data_3BDP
# 
_entry.id   3BDP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3BDP         
RCSB  PDE0132      
WWPDB D_1000178887 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3BDP 
_pdbx_database_status.recvd_initial_deposition_date   1997-11-17 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    NDB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kiefer, J.R.' 1 
'Mao, C.'      2 
'Beese, L.S.'  3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Visualizing DNA replication in a catalytically active Bacillus DNA polymerase crystal.'           Nature    391 304 307 
1998 NATUAS UK 0028-0836 0006 ? 9440698 10.1038/34693 
1       'Crystal Structure of a Thermostable Bacillus DNA Polymerase I Large Fragment at 2.1 A Resolution' Structure 5   95  ?   
1997 STRUE6 UK 0969-2126 2005 ? ?       ?             
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kiefer, J.R.'   1  
primary 'Mao, C.'        2  
primary 'Braman, J.C.'   3  
primary 'Beese, L.S.'    4  
1       'Kiefer, J.R.'   5  
1       'Mao, C.'        6  
1       'Hansen, C.J.'   7  
1       'Basehore, S.L.' 8  
1       'Hogrefe, H.H.'  9  
1       'Braman, J.C.'   10 
1       'Beese, L.S.'    11 
# 
_cell.entry_id           3BDP 
_cell.length_a           87.063 
_cell.length_b           93.547 
_cell.length_c           106.252 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         3BDP 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     orthorhombic 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*GP*CP*AP*TP*GP*AP*TP*GP*CP*2DT)-3')
;
3044.017  1   ?       ? ?                  ? 
2 polymer     syn 
;DNA (5'-D(*AP*GP*CP*AP*TP*CP*AP*TP*GP*C)-3')
;
3029.006  1   ?       ? ?                  ? 
3 polymer     man 'PROTEIN (DNA POLYMERASE I)'                     66200.859 1   2.7.7.7 ? 'RESIDUES 297-876' ? 
4 non-polymer syn 'SULFATE ION'                                    96.063    4   ?       ? ?                  ? 
5 water       nat water                                            18.015    434 ?       ? ?                  ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        BF 
# 
_entity_name_sys.entity_id   3 
_entity_name_sys.name        E.C.2.7.7.7 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes '(DG)(DC)(DA)(DT)(DG)(DA)(DT)(DG)(DC)(2DT)' GCATGATGCT P ? 
2 polydeoxyribonucleotide no no  '(DA)(DG)(DC)(DA)(DT)(DC)(DA)(DT)(DG)(DC)' AGCATCATGC T ? 
3 'polypeptide(L)'        no no  
;AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRA
AVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVRAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWE
LERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGV
ILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRL
SSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDE
VTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDI
TSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV
TLRVPLKVDYHYGSTWYDAK
;
;AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRA
AVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVRAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWE
LERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGV
ILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRL
SSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDE
VTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDI
TSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV
TLRVPLKVDYHYGSTWYDAK
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DC  n 
1 3   DA  n 
1 4   DT  n 
1 5   DG  n 
1 6   DA  n 
1 7   DT  n 
1 8   DG  n 
1 9   DC  n 
1 10  2DT n 
2 1   DA  n 
2 2   DG  n 
2 3   DC  n 
2 4   DA  n 
2 5   DT  n 
2 6   DC  n 
2 7   DA  n 
2 8   DT  n 
2 9   DG  n 
2 10  DC  n 
3 1   ALA n 
3 2   ALA n 
3 3   MET n 
3 4   ALA n 
3 5   PHE n 
3 6   THR n 
3 7   LEU n 
3 8   ALA n 
3 9   ASP n 
3 10  ARG n 
3 11  VAL n 
3 12  THR n 
3 13  GLU n 
3 14  GLU n 
3 15  MET n 
3 16  LEU n 
3 17  ALA n 
3 18  ASP n 
3 19  LYS n 
3 20  ALA n 
3 21  ALA n 
3 22  LEU n 
3 23  VAL n 
3 24  VAL n 
3 25  GLU n 
3 26  VAL n 
3 27  VAL n 
3 28  GLU n 
3 29  GLU n 
3 30  ASN n 
3 31  TYR n 
3 32  HIS n 
3 33  ASP n 
3 34  ALA n 
3 35  PRO n 
3 36  ILE n 
3 37  VAL n 
3 38  GLY n 
3 39  ILE n 
3 40  ALA n 
3 41  VAL n 
3 42  VAL n 
3 43  ASN n 
3 44  GLU n 
3 45  HIS n 
3 46  GLY n 
3 47  ARG n 
3 48  PHE n 
3 49  PHE n 
3 50  LEU n 
3 51  ARG n 
3 52  PRO n 
3 53  GLU n 
3 54  THR n 
3 55  ALA n 
3 56  LEU n 
3 57  ALA n 
3 58  ASP n 
3 59  PRO n 
3 60  GLN n 
3 61  PHE n 
3 62  VAL n 
3 63  ALA n 
3 64  TRP n 
3 65  LEU n 
3 66  GLY n 
3 67  ASP n 
3 68  GLU n 
3 69  THR n 
3 70  LYS n 
3 71  LYS n 
3 72  LYS n 
3 73  SER n 
3 74  MET n 
3 75  PHE n 
3 76  ASP n 
3 77  SER n 
3 78  LYS n 
3 79  ARG n 
3 80  ALA n 
3 81  ALA n 
3 82  VAL n 
3 83  ALA n 
3 84  LEU n 
3 85  LYS n 
3 86  TRP n 
3 87  LYS n 
3 88  GLY n 
3 89  ILE n 
3 90  GLU n 
3 91  LEU n 
3 92  CYS n 
3 93  GLY n 
3 94  VAL n 
3 95  SER n 
3 96  PHE n 
3 97  ASP n 
3 98  LEU n 
3 99  LEU n 
3 100 LEU n 
3 101 ALA n 
3 102 ALA n 
3 103 TYR n 
3 104 LEU n 
3 105 LEU n 
3 106 ASP n 
3 107 PRO n 
3 108 ALA n 
3 109 GLN n 
3 110 GLY n 
3 111 VAL n 
3 112 ASP n 
3 113 ASP n 
3 114 VAL n 
3 115 ARG n 
3 116 ALA n 
3 117 ALA n 
3 118 ALA n 
3 119 LYS n 
3 120 MET n 
3 121 LYS n 
3 122 GLN n 
3 123 TYR n 
3 124 GLU n 
3 125 ALA n 
3 126 VAL n 
3 127 ARG n 
3 128 PRO n 
3 129 ASP n 
3 130 GLU n 
3 131 ALA n 
3 132 VAL n 
3 133 TYR n 
3 134 GLY n 
3 135 LYS n 
3 136 GLY n 
3 137 ALA n 
3 138 LYS n 
3 139 ARG n 
3 140 ALA n 
3 141 VAL n 
3 142 PRO n 
3 143 ASP n 
3 144 GLU n 
3 145 PRO n 
3 146 VAL n 
3 147 LEU n 
3 148 ALA n 
3 149 GLU n 
3 150 HIS n 
3 151 LEU n 
3 152 VAL n 
3 153 ARG n 
3 154 LYS n 
3 155 ALA n 
3 156 ALA n 
3 157 ALA n 
3 158 ILE n 
3 159 TRP n 
3 160 GLU n 
3 161 LEU n 
3 162 GLU n 
3 163 ARG n 
3 164 PRO n 
3 165 PHE n 
3 166 LEU n 
3 167 ASP n 
3 168 GLU n 
3 169 LEU n 
3 170 ARG n 
3 171 ARG n 
3 172 ASN n 
3 173 GLU n 
3 174 GLN n 
3 175 ASP n 
3 176 ARG n 
3 177 LEU n 
3 178 LEU n 
3 179 VAL n 
3 180 GLU n 
3 181 LEU n 
3 182 GLU n 
3 183 GLN n 
3 184 PRO n 
3 185 LEU n 
3 186 SER n 
3 187 SER n 
3 188 ILE n 
3 189 LEU n 
3 190 ALA n 
3 191 GLU n 
3 192 MET n 
3 193 GLU n 
3 194 PHE n 
3 195 ALA n 
3 196 GLY n 
3 197 VAL n 
3 198 LYS n 
3 199 VAL n 
3 200 ASP n 
3 201 THR n 
3 202 LYS n 
3 203 ARG n 
3 204 LEU n 
3 205 GLU n 
3 206 GLN n 
3 207 MET n 
3 208 GLY n 
3 209 LYS n 
3 210 GLU n 
3 211 LEU n 
3 212 ALA n 
3 213 GLU n 
3 214 GLN n 
3 215 LEU n 
3 216 GLY n 
3 217 THR n 
3 218 VAL n 
3 219 GLU n 
3 220 GLN n 
3 221 ARG n 
3 222 ILE n 
3 223 TYR n 
3 224 GLU n 
3 225 LEU n 
3 226 ALA n 
3 227 GLY n 
3 228 GLN n 
3 229 GLU n 
3 230 PHE n 
3 231 ASN n 
3 232 ILE n 
3 233 ASN n 
3 234 SER n 
3 235 PRO n 
3 236 LYS n 
3 237 GLN n 
3 238 LEU n 
3 239 GLY n 
3 240 VAL n 
3 241 ILE n 
3 242 LEU n 
3 243 PHE n 
3 244 GLU n 
3 245 LYS n 
3 246 LEU n 
3 247 GLN n 
3 248 LEU n 
3 249 PRO n 
3 250 VAL n 
3 251 LEU n 
3 252 LYS n 
3 253 LYS n 
3 254 THR n 
3 255 LYS n 
3 256 THR n 
3 257 GLY n 
3 258 TYR n 
3 259 SER n 
3 260 THR n 
3 261 SER n 
3 262 ALA n 
3 263 ASP n 
3 264 VAL n 
3 265 LEU n 
3 266 GLU n 
3 267 LYS n 
3 268 LEU n 
3 269 ALA n 
3 270 PRO n 
3 271 TYR n 
3 272 HIS n 
3 273 GLU n 
3 274 ILE n 
3 275 VAL n 
3 276 GLU n 
3 277 ASN n 
3 278 ILE n 
3 279 LEU n 
3 280 HIS n 
3 281 TYR n 
3 282 ARG n 
3 283 GLN n 
3 284 LEU n 
3 285 GLY n 
3 286 LYS n 
3 287 LEU n 
3 288 GLN n 
3 289 SER n 
3 290 THR n 
3 291 TYR n 
3 292 ILE n 
3 293 GLU n 
3 294 GLY n 
3 295 LEU n 
3 296 LEU n 
3 297 LYS n 
3 298 VAL n 
3 299 VAL n 
3 300 ARG n 
3 301 PRO n 
3 302 ASP n 
3 303 THR n 
3 304 LYS n 
3 305 LYS n 
3 306 VAL n 
3 307 HIS n 
3 308 THR n 
3 309 ILE n 
3 310 PHE n 
3 311 ASN n 
3 312 GLN n 
3 313 ALA n 
3 314 LEU n 
3 315 THR n 
3 316 GLN n 
3 317 THR n 
3 318 GLY n 
3 319 ARG n 
3 320 LEU n 
3 321 SER n 
3 322 SER n 
3 323 THR n 
3 324 GLU n 
3 325 PRO n 
3 326 ASN n 
3 327 LEU n 
3 328 GLN n 
3 329 ASN n 
3 330 ILE n 
3 331 PRO n 
3 332 ILE n 
3 333 ARG n 
3 334 LEU n 
3 335 GLU n 
3 336 GLU n 
3 337 GLY n 
3 338 ARG n 
3 339 LYS n 
3 340 ILE n 
3 341 ARG n 
3 342 GLN n 
3 343 ALA n 
3 344 PHE n 
3 345 VAL n 
3 346 PRO n 
3 347 SER n 
3 348 GLU n 
3 349 SER n 
3 350 ASP n 
3 351 TRP n 
3 352 LEU n 
3 353 ILE n 
3 354 PHE n 
3 355 ALA n 
3 356 ALA n 
3 357 ASP n 
3 358 TYR n 
3 359 SER n 
3 360 GLN n 
3 361 ILE n 
3 362 GLU n 
3 363 LEU n 
3 364 ARG n 
3 365 VAL n 
3 366 LEU n 
3 367 ALA n 
3 368 HIS n 
3 369 ILE n 
3 370 ALA n 
3 371 GLU n 
3 372 ASP n 
3 373 ASP n 
3 374 ASN n 
3 375 LEU n 
3 376 MET n 
3 377 GLU n 
3 378 ALA n 
3 379 PHE n 
3 380 ARG n 
3 381 ARG n 
3 382 ASP n 
3 383 LEU n 
3 384 ASP n 
3 385 ILE n 
3 386 HIS n 
3 387 THR n 
3 388 LYS n 
3 389 THR n 
3 390 ALA n 
3 391 MET n 
3 392 ASP n 
3 393 ILE n 
3 394 PHE n 
3 395 GLN n 
3 396 VAL n 
3 397 SER n 
3 398 GLU n 
3 399 ASP n 
3 400 GLU n 
3 401 VAL n 
3 402 THR n 
3 403 PRO n 
3 404 ASN n 
3 405 MET n 
3 406 ARG n 
3 407 ARG n 
3 408 GLN n 
3 409 ALA n 
3 410 LYS n 
3 411 ALA n 
3 412 VAL n 
3 413 ASN n 
3 414 PHE n 
3 415 GLY n 
3 416 ILE n 
3 417 VAL n 
3 418 TYR n 
3 419 GLY n 
3 420 ILE n 
3 421 SER n 
3 422 ASP n 
3 423 TYR n 
3 424 GLY n 
3 425 LEU n 
3 426 ALA n 
3 427 GLN n 
3 428 ASN n 
3 429 LEU n 
3 430 ASN n 
3 431 ILE n 
3 432 SER n 
3 433 ARG n 
3 434 LYS n 
3 435 GLU n 
3 436 ALA n 
3 437 ALA n 
3 438 GLU n 
3 439 PHE n 
3 440 ILE n 
3 441 GLU n 
3 442 ARG n 
3 443 TYR n 
3 444 PHE n 
3 445 GLU n 
3 446 SER n 
3 447 PHE n 
3 448 PRO n 
3 449 GLY n 
3 450 VAL n 
3 451 LYS n 
3 452 ARG n 
3 453 TYR n 
3 454 MET n 
3 455 GLU n 
3 456 ASN n 
3 457 ILE n 
3 458 VAL n 
3 459 GLN n 
3 460 GLU n 
3 461 ALA n 
3 462 LYS n 
3 463 GLN n 
3 464 LYS n 
3 465 GLY n 
3 466 TYR n 
3 467 VAL n 
3 468 THR n 
3 469 THR n 
3 470 LEU n 
3 471 LEU n 
3 472 HIS n 
3 473 ARG n 
3 474 ARG n 
3 475 ARG n 
3 476 TYR n 
3 477 LEU n 
3 478 PRO n 
3 479 ASP n 
3 480 ILE n 
3 481 THR n 
3 482 SER n 
3 483 ARG n 
3 484 ASN n 
3 485 PHE n 
3 486 ASN n 
3 487 VAL n 
3 488 ARG n 
3 489 SER n 
3 490 PHE n 
3 491 ALA n 
3 492 GLU n 
3 493 ARG n 
3 494 MET n 
3 495 ALA n 
3 496 MET n 
3 497 ASN n 
3 498 THR n 
3 499 PRO n 
3 500 ILE n 
3 501 GLN n 
3 502 GLY n 
3 503 SER n 
3 504 ALA n 
3 505 ALA n 
3 506 ASP n 
3 507 ILE n 
3 508 ILE n 
3 509 LYS n 
3 510 LYS n 
3 511 ALA n 
3 512 MET n 
3 513 ILE n 
3 514 ASP n 
3 515 LEU n 
3 516 ASN n 
3 517 ALA n 
3 518 ARG n 
3 519 LEU n 
3 520 LYS n 
3 521 GLU n 
3 522 GLU n 
3 523 ARG n 
3 524 LEU n 
3 525 GLN n 
3 526 ALA n 
3 527 HIS n 
3 528 LEU n 
3 529 LEU n 
3 530 LEU n 
3 531 GLN n 
3 532 VAL n 
3 533 HIS n 
3 534 ASP n 
3 535 GLU n 
3 536 LEU n 
3 537 ILE n 
3 538 LEU n 
3 539 GLU n 
3 540 ALA n 
3 541 PRO n 
3 542 LYS n 
3 543 GLU n 
3 544 GLU n 
3 545 MET n 
3 546 GLU n 
3 547 ARG n 
3 548 LEU n 
3 549 CYS n 
3 550 ARG n 
3 551 LEU n 
3 552 VAL n 
3 553 PRO n 
3 554 GLU n 
3 555 VAL n 
3 556 MET n 
3 557 GLU n 
3 558 GLN n 
3 559 ALA n 
3 560 VAL n 
3 561 THR n 
3 562 LEU n 
3 563 ARG n 
3 564 VAL n 
3 565 PRO n 
3 566 LEU n 
3 567 LYS n 
3 568 VAL n 
3 569 ASP n 
3 570 TYR n 
3 571 HIS n 
3 572 TYR n 
3 573 GLY n 
3 574 SER n 
3 575 THR n 
3 576 TRP n 
3 577 TYR n 
3 578 ASP n 
3 579 ALA n 
3 580 LYS n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Geobacillus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Geobacillus stearothermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1422 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP DPO1_BACST 3 P52026 ? ? ? 
2 PDB 3BDP       1 3BDP   ? ? ? 
3 PDB 3BDP       2 3BDP   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3BDP A 1 ? 580 ? P52026 297 ? 877 ? 297 876 
2 2 3BDP P 1 ? 10  ? 3BDP   7   ? 16  ? 7   16  
3 3 3BDP T 1 ? 10  ? 3BDP   18  ? 27  ? 18  27  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3BDP ALA A 2   ? UNP P52026 LYS 298 CONFLICT 298 1 
1 3BDP ARG A 115 ? UNP P52026 ALA 411 CONFLICT 411 2 
1 3BDP GLU A 160 ? UNP P52026 ALA 456 CONFLICT 456 3 
1 3BDP LYS A 209 ? UNP P52026 GLU 505 CONFLICT 505 4 
1 3BDP GLY A 216 ? UNP P52026 ARG 512 CONFLICT 512 5 
1 3BDP THR A 254 ? UNP P52026 SER 550 CONFLICT 550 6 
1 3BDP ?   A ?   ? UNP P52026 GLN 576 DELETION ?   7 
1 3BDP HIS A 527 ? UNP P52026 ARG 824 CONFLICT 823 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2DT 'DNA linking'       n "3'-DEOXYTHYMIDINE-5'-MONOPHOSPHATE" "2',3'-DIDEOXYTHYMIDINE-5'-MONOPHOSPHATE" 'C10 H15 N2 O7 P' 306.209 
ALA 'L-peptide linking' y ALANINE                              ?                                         'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ?                                         'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                                         'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                                         'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ?                                         'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                                         'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                                         'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                                         'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                                         'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ?                                         'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                                         'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ?                                         'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ?                                         'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ?                                         'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                                         'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                                         'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ?                                         'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ?                                         'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ?                                         'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ?                                         'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ?                                         'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                        ?                                         'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                            ?                                         'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                                         'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                                         'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ?                                         'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3BDP 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.98 
_exptl_crystal.density_percent_sol   58.76 
_exptl_crystal.description           'LTI/SIGMA(I)> FOR THE DATA SET : 26.4 LTI/SIGMA(I)> FOR SHELL : 6.1' 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pdbx_details    'pH 5.8' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           90 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   1997-08-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      ? 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3BDP 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            1.9 
_reflns.number_obs                   63997 
_reflns.number_all                   63997 
_reflns.percent_possible_obs         92.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.0610000 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        21.1 
_reflns.pdbx_redundancy              5.1 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.93 
_reflns_shell.percent_possible_all   75.4 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.1870000 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3BDP 
_refine.ls_number_reflns_obs                     63955 
_refine.ls_number_reflns_all                     63955 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    88.1 
_refine.ls_R_factor_obs                          0.2500000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2500000 
_refine.ls_R_factor_R_free                       0.2940000 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  3232 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               20.5 
_refine.aniso_B[1][1]                            5.64 
_refine.aniso_B[2][2]                            -2.45 
_refine.aniso_B[3][3]                            -3.19 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      2BDP 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3BDP 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_sigma_a_obs             0.05 
_refine_analyze.Luzzati_d_res_low_obs           20.0 
_refine_analyze.Luzzati_coordinate_error_free   0.29 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4656 
_refine_hist.pdbx_number_atoms_nucleic_acid   403 
_refine_hist.pdbx_number_atoms_ligand         20 
_refine_hist.number_atoms_solvent             434 
_refine_hist.number_atoms_total               5513 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.012 ?    ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.5   ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      25.4  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.01  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             0.88  1.50 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            1.47  2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             1.57  2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            2.50  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       1.90 
_refine_ls_shell.d_res_low                        2.02 
_refine_ls_shell.number_reflns_R_work             8257 
_refine_ls_shell.R_factor_R_work                  0.3890000 
_refine_ls_shell.percent_reflns_obs               72.7 
_refine_ls_shell.R_factor_R_free                  0.3980000 
_refine_ls_shell.R_factor_R_free_error            0.019 
_refine_ls_shell.percent_reflns_R_free            5.2 
_refine_ls_shell.number_reflns_R_free             450 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM        TOPHCSDX.PRO           'X-RAY DIFFRACTION' 
2 PARAM19.SOL              TOPH19.SOL             'X-RAY DIFFRACTION' 
3 DNA-RNA-MULTI-ENDO.PARAM DNA-RNA-MULTI-ENDO.TOP 'X-RAY DIFFRACTION' 
4 PARAM_SULFATE.TXT        TOP_SULFATE.TXT        'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3BDP 
_struct.title                     'DNA POLYMERASE I/DNA COMPLEX' 
_struct.pdbx_descriptor           'DNA POLYMERASE I/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3BDP 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            
;BACILLUS STEAROTHERMOPHILUS DNA POLYMERASE, BF THERMOPHILUS POLYMERASE, COMPLEX (NUCLEOTIDYLTRANSFERASE-DNA), TRANSFERASE-DNA complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU C 13  ? LEU C 16  ? GLU A 309 LEU A 312 5 ? 4  
HELX_P HELX_P2  2  PRO C 52  ? ALA C 57  ? PRO A 348 ALA A 353 1 ? 6  
HELX_P HELX_P3  3  PRO C 59  ? GLY C 66  ? PRO A 355 GLY A 362 1 ? 8  
HELX_P HELX_P4  4  SER C 77  ? LYS C 87  ? SER A 373 LYS A 383 1 ? 11 
HELX_P HELX_P5  5  LEU C 98  ? LEU C 105 ? LEU A 394 LEU A 401 1 ? 8  
HELX_P HELX_P6  6  PRO C 107 ? GLN C 109 ? PRO A 403 GLN A 405 5 ? 3  
HELX_P HELX_P7  7  VAL C 114 ? LYS C 121 ? VAL A 410 LYS A 417 1 ? 8  
HELX_P HELX_P8  8  ASP C 129 ? TYR C 133 ? ASP A 425 TYR A 429 1 ? 5  
HELX_P HELX_P9  9  GLY C 136 ? LYS C 138 ? GLY A 432 LYS A 434 5 ? 3  
HELX_P HELX_P10 10 GLU C 144 ? ARG C 171 ? GLU A 440 ARG A 467 1 ? 28 
HELX_P HELX_P11 11 ASP C 175 ? VAL C 179 ? ASP A 471 VAL A 475 1 ? 5  
HELX_P HELX_P12 12 GLU C 182 ? ALA C 195 ? GLU A 478 ALA A 491 1 ? 14 
HELX_P HELX_P13 13 THR C 201 ? ALA C 226 ? THR A 497 ALA A 522 1 ? 26 
HELX_P HELX_P14 14 PRO C 235 ? PHE C 243 ? PRO A 531 PHE A 539 1 ? 9  
HELX_P HELX_P15 15 ALA C 262 ? TYR C 271 ? ALA A 558 TYR A 567 1 ? 10 
HELX_P HELX_P16 16 GLU C 273 ? TYR C 291 ? GLU A 569 TYR A 587 1 ? 19 
HELX_P HELX_P17 17 GLU C 293 ? VAL C 298 ? GLU A 589 VAL A 594 1 ? 6  
HELX_P HELX_P18 18 GLU C 335 ? ALA C 343 ? GLU A 631 ALA A 639 1 ? 9  
HELX_P HELX_P19 19 ILE C 361 ? ALA C 370 ? ILE A 657 ALA A 666 1 ? 10 
HELX_P HELX_P20 20 ASP C 373 ? ARG C 380 ? ASP A 669 ARG A 676 1 ? 8  
HELX_P HELX_P21 21 ILE C 385 ? ILE C 393 ? ILE A 681 ILE A 689 1 ? 9  
HELX_P HELX_P22 22 PRO C 403 ? VAL C 417 ? PRO A 699 VAL A 713 1 ? 15 
HELX_P HELX_P23 23 ASP C 422 ? ASN C 428 ? ASP A 718 ASN A 724 1 ? 7  
HELX_P HELX_P24 24 ARG C 433 ? SER C 446 ? ARG A 729 SER A 742 1 ? 14 
HELX_P HELX_P25 25 PRO C 448 ? LYS C 464 ? PRO A 744 LYS A 760 1 ? 17 
HELX_P HELX_P26 26 PRO C 478 ? THR C 481 ? PRO A 774 THR A 777 5 ? 4  
HELX_P HELX_P27 27 PHE C 485 ? GLU C 521 ? PHE A 781 GLU A 817 1 ? 37 
HELX_P HELX_P28 28 LYS C 542 ? GLN C 558 ? LYS A 838 GLN A 854 5 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A 2DT 10 P  ? ? ? 1_555 A DC 9  "O3'" ? ? P 2DT 16 P DC 15 1_555 ? ? ? ? ? ? ?            1.596 ? 
hydrog1  hydrog ? ? A DG  1  N1 ? ? ? 1_555 B DC 10 O2    ? ? P DG  7  T DC 27 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog2  hydrog ? ? A DC  2  N3 ? ? ? 1_555 B DG 9  N1    ? ? P DC  8  T DG 26 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DC  2  N4 ? ? ? 1_555 B DG 9  O6    ? ? P DC  8  T DG 26 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DC  2  O2 ? ? ? 1_555 B DG 9  N2    ? ? P DC  8  T DG 26 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DA  3  N1 ? ? ? 1_555 B DT 8  N3    ? ? P DA  9  T DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DA  3  N6 ? ? ? 1_555 B DT 8  O4    ? ? P DA  9  T DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DT  4  N3 ? ? ? 1_555 B DA 7  N1    ? ? P DT  10 T DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DT  4  O4 ? ? ? 1_555 B DA 7  N6    ? ? P DT  10 T DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DG  5  N1 ? ? ? 1_555 B DC 6  N3    ? ? P DG  11 T DC 23 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DG  5  N2 ? ? ? 1_555 B DC 6  O2    ? ? P DG  11 T DC 23 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DG  5  O6 ? ? ? 1_555 B DC 6  N4    ? ? P DG  11 T DC 23 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DA  6  N1 ? ? ? 1_555 B DT 5  N3    ? ? P DA  12 T DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DA  6  N6 ? ? ? 1_555 B DT 5  O4    ? ? P DA  12 T DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DT  7  N3 ? ? ? 1_555 B DA 4  N1    ? ? P DT  13 T DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DT  7  O4 ? ? ? 1_555 B DA 4  N6    ? ? P DT  13 T DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DG  8  N1 ? ? ? 1_555 B DC 3  N3    ? ? P DG  14 T DC 20 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DG  8  N2 ? ? ? 1_555 B DC 3  O2    ? ? P DG  14 T DC 20 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DG  8  O6 ? ? ? 1_555 B DC 3  N4    ? ? P DG  14 T DC 20 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DC  9  N3 ? ? ? 1_555 B DG 2  N1    ? ? P DC  15 T DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DC  9  N4 ? ? ? 1_555 B DG 2  O6    ? ? P DC  15 T DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DC  9  O2 ? ? ? 1_555 B DG 2  N2    ? ? P DC  15 T DG 19 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A 2DT 10 N3 ? ? ? 1_555 B DA 1  N1    ? ? P 2DT 16 T DA 18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A 2DT 10 O4 ? ? ? 1_555 B DA 1  N6    ? ? P 2DT 16 T DA 18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLU 
_struct_mon_prot_cis.label_seq_id           324 
_struct_mon_prot_cis.label_asym_id          C 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLU 
_struct_mon_prot_cis.auth_seq_id            620 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    325 
_struct_mon_prot_cis.pdbx_label_asym_id_2   C 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     621 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.07 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 4 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR C 6   ? ALA C 8   ? THR A 302 ALA A 304 
A 2 GLY C 46  ? LEU C 50  ? GLY A 342 LEU A 346 
A 3 GLY C 38  ? ASN C 43  ? GLY A 334 ASN A 339 
A 4 LYS C 19  ? GLU C 25  ? LYS A 315 GLU A 321 
A 5 LYS C 71  ? MET C 74  ? LYS A 367 MET A 370 
A 6 VAL C 94  ? ASP C 97  ? VAL A 390 ASP A 393 
B 1 ILE C 309 ? ASN C 311 ? ILE A 605 ASN A 607 
B 2 SER C 321 ? THR C 323 ? SER A 617 THR A 619 
C 1 VAL C 568 ? GLY C 573 ? VAL A 864 GLY A 869 
C 2 TRP C 351 ? TYR C 358 ? TRP A 647 TYR A 654 
C 3 GLU C 535 ? PRO C 541 ? GLU A 831 PRO A 837 
C 4 HIS C 527 ? GLN C 531 ? HIS A 823 GLN A 827 
D 1 TYR C 466 ? THR C 468 ? TYR A 762 THR A 764 
D 2 ARG C 474 ? TYR C 476 ? ARG A 770 TYR A 772 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR C 6   ? O THR A 302 N PHE C 49  ? N PHE A 345 
A 2 3 O GLY C 46  ? O GLY A 342 N ASN C 43  ? N ASN A 339 
A 3 4 O GLY C 38  ? O GLY A 334 N GLU C 25  ? N GLU A 321 
A 4 5 O ALA C 20  ? O ALA A 316 N LYS C 71  ? N LYS A 367 
A 5 6 O LYS C 72  ? O LYS A 368 N SER C 95  ? N SER A 391 
B 1 2 O ILE C 309 ? O ILE A 605 N THR C 323 ? N THR A 619 
C 1 2 O ASP C 569 ? O ASP A 865 N ASP C 357 ? N ASP A 653 
C 2 3 O LEU C 352 ? O LEU A 648 N ALA C 540 ? N ALA A 836 
C 3 4 O ILE C 537 ? O ILE A 833 N LEU C 530 ? N LEU A 826 
D 1 2 O VAL C 467 ? O VAL A 763 N ARG C 475 ? N ARG A 771 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 910' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A 912' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A 915' 
AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 920' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 ARG C 406 ? ARG A 702  . ? 1_555 ? 
2  AC1 4 LYS C 410 ? LYS A 706  . ? 1_555 ? 
3  AC1 4 SO4 F .   ? SO4 A 915  . ? 1_555 ? 
4  AC1 4 HOH J .   ? HOH A 2301 . ? 1_555 ? 
5  AC2 5 MET C 3   ? MET A 299  . ? 1_555 ? 
6  AC2 5 ALA C 4   ? ALA A 300  . ? 1_555 ? 
7  AC2 5 ARG C 47  ? ARG A 343  . ? 1_555 ? 
8  AC2 5 ARG C 381 ? ARG A 677  . ? 3_545 ? 
9  AC2 5 HOH J .   ? HOH A 2752 . ? 1_555 ? 
10 AC3 5 SER C 359 ? SER A 655  . ? 1_555 ? 
11 AC3 5 GLN C 360 ? GLN A 656  . ? 1_555 ? 
12 AC3 5 SO4 D .   ? SO4 A 910  . ? 1_555 ? 
13 AC3 5 HOH J .   ? HOH A 2279 . ? 1_555 ? 
14 AC3 5 HOH J .   ? HOH A 2796 . ? 1_555 ? 
15 AC4 3 ARG C 483 ? ARG A 779  . ? 4_556 ? 
16 AC4 3 ARG C 523 ? ARG A 819  . ? 2_565 ? 
17 AC4 3 HOH J .   ? HOH A 2664 . ? 2_565 ? 
# 
_database_PDB_matrix.entry_id          3BDP 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3BDP 
_atom_sites.fract_transf_matrix[1][1]   0.011486 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010690 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009412 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DG  A 1 1   ? 32.010  18.622 20.292  1.00 65.62 ? 7    DG  P "O5'" 1 
ATOM   2    C "C5'" . DG  A 1 1   ? 32.712  18.797 21.539  1.00 63.83 ? 7    DG  P "C5'" 1 
ATOM   3    C "C4'" . DG  A 1 1   ? 31.989  18.227 22.738  1.00 62.78 ? 7    DG  P "C4'" 1 
ATOM   4    O "O4'" . DG  A 1 1   ? 32.887  18.237 23.871  1.00 62.02 ? 7    DG  P "O4'" 1 
ATOM   5    C "C3'" . DG  A 1 1   ? 30.734  18.983 23.180  1.00 62.24 ? 7    DG  P "C3'" 1 
ATOM   6    O "O3'" . DG  A 1 1   ? 29.787  18.016 23.655  1.00 63.10 ? 7    DG  P "O3'" 1 
ATOM   7    C "C2'" . DG  A 1 1   ? 31.235  19.858 24.319  1.00 61.37 ? 7    DG  P "C2'" 1 
ATOM   8    C "C1'" . DG  A 1 1   ? 32.350  19.016 24.933  1.00 60.73 ? 7    DG  P "C1'" 1 
ATOM   9    N N9    . DG  A 1 1   ? 33.460  19.762 25.520  1.00 58.90 ? 7    DG  P N9    1 
ATOM   10   C C8    . DG  A 1 1   ? 34.215  20.735 24.912  1.00 58.39 ? 7    DG  P C8    1 
ATOM   11   N N7    . DG  A 1 1   ? 35.192  21.170 25.664  1.00 57.79 ? 7    DG  P N7    1 
ATOM   12   C C5    . DG  A 1 1   ? 35.063  20.456 26.846  1.00 57.29 ? 7    DG  P C5    1 
ATOM   13   C C6    . DG  A 1 1   ? 35.850  20.487 28.032  1.00 57.03 ? 7    DG  P C6    1 
ATOM   14   O O6    . DG  A 1 1   ? 36.854  21.172 28.277  1.00 56.26 ? 7    DG  P O6    1 
ATOM   15   N N1    . DG  A 1 1   ? 35.368  19.598 28.987  1.00 57.08 ? 7    DG  P N1    1 
ATOM   16   C C2    . DG  A 1 1   ? 34.272  18.778 28.822  1.00 57.20 ? 7    DG  P C2    1 
ATOM   17   N N2    . DG  A 1 1   ? 33.959  17.986 29.865  1.00 57.26 ? 7    DG  P N2    1 
ATOM   18   N N3    . DG  A 1 1   ? 33.536  18.737 27.721  1.00 57.22 ? 7    DG  P N3    1 
ATOM   19   C C4    . DG  A 1 1   ? 33.987  19.594 26.781  1.00 57.74 ? 7    DG  P C4    1 
ATOM   20   P P     . DC  A 1 2   ? 28.283  18.462 24.026  1.00 64.13 ? 8    DC  P P     1 
ATOM   21   O OP1   . DC  A 1 2   ? 27.327  17.414 23.565  1.00 64.35 ? 8    DC  P OP1   1 
ATOM   22   O OP2   . DC  A 1 2   ? 28.107  19.876 23.576  1.00 64.15 ? 8    DC  P OP2   1 
ATOM   23   O "O5'" . DC  A 1 2   ? 28.259  18.412 25.620  1.00 63.61 ? 8    DC  P "O5'" 1 
ATOM   24   C "C5'" . DC  A 1 2   ? 29.420  18.796 26.378  1.00 61.44 ? 8    DC  P "C5'" 1 
ATOM   25   C "C4'" . DC  A 1 2   ? 29.204  18.546 27.853  1.00 59.74 ? 8    DC  P "C4'" 1 
ATOM   26   O "O4'" . DC  A 1 2   ? 30.381  19.027 28.539  1.00 58.56 ? 8    DC  P "O4'" 1 
ATOM   27   C "C3'" . DC  A 1 2   ? 28.026  19.306 28.461  1.00 59.17 ? 8    DC  P "C3'" 1 
ATOM   28   O "O3'" . DC  A 1 2   ? 27.438  18.533 29.530  1.00 59.71 ? 8    DC  P "O3'" 1 
ATOM   29   C "C2'" . DC  A 1 2   ? 28.658  20.607 28.935  1.00 58.10 ? 8    DC  P "C2'" 1 
ATOM   30   C "C1'" . DC  A 1 2   ? 30.117  20.248 29.216  1.00 56.98 ? 8    DC  P "C1'" 1 
ATOM   31   N N1    . DC  A 1 2   ? 31.110  21.234 28.743  1.00 54.70 ? 8    DC  P N1    1 
ATOM   32   C C2    . DC  A 1 2   ? 32.266  21.430 29.501  1.00 53.89 ? 8    DC  P C2    1 
ATOM   33   O O2    . DC  A 1 2   ? 32.385  20.818 30.572  1.00 54.62 ? 8    DC  P O2    1 
ATOM   34   N N3    . DC  A 1 2   ? 33.217  22.280 29.055  1.00 52.74 ? 8    DC  P N3    1 
ATOM   35   C C4    . DC  A 1 2   ? 33.039  22.930 27.906  1.00 52.51 ? 8    DC  P C4    1 
ATOM   36   N N4    . DC  A 1 2   ? 34.010  23.740 27.491  1.00 51.95 ? 8    DC  P N4    1 
ATOM   37   C C5    . DC  A 1 2   ? 31.855  22.774 27.128  1.00 52.64 ? 8    DC  P C5    1 
ATOM   38   C C6    . DC  A 1 2   ? 30.924  21.926 27.581  1.00 53.47 ? 8    DC  P C6    1 
ATOM   39   P P     . DA  A 1 3   ? 26.375  19.219 30.537  1.00 60.77 ? 9    DA  P P     1 
ATOM   40   O OP1   . DA  A 1 3   ? 25.318  18.253 30.982  1.00 60.69 ? 9    DA  P OP1   1 
ATOM   41   O OP2   . DA  A 1 3   ? 25.973  20.493 29.876  1.00 60.80 ? 9    DA  P OP2   1 
ATOM   42   O "O5'" . DA  A 1 3   ? 27.256  19.605 31.814  1.00 59.47 ? 9    DA  P "O5'" 1 
ATOM   43   C "C5'" . DA  A 1 3   ? 27.409  18.720 32.955  1.00 55.82 ? 9    DA  P "C5'" 1 
ATOM   44   C "C4'" . DA  A 1 3   ? 27.804  19.540 34.163  1.00 53.57 ? 9    DA  P "C4'" 1 
ATOM   45   O "O4'" . DA  A 1 3   ? 29.018  20.264 33.827  1.00 52.09 ? 9    DA  P "O4'" 1 
ATOM   46   C "C3'" . DA  A 1 3   ? 26.746  20.604 34.489  1.00 52.82 ? 9    DA  P "C3'" 1 
ATOM   47   O "O3'" . DA  A 1 3   ? 26.666  20.949 35.886  1.00 53.34 ? 9    DA  P "O3'" 1 
ATOM   48   C "C2'" . DA  A 1 3   ? 27.282  21.839 33.791  1.00 51.07 ? 9    DA  P "C2'" 1 
ATOM   49   C "C1'" . DA  A 1 3   ? 28.787  21.660 33.914  1.00 49.26 ? 9    DA  P "C1'" 1 
ATOM   50   N N9    . DA  A 1 3   ? 29.543  22.331 32.856  1.00 46.66 ? 9    DA  P N9    1 
ATOM   51   C C8    . DA  A 1 3   ? 29.152  22.510 31.558  1.00 45.43 ? 9    DA  P C8    1 
ATOM   52   N N7    . DA  A 1 3   ? 29.982  23.237 30.852  1.00 45.23 ? 9    DA  P N7    1 
ATOM   53   C C5    . DA  A 1 3   ? 31.004  23.540 31.740  1.00 44.30 ? 9    DA  P C5    1 
ATOM   54   C C6    . DA  A 1 3   ? 32.180  24.305 31.605  1.00 43.92 ? 9    DA  P C6    1 
ATOM   55   N N6    . DA  A 1 3   ? 32.533  24.937 30.480  1.00 43.15 ? 9    DA  P N6    1 
ATOM   56   N N1    . DA  A 1 3   ? 32.989  24.410 32.683  1.00 42.96 ? 9    DA  P N1    1 
ATOM   57   C C2    . DA  A 1 3   ? 32.628  23.797 33.811  1.00 43.04 ? 9    DA  P C2    1 
ATOM   58   N N3    . DA  A 1 3   ? 31.544  23.059 34.063  1.00 44.10 ? 9    DA  P N3    1 
ATOM   59   C C4    . DA  A 1 3   ? 30.761  22.968 32.972  1.00 44.83 ? 9    DA  P C4    1 
ATOM   60   P P     . DT  A 1 4   ? 26.986  19.869 37.042  1.00 53.22 ? 10   DT  P P     1 
ATOM   61   O OP1   . DT  A 1 4   ? 27.774  18.719 36.496  1.00 53.20 ? 10   DT  P OP1   1 
ATOM   62   O OP2   . DT  A 1 4   ? 25.706  19.612 37.768  1.00 53.14 ? 10   DT  P OP2   1 
ATOM   63   O "O5'" . DT  A 1 4   ? 27.955  20.683 38.020  1.00 51.32 ? 10   DT  P "O5'" 1 
ATOM   64   C "C5'" . DT  A 1 4   ? 29.363  20.836 37.695  1.00 48.23 ? 10   DT  P "C5'" 1 
ATOM   65   C "C4'" . DT  A 1 4   ? 29.934  22.115 38.275  1.00 44.93 ? 10   DT  P "C4'" 1 
ATOM   66   O "O4'" . DT  A 1 4   ? 30.472  23.000 37.255  1.00 43.61 ? 10   DT  P "O4'" 1 
ATOM   67   C "C3'" . DT  A 1 4   ? 29.037  22.970 39.169  1.00 42.95 ? 10   DT  P "C3'" 1 
ATOM   68   O "O3'" . DT  A 1 4   ? 29.775  23.283 40.354  1.00 40.96 ? 10   DT  P "O3'" 1 
ATOM   69   C "C2'" . DT  A 1 4   ? 28.771  24.210 38.323  1.00 42.01 ? 10   DT  P "C2'" 1 
ATOM   70   C "C1'" . DT  A 1 4   ? 30.024  24.333 37.461  1.00 41.37 ? 10   DT  P "C1'" 1 
ATOM   71   N N1    . DT  A 1 4   ? 29.815  24.953 36.125  1.00 39.53 ? 10   DT  P N1    1 
ATOM   72   C C2    . DT  A 1 4   ? 30.804  25.775 35.594  1.00 38.44 ? 10   DT  P C2    1 
ATOM   73   O O2    . DT  A 1 4   ? 31.858  26.028 36.162  1.00 39.53 ? 10   DT  P O2    1 
ATOM   74   N N3    . DT  A 1 4   ? 30.510  26.292 34.356  1.00 37.46 ? 10   DT  P N3    1 
ATOM   75   C C4    . DT  A 1 4   ? 29.368  26.076 33.609  1.00 36.80 ? 10   DT  P C4    1 
ATOM   76   O O4    . DT  A 1 4   ? 29.244  26.619 32.512  1.00 35.77 ? 10   DT  P O4    1 
ATOM   77   C C5    . DT  A 1 4   ? 28.390  25.198 34.216  1.00 36.60 ? 10   DT  P C5    1 
ATOM   78   C C7    . DT  A 1 4   ? 27.142  24.873 33.465  1.00 36.89 ? 10   DT  P C7    1 
ATOM   79   C C6    . DT  A 1 4   ? 28.653  24.700 35.429  1.00 37.65 ? 10   DT  P C6    1 
ATOM   80   P P     . DG  A 1 5   ? 29.083  24.102 41.548  1.00 39.49 ? 11   DG  P P     1 
