# 
_citation.id                        primary 
_citation.title                     'A logical OR redundancy within the Asx-Pro-Asx-Gly type I beta-turn motif.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            377 
_citation.page_first                1251 
_citation.page_last                 1264 
_citation.year                      2008 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18308335 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2008.01.055 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lee, J.'     1 
primary 'Dubey, V.K.' 2 
primary 'Longo, L.M.' 3 
primary 'Blaber, M.'  4 
# 
_cell.entry_id           3BB2 
_cell.length_a           75.442 
_cell.length_b           96.700 
_cell.length_c           108.071 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3BB2 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Heparin-binding growth factor 1' 16687.693 2   ? 'L26D, D28N' ? ? 
2 non-polymer syn 'SULFATE ION'                     96.063    1   ? ?            ? ? 
3 non-polymer syn 'FORMIC ACID'                     46.025    3   ? ?            ? ? 
4 water       nat water                             18.015    222 ? ?            ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'HBGF-1, Acidic fibroblast growth factor, aFGF, Beta-endothelial cell growth factor, ECGF-beta' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;HHHHHHFNLPPGNYKKPKLLYCSNGGHFLRIDPNGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLY
GSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;HHHHHHFNLPPGNYKKPKLLYCSNGGHFLRIDPNGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLY
GSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   PHE n 
1 8   ASN n 
1 9   LEU n 
1 10  PRO n 
1 11  PRO n 
1 12  GLY n 
1 13  ASN n 
1 14  TYR n 
1 15  LYS n 
1 16  LYS n 
1 17  PRO n 
1 18  LYS n 
1 19  LEU n 
1 20  LEU n 
1 21  TYR n 
1 22  CYS n 
1 23  SER n 
1 24  ASN n 
1 25  GLY n 
1 26  GLY n 
1 27  HIS n 
1 28  PHE n 
1 29  LEU n 
1 30  ARG n 
1 31  ILE n 
1 32  ASP n 
1 33  PRO n 
1 34  ASN n 
1 35  GLY n 
1 36  THR n 
1 37  VAL n 
1 38  ASP n 
1 39  GLY n 
1 40  THR n 
1 41  ARG n 
1 42  ASP n 
1 43  ARG n 
1 44  SER n 
1 45  ASP n 
1 46  GLN n 
1 47  HIS n 
1 48  ILE n 
1 49  GLN n 
1 50  LEU n 
1 51  GLN n 
1 52  LEU n 
1 53  SER n 
1 54  ALA n 
1 55  GLU n 
1 56  SER n 
1 57  VAL n 
1 58  GLY n 
1 59  GLU n 
1 60  VAL n 
1 61  TYR n 
1 62  ILE n 
1 63  LYS n 
1 64  SER n 
1 65  THR n 
1 66  GLU n 
1 67  THR n 
1 68  GLY n 
1 69  GLN n 
1 70  TYR n 
1 71  LEU n 
1 72  ALA n 
1 73  MET n 
1 74  ASP n 
1 75  THR n 
1 76  ASP n 
1 77  GLY n 
1 78  LEU n 
1 79  LEU n 
1 80  TYR n 
1 81  GLY n 
1 82  SER n 
1 83  GLN n 
1 84  THR n 
1 85  PRO n 
1 86  ASN n 
1 87  GLU n 
1 88  GLU n 
1 89  CYS n 
1 90  LEU n 
1 91  PHE n 
1 92  LEU n 
1 93  GLU n 
1 94  ARG n 
1 95  LEU n 
1 96  GLU n 
1 97  GLU n 
1 98  ASN n 
1 99  HIS n 
1 100 TYR n 
1 101 ASN n 
1 102 THR n 
1 103 TYR n 
1 104 ILE n 
1 105 SER n 
1 106 LYS n 
1 107 LYS n 
1 108 HIS n 
1 109 ALA n 
1 110 GLU n 
1 111 LYS n 
1 112 ASN n 
1 113 TRP n 
1 114 PHE n 
1 115 VAL n 
1 116 GLY n 
1 117 LEU n 
1 118 LYS n 
1 119 LYS n 
1 120 ASN n 
1 121 GLY n 
1 122 SER n 
1 123 CYS n 
1 124 LYS n 
1 125 ARG n 
1 126 GLY n 
1 127 PRO n 
1 128 ARG n 
1 129 THR n 
1 130 HIS n 
1 131 TYR n 
1 132 GLY n 
1 133 GLN n 
1 134 LYS n 
1 135 ALA n 
1 136 ILE n 
1 137 LEU n 
1 138 PHE n 
1 139 LEU n 
1 140 PRO n 
1 141 LEU n 
1 142 PRO n 
1 143 VAL n 
1 144 SER n 
1 145 SER n 
1 146 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'FGF1, FGFA' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'PET21a(+)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    FGF1_HUMAN 
_struct_ref.pdbx_db_accession          P05230 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPN
EECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
;
_struct_ref.pdbx_align_begin           16 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3BB2 A 7 G 146 ? P05230 16 ? 155 ? 1 140 
2 1 3BB2 B 7 G 146 ? P05230 16 ? 155 ? 1 140 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3BB2 HIS A 1  ? UNP P05230 ?   ?  'EXPRESSION TAG' -1 1  
1 3BB2 HIS A 2  ? UNP P05230 ?   ?  'EXPRESSION TAG' 0  2  
1 3BB2 HIS A 3  C UNP P05230 ?   ?  'EXPRESSION TAG' 1  3  
1 3BB2 HIS A 4  D UNP P05230 ?   ?  'EXPRESSION TAG' 1  4  
1 3BB2 HIS A 5  E UNP P05230 ?   ?  'EXPRESSION TAG' 1  5  
1 3BB2 HIS A 6  F UNP P05230 ?   ?  'EXPRESSION TAG' 1  6  
1 3BB2 ASP A 32 ? UNP P05230 LEU 41 ENGINEERED       26 7  
1 3BB2 ASN A 34 ? UNP P05230 ASP 43 ENGINEERED       28 8  
2 3BB2 HIS B 1  ? UNP P05230 ?   ?  'EXPRESSION TAG' -1 9  
2 3BB2 HIS B 2  ? UNP P05230 ?   ?  'EXPRESSION TAG' 0  10 
2 3BB2 HIS B 3  C UNP P05230 ?   ?  'EXPRESSION TAG' 1  11 
2 3BB2 HIS B 4  D UNP P05230 ?   ?  'EXPRESSION TAG' 1  12 
2 3BB2 HIS B 5  E UNP P05230 ?   ?  'EXPRESSION TAG' 1  13 
2 3BB2 HIS B 6  F UNP P05230 ?   ?  'EXPRESSION TAG' 1  14 
2 3BB2 ASP B 32 ? UNP P05230 LEU 41 ENGINEERED       26 15 
2 3BB2 ASN B 34 ? UNP P05230 ASP 43 ENGINEERED       28 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
FMT non-polymer         . 'FORMIC ACID'   ? 'C H2 O2'        46.025  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3BB2 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.95 
_exptl_crystal.density_percent_sol   58.34 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    '2.8M Na-formate, 0.6M (NH4)2SO4, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.15K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           103 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-10-11 
_diffrn_detector.details                'double crystal monochromator' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     3BB2 
_reflns.observed_criterion_sigma_I   3 
_reflns.observed_criterion_sigma_F   3 
_reflns.d_resolution_low             22.89 
_reflns.d_resolution_high            1.50 
_reflns.number_obs                   56349 
_reflns.number_all                   61277 
_reflns.percent_possible_obs         92.0 
_reflns.pdbx_Rmerge_I_obs            0.06 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        47.31 
_reflns.B_iso_Wilson_estimate        17.9 
_reflns.pdbx_redundancy              6.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.50 
_reflns_shell.d_res_low              1.55 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.399 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    5.20 
_reflns_shell.pdbx_redundancy        6.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      6222 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3BB2 
_refine.ls_number_reflns_obs                     56349 
_refine.ls_number_reflns_all                     61277 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               130071.91 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             22.89 
_refine.ls_d_res_high                            1.50 
_refine.ls_percent_reflns_obs                    88.8 
_refine.ls_R_factor_obs                          0.198 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.198 
_refine.ls_R_factor_R_free                       0.228 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2888 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               19.6 
_refine.aniso_B[1][1]                            0.04 
_refine.aniso_B[2][2]                            2.40 
_refine.aniso_B[3][3]                            -2.44 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.385248 
_refine.solvent_model_param_bsol                 41.1996 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'pdb entry 1JQZ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3BB2 
_refine_analyze.Luzzati_coordinate_error_obs    0.17 
_refine_analyze.Luzzati_sigma_a_obs             0.06 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.20 
_refine_analyze.Luzzati_sigma_a_free            0.13 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2272 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.number_atoms_solvent             231 
_refine_hist.number_atoms_total               2508 
_refine_hist.d_res_high                       1.50 
_refine_hist.d_res_low                        22.89 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.017 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.8   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      26.5  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.26  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             2.56  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            3.34  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             3.57  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            4.76  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.50 
_refine_ls_shell.d_res_low                        1.59 
_refine_ls_shell.number_reflns_R_work             7673 
_refine_ls_shell.R_factor_R_work                  0.217 
_refine_ls_shell.percent_reflns_obs               77.6 
_refine_ls_shell.R_factor_R_free                  0.26 
_refine_ls_shell.R_factor_R_free_error            0.013 
_refine_ls_shell.percent_reflns_R_free            5.2 
_refine_ls_shell.number_reflns_R_free             417 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                7673 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 dna-rna_rep.param dna-rna.top 'X-RAY DIFFRACTION' 
3 water_rep.param   water.top   'X-RAY DIFFRACTION' 
4 ion.param         ion.top     'X-RAY DIFFRACTION' 
5 formate.param     formate.top 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3BB2 
_struct.title                     'Crystal structure of L26D/D28N mutant of Human acidic fibroblast growth factor' 
_struct.pdbx_descriptor           'Heparin-binding growth factor 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3BB2 
_struct_keywords.pdbx_keywords   HORMONE 
_struct_keywords.text            
;beta-trefoil, Acetylation, Angiogenesis, Developmental protein, Differentiation, Growth factor, Heparin-binding, Mitogen, Polymorphism, HORMONE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASN A 86  ? CYS A 89  ? ASN A 80  CYS A 83  5 ? 4 
HELX_P HELX_P2 2 HIS A 108 ? ASN A 112 ? HIS A 102 ASN A 106 5 ? 5 
HELX_P HELX_P3 3 ARG A 125 ? THR A 129 ? ARG A 119 THR A 123 5 ? 5 
HELX_P HELX_P4 4 ASN B 86  ? CYS B 89  ? ASN B 80  CYS B 83  5 ? 4 
HELX_P HELX_P5 5 HIS B 108 ? ASN B 112 ? HIS B 102 ASN B 106 5 ? 5 
HELX_P HELX_P6 6 ARG B 125 ? THR B 129 ? ARG B 119 THR B 123 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 2 ? 
D ? 4 ? 
E ? 4 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 37  ? THR A 40  ? VAL A 31  THR A 34  
A 2 HIS A 27  ? ILE A 31  ? HIS A 21  ILE A 25  
A 3 LYS A 18  ? CYS A 22  ? LYS A 12  CYS A 16  
A 4 PHE A 138 ? PRO A 142 ? PHE A 132 PRO A 136 
B 1 LEU A 50  ? SER A 56  ? LEU A 44  SER A 50  
B 2 GLU A 59  ? SER A 64  ? GLU A 53  SER A 58  
B 3 PHE A 91  ? GLU A 96  ? PHE A 85  GLU A 90  
B 4 TYR A 100 ? SER A 105 ? TYR A 94  SER A 99  
C 1 TYR A 70  ? MET A 73  ? TYR A 64  MET A 67  
C 2 LEU A 79  ? SER A 82  ? LEU A 73  SER A 76  
D 1 VAL B 37  ? THR B 40  ? VAL B 31  THR B 34  
D 2 HIS B 27  ? ILE B 31  ? HIS B 21  ILE B 25  
D 3 LYS B 18  ? CYS B 22  ? LYS B 12  CYS B 16  
D 4 PHE B 138 ? PRO B 142 ? PHE B 132 PRO B 136 
E 1 LEU B 50  ? ALA B 54  ? LEU B 44  ALA B 48  
E 2 GLU B 59  ? SER B 64  ? GLU B 53  SER B 58  
E 3 PHE B 91  ? GLU B 96  ? PHE B 85  GLU B 90  
E 4 TYR B 100 ? SER B 105 ? TYR B 94  SER B 99  
F 1 TYR B 70  ? MET B 73  ? TYR B 64  MET B 67  
F 2 LEU B 79  ? SER B 82  ? LEU B 73  SER B 76  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ASP A 38 ? O ASP A 32 N ARG A 30  ? N ARG A 24  
A 2 3 O HIS A 27 ? O HIS A 21 N CYS A 22  ? N CYS A 16  
A 3 4 N LEU A 19 ? N LEU A 13 O LEU A 141 ? O LEU A 135 
B 1 2 N GLN A 51 ? N GLN A 45 O LYS A 63  ? O LYS A 57  
B 2 3 N VAL A 60 ? N VAL A 54 O PHE A 91  ? O PHE A 85  
B 3 4 N LEU A 92 ? N LEU A 86 O ILE A 104 ? O ILE A 98  
C 1 2 N TYR A 70 ? N TYR A 64 O SER A 82  ? O SER A 76  
D 1 2 O THR B 40 ? O THR B 34 N PHE B 28  ? N PHE B 22  
D 2 3 O HIS B 27 ? O HIS B 21 N CYS B 22  ? N CYS B 16  
D 3 4 N LEU B 19 ? N LEU B 13 O LEU B 141 ? O LEU B 135 
E 1 2 N GLN B 51 ? N GLN B 45 O LYS B 63  ? O LYS B 57  
E 2 3 N VAL B 60 ? N VAL B 54 O PHE B 91  ? O PHE B 85  
E 3 4 N LEU B 92 ? N LEU B 86 O ILE B 104 ? O ILE B 98  
F 1 2 N TYR B 70 ? N TYR B 64 O SER B 82  ? O SER B 76  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 141' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE FMT A 142' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE FMT B 141' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FMT B 142' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASN A 24  ? ASN A 18  . ? 1_555 ? 
2  AC1 6 LYS A 118 ? LYS A 112 . ? 1_555 ? 
3  AC1 6 LYS A 119 ? LYS A 113 . ? 1_555 ? 
4  AC1 6 HOH G .   ? HOH A 176 . ? 1_555 ? 
5  AC1 6 HOH G .   ? HOH A 235 . ? 1_555 ? 
6  AC1 6 ASP B 76  ? ASP B 70  . ? 1_555 ? 
7  AC2 4 HIS A 3   C HIS A 1   . ? 1_555 ? 
8  AC2 4 HIS A 4   D HIS A 1   . ? 1_555 ? 
9  AC2 4 HIS A 5   E HIS A 1   . ? 1_555 ? 
10 AC2 4 HOH G .   ? HOH A 147 . ? 1_555 ? 
11 AC3 4 GLN B 133 ? GLN B 127 . ? 1_555 ? 
12 AC3 4 LYS B 134 ? LYS B 128 . ? 1_555 ? 
13 AC3 4 ALA B 135 ? ALA B 129 . ? 1_555 ? 
14 AC3 4 HOH H .   ? HOH B 220 . ? 1_555 ? 
15 AC4 5 HIS B 3   C HIS B 1   . ? 1_555 ? 
16 AC4 5 HIS B 4   D HIS B 1   . ? 1_555 ? 
17 AC4 5 HIS B 5   E HIS B 1   . ? 1_555 ? 
18 AC4 5 LEU B 92  ? LEU B 86  . ? 1_555 ? 
19 AC4 5 HOH H .   ? HOH B 150 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3BB2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3BB2 
_atom_sites.fract_transf_matrix[1][1]   0.013255 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010341 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009253 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . HIS A 1 3   C 45.598 38.431 45.914 1.00 36.43 ? 1   HIS A N   1 
ATOM   2    C CA  . HIS A 1 3   C 44.328 37.751 45.551 1.00 29.37 ? 1   HIS A CA  1 
ATOM   3    C C   . HIS A 1 3   C 44.089 36.405 46.266 1.00 25.97 ? 1   HIS A C   1 
ATOM   4    O O   . HIS A 1 3   C 45.009 35.614 46.521 1.00 26.83 ? 1   HIS A O   1 
ATOM   5    C CB  . HIS A 1 3   C 44.283 37.512 44.024 1.00 36.08 ? 1   HIS A CB  1 
ATOM   6    C CG  . HIS A 1 3   C 43.867 38.704 43.214 1.00 40.93 ? 1   HIS A CG  1 
ATOM   7    N ND1 . HIS A 1 3   C 43.788 38.672 41.834 1.00 41.10 ? 1   HIS A ND1 1 
ATOM   8    C CD2 . HIS A 1 3   C 43.413 39.927 43.587 1.00 40.84 ? 1   HIS A CD2 1 
ATOM   9    C CE1 . HIS A 1 3   C 43.291 39.817 41.393 1.00 40.58 ? 1   HIS A CE1 1 
ATOM   10   N NE2 . HIS A 1 3   C 43.056 40.596 42.436 1.00 44.37 ? 1   HIS A NE2 1 
ATOM   11   N N   . HIS A 1 4   D 42.834 36.145 46.591 1.00 22.58 ? 1   HIS A N   1 
ATOM   12   C CA  . HIS A 1 4   D 42.468 34.877 47.189 1.00 22.63 ? 1   HIS A CA  1 
ATOM   13   C C   . HIS A 1 4   D 41.872 33.969 46.094 1.00 21.59 ? 1   HIS A C   1 
ATOM   14   O O   . HIS A 1 4   D 41.599 32.779 46.359 1.00 20.32 ? 1   HIS A O   1 
ATOM   15   C CB  . HIS A 1 4   D 41.387 35.084 48.266 1.00 26.25 ? 1   HIS A CB  1 
ATOM   16   C CG  . HIS A 1 4   D 41.885 35.742 49.517 1.00 30.92 ? 1   HIS A CG  1 
ATOM   17   N ND1 . HIS A 1 4   D 42.573 35.049 50.490 1.00 36.39 ? 1   HIS A ND1 1 
ATOM   18   C CD2 . HIS A 1 4   D 41.819 37.028 49.947 1.00 35.57 ? 1   HIS A CD2 1 
ATOM   19   C CE1 . HIS A 1 4   D 42.911 35.875 51.464 1.00 35.38 ? 1   HIS A CE1 1 
ATOM   20   N NE2 . HIS A 1 4   D 42.469 37.081 51.159 1.00 34.85 ? 1   HIS A NE2 1 
ATOM   21   N N   . HIS A 1 5   E 41.674 34.513 44.873 1.00 14.64 ? 1   HIS A N   1 
ATOM   22   C CA  . HIS A 1 5   E 41.007 33.775 43.825 1.00 13.20 ? 1   HIS A CA  1 
ATOM   23   C C   . HIS A 1 5   E 41.666 33.969 42.457 1.00 11.22 ? 1   HIS A C   1 
ATOM   24   O O   . HIS A 1 5   E 42.387 34.935 42.219 1.00 12.50 ? 1   HIS A O   1 
ATOM   25   C CB  . HIS A 1 5   E 39.552 34.291 43.762 1.00 13.70 ? 1   HIS A CB  1 
ATOM   26   C CG  . HIS A 1 5   E 38.819 34.008 45.030 1.00 14.97 ? 1   HIS A CG  1 
ATOM   27   N ND1 . HIS A 1 5   E 38.241 32.786 45.283 1.00 16.16 ? 1   HIS A ND1 1 
ATOM   28   C CD2 . HIS A 1 5   E 38.591 34.774 46.132 1.00 17.48 ? 1   HIS A CD2 1 
ATOM   29   C CE1 . HIS A 1 5   E 37.687 32.803 46.488 1.00 18.05 ? 1   HIS A CE1 1 
ATOM   30   N NE2 . HIS A 1 5   E 37.885 33.998 47.022 1.00 18.04 ? 1   HIS A NE2 1 
ATOM   31   N N   . HIS A 1 6   F 41.342 33.021 41.581 1.00 11.86 ? 1   HIS A N   1 
ATOM   32   C CA  . HIS A 1 6   F 41.812 33.055 40.187 1.00 10.02 ? 1   HIS A CA  1 
ATOM   33   C C   . HIS A 1 6   F 41.232 34.288 39.454 1.00 9.33  ? 1   HIS A C   1 
ATOM   34   O O   . HIS A 1 6   F 40.410 35.059 40.012 1.00 11.45 ? 1   HIS A O   1 
ATOM   35   C CB  . HIS A 1 6   F 41.330 31.799 39.484 1.00 12.11 ? 1   HIS A CB  1 
ATOM   36   C CG  . HIS A 1 6   F 39.853 31.786 39.253 1.00 9.83  ? 1   HIS A CG  1 
ATOM   37   N ND1 . HIS A 1 6   F 39.288 31.934 37.998 1.00 10.71 ? 1   HIS A ND1 1 
ATOM   38   C CD2 . HIS A 1 6   F 38.815 31.620 40.119 1.00 11.05 ? 1   HIS A CD2 1 
ATOM   39   C CE1 . HIS A 1 6   F 37.967 31.856 38.103 1.00 12.86 ? 1   HIS A CE1 1 
ATOM   40   N NE2 . HIS A 1 6   F 37.649 31.663 39.378 1.00 11.02 ? 1   HIS A NE2 1 
ATOM   41   N N   . PHE A 1 7   G 41.678 34.451 38.216 1.00 10.40 ? 1   PHE A N   1 
ATOM   42   C CA  . PHE A 1 7   G 41.263 35.608 37.418 1.00 9.54  ? 1   PHE A CA  1 
ATOM   43   C C   . PHE A 1 7   G 40.801 35.196 36.015 1.00 9.04  ? 1   PHE A C   1 
ATOM   44   O O   . PHE A 1 7   G 41.091 35.949 35.029 1.00 12.27 ? 1   PHE A O   1 
ATOM   45   C CB  . PHE A 1 7   G 42.372 36.669 37.393 1.00 10.79 ? 1   PHE A CB  1 
ATOM   46   C CG  . PHE A 1 7   G 41.861 38.075 37.197 1.00 13.41 ? 1   PHE A CG  1 
ATOM   47   C CD1 . PHE A 1 7   G 41.057 38.687 38.145 1.00 16.74 ? 1   PHE A CD1 1 
ATOM   48   C CD2 . PHE A 1 7   G 42.224 38.818 36.070 1.00 18.57 ? 1   PHE A CD2 1 
ATOM   49   C CE1 . PHE A 1 7   G 40.613 39.992 38.003 1.00 18.53 ? 1   PHE A CE1 1 
ATOM   50   C CE2 . PHE A 1 7   G 41.771 40.149 35.919 1.00 18.46 ? 1   PHE A CE2 1 
ATOM   51   C CZ  . PHE A 1 7   G 40.970 40.728 36.887 1.00 17.71 ? 1   PHE A CZ  1 
ATOM   52   N N   . ASN A 1 8   ? 40.144 34.027 35.912 1.00 9.79  ? 2   ASN A N   1 
ATOM   53   C CA  . ASN A 1 8   ? 39.505 33.692 34.625 1.00 9.65  ? 2   ASN A CA  1 
ATOM   54   C C   . ASN A 1 8   ? 38.181 34.490 34.622 1.00 13.27 ? 2   ASN A C   1 
ATOM   55   O O   . ASN A 1 8   ? 37.359 34.291 35.524 1.00 10.82 ? 2   ASN A O   1 
ATOM   56   C CB  . ASN A 1 8   ? 39.241 32.207 34.486 1.00 10.74 ? 2   ASN A CB  1 
ATOM   57   C CG  . ASN A 1 8   ? 40.538 31.400 34.513 1.00 11.27 ? 2   ASN A CG  1 
ATOM   58   O OD1 . ASN A 1 8   ? 41.274 31.391 33.523 1.00 11.09 ? 2   ASN A OD1 1 
ATOM   59   N ND2 . ASN A 1 8   ? 40.841 30.763 35.641 1.00 11.07 ? 2   ASN A ND2 1 
ATOM   60   N N   . LEU A 1 9   ? 38.040 35.343 33.613 1.00 11.33 ? 3   LEU A N   1 
ATOM   61   C CA  . LEU A 1 9   ? 36.850 36.193 33.494 1.00 11.59 ? 3   LEU A CA  1 
ATOM   62   C C   . LEU A 1 9   ? 35.919 35.651 32.421 1.00 13.48 ? 3   LEU A C   1 
ATOM   63   O O   . LEU A 1 9   ? 36.326 35.041 31.428 1.00 12.65 ? 3   LEU A O   1 
ATOM   64   C CB  . LEU A 1 9   ? 37.260 37.623 33.133 1.00 12.90 ? 3   LEU A CB  1 
ATOM   65   C CG  . LEU A 1 9   ? 38.299 38.214 34.099 1.00 11.02 ? 3   LEU A CG  1 
ATOM   66   C CD1 . LEU A 1 9   ? 38.790 39.552 33.551 1.00 17.52 ? 3   LEU A CD1 1 
ATOM   67   C CD2 . LEU A 1 9   ? 37.764 38.338 35.528 1.00 13.80 ? 3   LEU A CD2 1 
ATOM   68   N N   . PRO A 1 10  ? 34.626 35.936 32.545 1.00 12.20 ? 4   PRO A N   1 
ATOM   69   C CA  . PRO A 1 10  ? 33.676 35.462 31.535 1.00 12.13 ? 4   PRO A CA  1 
ATOM   70   C C   . PRO A 1 10  ? 33.661 36.474 30.388 1.00 13.14 ? 4   PRO A C   1 
ATOM   71   O O   . PRO A 1 10  ? 34.149 37.591 30.487 1.00 13.08 ? 4   PRO A O   1 
ATOM   72   C CB  . PRO A 1 10  ? 32.332 35.380 32.308 1.00 16.16 ? 4   PRO A CB  1 
ATOM   73   C CG  . PRO A 1 10  ? 32.477 36.417 33.415 1.00 17.20 ? 4   PRO A CG  1 
ATOM   74   C CD  . PRO A 1 10  ? 33.988 36.590 33.723 1.00 13.76 ? 4   PRO A CD  1 
ATOM   75   N N   . PRO A 1 11  ? 33.137 36.067 29.228 1.00 16.60 ? 5   PRO A N   1 
ATOM   76   C CA  . PRO A 1 11  ? 33.044 36.895 28.042 1.00 27.49 ? 5   PRO A CA  1 
ATOM   77   C C   . PRO A 1 11  ? 31.775 37.733 28.264 1.00 21.59 ? 5   PRO A C   1 
ATOM   78   O O   . PRO A 1 11  ? 31.380 37.958 29.416 1.00 36.47 ? 5   PRO A O   1 
ATOM   79   C CB  . PRO A 1 11  ? 32.938 35.840 26.923 1.00 25.49 ? 5   PRO A CB  1 
ATOM   80   C CG  . PRO A 1 11  ? 32.159 34.784 27.536 1.00 24.62 ? 5   PRO A CG  1 
ATOM   81   C CD  . PRO A 1 11  ? 32.566 34.723 29.013 1.00 21.28 ? 5   PRO A CD  1 
ATOM   82   N N   . GLY A 1 12  ? 31.127 38.217 27.232 1.00 38.76 ? 6   GLY A N   1 
ATOM   83   C CA  . GLY A 1 12  ? 29.945 38.986 27.559 1.00 32.22 ? 6   GLY A CA  1 
ATOM   84   C C   . GLY A 1 12  ? 30.337 40.303 28.196 1.00 33.30 ? 6   GLY A C   1 
ATOM   85   O O   . GLY A 1 12  ? 31.450 40.494 28.710 1.00 33.20 ? 6   GLY A O   1 
ATOM   86   N N   . ASN A 1 13  ? 29.399 41.231 28.148 1.00 29.69 ? 7   ASN A N   1 
ATOM   87   C CA  . ASN A 1 13  ? 29.649 42.552 28.655 1.00 30.43 ? 7   ASN A CA  1 
ATOM   88   C C   . ASN A 1 13  ? 28.463 43.004 29.484 1.00 25.37 ? 7   ASN A C   1 
ATOM   89   O O   . ASN A 1 13  ? 27.578 42.208 29.802 1.00 24.44 ? 7   ASN A O   1 
ATOM   90   C CB  . ASN A 1 13  ? 29.915 43.522 27.489 1.00 29.56 ? 7   ASN A CB  1 
ATOM   91   C CG  . ASN A 1 13  ? 28.763 43.564 26.471 1.00 33.26 ? 7   ASN A CG  1 
ATOM   92   O OD1 . ASN A 1 13  ? 27.600 43.698 26.839 1.00 29.34 ? 7   ASN A OD1 1 
ATOM   93   N ND2 . ASN A 1 13  ? 29.100 43.472 25.178 1.00 35.28 ? 7   ASN A ND2 1 
ATOM   94   N N   . TYR A 1 14  ? 28.465 44.289 29.801 1.00 24.84 ? 8   TYR A N   1 
ATOM   95   C CA  . TYR A 1 14  ? 27.469 44.881 30.685 1.00 19.52 ? 8   TYR A CA  1 
ATOM   96   C C   . TYR A 1 14  ? 26.529 45.822 29.971 1.00 21.59 ? 8   TYR A C   1 
ATOM   97   O O   . TYR A 1 14  ? 25.801 46.598 30.626 1.00 21.20 ? 8   TYR A O   1 
ATOM   98   C CB  . TYR A 1 14  ? 28.219 45.647 31.779 1.00 16.78 ? 8   TYR A CB  1 
ATOM   99   C CG  . TYR A 1 14  ? 29.228 44.763 32.519 1.00 16.66 ? 8   TYR A CG  1 
ATOM   100  C CD1 . TYR A 1 14  ? 28.804 43.664 33.233 1.00 14.51 ? 8   TYR A CD1 1 
ATOM   101  C CD2 . TYR A 1 14  ? 30.580 45.027 32.429 1.00 20.96 ? 8   TYR A CD2 1 
ATOM   102  C CE1 . TYR A 1 14  ? 29.737 42.804 33.845 1.00 14.75 ? 8   TYR A CE1 1 
ATOM   103  C CE2 . TYR A 1 14  ? 31.531 44.194 33.032 1.00 23.29 ? 8   TYR A CE2 1 
ATOM   104  C CZ  . TYR A 1 14  ? 31.083 43.085 33.730 1.00 16.04 ? 8   TYR A CZ  1 
ATOM   105  O OH  . TYR A 1 14  ? 32.050 42.253 34.287 1.00 18.16 ? 8   TYR A OH  1 
ATOM   106  N N   . LYS A 1 15  ? 26.545 45.771 28.645 1.00 21.38 ? 9   LYS A N   1 
ATOM   107  C CA  . LYS A 1 15  ? 25.705 46.691 27.868 1.00 25.17 ? 9   LYS A CA  1 
ATOM   108  C C   . LYS A 1 15  ? 24.213 46.592 28.083 1.00 20.75 ? 9   LYS A C   1 
ATOM   109  O O   . LYS A 1 15  ? 23.512 47.608 28.057 1.00 27.33 ? 9   LYS A O   1 
ATOM   110  C CB  . LYS A 1 15  ? 25.990 46.537 26.363 1.00 27.13 ? 9   LYS A CB  1 
ATOM   111  C CG  . LYS A 1 15  ? 27.277 47.239 25.917 1.00 35.87 ? 9   LYS A CG  1 
ATOM   112  C CD  . LYS A 1 15  ? 27.364 47.329 24.392 1.00 42.10 ? 9   LYS A CD  1 
ATOM   113  C CE  . LYS A 1 15  ? 28.352 48.423 23.940 1.00 45.91 ? 9   LYS A CE  1 
ATOM   114  N NZ  . LYS A 1 15  ? 29.796 48.087 24.195 1.00 48.31 ? 9   LYS A NZ  1 
ATOM   115  N N   . LYS A 1 16  ? 23.709 45.387 28.284 1.00 19.47 ? 10  LYS A N   1 
ATOM   116  C CA  . LYS A 1 16  ? 22.301 45.152 28.458 1.00 22.78 ? 10  LYS A CA  1 
ATOM   117  C C   . LYS A 1 16  ? 22.048 44.394 29.744 1.00 20.96 ? 10  LYS A C   1 
ATOM   118  O O   . LYS A 1 16  ? 22.946 43.764 30.297 1.00 20.01 ? 10  LYS A O   1 
ATOM   119  C CB  . LYS A 1 16  ? 21.778 44.347 27.272 1.00 31.10 ? 10  LYS A CB  1 
ATOM   120  C CG  . LYS A 1 16  ? 21.821 45.110 25.927 1.00 37.46 ? 10  LYS A CG  1 
ATOM   121  C CD  . LYS A 1 16  ? 20.647 46.094 25.767 1.00 45.85 ? 10  LYS A CD  1 
ATOM   122  C CE  . LYS A 1 16  ? 20.817 47.003 24.522 1.00 49.11 ? 10  LYS A CE  1 
ATOM   123  N NZ  . LYS A 1 16  ? 21.164 46.248 23.261 1.00 52.19 ? 10  LYS A NZ  1 
ATOM   124  N N   . PRO A 1 17  ? 20.825 44.479 30.250 1.00 19.23 ? 11  PRO A N   1 
ATOM   125  C CA  . PRO A 1 17  ? 20.448 43.780 31.478 1.00 18.92 ? 11  PRO A CA  1 
ATOM   126  C C   . PRO A 1 17  ? 20.388 42.294 31.196 1.00 17.09 ? 11  PRO A C   1 
ATOM   127  O O   . PRO A 1 17  ? 20.308 41.845 30.038 1.00 18.11 ? 11  PRO A O   1 
ATOM   128  C CB  . PRO A 1 17  ? 19.087 44.365 31.814 1.00 22.85 ? 11  PRO A CB  1 
ATOM   129  C CG  . PRO A 1 17  ? 18.551 44.757 30.422 1.00 25.50 ? 11  PRO A CG  1 
ATOM   130  C CD  . PRO A 1 17  ? 19.729 45.349 29.767 1.00 26.17 ? 11  PRO A CD  1 
ATOM   131  N N   . LYS A 1 18  ? 20.415 41.515 32.269 1.00 17.23 ? 12  LYS A N   1 
ATOM   132  C CA  . LYS A 1 18  ? 20.406 40.067 32.123 1.00 16.30 ? 12  LYS A CA  1 
ATOM   133  C C   . LYS A 1 18  ? 19.529 39.385 33.146 1.00 14.30 ? 12  LYS A C   1 
ATOM   134  O O   . LYS A 1 18  ? 19.153 40.002 34.163 1.00 16.60 ? 12  LYS A O   1 
ATOM   135  C CB  . LYS A 1 18  ? 21.833 39.514 32.382 1.00 15.71 ? 12  LYS A CB  1 
ATOM   136  C CG  . LYS A 1 18  ? 22.930 40.030 31.456 1.00 19.32 ? 12  LYS A CG  1 
ATOM   137  C CD  . LYS A 1 18  ? 22.719 39.567 29.991 1.00 20.26 ? 12  LYS A CD  1 
ATOM   138  C CE  . LYS A 1 18  ? 23.526 40.392 28.976 1.00 21.19 ? 12  LYS A CE  1 
ATOM   139  N NZ  . LYS A 1 18  ? 24.948 40.733 29.360 1.00 28.52 ? 12  LYS A NZ  1 
ATOM   140  N N   . LEU A 1 19  ? 19.205 38.124 32.899 1.00 13.82 ? 13  LEU A N   1 
ATOM   141  C CA  . LEU A 1 19  ? 18.559 37.291 33.900 1.00 14.48 ? 13  LEU A CA  1 
ATOM   142  C C   . LEU A 1 19  ? 19.742 36.434 34.395 1.00 15.63 ? 13  LEU A C   1 
ATOM   143  O O   . LEU A 1 19  ? 20.561 35.963 33.574 1.00 18.03 ? 13  LEU A O   1 
ATOM   144  C CB  . LEU A 1 19  ? 17.530 36.324 33.291 1.00 14.26 ? 13  LEU A CB  1 
ATOM   145  C CG  . LEU A 1 19  ? 16.516 37.049 32.425 1.00 16.39 ? 13  LEU A CG  1 
ATOM   146  C CD1 . LEU A 1 19  ? 15.492 36.001 31.968 1.00 20.56 ? 13  LEU A CD1 1 
ATOM   147  C CD2 . LEU A 1 19  ? 15.791 38.130 33.243 1.00 17.67 ? 13  LEU A CD2 1 
ATOM   148  N N   . LEU A 1 20  ? 19.865 36.218 35.708 1.00 12.22 ? 14  LEU A N   1 
ATOM   149  C CA  . LEU A 1 20  ? 20.932 35.345 36.212 1.00 12.38 ? 14  LEU A CA  1 
ATOM   150  C C   . LEU A 1 20  ? 20.274 34.013 36.502 1.00 13.47 ? 14  LEU A C   1 
ATOM   151  O O   . LEU A 1 20  ? 19.580 33.806 37.502 1.00 14.00 ? 14  LEU A O   1 
ATOM   152  C CB  . LEU A 1 20  ? 21.594 35.977 37.461 1.00 12.23 ? 14  LEU A CB  1 
ATOM   153  C CG  . LEU A 1 20  ? 22.522 37.143 37.064 1.00 12.66 ? 14  LEU A CG  1 
ATOM   154  C CD1 . LEU A 1 20  ? 23.257 37.603 38.330 1.00 13.05 ? 14  LEU A CD1 1 
ATOM   155  C CD2 . LEU A 1 20  ? 23.592 36.726 36.032 1.00 15.94 ? 14  LEU A CD2 1 
ATOM   156  N N   . TYR A 1 21  ? 20.463 33.067 35.591 1.00 12.60 ? 15  TYR A N   1 
ATOM   157  C CA  . TYR A 1 21  ? 19.827 31.767 35.695 1.00 10.41 ? 15  TYR A CA  1 
ATOM   158  C C   . TYR A 1 21  ? 20.714 30.751 36.395 1.00 13.61 ? 15  TYR A C   1 
ATOM   159  O O   . TYR A 1 21  ? 21.867 30.528 35.970 1.00 14.88 ? 15  TYR A O   1 
ATOM   160  C CB  . TYR A 1 21  ? 19.550 31.294 34.263 1.00 15.36 ? 15  TYR A CB  1 
ATOM   161  C CG  . TYR A 1 21  ? 19.019 29.897 34.170 1.00 19.03 ? 15  TYR A CG  1 
ATOM   162  C CD1 . TYR A 1 21  ? 17.654 29.639 34.397 1.00 20.59 ? 15  TYR A CD1 1 
ATOM   163  C CD2 . TYR A 1 21  ? 19.865 28.822 33.832 1.00 21.14 ? 15  TYR A CD2 1 
ATOM   164  C CE1 . TYR A 1 21  ? 17.147 28.321 34.267 1.00 21.04 ? 15  TYR A CE1 1 
ATOM   165  C CE2 . TYR A 1 21  ? 19.347 27.516 33.715 1.00 21.66 ? 15  TYR A CE2 1 
ATOM   166  C CZ  . TYR A 1 21  ? 18.001 27.312 33.930 1.00 17.44 ? 15  TYR A CZ  1 
ATOM   167  O OH  . TYR A 1 21  ? 17.504 26.020 33.821 1.00 28.56 ? 15  TYR A OH  1 
ATOM   168  N N   . CYS A 1 22  ? 20.203 30.075 37.432 1.00 15.22 ? 16  CYS A N   1 
ATOM   169  C CA  . CYS A 1 22  ? 20.995 29.080 38.174 1.00 15.60 ? 16  CYS A CA  1 
ATOM   170  C C   . CYS A 1 22  ? 20.554 27.713 37.694 1.00 20.74 ? 16  CYS A C   1 
ATOM   171  O O   . CYS A 1 22  ? 19.397 27.343 37.882 1.00 19.51 ? 16  CYS A O   1 
ATOM   172  C CB  . CYS A 1 22  ? 20.702 29.207 39.697 1.00 14.61 ? 16  CYS A CB  1 
ATOM   173  S SG  . CYS A 1 22  ? 21.731 28.152 40.657 1.00 16.57 ? 16  CYS A SG  1 
ATOM   174  N N   . SER A 1 23  ? 21.481 26.939 37.107 1.00 26.07 ? 17  SER A N   1 
ATOM   175  C CA  . SER A 1 23  ? 21.074 25.639 36.597 1.00 29.91 ? 17  SER A CA  1 
ATOM   176  C C   . SER A 1 23  ? 20.779 24.641 37.702 1.00 29.52 ? 17  SER A C   1 
ATOM   177  O O   . SER A 1 23  ? 20.122 23.609 37.474 1.00 34.78 ? 17  SER A O   1 
ATOM   178  C CB  . SER A 1 23  ? 22.143 25.042 35.677 1.00 28.50 ? 17  SER A CB  1 
ATOM   179  O OG  . SER A 1 23  ? 22.275 25.790 34.492 1.00 36.82 ? 17  SER A OG  1 
ATOM   180  N N   . ASN A 1 24  ? 21.219 24.951 38.916 1.00 22.41 ? 18  ASN A N   1 
ATOM   181  C CA  . ASN A 1 24  ? 20.991 24.003 39.996 1.00 18.72 ? 18  ASN A CA  1 
ATOM   182  C C   . ASN A 1 24  ? 19.516 23.598 40.069 1.00 26.81 ? 18  ASN A C   1 
ATOM   183  O O   . ASN A 1 24  ? 19.197 22.394 40.001 1.00 28.96 ? 18  ASN A O   1 
ATOM   184  C CB  . ASN A 1 24  ? 21.539 24.602 41.308 1.00 15.34 ? 18  ASN A CB  1 
ATOM   185  C CG  . ASN A 1 24  ? 21.528 23.626 42.483 1.00 17.37 ? 18  ASN A CG  1 
ATOM   186  O OD1 . ASN A 1 24  ? 21.724 22.424 42.323 1.00 19.30 ? 18  ASN A OD1 1 
ATOM   187  N ND2 . ASN A 1 24  ? 21.366 24.168 43.714 1.00 16.76 ? 18  ASN A ND2 1 
ATOM   188  N N   . GLY A 1 25  ? 18.619 24.564 40.193 1.00 23.95 ? 19  GLY A N   1 
ATOM   189  C CA  . GLY A 1 25  ? 17.202 24.236 40.243 1.00 24.98 ? 19  GLY A CA  1 
ATOM   190  C C   . GLY A 1 25  ? 16.462 24.893 39.090 1.00 22.85 ? 19  GLY A C   1 
ATOM   191  O O   . GLY A 1 25  ? 15.252 24.720 38.947 1.00 29.10 ? 19  GLY A O   1 
ATOM   192  N N   . GLY A 1 26  ? 17.190 25.634 38.262 1.00 20.46 ? 20  GLY A N   1 
ATOM   193  C CA  . GLY A 1 26  ? 16.607 26.338 37.131 1.00 20.35 ? 20  GLY A CA  1 
ATOM   194  C C   . GLY A 1 26  ? 15.845 27.578 37.561 1.00 22.94 ? 20  GLY A C   1 
ATOM   195  O O   . GLY A 1 26  ? 14.765 27.833 37.061 1.00 29.92 ? 20  GLY A O   1 
ATOM   196  N N   . HIS A 1 27  ? 16.380 28.326 38.529 1.00 14.67 ? 21  HIS A N   1 
ATOM   197  C CA  . HIS A 1 27  ? 15.705 29.547 38.979 1.00 14.09 ? 21  HIS A CA  1 
ATOM   198  C C   . HIS A 1 27  ? 16.454 30.774 38.545 1.00 15.80 ? 21  HIS A C   1 
ATOM   199  O O   . HIS A 1 27  ? 17.664 30.734 38.404 1.00 16.91 ? 21  HIS A O   1 
ATOM   200  C CB  . HIS A 1 27  ? 15.701 29.608 40.512 1.00 17.91 ? 21  HIS A CB  1 
ATOM   201  C CG  . HIS A 1 27  ? 14.908 28.517 41.160 1.00 15.67 ? 21  HIS A CG  1 
ATOM   202  N ND1 . HIS A 1 27  ? 15.451 27.292 41.485 1.00 18.69 ? 21  HIS A ND1 1 
ATOM   203  C CD2 . HIS A 1 27  ? 13.613 28.477 41.551 1.00 18.74 ? 21  HIS A CD2 1 
ATOM   204  C CE1 . HIS A 1 27  ? 14.521 26.544 42.045 1.00 17.84 ? 21  HIS A CE1 1 
ATOM   205  N NE2 . HIS A 1 27  ? 13.396 27.240 42.096 1.00 18.51 ? 21  HIS A NE2 1 
ATOM   206  N N   . PHE A 1 28  ? 15.730 31.874 38.354 1.00 13.88 ? 22  PHE A N   1 
ATOM   207  C CA  . PHE A 1 28  ? 16.328 33.163 38.054 1.00 13.33 ? 22  PHE A CA  1 
ATOM   208  C C   . PHE A 1 28  ? 16.443 33.884 39.390 1.00 14.58 ? 22  PHE A C   1 
ATOM   209  O O   . PHE A 1 28  ? 15.506 33.815 40.222 1.00 15.60 ? 22  PHE A O   1 
ATOM   210  C CB  . PHE A 1 28  ? 15.418 33.991 37.139 1.00 15.73 ? 22  PHE A CB  1 
ATOM   211  C CG  . PHE A 1 28  ? 15.068 33.299 35.861 1.00 16.88 ? 22  PHE A CG  1 
ATOM   212  C CD1 . PHE A 1 28  ? 16.014 33.219 34.844 1.00 19.73 ? 22  PHE A CD1 1 
ATOM   213  C CD2 . PHE A 1 28  ? 13.814 32.710 35.702 1.00 20.72 ? 22  PHE A CD2 1 
ATOM   214  C CE1 . PHE A 1 28  ? 15.725 32.550 33.661 1.00 20.60 ? 22  PHE A CE1 1 
ATOM   215  C CE2 . PHE A 1 28  ? 13.499 32.032 34.515 1.00 28.99 ? 22  PHE A CE2 1 
ATOM   216  C CZ  . PHE A 1 28  ? 14.469 31.958 33.496 1.00 21.00 ? 22  PHE A CZ  1 
ATOM   217  N N   . LEU A 1 29  ? 17.576 34.573 39.596 1.00 12.02 ? 23  LEU A N   1 
ATOM   218  C CA  . LEU A 1 29  ? 17.803 35.327 40.837 1.00 12.87 ? 23  LEU A CA  1 
ATOM   219  C C   . LEU A 1 29  ? 16.787 36.485 40.865 1.00 13.67 ? 23  LEU A C   1 
ATOM   220  O O   . LEU A 1 29  ? 16.659 37.232 39.913 1.00 13.69 ? 23  LEU A O   1 
ATOM   221  C CB  . LEU A 1 29  ? 19.218 35.912 40.849 1.00 11.85 ? 23  LEU A CB  1 
ATOM   222  C CG  . LEU A 1 29  ? 19.680 36.518 42.176 1.00 13.80 ? 23  LEU A CG  1 
ATOM   223  C CD1 . LEU A 1 29  ? 19.671 35.524 43.271 1.00 15.47 ? 23  LEU A CD1 1 
ATOM   224  C CD2 . LEU A 1 29  ? 21.067 37.073 41.983 1.00 15.62 ? 23  LEU A CD2 1 
ATOM   225  N N   . ARG A 1 30  ? 16.122 36.658 42.015 1.00 11.71 ? 24  ARG A N   1 
ATOM   226  C CA  . ARG A 1 30  ? 15.079 37.667 42.136 1.00 10.60 ? 24  ARG A CA  1 
ATOM   227  C C   . ARG A 1 30  ? 15.288 38.543 43.383 1.00 12.49 ? 24  ARG A C   1 
ATOM   228  O O   . ARG A 1 30  ? 15.543 38.019 44.479 1.00 14.27 ? 24  ARG A O   1 
ATOM   229  C CB  . ARG A 1 30  ? 13.705 36.945 42.277 1.00 13.85 ? 24  ARG A CB  1 
ATOM   230  C CG  . ARG A 1 30  ? 12.538 37.902 42.372 1.00 15.69 ? 24  ARG A CG  1 
ATOM   231  C CD  . ARG A 1 30  ? 11.172 37.206 42.339 1.00 17.19 ? 24  ARG A CD  1 
ATOM   232  N NE  . ARG A 1 30  ? 11.036 36.144 43.292 1.00 24.27 ? 24  ARG A NE  1 
ATOM   233  C CZ  . ARG A 1 30  ? 9.919  35.420 43.449 1.00 27.98 ? 24  ARG A CZ  1 
ATOM   234  N NH1 . ARG A 1 30  ? 8.854  35.663 42.690 1.00 29.76 ? 24  ARG A NH1 1 
ATOM   235  N NH2 . ARG A 1 30  ? 9.865  34.467 44.375 1.00 28.20 ? 24  ARG A NH2 1 
ATOM   236  N N   . ILE A 1 31  ? 15.182 39.849 43.184 1.00 13.73 ? 25  ILE A N   1 
ATOM   237  C CA  . ILE A 1 31  ? 15.278 40.786 44.321 1.00 13.13 ? 25  ILE A CA  1 
ATOM   238  C C   . ILE A 1 31  ? 13.878 41.441 44.472 1.00 13.74 ? 25  ILE A C   1 
ATOM   239  O O   . ILE A 1 31  ? 13.453 42.254 43.646 1.00 15.52 ? 25  ILE A O   1 
ATOM   240  C CB  . ILE A 1 31  ? 16.361 41.887 44.117 1.00 12.33 ? 25  ILE A CB  1 
ATOM   241  C CG1 . ILE A 1 31  ? 17.715 41.246 43.790 1.00 13.50 ? 25  ILE A CG1 1 
ATOM   242  C CG2 . ILE A 1 31  ? 16.416 42.777 45.419 1.00 12.93 ? 25  ILE A CG2 1 
ATOM   243  C CD1 . ILE A 1 31  ? 18.808 42.328 43.443 1.00 16.05 ? 25  ILE A CD1 1 
ATOM   244  N N   . ASP A 1 32  ? 13.205 41.050 45.551 1.00 17.03 ? 26  ASP A N   1 
ATOM   245  C CA  . ASP A 1 32  ? 11.854 41.573 45.843 1.00 20.32 ? 26  ASP A CA  1 
ATOM   246  C C   . ASP A 1 32  ? 11.923 43.044 46.264 1.00 25.02 ? 26  ASP A C   1 
ATOM   247  O O   . ASP A 1 32  ? 12.939 43.499 46.845 1.00 21.08 ? 26  ASP A O   1 
ATOM   248  C CB  . ASP A 1 32  ? 11.249 40.755 46.990 1.00 19.62 ? 26  ASP A CB  1 
ATOM   249  C CG  . ASP A 1 32  ? 9.748  41.031 47.200 1.00 28.80 ? 26  ASP A CG  1 
ATOM   250  O OD1 . ASP A 1 32  ? 8.902  40.347 46.553 1.00 29.26 ? 26  ASP A OD1 1 
ATOM   251  O OD2 . ASP A 1 32  ? 9.415  41.949 48.001 1.00 28.97 ? 26  ASP A OD2 1 
ATOM   252  N N   . PRO A 1 33  ? 10.847 43.819 45.985 1.00 23.64 ? 27  PRO A N   1 
ATOM   253  C CA  . PRO A 1 33  ? 10.895 45.223 46.392 1.00 25.68 ? 27  PRO A CA  1 
ATOM   254  C C   . PRO A 1 33  ? 11.155 45.385 47.911 1.00 21.66 ? 27  PRO A C   1 
ATOM   255  O O   . PRO A 1 33  ? 11.695 46.414 48.326 1.00 24.01 ? 27  PRO A O   1 
ATOM   256  C CB  . PRO A 1 33  ? 9.523  45.769 45.992 1.00 26.25 ? 27  PRO A CB  1 
ATOM   257  C CG  . PRO A 1 33  ? 9.098  44.906 44.841 1.00 30.41 ? 27  PRO A CG  1 
ATOM   258  C CD  . PRO A 1 33  ? 9.679  43.524 45.131 1.00 22.35 ? 27  PRO A CD  1 
ATOM   259  N N   . ASN A 1 34  ? 10.816 44.384 48.727 1.00 20.70 ? 28  ASN A N   1 
ATOM   260  C CA  . ASN A 1 34  ? 11.018 44.506 50.167 1.00 21.15 ? 28  ASN A CA  1 
ATOM   261  C C   . ASN A 1 34  ? 12.420 44.152 50.639 1.00 23.43 ? 28  ASN A C   1 
ATOM   262  O O   . ASN A 1 34  ? 12.688 44.097 51.848 1.00 22.37 ? 28  ASN A O   1 
ATOM   263  C CB  . ASN A 1 34  ? 9.958  43.704 50.960 1.00 24.29 ? 28  ASN A CB  1 
ATOM   264  C CG  . ASN A 1 34  ? 10.058 42.211 50.772 1.00 26.99 ? 28  ASN A CG  1 
ATOM   265  O OD1 . ASN A 1 34  ? 11.132 41.665 50.501 1.00 26.18 ? 28  ASN A OD1 1 
ATOM   266  N ND2 . ASN A 1 34  ? 8.929  41.520 50.940 1.00 28.87 ? 28  ASN A ND2 1 
ATOM   267  N N   . GLY A 1 35  ? 13.313 43.878 49.670 1.00 17.49 ? 29  GLY A N   1 
ATOM   268  C CA  . GLY A 1 35  ? 14.679 43.560 50.031 1.00 18.28 ? 29  GLY A CA  1 
ATOM   269  C C   . GLY A 1 35  ? 15.054 42.081 50.172 1.00 20.28 ? 29  GLY A C   1 
ATOM   270  O O   . GLY A 1 35  ? 16.229 41.752 50.330 1.00 21.54 ? 29  GLY A O   1 
ATOM   271  N N   . THR A 1 36  ? 14.068 41.183 50.136 1.00 19.34 ? 30  THR A N   1 
ATOM   272  C CA  . THR A 1 36  ? 14.341 39.755 50.238 1.00 19.54 ? 30  THR A CA  1 
ATOM   273  C C   . THR A 1 36  ? 14.831 39.247 48.887 1.00 16.50 ? 30  THR A C   1 
ATOM   274  O O   . THR A 1 36  ? 14.454 39.759 47.854 1.00 19.35 ? 30  THR A O   1 
ATOM   275  C CB  . THR A 1 36  ? 13.071 38.952 50.672 1.00 26.72 ? 30  THR A CB  1 
ATOM   276  O OG1 . THR A 1 36  ? 12.001 39.200 49.769 1.00 29.48 ? 30  THR A OG1 1 
ATOM   277  C CG2 . THR A 1 36  ? 12.657 39.381 52.056 1.00 28.76 ? 30  THR A CG2 1 
ATOM   278  N N   . VAL A 1 37  ? 15.692 38.236 48.944 1.00 15.35 ? 31  VAL A N   1 
ATOM   279  C CA  . VAL A 1 37  ? 16.239 37.671 47.716 1.00 13.58 ? 31  VAL A CA  1 
ATOM   280  C C   . VAL A 1 37  ? 15.955 36.173 47.701 1.00 13.09 ? 31  VAL A C   1 
ATOM   281  O O   . VAL A 1 37  ? 16.062 35.484 48.718 1.00 17.19 ? 31  VAL A O   1 
ATOM   282  C CB  . VAL A 1 37  ? 17.802 37.906 47.679 1.00 14.03 ? 31  VAL A CB  1 
ATOM   283  C CG1 . VAL A 1 37  ? 18.447 37.324 46.357 1.00 14.31 ? 31  VAL A CG1 1 
ATOM   284  C CG2 . VAL A 1 37  ? 18.122 39.394 47.744 1.00 14.04 ? 31  VAL A CG2 1 
ATOM   285  N N   . ASP A 1 38  ? 15.608 35.653 46.513 1.00 13.54 ? 32  ASP A N   1 
ATOM   286  C CA  . ASP A 1 38  ? 15.384 34.239 46.308 1.00 13.72 ? 32  ASP A CA  1 
ATOM   287  C C   . ASP A 1 38  ? 15.415 33.971 44.821 1.00 14.08 ? 32  ASP A C   1 
ATOM   288  O O   . ASP A 1 38  ? 15.874 34.814 44.052 1.00 15.34 ? 32  ASP A O   1 
ATOM   289  C CB  . ASP A 1 38  ? 14.034 33.762 46.907 1.00 16.68 ? 32  ASP A CB  1 
ATOM   290  C CG  . ASP A 1 38  ? 12.829 34.270 46.166 1.00 15.83 ? 32  ASP A CG  1 
ATOM   291  O OD1 . ASP A 1 38  ? 12.878 35.145 45.286 1.00 17.57 ? 32  ASP A OD1 1 
ATOM   292  O OD2 . ASP A 1 38  ? 11.751 33.715 46.494 1.00 27.77 ? 32  ASP A OD2 1 
ATOM   293  N N   . GLY A 1 39  ? 14.955 32.778 44.435 1.00 14.76 ? 33  GLY A N   1 
ATOM   294  C CA  . GLY A 1 39  ? 14.911 32.466 43.025 1.00 14.19 ? 33  GLY A CA  1 
ATOM   295  C C   . GLY A 1 39  ? 13.480 32.126 42.615 1.00 16.41 ? 33  GLY A C   1 
ATOM   296  O O   . GLY A 1 39  ? 12.672 31.665 43.454 1.00 17.07 ? 33  GLY A O   1 
ATOM   297  N N   . THR A 1 40  ? 13.190 32.329 41.333 1.00 14.68 ? 34  THR A N   1 
ATOM   298  C CA  . THR A 1 40  ? 11.872 31.983 40.798 1.00 13.46 ? 34  THR A CA  1 
ATOM   299  C C   . THR A 1 40  ? 12.038 31.370 39.424 1.00 17.65 ? 34  THR A C   1 
ATOM   300  O O   . THR A 1 40  ? 12.953 31.701 38.695 1.00 16.98 ? 34  THR A O   1 
ATOM   301  C CB  . THR A 1 40  ? 10.933 33.231 40.682 1.00 16.34 ? 34  THR A CB  1 
ATOM   302  O OG1 . THR A 1 40  ? 9.680  32.790 40.114 1.00 19.30 ? 34  THR A OG1 1 
ATOM   303  C CG2 . THR A 1 40  ? 11.523 34.371 39.832 1.00 16.34 ? 34  THR A CG2 1 
ATOM   304  N N   . ARG A 1 41  ? 11.126 30.479 39.060 1.00 17.51 ? 35  ARG A N   1 
ATOM   305  C CA  . ARG A 1 41  ? 11.183 29.914 37.711 1.00 18.97 ? 35  ARG A CA  1 
ATOM   306  C C   . ARG A 1 41  ? 10.289 30.690 36.747 1.00 21.01 ? 35  ARG A C   1 
ATOM   307  O O   . ARG A 1 41  ? 10.261 30.421 35.540 1.00 21.94 ? 35  ARG A O   1 
ATOM   308  C CB  . ARG A 1 41  ? 10.768 28.444 37.722 1.00 23.96 ? 35  ARG A CB  1 
ATOM   309  C CG  . ARG A 1 41  ? 11.621 27.562 38.608 1.00 27.73 ? 35  ARG A CG  1 
ATOM   310  C CD  . ARG A 1 41  ? 11.557 26.099 38.149 1.00 30.88 ? 35  ARG A CD  1 
ATOM   311  N NE  . ARG A 1 41  ? 12.448 25.215 38.891 1.00 28.75 ? 35  ARG A NE  1 
ATOM   312  C CZ  . ARG A 1 41  ? 12.075 24.531 39.969 1.00 36.54 ? 35  ARG A CZ  1 
ATOM   313  N NH1 . ARG A 1 41  ? 10.828 24.638 40.427 1.00 38.37 ? 35  ARG A NH1 1 
ATOM   314  N NH2 . ARG A 1 41  ? 12.937 23.721 40.583 1.00 38.71 ? 35  ARG A NH2 1 
ATOM   315  N N   . ASP A 1 42  ? 9.584  31.690 37.252 1.00 19.03 ? 36  ASP A N   1 
ATOM   316  C CA  . ASP A 1 42  ? 8.659  32.454 36.421 1.00 18.85 ? 36  ASP A CA  1 
ATOM   317  C C   . ASP A 1 42  ? 9.398  33.529 35.631 1.00 22.73 ? 36  ASP A C   1 
ATOM   318  O O   . ASP A 1 42  ? 9.800  34.567 36.164 1.00 20.87 ? 36  ASP A O   1 
ATOM   319  C CB  . ASP A 1 42  ? 7.590  33.057 37.325 1.00 21.82 ? 36  ASP A CB  1 
ATOM   320  C CG  . ASP A 1 42  ? 6.625  33.936 36.575 1.00 29.21 ? 36  ASP A CG  1 
ATOM   321  O OD1 . ASP A 1 42  ? 6.648  33.914 35.330 1.00 30.11 ? 36  ASP A OD1 1 
ATOM   322  O OD2 . ASP A 1 42  ? 5.854  34.668 37.247 1.00 32.32 ? 36  ASP A OD2 1 
ATOM   323  N N   . ARG A 1 43  ? 9.598  33.270 34.344 1.00 22.38 ? 37  ARG A N   1 
ATOM   324  C CA  . ARG A 1 43  ? 10.327 34.193 33.502 1.00 26.94 ? 37  ARG A CA  1 
ATOM   325  C C   . ARG A 1 43  ? 9.570  35.502 33.316 1.00 25.75 ? 37  ARG A C   1 
ATOM   326  O O   . ARG A 1 43  ? 10.145 36.503 32.890 1.00 29.31 ? 37  ARG A O   1 
ATOM   327  C CB  . ARG A 1 43  ? 10.624 33.522 32.149 1.00 27.53 ? 37  ARG A CB  1 
ATOM   328  C CG  . ARG A 1 43  ? 11.827 34.125 31.413 1.00 36.92 ? 37  ARG A CG  1 
ATOM   329  C CD  . ARG A 1 43  ? 11.401 35.334 30.574 1.00 44.55 ? 37  ARG A CD  1 
ATOM   330  N NE  . ARG A 1 43  ? 12.497 35.986 29.841 1.00 47.65 ? 37  ARG A NE  1 
ATOM   331  C CZ  . ARG A 1 43  ? 13.429 35.349 29.129 1.00 48.57 ? 37  ARG A CZ  1 
ATOM   332  N NH1 . ARG A 1 43  ? 13.431 34.017 29.045 1.00 50.44 ? 37  ARG A NH1 1 
ATOM   333  N NH2 . ARG A 1 43  ? 14.343 36.055 28.467 1.00 48.64 ? 37  ARG A NH2 1 
ATOM   334  N N   . SER A 1 44  ? 8.292  35.505 33.659 1.00 26.77 ? 38  SER A N   1 
ATOM   335  C CA  . SER A 1 44  ? 7.506  36.726 33.510 1.00 29.61 ? 38  SER A CA  1 
ATOM   336  C C   . SER A 1 44  ? 7.638  37.669 34.723 1.00 27.31 ? 38  SER A C   1 
ATOM   337  O O   . SER A 1 44  ? 7.147  38.791 34.713 1.00 28.88 ? 38  SER A O   1 
ATOM   338  C CB  . SER A 1 44  ? 6.014  36.385 33.274 1.00 31.11 ? 38  SER A CB  1 
ATOM   339  O OG  . SER A 1 44  ? 5.320  36.133 34.488 1.00 35.17 ? 38  SER A OG  1 
ATOM   340  N N   . ASP A 1 45  ? 8.330  37.210 35.756 1.00 26.91 ? 39  ASP A N   1 
ATOM   341  C CA  . ASP A 1 45  ? 8.482  38.020 36.969 1.00 21.17 ? 39  ASP A CA  1 
ATOM   342  C C   . ASP A 1 45  ? 9.207  39.329 36.636 1.00 23.03 ? 39  ASP A C   1 
ATOM   343  O O   . ASP A 1 45  ? 10.106 39.366 35.800 1.00 25.22 ? 39  ASP A O   1 
ATOM   344  C CB  . ASP A 1 45  ? 9.235  37.188 38.020 1.00 20.69 ? 39  ASP A CB  1 
ATOM   345  C CG  . ASP A 1 45  ? 9.181  37.820 39.419 1.00 21.25 ? 39  ASP A CG  1 
ATOM   346  O OD1 . ASP A 1 45  ? 9.897  38.789 39.633 1.00 23.50 ? 39  ASP A OD1 1 
ATOM   347  O OD2 . ASP A 1 45  ? 8.424  37.339 40.276 1.00 21.70 ? 39  ASP A OD2 1 
ATOM   348  N N   . GLN A 1 46  ? 8.808  40.422 37.278 1.00 21.83 ? 40  GLN A N   1 
ATOM   349  C CA  . GLN A 1 46  ? 9.420  41.699 36.965 1.00 20.50 ? 40  GLN A CA  1 
ATOM   350  C C   . GLN A 1 46  ? 10.572 42.062 37.872 1.00 18.97 ? 40  GLN A C   1 
ATOM   351  O O   . GLN A 1 46  ? 11.066 43.172 37.776 1.00 23.06 ? 40  GLN A O   1 
ATOM   352  C CB  . GLN A 1 46  ? 8.359  42.818 37.045 1.00 26.33 ? 40  GLN A CB  1 
ATOM   353  C CG  . GLN A 1 46  ? 7.237  42.620 36.021 1.00 33.45 ? 40  GLN A CG  1 
ATOM   354  C CD  . GLN A 1 46  ? 7.715  42.778 34.587 1.00 35.95 ? 40  GLN A CD  1 
ATOM   355  O OE1 . GLN A 1 46  ? 7.998  43.894 34.132 1.00 41.13 ? 40  GLN A OE1 1 
ATOM   356  N NE2 . GLN A 1 46  ? 7.836  41.648 33.863 1.00 37.18 ? 40  GLN A NE2 1 
ATOM   357  N N   . HIS A 1 47  ? 10.978 41.137 38.732 1.00 19.36 ? 41  HIS A N   1 
ATOM   358  C CA  . HIS A 1 47  ? 12.069 41.450 39.648 1.00 17.49 ? 41  HIS A CA  1 
ATOM   359  C C   . HIS A 1 47  ? 13.296 40.582 39.427 1.00 15.97 ? 41  HIS A C   1 
ATOM   360  O O   . HIS A 1 47  ? 14.170 40.481 40.313 1.00 18.64 ? 41  HIS A O   1 
ATOM   361  C CB  . HIS A 1 47  ? 11.553 41.359 41.072 1.00 17.39 ? 41  HIS A CB  1 
ATOM   362  C CG  . HIS A 1 47  ? 10.493 42.382 41.347 1.00 22.23 ? 41  HIS A CG  1 
ATOM   363  N ND1 . HIS A 1 47  ? 9.165  42.062 41.573 1.00 25.09 ? 41  HIS A ND1 1 
ATOM   364  C CD2 . HIS A 1 47  ? 10.558 43.732 41.337 1.00 17.86 ? 41  HIS A CD2 1 
ATOM   365  C CE1 . HIS A 1 47  ? 8.464  43.178 41.696 1.00 20.98 ? 41  HIS A CE1 1 
ATOM   366  N NE2 . HIS A 1 47  ? 9.284  44.207 41.557 1.00 24.42 ? 41  HIS A NE2 1 
ATOM   367  N N   . ILE A 1 48  ? 13.362 39.979 38.240 1.00 15.83 ? 42  ILE A N   1 
ATOM   368  C CA  . ILE A 1 48  ? 14.525 39.138 37.906 1.00 15.02 ? 42  ILE A CA  1 
ATOM   369  C C   . ILE A 1 48  ? 15.455 39.812 36.866 1.00 15.87 ? 42  ILE A C   1 
ATOM   370  O O   . ILE A 1 48  ? 16.512 39.261 36.506 1.00 16.43 ? 42  ILE A O   1 
ATOM   371  C CB  . ILE A 1 48  ? 14.085 37.761 37.372 1.00 13.13 ? 42  ILE A CB  1 
ATOM   372  C CG1 . ILE A 1 48  ? 13.182 37.928 36.150 1.00 18.45 ? 42  ILE A CG1 1 
ATOM   373  C CG2 . ILE A 1 48  ? 13.440 36.983 38.517 1.00 16.40 ? 42  ILE A CG2 1 
ATOM   374  C CD1 . ILE A 1 48  ? 12.885 36.594 35.487 1.00 20.08 ? 42  ILE A CD1 1 
ATOM   375  N N   . GLN A 1 49  ? 15.049 40.968 36.324 1.00 16.52 ? 43  GLN A N   1 
ATOM   376  C CA  . GLN A 1 49  ? 15.866 41.691 35.365 1.00 14.59 ? 43  GLN A CA  1 
ATOM   377  C C   . GLN A 1 49  ? 16.935 42.445 36.114 1.00 14.78 ? 43  GLN A C   1 
ATOM   378  O O   . GLN A 1 49  ? 16.611 43.305 36.948 1.00 17.53 ? 43  GLN A O   1 
ATOM   379  C CB  . GLN A 1 49  ? 15.023 42.668 34.552 1.00 13.89 ? 43  GLN A CB  1 
ATOM   380  C CG  . GLN A 1 49  ? 13.986 41.948 33.668 1.00 22.67 ? 43  GLN A CG  1 
ATOM   381  C CD  . GLN A 1 49  ? 12.769 41.511 34.481 1.00 25.38 ? 43  GLN A CD  1 
ATOM   382  O OE1 . GLN A 1 49  ? 12.511 42.023 35.575 1.00 24.37 ? 43  GLN A OE1 1 
ATOM   383  N NE2 . GLN A 1 49  ? 11.996 40.573 33.935 1.00 32.41 ? 43  GLN A NE2 1 
ATOM   384  N N   . LEU A 1 50  ? 18.199 42.135 35.823 1.00 13.64 ? 44  LEU A N   1 
ATOM   385  C CA  . LEU A 1 50  ? 19.313 42.759 36.570 1.00 14.40 ? 44  LEU A CA  1 
ATOM   386  C C   . LEU A 1 50  ? 20.270 43.461 35.632 1.00 17.63 ? 44  LEU A C   1 
ATOM   387  O O   . LEU A 1 50  ? 20.541 42.990 34.526 1.00 22.88 ? 44  LEU A O   1 
ATOM   388  C CB  . LEU A 1 50  ? 20.090 41.623 37.314 1.00 11.65 ? 44  LEU A CB  1 
ATOM   389  C CG  . LEU A 1 50  ? 19.172 40.742 38.149 1.00 12.67 ? 44  LEU A CG  1 
ATOM   390  C CD1 . LEU A 1 50  ? 19.919 39.529 38.740 1.00 14.30 ? 44  LEU A CD1 1 
ATOM   391  C CD2 . LEU A 1 50  ? 18.645 41.567 39.299 1.00 16.60 ? 44  LEU A CD2 1 
ATOM   392  N N   . GLN A 1 51  ? 20.853 44.546 36.096 1.00 12.39 ? 45  GLN A N   1 
ATOM   393  C CA  . GLN A 1 51  ? 21.832 45.271 35.344 1.00 12.34 ? 45  GLN A CA  1 
ATOM   394  C C   . GLN A 1 51  ? 23.136 45.115 36.082 1.00 14.96 ? 45  GLN A C   1 
ATOM   395  O O   . GLN A 1 51  ? 23.225 45.504 37.268 1.00 14.76 ? 45  GLN A O   1 
ATOM   396  C CB  . GLN A 1 51  ? 21.517 46.772 35.268 1.00 14.66 ? 45  GLN A CB  1 
ATOM   397  C CG  . GLN A 1 51  ? 22.557 47.572 34.515 1.00 15.23 ? 45  GLN A CG  1 
ATOM   398  C CD  . GLN A 1 51  ? 22.653 47.135 33.064 1.00 20.22 ? 45  GLN A CD  1 
ATOM   399  O OE1 . GLN A 1 51  ? 21.665 47.201 32.320 1.00 24.32 ? 45  GLN A OE1 1 
ATOM   400  N NE2 . GLN A 1 51  ? 23.828 46.621 32.668 1.00 16.76 ? 45  GLN A NE2 1 
ATOM   401  N N   . LEU A 1 52  ? 24.137 44.540 35.420 1.00 12.98 ? 46  LEU A N   1 
ATOM   402  C CA  . LEU A 1 52  ? 25.456 44.449 36.050 1.00 11.64 ? 46  LEU A CA  1 
ATOM   403  C C   . LEU A 1 52  ? 26.320 45.548 35.520 1.00 14.57 ? 46  LEU A C   1 
ATOM   404  O O   . LEU A 1 52  ? 26.117 46.040 34.409 1.00 17.65 ? 46  LEU A O   1 
ATOM   405  C CB  . LEU A 1 52  ? 26.131 43.078 35.782 1.00 12.20 ? 46  LEU A CB  1 
ATOM   406  C CG  . LEU A 1 52  ? 25.480 41.917 36.566 1.00 14.17 ? 46  LEU A CG  1 
ATOM   407  C CD1 . LEU A 1 52  ? 24.145 41.513 35.958 1.00 19.19 ? 46  LEU A CD1 1 
ATOM   408  C CD2 . LEU A 1 52  ? 26.443 40.703 36.546 1.00 17.10 ? 46  LEU A CD2 1 
ATOM   409  N N   . SER A 1 53  ? 27.250 46.000 36.340 1.00 12.53 ? 47  SER A N   1 
ATOM   410  C CA  . SER A 1 53  ? 28.181 47.044 35.950 1.00 14.64 ? 47  SER A CA  1 
ATOM   411  C C   . SER A 1 53  ? 29.527 46.762 36.587 1.00 17.49 ? 47  SER A C   1 
ATOM   412  O O   . SER A 1 53  ? 29.630 46.222 37.695 1.00 15.28 ? 47  SER A O   1 
ATOM   413  C CB  . SER A 1 53  ? 27.648 48.415 36.383 1.00 17.24 ? 47  SER A CB  1 
ATOM   414  O OG  . SER A 1 53  ? 27.440 48.438 37.786 1.00 18.25 ? 47  SER A OG  1 
ATOM   415  N N   . ALA A 1 54  ? 30.589 47.149 35.910 1.00 18.05 ? 48  ALA A N   1 
ATOM   416  C CA  . ALA A 1 54  ? 31.908 46.912 36.440 1.00 20.32 ? 48  ALA A CA  1 
ATOM   417  C C   . ALA A 1 54  ? 32.437 48.097 37.186 1.00 20.84 ? 48  ALA A C   1 
ATOM   418  O O   . ALA A 1 54  ? 32.428 49.219 36.660 1.00 27.71 ? 48  ALA A O   1 
ATOM   419  C CB  . ALA A 1 54  ? 32.865 46.529 35.297 1.00 23.08 ? 48  ALA A CB  1 
ATOM   420  N N   . GLU A 1 55  ? 32.889 47.872 38.414 1.00 16.96 ? 49  GLU A N   1 
ATOM   421  C CA  . GLU A 1 55  ? 33.494 48.901 39.242 1.00 19.16 ? 49  GLU A CA  1 
ATOM   422  C C   . GLU A 1 55  ? 34.986 48.904 38.975 1.00 23.54 ? 49  GLU A C   1 
ATOM   423  O O   . GLU A 1 55  ? 35.601 49.962 38.921 1.00 31.42 ? 49  GLU A O   1 
ATOM   424  C CB  . GLU A 1 55  ? 33.242 48.650 40.747 1.00 26.00 ? 49  GLU A CB  1 
ATOM   425  C CG  . GLU A 1 55  ? 33.894 49.697 41.670 1.00 34.15 ? 49  GLU A CG  1 
ATOM   426  C CD  . GLU A 1 55  ? 33.340 51.115 41.433 1.00 38.65 ? 49  GLU A CD  1 
ATOM   427  O OE1 . GLU A 1 55  ? 32.127 51.310 41.675 1.00 33.89 ? 49  GLU A OE1 1 
ATOM   428  O OE2 . GLU A 1 55  ? 34.119 52.013 41.001 1.00 43.38 ? 49  GLU A OE2 1 
ATOM   429  N N   . SER A 1 56  ? 35.568 47.711 38.893 1.00 22.30 ? 50  SER A N   1 
ATOM   430  C CA  . SER A 1 56  ? 36.976 47.489 38.579 1.00 23.69 ? 50  SER A CA  1 
ATOM   431  C C   . SER A 1 56  ? 36.920 46.265 37.690 1.00 21.25 ? 50  SER A C   1 
ATOM   432  O O   . SER A 1 56  ? 35.884 45.595 37.626 1.00 20.30 ? 50  SER A O   1 
ATOM   433  C CB  . SER A 1 56  ? 37.809 47.155 39.811 1.00 22.81 ? 50  SER A CB  1 
ATOM   434  O OG  . SER A 1 56  ? 38.002 48.304 40.618 1.00 30.53 ? 50  SER A OG  1 
ATOM   435  N N   . VAL A 1 57  ? 38.010 45.921 37.000 1.00 17.00 ? 51  VAL A N   1 
ATOM   436  C CA  . VAL A 1 57  ? 37.904 44.751 36.154 1.00 16.64 ? 51  VAL A CA  1 
ATOM   437  C C   . VAL A 1 57  ? 37.594 43.514 37.007 1.00 15.15 ? 51  VAL A C   1 
ATOM   438  O O   . VAL A 1 57  ? 38.270 43.263 38.006 1.00 16.66 ? 51  VAL A O   1 
ATOM   439  C CB  . VAL A 1 57  ? 39.190 44.511 35.376 1.00 21.32 ? 51  VAL A CB  1 
ATOM   440  C CG1 . VAL A 1 57  ? 39.053 43.266 34.560 1.00 19.84 ? 51  VAL A CG1 1 
ATOM   441  C CG2 . VAL A 1 57  ? 39.463 45.736 34.469 1.00 24.28 ? 51  VAL A CG2 1 
ATOM   442  N N   . GLY A 1 58  ? 36.543 42.784 36.628 1.00 15.74 ? 52  GLY A N   1 
ATOM   443  C CA  . GLY A 1 58  ? 36.170 41.596 37.384 1.00 13.16 ? 52  GLY A CA  1 
ATOM   444  C C   . GLY A 1 58  ? 35.383 41.863 38.669 1.00 13.09 ? 52  GLY A C   1 
ATOM   445  O O   . GLY A 1 58  ? 35.090 40.901 39.365 1.00 10.85 ? 52  GLY A O   1 
ATOM   446  N N   . GLU A 1 59  ? 35.053 43.121 38.980 1.00 13.52 ? 53  GLU A N   1 
ATOM   447  C CA  . GLU A 1 59  ? 34.315 43.442 40.205 1.00 11.42 ? 53  GLU A CA  1 
ATOM   448  C C   . GLU A 1 59  ? 33.013 44.096 39.774 1.00 14.65 ? 53  GLU A C   1 
ATOM   449  O O   . GLU A 1 59  ? 33.048 45.108 39.068 1.00 19.83 ? 53  GLU A O   1 
ATOM   450  C CB  . GLU A 1 59  ? 35.021 44.506 41.070 1.00 18.68 ? 53  GLU A CB  1 
ATOM   451  C CG  . GLU A 1 59  ? 36.344 44.172 41.693 1.00 23.29 ? 53  GLU A CG  1 
ATOM   452  C CD  . GLU A 1 59  ? 36.670 45.164 42.846 1.00 19.37 ? 53  GLU A CD  1 
ATOM   453  O OE1 . GLU A 1 59  ? 35.885 46.121 43.057 1.00 36.00 ? 53  GLU A OE1 1 
ATOM   454  O OE2 . GLU A 1 59  ? 37.651 44.988 43.510 1.00 28.60 ? 53  GLU A OE2 1 
ATOM   455  N N   . VAL A 1 60  ? 31.883 43.554 40.214 1.00 11.62 ? 54  VAL A N   1 
ATOM   456  C CA  . VAL A 1 60  ? 30.608 44.098 39.766 1.00 12.43 ? 54  VAL A CA  1 
ATOM   457  C C   . VAL A 1 60  ? 29.595 44.436 40.798 1.00 10.46 ? 54  VAL A C   1 
ATOM   458  O O   . VAL A 1 60  ? 29.653 43.966 41.924 1.00 11.33 ? 54  VAL A O   1 
ATOM   459  C CB  . VAL A 1 60  ? 29.850 43.093 38.822 1.00 11.65 ? 54  VAL A CB  1 
ATOM   460  C CG1 . VAL A 1 60  ? 30.768 42.748 37.591 1.00 13.54 ? 54  VAL A CG1 1 
ATOM   461  C CG2 . VAL A 1 60  ? 29.409 41.801 39.563 1.00 12.49 ? 54  VAL A CG2 1 
ATOM   462  N N   . TYR A 1 61  ? 28.687 45.333 40.395 1.00 11.69 ? 55  TYR A N   1 
ATOM   463  C CA  . TYR A 1 61  ? 27.445 45.552 41.132 1.00 10.78 ? 55  TYR A CA  1 
ATOM   464  C C   . TYR A 1 61  ? 26.392 44.790 40.301 1.00 11.19 ? 55  TYR A C   1 
ATOM   465  O O   . TYR A 1 61  ? 26.481 44.672 39.053 1.00 11.83 ? 55  TYR A O   1 
ATOM   466  C CB  . TYR A 1 61  ? 26.963 47.024 41.206 1.00 9.56  ? 55  TYR A CB  1 
ATOM   467  C CG  . TYR A 1 61  ? 27.717 47.944 42.080 1.00 12.03 ? 55  TYR A CG  1 
ATOM   468  C CD1 . TYR A 1 61  ? 28.123 47.568 43.357 1.00 13.04 ? 55  TYR A CD1 1 
ATOM   469  C CD2 . TYR A 1 61  ? 28.018 49.234 41.648 1.00 20.23 ? 55  TYR A CD2 1 
ATOM   470  C CE1 . TYR A 1 61  ? 28.801 48.445 44.160 1.00 15.09 ? 55  TYR A CE1 1 
ATOM   471  C CE2 . TYR A 1 61  ? 28.705 50.113 42.446 1.00 19.62 ? 55  TYR A CE2 1 
ATOM   472  C CZ  . TYR A 1 61  ? 29.093 49.719 43.704 1.00 16.92 ? 55  TYR A CZ  1 
ATOM   473  O OH  . TYR A 1 61  ? 29.765 50.594 44.545 1.00 19.50 ? 55  TYR A OH  1 
ATOM   474  N N   . ILE A 1 62  ? 25.352 44.303 40.972 1.00 10.22 ? 56  ILE A N   1 
ATOM   475  C CA  . ILE A 1 62  ? 24.208 43.595 40.357 1.00 10.51 ? 56  ILE A CA  1 
ATOM   476  C C   . ILE A 1 62  ? 22.972 44.348 40.880 1.00 10.12 ? 56  ILE A C   1 
ATOM   477  O O   . ILE A 1 62  ? 22.661 44.299 42.064 1.00 12.50 ? 56  ILE A O   1 
ATOM   478  C CB  . ILE A 1 62  ? 24.193 42.149 40.809 1.00 10.65 ? 56  ILE A CB  1 
ATOM   479  C CG1 . ILE A 1 62  ? 25.457 41.415 40.298 1.00 14.81 ? 56  ILE A CG1 1 
ATOM   480  C CG2 . ILE A 1 62  ? 22.920 41.457 40.300 1.00 13.53 ? 56  ILE A CG2 1 
ATOM   481  C CD1 . ILE A 1 62  ? 25.715 40.024 41.015 1.00 14.59 ? 56  ILE A CD1 1 
ATOM   482  N N   . LYS A 1 63  ? 22.244 45.004 39.969 1.00 10.52 ? 57  LYS A N   1 
ATOM   483  C CA  . LYS A 1 63  ? 21.147 45.866 40.372 1.00 12.58 ? 57  LYS A CA  1 
ATOM   484  C C   . LYS A 1 63  ? 19.841 45.477 39.743 1.00 13.64 ? 57  LYS A C   1 
ATOM   485  O O   . LYS A 1 63  ? 19.786 45.134 38.569 1.00 14.40 ? 57  LYS A O   1 
ATOM   486  C CB  . LYS A 1 63  ? 21.471 47.286 39.944 1.00 17.97 ? 57  LYS A CB  1 
ATOM   487  C CG  . LYS A 1 63  ? 22.650 47.861 40.629 1.00 24.57 ? 57  LYS A CG  1 
ATOM   488  C CD  . LYS A 1 63  ? 22.950 49.239 40.083 1.00 29.48 ? 57  LYS A CD  1 
ATOM   489  C CE  . LYS A 1 63  ? 21.729 50.161 40.180 1.00 30.01 ? 57  LYS A CE  1 
ATOM   490  N NZ  . LYS A 1 63  ? 22.116 51.579 39.861 1.00 32.74 ? 57  LYS A NZ  1 
ATOM   491  N N   . SER A 1 64  ? 18.775 45.541 40.514 1.00 13.99 ? 58  SER A N   1 
ATOM   492  C CA  . SER A 1 64  ? 17.430 45.254 39.971 1.00 15.08 ? 58  SER A CA  1 
ATOM   493  C C   . SER A 1 64  ? 17.060 46.452 39.093 1.00 18.41 ? 58  SER A C   1 
ATOM   494  O O   . SER A 1 64  ? 17.107 47.614 39.557 1.00 17.78 ? 58  SER A O   1 
ATOM   495  C CB  . SER A 1 64  ? 16.413 45.214 41.109 1.00 20.66 ? 58  SER A CB  1 
ATOM   496  O OG  . SER A 1 64  ? 15.093 45.414 40.570 1.00 20.52 ? 58  SER A OG  1 
ATOM   497  N N   . THR A 1 65  ? 16.657 46.210 37.857 1.00 17.30 ? 59  THR A N   1 
ATOM   498  C CA  . THR A 1 65  ? 16.293 47.324 37.004 1.00 15.83 ? 59  THR A CA  1 
ATOM   499  C C   . THR A 1 65  ? 14.915 47.833 37.382 1.00 19.30 ? 59  THR A C   1 
ATOM   500  O O   . THR A 1 65  ? 14.640 48.994 37.125 1.00 22.44 ? 59  THR A O   1 
ATOM   501  C CB  . THR A 1 65  ? 16.276 46.960 35.508 1.00 20.48 ? 59  THR A CB  1 
ATOM   502  O OG1 . THR A 1 65  ? 15.370 45.891 35.277 1.00 19.78 ? 59  THR A OG1 1 
ATOM   503  C CG2 . THR A 1 65  ? 17.685 46.568 35.042 1.00 20.65 ? 59  THR A CG2 1 
ATOM   504  N N   . GLU A 1 66  ? 14.094 46.985 38.003 1.00 17.81 ? 60  GLU A N   1 
ATOM   505  C CA  . GLU A 1 66  ? 12.729 47.362 38.404 1.00 19.42 ? 60  GLU A CA  1 
ATOM   506  C C   . GLU A 1 66  ? 12.691 48.225 39.639 1.00 21.60 ? 60  GLU A C   1 
ATOM   507  O O   . GLU A 1 66  ? 11.854 49.149 39.725 1.00 21.71 ? 60  GLU A O   1 
ATOM   508  C CB  . GLU A 1 66  ? 11.875 46.115 38.692 1.00 21.56 ? 60  GLU A CB  1 
ATOM   509  C CG  . GLU A 1 66  ? 10.356 46.405 38.942 1.00 25.14 ? 60  GLU A CG  1 
ATOM   510  C CD  . GLU A 1 66  ? 9.675  47.023 37.718 1.00 29.57 ? 60  GLU A CD  1 
ATOM   511  O OE1 . GLU A 1 66  ? 10.059 46.696 36.567 1.00 30.44 ? 60  GLU A OE1 1 
ATOM   512  O OE2 . GLU A 1 66  ? 8.744  47.847 37.900 1.00 35.28 ? 60  GLU A OE2 1 
ATOM   513  N N   . THR A 1 67  ? 13.581 47.963 40.601 1.00 19.86 ? 61  THR A N   1 
ATOM   514  C CA  . THR A 1 67  ? 13.518 48.693 41.860 1.00 17.24 ? 61  THR A CA  1 
ATOM   515  C C   . THR A 1 67  ? 14.739 49.506 42.171 1.00 18.09 ? 61  THR A C   1 
ATOM   516  O O   . THR A 1 67  ? 14.701 50.315 43.114 1.00 18.96 ? 61  THR A O   1 
ATOM   517  C CB  . THR A 1 67  ? 13.291 47.760 43.039 1.00 19.61 ? 61  THR A CB  1 
ATOM   518  O OG1 . THR A 1 67  ? 14.444 46.911 43.226 1.00 19.89 ? 61  THR A OG1 1 
ATOM   519  C CG2 . THR A 1 67  ? 12.072 46.846 42.797 1.00 23.93 ? 61  THR A CG2 1 
ATOM   520  N N   . GLY A 1 68  ? 15.823 49.277 41.422 1.00 18.84 ? 62  GLY A N   1 
ATOM   521  C CA  . GLY A 1 68  ? 17.090 49.998 41.663 1.00 15.73 ? 62  GLY A CA  1 
ATOM   522  C C   . GLY A 1 68  ? 17.939 49.398 42.816 1.00 13.35 ? 62  GLY A C   1 
ATOM   523  O O   . GLY A 1 68  ? 18.980 49.968 43.124 1.00 13.94 ? 62  GLY A O   1 
ATOM   524  N N   . GLN A 1 69  ? 17.462 48.365 43.482 1.00 13.25 ? 63  GLN A N   1 
ATOM   525  C CA  . GLN A 1 69  ? 18.227 47.790 44.604 1.00 11.44 ? 63  GLN A CA  1 
ATOM   526  C C   . GLN A 1 69  ? 19.455 47.062 44.125 1.00 15.39 ? 63  GLN A C   1 
ATOM   527  O O   . GLN A 1 69  ? 19.474 46.468 43.044 1.00 14.47 ? 63  GLN A O   1 
ATOM   528  C CB  . GLN A 1 69  ? 17.400 46.768 45.370 1.00 12.04 ? 63  GLN A CB  1 
ATOM   529  C CG  . GLN A 1 69  ? 16.199 47.422 46.102 1.00 14.71 ? 63  GLN A CG  1 
ATOM   530  C CD  . GLN A 1 69  ? 15.331 46.349 46.638 1.00 18.54 ? 63  GLN A CD  1 
ATOM   531  O OE1 . GLN A 1 69  ? 15.515 45.873 47.753 1.00 19.70 ? 63  GLN A OE1 1 
ATOM   532  N NE2 . GLN A 1 69  ? 14.427 45.868 45.795 1.00 22.22 ? 63  GLN A NE2 1 
ATOM   533  N N   . TYR A 1 70  ? 20.473 47.106 44.969 1.00 10.16 ? 64  TYR A N   1 
ATOM   534  C CA  . TYR A 1 70  ? 21.703 46.393 44.704 1.00 10.70 ? 64  TYR A CA  1 
ATOM   535  C C   . TYR A 1 70  ? 21.704 45.078 45.468 1.00 13.26 ? 64  TYR A C   1 
ATOM   536  O O   . TYR A 1 70  ? 21.376 45.019 46.650 1.00 12.46 ? 64  TYR A O   1 
ATOM   537  C CB  . TYR A 1 70  ? 22.865 47.190 45.216 1.00 10.13 ? 64  TYR A CB  1 
ATOM   538  C CG  . TYR A 1 70  ? 23.141 48.497 44.539 1.00 11.48 ? 64  TYR A CG  1 
ATOM   539  C CD1 . TYR A 1 70  ? 22.329 49.606 44.791 1.00 11.58 ? 64  TYR A CD1 1 
ATOM   540  C CD2 . TYR A 1 70  ? 24.177 48.632 43.625 1.00 13.11 ? 64  TYR A CD2 1 
ATOM   541  C CE1 . TYR A 1 70  ? 22.552 50.803 44.138 1.00 13.76 ? 64  TYR A CE1 1 
ATOM   542  C CE2 . TYR A 1 70  ? 24.418 49.824 42.980 1.00 14.45 ? 64  TYR A CE2 1 
ATOM   543  C CZ  . TYR A 1 70  ? 23.584 50.910 43.256 1.00 18.04 ? 64  TYR A CZ  1 
ATOM   544  O OH  . TYR A 1 70  ? 23.876 52.125 42.668 1.00 24.71 ? 64  TYR A OH  1 
ATOM   545  N N   . LEU A 1 71  ? 22.113 44.011 44.787 1.00 8.67  ? 65  LEU A N   1 
ATOM   546  C CA  . LEU A 1 71  ? 22.322 42.720 45.508 1.00 9.16  ? 65  LEU A CA  1 
ATOM   547  C C   . LEU A 1 71  ? 23.505 42.916 46.468 1.00 9.91  ? 65  LEU A C   1 
ATOM   548  O O   . LEU A 1 71  ? 24.530 43.549 46.123 1.00 9.69  ? 65  LEU A O   1 
ATOM   549  C CB  . LEU A 1 71  ? 22.738 41.642 44.530 1.00 10.56 ? 65  LEU A CB  1 
ATOM   550  C CG  . LEU A 1 71  ? 22.829 40.272 45.193 1.00 9.60  ? 65  LEU A CG  1 
ATOM   551  C CD1 . LEU A 1 71  ? 21.441 39.677 45.525 1.00 12.85 ? 65  LEU A CD1 1 
ATOM   552  C CD2 . LEU A 1 71  ? 23.542 39.326 44.149 1.00 9.79  ? 65  LEU A CD2 1 
ATOM   553  N N   . ALA A 1 72  ? 23.348 42.390 47.681 1.00 8.12  ? 66  ALA A N   1 
ATOM   554  C CA  . ALA A 1 72  ? 24.399 42.548 48.686 1.00 9.63  ? 66  ALA A CA  1 
ATOM   555  C C   . ALA A 1 72  ? 24.400 41.309 49.569 1.00 9.67  ? 66  ALA A C   1 
ATOM   556  O O   . ALA A 1 72  ? 23.404 40.570 49.616 1.00 9.04  ? 66  ALA A O   1 
ATOM   557  C CB  . ALA A 1 72  ? 24.104 43.797 49.533 1.00 10.73 ? 66  ALA A CB  1 
ATOM   558  N N   . MET A 1 73  ? 25.559 40.998 50.186 1.00 10.03 ? 67  MET A N   1 
ATOM   559  C CA  . MET A 1 73  ? 25.614 39.881 51.134 1.00 8.43  ? 67  MET A CA  1 
ATOM   560  C C   . MET A 1 73  ? 26.053 40.456 52.500 1.00 8.71  ? 67  MET A C   1 
ATOM   561  O O   . MET A 1 73  ? 27.074 41.139 52.584 1.00 10.33 ? 67  MET A O   1 
ATOM   562  C CB  . MET A 1 73  ? 26.607 38.780 50.681 1.00 9.85  ? 67  MET A CB  1 
ATOM   563  C CG  . MET A 1 73  ? 26.542 37.591 51.663 1.00 9.01  ? 67  MET A CG  1 
ATOM   564  S SD  . MET A 1 73  ? 27.608 36.238 51.128 1.00 10.65 ? 67  MET A SD  1 
ATOM   565  C CE  . MET A 1 73  ? 26.556 35.437 49.905 1.00 12.40 ? 67  MET A CE  1 