ATOM   81   O OP1   . DG  A 1 5   ? 29.770  23.656 42.772  1.00 40.26 ? 11   DG  P OP1   1 
ATOM   82   O OP2   . DG  A 1 5   ? 27.605  24.056 41.484  1.00 38.73 ? 11   DG  P OP2   1 
ATOM   83   O "O5'" . DG  A 1 5   ? 29.581  25.577 41.252  1.00 38.22 ? 11   DG  P "O5'" 1 
ATOM   84   C "C5'" . DG  A 1 5   ? 30.981  25.831 41.091  1.00 35.16 ? 11   DG  P "C5'" 1 
ATOM   85   C "C4'" . DG  A 1 5   ? 31.200  27.290 40.788  1.00 34.30 ? 11   DG  P "C4'" 1 
ATOM   86   O "O4'" . DG  A 1 5   ? 30.889  27.587 39.403  1.00 33.06 ? 11   DG  P "O4'" 1 
ATOM   87   C "C3'" . DG  A 1 5   ? 30.333  28.224 41.638  1.00 33.49 ? 11   DG  P "C3'" 1 
ATOM   88   O "O3'" . DG  A 1 5   ? 31.124  29.378 41.969  1.00 33.66 ? 11   DG  P "O3'" 1 
ATOM   89   C "C2'" . DG  A 1 5   ? 29.215  28.619 40.687  1.00 32.02 ? 11   DG  P "C2'" 1 
ATOM   90   C "C1'" . DG  A 1 5   ? 29.975  28.668 39.374  1.00 31.72 ? 11   DG  P "C1'" 1 
ATOM   91   N N9    . DG  A 1 5   ? 29.203  28.587 38.145  1.00 29.85 ? 11   DG  P N9    1 
ATOM   92   C C8    . DG  A 1 5   ? 28.022  27.926 37.926  1.00 29.17 ? 11   DG  P C8    1 
ATOM   93   N N7    . DG  A 1 5   ? 27.592  28.045 36.698  1.00 29.79 ? 11   DG  P N7    1 
ATOM   94   C C5    . DG  A 1 5   ? 28.553  28.837 36.074  1.00 28.66 ? 11   DG  P C5    1 
ATOM   95   C C6    . DG  A 1 5   ? 28.642  29.318 34.721  1.00 27.04 ? 11   DG  P C6    1 
ATOM   96   O O6    . DG  A 1 5   ? 27.870  29.128 33.784  1.00 26.18 ? 11   DG  P O6    1 
ATOM   97   N N1    . DG  A 1 5   ? 29.777  30.094 34.530  1.00 25.19 ? 11   DG  P N1    1 
ATOM   98   C C2    . DG  A 1 5   ? 30.709  30.375 35.500  1.00 25.61 ? 11   DG  P C2    1 
ATOM   99   N N2    . DG  A 1 5   ? 31.735  31.137 35.129  1.00 25.80 ? 11   DG  P N2    1 
ATOM   100  N N3    . DG  A 1 5   ? 30.641  29.938 36.747  1.00 26.91 ? 11   DG  P N3    1 
ATOM   101  C C4    . DG  A 1 5   ? 29.546  29.182 36.960  1.00 28.14 ? 11   DG  P C4    1 
ATOM   102  P P     . DA  A 1 6   ? 30.736  30.299 43.236  1.00 32.22 ? 12   DA  P P     1 
ATOM   103  O OP1   . DA  A 1 6   ? 31.911  30.168 44.150  1.00 31.35 ? 12   DA  P OP1   1 
ATOM   104  O OP2   . DA  A 1 6   ? 29.364  30.016 43.732  1.00 29.86 ? 12   DA  P OP2   1 
ATOM   105  O "O5'" . DA  A 1 6   ? 30.681  31.765 42.601  1.00 32.98 ? 12   DA  P "O5'" 1 
ATOM   106  C "C5'" . DA  A 1 6   ? 31.832  32.334 41.943  1.00 31.27 ? 12   DA  P "C5'" 1 
ATOM   107  C "C4'" . DA  A 1 6   ? 31.421  33.149 40.734  1.00 30.00 ? 12   DA  P "C4'" 1 
ATOM   108  O "O4'" . DA  A 1 6   ? 30.896  32.297 39.689  1.00 28.85 ? 12   DA  P "O4'" 1 
ATOM   109  C "C3'" . DA  A 1 6   ? 30.348  34.223 40.900  1.00 29.43 ? 12   DA  P "C3'" 1 
ATOM   110  O "O3'" . DA  A 1 6   ? 30.899  35.464 41.355  1.00 29.03 ? 12   DA  P "O3'" 1 
ATOM   111  C "C2'" . DA  A 1 6   ? 29.910  34.444 39.468  1.00 29.86 ? 12   DA  P "C2'" 1 
ATOM   112  C "C1'" . DA  A 1 6   ? 30.262  33.150 38.751  1.00 27.90 ? 12   DA  P "C1'" 1 
ATOM   113  N N9    . DA  A 1 6   ? 29.072  32.500 38.232  1.00 26.04 ? 12   DA  P N9    1 
ATOM   114  C C8    . DA  A 1 6   ? 28.164  31.664 38.814  1.00 25.20 ? 12   DA  P C8    1 
ATOM   115  N N7    . DA  A 1 6   ? 27.178  31.322 38.015  1.00 25.80 ? 12   DA  P N7    1 
ATOM   116  C C5    . DA  A 1 6   ? 27.473  31.975 36.820  1.00 25.21 ? 12   DA  P C5    1 
ATOM   117  C C6    . DA  A 1 6   ? 26.821  32.031 35.560  1.00 23.91 ? 12   DA  P C6    1 
ATOM   118  N N6    . DA  A 1 6   ? 25.689  31.392 35.275  1.00 22.28 ? 12   DA  P N6    1 
ATOM   119  N N1    . DA  A 1 6   ? 27.390  32.788 34.593  1.00 24.37 ? 12   DA  P N1    1 
ATOM   120  C C2    . DA  A 1 6   ? 28.524  33.444 34.875  1.00 24.67 ? 12   DA  P C2    1 
ATOM   121  N N3    . DA  A 1 6   ? 29.225  33.469 36.006  1.00 24.61 ? 12   DA  P N3    1 
ATOM   122  C C4    . DA  A 1 6   ? 28.639  32.701 36.946  1.00 25.37 ? 12   DA  P C4    1 
ATOM   123  P P     . DT  A 1 7   ? 29.916  36.698 41.705  1.00 27.55 ? 13   DT  P P     1 
ATOM   124  O OP1   . DT  A 1 7   ? 30.741  37.642 42.493  1.00 29.11 ? 13   DT  P OP1   1 
ATOM   125  O OP2   . DT  A 1 7   ? 28.657  36.181 42.262  1.00 29.29 ? 13   DT  P OP2   1 
ATOM   126  O "O5'" . DT  A 1 7   ? 29.559  37.398 40.318  1.00 29.44 ? 13   DT  P "O5'" 1 
ATOM   127  C "C5'" . DT  A 1 7   ? 30.599  37.948 39.488  1.00 29.63 ? 13   DT  P "C5'" 1 
ATOM   128  C "C4'" . DT  A 1 7   ? 30.002  38.725 38.340  1.00 31.19 ? 13   DT  P "C4'" 1 
ATOM   129  O "O4'" . DT  A 1 7   ? 29.418  37.814 37.370  1.00 31.30 ? 13   DT  P "O4'" 1 
ATOM   130  C "C3'" . DT  A 1 7   ? 28.900  39.709 38.742  1.00 31.44 ? 13   DT  P "C3'" 1 
ATOM   131  O "O3'" . DT  A 1 7   ? 29.045  40.972 38.083  1.00 31.43 ? 13   DT  P "O3'" 1 
ATOM   132  C "C2'" . DT  A 1 7   ? 27.626  39.028 38.289  1.00 31.12 ? 13   DT  P "C2'" 1 
ATOM   133  C "C1'" . DT  A 1 7   ? 28.082  38.192 37.097  1.00 31.40 ? 13   DT  P "C1'" 1 
ATOM   134  N N1    . DT  A 1 7   ? 27.264  36.967 36.967  1.00 31.61 ? 13   DT  P N1    1 
ATOM   135  C C2    . DT  A 1 7   ? 26.770  36.625 35.713  1.00 30.78 ? 13   DT  P C2    1 
ATOM   136  O O2    . DT  A 1 7   ? 27.142  37.160 34.671  1.00 31.57 ? 13   DT  P O2    1 
ATOM   137  N N3    . DT  A 1 7   ? 25.839  35.613 35.733  1.00 29.21 ? 13   DT  P N3    1 
ATOM   138  C C4    . DT  A 1 7   ? 25.408  34.900 36.837  1.00 27.88 ? 13   DT  P C4    1 
ATOM   139  O O4    . DT  A 1 7   ? 24.521  34.071 36.719  1.00 27.67 ? 13   DT  P O4    1 
ATOM   140  C C5    . DT  A 1 7   ? 26.058  35.226 38.083  1.00 28.35 ? 13   DT  P C5    1 
ATOM   141  C C7    . DT  A 1 7   ? 25.721  34.429 39.300  1.00 29.01 ? 13   DT  P C7    1 
ATOM   142  C C6    . DT  A 1 7   ? 26.940  36.226 38.092  1.00 29.61 ? 13   DT  P C6    1 
ATOM   143  P P     . DG  A 1 8   ? 28.057  42.188 38.470  1.00 31.16 ? 14   DG  P P     1 
ATOM   144  O OP1   . DG  A 1 8   ? 28.838  43.449 38.491  1.00 31.98 ? 14   DG  P OP1   1 
ATOM   145  O OP2   . DG  A 1 8   ? 27.232  41.802 39.652  1.00 30.99 ? 14   DG  P OP2   1 
ATOM   146  O "O5'" . DG  A 1 8   ? 27.052  42.253 37.243  1.00 30.08 ? 14   DG  P "O5'" 1 
ATOM   147  C "C5'" . DG  A 1 8   ? 27.492  42.692 35.965  1.00 26.70 ? 14   DG  P "C5'" 1 
ATOM   148  C "C4'" . DG  A 1 8   ? 26.390  42.478 34.963  1.00 25.38 ? 14   DG  P "C4'" 1 
ATOM   149  O "O4'" . DG  A 1 8   ? 26.273  41.071 34.628  1.00 24.42 ? 14   DG  P "O4'" 1 
ATOM   150  C "C3'" . DG  A 1 8   ? 25.005  42.867 35.460  1.00 24.19 ? 14   DG  P "C3'" 1 
ATOM   151  O "O3'" . DG  A 1 8   ? 24.773  44.277 35.341  1.00 24.30 ? 14   DG  P "O3'" 1 
ATOM   152  C "C2'" . DG  A 1 8   ? 24.116  42.071 34.528  1.00 24.56 ? 14   DG  P "C2'" 1 
ATOM   153  C "C1'" . DG  A 1 8   ? 24.927  40.808 34.244  1.00 24.25 ? 14   DG  P "C1'" 1 
ATOM   154  N N9    . DG  A 1 8   ? 24.413  39.708 35.046  1.00 24.78 ? 14   DG  P N9    1 
ATOM   155  C C8    . DG  A 1 8   ? 24.696  39.406 36.357  1.00 24.15 ? 14   DG  P C8    1 
ATOM   156  N N7    . DG  A 1 8   ? 23.971  38.421 36.820  1.00 24.25 ? 14   DG  P N7    1 
ATOM   157  C C5    . DG  A 1 8   ? 23.192  38.031 35.739  1.00 24.25 ? 14   DG  P C5    1 
ATOM   158  C C6    . DG  A 1 8   ? 22.210  37.016 35.632  1.00 25.10 ? 14   DG  P C6    1 
ATOM   159  O O6    . DG  A 1 8   ? 21.823  36.214 36.501  1.00 25.60 ? 14   DG  P O6    1 
ATOM   160  N N1    . DG  A 1 8   ? 21.655  36.976 34.355  1.00 25.22 ? 14   DG  P N1    1 
ATOM   161  C C2    . DG  A 1 8   ? 22.016  37.799 33.313  1.00 24.89 ? 14   DG  P C2    1 
ATOM   162  N N2    . DG  A 1 8   ? 21.370  37.608 32.155  1.00 24.58 ? 14   DG  P N2    1 
ATOM   163  N N3    . DG  A 1 8   ? 22.937  38.735 33.401  1.00 24.37 ? 14   DG  P N3    1 
ATOM   164  C C4    . DG  A 1 8   ? 23.473  38.801 34.633  1.00 24.02 ? 14   DG  P C4    1 
ATOM   165  P P     . DC  A 1 9   ? 23.568  44.961 36.164  1.00 24.90 ? 15   DC  P P     1 
ATOM   166  O OP1   . DC  A 1 9   ? 23.763  46.428 36.120  1.00 25.57 ? 15   DC  P OP1   1 
ATOM   167  O OP2   . DC  A 1 9   ? 23.446  44.273 37.477  1.00 26.55 ? 15   DC  P OP2   1 
ATOM   168  O "O5'" . DC  A 1 9   ? 22.229  44.595 35.377  1.00 23.24 ? 15   DC  P "O5'" 1 
ATOM   169  C "C5'" . DC  A 1 9   ? 22.012  45.067 34.040  1.00 22.01 ? 15   DC  P "C5'" 1 
ATOM   170  C "C4'" . DC  A 1 9   ? 20.778  44.428 33.447  1.00 20.16 ? 15   DC  P "C4'" 1 
ATOM   171  O "O4'" . DC  A 1 9   ? 20.907  42.991 33.395  1.00 19.03 ? 15   DC  P "O4'" 1 
ATOM   172  C "C3'" . DC  A 1 9   ? 19.478  44.690 34.184  1.00 19.78 ? 15   DC  P "C3'" 1 
ATOM   173  O "O3'" . DC  A 1 9   ? 18.962  45.940 33.719  1.00 21.32 ? 15   DC  P "O3'" 1 
ATOM   174  C "C2'" . DC  A 1 9   ? 18.616  43.519 33.750  1.00 18.77 ? 15   DC  P "C2'" 1 
ATOM   175  C "C1'" . DC  A 1 9   ? 19.632  42.384 33.567  1.00 19.85 ? 15   DC  P "C1'" 1 
ATOM   176  N N1    . DC  A 1 9   ? 19.735  41.432 34.697  1.00 19.45 ? 15   DC  P N1    1 
ATOM   177  C C2    . DC  A 1 9   ? 18.916  40.312 34.706  1.00 18.75 ? 15   DC  P C2    1 
ATOM   178  O O2    . DC  A 1 9   ? 18.134  40.146 33.773  1.00 17.67 ? 15   DC  P O2    1 
ATOM   179  N N3    . DC  A 1 9   ? 18.996  39.442 35.734  1.00 18.80 ? 15   DC  P N3    1 
ATOM   180  C C4    . DC  A 1 9   ? 19.852  39.667 36.728  1.00 18.96 ? 15   DC  P C4    1 
ATOM   181  N N4    . DC  A 1 9   ? 19.897  38.793 37.720  1.00 19.60 ? 15   DC  P N4    1 
ATOM   182  C C5    . DC  A 1 9   ? 20.704  40.798 36.747  1.00 19.44 ? 15   DC  P C5    1 
ATOM   183  C C6    . DC  A 1 9   ? 20.617  41.648 35.719  1.00 20.20 ? 15   DC  P C6    1 
HETATM 184  P P     . 2DT A 1 10  ? 17.858  46.724 34.563  1.00 19.79 ? 16   2DT P P     1 
HETATM 185  O OP1   . 2DT A 1 10  ? 17.623  48.032 33.871  1.00 21.19 ? 16   2DT P OP1   1 
HETATM 186  O OP2   . 2DT A 1 10  ? 18.351  46.697 35.969  1.00 19.88 ? 16   2DT P OP2   1 
HETATM 187  O "O5'" . 2DT A 1 10  ? 16.532  45.853 34.412  1.00 20.63 ? 16   2DT P "O5'" 1 
HETATM 188  N N1    . 2DT A 1 10  ? 15.120  42.269 35.391  1.00 19.79 ? 16   2DT P N1    1 
HETATM 189  C C6    . 2DT A 1 10  ? 16.065  43.061 36.008  1.00 20.78 ? 16   2DT P C6    1 
HETATM 190  C C2    . 2DT A 1 10  ? 14.891  40.973 35.808  1.00 20.29 ? 16   2DT P C2    1 
HETATM 191  O O2    . 2DT A 1 10  ? 14.031  40.268 35.320  1.00 20.68 ? 16   2DT P O2    1 
HETATM 192  N N3    . 2DT A 1 10  ? 15.694  40.545 36.847  1.00 20.03 ? 16   2DT P N3    1 
HETATM 193  C C4    . 2DT A 1 10  ? 16.648  41.276 37.517  1.00 20.67 ? 16   2DT P C4    1 
HETATM 194  O O4    . 2DT A 1 10  ? 17.267  40.769 38.444  1.00 20.75 ? 16   2DT P O4    1 
HETATM 195  C C5    . 2DT A 1 10  ? 16.826  42.644 37.039  1.00 21.88 ? 16   2DT P C5    1 
HETATM 196  C C5M   . 2DT A 1 10  ? 17.838  43.518 37.714  1.00 21.61 ? 16   2DT P C5M   1 
HETATM 197  C "C2'" . 2DT A 1 10  ? 13.122  43.666 34.603  1.00 19.73 ? 16   2DT P "C2'" 1 
HETATM 198  C "C5'" . 2DT A 1 10  ? 15.781  45.861 33.177  1.00 19.96 ? 16   2DT P "C5'" 1 
HETATM 199  C "C4'" . 2DT A 1 10  ? 14.637  44.873 33.227  1.00 19.70 ? 16   2DT P "C4'" 1 
HETATM 200  O "O4'" . 2DT A 1 10  ? 15.184  43.555 33.429  1.00 20.07 ? 16   2DT P "O4'" 1 
HETATM 201  C "C1'" . 2DT A 1 10  ? 14.322  42.783 34.256  1.00 20.09 ? 16   2DT P "C1'" 1 
HETATM 202  C "C3'" . 2DT A 1 10  ? 13.626  45.074 34.352  1.00 19.99 ? 16   2DT P "C3'" 1 
ATOM   203  O "O5'" . DA  B 2 1   ? 13.237  30.864 42.585  1.00 38.79 ? 18   DA  T "O5'" 1 
ATOM   204  C "C5'" . DA  B 2 1   ? 13.057  32.134 41.964  1.00 42.77 ? 18   DA  T "C5'" 1 
ATOM   205  C "C4'" . DA  B 2 1   ? 12.166  32.252 40.742  1.00 45.00 ? 18   DA  T "C4'" 1 
ATOM   206  O "O4'" . DA  B 2 1   ? 12.099  33.650 40.356  1.00 46.68 ? 18   DA  T "O4'" 1 
ATOM   207  C "C3'" . DA  B 2 1   ? 12.650  31.506 39.492  1.00 45.77 ? 18   DA  T "C3'" 1 
ATOM   208  O "O3'" . DA  B 2 1   ? 11.523  31.087 38.696  1.00 45.85 ? 18   DA  T "O3'" 1 
ATOM   209  C "C2'" . DA  B 2 1   ? 13.457  32.552 38.744  1.00 45.64 ? 18   DA  T "C2'" 1 
ATOM   210  C "C1'" . DA  B 2 1   ? 12.844  33.885 39.166  1.00 45.72 ? 18   DA  T "C1'" 1 
ATOM   211  N N9    . DA  B 2 1   ? 13.888  34.850 39.497  1.00 45.21 ? 18   DA  T N9    1 
ATOM   212  C C8    . DA  B 2 1   ? 14.779  34.788 40.538  1.00 44.46 ? 18   DA  T C8    1 
ATOM   213  N N7    . DA  B 2 1   ? 15.615  35.794 40.581  1.00 44.42 ? 18   DA  T N7    1 
ATOM   214  C C5    . DA  B 2 1   ? 15.247  36.575 39.494  1.00 43.95 ? 18   DA  T C5    1 
ATOM   215  C C6    . DA  B 2 1   ? 15.741  37.781 38.992  1.00 42.63 ? 18   DA  T C6    1 
ATOM   216  N N6    . DA  B 2 1   ? 16.757  38.447 39.538  1.00 41.75 ? 18   DA  T N6    1 
ATOM   217  N N1    . DA  B 2 1   ? 15.148  38.290 37.893  1.00 42.87 ? 18   DA  T N1    1 
ATOM   218  C C2    . DA  B 2 1   ? 14.124  37.619 37.344  1.00 43.33 ? 18   DA  T C2    1 
ATOM   219  N N3    . DA  B 2 1   ? 13.570  36.479 37.723  1.00 43.99 ? 18   DA  T N3    1 
ATOM   220  C C4    . DA  B 2 1   ? 14.184  36.002 38.817  1.00 44.59 ? 18   DA  T C4    1 
ATOM   221  P P     . DG  B 2 2   ? 11.747  30.113 37.425  1.00 45.19 ? 19   DG  T P     1 
ATOM   222  O OP1   . DG  B 2 2   ? 10.407  29.835 36.829  1.00 45.25 ? 19   DG  T OP1   1 
ATOM   223  O OP2   . DG  B 2 2   ? 12.638  28.990 37.803  1.00 46.02 ? 19   DG  T OP2   1 
ATOM   224  O "O5'" . DG  B 2 2   ? 12.614  30.983 36.410  1.00 46.12 ? 19   DG  T "O5'" 1 
ATOM   225  C "C5'" . DG  B 2 2   ? 12.009  31.621 35.263  1.00 43.66 ? 19   DG  T "C5'" 1 
ATOM   226  C "C4'" . DG  B 2 2   ? 13.075  32.051 34.280  1.00 41.18 ? 19   DG  T "C4'" 1 
ATOM   227  O "O4'" . DG  B 2 2   ? 13.876  33.118 34.849  1.00 41.81 ? 19   DG  T "O4'" 1 
ATOM   228  C "C3'" . DG  B 2 2   ? 14.064  30.954 33.855  1.00 39.25 ? 19   DG  T "C3'" 1 
ATOM   229  O "O3'" . DG  B 2 2   ? 14.426  31.162 32.493  1.00 35.49 ? 19   DG  T "O3'" 1 
ATOM   230  C "C2'" . DG  B 2 2   ? 15.322  31.291 34.643  1.00 38.79 ? 19   DG  T "C2'" 1 
ATOM   231  C "C1'" . DG  B 2 2   ? 15.241  32.809 34.647  1.00 39.98 ? 19   DG  T "C1'" 1 
ATOM   232  N N9    . DG  B 2 2   ? 16.033  33.528 35.640  1.00 39.60 ? 19   DG  T N9    1 
ATOM   233  C C8    . DG  B 2 2   ? 16.601  33.018 36.784  1.00 39.04 ? 19   DG  T C8    1 
ATOM   234  N N7    . DG  B 2 2   ? 17.365  33.878 37.399  1.00 39.09 ? 19   DG  T N7    1 
ATOM   235  C C5    . DG  B 2 2   ? 17.274  35.034 36.631  1.00 38.15 ? 19   DG  T C5    1 
ATOM   236  C C6    . DG  B 2 2   ? 17.922  36.275 36.778  1.00 36.52 ? 19   DG  T C6    1 
ATOM   237  O O6    . DG  B 2 2   ? 18.739  36.600 37.638  1.00 34.82 ? 19   DG  T O6    1 
ATOM   238  N N1    . DG  B 2 2   ? 17.547  37.180 35.776  1.00 36.01 ? 19   DG  T N1    1 
ATOM   239  C C2    . DG  B 2 2   ? 16.659  36.909 34.761  1.00 36.18 ? 19   DG  T C2    1 
ATOM   240  N N2    . DG  B 2 2   ? 16.397  37.908 33.897  1.00 34.27 ? 19   DG  T N2    1 
ATOM   241  N N3    . DG  B 2 2   ? 16.061  35.737 34.606  1.00 37.43 ? 19   DG  T N3    1 
ATOM   242  C C4    . DG  B 2 2   ? 16.420  34.850 35.567  1.00 38.63 ? 19   DG  T C4    1 
ATOM   243  P P     . DC  B 2 3   ? 13.453  30.716 31.303  1.00 30.85 ? 20   DC  T P     1 
ATOM   244  O OP1   . DC  B 2 3   ? 12.036  31.067 31.512  1.00 31.04 ? 20   DC  T OP1   1 
ATOM   245  O OP2   . DC  B 2 3   ? 13.817  29.312 31.016  1.00 34.22 ? 20   DC  T OP2   1 
ATOM   246  O "O5'" . DC  B 2 3   ? 14.068  31.592 30.120  1.00 30.68 ? 20   DC  T "O5'" 1 
ATOM   247  C "C5'" . DC  B 2 3   ? 15.490  31.553 29.864  1.00 26.43 ? 20   DC  T "C5'" 1 
ATOM   248  C "C4'" . DC  B 2 3   ? 16.064  32.948 29.777  1.00 25.35 ? 20   DC  T "C4'" 1 
ATOM   249  O "O4'" . DC  B 2 3   ? 16.148  33.625 31.054  1.00 24.71 ? 20   DC  T "O4'" 1 
ATOM   250  C "C3'" . DC  B 2 3   ? 17.486  32.950 29.247  1.00 24.32 ? 20   DC  T "C3'" 1 
ATOM   251  O "O3'" . DC  B 2 3   ? 17.399  32.937 27.829  1.00 23.12 ? 20   DC  T "O3'" 1 
ATOM   252  C "C2'" . DC  B 2 3   ? 18.039  34.267 29.749  1.00 23.61 ? 20   DC  T "C2'" 1 
ATOM   253  C "C1'" . DC  B 2 3   ? 17.271  34.512 31.043  1.00 25.29 ? 20   DC  T "C1'" 1 
ATOM   254  N N1    . DC  B 2 3   ? 18.075  34.276 32.252  1.00 26.77 ? 20   DC  T N1    1 
ATOM   255  C C2    . DC  B 2 3   ? 18.975  35.275 32.659  1.00 26.69 ? 20   DC  T C2    1 
ATOM   256  O O2    . DC  B 2 3   ? 19.078  36.303 31.980  1.00 25.53 ? 20   DC  T O2    1 
ATOM   257  N N3    . DC  B 2 3   ? 19.708  35.090 33.777  1.00 26.72 ? 20   DC  T N3    1 
ATOM   258  C C4    . DC  B 2 3   ? 19.579  33.964 34.481  1.00 27.85 ? 20   DC  T C4    1 
ATOM   259  N N4    . DC  B 2 3   ? 20.306  33.843 35.595  1.00 28.18 ? 20   DC  T N4    1 
ATOM   260  C C5    . DC  B 2 3   ? 18.690  32.917 34.080  1.00 28.23 ? 20   DC  T C5    1 
ATOM   261  C C6    . DC  B 2 3   ? 17.959  33.117 32.972  1.00 27.69 ? 20   DC  T C6    1 
ATOM   262  P P     . DA  B 2 4   ? 18.635  32.432 26.969  1.00 23.81 ? 21   DA  T P     1 
ATOM   263  O OP1   . DA  B 2 4   ? 18.295  32.565 25.532  1.00 24.84 ? 21   DA  T OP1   1 
ATOM   264  O OP2   . DA  B 2 4   ? 19.063  31.119 27.503  1.00 26.59 ? 21   DA  T OP2   1 
ATOM   265  O "O5'" . DA  B 2 4   ? 19.798  33.450 27.340  1.00 23.92 ? 21   DA  T "O5'" 1 
ATOM   266  C "C5'" . DA  B 2 4   ? 19.778  34.799 26.893  1.00 22.00 ? 21   DA  T "C5'" 1 
ATOM   267  C "C4'" . DA  B 2 4   ? 21.187  35.334 26.889  1.00 22.25 ? 21   DA  T "C4'" 1 
ATOM   268  O "O4'" . DA  B 2 4   ? 21.658  35.488 28.250  1.00 22.52 ? 21   DA  T "O4'" 1 
ATOM   269  C "C3'" . DA  B 2 4   ? 22.201  34.434 26.189  1.00 21.51 ? 21   DA  T "C3'" 1 
ATOM   270  O "O3'" . DA  B 2 4   ? 23.082  35.285 25.459  1.00 20.99 ? 21   DA  T "O3'" 1 
ATOM   271  C "C2'" . DA  B 2 4   ? 22.910  33.720 27.339  1.00 21.66 ? 21   DA  T "C2'" 1 
ATOM   272  C "C1'" . DA  B 2 4   ? 22.845  34.731 28.484  1.00 21.95 ? 21   DA  T "C1'" 1 
ATOM   273  N N9    . DA  B 2 4   ? 22.743  34.169 29.844  1.00 22.92 ? 21   DA  T N9    1 
ATOM   274  C C8    . DA  B 2 4   ? 21.920  33.149 30.281  1.00 22.26 ? 21   DA  T C8    1 
ATOM   275  N N7    . DA  B 2 4   ? 22.009  32.915 31.572  1.00 21.72 ? 21   DA  T N7    1 
ATOM   276  C C5    . DA  B 2 4   ? 22.963  33.822 32.014  1.00 21.75 ? 21   DA  T C5    1 
ATOM   277  C C6    . DA  B 2 4   ? 23.506  34.081 33.293  1.00 22.74 ? 21   DA  T C6    1 
ATOM   278  N N6    . DA  B 2 4   ? 23.130  33.431 34.399  1.00 22.77 ? 21   DA  T N6    1 
ATOM   279  N N1    . DA  B 2 4   ? 24.452  35.049 33.398  1.00 22.62 ? 21   DA  T N1    1 
ATOM   280  C C2    . DA  B 2 4   ? 24.805  35.715 32.293  1.00 23.20 ? 21   DA  T C2    1 
ATOM   281  N N3    . DA  B 2 4   ? 24.356  35.570 31.034  1.00 22.32 ? 21   DA  T N3    1 
ATOM   282  C C4    . DA  B 2 4   ? 23.432  34.595 30.964  1.00 22.21 ? 21   DA  T C4    1 
ATOM   283  P P     . DT  B 2 5   ? 24.306  34.666 24.633  1.00 22.61 ? 22   DT  T P     1 
ATOM   284  O OP1   . DT  B 2 5   ? 24.540  35.561 23.458  1.00 22.77 ? 22   DT  T OP1   1 
ATOM   285  O OP2   . DT  B 2 5   ? 24.083  33.217 24.422  1.00 22.91 ? 22   DT  T OP2   1 
ATOM   286  O "O5'" . DT  B 2 5   ? 25.538  34.846 25.609  1.00 22.22 ? 22   DT  T "O5'" 1 
ATOM   287  C "C5'" . DT  B 2 5   ? 25.777  36.121 26.192  1.00 24.28 ? 22   DT  T "C5'" 1 
ATOM   288  C "C4'" . DT  B 2 5   ? 27.016  36.091 27.049  1.00 25.23 ? 22   DT  T "C4'" 1 
ATOM   289  O "O4'" . DT  B 2 5   ? 26.748  35.612 28.383  1.00 24.99 ? 22   DT  T "O4'" 1 
ATOM   290  C "C3'" . DT  B 2 5   ? 28.196  35.288 26.520  1.00 26.18 ? 22   DT  T "C3'" 1 
ATOM   291  O "O3'" . DT  B 2 5   ? 29.346  36.116 26.524  1.00 28.49 ? 22   DT  T "O3'" 1 
ATOM   292  C "C2'" . DT  B 2 5   ? 28.327  34.132 27.502  1.00 25.87 ? 22   DT  T "C2'" 1 
ATOM   293  C "C1'" . DT  B 2 5   ? 27.750  34.707 28.791  1.00 24.68 ? 22   DT  T "C1'" 1 
ATOM   294  N N1    . DT  B 2 5   ? 27.113  33.737 29.709  1.00 23.51 ? 22   DT  T N1    1 
ATOM   295  C C2    . DT  B 2 5   ? 27.423  33.810 31.057  1.00 23.57 ? 22   DT  T C2    1 
ATOM   296  O O2    . DT  B 2 5   ? 28.219  34.616 31.518  1.00 23.59 ? 22   DT  T O2    1 
ATOM   297  N N3    . DT  B 2 5   ? 26.762  32.900 31.847  1.00 22.90 ? 22   DT  T N3    1 
ATOM   298  C C4    . DT  B 2 5   ? 25.849  31.950 31.432  1.00 23.24 ? 22   DT  T C4    1 
ATOM   299  O O4    . DT  B 2 5   ? 25.321  31.211 32.253  1.00 23.64 ? 22   DT  T O4    1 
ATOM   300  C C5    . DT  B 2 5   ? 25.586  31.921 30.004  1.00 22.76 ? 22   DT  T C5    1 
ATOM   301  C C7    . DT  B 2 5   ? 24.623  30.910 29.464  1.00 23.13 ? 22   DT  T C7    1 
ATOM   302  C C6    . DT  B 2 5   ? 26.223  32.804 29.230  1.00 22.39 ? 22   DT  T C6    1 
ATOM   303  P P     . DC  B 2 6   ? 30.659  35.642 25.746  1.00 30.02 ? 23   DC  T P     1 
ATOM   304  O OP1   . DC  B 2 6   ? 31.171  36.759 24.913  1.00 30.29 ? 23   DC  T OP1   1 
ATOM   305  O OP2   . DC  B 2 6   ? 30.357  34.333 25.123  1.00 30.44 ? 23   DC  T OP2   1 
ATOM   306  O "O5'" . DC  B 2 6   ? 31.693  35.400 26.923  1.00 29.47 ? 23   DC  T "O5'" 1 
ATOM   307  C "C5'" . DC  B 2 6   ? 31.797  36.333 28.000  1.00 28.54 ? 23   DC  T "C5'" 1 
ATOM   308  C "C4'" . DC  B 2 6   ? 32.530  35.690 29.151  1.00 28.47 ? 23   DC  T "C4'" 1 
ATOM   309  O "O4'" . DC  B 2 6   ? 31.643  34.872 29.954  1.00 27.89 ? 23   DC  T "O4'" 1 
ATOM   310  C "C3'" . DC  B 2 6   ? 33.669  34.778 28.702  1.00 28.43 ? 23   DC  T "C3'" 1 
ATOM   311  O "O3'" . DC  B 2 6   ? 34.845  35.038 29.441  1.00 30.34 ? 23   DC  T "O3'" 1 
ATOM   312  C "C2'" . DC  B 2 6   ? 33.162  33.377 28.992  1.00 28.37 ? 23   DC  T "C2'" 1 
ATOM   313  C "C1'" . DC  B 2 6   ? 32.249  33.606 30.177  1.00 28.22 ? 23   DC  T "C1'" 1 
ATOM   314  N N1    . DC  B 2 6   ? 31.181  32.608 30.387  1.00 27.41 ? 23   DC  T N1    1 
ATOM   315  C C2    . DC  B 2 6   ? 30.910  32.192 31.700  1.00 27.33 ? 23   DC  T C2    1 
ATOM   316  O O2    . DC  B 2 6   ? 31.585  32.659 32.623  1.00 28.53 ? 23   DC  T O2    1 
ATOM   317  N N3    . DC  B 2 6   ? 29.924  31.305 31.928  1.00 25.50 ? 23   DC  T N3    1 
ATOM   318  C C4    . DC  B 2 6   ? 29.206  30.841 30.909  1.00 26.53 ? 23   DC  T C4    1 
ATOM   319  N N4    . DC  B 2 6   ? 28.201  30.018 31.192  1.00 25.96 ? 23   DC  T N4    1 
ATOM   320  C C5    . DC  B 2 6   ? 29.475  31.222 29.551  1.00 26.56 ? 23   DC  T C5    1 
ATOM   321  C C6    . DC  B 2 6   ? 30.463  32.099 29.340  1.00 26.85 ? 23   DC  T C6    1 
ATOM   322  P P     . DA  B 2 7   ? 36.255  34.524 28.882  1.00 31.24 ? 24   DA  T P     1 
ATOM   323  O OP1   . DA  B 2 7   ? 37.109  35.684 28.534  1.00 32.41 ? 24   DA  T OP1   1 
ATOM   324  O OP2   . DA  B 2 7   ? 35.965  33.492 27.861  1.00 32.97 ? 24   DA  T OP2   1 
ATOM   325  O "O5'" . DA  B 2 7   ? 36.893  33.772 30.132  1.00 32.32 ? 24   DA  T "O5'" 1 
ATOM   326  C "C5'" . DA  B 2 7   ? 36.892  34.379 31.434  1.00 31.72 ? 24   DA  T "C5'" 1 
ATOM   327  C "C4'" . DA  B 2 7   ? 37.201  33.347 32.494  1.00 32.22 ? 24   DA  T "C4'" 1 
ATOM   328  O "O4'" . DA  B 2 7   ? 36.049  32.505 32.753  1.00 32.45 ? 24   DA  T "O4'" 1 
ATOM   329  C "C3'" . DA  B 2 7   ? 38.366  32.405 32.192  1.00 32.67 ? 24   DA  T "C3'" 1 
ATOM   330  O "O3'" . DA  B 2 7   ? 39.233  32.361 33.345  1.00 34.34 ? 24   DA  T "O3'" 1 
ATOM   331  C "C2'" . DA  B 2 7   ? 37.683  31.079 31.851  1.00 31.08 ? 24   DA  T "C2'" 1 
ATOM   332  C "C1'" . DA  B 2 7   ? 36.370  31.126 32.632  1.00 30.28 ? 24   DA  T "C1'" 1 
ATOM   333  N N9    . DA  B 2 7   ? 35.215  30.470 32.007  1.00 28.95 ? 24   DA  T N9    1 
ATOM   334  C C8    . DA  B 2 7   ? 34.790  30.606 30.706  1.00 28.16 ? 24   DA  T C8    1 
ATOM   335  N N7    . DA  B 2 7   ? 33.698  29.926 30.427  1.00 27.25 ? 24   DA  T N7    1 
ATOM   336  C C5    . DA  B 2 7   ? 33.378  29.296 31.621  1.00 27.31 ? 24   DA  T C5    1 
ATOM   337  C C6    . DA  B 2 7   ? 32.328  28.442 31.981  1.00 27.09 ? 24   DA  T C6    1 
ATOM   338  N N6    . DA  B 2 7   ? 31.366  28.074 31.143  1.00 26.94 ? 24   DA  T N6    1 
ATOM   339  N N1    . DA  B 2 7   ? 32.295  27.975 33.255  1.00 27.51 ? 24   DA  T N1    1 
ATOM   340  C C2    . DA  B 2 7   ? 33.259  28.361 34.099  1.00 26.60 ? 24   DA  T C2    1 
ATOM   341  N N3    . DA  B 2 7   ? 34.298  29.169 33.881  1.00 28.20 ? 24   DA  T N3    1 
ATOM   342  C C4    . DA  B 2 7   ? 34.306  29.611 32.606  1.00 28.53 ? 24   DA  T C4    1 
ATOM   343  P P     . DT  B 2 8   ? 40.605  31.512 33.305  1.00 34.77 ? 25   DT  T P     1 
ATOM   344  O OP1   . DT  B 2 8   ? 41.716  32.324 33.896  1.00 34.24 ? 25   DT  T OP1   1 
ATOM   345  O OP2   . DT  B 2 8   ? 40.730  30.969 31.915  1.00 35.29 ? 25   DT  T OP2   1 
ATOM   346  O "O5'" . DT  B 2 8   ? 40.280  30.303 34.273  1.00 33.06 ? 25   DT  T "O5'" 1 
ATOM   347  C "C5'" . DT  B 2 8   ? 38.972  29.785 34.277  1.00 33.31 ? 25   DT  T "C5'" 1 
ATOM   348  C "C4'" . DT  B 2 8   ? 38.800  28.788 35.386  1.00 33.26 ? 25   DT  T "C4'" 1 
ATOM   349  O "O4'" . DT  B 2 8   ? 37.538  28.151 35.128  1.00 33.98 ? 25   DT  T "O4'" 1 
ATOM   350  C "C3'" . DT  B 2 8   ? 39.833  27.674 35.366  1.00 33.97 ? 25   DT  T "C3'" 1 
ATOM   351  O "O3'" . DT  B 2 8   ? 39.974  27.201 36.706  1.00 35.90 ? 25   DT  T "O3'" 1 
ATOM   352  C "C2'" . DT  B 2 8   ? 39.214  26.632 34.449  1.00 32.67 ? 25   DT  T "C2'" 1 
ATOM   353  C "C1'" . DT  B 2 8   ? 37.717  26.841 34.612  1.00 32.95 ? 25   DT  T "C1'" 1 
ATOM   354  N N1    . DT  B 2 8   ? 36.926  26.757 33.369  1.00 31.71 ? 25   DT  T N1    1 
ATOM   355  C C2    . DT  B 2 8   ? 35.701  26.138 33.437  1.00 31.25 ? 25   DT  T C2    1 
ATOM   356  O O2    . DT  B 2 8   ? 35.278  25.593 34.443  1.00 32.11 ? 25   DT  T O2    1 
ATOM   357  N N3    . DT  B 2 8   ? 34.981  26.168 32.271  1.00 31.09 ? 25   DT  T N3    1 
ATOM   358  C C4    . DT  B 2 8   ? 35.359  26.715 31.071  1.00 29.68 ? 25   DT  T C4    1 
ATOM   359  O O4    . DT  B 2 8   ? 34.594  26.667 30.128  1.00 31.29 ? 25   DT  T O4    1 
ATOM   360  C C5    . DT  B 2 8   ? 36.670  27.315 31.049  1.00 29.70 ? 25   DT  T C5    1 
ATOM   361  C C7    . DT  B 2 8   ? 37.170  27.917 29.776  1.00 28.83 ? 25   DT  T C7    1 
ATOM   362  C C6    . DT  B 2 8   ? 37.385  27.309 32.185  1.00 30.58 ? 25   DT  T C6    1 
ATOM   363  P P     . DG  B 2 9   ? 41.112  26.127 37.064  1.00 37.70 ? 26   DG  T P     1 
ATOM   364  O OP1   . DG  B 2 9   ? 41.167  25.990 38.554  1.00 37.72 ? 26   DG  T OP1   1 
ATOM   365  O OP2   . DG  B 2 9   ? 42.342  26.496 36.315  1.00 35.58 ? 26   DG  T OP2   1 
ATOM   366  O "O5'" . DG  B 2 9   ? 40.490  24.769 36.526  1.00 39.02 ? 26   DG  T "O5'" 1 
ATOM   367  C "C5'" . DG  B 2 9   ? 39.381  24.160 37.216  1.00 42.26 ? 26   DG  T "C5'" 1 
ATOM   368  C "C4'" . DG  B 2 9   ? 39.002  22.863 36.541  1.00 45.49 ? 26   DG  T "C4'" 1 
ATOM   369  O "O4'" . DG  B 2 9   ? 38.246  23.107 35.329  1.00 45.25 ? 26   DG  T "O4'" 1 
ATOM   370  C "C3'" . DG  B 2 9   ? 40.188  21.977 36.135  1.00 47.55 ? 26   DG  T "C3'" 1 
ATOM   371  O "O3'" . DG  B 2 9   ? 39.798  20.610 36.293  1.00 52.81 ? 26   DG  T "O3'" 1 
ATOM   372  C "C2'" . DG  B 2 9   ? 40.310  22.225 34.642  1.00 45.74 ? 26   DG  T "C2'" 1 
ATOM   373  C "C1'" . DG  B 2 9   ? 38.845  22.368 34.278  1.00 44.23 ? 26   DG  T "C1'" 1 
ATOM   374  N N9    . DG  B 2 9   ? 38.497  22.998 33.009  1.00 42.51 ? 26   DG  T N9    1 
ATOM   375  C C8    . DG  B 2 9   ? 39.239  23.878 32.250  1.00 41.27 ? 26   DG  T C8    1 
ATOM   376  N N7    . DG  B 2 9   ? 38.629  24.240 31.151  1.00 40.26 ? 26   DG  T N7    1 
ATOM   377  C C5    . DG  B 2 9   ? 37.416  23.563 31.192  1.00 39.72 ? 26   DG  T C5    1 
ATOM   378  C C6    . DG  B 2 9   ? 36.336  23.559 30.282  1.00 39.82 ? 26   DG  T C6    1 
ATOM   379  O O6    . DG  B 2 9   ? 36.233  24.169 29.218  1.00 40.56 ? 26   DG  T O6    1 
ATOM   380  N N1    . DG  B 2 9   ? 35.295  22.734 30.718  1.00 39.42 ? 26   DG  T N1    1 
ATOM   381  C C2    . DG  B 2 9   ? 35.303  22.007 31.889  1.00 38.56 ? 26   DG  T C2    1 
ATOM   382  N N2    . DG  B 2 9   ? 34.214  21.290 32.158  1.00 36.46 ? 26   DG  T N2    1 
ATOM   383  N N3    . DG  B 2 9   ? 36.309  21.996 32.736  1.00 38.96 ? 26   DG  T N3    1 
ATOM   384  C C4    . DG  B 2 9   ? 37.323  22.793 32.331  1.00 40.46 ? 26   DG  T C4    1 
ATOM   385  P P     . DC  B 2 10  ? 40.562  19.652 37.342  1.00 56.77 ? 27   DC  T P     1 
ATOM   386  O OP1   . DC  B 2 10  ? 40.263  20.119 38.734  1.00 55.25 ? 27   DC  T OP1   1 
ATOM   387  O OP2   . DC  B 2 10  ? 41.980  19.537 36.885  1.00 56.10 ? 27   DC  T OP2   1 
ATOM   388  O "O5'" . DC  B 2 10  ? 39.817  18.258 37.116  1.00 57.77 ? 27   DC  T "O5'" 1 
ATOM   389  C "C5'" . DC  B 2 10  ? 38.392  18.128 37.392  1.00 60.15 ? 27   DC  T "C5'" 1 
ATOM   390  C "C4'" . DC  B 2 10  ? 37.683  17.360 36.292  1.00 61.08 ? 27   DC  T "C4'" 1 
ATOM   391  O "O4'" . DC  B 2 10  ? 37.503  18.171 35.103  1.00 61.12 ? 27   DC  T "O4'" 1 
ATOM   392  C "C3'" . DC  B 2 10  ? 38.339  16.054 35.829  1.00 61.68 ? 27   DC  T "C3'" 1 
ATOM   393  O "O3'" . DC  B 2 10  ? 37.320  15.050 35.612  1.00 62.93 ? 27   DC  T "O3'" 1 
ATOM   394  C "C2'" . DC  B 2 10  ? 38.958  16.422 34.488  1.00 61.04 ? 27   DC  T "C2'" 1 
ATOM   395  C "C1'" . DC  B 2 10  ? 37.992  17.477 33.958  1.00 60.46 ? 27   DC  T "C1'" 1 
ATOM   396  N N1    . DC  B 2 10  ? 38.588  18.468 33.037  1.00 58.91 ? 27   DC  T N1    1 
ATOM   397  C C2    . DC  B 2 10  ? 37.766  19.066 32.057  1.00 57.62 ? 27   DC  T C2    1 
ATOM   398  O O2    . DC  B 2 10  ? 36.570  18.740 31.997  1.00 56.93 ? 27   DC  T O2    1 
ATOM   399  N N3    . DC  B 2 10  ? 38.302  19.979 31.207  1.00 57.05 ? 27   DC  T N3    1 
ATOM   400  C C4    . DC  B 2 10  ? 39.598  20.301 31.304  1.00 57.30 ? 27   DC  T C4    1 
ATOM   401  N N4    . DC  B 2 10  ? 40.086  21.211 30.454  1.00 56.41 ? 27   DC  T N4    1 
ATOM   402  C C5    . DC  B 2 10  ? 40.457  19.705 32.284  1.00 57.99 ? 27   DC  T C5    1 
ATOM   403  C C6    . DC  B 2 10  ? 39.914  18.803 33.123  1.00 58.46 ? 27   DC  T C6    1 
ATOM   404  N N     . ALA C 3 1   ? 10.462  5.164  3.926   1.00 42.51 ? 297  ALA A N     1 
ATOM   405  C CA    . ALA C 3 1   ? 9.778   5.396  2.624   1.00 43.03 ? 297  ALA A CA    1 
ATOM   406  C C     . ALA C 3 1   ? 9.801   6.877  2.189   1.00 42.78 ? 297  ALA A C     1 
ATOM   407  O O     . ALA C 3 1   ? 8.955   7.686  2.626   1.00 43.02 ? 297  ALA A O     1 
ATOM   408  C CB    . ALA C 3 1   ? 8.335   4.881  2.701   1.00 42.88 ? 297  ALA A CB    1 
ATOM   409  N N     . ALA C 3 2   ? 10.772  7.208  1.324   1.00 41.42 ? 298  ALA A N     1 
ATOM   410  C CA    . ALA C 3 2   ? 10.956  8.567  0.792   1.00 39.24 ? 298  ALA A CA    1 
ATOM   411  C C     . ALA C 3 2   ? 9.632   9.231  0.412   1.00 37.00 ? 298  ALA A C     1 
ATOM   412  O O     . ALA C 3 2   ? 8.638   8.569  0.089   1.00 37.83 ? 298  ALA A O     1 
ATOM   413  C CB    . ALA C 3 2   ? 11.905  8.547  -0.426  1.00 38.60 ? 298  ALA A CB    1 
ATOM   414  N N     . MET C 3 3   ? 9.629   10.554 0.471   1.00 33.68 ? 299  MET A N     1 
ATOM   415  C CA    . MET C 3 3   ? 8.446   11.343 0.151   1.00 30.16 ? 299  MET A CA    1 
ATOM   416  C C     . MET C 3 3   ? 8.597   11.935 -1.254  1.00 28.40 ? 299  MET A C     1 
ATOM   417  O O     . MET C 3 3   ? 9.669   12.395 -1.648  1.00 27.55 ? 299  MET A O     1 
ATOM   418  C CB    . MET C 3 3   ? 8.278   12.463 1.191   1.00 28.55 ? 299  MET A CB    1 
ATOM   419  C CG    . MET C 3 3   ? 7.102   13.390 0.959   1.00 26.95 ? 299  MET A CG    1 
ATOM   420  S SD    . MET C 3 3   ? 6.984   14.616 2.280   1.00 24.99 ? 299  MET A SD    1 
ATOM   421  C CE    . MET C 3 3   ? 6.027   13.701 3.564   1.00 24.04 ? 299  MET A CE    1 
ATOM   422  N N     . ALA C 3 4   ? 7.509   11.920 -2.002  1.00 26.76 ? 300  ALA A N     1 
ATOM   423  C CA    . ALA C 3 4   ? 7.526   12.443 -3.346  1.00 26.17 ? 300  ALA A CA    1 
ATOM   424  C C     . ALA C 3 4   ? 7.518   13.976 -3.411  1.00 26.19 ? 300  ALA A C     1 
ATOM   425  O O     . ALA C 3 4   ? 6.826   14.656 -2.638  1.00 26.58 ? 300  ALA A O     1 
ATOM   426  C CB    . ALA C 3 4   ? 6.342   11.896 -4.107  1.00 26.15 ? 300  ALA A CB    1 
ATOM   427  N N     . PHE C 3 5   ? 8.297   14.507 -4.347  1.00 25.23 ? 301  PHE A N     1 
ATOM   428  C CA    . PHE C 3 5   ? 8.370   15.942 -4.577  1.00 24.50 ? 301  PHE A CA    1 
ATOM   429  C C     . PHE C 3 5   ? 9.129   16.237 -5.877  1.00 24.39 ? 301  PHE A C     1 
ATOM   430  O O     . PHE C 3 5   ? 9.939   15.430 -6.327  1.00 24.09 ? 301  PHE A O     1 
ATOM   431  C CB    . PHE C 3 5   ? 9.062   16.638 -3.400  1.00 21.80 ? 301  PHE A CB    1 
ATOM   432  C CG    . PHE C 3 5   ? 10.510  16.300 -3.267  1.00 19.46 ? 301  PHE A CG    1 
ATOM   433  C CD1   . PHE C 3 5   ? 10.913  15.228 -2.486  1.00 19.20 ? 301  PHE A CD1   1 
ATOM   434  C CD2   . PHE C 3 5   ? 11.474  17.074 -3.890  1.00 18.88 ? 301  PHE A CD2   1 
ATOM   435  C CE1   . PHE C 3 5   ? 12.256  14.928 -2.326  1.00 18.83 ? 301  PHE A CE1   1 
ATOM   436  C CE2   . PHE C 3 5   ? 12.818  16.787 -3.737  1.00 18.62 ? 301  PHE A CE2   1 
ATOM   437  C CZ    . PHE C 3 5   ? 13.214  15.704 -2.948  1.00 19.37 ? 301  PHE A CZ    1 
ATOM   438  N N     . THR C 3 6   ? 8.852   17.386 -6.480  1.00 24.59 ? 302  THR A N     1 
ATOM   439  C CA    . THR C 3 6   ? 9.548   17.788 -7.687  1.00 25.29 ? 302  THR A CA    1 
ATOM   440  C C     . THR C 3 6   ? 10.803  18.563 -7.306  1.00 26.01 ? 302  THR A C     1 
ATOM   441  O O     . THR C 3 6   ? 10.742  19.507 -6.521  1.00 26.27 ? 302  THR A O     1 
ATOM   442  C CB    . THR C 3 6   ? 8.668   18.697 -8.528  1.00 25.30 ? 302  THR A CB    1 
ATOM   443  O OG1   . THR C 3 6   ? 7.444   18.022 -8.806  1.00 25.72 ? 302  THR A OG1   1 
ATOM   444  C CG2   . THR C 3 6   ? 9.367   19.097 -9.818  1.00 24.85 ? 302  THR A CG2   1 
ATOM   445  N N     . LEU C 3 7   ? 11.950  18.154 -7.818  1.00 27.24 ? 303  LEU A N     1 
ATOM   446  C CA    . LEU C 3 7   ? 13.158  18.901 -7.533  1.00 29.80 ? 303  LEU A CA    1 
ATOM   447  C C     . LEU C 3 7   ? 13.261  19.892 -8.689  1.00 31.03 ? 303  LEU A C     1 
ATOM   448  O O     . LEU C 3 7   ? 13.952  19.631 -9.659  1.00 32.34 ? 303  LEU A O     1 
ATOM   449  C CB    . LEU C 3 7   ? 14.388  17.991 -7.498  1.00 29.35 ? 303  LEU A CB    1 
ATOM   450  C CG    . LEU C 3 7   ? 15.461  18.366 -6.470  1.00 29.47 ? 303  LEU A CG    1 
ATOM   451  C CD1   . LEU C 3 7   ? 16.298  17.165 -6.193  1.00 29.86 ? 303  LEU A CD1   1 
ATOM   452  C CD2   . LEU C 3 7   ? 16.331  19.523 -6.971  1.00 30.37 ? 303  LEU A CD2   1 
ATOM   453  N N     . ALA C 3 8   ? 12.562  21.019 -8.575  1.00 32.18 ? 304  ALA A N     1 
ATOM   454  C CA    . ALA C 3 8   ? 12.525  22.052 -9.617  1.00 33.50 ? 304  ALA A CA    1 
ATOM   455  C C     . ALA C 3 8   ? 13.845  22.726 -10.017 1.00 34.56 ? 304  ALA A C     1 