ATOM   566  N N   . ASP A 1 74  ? 25.228 40.186 53.528 1.00 8.44  ? 68  ASP A N   1 
ATOM   567  C CA  . ASP A 1 74  ? 25.493 40.704 54.863 1.00 7.87  ? 68  ASP A CA  1 
ATOM   568  C C   . ASP A 1 74  ? 26.538 39.966 55.636 1.00 7.81  ? 68  ASP A C   1 
ATOM   569  O O   . ASP A 1 74  ? 27.115 38.983 55.171 1.00 9.38  ? 68  ASP A O   1 
ATOM   570  C CB  . ASP A 1 74  ? 24.170 40.899 55.651 1.00 9.28  ? 68  ASP A CB  1 
ATOM   571  C CG  . ASP A 1 74  ? 23.563 39.563 56.201 1.00 11.66 ? 68  ASP A CG  1 
ATOM   572  O OD1 . ASP A 1 74  ? 24.293 38.557 56.316 1.00 10.53 ? 68  ASP A OD1 1 
ATOM   573  O OD2 . ASP A 1 74  ? 22.326 39.627 56.522 1.00 11.18 ? 68  ASP A OD2 1 
ATOM   574  N N   . THR A 1 75  ? 26.804 40.467 56.849 1.00 10.33 ? 69  THR A N   1 
ATOM   575  C CA  . THR A 1 75  ? 27.870 39.917 57.662 1.00 11.93 ? 69  THR A CA  1 
ATOM   576  C C   . THR A 1 75  ? 27.701 38.462 58.079 1.00 11.62 ? 69  THR A C   1 
ATOM   577  O O   . THR A 1 75  ? 28.671 37.763 58.468 1.00 10.25 ? 69  THR A O   1 
ATOM   578  C CB  . THR A 1 75  ? 28.049 40.827 58.926 1.00 15.80 ? 69  THR A CB  1 
ATOM   579  O OG1 . THR A 1 75  ? 29.253 40.453 59.568 1.00 20.62 ? 69  THR A OG1 1 
ATOM   580  C CG2 . THR A 1 75  ? 26.936 40.680 59.859 1.00 18.54 ? 69  THR A CG2 1 
ATOM   581  N N   . ASP A 1 76  ? 26.454 38.000 58.054 1.00 10.12 ? 70  ASP A N   1 
ATOM   582  C CA  . ASP A 1 76  ? 26.176 36.616 58.388 1.00 11.14 ? 70  ASP A CA  1 
ATOM   583  C C   . ASP A 1 76  ? 25.918 35.784 57.144 1.00 10.12 ? 70  ASP A C   1 
ATOM   584  O O   . ASP A 1 76  ? 25.363 34.675 57.212 1.00 12.17 ? 70  ASP A O   1 
ATOM   585  C CB  . ASP A 1 76  ? 25.006 36.464 59.373 1.00 11.69 ? 70  ASP A CB  1 
ATOM   586  C CG  . ASP A 1 76  ? 25.415 36.778 60.819 1.00 9.70  ? 70  ASP A CG  1 
ATOM   587  O OD1 . ASP A 1 76  ? 26.477 36.267 61.198 1.00 14.25 ? 70  ASP A OD1 1 
ATOM   588  O OD2 . ASP A 1 76  ? 24.660 37.516 61.496 1.00 12.70 ? 70  ASP A OD2 1 
ATOM   589  N N   . GLY A 1 77  ? 26.290 36.313 55.970 1.00 9.31  ? 71  GLY A N   1 
ATOM   590  C CA  . GLY A 1 77  ? 26.188 35.513 54.744 1.00 10.85 ? 71  GLY A CA  1 
ATOM   591  C C   . GLY A 1 77  ? 24.847 35.551 54.041 1.00 11.73 ? 71  GLY A C   1 
ATOM   592  O O   . GLY A 1 77  ? 24.662 34.788 53.091 1.00 10.40 ? 71  GLY A O   1 
ATOM   593  N N   . LEU A 1 78  ? 23.902 36.402 54.465 1.00 11.08 ? 72  LEU A N   1 
ATOM   594  C CA  . LEU A 1 78  ? 22.608 36.399 53.805 1.00 10.04 ? 72  LEU A CA  1 
ATOM   595  C C   . LEU A 1 78  ? 22.510 37.466 52.710 1.00 10.00 ? 72  LEU A C   1 
ATOM   596  O O   . LEU A 1 78  ? 22.905 38.632 52.882 1.00 11.46 ? 72  LEU A O   1 
ATOM   597  C CB  . LEU A 1 78  ? 21.471 36.687 54.834 1.00 9.28  ? 72  LEU A CB  1 
ATOM   598  C CG  . LEU A 1 78  ? 21.313 35.629 55.936 1.00 14.21 ? 72  LEU A CG  1 
ATOM   599  C CD1 . LEU A 1 78  ? 20.125 36.084 56.852 1.00 13.07 ? 72  LEU A CD1 1 
ATOM   600  C CD2 . LEU A 1 78  ? 20.986 34.254 55.305 1.00 15.36 ? 72  LEU A CD2 1 
ATOM   601  N N   . LEU A 1 79  ? 21.948 37.063 51.574 1.00 10.02 ? 73  LEU A N   1 
ATOM   602  C CA  . LEU A 1 79  ? 21.730 37.998 50.489 1.00 10.43 ? 73  LEU A CA  1 
ATOM   603  C C   . LEU A 1 79  ? 20.566 38.897 50.807 1.00 12.31 ? 73  LEU A C   1 
ATOM   604  O O   . LEU A 1 79  ? 19.577 38.460 51.423 1.00 12.68 ? 73  LEU A O   1 
ATOM   605  C CB  . LEU A 1 79  ? 21.450 37.255 49.181 1.00 10.23 ? 73  LEU A CB  1 
ATOM   606  C CG  . LEU A 1 79  ? 22.632 36.427 48.657 1.00 12.27 ? 73  LEU A CG  1 
ATOM   607  C CD1 . LEU A 1 79  ? 22.158 35.671 47.374 1.00 12.28 ? 73  LEU A CD1 1 
ATOM   608  C CD2 . LEU A 1 79  ? 23.766 37.387 48.246 1.00 14.15 ? 73  LEU A CD2 1 
ATOM   609  N N   . TYR A 1 80  ? 20.679 40.164 50.417 1.00 11.23 ? 74  TYR A N   1 
ATOM   610  C CA  . TYR A 1 80  ? 19.597 41.132 50.627 1.00 9.22  ? 74  TYR A CA  1 
ATOM   611  C C   . TYR A 1 80  ? 19.675 42.194 49.537 1.00 10.13 ? 74  TYR A C   1 
ATOM   612  O O   . TYR A 1 80  ? 20.663 42.291 48.856 1.00 11.80 ? 74  TYR A O   1 
ATOM   613  C CB  . TYR A 1 80  ? 19.696 41.796 52.048 1.00 9.22  ? 74  TYR A CB  1 
ATOM   614  C CG  . TYR A 1 80  ? 20.875 42.775 52.216 1.00 9.56  ? 74  TYR A CG  1 
ATOM   615  C CD1 . TYR A 1 80  ? 22.165 42.328 52.550 1.00 10.52 ? 74  TYR A CD1 1 
ATOM   616  C CD2 . TYR A 1 80  ? 20.641 44.144 52.078 1.00 8.81  ? 74  TYR A CD2 1 
ATOM   617  C CE1 . TYR A 1 80  ? 23.209 43.257 52.751 1.00 11.36 ? 74  TYR A CE1 1 
ATOM   618  C CE2 . TYR A 1 80  ? 21.674 45.064 52.276 1.00 9.39  ? 74  TYR A CE2 1 
ATOM   619  C CZ  . TYR A 1 80  ? 22.928 44.601 52.596 1.00 8.67  ? 74  TYR A CZ  1 
ATOM   620  O OH  . TYR A 1 80  ? 23.963 45.540 52.703 1.00 10.98 ? 74  TYR A OH  1 
ATOM   621  N N   . GLY A 1 81  ? 18.597 42.984 49.355 1.00 10.22 ? 75  GLY A N   1 
ATOM   622  C CA  . GLY A 1 81  ? 18.608 44.062 48.367 1.00 10.87 ? 75  GLY A CA  1 
ATOM   623  C C   . GLY A 1 81  ? 18.920 45.340 49.154 1.00 10.84 ? 75  GLY A C   1 
ATOM   624  O O   . GLY A 1 81  ? 18.213 45.639 50.145 1.00 12.87 ? 75  GLY A O   1 
ATOM   625  N N   . SER A 1 82  ? 19.919 46.112 48.720 1.00 10.90 ? 76  SER A N   1 
ATOM   626  C CA  . SER A 1 82  ? 20.348 47.348 49.421 1.00 12.22 ? 76  SER A CA  1 
ATOM   627  C C   . SER A 1 82  ? 19.873 48.533 48.579 1.00 13.47 ? 76  SER A C   1 
ATOM   628  O O   . SER A 1 82  ? 19.965 48.539 47.356 1.00 12.33 ? 76  SER A O   1 
ATOM   629  C CB  . SER A 1 82  ? 21.852 47.432 49.506 1.00 14.09 ? 76  SER A CB  1 
ATOM   630  O OG  . SER A 1 82  ? 22.233 48.588 50.252 1.00 12.98 ? 76  SER A OG  1 
ATOM   631  N N   . GLN A 1 83  ? 19.377 49.572 49.247 1.00 12.63 ? 77  GLN A N   1 
ATOM   632  C CA  . GLN A 1 83  ? 18.919 50.735 48.531 1.00 10.82 ? 77  GLN A CA  1 
ATOM   633  C C   . GLN A 1 83  ? 20.088 51.572 48.003 1.00 11.26 ? 77  GLN A C   1 
ATOM   634  O O   . GLN A 1 83  ? 19.943 52.335 47.038 1.00 14.20 ? 77  GLN A O   1 
ATOM   635  C CB  . GLN A 1 83  ? 18.103 51.657 49.478 1.00 15.83 ? 77  GLN A CB  1 
ATOM   636  C CG  . GLN A 1 83  ? 16.811 51.048 49.917 1.00 24.59 ? 77  GLN A CG  1 
ATOM   637  C CD  . GLN A 1 83  ? 15.828 50.908 48.731 1.00 29.69 ? 77  GLN A CD  1 
ATOM   638  O OE1 . GLN A 1 83  ? 15.108 49.916 48.622 1.00 32.12 ? 77  GLN A OE1 1 
ATOM   639  N NE2 . GLN A 1 83  ? 15.793 51.911 47.856 1.00 32.46 ? 77  GLN A NE2 1 
ATOM   640  N N   . THR A 1 84  ? 21.259 51.476 48.643 1.00 10.59 ? 78  THR A N   1 
ATOM   641  C CA  . THR A 1 84  ? 22.427 52.251 48.252 1.00 10.62 ? 78  THR A CA  1 
ATOM   642  C C   . THR A 1 84  ? 23.612 51.298 48.128 1.00 10.67 ? 78  THR A C   1 
ATOM   643  O O   . THR A 1 84  ? 23.660 50.240 48.780 1.00 12.89 ? 78  THR A O   1 
ATOM   644  C CB  . THR A 1 84  ? 22.747 53.334 49.288 1.00 11.12 ? 78  THR A CB  1 
ATOM   645  O OG1 . THR A 1 84  ? 22.727 52.728 50.593 1.00 15.03 ? 78  THR A OG1 1 
ATOM   646  C CG2 . THR A 1 84  ? 21.636 54.377 49.293 1.00 10.47 ? 78  THR A CG2 1 
ATOM   647  N N   . PRO A 1 85  ? 24.587 51.662 47.299 1.00 9.90  ? 79  PRO A N   1 
ATOM   648  C CA  . PRO A 1 85  ? 25.750 50.796 47.105 1.00 9.21  ? 79  PRO A CA  1 
ATOM   649  C C   . PRO A 1 85  ? 26.682 50.907 48.290 1.00 11.72 ? 79  PRO A C   1 
ATOM   650  O O   . PRO A 1 85  ? 27.014 52.002 48.764 1.00 12.11 ? 79  PRO A O   1 
ATOM   651  C CB  . PRO A 1 85  ? 26.361 51.359 45.807 1.00 13.01 ? 79  PRO A CB  1 
ATOM   652  C CG  . PRO A 1 85  ? 25.970 52.873 45.850 1.00 13.85 ? 79  PRO A CG  1 
ATOM   653  C CD  . PRO A 1 85  ? 24.559 52.777 46.317 1.00 13.62 ? 79  PRO A CD  1 
ATOM   654  N N   . ASN A 1 86  ? 27.158 49.752 48.759 1.00 11.75 ? 80  ASN A N   1 
ATOM   655  C CA  . ASN A 1 86  ? 28.082 49.745 49.884 1.00 10.04 ? 80  ASN A CA  1 
ATOM   656  C C   . ASN A 1 86  ? 29.060 48.591 49.644 1.00 9.37  ? 80  ASN A C   1 
ATOM   657  O O   . ASN A 1 86  ? 28.991 47.916 48.597 1.00 10.64 ? 80  ASN A O   1 
ATOM   658  C CB  . ASN A 1 86  ? 27.334 49.612 51.207 1.00 8.26  ? 80  ASN A CB  1 
ATOM   659  C CG  . ASN A 1 86  ? 26.496 48.330 51.292 1.00 10.48 ? 80  ASN A CG  1 
ATOM   660  O OD1 . ASN A 1 86  ? 26.981 47.262 50.976 1.00 11.25 ? 80  ASN A OD1 1 
ATOM   661  N ND2 . ASN A 1 86  ? 25.242 48.444 51.732 1.00 12.37 ? 80  ASN A ND2 1 
ATOM   662  N N   . GLU A 1 87  ? 29.975 48.392 50.594 1.00 8.84  ? 81  GLU A N   1 
ATOM   663  C CA  . GLU A 1 87  ? 31.010 47.359 50.388 1.00 9.00  ? 81  GLU A CA  1 
ATOM   664  C C   . GLU A 1 87  ? 30.437 45.979 50.253 1.00 12.77 ? 81  GLU A C   1 
ATOM   665  O O   . GLU A 1 87  ? 31.138 45.091 49.733 1.00 10.61 ? 81  GLU A O   1 
ATOM   666  C CB  . GLU A 1 87  ? 31.975 47.361 51.563 1.00 11.14 ? 81  GLU A CB  1 
ATOM   667  C CG  . GLU A 1 87  ? 32.823 48.613 51.557 1.00 19.86 ? 81  GLU A CG  1 
ATOM   668  C CD  . GLU A 1 87  ? 33.924 48.593 52.566 1.00 26.41 ? 81  GLU A CD  1 
ATOM   669  O OE1 . GLU A 1 87  ? 34.363 47.468 52.946 1.00 32.51 ? 81  GLU A OE1 1 
ATOM   670  O OE2 . GLU A 1 87  ? 34.391 49.723 52.932 1.00 29.99 ? 81  GLU A OE2 1 
ATOM   671  N N   . GLU A 1 88  ? 29.243 45.747 50.771 1.00 9.90  ? 82  GLU A N   1 
ATOM   672  C CA  . GLU A 1 88  ? 28.635 44.417 50.744 1.00 7.81  ? 82  GLU A CA  1 
ATOM   673  C C   . GLU A 1 88  ? 28.019 44.113 49.396 1.00 9.32  ? 82  GLU A C   1 
ATOM   674  O O   . GLU A 1 88  ? 27.522 43.013 49.178 1.00 9.52  ? 82  GLU A O   1 
ATOM   675  C CB  . GLU A 1 88  ? 27.581 44.288 51.837 1.00 9.38  ? 82  GLU A CB  1 
ATOM   676  C CG  . GLU A 1 88  ? 28.140 44.550 53.218 1.00 10.15 ? 82  GLU A CG  1 
ATOM   677  C CD  . GLU A 1 88  ? 27.112 44.295 54.314 1.00 11.12 ? 82  GLU A CD  1 
ATOM   678  O OE1 . GLU A 1 88  ? 25.894 44.542 54.121 1.00 12.36 ? 82  GLU A OE1 1 
ATOM   679  O OE2 . GLU A 1 88  ? 27.584 43.898 55.417 1.00 12.50 ? 82  GLU A OE2 1 
ATOM   680  N N   . CYS A 1 89  ? 28.034 45.105 48.486 1.00 9.89  ? 83  CYS A N   1 
ATOM   681  C CA  . CYS A 1 89  ? 27.381 44.991 47.150 1.00 8.14  ? 83  CYS A CA  1 
ATOM   682  C C   . CYS A 1 89  ? 28.329 44.641 46.036 1.00 10.36 ? 83  CYS A C   1 
ATOM   683  O O   . CYS A 1 89  ? 27.901 44.443 44.894 1.00 10.74 ? 83  CYS A O   1 
ATOM   684  C CB  . CYS A 1 89  ? 26.697 46.312 46.756 1.00 8.89  ? 83  CYS A CB  1 
ATOM   685  S SG  . CYS A 1 89  ? 25.415 46.890 47.893 1.00 11.37 ? 83  CYS A SG  1 
ATOM   686  N N   . LEU A 1 90  ? 29.624 44.574 46.352 1.00 10.72 ? 84  LEU A N   1 
ATOM   687  C CA  . LEU A 1 90  ? 30.593 44.232 45.329 1.00 9.61  ? 84  LEU A CA  1 
ATOM   688  C C   . LEU A 1 90  ? 30.870 42.764 45.237 1.00 10.29 ? 84  LEU A C   1 
ATOM   689  O O   . LEU A 1 90  ? 31.088 42.114 46.260 1.00 11.22 ? 84  LEU A O   1 
ATOM   690  C CB  . LEU A 1 90  ? 31.904 44.978 45.602 1.00 12.38 ? 84  LEU A CB  1 
ATOM   691  C CG  . LEU A 1 90  ? 31.903 46.454 45.220 1.00 17.51 ? 84  LEU A CG  1 
ATOM   692  C CD1 . LEU A 1 90  ? 33.231 47.090 45.658 1.00 22.53 ? 84  LEU A CD1 1 
ATOM   693  C CD2 . LEU A 1 90  ? 31.776 46.622 43.713 1.00 17.47 ? 84  LEU A CD2 1 
ATOM   694  N N   . PHE A 1 91  ? 30.827 42.223 44.017 1.00 10.42 ? 85  PHE A N   1 
ATOM   695  C CA  . PHE A 1 91  ? 31.087 40.794 43.781 1.00 8.66  ? 85  PHE A CA  1 
ATOM   696  C C   . PHE A 1 91  ? 32.169 40.569 42.769 1.00 10.65 ? 85  PHE A C   1 
ATOM   697  O O   . PHE A 1 91  ? 32.302 41.363 41.830 1.00 11.73 ? 85  PHE A O   1 
ATOM   698  C CB  . PHE A 1 91  ? 29.810 40.070 43.299 1.00 10.30 ? 85  PHE A CB  1 
ATOM   699  C CG  . PHE A 1 91  ? 28.711 40.090 44.342 1.00 9.03  ? 85  PHE A CG  1 
ATOM   700  C CD1 . PHE A 1 91  ? 28.698 39.083 45.311 1.00 11.10 ? 85  PHE A CD1 1 
ATOM   701  C CD2 . PHE A 1 91  ? 27.765 41.161 44.415 1.00 9.26  ? 85  PHE A CD2 1 
ATOM   702  C CE1 . PHE A 1 91  ? 27.794 39.105 46.368 1.00 9.60  ? 85  PHE A CE1 1 
ATOM   703  C CE2 . PHE A 1 91  ? 26.842 41.192 45.487 1.00 11.37 ? 85  PHE A CE2 1 
ATOM   704  C CZ  . PHE A 1 91  ? 26.851 40.179 46.458 1.00 11.03 ? 85  PHE A CZ  1 
ATOM   705  N N   . LEU A 1 92  ? 32.998 39.546 42.996 1.00 10.42 ? 86  LEU A N   1 
ATOM   706  C CA  . LEU A 1 92  ? 34.037 39.170 42.023 1.00 10.36 ? 86  LEU A CA  1 
ATOM   707  C C   . LEU A 1 92  ? 33.380 38.205 41.062 1.00 9.91  ? 86  LEU A C   1 
ATOM   708  O O   . LEU A 1 92  ? 32.963 37.089 41.420 1.00 10.50 ? 86  LEU A O   1 
ATOM   709  C CB  . LEU A 1 92  ? 35.170 38.474 42.748 1.00 10.86 ? 86  LEU A CB  1 
ATOM   710  C CG  . LEU A 1 92  ? 35.672 39.276 43.947 1.00 10.28 ? 86  LEU A CG  1 
ATOM   711  C CD1 . LEU A 1 92  ? 36.860 38.448 44.596 1.00 14.10 ? 86  LEU A CD1 1 
ATOM   712  C CD2 . LEU A 1 92  ? 36.208 40.668 43.568 1.00 11.93 ? 86  LEU A CD2 1 
ATOM   713  N N   . GLU A 1 93  ? 33.181 38.676 39.830 1.00 10.14 ? 87  GLU A N   1 
ATOM   714  C CA  . GLU A 1 93  ? 32.556 37.896 38.758 1.00 7.07  ? 87  GLU A CA  1 
ATOM   715  C C   . GLU A 1 93  ? 33.598 37.090 38.023 1.00 9.90  ? 87  GLU A C   1 
ATOM   716  O O   . GLU A 1 93  ? 34.531 37.665 37.447 1.00 12.03 ? 87  GLU A O   1 
ATOM   717  C CB  . GLU A 1 93  ? 31.833 38.837 37.810 1.00 10.75 ? 87  GLU A CB  1 
ATOM   718  C CG  . GLU A 1 93  ? 31.190 38.111 36.641 1.00 10.45 ? 87  GLU A CG  1 
ATOM   719  C CD  . GLU A 1 93  ? 30.646 39.104 35.600 1.00 15.55 ? 87  GLU A CD  1 
ATOM   720  O OE1 . GLU A 1 93  ? 31.481 39.861 35.048 1.00 14.42 ? 87  GLU A OE1 1 
ATOM   721  O OE2 . GLU A 1 93  ? 29.399 39.133 35.396 1.00 16.80 ? 87  GLU A OE2 1 
ATOM   722  N N   . ARG A 1 94  ? 33.420 35.785 38.027 1.00 9.41  ? 88  ARG A N   1 
ATOM   723  C CA  . ARG A 1 94  ? 34.450 34.921 37.418 1.00 7.12  ? 88  ARG A CA  1 
ATOM   724  C C   . ARG A 1 94  ? 33.842 33.864 36.560 1.00 9.78  ? 88  ARG A C   1 
ATOM   725  O O   . ARG A 1 94  ? 32.711 33.421 36.737 1.00 11.84 ? 88  ARG A O   1 
ATOM   726  C CB  . ARG A 1 94  ? 35.234 34.229 38.545 1.00 9.81  ? 88  ARG A CB  1 
ATOM   727  C CG  . ARG A 1 94  ? 36.110 35.102 39.430 1.00 9.06  ? 88  ARG A CG  1 
ATOM   728  C CD  . ARG A 1 94  ? 37.274 35.768 38.687 1.00 7.58  ? 88  ARG A CD  1 
ATOM   729  N NE  . ARG A 1 94  ? 38.070 36.675 39.540 1.00 9.73  ? 88  ARG A NE  1 
ATOM   730  C CZ  . ARG A 1 94  ? 37.743 37.943 39.777 1.00 10.97 ? 88  ARG A CZ  1 
ATOM   731  N NH1 . ARG A 1 94  ? 36.653 38.488 39.187 1.00 11.28 ? 88  ARG A NH1 1 
ATOM   732  N NH2 . ARG A 1 94  ? 38.453 38.687 40.650 1.00 10.18 ? 88  ARG A NH2 1 
ATOM   733  N N   . LEU A 1 95  ? 34.648 33.344 35.615 1.00 10.79 ? 89  LEU A N   1 
ATOM   734  C CA  . LEU A 1 95  ? 34.215 32.187 34.810 1.00 11.48 ? 89  LEU A CA  1 
ATOM   735  C C   . LEU A 1 95  ? 34.435 30.932 35.689 1.00 11.06 ? 89  LEU A C   1 
ATOM   736  O O   . LEU A 1 95  ? 35.346 30.970 36.519 1.00 10.75 ? 89  LEU A O   1 
ATOM   737  C CB  . LEU A 1 95  ? 35.139 32.062 33.570 1.00 12.36 ? 89  LEU A CB  1 
ATOM   738  C CG  . LEU A 1 95  ? 34.771 30.958 32.620 1.00 11.00 ? 89  LEU A CG  1 
ATOM   739  C CD1 . LEU A 1 95  ? 33.503 31.312 31.883 1.00 10.28 ? 89  LEU A CD1 1 
ATOM   740  C CD2 . LEU A 1 95  ? 35.906 30.848 31.551 1.00 13.52 ? 89  LEU A CD2 1 
ATOM   741  N N   . GLU A 1 96  ? 33.593 29.897 35.562 1.00 10.04 ? 90  GLU A N   1 
ATOM   742  C CA  . GLU A 1 96  ? 33.740 28.668 36.301 1.00 10.33 ? 90  GLU A CA  1 
ATOM   743  C C   . GLU A 1 96  ? 33.397 27.483 35.414 1.00 12.10 ? 90  GLU A C   1 
ATOM   744  O O   . GLU A 1 96  ? 32.479 27.577 34.566 1.00 12.29 ? 90  GLU A O   1 
ATOM   745  C CB  . GLU A 1 96  ? 32.865 28.724 37.586 1.00 11.04 ? 90  GLU A CB  1 
ATOM   746  C CG  . GLU A 1 96  ? 33.031 27.532 38.478 1.00 13.91 ? 90  GLU A CG  1 
ATOM   747  C CD  . GLU A 1 96  ? 34.482 27.391 38.924 1.00 14.40 ? 90  GLU A CD  1 
ATOM   748  O OE1 . GLU A 1 96  ? 35.241 26.757 38.161 1.00 14.14 ? 90  GLU A OE1 1 
ATOM   749  O OE2 . GLU A 1 96  ? 34.893 27.897 39.994 1.00 15.06 ? 90  GLU A OE2 1 
ATOM   750  N N   . GLU A 1 97  ? 34.204 26.412 35.554 1.00 10.48 ? 91  GLU A N   1 
ATOM   751  C CA  . GLU A 1 97  ? 34.048 25.215 34.777 1.00 13.17 ? 91  GLU A CA  1 
ATOM   752  C C   . GLU A 1 97  ? 34.055 25.580 33.303 1.00 11.16 ? 91  GLU A C   1 
ATOM   753  O O   . GLU A 1 97  ? 33.346 24.984 32.513 1.00 12.93 ? 91  GLU A O   1 
ATOM   754  C CB  . GLU A 1 97  ? 32.798 24.368 35.167 1.00 13.85 ? 91  GLU A CB  1 
ATOM   755  C CG  . GLU A 1 97  ? 32.905 23.854 36.612 1.00 13.49 ? 91  GLU A CG  1 
ATOM   756  C CD  . GLU A 1 97  ? 31.682 23.123 37.158 1.00 20.39 ? 91  GLU A CD  1 
ATOM   757  O OE1 . GLU A 1 97  ? 30.771 22.726 36.389 1.00 21.93 ? 91  GLU A OE1 1 
ATOM   758  O OE2 . GLU A 1 97  ? 31.620 22.955 38.398 1.00 24.29 ? 91  GLU A OE2 1 
ATOM   759  N N   . ASN A 1 98  ? 34.860 26.558 32.957 1.00 11.42 ? 92  ASN A N   1 
ATOM   760  C CA  . ASN A 1 98  ? 35.025 26.980 31.568 1.00 13.05 ? 92  ASN A CA  1 
ATOM   761  C C   . ASN A 1 98  ? 33.724 27.372 30.893 1.00 13.22 ? 92  ASN A C   1 
ATOM   762  O O   . ASN A 1 98  ? 33.613 27.327 29.673 1.00 14.61 ? 92  ASN A O   1 
ATOM   763  C CB  . ASN A 1 98  ? 35.636 25.838 30.740 1.00 13.51 ? 92  ASN A CB  1 
ATOM   764  C CG  . ASN A 1 98  ? 37.025 25.392 31.260 1.00 10.69 ? 92  ASN A CG  1 
ATOM   765  O OD1 . ASN A 1 98  ? 37.119 24.447 32.038 1.00 13.57 ? 92  ASN A OD1 1 
ATOM   766  N ND2 . ASN A 1 98  ? 38.055 26.143 30.864 1.00 14.19 ? 92  ASN A ND2 1 
ATOM   767  N N   . HIS A 1 99  ? 32.747 27.865 31.666 1.00 11.89 ? 93  HIS A N   1 
ATOM   768  C CA  . HIS A 1 99  ? 31.438 28.144 31.074 1.00 13.40 ? 93  HIS A CA  1 
ATOM   769  C C   . HIS A 1 99  ? 30.524 29.062 31.847 1.00 11.08 ? 93  HIS A C   1 
ATOM   770  O O   . HIS A 1 99  ? 29.922 29.966 31.268 1.00 14.59 ? 93  HIS A O   1 
ATOM   771  C CB  . HIS A 1 99  ? 30.731 26.800 30.920 1.00 12.80 ? 93  HIS A CB  1 
ATOM   772  C CG  . HIS A 1 99  ? 29.359 26.856 30.312 1.00 14.86 ? 93  HIS A CG  1 
ATOM   773  N ND1 . HIS A 1 99  ? 29.137 27.333 29.035 1.00 21.40 ? 93  HIS A ND1 1 
ATOM   774  C CD2 . HIS A 1 99  ? 28.158 26.420 30.772 1.00 16.91 ? 93  HIS A CD2 1 
ATOM   775  C CE1 . HIS A 1 99  ? 27.856 27.182 28.736 1.00 15.85 ? 93  HIS A CE1 1 
ATOM   776  N NE2 . HIS A 1 99  ? 27.241 26.623 29.766 1.00 19.69 ? 93  HIS A NE2 1 
ATOM   777  N N   . TYR A 1 100 ? 30.371 28.779 33.144 1.00 10.39 ? 94  TYR A N   1 
ATOM   778  C CA  . TYR A 1 100 ? 29.412 29.530 33.976 1.00 10.37 ? 94  TYR A CA  1 
ATOM   779  C C   . TYR A 1 100 ? 30.004 30.745 34.578 1.00 11.54 ? 94  TYR A C   1 
ATOM   780  O O   . TYR A 1 100 ? 31.238 30.976 34.512 1.00 10.89 ? 94  TYR A O   1 
ATOM   781  C CB  . TYR A 1 100 ? 29.026 28.641 35.149 1.00 13.10 ? 94  TYR A CB  1 
ATOM   782  C CG  . TYR A 1 100 ? 28.336 27.382 34.735 1.00 12.29 ? 94  TYR A CG  1 
ATOM   783  C CD1 . TYR A 1 100 ? 29.017 26.174 34.646 1.00 12.46 ? 94  TYR A CD1 1 
ATOM   784  C CD2 . TYR A 1 100 ? 26.993 27.416 34.449 1.00 13.67 ? 94  TYR A CD2 1 
ATOM   785  C CE1 . TYR A 1 100 ? 28.361 25.021 34.291 1.00 18.01 ? 94  TYR A CE1 1 
ATOM   786  C CE2 . TYR A 1 100 ? 26.323 26.266 34.071 1.00 15.08 ? 94  TYR A CE2 1 
ATOM   787  C CZ  . TYR A 1 100 ? 27.018 25.077 33.997 1.00 16.31 ? 94  TYR A CZ  1 
ATOM   788  O OH  . TYR A 1 100 ? 26.407 23.913 33.564 1.00 24.16 ? 94  TYR A OH  1 
ATOM   789  N N   . ASN A 1 101 ? 29.117 31.616 35.114 1.00 8.48  ? 95  ASN A N   1 
ATOM   790  C CA  . ASN A 1 101 ? 29.596 32.770 35.872 1.00 10.87 ? 95  ASN A CA  1 
ATOM   791  C C   . ASN A 1 101 ? 29.324 32.484 37.361 1.00 10.85 ? 95  ASN A C   1 
ATOM   792  O O   . ASN A 1 101 ? 28.277 31.918 37.749 1.00 12.60 ? 95  ASN A O   1 
ATOM   793  C CB  . ASN A 1 101 ? 28.741 34.010 35.600 1.00 10.35 ? 95  ASN A CB  1 
ATOM   794  C CG  . ASN A 1 101 ? 29.058 34.657 34.253 1.00 14.39 ? 95  ASN A CG  1 
ATOM   795  O OD1 . ASN A 1 101 ? 29.653 34.032 33.371 1.00 20.18 ? 95  ASN A OD1 1 
ATOM   796  N ND2 . ASN A 1 101 ? 28.626 35.879 34.078 1.00 14.98 ? 95  ASN A ND2 1 
ATOM   797  N N   . THR A 1 102 ? 30.286 32.847 38.176 1.00 10.35 ? 96  THR A N   1 
ATOM   798  C CA  . THR A 1 102 ? 30.143 32.782 39.654 1.00 9.88  ? 96  THR A CA  1 
ATOM   799  C C   . THR A 1 102 ? 30.402 34.187 40.196 1.00 9.88  ? 96  THR A C   1 
ATOM   800  O O   . THR A 1 102 ? 31.065 35.035 39.584 1.00 10.08 ? 96  THR A O   1 
ATOM   801  C CB  . THR A 1 102 ? 31.164 31.813 40.322 1.00 11.97 ? 96  THR A CB  1 
ATOM   802  O OG1 . THR A 1 102 ? 32.511 32.225 40.038 1.00 11.67 ? 96  THR A OG1 1 
ATOM   803  C CG2 . THR A 1 102 ? 30.875 30.399 39.884 1.00 12.11 ? 96  THR A CG2 1 
ATOM   804  N N   . TYR A 1 103 ? 29.862 34.422 41.401 1.00 10.18 ? 97  TYR A N   1 
ATOM   805  C CA  . TYR A 1 103 ? 29.914 35.688 42.073 1.00 10.82 ? 97  TYR A CA  1 
ATOM   806  C C   . TYR A 1 103 ? 30.335 35.507 43.502 1.00 10.90 ? 97  TYR A C   1 
ATOM   807  O O   . TYR A 1 103 ? 29.588 34.988 44.307 1.00 10.82 ? 97  TYR A O   1 
ATOM   808  C CB  . TYR A 1 103 ? 28.531 36.390 41.988 1.00 9.51  ? 97  TYR A CB  1 
ATOM   809  C CG  . TYR A 1 103 ? 28.128 36.713 40.588 1.00 8.63  ? 97  TYR A CG  1 
ATOM   810  C CD1 . TYR A 1 103 ? 28.631 37.846 39.971 1.00 10.21 ? 97  TYR A CD1 1 
ATOM   811  C CD2 . TYR A 1 103 ? 27.373 35.816 39.818 1.00 11.16 ? 97  TYR A CD2 1 
ATOM   812  C CE1 . TYR A 1 103 ? 28.408 38.091 38.609 1.00 12.05 ? 97  TYR A CE1 1 
ATOM   813  C CE2 . TYR A 1 103 ? 27.152 36.060 38.424 1.00 11.43 ? 97  TYR A CE2 1 
ATOM   814  C CZ  . TYR A 1 103 ? 27.688 37.193 37.870 1.00 10.42 ? 97  TYR A CZ  1 
ATOM   815  O OH  . TYR A 1 103 ? 27.533 37.400 36.500 1.00 14.83 ? 97  TYR A OH  1 
ATOM   816  N N   . ILE A 1 104 ? 31.544 35.976 43.801 1.00 10.04 ? 98  ILE A N   1 
ATOM   817  C CA  . ILE A 1 104 ? 32.063 35.854 45.150 1.00 11.85 ? 98  ILE A CA  1 
ATOM   818  C C   . ILE A 1 104 ? 31.943 37.219 45.866 1.00 11.62 ? 98  ILE A C   1 
ATOM   819  O O   . ILE A 1 104 ? 32.258 38.272 45.321 1.00 10.24 ? 98  ILE A O   1 
ATOM   820  C CB  . ILE A 1 104 ? 33.556 35.426 45.180 1.00 12.27 ? 98  ILE A CB  1 
ATOM   821  C CG1 . ILE A 1 104 ? 33.644 33.952 44.754 1.00 15.42 ? 98  ILE A CG1 1 
ATOM   822  C CG2 . ILE A 1 104 ? 34.172 35.659 46.577 1.00 13.67 ? 98  ILE A CG2 1 
ATOM   823  C CD1 . ILE A 1 104 ? 35.063 33.374 44.769 1.00 25.16 ? 98  ILE A CD1 1 
ATOM   824  N N   . SER A 1 105 ? 31.443 37.208 47.099 1.00 9.20  ? 99  SER A N   1 
ATOM   825  C CA  . SER A 1 105 ? 31.382 38.426 47.894 1.00 9.35  ? 99  SER A CA  1 
ATOM   826  C C   . SER A 1 105 ? 32.790 39.036 48.035 1.00 9.99  ? 99  SER A C   1 
ATOM   827  O O   . SER A 1 105 ? 33.713 38.346 48.536 1.00 10.77 ? 99  SER A O   1 
ATOM   828  C CB  . SER A 1 105 ? 30.874 38.075 49.287 1.00 11.15 ? 99  SER A CB  1 
ATOM   829  O OG  . SER A 1 105 ? 31.218 39.091 50.224 1.00 12.17 ? 99  SER A OG  1 
ATOM   830  N N   . LYS A 1 106 ? 33.022 40.223 47.515 1.00 9.98  ? 100 LYS A N   1 
ATOM   831  C CA  . LYS A 1 106 ? 34.327 40.848 47.715 1.00 8.99  ? 100 LYS A CA  1 
ATOM   832  C C   . LYS A 1 106 ? 34.671 41.022 49.197 1.00 11.55 ? 100 LYS A C   1 
ATOM   833  O O   . LYS A 1 106 ? 35.788 40.713 49.633 1.00 12.87 ? 100 LYS A O   1 
ATOM   834  C CB  . LYS A 1 106 ? 34.390 42.173 46.984 1.00 11.26 ? 100 LYS A CB  1 
ATOM   835  C CG  . LYS A 1 106 ? 35.769 42.833 47.128 1.00 12.56 ? 100 LYS A CG  1 
ATOM   836  C CD  . LYS A 1 106 ? 35.841 44.140 46.372 1.00 13.16 ? 100 LYS A CD  1 
ATOM   837  C CE  . LYS A 1 106 ? 37.283 44.725 46.544 1.00 17.44 ? 100 LYS A CE  1 
ATOM   838  N NZ  . LYS A 1 106 ? 37.413 46.133 45.992 1.00 22.98 ? 100 LYS A NZ  1 
ATOM   839  N N   . LYS A 1 107 ? 33.718 41.487 49.985 1.00 10.62 ? 101 LYS A N   1 
ATOM   840  C CA  . LYS A 1 107 ? 33.975 41.698 51.395 1.00 11.55 ? 101 LYS A CA  1 
ATOM   841  C C   . LYS A 1 107 ? 34.405 40.461 52.109 1.00 12.63 ? 101 LYS A C   1 
ATOM   842  O O   . LYS A 1 107 ? 35.215 40.523 53.038 1.00 15.90 ? 101 LYS A O   1 
ATOM   843  C CB  . LYS A 1 107 ? 32.715 42.274 52.036 1.00 12.28 ? 101 LYS A CB  1 
ATOM   844  C CG  . LYS A 1 107 ? 32.732 42.466 53.550 1.00 18.34 ? 101 LYS A CG  1 
ATOM   845  C CD  . LYS A 1 107 ? 33.667 43.507 54.004 1.00 23.10 ? 101 LYS A CD  1 
ATOM   846  C CE  . LYS A 1 107 ? 33.438 43.779 55.512 1.00 23.28 ? 101 LYS A CE  1 
ATOM   847  N NZ  . LYS A 1 107 ? 34.571 44.622 56.074 1.00 27.08 ? 101 LYS A NZ  1 
ATOM   848  N N   . HIS A 1 108 ? 33.850 39.324 51.687 1.00 11.25 ? 102 HIS A N   1 
ATOM   849  C CA  . HIS A 1 108 ? 34.133 38.046 52.344 1.00 11.36 ? 102 HIS A CA  1 
ATOM   850  C C   . HIS A 1 108 ? 34.874 37.094 51.416 1.00 11.85 ? 102 HIS A C   1 
ATOM   851  O O   . HIS A 1 108 ? 34.770 35.894 51.565 1.00 13.22 ? 102 HIS A O   1 
ATOM   852  C CB  . HIS A 1 108 ? 32.805 37.424 52.791 1.00 13.46 ? 102 HIS A CB  1 
ATOM   853  C CG  . HIS A 1 108 ? 32.068 38.271 53.776 1.00 11.79 ? 102 HIS A CG  1 
ATOM   854  N ND1 . HIS A 1 108 ? 32.445 38.370 55.107 1.00 12.66 ? 102 HIS A ND1 1 
ATOM   855  C CD2 . HIS A 1 108 ? 31.025 39.125 53.615 1.00 11.75 ? 102 HIS A CD2 1 
ATOM   856  C CE1 . HIS A 1 108 ? 31.671 39.269 55.713 1.00 13.52 ? 102 HIS A CE1 1 
ATOM   857  N NE2 . HIS A 1 108 ? 30.799 39.739 54.829 1.00 13.15 ? 102 HIS A NE2 1 
ATOM   858  N N   . ALA A 1 109 ? 35.647 37.663 50.505 1.00 12.14 ? 103 ALA A N   1 
ATOM   859  C CA  . ALA A 1 109 ? 36.344 36.817 49.542 1.00 10.68 ? 103 ALA A CA  1 
ATOM   860  C C   . ALA A 1 109 ? 37.301 35.798 50.153 1.00 12.70 ? 103 ALA A C   1 
ATOM   861  O O   . ALA A 1 109 ? 37.455 34.699 49.604 1.00 14.84 ? 103 ALA A O   1 
ATOM   862  C CB  . ALA A 1 109 ? 37.126 37.697 48.567 1.00 14.40 ? 103 ALA A CB  1 
ATOM   863  N N   . GLU A 1 110 ? 37.878 36.148 51.304 1.00 13.13 ? 104 GLU A N   1 
ATOM   864  C CA  . GLU A 1 110 ? 38.845 35.230 51.933 1.00 13.59 ? 104 GLU A CA  1 
ATOM   865  C C   . GLU A 1 110 ? 38.127 33.986 52.515 1.00 16.63 ? 104 GLU A C   1 
ATOM   866  O O   . GLU A 1 110 ? 38.757 32.944 52.795 1.00 19.54 ? 104 GLU A O   1 
ATOM   867  C CB  . GLU A 1 110 ? 39.608 36.003 53.019 1.00 16.18 ? 104 GLU A CB  1 
ATOM   868  C CG  . GLU A 1 110 ? 38.854 36.276 54.347 1.00 24.37 ? 104 GLU A CG  1 
ATOM   869  C CD  . GLU A 1 110 ? 37.741 37.373 54.363 1.00 30.06 ? 104 GLU A CD  1 
ATOM   870  O OE1 . GLU A 1 110 ? 37.476 38.117 53.353 1.00 27.83 ? 104 GLU A OE1 1 
ATOM   871  O OE2 . GLU A 1 110 ? 37.130 37.479 55.469 1.00 32.56 ? 104 GLU A OE2 1 
ATOM   872  N N   . LYS A 1 111 ? 36.825 34.068 52.690 1.00 14.37 ? 105 LYS A N   1 
ATOM   873  C CA  . LYS A 1 111 ? 36.068 32.926 53.196 1.00 13.07 ? 105 LYS A CA  1 
ATOM   874  C C   . LYS A 1 111 ? 35.320 32.185 52.100 1.00 12.91 ? 105 LYS A C   1 
ATOM   875  O O   . LYS A 1 111 ? 34.542 31.265 52.384 1.00 13.29 ? 105 LYS A O   1 
ATOM   876  C CB  . LYS A 1 111 ? 35.075 33.407 54.259 1.00 17.92 ? 105 LYS A CB  1 
ATOM   877  C CG  . LYS A 1 111 ? 35.734 34.048 55.485 1.00 24.79 ? 105 LYS A CG  1 
ATOM   878  C CD  . LYS A 1 111 ? 34.664 34.407 56.572 1.00 30.91 ? 105 LYS A CD  1 
ATOM   879  C CE  . LYS A 1 111 ? 33.817 35.669 56.208 1.00 30.07 ? 105 LYS A CE  1 
ATOM   880  N NZ  . LYS A 1 111 ? 34.495 36.987 56.437 1.00 31.39 ? 105 LYS A NZ  1 
ATOM   881  N N   . ASN A 1 112 ? 35.507 32.591 50.840 1.00 12.64 ? 106 ASN A N   1 
ATOM   882  C CA  . ASN A 1 112 ? 34.838 31.913 49.715 1.00 12.29 ? 106 ASN A CA  1 
ATOM   883  C C   . ASN A 1 112 ? 33.329 31.835 49.837 1.00 10.78 ? 106 ASN A C   1 
ATOM   884  O O   . ASN A 1 112 ? 32.704 30.763 49.712 1.00 12.61 ? 106 ASN A O   1 
ATOM   885  C CB  . ASN A 1 112 ? 35.419 30.487 49.516 1.00 15.93 ? 106 ASN A CB  1 
ATOM   886  C CG  . ASN A 1 112 ? 36.896 30.483 49.108 1.00 18.25 ? 106 ASN A CG  1 
ATOM   887  O OD1 . ASN A 1 112 ? 37.616 31.481 49.240 1.00 19.19 ? 106 ASN A OD1 1 
ATOM   888  N ND2 . ASN A 1 112 ? 37.352 29.337 48.603 1.00 25.89 ? 106 ASN A ND2 1 
ATOM   889  N N   . TRP A 1 113 ? 32.732 33.010 50.078 1.00 11.45 ? 107 TRP A N   1 
ATOM   890  C CA  . TRP A 1 113 ? 31.251 33.137 50.175 1.00 10.73 ? 107 TRP A CA  1 
ATOM   891  C C   . TRP A 1 113 ? 30.743 33.572 48.809 1.00 10.43 ? 107 TRP A C   1 
ATOM   892  O O   . TRP A 1 113 ? 31.196 34.608 48.292 1.00 11.96 ? 107 TRP A O   1 
ATOM   893  C CB  . TRP A 1 113 ? 30.843 34.214 51.176 1.00 9.71  ? 107 TRP A CB  1 
ATOM   894  C CG  . TRP A 1 113 ? 31.034 33.815 52.647 1.00 13.90 ? 107 TRP A CG  1 
ATOM   895  C CD1 . TRP A 1 113 ? 31.672 32.694 53.127 1.00 14.15 ? 107 TRP A CD1 1 
ATOM   896  C CD2 . TRP A 1 113 ? 30.596 34.553 53.792 1.00 12.43 ? 107 TRP A CD2 1 
ATOM   897  N NE1 . TRP A 1 113 ? 31.653 32.701 54.502 1.00 16.99 ? 107 TRP A NE1 1 
ATOM   898  C CE2 . TRP A 1 113 ? 31.000 33.825 54.937 1.00 13.07 ? 107 TRP A CE2 1 
ATOM   899  C CE3 . TRP A 1 113 ? 29.907 35.757 53.964 1.00 11.78 ? 107 TRP A CE3 1 
ATOM   900  C CZ2 . TRP A 1 113 ? 30.727 34.267 56.255 1.00 13.64 ? 107 TRP A CZ2 1 
ATOM   901  C CZ3 . TRP A 1 113 ? 29.634 36.204 55.289 1.00 13.51 ? 107 TRP A CZ3 1 
ATOM   902  C CH2 . TRP A 1 113 ? 30.043 35.454 56.406 1.00 12.88 ? 107 TRP A CH2 1 
ATOM   903  N N   . PHE A 1 114 ? 29.885 32.744 48.221 1.00 9.10  ? 108 PHE A N   1 
ATOM   904  C CA  . PHE A 1 114 ? 29.333 32.942 46.899 1.00 9.62  ? 108 PHE A CA  1 
ATOM   905  C C   . PHE A 1 114 ? 27.830 33.258 46.914 1.00 10.47 ? 108 PHE A C   1 
ATOM   906  O O   . PHE A 1 114 ? 27.118 32.902 47.860 1.00 10.40 ? 108 PHE A O   1 
ATOM   907  C CB  . PHE A 1 114 ? 29.409 31.658 46.025 1.00 10.83 ? 108 PHE A CB  1 
ATOM   908  C CG  . PHE A 1 114 ? 30.805 31.143 45.721 1.00 10.85 ? 108 PHE A CG  1 
ATOM   909  C CD1 . PHE A 1 114 ? 31.545 30.418 46.667 1.00 10.74 ? 108 PHE A CD1 1 
ATOM   910  C CD2 . PHE A 1 114 ? 31.361 31.384 44.445 1.00 14.32 ? 108 PHE A CD2 1 
ATOM   911  C CE1 . PHE A 1 114 ? 32.852 29.924 46.323 1.00 10.46 ? 108 PHE A CE1 1 
ATOM   912  C CE2 . PHE A 1 114 ? 32.655 30.895 44.108 1.00 12.84 ? 108 PHE A CE2 1 
ATOM   913  C CZ  . PHE A 1 114 ? 33.389 30.172 45.052 1.00 10.13 ? 108 PHE A CZ  1 
ATOM   914  N N   . VAL A 1 115 ? 27.388 33.896 45.836 1.00 11.19 ? 109 VAL A N   1 
ATOM   915  C CA  . VAL A 1 115 ? 25.960 34.022 45.549 1.00 9.83  ? 109 VAL A CA  1 
ATOM   916  C C   . VAL A 1 115 ? 25.547 32.604 45.084 1.00 9.97  ? 109 VAL A C   1 
ATOM   917  O O   . VAL A 1 115 ? 26.241 31.941 44.248 1.00 11.22 ? 109 VAL A O   1 
ATOM   918  C CB  . VAL A 1 115 ? 25.716 34.968 44.376 1.00 9.81  ? 109 VAL A CB  1 
ATOM   919  C CG1 . VAL A 1 115 ? 24.260 34.934 43.965 1.00 12.37 ? 109 VAL A CG1 1 
ATOM   920  C CG2 . VAL A 1 115 ? 26.143 36.401 44.783 1.00 12.17 ? 109 VAL A CG2 1 
ATOM   921  N N   . GLY A 1 116 ? 24.473 32.035 45.622 1.00 9.68  ? 110 GLY A N   1 
ATOM   922  C CA  . GLY A 1 116 ? 24.062 30.709 45.185 1.00 12.75 ? 110 GLY A CA  1 
ATOM   923  C C   . GLY A 1 116 ? 22.600 30.442 45.473 1.00 12.34 ? 110 GLY A C   1 
ATOM   924  O O   . GLY A 1 116 ? 22.035 31.026 46.426 1.00 13.11 ? 110 GLY A O   1 
ATOM   925  N N   . LEU A 1 117 ? 21.979 29.614 44.625 1.00 11.56 ? 111 LEU A N   1 
ATOM   926  C CA  . LEU A 1 117 ? 20.571 29.231 44.843 1.00 12.82 ? 111 LEU A CA  1 
ATOM   927  C C   . LEU A 1 117 ? 20.462 27.745 44.959 1.00 12.71 ? 111 LEU A C   1 
ATOM   928  O O   . LEU A 1 117 ? 21.059 26.996 44.170 1.00 15.23 ? 111 LEU A O   1 
ATOM   929  C CB  . LEU A 1 117 ? 19.644 29.685 43.697 1.00 12.05 ? 111 LEU A CB  1 
ATOM   930  C CG  . LEU A 1 117 ? 19.499 31.200 43.495 1.00 12.93 ? 111 LEU A CG  1 
ATOM   931  C CD1 . LEU A 1 117 ? 18.755 31.495 42.238 1.00 12.96 ? 111 LEU A CD1 1 
ATOM   932  C CD2 . LEU A 1 117 ? 18.789 31.853 44.718 1.00 18.91 ? 111 LEU A CD2 1 
ATOM   933  N N   . LYS A 1 118 ? 19.707 27.319 45.968 1.00 13.58 ? 112 LYS A N   1 
ATOM   934  C CA  . LYS A 1 118 ? 19.404 25.917 46.204 1.00 13.01 ? 112 LYS A CA  1 
ATOM   935  C C   . LYS A 1 118 ? 18.402 25.390 45.184 1.00 14.00 ? 112 LYS A C   1 
ATOM   936  O O   . LYS A 1 118 ? 17.742 26.166 44.489 1.00 15.98 ? 112 LYS A O   1 
ATOM   937  C CB  . LYS A 1 118 ? 18.842 25.741 47.624 1.00 14.78 ? 112 LYS A CB  1 
ATOM   938  C CG  . LYS A 1 118 ? 19.878 25.987 48.727 1.00 14.81 ? 112 LYS A CG  1 
ATOM   939  C CD  . LYS A 1 118 ? 19.245 25.901 50.117 1.00 14.91 ? 112 LYS A CD  1 
ATOM   940  C CE  . LYS A 1 118 ? 18.583 24.537 50.400 1.00 15.98 ? 112 LYS A CE  1 
ATOM   941  N NZ  . LYS A 1 118 ? 19.469 23.378 50.249 1.00 15.34 ? 112 LYS A NZ  1 
ATOM   942  N N   . LYS A 1 119 ? 18.284 24.070 45.131 1.00 16.55 ? 113 LYS A N   1 
ATOM   943  C CA  . LYS A 1 119 ? 17.333 23.471 44.204 1.00 19.33 ? 113 LYS A CA  1 
ATOM   944  C C   . LYS A 1 119 ? 15.890 23.899 44.471 1.00 20.84 ? 113 LYS A C   1 
ATOM   945  O O   . LYS A 1 119 ? 15.063 23.899 43.549 1.00 21.96 ? 113 LYS A O   1 
ATOM   946  C CB  . LYS A 1 119 ? 17.436 21.930 44.228 1.00 20.90 ? 113 LYS A CB  1 
ATOM   947  C CG  . LYS A 1 119 ? 18.819 21.395 43.833 1.00 27.25 ? 113 LYS A CG  1 
ATOM   948  C CD  . LYS A 1 119 ? 18.901 19.868 44.015 1.00 26.67 ? 113 LYS A CD  1 
ATOM   949  C CE  . LYS A 1 119 ? 20.218 19.326 43.466 1.00 30.01 ? 113 LYS A CE  1 
ATOM   950  N NZ  . LYS A 1 119 ? 21.416 20.106 44.025 1.00 31.98 ? 113 LYS A NZ  1 
ATOM   951  N N   . ASN A 1 120 ? 15.571 24.273 45.723 1.00 19.77 ? 114 ASN A N   1 
ATOM   952  C CA  . ASN A 1 120 ? 14.223 24.720 46.030 1.00 20.37 ? 114 ASN A CA  1 
ATOM   953  C C   . ASN A 1 120 ? 13.996 26.188 45.834 1.00 18.38 ? 114 ASN A C   1 
ATOM   954  O O   . ASN A 1 120 ? 12.917 26.716 46.139 1.00 20.64 ? 114 ASN A O   1 
ATOM   955  C CB  . ASN A 1 120 ? 13.790 24.307 47.450 1.00 17.32 ? 114 ASN A CB  1 
ATOM   956  C CG  . ASN A 1 120 ? 14.620 24.960 48.533 1.00 20.60 ? 114 ASN A CG  1 
ATOM   957  O OD1 . ASN A 1 120 ? 15.380 25.891 48.262 1.00 17.58 ? 114 ASN A OD1 1 
ATOM   958  N ND2 . ASN A 1 120 ? 14.503 24.466 49.769 1.00 22.36 ? 114 ASN A ND2 1 
ATOM   959  N N   . GLY A 1 121 ? 15.017 26.884 45.319 1.00 18.56 ? 115 GLY A N   1 
ATOM   960  C CA  . GLY A 1 121 ? 14.843 28.287 45.036 1.00 17.67 ? 115 GLY A CA  1 
ATOM   961  C C   . GLY A 1 121 ? 15.267 29.257 46.130 1.00 15.83 ? 115 GLY A C   1 
ATOM   962  O O   . GLY A 1 121 ? 15.218 30.474 45.926 1.00 19.51 ? 115 GLY A O   1 
ATOM   963  N N   . SER A 1 122 ? 15.621 28.728 47.278 1.00 13.43 ? 116 SER A N   1 
ATOM   964  C CA  . SER A 1 122 ? 16.048 29.647 48.347 1.00 11.92 ? 116 SER A CA  1 
ATOM   965  C C   . SER A 1 122 ? 17.523 29.936 48.154 1.00 15.14 ? 116 SER A C   1 
ATOM   966  O O   . SER A 1 122 ? 18.281 29.125 47.586 1.00 14.70 ? 116 SER A O   1 
ATOM   967  C CB  . SER A 1 122 ? 15.803 29.011 49.728 1.00 17.04 ? 116 SER A CB  1 
ATOM   968  O OG  . SER A 1 122 ? 16.563 27.828 49.942 1.00 18.22 ? 116 SER A OG  1 
ATOM   969  N N   . CYS A 1 123 ? 17.941 31.083 48.653 1.00 13.95 ? 117 CYS A N   1 
ATOM   970  C CA  . CYS A 1 123 ? 19.344 31.462 48.569 1.00 12.02 ? 117 CYS A CA  1 
ATOM   971  C C   . CYS A 1 123 ? 20.199 30.704 49.562 1.00 13.64 ? 117 CYS A C   1 
ATOM   972  O O   . CYS A 1 123 ? 19.762 30.437 50.709 1.00 13.82 ? 117 CYS A O   1 
ATOM   973  C CB  . CYS A 1 123 ? 19.546 32.935 48.906 1.00 13.43 ? 117 CYS A CB  1 
ATOM   974  S SG  . CYS A 1 123 ? 18.794 34.047 47.713 1.00 20.95 ? 117 CYS A SG  1 
ATOM   975  N N   . LYS A 1 124 ? 21.429 30.398 49.182 1.00 12.66 ? 118 LYS A N   1 
ATOM   976  C CA  . LYS A 1 124 ? 22.347 29.759 50.111 1.00 11.63 ? 118 LYS A CA  1 
ATOM   977  C C   . LYS A 1 124 ? 23.015 30.847 50.989 1.00 14.99 ? 118 LYS A C   1 
ATOM   978  O O   . LYS A 1 124 ? 23.296 31.969 50.543 1.00 14.19 ? 118 LYS A O   1 
ATOM   979  C CB  . LYS A 1 124 ? 23.459 29.015 49.340 1.00 18.72 ? 118 LYS A CB  1 
ATOM   980  C CG  . LYS A 1 124 ? 23.019 27.617 48.823 1.00 23.65 ? 118 LYS A CG  1 
ATOM   981  C CD  . LYS A 1 124 ? 24.177 26.789 48.440 1.00 31.80 ? 118 LYS A CD  1 
ATOM   982  C CE  . LYS A 1 124 ? 24.801 26.215 49.611 1.00 22.53 ? 118 LYS A CE  1 
ATOM   983  N NZ  . LYS A 1 124 ? 24.087 24.916 49.972 1.00 26.17 ? 118 LYS A NZ  1 
ATOM   984  N N   . ARG A 1 125 ? 23.271 30.515 52.251 1.00 10.61 ? 119 ARG A N   1 
ATOM   985  C CA  . ARG A 1 125 ? 24.001 31.407 53.125 1.00 10.40 ? 119 ARG A CA  1 
ATOM   986  C C   . ARG A 1 125 ? 25.473 31.290 52.789 1.00 12.34 ? 119 ARG A C   1 
ATOM   987  O O   . ARG A 1 125 ? 25.997 30.202 52.547 1.00 10.43 ? 119 ARG A O   1 
ATOM   988  C CB  . ARG A 1 125 ? 23.692 31.047 54.602 1.00 11.42 ? 119 ARG A CB  1 
ATOM   989  C CG  . ARG A 1 125 ? 24.016 32.199 55.565 1.00 11.43 ? 119 ARG A CG  1 
ATOM   990  C CD  . ARG A 1 125 ? 23.498 31.858 57.022 1.00 10.60 ? 119 ARG A CD  1 
ATOM   991  N NE  . ARG A 1 125 ? 24.307 30.836 57.659 1.00 12.47 ? 119 ARG A NE  1 
ATOM   992  C CZ  . ARG A 1 125 ? 25.425 31.030 58.339 1.00 11.06 ? 119 ARG A CZ  1 
ATOM   993  N NH1 . ARG A 1 125 ? 25.978 32.230 58.461 1.00 11.93 ? 119 ARG A NH1 1 
ATOM   994  N NH2 . ARG A 1 125 ? 25.998 30.007 58.951 1.00 13.00 ? 119 ARG A NH2 1 
ATOM   995  N N   . GLY A 1 126 ? 26.171 32.422 52.836 1.00 11.10 ? 120 GLY A N   1 
ATOM   996  C CA  . GLY A 1 126 ? 27.566 32.410 52.440 1.00 13.36 ? 120 GLY A CA  1 
ATOM   997  C C   . GLY A 1 126 ? 28.414 31.258 52.920 1.00 11.50 ? 120 GLY A C   1 
ATOM   998  O O   . GLY A 1 126 ? 29.051 30.599 52.093 1.00 11.72 ? 120 GLY A O   1 
ATOM   999  N N   . PRO A 1 127 ? 28.438 30.972 54.211 1.00 11.73 ? 121 PRO A N   1 
ATOM   1000 C CA  . PRO A 1 127 ? 29.271 29.858 54.703 1.00 14.42 ? 121 PRO A CA  1 
ATOM   1001 C C   . PRO A 1 127 ? 28.897 28.486 54.168 1.00 14.89 ? 121 PRO A C   1 
ATOM   1002 O O   . PRO A 1 127 ? 29.710 27.538 54.255 1.00 18.41 ? 121 PRO A O   1 
ATOM   1003 C CB  . PRO A 1 127 ? 29.041 29.888 56.235 1.00 17.59 ? 121 PRO A CB  1 
ATOM   1004 C CG  . PRO A 1 127 ? 28.667 31.274 56.526 1.00 13.53 ? 121 PRO A CG  1 
ATOM   1005 C CD  . PRO A 1 127 ? 27.902 31.800 55.323 1.00 12.74 ? 121 PRO A CD  1 
ATOM   1006 N N   . ARG A 1 128 ? 27.680 28.344 53.669 1.00 14.30 ? 122 ARG A N   1 
ATOM   1007 C CA  . ARG A 1 128 ? 27.236 27.063 53.152 1.00 16.48 ? 122 ARG A CA  1 
ATOM   1008 C C   . ARG A 1 128 ? 27.624 26.906 51.683 1.00 15.82 ? 122 ARG A C   1 
ATOM   1009 O O   . ARG A 1 128 ? 27.334 25.873 51.104 1.00 15.66 ? 122 ARG A O   1 
ATOM   1010 C CB  . ARG A 1 128 ? 25.721 26.894 53.277 1.00 15.39 ? 122 ARG A CB  1 
ATOM   1011 C CG  . ARG A 1 128 ? 25.209 26.981 54.755 1.00 18.82 ? 122 ARG A CG  1 
ATOM   1012 C CD  . ARG A 1 128 ? 26.156 26.317 55.841 1.00 25.66 ? 122 ARG A CD  1 
ATOM   1013 N NE  . ARG A 1 128 ? 25.656 26.745 57.173 1.00 21.85 ? 122 ARG A NE  1 
ATOM   1014 C CZ  . ARG A 1 128 ? 26.290 26.635 58.329 1.00 24.79 ? 122 ARG A CZ  1 
ATOM   1015 N NH1 . ARG A 1 128 ? 27.515 26.100 58.403 1.00 28.57 ? 122 ARG A NH1 1 
ATOM   1016 N NH2 . ARG A 1 128 ? 25.665 27.043 59.445 1.00 33.20 ? 122 ARG A NH2 1 
ATOM   1017 N N   . THR A 1 129 ? 28.206 27.961 51.090 1.00 11.25 ? 123 THR A N   1 
ATOM   1018 C CA  . THR A 1 129 ? 28.619 27.827 49.700 1.00 14.23 ? 123 THR A CA  1 
ATOM   1019 C C   . THR A 1 129 ? 30.100 27.474 49.657 1.00 12.38 ? 123 THR A C   1 
ATOM   1020 O O   . THR A 1 129 ? 30.843 27.709 50.626 1.00 15.05 ? 123 THR A O   1 
ATOM   1021 C CB  . THR A 1 129 ? 28.438 29.156 48.875 1.00 11.63 ? 123 THR A CB  1 
ATOM   1022 O OG1 . THR A 1 129 ? 29.301 30.197 49.388 1.00 11.21 ? 123 THR A OG1 1 
ATOM   1023 C CG2 . THR A 1 129 ? 26.988 29.601 48.886 1.00 10.80 ? 123 THR A CG2 1 
ATOM   1024 N N   . HIS A 1 130 ? 30.549 26.924 48.512 1.00 14.41 ? 124 HIS A N   1 
ATOM   1025 C CA  . HIS A 1 130 ? 31.991 26.668 48.298 1.00 15.70 ? 124 HIS A CA  1 
ATOM   1026 C C   . HIS A 1 130 ? 32.232 26.289 46.853 1.00 14.52 ? 124 HIS A C   1 
ATOM   1027 O O   . HIS A 1 130 ? 31.273 25.920 46.151 1.00 14.90 ? 124 HIS A O   1 
ATOM   1028 C CB  . HIS A 1 130 ? 32.593 25.577 49.202 1.00 21.22 ? 124 HIS A CB  1 
ATOM   1029 C CG  . HIS A 1 130 ? 31.794 24.328 49.265 1.00 23.49 ? 124 HIS A CG  1 
ATOM   1030 N ND1 . HIS A 1 130 ? 30.937 24.045 50.316 1.00 25.22 ? 124 HIS A ND1 1 
ATOM   1031 C CD2 . HIS A 1 130 ? 31.699 23.284 48.402 1.00 25.12 ? 124 HIS A CD2 1 
ATOM   1032 C CE1 . HIS A 1 130 ? 30.345 22.882 50.087 1.00 31.02 ? 124 HIS A CE1 1 
ATOM   1033 N NE2 . HIS A 1 130 ? 30.786 22.401 48.937 1.00 31.10 ? 124 HIS A NE2 1 
ATOM   1034 N N   . TYR A 1 131 ? 33.497 26.379 46.435 1.00 13.43 ? 125 TYR A N   1 
ATOM   1035 C CA  . TYR A 1 131 ? 33.836 25.930 45.087 1.00 18.47 ? 125 TYR A CA  1 
ATOM   1036 C C   . TYR A 1 131 ? 33.379 24.495 44.914 1.00 14.86 ? 125 TYR A C   1 
ATOM   1037 O O   . TYR A 1 131 ? 33.429 23.693 45.856 1.00 17.68 ? 125 TYR A O   1 
ATOM   1038 C CB  . TYR A 1 131 ? 35.327 25.990 44.877 1.00 15.40 ? 125 TYR A CB  1 
ATOM   1039 C CG  . TYR A 1 131 ? 35.846 27.388 44.524 1.00 11.12 ? 125 TYR A CG  1 
ATOM   1040 C CD1 . TYR A 1 131 ? 35.553 27.951 43.268 1.00 13.38 ? 125 TYR A CD1 1 
ATOM   1041 C CD2 . TYR A 1 131 ? 36.670 28.089 45.385 1.00 13.52 ? 125 TYR A CD2 1 
ATOM   1042 C CE1 . TYR A 1 131 ? 36.096 29.191 42.891 1.00 11.91 ? 125 TYR A CE1 1 
ATOM   1043 C CE2 . TYR A 1 131 ? 37.223 29.340 45.014 1.00 13.62 ? 125 TYR A CE2 1 
ATOM   1044 C CZ  . TYR A 1 131 ? 36.896 29.869 43.724 1.00 13.07 ? 125 TYR A CZ  1 
ATOM   1045 O OH  . TYR A 1 131 ? 37.454 31.039 43.307 1.00 15.42 ? 125 TYR A OH  1 
ATOM   1046 N N   . GLY A 1 132 ? 32.935 24.167 43.707 1.00 14.63 ? 126 GLY A N   1 
ATOM   1047 C CA  . GLY A 1 132 ? 32.498 22.834 43.400 1.00 18.56 ? 126 GLY A CA  1 
ATOM   1048 C C   . GLY A 1 132 ? 31.031 22.598 43.463 1.00 20.88 ? 126 GLY A C   1 
ATOM   1049 O O   . GLY A 1 132 ? 30.562 21.591 42.958 1.00 22.86 ? 126 GLY A O   1 
ATOM   1050 N N   . GLN A 1 133 ? 30.267 23.530 44.042 1.00 15.72 ? 127 GLN A N   1 
ATOM   1051 C CA  . GLN A 1 133 ? 28.836 23.340 44.106 1.00 15.97 ? 127 GLN A CA  1 
ATOM   1052 C C   . GLN A 1 133 ? 28.081 23.750 42.841 1.00 17.75 ? 127 GLN A C   1 
ATOM   1053 O O   . GLN A 1 133 ? 28.526 24.615 42.071 1.00 19.35 ? 127 GLN A O   1 
ATOM   1054 C CB  . GLN A 1 133 ? 28.249 24.187 45.241 1.00 17.98 ? 127 GLN A CB  1 
ATOM   1055 C CG  . GLN A 1 133 ? 28.611 23.747 46.635 1.00 18.25 ? 127 GLN A CG  1 
ATOM   1056 C CD  . GLN A 1 133 ? 27.983 24.672 47.634 1.00 19.52 ? 127 GLN A CD  1 
ATOM   1057 O OE1 . GLN A 1 133 ? 27.859 25.884 47.376 1.00 18.53 ? 127 GLN A OE1 1 
ATOM   1058 N NE2 . GLN A 1 133 ? 27.570 24.125 48.786 1.00 20.46 ? 127 GLN A NE2 1 
ATOM   1059 N N   . LYS A 1 134 ? 26.939 23.114 42.615 1.00 14.12 ? 128 LYS A N   1 
ATOM   1060 C CA  . LYS A 1 134 ? 26.115 23.508 41.517 1.00 14.65 ? 128 LYS A CA  1 
ATOM   1061 C C   . LYS A 1 134 ? 25.360 24.820 41.831 1.00 14.25 ? 128 LYS A C   1 
ATOM   1062 O O   . LYS A 1 134 ? 24.973 25.581 40.934 1.00 15.39 ? 128 LYS A O   1 
ATOM   1063 C CB  . LYS A 1 134 ? 25.098 22.404 41.206 1.00 20.53 ? 128 LYS A CB  1 
ATOM   1064 C CG  . LYS A 1 134 ? 25.774 21.052 40.904 1.00 26.56 ? 128 LYS A CG  1 
ATOM   1065 C CD  . LYS A 1 134 ? 26.533 21.101 39.601 1.00 31.75 ? 128 LYS A CD  1 
ATOM   1066 C CE  . LYS A 1 134 ? 27.092 19.699 39.275 1.00 30.72 ? 128 LYS A CE  1 
ATOM   1067 N NZ  . LYS A 1 134 ? 28.227 19.663 38.284 1.00 36.00 ? 128 LYS A NZ  1 
ATOM   1068 N N   . ALA A 1 135 ? 25.143 25.071 43.125 1.00 14.06 ? 129 ALA A N   1 
ATOM   1069 C CA  . ALA A 1 135 ? 24.340 26.266 43.521 1.00 13.29 ? 129 ALA A CA  1 
ATOM   1070 C C   . ALA A 1 135 ? 24.948 27.591 43.122 1.00 10.91 ? 129 ALA A C   1 
ATOM   1071 O O   . ALA A 1 135 ? 24.205 28.577 42.967 1.00 11.03 ? 129 ALA A O   1 
ATOM   1072 C CB  . ALA A 1 135 ? 24.100 26.274 45.059 1.00 12.86 ? 129 ALA A CB  1 
ATOM   1073 N N   . ILE A 1 136 ? 26.270 27.619 42.949 1.00 11.97 ? 130 ILE A N   1 
ATOM   1074 C CA  . ILE A 1 136 ? 26.963 28.855 42.667 1.00 9.77  ? 130 ILE A CA  1 
ATOM   1075 C C   . ILE A 1 136 ? 27.119 29.168 41.193 1.00 10.09 ? 130 ILE A C   1 
ATOM   1076 O O   . ILE A 1 136 ? 27.654 30.215 40.846 1.00 9.87  ? 130 ILE A O   1 
ATOM   1077 C CB  . ILE A 1 136 ? 28.388 28.844 43.316 1.00 10.41 ? 130 ILE A CB  1 
ATOM   1078 C CG1 . ILE A 1 136 ? 29.259 27.723 42.706 1.00 12.16 ? 130 ILE A CG1 1 
ATOM   1079 C CG2 . ILE A 1 136 ? 28.237 28.642 44.845 1.00 13.74 ? 130 ILE A CG2 1 
ATOM   1080 C CD1 . ILE A 1 136 ? 30.781 27.856 43.167 1.00 15.87 ? 130 ILE A CD1 1 
ATOM   1081 N N   . LEU A 1 137 ? 26.605 28.246 40.339 1.00 11.96 ? 131 LEU A N   1 
ATOM   1082 C CA  . LEU A 1 137 ? 26.791 28.381 38.883 1.00 11.60 ? 131 LEU A CA  1 
ATOM   1083 C C   . LEU A 1 137 ? 25.642 29.102 38.157 1.00 11.39 ? 131 LEU A C   1 
ATOM   1084 O O   . LEU A 1 137 ? 24.507 28.619 38.181 1.00 14.88 ? 131 LEU A O   1 
ATOM   1085 C CB  . LEU A 1 137 ? 27.003 27.008 38.260 1.00 12.32 ? 131 LEU A CB  1 
ATOM   1086 C CG  . LEU A 1 137 ? 28.186 26.215 38.843 1.00 15.19 ? 131 LEU A CG  1 
ATOM   1087 C CD1 . LEU A 1 137 ? 28.127 24.834 38.220 1.00 16.89 ? 131 LEU A CD1 1 
ATOM   1088 C CD2 . LEU A 1 137 ? 29.505 26.873 38.550 1.00 12.92 ? 131 LEU A CD2 1 
ATOM   1089 N N   . PHE A 1 138 ? 25.959 30.206 37.520 1.00 11.05 ? 132 PHE A N   1 
ATOM   1090 C CA  . PHE A 1 138 ? 24.931 30.980 36.821 1.00 10.50 ? 132 PHE A CA  1 
ATOM   1091 C C   . PHE A 1 138 ? 25.243 31.189 35.351 1.00 15.28 ? 132 PHE A C   1 
ATOM   1092 O O   . PHE A 1 138 ? 26.403 31.108 34.889 1.00 13.47 ? 132 PHE A O   1 
ATOM   1093 C CB  . PHE A 1 138 ? 24.807 32.377 37.451 1.00 11.55 ? 132 PHE A CB  1 
ATOM   1094 C CG  . PHE A 1 138 ? 24.231 32.367 38.836 1.00 12.15 ? 132 PHE A CG  1 
ATOM   1095 C CD1 . PHE A 1 138 ? 25.042 32.175 39.932 1.00 12.13 ? 132 PHE A CD1 1 
ATOM   1096 C CD2 . PHE A 1 138 ? 22.860 32.518 39.003 1.00 12.10 ? 132 PHE A CD2 1 
ATOM   1097 C CE1 . PHE A 1 138 ? 24.496 32.116 41.239 1.00 13.63 ? 132 PHE A CE1 1 
ATOM   1098 C CE2 . PHE A 1 138 ? 22.299 32.469 40.296 1.00 11.45 ? 132 PHE A CE2 1 
ATOM   1099 C CZ  . PHE A 1 138 ? 23.114 32.261 41.415 1.00 14.27 ? 132 PHE A CZ  1 
ATOM   1100 N N   . LEU A 1 139 ? 24.199 31.451 34.585 1.00 12.13 ? 133 LEU A N   1 
ATOM   1101 C CA  . LEU A 1 139 ? 24.349 31.795 33.179 1.00 11.14 ? 133 LEU A CA  1 
ATOM   1102 C C   . LEU A 1 139 ? 23.585 33.070 32.962 1.00 14.15 ? 133 LEU A C   1 
ATOM   1103 O O   . LEU A 1 139 ? 22.398 33.164 33.292 1.00 17.08 ? 133 LEU A O   1 
ATOM   1104 C CB  . LEU A 1 139 ? 23.729 30.712 32.280 1.00 13.25 ? 133 LEU A CB  1 
ATOM   1105 C CG  . LEU A 1 139 ? 24.531 29.416 32.249 1.00 14.17 ? 133 LEU A CG  1 
ATOM   1106 C CD1 . LEU A 1 139 ? 23.668 28.351 31.523 1.00 20.86 ? 133 LEU A CD1 1 
ATOM   1107 C CD2 . LEU A 1 139 ? 25.838 29.641 31.458 1.00 18.14 ? 133 LEU A CD2 1 
ATOM   1108 N N   . PRO A 1 140 ? 24.240 34.098 32.464 1.00 14.22 ? 134 PRO A N   1 
ATOM   1109 C CA  . PRO A 1 140 ? 23.534 35.345 32.217 1.00 14.97 ? 134 PRO A CA  1 
ATOM   1110 C C   . PRO A 1 140 ? 22.748 35.245 30.920 1.00 17.35 ? 134 PRO A C   1 
ATOM   1111 O O   . PRO A 1 140 ? 23.370 35.168 29.832 1.00 22.90 ? 134 PRO A O   1 
ATOM   1112 C CB  . PRO A 1 140 ? 24.664 36.372 32.114 1.00 19.86 ? 134 PRO A CB  1 
ATOM   1113 C CG  . PRO A 1 140 ? 25.779 35.570 31.447 1.00 23.10 ? 134 PRO A CG  1 
ATOM   1114 C CD  . PRO A 1 140 ? 25.686 34.221 32.153 1.00 16.13 ? 134 PRO A CD  1 
ATOM   1115 N N   . LEU A 1 141 ? 21.413 35.291 30.990 1.00 15.86 ? 135 LEU A N   1 
ATOM   1116 C CA  . LEU A 1 141 ? 20.588 35.200 29.764 1.00 15.48 ? 135 LEU A CA  1 
ATOM   1117 C C   . LEU A 1 141 ? 19.992 36.534 29.401 1.00 19.89 ? 135 LEU A C   1 
ATOM   1118 O O   . LEU A 1 141 ? 19.772 37.393 30.251 1.00 18.75 ? 135 LEU A O   1 
ATOM   1119 C CB  . LEU A 1 141 ? 19.420 34.222 29.960 1.00 16.33 ? 135 LEU A CB  1 
ATOM   1120 C CG  . LEU A 1 141 ? 19.755 32.890 30.604 1.00 14.12 ? 135 LEU A CG  1 
ATOM   1121 C CD1 . LEU A 1 141 ? 18.494 32.055 30.662 1.00 18.70 ? 135 LEU A CD1 1 
ATOM   1122 C CD2 . LEU A 1 141 ? 20.832 32.121 29.775 1.00 16.36 ? 135 LEU A CD2 1 
ATOM   1123 N N   . PRO A 1 142 ? 19.688 36.742 28.121 1.00 22.92 ? 136 PRO A N   1 
ATOM   1124 C CA  . PRO A 1 142 ? 19.090 38.022 27.721 1.00 23.59 ? 136 PRO A CA  1 
ATOM   1125 C C   . PRO A 1 142 ? 17.685 38.160 28.295 1.00 21.82 ? 136 PRO A C   1 
ATOM   1126 O O   . PRO A 1 142 ? 16.991 37.181 28.521 1.00 20.95 ? 136 PRO A O   1 
ATOM   1127 C CB  . PRO A 1 142 ? 19.052 37.934 26.177 1.00 26.48 ? 136 PRO A CB  1 
ATOM   1128 C CG  . PRO A 1 142 ? 20.238 37.055 25.869 1.00 26.86 ? 136 PRO A CG  1 
ATOM   1129 C CD  . PRO A 1 142 ? 20.128 35.963 26.947 1.00 27.51 ? 136 PRO A CD  1 
ATOM   1130 N N   . VAL A 1 143 ? 17.278 39.402 28.557 1.00 24.86 ? 137 VAL A N   1 
ATOM   1131 C CA  . VAL A 1 143 ? 15.944 39.689 29.073 1.00 28.62 ? 137 VAL A CA  1 
ATOM   1132 C C   . VAL A 1 143 ? 14.906 39.661 27.946 1.00 32.03 ? 137 VAL A C   1 
ATOM   1133 O O   . VAL A 1 143 ? 13.755 39.248 28.211 1.00 34.78 ? 137 VAL A O   1 
ATOM   1134 C CB  . VAL A 1 143 ? 15.889 41.070 29.736 1.00 28.34 ? 137 VAL A CB  1 
ATOM   1135 C CG1 . VAL A 1 143 ? 16.862 41.105 30.927 1.00 30.02 ? 137 VAL A CG1 1 
ATOM   1136 C CG2 . VAL A 1 143 ? 16.262 42.158 28.715 1.00 34.50 ? 137 VAL A CG2 1 
ATOM   1137 N N   . HIS B 1 3   C -1.482 26.664 60.548 1.00 28.31 ? 1   HIS B N   1 
ATOM   1138 C CA  . HIS B 1 3   C -0.403 25.864 61.221 1.00 23.00 ? 1   HIS B CA  1 
ATOM   1139 C C   . HIS B 1 3   C -0.080 24.481 60.618 1.00 24.51 ? 1   HIS B C   1 
ATOM   1140 O O   . HIS B 1 3   C -0.961 23.748 60.135 1.00 22.29 ? 1   HIS B O   1 
ATOM   1141 C CB  . HIS B 1 3   C -0.784 25.621 62.695 1.00 24.99 ? 1   HIS B CB  1 
ATOM   1142 C CG  . HIS B 1 3   C -0.606 26.804 63.583 1.00 27.29 ? 1   HIS B CG  1 
ATOM   1143 N ND1 . HIS B 1 3   C -1.101 26.834 64.869 1.00 25.37 ? 1   HIS B ND1 1 
ATOM   1144 C CD2 . HIS B 1 3   C 0.083  27.960 63.415 1.00 26.27 ? 1   HIS B CD2 1 
ATOM   1145 C CE1 . HIS B 1 3   C -0.722 27.956 65.459 1.00 33.18 ? 1   HIS B CE1 1 
ATOM   1146 N NE2 . HIS B 1 3   C -0.001 28.657 64.600 1.00 33.00 ? 1   HIS B NE2 1 
ATOM   1147 N N   . HIS B 1 4   D 1.182  24.101 60.680 1.00 18.40 ? 1   HIS B N   1 
ATOM   1148 C CA  . HIS B 1 4   D 1.581  22.789 60.232 1.00 19.78 ? 1   HIS B CA  1 
ATOM   1149 C C   . HIS B 1 4   D 1.922  21.933 61.462 1.00 16.27 ? 1   HIS B C   1 
ATOM   1150 O O   . HIS B 1 4   D 2.258  20.772 61.338 1.00 17.93 ? 1   HIS B O   1 
ATOM   1151 C CB  . HIS B 1 4   D 2.761  22.886 59.259 1.00 26.97 ? 1   HIS B CB  1 
ATOM   1152 C CG  . HIS B 1 4   D 2.449  23.699 58.031 1.00 31.51 ? 1   HIS B CG  1 
ATOM   1153 N ND1 . HIS B 1 4   D 1.331  23.468 57.253 1.00 39.31 ? 1   HIS B ND1 1 
ATOM   1154 C CD2 . HIS B 1 4   D 3.051  24.798 57.507 1.00 38.59 ? 1   HIS B CD2 1 
ATOM   1155 C CE1 . HIS B 1 4   D 1.252  24.392 56.310 1.00 35.80 ? 1   HIS B CE1 1 
ATOM   1156 N NE2 . HIS B 1 4   D 2.285  25.211 56.442 1.00 36.93 ? 1   HIS B NE2 1 
ATOM   1157 N N   . HIS B 1 5   E 1.802  22.534 62.655 1.00 15.04 ? 1   HIS B N   1 
ATOM   1158 C CA  . HIS B 1 5   E 2.136  21.856 63.880 1.00 12.95 ? 1   HIS B CA  1 
ATOM   1159 C C   . HIS B 1 5   E 1.117  22.116 64.992 1.00 9.33  ? 1   HIS B C   1 
ATOM   1160 O O   . HIS B 1 5   E 0.364  23.090 64.937 1.00 11.48 ? 1   HIS B O   1 
ATOM   1161 C CB  . HIS B 1 5   E 3.522  22.382 64.350 1.00 14.92 ? 1   HIS B CB  1 
ATOM   1162 C CG  . HIS B 1 5   E 4.604  22.053 63.385 1.00 11.97 ? 1   HIS B CG  1 
ATOM   1163 N ND1 . HIS B 1 5   E 5.182  20.809 63.320 1.00 14.48 ? 1   HIS B ND1 1 
ATOM   1164 C CD2 . HIS B 1 5   E 5.150  22.788 62.379 1.00 15.27 ? 1   HIS B CD2 1 
ATOM   1165 C CE1 . HIS B 1 5   E 6.041  20.784 62.302 1.00 18.00 ? 1   HIS B CE1 1 
ATOM   1166 N NE2 . HIS B 1 5   E 6.032  21.970 61.722 1.00 16.83 ? 1   HIS B NE2 1 
ATOM   1167 N N   . HIS B 1 6   F 1.142  21.240 66.001 1.00 10.43 ? 1   HIS B N   1 
ATOM   1168 C CA  . HIS B 1 6   F 0.263  21.370 67.176 1.00 11.03 ? 1   HIS B CA  1 
ATOM   1169 C C   . HIS B 1 6   F 0.598  22.619 67.981 1.00 9.61  ? 1   HIS B C   1 
ATOM   1170 O O   . HIS B 1 6   F 1.546  23.409 67.644 1.00 11.90 ? 1   HIS B O   1 
ATOM   1171 C CB  . HIS B 1 6   F 0.457  20.170 68.064 1.00 11.72 ? 1   HIS B CB  1 
ATOM   1172 C CG  . HIS B 1 6   F 1.811  20.129 68.724 1.00 11.12 ? 1   HIS B CG  1 
ATOM   1173 N ND1 . HIS B 1 6   F 1.994  20.375 70.078 1.00 11.46 ? 1   HIS B ND1 1 
ATOM   1174 C CD2 . HIS B 1 6   F 3.050  19.871 68.218 1.00 11.65 ? 1   HIS B CD2 1 
ATOM   1175 C CE1 . HIS B 1 6   F 3.285  20.250 70.385 1.00 11.71 ? 1   HIS B CE1 1 
ATOM   1176 N NE2 . HIS B 1 6   F 3.950  19.944 69.269 1.00 12.19 ? 1   HIS B NE2 1 
ATOM   1177 N N   . PHE B 1 7   G -0.141 22.822 69.069 1.00 11.00 ? 1   PHE B N   1 
ATOM   1178 C CA  . PHE B 1 7   G 0.024  24.024 69.869 1.00 10.40 ? 1   PHE B CA  1 
ATOM   1179 C C   . PHE B 1 7   G 0.011  23.692 71.359 1.00 8.95  ? 1   PHE B C   1 
ATOM   1180 O O   . PHE B 1 7   G -0.545 24.476 72.148 1.00 12.10 ? 1   PHE B O   1 
ATOM   1181 C CB  . PHE B 1 7   G -1.070 25.068 69.479 1.00 11.51 ? 1   PHE B CB  1 
ATOM   1182 C CG  . PHE B 1 7   G -0.673 26.510 69.719 1.00 13.58 ? 1   PHE B CG  1 
ATOM   1183 C CD1 . PHE B 1 7   G 0.366  27.100 68.961 1.00 17.23 ? 1   PHE B CD1 1 
ATOM   1184 C CD2 . PHE B 1 7   G -1.309 27.279 70.682 1.00 16.71 ? 1   PHE B CD2 1 
ATOM   1185 C CE1 . PHE B 1 7   G 0.773  28.428 69.182 1.00 16.72 ? 1   PHE B CE1 1 
ATOM   1186 C CE2 . PHE B 1 7   G -0.895 28.633 70.916 1.00 18.22 ? 1   PHE B CE2 1 
ATOM   1187 C CZ  . PHE B 1 7   G 0.155  29.178 70.137 1.00 16.73 ? 1   PHE B CZ  1 
ATOM   1188 N N   . ASN B 1 8   ? 0.583  22.542 71.712 1.00 10.14 ? 2   ASN B N   1 
ATOM   1189 C CA  . ASN B 1 8   ? 0.784  22.244 73.162 1.00 9.55  ? 2   ASN B CA  1 
ATOM   1190 C C   . ASN B 1 8   ? 2.023  23.061 73.503 1.00 12.83 ? 2   ASN B C   1 
ATOM   1191 O O   . ASN B 1 8   ? 3.085  22.840 72.906 1.00 12.29 ? 2   ASN B O   1 
ATOM   1192 C CB  . ASN B 1 8   ? 1.034  20.768 73.329 1.00 12.07 ? 2   ASN B CB  1 
ATOM   1193 C CG  . ASN B 1 8   ? -0.234 19.960 73.008 1.00 11.96 ? 2   ASN B CG  1 
ATOM   1194 O OD1 . ASN B 1 8   ? -1.213 20.003 73.768 1.00 11.87 ? 2   ASN B OD1 1 
ATOM   1195 N ND2 . ASN B 1 8   ? -0.206 19.232 71.900 1.00 12.09 ? 2   ASN B ND2 1 
ATOM   1196 N N   . LEU B 1 9   ? 1.901  23.928 74.502 1.00 12.62 ? 3   LEU B N   1 
ATOM   1197 C CA  . LEU B 1 9   ? 3.016  24.816 74.868 1.00 11.71 ? 3   LEU B CA  1 
ATOM   1198 C C   . LEU B 1 9   ? 3.560  24.340 76.203 1.00 14.27 ? 3   LEU B C   1 
ATOM   1199 O O   . LEU B 1 9   ? 2.847  23.793 77.039 1.00 12.88 ? 3   LEU B O   1 
ATOM   1200 C CB  . LEU B 1 9   ? 2.503  26.219 74.984 1.00 12.59 ? 3   LEU B CB  1 
ATOM   1201 C CG  . LEU B 1 9   ? 1.775  26.782 73.745 1.00 11.69 ? 3   LEU B CG  1 
ATOM   1202 C CD1 . LEU B 1 9   ? 1.310  28.159 74.078 1.00 17.33 ? 3   LEU B CD1 1 
ATOM   1203 C CD2 . LEU B 1 9   ? 2.658  26.812 72.464 1.00 14.57 ? 3   LEU B CD2 1 
ATOM   1204 N N   . PRO B 1 10  ? 4.857  24.571 76.449 1.00 13.74 ? 4   PRO B N   1 
ATOM   1205 C CA  . PRO B 1 10  ? 5.436  24.128 77.722 1.00 14.35 ? 4   PRO B CA  1 
ATOM   1206 C C   . PRO B 1 10  ? 5.077  25.129 78.815 1.00 16.13 ? 4   PRO B C   1 
ATOM   1207 O O   . PRO B 1 10  ? 4.639  26.251 78.582 1.00 15.12 ? 4   PRO B O   1 
ATOM   1208 C CB  . PRO B 1 10  ? 6.953  24.092 77.439 1.00 16.92 ? 4   PRO B CB  1 
ATOM   1209 C CG  . PRO B 1 10  ? 7.136  25.038 76.258 1.00 16.73 ? 4   PRO B CG  1 
ATOM   1210 C CD  . PRO B 1 10  ? 5.831  25.237 75.556 1.00 13.97 ? 4   PRO B CD  1 
ATOM   1211 N N   . PRO B 1 11  ? 5.203  24.704 80.059 1.00 15.97 ? 5   PRO B N   1 
ATOM   1212 C CA  . PRO B 1 11  ? 4.918  25.551 81.209 1.00 19.00 ? 5   PRO B CA  1 
ATOM   1213 C C   . PRO B 1 11  ? 6.208  26.372 81.413 1.00 21.39 ? 5   PRO B C   1 
ATOM   1214 O O   . PRO B 1 11  ? 7.234  26.076 80.815 1.00 25.75 ? 5   PRO B O   1 
ATOM   1215 C CB  . PRO B 1 11  ? 4.686  24.527 82.342 1.00 19.13 ? 5   PRO B CB  1 
ATOM   1216 C CG  . PRO B 1 11  ? 5.658  23.415 82.003 1.00 16.96 ? 5   PRO B CG  1 
ATOM   1217 C CD  . PRO B 1 11  ? 5.504  23.302 80.430 1.00 15.71 ? 5   PRO B CD  1 
ATOM   1218 N N   . GLY B 1 12  ? 6.195  27.377 82.242 1.00 34.38 ? 6   GLY B N   1 
ATOM   1219 C CA  . GLY B 1 12  ? 7.479  28.037 82.367 1.00 31.54 ? 6   GLY B CA  1 
ATOM   1220 C C   . GLY B 1 12  ? 7.434  29.305 81.564 1.00 32.50 ? 6   GLY B C   1 
ATOM   1221 O O   . GLY B 1 12  ? 6.578  29.480 80.686 1.00 33.52 ? 6   GLY B O   1 
ATOM   1222 N N   . ASN B 1 13  ? 8.390  30.177 81.835 1.00 28.95 ? 7   ASN B N   1 
ATOM   1223 C CA  . ASN B 1 13  ? 8.361  31.460 81.206 1.00 27.99 ? 7   ASN B CA  1 
ATOM   1224 C C   . ASN B 1 13  ? 9.756  31.896 80.860 1.00 22.04 ? 7   ASN B C   1 
ATOM   1225 O O   . ASN B 1 13  ? 10.688 31.115 80.941 1.00 22.69 ? 7   ASN B O   1 
ATOM   1226 C CB  . ASN B 1 13  ? 7.729  32.467 82.156 1.00 32.05 ? 7   ASN B CB  1 
ATOM   1227 C CG  . ASN B 1 13  ? 8.413  32.491 83.512 1.00 32.40 ? 7   ASN B CG  1 
ATOM   1228 O OD1 . ASN B 1 13  ? 9.592  32.854 83.632 1.00 28.71 ? 7   ASN B OD1 1 
ATOM   1229 N ND2 . ASN B 1 13  ? 7.673  32.087 84.551 1.00 36.23 ? 7   ASN B ND2 1 
ATOM   1230 N N   . TYR B 1 14  ? 9.854  33.149 80.469 1.00 25.28 ? 8   TYR B N   1 
ATOM   1231 C CA  . TYR B 1 14  ? 11.104 33.702 80.011 1.00 20.99 ? 8   TYR B CA  1 
ATOM   1232 C C   . TYR B 1 14  ? 11.725 34.705 80.960 1.00 29.33 ? 8   TYR B C   1 
ATOM   1233 O O   . TYR B 1 14  ? 12.675 35.367 80.587 1.00 25.89 ? 8   TYR B O   1 
ATOM   1234 C CB  . TYR B 1 14  ? 10.826 34.353 78.660 1.00 17.35 ? 8   TYR B CB  1 
ATOM   1235 C CG  . TYR B 1 14  ? 10.081 33.416 77.739 1.00 20.72 ? 8   TYR B CG  1 
ATOM   1236 C CD1 . TYR B 1 14  ? 10.590 32.173 77.439 1.00 18.56 ? 8   TYR B CD1 1 
ATOM   1237 C CD2 . TYR B 1 14  ? 8.860  33.791 77.179 1.00 20.48 ? 8   TYR B CD2 1 
ATOM   1238 C CE1 . TYR B 1 14  ? 9.886  31.294 76.572 1.00 16.96 ? 8   TYR B CE1 1 
ATOM   1239 C CE2 . TYR B 1 14  ? 8.149  32.917 76.306 1.00 24.42 ? 8   TYR B CE2 1 
ATOM   1240 C CZ  . TYR B 1 14  ? 8.681  31.688 76.024 1.00 20.20 ? 8   TYR B CZ  1 
ATOM   1241 O OH  . TYR B 1 14  ? 7.951  30.832 75.197 1.00 17.86 ? 8   TYR B OH  1 
ATOM   1242 N N   . LYS B 1 15  ? 11.202 34.792 82.178 1.00 28.52 ? 9   LYS B N   1 
ATOM   1243 C CA  . LYS B 1 15  ? 11.702 35.753 83.157 1.00 34.62 ? 9   LYS B CA  1 
ATOM   1244 C C   . LYS B 1 15  ? 13.204 35.696 83.338 1.00 33.64 ? 9   LYS B C   1 
ATOM   1245 O O   . LYS B 1 15  ? 13.860 36.733 83.390 1.00 36.54 ? 9   LYS B O   1 
ATOM   1246 C CB  . LYS B 1 15  ? 11.025 35.543 84.518 1.00 36.35 ? 9   LYS B CB  1 
ATOM   1247 C CG  . LYS B 1 15  ? 9.529  35.826 84.522 1.00 45.68 ? 9   LYS B CG  1 
ATOM   1248 C CD  . LYS B 1 15  ? 8.933  35.637 85.926 1.00 49.55 ? 9   LYS B CD  1 
ATOM   1249 C CE  . LYS B 1 15  ? 7.419  35.876 85.944 1.00 54.03 ? 9   LYS B CE  1 
ATOM   1250 N NZ  . LYS B 1 15  ? 6.859  35.790 87.331 1.00 57.69 ? 9   LYS B NZ  1 
ATOM   1251 N N   . LYS B 1 16  ? 13.760 34.494 83.424 1.00 27.75 ? 10  LYS B N   1 
ATOM   1252 C CA  . LYS B 1 16  ? 15.183 34.380 83.623 1.00 30.00 ? 10  LYS B CA  1 
ATOM   1253 C C   . LYS B 1 16  ? 15.877 33.553 82.573 1.00 27.74 ? 10  LYS B C   1 
ATOM   1254 O O   . LYS B 1 16  ? 15.230 32.856 81.819 1.00 22.54 ? 10  LYS B O   1 
ATOM   1255 C CB  . LYS B 1 16  ? 15.431 33.780 84.997 1.00 36.65 ? 10  LYS B CB  1 
ATOM   1256 C CG  . LYS B 1 16  ? 14.923 34.705 86.102 1.00 43.67 ? 10  LYS B CG  1 
ATOM   1257 C CD  . LYS B 1 16  ? 14.762 33.992 87.431 1.00 48.63 ? 10  LYS B CD  1 
ATOM   1258 C CE  . LYS B 1 16  ? 13.620 32.993 87.391 1.00 50.38 ? 10  LYS B CE  1 
ATOM   1259 N NZ  . LYS B 1 16  ? 13.481 32.276 88.702 1.00 51.62 ? 10  LYS B NZ  1 
ATOM   1260 N N   . PRO B 1 17  ? 17.205 33.666 82.484 1.00 26.04 ? 11  PRO B N   1 
ATOM   1261 C CA  . PRO B 1 17  ? 17.988 32.891 81.517 1.00 24.84 ? 11  PRO B CA  1 
ATOM   1262 C C   . PRO B 1 17  ? 17.977 31.430 81.902 1.00 26.77 ? 11  PRO B C   1 
ATOM   1263 O O   . PRO B 1 17  ? 17.688 31.055 83.058 1.00 22.63 ? 11  PRO B O   1 
ATOM   1264 C CB  . PRO B 1 17  ? 19.403 33.473 81.647 1.00 26.39 ? 11  PRO B CB  1 
ATOM   1265 C CG  . PRO B 1 17  ? 19.411 34.011 83.074 1.00 30.63 ? 11  PRO B CG  1 
ATOM   1266 C CD  . PRO B 1 17  ? 18.055 34.664 83.157 1.00 27.56 ? 11  PRO B CD  1 
ATOM   1267 N N   . LYS B 1 18  ? 18.310 30.590 80.937 1.00 20.84 ? 12  LYS B N   1 
ATOM   1268 C CA  . LYS B 1 18  ? 18.360 29.171 81.192 1.00 21.32 ? 12  LYS B CA  1 
ATOM   1269 C C   . LYS B 1 18  ? 19.388 28.446 80.353 1.00 19.67 ? 12  LYS B C   1 
ATOM   1270 O O   . LYS B 1 18  ? 20.007 29.029 79.460 1.00 19.66 ? 12  LYS B O   1 
ATOM   1271 C CB  . LYS B 1 18  ? 17.000 28.514 80.938 1.00 26.96 ? 12  LYS B CB  1 
ATOM   1272 C CG  . LYS B 1 18  ? 16.543 28.643 79.552 1.00 31.79 ? 12  LYS B CG  1 
ATOM   1273 C CD  . LYS B 1 18  ? 15.505 29.762 79.362 1.00 36.53 ? 12  LYS B CD  1 
ATOM   1274 C CE  . LYS B 1 18  ? 14.145 29.443 80.025 1.00 34.94 ? 12  LYS B CE  1 
ATOM   1275 N NZ  . LYS B 1 18  ? 12.974 30.153 79.372 1.00 29.90 ? 12  LYS B NZ  1 
ATOM   1276 N N   . LEU B 1 19  ? 19.606 27.190 80.688 1.00 17.21 ? 13  LEU B N   1 
ATOM   1277 C CA  . LEU B 1 19  ? 20.444 26.328 79.916 1.00 15.35 ? 13  LEU B CA  1 
ATOM   1278 C C   . LEU B 1 19  ? 19.461 25.445 79.118 1.00 20.68 ? 13  LEU B C   1 
ATOM   1279 O O   . LEU B 1 19  ? 18.425 25.006 79.649 1.00 18.22 ? 13  LEU B O   1 
ATOM   1280 C CB  . LEU B 1 19  ? 21.272 25.373 80.784 1.00 20.31 ? 13  LEU B CB  1 
ATOM   1281 C CG  . LEU B 1 19  ? 22.087 26.015 81.874 1.00 18.16 ? 13  LEU B CG  1 
ATOM   1282 C CD1 . LEU B 1 19  ? 22.895 24.997 82.626 1.00 22.28 ? 13  LEU B CD1 1 
ATOM   1283 C CD2 . LEU B 1 19  ? 23.039 27.024 81.201 1.00 19.22 ? 13  LEU B CD2 1 
ATOM   1284 N N   . LEU B 1 20  ? 19.748 25.171 77.849 1.00 17.29 ? 14  LEU B N   1 
ATOM   1285 C CA  . LEU B 1 20  ? 18.878 24.255 77.100 1.00 13.38 ? 14  LEU B CA  1 
ATOM   1286 C C   . LEU B 1 20  ? 19.623 22.936 77.076 1.00 18.12 ? 14  LEU B C   1 
ATOM   1287 O O   . LEU B 1 20  ? 20.601 22.717 76.342 1.00 15.83 ? 14  LEU B O   1 
ATOM   1288 C CB  . LEU B 1 20  ? 18.561 24.785 75.674 1.00 16.01 ? 14  LEU B CB  1 
ATOM   1289 C CG  . LEU B 1 20  ? 17.538 25.915 75.720 1.00 14.92 ? 14  LEU B CG  1 
ATOM   1290 C CD1 . LEU B 1 20  ? 17.326 26.418 74.269 1.00 17.85 ? 14  LEU B CD1 1 
ATOM   1291 C CD2 . LEU B 1 20  ? 16.206 25.419 76.303 1.00 19.52 ? 14  LEU B CD2 1 
ATOM   1292 N N   . TYR B 1 21  ? 19.155 22.012 77.911 1.00 15.81 ? 15  TYR B N   1 
ATOM   1293 C CA  . TYR B 1 21  ? 19.776 20.712 78.048 1.00 15.21 ? 15  TYR B CA  1 