ATOM   456  O O     . ALA C 3 8   ? 14.712  22.989 -9.180  1.00 35.23 ? 304  ALA A O     1 
ATOM   457  C CB    . ALA C 3 8   ? 11.507  23.123 -9.231  1.00 32.69 ? 304  ALA A CB    1 
ATOM   458  N N     . ASP C 3 9   ? 13.970  22.999 -11.322 1.00 36.13 ? 305  ASP A N     1 
ATOM   459  C CA    . ASP C 3 9   ? 15.137  23.668 -11.914 1.00 36.66 ? 305  ASP A CA    1 
ATOM   460  C C     . ASP C 3 9   ? 14.732  25.106 -12.218 1.00 36.31 ? 305  ASP A C     1 
ATOM   461  O O     . ASP C 3 9   ? 15.579  25.976 -12.407 1.00 36.96 ? 305  ASP A O     1 
ATOM   462  C CB    . ASP C 3 9   ? 15.572  22.956 -13.204 1.00 38.45 ? 305  ASP A CB    1 
ATOM   463  C CG    . ASP C 3 9   ? 16.277  21.616 -12.928 1.00 41.49 ? 305  ASP A CG    1 
ATOM   464  O OD1   . ASP C 3 9   ? 17.371  21.613 -12.310 1.00 42.08 ? 305  ASP A OD1   1 
ATOM   465  O OD2   . ASP C 3 9   ? 15.732  20.554 -13.322 1.00 43.79 ? 305  ASP A OD2   1 
ATOM   466  N N     . ARG C 3 10  ? 13.421  25.335 -12.245 1.00 35.96 ? 306  ARG A N     1 
ATOM   467  C CA    . ARG C 3 10  ? 12.836  26.648 -12.492 1.00 35.46 ? 306  ARG A CA    1 
ATOM   468  C C     . ARG C 3 10  ? 11.470  26.786 -11.780 1.00 32.70 ? 306  ARG A C     1 
ATOM   469  O O     . ARG C 3 10  ? 10.746  25.811 -11.624 1.00 31.29 ? 306  ARG A O     1 
ATOM   470  C CB    . ARG C 3 10  ? 12.657  26.850 -13.996 1.00 39.32 ? 306  ARG A CB    1 
ATOM   471  C CG    . ARG C 3 10  ? 12.859  28.291 -14.468 1.00 44.66 ? 306  ARG A CG    1 
ATOM   472  C CD    . ARG C 3 10  ? 14.297  28.793 -14.223 1.00 48.86 ? 306  ARG A CD    1 
ATOM   473  N NE    . ARG C 3 10  ? 15.047  29.002 -15.468 1.00 52.44 ? 306  ARG A NE    1 
ATOM   474  C CZ    . ARG C 3 10  ? 16.344  28.729 -15.614 1.00 54.15 ? 306  ARG A CZ    1 
ATOM   475  N NH1   . ARG C 3 10  ? 17.034  28.232 -14.582 1.00 55.09 ? 306  ARG A NH1   1 
ATOM   476  N NH2   . ARG C 3 10  ? 16.952  28.958 -16.783 1.00 54.42 ? 306  ARG A NH2   1 
ATOM   477  N N     . VAL C 3 11  ? 11.134  28.003 -11.357 1.00 30.13 ? 307  VAL A N     1 
ATOM   478  C CA    . VAL C 3 11  ? 9.867   28.290 -10.678 1.00 28.05 ? 307  VAL A CA    1 
ATOM   479  C C     . VAL C 3 11  ? 8.692   28.202 -11.647 1.00 27.94 ? 307  VAL A C     1 
ATOM   480  O O     . VAL C 3 11  ? 8.768   28.702 -12.772 1.00 26.97 ? 307  VAL A O     1 
ATOM   481  C CB    . VAL C 3 11  ? 9.849   29.736 -10.088 1.00 26.91 ? 307  VAL A CB    1 
ATOM   482  C CG1   . VAL C 3 11  ? 8.460   30.051 -9.517  1.00 24.64 ? 307  VAL A CG1   1 
ATOM   483  C CG2   . VAL C 3 11  ? 10.955  29.908 -9.056  1.00 25.69 ? 307  VAL A CG2   1 
ATOM   484  N N     . THR C 3 12  ? 7.597   27.591 -11.212 1.00 27.65 ? 308  THR A N     1 
ATOM   485  C CA    . THR C 3 12  ? 6.424   27.492 -12.067 1.00 27.55 ? 308  THR A CA    1 
ATOM   486  C C     . THR C 3 12  ? 5.230   28.103 -11.381 1.00 28.52 ? 308  THR A C     1 
ATOM   487  O O     . THR C 3 12  ? 5.208   28.274 -10.160 1.00 28.78 ? 308  THR A O     1 
ATOM   488  C CB    . THR C 3 12  ? 6.065   26.045 -12.420 1.00 26.86 ? 308  THR A CB    1 
ATOM   489  O OG1   . THR C 3 12  ? 5.655   25.348 -11.236 1.00 26.54 ? 308  THR A OG1   1 
ATOM   490  C CG2   . THR C 3 12  ? 7.251   25.352 -13.063 1.00 25.25 ? 308  THR A CG2   1 
ATOM   491  N N     . GLU C 3 13  ? 4.233   28.439 -12.183 1.00 28.95 ? 309  GLU A N     1 
ATOM   492  C CA    . GLU C 3 13  ? 3.021   29.042 -11.663 1.00 30.16 ? 309  GLU A CA    1 
ATOM   493  C C     . GLU C 3 13  ? 2.421   28.174 -10.558 1.00 28.81 ? 309  GLU A C     1 
ATOM   494  O O     . GLU C 3 13  ? 1.851   28.680 -9.599  1.00 28.26 ? 309  GLU A O     1 
ATOM   495  C CB    . GLU C 3 13  ? 2.025   29.231 -12.813 1.00 32.35 ? 309  GLU A CB    1 
ATOM   496  C CG    . GLU C 3 13  ? 0.586   29.415 -12.397 1.00 36.79 ? 309  GLU A CG    1 
ATOM   497  C CD    . GLU C 3 13  ? 0.146   30.873 -12.451 1.00 40.29 ? 309  GLU A CD    1 
ATOM   498  O OE1   . GLU C 3 13  ? 0.711   31.693 -11.675 1.00 42.11 ? 309  GLU A OE1   1 
ATOM   499  O OE2   . GLU C 3 13  ? -0.761  31.193 -13.267 1.00 41.54 ? 309  GLU A OE2   1 
ATOM   500  N N     . GLU C 3 14  ? 2.575   26.864 -10.709 1.00 28.01 ? 310  GLU A N     1 
ATOM   501  C CA    . GLU C 3 14  ? 2.064   25.872 -9.767  1.00 26.94 ? 310  GLU A CA    1 
ATOM   502  C C     . GLU C 3 14  ? 2.601   26.097 -8.360  1.00 25.57 ? 310  GLU A C     1 
ATOM   503  O O     . GLU C 3 14  ? 1.934   25.806 -7.369  1.00 24.12 ? 310  GLU A O     1 
ATOM   504  C CB    . GLU C 3 14  ? 2.480   24.474 -10.225 1.00 27.30 ? 310  GLU A CB    1 
ATOM   505  C CG    . GLU C 3 14  ? 1.350   23.663 -10.764 1.00 28.50 ? 310  GLU A CG    1 
ATOM   506  C CD    . GLU C 3 14  ? 1.640   22.190 -10.726 1.00 28.58 ? 310  GLU A CD    1 
ATOM   507  O OE1   . GLU C 3 14  ? 2.814   21.809 -10.539 1.00 30.08 ? 310  GLU A OE1   1 
ATOM   508  O OE2   . GLU C 3 14  ? 0.684   21.411 -10.885 1.00 30.87 ? 310  GLU A OE2   1 
ATOM   509  N N     . MET C 3 15  ? 3.823   26.600 -8.302  1.00 24.34 ? 311  MET A N     1 
ATOM   510  C CA    . MET C 3 15  ? 4.491   26.863 -7.046  1.00 23.92 ? 311  MET A CA    1 
ATOM   511  C C     . MET C 3 15  ? 4.105   28.186 -6.429  1.00 23.56 ? 311  MET A C     1 
ATOM   512  O O     . MET C 3 15  ? 4.559   28.498 -5.329  1.00 24.39 ? 311  MET A O     1 
ATOM   513  C CB    . MET C 3 15  ? 5.992   26.843 -7.258  1.00 23.34 ? 311  MET A CB    1 
ATOM   514  C CG    . MET C 3 15  ? 6.441   25.692 -8.116  1.00 23.80 ? 311  MET A CG    1 
ATOM   515  S SD    . MET C 3 15  ? 8.191   25.742 -8.323  1.00 26.17 ? 311  MET A SD    1 
ATOM   516  C CE    . MET C 3 15  ? 8.460   24.324 -9.344  1.00 24.65 ? 311  MET A CE    1 
ATOM   517  N N     . LEU C 3 16  ? 3.264   28.954 -7.116  1.00 22.91 ? 312  LEU A N     1 
ATOM   518  C CA    . LEU C 3 16  ? 2.855   30.270 -6.609  1.00 23.35 ? 312  LEU A CA    1 
ATOM   519  C C     . LEU C 3 16  ? 1.378   30.372 -6.217  1.00 23.22 ? 312  LEU A C     1 
ATOM   520  O O     . LEU C 3 16  ? 0.731   31.399 -6.433  1.00 23.08 ? 312  LEU A O     1 
ATOM   521  C CB    . LEU C 3 16  ? 3.202   31.364 -7.638  1.00 22.04 ? 312  LEU A CB    1 
ATOM   522  C CG    . LEU C 3 16  ? 4.588   31.233 -8.263  1.00 21.89 ? 312  LEU A CG    1 
ATOM   523  C CD1   . LEU C 3 16  ? 4.823   32.372 -9.213  1.00 22.73 ? 312  LEU A CD1   1 
ATOM   524  C CD2   . LEU C 3 16  ? 5.637   31.217 -7.188  1.00 21.06 ? 312  LEU A CD2   1 
ATOM   525  N N     . ALA C 3 17  ? 0.868   29.315 -5.592  1.00 23.34 ? 313  ALA A N     1 
ATOM   526  C CA    . ALA C 3 17  ? -0.519  29.258 -5.184  1.00 22.94 ? 313  ALA A CA    1 
ATOM   527  C C     . ALA C 3 17  ? -0.848  30.157 -4.003  1.00 23.00 ? 313  ALA A C     1 
ATOM   528  O O     . ALA C 3 17  ? 0.024   30.626 -3.286  1.00 23.64 ? 313  ALA A O     1 
ATOM   529  C CB    . ALA C 3 17  ? -0.908  27.807 -4.869  1.00 22.69 ? 313  ALA A CB    1 
ATOM   530  N N     . ASP C 3 18  ? -2.143  30.362 -3.838  1.00 23.62 ? 314  ASP A N     1 
ATOM   531  C CA    . ASP C 3 18  ? -2.773  31.163 -2.795  1.00 25.40 ? 314  ASP A CA    1 
ATOM   532  C C     . ASP C 3 18  ? -2.430  30.792 -1.358  1.00 24.26 ? 314  ASP A C     1 
ATOM   533  O O     . ASP C 3 18  ? -2.612  31.602 -0.455  1.00 23.48 ? 314  ASP A O     1 
ATOM   534  C CB    . ASP C 3 18  ? -4.292  31.027 -2.922  1.00 28.29 ? 314  ASP A CB    1 
ATOM   535  C CG    . ASP C 3 18  ? -4.925  32.224 -3.564  1.00 32.59 ? 314  ASP A CG    1 
ATOM   536  O OD1   . ASP C 3 18  ? -4.177  33.049 -4.148  1.00 35.38 ? 314  ASP A OD1   1 
ATOM   537  O OD2   . ASP C 3 18  ? -6.171  32.342 -3.488  1.00 34.20 ? 314  ASP A OD2   1 
ATOM   538  N N     . LYS C 3 19  ? -2.016  29.550 -1.147  1.00 22.89 ? 315  LYS A N     1 
ATOM   539  C CA    . LYS C 3 19  ? -1.700  29.060 0.188   1.00 22.58 ? 315  LYS A CA    1 
ATOM   540  C C     . LYS C 3 19  ? -0.708  27.952 0.073   1.00 21.13 ? 315  LYS A C     1 
ATOM   541  O O     . LYS C 3 19  ? -0.875  27.048 -0.731  1.00 21.99 ? 315  LYS A O     1 
ATOM   542  C CB    . LYS C 3 19  ? -2.947  28.522 0.898   1.00 22.13 ? 315  LYS A CB    1 
ATOM   543  C CG    . LYS C 3 19  ? -2.793  28.479 2.441   1.00 23.76 ? 315  LYS A CG    1 
ATOM   544  C CD    . LYS C 3 19  ? -3.712  27.430 3.049   1.00 25.30 ? 315  LYS A CD    1 
ATOM   545  C CE    . LYS C 3 19  ? -3.558  27.284 4.573   1.00 26.22 ? 315  LYS A CE    1 
ATOM   546  N NZ    . LYS C 3 19  ? -3.115  28.523 5.268   1.00 26.38 ? 315  LYS A NZ    1 
ATOM   547  N N     . ALA C 3 20  ? 0.317   28.016 0.898   1.00 19.59 ? 316  ALA A N     1 
ATOM   548  C CA    . ALA C 3 20  ? 1.343   27.010 0.865   1.00 18.46 ? 316  ALA A CA    1 
ATOM   549  C C     . ALA C 3 20  ? 2.109   26.945 2.180   1.00 18.03 ? 316  ALA A C     1 
ATOM   550  O O     . ALA C 3 20  ? 2.100   27.897 2.978   1.00 17.81 ? 316  ALA A O     1 
ATOM   551  C CB    . ALA C 3 20  ? 2.316   27.335 -0.274  1.00 16.45 ? 316  ALA A CB    1 
ATOM   552  N N     . ALA C 3 21  ? 2.767   25.810 2.399   1.00 17.21 ? 317  ALA A N     1 
ATOM   553  C CA    . ALA C 3 21  ? 3.642   25.644 3.545   1.00 16.52 ? 317  ALA A CA    1 
ATOM   554  C C     . ALA C 3 21  ? 4.957   26.043 2.868   1.00 17.09 ? 317  ALA A C     1 
ATOM   555  O O     . ALA C 3 21  ? 5.278   25.534 1.776   1.00 17.33 ? 317  ALA A O     1 
ATOM   556  C CB    . ALA C 3 21  ? 3.691   24.173 4.011   1.00 14.77 ? 317  ALA A CB    1 
ATOM   557  N N     . LEU C 3 22  ? 5.704   26.969 3.477   1.00 17.26 ? 318  LEU A N     1 
ATOM   558  C CA    . LEU C 3 22  ? 6.965   27.434 2.894   1.00 16.48 ? 318  LEU A CA    1 
ATOM   559  C C     . LEU C 3 22  ? 8.145   27.240 3.815   1.00 16.17 ? 318  LEU A C     1 
ATOM   560  O O     . LEU C 3 22  ? 8.065   27.530 5.012   1.00 17.39 ? 318  LEU A O     1 
ATOM   561  C CB    . LEU C 3 22  ? 6.873   28.930 2.497   1.00 15.96 ? 318  LEU A CB    1 
ATOM   562  C CG    . LEU C 3 22  ? 8.197   29.604 2.076   1.00 15.74 ? 318  LEU A CG    1 
ATOM   563  C CD1   . LEU C 3 22  ? 8.699   29.032 0.728   1.00 13.81 ? 318  LEU A CD1   1 
ATOM   564  C CD2   . LEU C 3 22  ? 7.995   31.120 2.000   1.00 14.72 ? 318  LEU A CD2   1 
ATOM   565  N N     . VAL C 3 23  ? 9.239   26.739 3.255   1.00 16.14 ? 319  VAL A N     1 
ATOM   566  C CA    . VAL C 3 23  ? 10.467  26.541 4.007   1.00 16.27 ? 319  VAL A CA    1 
ATOM   567  C C     . VAL C 3 23  ? 11.563  27.307 3.299   1.00 17.37 ? 319  VAL A C     1 
ATOM   568  O O     . VAL C 3 23  ? 11.839  27.049 2.124   1.00 17.89 ? 319  VAL A O     1 
ATOM   569  C CB    . VAL C 3 23  ? 10.907  25.036 4.086   1.00 14.86 ? 319  VAL A CB    1 
ATOM   570  C CG1   . VAL C 3 23  ? 12.318  24.923 4.620   1.00 12.81 ? 319  VAL A CG1   1 
ATOM   571  C CG2   . VAL C 3 23  ? 9.966   24.271 4.981   1.00 13.96 ? 319  VAL A CG2   1 
ATOM   572  N N     . VAL C 3 24  ? 12.162  28.265 4.009   1.00 16.65 ? 320  VAL A N     1 
ATOM   573  C CA    . VAL C 3 24  ? 13.274  29.050 3.488   1.00 16.19 ? 320  VAL A CA    1 
ATOM   574  C C     . VAL C 3 24  ? 14.414  28.760 4.469   1.00 16.66 ? 320  VAL A C     1 
ATOM   575  O O     . VAL C 3 24  ? 14.616  29.475 5.450   1.00 17.58 ? 320  VAL A O     1 
ATOM   576  C CB    . VAL C 3 24  ? 12.918  30.563 3.433   1.00 14.64 ? 320  VAL A CB    1 
ATOM   577  C CG1   . VAL C 3 24  ? 14.082  31.342 2.882   1.00 14.32 ? 320  VAL A CG1   1 
ATOM   578  C CG2   . VAL C 3 24  ? 11.701  30.766 2.563   1.00 13.96 ? 320  VAL A CG2   1 
ATOM   579  N N     . GLU C 3 25  ? 15.181  27.715 4.186   1.00 16.64 ? 321  GLU A N     1 
ATOM   580  C CA    . GLU C 3 25  ? 16.218  27.260 5.094   1.00 16.51 ? 321  GLU A CA    1 
ATOM   581  C C     . GLU C 3 25  ? 17.514  28.026 5.301   1.00 17.56 ? 321  GLU A C     1 
ATOM   582  O O     . GLU C 3 25  ? 18.329  28.170 4.397   1.00 18.51 ? 321  GLU A O     1 
ATOM   583  C CB    . GLU C 3 25  ? 16.544  25.788 4.780   1.00 16.43 ? 321  GLU A CB    1 
ATOM   584  C CG    . GLU C 3 25  ? 17.229  25.023 5.929   1.00 17.20 ? 321  GLU A CG    1 
ATOM   585  C CD    . GLU C 3 25  ? 16.249  24.370 6.906   1.00 16.82 ? 321  GLU A CD    1 
ATOM   586  O OE1   . GLU C 3 25  ? 15.069  24.719 6.913   1.00 17.55 ? 321  GLU A OE1   1 
ATOM   587  O OE2   . GLU C 3 25  ? 16.656  23.494 7.678   1.00 18.97 ? 321  GLU A OE2   1 
ATOM   588  N N     . VAL C 3 26  ? 17.707  28.486 6.536   1.00 18.04 ? 322  VAL A N     1 
ATOM   589  C CA    . VAL C 3 26  ? 18.909  29.198 6.956   1.00 17.46 ? 322  VAL A CA    1 
ATOM   590  C C     . VAL C 3 26  ? 19.408  28.305 8.076   1.00 18.63 ? 322  VAL A C     1 
ATOM   591  O O     . VAL C 3 26  ? 18.818  28.251 9.160   1.00 17.93 ? 322  VAL A O     1 
ATOM   592  C CB    . VAL C 3 26  ? 18.586  30.616 7.515   1.00 17.08 ? 322  VAL A CB    1 
ATOM   593  C CG1   . VAL C 3 26  ? 19.876  31.304 7.960   1.00 16.55 ? 322  VAL A CG1   1 
ATOM   594  C CG2   . VAL C 3 26  ? 17.844  31.431 6.455   1.00 13.89 ? 322  VAL A CG2   1 
ATOM   595  N N     . VAL C 3 27  ? 20.496  27.601 7.802   1.00 19.44 ? 323  VAL A N     1 
ATOM   596  C CA    . VAL C 3 27  ? 21.063  26.656 8.746   1.00 19.62 ? 323  VAL A CA    1 
ATOM   597  C C     . VAL C 3 27  ? 21.958  27.251 9.829   1.00 20.24 ? 323  VAL A C     1 
ATOM   598  O O     . VAL C 3 27  ? 22.015  26.690 10.915  1.00 20.99 ? 323  VAL A O     1 
ATOM   599  C CB    . VAL C 3 27  ? 21.791  25.530 7.961   1.00 18.75 ? 323  VAL A CB    1 
ATOM   600  C CG1   . VAL C 3 27  ? 22.520  24.586 8.917   1.00 18.82 ? 323  VAL A CG1   1 
ATOM   601  C CG2   . VAL C 3 27  ? 20.754  24.768 7.112   1.00 18.25 ? 323  VAL A CG2   1 
ATOM   602  N N     . GLU C 3 28  ? 22.651  28.360 9.554   1.00 21.03 ? 324  GLU A N     1 
ATOM   603  C CA    . GLU C 3 28  ? 23.493  29.010 10.577  1.00 22.88 ? 324  GLU A CA    1 
ATOM   604  C C     . GLU C 3 28  ? 22.585  29.466 11.721  1.00 21.96 ? 324  GLU A C     1 
ATOM   605  O O     . GLU C 3 28  ? 21.514  30.010 11.465  1.00 21.28 ? 324  GLU A O     1 
ATOM   606  C CB    . GLU C 3 28  ? 24.216  30.233 10.011  1.00 25.52 ? 324  GLU A CB    1 
ATOM   607  C CG    . GLU C 3 28  ? 24.728  30.040 8.610   1.00 30.84 ? 324  GLU A CG    1 
ATOM   608  C CD    . GLU C 3 28  ? 26.172  29.601 8.597   1.00 33.78 ? 324  GLU A CD    1 
ATOM   609  O OE1   . GLU C 3 28  ? 26.718  29.425 9.715   1.00 35.98 ? 324  GLU A OE1   1 
ATOM   610  O OE2   . GLU C 3 28  ? 26.758  29.435 7.487   1.00 35.33 ? 324  GLU A OE2   1 
ATOM   611  N N     . GLU C 3 29  ? 23.002  29.244 12.971  1.00 21.99 ? 325  GLU A N     1 
ATOM   612  C CA    . GLU C 3 29  ? 22.165  29.634 14.112  1.00 22.91 ? 325  GLU A CA    1 
ATOM   613  C C     . GLU C 3 29  ? 21.893  31.119 14.041  1.00 20.03 ? 325  GLU A C     1 
ATOM   614  O O     . GLU C 3 29  ? 20.758  31.558 14.208  1.00 19.81 ? 325  GLU A O     1 
ATOM   615  C CB    . GLU C 3 29  ? 22.816  29.297 15.460  1.00 26.33 ? 325  GLU A CB    1 
ATOM   616  C CG    . GLU C 3 29  ? 23.677  28.060 15.471  1.00 34.28 ? 325  GLU A CG    1 
ATOM   617  C CD    . GLU C 3 29  ? 24.907  28.224 16.377  1.00 39.54 ? 325  GLU A CD    1 
ATOM   618  O OE1   . GLU C 3 29  ? 24.844  29.051 17.341  1.00 42.39 ? 325  GLU A OE1   1 
ATOM   619  O OE2   . GLU C 3 29  ? 25.934  27.533 16.124  1.00 41.25 ? 325  GLU A OE2   1 
ATOM   620  N N     . ASN C 3 30  ? 22.941  31.894 13.811  1.00 18.31 ? 326  ASN A N     1 
ATOM   621  C CA    . ASN C 3 30  ? 22.767  33.326 13.670  1.00 17.26 ? 326  ASN A CA    1 
ATOM   622  C C     . ASN C 3 30  ? 22.425  33.533 12.192  1.00 17.10 ? 326  ASN A C     1 
ATOM   623  O O     . ASN C 3 30  ? 23.282  33.376 11.319  1.00 16.65 ? 326  ASN A O     1 
ATOM   624  C CB    . ASN C 3 30  ? 24.052  34.053 14.017  1.00 17.41 ? 326  ASN A CB    1 
ATOM   625  C CG    . ASN C 3 30  ? 23.866  35.543 14.066  1.00 17.84 ? 326  ASN A CG    1 
ATOM   626  O OD1   . ASN C 3 30  ? 23.071  36.112 13.321  1.00 17.70 ? 326  ASN A OD1   1 
ATOM   627  N ND2   . ASN C 3 30  ? 24.599  36.191 14.952  1.00 19.58 ? 326  ASN A ND2   1 
ATOM   628  N N     . TYR C 3 31  ? 21.168  33.862 11.922  1.00 16.24 ? 327  TYR A N     1 
ATOM   629  C CA    . TYR C 3 31  ? 20.694  34.058 10.557  1.00 15.95 ? 327  TYR A CA    1 
ATOM   630  C C     . TYR C 3 31  ? 20.982  35.434 9.914   1.00 15.72 ? 327  TYR A C     1 
ATOM   631  O O     . TYR C 3 31  ? 20.579  35.666 8.777   1.00 13.50 ? 327  TYR A O     1 
ATOM   632  C CB    . TYR C 3 31  ? 19.186  33.781 10.507  1.00 15.03 ? 327  TYR A CB    1 
ATOM   633  C CG    . TYR C 3 31  ? 18.376  34.468 11.601  1.00 16.57 ? 327  TYR A CG    1 
ATOM   634  C CD1   . TYR C 3 31  ? 18.203  35.854 11.614  1.00 15.88 ? 327  TYR A CD1   1 
ATOM   635  C CD2   . TYR C 3 31  ? 17.743  33.721 12.604  1.00 16.60 ? 327  TYR A CD2   1 
ATOM   636  C CE1   . TYR C 3 31  ? 17.409  36.473 12.598  1.00 16.03 ? 327  TYR A CE1   1 
ATOM   637  C CE2   . TYR C 3 31  ? 16.952  34.333 13.581  1.00 16.35 ? 327  TYR A CE2   1 
ATOM   638  C CZ    . TYR C 3 31  ? 16.788  35.706 13.566  1.00 15.33 ? 327  TYR A CZ    1 
ATOM   639  O OH    . TYR C 3 31  ? 15.956  36.283 14.492  1.00 14.60 ? 327  TYR A OH    1 
ATOM   640  N N     . HIS C 3 32  ? 21.678  36.324 10.630  1.00 15.24 ? 328  HIS A N     1 
ATOM   641  C CA    . HIS C 3 32  ? 21.963  37.654 10.106  1.00 15.11 ? 328  HIS A CA    1 
ATOM   642  C C     . HIS C 3 32  ? 22.955  37.596 8.954   1.00 14.40 ? 328  HIS A C     1 
ATOM   643  O O     . HIS C 3 32  ? 24.098  37.174 9.159   1.00 14.27 ? 328  HIS A O     1 
ATOM   644  C CB    . HIS C 3 32  ? 22.492  38.579 11.224  1.00 14.69 ? 328  HIS A CB    1 
ATOM   645  C CG    . HIS C 3 32  ? 21.406  39.161 12.072  1.00 15.09 ? 328  HIS A CG    1 
ATOM   646  N ND1   . HIS C 3 32  ? 21.302  38.909 13.426  1.00 15.96 ? 328  HIS A ND1   1 
ATOM   647  C CD2   . HIS C 3 32  ? 20.319  39.903 11.744  1.00 14.16 ? 328  HIS A CD2   1 
ATOM   648  C CE1   . HIS C 3 32  ? 20.198  39.468 13.894  1.00 13.86 ? 328  HIS A CE1   1 
ATOM   649  N NE2   . HIS C 3 32  ? 19.583  40.075 12.895  1.00 15.80 ? 328  HIS A NE2   1 
ATOM   650  N N     . ASP C 3 33  ? 22.510  38.027 7.760   1.00 14.09 ? 329  ASP A N     1 
ATOM   651  C CA    . ASP C 3 33  ? 23.334  38.034 6.534   1.00 14.10 ? 329  ASP A CA    1 
ATOM   652  C C     . ASP C 3 33  ? 23.853  36.616 6.239   1.00 14.33 ? 329  ASP A C     1 
ATOM   653  O O     . ASP C 3 33  ? 24.943  36.437 5.719   1.00 14.52 ? 329  ASP A O     1 
ATOM   654  C CB    . ASP C 3 33  ? 24.524  39.006 6.695   1.00 14.74 ? 329  ASP A CB    1 
ATOM   655  C CG    . ASP C 3 33  ? 24.895  39.745 5.379   1.00 14.26 ? 329  ASP A CG    1 
ATOM   656  O OD1   . ASP C 3 33  ? 24.125  39.672 4.405   1.00 15.34 ? 329  ASP A OD1   1 
ATOM   657  O OD2   . ASP C 3 33  ? 25.958  40.398 5.325   1.00 15.22 ? 329  ASP A OD2   1 
ATOM   658  N N     . ALA C 3 34  ? 23.054  35.615 6.580   1.00 14.37 ? 330  ALA A N     1 
ATOM   659  C CA    . ALA C 3 34  ? 23.446  34.223 6.386   1.00 15.52 ? 330  ALA A CA    1 
ATOM   660  C C     . ALA C 3 34  ? 22.854  33.592 5.139   1.00 14.47 ? 330  ALA A C     1 
ATOM   661  O O     . ALA C 3 34  ? 21.807  34.015 4.634   1.00 15.08 ? 330  ALA A O     1 
ATOM   662  C CB    . ALA C 3 34  ? 23.046  33.379 7.612   1.00 13.66 ? 330  ALA A CB    1 
ATOM   663  N N     . PRO C 3 35  ? 23.507  32.532 4.656   1.00 14.85 ? 331  PRO A N     1 
ATOM   664  C CA    . PRO C 3 35  ? 23.040  31.831 3.459   1.00 15.19 ? 331  PRO A CA    1 
ATOM   665  C C     . PRO C 3 35  ? 21.685  31.163 3.593   1.00 16.26 ? 331  PRO A C     1 
ATOM   666  O O     . PRO C 3 35  ? 21.319  30.655 4.652   1.00 16.70 ? 331  PRO A O     1 
ATOM   667  C CB    . PRO C 3 35  ? 24.148  30.801 3.177   1.00 14.21 ? 331  PRO A CB    1 
ATOM   668  C CG    . PRO C 3 35  ? 25.305  31.186 4.047   1.00 13.82 ? 331  PRO A CG    1 
ATOM   669  C CD    . PRO C 3 35  ? 24.739  31.943 5.209   1.00 13.15 ? 331  PRO A CD    1 
ATOM   670  N N     . ILE C 3 36  ? 20.911  31.208 2.518   1.00 18.05 ? 332  ILE A N     1 
ATOM   671  C CA    . ILE C 3 36  ? 19.637  30.505 2.479   1.00 18.73 ? 332  ILE A CA    1 
ATOM   672  C C     . ILE C 3 36  ? 20.082  29.290 1.660   1.00 20.25 ? 332  ILE A C     1 
ATOM   673  O O     . ILE C 3 36  ? 20.517  29.404 0.517   1.00 20.32 ? 332  ILE A O     1 
ATOM   674  C CB    . ILE C 3 36  ? 18.544  31.303 1.773   1.00 17.68 ? 332  ILE A CB    1 
ATOM   675  C CG1   . ILE C 3 36  ? 18.112  32.453 2.674   1.00 17.37 ? 332  ILE A CG1   1 
ATOM   676  C CG2   . ILE C 3 36  ? 17.338  30.420 1.505   1.00 17.01 ? 332  ILE A CG2   1 
ATOM   677  C CD1   . ILE C 3 36  ? 17.121  33.379 2.052   1.00 17.38 ? 332  ILE A CD1   1 
ATOM   678  N N     . VAL C 3 37  ? 20.012  28.134 2.304   1.00 21.66 ? 333  VAL A N     1 
ATOM   679  C CA    . VAL C 3 37  ? 20.458  26.838 1.777   1.00 22.15 ? 333  VAL A CA    1 
ATOM   680  C C     . VAL C 3 37  ? 19.565  26.061 0.777   1.00 21.14 ? 333  VAL A C     1 
ATOM   681  O O     . VAL C 3 37  ? 20.053  25.201 0.038   1.00 22.34 ? 333  VAL A O     1 
ATOM   682  C CB    . VAL C 3 37  ? 20.811  25.943 3.019   1.00 22.03 ? 333  VAL A CB    1 
ATOM   683  C CG1   . VAL C 3 37  ? 20.874  24.507 2.655   1.00 24.83 ? 333  VAL A CG1   1 
ATOM   684  C CG2   . VAL C 3 37  ? 22.131  26.411 3.610   1.00 21.72 ? 333  VAL A CG2   1 
ATOM   685  N N     . GLY C 3 38  ? 18.274  26.354 0.749   1.00 19.77 ? 334  GLY A N     1 
ATOM   686  C CA    . GLY C 3 38  ? 17.390  25.658 -0.153  1.00 18.34 ? 334  GLY A CA    1 
ATOM   687  C C     . GLY C 3 38  ? 16.003  26.114 0.184   1.00 18.65 ? 334  GLY A C     1 
ATOM   688  O O     . GLY C 3 38  ? 15.795  26.710 1.240   1.00 19.54 ? 334  GLY A O     1 
ATOM   689  N N     . ILE C 3 39  ? 15.043  25.826 -0.685  1.00 18.35 ? 335  ILE A N     1 
ATOM   690  C CA    . ILE C 3 39  ? 13.665  26.241 -0.468  1.00 18.00 ? 335  ILE A CA    1 
ATOM   691  C C     . ILE C 3 39  ? 12.696  25.084 -0.757  1.00 18.57 ? 335  ILE A C     1 
ATOM   692  O O     . ILE C 3 39  ? 12.967  24.226 -1.598  1.00 18.95 ? 335  ILE A O     1 
ATOM   693  C CB    . ILE C 3 39  ? 13.305  27.485 -1.380  1.00 18.03 ? 335  ILE A CB    1 
ATOM   694  C CG1   . ILE C 3 39  ? 13.876  28.785 -0.764  1.00 19.20 ? 335  ILE A CG1   1 
ATOM   695  C CG2   . ILE C 3 39  ? 11.789  27.605 -1.529  1.00 17.58 ? 335  ILE A CG2   1 
ATOM   696  C CD1   . ILE C 3 39  ? 14.536  29.771 -1.743  1.00 18.03 ? 335  ILE A CD1   1 
ATOM   697  N N     . ALA C 3 40  ? 11.579  25.050 -0.039  1.00 17.84 ? 336  ALA A N     1 
ATOM   698  C CA    . ALA C 3 40  ? 10.582  24.019 -0.258  1.00 17.21 ? 336  ALA A CA    1 
ATOM   699  C C     . ALA C 3 40  ? 9.194   24.625 -0.168  1.00 17.22 ? 336  ALA A C     1 
ATOM   700  O O     . ALA C 3 40  ? 8.906   25.486 0.674   1.00 17.63 ? 336  ALA A O     1 
ATOM   701  C CB    . ALA C 3 40  ? 10.745  22.890 0.759   1.00 16.64 ? 336  ALA A CB    1 
ATOM   702  N N     . VAL C 3 41  ? 8.330   24.196 -1.065  1.00 17.04 ? 337  VAL A N     1 
ATOM   703  C CA    . VAL C 3 41  ? 6.966   24.692 -1.099  1.00 18.48 ? 337  VAL A CA    1 
ATOM   704  C C     . VAL C 3 41  ? 6.055   23.481 -1.226  1.00 19.45 ? 337  VAL A C     1 
ATOM   705  O O     . VAL C 3 41  ? 6.319   22.599 -2.050  1.00 21.02 ? 337  VAL A O     1 
ATOM   706  C CB    . VAL C 3 41  ? 6.704   25.639 -2.337  1.00 16.87 ? 337  VAL A CB    1 
ATOM   707  C CG1   . VAL C 3 41  ? 5.253   26.025 -2.397  1.00 16.51 ? 337  VAL A CG1   1 
ATOM   708  C CG2   . VAL C 3 41  ? 7.567   26.885 -2.265  1.00 17.47 ? 337  VAL A CG2   1 
ATOM   709  N N     . VAL C 3 42  ? 5.011   23.424 -0.398  1.00 19.37 ? 338  VAL A N     1 
ATOM   710  C CA    . VAL C 3 42  ? 4.036   22.345 -0.451  1.00 18.91 ? 338  VAL A CA    1 
ATOM   711  C C     . VAL C 3 42  ? 2.719   23.092 -0.479  1.00 19.96 ? 338  VAL A C     1 
ATOM   712  O O     . VAL C 3 42  ? 2.474   23.959 0.370   1.00 19.57 ? 338  VAL A O     1 
ATOM   713  C CB    . VAL C 3 42  ? 4.064   21.410 0.814   1.00 18.60 ? 338  VAL A CB    1 
ATOM   714  C CG1   . VAL C 3 42  ? 2.833   20.535 0.827   1.00 16.09 ? 338  VAL A CG1   1 
ATOM   715  C CG2   . VAL C 3 42  ? 5.307   20.536 0.831   1.00 17.97 ? 338  VAL A CG2   1 
ATOM   716  N N     . ASN C 3 43  ? 1.891   22.797 -1.481  1.00 20.57 ? 339  ASN A N     1 
ATOM   717  C CA    . ASN C 3 43  ? 0.575   23.423 -1.617  1.00 21.50 ? 339  ASN A CA    1 
ATOM   718  C C     . ASN C 3 43  ? -0.362  22.381 -2.237  1.00 23.00 ? 339  ASN A C     1 
ATOM   719  O O     . ASN C 3 43  ? 0.023   21.234 -2.418  1.00 22.87 ? 339  ASN A O     1 
ATOM   720  C CB    . ASN C 3 43  ? 0.631   24.702 -2.491  1.00 20.94 ? 339  ASN A CB    1 
ATOM   721  C CG    . ASN C 3 43  ? 1.286   24.475 -3.859  1.00 21.63 ? 339  ASN A CG    1 
ATOM   722  O OD1   . ASN C 3 43  ? 1.996   25.346 -4.365  1.00 23.44 ? 339  ASN A OD1   1 
ATOM   723  N ND2   . ASN C 3 43  ? 1.054   23.319 -4.454  1.00 19.44 ? 339  ASN A ND2   1 
ATOM   724  N N     . GLU C 3 44  ? -1.586  22.762 -2.564  1.00 24.75 ? 340  GLU A N     1 
ATOM   725  C CA    . GLU C 3 44  ? -2.510  21.799 -3.135  1.00 26.66 ? 340  GLU A CA    1 
ATOM   726  C C     . GLU C 3 44  ? -1.985  21.134 -4.405  1.00 27.19 ? 340  GLU A C     1 
ATOM   727  O O     . GLU C 3 44  ? -2.381  20.011 -4.712  1.00 28.48 ? 340  GLU A O     1 
ATOM   728  C CB    . GLU C 3 44  ? -3.846  22.467 -3.424  1.00 28.21 ? 340  GLU A CB    1 
ATOM   729  C CG    . GLU C 3 44  ? -3.777  23.383 -4.603  1.00 32.03 ? 340  GLU A CG    1 
ATOM   730  C CD    . GLU C 3 44  ? -5.022  24.215 -4.763  1.00 35.20 ? 340  GLU A CD    1 
ATOM   731  O OE1   . GLU C 3 44  ? -6.145  23.665 -4.646  1.00 36.57 ? 340  GLU A OE1   1 
ATOM   732  O OE2   . GLU C 3 44  ? -4.869  25.430 -5.013  1.00 37.88 ? 340  GLU A OE2   1 
ATOM   733  N N     . HIS C 3 45  ? -1.103  21.808 -5.149  1.00 27.16 ? 341  HIS A N     1 
ATOM   734  C CA    . HIS C 3 45  ? -0.566  21.230 -6.390  1.00 25.51 ? 341  HIS A CA    1 
ATOM   735  C C     . HIS C 3 45  ? 0.628   20.323 -6.191  1.00 25.49 ? 341  HIS A C     1 
ATOM   736  O O     . HIS C 3 45  ? 1.163   19.812 -7.166  1.00 27.03 ? 341  HIS A O     1 
ATOM   737  C CB    . HIS C 3 45  ? -0.132  22.307 -7.387  1.00 25.11 ? 341  HIS A CB    1 
ATOM   738  C CG    . HIS C 3 45  ? -1.157  23.364 -7.638  1.00 24.36 ? 341  HIS A CG    1 
ATOM   739  N ND1   . HIS C 3 45  ? -2.484  23.078 -7.879  1.00 24.83 ? 341  HIS A ND1   1 
ATOM   740  C CD2   . HIS C 3 45  ? -1.051  24.712 -7.674  1.00 24.25 ? 341  HIS A CD2   1 
ATOM   741  C CE1   . HIS C 3 45  ? -3.153  24.203 -8.051  1.00 24.06 ? 341  HIS A CE1   1 
ATOM   742  N NE2   . HIS C 3 45  ? -2.307  25.210 -7.931  1.00 25.02 ? 341  HIS A NE2   1 
ATOM   743  N N     . GLY C 3 46  ? 1.091   20.135 -4.960  1.00 24.71 ? 342  GLY A N     1 
ATOM   744  C CA    . GLY C 3 46  ? 2.224   19.246 -4.772  1.00 22.64 ? 342  GLY A CA    1 
ATOM   745  C C     . GLY C 3 46  ? 3.344   19.730 -3.897  1.00 21.44 ? 342  GLY A C     1 
ATOM   746  O O     . GLY C 3 46  ? 3.198   20.687 -3.161  1.00 21.55 ? 342  GLY A O     1 
ATOM   747  N N     . ARG C 3 47  ? 4.475   19.054 -3.997  1.00 21.22 ? 343  ARG A N     1 
ATOM   748  C CA    . ARG C 3 47  ? 5.651   19.374 -3.208  1.00 21.62 ? 343  ARG A CA    1 
ATOM   749  C C     . ARG C 3 47  ? 6.816   19.731 -4.116  1.00 22.62 ? 343  ARG A C     1 
ATOM   750  O O     . ARG C 3 47  ? 7.130   18.993 -5.053  1.00 22.61 ? 343  ARG A O     1 
ATOM   751  C CB    . ARG C 3 47  ? 6.040   18.176 -2.347  1.00 20.65 ? 343  ARG A CB    1 
ATOM   752  C CG    . ARG C 3 47  ? 4.863   17.483 -1.730  1.00 19.37 ? 343  ARG A CG    1 
ATOM   753  C CD    . ARG C 3 47  ? 5.306   16.579 -0.620  1.00 19.51 ? 343  ARG A CD    1 
ATOM   754  N NE    . ARG C 3 47  ? 4.147   15.921 -0.037  1.00 21.38 ? 343  ARG A NE    1 
ATOM   755  C CZ    . ARG C 3 47  ? 3.785   14.663 -0.296  1.00 21.13 ? 343  ARG A CZ    1 
ATOM   756  N NH1   . ARG C 3 47  ? 4.489   13.910 -1.132  1.00 21.08 ? 343  ARG A NH1   1 
ATOM   757  N NH2   . ARG C 3 47  ? 2.708   14.159 0.285   1.00 21.29 ? 343  ARG A NH2   1 
ATOM   758  N N     . PHE C 3 48  ? 7.475   20.849 -3.815  1.00 21.87 ? 344  PHE A N     1 
ATOM   759  C CA    . PHE C 3 48  ? 8.581   21.298 -4.630  1.00 21.78 ? 344  PHE A CA    1 
ATOM   760  C C     . PHE C 3 48  ? 9.793   21.736 -3.826  1.00 22.45 ? 344  PHE A C     1 
ATOM   761  O O     . PHE C 3 48  ? 9.669   22.258 -2.716  1.00 23.40 ? 344  PHE A O     1 
ATOM   762  C CB    . PHE C 3 48  ? 8.141   22.484 -5.514  1.00 21.42 ? 344  PHE A CB    1 
ATOM   763  C CG    . PHE C 3 48  ? 6.727   22.388 -6.025  1.00 20.67 ? 344  PHE A CG    1 
ATOM   764  C CD1   . PHE C 3 48  ? 5.666   22.859 -5.266  1.00 19.79 ? 344  PHE A CD1   1 
ATOM   765  C CD2   . PHE C 3 48  ? 6.469   21.859 -7.286  1.00 20.71 ? 344  PHE A CD2   1 
ATOM   766  C CE1   . PHE C 3 48  ? 4.369   22.817 -5.741  1.00 20.24 ? 344  PHE A CE1   1 
ATOM   767  C CE2   . PHE C 3 48  ? 5.172   21.809 -7.779  1.00 20.58 ? 344  PHE A CE2   1 
ATOM   768  C CZ    . PHE C 3 48  ? 4.111   22.290 -7.003  1.00 22.30 ? 344  PHE A CZ    1 
ATOM   769  N N     . PHE C 3 49  ? 10.971  21.512 -4.397  1.00 22.03 ? 345  PHE A N     1 
ATOM   770  C CA    . PHE C 3 49  ? 12.207  21.963 -3.791  1.00 22.19 ? 345  PHE A CA    1 
ATOM   771  C C     . PHE C 3 49  ? 12.806  22.879 -4.851  1.00 23.07 ? 345  PHE A C     1 
ATOM   772  O O     . PHE C 3 49  ? 12.763  22.554 -6.043  1.00 22.96 ? 345  PHE A O     1 
ATOM   773  C CB    . PHE C 3 49  ? 13.160  20.816 -3.526  1.00 21.41 ? 345  PHE A CB    1 
ATOM   774  C CG    . PHE C 3 49  ? 14.540  21.262 -3.203  1.00 22.69 ? 345  PHE A CG    1 
ATOM   775  C CD1   . PHE C 3 49  ? 14.854  21.716 -1.925  1.00 23.01 ? 345  PHE A CD1   1 
ATOM   776  C CD2   . PHE C 3 49  ? 15.529  21.262 -4.180  1.00 22.84 ? 345  PHE A CD2   1 
ATOM   777  C CE1   . PHE C 3 49  ? 16.136  22.168 -1.617  1.00 22.80 ? 345  PHE A CE1   1 
ATOM   778  C CE2   . PHE C 3 49  ? 16.814  21.709 -3.892  1.00 23.14 ? 345  PHE A CE2   1 
ATOM   779  C CZ    . PHE C 3 49  ? 17.119  22.167 -2.600  1.00 23.54 ? 345  PHE A CZ    1 
ATOM   780  N N     . LEU C 3 50  ? 13.334  24.025 -4.425  1.00 23.13 ? 346  LEU A N     1 
ATOM   781  C CA    . LEU C 3 50  ? 13.940  25.000 -5.330  1.00 22.81 ? 346  LEU A CA    1 
ATOM   782  C C     . LEU C 3 50  ? 15.298  25.383 -4.812  1.00 23.45 ? 346  LEU A C     1 
ATOM   783  O O     . LEU C 3 50  ? 15.469  25.559 -3.614  1.00 23.61 ? 346  LEU A O     1 
ATOM   784  C CB    . LEU C 3 50  ? 13.107  26.280 -5.396  1.00 22.88 ? 346  LEU A CB    1 
ATOM   785  C CG    . LEU C 3 50  ? 11.717  26.182 -5.996  1.00 22.06 ? 346  LEU A CG    1 
ATOM   786  C CD1   . LEU C 3 50  ? 10.845  27.313 -5.497  1.00 21.64 ? 346  LEU A CD1   1 
ATOM   787  C CD2   . LEU C 3 50  ? 11.851  26.221 -7.506  1.00 22.43 ? 346  LEU A CD2   1 
ATOM   788  N N     . ARG C 3 51  ? 16.273  25.497 -5.700  1.00 24.16 ? 347  ARG A N     1 
ATOM   789  C CA    . ARG C 3 51  ? 17.589  25.924 -5.278  1.00 25.36 ? 347  ARG A CA    1 
ATOM   790  C C     . ARG C 3 51  ? 17.392  27.412 -5.052  1.00 25.39 ? 347  ARG A C     1 
ATOM   791  O O     . ARG C 3 51  ? 16.716  28.072 -5.826  1.00 25.40 ? 347  ARG A O     1 
ATOM   792  C CB    . ARG C 3 51  ? 18.598  25.664 -6.382  1.00 27.04 ? 347  ARG A CB    1 
ATOM   793  C CG    . ARG C 3 51  ? 18.595  24.217 -6.790  1.00 29.02 ? 347  ARG A CG    1 
ATOM   794  C CD    . ARG C 3 51  ? 19.620  23.927 -7.860  1.00 31.52 ? 347  ARG A CD    1 
ATOM   795  N NE    . ARG C 3 51  ? 19.761  22.482 -8.066  1.00 34.97 ? 347  ARG A NE    1 
ATOM   796  C CZ    . ARG C 3 51  ? 18.922  21.721 -8.774  1.00 35.25 ? 347  ARG A CZ    1 
ATOM   797  N NH1   . ARG C 3 51  ? 17.852  22.253 -9.369  1.00 35.77 ? 347  ARG A NH1   1 
ATOM   798  N NH2   . ARG C 3 51  ? 19.156  20.416 -8.878  1.00 35.02 ? 347  ARG A NH2   1 
ATOM   799  N N     . PRO C 3 52  ? 17.980  27.960 -3.987  1.00 26.01 ? 348  PRO A N     1 
ATOM   800  C CA    . PRO C 3 52  ? 17.839  29.389 -3.672  1.00 27.17 ? 348  PRO A CA    1 
ATOM   801  C C     . PRO C 3 52  ? 18.387  30.383 -4.714  1.00 27.66 ? 348  PRO A C     1 
ATOM   802  O O     . PRO C 3 52  ? 17.795  31.432 -4.951  1.00 26.67 ? 348  PRO A O     1 
ATOM   803  C CB    . PRO C 3 52  ? 18.537  29.523 -2.315  1.00 27.06 ? 348  PRO A CB    1 
ATOM   804  C CG    . PRO C 3 52  ? 19.525  28.389 -2.296  1.00 27.15 ? 348  PRO A CG    1 
ATOM   805  C CD    . PRO C 3 52  ? 18.854  27.264 -3.028  1.00 26.30 ? 348  PRO A CD    1 
ATOM   806  N N     . GLU C 3 53  ? 19.524  30.061 -5.319  1.00 29.28 ? 349  GLU A N     1 
ATOM   807  C CA    . GLU C 3 53  ? 20.117  30.937 -6.319  1.00 31.50 ? 349  GLU A CA    1 
ATOM   808  C C     . GLU C 3 53  ? 19.153  31.194 -7.478  1.00 31.31 ? 349  GLU A C     1 
ATOM   809  O O     . GLU C 3 53  ? 19.144  32.273 -8.054  1.00 32.41 ? 349  GLU A O     1 
ATOM   810  C CB    . GLU C 3 53  ? 21.406  30.323 -6.853  1.00 34.17 ? 349  GLU A CB    1 
ATOM   811  C CG    . GLU C 3 53  ? 22.079  29.370 -5.866  1.00 40.92 ? 349  GLU A CG    1 
ATOM   812  C CD    . GLU C 3 53  ? 21.409  27.986 -5.790  1.00 43.12 ? 349  GLU A CD    1 
ATOM   813  O OE1   . GLU C 3 53  ? 20.971  27.470 -6.847  1.00 45.39 ? 349  GLU A OE1   1 
ATOM   814  O OE2   . GLU C 3 53  ? 21.325  27.414 -4.672  1.00 44.60 ? 349  GLU A OE2   1 
ATOM   815  N N     . THR C 3 54  ? 18.318  30.223 -7.816  1.00 30.25 ? 350  THR A N     1 
ATOM   816  C CA    . THR C 3 54  ? 17.415  30.445 -8.917  1.00 29.20 ? 350  THR A CA    1 
ATOM   817  C C     . THR C 3 54  ? 16.064  31.026 -8.501  1.00 28.56 ? 350  THR A C     1 
ATOM   818  O O     . THR C 3 54  ? 15.540  31.932 -9.162  1.00 28.79 ? 350  THR A O     1 
ATOM   819  C CB    . THR C 3 54  ? 17.234  29.145 -9.764  1.00 29.78 ? 350  THR A CB    1 
ATOM   820  O OG1   . THR C 3 54  ? 15.907  28.637 -9.616  1.00 31.64 ? 350  THR A OG1   1 
ATOM   821  C CG2   . THR C 3 54  ? 18.219  28.073 -9.336  1.00 29.72 ? 350  THR A CG2   1 
ATOM   822  N N     . ALA C 3 55  ? 15.491  30.543 -7.408  1.00 26.67 ? 351  ALA A N     1 
ATOM   823  C CA    . ALA C 3 55  ? 14.201  31.072 -6.998  1.00 25.66 ? 351  ALA A CA    1 
ATOM   824  C C     . ALA C 3 55  ? 14.288  32.534 -6.515  1.00 24.96 ? 351  ALA A C     1 
ATOM   825  O O     . ALA C 3 55  ? 13.428  33.349 -6.820  1.00 24.09 ? 351  ALA A O     1 
ATOM   826  C CB    . ALA C 3 55  ? 13.601  30.197 -5.912  1.00 26.01 ? 351  ALA A CB    1 
ATOM   827  N N     . LEU C 3 56  ? 15.328  32.872 -5.772  1.00 24.86 ? 352  LEU A N     1 
ATOM   828  C CA    . LEU C 3 56  ? 15.446  34.231 -5.261  1.00 26.08 ? 352  LEU A CA    1 
ATOM   829  C C     . LEU C 3 56  ? 15.869  35.247 -6.344  1.00 27.28 ? 352  LEU A C     1 
ATOM   830  O O     . LEU C 3 56  ? 15.903  36.464 -6.113  1.00 27.23 ? 352  LEU A O     1 
ATOM   831  C CB    . LEU C 3 56  ? 16.401  34.237 -4.058  1.00 25.22 ? 352  LEU A CB    1 
ATOM   832  C CG    . LEU C 3 56  ? 15.855  33.497 -2.810  1.00 24.15 ? 352  LEU A CG    1 
ATOM   833  C CD1   . LEU C 3 56  ? 16.851  33.593 -1.661  1.00 24.30 ? 352  LEU A CD1   1 
ATOM   834  C CD2   . LEU C 3 56  ? 14.520  34.081 -2.382  1.00 23.02 ? 352  LEU A CD2   1 
ATOM   835  N N     . ALA C 3 57  ? 16.169  34.725 -7.531  1.00 27.36 ? 353  ALA A N     1 
ATOM   836  C CA    . ALA C 3 57  ? 16.545  35.549 -8.661  1.00 27.42 ? 353  ALA A CA    1 
ATOM   837  C C     . ALA C 3 57  ? 15.358  35.613 -9.633  1.00 27.55 ? 353  ALA A C     1 
ATOM   838  O O     . ALA C 3 57  ? 15.406  36.336 -10.626 1.00 28.74 ? 353  ALA A O     1 
ATOM   839  C CB    . ALA C 3 57  ? 17.771  34.966 -9.352  1.00 26.36 ? 353  ALA A CB    1 
ATOM   840  N N     . ASP C 3 58  ? 14.297  34.861 -9.335  1.00 26.87 ? 354  ASP A N     1 
ATOM   841  C CA    . ASP C 3 58  ? 13.088  34.821 -10.167 1.00 27.43 ? 354  ASP A CA    1 
ATOM   842  C C     . ASP C 3 58  ? 12.107  35.903 -9.707  1.00 27.81 ? 354  ASP A C     1 
ATOM   843  O O     . ASP C 3 58  ? 11.620  35.867 -8.580  1.00 27.57 ? 354  ASP A O     1 
ATOM   844  C CB    . ASP C 3 58  ? 12.420  33.430 -10.070 1.00 27.84 ? 354  ASP A CB    1 
ATOM   845  C CG    . ASP C 3 58  ? 11.118  33.325 -10.871 1.00 27.95 ? 354  ASP A CG    1 
ATOM   846  O OD1   . ASP C 3 58  ? 10.063  33.795 -10.394 1.00 29.86 ? 354  ASP A OD1   1 
ATOM   847  O OD2   . ASP C 3 58  ? 11.141  32.749 -11.975 1.00 28.27 ? 354  ASP A OD2   1 
ATOM   848  N N     . PRO C 3 59  ? 11.791  36.879 -10.590 1.00 27.81 ? 355  PRO A N     1 
ATOM   849  C CA    . PRO C 3 59  ? 10.861  37.940 -10.183 1.00 27.28 ? 355  PRO A CA    1 
ATOM   850  C C     . PRO C 3 59  ? 9.491   37.474 -9.691  1.00 27.12 ? 355  PRO A C     1 
ATOM   851  O O     . PRO C 3 59  ? 8.931   38.090 -8.794  1.00 26.61 ? 355  PRO A O     1 
ATOM   852  C CB    . PRO C 3 59  ? 10.765  38.837 -11.425 1.00 26.87 ? 355  PRO A CB    1 
ATOM   853  C CG    . PRO C 3 59  ? 11.971  38.508 -12.227 1.00 26.50 ? 355  PRO A CG    1 
ATOM   854  C CD    . PRO C 3 59  ? 12.261  37.064 -11.976 1.00 27.07 ? 355  PRO A CD    1 
ATOM   855  N N     . GLN C 3 60  ? 8.949   36.403 -10.276 1.00 27.63 ? 356  GLN A N     1 
ATOM   856  C CA    . GLN C 3 60  ? 7.629   35.903 -9.874  1.00 28.14 ? 356  GLN A CA    1 
ATOM   857  C C     . GLN C 3 60  ? 7.645   35.301 -8.486  1.00 26.03 ? 356  GLN A C     1 
ATOM   858  O O     . GLN C 3 60  ? 6.664   35.426 -7.755  1.00 24.47 ? 356  GLN A O     1 
ATOM   859  C CB    . GLN C 3 60  ? 7.099   34.830 -10.832 1.00 31.38 ? 356  GLN A CB    1 
ATOM   860  C CG    . GLN C 3 60  ? 7.905   34.664 -12.083 1.00 36.80 ? 356  GLN A CG    1 
ATOM   861  C CD    . GLN C 3 60  ? 7.204   35.278 -13.254 1.00 38.67 ? 356  GLN A CD    1 
ATOM   862  O OE1   . GLN C 3 60  ? 6.168   34.764 -13.703 1.00 40.03 ? 356  GLN A OE1   1 
ATOM   863  N NE2   . GLN C 3 60  ? 7.751   36.392 -13.762 1.00 39.43 ? 356  GLN A NE2   1 
ATOM   864  N N     . PHE C 3 61  ? 8.732   34.607 -8.163  1.00 24.61 ? 357  PHE A N     1 
ATOM   865  C CA    . PHE C 3 61  ? 8.874   34.011 -6.842  1.00 24.03 ? 357  PHE A CA    1 
ATOM   866  C C     . PHE C 3 61  ? 9.091   35.108 -5.786  1.00 22.63 ? 357  PHE A C     1 
ATOM   867  O O     . PHE C 3 61  ? 8.488   35.075 -4.725  1.00 22.48 ? 357  PHE A O     1 
ATOM   868  C CB    . PHE C 3 61  ? 10.026  33.002 -6.806  1.00 23.88 ? 357  PHE A CB    1 
ATOM   869  C CG    . PHE C 3 61  ? 10.000  32.115 -5.586  1.00 25.06 ? 357  PHE A CG    1 
ATOM   870  C CD1   . PHE C 3 61  ? 9.062   31.084 -5.475  1.00 25.50 ? 357  PHE A CD1   1 
ATOM   871  C CD2   . PHE C 3 61  ? 10.867  32.349 -4.517  1.00 25.38 ? 357  PHE A CD2   1 
ATOM   872  C CE1   . PHE C 3 61  ? 8.983   30.297 -4.316  1.00 25.32 ? 357  PHE A CE1   1 
ATOM   873  C CE2   . PHE C 3 61  ? 10.793  31.567 -3.357  1.00 25.28 ? 357  PHE A CE2   1 
ATOM   874  C CZ    . PHE C 3 61  ? 9.846   30.541 -3.259  1.00 25.08 ? 357  PHE A CZ    1 
ATOM   875  N N     . VAL C 3 62  ? 9.945   36.082 -6.075  1.00 22.45 ? 358  VAL A N     1 
ATOM   876  C CA    . VAL C 3 62  ? 10.160  37.180 -5.138  1.00 21.40 ? 358  VAL A CA    1 
ATOM   877  C C     . VAL C 3 62  ? 8.856   37.963 -4.962  1.00 21.37 ? 358  VAL A C     1 
ATOM   878  O O     . VAL C 3 62  ? 8.536   38.400 -3.850  1.00 22.05 ? 358  VAL A O     1 
ATOM   879  C CB    . VAL C 3 62  ? 11.280  38.135 -5.616  1.00 21.00 ? 358  VAL A CB    1 
ATOM   880  C CG1   . VAL C 3 62  ? 11.247  39.440 -4.819  1.00 20.63 ? 358  VAL A CG1   1 
ATOM   881  C CG2   . VAL C 3 62  ? 12.623  37.478 -5.416  1.00 21.59 ? 358  VAL A CG2   1 
ATOM   882  N N     . ALA C 3 63  ? 8.081   38.121 -6.035  1.00 20.52 ? 359  ALA A N     1 
ATOM   883  C CA    . ALA C 3 63  ? 6.812   38.848 -5.950  1.00 19.45 ? 359  ALA A CA    1 
ATOM   884  C C     . ALA C 3 63  ? 5.806   38.055 -5.145  1.00 19.14 ? 359  ALA A C     1 
ATOM   885  O O     . ALA C 3 63  ? 5.046   38.624 -4.360  1.00 19.73 ? 359  ALA A O     1 
ATOM   886  C CB    . ALA C 3 63  ? 6.252   39.113 -7.331  1.00 20.14 ? 359  ALA A CB    1 
ATOM   887  N N     . TRP C 3 64  ? 5.790   36.743 -5.342  1.00 17.65 ? 360  TRP A N     1 
ATOM   888  C CA    . TRP C 3 64  ? 4.872   35.872 -4.612  1.00 17.74 ? 360  TRP A CA    1 
ATOM   889  C C     . TRP C 3 64  ? 5.228   35.953 -3.111  1.00 17.37 ? 360  TRP A C     1 
ATOM   890  O O     . TRP C 3 64  ? 4.346   36.014 -2.257  1.00 18.54 ? 360  TRP A O     1 
ATOM   891  C CB    . TRP C 3 64  ? 4.998   34.415 -5.130  1.00 17.65 ? 360  TRP A CB    1 
ATOM   892  C CG    . TRP C 3 64  ? 4.263   33.368 -4.279  1.00 17.16 ? 360  TRP A CG    1 
ATOM   893  C CD1   . TRP C 3 64  ? 2.930   33.117 -4.271  1.00 16.89 ? 360  TRP A CD1   1 
ATOM   894  C CD2   . TRP C 3 64  ? 4.842   32.490 -3.293  1.00 17.46 ? 360  TRP A CD2   1 
ATOM   895  N NE1   . TRP C 3 64  ? 2.632   32.146 -3.347  1.00 17.91 ? 360  TRP A NE1   1 
ATOM   896  C CE2   . TRP C 3 64  ? 3.790   31.743 -2.732  1.00 17.91 ? 360  TRP A CE2   1 
ATOM   897  C CE3   . TRP C 3 64  ? 6.148   32.270 -2.833  1.00 17.20 ? 360  TRP A CE3   1 
ATOM   898  C CZ2   . TRP C 3 64  ? 3.999   30.784 -1.729  1.00 17.98 ? 360  TRP A CZ2   1 
ATOM   899  C CZ3   . TRP C 3 64  ? 6.354   31.316 -1.839  1.00 18.20 ? 360  TRP A CZ3   1 
ATOM   900  C CH2   . TRP C 3 64  ? 5.286   30.588 -1.299  1.00 17.06 ? 360  TRP A CH2   1 
ATOM   901  N N     . LEU C 3 65  ? 6.526   35.958 -2.810  1.00 17.25 ? 361  LEU A N     1 
ATOM   902  C CA    . LEU C 3 65  ? 7.018   36.047 -1.434  1.00 17.57 ? 361  LEU A CA    1 
ATOM   903  C C     . LEU C 3 65  ? 6.518   37.339 -0.763  1.00 18.60 ? 361  LEU A C     1 
ATOM   904  O O     . LEU C 3 65  ? 6.112   37.339 0.410   1.00 17.95 ? 361  LEU A O     1 
ATOM   905  C CB    . LEU C 3 65  ? 8.560   36.040 -1.408  1.00 15.39 ? 361  LEU A CB    1 
ATOM   906  C CG    . LEU C 3 65  ? 9.357   34.735 -1.543  1.00 14.29 ? 361  LEU A CG    1 
ATOM   907  C CD1   . LEU C 3 65  ? 10.815  35.057 -1.437  1.00 13.02 ? 361  LEU A CD1   1 
ATOM   908  C CD2   . LEU C 3 65  ? 8.964   33.710 -0.454  1.00 15.65 ? 361  LEU A CD2   1 
ATOM   909  N N     . GLY C 3 66  ? 6.543   38.438 -1.516  1.00 18.19 ? 362  GLY A N     1 
ATOM   910  C CA    . GLY C 3 66  ? 6.125   39.701 -0.947  1.00 18.17 ? 362  GLY A CA    1 
ATOM   911  C C     . GLY C 3 66  ? 4.643   39.978 -1.043  1.00 18.62 ? 362  GLY A C     1 
ATOM   912  O O     . GLY C 3 66  ? 4.175   41.003 -0.562  1.00 18.90 ? 362  GLY A O     1 
ATOM   913  N N     . ASP C 3 67  ? 3.886   39.093 -1.665  1.00 19.34 ? 363  ASP A N     1 
ATOM   914  C CA    . ASP C 3 67  ? 2.465   39.337 -1.783  1.00 21.00 ? 363  ASP A CA    1 
ATOM   915  C C     . ASP C 3 67  ? 1.735   38.902 -0.519  1.00 22.29 ? 363  ASP A C     1 
ATOM   916  O O     . ASP C 3 67  ? 1.610   37.710 -0.221  1.00 21.05 ? 363  ASP A O     1 
ATOM   917  C CB    . ASP C 3 67  ? 1.903   38.620 -3.001  1.00 21.52 ? 363  ASP A CB    1 
ATOM   918  C CG    . ASP C 3 67  ? 0.498   39.065 -3.340  1.00 22.52 ? 363  ASP A CG    1 
ATOM   919  O OD1   . ASP C 3 67  ? -0.235  39.544 -2.450  1.00 23.32 ? 363  ASP A OD1   1 
ATOM   920  O OD2   . ASP C 3 67  ? 0.110   38.921 -4.512  1.00 24.95 ? 363  ASP A OD2   1 
ATOM   921  N N     . GLU C 3 68  ? 1.256   39.901 0.213   1.00 22.81 ? 364  GLU A N     1 
ATOM   922  C CA    . GLU C 3 68  ? 0.548   39.697 1.452   1.00 24.19 ? 364  GLU A CA    1 
ATOM   923  C C     . GLU C 3 68  ? -0.696  38.824 1.295   1.00 23.74 ? 364  GLU A C     1 
ATOM   924  O O     . GLU C 3 68  ? -1.133  38.180 2.255   1.00 23.74 ? 364  GLU A O     1 
ATOM   925  C CB    . GLU C 3 68  ? 0.182   41.059 2.030   1.00 26.44 ? 364  GLU A CB    1 
ATOM   926  C CG    . GLU C 3 68  ? -1.120  41.085 2.772   1.00 32.07 ? 364  GLU A CG    1 
ATOM   927  C CD    . GLU C 3 68  ? -1.024  40.409 4.142   1.00 35.93 ? 364  GLU A CD    1 
ATOM   928  O OE1   . GLU C 3 68  ? 0.118   40.183 4.638   1.00 37.66 ? 364  GLU A OE1   1 
ATOM   929  O OE2   . GLU C 3 68  ? -2.101  40.106 4.724   1.00 38.79 ? 364  GLU A OE2   1 
ATOM   930  N N     . THR C 3 69  ? -1.279  38.785 0.099   1.00 22.99 ? 365  THR A N     1 
ATOM   931  C CA    . THR C 3 69  ? -2.478  37.974 -0.095  1.00 22.25 ? 365  THR A CA    1 
ATOM   932  C C     . THR C 3 69  ? -2.189  36.500 -0.434  1.00 20.89 ? 365  THR A C     1 
ATOM   933  O O     . THR C 3 69  ? -3.112  35.701 -0.568  1.00 21.83 ? 365  THR A O     1 
ATOM   934  C CB    . THR C 3 69  ? -3.425  38.600 -1.161  1.00 23.33 ? 365  THR A CB    1 
ATOM   935  O OG1   . THR C 3 69  ? -2.924  38.330 -2.473  1.00 24.83 ? 365  THR A OG1   1 
ATOM   936  C CG2   . THR C 3 69  ? -3.518  40.112 -0.964  1.00 22.77 ? 365  THR A CG2   1 
ATOM   937  N N     . LYS C 3 70  ? -0.910  36.157 -0.565  1.00 20.00 ? 366  LYS A N     1 
ATOM   938  C CA    . LYS C 3 70  ? -0.471  34.788 -0.836  1.00 19.07 ? 366  LYS A CA    1 
ATOM   939  C C     . LYS C 3 70  ? -0.027  34.308 0.539   1.00 17.90 ? 366  LYS A C     1 
ATOM   940  O O     . LYS C 3 70  ? 1.044   34.656 1.007   1.00 17.82 ? 366  LYS A O     1 
ATOM   941  C CB    . LYS C 3 70  ? 0.732   34.764 -1.795  1.00 19.63 ? 366  LYS A CB    1 
ATOM   942  C CG    . LYS C 3 70  ? 0.461   35.373 -3.179  1.00 20.64 ? 366  LYS A CG    1 
ATOM   943  C CD    . LYS C 3 70  ? -0.582  34.568 -3.936  1.00 21.47 ? 366  LYS A CD    1 
ATOM   944  C CE    . LYS C 3 70  ? -0.894  35.213 -5.268  1.00 21.18 ? 366  LYS A CE    1 
ATOM   945  N NZ    . LYS C 3 70  ? -2.209  35.875 -5.218  1.00 22.75 ? 366  LYS A NZ    1 
ATOM   946  N N     . LYS C 3 71  ? -0.870  33.515 1.172   1.00 17.96 ? 367  LYS A N     1 
ATOM   947  C CA    . LYS C 3 71  ? -0.620  33.023 2.518   1.00 18.86 ? 367  LYS A CA    1 
ATOM   948  C C     . LYS C 3 71  ? 0.368   31.880 2.674   1.00 17.88 ? 367  LYS A C     1 
ATOM   949  O O     . LYS C 3 71  ? 0.270   30.859 2.006   1.00 18.50 ? 367  LYS A O     1 
ATOM   950  C CB    . LYS C 3 71  ? -1.951  32.645 3.149   1.00 19.46 ? 367  LYS A CB    1 
ATOM   951  C CG    . LYS C 3 71  ? -3.014  33.720 2.983   1.00 21.00 ? 367  LYS A CG    1 
ATOM   952  C CD    . LYS C 3 71  ? -2.529  35.065 3.522   1.00 22.61 ? 367  LYS A CD    1 
ATOM   953  C CE    . LYS C 3 71  ? -3.624  36.139 3.421   1.00 23.98 ? 367  LYS A CE    1 
ATOM   954  N NZ    . LYS C 3 71  ? -3.253  37.362 4.210   1.00 24.52 ? 367  LYS A NZ    1 
ATOM   955  N N     . LYS C 3 72  ? 1.319   32.067 3.576   1.00 17.24 ? 368  LYS A N     1 
ATOM   956  C CA    . LYS C 3 72  ? 2.335   31.070 3.836   1.00 17.74 ? 368  LYS A CA    1 
ATOM   957  C C     . LYS C 3 72  ? 2.284   30.601 5.300   1.00 18.61 ? 368  LYS A C     1 
ATOM   958  O O     . LYS C 3 72  ? 2.026   31.388 6.233   1.00 17.51 ? 368  LYS A O     1 
ATOM   959  C CB    . LYS C 3 72  ? 3.734   31.640 3.562   1.00 18.50 ? 368  LYS A CB    1 
ATOM   960  C CG    . LYS C 3 72  ? 3.993   32.063 2.118   1.00 19.71 ? 368  LYS A CG    1 
ATOM   961  C CD    . LYS C 3 72  ? 3.914   33.583 1.968   1.00 20.16 ? 368  LYS A CD    1 
ATOM   962  C CE    . LYS C 3 72  ? 4.101   34.052 0.520   1.00 19.96 ? 368  LYS A CE    1 
ATOM   963  N NZ    . LYS C 3 72  ? 3.566   35.439 0.327   1.00 18.87 ? 368  LYS A NZ    1 
ATOM   964  N N     . SER C 3 73  ? 2.502   29.304 5.483   1.00 18.04 ? 369  SER A N     1 
ATOM   965  C CA    . SER C 3 73  ? 2.559   28.724 6.808   1.00 16.87 ? 369  SER A CA    1 
ATOM   966  C C     . SER C 3 73  ? 4.011   28.331 6.918   1.00 16.30 ? 369  SER A C     1 
ATOM   967  O O     . SER C 3 73  ? 4.589   27.739 5.989   1.00 16.92 ? 369  SER A O     1 
ATOM   968  C CB    . SER C 3 73  ? 1.659   27.507 6.891   1.00 16.38 ? 369  SER A CB    1 
ATOM   969  O OG    . SER C 3 73  ? 0.328   27.951 6.912   1.00 18.20 ? 369  SER A OG    1 
ATOM   970  N N     . MET C 3 74  ? 4.628   28.680 8.033   1.00 15.72 ? 370  MET A N     1 
ATOM   971  C CA    . MET C 3 74  ? 6.029   28.358 8.222   1.00 15.20 ? 370  MET A CA    1 
ATOM   972  C C     . MET C 3 74  ? 6.370   27.955 9.671   1.00 15.26 ? 370  MET A C     1 
ATOM   973  O O     . MET C 3 74  ? 5.480   27.819 10.511  1.00 16.08 ? 370  MET A O     1 
ATOM   974  C CB    . MET C 3 74  ? 6.880   29.560 7.819   1.00 15.72 ? 370  MET A CB    1 
ATOM   975  C CG    . MET C 3 74  ? 6.468   30.233 6.496   1.00 16.68 ? 370  MET A CG    1 
ATOM   976  S SD    . MET C 3 74  ? 7.543   31.672 6.070   1.00 15.40 ? 370  MET A SD    1 
ATOM   977  C CE    . MET C 3 74  ? 9.081   30.986 5.968   1.00 10.10 ? 370  MET A CE    1 
ATOM   978  N N     . PHE C 3 75  ? 7.657   27.738 9.923   1.00 14.45 ? 371  PHE A N     1 
ATOM   979  C CA    . PHE C 3 75  ? 8.174   27.421 11.246  1.00 15.27 ? 371  PHE A CA    1 
ATOM   980  C C     . PHE C 3 75  ? 9.366   28.372 11.433  1.00 15.19 ? 371  PHE A C     1 
ATOM   981  O O     . PHE C 3 75  ? 10.375  28.239 10.753  1.00 15.85 ? 371  PHE A O     1 
ATOM   982  C CB    . PHE C 3 75  ? 8.626   25.951 11.344  1.00 14.55 ? 371  PHE A CB    1 
ATOM   983  C CG    . PHE C 3 75  ? 9.160   25.569 12.711  1.00 13.40 ? 371  PHE A CG    1 
ATOM   984  C CD1   . PHE C 3 75  ? 10.454  25.900 13.083  1.00 12.07 ? 371  PHE A CD1   1 
ATOM   985  C CD2   . PHE C 3 75  ? 8.345   24.929 13.637  1.00 12.81 ? 371  PHE A CD2   1 
ATOM   986  C CE1   . PHE C 3 75  ? 10.916  25.604 14.360  1.00 12.69 ? 371  PHE A CE1   1 
ATOM   987  C CE2   . PHE C 3 75  ? 8.805   24.627 14.924  1.00 11.65 ? 371  PHE A CE2   1 
ATOM   988  C CZ    . PHE C 3 75  ? 10.068  24.962 15.278  1.00 11.59 ? 371  PHE A CZ    1 
ATOM   989  N N     . ASP C 3 76  ? 9.241   29.329 12.362  1.00 15.53 ? 372  ASP A N     1 
ATOM   990  C CA    . ASP C 3 76  ? 10.275  30.340 12.608  1.00 14.69 ? 372  ASP A CA    1 
ATOM   991  C C     . ASP C 3 76  ? 10.444  31.259 11.373  1.00 14.32 ? 372  ASP A C     1 
ATOM   992  O O     . ASP C 3 76  ? 11.529  31.396 10.794  1.00 12.84 ? 372  ASP A O     1 
ATOM   993  C CB    . ASP C 3 76  ? 11.610  29.701 12.952  1.00 15.40 ? 372  ASP A CB    1 
ATOM   994  C CG    . ASP C 3 76  ? 12.597  30.718 13.490  1.00 18.05 ? 372  ASP A CG    1 
ATOM   995  O OD1   . ASP C 3 76  ? 12.182  31.901 13.611  1.00 18.60 ? 372  ASP A OD1   1 
ATOM   996  O OD2   . ASP C 3 76  ? 13.764  30.362 13.786  1.00 16.39 ? 372  ASP A OD2   1 
ATOM   997  N N     . SER C 3 77  ? 9.349   31.882 10.978  1.00 14.08 ? 373  SER A N     1 
ATOM   998  C CA    . SER C 3 77  ? 9.365   32.767 9.829   1.00 15.14 ? 373  SER A CA    1 
ATOM   999  C C     . SER C 3 77  ? 10.248  33.994 10.062  1.00 15.52 ? 373  SER A C     1 
ATOM   1000 O O     . SER C 3 77  ? 10.736  34.576 9.111   1.00 15.99 ? 373  SER A O     1 
ATOM   1001 C CB    . SER C 3 77  ? 7.944   33.198 9.494   1.00 13.77 ? 373  SER A CB    1 
ATOM   1002 O OG    . SER C 3 77  ? 7.367   33.819 10.617  1.00 14.62 ? 373  SER A OG    1 
ATOM   1003 N N     . LYS C 3 78  ? 10.469  34.383 11.318  1.00 14.61 ? 374  LYS A N     1 
ATOM   1004 C CA    . LYS C 3 78  ? 11.315  35.535 11.595  1.00 14.06 ? 374  LYS A CA    1 
ATOM   1005 C C     . LYS C 3 78  ? 12.729  35.263 11.061  1.00 13.53 ? 374  LYS A C     1 
ATOM   1006 O O     . LYS C 3 78  ? 13.357  36.141 10.488  1.00 12.68 ? 374  LYS A O     1 
ATOM   1007 C CB    . LYS C 3 78  ? 11.330  35.841 13.113  1.00 13.60 ? 374  LYS A CB    1 
ATOM   1008 C CG    . LYS C 3 78  ? 12.472  36.748 13.592  1.00 12.28 ? 374  LYS A CG    1 
ATOM   1009 C CD    . LYS C 3 78  ? 12.054  37.534 14.850  1.00 12.06 ? 374  LYS A CD    1 
ATOM   1010 C CE    . LYS C 3 78  ? 12.309  36.727 16.121  1.00 9.26  ? 374  LYS A CE    1 
ATOM   1011 N NZ    . LYS C 3 78  ? 13.744  36.321 16.250  1.00 9.96  ? 374  LYS A NZ    1 
ATOM   1012 N N     . ARG C 3 79  ? 13.217  34.037 11.239  1.00 14.28 ? 375  ARG A N     1 
ATOM   1013 C CA    . ARG C 3 79  ? 14.548  33.638 10.762  1.00 14.14 ? 375  ARG A CA    1 
ATOM   1014 C C     . ARG C 3 79  ? 14.656  33.857 9.227   1.00 14.77 ? 375  ARG A C     1 
ATOM   1015 O O     . ARG C 3 79  ? 15.645  34.406 8.741   1.00 14.44 ? 375  ARG A O     1 
ATOM   1016 C CB    . ARG C 3 79  ? 14.799  32.154 11.110  1.00 14.55 ? 375  ARG A CB    1 
ATOM   1017 C CG    . ARG C 3 79  ? 15.966  31.477 10.384  1.00 12.96 ? 375  ARG A CG    1 
ATOM   1018 C CD    . ARG C 3 79  ? 16.167  30.035 10.884  1.00 14.78 ? 375  ARG A CD    1 
ATOM   1019 N NE    . ARG C 3 79  ? 16.632  30.055 12.261  1.00 14.43 ? 375  ARG A NE    1 
ATOM   1020 C CZ    . ARG C 3 79  ? 17.910  30.073 12.626  1.00 15.60 ? 375  ARG A CZ    1 
ATOM   1021 N NH1   . ARG C 3 79  ? 18.880  30.060 11.715  1.00 15.42 ? 375  ARG A NH1   1 
ATOM   1022 N NH2   . ARG C 3 79  ? 18.222  30.212 13.914  1.00 14.32 ? 375  ARG A NH2   1 
ATOM   1023 N N     . ALA C 3 80  ? 13.629  33.422 8.493   1.00 14.73 ? 376  ALA A N     1 
ATOM   1024 C CA    . ALA C 3 80  ? 13.568  33.550 7.030   1.00 14.77 ? 376  ALA A CA    1 
ATOM   1025 C C     . ALA C 3 80  ? 13.412  35.022 6.634   1.00 14.61 ? 376  ALA A C     1 
ATOM   1026 O O     . ALA C 3 80  ? 14.095  35.523 5.734   1.00 14.22 ? 376  ALA A O     1 
ATOM   1027 C CB    . ALA C 3 80  ? 12.382  32.760 6.494   1.00 13.30 ? 376  ALA A CB    1 
ATOM   1028 N N     . ALA C 3 81  ? 12.476  35.695 7.296   1.00 14.22 ? 377  ALA A N     1 
ATOM   1029 C CA    . ALA C 3 81  ? 12.227  37.104 7.037   1.00 15.38 ? 377  ALA A CA    1 
ATOM   1030 C C     . ALA C 3 81  ? 13.498  37.950 7.153   1.00 15.72 ? 377  ALA A C     1 
ATOM   1031 O O     . ALA C 3 81  ? 13.794  38.774 6.264   1.00 17.48 ? 377  ALA A O     1 
ATOM   1032 C CB    . ALA C 3 81  ? 11.174  37.616 7.972   1.00 15.73 ? 377  ALA A CB    1 
ATOM   1033 N N     . VAL C 3 82  ? 14.261  37.750 8.223   1.00 14.74 ? 378  VAL A N     1 
ATOM   1034 C CA    . VAL C 3 82  ? 15.482  38.519 8.405   1.00 14.79 ? 378  VAL A CA    1 
ATOM   1035 C C     . VAL C 3 82  ? 16.558  38.113 7.410   1.00 14.86 ? 378  VAL A C     1 
ATOM   1036 O O     . VAL C 3 82  ? 17.232  38.987 6.874   1.00 14.62 ? 378  VAL A O     1 
ATOM   1037 C CB    . VAL C 3 82  ? 16.050  38.403 9.847   1.00 13.53 ? 378  VAL A CB    1 
ATOM   1038 C CG1   . VAL C 3 82  ? 17.420  38.988 9.902   1.00 11.90 ? 378  VAL A CG1   1 
ATOM   1039 C CG2   . VAL C 3 82  ? 15.131  39.136 10.830  1.00 14.11 ? 378  VAL A CG2   1 
ATOM   1040 N N     . ALA C 3 83  ? 16.733  36.804 7.168   1.00 15.61 ? 379  ALA A N     1 
ATOM   1041 C CA    . ALA C 3 83  ? 17.746  36.340 6.197   1.00 16.01 ? 379  ALA A CA    1 
ATOM   1042 C C     . ALA C 3 83  ? 17.419  36.947 4.819   1.00 15.61 ? 379  ALA A C     1 
ATOM   1043 O O     . ALA C 3 83  ? 18.321  37.247 4.056   1.00 17.50 ? 379  ALA A O     1 
ATOM   1044 C CB    . ALA C 3 83  ? 17.763  34.800 6.100   1.00 14.60 ? 379  ALA A CB    1 
ATOM   1045 N N     . LEU C 3 84  ? 16.133  37.113 4.521   1.00 16.40 ? 380  LEU A N     1 
ATOM   1046 C CA    . LEU C 3 84  ? 15.687  37.710 3.253   1.00 17.66 ? 380  LEU A CA    1 
ATOM   1047 C C     . LEU C 3 84  ? 15.828  39.258 3.258   1.00 18.37 ? 380  LEU A C     1 
ATOM   1048 O O     . LEU C 3 84  ? 16.195  39.848 2.235   1.00 17.68 ? 380  LEU A O     1 
ATOM   1049 C CB    . LEU C 3 84  ? 14.236  37.293 2.947   1.00 16.71 ? 380  LEU A CB    1 
ATOM   1050 C CG    . LEU C 3 84  ? 14.063  35.831 2.479   1.00 16.51 ? 380  LEU A CG    1 
ATOM   1051 C CD1   . LEU C 3 84  ? 12.589  35.471 2.537   1.00 14.68 ? 380  LEU A CD1   1 
ATOM   1052 C CD2   . LEU C 3 84  ? 14.637  35.629 1.089   1.00 14.48 ? 380  LEU A CD2   1 
ATOM   1053 N N     . LYS C 3 85  ? 15.542  39.906 4.396   1.00 17.68 ? 381  LYS A N     1 
ATOM   1054 C CA    . LYS C 3 85  ? 15.729  41.355 4.503   1.00 17.42 ? 381  LYS A CA    1 
ATOM   1055 C C     . LYS C 3 85  ? 17.183  41.641 4.147   1.00 17.58 ? 381  LYS A C     1 
ATOM   1056 O O     . LYS C 3 85  ? 17.483  42.628 3.486   1.00 17.60 ? 381  LYS A O     1 
ATOM   1057 C CB    . LYS C 3 85  ? 15.524  41.846 5.930   1.00 17.13 ? 381  LYS A CB    1 
ATOM   1058 C CG    . LYS C 3 85  ? 14.097  42.180 6.311   1.00 17.62 ? 381  LYS A CG    1 
ATOM   1059 C CD    . LYS C 3 85  ? 14.048  42.635 7.780   1.00 16.91 ? 381  LYS A CD    1 
ATOM   1060 C CE    . LYS C 3 85  ? 12.642  42.636 8.333   1.00 16.96 ? 381  LYS A CE    1 
ATOM   1061 N NZ    . LYS C 3 85  ? 11.776  43.674 7.694   1.00 17.16 ? 381  LYS A NZ    1 
ATOM   1062 N N     . TRP C 3 86  ? 18.104  40.797 4.609   1.00 16.92 ? 382  TRP A N     1 
ATOM   1063 C CA    . TRP C 3 86  ? 19.506  41.026 4.294   1.00 16.77 ? 382  TRP A CA    1 
ATOM   1064 C C     . TRP C 3 86  ? 19.784  40.882 2.786   1.00 17.06 ? 382  TRP A C     1 
ATOM   1065 O O     . TRP C 3 86  ? 20.838  41.316 2.301   1.00 16.49 ? 382  TRP A O     1 
ATOM   1066 C CB    . TRP C 3 86  ? 20.408  40.075 5.092   1.00 16.00 ? 382  TRP A CB    1 
ATOM   1067 C CG    . TRP C 3 86  ? 20.604  40.507 6.513   1.00 15.88 ? 382  TRP A CG    1 
ATOM   1068 C CD1   . TRP C 3 86  ? 19.884  40.088 7.595   1.00 16.14 ? 382  TRP A CD1   1 
ATOM   1069 C CD2   . TRP C 3 86  ? 21.615  41.407 7.022   1.00 15.93 ? 382  TRP A CD2   1 
ATOM   1070 N NE1   . TRP C 3 86  ? 20.385  40.662 8.753   1.00 15.68 ? 382  TRP A NE1   1 
ATOM   1071 C CE2   . TRP C 3 86  ? 21.444  41.474 8.434   1.00 16.06 ? 382  TRP A CE2   1 
ATOM   1072 C CE3   . TRP C 3 86  ? 22.646  42.158 6.429   1.00 14.20 ? 382  TRP A CE3   1 
ATOM   1073 C CZ2   . TRP C 3 86  ? 22.270  42.261 9.258   1.00 14.70 ? 382  TRP A CZ2   1 
ATOM   1074 C CZ3   . TRP C 3 86  ? 23.472  42.944 7.253   1.00 13.65 ? 382  TRP A CZ3   1 
ATOM   1075 C CH2   . TRP C 3 86  ? 23.277  42.984 8.653   1.00 14.73 ? 382  TRP A CH2   1 
ATOM   1076 N N     . LYS C 3 87  ? 18.843  40.281 2.058   1.00 17.56 ? 383  LYS A N     1 
ATOM   1077 C CA    . LYS C 3 87  ? 18.982  40.092 0.606   1.00 18.58 ? 383  LYS A CA    1 
ATOM   1078 C C     . LYS C 3 87  ? 18.112  41.078 -0.144  1.00 19.10 ? 383  LYS A C     1 
ATOM   1079 O O     . LYS C 3 87  ? 17.948  40.978 -1.355  1.00 20.07 ? 383  LYS A O     1 
ATOM   1080 C CB    . LYS C 3 87  ? 18.565  38.676 0.199   1.00 18.23 ? 383  LYS A CB    1 
ATOM   1081 C CG    . LYS C 3 87  ? 19.615  37.635 0.510   1.00 17.49 ? 383  LYS A CG    1 
ATOM   1082 C CD    . LYS C 3 87  ? 19.033  36.270 0.358   1.00 18.89 ? 383  LYS A CD    1 
ATOM   1083 C CE    . LYS C 3 87  ? 20.010  35.224 0.845   1.00 18.45 ? 383  LYS A CE    1 
ATOM   1084 N NZ    . LYS C 3 87  ? 21.347  35.427 0.233   1.00 18.93 ? 383  LYS A NZ    1 
ATOM   1085 N N     . GLY C 3 88  ? 17.533  42.028 0.575   1.00 19.00 ? 384  GLY A N     1 
ATOM   1086 C CA    . GLY C 3 88  ? 16.687  43.000 -0.088  1.00 18.80 ? 384  GLY A CA    1 
ATOM   1087 C C     . GLY C 3 88  ? 15.359  42.441 -0.552  1.00 19.18 ? 384  GLY A C     1 
ATOM   1088 O O     . GLY C 3 88  ? 14.727  43.041 -1.436  1.00 19.38 ? 384  GLY A O     1 
ATOM   1089 N N     . ILE C 3 89  ? 14.928  41.308 0.021   1.00 18.58 ? 385  ILE A N     1 
ATOM   1090 C CA    . ILE C 3 89  ? 13.634  40.693 -0.320  1.00 17.69 ? 385  ILE A CA    1 
ATOM   1091 C C     . ILE C 3 89  ? 12.665  40.750 0.880   1.00 18.90 ? 385  ILE A C     1 
ATOM   1092 O O     . ILE C 3 89  ? 13.049  40.429 2.012   1.00 17.69 ? 385  ILE A O     1 
ATOM   1093 C CB    . ILE C 3 89  ? 13.792  39.203 -0.753  1.00 17.52 ? 385  ILE A CB    1 
ATOM   1094 C CG1   . ILE C 3 89  ? 14.486  39.128 -2.100  1.00 17.30 ? 385  ILE A CG1   1 
ATOM   1095 C CG2   . ILE C 3 89  ? 12.421  38.528 -0.872  1.00 16.00 ? 385  ILE A CG2   1 
ATOM   1096 C CD1   . ILE C 3 89  ? 15.573  38.115 -2.150  1.00 18.45 ? 385  ILE A CD1   1 
ATOM   1097 N N     . GLU C 3 90  ? 11.416  41.151 0.624   1.00 19.76 ? 386  GLU A N     1 
ATOM   1098 C CA    . GLU C 3 90  ? 10.378  41.263 1.663   1.00 21.32 ? 386  GLU A CA    1 
ATOM   1099 C C     . GLU C 3 90  ? 9.497   40.013 1.728   1.00 20.85 ? 386  GLU A C     1 
ATOM   1100 O O     . GLU C 3 90  ? 8.995   39.545 0.706   1.00 20.21 ? 386  GLU A O     1 
ATOM   1101 C CB    . GLU C 3 90  ? 9.473   42.484 1.401   1.00 23.18 ? 386  GLU A CB    1 
ATOM   1102 C CG    . GLU C 3 90  ? 9.243   43.399 2.610   1.00 28.72 ? 386  GLU A CG    1 
ATOM   1103 C CD    . GLU C 3 90  ? 7.884   44.137 2.583   1.00 32.10 ? 386  GLU A CD    1 
ATOM   1104 O OE1   . GLU C 3 90  ? 7.328   44.370 1.482   1.00 34.73 ? 386  GLU A OE1   1 
ATOM   1105 O OE2   . GLU C 3 90  ? 7.354   44.502 3.662   1.00 34.64 ? 386  GLU A OE2   1 
ATOM   1106 N N     . LEU C 3 91  ? 9.309   39.472 2.930   1.00 19.61 ? 387  LEU A N     1 
ATOM   1107 C CA    . LEU C 3 91  ? 8.459   38.299 3.097   1.00 18.47 ? 387  LEU A CA    1 
ATOM   1108 C C     . LEU C 3 91  ? 7.128   38.764 3.698   1.00 18.15 ? 387  LEU A C     1 
ATOM   1109 O O     . LEU C 3 91  ? 7.112   39.431 4.726   1.00 19.24 ? 387  LEU A O     1 
ATOM   1110 C CB    . LEU C 3 91  ? 9.148   37.284 4.016   1.00 18.07 ? 387  LEU A CB    1 
ATOM   1111 C CG    . LEU C 3 91  ? 8.289   36.105 4.504   1.00 19.85 ? 387  LEU A CG    1 
ATOM   1112 C CD1   . LEU C 3 91  ? 7.794   35.243 3.311   1.00 19.56 ? 387  LEU A CD1   1 
ATOM   1113 C CD2   . LEU C 3 91  ? 9.132   35.249 5.455   1.00 18.81 ? 387  LEU A CD2   1 
ATOM   1114 N N     . CYS C 3 92  ? 6.011   38.438 3.063   1.00 17.13 ? 388  CYS A N     1 
ATOM   1115 C CA    . CYS C 3 92  ? 4.708   38.859 3.567   1.00 17.38 ? 388  CYS A CA    1 
ATOM   1116 C C     . CYS C 3 92  ? 3.730   37.702 3.506   1.00 16.81 ? 388  CYS A C     1 
ATOM   1117 O O     . CYS C 3 92  ? 4.013   36.674 2.898   1.00 16.67 ? 388  CYS A O     1 
ATOM   1118 C CB    . CYS C 3 92  ? 4.150   40.030 2.713   1.00 17.08 ? 388  CYS A CB    1 
ATOM   1119 S SG    . CYS C 3 92  ? 5.060   41.633 2.830   1.00 22.44 ? 388  CYS A SG    1 
ATOM   1120 N N     . GLY C 3 93  ? 2.568   37.884 4.118   1.00 16.48 ? 389  GLY A N     1 
ATOM   1121 C CA    . GLY C 3 93  ? 1.540   36.864 4.053   1.00 17.06 ? 389  GLY A CA    1 
ATOM   1122 C C     . GLY C 3 93  ? 1.719   35.630 4.923   1.00 17.88 ? 389  GLY A C     1 
ATOM   1123 O O     . GLY C 3 93  ? 1.070   34.607 4.691   1.00 18.20 ? 389  GLY A O     1 
ATOM   1124 N N     . VAL C 3 94  ? 2.604   35.694 5.909   1.00 18.00 ? 390  VAL A N     1 
ATOM   1125 C CA    . VAL C 3 94  ? 2.797   34.544 6.792   1.00 17.84 ? 390  VAL A CA    1 
ATOM   1126 C C     . VAL C 3 94  ? 1.601   34.508 7.761   1.00 17.86 ? 390  VAL A C     1 
ATOM   1127 O O     . VAL C 3 94  ? 1.522   35.301 8.704   1.00 19.30 ? 390  VAL A O     1 
ATOM   1128 C CB    . VAL C 3 94  ? 4.127   34.659 7.562   1.00 17.15 ? 390  VAL A CB    1 
ATOM   1129 C CG1   . VAL C 3 94  ? 4.348   33.416 8.401   1.00 16.86 ? 390  VAL A CG1   1 
ATOM   1130 C CG2   . VAL C 3 94  ? 5.278   34.817 6.590   1.00 17.24 ? 390  VAL A CG2   1 
ATOM   1131 N N     . SER C 3 95  ? 0.659   33.602 7.529   1.00 16.47 ? 391  SER A N     1 
ATOM   1132 C CA    . SER C 3 95  ? -0.512  33.552 8.379   1.00 15.72 ? 391  SER A CA    1 
ATOM   1133 C C     . SER C 3 95  ? -0.429  32.544 9.514   1.00 15.13 ? 391  SER A C     1 
ATOM   1134 O O     . SER C 3 95  ? -1.285  32.513 10.375  1.00 15.66 ? 391  SER A O     1 
ATOM   1135 C CB    . SER C 3 95  ? -1.753  33.277 7.532   1.00 14.54 ? 391  SER A CB    1 
ATOM   1136 O OG    . SER C 3 95  ? -1.613  32.057 6.844   1.00 15.70 ? 391  SER A OG    1 
ATOM   1137 N N     . PHE C 3 96  ? 0.602   31.728 9.526   1.00 15.31 ? 392  PHE A N     1 
ATOM   1138 C CA    . PHE C 3 96  ? 0.735   30.725 10.572  1.00 16.13 ? 392  PHE A CA    1 
ATOM   1139 C C     . PHE C 3 96  ? 2.190   30.330 10.765  1.00 16.44 ? 392  PHE A C     1 
ATOM   1140 O O     . PHE C 3 96  ? 2.870   29.949 9.805   1.00 17.65 ? 392  PHE A O     1 
ATOM   1141 C CB    . PHE C 3 96  ? -0.092  29.497 10.221  1.00 15.48 ? 392  PHE A CB    1 
ATOM   1142 C CG    . PHE C 3 96  ? 0.050   28.374 11.210  1.00 16.02 ? 392  PHE A CG    1 
ATOM   1143 C CD1   . PHE C 3 96  ? -0.707  28.367 12.379  1.00 15.88 ? 392  PHE A CD1   1 
ATOM   1144 C CD2   . PHE C 3 96  ? 0.958   27.341 10.985  1.00 15.59 ? 392  PHE A CD2   1 
ATOM   1145 C CE1   . PHE C 3 96  ? -0.563  27.349 13.318  1.00 16.31 ? 392  PHE A CE1   1 
ATOM   1146 C CE2   . PHE C 3 96  ? 1.114   26.309 11.924  1.00 17.13 ? 392  PHE A CE2   1 
ATOM   1147 C CZ    . PHE C 3 96  ? 0.354   26.316 13.092  1.00 16.30 ? 392  PHE A CZ    1 
ATOM   1148 N N     . ASP C 3 97  ? 2.676   30.450 12.002  1.00 16.10 ? 393  ASP A N     1 
ATOM   1149 C CA    . ASP C 3 97  ? 4.050   30.095 12.351  1.00 15.58 ? 393  ASP A CA    1 
ATOM   1150 C C     . ASP C 3 97  ? 3.964   28.964 13.391  1.00 16.33 ? 393  ASP A C     1 
ATOM   1151 O O     . ASP C 3 97  ? 3.557   29.192 14.540  1.00 15.75 ? 393  ASP A O     1 
ATOM   1152 C CB    . ASP C 3 97  ? 4.769   31.303 12.941  1.00 14.83 ? 393  ASP A CB    1 
ATOM   1153 C CG    . ASP C 3 97  ? 6.236   31.050 13.143  1.00 16.01 ? 393  ASP A CG    1 
ATOM   1154 O OD1   . ASP C 3 97  ? 6.595   29.898 13.500  1.00 15.53 ? 393  ASP A OD1   1 
ATOM   1155 O OD2   . ASP C 3 97  ? 7.041   31.995 12.940  1.00 14.95 ? 393  ASP A OD2   1 
ATOM   1156 N N     . LEU C 3 98  ? 4.335   27.752 12.970  1.00 15.54 ? 394  LEU A N     1 
ATOM   1157 C CA    . LEU C 3 98  ? 4.267   26.551 13.813  1.00 15.52 ? 394  LEU A CA    1 
ATOM   1158 C C     . LEU C 3 98  ? 5.097   26.622 15.098  1.00 14.80 ? 394  LEU A C     1 
ATOM   1159 O O     . LEU C 3 98  ? 4.708   26.052 16.107  1.00 15.90 ? 394  LEU A O     1 
ATOM   1160 C CB    . LEU C 3 98  ? 4.687   25.315 12.995  1.00 14.24 ? 394  LEU A CB    1 
ATOM   1161 C CG    . LEU C 3 98  ? 4.700   23.960 13.721  1.00 13.76 ? 394  LEU A CG    1 
ATOM   1162 C CD1   . LEU C 3 98  ? 3.281   23.638 14.235  1.00 12.77 ? 394  LEU A CD1   1 
ATOM   1163 C CD2   . LEU C 3 98  ? 5.188   22.876 12.765  1.00 13.68 ? 394  LEU A CD2   1 
ATOM   1164 N N     . LEU C 3 99  ? 6.241   27.297 15.052  1.00 14.90 ? 395  LEU A N     1 
ATOM   1165 C CA    . LEU C 3 99  ? 7.087   27.435 16.228  1.00 15.27 ? 395  LEU A CA    1 
ATOM   1166 C C     . LEU C 3 99  ? 6.357   28.225 17.312  1.00 15.88 ? 395  LEU A C     1 
ATOM   1167 O O     . LEU C 3 99  ? 6.370   27.868 18.492  1.00 16.37 ? 395  LEU A O     1 
ATOM   1168 C CB    . LEU C 3 99  ? 8.368   28.183 15.872  1.00 15.57 ? 395  LEU A CB    1 
ATOM   1169 C CG    . LEU C 3 99  ? 9.199   28.722 17.052  1.00 16.06 ? 395  LEU A CG    1 
ATOM   1170 C CD1   . LEU C 3 99  ? 9.803   27.571 17.899  1.00 15.40 ? 395  LEU A CD1   1 
ATOM   1171 C CD2   . LEU C 3 99  ? 10.305  29.574 16.490  1.00 16.22 ? 395  LEU A CD2   1 
ATOM   1172 N N     . LEU C 3 100 ? 5.719   29.312 16.900  1.00 15.42 ? 396  LEU A N     1 
ATOM   1173 C CA    . LEU C 3 100 ? 5.000   30.157 17.824  1.00 14.44 ? 396  LEU A CA    1 
ATOM   1174 C C     . LEU C 3 100 ? 3.748   29.462 18.324  1.00 13.56 ? 396  LEU A C     1 
ATOM   1175 O O     . LEU C 3 100 ? 3.385   29.616 19.479  1.00 12.88 ? 396  LEU A O     1 
ATOM   1176 C CB    . LEU C 3 100 ? 4.673   31.506 17.154  1.00 12.85 ? 396  LEU A CB    1 
ATOM   1177 C CG    . LEU C 3 100 ? 5.919   32.362 16.907  1.00 13.64 ? 396  LEU A CG    1 
ATOM   1178 C CD1   . LEU C 3 100 ? 5.528   33.679 16.193  1.00 13.15 ? 396  LEU A CD1   1 
ATOM   1179 C CD2   . LEU C 3 100 ? 6.645   32.640 18.248  1.00 13.29 ? 396  LEU A CD2   1 
ATOM   1180 N N     . ALA C 3 101 ? 3.073   28.716 17.454  1.00 13.34 ? 397  ALA A N     1 
ATOM   1181 C CA    . ALA C 3 101 ? 1.863   27.991 17.845  1.00 13.80 ? 397  ALA A CA    1 
ATOM   1182 C C     . ALA C 3 101 ? 2.242   26.939 18.899  1.00 14.79 ? 397  ALA A C     1 
ATOM   1183 O O     . ALA C 3 101 ? 1.561   26.781 19.918  1.00 15.25 ? 397  ALA A O     1 
ATOM   1184 C CB    . ALA C 3 101 ? 1.232   27.311 16.627  1.00 12.17 ? 397  ALA A CB    1 
ATOM   1185 N N     . ALA C 3 102 ? 3.335   26.232 18.652  1.00 14.51 ? 398  ALA A N     1 
ATOM   1186 C CA    . ALA C 3 102 ? 3.800   25.218 19.585  1.00 15.69 ? 398  ALA A CA    1 
ATOM   1187 C C     . ALA C 3 102 ? 4.191   25.884 20.926  1.00 16.04 ? 398  ALA A C     1 
ATOM   1188 O O     . ALA C 3 102 ? 3.869   25.390 22.012  1.00 16.34 ? 398  ALA A O     1 
ATOM   1189 C CB    . ALA C 3 102 ? 4.999   24.482 18.990  1.00 12.54 ? 398  ALA A CB    1 
ATOM   1190 N N     . TYR C 3 103 ? 4.888   27.009 20.851  1.00 15.98 ? 399  TYR A N     1 
ATOM   1191 C CA    . TYR C 3 103 ? 5.314   27.714 22.064  1.00 15.63 ? 399  TYR A CA    1 
ATOM   1192 C C     . TYR C 3 103 ? 4.139   28.115 22.952  1.00 14.93 ? 399  TYR A C     1 
ATOM   1193 O O     . TYR C 3 103 ? 4.186   27.974 24.164  1.00 15.73 ? 399  TYR A O     1 
ATOM   1194 C CB    . TYR C 3 103 ? 6.118   28.949 21.664  1.00 16.32 ? 399  TYR A CB    1 
ATOM   1195 C CG    . TYR C 3 103 ? 6.529   29.858 22.804  1.00 16.84 ? 399  TYR A CG    1 
ATOM   1196 C CD1   . TYR C 3 103 ? 7.465   29.442 23.762  1.00 16.57 ? 399  TYR A CD1   1 
ATOM   1197 C CD2   . TYR C 3 103 ? 6.031   31.150 22.879  1.00 16.89 ? 399  TYR A CD2   1 
ATOM   1198 C CE1   . TYR C 3 103 ? 7.892   30.300 24.752  1.00 16.75 ? 399  TYR A CE1   1 
ATOM   1199 C CE2   . TYR C 3 103 ? 6.447   32.015 23.857  1.00 17.10 ? 399  TYR A CE2   1 
ATOM   1200 C CZ    . TYR C 3 103 ? 7.378   31.597 24.791  1.00 16.95 ? 399  TYR A CZ    1 
ATOM   1201 O OH    . TYR C 3 103 ? 7.817   32.507 25.737  1.00 16.24 ? 399  TYR A OH    1 
ATOM   1202 N N     . LEU C 3 104 ? 3.086   28.619 22.343  1.00 14.80 ? 400  LEU A N     1 
ATOM   1203 C CA    . LEU C 3 104 ? 1.928   29.048 23.087  1.00 14.94 ? 400  LEU A CA    1 
ATOM   1204 C C     . LEU C 3 104 ? 1.205   27.874 23.695  1.00 16.05 ? 400  LEU A C     1 