ATOM   1294 C C   . TYR B 1 21  ? 19.166 19.714 77.094 1.00 18.17 ? 15  TYR B C   1 
ATOM   1295 O O   . TYR B 1 21  ? 17.945 19.461 77.151 1.00 18.16 ? 15  TYR B O   1 
ATOM   1296 C CB  . TYR B 1 21  ? 19.557 20.249 79.504 1.00 18.78 ? 15  TYR B CB  1 
ATOM   1297 C CG  . TYR B 1 21  ? 19.994 18.853 79.779 1.00 20.15 ? 15  TYR B CG  1 
ATOM   1298 C CD1 . TYR B 1 21  ? 21.337 18.549 80.031 1.00 25.46 ? 15  TYR B CD1 1 
ATOM   1299 C CD2 . TYR B 1 21  ? 19.052 17.807 79.854 1.00 24.93 ? 15  TYR B CD2 1 
ATOM   1300 C CE1 . TYR B 1 21  ? 21.719 17.231 80.377 1.00 27.95 ? 15  TYR B CE1 1 
ATOM   1301 C CE2 . TYR B 1 21  ? 19.431 16.508 80.186 1.00 28.92 ? 15  TYR B CE2 1 
ATOM   1302 C CZ  . TYR B 1 21  ? 20.757 16.237 80.452 1.00 29.95 ? 15  TYR B CZ  1 
ATOM   1303 O OH  . TYR B 1 21  ? 21.097 14.952 80.831 1.00 39.75 ? 15  TYR B OH  1 
ATOM   1304 N N   . CYS B 1 22  ? 19.970 19.107 76.237 1.00 18.68 ? 16  CYS B N   1 
ATOM   1305 C CA  . CYS B 1 22  ? 19.473 18.115 75.309 1.00 14.76 ? 16  CYS B CA  1 
ATOM   1306 C C   . CYS B 1 22  ? 19.579 16.776 75.987 1.00 22.95 ? 16  CYS B C   1 
ATOM   1307 O O   . CYS B 1 22  ? 20.672 16.303 76.303 1.00 22.21 ? 16  CYS B O   1 
ATOM   1308 C CB  . CYS B 1 22  ? 20.262 18.104 73.965 1.00 14.38 ? 16  CYS B CB  1 
ATOM   1309 S SG  . CYS B 1 22  ? 19.654 16.997 72.765 1.00 19.89 ? 16  CYS B SG  1 
ATOM   1310 N N   . SER B 1 23  ? 18.417 16.177 76.228 1.00 23.52 ? 17  SER B N   1 
ATOM   1311 C CA  . SER B 1 23  ? 18.368 14.894 76.891 1.00 27.48 ? 17  SER B CA  1 
ATOM   1312 C C   . SER B 1 23  ? 19.047 13.774 76.117 1.00 26.94 ? 17  SER B C   1 
ATOM   1313 O O   . SER B 1 23  ? 19.339 12.740 76.702 1.00 30.35 ? 17  SER B O   1 
ATOM   1314 C CB  . SER B 1 23  ? 16.912 14.497 77.168 1.00 27.11 ? 17  SER B CB  1 
ATOM   1315 O OG  . SER B 1 23  ? 16.168 14.480 75.962 1.00 29.59 ? 17  SER B OG  1 
ATOM   1316 N N   . ASN B 1 24  ? 19.285 13.970 74.813 1.00 24.13 ? 18  ASN B N   1 
ATOM   1317 C CA  . ASN B 1 24  ? 19.921 12.953 73.981 1.00 26.34 ? 18  ASN B CA  1 
ATOM   1318 C C   . ASN B 1 24  ? 21.309 12.553 74.492 1.00 28.92 ? 18  ASN B C   1 
ATOM   1319 O O   . ASN B 1 24  ? 21.508 11.378 74.820 1.00 31.06 ? 18  ASN B O   1 
ATOM   1320 C CB  . ASN B 1 24  ? 19.969 13.428 72.527 1.00 25.29 ? 18  ASN B CB  1 
ATOM   1321 C CG  . ASN B 1 24  ? 20.432 12.356 71.567 1.00 29.79 ? 18  ASN B CG  1 
ATOM   1322 O OD1 . ASN B 1 24  ? 20.276 11.160 71.828 1.00 32.49 ? 18  ASN B OD1 1 
ATOM   1323 N ND2 . ASN B 1 24  ? 20.987 12.774 70.432 1.00 24.34 ? 18  ASN B ND2 1 
ATOM   1324 N N   . GLY B 1 25  ? 22.257 13.494 74.574 1.00 28.67 ? 19  GLY B N   1 
ATOM   1325 C CA  . GLY B 1 25  ? 23.586 13.150 75.082 1.00 26.78 ? 19  GLY B CA  1 
ATOM   1326 C C   . GLY B 1 25  ? 23.918 13.873 76.368 1.00 26.45 ? 19  GLY B C   1 
ATOM   1327 O O   . GLY B 1 25  ? 25.026 13.762 76.912 1.00 29.77 ? 19  GLY B O   1 
ATOM   1328 N N   . GLY B 1 26  ? 22.969 14.654 76.859 1.00 23.10 ? 20  GLY B N   1 
ATOM   1329 C CA  . GLY B 1 26  ? 23.202 15.374 78.073 1.00 23.01 ? 20  GLY B CA  1 
ATOM   1330 C C   . GLY B 1 26  ? 24.012 16.628 77.863 1.00 25.57 ? 20  GLY B C   1 
ATOM   1331 O O   . GLY B 1 26  ? 24.644 17.114 78.796 1.00 31.60 ? 20  GLY B O   1 
ATOM   1332 N N   . HIS B 1 27  ? 23.986 17.166 76.640 1.00 22.79 ? 21  HIS B N   1 
ATOM   1333 C CA  . HIS B 1 27  ? 24.723 18.402 76.366 1.00 22.49 ? 21  HIS B CA  1 
ATOM   1334 C C   . HIS B 1 27  ? 23.866 19.636 76.450 1.00 19.64 ? 21  HIS B C   1 
ATOM   1335 O O   . HIS B 1 27  ? 22.682 19.612 76.081 1.00 20.30 ? 21  HIS B O   1 
ATOM   1336 C CB  . HIS B 1 27  ? 25.266 18.424 74.948 1.00 21.56 ? 21  HIS B CB  1 
ATOM   1337 C CG  . HIS B 1 27  ? 26.159 17.289 74.628 1.00 24.09 ? 21  HIS B CG  1 
ATOM   1338 N ND1 . HIS B 1 27  ? 25.685 16.096 74.132 1.00 26.40 ? 21  HIS B ND1 1 
ATOM   1339 C CD2 . HIS B 1 27  ? 27.504 17.155 74.726 1.00 27.06 ? 21  HIS B CD2 1 
ATOM   1340 C CE1 . HIS B 1 27  ? 26.696 15.273 73.941 1.00 28.38 ? 21  HIS B CE1 1 
ATOM   1341 N NE2 . HIS B 1 27  ? 27.810 15.890 74.297 1.00 28.44 ? 21  HIS B NE2 1 
ATOM   1342 N N   . PHE B 1 28  ? 24.492 20.726 76.848 1.00 15.43 ? 22  PHE B N   1 
ATOM   1343 C CA  . PHE B 1 28  ? 23.855 22.030 76.905 1.00 16.32 ? 22  PHE B CA  1 
ATOM   1344 C C   . PHE B 1 28  ? 24.140 22.736 75.570 1.00 19.35 ? 22  PHE B C   1 
ATOM   1345 O O   . PHE B 1 28  ? 25.290 22.727 75.063 1.00 19.39 ? 22  PHE B O   1 
ATOM   1346 C CB  . PHE B 1 28  ? 24.432 22.887 78.034 1.00 19.91 ? 22  PHE B CB  1 
ATOM   1347 C CG  . PHE B 1 28  ? 24.337 22.235 79.372 1.00 23.63 ? 22  PHE B CG  1 
ATOM   1348 C CD1 . PHE B 1 28  ? 23.121 22.189 80.051 1.00 23.24 ? 22  PHE B CD1 1 
ATOM   1349 C CD2 . PHE B 1 28  ? 25.440 21.579 79.910 1.00 24.22 ? 22  PHE B CD2 1 
ATOM   1350 C CE1 . PHE B 1 28  ? 23.020 21.474 81.255 1.00 20.36 ? 22  PHE B CE1 1 
ATOM   1351 C CE2 . PHE B 1 28  ? 25.337 20.879 81.093 1.00 27.59 ? 22  PHE B CE2 1 
ATOM   1352 C CZ  . PHE B 1 28  ? 24.135 20.821 81.762 1.00 20.33 ? 22  PHE B CZ  1 
ATOM   1353 N N   . LEU B 1 29  ? 23.115 23.375 75.005 1.00 13.98 ? 23  LEU B N   1 
ATOM   1354 C CA  . LEU B 1 29  ? 23.317 24.077 73.736 1.00 14.76 ? 23  LEU B CA  1 
ATOM   1355 C C   . LEU B 1 29  ? 24.262 25.241 73.964 1.00 14.78 ? 23  LEU B C   1 
ATOM   1356 O O   . LEU B 1 29  ? 24.134 26.023 74.903 1.00 16.64 ? 23  LEU B O   1 
ATOM   1357 C CB  . LEU B 1 29  ? 21.958 24.530 73.214 1.00 15.81 ? 23  LEU B CB  1 
ATOM   1358 C CG  . LEU B 1 29  ? 21.918 25.181 71.819 1.00 16.58 ? 23  LEU B CG  1 
ATOM   1359 C CD1 . LEU B 1 29  ? 22.236 24.207 70.773 1.00 16.91 ? 23  LEU B CD1 1 
ATOM   1360 C CD2 . LEU B 1 29  ? 20.499 25.679 71.576 1.00 19.29 ? 23  LEU B CD2 1 
ATOM   1361 N N   . ARG B 1 30  ? 25.192 25.389 73.009 1.00 13.08 ? 24  ARG B N   1 
ATOM   1362 C CA  . ARG B 1 30  ? 26.237 26.412 73.141 1.00 14.26 ? 24  ARG B CA  1 
ATOM   1363 C C   . ARG B 1 30  ? 26.449 27.217 71.836 1.00 13.46 ? 24  ARG B C   1 
ATOM   1364 O O   . ARG B 1 30  ? 26.500 26.632 70.778 1.00 17.38 ? 24  ARG B O   1 
ATOM   1365 C CB  . ARG B 1 30  ? 27.567 25.693 73.483 1.00 14.56 ? 24  ARG B CB  1 
ATOM   1366 C CG  . ARG B 1 30  ? 28.783 26.690 73.614 1.00 19.50 ? 24  ARG B CG  1 
ATOM   1367 C CD  . ARG B 1 30  ? 30.014 25.987 74.213 1.00 20.07 ? 24  ARG B CD  1 
ATOM   1368 N NE  . ARG B 1 30  ? 30.450 24.886 73.403 1.00 23.95 ? 24  ARG B NE  1 
ATOM   1369 C CZ  . ARG B 1 30  ? 31.552 24.169 73.649 1.00 29.36 ? 24  ARG B CZ  1 
ATOM   1370 N NH1 . ARG B 1 30  ? 32.301 24.478 74.696 1.00 27.60 ? 24  ARG B NH1 1 
ATOM   1371 N NH2 . ARG B 1 30  ? 31.889 23.139 72.869 1.00 28.66 ? 24  ARG B NH2 1 
ATOM   1372 N N   . ILE B 1 31  ? 26.575 28.530 71.992 1.00 17.32 ? 25  ILE B N   1 
ATOM   1373 C CA  . ILE B 1 31  ? 26.841 29.414 70.849 1.00 14.49 ? 25  ILE B CA  1 
ATOM   1374 C C   . ILE B 1 31  ? 28.225 30.095 71.132 1.00 15.98 ? 25  ILE B C   1 
ATOM   1375 O O   . ILE B 1 31  ? 28.387 30.902 72.053 1.00 17.01 ? 25  ILE B O   1 
ATOM   1376 C CB  . ILE B 1 31  ? 25.739 30.502 70.698 1.00 17.36 ? 25  ILE B CB  1 
ATOM   1377 C CG1 . ILE B 1 31  ? 24.351 29.882 70.649 1.00 16.58 ? 25  ILE B CG1 1 
ATOM   1378 C CG2 . ILE B 1 31  ? 25.981 31.314 69.383 1.00 17.14 ? 25  ILE B CG2 1 
ATOM   1379 C CD1 . ILE B 1 31  ? 23.229 30.899 70.507 1.00 18.45 ? 25  ILE B CD1 1 
ATOM   1380 N N   . ASP B 1 32  ? 29.209 29.716 70.330 1.00 20.08 ? 26  ASP B N   1 
ATOM   1381 C CA  . ASP B 1 32  ? 30.596 30.211 70.457 1.00 25.31 ? 26  ASP B CA  1 
ATOM   1382 C C   . ASP B 1 32  ? 30.675 31.650 69.993 1.00 24.92 ? 26  ASP B C   1 
ATOM   1383 O O   . ASP B 1 32  ? 29.843 32.086 69.199 1.00 23.29 ? 26  ASP B O   1 
ATOM   1384 C CB  . ASP B 1 32  ? 31.521 29.375 69.558 1.00 24.94 ? 26  ASP B CB  1 
ATOM   1385 C CG  . ASP B 1 32  ? 33.001 29.663 69.807 1.00 30.61 ? 26  ASP B CG  1 
ATOM   1386 O OD1 . ASP B 1 32  ? 33.575 29.053 70.741 1.00 32.05 ? 26  ASP B OD1 1 
ATOM   1387 O OD2 . ASP B 1 32  ? 33.588 30.511 69.094 1.00 31.10 ? 26  ASP B OD2 1 
ATOM   1388 N N   . PRO B 1 33  ? 31.661 32.418 70.487 1.00 24.50 ? 27  PRO B N   1 
ATOM   1389 C CA  . PRO B 1 33  ? 31.826 33.816 70.074 1.00 24.69 ? 27  PRO B CA  1 
ATOM   1390 C C   . PRO B 1 33  ? 31.969 33.933 68.529 1.00 19.82 ? 27  PRO B C   1 
ATOM   1391 O O   . PRO B 1 33  ? 31.568 34.952 67.938 1.00 21.36 ? 27  PRO B O   1 
ATOM   1392 C CB  . PRO B 1 33  ? 33.113 34.223 70.796 1.00 26.21 ? 27  PRO B CB  1 
ATOM   1393 C CG  . PRO B 1 33  ? 32.970 33.507 72.131 1.00 27.71 ? 27  PRO B CG  1 
ATOM   1394 C CD  . PRO B 1 33  ? 32.463 32.134 71.703 1.00 23.31 ? 27  PRO B CD  1 
ATOM   1395 N N   . ASN B 1 34  ? 32.509 32.903 67.896 1.00 20.12 ? 28  ASN B N   1 
ATOM   1396 C CA  . ASN B 1 34  ? 32.673 32.917 66.431 1.00 22.34 ? 28  ASN B CA  1 
ATOM   1397 C C   . ASN B 1 34  ? 31.407 32.542 65.663 1.00 19.96 ? 28  ASN B C   1 
ATOM   1398 O O   . ASN B 1 34  ? 31.391 32.517 64.434 1.00 23.60 ? 28  ASN B O   1 
ATOM   1399 C CB  . ASN B 1 34  ? 33.861 32.021 65.974 1.00 25.56 ? 28  ASN B CB  1 
ATOM   1400 C CG  . ASN B 1 34  ? 33.642 30.549 66.228 1.00 31.71 ? 28  ASN B CG  1 
ATOM   1401 O OD1 . ASN B 1 34  ? 32.512 30.040 66.184 1.00 32.83 ? 28  ASN B OD1 1 
ATOM   1402 N ND2 . ASN B 1 34  ? 34.737 29.836 66.482 1.00 33.87 ? 28  ASN B ND2 1 
ATOM   1403 N N   . GLY B 1 35  ? 30.339 32.241 66.408 1.00 18.65 ? 29  GLY B N   1 
ATOM   1404 C CA  . GLY B 1 35  ? 29.075 31.901 65.788 1.00 18.24 ? 29  GLY B CA  1 
ATOM   1405 C C   . GLY B 1 35  ? 28.767 30.423 65.667 1.00 18.19 ? 29  GLY B C   1 
ATOM   1406 O O   . GLY B 1 35  ? 27.656 30.046 65.268 1.00 19.23 ? 29  GLY B O   1 
ATOM   1407 N N   . THR B 1 36  ? 29.753 29.578 65.971 1.00 19.61 ? 30  THR B N   1 
ATOM   1408 C CA  . THR B 1 36  ? 29.562 28.142 65.895 1.00 19.84 ? 30  THR B CA  1 
ATOM   1409 C C   . THR B 1 36  ? 28.627 27.699 67.013 1.00 15.91 ? 30  THR B C   1 
ATOM   1410 O O   . THR B 1 36  ? 28.726 28.161 68.152 1.00 20.90 ? 30  THR B O   1 
ATOM   1411 C CB  . THR B 1 36  ? 30.942 27.401 66.027 1.00 21.28 ? 30  THR B CB  1 
ATOM   1412 O OG1 . THR B 1 36  ? 31.815 27.901 65.008 1.00 32.11 ? 30  THR B OG1 1 
ATOM   1413 C CG2 . THR B 1 36  ? 30.778 25.956 65.833 1.00 26.25 ? 30  THR B CG2 1 
ATOM   1414 N N   . VAL B 1 37  ? 27.718 26.806 66.644 1.00 17.46 ? 31  VAL B N   1 
ATOM   1415 C CA  . VAL B 1 37  ? 26.755 26.237 67.600 1.00 19.19 ? 31  VAL B CA  1 
ATOM   1416 C C   . VAL B 1 37  ? 27.064 24.772 67.798 1.00 18.25 ? 31  VAL B C   1 
ATOM   1417 O O   . VAL B 1 37  ? 27.360 24.035 66.857 1.00 21.45 ? 31  VAL B O   1 
ATOM   1418 C CB  . VAL B 1 37  ? 25.318 26.383 67.055 1.00 16.85 ? 31  VAL B CB  1 
ATOM   1419 C CG1 . VAL B 1 37  ? 24.322 25.634 67.992 1.00 16.32 ? 31  VAL B CG1 1 
ATOM   1420 C CG2 . VAL B 1 37  ? 24.951 27.834 67.013 1.00 14.79 ? 31  VAL B CG2 1 
ATOM   1421 N N   . ASP B 1 38  ? 27.002 24.317 69.055 1.00 17.70 ? 32  ASP B N   1 
ATOM   1422 C CA  . ASP B 1 38  ? 27.246 22.891 69.303 1.00 19.14 ? 32  ASP B CA  1 
ATOM   1423 C C   . ASP B 1 38  ? 26.757 22.609 70.704 1.00 20.38 ? 32  ASP B C   1 
ATOM   1424 O O   . ASP B 1 38  ? 26.023 23.408 71.238 1.00 19.25 ? 32  ASP B O   1 
ATOM   1425 C CB  . ASP B 1 38  ? 28.745 22.532 69.135 1.00 24.14 ? 32  ASP B CB  1 
ATOM   1426 C CG  . ASP B 1 38  ? 29.597 22.992 70.277 1.00 16.62 ? 32  ASP B CG  1 
ATOM   1427 O OD1 . ASP B 1 38  ? 29.241 23.933 71.008 1.00 23.99 ? 32  ASP B OD1 1 
ATOM   1428 O OD2 . ASP B 1 38  ? 30.682 22.390 70.451 1.00 32.03 ? 32  ASP B OD2 1 
ATOM   1429 N N   . GLY B 1 39  ? 27.142 21.487 71.301 1.00 23.77 ? 33  GLY B N   1 
ATOM   1430 C CA  . GLY B 1 39  ? 26.699 21.224 72.666 1.00 21.39 ? 33  GLY B CA  1 
ATOM   1431 C C   . GLY B 1 39  ? 27.892 20.876 73.551 1.00 23.64 ? 33  GLY B C   1 
ATOM   1432 O O   . GLY B 1 39  ? 28.901 20.342 73.039 1.00 26.02 ? 33  GLY B O   1 
ATOM   1433 N N   . THR B 1 40  ? 27.806 21.201 74.837 1.00 19.75 ? 34  THR B N   1 
ATOM   1434 C CA  . THR B 1 40  ? 28.877 20.838 75.778 1.00 21.10 ? 34  THR B CA  1 
ATOM   1435 C C   . THR B 1 40  ? 28.296 20.290 77.086 1.00 26.46 ? 34  THR B C   1 
ATOM   1436 O O   . THR B 1 40  ? 27.205 20.655 77.487 1.00 22.82 ? 34  THR B O   1 
ATOM   1437 C CB  . THR B 1 40  ? 29.778 22.035 76.142 1.00 24.08 ? 34  THR B CB  1 
ATOM   1438 O OG1 . THR B 1 40  ? 30.749 21.596 77.111 1.00 26.24 ? 34  THR B OG1 1 
ATOM   1439 C CG2 . THR B 1 40  ? 29.005 23.158 76.756 1.00 18.63 ? 34  THR B CG2 1 
ATOM   1440 N N   . ARG B 1 41  ? 29.032 19.402 77.752 1.00 26.67 ? 35  ARG B N   1 
ATOM   1441 C CA  . ARG B 1 41  ? 28.549 18.874 79.026 1.00 29.89 ? 35  ARG B CA  1 
ATOM   1442 C C   . ARG B 1 41  ? 29.102 19.719 80.160 1.00 31.09 ? 35  ARG B C   1 
ATOM   1443 O O   . ARG B 1 41  ? 28.758 19.515 81.320 1.00 31.92 ? 35  ARG B O   1 
ATOM   1444 C CB  . ARG B 1 41  ? 28.974 17.419 79.220 1.00 34.31 ? 35  ARG B CB  1 
ATOM   1445 C CG  . ARG B 1 41  ? 28.418 16.468 78.201 1.00 33.80 ? 35  ARG B CG  1 
ATOM   1446 C CD  . ARG B 1 41  ? 28.295 15.060 78.761 1.00 38.55 ? 35  ARG B CD  1 
ATOM   1447 N NE  . ARG B 1 41  ? 27.693 14.143 77.803 1.00 38.62 ? 35  ARG B NE  1 
ATOM   1448 C CZ  . ARG B 1 41  ? 28.372 13.425 76.911 1.00 41.48 ? 35  ARG B CZ  1 
ATOM   1449 N NH1 . ARG B 1 41  ? 29.705 13.512 76.846 1.00 42.56 ? 35  ARG B NH1 1 
ATOM   1450 N NH2 . ARG B 1 41  ? 27.720 12.611 76.091 1.00 40.64 ? 35  ARG B NH2 1 
ATOM   1451 N N   . ASP B 1 42  ? 29.948 20.690 79.824 1.00 25.29 ? 36  ASP B N   1 
ATOM   1452 C CA  . ASP B 1 42  ? 30.553 21.534 80.846 1.00 30.94 ? 36  ASP B CA  1 
ATOM   1453 C C   . ASP B 1 42  ? 29.632 22.642 81.333 1.00 32.66 ? 36  ASP B C   1 
ATOM   1454 O O   . ASP B 1 42  ? 29.492 23.684 80.685 1.00 31.13 ? 36  ASP B O   1 
ATOM   1455 C CB  . ASP B 1 42  ? 31.864 22.120 80.304 1.00 30.50 ? 36  ASP B CB  1 
ATOM   1456 C CG  . ASP B 1 42  ? 32.608 22.944 81.334 1.00 36.99 ? 36  ASP B CG  1 
ATOM   1457 O OD1 . ASP B 1 42  ? 32.127 23.072 82.488 1.00 35.07 ? 36  ASP B OD1 1 
ATOM   1458 O OD2 . ASP B 1 42  ? 33.692 23.467 80.969 1.00 40.03 ? 36  ASP B OD2 1 
ATOM   1459 N N   . ARG B 1 43  ? 29.008 22.429 82.493 1.00 31.81 ? 37  ARG B N   1 
ATOM   1460 C CA  . ARG B 1 43  ? 28.099 23.404 83.068 1.00 32.40 ? 37  ARG B CA  1 
ATOM   1461 C C   . ARG B 1 43  ? 28.740 24.728 83.401 1.00 32.74 ? 37  ARG B C   1 
ATOM   1462 O O   . ARG B 1 43  ? 28.042 25.713 83.633 1.00 34.31 ? 37  ARG B O   1 
ATOM   1463 C CB  . ARG B 1 43  ? 27.449 22.862 84.352 1.00 37.24 ? 37  ARG B CB  1 
ATOM   1464 C CG  . ARG B 1 43  ? 26.044 22.353 84.164 1.00 40.38 ? 37  ARG B CG  1 
ATOM   1465 C CD  . ARG B 1 43  ? 25.286 22.273 85.494 1.00 43.55 ? 37  ARG B CD  1 
ATOM   1466 N NE  . ARG B 1 43  ? 24.684 23.554 85.881 1.00 46.61 ? 37  ARG B NE  1 
ATOM   1467 C CZ  . ARG B 1 43  ? 23.375 23.808 85.840 1.00 48.18 ? 37  ARG B CZ  1 
ATOM   1468 N NH1 . ARG B 1 43  ? 22.524 22.866 85.428 1.00 49.44 ? 37  ARG B NH1 1 
ATOM   1469 N NH2 . ARG B 1 43  ? 22.913 25.001 86.210 1.00 48.89 ? 37  ARG B NH2 1 
ATOM   1470 N N   . SER B 1 44  ? 30.070 24.765 83.443 1.00 33.21 ? 38  SER B N   1 
ATOM   1471 C CA  . SER B 1 44  ? 30.770 25.998 83.785 1.00 30.08 ? 38  SER B CA  1 
ATOM   1472 C C   . SER B 1 44  ? 31.033 26.865 82.545 1.00 31.40 ? 38  SER B C   1 
ATOM   1473 O O   . SER B 1 44  ? 31.422 28.026 82.664 1.00 35.54 ? 38  SER B O   1 
ATOM   1474 C CB  . SER B 1 44  ? 32.107 25.685 84.475 1.00 34.30 ? 38  SER B CB  1 
ATOM   1475 O OG  . SER B 1 44  ? 33.016 25.065 83.565 1.00 36.96 ? 38  SER B OG  1 
ATOM   1476 N N   . ASP B 1 45  ? 30.809 26.291 81.373 1.00 29.62 ? 39  ASP B N   1 
ATOM   1477 C CA  . ASP B 1 45  ? 31.010 27.025 80.122 1.00 31.06 ? 39  ASP B CA  1 
ATOM   1478 C C   . ASP B 1 45  ? 30.202 28.331 80.135 1.00 31.54 ? 39  ASP B C   1 
ATOM   1479 O O   . ASP B 1 45  ? 29.053 28.346 80.552 1.00 31.26 ? 39  ASP B O   1 
ATOM   1480 C CB  . ASP B 1 45  ? 30.597 26.135 78.964 1.00 27.29 ? 39  ASP B CB  1 
ATOM   1481 C CG  . ASP B 1 45  ? 31.079 26.663 77.623 1.00 31.56 ? 39  ASP B CG  1 
ATOM   1482 O OD1 . ASP B 1 45  ? 30.570 27.732 77.210 1.00 33.16 ? 39  ASP B OD1 1 
ATOM   1483 O OD2 . ASP B 1 45  ? 31.937 25.996 77.010 1.00 29.61 ? 39  ASP B OD2 1 
ATOM   1484 N N   . GLN B 1 46  ? 30.797 29.428 79.664 1.00 31.98 ? 40  GLN B N   1 
ATOM   1485 C CA  . GLN B 1 46  ? 30.113 30.713 79.685 1.00 30.29 ? 40  GLN B CA  1 
ATOM   1486 C C   . GLN B 1 46  ? 29.310 31.039 78.428 1.00 27.84 ? 40  GLN B C   1 
ATOM   1487 O O   . GLN B 1 46  ? 28.795 32.134 78.287 1.00 31.78 ? 40  GLN B O   1 
ATOM   1488 C CB  . GLN B 1 46  ? 31.134 31.824 79.951 1.00 37.46 ? 40  GLN B CB  1 
ATOM   1489 C CG  . GLN B 1 46  ? 31.730 31.765 81.369 1.00 40.12 ? 40  GLN B CG  1 
ATOM   1490 C CD  . GLN B 1 46  ? 30.733 32.224 82.429 1.00 45.39 ? 40  GLN B CD  1 
ATOM   1491 O OE1 . GLN B 1 46  ? 30.299 33.383 82.423 1.00 47.31 ? 40  GLN B OE1 1 
ATOM   1492 N NE2 . GLN B 1 46  ? 30.357 31.315 83.338 1.00 43.86 ? 40  GLN B NE2 1 
ATOM   1493 N N   . HIS B 1 47  ? 29.195 30.082 77.525 1.00 27.77 ? 41  HIS B N   1 
ATOM   1494 C CA  . HIS B 1 47  ? 28.457 30.360 76.310 1.00 21.96 ? 41  HIS B CA  1 
ATOM   1495 C C   . HIS B 1 47  ? 27.244 29.478 76.162 1.00 22.95 ? 41  HIS B C   1 
ATOM   1496 O O   . HIS B 1 47  ? 26.754 29.234 75.041 1.00 20.93 ? 41  HIS B O   1 
ATOM   1497 C CB  . HIS B 1 47  ? 29.374 30.209 75.106 1.00 23.77 ? 41  HIS B CB  1 
ATOM   1498 C CG  . HIS B 1 47  ? 30.508 31.185 75.122 1.00 28.72 ? 41  HIS B CG  1 
ATOM   1499 N ND1 . HIS B 1 47  ? 31.814 30.802 75.353 1.00 29.41 ? 41  HIS B ND1 1 
ATOM   1500 C CD2 . HIS B 1 47  ? 30.528 32.530 74.974 1.00 27.49 ? 41  HIS B CD2 1 
ATOM   1501 C CE1 . HIS B 1 47  ? 32.591 31.869 75.340 1.00 27.52 ? 41  HIS B CE1 1 
ATOM   1502 N NE2 . HIS B 1 47  ? 31.837 32.932 75.114 1.00 29.20 ? 41  HIS B NE2 1 
ATOM   1503 N N   . ILE B 1 48  ? 26.778 28.975 77.295 1.00 18.95 ? 42  ILE B N   1 
ATOM   1504 C CA  . ILE B 1 48  ? 25.570 28.122 77.307 1.00 19.78 ? 42  ILE B CA  1 
ATOM   1505 C C   . ILE B 1 48  ? 24.392 28.823 77.985 1.00 18.50 ? 42  ILE B C   1 
ATOM   1506 O O   . ILE B 1 48  ? 23.264 28.298 78.005 1.00 18.41 ? 42  ILE B O   1 
ATOM   1507 C CB  . ILE B 1 48  ? 25.823 26.760 78.015 1.00 18.95 ? 42  ILE B CB  1 
ATOM   1508 C CG1 . ILE B 1 48  ? 26.352 27.033 79.437 1.00 24.48 ? 42  ILE B CG1 1 
ATOM   1509 C CG2 . ILE B 1 48  ? 26.751 25.882 77.185 1.00 18.42 ? 42  ILE B CG2 1 
ATOM   1510 C CD1 . ILE B 1 48  ? 26.445 25.778 80.295 1.00 27.02 ? 42  ILE B CD1 1 
ATOM   1511 N N   . GLN B 1 49  ? 24.611 29.976 78.595 1.00 16.89 ? 43  GLN B N   1 
ATOM   1512 C CA  . GLN B 1 49  ? 23.525 30.707 79.230 1.00 18.14 ? 43  GLN B CA  1 
ATOM   1513 C C   . GLN B 1 49  ? 22.696 31.393 78.168 1.00 20.00 ? 43  GLN B C   1 
ATOM   1514 O O   . GLN B 1 49  ? 23.191 32.274 77.441 1.00 20.09 ? 43  GLN B O   1 
ATOM   1515 C CB  . GLN B 1 49  ? 24.050 31.740 80.208 1.00 21.22 ? 43  GLN B CB  1 
ATOM   1516 C CG  . GLN B 1 49  ? 24.806 31.132 81.371 1.00 31.79 ? 43  GLN B CG  1 
ATOM   1517 C CD  . GLN B 1 49  ? 26.150 30.534 80.969 1.00 38.31 ? 43  GLN B CD  1 
ATOM   1518 O OE1 . GLN B 1 49  ? 26.759 30.930 79.965 1.00 34.44 ? 43  GLN B OE1 1 
ATOM   1519 N NE2 . GLN B 1 49  ? 26.634 29.586 81.771 1.00 40.27 ? 43  GLN B NE2 1 
ATOM   1520 N N   . LEU B 1 50  ? 21.432 31.004 78.049 1.00 15.95 ? 44  LEU B N   1 
ATOM   1521 C CA  . LEU B 1 50  ? 20.589 31.575 77.029 1.00 16.02 ? 44  LEU B CA  1 
ATOM   1522 C C   . LEU B 1 50  ? 19.373 32.295 77.539 1.00 19.22 ? 44  LEU B C   1 
ATOM   1523 O O   . LEU B 1 50  ? 18.714 31.847 78.499 1.00 24.38 ? 44  LEU B O   1 
ATOM   1524 C CB  . LEU B 1 50  ? 20.131 30.445 76.085 1.00 13.38 ? 44  LEU B CB  1 
ATOM   1525 C CG  . LEU B 1 50  ? 21.225 29.514 75.581 1.00 13.19 ? 44  LEU B CG  1 
ATOM   1526 C CD1 . LEU B 1 50  ? 20.661 28.316 74.771 1.00 15.41 ? 44  LEU B CD1 1 
ATOM   1527 C CD2 . LEU B 1 50  ? 22.141 30.378 74.677 1.00 18.43 ? 44  LEU B CD2 1 
ATOM   1528 N N   . GLN B 1 51  ? 19.046 33.400 76.904 1.00 13.04 ? 45  GLN B N   1 
ATOM   1529 C CA  . GLN B 1 51  ? 17.834 34.161 77.243 1.00 13.65 ? 45  GLN B CA  1 
ATOM   1530 C C   . GLN B 1 51  ? 16.789 33.992 76.166 1.00 18.57 ? 45  GLN B C   1 
ATOM   1531 O O   . GLN B 1 51  ? 17.065 34.362 75.008 1.00 15.25 ? 45  GLN B O   1 
ATOM   1532 C CB  . GLN B 1 51  ? 18.150 35.656 77.410 1.00 18.34 ? 45  GLN B CB  1 
ATOM   1533 C CG  . GLN B 1 51  ? 16.952 36.508 77.812 1.00 20.32 ? 45  GLN B CG  1 
ATOM   1534 C CD  . GLN B 1 51  ? 16.390 36.104 79.200 1.00 23.90 ? 45  GLN B CD  1 
ATOM   1535 O OE1 . GLN B 1 51  ? 17.078 36.200 80.216 1.00 25.71 ? 45  GLN B OE1 1 
ATOM   1536 N NE2 . GLN B 1 51  ? 15.148 35.630 79.219 1.00 23.39 ? 45  GLN B NE2 1 
ATOM   1537 N N   . LEU B 1 52  ? 15.646 33.356 76.493 1.00 14.33 ? 46  LEU B N   1 
ATOM   1538 C CA  . LEU B 1 52  ? 14.583 33.227 75.533 1.00 12.68 ? 46  LEU B CA  1 
ATOM   1539 C C   . LEU B 1 52  ? 13.648 34.403 75.688 1.00 15.00 ? 46  LEU B C   1 
ATOM   1540 O O   . LEU B 1 52  ? 13.551 34.997 76.782 1.00 19.39 ? 46  LEU B O   1 
ATOM   1541 C CB  . LEU B 1 52  ? 13.826 31.909 75.778 1.00 15.83 ? 46  LEU B CB  1 
ATOM   1542 C CG  . LEU B 1 52  ? 14.619 30.733 75.198 1.00 14.84 ? 46  LEU B CG  1 
ATOM   1543 C CD1 . LEU B 1 52  ? 15.816 30.385 76.018 1.00 20.51 ? 46  LEU B CD1 1 
ATOM   1544 C CD2 . LEU B 1 52  ? 13.719 29.515 75.119 1.00 19.64 ? 46  LEU B CD2 1 
ATOM   1545 N N   . SER B 1 53  ? 12.952 34.761 74.637 1.00 13.50 ? 47  SER B N   1 
ATOM   1546 C CA  . SER B 1 53  ? 12.002 35.849 74.643 1.00 17.77 ? 47  SER B CA  1 
ATOM   1547 C C   . SER B 1 53  ? 10.929 35.513 73.605 1.00 19.32 ? 47  SER B C   1 
ATOM   1548 O O   . SER B 1 53  ? 11.171 34.819 72.608 1.00 16.77 ? 47  SER B O   1 
ATOM   1549 C CB  . SER B 1 53  ? 12.686 37.183 74.320 1.00 22.00 ? 47  SER B CB  1 
ATOM   1550 O OG  . SER B 1 53  ? 13.338 37.134 73.062 1.00 19.04 ? 47  SER B OG  1 
ATOM   1551 N N   . ALA B 1 54  ? 9.731  35.981 73.843 1.00 21.27 ? 48  ALA B N   1 
ATOM   1552 C CA  . ALA B 1 54  ? 8.647  35.696 72.949 1.00 18.36 ? 48  ALA B CA  1 
ATOM   1553 C C   . ALA B 1 54  ? 8.453  36.716 71.826 1.00 26.94 ? 48  ALA B C   1 
ATOM   1554 O O   . ALA B 1 54  ? 8.851  37.887 71.946 1.00 28.19 ? 48  ALA B O   1 
ATOM   1555 C CB  . ALA B 1 54  ? 7.361  35.607 73.785 1.00 26.04 ? 48  ALA B CB  1 
ATOM   1556 N N   . GLU B 1 55  ? 7.882  36.268 70.709 1.00 21.22 ? 49  GLU B N   1 
ATOM   1557 C CA  . GLU B 1 55  ? 7.518  37.178 69.629 1.00 21.92 ? 49  GLU B CA  1 
ATOM   1558 C C   . GLU B 1 55  ? 6.004  36.957 69.740 1.00 24.53 ? 49  GLU B C   1 
ATOM   1559 O O   . GLU B 1 55  ? 5.398  37.450 70.694 1.00 26.84 ? 49  GLU B O   1 
ATOM   1560 C CB  . GLU B 1 55  ? 8.129  36.712 68.291 1.00 24.64 ? 49  GLU B CB  1 
ATOM   1561 C CG  . GLU B 1 55  ? 7.829  37.625 67.103 1.00 27.85 ? 49  GLU B CG  1 
ATOM   1562 C CD  . GLU B 1 55  ? 8.203  39.089 67.348 1.00 32.47 ? 49  GLU B CD  1 
ATOM   1563 O OE1 . GLU B 1 55  ? 9.400  39.434 67.299 1.00 33.54 ? 49  GLU B OE1 1 
ATOM   1564 O OE2 . GLU B 1 55  ? 7.280  39.885 67.592 1.00 36.74 ? 49  GLU B OE2 1 
ATOM   1565 N N   . SER B 1 56  ? 5.385  36.238 68.814 1.00 21.05 ? 50  SER B N   1 
ATOM   1566 C CA  . SER B 1 56  ? 3.966  35.939 69.014 1.00 21.22 ? 50  SER B CA  1 
ATOM   1567 C C   . SER B 1 56  ? 3.903  34.760 69.993 1.00 21.58 ? 50  SER B C   1 
ATOM   1568 O O   . SER B 1 56  ? 4.939  34.166 70.364 1.00 18.51 ? 50  SER B O   1 
ATOM   1569 C CB  . SER B 1 56  ? 3.292  35.578 67.703 1.00 24.07 ? 50  SER B CB  1 
ATOM   1570 O OG  . SER B 1 56  ? 3.214  36.719 66.869 1.00 29.39 ? 50  SER B OG  1 
ATOM   1571 N N   . VAL B 1 57  ? 2.705  34.393 70.448 1.00 19.54 ? 51  VAL B N   1 
ATOM   1572 C CA  . VAL B 1 57  ? 2.597  33.287 71.397 1.00 17.64 ? 51  VAL B CA  1 
ATOM   1573 C C   . VAL B 1 57  ? 3.165  31.988 70.815 1.00 14.73 ? 51  VAL B C   1 
ATOM   1574 O O   . VAL B 1 57  ? 2.850  31.655 69.695 1.00 17.50 ? 51  VAL B O   1 
ATOM   1575 C CB  . VAL B 1 57  ? 1.116  33.064 71.803 1.00 20.19 ? 51  VAL B CB  1 
ATOM   1576 C CG1 . VAL B 1 57  ? 1.008  31.936 72.784 1.00 23.06 ? 51  VAL B CG1 1 
ATOM   1577 C CG2 . VAL B 1 57  ? 0.570  34.357 72.474 1.00 24.46 ? 51  VAL B CG2 1 
ATOM   1578 N N   . GLY B 1 58  ? 4.027  31.320 71.600 1.00 16.09 ? 52  GLY B N   1 
ATOM   1579 C CA  . GLY B 1 58  ? 4.649  30.071 71.159 1.00 14.75 ? 52  GLY B CA  1 
ATOM   1580 C C   . GLY B 1 58  ? 5.857  30.254 70.243 1.00 13.26 ? 52  GLY B C   1 
ATOM   1581 O O   . GLY B 1 58  ? 6.439  29.264 69.802 1.00 13.31 ? 52  GLY B O   1 
ATOM   1582 N N   . GLU B 1 59  ? 6.230  31.513 69.963 1.00 14.30 ? 53  GLU B N   1 
ATOM   1583 C CA  . GLU B 1 59  ? 7.396  31.790 69.120 1.00 14.86 ? 53  GLU B CA  1 
ATOM   1584 C C   . GLU B 1 59  ? 8.489  32.338 70.026 1.00 16.79 ? 53  GLU B C   1 
ATOM   1585 O O   . GLU B 1 59  ? 8.220  33.139 70.943 1.00 18.67 ? 53  GLU B O   1 
ATOM   1586 C CB  . GLU B 1 59  ? 7.101  32.876 68.092 1.00 14.29 ? 53  GLU B CB  1 
ATOM   1587 C CG  . GLU B 1 59  ? 6.083  32.505 67.062 1.00 16.84 ? 53  GLU B CG  1 
ATOM   1588 C CD  . GLU B 1 59  ? 5.824  33.610 66.081 1.00 17.91 ? 53  GLU B CD  1 
ATOM   1589 O OE1 . GLU B 1 59  ? 6.218  34.791 66.347 1.00 20.64 ? 53  GLU B OE1 1 
ATOM   1590 O OE2 . GLU B 1 59  ? 5.214  33.309 65.052 1.00 21.66 ? 53  GLU B OE2 1 
ATOM   1591 N N   . VAL B 1 60  ? 9.710  31.891 69.817 1.00 12.78 ? 54  VAL B N   1 
ATOM   1592 C CA  . VAL B 1 60  ? 10.769 32.439 70.660 1.00 13.75 ? 54  VAL B CA  1 
ATOM   1593 C C   . VAL B 1 60  ? 12.026 32.781 69.895 1.00 14.41 ? 54  VAL B C   1 
ATOM   1594 O O   . VAL B 1 60  ? 12.266 32.271 68.809 1.00 13.24 ? 54  VAL B O   1 
ATOM   1595 C CB  . VAL B 1 60  ? 11.271 31.438 71.742 1.00 11.86 ? 54  VAL B CB  1 
ATOM   1596 C CG1 . VAL B 1 60  ? 10.105 31.093 72.730 1.00 14.02 ? 54  VAL B CG1 1 
ATOM   1597 C CG2 . VAL B 1 60  ? 11.860 30.174 71.128 1.00 14.48 ? 54  VAL B CG2 1 
ATOM   1598 N N   . TYR B 1 61  ? 12.796 33.701 70.475 1.00 14.73 ? 55  TYR B N   1 
ATOM   1599 C CA  . TYR B 1 61  ? 14.172 33.992 70.031 1.00 11.63 ? 55  TYR B CA  1 
ATOM   1600 C C   . TYR B 1 61  ? 14.990 33.360 71.175 1.00 11.52 ? 55  TYR B C   1 
ATOM   1601 O O   . TYR B 1 61  ? 14.515 33.301 72.351 1.00 14.46 ? 55  TYR B O   1 
ATOM   1602 C CB  . TYR B 1 61  ? 14.501 35.500 70.012 1.00 11.42 ? 55  TYR B CB  1 
ATOM   1603 C CG  . TYR B 1 61  ? 13.823 36.255 68.925 1.00 12.02 ? 55  TYR B CG  1 
ATOM   1604 C CD1 . TYR B 1 61  ? 14.263 36.140 67.597 1.00 13.62 ? 55  TYR B CD1 1 
ATOM   1605 C CD2 . TYR B 1 61  ? 12.734 37.089 69.201 1.00 15.19 ? 55  TYR B CD2 1 
ATOM   1606 C CE1 . TYR B 1 61  ? 13.637 36.836 66.548 1.00 13.94 ? 55  TYR B CE1 1 
ATOM   1607 C CE2 . TYR B 1 61  ? 12.099 37.795 68.155 1.00 19.39 ? 55  TYR B CE2 1 
ATOM   1608 C CZ  . TYR B 1 61  ? 12.562 37.651 66.855 1.00 19.19 ? 55  TYR B CZ  1 
ATOM   1609 O OH  . TYR B 1 61  ? 11.911 38.311 65.807 1.00 24.78 ? 55  TYR B OH  1 
ATOM   1610 N N   . ILE B 1 62  ? 16.198 32.871 70.864 1.00 11.36 ? 56  ILE B N   1 
ATOM   1611 C CA  . ILE B 1 62  ? 17.095 32.235 71.810 1.00 11.27 ? 56  ILE B CA  1 
ATOM   1612 C C   . ILE B 1 62  ? 18.424 33.009 71.716 1.00 15.01 ? 56  ILE B C   1 
ATOM   1613 O O   . ILE B 1 62  ? 19.119 32.885 70.717 1.00 13.33 ? 56  ILE B O   1 
ATOM   1614 C CB  . ILE B 1 62  ? 17.273 30.778 71.423 1.00 11.08 ? 56  ILE B CB  1 
ATOM   1615 C CG1 . ILE B 1 62  ? 15.894 30.054 71.571 1.00 13.87 ? 56  ILE B CG1 1 
ATOM   1616 C CG2 . ILE B 1 62  ? 18.323 30.057 72.352 1.00 12.95 ? 56  ILE B CG2 1 
ATOM   1617 C CD1 . ILE B 1 62  ? 15.888 28.634 70.945 1.00 13.89 ? 56  ILE B CD1 1 
ATOM   1618 N N   . LYS B 1 63  ? 18.748 33.762 72.764 1.00 13.34 ? 57  LYS B N   1 
ATOM   1619 C CA  . LYS B 1 63  ? 19.904 34.653 72.708 1.00 12.59 ? 57  LYS B CA  1 
ATOM   1620 C C   . LYS B 1 63  ? 20.999 34.270 73.658 1.00 17.98 ? 57  LYS B C   1 
ATOM   1621 O O   . LYS B 1 63  ? 20.737 33.938 74.833 1.00 16.97 ? 57  LYS B O   1 
ATOM   1622 C CB  . LYS B 1 63  ? 19.448 36.060 73.062 1.00 14.21 ? 57  LYS B CB  1 
ATOM   1623 C CG  . LYS B 1 63  ? 20.577 37.084 72.848 1.00 16.97 ? 57  LYS B CG  1 
ATOM   1624 C CD  . LYS B 1 63  ? 20.100 38.453 73.283 1.00 25.90 ? 57  LYS B CD  1 
ATOM   1625 C CE  . LYS B 1 63  ? 20.254 38.603 74.782 1.00 28.39 ? 57  LYS B CE  1 
ATOM   1626 N NZ  . LYS B 1 63  ? 19.504 39.810 75.276 1.00 33.10 ? 57  LYS B NZ  1 
ATOM   1627 N N   . SER B 1 64  ? 22.234 34.277 73.162 1.00 14.86 ? 58  SER B N   1 
ATOM   1628 C CA  . SER B 1 64  ? 23.402 34.031 74.025 1.00 15.22 ? 58  SER B CA  1 
ATOM   1629 C C   . SER B 1 64  ? 23.557 35.260 74.920 1.00 22.82 ? 58  SER B C   1 
ATOM   1630 O O   . SER B 1 64  ? 23.729 36.395 74.420 1.00 18.44 ? 58  SER B O   1 
ATOM   1631 C CB  . SER B 1 64  ? 24.655 33.895 73.165 1.00 22.27 ? 58  SER B CB  1 
ATOM   1632 O OG  . SER B 1 64  ? 25.826 34.121 73.928 1.00 22.77 ? 58  SER B OG  1 
ATOM   1633 N N   . THR B 1 65  ? 23.544 35.060 76.236 1.00 21.93 ? 59  THR B N   1 
ATOM   1634 C CA  . THR B 1 65  ? 23.663 36.211 77.116 1.00 22.64 ? 59  THR B CA  1 
ATOM   1635 C C   . THR B 1 65  ? 25.089 36.758 77.114 1.00 22.23 ? 59  THR B C   1 
ATOM   1636 O O   . THR B 1 65  ? 25.282 37.965 77.280 1.00 27.62 ? 59  THR B O   1 
ATOM   1637 C CB  . THR B 1 65  ? 23.244 35.854 78.597 1.00 20.96 ? 59  THR B CB  1 
ATOM   1638 O OG1 . THR B 1 65  ? 24.108 34.847 79.119 1.00 26.05 ? 59  THR B OG1 1 
ATOM   1639 C CG2 . THR B 1 65  ? 21.763 35.362 78.635 1.00 24.67 ? 59  THR B CG2 1 
ATOM   1640 N N   . GLU B 1 66  ? 26.053 35.886 76.865 1.00 17.05 ? 60  GLU B N   1 
ATOM   1641 C CA  . GLU B 1 66  ? 27.481 36.259 76.904 1.00 24.52 ? 60  GLU B CA  1 
ATOM   1642 C C   . GLU B 1 66  ? 27.921 37.067 75.682 1.00 25.33 ? 60  GLU B C   1 
ATOM   1643 O O   . GLU B 1 66  ? 28.714 38.032 75.786 1.00 24.09 ? 60  GLU B O   1 
ATOM   1644 C CB  . GLU B 1 66  ? 28.310 34.974 77.011 1.00 26.68 ? 60  GLU B CB  1 
ATOM   1645 C CG  . GLU B 1 66  ? 29.832 35.115 77.188 1.00 26.77 ? 60  GLU B CG  1 
ATOM   1646 C CD  . GLU B 1 66  ? 30.257 35.876 78.432 1.00 37.89 ? 60  GLU B CD  1 
ATOM   1647 O OE1 . GLU B 1 66  ? 29.442 36.053 79.356 1.00 34.03 ? 60  GLU B OE1 1 
ATOM   1648 O OE2 . GLU B 1 66  ? 31.441 36.303 78.483 1.00 41.95 ? 60  GLU B OE2 1 
ATOM   1649 N N   . THR B 1 67  ? 27.376 36.709 74.521 1.00 21.73 ? 61  THR B N   1 
ATOM   1650 C CA  . THR B 1 67  ? 27.799 37.361 73.269 1.00 20.68 ? 61  THR B CA  1 
ATOM   1651 C C   . THR B 1 67  ? 26.765 38.173 72.528 1.00 19.56 ? 61  THR B C   1 
ATOM   1652 O O   . THR B 1 67  ? 27.100 38.886 71.570 1.00 22.74 ? 61  THR B O   1 
ATOM   1653 C CB  . THR B 1 67  ? 28.325 36.335 72.274 1.00 18.86 ? 61  THR B CB  1 
ATOM   1654 O OG1 . THR B 1 67  ? 27.228 35.556 71.762 1.00 20.84 ? 61  THR B OG1 1 
ATOM   1655 C CG2 . THR B 1 67  ? 29.320 35.385 72.917 1.00 24.32 ? 61  THR B CG2 1 
ATOM   1656 N N   . GLY B 1 68  ? 25.499 38.055 72.924 1.00 20.53 ? 62  GLY B N   1 
ATOM   1657 C CA  . GLY B 1 68  ? 24.456 38.812 72.248 1.00 19.15 ? 62  GLY B CA  1 
ATOM   1658 C C   . GLY B 1 68  ? 23.929 38.190 70.954 1.00 13.45 ? 62  GLY B C   1 
ATOM   1659 O O   . GLY B 1 68  ? 23.016 38.739 70.367 1.00 15.31 ? 62  GLY B O   1 
ATOM   1660 N N   . GLN B 1 69  ? 24.545 37.105 70.503 1.00 15.49 ? 63  GLN B N   1 
ATOM   1661 C CA  . GLN B 1 69  ? 24.085 36.446 69.268 1.00 11.83 ? 63  GLN B CA  1 
ATOM   1662 C C   . GLN B 1 69  ? 22.798 35.659 69.484 1.00 16.18 ? 63  GLN B C   1 
ATOM   1663 O O   . GLN B 1 69  ? 22.506 35.133 70.575 1.00 15.82 ? 63  GLN B O   1 
ATOM   1664 C CB  . GLN B 1 69  ? 25.128 35.456 68.774 1.00 12.92 ? 63  GLN B CB  1 
ATOM   1665 C CG  . GLN B 1 69  ? 26.488 36.116 68.380 1.00 15.84 ? 63  GLN B CG  1 
ATOM   1666 C CD  . GLN B 1 69  ? 27.488 35.095 68.016 1.00 14.93 ? 63  GLN B CD  1 
ATOM   1667 O OE1 . GLN B 1 69  ? 27.736 34.827 66.835 1.00 22.62 ? 63  GLN B OE1 1 
ATOM   1668 N NE2 . GLN B 1 69  ? 28.112 34.494 69.030 1.00 18.98 ? 63  GLN B NE2 1 
ATOM   1669 N N   . TYR B 1 70  ? 22.052 35.552 68.402 1.00 11.53 ? 64  TYR B N   1 
ATOM   1670 C CA  . TYR B 1 70  ? 20.801 34.784 68.407 1.00 10.99 ? 64  TYR B CA  1 
ATOM   1671 C C   . TYR B 1 70  ? 20.989 33.480 67.691 1.00 14.24 ? 64  TYR B C   1 
ATOM   1672 O O   . TYR B 1 70  ? 21.641 33.396 66.653 1.00 13.14 ? 64  TYR B O   1 
ATOM   1673 C CB  . TYR B 1 70  ? 19.719 35.595 67.694 1.00 10.56 ? 64  TYR B CB  1 
ATOM   1674 C CG  . TYR B 1 70  ? 19.286 36.798 68.457 1.00 15.84 ? 64  TYR B CG  1 
ATOM   1675 C CD1 . TYR B 1 70  ? 19.971 38.022 68.343 1.00 16.10 ? 64  TYR B CD1 1 
ATOM   1676 C CD2 . TYR B 1 70  ? 18.201 36.702 69.328 1.00 18.12 ? 64  TYR B CD2 1 
ATOM   1677 C CE1 . TYR B 1 70  ? 19.535 39.140 69.106 1.00 16.17 ? 64  TYR B CE1 1 
ATOM   1678 C CE2 . TYR B 1 70  ? 17.774 37.765 70.087 1.00 17.77 ? 64  TYR B CE2 1 
ATOM   1679 C CZ  . TYR B 1 70  ? 18.444 38.980 69.966 1.00 17.48 ? 64  TYR B CZ  1 
ATOM   1680 O OH  . TYR B 1 70  ? 17.983 40.054 70.693 1.00 24.35 ? 64  TYR B OH  1 
ATOM   1681 N N   . LEU B 1 71  ? 20.366 32.432 68.225 1.00 11.46 ? 65  LEU B N   1 
ATOM   1682 C CA  . LEU B 1 71  ? 20.400 31.155 67.539 1.00 9.56  ? 65  LEU B CA  1 
ATOM   1683 C C   . LEU B 1 71  ? 19.556 31.301 66.251 1.00 11.15 ? 65  LEU B C   1 
ATOM   1684 O O   . LEU B 1 71  ? 18.466 31.920 66.245 1.00 10.56 ? 65  LEU B O   1 
ATOM   1685 C CB  . LEU B 1 71  ? 19.758 30.075 68.443 1.00 10.02 ? 65  LEU B CB  1 
ATOM   1686 C CG  . LEU B 1 71  ? 19.807 28.701 67.760 1.00 11.28 ? 65  LEU B CG  1 
ATOM   1687 C CD1 . LEU B 1 71  ? 21.255 28.128 67.792 1.00 16.04 ? 65  LEU B CD1 1 
ATOM   1688 C CD2 . LEU B 1 71  ? 18.874 27.680 68.492 1.00 11.52 ? 65  LEU B CD2 1 
ATOM   1689 N N   . ALA B 1 72  ? 20.078 30.740 65.168 1.00 10.07 ? 66  ALA B N   1 
ATOM   1690 C CA  . ALA B 1 72  ? 19.394 30.850 63.867 1.00 10.98 ? 66  ALA B CA  1 
ATOM   1691 C C   . ALA B 1 72  ? 19.619 29.547 63.119 1.00 10.31 ? 66  ALA B C   1 
ATOM   1692 O O   . ALA B 1 72  ? 20.559 28.793 63.416 1.00 10.55 ? 66  ALA B O   1 
ATOM   1693 C CB  . ALA B 1 72  ? 20.011 32.013 63.031 1.00 10.99 ? 66  ALA B CB  1 
ATOM   1694 N N   . MET B 1 73  ? 18.739 29.269 62.151 1.00 12.08 ? 67  MET B N   1 
ATOM   1695 C CA  . MET B 1 73  ? 18.883 28.095 61.276 1.00 11.03 ? 67  MET B CA  1 
ATOM   1696 C C   . MET B 1 73  ? 18.812 28.610 59.852 1.00 10.55 ? 67  MET B C   1 
ATOM   1697 O O   . MET B 1 73  ? 17.851 29.282 59.494 1.00 10.55 ? 67  MET B O   1 
ATOM   1698 C CB  . MET B 1 73  ? 17.758 27.049 61.508 1.00 11.83 ? 67  MET B CB  1 
ATOM   1699 C CG  . MET B 1 73  ? 17.922 25.860 60.592 1.00 8.82  ? 67  MET B CG  1 
ATOM   1700 S SD  . MET B 1 73  ? 16.717 24.594 60.858 1.00 12.57 ? 67  MET B SD  1 
ATOM   1701 C CE  . MET B 1 73  ? 17.387 23.751 62.264 1.00 15.55 ? 67  MET B CE  1 
ATOM   1702 N N   . ASP B 1 74  ? 19.846 28.250 59.068 1.00 11.76 ? 68  ASP B N   1 
ATOM   1703 C CA  . ASP B 1 74  ? 19.925 28.750 57.728 1.00 11.93 ? 68  ASP B CA  1 
ATOM   1704 C C   . ASP B 1 74  ? 19.137 27.925 56.733 1.00 10.68 ? 68  ASP B C   1 
ATOM   1705 O O   . ASP B 1 74  ? 18.466 26.954 57.106 1.00 12.06 ? 68  ASP B O   1 
ATOM   1706 C CB  . ASP B 1 74  ? 21.404 28.992 57.314 1.00 12.06 ? 68  ASP B CB  1 
ATOM   1707 C CG  . ASP B 1 74  ? 22.266 27.743 57.247 1.00 12.76 ? 68  ASP B CG  1 
ATOM   1708 O OD1 . ASP B 1 74  ? 21.753 26.620 56.941 1.00 11.96 ? 68  ASP B OD1 1 
ATOM   1709 O OD2 . ASP B 1 74  ? 23.476 27.889 57.452 1.00 13.75 ? 68  ASP B OD2 1 
ATOM   1710 N N   . THR B 1 75  ? 19.211 28.273 55.459 1.00 10.84 ? 69  THR B N   1 
ATOM   1711 C CA  . THR B 1 75  ? 18.378 27.583 54.475 1.00 10.75 ? 69  THR B CA  1 
ATOM   1712 C C   . THR B 1 75  ? 18.807 26.163 54.158 1.00 10.56 ? 69  THR B C   1 
ATOM   1713 O O   . THR B 1 75  ? 18.032 25.430 53.472 1.00 11.34 ? 69  THR B O   1 
ATOM   1714 C CB  . THR B 1 75  ? 18.284 28.384 53.155 1.00 11.83 ? 69  THR B CB  1 
ATOM   1715 O OG1 . THR B 1 75  ? 19.609 28.692 52.709 1.00 13.00 ? 69  THR B OG1 1 
ATOM   1716 C CG2 . THR B 1 75  ? 17.462 29.680 53.342 1.00 11.95 ? 69  THR B CG2 1 
ATOM   1717 N N   . ASP B 1 76  ? 19.976 25.773 54.636 1.00 12.09 ? 70  ASP B N   1 
ATOM   1718 C CA  . ASP B 1 76  ? 20.419 24.415 54.476 1.00 12.91 ? 70  ASP B CA  1 
ATOM   1719 C C   . ASP B 1 76  ? 20.078 23.605 55.744 1.00 15.41 ? 70  ASP B C   1 
ATOM   1720 O O   . ASP B 1 76  ? 20.370 22.417 55.816 1.00 16.69 ? 70  ASP B O   1 
ATOM   1721 C CB  . ASP B 1 76  ? 21.891 24.338 54.159 1.00 15.20 ? 70  ASP B CB  1 
ATOM   1722 C CG  . ASP B 1 76  ? 22.148 24.513 52.682 1.00 20.28 ? 70  ASP B CG  1 
ATOM   1723 O OD1 . ASP B 1 76  ? 21.729 23.629 51.904 1.00 18.39 ? 70  ASP B OD1 1 
ATOM   1724 O OD2 . ASP B 1 76  ? 22.746 25.524 52.299 1.00 23.18 ? 70  ASP B OD2 1 
ATOM   1725 N N   . GLY B 1 77  ? 19.434 24.265 56.710 1.00 13.20 ? 71  GLY B N   1 
ATOM   1726 C CA  . GLY B 1 77  ? 19.052 23.591 57.960 1.00 12.10 ? 71  GLY B CA  1 
ATOM   1727 C C   . GLY B 1 77  ? 20.144 23.556 59.003 1.00 15.26 ? 71  GLY B C   1 
ATOM   1728 O O   . GLY B 1 77  ? 20.046 22.793 59.950 1.00 14.65 ? 71  GLY B O   1 
ATOM   1729 N N   . LEU B 1 78  ? 21.195 24.372 58.872 1.00 12.29 ? 72  LEU B N   1 
ATOM   1730 C CA  . LEU B 1 78  ? 22.293 24.355 59.833 1.00 12.74 ? 72  LEU B CA  1 
ATOM   1731 C C   . LEU B 1 78  ? 22.190 25.512 60.820 1.00 13.28 ? 72  LEU B C   1 
ATOM   1732 O O   . LEU B 1 78  ? 21.867 26.666 60.453 1.00 12.96 ? 72  LEU B O   1 
ATOM   1733 C CB  . LEU B 1 78  ? 23.690 24.433 59.132 1.00 16.62 ? 72  LEU B CB  1 
ATOM   1734 C CG  . LEU B 1 78  ? 24.171 23.096 58.577 1.00 26.05 ? 72  LEU B CG  1 
ATOM   1735 C CD1 . LEU B 1 78  ? 23.391 22.818 57.327 1.00 26.10 ? 72  LEU B CD1 1 
ATOM   1736 C CD2 . LEU B 1 78  ? 25.673 23.096 58.284 1.00 26.72 ? 72  LEU B CD2 1 
ATOM   1737 N N   . LEU B 1 79  ? 22.453 25.187 62.074 1.00 13.35 ? 73  LEU B N   1 
ATOM   1738 C CA  . LEU B 1 79  ? 22.427 26.175 63.133 1.00 12.70 ? 73  LEU B CA  1 
ATOM   1739 C C   . LEU B 1 79  ? 23.641 27.084 63.102 1.00 14.47 ? 73  LEU B C   1 
ATOM   1740 O O   . LEU B 1 79  ? 24.766 26.639 62.840 1.00 14.73 ? 73  LEU B O   1 
ATOM   1741 C CB  . LEU B 1 79  ? 22.389 25.510 64.532 1.00 12.69 ? 73  LEU B CB  1 
ATOM   1742 C CG  . LEU B 1 79  ? 21.173 24.599 64.787 1.00 13.13 ? 73  LEU B CG  1 
ATOM   1743 C CD1 . LEU B 1 79  ? 21.374 23.951 66.179 1.00 14.38 ? 73  LEU B CD1 1 
ATOM   1744 C CD2 . LEU B 1 79  ? 19.910 25.394 64.679 1.00 13.57 ? 73  LEU B CD2 1 
ATOM   1745 N N   . TYR B 1 80  ? 23.405 28.340 63.456 1.00 11.77 ? 74  TYR B N   1 
ATOM   1746 C CA  . TYR B 1 80  ? 24.532 29.296 63.597 1.00 11.89 ? 74  TYR B CA  1 
ATOM   1747 C C   . TYR B 1 80  ? 24.131 30.417 64.530 1.00 13.10 ? 74  TYR B C   1 
ATOM   1748 O O   . TYR B 1 80  ? 22.950 30.631 64.824 1.00 12.41 ? 74  TYR B O   1 
ATOM   1749 C CB  . TYR B 1 80  ? 24.959 29.871 62.227 1.00 13.87 ? 74  TYR B CB  1 
ATOM   1750 C CG  . TYR B 1 80  ? 23.910 30.811 61.575 1.00 12.33 ? 74  TYR B CG  1 
ATOM   1751 C CD1 . TYR B 1 80  ? 22.786 30.304 60.902 1.00 11.62 ? 74  TYR B CD1 1 
ATOM   1752 C CD2 . TYR B 1 80  ? 24.098 32.205 61.603 1.00 10.06 ? 74  TYR B CD2 1 
ATOM   1753 C CE1 . TYR B 1 80  ? 21.884 31.181 60.256 1.00 9.59  ? 74  TYR B CE1 1 
ATOM   1754 C CE2 . TYR B 1 80  ? 23.218 33.090 60.973 1.00 11.20 ? 74  TYR B CE2 1 
ATOM   1755 C CZ  . TYR B 1 80  ? 22.110 32.571 60.298 1.00 10.56 ? 74  TYR B CZ  1 
ATOM   1756 O OH  . TYR B 1 80  ? 21.233 33.449 59.706 1.00 11.73 ? 74  TYR B OH  1 
ATOM   1757 N N   . GLY B 1 81  ? 25.118 31.177 65.016 1.00 12.55 ? 75  GLY B N   1 
ATOM   1758 C CA  . GLY B 1 81  ? 24.801 32.311 65.868 1.00 12.42 ? 75  GLY B CA  1 
ATOM   1759 C C   . GLY B 1 81  ? 24.750 33.534 64.956 1.00 14.78 ? 75  GLY B C   1 
ATOM   1760 O O   . GLY B 1 81  ? 25.704 33.783 64.206 1.00 14.20 ? 75  GLY B O   1 
ATOM   1761 N N   . SER B 1 82  ? 23.657 34.273 65.024 1.00 12.45 ? 76  SER B N   1 
ATOM   1762 C CA  . SER B 1 82  ? 23.416 35.454 64.193 1.00 14.74 ? 76  SER B CA  1 
ATOM   1763 C C   . SER B 1 82  ? 23.655 36.742 64.976 1.00 12.10 ? 76  SER B C   1 
ATOM   1764 O O   . SER B 1 82  ? 23.301 36.858 66.158 1.00 13.32 ? 76  SER B O   1 
ATOM   1765 C CB  . SER B 1 82  ? 21.952 35.429 63.741 1.00 11.61 ? 76  SER B CB  1 
ATOM   1766 O OG  . SER B 1 82  ? 21.590 36.588 62.987 1.00 12.06 ? 76  SER B OG  1 
ATOM   1767 N N   . GLN B 1 83  ? 24.229 37.737 64.325 1.00 11.89 ? 77  GLN B N   1 
ATOM   1768 C CA  . GLN B 1 83  ? 24.411 39.012 64.970 1.00 12.18 ? 77  GLN B CA  1 
ATOM   1769 C C   . GLN B 1 83  ? 23.106 39.761 65.237 1.00 13.72 ? 77  GLN B C   1 
ATOM   1770 O O   . GLN B 1 83  ? 23.048 40.693 66.066 1.00 15.12 ? 77  GLN B O   1 
ATOM   1771 C CB  . GLN B 1 83  ? 25.272 39.912 64.067 1.00 16.71 ? 77  GLN B CB  1 
ATOM   1772 C CG  . GLN B 1 83  ? 26.668 39.361 63.848 1.00 18.33 ? 77  GLN B CG  1 
ATOM   1773 C CD  . GLN B 1 83  ? 27.441 39.257 65.149 1.00 14.69 ? 77  GLN B CD  1 
ATOM   1774 O OE1 . GLN B 1 83  ? 27.920 38.160 65.532 1.00 20.97 ? 77  GLN B OE1 1 
ATOM   1775 N NE2 . GLN B 1 83  ? 27.600 40.400 65.830 1.00 17.55 ? 77  GLN B NE2 1 
ATOM   1776 N N   . THR B 1 84  ? 22.057 39.415 64.501 1.00 12.62 ? 78  THR B N   1 
ATOM   1777 C CA  . THR B 1 84  ? 20.799 40.145 64.613 1.00 12.73 ? 78  THR B CA  1 
ATOM   1778 C C   . THR B 1 84  ? 19.655 39.126 64.699 1.00 13.82 ? 78  THR B C   1 
ATOM   1779 O O   . THR B 1 84  ? 19.764 38.024 64.170 1.00 15.60 ? 78  THR B O   1 
ATOM   1780 C CB  . THR B 1 84  ? 20.563 40.986 63.385 1.00 13.30 ? 78  THR B CB  1 
ATOM   1781 O OG1 . THR B 1 84  ? 20.595 40.158 62.226 1.00 14.86 ? 78  THR B OG1 1 
ATOM   1782 C CG2 . THR B 1 84  ? 21.601 42.056 63.264 1.00 15.62 ? 78  THR B CG2 1 
ATOM   1783 N N   . PRO B 1 85  ? 18.546 39.517 65.322 1.00 12.17 ? 79  PRO B N   1 
ATOM   1784 C CA  . PRO B 1 85  ? 17.361 38.641 65.483 1.00 12.12 ? 79  PRO B CA  1 
ATOM   1785 C C   . PRO B 1 85  ? 16.446 38.875 64.314 1.00 19.21 ? 79  PRO B C   1 
ATOM   1786 O O   . PRO B 1 85  ? 15.694 39.864 64.269 1.00 30.31 ? 79  PRO B O   1 
ATOM   1787 C CB  . PRO B 1 85  ? 16.760 39.115 66.813 1.00 15.43 ? 79  PRO B CB  1 
ATOM   1788 C CG  . PRO B 1 85  ? 17.001 40.658 66.732 1.00 19.52 ? 79  PRO B CG  1 
ATOM   1789 C CD  . PRO B 1 85  ? 18.436 40.753 66.128 1.00 15.89 ? 79  PRO B CD  1 
ATOM   1790 N N   . ASN B 1 86  ? 16.459 37.962 63.364 1.00 15.95 ? 80  ASN B N   1 
ATOM   1791 C CA  . ASN B 1 86  ? 15.659 38.113 62.149 1.00 15.74 ? 80  ASN B CA  1 
ATOM   1792 C C   . ASN B 1 86  ? 14.795 36.867 61.929 1.00 14.32 ? 80  ASN B C   1 
ATOM   1793 O O   . ASN B 1 86  ? 14.715 36.025 62.828 1.00 14.74 ? 80  ASN B O   1 
ATOM   1794 C CB  . ASN B 1 86  ? 16.632 38.369 60.975 1.00 16.53 ? 80  ASN B CB  1 
ATOM   1795 C CG  . ASN B 1 86  ? 17.662 37.255 60.834 1.00 17.26 ? 80  ASN B CG  1 
ATOM   1796 O OD1 . ASN B 1 86  ? 17.288 36.090 60.769 1.00 16.57 ? 80  ASN B OD1 1 
ATOM   1797 N ND2 . ASN B 1 86  ? 18.948 37.599 60.805 1.00 17.84 ? 80  ASN B ND2 1 
ATOM   1798 N N   . GLU B 1 87  ? 14.208 36.713 60.736 1.00 14.30 ? 81  GLU B N   1 
ATOM   1799 C CA  . GLU B 1 87  ? 13.302 35.589 60.427 1.00 14.01 ? 81  GLU B CA  1 
ATOM   1800 C C   . GLU B 1 87  ? 13.964 34.220 60.576 1.00 14.22 ? 81  GLU B C   1 
ATOM   1801 O O   . GLU B 1 87  ? 13.264 33.232 60.879 1.00 14.67 ? 81  GLU B O   1 
ATOM   1802 C CB  . GLU B 1 87  ? 12.748 35.714 58.992 1.00 16.26 ? 81  GLU B CB  1 
ATOM   1803 C CG  . GLU B 1 87  ? 13.828 35.737 57.898 1.00 24.73 ? 81  GLU B CG  1 
ATOM   1804 C CD  . GLU B 1 87  ? 13.294 35.418 56.481 1.00 29.43 ? 81  GLU B CD  1 
ATOM   1805 O OE1 . GLU B 1 87  ? 12.115 35.741 56.189 1.00 37.80 ? 81  GLU B OE1 1 
ATOM   1806 O OE2 . GLU B 1 87  ? 14.073 34.852 55.677 1.00 29.51 ? 81  GLU B OE2 1 
ATOM   1807 N N   . GLU B 1 88  ? 15.282 34.150 60.460 1.00 13.51 ? 82  GLU B N   1 
ATOM   1808 C CA  . GLU B 1 88  ? 15.977 32.860 60.613 1.00 11.06 ? 82  GLU B CA  1 
ATOM   1809 C C   . GLU B 1 88  ? 16.148 32.464 62.069 1.00 10.16 ? 82  GLU B C   1 
ATOM   1810 O O   . GLU B 1 88  ? 16.576 31.358 62.367 1.00 12.13 ? 82  GLU B O   1 
ATOM   1811 C CB  . GLU B 1 88  ? 17.365 32.875 59.947 1.00 13.49 ? 82  GLU B CB  1 
ATOM   1812 C CG  . GLU B 1 88  ? 17.333 33.263 58.442 1.00 13.19 ? 82  GLU B CG  1 
ATOM   1813 C CD  . GLU B 1 88  ? 18.412 32.574 57.618 1.00 13.49 ? 82  GLU B CD  1 
ATOM   1814 O OE1 . GLU B 1 88  ? 19.499 32.282 58.131 1.00 14.06 ? 82  GLU B OE1 1 
ATOM   1815 O OE2 . GLU B 1 88  ? 18.123 32.300 56.403 1.00 14.98 ? 82  GLU B OE2 1 
ATOM   1816 N N   . CYS B 1 89  ? 15.771 33.378 62.974 1.00 10.50 ? 83  CYS B N   1 
ATOM   1817 C CA  . CYS B 1 89  ? 16.017 33.198 64.410 1.00 11.63 ? 83  CYS B CA  1 
ATOM   1818 C C   . CYS B 1 89  ? 14.778 32.887 65.191 1.00 13.09 ? 83  CYS B C   1 
ATOM   1819 O O   . CYS B 1 89  ? 14.856 32.693 66.412 1.00 12.15 ? 83  CYS B O   1 
ATOM   1820 C CB  . CYS B 1 89  ? 16.662 34.446 65.029 1.00 13.50 ? 83  CYS B CB  1 
ATOM   1821 S SG  . CYS B 1 89  ? 18.186 34.998 64.195 1.00 12.64 ? 83  CYS B SG  1 
ATOM   1822 N N   . LEU B 1 90  ? 13.631 32.818 64.526 1.00 11.60 ? 84  LEU B N   1 
ATOM   1823 C CA  . LEU B 1 90  ? 12.391 32.488 65.254 1.00 12.51 ? 84  LEU B CA  1 
ATOM   1824 C C   . LEU B 1 90  ? 12.116 31.022 65.269 1.00 14.59 ? 84  LEU B C   1 
ATOM   1825 O O   . LEU B 1 90  ? 12.192 30.373 64.238 1.00 12.80 ? 84  LEU B O   1 
ATOM   1826 C CB  . LEU B 1 90  ? 11.215 33.226 64.626 1.00 15.06 ? 84  LEU B CB  1 
ATOM   1827 C CG  . LEU B 1 90  ? 11.056 34.691 65.052 1.00 14.03 ? 84  LEU B CG  1 
ATOM   1828 C CD1 . LEU B 1 90  ? 10.032 35.337 64.096 1.00 21.02 ? 84  LEU B CD1 1 
ATOM   1829 C CD2 . LEU B 1 90  ? 10.624 34.818 66.570 1.00 14.55 ? 84  LEU B CD2 1 
ATOM   1830 N N   . PHE B 1 91  ? 11.787 30.499 66.448 1.00 11.55 ? 85  PHE B N   1 
ATOM   1831 C CA  . PHE B 1 91  ? 11.491 29.084 66.590 1.00 11.26 ? 85  PHE B CA  1 
ATOM   1832 C C   . PHE B 1 91  ? 10.175 28.903 67.274 1.00 12.42 ? 85  PHE B C   1 
ATOM   1833 O O   . PHE B 1 91  ? 9.767  29.698 68.125 1.00 13.58 ? 85  PHE B O   1 
ATOM   1834 C CB  . PHE B 1 91  ? 12.561 28.389 67.430 1.00 10.80 ? 85  PHE B CB  1 
ATOM   1835 C CG  . PHE B 1 91  ? 13.902 28.372 66.773 1.00 10.90 ? 85  PHE B CG  1 
ATOM   1836 C CD1 . PHE B 1 91  ? 14.802 29.424 66.974 1.00 11.59 ? 85  PHE B CD1 1 
ATOM   1837 C CD2 . PHE B 1 91  ? 14.227 27.360 65.863 1.00 11.44 ? 85  PHE B CD2 1 
ATOM   1838 C CE1 . PHE B 1 91  ? 15.990 29.447 66.276 1.00 11.84 ? 85  PHE B CE1 1 
ATOM   1839 C CE2 . PHE B 1 91  ? 15.456 27.380 65.142 1.00 10.21 ? 85  PHE B CE2 1 
ATOM   1840 C CZ  . PHE B 1 91  ? 16.338 28.456 65.373 1.00 11.52 ? 85  PHE B CZ  1 
ATOM   1841 N N   . LEU B 1 92  ? 9.497  27.834 66.888 1.00 11.77 ? 86  LEU B N   1 
ATOM   1842 C CA  . LEU B 1 92  ? 8.210  27.447 67.498 1.00 11.17 ? 86  LEU B CA  1 
ATOM   1843 C C   . LEU B 1 92  ? 8.557  26.526 68.668 1.00 10.74 ? 86  LEU B C   1 
ATOM   1844 O O   . LEU B 1 92  ? 9.052  25.425 68.478 1.00 12.07 ? 86  LEU B O   1 
ATOM   1845 C CB  . LEU B 1 92  ? 7.374  26.666 66.473 1.00 11.72 ? 86  LEU B CB  1 
ATOM   1846 C CG  . LEU B 1 92  ? 7.148  27.396 65.144 1.00 14.10 ? 86  LEU B CG  1 
ATOM   1847 C CD1 . LEU B 1 92  ? 6.183  26.559 64.306 1.00 16.04 ? 86  LEU B CD1 1 
ATOM   1848 C CD2 . LEU B 1 92  ? 6.632  28.817 65.325 1.00 14.79 ? 86  LEU B CD2 1 
ATOM   1849 N N   . GLU B 1 93  ? 8.357  27.042 69.905 1.00 11.31 ? 87  GLU B N   1 
ATOM   1850 C CA  . GLU B 1 93  ? 8.662  26.301 71.116 1.00 10.56 ? 87  GLU B CA  1 
ATOM   1851 C C   . GLU B 1 93  ? 7.408  25.520 71.509 1.00 10.27 ? 87  GLU B C   1 
ATOM   1852 O O   . GLU B 1 93  ? 6.348  26.160 71.752 1.00 11.37 ? 87  GLU B O   1 
ATOM   1853 C CB  . GLU B 1 93  ? 9.051  27.291 72.217 1.00 11.75 ? 87  GLU B CB  1 
ATOM   1854 C CG  . GLU B 1 93  ? 9.295  26.617 73.546 1.00 13.55 ? 87  GLU B CG  1 
ATOM   1855 C CD  . GLU B 1 93  ? 9.562  27.617 74.627 1.00 16.88 ? 87  GLU B CD  1 
ATOM   1856 O OE1 . GLU B 1 93  ? 8.607  28.347 74.981 1.00 14.27 ? 87  GLU B OE1 1 
ATOM   1857 O OE2 . GLU B 1 93  ? 10.733 27.698 75.091 1.00 15.63 ? 87  GLU B OE2 1 
ATOM   1858 N N   . ARG B 1 94  ? 7.578  24.209 71.598 1.00 11.01 ? 88  ARG B N   1 
ATOM   1859 C CA  . ARG B 1 94  ? 6.421  23.336 71.885 1.00 9.21  ? 88  ARG B CA  1 
ATOM   1860 C C   . ARG B 1 94  ? 6.748  22.313 72.904 1.00 10.95 ? 88  ARG B C   1 
ATOM   1861 O O   . ARG B 1 94  ? 7.907  21.858 73.071 1.00 12.23 ? 88  ARG B O   1 
ATOM   1862 C CB  . ARG B 1 94  ? 6.030  22.625 70.583 1.00 9.75  ? 88  ARG B CB  1 
ATOM   1863 C CG  . ARG B 1 94  ? 5.455  23.544 69.488 1.00 9.86  ? 88  ARG B CG  1 
ATOM   1864 C CD  . ARG B 1 94  ? 4.143  24.174 69.853 1.00 9.63  ? 88  ARG B CD  1 
ATOM   1865 N NE  . ARG B 1 94  ? 3.629  25.012 68.753 1.00 11.95 ? 88  ARG B NE  1 
ATOM   1866 C CZ  . ARG B 1 94  ? 3.995  26.299 68.578 1.00 10.94 ? 88  ARG B CZ  1 
ATOM   1867 N NH1 . ARG B 1 94  ? 4.835  26.892 69.451 1.00 12.35 ? 88  ARG B NH1 1 
ATOM   1868 N NH2 . ARG B 1 94  ? 3.553  26.989 67.528 1.00 12.49 ? 88  ARG B NH2 1 
ATOM   1869 N N   . LEU B 1 95  ? 5.692  21.920 73.630 1.00 12.30 ? 89  LEU B N   1 
ATOM   1870 C CA  . LEU B 1 95  ? 5.829  20.804 74.564 1.00 12.63 ? 89  LEU B CA  1 
ATOM   1871 C C   . LEU B 1 95  ? 5.912  19.488 73.733 1.00 9.59  ? 89  LEU B C   1 
ATOM   1872 O O   . LEU B 1 95  ? 5.299  19.411 72.641 1.00 11.19 ? 89  LEU B O   1 
ATOM   1873 C CB  . LEU B 1 95  ? 4.567  20.709 75.447 1.00 13.31 ? 89  LEU B CB  1 
ATOM   1874 C CG  . LEU B 1 95  ? 4.613  19.652 76.566 1.00 12.87 ? 89  LEU B CG  1 
ATOM   1875 C CD1 . LEU B 1 95  ? 5.651  19.987 77.676 1.00 10.75 ? 89  LEU B CD1 1 
ATOM   1876 C CD2 . LEU B 1 95  ? 3.183  19.644 77.238 1.00 13.72 ? 89  LEU B CD2 1 
ATOM   1877 N N   . GLU B 1 96  ? 6.699  18.505 74.137 1.00 10.94 ? 90  GLU B N   1 
ATOM   1878 C CA  . GLU B 1 96  ? 6.782  17.250 73.416 1.00 12.36 ? 90  GLU B CA  1 
ATOM   1879 C C   . GLU B 1 96  ? 6.810  16.100 74.433 1.00 12.51 ? 90  GLU B C   1 
ATOM   1880 O O   . GLU B 1 96  ? 7.416  16.195 75.485 1.00 12.28 ? 90  GLU B O   1 
ATOM   1881 C CB  . GLU B 1 96  ? 8.039  17.231 72.532 1.00 11.97 ? 90  GLU B CB  1 
ATOM   1882 C CG  . GLU B 1 96  ? 8.127  15.979 71.635 1.00 12.05 ? 90  GLU B CG  1 
ATOM   1883 C CD  . GLU B 1 96  ? 6.866  15.797 70.796 1.00 17.02 ? 90  GLU B CD  1 
ATOM   1884 O OE1 . GLU B 1 96  ? 5.910  15.129 71.276 1.00 14.68 ? 90  GLU B OE1 1 
ATOM   1885 O OE2 . GLU B 1 96  ? 6.776  16.288 69.643 1.00 17.89 ? 90  GLU B OE2 1 
ATOM   1886 N N   . GLU B 1 97  ? 6.132  15.018 74.093 1.00 11.91 ? 91  GLU B N   1 
ATOM   1887 C CA  . GLU B 1 97  ? 6.034  13.842 74.951 1.00 13.28 ? 91  GLU B CA  1 
ATOM   1888 C C   . GLU B 1 97  ? 5.575  14.240 76.330 1.00 11.33 ? 91  GLU B C   1 
ATOM   1889 O O   . GLU B 1 97  ? 6.001  13.647 77.356 1.00 13.60 ? 91  GLU B O   1 
ATOM   1890 C CB  . GLU B 1 97  ? 7.341  13.035 75.024 1.00 12.66 ? 91  GLU B CB  1 
ATOM   1891 C CG  . GLU B 1 97  ? 7.692  12.393 73.613 1.00 15.62 ? 91  GLU B CG  1 
ATOM   1892 C CD  . GLU B 1 97  ? 9.038  11.659 73.513 1.00 20.85 ? 91  GLU B CD  1 
ATOM   1893 O OE1 . GLU B 1 97  ? 9.645  11.313 74.525 1.00 23.51 ? 91  GLU B OE1 1 
ATOM   1894 O OE2 . GLU B 1 97  ? 9.489  11.431 72.368 1.00 25.38 ? 91  GLU B OE2 1 
ATOM   1895 N N   . ASN B 1 98  ? 4.742  15.257 76.357 1.00 11.43 ? 92  ASN B N   1 
ATOM   1896 C CA  . ASN B 1 98  ? 4.104  15.764 77.574 1.00 11.03 ? 92  ASN B CA  1 
ATOM   1897 C C   . ASN B 1 98  ? 5.139  16.202 78.605 1.00 15.50 ? 92  ASN B C   1 
ATOM   1898 O O   . ASN B 1 98  ? 4.826  16.244 79.784 1.00 15.89 ? 92  ASN B O   1 
ATOM   1899 C CB  . ASN B 1 98  ? 3.223  14.668 78.234 1.00 12.67 ? 92  ASN B CB  1 
ATOM   1900 C CG  . ASN B 1 98  ? 2.061  14.200 77.334 1.00 10.26 ? 92  ASN B CG  1 
ATOM   1901 O OD1 . ASN B 1 98  ? 2.185  13.180 76.630 1.00 13.38 ? 92  ASN B OD1 1 
ATOM   1902 N ND2 . ASN B 1 98  ? 0.963  14.957 77.355 1.00 15.40 ? 92  ASN B ND2 1 
ATOM   1903 N N   . HIS B 1 99  ? 6.336  16.647 78.167 1.00 14.23 ? 93  HIS B N   1 
ATOM   1904 C CA  . HIS B 1 99  ? 7.369  16.951 79.139 1.00 12.16 ? 93  HIS B CA  1 
ATOM   1905 C C   . HIS B 1 99  ? 8.507  17.829 78.645 1.00 11.68 ? 93  HIS B C   1 
ATOM   1906 O O   . HIS B 1 99  ? 8.882  18.785 79.329 1.00 13.41 ? 93  HIS B O   1 
ATOM   1907 C CB  . HIS B 1 99  ? 7.958  15.643 79.571 1.00 14.26 ? 93  HIS B CB  1 
ATOM   1908 C CG  . HIS B 1 99  ? 9.098  15.757 80.524 1.00 18.47 ? 93  HIS B CG  1 
ATOM   1909 N ND1 . HIS B 1 99  ? 8.942  16.210 81.819 1.00 16.64 ? 93  HIS B ND1 1 
ATOM   1910 C CD2 . HIS B 1 99  ? 10.401 15.406 80.397 1.00 14.82 ? 93  HIS B CD2 1 
ATOM   1911 C CE1 . HIS B 1 99  ? 10.108 16.123 82.456 1.00 17.83 ? 93  HIS B CE1 1 
ATOM   1912 N NE2 . HIS B 1 99  ? 11.008 15.635 81.615 1.00 19.70 ? 93  HIS B NE2 1 
ATOM   1913 N N   . TYR B 1 100 ? 9.070  17.473 77.472 1.00 11.53 ? 94  TYR B N   1 
ATOM   1914 C CA  . TYR B 1 100 ? 10.204 18.226 76.927 1.00 12.86 ? 94  TYR B CA  1 
ATOM   1915 C C   . TYR B 1 100 ? 9.827  19.429 76.106 1.00 14.54 ? 94  TYR B C   1 
ATOM   1916 O O   . TYR B 1 100 ? 8.649  19.642 75.772 1.00 13.27 ? 94  TYR B O   1 
ATOM   1917 C CB  . TYR B 1 100 ? 11.044 17.292 76.029 1.00 12.60 ? 94  TYR B CB  1 
ATOM   1918 C CG  . TYR B 1 100 ? 11.685 16.131 76.763 1.00 17.10 ? 94  TYR B CG  1 
ATOM   1919 C CD1 . TYR B 1 100 ? 12.833 16.353 77.534 1.00 19.99 ? 94  TYR B CD1 1 
ATOM   1920 C CD2 . TYR B 1 100 ? 11.153 14.839 76.708 1.00 22.81 ? 94  TYR B CD2 1 
ATOM   1921 C CE1 . TYR B 1 100 ? 13.454 15.305 78.249 1.00 25.83 ? 94  TYR B CE1 1 
ATOM   1922 C CE2 . TYR B 1 100 ? 11.781 13.782 77.422 1.00 24.72 ? 94  TYR B CE2 1 
ATOM   1923 C CZ  . TYR B 1 100 ? 12.931 14.046 78.180 1.00 26.65 ? 94  TYR B CZ  1 
ATOM   1924 O OH  . TYR B 1 100 ? 13.601 13.023 78.858 1.00 38.26 ? 94  TYR B OH  1 
ATOM   1925 N N   . ASN B 1 101 ? 10.819 20.274 75.787 1.00 12.68 ? 95  ASN B N   1 
ATOM   1926 C CA  . ASN B 1 101 ? 10.580 21.353 74.852 1.00 13.81 ? 95  ASN B CA  1 
ATOM   1927 C C   . ASN B 1 101 ? 11.267 20.977 73.508 1.00 13.01 ? 95  ASN B C   1 
ATOM   1928 O O   . ASN B 1 101 ? 12.351 20.374 73.475 1.00 14.53 ? 95  ASN B O   1 
ATOM   1929 C CB  . ASN B 1 101 ? 11.267 22.627 75.279 1.00 13.88 ? 95  ASN B CB  1 
ATOM   1930 C CG  . ASN B 1 101 ? 10.578 23.294 76.451 1.00 16.19 ? 95  ASN B CG  1 
ATOM   1931 O OD1 . ASN B 1 101 ? 9.695  22.692 77.092 1.00 19.48 ? 95  ASN B OD1 1 
ATOM   1932 N ND2 . ASN B 1 101 ? 10.968 24.508 76.736 1.00 15.99 ? 95  ASN B ND2 1 
ATOM   1933 N N   . THR B 1 102 ? 10.585 21.282 72.419 1.00 11.65 ? 96  THR B N   1 
ATOM   1934 C CA  . THR B 1 102 ? 11.209 21.144 71.085 1.00 12.17 ? 96  THR B CA  1 
ATOM   1935 C C   . THR B 1 102 ? 11.142 22.552 70.489 1.00 10.88 ? 96  THR B C   1 
ATOM   1936 O O   . THR B 1 102 ? 10.319 23.404 70.862 1.00 12.31 ? 96  THR B O   1 
ATOM   1937 C CB  . THR B 1 102 ? 10.462 20.167 70.156 1.00 14.03 ? 96  THR B CB  1 
ATOM   1938 O OG1 . THR B 1 102 ? 9.096  20.571 70.021 1.00 14.71 ? 96  THR B OG1 1 
ATOM   1939 C CG2 . THR B 1 102 ? 10.628 18.791 70.689 1.00 13.36 ? 96  THR B CG2 1 
ATOM   1940 N N   . TYR B 1 103 ? 12.009 22.778 69.501 1.00 12.36 ? 97  TYR B N   1 
ATOM   1941 C CA  . TYR B 1 103 ? 12.114 24.077 68.820 1.00 12.16 ? 97  TYR B CA  1 
ATOM   1942 C C   . TYR B 1 103 ? 12.159 23.837 67.315 1.00 10.67 ? 97  TYR B C   1 
ATOM   1943 O O   . TYR B 1 103 ? 13.152 23.311 66.750 1.00 13.37 ? 97  TYR B O   1 
ATOM   1944 C CB  . TYR B 1 103 ? 13.400 24.794 69.285 1.00 12.48 ? 97  TYR B CB  1 
ATOM   1945 C CG  . TYR B 1 103 ? 13.378 25.179 70.722 1.00 12.31 ? 97  TYR B CG  1 
ATOM   1946 C CD1 . TYR B 1 103 ? 12.744 26.316 71.121 1.00 12.34 ? 97  TYR B CD1 1 
ATOM   1947 C CD2 . TYR B 1 103 ? 13.883 24.341 71.701 1.00 13.38 ? 97  TYR B CD2 1 
ATOM   1948 C CE1 . TYR B 1 103 ? 12.588 26.592 72.461 1.00 13.34 ? 97  TYR B CE1 1 
ATOM   1949 C CE2 . TYR B 1 103 ? 13.730 24.630 73.068 1.00 13.25 ? 97  TYR B CE2 1 
ATOM   1950 C CZ  . TYR B 1 103 ? 13.065 25.752 73.414 1.00 12.77 ? 97  TYR B CZ  1 
ATOM   1951 O OH  . TYR B 1 103 ? 12.787 26.009 74.763 1.00 16.08 ? 97  TYR B OH  1 
ATOM   1952 N N   . ILE B 1 104 ? 11.085 24.213 66.641 1.00 11.23 ? 98  ILE B N   1 
ATOM   1953 C CA  . ILE B 1 104 ? 11.009 24.052 65.191 1.00 12.91 ? 98  ILE B CA  1 
ATOM   1954 C C   . ILE B 1 104 ? 11.310 25.411 64.539 1.00 10.68 ? 98  ILE B C   1 
ATOM   1955 O O   . ILE B 1 104 ? 10.826 26.443 64.971 1.00 12.07 ? 98  ILE B O   1 
ATOM   1956 C CB  . ILE B 1 104 ? 9.609  23.586 64.721 1.00 15.74 ? 98  ILE B CB  1 
ATOM   1957 C CG1 . ILE B 1 104 ? 9.482  22.090 65.053 1.00 19.42 ? 98  ILE B CG1 1 
ATOM   1958 C CG2 . ILE B 1 104 ? 9.431  23.788 63.189 1.00 17.53 ? 98  ILE B CG2 1 
ATOM   1959 C CD1 . ILE B 1 104 ? 8.125  21.479 64.629 1.00 19.06 ? 98  ILE B CD1 1 
ATOM   1960 N N   . SER B 1 105 ? 12.115 25.392 63.496 1.00 12.04 ? 99  SER B N   1 
ATOM   1961 C CA  . SER B 1 105 ? 12.390 26.610 62.735 1.00 12.65 ? 99  SER B CA  1 
ATOM   1962 C C   . SER B 1 105 ? 11.090 27.172 62.221 1.00 15.61 ? 99  SER B C   1 
ATOM   1963 O O   . SER B 1 105 ? 10.352 26.467 61.483 1.00 15.00 ? 99  SER B O   1 
ATOM   1964 C CB  . SER B 1 105 ? 13.220 26.217 61.521 1.00 11.43 ? 99  SER B CB  1 
ATOM   1965 O OG  . SER B 1 105 ? 13.230 27.239 60.570 1.00 13.55 ? 99  SER B OG  1 
ATOM   1966 N N   . LYS B 1 106 ? 10.767 28.404 62.568 1.00 12.05 ? 100 LYS B N   1 
ATOM   1967 C CA  . LYS B 1 106 ? 9.540  28.976 62.031 1.00 14.93 ? 100 LYS B CA  1 
ATOM   1968 C C   . LYS B 1 106 ? 9.639  29.105 60.510 1.00 16.85 ? 100 LYS B C   1 
ATOM   1969 O O   . LYS B 1 106 ? 8.688  28.748 59.778 1.00 15.64 ? 100 LYS B O   1 
ATOM   1970 C CB  . LYS B 1 106 ? 9.232  30.337 62.632 1.00 15.12 ? 100 LYS B CB  1 
ATOM   1971 C CG  . LYS B 1 106 ? 7.978  30.922 62.045 1.00 15.04 ? 100 LYS B CG  1 
ATOM   1972 C CD  . LYS B 1 106 ? 7.665  32.295 62.611 1.00 17.59 ? 100 LYS B CD  1 
ATOM   1973 C CE  . LYS B 1 106 ? 6.344  32.850 62.007 1.00 21.02 ? 100 LYS B CE  1 
ATOM   1974 N NZ  . LYS B 1 106 ? 6.026  34.172 62.601 1.00 24.00 ? 100 LYS B NZ  1 
ATOM   1975 N N   . LYS B 1 107 ? 10.758 29.636 60.018 1.00 12.56 ? 101 LYS B N   1 
ATOM   1976 C CA  . LYS B 1 107 ? 10.914 29.812 58.582 1.00 15.20 ? 101 LYS B CA  1 
ATOM   1977 C C   . LYS B 1 107 ? 10.754 28.497 57.777 1.00 16.14 ? 101 LYS B C   1 
ATOM   1978 O O   . LYS B 1 107 ? 10.184 28.489 56.691 1.00 17.55 ? 101 LYS B O   1 
ATOM   1979 C CB  . LYS B 1 107 ? 12.274 30.476 58.280 1.00 11.72 ? 101 LYS B CB  1 
ATOM   1980 C CG  . LYS B 1 107 ? 12.553 30.672 56.768 1.00 18.06 ? 101 LYS B CG  1 
ATOM   1981 C CD  . LYS B 1 107 ? 13.800 31.524 56.630 1.00 19.02 ? 101 LYS B CD  1 
ATOM   1982 C CE  . LYS B 1 107 ? 14.194 31.812 55.165 1.00 22.13 ? 101 LYS B CE  1 
ATOM   1983 N NZ  . LYS B 1 107 ? 13.148 32.554 54.394 1.00 27.90 ? 101 LYS B NZ  1 
ATOM   1984 N N   . HIS B 1 108 ? 11.218 27.402 58.336 1.00 13.99 ? 102 HIS B N   1 
ATOM   1985 C CA  . HIS B 1 108 ? 11.175 26.098 57.675 1.00 12.08 ? 102 HIS B CA  1 
ATOM   1986 C C   . HIS B 1 108 ? 10.202 25.154 58.369 1.00 13.65 ? 102 HIS B C   1 
ATOM   1987 O O   . HIS B 1 108 ? 10.394 23.966 58.343 1.00 14.07 ? 102 HIS B O   1 
ATOM   1988 C CB  . HIS B 1 108 ? 12.574 25.502 57.673 1.00 13.76 ? 102 HIS B CB  1 
ATOM   1989 C CG  . HIS B 1 108 ? 13.535 26.388 56.949 1.00 13.83 ? 102 HIS B CG  1 
ATOM   1990 N ND1 . HIS B 1 108 ? 13.466 26.564 55.585 1.00 13.38 ? 102 HIS B ND1 1 
ATOM   1991 C CD2 . HIS B 1 108 ? 14.476 27.241 57.410 1.00 12.26 ? 102 HIS B CD2 1 
ATOM   1992 C CE1 . HIS B 1 108 ? 14.350 27.499 55.223 1.00 12.80 ? 102 HIS B CE1 1 
ATOM   1993 N NE2 . HIS B 1 108 ? 14.966 27.931 56.312 1.00 12.49 ? 102 HIS B NE2 1 
ATOM   1994 N N   . ALA B 1 109 ? 9.177  25.733 58.980 1.00 14.22 ? 103 ALA B N   1 
ATOM   1995 C CA  . ALA B 1 109 ? 8.245  24.895 59.723 1.00 14.41 ? 103 ALA B CA  1 
ATOM   1996 C C   . ALA B 1 109 ? 7.601  23.810 58.891 1.00 16.28 ? 103 ALA B C   1 
ATOM   1997 O O   . ALA B 1 109 ? 7.395  22.718 59.395 1.00 15.45 ? 103 ALA B O   1 
ATOM   1998 C CB  . ALA B 1 109 ? 7.171  25.753 60.364 1.00 14.93 ? 103 ALA B CB  1 
ATOM   1999 N N   . GLU B 1 110 ? 7.312  24.127 57.645 1.00 15.38 ? 104 GLU B N   1 
ATOM   2000 C CA  . GLU B 1 110 ? 6.652  23.128 56.768 1.00 15.30 ? 104 GLU B CA  1 
ATOM   2001 C C   . GLU B 1 110 ? 7.585  21.941 56.439 1.00 19.52 ? 104 GLU B C   1 
ATOM   2002 O O   . GLU B 1 110 ? 7.129  20.893 55.972 1.00 20.75 ? 104 GLU B O   1 
ATOM   2003 C CB  . GLU B 1 110 ? 6.182  23.825 55.494 1.00 18.98 ? 104 GLU B CB  1 
ATOM   2004 C CG  . GLU B 1 110 ? 7.331  24.013 54.433 1.00 28.39 ? 104 GLU B CG  1 
ATOM   2005 C CD  . GLU B 1 110 ? 8.359  25.197 54.657 1.00 31.67 ? 104 GLU B CD  1 
ATOM   2006 O OE1 . GLU B 1 110 ? 8.377  25.909 55.719 1.00 30.62 ? 104 GLU B OE1 1 
ATOM   2007 O OE2 . GLU B 1 110 ? 9.168  25.403 53.699 1.00 26.09 ? 104 GLU B OE2 1 
ATOM   2008 N N   . LYS B 1 111 ? 8.874  22.081 56.701 1.00 16.93 ? 105 LYS B N   1 
ATOM   2009 C CA  . LYS B 1 111 ? 9.878  21.054 56.446 1.00 13.75 ? 105 LYS B CA  1 
ATOM   2010 C C   . LYS B 1 111 ? 10.148 20.214 57.709 1.00 16.09 ? 105 LYS B C   1 
ATOM   2011 O O   . LYS B 1 111 ? 10.950 19.265 57.685 1.00 15.26 ? 105 LYS B O   1 
ATOM   2012 C CB  . LYS B 1 111 ? 11.233 21.717 55.999 1.00 16.77 ? 105 LYS B CB  1 
ATOM   2013 C CG  . LYS B 1 111 ? 11.128 22.662 54.785 1.00 23.27 ? 105 LYS B CG  1 
ATOM   2014 C CD  . LYS B 1 111 ? 12.541 23.090 54.308 1.00 17.58 ? 105 LYS B CD  1 
ATOM   2015 C CE  . LYS B 1 111 ? 12.606 24.063 53.125 1.00 18.52 ? 105 LYS B CE  1 
ATOM   2016 N NZ  . LYS B 1 111 ? 11.958 25.372 53.453 1.00 20.63 ? 105 LYS B NZ  1 
ATOM   2017 N N   . ASN B 1 112 ? 9.494  20.576 58.830 1.00 14.50 ? 106 ASN B N   1 
ATOM   2018 C CA  . ASN B 1 112 ? 9.756  19.927 60.133 1.00 15.16 ? 106 ASN B CA  1 
ATOM   2019 C C   . ASN B 1 112 ? 11.253 19.887 60.499 1.00 11.44 ? 106 ASN B C   1 
ATOM   2020 O O   . ASN B 1 112 ? 11.845 18.846 60.794 1.00 14.96 ? 106 ASN B O   1 
ATOM   2021 C CB  . ASN B 1 112 ? 9.194  18.506 60.176 1.00 16.21 ? 106 ASN B CB  1 
ATOM   2022 C CG  . ASN B 1 112 ? 7.692  18.485 60.095 1.00 19.97 ? 106 ASN B CG  1 