ATOM   1205 O O     . LEU C 3 104 ? 0.710   27.966 24.816  1.00 16.40 ? 400  LEU A O     1 
ATOM   1206 C CB    . LEU C 3 104 ? 0.956   29.822 22.188  1.00 14.80 ? 400  LEU A CB    1 
ATOM   1207 C CG    . LEU C 3 104 ? 1.422   31.187 21.667  1.00 14.36 ? 400  LEU A CG    1 
ATOM   1208 C CD1   . LEU C 3 104 ? 0.298   31.838 20.856  1.00 13.14 ? 400  LEU A CD1   1 
ATOM   1209 C CD2   . LEU C 3 104 ? 1.854   32.084 22.865  1.00 13.33 ? 400  LEU A CD2   1 
ATOM   1210 N N     . LEU C 3 105 ? 1.136   26.769 22.960  1.00 16.25 ? 401  LEU A N     1 
ATOM   1211 C CA    . LEU C 3 105 ? 0.427   25.589 23.450  1.00 17.08 ? 401  LEU A CA    1 
ATOM   1212 C C     . LEU C 3 105 ? 1.092   25.024 24.692  1.00 17.69 ? 401  LEU A C     1 
ATOM   1213 O O     . LEU C 3 105 ? 0.405   24.590 25.629  1.00 19.41 ? 401  LEU A O     1 
ATOM   1214 C CB    . LEU C 3 105 ? 0.354   24.504 22.371  1.00 16.24 ? 401  LEU A CB    1 
ATOM   1215 C CG    . LEU C 3 105 ? -0.693  24.738 21.286  1.00 15.48 ? 401  LEU A CG    1 
ATOM   1216 C CD1   . LEU C 3 105 ? -0.719  23.511 20.358  1.00 15.77 ? 401  LEU A CD1   1 
ATOM   1217 C CD2   . LEU C 3 105 ? -2.057  25.011 21.905  1.00 11.93 ? 401  LEU A CD2   1 
ATOM   1218 N N     . ASP C 3 106 ? 2.422   25.026 24.698  1.00 18.58 ? 402  ASP A N     1 
ATOM   1219 C CA    . ASP C 3 106 ? 3.181   24.533 25.840  1.00 18.78 ? 402  ASP A CA    1 
ATOM   1220 C C     . ASP C 3 106 ? 4.653   24.849 25.724  1.00 18.71 ? 402  ASP A C     1 
ATOM   1221 O O     . ASP C 3 106 ? 5.413   24.110 25.091  1.00 18.13 ? 402  ASP A O     1 
ATOM   1222 C CB    . ASP C 3 106 ? 2.987   23.024 26.008  1.00 20.83 ? 402  ASP A CB    1 
ATOM   1223 C CG    . ASP C 3 106 ? 3.715   22.468 27.234  1.00 22.48 ? 402  ASP A CG    1 
ATOM   1224 O OD1   . ASP C 3 106 ? 4.180   23.255 28.096  1.00 20.53 ? 402  ASP A OD1   1 
ATOM   1225 O OD2   . ASP C 3 106 ? 3.831   21.225 27.318  1.00 23.36 ? 402  ASP A OD2   1 
ATOM   1226 N N     . PRO C 3 107 ? 5.077   25.969 26.338  1.00 17.64 ? 403  PRO A N     1 
ATOM   1227 C CA    . PRO C 3 107 ? 6.460   26.450 26.343  1.00 18.55 ? 403  PRO A CA    1 
ATOM   1228 C C     . PRO C 3 107 ? 7.483   25.512 26.988  1.00 19.54 ? 403  PRO A C     1 
ATOM   1229 O O     . PRO C 3 107 ? 8.683   25.589 26.700  1.00 19.92 ? 403  PRO A O     1 
ATOM   1230 C CB    . PRO C 3 107 ? 6.382   27.806 27.058  1.00 18.06 ? 403  PRO A CB    1 
ATOM   1231 C CG    . PRO C 3 107 ? 5.079   27.802 27.765  1.00 18.58 ? 403  PRO A CG    1 
ATOM   1232 C CD    . PRO C 3 107 ? 4.156   26.876 27.043  1.00 17.64 ? 403  PRO A CD    1 
ATOM   1233 N N     . ALA C 3 108 ? 7.012   24.622 27.851  1.00 20.93 ? 404  ALA A N     1 
ATOM   1234 C CA    . ALA C 3 108 ? 7.905   23.689 28.529  1.00 22.67 ? 404  ALA A CA    1 
ATOM   1235 C C     . ALA C 3 108 ? 8.394   22.576 27.609  1.00 24.39 ? 404  ALA A C     1 
ATOM   1236 O O     . ALA C 3 108 ? 9.421   21.957 27.884  1.00 24.67 ? 404  ALA A O     1 
ATOM   1237 C CB    . ALA C 3 108 ? 7.202   23.088 29.735  1.00 22.23 ? 404  ALA A CB    1 
ATOM   1238 N N     . GLN C 3 109 ? 7.668   22.317 26.518  1.00 25.49 ? 405  GLN A N     1 
ATOM   1239 C CA    . GLN C 3 109 ? 8.063   21.271 25.576  1.00 26.53 ? 405  GLN A CA    1 
ATOM   1240 C C     . GLN C 3 109 ? 9.443   21.548 24.999  1.00 26.78 ? 405  GLN A C     1 
ATOM   1241 O O     . GLN C 3 109 ? 10.185  20.623 24.662  1.00 27.62 ? 405  GLN A O     1 
ATOM   1242 C CB    . GLN C 3 109 ? 7.045   21.161 24.442  1.00 28.22 ? 405  GLN A CB    1 
ATOM   1243 C CG    . GLN C 3 109 ? 5.895   20.260 24.777  1.00 32.03 ? 405  GLN A CG    1 
ATOM   1244 C CD    . GLN C 3 109 ? 6.353   19.059 25.579  1.00 34.66 ? 405  GLN A CD    1 
ATOM   1245 O OE1   . GLN C 3 109 ? 6.946   18.127 25.029  1.00 35.43 ? 405  GLN A OE1   1 
ATOM   1246 N NE2   . GLN C 3 109 ? 6.098   19.080 26.896  1.00 36.37 ? 405  GLN A NE2   1 
ATOM   1247 N N     . GLY C 3 110 ? 9.793   22.825 24.886  1.00 26.62 ? 406  GLY A N     1 
ATOM   1248 C CA    . GLY C 3 110 ? 11.092  23.168 24.332  1.00 25.35 ? 406  GLY A CA    1 
ATOM   1249 C C     . GLY C 3 110 ? 11.157  22.929 22.827  1.00 24.34 ? 406  GLY A C     1 
ATOM   1250 O O     . GLY C 3 110 ? 12.202  22.560 22.290  1.00 24.06 ? 406  GLY A O     1 
ATOM   1251 N N     . VAL C 3 111 ? 10.036  23.144 22.148  1.00 23.69 ? 407  VAL A N     1 
ATOM   1252 C CA    . VAL C 3 111 ? 9.973   22.947 20.704  1.00 23.02 ? 407  VAL A CA    1 
ATOM   1253 C C     . VAL C 3 111 ? 10.911  23.894 19.980  1.00 23.22 ? 407  VAL A C     1 
ATOM   1254 O O     . VAL C 3 111 ? 10.738  25.115 20.035  1.00 23.46 ? 407  VAL A O     1 
ATOM   1255 C CB    . VAL C 3 111 ? 8.557   23.169 20.200  1.00 21.49 ? 407  VAL A CB    1 
ATOM   1256 C CG1   . VAL C 3 111 ? 8.570   23.400 18.685  1.00 22.33 ? 407  VAL A CG1   1 
ATOM   1257 C CG2   . VAL C 3 111 ? 7.707   21.972 20.569  1.00 20.27 ? 407  VAL A CG2   1 
ATOM   1258 N N     . ASP C 3 112 ? 11.927  23.333 19.332  1.00 23.12 ? 408  ASP A N     1 
ATOM   1259 C CA    . ASP C 3 112 ? 12.887  24.145 18.591  1.00 23.55 ? 408  ASP A CA    1 
ATOM   1260 C C     . ASP C 3 112 ? 13.132  23.658 17.158  1.00 22.29 ? 408  ASP A C     1 
ATOM   1261 O O     . ASP C 3 112 ? 14.070  24.088 16.488  1.00 22.14 ? 408  ASP A O     1 
ATOM   1262 C CB    . ASP C 3 112 ? 14.216  24.280 19.352  1.00 25.93 ? 408  ASP A CB    1 
ATOM   1263 C CG    . ASP C 3 112 ? 14.984  22.989 19.427  1.00 28.20 ? 408  ASP A CG    1 
ATOM   1264 O OD1   . ASP C 3 112 ? 14.426  21.931 19.043  1.00 30.97 ? 408  ASP A OD1   1 
ATOM   1265 O OD2   . ASP C 3 112 ? 16.147  23.041 19.885  1.00 30.73 ? 408  ASP A OD2   1 
ATOM   1266 N N     . ASP C 3 113 ? 12.306  22.721 16.709  1.00 20.58 ? 409  ASP A N     1 
ATOM   1267 C CA    . ASP C 3 113 ? 12.364  22.285 15.330  1.00 19.03 ? 409  ASP A CA    1 
ATOM   1268 C C     . ASP C 3 113 ? 11.027  21.682 14.969  1.00 18.18 ? 409  ASP A C     1 
ATOM   1269 O O     . ASP C 3 113 ? 10.159  21.451 15.843  1.00 15.94 ? 409  ASP A O     1 
ATOM   1270 C CB    . ASP C 3 113 ? 13.574  21.382 15.000  1.00 18.84 ? 409  ASP A CB    1 
ATOM   1271 C CG    . ASP C 3 113 ? 13.530  20.032 15.665  1.00 18.35 ? 409  ASP A CG    1 
ATOM   1272 O OD1   . ASP C 3 113 ? 12.535  19.699 16.339  1.00 18.90 ? 409  ASP A OD1   1 
ATOM   1273 O OD2   . ASP C 3 113 ? 14.524  19.301 15.503  1.00 18.35 ? 409  ASP A OD2   1 
ATOM   1274 N N     . VAL C 3 114 ? 10.831  21.494 13.669  1.00 17.75 ? 410  VAL A N     1 
ATOM   1275 C CA    . VAL C 3 114 ? 9.562   20.986 13.167  1.00 16.36 ? 410  VAL A CA    1 
ATOM   1276 C C     . VAL C 3 114 ? 9.265   19.609 13.727  1.00 15.32 ? 410  VAL A C     1 
ATOM   1277 O O     . VAL C 3 114 ? 8.129   19.331 14.063  1.00 15.10 ? 410  VAL A O     1 
ATOM   1278 C CB    . VAL C 3 114 ? 9.545   20.987 11.607  1.00 15.65 ? 410  VAL A CB    1 
ATOM   1279 C CG1   . VAL C 3 114 ? 8.326   20.231 11.065  1.00 14.12 ? 410  VAL A CG1   1 
ATOM   1280 C CG2   . VAL C 3 114 ? 9.547   22.445 11.110  1.00 14.87 ? 410  VAL A CG2   1 
ATOM   1281 N N     . ARG C 3 115 ? 10.282  18.766 13.855  1.00 16.12 ? 411  ARG A N     1 
ATOM   1282 C CA    . ARG C 3 115 ? 10.059  17.420 14.386  1.00 18.54 ? 411  ARG A CA    1 
ATOM   1283 C C     . ARG C 3 115 ? 9.484   17.455 15.807  1.00 17.46 ? 411  ARG A C     1 
ATOM   1284 O O     . ARG C 3 115 ? 8.547   16.695 16.109  1.00 17.22 ? 411  ARG A O     1 
ATOM   1285 C CB    . ARG C 3 115 ? 11.357  16.597 14.380  1.00 21.28 ? 411  ARG A CB    1 
ATOM   1286 C CG    . ARG C 3 115 ? 11.978  16.346 15.802  1.00 29.56 ? 411  ARG A CG    1 
ATOM   1287 C CD    . ARG C 3 115 ? 11.147  15.391 16.757  1.00 32.39 ? 411  ARG A CD    1 
ATOM   1288 N NE    . ARG C 3 115 ? 11.576  15.418 18.168  1.00 33.47 ? 411  ARG A NE    1 
ATOM   1289 C CZ    . ARG C 3 115 ? 10.757  15.642 19.207  1.00 36.12 ? 411  ARG A CZ    1 
ATOM   1290 N NH1   . ARG C 3 115 ? 9.458   15.862 19.000  1.00 38.71 ? 411  ARG A NH1   1 
ATOM   1291 N NH2   . ARG C 3 115 ? 11.221  15.653 20.460  1.00 34.74 ? 411  ARG A NH2   1 
ATOM   1292 N N     . ALA C 3 116 ? 10.041  18.329 16.664  1.00 16.54 ? 412  ALA A N     1 
ATOM   1293 C CA    . ALA C 3 116 ? 9.567   18.468 18.047  1.00 14.69 ? 412  ALA A CA    1 
ATOM   1294 C C     . ALA C 3 116 ? 8.104   18.901 18.064  1.00 14.68 ? 412  ALA A C     1 
ATOM   1295 O O     . ALA C 3 116 ? 7.309   18.333 18.810  1.00 13.36 ? 412  ALA A O     1 
ATOM   1296 C CB    . ALA C 3 116 ? 10.440  19.464 18.821  1.00 13.85 ? 412  ALA A CB    1 
ATOM   1297 N N     . ALA C 3 117 ? 7.723   19.877 17.226  1.00 13.85 ? 413  ALA A N     1 
ATOM   1298 C CA    . ALA C 3 117 ? 6.327   20.316 17.183  1.00 13.84 ? 413  ALA A CA    1 
ATOM   1299 C C     . ALA C 3 117 ? 5.402   19.232 16.629  1.00 14.70 ? 413  ALA A C     1 
ATOM   1300 O O     . ALA C 3 117 ? 4.296   19.016 17.126  1.00 14.95 ? 413  ALA A O     1 
ATOM   1301 C CB    . ALA C 3 117 ? 6.198   21.570 16.345  1.00 14.18 ? 413  ALA A CB    1 
ATOM   1302 N N     . ALA C 3 118 ? 5.863   18.540 15.594  1.00 16.32 ? 414  ALA A N     1 
ATOM   1303 C CA    . ALA C 3 118 ? 5.085   17.478 14.959  1.00 16.89 ? 414  ALA A CA    1 
ATOM   1304 C C     . ALA C 3 118 ? 4.849   16.320 15.929  1.00 17.70 ? 414  ALA A C     1 
ATOM   1305 O O     . ALA C 3 118 ? 3.760   15.738 15.958  1.00 18.44 ? 414  ALA A O     1 
ATOM   1306 C CB    . ALA C 3 118 ? 5.820   16.976 13.688  1.00 15.50 ? 414  ALA A CB    1 
ATOM   1307 N N     . LYS C 3 119 ? 5.854   15.989 16.729  1.00 19.21 ? 415  LYS A N     1 
ATOM   1308 C CA    . LYS C 3 119 ? 5.697   14.885 17.669  1.00 22.07 ? 415  LYS A CA    1 
ATOM   1309 C C     . LYS C 3 119 ? 4.552   15.151 18.632  1.00 23.39 ? 415  LYS A C     1 
ATOM   1310 O O     . LYS C 3 119 ? 3.900   14.221 19.103  1.00 24.51 ? 415  LYS A O     1 
ATOM   1311 C CB    . LYS C 3 119 ? 6.975   14.646 18.468  1.00 23.43 ? 415  LYS A CB    1 
ATOM   1312 C CG    . LYS C 3 119 ? 7.056   13.220 18.984  1.00 26.05 ? 415  LYS A CG    1 
ATOM   1313 C CD    . LYS C 3 119 ? 8.401   12.878 19.603  1.00 28.84 ? 415  LYS A CD    1 
ATOM   1314 C CE    . LYS C 3 119 ? 9.374   12.315 18.570  1.00 32.04 ? 415  LYS A CE    1 
ATOM   1315 N NZ    . LYS C 3 119 ? 10.169  11.148 19.101  1.00 33.89 ? 415  LYS A NZ    1 
ATOM   1316 N N     . MET C 3 120 ? 4.310   16.422 18.926  1.00 23.89 ? 416  MET A N     1 
ATOM   1317 C CA    . MET C 3 120 ? 3.222   16.800 19.814  1.00 24.91 ? 416  MET A CA    1 
ATOM   1318 C C     . MET C 3 120 ? 1.881   16.239 19.311  1.00 24.32 ? 416  MET A C     1 
ATOM   1319 O O     . MET C 3 120 ? 0.941   16.045 20.091  1.00 24.60 ? 416  MET A O     1 
ATOM   1320 C CB    . MET C 3 120 ? 3.115   18.326 19.907  1.00 27.29 ? 416  MET A CB    1 
ATOM   1321 C CG    . MET C 3 120 ? 4.092   19.010 20.882  1.00 30.75 ? 416  MET A CG    1 
ATOM   1322 S SD    . MET C 3 120 ? 3.909   20.837 20.835  1.00 34.61 ? 416  MET A SD    1 
ATOM   1323 C CE    . MET C 3 120 ? 3.017   21.210 22.412  1.00 34.48 ? 416  MET A CE    1 
ATOM   1324 N N     . LYS C 3 121 ? 1.782   15.988 18.011  1.00 22.26 ? 417  LYS A N     1 
ATOM   1325 C CA    . LYS C 3 121 ? 0.549   15.464 17.475  1.00 21.05 ? 417  LYS A CA    1 
ATOM   1326 C C     . LYS C 3 121 ? 0.726   14.120 16.795  1.00 20.50 ? 417  LYS A C     1 
ATOM   1327 O O     . LYS C 3 121 ? 0.029   13.818 15.843  1.00 20.26 ? 417  LYS A O     1 
ATOM   1328 C CB    . LYS C 3 121 ? -0.080  16.468 16.512  1.00 21.78 ? 417  LYS A CB    1 
ATOM   1329 C CG    . LYS C 3 121 ? -0.402  17.826 17.161  1.00 21.46 ? 417  LYS A CG    1 
ATOM   1330 C CD    . LYS C 3 121 ? -1.828  17.916 17.595  1.00 18.33 ? 417  LYS A CD    1 
ATOM   1331 C CE    . LYS C 3 121 ? -2.047  19.193 18.358  1.00 19.62 ? 417  LYS A CE    1 
ATOM   1332 N NZ    . LYS C 3 121 ? -3.259  19.086 19.200  1.00 18.56 ? 417  LYS A NZ    1 
ATOM   1333 N N     . GLN C 3 122 ? 1.674   13.329 17.286  1.00 20.84 ? 418  GLN A N     1 
ATOM   1334 C CA    . GLN C 3 122 ? 1.928   11.970 16.784  1.00 21.39 ? 418  GLN A CA    1 
ATOM   1335 C C     . GLN C 3 122 ? 2.266   11.905 15.295  1.00 20.87 ? 418  GLN A C     1 
ATOM   1336 O O     . GLN C 3 122 ? 1.848   10.982 14.575  1.00 20.24 ? 418  GLN A O     1 
ATOM   1337 C CB    . GLN C 3 122 ? 0.721   11.048 17.069  1.00 23.07 ? 418  GLN A CB    1 
ATOM   1338 C CG    . GLN C 3 122 ? 0.167   11.016 18.528  1.00 26.07 ? 418  GLN A CG    1 
ATOM   1339 C CD    . GLN C 3 122 ? 1.247   10.869 19.620  1.00 29.01 ? 418  GLN A CD    1 
ATOM   1340 O OE1   . GLN C 3 122 ? 1.738   11.877 20.160  1.00 31.63 ? 418  GLN A OE1   1 
ATOM   1341 N NE2   . GLN C 3 122 ? 1.609   9.622  19.959  1.00 28.90 ? 418  GLN A NE2   1 
ATOM   1342 N N     . TYR C 3 123 ? 3.017   12.904 14.843  1.00 20.37 ? 419  TYR A N     1 
ATOM   1343 C CA    . TYR C 3 123 ? 3.454   12.981 13.457  1.00 19.18 ? 419  TYR A CA    1 
ATOM   1344 C C     . TYR C 3 123 ? 4.969   12.891 13.556  1.00 18.63 ? 419  TYR A C     1 
ATOM   1345 O O     . TYR C 3 123 ? 5.624   13.746 14.164  1.00 18.06 ? 419  TYR A O     1 
ATOM   1346 C CB    . TYR C 3 123 ? 3.008   14.306 12.817  1.00 18.49 ? 419  TYR A CB    1 
ATOM   1347 C CG    . TYR C 3 123 ? 3.349   14.433 11.339  1.00 19.12 ? 419  TYR A CG    1 
ATOM   1348 C CD1   . TYR C 3 123 ? 4.664   14.653 10.921  1.00 17.81 ? 419  TYR A CD1   1 
ATOM   1349 C CD2   . TYR C 3 123 ? 2.351   14.335 10.360  1.00 18.64 ? 419  TYR A CD2   1 
ATOM   1350 C CE1   . TYR C 3 123 ? 4.970   14.772 9.570   1.00 19.08 ? 419  TYR A CE1   1 
ATOM   1351 C CE2   . TYR C 3 123 ? 2.654   14.456 9.004   1.00 18.59 ? 419  TYR A CE2   1 
ATOM   1352 C CZ    . TYR C 3 123 ? 3.955   14.674 8.623   1.00 18.15 ? 419  TYR A CZ    1 
ATOM   1353 O OH    . TYR C 3 123 ? 4.241   14.824 7.289   1.00 19.29 ? 419  TYR A OH    1 
ATOM   1354 N N     . GLU C 3 124 ? 5.532   11.825 12.994  1.00 18.11 ? 420  GLU A N     1 
ATOM   1355 C CA    . GLU C 3 124 ? 6.971   11.648 13.064  1.00 17.84 ? 420  GLU A CA    1 
ATOM   1356 C C     . GLU C 3 124 ? 7.629   11.384 11.725  1.00 16.92 ? 420  GLU A C     1 
ATOM   1357 O O     . GLU C 3 124 ? 8.742   10.885 11.660  1.00 17.13 ? 420  GLU A O     1 
ATOM   1358 C CB    . GLU C 3 124 ? 7.293   10.532 14.060  1.00 19.46 ? 420  GLU A CB    1 
ATOM   1359 C CG    . GLU C 3 124 ? 6.492   10.673 15.338  1.00 22.73 ? 420  GLU A CG    1 
ATOM   1360 C CD    . GLU C 3 124 ? 6.941   9.745  16.444  1.00 24.99 ? 420  GLU A CD    1 
ATOM   1361 O OE1   . GLU C 3 124 ? 7.782   8.843  16.190  1.00 26.43 ? 420  GLU A OE1   1 
ATOM   1362 O OE2   . GLU C 3 124 ? 6.436   9.925  17.572  1.00 25.60 ? 420  GLU A OE2   1 
ATOM   1363 N N     . ALA C 3 125 ? 6.950   11.769 10.657  1.00 17.30 ? 421  ALA A N     1 
ATOM   1364 C CA    . ALA C 3 125 ? 7.460   11.570 9.306   1.00 17.45 ? 421  ALA A CA    1 
ATOM   1365 C C     . ALA C 3 125 ? 8.386   12.733 8.881   1.00 17.87 ? 421  ALA A C     1 
ATOM   1366 O O     . ALA C 3 125 ? 8.385   13.200 7.724   1.00 17.91 ? 421  ALA A O     1 
ATOM   1367 C CB    . ALA C 3 125 ? 6.278   11.412 8.343   1.00 17.14 ? 421  ALA A CB    1 
ATOM   1368 N N     . VAL C 3 126 ? 9.192   13.179 9.832   1.00 16.88 ? 422  VAL A N     1 
ATOM   1369 C CA    . VAL C 3 126 ? 10.130  14.263 9.600   1.00 17.39 ? 422  VAL A CA    1 
ATOM   1370 C C     . VAL C 3 126 ? 11.253  14.100 10.621  1.00 17.33 ? 422  VAL A C     1 
ATOM   1371 O O     . VAL C 3 126 ? 11.002  13.710 11.759  1.00 17.60 ? 422  VAL A O     1 
ATOM   1372 C CB    . VAL C 3 126 ? 9.398   15.655 9.738   1.00 17.71 ? 422  VAL A CB    1 
ATOM   1373 C CG1   . VAL C 3 126 ? 8.852   15.833 11.159  1.00 16.55 ? 422  VAL A CG1   1 
ATOM   1374 C CG2   . VAL C 3 126 ? 10.335  16.797 9.334   1.00 16.93 ? 422  VAL A CG2   1 
ATOM   1375 N N     . ARG C 3 127 ? 12.489  14.354 10.217  1.00 17.14 ? 423  ARG A N     1 
ATOM   1376 C CA    . ARG C 3 127 ? 13.614  14.224 11.123  1.00 19.33 ? 423  ARG A CA    1 
ATOM   1377 C C     . ARG C 3 127 ? 13.951  15.503 11.879  1.00 19.99 ? 423  ARG A C     1 
ATOM   1378 O O     . ARG C 3 127 ? 13.585  16.610 11.466  1.00 19.46 ? 423  ARG A O     1 
ATOM   1379 C CB    . ARG C 3 127 ? 14.866  13.830 10.362  1.00 20.66 ? 423  ARG A CB    1 
ATOM   1380 C CG    . ARG C 3 127 ? 14.674  12.710 9.379   1.00 24.53 ? 423  ARG A CG    1 
ATOM   1381 C CD    . ARG C 3 127 ? 15.995  12.376 8.730   1.00 25.81 ? 423  ARG A CD    1 
ATOM   1382 N NE    . ARG C 3 127 ? 16.864  11.708 9.690   1.00 29.41 ? 423  ARG A NE    1 
ATOM   1383 C CZ    . ARG C 3 127 ? 18.188  11.631 9.578   1.00 30.36 ? 423  ARG A CZ    1 
ATOM   1384 N NH1   . ARG C 3 127 ? 18.799  12.193 8.537   1.00 30.28 ? 423  ARG A NH1   1 
ATOM   1385 N NH2   . ARG C 3 127 ? 18.902  10.996 10.509  1.00 31.99 ? 423  ARG A NH2   1 
ATOM   1386 N N     . PRO C 3 128 ? 14.569  15.349 13.055  1.00 20.78 ? 424  PRO A N     1 
ATOM   1387 C CA    . PRO C 3 128 ? 14.994  16.476 13.890  1.00 20.99 ? 424  PRO A CA    1 
ATOM   1388 C C     . PRO C 3 128 ? 16.120  17.111 13.088  1.00 21.28 ? 424  PRO A C     1 
ATOM   1389 O O     . PRO C 3 128 ? 16.894  16.398 12.432  1.00 21.55 ? 424  PRO A O     1 
ATOM   1390 C CB    . PRO C 3 128 ? 15.517  15.806 15.169  1.00 20.11 ? 424  PRO A CB    1 
ATOM   1391 C CG    . PRO C 3 128 ? 14.813  14.486 15.204  1.00 20.60 ? 424  PRO A CG    1 
ATOM   1392 C CD    . PRO C 3 128 ? 14.753  14.063 13.751  1.00 21.18 ? 424  PRO A CD    1 
ATOM   1393 N N     . ASP C 3 129 ? 16.210  18.434 13.117  1.00 21.45 ? 425  ASP A N     1 
ATOM   1394 C CA    . ASP C 3 129 ? 17.247  19.141 12.375  1.00 21.63 ? 425  ASP A CA    1 
ATOM   1395 C C     . ASP C 3 129 ? 18.644  18.686 12.747  1.00 22.10 ? 425  ASP A C     1 
ATOM   1396 O O     . ASP C 3 129 ? 19.527  18.585 11.893  1.00 21.25 ? 425  ASP A O     1 
ATOM   1397 C CB    . ASP C 3 129 ? 17.138  20.649 12.623  1.00 22.44 ? 425  ASP A CB    1 
ATOM   1398 C CG    . ASP C 3 129 ? 16.008  21.287 11.835  1.00 22.86 ? 425  ASP A CG    1 
ATOM   1399 O OD1   . ASP C 3 129 ? 15.786  20.846 10.695  1.00 24.02 ? 425  ASP A OD1   1 
ATOM   1400 O OD2   . ASP C 3 129 ? 15.339  22.217 12.350  1.00 23.15 ? 425  ASP A OD2   1 
ATOM   1401 N N     . GLU C 3 130 ? 18.846  18.419 14.028  1.00 22.19 ? 426  GLU A N     1 
ATOM   1402 C CA    . GLU C 3 130 ? 20.153  18.001 14.497  1.00 23.54 ? 426  GLU A CA    1 
ATOM   1403 C C     . GLU C 3 130 ? 20.574  16.715 13.850  1.00 22.41 ? 426  GLU A C     1 
ATOM   1404 O O     . GLU C 3 130 ? 21.756  16.493 13.602  1.00 22.49 ? 426  GLU A O     1 
ATOM   1405 C CB    . GLU C 3 130 ? 20.155  17.804 16.012  1.00 26.29 ? 426  GLU A CB    1 
ATOM   1406 C CG    . GLU C 3 130 ? 21.557  17.579 16.551  1.00 30.68 ? 426  GLU A CG    1 
ATOM   1407 C CD    . GLU C 3 130 ? 21.599  17.541 18.058  1.00 33.29 ? 426  GLU A CD    1 
ATOM   1408 O OE1   . GLU C 3 130 ? 20.789  18.244 18.701  1.00 35.22 ? 426  GLU A OE1   1 
ATOM   1409 O OE2   . GLU C 3 130 ? 22.443  16.802 18.600  1.00 35.89 ? 426  GLU A OE2   1 
ATOM   1410 N N     . ALA C 3 131 ? 19.592  15.864 13.604  1.00 22.04 ? 427  ALA A N     1 
ATOM   1411 C CA    . ALA C 3 131 ? 19.834  14.590 12.976  1.00 21.52 ? 427  ALA A CA    1 
ATOM   1412 C C     . ALA C 3 131 ? 20.349  14.790 11.556  1.00 22.61 ? 427  ALA A C     1 
ATOM   1413 O O     . ALA C 3 131 ? 21.273  14.111 11.123  1.00 22.78 ? 427  ALA A O     1 
ATOM   1414 C CB    . ALA C 3 131 ? 18.564  13.783 12.965  1.00 21.08 ? 427  ALA A CB    1 
ATOM   1415 N N     . VAL C 3 132 ? 19.795  15.734 10.809  1.00 23.78 ? 428  VAL A N     1 
ATOM   1416 C CA    . VAL C 3 132 ? 20.301  15.874 9.455   1.00 23.43 ? 428  VAL A CA    1 
ATOM   1417 C C     . VAL C 3 132 ? 21.490  16.820 9.287   1.00 23.72 ? 428  VAL A C     1 
ATOM   1418 O O     . VAL C 3 132 ? 22.353  16.564 8.450   1.00 22.71 ? 428  VAL A O     1 
ATOM   1419 C CB    . VAL C 3 132 ? 19.138  16.176 8.445   1.00 23.84 ? 428  VAL A CB    1 
ATOM   1420 C CG1   . VAL C 3 132 ? 17.790  16.164 9.160   1.00 22.17 ? 428  VAL A CG1   1 
ATOM   1421 C CG2   . VAL C 3 132 ? 19.403  17.442 7.681   1.00 23.69 ? 428  VAL A CG2   1 
ATOM   1422 N N     . TYR C 3 133 ? 21.573  17.872 10.107  1.00 24.55 ? 429  TYR A N     1 
ATOM   1423 C CA    . TYR C 3 133 ? 22.686  18.842 10.030  1.00 25.88 ? 429  TYR A CA    1 
ATOM   1424 C C     . TYR C 3 133 ? 23.868  18.508 10.913  1.00 28.12 ? 429  TYR A C     1 
ATOM   1425 O O     . TYR C 3 133 ? 24.990  18.941 10.650  1.00 29.01 ? 429  TYR A O     1 
ATOM   1426 C CB    . TYR C 3 133 ? 22.203  20.260 10.379  1.00 23.50 ? 429  TYR A CB    1 
ATOM   1427 C CG    . TYR C 3 133 ? 21.188  20.743 9.389   1.00 21.08 ? 429  TYR A CG    1 
ATOM   1428 C CD1   . TYR C 3 133 ? 21.509  20.826 8.035   1.00 20.76 ? 429  TYR A CD1   1 
ATOM   1429 C CD2   . TYR C 3 133 ? 19.893  21.028 9.778   1.00 20.07 ? 429  TYR A CD2   1 
ATOM   1430 C CE1   . TYR C 3 133 ? 20.564  21.170 7.100   1.00 18.75 ? 429  TYR A CE1   1 
ATOM   1431 C CE2   . TYR C 3 133 ? 18.937  21.373 8.848   1.00 19.31 ? 429  TYR A CE2   1 
ATOM   1432 C CZ    . TYR C 3 133 ? 19.288  21.437 7.508   1.00 18.93 ? 429  TYR A CZ    1 
ATOM   1433 O OH    . TYR C 3 133 ? 18.348  21.734 6.571   1.00 18.46 ? 429  TYR A OH    1 
ATOM   1434 N N     . GLY C 3 134 ? 23.619  17.737 11.964  1.00 31.14 ? 430  GLY A N     1 
ATOM   1435 C CA    . GLY C 3 134 ? 24.688  17.379 12.875  1.00 33.64 ? 430  GLY A CA    1 
ATOM   1436 C C     . GLY C 3 134 ? 24.781  18.423 13.965  1.00 36.20 ? 430  GLY A C     1 
ATOM   1437 O O     . GLY C 3 134 ? 23.980  19.360 14.012  1.00 35.36 ? 430  GLY A O     1 
ATOM   1438 N N     . LYS C 3 135 ? 25.776  18.276 14.831  1.00 39.56 ? 431  LYS A N     1 
ATOM   1439 C CA    . LYS C 3 135 ? 25.957  19.199 15.944  1.00 42.67 ? 431  LYS A CA    1 
ATOM   1440 C C     . LYS C 3 135 ? 27.329  19.875 15.964  1.00 43.59 ? 431  LYS A C     1 
ATOM   1441 O O     . LYS C 3 135 ? 28.349  19.247 15.680  1.00 44.05 ? 431  LYS A O     1 
ATOM   1442 C CB    . LYS C 3 135 ? 25.741  18.448 17.258  1.00 44.05 ? 431  LYS A CB    1 
ATOM   1443 C CG    . LYS C 3 135 ? 24.564  18.945 18.073  1.00 46.39 ? 431  LYS A CG    1 
ATOM   1444 C CD    . LYS C 3 135 ? 24.717  18.574 19.560  1.00 48.73 ? 431  LYS A CD    1 
ATOM   1445 C CE    . LYS C 3 135 ? 26.092  18.955 20.122  1.00 50.37 ? 431  LYS A CE    1 
ATOM   1446 N NZ    . LYS C 3 135 ? 27.085  17.825 20.067  1.00 51.36 ? 431  LYS A NZ    1 
ATOM   1447 N N     . GLY C 3 136 ? 27.339  21.159 16.298  1.00 44.62 ? 432  GLY A N     1 
ATOM   1448 C CA    . GLY C 3 136 ? 28.584  21.910 16.382  1.00 46.47 ? 432  GLY A CA    1 
ATOM   1449 C C     . GLY C 3 136 ? 29.620  21.727 15.286  1.00 47.69 ? 432  GLY A C     1 
ATOM   1450 O O     . GLY C 3 136 ? 29.340  21.906 14.105  1.00 48.39 ? 432  GLY A O     1 
ATOM   1451 N N     . ALA C 3 137 ? 30.839  21.378 15.672  1.00 48.64 ? 433  ALA A N     1 
ATOM   1452 C CA    . ALA C 3 137 ? 31.896  21.199 14.688  1.00 49.10 ? 433  ALA A CA    1 
ATOM   1453 C C     . ALA C 3 137 ? 31.390  20.412 13.484  1.00 49.31 ? 433  ALA A C     1 
ATOM   1454 O O     . ALA C 3 137 ? 31.377  20.924 12.366  1.00 50.21 ? 433  ALA A O     1 
ATOM   1455 C CB    . ALA C 3 137 ? 33.092  20.487 15.318  1.00 48.89 ? 433  ALA A CB    1 
ATOM   1456 N N     . LYS C 3 138 ? 30.960  19.175 13.717  1.00 49.23 ? 434  LYS A N     1 
ATOM   1457 C CA    . LYS C 3 138 ? 30.480  18.316 12.633  1.00 48.92 ? 434  LYS A CA    1 
ATOM   1458 C C     . LYS C 3 138 ? 29.207  18.794 11.911  1.00 47.71 ? 434  LYS A C     1 
ATOM   1459 O O     . LYS C 3 138 ? 28.706  18.118 11.004  1.00 47.98 ? 434  LYS A O     1 
ATOM   1460 C CB    . LYS C 3 138 ? 30.283  16.875 13.143  1.00 49.85 ? 434  LYS A CB    1 
ATOM   1461 C CG    . LYS C 3 138 ? 30.487  16.686 14.640  1.00 51.48 ? 434  LYS A CG    1 
ATOM   1462 C CD    . LYS C 3 138 ? 29.394  15.785 15.268  1.00 52.45 ? 434  LYS A CD    1 
ATOM   1463 C CE    . LYS C 3 138 ? 28.068  15.828 14.480  1.00 52.96 ? 434  LYS A CE    1 
ATOM   1464 N NZ    . LYS C 3 138 ? 26.882  15.954 15.381  1.00 52.83 ? 434  LYS A NZ    1 
ATOM   1465 N N     . ARG C 3 139 ? 28.680  19.949 12.308  1.00 46.10 ? 435  ARG A N     1 
ATOM   1466 C CA    . ARG C 3 139 ? 27.492  20.490 11.656  1.00 44.24 ? 435  ARG A CA    1 
ATOM   1467 C C     . ARG C 3 139 ? 27.840  20.688 10.188  1.00 43.41 ? 435  ARG A C     1 
ATOM   1468 O O     . ARG C 3 139 ? 28.992  20.979 9.851   1.00 44.65 ? 435  ARG A O     1 
ATOM   1469 C CB    . ARG C 3 139 ? 27.123  21.832 12.263  1.00 43.94 ? 435  ARG A CB    1 
ATOM   1470 C CG    . ARG C 3 139 ? 25.764  22.326 11.865  1.00 44.56 ? 435  ARG A CG    1 
ATOM   1471 C CD    . ARG C 3 139 ? 25.060  22.931 13.067  1.00 45.16 ? 435  ARG A CD    1 
ATOM   1472 N NE    . ARG C 3 139 ? 23.618  23.035 12.865  1.00 45.40 ? 435  ARG A NE    1 
ATOM   1473 C CZ    . ARG C 3 139 ? 22.969  24.188 12.777  1.00 45.81 ? 435  ARG A CZ    1 
ATOM   1474 N NH1   . ARG C 3 139 ? 23.651  25.323 12.877  1.00 46.38 ? 435  ARG A NH1   1 
ATOM   1475 N NH2   . ARG C 3 139 ? 21.652  24.210 12.580  1.00 46.08 ? 435  ARG A NH2   1 
ATOM   1476 N N     . ALA C 3 140 ? 26.862  20.533 9.308   1.00 41.08 ? 436  ALA A N     1 
ATOM   1477 C CA    . ALA C 3 140 ? 27.119  20.704 7.889   1.00 38.50 ? 436  ALA A CA    1 
ATOM   1478 C C     . ALA C 3 140 ? 25.848  20.492 7.089   1.00 37.52 ? 436  ALA A C     1 
ATOM   1479 O O     . ALA C 3 140 ? 24.986  19.694 7.483   1.00 36.82 ? 436  ALA A O     1 
ATOM   1480 C CB    . ALA C 3 140 ? 28.179  19.715 7.438   1.00 37.75 ? 436  ALA A CB    1 
ATOM   1481 N N     . VAL C 3 141 ? 25.723  21.219 5.976   1.00 36.02 ? 437  VAL A N     1 
ATOM   1482 C CA    . VAL C 3 141 ? 24.563  21.070 5.104   1.00 34.29 ? 437  VAL A CA    1 
ATOM   1483 C C     . VAL C 3 141 ? 24.842  19.791 4.316   1.00 33.57 ? 437  VAL A C     1 
ATOM   1484 O O     . VAL C 3 141 ? 25.942  19.595 3.811   1.00 33.98 ? 437  VAL A O     1 
ATOM   1485 C CB    . VAL C 3 141 ? 24.404  22.269 4.137   1.00 33.81 ? 437  VAL A CB    1 
ATOM   1486 C CG1   . VAL C 3 141 ? 23.213  22.047 3.239   1.00 33.14 ? 437  VAL A CG1   1 
ATOM   1487 C CG2   . VAL C 3 141 ? 24.192  23.542 4.916   1.00 33.81 ? 437  VAL A CG2   1 
ATOM   1488 N N     . PRO C 3 142 ? 23.854  18.894 4.215   1.00 32.42 ? 438  PRO A N     1 
ATOM   1489 C CA    . PRO C 3 142 ? 24.095  17.659 3.474   1.00 31.33 ? 438  PRO A CA    1 
ATOM   1490 C C     . PRO C 3 142 ? 23.921  17.848 1.979   1.00 31.39 ? 438  PRO A C     1 
ATOM   1491 O O     . PRO C 3 142 ? 23.549  18.930 1.523   1.00 30.84 ? 438  PRO A O     1 
ATOM   1492 C CB    . PRO C 3 142 ? 23.070  16.699 4.054   1.00 31.62 ? 438  PRO A CB    1 
ATOM   1493 C CG    . PRO C 3 142 ? 21.932  17.591 4.491   1.00 31.52 ? 438  PRO A CG    1 
ATOM   1494 C CD    . PRO C 3 142 ? 22.481  18.973 4.742   1.00 31.67 ? 438  PRO A CD    1 
ATOM   1495 N N     . ASP C 3 143 ? 24.176  16.792 1.211   1.00 31.25 ? 439  ASP A N     1 
ATOM   1496 C CA    . ASP C 3 143 ? 24.035  16.884 -0.228  1.00 30.86 ? 439  ASP A CA    1 
ATOM   1497 C C     . ASP C 3 143 ? 22.583  17.106 -0.612  1.00 29.68 ? 439  ASP A C     1 
ATOM   1498 O O     . ASP C 3 143 ? 21.669  16.712 0.092   1.00 29.81 ? 439  ASP A O     1 
ATOM   1499 C CB    . ASP C 3 143 ? 24.619  15.641 -0.898  1.00 33.07 ? 439  ASP A CB    1 
ATOM   1500 C CG    . ASP C 3 143 ? 26.147  15.713 -1.016  1.00 35.56 ? 439  ASP A CG    1 
ATOM   1501 O OD1   . ASP C 3 143 ? 26.708  16.838 -0.986  1.00 37.14 ? 439  ASP A OD1   1 
ATOM   1502 O OD2   . ASP C 3 143 ? 26.797  14.649 -1.130  1.00 37.62 ? 439  ASP A OD2   1 
ATOM   1503 N N     . GLU C 3 144 ? 22.389  17.761 -1.742  1.00 28.91 ? 440  GLU A N     1 
ATOM   1504 C CA    . GLU C 3 144 ? 21.070  18.116 -2.232  1.00 28.19 ? 440  GLU A CA    1 
ATOM   1505 C C     . GLU C 3 144 ? 19.941  17.118 -2.097  1.00 27.13 ? 440  GLU A C     1 
ATOM   1506 O O     . GLU C 3 144 ? 18.821  17.486 -1.769  1.00 27.11 ? 440  GLU A O     1 
ATOM   1507 C CB    . GLU C 3 144 ? 21.167  18.540 -3.693  1.00 28.64 ? 440  GLU A CB    1 
ATOM   1508 C CG    . GLU C 3 144 ? 19.878  19.088 -4.228  1.00 29.88 ? 440  GLU A CG    1 
ATOM   1509 C CD    . GLU C 3 144 ? 20.055  19.720 -5.581  1.00 31.70 ? 440  GLU A CD    1 
ATOM   1510 O OE1   . GLU C 3 144 ? 19.941  18.986 -6.584  1.00 33.62 ? 440  GLU A OE1   1 
ATOM   1511 O OE2   . GLU C 3 144 ? 20.312  20.944 -5.645  1.00 31.97 ? 440  GLU A OE2   1 
ATOM   1512 N N     . PRO C 3 145 ? 20.205  15.840 -2.372  1.00 26.76 ? 441  PRO A N     1 
ATOM   1513 C CA    . PRO C 3 145 ? 19.111  14.875 -2.254  1.00 26.20 ? 441  PRO A CA    1 
ATOM   1514 C C     . PRO C 3 145 ? 18.629  14.733 -0.819  1.00 25.23 ? 441  PRO A C     1 
ATOM   1515 O O     . PRO C 3 145 ? 17.429  14.654 -0.553  1.00 24.93 ? 441  PRO A O     1 
ATOM   1516 C CB    . PRO C 3 145 ? 19.709  13.579 -2.818  1.00 26.36 ? 441  PRO A CB    1 
ATOM   1517 C CG    . PRO C 3 145 ? 20.960  14.018 -3.554  1.00 26.54 ? 441  PRO A CG    1 
ATOM   1518 C CD    . PRO C 3 145 ? 21.457  15.206 -2.805  1.00 26.48 ? 441  PRO A CD    1 
ATOM   1519 N N     . VAL C 3 146 ? 19.584  14.715 0.098   1.00 24.90 ? 442  VAL A N     1 
ATOM   1520 C CA    . VAL C 3 146 ? 19.292  14.599 1.517   1.00 24.54 ? 442  VAL A CA    1 
ATOM   1521 C C     . VAL C 3 146 ? 18.648  15.896 2.027   1.00 24.15 ? 442  VAL A C     1 
ATOM   1522 O O     . VAL C 3 146 ? 17.628  15.873 2.738   1.00 24.47 ? 442  VAL A O     1 
ATOM   1523 C CB    . VAL C 3 146 ? 20.584  14.333 2.297   1.00 24.83 ? 442  VAL A CB    1 
ATOM   1524 C CG1   . VAL C 3 146 ? 20.351  14.588 3.785   1.00 24.46 ? 442  VAL A CG1   1 
ATOM   1525 C CG2   . VAL C 3 146 ? 21.073  12.898 2.027   1.00 23.41 ? 442  VAL A CG2   1 
ATOM   1526 N N     . LEU C 3 147 ? 19.250  17.019 1.640   1.00 22.93 ? 443  LEU A N     1 
ATOM   1527 C CA    . LEU C 3 147 ? 18.782  18.352 2.016   1.00 21.59 ? 443  LEU A CA    1 
ATOM   1528 C C     . LEU C 3 147 ? 17.370  18.592 1.507   1.00 21.08 ? 443  LEU A C     1 
ATOM   1529 O O     . LEU C 3 147 ? 16.479  19.007 2.256   1.00 19.85 ? 443  LEU A O     1 
ATOM   1530 C CB    . LEU C 3 147 ? 19.724  19.394 1.411   1.00 22.06 ? 443  LEU A CB    1 
ATOM   1531 C CG    . LEU C 3 147 ? 19.927  20.773 2.050   1.00 23.88 ? 443  LEU A CG    1 
ATOM   1532 C CD1   . LEU C 3 147 ? 20.046  21.826 0.931   1.00 22.56 ? 443  LEU A CD1   1 
ATOM   1533 C CD2   . LEU C 3 147 ? 18.794  21.109 3.018   1.00 22.43 ? 443  LEU A CD2   1 
ATOM   1534 N N     . ALA C 3 148 ? 17.173  18.333 0.217   1.00 20.24 ? 444  ALA A N     1 
ATOM   1535 C CA    . ALA C 3 148 ? 15.881  18.542 -0.406  1.00 21.03 ? 444  ALA A CA    1 
ATOM   1536 C C     . ALA C 3 148 ? 14.777  17.711 0.228   1.00 21.60 ? 444  ALA A C     1 
ATOM   1537 O O     . ALA C 3 148 ? 13.642  18.184 0.382   1.00 21.79 ? 444  ALA A O     1 
ATOM   1538 C CB    . ALA C 3 148 ? 15.965  18.247 -1.899  1.00 21.65 ? 444  ALA A CB    1 
ATOM   1539 N N     . GLU C 3 149 ? 15.087  16.467 0.582   1.00 21.79 ? 445  GLU A N     1 
ATOM   1540 C CA    . GLU C 3 149 ? 14.065  15.647 1.208   1.00 22.13 ? 445  GLU A CA    1 
ATOM   1541 C C     . GLU C 3 149 ? 13.720  16.182 2.599   1.00 20.60 ? 445  GLU A C     1 
ATOM   1542 O O     . GLU C 3 149 ? 12.555  16.220 2.977   1.00 19.91 ? 445  GLU A O     1 
ATOM   1543 C CB    . GLU C 3 149 ? 14.494  14.186 1.338   1.00 24.10 ? 445  GLU A CB    1 
ATOM   1544 C CG    . GLU C 3 149 ? 13.476  13.417 2.173   1.00 26.93 ? 445  GLU A CG    1 
ATOM   1545 C CD    . GLU C 3 149 ? 13.308  11.977 1.747   1.00 29.79 ? 445  GLU A CD    1 
ATOM   1546 O OE1   . GLU C 3 149 ? 14.312  11.354 1.328   1.00 30.62 ? 445  GLU A OE1   1 
ATOM   1547 O OE2   . GLU C 3 149 ? 12.169  11.461 1.842   1.00 30.82 ? 445  GLU A OE2   1 
ATOM   1548 N N     . HIS C 3 150 ? 14.732  16.585 3.362   1.00 20.11 ? 446  HIS A N     1 
ATOM   1549 C CA    . HIS C 3 150 ? 14.479  17.124 4.689   1.00 19.35 ? 446  HIS A CA    1 
ATOM   1550 C C     . HIS C 3 150 ? 13.587  18.377 4.656   1.00 19.06 ? 446  HIS A C     1 
ATOM   1551 O O     . HIS C 3 150 ? 12.631  18.478 5.437   1.00 19.52 ? 446  HIS A O     1 
ATOM   1552 C CB    . HIS C 3 150 ? 15.798  17.435 5.386   1.00 19.85 ? 446  HIS A CB    1 
ATOM   1553 C CG    . HIS C 3 150 ? 15.629  17.991 6.768   1.00 20.56 ? 446  HIS A CG    1 
ATOM   1554 N ND1   . HIS C 3 150 ? 14.703  17.495 7.662   1.00 21.17 ? 446  HIS A ND1   1 
ATOM   1555 C CD2   . HIS C 3 150 ? 16.277  18.992 7.414   1.00 20.74 ? 446  HIS A CD2   1 
ATOM   1556 C CE1   . HIS C 3 150 ? 14.789  18.164 8.800   1.00 20.66 ? 446  HIS A CE1   1 
ATOM   1557 N NE2   . HIS C 3 150 ? 15.736  19.077 8.675   1.00 20.14 ? 446  HIS A NE2   1 
ATOM   1558 N N     . LEU C 3 151 ? 13.880  19.321 3.755   1.00 18.31 ? 447  LEU A N     1 
ATOM   1559 C CA    . LEU C 3 151 ? 13.080  20.541 3.650   1.00 17.68 ? 447  LEU A CA    1 
ATOM   1560 C C     . LEU C 3 151 ? 11.651  20.258 3.207   1.00 17.12 ? 447  LEU A C     1 
ATOM   1561 O O     . LEU C 3 151 ? 10.697  20.853 3.711   1.00 17.73 ? 447  LEU A O     1 
ATOM   1562 C CB    . LEU C 3 151 ? 13.727  21.537 2.686   1.00 18.39 ? 447  LEU A CB    1 
ATOM   1563 C CG    . LEU C 3 151 ? 15.161  22.002 3.016   1.00 19.75 ? 447  LEU A CG    1 
ATOM   1564 C CD1   . LEU C 3 151 ? 15.474  23.341 2.290   1.00 18.21 ? 447  LEU A CD1   1 
ATOM   1565 C CD2   . LEU C 3 151 ? 15.338  22.135 4.546   1.00 17.83 ? 447  LEU A CD2   1 
ATOM   1566 N N     . VAL C 3 152 ? 11.483  19.339 2.269   1.00 16.78 ? 448  VAL A N     1 
ATOM   1567 C CA    . VAL C 3 152 ? 10.147  19.002 1.812   1.00 15.22 ? 448  VAL A CA    1 
ATOM   1568 C C     . VAL C 3 152 ? 9.365   18.322 2.946   1.00 14.34 ? 448  VAL A C     1 
ATOM   1569 O O     . VAL C 3 152 ? 8.180   18.575 3.129   1.00 13.55 ? 448  VAL A O     1 
ATOM   1570 C CB    . VAL C 3 152 ? 10.201  18.061 0.572   1.00 15.38 ? 448  VAL A CB    1 
ATOM   1571 C CG1   . VAL C 3 152 ? 8.836   17.481 0.296   1.00 15.13 ? 448  VAL A CG1   1 
ATOM   1572 C CG2   . VAL C 3 152 ? 10.669  18.843 -0.654  1.00 15.35 ? 448  VAL A CG2   1 
ATOM   1573 N N     . ARG C 3 153 ? 10.022  17.440 3.694   1.00 14.67 ? 449  ARG A N     1 
ATOM   1574 C CA    . ARG C 3 153 ? 9.343   16.751 4.795   1.00 15.16 ? 449  ARG A CA    1 
ATOM   1575 C C     . ARG C 3 153 ? 8.943   17.770 5.883   1.00 14.20 ? 449  ARG A C     1 
ATOM   1576 O O     . ARG C 3 153 ? 7.894   17.645 6.497   1.00 13.71 ? 449  ARG A O     1 
ATOM   1577 C CB    . ARG C 3 153 ? 10.239  15.631 5.365   1.00 15.51 ? 449  ARG A CB    1 
ATOM   1578 C CG    . ARG C 3 153 ? 10.113  14.292 4.578   1.00 16.75 ? 449  ARG A CG    1 
ATOM   1579 C CD    . ARG C 3 153 ? 10.938  13.192 5.208   1.00 17.51 ? 449  ARG A CD    1 