ATOM   2023 O OD1 . ASN B 1 112 ? 7.043  19.468 59.689 1.00 21.75 ? 106 ASN B OD1 1 
ATOM   2024 N ND2 . ASN B 1 112 ? 7.106  17.335 60.484 1.00 21.46 ? 106 ASN B ND2 1 
ATOM   2025 N N   . TRP B 1 113 ? 11.892 21.054 60.411 1.00 14.24 ? 107 TRP B N   1 
ATOM   2026 C CA  . TRP B 1 113 ? 13.300 21.185 60.778 1.00 13.66 ? 107 TRP B CA  1 
ATOM   2027 C C   . TRP B 1 113 ? 13.381 21.644 62.195 1.00 10.69 ? 107 TRP B C   1 
ATOM   2028 O O   . TRP B 1 113 ? 12.850 22.706 62.508 1.00 13.75 ? 107 TRP B O   1 
ATOM   2029 C CB  . TRP B 1 113 ? 14.031 22.204 59.892 1.00 11.91 ? 107 TRP B CB  1 
ATOM   2030 C CG  . TRP B 1 113 ? 14.329 21.696 58.488 1.00 16.10 ? 107 TRP B CG  1 
ATOM   2031 C CD1 . TRP B 1 113 ? 14.004 20.449 57.964 1.00 17.09 ? 107 TRP B CD1 1 
ATOM   2032 C CD2 . TRP B 1 113 ? 15.008 22.395 57.448 1.00 13.63 ? 107 TRP B CD2 1 
ATOM   2033 N NE1 . TRP B 1 113 ? 14.461 20.350 56.659 1.00 16.50 ? 107 TRP B NE1 1 
ATOM   2034 C CE2 . TRP B 1 113 ? 15.080 21.529 56.323 1.00 17.66 ? 107 TRP B CE2 1 
ATOM   2035 C CE3 . TRP B 1 113 ? 15.552 23.680 57.346 1.00 14.79 ? 107 TRP B CE3 1 
ATOM   2036 C CZ2 . TRP B 1 113 ? 15.692 21.893 55.131 1.00 15.33 ? 107 TRP B CZ2 1 
ATOM   2037 C CZ3 . TRP B 1 113 ? 16.164 24.056 56.126 1.00 14.31 ? 107 TRP B CZ3 1 
ATOM   2038 C CH2 . TRP B 1 113 ? 16.229 23.168 55.056 1.00 14.58 ? 107 TRP B CH2 1 
ATOM   2039 N N   . PHE B 1 114 ? 14.055 20.846 63.006 1.00 10.96 ? 108 PHE B N   1 
ATOM   2040 C CA  . PHE B 1 114 ? 14.216 21.112 64.434 1.00 12.07 ? 108 PHE B CA  1 
ATOM   2041 C C   . PHE B 1 114 ? 15.616 21.459 64.866 1.00 13.11 ? 108 PHE B C   1 
ATOM   2042 O O   . PHE B 1 114 ? 16.598 21.065 64.234 1.00 12.22 ? 108 PHE B O   1 
ATOM   2043 C CB  . PHE B 1 114 ? 13.881 19.842 65.287 1.00 12.02 ? 108 PHE B CB  1 
ATOM   2044 C CG  . PHE B 1 114 ? 12.457 19.334 65.176 1.00 13.20 ? 108 PHE B CG  1 
ATOM   2045 C CD1 . PHE B 1 114 ? 12.052 18.570 64.082 1.00 12.99 ? 108 PHE B CD1 1 
ATOM   2046 C CD2 . PHE B 1 114 ? 11.529 19.599 66.210 1.00 13.15 ? 108 PHE B CD2 1 
ATOM   2047 C CE1 . PHE B 1 114 ? 10.750 18.052 64.002 1.00 15.95 ? 108 PHE B CE1 1 
ATOM   2048 C CE2 . PHE B 1 114 ? 10.214 19.085 66.144 1.00 15.14 ? 108 PHE B CE2 1 
ATOM   2049 C CZ  . PHE B 1 114 ? 9.832  18.318 65.041 1.00 15.48 ? 108 PHE B CZ  1 
ATOM   2050 N N   . VAL B 1 115 ? 15.705 22.186 65.991 1.00 12.79 ? 109 VAL B N   1 
ATOM   2051 C CA  . VAL B 1 115 ? 16.965 22.367 66.669 1.00 13.97 ? 109 VAL B CA  1 
ATOM   2052 C C   . VAL B 1 115 ? 17.247 20.991 67.324 1.00 15.84 ? 109 VAL B C   1 
ATOM   2053 O O   . VAL B 1 115 ? 16.334 20.376 67.967 1.00 14.87 ? 109 VAL B O   1 
ATOM   2054 C CB  . VAL B 1 115 ? 16.824 23.405 67.793 1.00 11.97 ? 109 VAL B CB  1 
ATOM   2055 C CG1 . VAL B 1 115 ? 18.109 23.506 68.596 1.00 13.36 ? 109 VAL B CG1 1 
ATOM   2056 C CG2 . VAL B 1 115 ? 16.527 24.762 67.194 1.00 11.84 ? 109 VAL B CG2 1 
ATOM   2057 N N   . GLY B 1 116 ? 18.456 20.453 67.182 1.00 14.16 ? 110 GLY B N   1 
ATOM   2058 C CA  . GLY B 1 116 ? 18.738 19.177 67.813 1.00 16.09 ? 110 GLY B CA  1 
ATOM   2059 C C   . GLY B 1 116 ? 20.225 18.921 67.977 1.00 20.12 ? 110 GLY B C   1 
ATOM   2060 O O   . GLY B 1 116 ? 21.037 19.528 67.237 1.00 20.25 ? 110 GLY B O   1 
ATOM   2061 N N   . LEU B 1 117 ? 20.593 18.087 68.942 1.00 17.88 ? 111 LEU B N   1 
ATOM   2062 C CA  . LEU B 1 117 ? 22.000 17.748 69.189 1.00 16.23 ? 111 LEU B CA  1 
ATOM   2063 C C   . LEU B 1 117 ? 22.179 16.257 69.200 1.00 24.95 ? 111 LEU B C   1 
ATOM   2064 O O   . LEU B 1 117 ? 21.380 15.541 69.811 1.00 19.96 ? 111 LEU B O   1 
ATOM   2065 C CB  . LEU B 1 117 ? 22.487 18.294 70.516 1.00 18.02 ? 111 LEU B CB  1 
ATOM   2066 C CG  . LEU B 1 117 ? 22.529 19.820 70.696 1.00 18.46 ? 111 LEU B CG  1 
ATOM   2067 C CD1 . LEU B 1 117 ? 23.001 20.188 72.085 1.00 17.19 ? 111 LEU B CD1 1 
ATOM   2068 C CD2 . LEU B 1 117 ? 23.493 20.399 69.632 1.00 21.23 ? 111 LEU B CD2 1 
ATOM   2069 N N   . LYS B 1 118 ? 23.235 15.796 68.516 1.00 25.03 ? 112 LYS B N   1 
ATOM   2070 C CA  . LYS B 1 118 ? 23.576 14.378 68.478 1.00 21.82 ? 112 LYS B CA  1 
ATOM   2071 C C   . LYS B 1 118 ? 24.201 13.961 69.794 1.00 25.54 ? 112 LYS B C   1 
ATOM   2072 O O   . LYS B 1 118 ? 24.599 14.794 70.613 1.00 26.69 ? 112 LYS B O   1 
ATOM   2073 C CB  . LYS B 1 118 ? 24.576 14.104 67.329 1.00 25.63 ? 112 LYS B CB  1 
ATOM   2074 C CG  . LYS B 1 118 ? 24.088 14.472 65.933 1.00 26.26 ? 112 LYS B CG  1 
ATOM   2075 C CD  . LYS B 1 118 ? 25.138 14.050 64.895 1.00 32.64 ? 112 LYS B CD  1 
ATOM   2076 C CE  . LYS B 1 118 ? 24.908 14.668 63.559 1.00 38.85 ? 112 LYS B CE  1 
ATOM   2077 N NZ  . LYS B 1 118 ? 25.937 14.167 62.582 1.00 40.19 ? 112 LYS B NZ  1 
ATOM   2078 N N   . LYS B 1 119 ? 24.299 12.651 70.008 1.00 30.87 ? 113 LYS B N   1 
ATOM   2079 C CA  . LYS B 1 119 ? 24.893 12.141 71.236 1.00 33.74 ? 113 LYS B CA  1 
ATOM   2080 C C   . LYS B 1 119 ? 26.327 12.610 71.425 1.00 34.85 ? 113 LYS B C   1 
ATOM   2081 O O   . LYS B 1 119 ? 26.781 12.765 72.563 1.00 33.81 ? 113 LYS B O   1 
ATOM   2082 C CB  . LYS B 1 119 ? 24.823 10.612 71.265 1.00 36.79 ? 113 LYS B CB  1 
ATOM   2083 C CG  . LYS B 1 119 ? 23.398 10.105 71.319 1.00 41.74 ? 113 LYS B CG  1 
ATOM   2084 C CD  . LYS B 1 119 ? 23.289 8.682  70.792 1.00 47.99 ? 113 LYS B CD  1 
ATOM   2085 C CE  . LYS B 1 119 ? 21.822 8.279  70.596 1.00 50.34 ? 113 LYS B CE  1 
ATOM   2086 N NZ  . LYS B 1 119 ? 21.652 6.836  70.244 1.00 52.25 ? 113 LYS B NZ  1 
ATOM   2087 N N   . ASN B 1 120 ? 27.021 12.861 70.313 1.00 34.24 ? 114 ASN B N   1 
ATOM   2088 C CA  . ASN B 1 120 ? 28.408 13.326 70.360 1.00 36.30 ? 114 ASN B CA  1 
ATOM   2089 C C   . ASN B 1 120 ? 28.530 14.845 70.571 1.00 37.14 ? 114 ASN B C   1 
ATOM   2090 O O   . ASN B 1 120 ? 29.637 15.399 70.552 1.00 36.06 ? 114 ASN B O   1 
ATOM   2091 C CB  . ASN B 1 120 ? 29.175 12.882 69.092 1.00 36.12 ? 114 ASN B CB  1 
ATOM   2092 C CG  . ASN B 1 120 ? 28.818 13.688 67.856 1.00 38.49 ? 114 ASN B CG  1 
ATOM   2093 O OD1 . ASN B 1 120 ? 27.962 14.569 67.888 1.00 36.87 ? 114 ASN B OD1 1 
ATOM   2094 N ND2 . ASN B 1 120 ? 29.484 13.384 66.746 1.00 38.85 ? 114 ASN B ND2 1 
ATOM   2095 N N   . GLY B 1 121 ? 27.402 15.530 70.760 1.00 32.02 ? 115 GLY B N   1 
ATOM   2096 C CA  . GLY B 1 121 ? 27.481 16.962 71.012 1.00 30.25 ? 115 GLY B CA  1 
ATOM   2097 C C   . GLY B 1 121 ? 27.399 17.866 69.793 1.00 25.41 ? 115 GLY B C   1 
ATOM   2098 O O   . GLY B 1 121 ? 27.215 19.080 69.937 1.00 28.25 ? 115 GLY B O   1 
ATOM   2099 N N   . SER B 1 122 ? 27.537 17.293 68.607 1.00 25.78 ? 116 SER B N   1 
ATOM   2100 C CA  . SER B 1 122 ? 27.464 18.078 67.380 1.00 28.00 ? 116 SER B CA  1 
ATOM   2101 C C   . SER B 1 122 ? 25.997 18.378 67.046 1.00 27.04 ? 116 SER B C   1 
ATOM   2102 O O   . SER B 1 122 ? 25.086 17.655 67.467 1.00 24.89 ? 116 SER B O   1 
ATOM   2103 C CB  . SER B 1 122 ? 28.138 17.342 66.220 1.00 28.43 ? 116 SER B CB  1 
ATOM   2104 O OG  . SER B 1 122 ? 27.381 16.241 65.770 1.00 36.78 ? 116 SER B OG  1 
ATOM   2105 N N   . CYS B 1 123 ? 25.778 19.440 66.291 1.00 24.67 ? 117 CYS B N   1 
ATOM   2106 C CA  . CYS B 1 123 ? 24.415 19.867 65.924 1.00 18.61 ? 117 CYS B CA  1 
ATOM   2107 C C   . CYS B 1 123 ? 23.814 18.990 64.855 1.00 20.50 ? 117 CYS B C   1 
ATOM   2108 O O   . CYS B 1 123 ? 24.513 18.553 63.928 1.00 20.93 ? 117 CYS B O   1 
ATOM   2109 C CB  . CYS B 1 123 ? 24.425 21.288 65.333 1.00 28.09 ? 117 CYS B CB  1 
ATOM   2110 S SG  . CYS B 1 123 ? 24.900 22.535 66.423 0.50 22.20 ? 117 CYS B SG  1 
ATOM   2111 N N   . LYS B 1 124 ? 22.518 18.713 64.960 1.00 19.06 ? 118 LYS B N   1 
ATOM   2112 C CA  . LYS B 1 124 ? 21.879 18.002 63.896 1.00 19.28 ? 118 LYS B CA  1 
ATOM   2113 C C   . LYS B 1 124 ? 21.568 19.026 62.793 1.00 21.49 ? 118 LYS B C   1 
ATOM   2114 O O   . LYS B 1 124 ? 21.480 20.249 63.062 1.00 21.95 ? 118 LYS B O   1 
ATOM   2115 C CB  . LYS B 1 124 ? 20.569 17.326 64.378 1.00 23.70 ? 118 LYS B CB  1 
ATOM   2116 C CG  . LYS B 1 124 ? 20.860 16.003 65.075 1.00 30.59 ? 118 LYS B CG  1 
ATOM   2117 C CD  . LYS B 1 124 ? 19.699 15.080 65.097 1.00 34.98 ? 118 LYS B CD  1 
ATOM   2118 C CE  . LYS B 1 124 ? 19.314 14.590 63.748 1.00 23.40 ? 118 LYS B CE  1 
ATOM   2119 N NZ  . LYS B 1 124 ? 19.758 13.180 63.489 1.00 28.54 ? 118 LYS B NZ  1 
ATOM   2120 N N   . ARG B 1 125 ? 21.481 18.552 61.556 1.00 19.18 ? 119 ARG B N   1 
ATOM   2121 C CA  . ARG B 1 125 ? 21.077 19.414 60.469 1.00 21.71 ? 119 ARG B CA  1 
ATOM   2122 C C   . ARG B 1 125 ? 19.565 19.255 60.366 1.00 17.98 ? 119 ARG B C   1 
ATOM   2123 O O   . ARG B 1 125 ? 19.010 18.136 60.540 1.00 16.52 ? 119 ARG B O   1 
ATOM   2124 C CB  . ARG B 1 125 ? 21.727 18.983 59.146 1.00 27.30 ? 119 ARG B CB  1 
ATOM   2125 C CG  . ARG B 1 125 ? 23.160 19.402 58.988 1.00 40.41 ? 119 ARG B CG  1 
ATOM   2126 C CD  . ARG B 1 125 ? 23.633 19.068 57.586 1.00 42.64 ? 119 ARG B CD  1 
ATOM   2127 N NE  . ARG B 1 125 ? 23.640 17.632 57.327 1.00 51.58 ? 119 ARG B NE  1 
ATOM   2128 C CZ  . ARG B 1 125 ? 22.781 16.992 56.531 1.00 52.32 ? 119 ARG B CZ  1 
ATOM   2129 N NH1 . ARG B 1 125 ? 21.811 17.646 55.895 1.00 52.81 ? 119 ARG B NH1 1 
ATOM   2130 N NH2 . ARG B 1 125 ? 22.918 15.690 56.345 1.00 54.80 ? 119 ARG B NH2 1 
ATOM   2131 N N   . GLY B 1 126 ? 18.862 20.344 60.081 1.00 17.00 ? 120 GLY B N   1 
ATOM   2132 C CA  . GLY B 1 126 ? 17.418 20.280 59.952 1.00 16.36 ? 120 GLY B CA  1 
ATOM   2133 C C   . GLY B 1 126 ? 16.833 19.126 59.148 1.00 18.16 ? 120 GLY B C   1 
ATOM   2134 O O   . GLY B 1 126 ? 15.894 18.482 59.626 1.00 17.96 ? 120 GLY B O   1 
ATOM   2135 N N   . PRO B 1 127 ? 17.354 18.801 57.941 1.00 17.98 ? 121 PRO B N   1 
ATOM   2136 C CA  . PRO B 1 127 ? 16.802 17.699 57.141 1.00 16.14 ? 121 PRO B CA  1 
ATOM   2137 C C   . PRO B 1 127 ? 16.976 16.326 57.789 1.00 17.50 ? 121 PRO B C   1 
ATOM   2138 O O   . PRO B 1 127 ? 16.310 15.375 57.371 1.00 24.25 ? 121 PRO B O   1 
ATOM   2139 C CB  . PRO B 1 127 ? 17.592 17.761 55.810 1.00 17.85 ? 121 PRO B CB  1 
ATOM   2140 C CG  . PRO B 1 127 ? 18.096 19.210 55.778 1.00 17.94 ? 121 PRO B CG  1 
ATOM   2141 C CD  . PRO B 1 127 ? 18.357 19.614 57.195 1.00 19.21 ? 121 PRO B CD  1 
ATOM   2142 N N   . ARG B 1 128 ? 17.854 16.215 58.781 1.00 16.84 ? 122 ARG B N   1 
ATOM   2143 C CA  . ARG B 1 128 ? 18.056 14.934 59.433 1.00 16.14 ? 122 ARG B CA  1 
ATOM   2144 C C   . ARG B 1 128 ? 17.336 14.853 60.760 1.00 19.89 ? 122 ARG B C   1 
ATOM   2145 O O   . ARG B 1 128 ? 17.608 13.952 61.585 1.00 21.69 ? 122 ARG B O   1 
ATOM   2146 C CB  . ARG B 1 128 ? 19.533 14.669 59.649 1.00 19.69 ? 122 ARG B CB  1 
ATOM   2147 C CG  . ARG B 1 128 ? 20.326 14.648 58.334 1.00 29.76 ? 122 ARG B CG  1 
ATOM   2148 C CD  . ARG B 1 128 ? 19.829 13.536 57.416 1.00 41.21 ? 122 ARG B CD  1 
ATOM   2149 N NE  . ARG B 1 128 ? 19.838 13.956 56.012 1.00 52.96 ? 122 ARG B NE  1 
ATOM   2150 C CZ  . ARG B 1 128 ? 18.764 13.996 55.219 1.00 53.96 ? 122 ARG B CZ  1 
ATOM   2151 N NH1 . ARG B 1 128 ? 17.567 13.635 55.679 1.00 55.61 ? 122 ARG B NH1 1 
ATOM   2152 N NH2 . ARG B 1 128 ? 18.884 14.421 53.965 1.00 55.66 ? 122 ARG B NH2 1 
ATOM   2153 N N   . THR B 1 129 ? 16.466 15.831 60.975 1.00 16.05 ? 123 THR B N   1 
ATOM   2154 C CA  . THR B 1 129 ? 15.673 15.854 62.200 1.00 16.73 ? 123 THR B CA  1 
ATOM   2155 C C   . THR B 1 129 ? 14.249 15.508 61.824 1.00 14.79 ? 123 THR B C   1 
ATOM   2156 O O   . THR B 1 129 ? 13.818 15.704 60.699 1.00 17.48 ? 123 THR B O   1 
ATOM   2157 C CB  . THR B 1 129 ? 15.639 17.262 62.941 1.00 14.70 ? 123 THR B CB  1 
ATOM   2158 O OG1 . THR B 1 129 ? 14.942 18.243 62.150 1.00 14.94 ? 123 THR B OG1 1 
ATOM   2159 C CG2 . THR B 1 129 ? 17.039 17.715 63.347 1.00 16.08 ? 123 THR B CG2 1 
ATOM   2160 N N   . HIS B 1 130 ? 13.527 14.955 62.804 1.00 16.29 ? 124 HIS B N   1 
ATOM   2161 C CA  . HIS B 1 130 ? 12.108 14.653 62.626 1.00 20.40 ? 124 HIS B CA  1 
ATOM   2162 C C   . HIS B 1 130 ? 11.452 14.332 63.944 1.00 14.49 ? 124 HIS B C   1 
ATOM   2163 O O   . HIS B 1 130 ? 12.113 13.974 64.918 1.00 16.84 ? 124 HIS B O   1 
ATOM   2164 C CB  . HIS B 1 130 ? 11.866 13.485 61.637 1.00 21.93 ? 124 HIS B CB  1 
ATOM   2165 C CG  . HIS B 1 130 ? 12.652 12.256 61.929 1.00 27.96 ? 124 HIS B CG  1 
ATOM   2166 N ND1 . HIS B 1 130 ? 12.309 11.366 62.925 1.00 28.01 ? 124 HIS B ND1 1 
ATOM   2167 C CD2 . HIS B 1 130 ? 13.743 11.736 61.314 1.00 27.31 ? 124 HIS B CD2 1 
ATOM   2168 C CE1 . HIS B 1 130 ? 13.149 10.345 62.911 1.00 29.43 ? 124 HIS B CE1 1 
ATOM   2169 N NE2 . HIS B 1 130 ? 14.028 10.546 61.947 1.00 31.11 ? 124 HIS B NE2 1 
ATOM   2170 N N   . TYR B 1 131 ? 10.123 14.464 63.923 1.00 15.63 ? 125 TYR B N   1 
ATOM   2171 C CA  . TYR B 1 131 ? 9.355  14.120 65.108 1.00 18.92 ? 125 TYR B CA  1 
ATOM   2172 C C   . TYR B 1 131 ? 9.734  12.699 65.519 1.00 21.02 ? 125 TYR B C   1 
ATOM   2173 O O   . TYR B 1 131 ? 9.960  11.824 64.653 1.00 21.42 ? 125 TYR B O   1 
ATOM   2174 C CB  . TYR B 1 131 ? 7.873  14.166 64.808 1.00 18.96 ? 125 TYR B CB  1 
ATOM   2175 C CG  . TYR B 1 131 ? 7.268  15.524 64.965 1.00 15.77 ? 125 TYR B CG  1 
ATOM   2176 C CD1 . TYR B 1 131 ? 7.206  16.129 66.223 1.00 17.07 ? 125 TYR B CD1 1 
ATOM   2177 C CD2 . TYR B 1 131 ? 6.694  16.172 63.882 1.00 17.23 ? 125 TYR B CD2 1 
ATOM   2178 C CE1 . TYR B 1 131 ? 6.568  17.342 66.367 1.00 13.77 ? 125 TYR B CE1 1 
ATOM   2179 C CE2 . TYR B 1 131 ? 6.050  17.404 64.016 1.00 15.98 ? 125 TYR B CE2 1 
ATOM   2180 C CZ  . TYR B 1 131 ? 5.996  17.978 65.276 1.00 14.90 ? 125 TYR B CZ  1 
ATOM   2181 O OH  . TYR B 1 131 ? 5.379  19.192 65.452 1.00 17.23 ? 125 TYR B OH  1 
ATOM   2182 N N   . GLY B 1 132 ? 9.792  12.473 66.827 1.00 17.65 ? 126 GLY B N   1 
ATOM   2183 C CA  . GLY B 1 132 ? 10.112 11.157 67.359 1.00 17.07 ? 126 GLY B CA  1 
ATOM   2184 C C   . GLY B 1 132 ? 11.528 10.897 67.791 1.00 20.97 ? 126 GLY B C   1 
ATOM   2185 O O   . GLY B 1 132 ? 11.814 9.919  68.475 1.00 23.09 ? 126 GLY B O   1 
ATOM   2186 N N   . GLN B 1 133 ? 12.451 11.795 67.423 1.00 17.99 ? 127 GLN B N   1 
ATOM   2187 C CA  . GLN B 1 133 ? 13.860 11.646 67.778 1.00 17.31 ? 127 GLN B CA  1 
ATOM   2188 C C   . GLN B 1 133 ? 14.183 12.140 69.198 1.00 17.05 ? 127 GLN B C   1 
ATOM   2189 O O   . GLN B 1 133 ? 13.436 12.952 69.743 1.00 18.67 ? 127 GLN B O   1 
ATOM   2190 C CB  . GLN B 1 133 ? 14.717 12.491 66.823 1.00 15.58 ? 127 GLN B CB  1 
ATOM   2191 C CG  . GLN B 1 133 ? 14.824 11.938 65.446 1.00 20.11 ? 127 GLN B CG  1 
ATOM   2192 C CD  . GLN B 1 133 ? 15.709 12.802 64.597 1.00 22.25 ? 127 GLN B CD  1 
ATOM   2193 O OE1 . GLN B 1 133 ? 15.800 14.016 64.831 1.00 17.65 ? 127 GLN B OE1 1 
ATOM   2194 N NE2 . GLN B 1 133 ? 16.370 12.189 63.598 1.00 25.35 ? 127 GLN B NE2 1 
ATOM   2195 N N   . LYS B 1 134 ? 15.274 11.669 69.787 1.00 16.94 ? 128 LYS B N   1 
ATOM   2196 C CA  . LYS B 1 134 ? 15.716 12.129 71.084 1.00 19.28 ? 128 LYS B CA  1 
ATOM   2197 C C   . LYS B 1 134 ? 16.562 13.391 70.923 1.00 16.97 ? 128 LYS B C   1 
ATOM   2198 O O   . LYS B 1 134 ? 16.640 14.195 71.837 1.00 16.99 ? 128 LYS B O   1 
ATOM   2199 C CB  . LYS B 1 134 ? 16.582 11.076 71.785 1.00 22.38 ? 128 LYS B CB  1 
ATOM   2200 C CG  . LYS B 1 134 ? 15.797 9.795  72.141 1.00 31.31 ? 128 LYS B CG  1 
ATOM   2201 C CD  . LYS B 1 134 ? 14.866 10.052 73.284 1.00 32.22 ? 128 LYS B CD  1 
ATOM   2202 C CE  . LYS B 1 134 ? 14.259 8.752  73.791 1.00 33.01 ? 128 LYS B CE  1 
ATOM   2203 N NZ  . LYS B 1 134 ? 13.439 8.108  72.748 1.00 35.13 ? 128 LYS B NZ  1 
ATOM   2204 N N   . ALA B 1 135 ? 17.184 13.536 69.746 1.00 17.48 ? 129 ALA B N   1 
ATOM   2205 C CA  . ALA B 1 135 ? 18.038 14.692 69.484 1.00 17.49 ? 129 ALA B CA  1 
ATOM   2206 C C   . ALA B 1 135 ? 17.306 16.020 69.593 1.00 16.24 ? 129 ALA B C   1 
ATOM   2207 O O   . ALA B 1 135 ? 17.942 17.045 69.910 1.00 15.06 ? 129 ALA B O   1 
ATOM   2208 C CB  . ALA B 1 135 ? 18.643 14.555 68.089 1.00 17.24 ? 129 ALA B CB  1 
ATOM   2209 N N   . ILE B 1 136 ? 15.983 15.990 69.380 1.00 15.04 ? 130 ILE B N   1 
ATOM   2210 C CA  . ILE B 1 136 ? 15.195 17.224 69.404 1.00 12.83 ? 130 ILE B CA  1 
ATOM   2211 C C   . ILE B 1 136 ? 14.563 17.596 70.779 1.00 12.11 ? 130 ILE B C   1 
ATOM   2212 O O   . ILE B 1 136 ? 13.962 18.660 70.917 1.00 13.25 ? 130 ILE B O   1 
ATOM   2213 C CB  . ILE B 1 136 ? 14.066 17.164 68.350 1.00 13.47 ? 130 ILE B CB  1 
ATOM   2214 C CG1 . ILE B 1 136 ? 12.975 16.125 68.752 1.00 14.56 ? 130 ILE B CG1 1 
ATOM   2215 C CG2 . ILE B 1 136 ? 14.662 16.842 66.924 1.00 14.88 ? 130 ILE B CG2 1 
ATOM   2216 C CD1 . ILE B 1 136 ? 11.793 16.100 67.764 1.00 17.19 ? 130 ILE B CD1 1 
ATOM   2217 N N   . LEU B 1 137 ? 14.773 16.741 71.777 1.00 14.28 ? 131 LEU B N   1 
ATOM   2218 C CA  . LEU B 1 137 ? 14.175 16.961 73.112 1.00 15.35 ? 131 LEU B CA  1 
ATOM   2219 C C   . LEU B 1 137 ? 15.050 17.728 74.085 1.00 16.51 ? 131 LEU B C   1 
ATOM   2220 O O   . LEU B 1 137 ? 16.095 17.230 74.506 1.00 22.31 ? 131 LEU B O   1 
ATOM   2221 C CB  . LEU B 1 137 ? 13.819 15.611 73.716 1.00 15.35 ? 131 LEU B CB  1 
ATOM   2222 C CG  . LEU B 1 137 ? 12.922 14.768 72.808 1.00 15.66 ? 131 LEU B CG  1 
ATOM   2223 C CD1 . LEU B 1 137 ? 12.788 13.362 73.455 1.00 17.63 ? 131 LEU B CD1 1 
ATOM   2224 C CD2 . LEU B 1 137 ? 11.556 15.424 72.650 1.00 16.41 ? 131 LEU B CD2 1 
ATOM   2225 N N   . PHE B 1 138 ? 14.588 18.904 74.477 1.00 12.35 ? 132 PHE B N   1 
ATOM   2226 C CA  . PHE B 1 138 ? 15.315 19.747 75.393 1.00 15.59 ? 132 PHE B CA  1 
ATOM   2227 C C   . PHE B 1 138 ? 14.543 20.008 76.690 1.00 15.28 ? 132 PHE B C   1 
ATOM   2228 O O   . PHE B 1 138 ? 13.300 19.905 76.771 1.00 16.09 ? 132 PHE B O   1 
ATOM   2229 C CB  . PHE B 1 138 ? 15.587 21.098 74.746 1.00 14.96 ? 132 PHE B CB  1 
ATOM   2230 C CG  . PHE B 1 138 ? 16.580 21.041 73.647 1.00 14.11 ? 132 PHE B CG  1 
ATOM   2231 C CD1 . PHE B 1 138 ? 16.194 20.740 72.355 1.00 16.65 ? 132 PHE B CD1 1 
ATOM   2232 C CD2 . PHE B 1 138 ? 17.930 21.266 73.933 1.00 14.15 ? 132 PHE B CD2 1 
ATOM   2233 C CE1 . PHE B 1 138 ? 17.150 20.657 71.318 1.00 16.53 ? 132 PHE B CE1 1 
ATOM   2234 C CE2 . PHE B 1 138 ? 18.870 21.181 72.932 1.00 12.69 ? 132 PHE B CE2 1 
ATOM   2235 C CZ  . PHE B 1 138 ? 18.513 20.883 71.634 1.00 13.52 ? 132 PHE B CZ  1 
ATOM   2236 N N   . LEU B 1 139 ? 15.285 20.337 77.719 1.00 14.39 ? 133 LEU B N   1 
ATOM   2237 C CA  . LEU B 1 139 ? 14.707 20.716 79.012 1.00 12.06 ? 133 LEU B CA  1 
ATOM   2238 C C   . LEU B 1 139 ? 15.376 22.012 79.421 1.00 14.37 ? 133 LEU B C   1 
ATOM   2239 O O   . LEU B 1 139 ? 16.634 22.080 79.431 1.00 19.45 ? 133 LEU B O   1 
ATOM   2240 C CB  . LEU B 1 139 ? 15.012 19.597 80.009 1.00 23.34 ? 133 LEU B CB  1 
ATOM   2241 C CG  . LEU B 1 139 ? 14.086 19.230 81.122 1.00 31.82 ? 133 LEU B CG  1 
ATOM   2242 C CD1 . LEU B 1 139 ? 12.657 19.018 80.628 1.00 22.40 ? 133 LEU B CD1 1 
ATOM   2243 C CD2 . LEU B 1 139 ? 14.688 17.952 81.755 1.00 25.21 ? 133 LEU B CD2 1 
ATOM   2244 N N   . PRO B 1 140 ? 14.608 23.062 79.735 1.00 15.39 ? 134 PRO B N   1 
ATOM   2245 C CA  . PRO B 1 140 ? 15.187 24.336 80.137 1.00 19.49 ? 134 PRO B CA  1 
ATOM   2246 C C   . PRO B 1 140 ? 15.583 24.233 81.604 1.00 23.95 ? 134 PRO B C   1 
ATOM   2247 O O   . PRO B 1 140 ? 14.723 24.019 82.459 1.00 28.06 ? 134 PRO B O   1 
ATOM   2248 C CB  . PRO B 1 140 ? 14.056 25.333 79.885 1.00 25.22 ? 134 PRO B CB  1 
ATOM   2249 C CG  . PRO B 1 140 ? 12.811 24.507 80.181 1.00 24.09 ? 134 PRO B CG  1 
ATOM   2250 C CD  . PRO B 1 140 ? 13.127 23.159 79.605 1.00 19.85 ? 134 PRO B CD  1 
ATOM   2251 N N   . LEU B 1 141 ? 16.873 24.374 81.890 1.00 19.05 ? 135 LEU B N   1 
ATOM   2252 C CA  . LEU B 1 141 ? 17.323 24.253 83.282 1.00 22.20 ? 135 LEU B CA  1 
ATOM   2253 C C   . LEU B 1 141 ? 17.789 25.572 83.818 1.00 23.93 ? 135 LEU B C   1 
ATOM   2254 O O   . LEU B 1 141 ? 18.292 26.398 83.092 1.00 21.21 ? 135 LEU B O   1 
ATOM   2255 C CB  . LEU B 1 141 ? 18.462 23.246 83.394 1.00 16.37 ? 135 LEU B CB  1 
ATOM   2256 C CG  . LEU B 1 141 ? 18.173 21.827 82.943 1.00 21.42 ? 135 LEU B CG  1 
ATOM   2257 C CD1 . LEU B 1 141 ? 19.378 20.980 83.204 1.00 25.30 ? 135 LEU B CD1 1 
ATOM   2258 C CD2 . LEU B 1 141 ? 16.977 21.235 83.714 1.00 25.89 ? 135 LEU B CD2 1 
ATOM   2259 N N   . PRO B 1 142 ? 17.683 25.784 85.131 1.00 26.97 ? 136 PRO B N   1 
ATOM   2260 C CA  . PRO B 1 142 ? 18.140 27.074 85.645 1.00 25.92 ? 136 PRO B CA  1 
ATOM   2261 C C   . PRO B 1 142 ? 19.649 27.217 85.496 1.00 24.67 ? 136 PRO B C   1 
ATOM   2262 O O   . PRO B 1 142 ? 20.391 26.227 85.404 1.00 25.12 ? 136 PRO B O   1 
ATOM   2263 C CB  . PRO B 1 142 ? 17.682 27.038 87.115 1.00 27.82 ? 136 PRO B CB  1 
ATOM   2264 C CG  . PRO B 1 142 ? 17.848 25.562 87.442 1.00 32.32 ? 136 PRO B CG  1 
ATOM   2265 C CD  . PRO B 1 142 ? 17.270 24.872 86.221 1.00 28.65 ? 136 PRO B CD  1 
ATOM   2266 N N   . VAL B 1 143 ? 20.097 28.467 85.419 1.00 30.62 ? 137 VAL B N   1 
ATOM   2267 C CA  . VAL B 1 143 ? 21.532 28.749 85.308 1.00 33.84 ? 137 VAL B CA  1 
ATOM   2268 C C   . VAL B 1 143 ? 22.145 28.705 86.717 1.00 35.94 ? 137 VAL B C   1 
ATOM   2269 O O   . VAL B 1 143 ? 23.193 28.044 86.877 1.00 38.61 ? 137 VAL B O   1 
ATOM   2270 C CB  . VAL B 1 143 ? 21.805 30.159 84.702 1.00 34.43 ? 137 VAL B CB  1 
ATOM   2271 C CG1 . VAL B 1 143 ? 21.548 30.143 83.181 1.00 32.55 ? 137 VAL B CG1 1 
ATOM   2272 C CG2 . VAL B 1 143 ? 20.940 31.196 85.389 1.00 34.78 ? 137 VAL B CG2 1 
HETATM 2273 S S   . SO4 C 2 .   ? 21.012 22.180 47.112 1.00 26.53 ? 141 SO4 A S   1 
HETATM 2274 O O1  . SO4 C 2 .   ? 21.676 23.101 46.137 1.00 31.70 ? 141 SO4 A O1  1 
HETATM 2275 O O2  . SO4 C 2 .   ? 21.313 20.766 46.719 1.00 26.98 ? 141 SO4 A O2  1 
HETATM 2276 O O3  . SO4 C 2 .   ? 19.573 22.376 47.070 1.00 32.68 ? 141 SO4 A O3  1 
HETATM 2277 O O4  . SO4 C 2 .   ? 21.662 22.412 48.424 1.00 28.21 ? 141 SO4 A O4  1 
HETATM 2278 C C   . FMT D 3 .   ? 40.562 38.325 45.142 1.00 39.12 ? 142 FMT A C   1 
HETATM 2279 O O1  . FMT D 3 .   ? 41.226 37.332 44.244 1.00 29.53 ? 142 FMT A O1  1 
HETATM 2280 O O2  . FMT D 3 .   ? 40.626 37.860 46.585 1.00 28.62 ? 142 FMT A O2  1 
HETATM 2281 C C   . FMT E 3 .   ? 17.702 10.161 68.550 1.00 46.30 ? 141 FMT B C   1 
HETATM 2282 O O1  . FMT E 3 .   ? 16.436 9.429  68.159 1.00 46.63 ? 141 FMT B O1  1 
HETATM 2283 O O2  . FMT E 3 .   ? 17.884 11.442 67.718 1.00 33.58 ? 141 FMT B O2  1 
HETATM 2284 C C   . FMT F 3 .   ? 3.155  26.257 62.396 1.00 44.67 ? 142 FMT B C   1 
HETATM 2285 O O1  . FMT F 3 .   ? 2.349  25.388 63.319 1.00 37.42 ? 142 FMT B O1  1 
HETATM 2286 O O2  . FMT F 3 .   ? 3.078  25.749 60.963 1.00 40.98 ? 142 FMT B O2  1 
HETATM 2287 O O   . HOH G 4 .   ? 25.448 44.781 43.809 1.00 10.61 ? 143 HOH A O   1 
HETATM 2288 O O   . HOH G 4 .   ? 25.852 53.528 50.697 1.00 11.09 ? 144 HOH A O   1 
HETATM 2289 O O   . HOH G 4 .   ? 31.022 42.471 49.024 1.00 10.78 ? 145 HOH A O   1 
HETATM 2290 O O   . HOH G 4 .   ? 28.103 32.389 42.328 1.00 11.69 ? 146 HOH A O   1 
HETATM 2291 O O   . HOH G 4 .   ? 40.785 37.411 41.670 1.00 13.46 ? 147 HOH A O   1 
HETATM 2292 O O   . HOH G 4 .   ? 28.993 41.634 54.556 1.00 14.42 ? 148 HOH A O   1 
HETATM 2293 O O   . HOH G 4 .   ? 24.382 33.110 48.282 1.00 11.00 ? 149 HOH A O   1 
HETATM 2294 O O   . HOH G 4 .   ? 24.112 51.068 52.178 1.00 13.92 ? 150 HOH A O   1 
HETATM 2295 O O   . HOH G 4 .   ? 29.356 40.924 50.846 1.00 12.57 ? 151 HOH A O   1 
HETATM 2296 O O   . HOH G 4 .   ? 34.256 39.620 35.320 1.00 14.17 ? 152 HOH A O   1 
HETATM 2297 O O   . HOH G 4 .   ? 21.553 38.633 58.856 1.00 13.17 ? 153 HOH A O   1 
HETATM 2298 O O   . HOH G 4 .   ? 46.609 33.334 46.777 1.00 19.71 ? 154 HOH A O   1 
HETATM 2299 O O   . HOH G 4 .   ? 20.013 40.642 55.598 1.00 16.08 ? 155 HOH A O   1 
HETATM 2300 O O   . HOH G 4 .   ? 38.193 41.520 40.344 1.00 15.42 ? 156 HOH A O   1 
HETATM 2301 O O   . HOH G 4 .   ? 40.173 30.019 42.701 1.00 16.41 ? 157 HOH A O   1 
HETATM 2302 O O   . HOH G 4 .   ? 31.432 38.164 58.867 1.00 18.16 ? 158 HOH A O   1 
HETATM 2303 O O   . HOH G 4 .   ? 19.945 32.423 52.638 1.00 15.97 ? 159 HOH A O   1 
HETATM 2304 O O   . HOH G 4 .   ? 22.983 39.538 60.986 1.00 14.44 ? 160 HOH A O   1 
HETATM 2305 O O   . HOH G 4 .   ? 27.402 35.925 63.727 1.00 16.09 ? 161 HOH A O   1 
HETATM 2306 O O   . HOH G 4 .   ? 33.930 45.270 49.063 1.00 15.46 ? 162 HOH A O   1 
HETATM 2307 O O   . HOH G 4 .   ? 29.164 37.626 31.468 1.00 18.12 ? 163 HOH A O   1 
HETATM 2308 O O   . HOH G 4 .   ? 17.636 36.962 37.328 1.00 14.14 ? 164 HOH A O   1 
HETATM 2309 O O   . HOH G 4 .   ? 33.604 34.167 41.563 1.00 17.20 ? 165 HOH A O   1 
HETATM 2310 O O   . HOH G 4 .   ? 21.546 34.158 51.355 1.00 15.20 ? 166 HOH A O   1 
HETATM 2311 O O   . HOH G 4 .   ? 37.725 28.416 28.946 1.00 18.18 ? 167 HOH A O   1 
HETATM 2312 O O   . HOH G 4 .   ? 21.947 49.291 52.966 1.00 15.27 ? 168 HOH A O   1 
HETATM 2313 O O   . HOH G 4 .   ? 19.472 52.516 42.553 1.00 20.69 ? 169 HOH A O   1 
HETATM 2314 O O   . HOH G 4 .   ? 44.071 36.074 40.461 1.00 17.55 ? 170 HOH A O   1 
HETATM 2315 O O   . HOH G 4 .   ? 27.553 33.812 60.371 1.00 16.46 ? 171 HOH A O   1 
HETATM 2316 O O   . HOH G 4 .   ? 18.286 52.770 44.944 1.00 19.77 ? 172 HOH A O   1 
HETATM 2317 O O   . HOH G 4 .   ? 33.732 25.693 41.475 1.00 21.41 ? 173 HOH A O   1 
HETATM 2318 O O   . HOH G 4 .   ? 24.857 22.993 45.259 1.00 22.15 ? 174 HOH A O   1 
HETATM 2319 O O   . HOH G 4 .   ? 18.243 27.001 41.546 1.00 17.91 ? 175 HOH A O   1 
HETATM 2320 O O   . HOH G 4 .   ? 16.917 22.567 47.940 1.00 22.15 ? 176 HOH A O   1 
HETATM 2321 O O   . HOH G 4 .   ? 24.813 47.753 37.944 1.00 17.53 ? 177 HOH A O   1 
HETATM 2322 O O   . HOH G 4 .   ? 29.149 37.470 61.369 1.00 20.70 ? 178 HOH A O   1 
HETATM 2323 O O   . HOH G 4 .   ? 33.267 28.456 27.368 1.00 20.51 ? 179 HOH A O   1 
HETATM 2324 O O   . HOH G 4 .   ? 16.218 32.805 50.147 1.00 22.32 ? 180 HOH A O   1 
HETATM 2325 O O   . HOH G 4 .   ? 41.739 37.259 32.668 1.00 21.43 ? 181 HOH A O   1 
HETATM 2326 O O   . HOH G 4 .   ? 34.801 43.284 34.252 1.00 20.75 ? 182 HOH A O   1 
HETATM 2327 O O   . HOH G 4 .   ? 30.087 48.654 33.478 1.00 25.74 ? 183 HOH A O   1 
HETATM 2328 O O   . HOH G 4 .   ? 24.202 43.458 32.751 1.00 19.76 ? 184 HOH A O   1 
HETATM 2329 O O   . HOH G 4 .   ? 30.682 28.299 27.062 1.00 22.47 ? 185 HOH A O   1 
HETATM 2330 O O   . HOH G 4 .   ? 19.150 49.473 52.201 1.00 24.00 ? 186 HOH A O   1 
HETATM 2331 O O   . HOH G 4 .   ? 35.781 32.398 41.726 1.00 18.13 ? 187 HOH A O   1 
HETATM 2332 O O   . HOH G 4 .   ? 26.172 52.756 41.490 1.00 27.57 ? 188 HOH A O   1 
HETATM 2333 O O   . HOH G 4 .   ? 30.931 39.767 32.198 1.00 24.53 ? 189 HOH A O   1 
HETATM 2334 O O   . HOH G 4 .   ? 34.807 30.663 39.812 1.00 20.36 ? 190 HOH A O   1 
HETATM 2335 O O   . HOH G 4 .   ? 14.147 43.898 38.066 1.00 22.31 ? 191 HOH A O   1 
HETATM 2336 O O   . HOH G 4 .   ? 40.208 47.786 36.990 1.00 28.03 ? 192 HOH A O   1 
HETATM 2337 O O   . HOH G 4 .   ? 38.795 43.157 42.524 1.00 22.86 ? 193 HOH A O   1 
HETATM 2338 O O   . HOH G 4 .   ? 32.832 30.738 56.334 1.00 24.83 ? 194 HOH A O   1 
HETATM 2339 O O   . HOH G 4 .   ? 26.089 41.544 32.005 1.00 22.20 ? 195 HOH A O   1 
HETATM 2340 O O   . HOH G 4 .   ? 20.889 53.050 52.474 1.00 25.74 ? 196 HOH A O   1 
HETATM 2341 O O   . HOH G 4 .   ? 31.181 24.512 40.813 1.00 22.39 ? 197 HOH A O   1 
HETATM 2342 O O   . HOH G 4 .   ? 40.677 44.179 39.023 1.00 28.55 ? 198 HOH A O   1 
HETATM 2343 O O   . HOH G 4 .   ? 11.287 28.423 33.906 1.00 30.37 ? 199 HOH A O   1 
HETATM 2344 O O   . HOH G 4 .   ? 31.767 22.774 31.749 1.00 24.58 ? 200 HOH A O   1 
HETATM 2345 O O   . HOH G 4 .   ? 19.379 41.386 27.638 1.00 25.30 ? 201 HOH A O   1 
HETATM 2346 O O   . HOH G 4 .   ? 16.084 50.917 45.525 1.00 28.57 ? 202 HOH A O   1 
HETATM 2347 O O   . HOH G 4 .   ? 29.181 42.021 62.061 1.00 26.11 ? 203 HOH A O   1 
HETATM 2348 O O   . HOH G 4 .   ? 16.317 40.815 53.239 1.00 33.00 ? 204 HOH A O   1 
HETATM 2349 O O   . HOH G 4 .   ? 30.664 50.078 47.070 1.00 32.56 ? 205 HOH A O   1 
HETATM 2350 O O   . HOH G 4 .   ? 18.517 38.954 53.862 1.00 23.13 ? 206 HOH A O   1 
HETATM 2351 O O   . HOH G 4 .   ? 9.252  29.213 41.030 1.00 27.02 ? 207 HOH A O   1 
HETATM 2352 O O   . HOH G 4 .   ? 32.586 28.196 54.586 1.00 29.18 ? 208 HOH A O   1 
HETATM 2353 O O   . HOH G 4 .   ? 13.019 47.340 50.406 1.00 31.08 ? 209 HOH A O   1 
HETATM 2354 O O   . HOH G 4 .   ? 30.845 25.195 52.801 1.00 28.92 ? 210 HOH A O   1 
HETATM 2355 O O   . HOH G 4 .   ? 6.315  36.086 39.591 1.00 35.87 ? 211 HOH A O   1 
HETATM 2356 O O   . HOH G 4 .   ? 32.940 28.925 51.962 1.00 22.24 ? 212 HOH A O   1 
HETATM 2357 O O   . HOH G 4 .   ? 12.547 37.549 46.041 1.00 26.57 ? 213 HOH A O   1 
HETATM 2358 O O   . HOH G 4 .   ? 18.302 35.951 51.067 1.00 25.42 ? 214 HOH A O   1 
HETATM 2359 O O   . HOH G 4 .   ? 30.303 46.463 28.888 1.00 29.67 ? 215 HOH A O   1 
HETATM 2360 O O   . HOH G 4 .   ? 28.607 29.876 59.866 1.00 33.26 ? 216 HOH A O   1 
HETATM 2361 O O   . HOH G 4 .   ? 25.188 42.868 27.368 1.00 42.64 ? 217 HOH A O   1 
HETATM 2362 O O   . HOH G 4 .   ? 29.545 50.063 38.681 1.00 36.00 ? 218 HOH A O   1 
HETATM 2363 O O   . HOH G 4 .   ? 35.631 40.080 55.831 1.00 30.71 ? 219 HOH A O   1 
HETATM 2364 O O   . HOH G 4 .   ? 37.194 42.513 53.147 1.00 30.38 ? 220 HOH A O   1 
HETATM 2365 O O   . HOH G 4 .   ? 36.004 34.565 28.566 1.00 27.56 ? 221 HOH A O   1 
HETATM 2366 O O   . HOH G 4 .   ? 27.198 40.064 27.068 1.00 37.93 ? 222 HOH A O   1 
HETATM 2367 O O   . HOH G 4 .   ? 29.661 52.876 47.687 1.00 35.94 ? 223 HOH A O   1 
HETATM 2368 O O   . HOH G 4 .   ? 42.076 31.225 48.439 1.00 29.79 ? 224 HOH A O   1 
HETATM 2369 O O   . HOH G 4 .   ? 28.513 32.410 31.512 1.00 32.76 ? 225 HOH A O   1 
HETATM 2370 O O   . HOH G 4 .   ? 9.886  38.640 44.810 1.00 31.44 ? 226 HOH A O   1 
HETATM 2371 O O   . HOH G 4 .   ? 27.606 39.456 33.356 1.00 27.73 ? 227 HOH A O   1 
HETATM 2372 O O   . HOH G 4 .   ? 8.241  31.266 32.822 1.00 30.72 ? 228 HOH A O   1 
HETATM 2373 O O   . HOH G 4 .   ? 16.905 44.735 52.441 1.00 28.59 ? 229 HOH A O   1 
HETATM 2374 O O   . HOH G 4 .   ? 36.543 38.597 29.481 1.00 30.04 ? 230 HOH A O   1 
HETATM 2375 O O   . HOH G 4 .   ? 25.740 23.276 51.347 1.00 31.65 ? 231 HOH A O   1 
HETATM 2376 O O   . HOH G 4 .   ? 16.161 37.558 51.520 1.00 37.52 ? 232 HOH A O   1 
HETATM 2377 O O   . HOH G 4 .   ? 29.324 35.512 29.653 1.00 32.58 ? 233 HOH A O   1 
HETATM 2378 O O   . HOH G 4 .   ? 38.421 41.155 49.279 1.00 25.49 ? 234 HOH A O   1 
HETATM 2379 O O   . HOH G 4 .   ? 23.878 23.469 47.815 1.00 31.32 ? 235 HOH A O   1 
HETATM 2380 O O   . HOH G 4 .   ? 21.978 48.593 29.812 1.00 30.41 ? 236 HOH A O   1 
HETATM 2381 O O   . HOH G 4 .   ? 15.863 47.511 50.018 1.00 30.66 ? 237 HOH A O   1 
HETATM 2382 O O   . HOH G 4 .   ? 23.700 24.522 32.423 1.00 34.12 ? 238 HOH A O   1 
HETATM 2383 O O   . HOH G 4 .   ? 30.970 21.421 34.030 1.00 41.78 ? 239 HOH A O   1 
HETATM 2384 O O   . HOH G 4 .   ? 37.675 50.889 40.049 1.00 41.96 ? 240 HOH A O   1 
HETATM 2385 O O   . HOH G 4 .   ? 31.162 41.672 57.773 1.00 28.40 ? 241 HOH A O   1 
HETATM 2386 O O   . HOH G 4 .   ? 10.609 26.800 43.012 1.00 44.15 ? 242 HOH A O   1 