ATOM   1580 N NE    . ARG C 3 153 ? 10.770  11.924 4.505   1.00 19.38 ? 449  ARG A NE    1 
ATOM   1581 C CZ    . ARG C 3 153 ? 9.674   11.168 4.571   1.00 20.96 ? 449  ARG A CZ    1 
ATOM   1582 N NH1   . ARG C 3 153 ? 8.643   11.563 5.317   1.00 21.14 ? 449  ARG A NH1   1 
ATOM   1583 N NH2   . ARG C 3 153 ? 9.611   10.008 3.906   1.00 20.65 ? 449  ARG A NH2   1 
ATOM   1584 N N     . LYS C 3 154 ? 9.769   18.785 6.104   1.00 14.72 ? 450  LYS A N     1 
ATOM   1585 C CA    . LYS C 3 154 ? 9.418   19.821 7.082   1.00 14.13 ? 450  LYS A CA    1 
ATOM   1586 C C     . LYS C 3 154 ? 8.199   20.616 6.557   1.00 13.68 ? 450  LYS A C     1 
ATOM   1587 O O     . LYS C 3 154 ? 7.224   20.874 7.286   1.00 14.10 ? 450  LYS A O     1 
ATOM   1588 C CB    . LYS C 3 154 ? 10.618  20.735 7.309   1.00 13.65 ? 450  LYS A CB    1 
ATOM   1589 C CG    . LYS C 3 154 ? 11.685  20.131 8.190   1.00 13.88 ? 450  LYS A CG    1 
ATOM   1590 C CD    . LYS C 3 154 ? 12.414  21.188 9.001   1.00 14.48 ? 450  LYS A CD    1 
ATOM   1591 C CE    . LYS C 3 154 ? 13.380  21.980 8.146   1.00 14.93 ? 450  LYS A CE    1 
ATOM   1592 N NZ    . LYS C 3 154 ? 14.361  22.767 8.967   1.00 14.01 ? 450  LYS A NZ    1 
ATOM   1593 N N     . ALA C 3 155 ? 8.226   20.981 5.279   1.00 14.40 ? 451  ALA A N     1 
ATOM   1594 C CA    . ALA C 3 155 ? 7.108   21.704 4.685   1.00 13.48 ? 451  ALA A CA    1 
ATOM   1595 C C     . ALA C 3 155 ? 5.828   20.897 4.722   1.00 13.30 ? 451  ALA A C     1 
ATOM   1596 O O     . ALA C 3 155 ? 4.752   21.450 4.959   1.00 13.57 ? 451  ALA A O     1 
ATOM   1597 C CB    . ALA C 3 155 ? 7.431   22.082 3.246   1.00 14.94 ? 451  ALA A CB    1 
ATOM   1598 N N     . ALA C 3 156 ? 5.926   19.592 4.470   1.00 14.15 ? 452  ALA A N     1 
ATOM   1599 C CA    . ALA C 3 156 ? 4.733   18.732 4.490   1.00 14.16 ? 452  ALA A CA    1 
ATOM   1600 C C     . ALA C 3 156 ? 4.154   18.651 5.907   1.00 13.59 ? 452  ALA A C     1 
ATOM   1601 O O     . ALA C 3 156 ? 2.937   18.601 6.064   1.00 14.05 ? 452  ALA A O     1 
ATOM   1602 C CB    . ALA C 3 156 ? 5.065   17.325 3.971   1.00 13.16 ? 452  ALA A CB    1 
ATOM   1603 N N     . ALA C 3 157 ? 5.017   18.634 6.926   1.00 14.14 ? 453  ALA A N     1 
ATOM   1604 C CA    . ALA C 3 157 ? 4.562   18.590 8.340   1.00 15.12 ? 453  ALA A CA    1 
ATOM   1605 C C     . ALA C 3 157 ? 3.778   19.856 8.661   1.00 14.85 ? 453  ALA A C     1 
ATOM   1606 O O     . ALA C 3 157 ? 2.647   19.781 9.161   1.00 15.73 ? 453  ALA A O     1 
ATOM   1607 C CB    . ALA C 3 157 ? 5.750   18.455 9.290   1.00 13.02 ? 453  ALA A CB    1 
ATOM   1608 N N     . ILE C 3 158 ? 4.366   21.016 8.353   1.00 15.90 ? 454  ILE A N     1 
ATOM   1609 C CA    . ILE C 3 158 ? 3.680   22.298 8.570   1.00 15.86 ? 454  ILE A CA    1 
ATOM   1610 C C     . ILE C 3 158 ? 2.351   22.301 7.830   1.00 16.37 ? 454  ILE A C     1 
ATOM   1611 O O     . ILE C 3 158 ? 1.308   22.661 8.380   1.00 16.93 ? 454  ILE A O     1 
ATOM   1612 C CB    . ILE C 3 158 ? 4.518   23.484 8.073   1.00 15.29 ? 454  ILE A CB    1 
ATOM   1613 C CG1   . ILE C 3 158 ? 5.735   23.630 8.973   1.00 15.44 ? 454  ILE A CG1   1 
ATOM   1614 C CG2   . ILE C 3 158 ? 3.662   24.782 8.043   1.00 13.87 ? 454  ILE A CG2   1 
ATOM   1615 C CD1   . ILE C 3 158 ? 6.999   24.116 8.238   1.00 16.19 ? 454  ILE A CD1   1 
ATOM   1616 N N     . TRP C 3 159 ? 2.369   21.872 6.576   1.00 17.47 ? 455  TRP A N     1 
ATOM   1617 C CA    . TRP C 3 159 ? 1.138   21.826 5.797   1.00 17.56 ? 455  TRP A CA    1 
ATOM   1618 C C     . TRP C 3 159 ? 0.077   20.982 6.524   1.00 18.10 ? 455  TRP A C     1 
ATOM   1619 O O     . TRP C 3 159 ? -1.090  21.382 6.641   1.00 18.04 ? 455  TRP A O     1 
ATOM   1620 C CB    . TRP C 3 159 ? 1.450   21.243 4.405   1.00 17.81 ? 455  TRP A CB    1 
ATOM   1621 C CG    . TRP C 3 159 ? 0.298   21.215 3.435   1.00 18.81 ? 455  TRP A CG    1 
ATOM   1622 C CD1   . TRP C 3 159 ? -0.355  20.103 2.985   1.00 18.98 ? 455  TRP A CD1   1 
ATOM   1623 C CD2   . TRP C 3 159 ? -0.323  22.340 2.766   1.00 19.20 ? 455  TRP A CD2   1 
ATOM   1624 N NE1   . TRP C 3 159 ? -1.333  20.459 2.087   1.00 18.76 ? 455  TRP A NE1   1 
ATOM   1625 C CE2   . TRP C 3 159 ? -1.336  21.823 1.935   1.00 19.88 ? 455  TRP A CE2   1 
ATOM   1626 C CE3   . TRP C 3 159 ? -0.118  23.725 2.790   1.00 19.41 ? 455  TRP A CE3   1 
ATOM   1627 C CZ2   . TRP C 3 159 ? -2.147  22.646 1.136   1.00 19.63 ? 455  TRP A CZ2   1 
ATOM   1628 C CZ3   . TRP C 3 159 ? -0.923  24.538 1.997   1.00 19.38 ? 455  TRP A CZ3   1 
ATOM   1629 C CH2   . TRP C 3 159 ? -1.923  23.996 1.184   1.00 20.46 ? 455  TRP A CH2   1 
ATOM   1630 N N     . GLU C 3 160 ? 0.490   19.826 7.036   1.00 18.79 ? 456  GLU A N     1 
ATOM   1631 C CA    . GLU C 3 160 ? -0.426  18.918 7.731   1.00 19.72 ? 456  GLU A CA    1 
ATOM   1632 C C     . GLU C 3 160 ? -0.827  19.335 9.142   1.00 18.98 ? 456  GLU A C     1 
ATOM   1633 O O     . GLU C 3 160 ? -1.994  19.217 9.524   1.00 18.60 ? 456  GLU A O     1 
ATOM   1634 C CB    . GLU C 3 160 ? 0.188   17.510 7.795   1.00 21.11 ? 456  GLU A CB    1 
ATOM   1635 C CG    . GLU C 3 160 ? 0.267   16.832 6.411   1.00 25.72 ? 456  GLU A CG    1 
ATOM   1636 C CD    . GLU C 3 160 ? -1.113  16.586 5.786   1.00 26.95 ? 456  GLU A CD    1 
ATOM   1637 O OE1   . GLU C 3 160 ? -2.022  16.103 6.507   1.00 30.73 ? 456  GLU A OE1   1 
ATOM   1638 O OE2   . GLU C 3 160 ? -1.297  16.872 4.586   1.00 27.20 ? 456  GLU A OE2   1 
ATOM   1639 N N     . LEU C 3 161 ? 0.143   19.830 9.901   1.00 19.06 ? 457  LEU A N     1 
ATOM   1640 C CA    . LEU C 3 161 ? -0.095  20.214 11.289  1.00 19.31 ? 457  LEU A CA    1 
ATOM   1641 C C     . LEU C 3 161 ? -0.778  21.546 11.555  1.00 19.64 ? 457  LEU A C     1 
ATOM   1642 O O     . LEU C 3 161 ? -1.234  21.770 12.667  1.00 20.08 ? 457  LEU A O     1 
ATOM   1643 C CB    . LEU C 3 161 ? 1.223   20.166 12.074  1.00 19.26 ? 457  LEU A CB    1 
ATOM   1644 C CG    . LEU C 3 161 ? 1.943   18.813 12.117  1.00 19.16 ? 457  LEU A CG    1 
ATOM   1645 C CD1   . LEU C 3 161 ? 3.374   19.038 12.517  1.00 19.96 ? 457  LEU A CD1   1 
ATOM   1646 C CD2   . LEU C 3 161 ? 1.248   17.884 13.101  1.00 18.50 ? 457  LEU A CD2   1 
ATOM   1647 N N     . GLU C 3 162 ? -0.854  22.426 10.565  1.00 19.05 ? 458  GLU A N     1 
ATOM   1648 C CA    . GLU C 3 162 ? -1.484  23.711 10.795  1.00 18.98 ? 458  GLU A CA    1 
ATOM   1649 C C     . GLU C 3 162 ? -2.908  23.654 11.362  1.00 19.23 ? 458  GLU A C     1 
ATOM   1650 O O     . GLU C 3 162 ? -3.233  24.383 12.299  1.00 18.01 ? 458  GLU A O     1 
ATOM   1651 C CB    . GLU C 3 162 ? -1.488  24.542 9.513   1.00 18.68 ? 458  GLU A CB    1 
ATOM   1652 C CG    . GLU C 3 162 ? -2.341  25.807 9.632   1.00 19.32 ? 458  GLU A CG    1 
ATOM   1653 C CD    . GLU C 3 162 ? -2.431  26.594 8.335   1.00 20.48 ? 458  GLU A CD    1 
ATOM   1654 O OE1   . GLU C 3 162 ? -1.572  26.429 7.437   1.00 20.39 ? 458  GLU A OE1   1 
ATOM   1655 O OE2   . GLU C 3 162 ? -3.375  27.388 8.214   1.00 21.51 ? 458  GLU A OE2   1 
ATOM   1656 N N     . ARG C 3 163 ? -3.757  22.793 10.811  1.00 19.65 ? 459  ARG A N     1 
ATOM   1657 C CA    . ARG C 3 163 ? -5.129  22.701 11.276  1.00 20.75 ? 459  ARG A CA    1 
ATOM   1658 C C     . ARG C 3 163 ? -5.271  22.208 12.718  1.00 20.66 ? 459  ARG A C     1 
ATOM   1659 O O     . ARG C 3 163 ? -5.966  22.815 13.518  1.00 19.73 ? 459  ARG A O     1 
ATOM   1660 C CB    . ARG C 3 163 ? -5.940  21.806 10.355  1.00 23.07 ? 459  ARG A CB    1 
ATOM   1661 C CG    . ARG C 3 163 ? -7.437  21.962 10.543  1.00 27.83 ? 459  ARG A CG    1 
ATOM   1662 C CD    . ARG C 3 163 ? -8.047  20.692 11.131  1.00 33.52 ? 459  ARG A CD    1 
ATOM   1663 N NE    . ARG C 3 163 ? -7.665  19.497 10.368  1.00 38.10 ? 459  ARG A NE    1 
ATOM   1664 C CZ    . ARG C 3 163 ? -7.304  18.332 10.913  1.00 40.49 ? 459  ARG A CZ    1 
ATOM   1665 N NH1   . ARG C 3 163 ? -7.271  18.196 12.248  1.00 39.95 ? 459  ARG A NH1   1 
ATOM   1666 N NH2   . ARG C 3 163 ? -6.951  17.312 10.120  1.00 40.73 ? 459  ARG A NH2   1 
ATOM   1667 N N     . PRO C 3 164 ? -4.667  21.059 13.051  1.00 21.01 ? 460  PRO A N     1 
ATOM   1668 C CA    . PRO C 3 164 ? -4.786  20.577 14.436  1.00 19.84 ? 460  PRO A CA    1 
ATOM   1669 C C     . PRO C 3 164 ? -4.219  21.560 15.476  1.00 19.66 ? 460  PRO A C     1 
ATOM   1670 O O     . PRO C 3 164 ? -4.754  21.679 16.573  1.00 18.72 ? 460  PRO A O     1 
ATOM   1671 C CB    . PRO C 3 164 ? -4.035  19.242 14.433  1.00 21.03 ? 460  PRO A CB    1 
ATOM   1672 C CG    . PRO C 3 164 ? -3.198  19.255 13.166  1.00 21.55 ? 460  PRO A CG    1 
ATOM   1673 C CD    . PRO C 3 164 ? -3.925  20.127 12.183  1.00 20.99 ? 460  PRO A CD    1 
ATOM   1674 N N     . PHE C 3 165 ? -3.133  22.253 15.142  1.00 18.51 ? 461  PHE A N     1 
ATOM   1675 C CA    . PHE C 3 165 ? -2.552  23.219 16.072  1.00 18.27 ? 461  PHE A CA    1 
ATOM   1676 C C     . PHE C 3 165 ? -3.487  24.414 16.302  1.00 18.12 ? 461  PHE A C     1 
ATOM   1677 O O     . PHE C 3 165 ? -3.714  24.815 17.446  1.00 19.07 ? 461  PHE A O     1 
ATOM   1678 C CB    . PHE C 3 165 ? -1.194  23.701 15.569  1.00 16.12 ? 461  PHE A CB    1 
ATOM   1679 C CG    . PHE C 3 165 ? -0.034  22.902 16.105  1.00 16.42 ? 461  PHE A CG    1 
ATOM   1680 C CD1   . PHE C 3 165 ? 0.245   21.638 15.608  1.00 15.78 ? 461  PHE A CD1   1 
ATOM   1681 C CD2   . PHE C 3 165 ? 0.783   23.414 17.093  1.00 14.28 ? 461  PHE A CD2   1 
ATOM   1682 C CE1   . PHE C 3 165 ? 1.315   20.911 16.087  1.00 15.15 ? 461  PHE A CE1   1 
ATOM   1683 C CE2   . PHE C 3 165 ? 1.845   22.690 17.571  1.00 14.49 ? 461  PHE A CE2   1 
ATOM   1684 C CZ    . PHE C 3 165 ? 2.117   21.435 17.069  1.00 14.34 ? 461  PHE A CZ    1 
ATOM   1685 N N     . LEU C 3 166 ? -4.035  24.965 15.218  1.00 18.14 ? 462  LEU A N     1 
ATOM   1686 C CA    . LEU C 3 166 ? -4.970  26.091 15.291  1.00 17.98 ? 462  LEU A CA    1 
ATOM   1687 C C     . LEU C 3 166 ? -6.214  25.662 16.070  1.00 18.88 ? 462  LEU A C     1 
ATOM   1688 O O     . LEU C 3 166 ? -6.779  26.437 16.838  1.00 18.20 ? 462  LEU A O     1 
ATOM   1689 C CB    . LEU C 3 166 ? -5.371  26.551 13.873  1.00 17.76 ? 462  LEU A CB    1 
ATOM   1690 C CG    . LEU C 3 166 ? -4.342  27.396 13.100  1.00 17.17 ? 462  LEU A CG    1 
ATOM   1691 C CD1   . LEU C 3 166 ? -4.810  27.657 11.674  1.00 15.85 ? 462  LEU A CD1   1 
ATOM   1692 C CD2   . LEU C 3 166 ? -4.124  28.711 13.857  1.00 16.86 ? 462  LEU A CD2   1 
ATOM   1693 N N     . ASP C 3 167 ? -6.629  24.411 15.864  1.00 20.00 ? 463  ASP A N     1 
ATOM   1694 C CA    . ASP C 3 167 ? -7.791  23.833 16.563  1.00 20.33 ? 463  ASP A CA    1 
ATOM   1695 C C     . ASP C 3 167 ? -7.551  23.796 18.088  1.00 19.10 ? 463  ASP A C     1 
ATOM   1696 O O     . ASP C 3 167 ? -8.445  24.156 18.871  1.00 18.96 ? 463  ASP A O     1 
ATOM   1697 C CB    . ASP C 3 167 ? -8.056  22.400 16.076  1.00 22.16 ? 463  ASP A CB    1 
ATOM   1698 C CG    . ASP C 3 167 ? -8.908  22.352 14.815  1.00 24.28 ? 463  ASP A CG    1 
ATOM   1699 O OD1   . ASP C 3 167 ? -9.468  23.405 14.429  1.00 24.41 ? 463  ASP A OD1   1 
ATOM   1700 O OD2   . ASP C 3 167 ? -9.014  21.252 14.216  1.00 25.08 ? 463  ASP A OD2   1 
ATOM   1701 N N     . GLU C 3 168 ? -6.371  23.335 18.505  1.00 17.65 ? 464  GLU A N     1 
ATOM   1702 C CA    . GLU C 3 168 ? -6.071  23.299 19.925  1.00 17.85 ? 464  GLU A CA    1 
ATOM   1703 C C     . GLU C 3 168 ? -5.932  24.736 20.456  1.00 17.65 ? 464  GLU A C     1 
ATOM   1704 O O     . GLU C 3 168 ? -6.470  25.047 21.515  1.00 16.84 ? 464  GLU A O     1 
ATOM   1705 C CB    . GLU C 3 168 ? -4.809  22.514 20.207  1.00 16.46 ? 464  GLU A CB    1 
ATOM   1706 C CG    . GLU C 3 168 ? -4.735  22.087 21.658  1.00 18.53 ? 464  GLU A CG    1 
ATOM   1707 C CD    . GLU C 3 168 ? -3.392  21.445 22.031  1.00 19.47 ? 464  GLU A CD    1 
ATOM   1708 O OE1   . GLU C 3 168 ? -2.626  21.065 21.103  1.00 18.66 ? 464  GLU A OE1   1 
ATOM   1709 O OE2   . GLU C 3 168 ? -3.108  21.330 23.253  1.00 18.61 ? 464  GLU A OE2   1 
ATOM   1710 N N     . LEU C 3 169 ? -5.228  25.607 19.727  1.00 17.23 ? 465  LEU A N     1 
ATOM   1711 C CA    . LEU C 3 169 ? -5.105  27.002 20.166  1.00 17.22 ? 465  LEU A CA    1 
ATOM   1712 C C     . LEU C 3 169 ? -6.488  27.612 20.396  1.00 16.66 ? 465  LEU A C     1 
ATOM   1713 O O     . LEU C 3 169 ? -6.696  28.343 21.353  1.00 15.93 ? 465  LEU A O     1 
ATOM   1714 C CB    . LEU C 3 169 ? -4.336  27.841 19.136  1.00 17.02 ? 465  LEU A CB    1 
ATOM   1715 C CG    . LEU C 3 169 ? -2.814  27.665 19.085  1.00 17.26 ? 465  LEU A CG    1 
ATOM   1716 C CD1   . LEU C 3 169 ? -2.339  28.135 17.751  1.00 16.94 ? 465  LEU A CD1   1 
ATOM   1717 C CD2   . LEU C 3 169 ? -2.114  28.438 20.193  1.00 16.83 ? 465  LEU A CD2   1 
ATOM   1718 N N     . ARG C 3 170 ? -7.442  27.307 19.531  1.00 17.48 ? 466  ARG A N     1 
ATOM   1719 C CA    . ARG C 3 170 ? -8.789  27.841 19.698  1.00 20.18 ? 466  ARG A CA    1 
ATOM   1720 C C     . ARG C 3 170 ? -9.471  27.322 20.965  1.00 20.00 ? 466  ARG A C     1 
ATOM   1721 O O     . ARG C 3 170 ? -10.161 28.069 21.657  1.00 19.51 ? 466  ARG A O     1 
ATOM   1722 C CB    . ARG C 3 170 ? -9.668  27.498 18.501  1.00 23.03 ? 466  ARG A CB    1 
ATOM   1723 C CG    . ARG C 3 170 ? -11.133 27.745 18.759  1.00 28.98 ? 466  ARG A CG    1 
ATOM   1724 C CD    . ARG C 3 170 ? -11.804 28.511 17.622  1.00 35.60 ? 466  ARG A CD    1 
ATOM   1725 N NE    . ARG C 3 170 ? -12.305 29.829 18.037  1.00 40.75 ? 466  ARG A NE    1 
ATOM   1726 C CZ    . ARG C 3 170 ? -12.997 30.657 17.242  1.00 43.96 ? 466  ARG A CZ    1 
ATOM   1727 N NH1   . ARG C 3 170 ? -13.276 30.307 15.980  1.00 44.73 ? 466  ARG A NH1   1 
ATOM   1728 N NH2   . ARG C 3 170 ? -13.418 31.839 17.706  1.00 44.89 ? 466  ARG A NH2   1 
ATOM   1729 N N     . ARG C 3 171 ? -9.293  26.034 21.248  1.00 19.90 ? 467  ARG A N     1 
ATOM   1730 C CA    . ARG C 3 171 ? -9.864  25.414 22.442  1.00 19.72 ? 467  ARG A CA    1 
ATOM   1731 C C     . ARG C 3 171 ? -9.279  26.087 23.692  1.00 17.63 ? 467  ARG A C     1 
ATOM   1732 O O     . ARG C 3 171 ? -9.986  26.308 24.662  1.00 17.55 ? 467  ARG A O     1 
ATOM   1733 C CB    . ARG C 3 171 ? -9.546  23.916 22.454  1.00 20.51 ? 467  ARG A CB    1 
ATOM   1734 C CG    . ARG C 3 171 ? -10.480 23.105 21.598  1.00 23.79 ? 467  ARG A CG    1 
ATOM   1735 C CD    . ARG C 3 171 ? -10.377 21.634 21.922  1.00 25.55 ? 467  ARG A CD    1 
ATOM   1736 N NE    . ARG C 3 171 ? -9.066  21.092 21.563  1.00 28.83 ? 467  ARG A NE    1 
ATOM   1737 C CZ    . ARG C 3 171 ? -8.719  20.707 20.333  1.00 28.13 ? 467  ARG A CZ    1 
ATOM   1738 N NH1   . ARG C 3 171 ? -9.588  20.803 19.343  1.00 27.99 ? 467  ARG A NH1   1 
ATOM   1739 N NH2   . ARG C 3 171 ? -7.502  20.223 20.099  1.00 27.49 ? 467  ARG A NH2   1 
ATOM   1740 N N     . ASN C 3 172 ? -7.989  26.410 23.639  1.00 16.96 ? 468  ASN A N     1 
ATOM   1741 C CA    . ASN C 3 172 ? -7.279  27.085 24.725  1.00 16.09 ? 468  ASN A CA    1 
ATOM   1742 C C     . ASN C 3 172 ? -7.582  28.590 24.726  1.00 17.05 ? 468  ASN A C     1 
ATOM   1743 O O     . ASN C 3 172 ? -7.064  29.329 25.563  1.00 16.39 ? 468  ASN A O     1 
ATOM   1744 C CB    . ASN C 3 172 ? -5.765  26.931 24.545  1.00 15.93 ? 468  ASN A CB    1 
ATOM   1745 C CG    . ASN C 3 172 ? -5.262  25.525 24.859  1.00 15.68 ? 468  ASN A CG    1 
ATOM   1746 O OD1   . ASN C 3 172 ? -6.040  24.617 25.099  1.00 17.37 ? 468  ASN A OD1   1 
ATOM   1747 N ND2   . ASN C 3 172 ? -3.954  25.354 24.856  1.00 14.21 ? 468  ASN A ND2   1 
ATOM   1748 N N     . GLU C 3 173 ? -8.403  29.054 23.792  1.00 17.48 ? 469  GLU A N     1 
ATOM   1749 C CA    . GLU C 3 173 ? -8.683  30.478 23.716  1.00 19.53 ? 469  GLU A CA    1 
ATOM   1750 C C     . GLU C 3 173 ? -7.388  31.237 23.468  1.00 19.10 ? 469  GLU A C     1 
ATOM   1751 O O     . GLU C 3 173 ? -7.200  32.339 23.979  1.00 17.67 ? 469  GLU A O     1 
ATOM   1752 C CB    . GLU C 3 173 ? -9.285  30.974 25.017  1.00 23.06 ? 469  GLU A CB    1 
ATOM   1753 C CG    . GLU C 3 173 ? -10.578 30.282 25.406  1.00 28.36 ? 469  GLU A CG    1 
ATOM   1754 C CD    . GLU C 3 173 ? -11.321 31.051 26.481  1.00 32.21 ? 469  GLU A CD    1 
ATOM   1755 O OE1   . GLU C 3 173 ? -10.657 31.595 27.402  1.00 34.12 ? 469  GLU A OE1   1 
ATOM   1756 O OE2   . GLU C 3 173 ? -12.566 31.117 26.399  1.00 34.49 ? 469  GLU A OE2   1 
ATOM   1757 N N     . GLN C 3 174 ? -6.501  30.632 22.681  1.00 18.74 ? 470  GLN A N     1 
ATOM   1758 C CA    . GLN C 3 174 ? -5.203  31.219 22.353  1.00 18.89 ? 470  GLN A CA    1 
ATOM   1759 C C     . GLN C 3 174 ? -5.014  31.556 20.859  1.00 19.13 ? 470  GLN A C     1 
ATOM   1760 O O     . GLN C 3 174 ? -3.905  31.892 20.417  1.00 18.81 ? 470  GLN A O     1 
ATOM   1761 C CB    . GLN C 3 174 ? -4.082  30.266 22.768  1.00 18.64 ? 470  GLN A CB    1 
ATOM   1762 C CG    . GLN C 3 174 ? -3.935  30.018 24.252  1.00 17.41 ? 470  GLN A CG    1 
ATOM   1763 C CD    . GLN C 3 174 ? -2.816  29.076 24.501  1.00 17.61 ? 470  GLN A CD    1 
ATOM   1764 O OE1   . GLN C 3 174 ? -2.809  27.977 23.978  1.00 18.30 ? 470  GLN A OE1   1 
ATOM   1765 N NE2   . GLN C 3 174 ? -1.834  29.503 25.271  1.00 18.79 ? 470  GLN A NE2   1 
ATOM   1766 N N     . ASP C 3 175 ? -6.083  31.447 20.081  1.00 19.70 ? 471  ASP A N     1 
ATOM   1767 C CA    . ASP C 3 175 ? -5.978  31.739 18.662  1.00 20.71 ? 471  ASP A CA    1 
ATOM   1768 C C     . ASP C 3 175 ? -5.590  33.205 18.388  1.00 19.63 ? 471  ASP A C     1 
ATOM   1769 O O     . ASP C 3 175 ? -4.728  33.469 17.550  1.00 19.34 ? 471  ASP A O     1 
ATOM   1770 C CB    . ASP C 3 175 ? -7.295  31.385 17.973  1.00 22.84 ? 471  ASP A CB    1 
ATOM   1771 C CG    . ASP C 3 175 ? -8.491  31.827 18.768  1.00 25.79 ? 471  ASP A CG    1 
ATOM   1772 O OD1   . ASP C 3 175 ? -8.520  31.608 19.995  1.00 27.84 ? 471  ASP A OD1   1 
ATOM   1773 O OD2   . ASP C 3 175 ? -9.413  32.406 18.166  1.00 28.23 ? 471  ASP A OD2   1 
ATOM   1774 N N     . ARG C 3 176 ? -6.206  34.153 19.094  1.00 19.05 ? 472  ARG A N     1 
ATOM   1775 C CA    . ARG C 3 176 ? -5.883  35.553 18.872  1.00 19.06 ? 472  ARG A CA    1 
ATOM   1776 C C     . ARG C 3 176 ? -4.543  35.868 19.452  1.00 17.82 ? 472  ARG A C     1 
ATOM   1777 O O     . ARG C 3 176 ? -3.831  36.727 18.941  1.00 17.63 ? 472  ARG A O     1 
ATOM   1778 C CB    . ARG C 3 176 ? -6.936  36.446 19.494  1.00 21.72 ? 472  ARG A CB    1 
ATOM   1779 C CG    . ARG C 3 176 ? -8.189  36.459 18.690  1.00 25.38 ? 472  ARG A CG    1 
ATOM   1780 C CD    . ARG C 3 176 ? -9.316  36.983 19.499  1.00 30.52 ? 472  ARG A CD    1 
ATOM   1781 N NE    . ARG C 3 176 ? -9.123  38.395 19.822  1.00 37.25 ? 472  ARG A NE    1 
ATOM   1782 C CZ    . ARG C 3 176 ? -9.629  39.401 19.103  1.00 40.49 ? 472  ARG A CZ    1 
ATOM   1783 N NH1   . ARG C 3 176 ? -10.361 39.137 18.013  1.00 42.73 ? 472  ARG A NH1   1 
ATOM   1784 N NH2   . ARG C 3 176 ? -9.424  40.671 19.477  1.00 41.09 ? 472  ARG A NH2   1 
ATOM   1785 N N     . LEU C 3 177 ? -4.183  35.165 20.523  1.00 16.36 ? 473  LEU A N     1 
ATOM   1786 C CA    . LEU C 3 177 ? -2.880  35.390 21.131  1.00 15.78 ? 473  LEU A CA    1 
ATOM   1787 C C     . LEU C 3 177 ? -1.853  35.101 20.064  1.00 15.54 ? 473  LEU A C     1 
ATOM   1788 O O     . LEU C 3 177 ? -0.834  35.768 19.967  1.00 15.59 ? 473  LEU A O     1 
ATOM   1789 C CB    . LEU C 3 177 ? -2.641  34.453 22.322  1.00 14.02 ? 473  LEU A CB    1 
ATOM   1790 C CG    . LEU C 3 177 ? -1.258  34.516 22.977  1.00 14.94 ? 473  LEU A CG    1 
ATOM   1791 C CD1   . LEU C 3 177 ? -0.987  35.907 23.553  1.00 15.00 ? 473  LEU A CD1   1 
ATOM   1792 C CD2   . LEU C 3 177 ? -1.207  33.477 24.108  1.00 15.17 ? 473  LEU A CD2   1 
ATOM   1793 N N     . LEU C 3 178 ? -2.112  34.091 19.249  1.00 15.63 ? 474  LEU A N     1 
ATOM   1794 C CA    . LEU C 3 178 ? -1.165  33.769 18.197  1.00 15.65 ? 474  LEU A CA    1 
ATOM   1795 C C     . LEU C 3 178 ? -1.280  34.722 16.995  1.00 16.02 ? 474  LEU A C     1 
ATOM   1796 O O     . LEU C 3 178 ? -0.285  35.271 16.519  1.00 16.64 ? 474  LEU A O     1 
ATOM   1797 C CB    . LEU C 3 178 ? -1.379  32.341 17.699  1.00 13.74 ? 474  LEU A CB    1 
ATOM   1798 C CG    . LEU C 3 178 ? -0.601  32.120 16.413  1.00 14.14 ? 474  LEU A CG    1 
ATOM   1799 C CD1   . LEU C 3 178 ? 0.821   31.742 16.776  1.00 14.20 ? 474  LEU A CD1   1 
ATOM   1800 C CD2   . LEU C 3 178 ? -1.264  31.041 15.549  1.00 14.91 ? 474  LEU A CD2   1 
ATOM   1801 N N     . VAL C 3 179 ? -2.496  34.923 16.512  1.00 16.61 ? 475  VAL A N     1 
ATOM   1802 C CA    . VAL C 3 179 ? -2.694  35.733 15.319  1.00 17.69 ? 475  VAL A CA    1 
ATOM   1803 C C     . VAL C 3 179 ? -2.587  37.243 15.468  1.00 17.75 ? 475  VAL A C     1 
ATOM   1804 O O     . VAL C 3 179 ? -2.109  37.918 14.562  1.00 17.84 ? 475  VAL A O     1 
ATOM   1805 C CB    . VAL C 3 179 ? -4.050  35.398 14.660  1.00 17.27 ? 475  VAL A CB    1 
ATOM   1806 C CG1   . VAL C 3 179 ? -4.353  36.385 13.537  1.00 18.37 ? 475  VAL A CG1   1 
ATOM   1807 C CG2   . VAL C 3 179 ? -4.007  33.997 14.114  1.00 17.99 ? 475  VAL A CG2   1 
ATOM   1808 N N     . GLU C 3 180 ? -3.017  37.769 16.606  1.00 17.82 ? 476  GLU A N     1 
ATOM   1809 C CA    . GLU C 3 180 ? -2.986  39.203 16.806  1.00 18.12 ? 476  GLU A CA    1 
ATOM   1810 C C     . GLU C 3 180 ? -1.848  39.691 17.675  1.00 17.86 ? 476  GLU A C     1 
ATOM   1811 O O     . GLU C 3 180 ? -1.558  40.896 17.696  1.00 17.15 ? 476  GLU A O     1 
ATOM   1812 C CB    . GLU C 3 180 ? -4.327  39.660 17.357  1.00 17.40 ? 476  GLU A CB    1 
ATOM   1813 C CG    . GLU C 3 180 ? -5.445  39.265 16.446  1.00 20.29 ? 476  GLU A CG    1 
ATOM   1814 C CD    . GLU C 3 180 ? -6.788  39.554 17.037  1.00 22.85 ? 476  GLU A CD    1 
ATOM   1815 O OE1   . GLU C 3 180 ? -6.851  40.382 17.965  1.00 25.43 ? 476  GLU A OE1   1 
ATOM   1816 O OE2   . GLU C 3 180 ? -7.787  38.957 16.585  1.00 24.96 ? 476  GLU A OE2   1 
ATOM   1817 N N     . LEU C 3 181 ? -1.189  38.774 18.381  1.00 16.75 ? 477  LEU A N     1 
ATOM   1818 C CA    . LEU C 3 181 ? -0.076  39.198 19.212  1.00 15.85 ? 477  LEU A CA    1 
ATOM   1819 C C     . LEU C 3 181 ? 1.288   38.704 18.773  1.00 15.09 ? 477  LEU A C     1 
ATOM   1820 O O     . LEU C 3 181 ? 2.081   39.479 18.237  1.00 14.62 ? 477  LEU A O     1 
ATOM   1821 C CB    . LEU C 3 181 ? -0.293  38.819 20.694  1.00 16.31 ? 477  LEU A CB    1 
ATOM   1822 C CG    . LEU C 3 181 ? 0.725   39.582 21.577  1.00 17.44 ? 477  LEU A CG    1 
ATOM   1823 C CD1   . LEU C 3 181 ? 0.109   40.928 21.982  1.00 16.57 ? 477  LEU A CD1   1 
ATOM   1824 C CD2   . LEU C 3 181 ? 1.136   38.772 22.821  1.00 17.74 ? 477  LEU A CD2   1 
ATOM   1825 N N     . GLU C 3 182 ? 1.573   37.416 18.990  1.00 14.48 ? 478  GLU A N     1 
ATOM   1826 C CA    . GLU C 3 182 ? 2.891   36.862 18.656  1.00 13.99 ? 478  GLU A CA    1 
ATOM   1827 C C     . GLU C 3 182 ? 3.334   36.916 17.199  1.00 12.81 ? 478  GLU A C     1 
ATOM   1828 O O     . GLU C 3 182 ? 4.495   37.174 16.915  1.00 12.03 ? 478  GLU A O     1 
ATOM   1829 C CB    . GLU C 3 182 ? 3.011   35.418 19.166  1.00 15.77 ? 478  GLU A CB    1 
ATOM   1830 C CG    . GLU C 3 182 ? 2.691   35.262 20.660  1.00 15.87 ? 478  GLU A CG    1 
ATOM   1831 C CD    . GLU C 3 182 ? 3.786   35.797 21.602  1.00 16.30 ? 478  GLU A CD    1 
ATOM   1832 O OE1   . GLU C 3 182 ? 4.772   36.427 21.155  1.00 17.24 ? 478  GLU A OE1   1 
ATOM   1833 O OE2   . GLU C 3 182 ? 3.659   35.573 22.815  1.00 16.64 ? 478  GLU A OE2   1 
ATOM   1834 N N     . GLN C 3 183 ? 2.424   36.659 16.269  1.00 13.72 ? 479  GLN A N     1 
ATOM   1835 C CA    . GLN C 3 183 ? 2.806   36.703 14.851  1.00 13.48 ? 479  GLN A CA    1 
ATOM   1836 C C     . GLN C 3 183 ? 3.097   38.163 14.440  1.00 12.35 ? 479  GLN A C     1 
ATOM   1837 O O     . GLN C 3 183 ? 4.140   38.423 13.872  1.00 12.99 ? 479  GLN A O     1 
ATOM   1838 C CB    . GLN C 3 183 ? 1.744   35.993 14.002  1.00 12.51 ? 479  GLN A CB    1 
ATOM   1839 C CG    . GLN C 3 183 ? 1.934   34.451 14.130  1.00 12.71 ? 479  GLN A CG    1 
ATOM   1840 C CD    . GLN C 3 183 ? 0.924   33.620 13.365  1.00 12.89 ? 479  GLN A CD    1 
ATOM   1841 O OE1   . GLN C 3 183 ? -0.055  34.138 12.809  1.00 15.71 ? 479  GLN A OE1   1 
ATOM   1842 N NE2   . GLN C 3 183 ? 1.155   32.320 13.329  1.00 9.35  ? 479  GLN A NE2   1 
ATOM   1843 N N     . PRO C 3 184 ? 2.198   39.121 14.729  1.00 12.31 ? 480  PRO A N     1 
ATOM   1844 C CA    . PRO C 3 184 ? 2.547   40.498 14.341  1.00 12.32 ? 480  PRO A CA    1 
ATOM   1845 C C     . PRO C 3 184 ? 3.836   40.938 15.060  1.00 13.08 ? 480  PRO A C     1 
ATOM   1846 O O     . PRO C 3 184 ? 4.656   41.683 14.503  1.00 12.65 ? 480  PRO A O     1 
ATOM   1847 C CB    . PRO C 3 184 ? 1.340   41.308 14.789  1.00 12.37 ? 480  PRO A CB    1 
ATOM   1848 C CG    . PRO C 3 184 ? 0.212   40.307 14.794  1.00 12.81 ? 480  PRO A CG    1 
ATOM   1849 C CD    . PRO C 3 184 ? 0.847   39.045 15.294  1.00 10.75 ? 480  PRO A CD    1 
ATOM   1850 N N     . LEU C 3 185 ? 4.044   40.454 16.286  1.00 13.66 ? 481  LEU A N     1 
ATOM   1851 C CA    . LEU C 3 185 ? 5.247   40.826 17.022  1.00 13.79 ? 481  LEU A CA    1 
ATOM   1852 C C     . LEU C 3 185 ? 6.487   40.278 16.363  1.00 13.67 ? 481  LEU A C     1 
ATOM   1853 O O     . LEU C 3 185 ? 7.544   40.896 16.399  1.00 12.97 ? 481  LEU A O     1 
ATOM   1854 C CB    . LEU C 3 185 ? 5.195   40.332 18.486  1.00 14.58 ? 481  LEU A CB    1 
ATOM   1855 C CG    . LEU C 3 185 ? 6.448   40.673 19.313  1.00 15.03 ? 481  LEU A CG    1 
ATOM   1856 C CD1   . LEU C 3 185 ? 6.487   42.183 19.590  1.00 15.53 ? 481  LEU A CD1   1 
ATOM   1857 C CD2   . LEU C 3 185 ? 6.446   39.885 20.616  1.00 14.94 ? 481  LEU A CD2   1 
ATOM   1858 N N     . SER C 3 186 ? 6.367   39.090 15.780  1.00 13.88 ? 482  SER A N     1 
ATOM   1859 C CA    . SER C 3 186 ? 7.502   38.466 15.115  1.00 13.39 ? 482  SER A CA    1 
ATOM   1860 C C     . SER C 3 186 ? 8.098   39.399 14.052  1.00 12.95 ? 482  SER A C     1 
ATOM   1861 O O     . SER C 3 186 ? 9.312   39.546 13.960  1.00 13.06 ? 482  SER A O     1 
ATOM   1862 C CB    . SER C 3 186 ? 7.057   37.153 14.446  1.00 13.75 ? 482  SER A CB    1 
ATOM   1863 O OG    . SER C 3 186 ? 8.201   36.440 14.045  1.00 17.22 ? 482  SER A OG    1 
ATOM   1864 N N     . SER C 3 187 ? 7.227   39.993 13.236  1.00 13.12 ? 483  SER A N     1 
ATOM   1865 C CA    . SER C 3 187 ? 7.643   40.927 12.182  1.00 13.99 ? 483  SER A CA    1 
ATOM   1866 C C     . SER C 3 187 ? 8.292   42.185 12.763  1.00 13.54 ? 483  SER A C     1 
ATOM   1867 O O     . SER C 3 187 ? 9.220   42.719 12.174  1.00 13.29 ? 483  SER A O     1 
ATOM   1868 C CB    . SER C 3 187 ? 6.454   41.365 11.326  1.00 13.38 ? 483  SER A CB    1 
ATOM   1869 O OG    . SER C 3 187 ? 5.641   40.279 10.961  1.00 15.92 ? 483  SER A OG    1 
ATOM   1870 N N     . ILE C 3 188 ? 7.796   42.660 13.911  1.00 13.26 ? 484  ILE A N     1 
ATOM   1871 C CA    . ILE C 3 188 ? 8.377   43.837 14.532  1.00 12.22 ? 484  ILE A CA    1 
ATOM   1872 C C     . ILE C 3 188 ? 9.776   43.460 15.026  1.00 12.63 ? 484  ILE A C     1 
ATOM   1873 O O     . ILE C 3 188 ? 10.736  44.224 14.825  1.00 12.34 ? 484  ILE A O     1 
ATOM   1874 C CB    . ILE C 3 188 ? 7.452   44.374 15.691  1.00 12.55 ? 484  ILE A CB    1 
ATOM   1875 C CG1   . ILE C 3 188 ? 6.132   44.877 15.102  1.00 11.28 ? 484  ILE A CG1   1 
ATOM   1876 C CG2   . ILE C 3 188 ? 8.126   45.535 16.432  1.00 13.32 ? 484  ILE A CG2   1 
ATOM   1877 C CD1   . ILE C 3 188 ? 5.044   45.138 16.103  1.00 10.82 ? 484  ILE A CD1   1 
ATOM   1878 N N     . LEU C 3 189 ? 9.928   42.269 15.629  1.00 12.42 ? 485  LEU A N     1 
ATOM   1879 C CA    . LEU C 3 189 ? 11.258  41.862 16.111  1.00 11.85 ? 485  LEU A CA    1 
ATOM   1880 C C     . LEU C 3 189 ? 12.237  41.714 14.959  1.00 11.31 ? 485  LEU A C     1 
ATOM   1881 O O     . LEU C 3 189 ? 13.420  42.002 15.099  1.00 10.56 ? 485  LEU A O     1 
ATOM   1882 C CB    . LEU C 3 189 ? 11.211  40.541 16.911  1.00 12.24 ? 485  LEU A CB    1 
ATOM   1883 C CG    . LEU C 3 189 ? 10.411  40.570 18.232  1.00 14.78 ? 485  LEU A CG    1 
ATOM   1884 C CD1   . LEU C 3 189 ? 10.331  39.157 18.883  1.00 13.78 ? 485  LEU A CD1   1 
ATOM   1885 C CD2   . LEU C 3 189 ? 11.068  41.599 19.172  1.00 12.93 ? 485  LEU A CD2   1 
ATOM   1886 N N     . ALA C 3 190 ? 11.744  41.249 13.821  1.00 11.97 ? 486  ALA A N     1 
ATOM   1887 C CA    . ALA C 3 190 ? 12.606  41.085 12.644  1.00 13.03 ? 486  ALA A CA    1 
ATOM   1888 C C     . ALA C 3 190 ? 13.158  42.462 12.218  1.00 11.94 ? 486  ALA A C     1 
ATOM   1889 O O     . ALA C 3 190 ? 14.319  42.596 11.882  1.00 12.04 ? 486  ALA A O     1 
ATOM   1890 C CB    . ALA C 3 190 ? 11.800  40.447 11.480  1.00 12.76 ? 486  ALA A CB    1 
ATOM   1891 N N     . GLU C 3 191 ? 12.308  43.475 12.229  1.00 13.43 ? 487  GLU A N     1 
ATOM   1892 C CA    . GLU C 3 191 ? 12.747  44.809 11.872  1.00 15.62 ? 487  GLU A CA    1 
ATOM   1893 C C     . GLU C 3 191 ? 13.810  45.312 12.864  1.00 16.09 ? 487  GLU A C     1 
ATOM   1894 O O     . GLU C 3 191 ? 14.844  45.866 12.463  1.00 15.42 ? 487  GLU A O     1 
ATOM   1895 C CB    . GLU C 3 191 ? 11.560  45.747 11.852  1.00 16.44 ? 487  GLU A CB    1 
ATOM   1896 C CG    . GLU C 3 191 ? 10.738  45.607 10.615  1.00 20.18 ? 487  GLU A CG    1 
ATOM   1897 C CD    . GLU C 3 191 ? 9.468   46.438 10.666  1.00 24.69 ? 487  GLU A CD    1 
ATOM   1898 O OE1   . GLU C 3 191 ? 9.245   47.157 11.679  1.00 26.66 ? 487  GLU A OE1   1 
ATOM   1899 O OE2   . GLU C 3 191 ? 8.682   46.374 9.692   1.00 27.24 ? 487  GLU A OE2   1 
ATOM   1900 N N     . MET C 3 192 ? 13.571  45.096 14.155  1.00 15.45 ? 488  MET A N     1 
ATOM   1901 C CA    . MET C 3 192 ? 14.527  45.536 15.169  1.00 14.98 ? 488  MET A CA    1 
ATOM   1902 C C     . MET C 3 192 ? 15.905  44.905 15.020  1.00 14.00 ? 488  MET A C     1 
ATOM   1903 O O     . MET C 3 192 ? 16.930  45.602 15.051  1.00 14.47 ? 488  MET A O     1 
ATOM   1904 C CB    . MET C 3 192 ? 13.974  45.240 16.576  1.00 14.05 ? 488  MET A CB    1 
ATOM   1905 C CG    . MET C 3 192 ? 12.757  46.066 16.932  1.00 14.72 ? 488  MET A CG    1 
ATOM   1906 S SD    . MET C 3 192 ? 11.957  45.446 18.448  1.00 16.45 ? 488  MET A SD    1 
ATOM   1907 C CE    . MET C 3 192 ? 10.452  45.306 17.977  1.00 15.97 ? 488  MET A CE    1 
ATOM   1908 N N     . GLU C 3 193 ? 15.933  43.578 14.885  1.00 13.68 ? 489  GLU A N     1 
ATOM   1909 C CA    . GLU C 3 193 ? 17.179  42.835 14.748  1.00 13.52 ? 489  GLU A CA    1 
ATOM   1910 C C     . GLU C 3 193 ? 17.917  43.258 13.485  1.00 13.50 ? 489  GLU A C     1 
ATOM   1911 O O     . GLU C 3 193 ? 19.127  43.472 13.511  1.00 13.40 ? 489  GLU A O     1 
ATOM   1912 C CB    . GLU C 3 193 ? 16.881  41.342 14.693  1.00 13.13 ? 489  GLU A CB    1 
ATOM   1913 C CG    . GLU C 3 193 ? 16.030  40.830 15.863  1.00 15.47 ? 489  GLU A CG    1 
ATOM   1914 C CD    . GLU C 3 193 ? 15.680  39.359 15.714  1.00 17.21 ? 489  GLU A CD    1 
ATOM   1915 O OE1   . GLU C 3 193 ? 16.024  38.794 14.659  1.00 16.69 ? 489  GLU A OE1   1 
ATOM   1916 O OE2   . GLU C 3 193 ? 15.068  38.768 16.639  1.00 18.07 ? 489  GLU A OE2   1 
ATOM   1917 N N     . PHE C 3 194 ? 17.178  43.365 12.383  1.00 14.40 ? 490  PHE A N     1 
ATOM   1918 C CA    . PHE C 3 194 ? 17.757  43.778 11.095  1.00 15.52 ? 490  PHE A CA    1 
ATOM   1919 C C     . PHE C 3 194 ? 18.374  45.187 11.197  1.00 14.32 ? 490  PHE A C     1 
ATOM   1920 O O     . PHE C 3 194 ? 19.495  45.413 10.746  1.00 14.92 ? 490  PHE A O     1 
ATOM   1921 C CB    . PHE C 3 194 ? 16.688  43.758 9.997   1.00 15.56 ? 490  PHE A CB    1 
ATOM   1922 C CG    . PHE C 3 194 ? 17.230  44.099 8.632   1.00 16.65 ? 490  PHE A CG    1 
ATOM   1923 C CD1   . PHE C 3 194 ? 18.266  43.347 8.075   1.00 15.74 ? 490  PHE A CD1   1 
ATOM   1924 C CD2   . PHE C 3 194 ? 16.742  45.201 7.929   1.00 16.20 ? 490  PHE A CD2   1 
ATOM   1925 C CE1   . PHE C 3 194 ? 18.816  43.687 6.846   1.00 14.96 ? 490  PHE A CE1   1 
ATOM   1926 C CE2   . PHE C 3 194 ? 17.287  45.553 6.688   1.00 16.32 ? 490  PHE A CE2   1 
ATOM   1927 C CZ    . PHE C 3 194 ? 18.326  44.795 6.152   1.00 16.26 ? 490  PHE A CZ    1 
ATOM   1928 N N     . ALA C 3 195 ? 17.635  46.121 11.799  1.00 14.94 ? 491  ALA A N     1 
ATOM   1929 C CA    . ALA C 3 195 ? 18.105  47.498 12.010  1.00 13.18 ? 491  ALA A CA    1 
ATOM   1930 C C     . ALA C 3 195 ? 19.375  47.522 12.861  1.00 13.75 ? 491  ALA A C     1 
ATOM   1931 O O     . ALA C 3 195 ? 20.341  48.224 12.544  1.00 13.13 ? 491  ALA A O     1 
ATOM   1932 C CB    . ALA C 3 195 ? 17.009  48.325 12.680  1.00 13.19 ? 491  ALA A CB    1 
ATOM   1933 N N     . GLY C 3 196 ? 19.402  46.744 13.939  1.00 12.88 ? 492  GLY A N     1 
ATOM   1934 C CA    . GLY C 3 196 ? 20.597  46.747 14.758  1.00 14.11 ? 492  GLY A CA    1 
ATOM   1935 C C     . GLY C 3 196 ? 20.783  48.007 15.611  1.00 14.57 ? 492  GLY A C     1 
ATOM   1936 O O     . GLY C 3 196 ? 19.995  48.944 15.545  1.00 14.17 ? 492  GLY A O     1 
ATOM   1937 N N     . VAL C 3 197 ? 21.843  48.016 16.415  1.00 15.64 ? 493  VAL A N     1 
ATOM   1938 C CA    . VAL C 3 197 ? 22.162  49.137 17.289  1.00 15.57 ? 493  VAL A CA    1 
ATOM   1939 C C     . VAL C 3 197 ? 23.598  49.518 17.000  1.00 16.25 ? 493  VAL A C     1 
ATOM   1940 O O     . VAL C 3 197 ? 24.483  48.660 17.004  1.00 16.61 ? 493  VAL A O     1 
ATOM   1941 C CB    . VAL C 3 197 ? 22.077  48.760 18.804  1.00 15.62 ? 493  VAL A CB    1 
ATOM   1942 C CG1   . VAL C 3 197 ? 22.412  49.974 19.656  1.00 15.00 ? 493  VAL A CG1   1 
ATOM   1943 C CG2   . VAL C 3 197 ? 20.690  48.267 19.155  1.00 15.66 ? 493  VAL A CG2   1 
ATOM   1944 N N     . LYS C 3 198 ? 23.819  50.807 16.750  1.00 16.94 ? 494  LYS A N     1 
ATOM   1945 C CA    . LYS C 3 198 ? 25.139  51.357 16.462  1.00 17.44 ? 494  LYS A CA    1 
ATOM   1946 C C     . LYS C 3 198 ? 26.018  51.377 17.718  1.00 17.83 ? 494  LYS A C     1 
ATOM   1947 O O     . LYS C 3 198 ? 25.571  51.752 18.804  1.00 18.33 ? 494  LYS A O     1 
ATOM   1948 C CB    . LYS C 3 198 ? 24.966  52.769 15.899  1.00 18.63 ? 494  LYS A CB    1 
ATOM   1949 C CG    . LYS C 3 198 ? 26.261  53.516 15.624  1.00 22.25 ? 494  LYS A CG    1 
ATOM   1950 C CD    . LYS C 3 198 ? 27.246  52.701 14.810  1.00 24.75 ? 494  LYS A CD    1 
ATOM   1951 C CE    . LYS C 3 198 ? 28.521  53.531 14.441  1.00 28.67 ? 494  LYS A CE    1 
ATOM   1952 N NZ    . LYS C 3 198 ? 29.756  53.424 15.356  1.00 27.68 ? 494  LYS A NZ    1 
ATOM   1953 N N     . VAL C 3 199 ? 27.269  50.964 17.561  1.00 17.79 ? 495  VAL A N     1 