HETATM 2387 O O   . HOH G 4 .   ? 28.214 21.698 36.441 1.00 31.59 ? 243 HOH A O   1 
HETATM 2388 O O   . HOH G 4 .   ? 24.145 33.666 27.895 1.00 29.28 ? 244 HOH A O   1 
HETATM 2389 O O   . HOH G 4 .   ? 12.630 22.140 49.903 1.00 34.37 ? 245 HOH A O   1 
HETATM 2390 O O   . HOH G 4 .   ? 33.384 40.315 31.317 1.00 29.55 ? 246 HOH A O   1 
HETATM 2391 O O   . HOH G 4 .   ? 11.414 44.613 35.063 1.00 38.75 ? 247 HOH A O   1 
HETATM 2392 O O   . HOH G 4 .   ? 15.687 45.380 32.458 1.00 37.55 ? 248 HOH A O   1 
HETATM 2393 O O   . HOH G 4 .   ? 19.487 48.552 32.697 1.00 37.41 ? 249 HOH A O   1 
HETATM 2394 O O   . HOH G 4 .   ? 13.422 26.566 35.155 1.00 41.53 ? 250 HOH A O   1 
HETATM 2395 O O   . HOH G 4 .   ? 27.558 21.013 48.810 1.00 35.94 ? 251 HOH A O   1 
HETATM 2396 O O   . HOH G 4 .   ? 29.929 21.208 39.800 1.00 45.44 ? 252 HOH A O   1 
HETATM 2397 O O   . HOH G 4 .   ? 36.084 29.610 54.440 1.00 41.55 ? 253 HOH A O   1 
HETATM 2398 O O   . HOH G 4 .   ? 38.731 29.811 52.232 1.00 43.83 ? 254 HOH A O   1 
HETATM 2399 O O   . HOH G 4 .   ? 12.849 46.703 34.712 1.00 28.47 ? 255 HOH A O   1 
HETATM 2400 O O   . HOH G 4 .   ? 14.465 30.362 30.260 1.00 36.91 ? 256 HOH A O   1 
HETATM 2401 O O   . HOH G 4 .   ? 35.264 52.351 38.129 1.00 44.16 ? 257 HOH A O   1 
HETATM 2402 O O   . HOH G 4 .   ? 12.741 39.390 31.092 1.00 35.91 ? 258 HOH A O   1 
HETATM 2403 O O   . HOH G 4 .   ? 16.766 37.162 55.146 1.00 37.19 ? 259 HOH A O   1 
HETATM 2404 O O   . HOH H 4 .   ? 16.774 29.928 56.972 1.00 11.60 ? 143 HOH B O   1 
HETATM 2405 O O   . HOH H 4 .   ? 16.935 33.063 68.187 1.00 11.61 ? 144 HOH B O   1 
HETATM 2406 O O   . HOH H 4 .   ? 20.231 30.988 55.104 1.00 12.77 ? 145 HOH B O   1 
HETATM 2407 O O   . HOH H 4 .   ? 13.944 20.760 69.105 1.00 13.68 ? 146 HOH B O   1 
HETATM 2408 O O   . HOH H 4 .   ? 13.061 30.671 61.656 1.00 11.75 ? 147 HOH B O   1 
HETATM 2409 O O   . HOH H 4 .   ? 15.158 29.139 60.384 1.00 12.44 ? 148 HOH B O   1 
HETATM 2410 O O   . HOH H 4 .   ? 22.223 28.035 53.215 1.00 14.60 ? 149 HOH B O   1 
HETATM 2411 O O   . HOH H 4 .   ? 1.713  25.651 65.848 1.00 15.45 ? 150 HOH B O   1 
HETATM 2412 O O   . HOH H 4 .   ? 21.528 36.202 60.223 1.00 13.36 ? 151 HOH B O   1 
HETATM 2413 O O   . HOH H 4 .   ? -2.249 21.352 59.463 1.00 17.60 ? 152 HOH B O   1 
HETATM 2414 O O   . HOH H 4 .   ? 6.030  28.123 73.841 1.00 15.27 ? 153 HOH B O   1 
HETATM 2415 O O   . HOH H 4 .   ? 19.446 21.403 64.593 1.00 16.50 ? 154 HOH B O   1 
HETATM 2416 O O   . HOH H 4 .   ? 27.761 32.499 62.812 1.00 16.24 ? 155 HOH B O   1 
HETATM 2417 O O   . HOH H 4 .   ? 3.814  29.872 67.684 1.00 17.62 ? 156 HOH B O   1 
HETATM 2418 O O   . HOH H 4 .   ? 0.633  17.272 79.171 1.00 17.44 ? 157 HOH B O   1 
HETATM 2419 O O   . HOH H 4 .   ? 22.336 25.903 77.031 1.00 16.34 ? 158 HOH B O   1 
HETATM 2420 O O   . HOH H 4 .   ? 13.672 15.979 56.414 1.00 31.08 ? 159 HOH B O   1 
HETATM 2421 O O   . HOH H 4 .   ? 15.884 36.574 73.560 1.00 19.66 ? 160 HOH B O   1 
HETATM 2422 O O   . HOH H 4 .   ? 9.720  26.264 78.978 1.00 18.45 ? 161 HOH B O   1 
HETATM 2423 O O   . HOH H 4 .   ? 2.822  18.179 62.725 1.00 17.18 ? 162 HOH B O   1 
HETATM 2424 O O   . HOH H 4 .   ? -1.939 25.972 74.183 1.00 21.77 ? 163 HOH B O   1 
HETATM 2425 O O   . HOH H 4 .   ? 25.931 32.837 77.030 1.00 21.03 ? 164 HOH B O   1 
HETATM 2426 O O   . HOH H 4 .   ? -1.817 24.351 66.134 1.00 19.78 ? 165 HOH B O   1 
HETATM 2427 O O   . HOH H 4 .   ? 6.794  16.981 83.193 1.00 23.29 ? 166 HOH B O   1 
HETATM 2428 O O   . HOH H 4 .   ? 6.750  18.996 69.613 1.00 17.60 ? 167 HOH B O   1 
HETATM 2429 O O   . HOH H 4 .   ? 9.596  21.610 79.356 1.00 21.06 ? 168 HOH B O   1 
HETATM 2430 O O   . HOH H 4 .   ? 3.740  31.069 65.030 1.00 22.42 ? 169 HOH B O   1 
HETATM 2431 O O   . HOH H 4 .   ? 8.495  22.526 68.224 1.00 18.16 ? 170 HOH B O   1 
HETATM 2432 O O   . HOH H 4 .   ? 16.628 34.005 54.987 1.00 24.54 ? 171 HOH B O   1 
HETATM 2433 O O   . HOH H 4 .   ? -3.411 28.605 64.072 1.00 43.81 ? 172 HOH B O   1 
HETATM 2434 O O   . HOH H 4 .   ? 0.840  37.663 65.546 1.00 40.45 ? 173 HOH B O   1 
HETATM 2435 O O   . HOH H 4 .   ? 14.027 18.182 54.711 1.00 23.88 ? 174 HOH B O   1 
HETATM 2436 O O   . HOH H 4 .   ? 13.996 39.046 58.931 1.00 29.75 ? 175 HOH B O   1 
HETATM 2437 O O   . HOH H 4 .   ? 10.362 33.333 60.744 1.00 20.11 ? 176 HOH B O   1 
HETATM 2438 O O   . HOH H 4 .   ? 15.517 25.851 52.144 1.00 20.06 ? 177 HOH B O   1 
HETATM 2439 O O   . HOH H 4 .   ? 23.034 15.707 73.160 1.00 23.58 ? 178 HOH B O   1 
HETATM 2440 O O   . HOH H 4 .   ? 6.426  20.789 67.402 1.00 20.46 ? 179 HOH B O   1 
HETATM 2441 O O   . HOH H 4 .   ? 10.541 12.971 70.019 1.00 21.02 ? 180 HOH B O   1 
HETATM 2442 O O   . HOH H 4 .   ? 24.885 41.684 67.824 1.00 22.21 ? 181 HOH B O   1 
HETATM 2443 O O   . HOH H 4 .   ? 8.318  14.121 68.683 1.00 21.32 ? 182 HOH B O   1 
HETATM 2444 O O   . HOH H 4 .   ? 18.599 41.199 60.514 1.00 23.35 ? 183 HOH B O   1 
HETATM 2445 O O   . HOH H 4 .   ? 12.272 16.850 58.593 1.00 23.18 ? 184 HOH B O   1 
HETATM 2446 O O   . HOH H 4 .   ? 21.686 43.213 66.829 1.00 34.35 ? 185 HOH B O   1 
HETATM 2447 O O   . HOH H 4 .   ? 30.187 35.587 65.722 1.00 24.62 ? 186 HOH B O   1 
HETATM 2448 O O   . HOH H 4 .   ? 4.310  17.145 82.135 1.00 22.42 ? 187 HOH B O   1 
HETATM 2449 O O   . HOH H 4 .   ? 21.861 20.307 54.955 1.00 26.03 ? 188 HOH B O   1 
HETATM 2450 O O   . HOH H 4 .   ? 11.910 28.029 77.724 1.00 23.41 ? 189 HOH B O   1 
HETATM 2451 O O   . HOH H 4 .   ? 7.443  11.752 78.490 1.00 28.68 ? 190 HOH B O   1 
HETATM 2452 O O   . HOH H 4 .   ? 29.950 34.855 62.963 1.00 23.95 ? 191 HOH B O   1 
HETATM 2453 O O   . HOH H 4 .   ? 30.088 26.295 70.164 1.00 29.47 ? 192 HOH B O   1 
HETATM 2454 O O   . HOH H 4 .   ? 12.425 37.604 77.678 1.00 28.42 ? 193 HOH B O   1 
HETATM 2455 O O   . HOH H 4 .   ? 9.353  37.517 76.377 1.00 26.84 ? 194 HOH B O   1 
HETATM 2456 O O   . HOH H 4 .   ? 12.999 22.923 83.910 1.00 27.31 ? 195 HOH B O   1 
HETATM 2457 O O   . HOH H 4 .   ? 12.025 10.292 75.097 1.00 32.68 ? 196 HOH B O   1 
HETATM 2458 O O   . HOH H 4 .   ? 16.624 38.807 74.890 1.00 31.39 ? 197 HOH B O   1 
HETATM 2459 O O   . HOH H 4 .   ? 13.175 39.579 71.826 1.00 26.97 ? 198 HOH B O   1 
HETATM 2460 O O   . HOH H 4 .   ? 0.755  32.478 68.016 1.00 26.08 ? 199 HOH B O   1 
HETATM 2461 O O   . HOH H 4 .   ? 1.325  25.247 79.029 1.00 24.36 ? 200 HOH B O   1 
HETATM 2462 O O   . HOH H 4 .   ? 26.978 32.045 74.024 1.00 36.03 ? 201 HOH B O   1 
HETATM 2463 O O   . HOH H 4 .   ? 6.616  32.162 73.100 1.00 25.01 ? 202 HOH B O   1 
HETATM 2464 O O   . HOH H 4 .   ? -0.218 26.669 58.679 1.00 25.23 ? 203 HOH B O   1 
HETATM 2465 O O   . HOH H 4 .   ? 27.861 42.910 65.111 1.00 26.86 ? 204 HOH B O   1 
HETATM 2466 O O   . HOH H 4 .   ? 1.330  11.218 78.822 1.00 33.05 ? 205 HOH B O   1 
HETATM 2467 O O   . HOH H 4 .   ? 0.424  36.148 69.737 1.00 34.39 ? 206 HOH B O   1 
HETATM 2468 O O   . HOH H 4 .   ? 22.210 13.189 61.825 1.00 34.55 ? 207 HOH B O   1 
HETATM 2469 O O   . HOH H 4 .   ? 10.611 32.086 53.939 1.00 37.04 ? 208 HOH B O   1 
HETATM 2470 O O   . HOH H 4 .   ? 29.091 38.487 68.188 1.00 26.67 ? 209 HOH B O   1 
HETATM 2471 O O   . HOH H 4 .   ? 26.471 11.297 68.080 1.00 36.33 ? 210 HOH B O   1 
HETATM 2472 O O   . HOH H 4 .   ? 22.242 41.411 70.401 1.00 29.39 ? 211 HOH B O   1 
HETATM 2473 O O   . HOH H 4 .   ? 27.922 21.075 65.500 1.00 31.70 ? 212 HOH B O   1 
HETATM 2474 O O   . HOH H 4 .   ? 3.854  35.149 61.252 1.00 39.45 ? 213 HOH B O   1 
HETATM 2475 O O   . HOH H 4 .   ? 6.020  29.140 59.470 1.00 29.54 ? 214 HOH B O   1 
HETATM 2476 O O   . HOH H 4 .   ? 22.544 15.863 61.303 1.00 28.97 ? 215 HOH B O   1 
HETATM 2477 O O   . HOH H 4 .   ? 3.121  34.837 64.304 1.00 33.38 ? 216 HOH B O   1 
HETATM 2478 O O   . HOH H 4 .   ? 8.940  24.236 80.592 1.00 29.29 ? 217 HOH B O   1 
HETATM 2479 O O   . HOH H 4 .   ? 8.758  30.418 55.490 1.00 34.01 ? 218 HOH B O   1 
HETATM 2480 O O   . HOH H 4 .   ? 19.105 10.986 61.829 1.00 33.07 ? 219 HOH B O   1 
HETATM 2481 O O   . HOH H 4 .   ? 19.732 11.727 65.883 1.00 30.88 ? 220 HOH B O   1 
HETATM 2482 O O   . HOH H 4 .   ? 14.635 13.173 58.759 1.00 34.17 ? 221 HOH B O   1 
HETATM 2483 O O   . HOH H 4 .   ? 25.249 28.443 88.193 1.00 40.22 ? 222 HOH B O   1 
HETATM 2484 O O   . HOH H 4 .   ? 19.176 42.185 70.469 1.00 44.35 ? 223 HOH B O   1 
HETATM 2485 O O   . HOH H 4 .   ? 16.449 41.833 62.083 1.00 29.44 ? 224 HOH B O   1 
HETATM 2486 O O   . HOH H 4 .   ? 7.804  35.057 80.519 1.00 32.42 ? 225 HOH B O   1 
HETATM 2487 O O   . HOH H 4 .   ? 34.050 24.943 78.604 1.00 34.54 ? 226 HOH B O   1 
HETATM 2488 O O   . HOH H 4 .   ? 37.324 30.987 65.538 1.00 43.36 ? 227 HOH B O   1 
HETATM 2489 O O   . HOH H 4 .   ? 32.191 27.085 72.286 1.00 40.14 ? 228 HOH B O   1 
HETATM 2490 O O   . HOH H 4 .   ? 12.042 31.674 84.333 1.00 40.41 ? 229 HOH B O   1 
HETATM 2491 O O   . HOH H 4 .   ? 11.175 17.995 55.185 1.00 37.18 ? 230 HOH B O   1 
HETATM 2492 O O   . HOH H 4 .   ? 6.010  36.631 64.260 1.00 31.04 ? 231 HOH B O   1 
HETATM 2493 O O   . HOH H 4 .   ? 16.670 9.123  63.846 1.00 38.19 ? 232 HOH B O   1 
HETATM 2494 O O   . HOH H 4 .   ? 2.560  19.187 59.092 1.00 33.73 ? 233 HOH B O   1 
HETATM 2495 O O   . HOH H 4 .   ? 8.206  28.349 77.794 1.00 28.71 ? 234 HOH B O   1 
HETATM 2496 O O   . HOH H 4 .   ? 8.609  23.553 51.624 1.00 39.21 ? 235 HOH B O   1 
HETATM 2497 O O   . HOH H 4 .   ? 13.654 35.032 52.492 1.00 45.55 ? 236 HOH B O   1 
HETATM 2498 O O   . HOH H 4 .   ? 28.640 29.838 62.679 1.00 29.80 ? 237 HOH B O   1 
HETATM 2499 O O   . HOH H 4 .   ? 31.316 18.008 76.528 1.00 35.37 ? 238 HOH B O   1 
HETATM 2500 O O   . HOH H 4 .   ? 5.680  28.698 78.146 1.00 42.60 ? 239 HOH B O   1 
HETATM 2501 O O   . HOH H 4 .   ? 12.072 38.147 62.887 1.00 32.70 ? 240 HOH B O   1 
HETATM 2502 O O   . HOH H 4 .   ? 30.118 20.255 84.488 1.00 40.77 ? 241 HOH B O   1 
HETATM 2503 O O   . HOH H 4 .   ? 11.519 9.869  71.526 1.00 37.04 ? 242 HOH B O   1 
HETATM 2504 O O   . HOH H 4 .   ? 16.679 40.549 73.038 1.00 41.99 ? 243 HOH B O   1 
HETATM 2505 O O   . HOH H 4 .   ? 8.028  28.868 52.936 1.00 42.16 ? 244 HOH B O   1 
HETATM 2506 O O   . HOH H 4 .   ? 9.470  10.800 77.286 1.00 37.89 ? 245 HOH B O   1 
HETATM 2507 O O   . HOH H 4 .   ? 4.768  20.243 58.022 1.00 45.25 ? 246 HOH B O   1 
HETATM 2508 O O   . HOH H 4 .   ? 25.540 15.700 80.767 1.00 43.07 ? 247 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   HIS 1   -1  ?   ?   ?   A . n 
A 1 2   HIS 2   0   ?   ?   ?   A . n 
A 1 3   HIS 3   1   1   HIS HIS A C n 
A 1 4   HIS 4   1   1   HIS HIS A D n 
A 1 5   HIS 5   1   1   HIS HIS A E n 
A 1 6   HIS 6   1   1   HIS HIS A F n 
A 1 7   PHE 7   1   1   PHE PHE A G n 
A 1 8   ASN 8   2   2   ASN ASN A . n 
A 1 9   LEU 9   3   3   LEU LEU A . n 
A 1 10  PRO 10  4   4   PRO PRO A . n 
A 1 11  PRO 11  5   5   PRO PRO A . n 
A 1 12  GLY 12  6   6   GLY GLY A . n 
A 1 13  ASN 13  7   7   ASN ASN A . n 
A 1 14  TYR 14  8   8   TYR TYR A . n 
A 1 15  LYS 15  9   9   LYS LYS A . n 
A 1 16  LYS 16  10  10  LYS LYS A . n 
A 1 17  PRO 17  11  11  PRO PRO A . n 
A 1 18  LYS 18  12  12  LYS LYS A . n 
A 1 19  LEU 19  13  13  LEU LEU A . n 
A 1 20  LEU 20  14  14  LEU LEU A . n 
A 1 21  TYR 21  15  15  TYR TYR A . n 
A 1 22  CYS 22  16  16  CYS CYS A . n 
A 1 23  SER 23  17  17  SER SER A . n 
A 1 24  ASN 24  18  18  ASN ASN A . n 
A 1 25  GLY 25  19  19  GLY GLY A . n 
A 1 26  GLY 26  20  20  GLY GLY A . n 
A 1 27  HIS 27  21  21  HIS HIS A . n 
A 1 28  PHE 28  22  22  PHE PHE A . n 
A 1 29  LEU 29  23  23  LEU LEU A . n 
A 1 30  ARG 30  24  24  ARG ARG A . n 
A 1 31  ILE 31  25  25  ILE ILE A . n 
A 1 32  ASP 32  26  26  ASP ASP A . n 
A 1 33  PRO 33  27  27  PRO PRO A . n 
A 1 34  ASN 34  28  28  ASN ASN A . n 
A 1 35  GLY 35  29  29  GLY GLY A . n 
A 1 36  THR 36  30  30  THR THR A . n 
A 1 37  VAL 37  31  31  VAL VAL A . n 
A 1 38  ASP 38  32  32  ASP ASP A . n 
A 1 39  GLY 39  33  33  GLY GLY A . n 
A 1 40  THR 40  34  34  THR THR A . n 
A 1 41  ARG 41  35  35  ARG ARG A . n 
A 1 42  ASP 42  36  36  ASP ASP A . n 
A 1 43  ARG 43  37  37  ARG ARG A . n 
A 1 44  SER 44  38  38  SER SER A . n 
A 1 45  ASP 45  39  39  ASP ASP A . n 
A 1 46  GLN 46  40  40  GLN GLN A . n 
A 1 47  HIS 47  41  41  HIS HIS A . n 
A 1 48  ILE 48  42  42  ILE ILE A . n 
A 1 49  GLN 49  43  43  GLN GLN A . n 
A 1 50  LEU 50  44  44  LEU LEU A . n 
A 1 51  GLN 51  45  45  GLN GLN A . n 
A 1 52  LEU 52  46  46  LEU LEU A . n 
A 1 53  SER 53  47  47  SER SER A . n 
A 1 54  ALA 54  48  48  ALA ALA A . n 
A 1 55  GLU 55  49  49  GLU GLU A . n 
A 1 56  SER 56  50  50  SER SER A . n 
A 1 57  VAL 57  51  51  VAL VAL A . n 
A 1 58  GLY 58  52  52  GLY GLY A . n 
A 1 59  GLU 59  53  53  GLU GLU A . n 
A 1 60  VAL 60  54  54  VAL VAL A . n 
A 1 61  TYR 61  55  55  TYR TYR A . n 
A 1 62  ILE 62  56  56  ILE ILE A . n 
A 1 63  LYS 63  57  57  LYS LYS A . n 
A 1 64  SER 64  58  58  SER SER A . n 
A 1 65  THR 65  59  59  THR THR A . n 
A 1 66  GLU 66  60  60  GLU GLU A . n 
A 1 67  THR 67  61  61  THR THR A . n 
A 1 68  GLY 68  62  62  GLY GLY A . n 
A 1 69  GLN 69  63  63  GLN GLN A . n 
A 1 70  TYR 70  64  64  TYR TYR A . n 
A 1 71  LEU 71  65  65  LEU LEU A . n 
A 1 72  ALA 72  66  66  ALA ALA A . n 
A 1 73  MET 73  67  67  MET MET A . n 
A 1 74  ASP 74  68  68  ASP ASP A . n 
A 1 75  THR 75  69  69  THR THR A . n 
A 1 76  ASP 76  70  70  ASP ASP A . n 
A 1 77  GLY 77  71  71  GLY GLY A . n 
A 1 78  LEU 78  72  72  LEU LEU A . n 
A 1 79  LEU 79  73  73  LEU LEU A . n 
A 1 80  TYR 80  74  74  TYR TYR A . n 
A 1 81  GLY 81  75  75  GLY GLY A . n 
A 1 82  SER 82  76  76  SER SER A . n 
A 1 83  GLN 83  77  77  GLN GLN A . n 
A 1 84  THR 84  78  78  THR THR A . n 
A 1 85  PRO 85  79  79  PRO PRO A . n 
A 1 86  ASN 86  80  80  ASN ASN A . n 
A 1 87  GLU 87  81  81  GLU GLU A . n 
A 1 88  GLU 88  82  82  GLU GLU A . n 
A 1 89  CYS 89  83  83  CYS CYS A . n 
A 1 90  LEU 90  84  84  LEU LEU A . n 
A 1 91  PHE 91  85  85  PHE PHE A . n 
A 1 92  LEU 92  86  86  LEU LEU A . n 
A 1 93  GLU 93  87  87  GLU GLU A . n 
A 1 94  ARG 94  88  88  ARG ARG A . n 
A 1 95  LEU 95  89  89  LEU LEU A . n 
A 1 96  GLU 96  90  90  GLU GLU A . n 
A 1 97  GLU 97  91  91  GLU GLU A . n 
A 1 98  ASN 98  92  92  ASN ASN A . n 
A 1 99  HIS 99  93  93  HIS HIS A . n 
A 1 100 TYR 100 94  94  TYR TYR A . n 
A 1 101 ASN 101 95  95  ASN ASN A . n 
A 1 102 THR 102 96  96  THR THR A . n 
A 1 103 TYR 103 97  97  TYR TYR A . n 
A 1 104 ILE 104 98  98  ILE ILE A . n 
A 1 105 SER 105 99  99  SER SER A . n 
A 1 106 LYS 106 100 100 LYS LYS A . n 
A 1 107 LYS 107 101 101 LYS LYS A . n 
A 1 108 HIS 108 102 102 HIS HIS A . n 
A 1 109 ALA 109 103 103 ALA ALA A . n 
A 1 110 GLU 110 104 104 GLU GLU A . n 
A 1 111 LYS 111 105 105 LYS LYS A . n 
A 1 112 ASN 112 106 106 ASN ASN A . n 
A 1 113 TRP 113 107 107 TRP TRP A . n 
A 1 114 PHE 114 108 108 PHE PHE A . n 
A 1 115 VAL 115 109 109 VAL VAL A . n 
A 1 116 GLY 116 110 110 GLY GLY A . n 
A 1 117 LEU 117 111 111 LEU LEU A . n 
A 1 118 LYS 118 112 112 LYS LYS A . n 
A 1 119 LYS 119 113 113 LYS LYS A . n 
A 1 120 ASN 120 114 114 ASN ASN A . n 
A 1 121 GLY 121 115 115 GLY GLY A . n 
A 1 122 SER 122 116 116 SER SER A . n 
A 1 123 CYS 123 117 117 CYS CYS A . n 
A 1 124 LYS 124 118 118 LYS LYS A . n 
A 1 125 ARG 125 119 119 ARG ARG A . n 
A 1 126 GLY 126 120 120 GLY GLY A . n 
A 1 127 PRO 127 121 121 PRO PRO A . n 
A 1 128 ARG 128 122 122 ARG ARG A . n 
A 1 129 THR 129 123 123 THR THR A . n 
A 1 130 HIS 130 124 124 HIS HIS A . n 
A 1 131 TYR 131 125 125 TYR TYR A . n 
A 1 132 GLY 132 126 126 GLY GLY A . n 
A 1 133 GLN 133 127 127 GLN GLN A . n 
A 1 134 LYS 134 128 128 LYS LYS A . n 
A 1 135 ALA 135 129 129 ALA ALA A . n 
A 1 136 ILE 136 130 130 ILE ILE A . n 
A 1 137 LEU 137 131 131 LEU LEU A . n 
A 1 138 PHE 138 132 132 PHE PHE A . n 
A 1 139 LEU 139 133 133 LEU LEU A . n 
A 1 140 PRO 140 134 134 PRO PRO A . n 
A 1 141 LEU 141 135 135 LEU LEU A . n 
A 1 142 PRO 142 136 136 PRO PRO A . n 
A 1 143 VAL 143 137 137 VAL VAL A . n 
A 1 144 SER 144 138 ?   ?   ?   A . n 
A 1 145 SER 145 139 ?   ?   ?   A . n 
A 1 146 ASP 146 140 ?   ?   ?   A . n 
B 1 1   HIS 1   -1  ?   ?   ?   B . n 
B 1 2   HIS 2   0   ?   ?   ?   B . n 
B 1 3   HIS 3   1   1   HIS HIS B C n 
B 1 4   HIS 4   1   1   HIS HIS B D n 
B 1 5   HIS 5   1   1   HIS HIS B E n 
B 1 6   HIS 6   1   1   HIS HIS B F n 
B 1 7   PHE 7   1   1   PHE PHE B G n 
B 1 8   ASN 8   2   2   ASN ASN B . n 
B 1 9   LEU 9   3   3   LEU LEU B . n 
B 1 10  PRO 10  4   4   PRO PRO B . n 
B 1 11  PRO 11  5   5   PRO PRO B . n 
B 1 12  GLY 12  6   6   GLY GLY B . n 
B 1 13  ASN 13  7   7   ASN ASN B . n 
B 1 14  TYR 14  8   8   TYR TYR B . n 
B 1 15  LYS 15  9   9   LYS LYS B . n 
B 1 16  LYS 16  10  10  LYS LYS B . n 
B 1 17  PRO 17  11  11  PRO PRO B . n 
B 1 18  LYS 18  12  12  LYS LYS B . n 
B 1 19  LEU 19  13  13  LEU LEU B . n 
B 1 20  LEU 20  14  14  LEU LEU B . n 
B 1 21  TYR 21  15  15  TYR TYR B . n 
B 1 22  CYS 22  16  16  CYS CYS B . n 
B 1 23  SER 23  17  17  SER SER B . n 
B 1 24  ASN 24  18  18  ASN ASN B . n 
B 1 25  GLY 25  19  19  GLY GLY B . n 
B 1 26  GLY 26  20  20  GLY GLY B . n 
B 1 27  HIS 27  21  21  HIS HIS B . n 
B 1 28  PHE 28  22  22  PHE PHE B . n 
B 1 29  LEU 29  23  23  LEU LEU B . n 
B 1 30  ARG 30  24  24  ARG ARG B . n 
B 1 31  ILE 31  25  25  ILE ILE B . n 
B 1 32  ASP 32  26  26  ASP ASP B . n 
B 1 33  PRO 33  27  27  PRO PRO B . n 
B 1 34  ASN 34  28  28  ASN ASN B . n 
B 1 35  GLY 35  29  29  GLY GLY B . n 
B 1 36  THR 36  30  30  THR THR B . n 
B 1 37  VAL 37  31  31  VAL VAL B . n 
B 1 38  ASP 38  32  32  ASP ASP B . n 
B 1 39  GLY 39  33  33  GLY GLY B . n 
B 1 40  THR 40  34  34  THR THR B . n 
B 1 41  ARG 41  35  35  ARG ARG B . n 
B 1 42  ASP 42  36  36  ASP ASP B . n 
B 1 43  ARG 43  37  37  ARG ARG B . n 
B 1 44  SER 44  38  38  SER SER B . n 
B 1 45  ASP 45  39  39  ASP ASP B . n 
B 1 46  GLN 46  40  40  GLN GLN B . n 
B 1 47  HIS 47  41  41  HIS HIS B . n 
B 1 48  ILE 48  42  42  ILE ILE B . n 
B 1 49  GLN 49  43  43  GLN GLN B . n 
B 1 50  LEU 50  44  44  LEU LEU B . n 
B 1 51  GLN 51  45  45  GLN GLN B . n 
B 1 52  LEU 52  46  46  LEU LEU B . n 
B 1 53  SER 53  47  47  SER SER B . n 
B 1 54  ALA 54  48  48  ALA ALA B . n 
B 1 55  GLU 55  49  49  GLU GLU B . n 
B 1 56  SER 56  50  50  SER SER B . n 
B 1 57  VAL 57  51  51  VAL VAL B . n 
B 1 58  GLY 58  52  52  GLY GLY B . n 
B 1 59  GLU 59  53  53  GLU GLU B . n 
B 1 60  VAL 60  54  54  VAL VAL B . n 
B 1 61  TYR 61  55  55  TYR TYR B . n 
B 1 62  ILE 62  56  56  ILE ILE B . n 
B 1 63  LYS 63  57  57  LYS LYS B . n 
B 1 64  SER 64  58  58  SER SER B . n 
B 1 65  THR 65  59  59  THR THR B . n 
B 1 66  GLU 66  60  60  GLU GLU B . n 
B 1 67  THR 67  61  61  THR THR B . n 
B 1 68  GLY 68  62  62  GLY GLY B . n 
B 1 69  GLN 69  63  63  GLN GLN B . n 
B 1 70  TYR 70  64  64  TYR TYR B . n 
B 1 71  LEU 71  65  65  LEU LEU B . n 
B 1 72  ALA 72  66  66  ALA ALA B . n 
B 1 73  MET 73  67  67  MET MET B . n 
B 1 74  ASP 74  68  68  ASP ASP B . n 
B 1 75  THR 75  69  69  THR THR B . n 
B 1 76  ASP 76  70  70  ASP ASP B . n 
B 1 77  GLY 77  71  71  GLY GLY B . n 
B 1 78  LEU 78  72  72  LEU LEU B . n 
B 1 79  LEU 79  73  73  LEU LEU B . n 
B 1 80  TYR 80  74  74  TYR TYR B . n 
B 1 81  GLY 81  75  75  GLY GLY B . n 
B 1 82  SER 82  76  76  SER SER B . n 
B 1 83  GLN 83  77  77  GLN GLN B . n 
B 1 84  THR 84  78  78  THR THR B . n 
B 1 85  PRO 85  79  79  PRO PRO B . n 
B 1 86  ASN 86  80  80  ASN ASN B . n 
B 1 87  GLU 87  81  81  GLU GLU B . n 
B 1 88  GLU 88  82  82  GLU GLU B . n 
B 1 89  CYS 89  83  83  CYS CYS B . n 
B 1 90  LEU 90  84  84  LEU LEU B . n 
B 1 91  PHE 91  85  85  PHE PHE B . n 
B 1 92  LEU 92  86  86  LEU LEU B . n 
B 1 93  GLU 93  87  87  GLU GLU B . n 
B 1 94  ARG 94  88  88  ARG ARG B . n 
B 1 95  LEU 95  89  89  LEU LEU B . n 
B 1 96  GLU 96  90  90  GLU GLU B . n 
B 1 97  GLU 97  91  91  GLU GLU B . n 
B 1 98  ASN 98  92  92  ASN ASN B . n 
B 1 99  HIS 99  93  93  HIS HIS B . n 
B 1 100 TYR 100 94  94  TYR TYR B . n 
B 1 101 ASN 101 95  95  ASN ASN B . n 
B 1 102 THR 102 96  96  THR THR B . n 
B 1 103 TYR 103 97  97  TYR TYR B . n 
B 1 104 ILE 104 98  98  ILE ILE B . n 
B 1 105 SER 105 99  99  SER SER B . n 
B 1 106 LYS 106 100 100 LYS LYS B . n 
B 1 107 LYS 107 101 101 LYS LYS B . n 
B 1 108 HIS 108 102 102 HIS HIS B . n 
B 1 109 ALA 109 103 103 ALA ALA B . n 
B 1 110 GLU 110 104 104 GLU GLU B . n 
B 1 111 LYS 111 105 105 LYS LYS B . n 
B 1 112 ASN 112 106 106 ASN ASN B . n 
B 1 113 TRP 113 107 107 TRP TRP B . n 
B 1 114 PHE 114 108 108 PHE PHE B . n 
B 1 115 VAL 115 109 109 VAL VAL B . n 
B 1 116 GLY 116 110 110 GLY GLY B . n 
B 1 117 LEU 117 111 111 LEU LEU B . n 
B 1 118 LYS 118 112 112 LYS LYS B . n 
B 1 119 LYS 119 113 113 LYS LYS B . n 
B 1 120 ASN 120 114 114 ASN ASN B . n 
B 1 121 GLY 121 115 115 GLY GLY B . n 
B 1 122 SER 122 116 116 SER SER B . n 
B 1 123 CYS 123 117 117 CYS CYS B . n 
B 1 124 LYS 124 118 118 LYS LYS B . n 
B 1 125 ARG 125 119 119 ARG ARG B . n 
B 1 126 GLY 126 120 120 GLY GLY B . n 
B 1 127 PRO 127 121 121 PRO PRO B . n 
B 1 128 ARG 128 122 122 ARG ARG B . n 
B 1 129 THR 129 123 123 THR THR B . n 
B 1 130 HIS 130 124 124 HIS HIS B . n 
B 1 131 TYR 131 125 125 TYR TYR B . n 
B 1 132 GLY 132 126 126 GLY GLY B . n 
B 1 133 GLN 133 127 127 GLN GLN B . n 
B 1 134 LYS 134 128 128 LYS LYS B . n 
B 1 135 ALA 135 129 129 ALA ALA B . n 
B 1 136 ILE 136 130 130 ILE ILE B . n 
B 1 137 LEU 137 131 131 LEU LEU B . n 
B 1 138 PHE 138 132 132 PHE PHE B . n 
B 1 139 LEU 139 133 133 LEU LEU B . n 
B 1 140 PRO 140 134 134 PRO PRO B . n 
B 1 141 LEU 141 135 135 LEU LEU B . n 
B 1 142 PRO 142 136 136 PRO PRO B . n 
B 1 143 VAL 143 137 137 VAL VAL B . n 
B 1 144 SER 144 138 ?   ?   ?   B . n 
B 1 145 SER 145 139 ?   ?   ?   B . n 
B 1 146 ASP 146 140 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 SO4 1   141 1   SO4 SO4 A . 
D 3 FMT 1   142 2   FMT FMT A . 
E 3 FMT 1   141 3   FMT FMT B . 
F 3 FMT 1   142 4   FMT FMT B . 
G 4 HOH 1   143 1   HOH HOH A . 
G 4 HOH 2   144 2   HOH HOH A . 
G 4 HOH 3   145 5   HOH HOH A . 
G 4 HOH 4   146 6   HOH HOH A . 
G 4 HOH 5   147 7   HOH HOH A . 
G 4 HOH 6   148 10  HOH HOH A . 
G 4 HOH 7   149 12  HOH HOH A . 
G 4 HOH 8   150 13  HOH HOH A . 
G 4 HOH 9   151 17  HOH HOH A . 
G 4 HOH 10  152 18  HOH HOH A . 
G 4 HOH 11  153 19  HOH HOH A . 
G 4 HOH 12  154 22  HOH HOH A . 
G 4 HOH 13  155 23  HOH HOH A . 
G 4 HOH 14  156 24  HOH HOH A . 
G 4 HOH 15  157 25  HOH HOH A . 
G 4 HOH 16  158 27  HOH HOH A . 
G 4 HOH 17  159 28  HOH HOH A . 
G 4 HOH 18  160 29  HOH HOH A . 
G 4 HOH 19  161 30  HOH HOH A . 
G 4 HOH 20  162 34  HOH HOH A . 
G 4 HOH 21  163 35  HOH HOH A . 
G 4 HOH 22  164 36  HOH HOH A . 
G 4 HOH 23  165 37  HOH HOH A . 
G 4 HOH 24  166 38  HOH HOH A . 
G 4 HOH 25  167 39  HOH HOH A . 
G 4 HOH 26  168 40  HOH HOH A . 
G 4 HOH 27  169 42  HOH HOH A . 
G 4 HOH 28  170 45  HOH HOH A . 
G 4 HOH 29  171 47  HOH HOH A . 
G 4 HOH 30  172 48  HOH HOH A . 
G 4 HOH 31  173 50  HOH HOH A . 
G 4 HOH 32  174 54  HOH HOH A . 
G 4 HOH 33  175 56  HOH HOH A . 
G 4 HOH 34  176 58  HOH HOH A . 
G 4 HOH 35  177 59  HOH HOH A . 
G 4 HOH 36  178 60  HOH HOH A . 
G 4 HOH 37  179 62  HOH HOH A . 
G 4 HOH 38  180 63  HOH HOH A . 
G 4 HOH 39  181 65  HOH HOH A . 
G 4 HOH 40  182 67  HOH HOH A . 
G 4 HOH 41  183 72  HOH HOH A . 
G 4 HOH 42  184 73  HOH HOH A . 
G 4 HOH 43  185 76  HOH HOH A . 
G 4 HOH 44  186 78  HOH HOH A . 
G 4 HOH 45  187 79  HOH HOH A . 
G 4 HOH 46  188 81  HOH HOH A . 
G 4 HOH 47  189 82  HOH HOH A . 
G 4 HOH 48  190 84  HOH HOH A . 
G 4 HOH 49  191 85  HOH HOH A . 
G 4 HOH 50  192 89  HOH HOH A . 
G 4 HOH 51  193 90  HOH HOH A . 
G 4 HOH 52  194 91  HOH HOH A . 
G 4 HOH 53  195 92  HOH HOH A . 
G 4 HOH 54  196 95  HOH HOH A . 
G 4 HOH 55  197 99  HOH HOH A . 
G 4 HOH 56  198 100 HOH HOH A . 
G 4 HOH 57  199 103 HOH HOH A . 
G 4 HOH 58  200 107 HOH HOH A . 
G 4 HOH 59  201 108 HOH HOH A . 
G 4 HOH 60  202 109 HOH HOH A . 
G 4 HOH 61  203 111 HOH HOH A . 
G 4 HOH 62  204 113 HOH HOH A . 
G 4 HOH 63  205 114 HOH HOH A . 
G 4 HOH 64  206 115 HOH HOH A . 
G 4 HOH 65  207 116 HOH HOH A . 
G 4 HOH 66  208 117 HOH HOH A . 
G 4 HOH 67  209 118 HOH HOH A . 
G 4 HOH 68  210 119 HOH HOH A . 
G 4 HOH 69  211 120 HOH HOH A . 
G 4 HOH 70  212 121 HOH HOH A . 
G 4 HOH 71  213 122 HOH HOH A . 
G 4 HOH 72  214 124 HOH HOH A . 
G 4 HOH 73  215 128 HOH HOH A . 
G 4 HOH 74  216 130 HOH HOH A . 
G 4 HOH 75  217 131 HOH HOH A . 
G 4 HOH 76  218 136 HOH HOH A . 
G 4 HOH 77  219 137 HOH HOH A . 
G 4 HOH 78  220 139 HOH HOH A . 
G 4 HOH 79  221 141 HOH HOH A . 
G 4 HOH 80  222 142 HOH HOH A . 
G 4 HOH 81  223 145 HOH HOH A . 
G 4 HOH 82  224 147 HOH HOH A . 
G 4 HOH 83  225 150 HOH HOH A . 
G 4 HOH 84  226 152 HOH HOH A . 
G 4 HOH 85  227 158 HOH HOH A . 
G 4 HOH 86  228 159 HOH HOH A . 
G 4 HOH 87  229 160 HOH HOH A . 
G 4 HOH 88  230 163 HOH HOH A . 
G 4 HOH 89  231 164 HOH HOH A . 
G 4 HOH 90  232 167 HOH HOH A . 
G 4 HOH 91  233 168 HOH HOH A . 
G 4 HOH 92  234 171 HOH HOH A . 
G 4 HOH 93  235 172 HOH HOH A . 
G 4 HOH 94  236 173 HOH HOH A . 
G 4 HOH 95  237 174 HOH HOH A . 
G 4 HOH 96  238 175 HOH HOH A . 
G 4 HOH 97  239 176 HOH HOH A . 
G 4 HOH 98  240 178 HOH HOH A . 
G 4 HOH 99  241 179 HOH HOH A . 
G 4 HOH 100 242 182 HOH HOH A . 
G 4 HOH 101 243 183 HOH HOH A . 
G 4 HOH 102 244 184 HOH HOH A . 
G 4 HOH 103 245 185 HOH HOH A . 
G 4 HOH 104 246 186 HOH HOH A . 
G 4 HOH 105 247 187 HOH HOH A . 
G 4 HOH 106 248 189 HOH HOH A . 
G 4 HOH 107 249 190 HOH HOH A . 
G 4 HOH 108 250 191 HOH HOH A . 
G 4 HOH 109 251 198 HOH HOH A . 
G 4 HOH 110 252 202 HOH HOH A . 
G 4 HOH 111 253 203 HOH HOH A . 
G 4 HOH 112 254 205 HOH HOH A . 
G 4 HOH 113 255 212 HOH HOH A . 
G 4 HOH 114 256 213 HOH HOH A . 
G 4 HOH 115 257 216 HOH HOH A . 
G 4 HOH 116 258 217 HOH HOH A . 
G 4 HOH 117 259 218 HOH HOH A . 
H 4 HOH 1   143 3   HOH HOH B . 
H 4 HOH 2   144 4   HOH HOH B . 
H 4 HOH 3   145 8   HOH HOH B . 
H 4 HOH 4   146 9   HOH HOH B . 
H 4 HOH 5   147 11  HOH HOH B . 
H 4 HOH 6   148 14  HOH HOH B . 
H 4 HOH 7   149 15  HOH HOH B . 
H 4 HOH 8   150 16  HOH HOH B . 
H 4 HOH 9   151 20  HOH HOH B . 
H 4 HOH 10  152 21  HOH HOH B . 
H 4 HOH 11  153 26  HOH HOH B . 
H 4 HOH 12  154 31  HOH HOH B . 
H 4 HOH 13  155 32  HOH HOH B . 
H 4 HOH 14  156 33  HOH HOH B . 
H 4 HOH 15  157 41  HOH HOH B . 
H 4 HOH 16  158 43  HOH HOH B . 
H 4 HOH 17  159 44  HOH HOH B . 
H 4 HOH 18  160 46  HOH HOH B . 
H 4 HOH 19  161 49  HOH HOH B . 
H 4 HOH 20  162 51  HOH HOH B . 
H 4 HOH 21  163 52  HOH HOH B . 
H 4 HOH 22  164 53  HOH HOH B . 
H 4 HOH 23  165 55  HOH HOH B . 
H 4 HOH 24  166 57  HOH HOH B . 
H 4 HOH 25  167 61  HOH HOH B . 
H 4 HOH 26  168 64  HOH HOH B . 
H 4 HOH 27  169 66  HOH HOH B . 
H 4 HOH 28  170 68  HOH HOH B . 
H 4 HOH 29  171 69  HOH HOH B . 
H 4 HOH 30  172 70  HOH HOH B . 
H 4 HOH 31  173 71  HOH HOH B . 
H 4 HOH 32  174 74  HOH HOH B . 
H 4 HOH 33  175 75  HOH HOH B . 
H 4 HOH 34  176 77  HOH HOH B . 
H 4 HOH 35  177 80  HOH HOH B . 
H 4 HOH 36  178 83  HOH HOH B . 
H 4 HOH 37  179 86  HOH HOH B . 
H 4 HOH 38  180 87  HOH HOH B . 
H 4 HOH 39  181 88  HOH HOH B . 
H 4 HOH 40  182 93  HOH HOH B . 
H 4 HOH 41  183 94  HOH HOH B . 
H 4 HOH 42  184 96  HOH HOH B . 
H 4 HOH 43  185 97  HOH HOH B . 
H 4 HOH 44  186 98  HOH HOH B . 
H 4 HOH 45  187 101 HOH HOH B . 
H 4 HOH 46  188 102 HOH HOH B . 
H 4 HOH 47  189 104 HOH HOH B . 
H 4 HOH 48  190 105 HOH HOH B . 
H 4 HOH 49  191 106 HOH HOH B . 
H 4 HOH 50  192 110 HOH HOH B . 
H 4 HOH 51  193 112 HOH HOH B . 
H 4 HOH 52  194 123 HOH HOH B . 
H 4 HOH 53  195 125 HOH HOH B . 
H 4 HOH 54  196 126 HOH HOH B . 
H 4 HOH 55  197 127 HOH HOH B . 
H 4 HOH 56  198 129 HOH HOH B . 
H 4 HOH 57  199 132 HOH HOH B . 
H 4 HOH 58  200 133 HOH HOH B . 
H 4 HOH 59  201 134 HOH HOH B . 
H 4 HOH 60  202 135 HOH HOH B . 
H 4 HOH 61  203 138 HOH HOH B . 
H 4 HOH 62  204 140 HOH HOH B . 
H 4 HOH 63  205 143 HOH HOH B . 
H 4 HOH 64  206 144 HOH HOH B . 
H 4 HOH 65  207 146 HOH HOH B . 
H 4 HOH 66  208 148 HOH HOH B . 
H 4 HOH 67  209 149 HOH HOH B . 
H 4 HOH 68  210 151 HOH HOH B . 
H 4 HOH 69  211 153 HOH HOH B . 
H 4 HOH 70  212 154 HOH HOH B . 
H 4 HOH 71  213 155 HOH HOH B . 
H 4 HOH 72  214 156 HOH HOH B . 
H 4 HOH 73  215 157 HOH HOH B . 
H 4 HOH 74  216 161 HOH HOH B . 
H 4 HOH 75  217 162 HOH HOH B . 
H 4 HOH 76  218 165 HOH HOH B . 
H 4 HOH 77  219 166 HOH HOH B . 
H 4 HOH 78  220 169 HOH HOH B . 
H 4 HOH 79  221 170 HOH HOH B . 
H 4 HOH 80  222 177 HOH HOH B . 
H 4 HOH 81  223 180 HOH HOH B . 
H 4 HOH 82  224 181 HOH HOH B . 
H 4 HOH 83  225 188 HOH HOH B . 
H 4 HOH 84  226 192 HOH HOH B . 
H 4 HOH 85  227 193 HOH HOH B . 
H 4 HOH 86  228 194 HOH HOH B . 
H 4 HOH 87  229 195 HOH HOH B . 
H 4 HOH 88  230 196 HOH HOH B . 
H 4 HOH 89  231 197 HOH HOH B . 
H 4 HOH 90  232 199 HOH HOH B . 
H 4 HOH 91  233 200 HOH HOH B . 
H 4 HOH 92  234 201 HOH HOH B . 
H 4 HOH 93  235 204 HOH HOH B . 
H 4 HOH 94  236 206 HOH HOH B . 
H 4 HOH 95  237 207 HOH HOH B . 
H 4 HOH 96  238 208 HOH HOH B . 
H 4 HOH 97  239 209 HOH HOH B . 
H 4 HOH 98  240 210 HOH HOH B . 
H 4 HOH 99  241 211 HOH HOH B . 
H 4 HOH 100 242 214 HOH HOH B . 
H 4 HOH 101 243 215 HOH HOH B . 
H 4 HOH 102 244 219 HOH HOH B . 
H 4 HOH 103 245 220 HOH HOH B . 
H 4 HOH 104 246 221 HOH HOH B . 
H 4 HOH 105 247 222 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,G 
2 1 B,E,F,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-04-15 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement        1.1 ? 1 
HKL-2000  'data collection' .   ? 2 
HKL-2000  'data reduction'  .   ? 3 
SCALEPACK 'data scaling'    .   ? 4 
CNS       phasing           .   ? 5 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_1              32 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_2              32 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             OD1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_3              32 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                123.77 
_pdbx_validate_rmsd_angle.angle_target_value         118.30 
_pdbx_validate_rmsd_angle.angle_deviation            5.47 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.90 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PRO A 5  ? ? -82.41  -155.27 
2 1 ASP A 32 ? ? -163.69 -166.65 
3 1 HIS A 93 ? ? -162.10 -48.87  
4 1 HIS B 1  F ? -65.44  -179.75 
5 1 ASP B 32 ? ? -165.30 -164.05 
6 1 GLU B 49 ? ? -114.85 -106.41 
7 1 ASN B 80 ? ? -127.00 -166.73 
8 1 HIS B 93 ? ? -161.92 -48.56  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A HIS -1  ? A HIS 1   
2  1 Y 1 A HIS 0   ? A HIS 2   
3  1 Y 1 A SER 138 ? A SER 144 
4  1 Y 1 A SER 139 ? A SER 145 
5  1 Y 1 A ASP 140 ? A ASP 146 
6  1 Y 1 B HIS -1  ? B HIS 1   
7  1 Y 1 B HIS 0   ? B HIS 2   
8  1 Y 1 B SER 138 ? B SER 144 
9  1 Y 1 B SER 139 ? B SER 145 
10 1 Y 1 B ASP 140 ? B ASP 146 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 'FORMIC ACID' FMT 
4 water         HOH 
#