ATOM   1954 C CA    . VAL C 3 199 ? 28.226  50.903 18.658  1.00 17.93 ? 495  VAL A CA    1 
ATOM   1955 C C     . VAL C 3 199 ? 29.440  51.792 18.383  1.00 18.99 ? 495  VAL A C     1 
ATOM   1956 O O     . VAL C 3 199 ? 30.054  51.730 17.321  1.00 18.42 ? 495  VAL A O     1 
ATOM   1957 C CB    . VAL C 3 199 ? 28.764  49.435 18.870  1.00 17.99 ? 495  VAL A CB    1 
ATOM   1958 C CG1   . VAL C 3 199 ? 29.833  49.401 19.977  1.00 17.99 ? 495  VAL A CG1   1 
ATOM   1959 C CG2   . VAL C 3 199 ? 27.634  48.499 19.166  1.00 17.20 ? 495  VAL A CG2   1 
ATOM   1960 N N     . ASP C 3 200 ? 29.793  52.614 19.357  1.00 20.26 ? 496  ASP A N     1 
ATOM   1961 C CA    . ASP C 3 200 ? 30.959  53.479 19.250  1.00 20.60 ? 496  ASP A CA    1 
ATOM   1962 C C     . ASP C 3 200 ? 32.143  52.626 19.720  1.00 21.37 ? 496  ASP A C     1 
ATOM   1963 O O     . ASP C 3 200 ? 32.509  52.654 20.902  1.00 22.06 ? 496  ASP A O     1 
ATOM   1964 C CB    . ASP C 3 200 ? 30.731  54.671 20.162  1.00 20.25 ? 496  ASP A CB    1 
ATOM   1965 C CG    . ASP C 3 200 ? 31.893  55.605 20.206  1.00 20.98 ? 496  ASP A CG    1 
ATOM   1966 O OD1   . ASP C 3 200 ? 33.004  55.280 19.710  1.00 20.56 ? 496  ASP A OD1   1 
ATOM   1967 O OD2   . ASP C 3 200 ? 31.673  56.692 20.770  1.00 22.46 ? 496  ASP A OD2   1 
ATOM   1968 N N     . THR C 3 201 ? 32.735  51.859 18.804  1.00 21.80 ? 497  THR A N     1 
ATOM   1969 C CA    . THR C 3 201 ? 33.834  50.962 19.154  1.00 22.90 ? 497  THR A CA    1 
ATOM   1970 C C     . THR C 3 201 ? 35.112  51.629 19.609  1.00 23.73 ? 497  THR A C     1 
ATOM   1971 O O     . THR C 3 201 ? 35.928  51.007 20.280  1.00 23.09 ? 497  THR A O     1 
ATOM   1972 C CB    . THR C 3 201 ? 34.171  50.038 18.004  1.00 22.91 ? 497  THR A CB    1 
ATOM   1973 O OG1   . THR C 3 201 ? 34.424  50.831 16.837  1.00 23.83 ? 497  THR A OG1   1 
ATOM   1974 C CG2   . THR C 3 201 ? 33.018  49.086 17.747  1.00 21.16 ? 497  THR A CG2   1 
ATOM   1975 N N     . LYS C 3 202 ? 35.301  52.883 19.224  1.00 25.49 ? 498  LYS A N     1 
ATOM   1976 C CA    . LYS C 3 202 ? 36.481  53.606 19.655  1.00 27.31 ? 498  LYS A CA    1 
ATOM   1977 C C     . LYS C 3 202 ? 36.296  53.838 21.153  1.00 27.74 ? 498  LYS A C     1 
ATOM   1978 O O     . LYS C 3 202 ? 37.235  53.677 21.928  1.00 28.32 ? 498  LYS A O     1 
ATOM   1979 C CB    . LYS C 3 202 ? 36.599  54.953 18.939  1.00 28.56 ? 498  LYS A CB    1 
ATOM   1980 C CG    . LYS C 3 202 ? 37.763  55.059 17.956  1.00 32.16 ? 498  LYS A CG    1 
ATOM   1981 C CD    . LYS C 3 202 ? 37.687  53.960 16.871  1.00 35.49 ? 498  LYS A CD    1 
ATOM   1982 C CE    . LYS C 3 202 ? 37.275  54.511 15.500  1.00 36.94 ? 498  LYS A CE    1 
ATOM   1983 N NZ    . LYS C 3 202 ? 38.454  55.118 14.805  1.00 37.30 ? 498  LYS A NZ    1 
ATOM   1984 N N     . ARG C 3 203 ? 35.085  54.204 21.565  1.00 27.87 ? 499  ARG A N     1 
ATOM   1985 C CA    . ARG C 3 203 ? 34.824  54.447 22.980  1.00 28.18 ? 499  ARG A CA    1 
ATOM   1986 C C     . ARG C 3 203 ? 35.021  53.156 23.748  1.00 28.38 ? 499  ARG A C     1 
ATOM   1987 O O     . ARG C 3 203 ? 35.669  53.119 24.790  1.00 27.95 ? 499  ARG A O     1 
ATOM   1988 C CB    . ARG C 3 203 ? 33.400  54.951 23.174  1.00 29.48 ? 499  ARG A CB    1 
ATOM   1989 C CG    . ARG C 3 203 ? 32.968  55.088 24.629  1.00 31.76 ? 499  ARG A CG    1 
ATOM   1990 C CD    . ARG C 3 203 ? 33.318  56.457 25.174  1.00 34.12 ? 499  ARG A CD    1 
ATOM   1991 N NE    . ARG C 3 203 ? 33.418  56.460 26.636  1.00 37.42 ? 499  ARG A NE    1 
ATOM   1992 C CZ    . ARG C 3 203 ? 34.567  56.459 27.318  1.00 38.30 ? 499  ARG A CZ    1 
ATOM   1993 N NH1   . ARG C 3 203 ? 35.734  56.457 26.677  1.00 37.89 ? 499  ARG A NH1   1 
ATOM   1994 N NH2   . ARG C 3 203 ? 34.548  56.432 28.650  1.00 39.57 ? 499  ARG A NH2   1 
ATOM   1995 N N     . LEU C 3 204 ? 34.446  52.092 23.207  1.00 28.70 ? 500  LEU A N     1 
ATOM   1996 C CA    . LEU C 3 204 ? 34.542  50.775 23.804  1.00 29.21 ? 500  LEU A CA    1 
ATOM   1997 C C     . LEU C 3 204 ? 35.998  50.391 23.930  1.00 29.46 ? 500  LEU A C     1 
ATOM   1998 O O     . LEU C 3 204 ? 36.409  49.854 24.944  1.00 29.22 ? 500  LEU A O     1 
ATOM   1999 C CB    . LEU C 3 204 ? 33.802  49.751 22.948  1.00 28.72 ? 500  LEU A CB    1 
ATOM   2000 C CG    . LEU C 3 204 ? 32.965  48.707 23.675  1.00 29.51 ? 500  LEU A CG    1 
ATOM   2001 C CD1   . LEU C 3 204 ? 32.188  49.317 24.823  1.00 29.34 ? 500  LEU A CD1   1 
ATOM   2002 C CD2   . LEU C 3 204 ? 32.016  48.093 22.678  1.00 30.86 ? 500  LEU A CD2   1 
ATOM   2003 N N     . GLU C 3 205 ? 36.789  50.664 22.905  1.00 30.72 ? 501  GLU A N     1 
ATOM   2004 C CA    . GLU C 3 205 ? 38.205  50.326 22.979  1.00 32.94 ? 501  GLU A CA    1 
ATOM   2005 C C     . GLU C 3 205 ? 38.957  51.201 24.009  1.00 33.42 ? 501  GLU A C     1 
ATOM   2006 O O     . GLU C 3 205 ? 39.950  50.766 24.596  1.00 32.83 ? 501  GLU A O     1 
ATOM   2007 C CB    . GLU C 3 205 ? 38.848  50.432 21.590  1.00 34.22 ? 501  GLU A CB    1 
ATOM   2008 C CG    . GLU C 3 205 ? 38.578  49.208 20.692  1.00 37.11 ? 501  GLU A CG    1 
ATOM   2009 C CD    . GLU C 3 205 ? 38.492  49.550 19.206  1.00 38.73 ? 501  GLU A CD    1 
ATOM   2010 O OE1   . GLU C 3 205 ? 38.829  50.695 18.816  1.00 39.92 ? 501  GLU A OE1   1 
ATOM   2011 O OE2   . GLU C 3 205 ? 38.086  48.665 18.423  1.00 39.42 ? 501  GLU A OE2   1 
ATOM   2012 N N     . GLN C 3 206 ? 38.485  52.424 24.240  1.00 34.37 ? 502  GLN A N     1 
ATOM   2013 C CA    . GLN C 3 206 ? 39.134  53.285 25.224  1.00 35.98 ? 502  GLN A CA    1 
ATOM   2014 C C     . GLN C 3 206 ? 38.836  52.703 26.614  1.00 35.34 ? 502  GLN A C     1 
ATOM   2015 O O     . GLN C 3 206 ? 39.737  52.579 27.443  1.00 34.61 ? 502  GLN A O     1 
ATOM   2016 C CB    . GLN C 3 206 ? 38.605  54.729 25.142  1.00 37.58 ? 502  GLN A CB    1 
ATOM   2017 C CG    . GLN C 3 206 ? 38.790  55.418 23.780  1.00 42.46 ? 502  GLN A CG    1 
ATOM   2018 C CD    . GLN C 3 206 ? 37.818  56.601 23.565  1.00 45.40 ? 502  GLN A CD    1 
ATOM   2019 O OE1   . GLN C 3 206 ? 37.260  57.140 24.533  1.00 47.54 ? 502  GLN A OE1   1 
ATOM   2020 N NE2   . GLN C 3 206 ? 37.615  57.003 22.297  1.00 45.67 ? 502  GLN A NE2   1 
ATOM   2021 N N     . MET C 3 207 ? 37.570  52.340 26.848  1.00 34.63 ? 503  MET A N     1 
ATOM   2022 C CA    . MET C 3 207 ? 37.143  51.775 28.127  1.00 34.25 ? 503  MET A CA    1 
ATOM   2023 C C     . MET C 3 207 ? 37.918  50.501 28.459  1.00 34.23 ? 503  MET A C     1 
ATOM   2024 O O     . MET C 3 207 ? 38.453  50.358 29.549  1.00 33.59 ? 503  MET A O     1 
ATOM   2025 C CB    . MET C 3 207 ? 35.636  51.491 28.105  1.00 34.38 ? 503  MET A CB    1 
ATOM   2026 C CG    . MET C 3 207 ? 34.801  52.646 27.577  1.00 35.16 ? 503  MET A CG    1 
ATOM   2027 S SD    . MET C 3 207 ? 33.079  52.749 28.166  1.00 37.51 ? 503  MET A SD    1 
ATOM   2028 C CE    . MET C 3 207 ? 32.258  51.604 27.118  1.00 35.00 ? 503  MET A CE    1 
ATOM   2029 N N     . GLY C 3 208 ? 37.990  49.573 27.516  1.00 34.86 ? 504  GLY A N     1 
ATOM   2030 C CA    . GLY C 3 208 ? 38.725  48.350 27.773  1.00 35.82 ? 504  GLY A CA    1 
ATOM   2031 C C     . GLY C 3 208 ? 40.163  48.637 28.172  1.00 36.65 ? 504  GLY A C     1 
ATOM   2032 O O     . GLY C 3 208 ? 40.787  47.866 28.905  1.00 35.81 ? 504  GLY A O     1 
ATOM   2033 N N     . LYS C 3 209 ? 40.681  49.763 27.683  1.00 37.81 ? 505  LYS A N     1 
ATOM   2034 C CA    . LYS C 3 209 ? 42.051  50.196 27.944  1.00 38.63 ? 505  LYS A CA    1 
ATOM   2035 C C     . LYS C 3 209 ? 42.255  50.606 29.408  1.00 38.95 ? 505  LYS A C     1 
ATOM   2036 O O     . LYS C 3 209 ? 43.218  50.187 30.058  1.00 38.67 ? 505  LYS A O     1 
ATOM   2037 C CB    . LYS C 3 209 ? 42.393  51.368 27.022  1.00 38.97 ? 505  LYS A CB    1 
ATOM   2038 C CG    . LYS C 3 209 ? 43.711  51.219 26.302  1.00 40.85 ? 505  LYS A CG    1 
ATOM   2039 C CD    . LYS C 3 209 ? 44.735  52.255 26.781  1.00 43.33 ? 505  LYS A CD    1 
ATOM   2040 C CE    . LYS C 3 209 ? 46.191  51.839 26.447  1.00 44.92 ? 505  LYS A CE    1 
ATOM   2041 N NZ    . LYS C 3 209 ? 46.973  52.851 25.641  1.00 45.74 ? 505  LYS A NZ    1 
ATOM   2042 N N     . GLU C 3 210 ? 41.354  51.443 29.908  1.00 39.02 ? 506  GLU A N     1 
ATOM   2043 C CA    . GLU C 3 210 ? 41.419  51.884 31.285  1.00 39.68 ? 506  GLU A CA    1 
ATOM   2044 C C     . GLU C 3 210 ? 41.096  50.664 32.171  1.00 39.56 ? 506  GLU A C     1 
ATOM   2045 O O     . GLU C 3 210 ? 41.825  50.352 33.118  1.00 39.90 ? 506  GLU A O     1 
ATOM   2046 C CB    . GLU C 3 210 ? 40.415  53.019 31.503  1.00 40.83 ? 506  GLU A CB    1 
ATOM   2047 C CG    . GLU C 3 210 ? 40.901  54.381 30.968  1.00 44.27 ? 506  GLU A CG    1 
ATOM   2048 C CD    . GLU C 3 210 ? 39.786  55.262 30.373  1.00 46.43 ? 506  GLU A CD    1 
ATOM   2049 O OE1   . GLU C 3 210 ? 38.581  54.907 30.498  1.00 47.46 ? 506  GLU A OE1   1 
ATOM   2050 O OE2   . GLU C 3 210 ? 40.119  56.321 29.775  1.00 47.31 ? 506  GLU A OE2   1 
ATOM   2051 N N     . LEU C 3 211 ? 40.019  49.958 31.843  1.00 38.38 ? 507  LEU A N     1 
ATOM   2052 C CA    . LEU C 3 211 ? 39.625  48.779 32.598  1.00 37.82 ? 507  LEU A CA    1 
ATOM   2053 C C     . LEU C 3 211 ? 40.789  47.801 32.737  1.00 38.15 ? 507  LEU A C     1 
ATOM   2054 O O     . LEU C 3 211 ? 40.920  47.132 33.760  1.00 38.95 ? 507  LEU A O     1 
ATOM   2055 C CB    . LEU C 3 211 ? 38.450  48.085 31.907  1.00 36.87 ? 507  LEU A CB    1 
ATOM   2056 C CG    . LEU C 3 211 ? 37.492  47.213 32.720  1.00 36.53 ? 507  LEU A CG    1 
ATOM   2057 C CD1   . LEU C 3 211 ? 36.889  47.994 33.874  1.00 34.98 ? 507  LEU A CD1   1 
ATOM   2058 C CD2   . LEU C 3 211 ? 36.398  46.714 31.783  1.00 36.30 ? 507  LEU A CD2   1 
ATOM   2059 N N     . ALA C 3 212 ? 41.631  47.712 31.710  1.00 37.72 ? 508  ALA A N     1 
ATOM   2060 C CA    . ALA C 3 212 ? 42.776  46.804 31.744  1.00 37.96 ? 508  ALA A CA    1 
ATOM   2061 C C     . ALA C 3 212 ? 43.794  47.323 32.735  1.00 37.95 ? 508  ALA A C     1 
ATOM   2062 O O     . ALA C 3 212 ? 44.532  46.563 33.346  1.00 37.36 ? 508  ALA A O     1 
ATOM   2063 C CB    . ALA C 3 212 ? 43.417  46.693 30.364  1.00 37.88 ? 508  ALA A CB    1 
ATOM   2064 N N     . GLU C 3 213 ? 43.831  48.635 32.875  1.00 38.21 ? 509  GLU A N     1 
ATOM   2065 C CA    . GLU C 3 213 ? 44.741  49.255 33.802  1.00 39.72 ? 509  GLU A CA    1 
ATOM   2066 C C     . GLU C 3 213 ? 44.280  48.928 35.221  1.00 39.77 ? 509  GLU A C     1 
ATOM   2067 O O     . GLU C 3 213 ? 45.044  48.391 36.017  1.00 39.34 ? 509  GLU A O     1 
ATOM   2068 C CB    . GLU C 3 213 ? 44.745  50.758 33.578  1.00 40.94 ? 509  GLU A CB    1 
ATOM   2069 C CG    . GLU C 3 213 ? 45.663  51.490 34.502  1.00 44.20 ? 509  GLU A CG    1 
ATOM   2070 C CD    . GLU C 3 213 ? 46.782  52.176 33.759  1.00 46.26 ? 509  GLU A CD    1 
ATOM   2071 O OE1   . GLU C 3 213 ? 46.578  53.339 33.340  1.00 47.11 ? 509  GLU A OE1   1 
ATOM   2072 O OE2   . GLU C 3 213 ? 47.860  51.550 33.595  1.00 47.93 ? 509  GLU A OE2   1 
ATOM   2073 N N     . GLN C 3 214 ? 43.026  49.252 35.517  1.00 40.31 ? 510  GLN A N     1 
ATOM   2074 C CA    . GLN C 3 214 ? 42.422  48.994 36.823  1.00 41.74 ? 510  GLN A CA    1 
ATOM   2075 C C     . GLN C 3 214 ? 42.550  47.535 37.245  1.00 41.53 ? 510  GLN A C     1 
ATOM   2076 O O     . GLN C 3 214 ? 42.975  47.224 38.359  1.00 41.69 ? 510  GLN A O     1 
ATOM   2077 C CB    . GLN C 3 214 ? 40.941  49.321 36.785  1.00 43.47 ? 510  GLN A CB    1 
ATOM   2078 C CG    . GLN C 3 214 ? 40.601  50.724 36.360  1.00 47.37 ? 510  GLN A CG    1 
ATOM   2079 C CD    . GLN C 3 214 ? 39.108  50.998 36.478  1.00 49.96 ? 510  GLN A CD    1 
ATOM   2080 O OE1   . GLN C 3 214 ? 38.516  50.886 37.571  1.00 51.02 ? 510  GLN A OE1   1 
ATOM   2081 N NE2   . GLN C 3 214 ? 38.483  51.349 35.351  1.00 51.06 ? 510  GLN A NE2   1 
ATOM   2082 N N     . LEU C 3 215 ? 42.130  46.656 36.345  1.00 41.14 ? 511  LEU A N     1 
ATOM   2083 C CA    . LEU C 3 215 ? 42.169  45.223 36.554  1.00 40.85 ? 511  LEU A CA    1 
ATOM   2084 C C     . LEU C 3 215 ? 43.548  44.825 37.056  1.00 41.20 ? 511  LEU A C     1 
ATOM   2085 O O     . LEU C 3 215 ? 43.677  44.191 38.106  1.00 40.67 ? 511  LEU A O     1 
ATOM   2086 C CB    . LEU C 3 215 ? 41.881  44.509 35.229  1.00 40.31 ? 511  LEU A CB    1 
ATOM   2087 C CG    . LEU C 3 215 ? 40.935  43.311 35.043  1.00 40.28 ? 511  LEU A CG    1 
ATOM   2088 C CD1   . LEU C 3 215 ? 40.107  43.017 36.273  1.00 39.14 ? 511  LEU A CD1   1 
ATOM   2089 C CD2   . LEU C 3 215 ? 40.032  43.633 33.860  1.00 40.16 ? 511  LEU A CD2   1 
ATOM   2090 N N     . GLY C 3 216 ? 44.575  45.209 36.299  1.00 41.54 ? 512  GLY A N     1 
ATOM   2091 C CA    . GLY C 3 216 ? 45.950  44.868 36.647  1.00 41.91 ? 512  GLY A CA    1 
ATOM   2092 C C     . GLY C 3 216 ? 46.409  45.366 38.002  1.00 41.73 ? 512  GLY A C     1 
ATOM   2093 O O     . GLY C 3 216 ? 47.236  44.742 38.671  1.00 41.11 ? 512  GLY A O     1 
ATOM   2094 N N     . THR C 3 217 ? 45.858  46.505 38.394  1.00 42.03 ? 513  THR A N     1 
ATOM   2095 C CA    . THR C 3 217 ? 46.174  47.132 39.660  1.00 42.68 ? 513  THR A CA    1 
ATOM   2096 C C     . THR C 3 217 ? 45.496  46.383 40.818  1.00 42.37 ? 513  THR A C     1 
ATOM   2097 O O     . THR C 3 217 ? 46.123  46.108 41.846  1.00 42.33 ? 513  THR A O     1 
ATOM   2098 C CB    . THR C 3 217 ? 45.739  48.626 39.632  1.00 43.17 ? 513  THR A CB    1 
ATOM   2099 O OG1   . THR C 3 217 ? 46.636  49.365 38.786  1.00 43.42 ? 513  THR A OG1   1 
ATOM   2100 C CG2   . THR C 3 217 ? 45.757  49.225 41.027  1.00 42.83 ? 513  THR A CG2   1 
ATOM   2101 N N     . VAL C 3 218 ? 44.222  46.047 40.651  1.00 42.08 ? 514  VAL A N     1 
ATOM   2102 C CA    . VAL C 3 218 ? 43.510  45.320 41.690  1.00 42.21 ? 514  VAL A CA    1 
ATOM   2103 C C     . VAL C 3 218 ? 44.046  43.895 41.790  1.00 42.93 ? 514  VAL A C     1 
ATOM   2104 O O     . VAL C 3 218 ? 44.138  43.334 42.873  1.00 42.71 ? 514  VAL A O     1 
ATOM   2105 C CB    . VAL C 3 218 ? 42.013  45.258 41.393  1.00 41.97 ? 514  VAL A CB    1 
ATOM   2106 C CG1   . VAL C 3 218 ? 41.345  44.264 42.326  1.00 41.32 ? 514  VAL A CG1   1 
ATOM   2107 C CG2   . VAL C 3 218 ? 41.395  46.648 41.551  1.00 42.30 ? 514  VAL A CG2   1 
ATOM   2108 N N     . GLU C 3 219 ? 44.409  43.315 40.653  1.00 44.09 ? 515  GLU A N     1 
ATOM   2109 C CA    . GLU C 3 219 ? 44.927  41.954 40.628  1.00 45.23 ? 515  GLU A CA    1 
ATOM   2110 C C     . GLU C 3 219 ? 46.264  41.842 41.357  1.00 45.60 ? 515  GLU A C     1 
ATOM   2111 O O     . GLU C 3 219 ? 46.509  40.870 42.078  1.00 45.51 ? 515  GLU A O     1 
ATOM   2112 C CB    . GLU C 3 219 ? 45.070  41.477 39.181  1.00 46.02 ? 515  GLU A CB    1 
ATOM   2113 C CG    . GLU C 3 219 ? 46.404  40.851 38.846  1.00 47.44 ? 515  GLU A CG    1 
ATOM   2114 C CD    . GLU C 3 219 ? 46.477  40.391 37.393  1.00 48.77 ? 515  GLU A CD    1 
ATOM   2115 O OE1   . GLU C 3 219 ? 46.312  41.245 36.484  1.00 48.39 ? 515  GLU A OE1   1 
ATOM   2116 O OE2   . GLU C 3 219 ? 46.700  39.174 37.166  1.00 49.17 ? 515  GLU A OE2   1 
ATOM   2117 N N     . GLN C 3 220 ? 47.131  42.831 41.172  1.00 45.71 ? 516  GLN A N     1 
ATOM   2118 C CA    . GLN C 3 220 ? 48.425  42.810 41.843  1.00 45.99 ? 516  GLN A CA    1 
ATOM   2119 C C     . GLN C 3 220 ? 48.182  42.963 43.346  1.00 45.65 ? 516  GLN A C     1 
ATOM   2120 O O     . GLN C 3 220 ? 48.736  42.223 44.146  1.00 46.10 ? 516  GLN A O     1 
ATOM   2121 C CB    . GLN C 3 220 ? 49.324  43.938 41.319  1.00 45.76 ? 516  GLN A CB    1 
ATOM   2122 C CG    . GLN C 3 220 ? 50.573  43.469 40.535  1.00 46.39 ? 516  GLN A CG    1 
ATOM   2123 C CD    . GLN C 3 220 ? 50.527  42.002 40.093  1.00 46.61 ? 516  GLN A CD    1 
ATOM   2124 O OE1   . GLN C 3 220 ? 49.503  41.505 39.625  1.00 47.01 ? 516  GLN A OE1   1 
ATOM   2125 N NE2   . GLN C 3 220 ? 51.652  41.310 40.236  1.00 47.13 ? 516  GLN A NE2   1 
ATOM   2126 N N     . ARG C 3 221 ? 47.333  43.911 43.718  1.00 45.81 ? 517  ARG A N     1 
ATOM   2127 C CA    . ARG C 3 221 ? 47.003  44.147 45.119  1.00 45.89 ? 517  ARG A CA    1 
ATOM   2128 C C     . ARG C 3 221 ? 46.569  42.831 45.759  1.00 45.21 ? 517  ARG A C     1 
ATOM   2129 O O     . ARG C 3 221 ? 47.006  42.485 46.853  1.00 44.90 ? 517  ARG A O     1 
ATOM   2130 C CB    . ARG C 3 221 ? 45.858  45.169 45.216  1.00 47.68 ? 517  ARG A CB    1 
ATOM   2131 C CG    . ARG C 3 221 ? 45.388  45.497 46.636  1.00 50.31 ? 517  ARG A CG    1 
ATOM   2132 C CD    . ARG C 3 221 ? 46.512  46.148 47.433  1.00 52.70 ? 517  ARG A CD    1 
ATOM   2133 N NE    . ARG C 3 221 ? 46.164  46.376 48.834  1.00 55.00 ? 517  ARG A NE    1 
ATOM   2134 C CZ    . ARG C 3 221 ? 47.051  46.448 49.832  1.00 55.99 ? 517  ARG A CZ    1 
ATOM   2135 N NH1   . ARG C 3 221 ? 48.354  46.309 49.594  1.00 55.81 ? 517  ARG A NH1   1 
ATOM   2136 N NH2   . ARG C 3 221 ? 46.633  46.675 51.077  1.00 56.29 ? 517  ARG A NH2   1 
ATOM   2137 N N     . ILE C 3 222 ? 45.707  42.104 45.054  1.00 44.48 ? 518  ILE A N     1 
ATOM   2138 C CA    . ILE C 3 222 ? 45.184  40.834 45.538  1.00 43.78 ? 518  ILE A CA    1 
ATOM   2139 C C     . ILE C 3 222 ? 46.287  39.798 45.772  1.00 43.51 ? 518  ILE A C     1 
ATOM   2140 O O     . ILE C 3 222 ? 46.175  38.962 46.669  1.00 43.13 ? 518  ILE A O     1 
ATOM   2141 C CB    . ILE C 3 222 ? 44.132  40.245 44.555  1.00 43.05 ? 518  ILE A CB    1 
ATOM   2142 C CG1   . ILE C 3 222 ? 42.754  40.873 44.817  1.00 42.50 ? 518  ILE A CG1   1 
ATOM   2143 C CG2   . ILE C 3 222 ? 44.055  38.739 44.732  1.00 42.91 ? 518  ILE A CG2   1 
ATOM   2144 C CD1   . ILE C 3 222 ? 41.748  40.709 43.679  1.00 40.48 ? 518  ILE A CD1   1 
ATOM   2145 N N     . TYR C 3 223 ? 47.344  39.850 44.968  1.00 43.57 ? 519  TYR A N     1 
ATOM   2146 C CA    . TYR C 3 223 ? 48.447  38.909 45.131  1.00 44.52 ? 519  TYR A CA    1 
ATOM   2147 C C     . TYR C 3 223 ? 49.221  39.299 46.376  1.00 45.32 ? 519  TYR A C     1 
ATOM   2148 O O     . TYR C 3 223 ? 49.804  38.457 47.045  1.00 45.25 ? 519  TYR A O     1 
ATOM   2149 C CB    . TYR C 3 223 ? 49.381  38.926 43.912  1.00 44.21 ? 519  TYR A CB    1 
ATOM   2150 C CG    . TYR C 3 223 ? 48.736  38.393 42.659  1.00 43.73 ? 519  TYR A CG    1 
ATOM   2151 C CD1   . TYR C 3 223 ? 47.752  37.411 42.728  1.00 43.29 ? 519  TYR A CD1   1 
ATOM   2152 C CD2   . TYR C 3 223 ? 49.062  38.913 41.411  1.00 44.09 ? 519  TYR A CD2   1 
ATOM   2153 C CE1   . TYR C 3 223 ? 47.098  36.961 41.585  1.00 43.47 ? 519  TYR A CE1   1 
ATOM   2154 C CE2   . TYR C 3 223 ? 48.416  38.472 40.257  1.00 43.94 ? 519  TYR A CE2   1 
ATOM   2155 C CZ    . TYR C 3 223 ? 47.430  37.496 40.351  1.00 43.86 ? 519  TYR A CZ    1 
ATOM   2156 O OH    . TYR C 3 223 ? 46.764  37.078 39.214  1.00 43.70 ? 519  TYR A OH    1 
ATOM   2157 N N     . GLU C 3 224 ? 49.218  40.590 46.685  1.00 46.39 ? 520  GLU A N     1 
ATOM   2158 C CA    . GLU C 3 224 ? 49.907  41.083 47.867  1.00 47.06 ? 520  GLU A CA    1 
ATOM   2159 C C     . GLU C 3 224 ? 49.185  40.546 49.097  1.00 46.22 ? 520  GLU A C     1 
ATOM   2160 O O     . GLU C 3 224 ? 49.762  39.803 49.889  1.00 45.89 ? 520  GLU A O     1 
ATOM   2161 C CB    . GLU C 3 224 ? 49.896  42.609 47.886  1.00 48.95 ? 520  GLU A CB    1 
ATOM   2162 C CG    . GLU C 3 224 ? 51.265  43.237 47.760  1.00 52.50 ? 520  GLU A CG    1 
ATOM   2163 C CD    . GLU C 3 224 ? 51.179  44.737 47.526  1.00 55.37 ? 520  GLU A CD    1 
ATOM   2164 O OE1   . GLU C 3 224 ? 50.169  45.181 46.932  1.00 56.68 ? 520  GLU A OE1   1 
ATOM   2165 O OE2   . GLU C 3 224 ? 52.112  45.473 47.935  1.00 56.89 ? 520  GLU A OE2   1 
ATOM   2166 N N     . LEU C 3 225 ? 47.913  40.914 49.231  1.00 45.53 ? 521  LEU A N     1 
ATOM   2167 C CA    . LEU C 3 225 ? 47.086  40.488 50.355  1.00 45.06 ? 521  LEU A CA    1 
ATOM   2168 C C     . LEU C 3 225 ? 47.032  38.969 50.541  1.00 44.80 ? 521  LEU A C     1 
ATOM   2169 O O     . LEU C 3 225 ? 46.781  38.480 51.641  1.00 45.18 ? 521  LEU A O     1 
ATOM   2170 C CB    . LEU C 3 225 ? 45.657  41.023 50.190  1.00 45.54 ? 521  LEU A CB    1 
ATOM   2171 C CG    . LEU C 3 225 ? 45.469  42.543 50.107  1.00 46.00 ? 521  LEU A CG    1 
ATOM   2172 C CD1   . LEU C 3 225 ? 44.131  42.943 50.717  1.00 46.14 ? 521  LEU A CD1   1 
ATOM   2173 C CD2   . LEU C 3 225 ? 46.605  43.225 50.836  1.00 46.09 ? 521  LEU A CD2   1 
ATOM   2174 N N     . ALA C 3 226 ? 47.251  38.220 49.469  1.00 44.17 ? 522  ALA A N     1 
ATOM   2175 C CA    . ALA C 3 226 ? 47.209  36.771 49.560  1.00 43.12 ? 522  ALA A CA    1 
ATOM   2176 C C     . ALA C 3 226 ? 48.590  36.253 49.925  1.00 43.04 ? 522  ALA A C     1 
ATOM   2177 O O     . ALA C 3 226 ? 48.731  35.228 50.586  1.00 42.97 ? 522  ALA A O     1 
ATOM   2178 C CB    . ALA C 3 226 ? 46.757  36.173 48.231  1.00 42.66 ? 522  ALA A CB    1 
ATOM   2179 N N     . GLY C 3 227 ? 49.616  36.973 49.501  1.00 42.69 ? 523  GLY A N     1 
ATOM   2180 C CA    . GLY C 3 227 ? 50.965  36.527 49.782  1.00 42.87 ? 523  GLY A CA    1 
ATOM   2181 C C     . GLY C 3 227 ? 51.496  35.651 48.658  1.00 43.25 ? 523  GLY A C     1 
ATOM   2182 O O     . GLY C 3 227 ? 52.607  35.124 48.742  1.00 43.85 ? 523  GLY A O     1 
ATOM   2183 N N     . GLN C 3 228 ? 50.705  35.496 47.597  1.00 43.19 ? 524  GLN A N     1 
ATOM   2184 C CA    . GLN C 3 228 ? 51.099  34.682 46.443  1.00 42.76 ? 524  GLN A CA    1 
ATOM   2185 C C     . GLN C 3 228 ? 50.146  34.916 45.278  1.00 42.26 ? 524  GLN A C     1 
ATOM   2186 O O     . GLN C 3 228 ? 49.011  35.380 45.461  1.00 42.22 ? 524  GLN A O     1 
ATOM   2187 C CB    . GLN C 3 228 ? 51.025  33.210 46.796  1.00 42.83 ? 524  GLN A CB    1 
ATOM   2188 C CG    . GLN C 3 228 ? 49.594  32.800 47.057  1.00 43.44 ? 524  GLN A CG    1 
ATOM   2189 C CD    . GLN C 3 228 ? 49.426  31.311 47.121  1.00 44.83 ? 524  GLN A CD    1 
ATOM   2190 O OE1   . GLN C 3 228 ? 49.101  30.753 48.170  1.00 45.91 ? 524  GLN A OE1   1 
ATOM   2191 N NE2   . GLN C 3 228 ? 49.645  30.647 45.996  1.00 44.87 ? 524  GLN A NE2   1 
ATOM   2192 N N     . GLU C 3 229 ? 50.600  34.565 44.082  1.00 41.20 ? 525  GLU A N     1 
ATOM   2193 C CA    . GLU C 3 229 ? 49.763  34.712 42.911  1.00 40.65 ? 525  GLU A CA    1 
ATOM   2194 C C     . GLU C 3 229 ? 48.940  33.438 42.734  1.00 39.16 ? 525  GLU A C     1 
ATOM   2195 O O     . GLU C 3 229 ? 49.414  32.340 43.019  1.00 39.54 ? 525  GLU A O     1 
ATOM   2196 C CB    . GLU C 3 229 ? 50.629  34.971 41.674  1.00 41.99 ? 525  GLU A CB    1 
ATOM   2197 C CG    . GLU C 3 229 ? 51.275  36.356 41.677  1.00 44.46 ? 525  GLU A CG    1 
ATOM   2198 C CD    . GLU C 3 229 ? 51.959  36.710 40.360  1.00 45.67 ? 525  GLU A CD    1 
ATOM   2199 O OE1   . GLU C 3 229 ? 51.952  35.862 39.434  1.00 46.63 ? 525  GLU A OE1   1 
ATOM   2200 O OE2   . GLU C 3 229 ? 52.502  37.842 40.257  1.00 46.43 ? 525  GLU A OE2   1 
ATOM   2201 N N     . PHE C 3 230 ? 47.700  33.591 42.287  1.00 37.26 ? 526  PHE A N     1 
ATOM   2202 C CA    . PHE C 3 230 ? 46.815  32.454 42.043  1.00 35.54 ? 526  PHE A CA    1 
ATOM   2203 C C     . PHE C 3 230 ? 45.765  32.878 40.995  1.00 35.26 ? 526  PHE A C     1 
ATOM   2204 O O     . PHE C 3 230 ? 45.703  34.063 40.633  1.00 35.72 ? 526  PHE A O     1 
ATOM   2205 C CB    . PHE C 3 230 ? 46.130  32.028 43.342  1.00 34.05 ? 526  PHE A CB    1 
ATOM   2206 C CG    . PHE C 3 230 ? 45.339  33.120 43.990  1.00 33.12 ? 526  PHE A CG    1 
ATOM   2207 C CD1   . PHE C 3 230 ? 45.983  34.218 44.552  1.00 32.74 ? 526  PHE A CD1   1 
ATOM   2208 C CD2   . PHE C 3 230 ? 43.949  33.067 44.012  1.00 32.56 ? 526  PHE A CD2   1 
ATOM   2209 C CE1   . PHE C 3 230 ? 45.253  35.249 45.122  1.00 32.76 ? 526  PHE A CE1   1 
ATOM   2210 C CE2   . PHE C 3 230 ? 43.208  34.093 44.581  1.00 32.92 ? 526  PHE A CE2   1 
ATOM   2211 C CZ    . PHE C 3 230 ? 43.861  35.190 45.137  1.00 32.34 ? 526  PHE A CZ    1 
ATOM   2212 N N     . ASN C 3 231 ? 44.953  31.936 40.504  1.00 33.72 ? 527  ASN A N     1 
ATOM   2213 C CA    . ASN C 3 231 ? 43.930  32.275 39.512  1.00 32.60 ? 527  ASN A CA    1 
ATOM   2214 C C     . ASN C 3 231 ? 42.641  32.755 40.168  1.00 31.30 ? 527  ASN A C     1 
ATOM   2215 O O     . ASN C 3 231 ? 41.799  31.960 40.570  1.00 30.64 ? 527  ASN A O     1 
ATOM   2216 C CB    . ASN C 3 231 ? 43.632  31.080 38.610  1.00 32.33 ? 527  ASN A CB    1 
ATOM   2217 C CG    . ASN C 3 231 ? 42.738  31.448 37.445  1.00 32.97 ? 527  ASN A CG    1 
ATOM   2218 O OD1   . ASN C 3 231 ? 42.323  32.593 37.300  1.00 33.03 ? 527  ASN A OD1   1 
ATOM   2219 N ND2   . ASN C 3 231 ? 42.438  30.477 36.608  1.00 34.24 ? 527  ASN A ND2   1 
ATOM   2220 N N     . ILE C 3 232 ? 42.501  34.070 40.269  1.00 31.11 ? 528  ILE A N     1 
ATOM   2221 C CA    . ILE C 3 232 ? 41.337  34.664 40.890  1.00 30.82 ? 528  ILE A CA    1 
ATOM   2222 C C     . ILE C 3 232 ? 40.055  34.275 40.181  1.00 32.04 ? 528  ILE A C     1 
ATOM   2223 O O     . ILE C 3 232 ? 38.976  34.370 40.762  1.00 32.18 ? 528  ILE A O     1 
ATOM   2224 C CB    . ILE C 3 232 ? 41.460  36.195 40.923  1.00 30.30 ? 528  ILE A CB    1 
ATOM   2225 C CG1   . ILE C 3 232 ? 42.856  36.589 41.392  1.00 29.29 ? 528  ILE A CG1   1 
ATOM   2226 C CG2   . ILE C 3 232 ? 40.399  36.789 41.834  1.00 30.05 ? 528  ILE A CG2   1 
ATOM   2227 C CD1   . ILE C 3 232 ? 43.266  37.972 40.959  1.00 30.47 ? 528  ILE A CD1   1 
ATOM   2228 N N     . ASN C 3 233 ? 40.167  33.820 38.934  1.00 32.59 ? 529  ASN A N     1 
ATOM   2229 C CA    . ASN C 3 233 ? 38.992  33.421 38.166  1.00 33.74 ? 529  ASN A CA    1 
ATOM   2230 C C     . ASN C 3 233 ? 38.623  31.988 38.431  1.00 34.13 ? 529  ASN A C     1 
ATOM   2231 O O     . ASN C 3 233 ? 37.620  31.487 37.916  1.00 34.91 ? 529  ASN A O     1 
ATOM   2232 C CB    . ASN C 3 233 ? 39.237  33.587 36.672  1.00 34.30 ? 529  ASN A CB    1 
ATOM   2233 C CG    . ASN C 3 233 ? 39.330  35.010 36.281  1.00 35.02 ? 529  ASN A CG    1 
ATOM   2234 O OD1   . ASN C 3 233 ? 38.738  35.866 36.928  1.00 36.82 ? 529  ASN A OD1   1 
ATOM   2235 N ND2   . ASN C 3 233 ? 40.084  35.293 35.230  1.00 36.58 ? 529  ASN A ND2   1 
ATOM   2236 N N     . SER C 3 234 ? 39.455  31.318 39.205  1.00 34.00 ? 530  SER A N     1 
ATOM   2237 C CA    . SER C 3 234 ? 39.193  29.941 39.548  1.00 35.33 ? 530  SER A CA    1 
ATOM   2238 C C     . SER C 3 234 ? 38.595  29.896 40.950  1.00 36.47 ? 530  SER A C     1 
ATOM   2239 O O     . SER C 3 234 ? 39.326  29.997 41.934  1.00 36.66 ? 530  SER A O     1 
ATOM   2240 C CB    . SER C 3 234 ? 40.494  29.146 39.521  1.00 34.24 ? 530  SER A CB    1 
ATOM   2241 O OG    . SER C 3 234 ? 40.330  27.896 40.160  1.00 34.37 ? 530  SER A OG    1 
ATOM   2242 N N     . PRO C 3 235 ? 37.257  29.785 41.064  1.00 37.74 ? 531  PRO A N     1 
ATOM   2243 C CA    . PRO C 3 235 ? 36.665  29.731 42.408  1.00 39.00 ? 531  PRO A CA    1 
ATOM   2244 C C     . PRO C 3 235 ? 37.340  28.616 43.234  1.00 39.93 ? 531  PRO A C     1 
ATOM   2245 O O     . PRO C 3 235 ? 37.285  28.594 44.470  1.00 40.17 ? 531  PRO A O     1 
ATOM   2246 C CB    . PRO C 3 235 ? 35.179  29.446 42.146  1.00 39.05 ? 531  PRO A CB    1 
ATOM   2247 C CG    . PRO C 3 235 ? 34.931  29.943 40.761  1.00 38.67 ? 531  PRO A CG    1 
ATOM   2248 C CD    . PRO C 3 235 ? 36.234  29.728 40.006  1.00 38.53 ? 531  PRO A CD    1 
ATOM   2249 N N     . LYS C 3 236 ? 37.990  27.699 42.529  1.00 39.80 ? 532  LYS A N     1 
ATOM   2250 C CA    . LYS C 3 236 ? 38.678  26.604 43.169  1.00 39.50 ? 532  LYS A CA    1 
ATOM   2251 C C     . LYS C 3 236 ? 39.913  27.128 43.877  1.00 38.80 ? 532  LYS A C     1 
ATOM   2252 O O     . LYS C 3 236 ? 40.054  26.994 45.091  1.00 39.11 ? 532  LYS A O     1 
ATOM   2253 C CB    . LYS C 3 236 ? 39.075  25.569 42.121  1.00 40.82 ? 532  LYS A CB    1 
ATOM   2254 C CG    . LYS C 3 236 ? 38.598  24.169 42.444  1.00 41.97 ? 532  LYS A CG    1 
ATOM   2255 C CD    . LYS C 3 236 ? 39.487  23.546 43.498  1.00 43.19 ? 532  LYS A CD    1 
ATOM   2256 C CE    . LYS C 3 236 ? 40.898  24.108 43.413  1.00 43.62 ? 532  LYS A CE    1 
ATOM   2257 N NZ    . LYS C 3 236 ? 41.860  23.249 44.153  1.00 45.22 ? 532  LYS A NZ    1 
ATOM   2258 N N     . GLN C 3 237 ? 40.819  27.712 43.106  1.00 38.24 ? 533  GLN A N     1 
ATOM   2259 C CA    . GLN C 3 237 ? 42.039  28.270 43.666  1.00 37.61 ? 533  GLN A CA    1 
ATOM   2260 C C     . GLN C 3 237 ? 41.689  29.411 44.612  1.00 37.32 ? 533  GLN A C     1 
ATOM   2261 O O     . GLN C 3 237 ? 42.444  29.714 45.524  1.00 37.42 ? 533  GLN A O     1 
ATOM   2262 C CB    . GLN C 3 237 ? 42.932  28.796 42.555  1.00 37.66 ? 533  GLN A CB    1 
ATOM   2263 C CG    . GLN C 3 237 ? 43.059  27.840 41.401  1.00 38.23 ? 533  GLN A CG    1 
ATOM   2264 C CD    . GLN C 3 237 ? 44.140  28.252 40.430  1.00 38.47 ? 533  GLN A CD    1 
ATOM   2265 O OE1   . GLN C 3 237 ? 44.104  27.868 39.263  1.00 40.11 ? 533  GLN A OE1   1 
ATOM   2266 N NE2   . GLN C 3 237 ? 45.108  29.038 40.898  1.00 37.24 ? 533  GLN A NE2   1 
ATOM   2267 N N     . LEU C 3 238 ? 40.544  30.040 44.378  1.00 36.26 ? 534  LEU A N     1 
ATOM   2268 C CA    . LEU C 3 238 ? 40.089  31.140 45.205  1.00 35.74 ? 534  LEU A CA    1 
ATOM   2269 C C     . LEU C 3 238 ? 39.698  30.585 46.571  1.00 35.48 ? 534  LEU A C     1 
ATOM   2270 O O     . LEU C 3 238 ? 40.169  31.066 47.596  1.00 35.84 ? 534  LEU A O     1 
ATOM   2271 C CB    . LEU C 3 238 ? 38.881  31.818 44.550  1.00 35.56 ? 534  LEU A CB    1 
ATOM   2272 C CG    . LEU C 3 238 ? 38.691  33.339 44.616  1.00 35.92 ? 534  LEU A CG    1 
ATOM   2273 C CD1   . LEU C 3 238 ? 37.237  33.638 45.006  1.00 35.54 ? 534  LEU A CD1   1 
ATOM   2274 C CD2   . LEU C 3 238 ? 39.666  33.969 45.609  1.00 34.58 ? 534  LEU A CD2   1 
ATOM   2275 N N     . GLY C 3 239 ? 38.845  29.568 46.581  1.00 35.20 ? 535  GLY A N     1 
ATOM   2276 C CA    . GLY C 3 239 ? 38.392  28.973 47.831  1.00 35.12 ? 535  GLY A CA    1 
ATOM   2277 C C     . GLY C 3 239 ? 39.480  28.442 48.766  1.00 35.14 ? 535  GLY A C     1 
ATOM   2278 O O     . GLY C 3 239 ? 39.304  28.379 49.994  1.00 35.78 ? 535  GLY A O     1 
ATOM   2279 N N     . VAL C 3 240 ? 40.610  28.059 48.196  1.00 33.97 ? 536  VAL A N     1 
ATOM   2280 C CA    . VAL C 3 240 ? 41.703  27.544 48.985  1.00 33.66 ? 536  VAL A CA    1 
ATOM   2281 C C     . VAL C 3 240 ? 42.508  28.687 49.626  1.00 34.32 ? 536  VAL A C     1 
ATOM   2282 O O     . VAL C 3 240 ? 42.925  28.596 50.788  1.00 34.32 ? 536  VAL A O     1 
ATOM   2283 C CB    . VAL C 3 240 ? 42.604  26.664 48.103  1.00 33.73 ? 536  VAL A CB    1 
ATOM   2284 C CG1   . VAL C 3 240 ? 43.988  26.504 48.721  1.00 32.63 ? 536  VAL A CG1   1 
ATOM   2285 C CG2   . VAL C 3 240 ? 41.918  25.314 47.883  1.00 33.70 ? 536  VAL A CG2   1 
ATOM   2286 N N     . ILE C 3 241 ? 42.719  29.766 48.872  1.00 33.78 ? 537  ILE A N     1 
ATOM   2287 C CA    . ILE C 3 241 ? 43.466  30.920 49.368  1.00 32.59 ? 537  ILE A CA    1 
ATOM   2288 C C     . ILE C 3 241 ? 42.686  31.647 50.459  1.00 32.04 ? 537  ILE A C     1 
ATOM   2289 O O     . ILE C 3 241 ? 43.272  32.149 51.411  1.00 32.84 ? 537  ILE A O     1 
ATOM   2290 C CB    . ILE C 3 241 ? 43.758  31.924 48.235  1.00 31.91 ? 537  ILE A CB    1 
ATOM   2291 C CG1   . ILE C 3 241 ? 44.936  31.426 47.414  1.00 30.60 ? 537  ILE A CG1   1 
ATOM   2292 C CG2   . ILE C 3 241 ? 44.064  33.302 48.812  1.00 31.48 ? 537  ILE A CG2   1 
ATOM   2293 C CD1   . ILE C 3 241 ? 46.248  31.920 47.912  1.00 31.23 ? 537  ILE A CD1   1 
ATOM   2294 N N     . LEU C 3 242 ? 41.367  31.694 50.317  1.00 31.20 ? 538  LEU A N     1 
ATOM   2295 C CA    . LEU C 3 242 ? 40.513  32.372 51.282  1.00 31.06 ? 538  LEU A CA    1 
ATOM   2296 C C     . LEU C 3 242 ? 40.279  31.540 52.546  1.00 31.40 ? 538  LEU A C     1 
ATOM   2297 O O     . LEU C 3 242 ? 40.569  31.979 53.667  1.00 31.06 ? 538  LEU A O     1 
ATOM   2298 C CB    . LEU C 3 242 ? 39.151  32.704 50.644  1.00 30.30 ? 538  LEU A CB    1 
ATOM   2299 C CG    . LEU C 3 242 ? 38.972  33.792 49.554  1.00 29.31 ? 538  LEU A CG    1 
ATOM   2300 C CD1   . LEU C 3 242 ? 37.481  34.086 49.406  1.00 27.43 ? 538  LEU A CD1   1 
ATOM   2301 C CD2   . LEU C 3 242 ? 39.744  35.058 49.891  1.00 27.59 ? 538  LEU A CD2   1 
ATOM   2302 N N     . PHE C 3 243 ? 39.777  30.326 52.352  1.00 31.45 ? 539  PHE A N     1 
ATOM   2303 C CA    . PHE C 3 243 ? 39.446  29.448 53.462  1.00 31.92 ? 539  PHE A CA    1 
ATOM   2304 C C     . PHE C 3 243 ? 40.527  28.531 54.045  1.00 31.71 ? 539  PHE A C     1 
ATOM   2305 O O     . PHE C 3 243 ? 40.303  27.875 55.061  1.00 31.62 ? 539  PHE A O     1 
ATOM   2306 C CB    . PHE C 3 243 ? 38.207  28.653 53.071  1.00 32.12 ? 539  PHE A CB    1 
ATOM   2307 C CG    . PHE C 3 243 ? 37.096  29.520 52.542  1.00 33.50 ? 539  PHE A CG    1 
ATOM   2308 C CD1   . PHE C 3 243 ? 36.462  30.439 53.371  1.00 33.86 ? 539  PHE A CD1   1 
ATOM   2309 C CD2   . PHE C 3 243 ? 36.700  29.445 51.213  1.00 33.56 ? 539  PHE A CD2   1 
ATOM   2310 C CE1   . PHE C 3 243 ? 35.454  31.266 52.886  1.00 33.51 ? 539  PHE A CE1   1 
ATOM   2311 C CE2   . PHE C 3 243 ? 35.691  30.269 50.725  1.00 33.11 ? 539  PHE A CE2   1 
ATOM   2312 C CZ    . PHE C 3 243 ? 35.072  31.178 51.564  1.00 33.19 ? 539  PHE A CZ    1 
ATOM   2313 N N     . GLU C 3 244 ? 41.697  28.486 53.422  1.00 31.67 ? 540  GLU A N     1 
ATOM   2314 C CA    . GLU C 3 244 ? 42.780  27.659 53.937  1.00 31.15 ? 540  GLU A CA    1 
ATOM   2315 C C     . GLU C 3 244 ? 43.982  28.549 54.273  1.00 31.24 ? 540  GLU A C     1 
ATOM   2316 O O     . GLU C 3 244 ? 44.414  28.609 55.425  1.00 31.45 ? 540  GLU A O     1 
ATOM   2317 C CB    . GLU C 3 244 ? 43.142  26.560 52.922  1.00 30.58 ? 540  GLU A CB    1 
ATOM   2318 C CG    . GLU C 3 244 ? 42.017  25.527 52.717  1.00 29.50 ? 540  GLU A CG    1 
ATOM   2319 C CD    . GLU C 3 244 ? 42.371  24.423 51.713  1.00 29.95 ? 540  GLU A CD    1 
ATOM   2320 O OE1   . GLU C 3 244 ? 43.571  24.157 51.486  1.00 30.18 ? 540  GLU A OE1   1 
ATOM   2321 O OE2   . GLU C 3 244 ? 41.445  23.812 51.148  1.00 29.35 ? 540  GLU A OE2   1 
ATOM   2322 N N     . LYS C 3 245 ? 44.502  29.272 53.288  1.00 31.01 ? 541  LYS A N     1 
ATOM   2323 C CA    . LYS C 3 245 ? 45.643  30.150 53.530  1.00 31.95 ? 541  LYS A CA    1 
ATOM   2324 C C     . LYS C 3 245 ? 45.395  31.359 54.462  1.00 31.64 ? 541  LYS A C     1 
ATOM   2325 O O     . LYS C 3 245 ? 46.253  31.713 55.277  1.00 31.11 ? 541  LYS A O     1 
ATOM   2326 C CB    . LYS C 3 245 ? 46.187  30.663 52.205  1.00 32.54 ? 541  LYS A CB    1 
ATOM   2327 C CG    . LYS C 3 245 ? 47.669  30.930 52.254  1.00 33.75 ? 541  LYS A CG    1 
ATOM   2328 C CD    . LYS C 3 245 ? 48.058  32.113 51.391  1.00 35.18 ? 541  LYS A CD    1 
ATOM   2329 C CE    . LYS C 3 245 ? 49.388  32.682 51.848  1.00 35.84 ? 541  LYS A CE    1 
ATOM   2330 N NZ    . LYS C 3 245 ? 50.373  32.725 50.732  1.00 37.53 ? 541  LYS A NZ    1 
ATOM   2331 N N     . LEU C 3 246 ? 44.235  31.995 54.324  1.00 31.15 ? 542  LEU A N     1 
ATOM   2332 C CA    . LEU C 3 246 ? 43.907  33.154 55.138  1.00 31.06 ? 542  LEU A CA    1 
ATOM   2333 C C     . LEU C 3 246 ? 42.922  32.780 56.231  1.00 31.15 ? 542  LEU A C     1 
ATOM   2334 O O     . LEU C 3 246 ? 42.504  33.621 57.010  1.00 31.12 ? 542  LEU A O     1 
ATOM   2335 C CB    . LEU C 3 246 ? 43.331  34.276 54.271  1.00 30.77 ? 542  LEU A CB    1 
ATOM   2336 C CG    . LEU C 3 246 ? 44.215  34.766 53.122  1.00 30.61 ? 542  LEU A CG    1 
ATOM   2337 C CD1   . LEU C 3 246 ? 43.509  35.920 52.437  1.00 31.45 ? 542  LEU A CD1   1 
ATOM   2338 C CD2   . LEU C 3 246 ? 45.572  35.198 53.628  1.00 30.03 ? 542  LEU A CD2   1 
ATOM   2339 N N     . GLN C 3 247 ? 42.534  31.514 56.278  1.00 31.88 ? 543  GLN A N     1 
ATOM   2340 C CA    . GLN C 3 247 ? 41.641  31.039 57.339  1.00 33.02 ? 543  GLN A CA    1 
ATOM   2341 C C     . GLN C 3 247 ? 40.335  31.779 57.496  1.00 33.46 ? 543  GLN A C     1 
ATOM   2342 O O     . GLN C 3 247 ? 39.788  31.817 58.601  1.00 33.30 ? 543  GLN A O     1 
ATOM   2343 C CB    . GLN C 3 247 ? 42.339  31.096 58.707  1.00 33.74 ? 543  GLN A CB    1 
ATOM   2344 C CG    . GLN C 3 247 ? 43.626  30.289 58.821  1.00 35.69 ? 543  GLN A CG    1 
ATOM   2345 C CD    . GLN C 3 247 ? 43.364  28.804 58.764  1.00 36.24 ? 543  GLN A CD    1 
ATOM   2346 O OE1   . GLN C 3 247 ? 43.895  28.105 57.904  1.00 38.12 ? 543  GLN A OE1   1 
ATOM   2347 N NE2   . GLN C 3 247 ? 42.530  28.313 59.672  1.00 35.64 ? 543  GLN A NE2   1 
ATOM   2348 N N     . LEU C 3 248 ? 39.825  32.379 56.431  1.00 33.41 ? 544  LEU A N     1 
ATOM   2349 C CA    . LEU C 3 248 ? 38.557  33.076 56.560  1.00 33.74 ? 544  LEU A CA    1 
ATOM   2350 C C     . LEU C 3 248 ? 37.498  32.028 56.913  1.00 34.31 ? 544  LEU A C     1 
ATOM   2351 O O     . LEU C 3 248 ? 37.637  30.854 56.579  1.00 33.64 ? 544  LEU A O     1 
ATOM   2352 C CB    . LEU C 3 248 ? 38.220  33.811 55.255  1.00 33.10 ? 544  LEU A CB    1 
ATOM   2353 C CG    . LEU C 3 248 ? 39.309  34.815 54.868  1.00 32.54 ? 544  LEU A CG    1 
ATOM   2354 C CD1   . LEU C 3 248 ? 38.854  35.671 53.684  1.00 31.71 ? 544  LEU A CD1   1 
ATOM   2355 C CD2   . LEU C 3 248 ? 39.641  35.676 56.096  1.00 32.23 ? 544  LEU A CD2   1 
ATOM   2356 N N     . PRO C 3 249 ? 36.434  32.441 57.614  1.00 35.63 ? 545  PRO A N     1 
ATOM   2357 C CA    . PRO C 3 249 ? 35.361  31.528 58.018  1.00 36.66 ? 545  PRO A CA    1 
ATOM   2358 C C     . PRO C 3 249 ? 34.612  30.929 56.851  1.00 38.19 ? 545  PRO A C     1 
ATOM   2359 O O     . PRO C 3 249 ? 34.513  31.545 55.790  1.00 38.05 ? 545  PRO A O     1 
ATOM   2360 C CB    . PRO C 3 249 ? 34.429  32.394 58.874  1.00 36.41 ? 545  PRO A CB    1 
ATOM   2361 C CG    . PRO C 3 249 ? 35.163  33.665 59.129  1.00 36.26 ? 545  PRO A CG    1 
ATOM   2362 C CD    . PRO C 3 249 ? 36.197  33.824 58.063  1.00 35.84 ? 545  PRO A CD    1 
ATOM   2363 N N     . VAL C 3 250 ? 34.083  29.727 57.056  1.00 40.04 ? 546  VAL A N     1 
ATOM   2364 C CA    . VAL C 3 250 ? 33.300  29.059 56.032  1.00 42.34 ? 546  VAL A CA    1 
ATOM   2365 C C     . VAL C 3 250 ? 31.867  29.193 56.504  1.00 44.06 ? 546  VAL A C     1 
ATOM   2366 O O     . VAL C 3 250 ? 31.396  28.433 57.348  1.00 44.01 ? 546  VAL A O     1 
ATOM   2367 C CB    . VAL C 3 250 ? 33.680  27.555 55.873  1.00 42.23 ? 546  VAL A CB    1 
ATOM   2368 C CG1   . VAL C 3 250 ? 32.711  26.864 54.918  1.00 42.14 ? 546  VAL A CG1   1 
ATOM   2369 C CG2   . VAL C 3 250 ? 35.097  27.429 55.332  1.00 41.48 ? 546  VAL A CG2   1 
ATOM   2370 N N     . LEU C 3 251 ? 31.206  30.216 55.974  1.00 46.77 ? 547  LEU A N     1 
ATOM   2371 C CA    . LEU C 3 251 ? 29.818  30.521 56.285  1.00 49.31 ? 547  LEU A CA    1 
ATOM   2372 C C     . LEU C 3 251 ? 28.947  29.794 55.266  1.00 51.22 ? 547  LEU A C     1 
ATOM   2373 O O     . LEU C 3 251 ? 27.741  29.614 55.472  1.00 51.05 ? 547  LEU A O     1 
ATOM   2374 C CB    . LEU C 3 251 ? 29.584  32.033 56.203  1.00 49.50 ? 547  LEU A CB    1 
ATOM   2375 C CG    . LEU C 3 251 ? 30.582  32.891 56.994  1.00 49.92 ? 547  LEU A CG    1 
ATOM   2376 C CD1   . LEU C 3 251 ? 30.722  34.246 56.322  1.00 50.14 ? 547  LEU A CD1   1 
ATOM   2377 C CD2   . LEU C 3 251 ? 30.123  33.057 58.435  1.00 49.43 ? 547  LEU A CD2   1 
ATOM   2378 N N     . LYS C 3 252 ? 29.574  29.378 54.165  1.00 53.56 ? 548  LYS A N     1 
ATOM   2379 C CA    . LYS C 3 252 ? 28.876  28.642 53.117  1.00 55.73 ? 548  LYS A CA    1 
ATOM   2380 C C     . LYS C 3 252 ? 29.805  27.790 52.256  1.00 57.25 ? 548  LYS A C     1 
ATOM   2381 O O     . LYS C 3 252 ? 30.965  28.141 51.988  1.00 57.08 ? 548  LYS A O     1 
ATOM   2382 C CB    . LYS C 3 252 ? 28.075  29.590 52.216  1.00 56.13 ? 548  LYS A CB    1 
ATOM   2383 C CG    . LYS C 3 252 ? 26.736  29.005 51.744  1.00 56.33 ? 548  LYS A CG    1 
ATOM   2384 C CD    . LYS C 3 252 ? 26.412  29.398 50.300  1.00 56.82 ? 548  LYS A CD    1 
ATOM   2385 C CE    . LYS C 3 252 ? 25.521  30.639 50.213  1.00 56.88 ? 548  LYS A CE    1 
ATOM   2386 N NZ    . LYS C 3 252 ? 25.394  31.141 48.807  1.00 56.36 ? 548  LYS A NZ    1 
ATOM   2387 N N     . LYS C 3 253 ? 29.263  26.657 51.829  1.00 59.10 ? 549  LYS A N     1 
ATOM   2388 C CA    . LYS C 3 253 ? 29.976  25.702 50.996  1.00 60.84 ? 549  LYS A CA    1 
ATOM   2389 C C     . LYS C 3 253 ? 29.251  25.553 49.647  1.00 62.09 ? 549  LYS A C     1 
ATOM   2390 O O     . LYS C 3 253 ? 28.168  26.127 49.431  1.00 62.60 ? 549  LYS A O     1 
ATOM   2391 C CB    . LYS C 3 253 ? 30.026  24.347 51.713  1.00 60.79 ? 549  LYS A CB    1 
ATOM   2392 C CG    . LYS C 3 253 ? 28.679  23.912 52.298  1.00 60.74 ? 549  LYS A CG    1 
ATOM   2393 C CD    . LYS C 3 253 ? 28.631  24.101 53.813  1.00 60.90 ? 549  LYS A CD    1 
ATOM   2394 C CE    . LYS C 3 253 ? 27.637  25.182 54.221  1.00 61.04 ? 549  LYS A CE    1 
ATOM   2395 N NZ    . LYS C 3 253 ? 28.341  26.316 54.885  1.00 61.19 ? 549  LYS A NZ    1 
ATOM   2396 N N     . THR C 3 254 ? 29.854  24.790 48.739  1.00 62.66 ? 550  THR A N     1 
ATOM   2397 C CA    . THR C 3 254 ? 29.269  24.540 47.419  1.00 62.83 ? 550  THR A CA    1 
ATOM   2398 C C     . THR C 3 254 ? 29.112  23.014 47.391  1.00 62.97 ? 550  THR A C     1 
ATOM   2399 O O     . THR C 3 254 ? 29.469  22.361 48.381  1.00 62.94 ? 550  THR A O     1 
ATOM   2400 C CB    . THR C 3 254 ? 30.235  25.054 46.290  1.00 62.99 ? 550  THR A CB    1 
ATOM   2401 O OG1   . THR C 3 254 ? 29.592  26.086 45.527  1.00 62.54 ? 550  THR A OG1   1 
ATOM   2402 C CG2   . THR C 3 254 ? 30.662  23.923 45.375  1.00 62.97 ? 550  THR A CG2   1 
ATOM   2403 N N     . LYS C 3 255 ? 28.570  22.444 46.307  1.00 62.96 ? 551  LYS A N     1 
ATOM   2404 C CA    . LYS C 3 255 ? 28.405  20.981 46.215  1.00 62.59 ? 551  LYS A CA    1 
ATOM   2405 C C     . LYS C 3 255 ? 29.629  20.307 46.853  1.00 62.53 ? 551  LYS A C     1 
ATOM   2406 O O     . LYS C 3 255 ? 29.512  19.592 47.855  1.00 62.54 ? 551  LYS A O     1 
ATOM   2407 C CB    . LYS C 3 255 ? 28.262  20.539 44.750  1.00 62.52 ? 551  LYS A CB    1 
ATOM   2408 C CG    . LYS C 3 255 ? 29.085  21.345 43.755  1.00 61.67 ? 551  LYS A CG    1 
ATOM   2409 C CD    . LYS C 3 255 ? 30.367  20.630 43.353  1.00 61.14 ? 551  LYS A CD    1 
ATOM   2410 C CE    . LYS C 3 255 ? 31.546  21.588 43.310  1.00 60.30 ? 551  LYS A CE    1 
ATOM   2411 N NZ    . LYS C 3 255 ? 31.806  22.092 41.929  1.00 60.29 ? 551  LYS A NZ    1 
ATOM   2412 N N     . THR C 3 256 ? 30.798  20.534 46.257  1.00 62.29 ? 552  THR A N     1 
ATOM   2413 C CA    . THR C 3 256 ? 32.059  20.022 46.799  1.00 62.13 ? 552  THR A CA    1 
ATOM   2414 C C     . THR C 3 256 ? 32.992  21.239 46.865  1.00 60.85 ? 552  THR A C     1 
ATOM   2415 O O     . THR C 3 256 ? 33.030  22.050 45.930  1.00 61.17 ? 552  THR A O     1 
ATOM   2416 C CB    . THR C 3 256 ? 32.703  18.933 45.899  1.00 63.19 ? 552  THR A CB    1 
ATOM   2417 O OG1   . THR C 3 256 ? 31.795  17.828 45.762  1.00 64.41 ? 552  THR A OG1   1 
ATOM   2418 C CG2   . THR C 3 256 ? 34.044  18.437 46.516  1.00 63.23 ? 552  THR A CG2   1 
ATOM   2419 N N     . GLY C 3 257 ? 33.727  21.376 47.966  1.00 58.78 ? 553  GLY A N     1 
ATOM   2420 C CA    . GLY C 3 257 ? 34.611  22.520 48.113  1.00 55.59 ? 553  GLY A CA    1 
ATOM   2421 C C     . GLY C 3 257 ? 33.882  23.698 48.746  1.00 53.20 ? 553  GLY A C     1 
ATOM   2422 O O     . GLY C 3 257 ? 32.795  23.547 49.310  1.00 52.99 ? 553  GLY A O     1 
ATOM   2423 N N     . TYR C 3 258 ? 34.464  24.885 48.634  1.00 50.51 ? 554  TYR A N     1 
ATOM   2424 C CA    . TYR C 3 258 ? 33.858  26.064 49.230  1.00 47.50 ? 554  TYR A CA    1 
ATOM   2425 C C     . TYR C 3 258 ? 33.083  26.925 48.254  1.00 46.45 ? 554  TYR A C     1 
ATOM   2426 O O     . TYR C 3 258 ? 33.281  26.859 47.042  1.00 46.86 ? 554  TYR A O     1 
ATOM   2427 C CB    . TYR C 3 258 ? 34.929  26.926 49.873  1.00 45.59 ? 554  TYR A CB    1 
ATOM   2428 C CG    . TYR C 3 258 ? 36.089  26.167 50.453  1.00 43.49 ? 554  TYR A CG    1 
ATOM   2429 C CD1   . TYR C 3 258 ? 36.010  25.612 51.721  1.00 43.11 ? 554  TYR A CD1   1 
ATOM   2430 C CD2   . TYR C 3 258 ? 37.298  26.087 49.776  1.00 42.49 ? 554  TYR A CD2   1 
ATOM   2431 C CE1   . TYR C 3 258 ? 37.117  25.003 52.307  1.00 42.40 ? 554  TYR A CE1   1 
ATOM   2432 C CE2   . TYR C 3 258 ? 38.405  25.485 50.349  1.00 41.74 ? 554  TYR A CE2   1 
ATOM   2433 C CZ    . TYR C 3 258 ? 38.313  24.949 51.617  1.00 42.21 ? 554  TYR A CZ    1 
ATOM   2434 O OH    . TYR C 3 258 ? 39.429  24.401 52.218  1.00 42.01 ? 554  TYR A OH    1 
ATOM   2435 N N     . SER C 3 259 ? 32.203  27.753 48.797  1.00 45.00 ? 555  SER A N     1 
ATOM   2436 C CA    . SER C 3 259 ? 31.425  28.657 47.975  1.00 43.17 ? 555  SER A CA    1 
ATOM   2437 C C     . SER C 3 259 ? 31.982  30.076 48.073  1.00 42.33 ? 555  SER A C     1 
ATOM   2438 O O     . SER C 3 259 ? 32.090  30.633 49.157  1.00 42.21 ? 555  SER A O     1 
ATOM   2439 C CB    . SER C 3 259 ? 29.961  28.649 48.411  1.00 42.79 ? 555  SER A CB    1 
ATOM   2440 O OG    . SER C 3 259 ? 29.359  29.917 48.201  1.00 42.32 ? 555  SER A OG    1 
ATOM   2441 N N     . THR C 3 260 ? 32.357  30.643 46.929  1.00 41.83 ? 556  THR A N     1 
ATOM   2442 C CA    . THR C 3 260 ? 32.870  32.006 46.862  1.00 40.82 ? 556  THR A CA    1 
ATOM   2443 C C     . THR C 3 260 ? 31.766  32.848 46.227  1.00 40.83 ? 556  THR A C     1 
ATOM   2444 O O     . THR C 3 260 ? 32.024  33.853 45.568  1.00 40.05 ? 556  THR A O     1 
ATOM   2445 C CB    . THR C 3 260 ? 34.168  32.105 45.993  1.00 40.99 ? 556  THR A CB    1 
ATOM   2446 O OG1   . THR C 3 260 ? 33.919  31.610 44.664  1.00 40.18 ? 556  THR A OG1   1 
ATOM   2447 C CG2   . THR C 3 260 ? 35.301  31.313 46.641  1.00 39.68 ? 556  THR A CG2   1 
ATOM   2448 N N     . SER C 3 261 ? 30.528  32.415 46.430  1.00 41.19 ? 557  SER A N     1 
ATOM   2449 C CA    . SER C 3 261 ? 29.380  33.109 45.881  1.00 42.36 ? 557  SER A CA    1 
ATOM   2450 C C     . SER C 3 261 ? 29.505  34.568 46.261  1.00 43.18 ? 557  SER A C     1 
ATOM   2451 O O     . SER C 3 261 ? 30.270  34.907 47.159  1.00 43.64 ? 557  SER A O     1 
ATOM   2452 C CB    . SER C 3 261 ? 28.084  32.503 46.429  1.00 42.21 ? 557  SER A CB    1 
ATOM   2453 O OG    . SER C 3 261 ? 27.559  33.276 47.488  1.00 43.44 ? 557  SER A OG    1 
ATOM   2454 N N     . ALA C 3 262 ? 28.760  35.431 45.581  1.00 43.99 ? 558  ALA A N     1 
ATOM   2455 C CA    . ALA C 3 262 ? 28.830  36.867 45.835  1.00 44.88 ? 558  ALA A CA    1 
ATOM   2456 C C     . ALA C 3 262 ? 28.535  37.341 47.267  1.00 45.98 ? 558  ALA A C     1 
ATOM   2457 O O     . ALA C 3 262 ? 29.366  37.998 47.906  1.00 46.36 ? 558  ALA A O     1 
ATOM   2458 C CB    . ALA C 3 262 ? 27.916  37.582 44.882  1.00 44.63 ? 558  ALA A CB    1 
ATOM   2459 N N     . ASP C 3 263 ? 27.350  37.031 47.771  1.00 46.76 ? 559  ASP A N     1 
ATOM   2460 C CA    . ASP C 3 263 ? 26.996  37.489 49.107  1.00 47.84 ? 559  ASP A CA    1 
ATOM   2461 C C     . ASP C 3 263 ? 27.762  36.764 50.224  1.00 47.23 ? 559  ASP A C     1 
ATOM   2462 O O     . ASP C 3 263 ? 27.746  37.203 51.376  1.00 47.92 ? 559  ASP A O     1 
ATOM   2463 C CB    . ASP C 3 263 ? 25.478  37.383 49.320  1.00 49.06 ? 559  ASP A CB    1 
ATOM   2464 C CG    . ASP C 3 263 ? 24.983  35.964 49.227  1.00 50.48 ? 559  ASP A CG    1 
ATOM   2465 O OD1   . ASP C 3 263 ? 25.779  35.095 48.801  1.00 50.95 ? 559  ASP A OD1   1 
ATOM   2466 O OD2   . ASP C 3 263 ? 23.806  35.722 49.582  1.00 51.79 ? 559  ASP A OD2   1 
ATOM   2467 N N     . VAL C 3 264 ? 28.423  35.657 49.901  1.00 45.69 ? 560  VAL A N     1 
ATOM   2468 C CA    . VAL C 3 264 ? 29.208  34.976 50.913  1.00 44.17 ? 560  VAL A CA    1 
ATOM   2469 C C     . VAL C 3 264 ? 30.421  35.876 51.132  1.00 43.77 ? 560  VAL A C     1 
ATOM   2470 O O     . VAL C 3 264 ? 30.797  36.162 52.269  1.00 43.89 ? 560  VAL A O     1 
ATOM   2471 C CB    . VAL C 3 264 ? 29.663  33.578 50.446  1.00 43.70 ? 560  VAL A CB    1 
ATOM   2472 C CG1   . VAL C 3 264 ? 30.909  33.145 51.206  1.00 42.89 ? 560  VAL A CG1   1 
ATOM   2473 C CG2   . VAL C 3 264 ? 28.544  32.581 50.671  1.00 44.10 ? 560  VAL A CG2   1 
ATOM   2474 N N     . LEU C 3 265 ? 31.012  36.345 50.035  1.00 42.78 ? 561  LEU A N     1 
ATOM   2475 C CA    . LEU C 3 265 ? 32.177  37.221 50.099  1.00 42.42 ? 561  LEU A CA    1 
ATOM   2476 C C     . LEU C 3 265 ? 31.793  38.542 50.752  1.00 42.65 ? 561  LEU A C     1 
ATOM   2477 O O     . LEU C 3 265 ? 32.634  39.257 51.310  1.00 42.28 ? 561  LEU A O     1 
ATOM   2478 C CB    . LEU C 3 265 ? 32.706  37.486 48.693  1.00 41.96 ? 561  LEU A CB    1 
ATOM   2479 C CG    . LEU C 3 265 ? 33.565  36.381 48.086  1.00 41.65 ? 561  LEU A CG    1 
ATOM   2480 C CD1   . LEU C 3 265 ? 34.522  36.966 47.066  1.00 40.86 ? 561  LEU A CD1   1 
ATOM   2481 C CD2   . LEU C 3 265 ? 34.336  35.682 49.192  1.00 41.82 ? 561  LEU A CD2   1 
ATOM   2482 N N     . GLU C 3 266 ? 30.509  38.865 50.645  1.00 43.39 ? 562  GLU A N     1 
ATOM   2483 C CA    . GLU C 3 266 ? 29.950  40.080 51.223  1.00 43.73 ? 562  GLU A CA    1 
ATOM   2484 C C     . GLU C 3 266 ? 30.134  39.932 52.736  1.00 42.74 ? 562  GLU A C     1 
ATOM   2485 O O     . GLU C 3 266 ? 30.746  40.789 53.390  1.00 42.64 ? 562  GLU A O     1 
ATOM   2486 C CB    . GLU C 3 266 ? 28.459  40.185 50.859  1.00 45.58 ? 562  GLU A CB    1 
ATOM   2487 C CG    . GLU C 3 266 ? 28.137  41.245 49.796  1.00 48.59 ? 562  GLU A CG    1 
ATOM   2488 C CD    . GLU C 3 266 ? 27.467  40.681 48.535  1.00 50.43 ? 562  GLU A CD    1 
ATOM   2489 O OE1   . GLU C 3 266 ? 26.212  40.589 48.502  1.00 51.07 ? 562  GLU A OE1   1 
ATOM   2490 O OE2   . GLU C 3 266 ? 28.196  40.342 47.573  1.00 51.15 ? 562  GLU A OE2   1 
ATOM   2491 N N     . LYS C 3 267 ? 29.626  38.817 53.269  1.00 41.40 ? 563  LYS A N     1 
ATOM   2492 C CA    . LYS C 3 267 ? 29.737  38.497 54.691  1.00 39.39 ? 563  LYS A CA    1 
ATOM   2493 C C     . LYS C 3 267 ? 31.201  38.481 55.131  1.00 38.79 ? 563  LYS A C     1 
ATOM   2494 O O     . LYS C 3 267 ? 31.558  39.024 56.178  1.00 39.26 ? 563  LYS A O     1 
ATOM   2495 C CB    . LYS C 3 267 ? 29.122  37.129 54.973  1.00 39.45 ? 563  LYS A CB    1 
ATOM   2496 C CG    . LYS C 3 267 ? 27.844  36.828 54.218  1.00 38.77 ? 563  LYS A CG    1 
ATOM   2497 C CD    . LYS C 3 267 ? 26.712  37.707 54.690  1.00 38.90 ? 563  LYS A CD    1 
ATOM   2498 C CE    . LYS C 3 267 ? 25.382  37.162 54.222  1.00 39.38 ? 563  LYS A CE    1 
ATOM   2499 N NZ    . LYS C 3 267 ? 25.302  35.696 54.443  1.00 39.90 ? 563  LYS A NZ    1 
ATOM   2500 N N     . LEU C 3 268 ? 32.051  37.857 54.325  1.00 37.26 ? 564  LEU A N     1 
ATOM   2501 C CA    . LEU C 3 268 ? 33.476  37.765 54.631  1.00 35.56 ? 564  LEU A CA    1 
ATOM   2502 C C     . LEU C 3 268 ? 34.211  39.097 54.601  1.00 34.48 ? 564  LEU A C     1 
ATOM   2503 O O     . LEU C 3 268 ? 35.265  39.231 55.222  1.00 33.42 ? 564  LEU A O     1 
ATOM   2504 C CB    . LEU C 3 268 ? 34.164  36.825 53.641  1.00 35.72 ? 564  LEU A CB    1 
ATOM   2505 C CG    . LEU C 3 268 ? 33.763  35.361 53.684  1.00 36.14 ? 564  LEU A CG    1 
ATOM   2506 C CD1   . LEU C 3 268 ? 34.635  34.592 52.722  1.00 35.78 ? 564  LEU A CD1   1 
ATOM   2507 C CD2   . LEU C 3 268 ? 33.912  34.843 55.114  1.00 36.06 ? 564  LEU A CD2   1 
ATOM   2508 N N     . ALA C 3 269 ? 33.669  40.061 53.856  1.00 34.11 ? 565  ALA A N     1 
ATOM   2509 C CA    . ALA C 3 269 ? 34.287  41.378 53.701  1.00 34.01 ? 565  ALA A CA    1 
ATOM   2510 C C     . ALA C 3 269 ? 34.994  41.880 54.971  1.00 33.70 ? 565  ALA A C     1 
ATOM   2511 O O     . ALA C 3 269 ? 36.195  42.193 54.961  1.00 32.66 ? 565  ALA A O     1 
ATOM   2512 C CB    . ALA C 3 269 ? 33.229  42.377 53.246  1.00 34.81 ? 565  ALA A CB    1 
ATOM   2513 N N     . PRO C 3 270 ? 34.239  42.010 56.069  1.00 33.36 ? 566  PRO A N     1 
ATOM   2514 C CA    . PRO C 3 270 ? 34.767  42.461 57.357  1.00 33.55 ? 566  PRO A CA    1 
ATOM   2515 C C     . PRO C 3 270 ? 36.090  41.817 57.810  1.00 33.08 ? 566  PRO A C     1 
ATOM   2516 O O     . PRO C 3 270 ? 36.944  42.496 58.367  1.00 33.12 ? 566  PRO A O     1 
ATOM   2517 C CB    . PRO C 3 270 ? 33.620  42.168 58.328  1.00 33.82 ? 566  PRO A CB    1 
ATOM   2518 C CG    . PRO C 3 270 ? 32.388  42.299 57.493  1.00 33.72 ? 566  PRO A CG    1 
ATOM   2519 C CD    . PRO C 3 270 ? 32.777  41.808 56.111  1.00 33.75 ? 566  PRO A CD    1 
ATOM   2520 N N     . TYR C 3 271 ? 36.291  40.527 57.558  1.00 33.09 ? 567  TYR A N     1 
ATOM   2521 C CA    . TYR C 3 271 ? 37.527  39.868 58.010  1.00 32.91 ? 567  TYR A CA    1 
ATOM   2522 C C     . TYR C 3 271 ? 38.861  40.142 57.327  1.00 33.40 ? 567  TYR A C     1 
ATOM   2523 O O     . TYR C 3 271 ? 39.916  40.117 57.978  1.00 32.60 ? 567  TYR A O     1 
ATOM   2524 C CB    . TYR C 3 271 ? 37.338  38.357 58.026  1.00 33.12 ? 567  TYR A CB    1 
ATOM   2525 C CG    . TYR C 3 271 ? 36.170  37.913 58.844  1.00 33.58 ? 567  TYR A CG    1 
ATOM   2526 C CD1   . TYR C 3 271 ? 34.897  37.894 58.304  1.00 34.25 ? 567  TYR A CD1   1 
ATOM   2527 C CD2   . TYR C 3 271 ? 36.334  37.521 60.163  1.00 34.23 ? 567  TYR A CD2   1 
ATOM   2528 C CE1   . TYR C 3 271 ? 33.815  37.501 59.050  1.00 35.22 ? 567  TYR A CE1   1 
ATOM   2529 C CE2   . TYR C 3 271 ? 35.252  37.124 60.926  1.00 34.91 ? 567  TYR A CE2   1 
ATOM   2530 C CZ    . TYR C 3 271 ? 33.996  37.118 60.365  1.00 35.44 ? 567  TYR A CZ    1 
ATOM   2531 O OH    . TYR C 3 271 ? 32.904  36.758 61.116  1.00 35.97 ? 567  TYR A OH    1 
ATOM   2532 N N     . HIS C 3 272 ? 38.838  40.383 56.019  1.00 34.26 ? 568  HIS A N     1 
ATOM   2533 C CA    . HIS C 3 272 ? 40.089  40.589 55.297  1.00 34.51 ? 568  HIS A CA    1 
ATOM   2534 C C     . HIS C 3 272 ? 40.017  41.638 54.193  1.00 35.33 ? 568  HIS A C     1 
ATOM   2535 O O     . HIS C 3 272 ? 39.008  41.734 53.500  1.00 35.88 ? 568  HIS A O     1 
ATOM   2536 C CB    . HIS C 3 272 ? 40.543  39.257 54.695  1.00 32.53 ? 568  HIS A CB    1 
ATOM   2537 C CG    . HIS C 3 272 ? 42.021  39.152 54.539  1.00 31.68 ? 568  HIS A CG    1 
ATOM   2538 N ND1   . HIS C 3 272 ? 42.784  38.268 55.268  1.00 32.85 ? 568  HIS A ND1   1 
ATOM   2539 C CD2   . HIS C 3 272 ? 42.887  39.852 53.771  1.00 31.87 ? 568  HIS A CD2   1 
ATOM   2540 C CE1   . HIS C 3 272 ? 44.059  38.427 54.959  1.00 32.55 ? 568  HIS A CE1   1 
ATOM   2541 N NE2   . HIS C 3 272 ? 44.149  39.383 54.052  1.00 32.34 ? 568  HIS A NE2   1 
ATOM   2542 N N     . GLU C 3 273 ? 41.100  42.402 54.030  1.00 35.96 ? 569  GLU A N     1 
ATOM   2543 C CA    . GLU C 3 273 ? 41.191  43.449 53.002  1.00 36.19 ? 569  GLU A CA    1 
ATOM   2544 C C     . GLU C 3 273 ? 41.130  42.841 51.593  1.00 35.20 ? 569  GLU A C     1 
ATOM   2545 O O     . GLU C 3 273 ? 40.829  43.535 50.621  1.00 34.62 ? 569  GLU A O     1 
ATOM   2546 C CB    . GLU C 3 273 ? 42.505  44.250 53.155  1.00 38.02 ? 569  GLU A CB    1 
ATOM   2547 C CG    . GLU C 3 273 ? 42.382  45.789 52.892  1.00 41.38 ? 569  GLU A CG    1 
ATOM   2548 C CD    . GLU C 3 273 ? 43.708  46.477 52.506  1.00 42.21 ? 569  GLU A CD    1 
ATOM   2549 O OE1   . GLU C 3 273 ? 44.705  46.302 53.241  1.00 44.63 ? 569  GLU A OE1   1 
ATOM   2550 O OE2   . GLU C 3 273 ? 43.759  47.198 51.477  1.00 42.09 ? 569  GLU A OE2   1 
ATOM   2551 N N     . ILE C 3 274 ? 41.422  41.546 51.488  1.00 33.99 ? 570  ILE A N     1 
ATOM   2552 C CA    . ILE C 3 274 ? 41.400  40.861 50.198  1.00 31.99 ? 570  ILE A CA    1 
ATOM   2553 C C     . ILE C 3 274 ? 40.001  40.646 49.631  1.00 31.57 ? 570  ILE A C     1 
ATOM   2554 O O     . ILE C 3 274 ? 39.826  40.669 48.425  1.00 31.77 ? 570  ILE A O     1 
ATOM   2555 C CB    . ILE C 3 274 ? 42.095  39.487 50.273  1.00 31.23 ? 570  ILE A CB    1 
ATOM   2556 C CG1   . ILE C 3 274 ? 42.519  39.044 48.863  1.00 29.79 ? 570  ILE A CG1   1 
ATOM   2557 C CG2   . ILE C 3 274 ? 41.144  38.470 50.918  1.00 29.82 ? 570  ILE A CG2   1 
ATOM   2558 C CD1   . ILE C 3 274 ? 43.560  37.963 48.826  1.00 28.87 ? 570  ILE A CD1   1 
ATOM   2559 N N     . VAL C 3 275 ? 38.999  40.449 50.475  1.00 31.37 ? 571  VAL A N     1 
ATOM   2560 C CA    . VAL C 3 275 ? 37.662  40.205 49.949  1.00 32.49 ? 571  VAL A CA    1 
ATOM   2561 C C     . VAL C 3 275 ? 37.109  41.345 49.055  1.00 34.05 ? 571  VAL A C     1 
ATOM   2562 O O     . VAL C 3 275 ? 36.556  41.086 47.979  1.00 33.18 ? 571  VAL A O     1 
ATOM   2563 C CB    . VAL C 3 275 ? 36.669  39.866 51.097  1.00 31.51 ? 571  VAL A CB    1 
ATOM   2564 C CG1   . VAL C 3 275 ? 35.294  39.490 50.545  1.00 30.68 ? 571  VAL A CG1   1 
ATOM   2565 C CG2   . VAL C 3 275 ? 37.209  38.701 51.892  1.00 31.36 ? 571  VAL A CG2   1 
ATOM   2566 N N     . GLU C 3 276 ? 37.264  42.597 49.486  1.00 35.22 ? 572  GLU A N     1 
ATOM   2567 C CA    . GLU C 3 276 ? 36.771  43.733 48.701  1.00 35.59 ? 572  GLU A CA    1 
ATOM   2568 C C     . GLU C 3 276 ? 37.455  43.793 47.331  1.00 34.25 ? 572  GLU A C     1 
ATOM   2569 O O     . GLU C 3 276 ? 36.811  44.091 46.331  1.00 34.15 ? 572  GLU A O     1 
ATOM   2570 C CB    . GLU C 3 276 ? 36.979  45.066 49.460  1.00 37.82 ? 572  GLU A CB    1 
ATOM   2571 C CG    . GLU C 3 276 ? 38.439  45.403 49.864  1.00 41.56 ? 572  GLU A CG    1 
ATOM   2572 C CD    . GLU C 3 276 ? 38.563  46.203 51.198  1.00 44.21 ? 572  GLU A CD    1 
ATOM   2573 O OE1   . GLU C 3 276 ? 37.625  46.172 52.045  1.00 45.82 ? 572  GLU A OE1   1 
ATOM   2574 O OE2   . GLU C 3 276 ? 39.614  46.864 51.408  1.00 45.16 ? 572  GLU A OE2   1 
ATOM   2575 N N     . ASN C 3 277 ? 38.749  43.501 47.284  1.00 33.00 ? 573  ASN A N     1 
ATOM   2576 C CA    . ASN C 3 277 ? 39.481  43.533 46.024  1.00 33.08 ? 573  ASN A CA    1 
ATOM   2577 C C     . ASN C 3 277 ? 39.070  42.423 45.056  1.00 32.63 ? 573  ASN A C     1 
ATOM   2578 O O     . ASN C 3 277 ? 39.124  42.605 43.837  1.00 32.26 ? 573  ASN A O     1 
ATOM   2579 C CB    . ASN C 3 277 ? 40.976  43.439 46.276  1.00 32.96 ? 573  ASN A CB    1 
ATOM   2580 C CG    . ASN C 3 277 ? 41.521  44.665 46.967  1.00 35.06 ? 573  ASN A CG    1 
ATOM   2581 O OD1   . ASN C 3 277 ? 42.271  45.439 46.375  1.00 36.12 ? 573  ASN A OD1   1 
ATOM   2582 N ND2   . ASN C 3 277 ? 41.154  44.847 48.235  1.00 34.78 ? 573  ASN A ND2   1 
ATOM   2583 N N     . ILE C 3 278 ? 38.667  41.277 45.602  1.00 31.49 ? 574  ILE A N     1 
ATOM   2584 C CA    . ILE C 3 278 ? 38.256  40.156 44.780  1.00 30.00 ? 574  ILE A CA    1 
ATOM   2585 C C     . ILE C 3 278 ? 36.887  40.440 44.207  1.00 30.07 ? 574  ILE A C     1 
ATOM   2586 O O     . ILE C 3 278 ? 36.601  40.057 43.081  1.00 30.26 ? 574  ILE A O     1 
ATOM   2587 C CB    . ILE C 3 278 ? 38.214  38.839 45.586  1.00 28.96 ? 574  ILE A CB    1 
ATOM   2588 C CG1   . ILE C 3 278 ? 39.632  38.339 45.800  1.00 28.67 ? 574  ILE A CG1   1 
ATOM   2589 C CG2   . ILE C 3 278 ? 37.402  37.777 44.858  1.00 26.85 ? 574  ILE A CG2   1 
ATOM   2590 C CD1   . ILE C 3 278 ? 39.791  37.649 47.115  1.00 29.92 ? 574  ILE A CD1   1 
ATOM   2591 N N     . LEU C 3 279 ? 36.038  41.122 44.965  1.00 29.81 ? 575  LEU A N     1 
ATOM   2592 C CA    . LEU C 3 279 ? 34.700  41.426 44.466  1.00 30.82 ? 575  LEU A CA    1 
ATOM   2593 C C     . LEU C 3 279 ? 34.759  42.521 43.395  1.00 30.79 ? 575  LEU A C     1 
ATOM   2594 O O     . LEU C 3 279 ? 33.993  42.504 42.429  1.00 31.36 ? 575  LEU A O     1 
ATOM   2595 C CB    . LEU C 3 279 ? 33.781  41.887 45.606  1.00 31.73 ? 575  LEU A CB    1 
ATOM   2596 C CG    . LEU C 3 279 ? 33.034  40.881 46.487  1.00 31.12 ? 575  LEU A CG    1 
ATOM   2597 C CD1   . LEU C 3 279 ? 32.830  41.547 47.822  1.00 31.58 ? 575  LEU A CD1   1 
ATOM   2598 C CD2   . LEU C 3 279 ? 31.699  40.474 45.896  1.00 30.70 ? 575  LEU A CD2   1 
ATOM   2599 N N     . HIS C 3 280 ? 35.663  43.474 43.592  1.00 30.50 ? 576  HIS A N     1 
ATOM   2600 C CA    . HIS C 3 280 ? 35.862  44.579 42.667  1.00 30.50 ? 576  HIS A CA    1 
ATOM   2601 C C     . HIS C 3 280 ? 36.516  44.021 41.415  1.00 30.49 ? 576  HIS A C     1 
ATOM   2602 O O     . HIS C 3 280 ? 36.143  44.379 40.301  1.00 31.46 ? 576  HIS A O     1 
ATOM   2603 C CB    . HIS C 3 280 ? 36.773  45.628 43.288  1.00 30.33 ? 576  HIS A CB    1 
ATOM   2604 C CG    . HIS C 3 280 ? 37.011  46.806 42.405  1.00 31.44 ? 576  HIS A CG    1 
ATOM   2605 N ND1   . HIS C 3 280 ? 35.996  47.429 41.711  1.00 31.31 ? 576  HIS A ND1   1 
ATOM   2606 C CD2   . HIS C 3 280 ? 38.149  47.477 42.098  1.00 32.24 ? 576  HIS A CD2   1 
ATOM   2607 C CE1   . HIS C 3 280 ? 36.498  48.434 41.014  1.00 31.80 ? 576  HIS A CE1   1 
ATOM   2608 N NE2   . HIS C 3 280 ? 37.801  48.484 41.231  1.00 31.88 ? 576  HIS A NE2   1 
ATOM   2609 N N     . TYR C 3 281 ? 37.495  43.143 41.604  1.00 29.74 ? 577  TYR A N     1 
ATOM   2610 C CA    . TYR C 3 281 ? 38.189  42.509 40.488  1.00 29.08 ? 577  TYR A CA    1 
ATOM   2611 C C     . TYR C 3 281 ? 37.189  41.698 39.637  1.00 28.49 ? 577  TYR A C     1 
ATOM   2612 O O     . TYR C 3 281 ? 37.280  41.638 38.408  1.00 27.41 ? 577  TYR A O     1 
ATOM   2613 C CB    . TYR C 3 281 ? 39.291  41.603 41.028  1.00 28.76 ? 577  TYR A CB    1 
ATOM   2614 C CG    . TYR C 3 281 ? 39.988  40.792 39.967  1.00 29.95 ? 577  TYR A CG    1 
ATOM   2615 C CD1   . TYR C 3 281 ? 39.487  39.564 39.579  1.00 29.35 ? 577  TYR A CD1   1 
ATOM   2616 C CD2   . TYR C 3 281 ? 41.143  41.259 39.345  1.00 29.87 ? 577  TYR A CD2   1 
ATOM   2617 C CE1   . TYR C 3 281 ? 40.106  38.826 38.611  1.00 30.72 ? 577  TYR A CE1   1 
ATOM   2618 C CE2   . TYR C 3 281 ? 41.772  40.519 38.363  1.00 29.80 ? 577  TYR A CE2   1 
ATOM   2619 C CZ    . TYR C 3 281 ? 41.247  39.305 38.004  1.00 30.97 ? 577  TYR A CZ    1 
ATOM   2620 O OH    . TYR C 3 281 ? 41.845  38.532 37.030  1.00 33.93 ? 577  TYR A OH    1 
ATOM   2621 N N     . ARG C 3 282 ? 36.219  41.087 40.298  1.00 28.29 ? 578  ARG A N     1 
ATOM   2622 C CA    . ARG C 3 282 ? 35.224  40.295 39.596  1.00 28.44 ? 578  ARG A CA    1 
ATOM   2623 C C     . ARG C 3 282 ? 34.284  41.201 38.819  1.00 28.20 ? 578  ARG A C     1 
ATOM   2624 O O     . ARG C 3 282 ? 33.736  40.807 37.792  1.00 28.38 ? 578  ARG A O     1 
ATOM   2625 C CB    . ARG C 3 282 ? 34.417  39.475 40.587  1.00 28.63 ? 578  ARG A CB    1 
ATOM   2626 C CG    . ARG C 3 282 ? 35.014  38.149 40.955  1.00 27.76 ? 578  ARG A CG    1 
ATOM   2627 C CD    . ARG C 3 282 ? 34.023  37.428 41.834  1.00 29.54 ? 578  ARG A CD    1 
ATOM   2628 N NE    . ARG C 3 282 ? 34.491  36.104 42.223  1.00 30.66 ? 578  ARG A NE    1 
ATOM   2629 C CZ    . ARG C 3 282 ? 33.843  35.315 43.065  1.00 30.20 ? 578  ARG A CZ    1 
ATOM   2630 N NH1   . ARG C 3 282 ? 32.697  35.733 43.596  1.00 29.96 ? 578  ARG A NH1   1 
ATOM   2631 N NH2   . ARG C 3 282 ? 34.342  34.115 43.374  1.00 30.51 ? 578  ARG A NH2   1 
ATOM   2632 N N     . GLN C 3 283 ? 34.072  42.407 39.331  1.00 27.96 ? 579  GLN A N     1 
ATOM   2633 C CA    . GLN C 3 283 ? 33.201  43.348 38.645  1.00 28.12 ? 579  GLN A CA    1 
ATOM   2634 C C     . GLN C 3 283 ? 33.867  43.848 37.361  1.00 26.05 ? 579  GLN A C     1 
ATOM   2635 O O     . GLN C 3 283 ? 33.275  43.780 36.289  1.00 26.00 ? 579  GLN A O     1 
ATOM   2636 C CB    . GLN C 3 283 ? 32.855  44.532 39.545  1.00 29.80 ? 579  GLN A CB    1 
ATOM   2637 C CG    . GLN C 3 283 ? 31.851  45.498 38.922  1.00 33.01 ? 579  GLN A CG    1 
ATOM   2638 C CD    . GLN C 3 283 ? 32.193  46.948 39.191  1.00 34.92 ? 579  GLN A CD    1 
ATOM   2639 O OE1   . GLN C 3 283 ? 33.128  47.246 39.936  1.00 36.73 ? 579  GLN A OE1   1 
ATOM   2640 N NE2   . GLN C 3 283 ? 31.433  47.865 38.585  1.00 37.15 ? 579  GLN A NE2   1 
ATOM   2641 N N     . LEU C 3 284 ? 35.095  44.339 37.469  1.00 24.50 ? 580  LEU A N     1 
ATOM   2642 C CA    . LEU C 3 284 ? 35.808  44.836 36.292  1.00 24.17 ? 580  LEU A CA    1 
ATOM   2643 C C     . LEU C 3 284 ? 36.011  43.708 35.294  1.00 23.48 ? 580  LEU A C     1 
ATOM   2644 O O     . LEU C 3 284 ? 35.926  43.913 34.094  1.00 23.46 ? 580  LEU A O     1 
ATOM   2645 C CB    . LEU C 3 284 ? 37.172  45.415 36.681  1.00 23.82 ? 580  LEU A CB    1 
ATOM   2646 C CG    . LEU C 3 284 ? 37.168  46.559 37.693  1.00 24.31 ? 580  LEU A CG    1 
ATOM   2647 C CD1   . LEU C 3 284 ? 38.453  47.345 37.569  1.00 24.87 ? 580  LEU A CD1   1 
ATOM   2648 C CD2   . LEU C 3 284 ? 35.955  47.452 37.454  1.00 24.74 ? 580  LEU A CD2   1 
ATOM   2649 N N     . GLY C 3 285 ? 36.278  42.514 35.811  1.00 22.98 ? 581  GLY A N     1 
ATOM   2650 C CA    . GLY C 3 285 ? 36.500  41.358 34.962  1.00 22.05 ? 581  GLY A CA    1 
ATOM   2651 C C     . GLY C 3 285 ? 35.296  40.958 34.140  1.00 20.97 ? 581  GLY A C     1 
ATOM   2652 O O     . GLY C 3 285 ? 35.446  40.528 33.009  1.00 21.46 ? 581  GLY A O     1 
ATOM   2653 N N     . LYS C 3 286 ? 34.104  41.075 34.703  1.00 21.21 ? 582  LYS A N     1 
ATOM   2654 C CA    . LYS C 3 286 ? 32.903  40.728 33.969  1.00 22.40 ? 582  LYS A CA    1 
ATOM   2655 C C     . LYS C 3 286 ? 32.685  41.781 32.891  1.00 23.06 ? 582  LYS A C     1 
ATOM   2656 O O     . LYS C 3 286 ? 32.230  41.473 31.788  1.00 22.69 ? 582  LYS A O     1 
ATOM   2657 C CB    . LYS C 3 286 ? 31.698  40.703 34.898  1.00 24.29 ? 582  LYS A CB    1 
ATOM   2658 C CG    . LYS C 3 286 ? 30.354  40.642 34.168  1.00 27.68 ? 582  LYS A CG    1 
ATOM   2659 C CD    . LYS C 3 286 ? 30.011  39.217 33.715  1.00 30.13 ? 582  LYS A CD    1 
ATOM   2660 C CE    . LYS C 3 286 ? 28.848  39.211 32.735  1.00 31.69 ? 582  LYS A CE    1 
ATOM   2661 N NZ    . LYS C 3 286 ? 28.624  37.852 32.139  1.00 33.88 ? 582  LYS A NZ    1 
ATOM   2662 N N     . LEU C 3 287 ? 33.023  43.028 33.227  1.00 22.85 ? 583  LEU A N     1 
ATOM   2663 C CA    . LEU C 3 287 ? 32.886  44.155 32.311  1.00 23.54 ? 583  LEU A CA    1 
ATOM   2664 C C     . LEU C 3 287 ? 33.800  43.967 31.098  1.00 23.13 ? 583  LEU A C     1 
ATOM   2665 O O     . LEU C 3 287 ? 33.372  44.091 29.942  1.00 22.19 ? 583  LEU A O     1 
ATOM   2666 C CB    . LEU C 3 287 ? 33.256  45.444 33.037  1.00 23.29 ? 583  LEU A CB    1 
ATOM   2667 C CG    . LEU C 3 287 ? 32.140  46.422 33.403  1.00 24.97 ? 583  LEU A CG    1 
ATOM   2668 C CD1   . LEU C 3 287 ? 30.823  45.698 33.606  1.00 22.89 ? 583  LEU A CD1   1 
ATOM   2669 C CD2   . LEU C 3 287 ? 32.571  47.210 34.659  1.00 23.34 ? 583  LEU A CD2   1 
ATOM   2670 N N     . GLN C 3 288 ? 35.060  43.656 31.378  1.00 23.03 ? 584  GLN A N     1 
ATOM   2671 C CA    . GLN C 3 288 ? 36.044  43.447 30.336  1.00 24.40 ? 584  GLN A CA    1 
ATOM   2672 C C     . GLN C 3 288 ? 35.738  42.251 29.441  1.00 24.72 ? 584  GLN A C     1 
ATOM   2673 O O     . GLN C 3 288 ? 35.657  42.377 28.217  1.00 24.06 ? 584  GLN A O     1 
ATOM   2674 C CB    . GLN C 3 288 ? 37.428  43.262 30.945  1.00 24.05 ? 584  GLN A CB    1 
ATOM   2675 C CG    . GLN C 3 288 ? 38.518  43.030 29.917  1.00 26.55 ? 584  GLN A CG    1 
ATOM   2676 C CD    . GLN C 3 288 ? 39.145  44.337 29.459  1.00 28.44 ? 584  GLN A CD    1 
ATOM   2677 O OE1   . GLN C 3 288 ? 38.517  45.134 28.759  1.00 28.98 ? 584  GLN A OE1   1 
ATOM   2678 N NE2   . GLN C 3 288 ? 40.384  44.567 29.864  1.00 29.94 ? 584  GLN A NE2   1 
ATOM   2679 N N     . SER C 3 289 ? 35.553  41.090 30.051  1.00 25.05 ? 585  SER A N     1 
ATOM   2680 C CA    . SER C 3 289 ? 35.311  39.879 29.282  1.00 26.49 ? 585  SER A CA    1 
ATOM   2681 C C     . SER C 3 289 ? 34.007  39.831 28.499  1.00 26.33 ? 585  SER A C     1 
ATOM   2682 O O     . SER C 3 289 ? 33.996  39.465 27.316  1.00 26.33 ? 585  SER A O     1 
ATOM   2683 C CB    . SER C 3 289 ? 35.393  38.654 30.202  1.00 27.40 ? 585  SER A CB    1 
ATOM   2684 O OG    . SER C 3 289 ? 34.149  38.435 30.864  1.00 30.42 ? 585  SER A OG    1 
ATOM   2685 N N     . THR C 3 290 ? 32.911  40.191 29.152  1.00 26.05 ? 586  THR A N     1 
ATOM   2686 C CA    . THR C 3 290 ? 31.598  40.138 28.515  1.00 26.45 ? 586  THR A CA    1 
ATOM   2687 C C     . THR C 3 290 ? 31.168  41.416 27.798  1.00 26.90 ? 586  THR A C     1 
ATOM   2688 O O     . THR C 3 290 ? 30.672  41.361 26.676  1.00 27.25 ? 586  THR A O     1 
ATOM   2689 C CB    . THR C 3 290 ? 30.485  39.790 29.554  1.00 26.83 ? 586  THR A CB    1 
ATOM   2690 O OG1   . THR C 3 290 ? 30.792  38.544 30.184  1.00 28.43 ? 586  THR A OG1   1 
ATOM   2691 C CG2   . THR C 3 290 ? 29.117  39.691 28.889  1.00 25.90 ? 586  THR A CG2   1 
ATOM   2692 N N     . TYR C 3 291 ? 31.369  42.565 28.427  1.00 25.93 ? 587  TYR A N     1 
ATOM   2693 C CA    . TYR C 3 291 ? 30.909  43.798 27.826  1.00 26.73 ? 587  TYR A CA    1 
ATOM   2694 C C     . TYR C 3 291 ? 31.850  44.655 26.963  1.00 27.71 ? 587  TYR A C     1 
ATOM   2695 O O     . TYR C 3 291 ? 31.398  45.623 26.340  1.00 29.96 ? 587  TYR A O     1 
ATOM   2696 C CB    . TYR C 3 291 ? 30.243  44.619 28.914  1.00 25.19 ? 587  TYR A CB    1 
ATOM   2697 C CG    . TYR C 3 291 ? 29.140  43.822 29.590  1.00 24.24 ? 587  TYR A CG    1 
ATOM   2698 C CD1   . TYR C 3 291 ? 27.914  43.605 28.946  1.00 23.92 ? 587  TYR A CD1   1 
ATOM   2699 C CD2   . TYR C 3 291 ? 29.310  43.308 30.867  1.00 22.45 ? 587  TYR A CD2   1 
ATOM   2700 C CE1   . TYR C 3 291 ? 26.894  42.907 29.555  1.00 22.81 ? 587  TYR A CE1   1 
ATOM   2701 C CE2   . TYR C 3 291 ? 28.292  42.606 31.489  1.00 23.44 ? 587  TYR A CE2   1 
ATOM   2702 C CZ    . TYR C 3 291 ? 27.087  42.411 30.831  1.00 23.11 ? 587  TYR A CZ    1 
ATOM   2703 O OH    . TYR C 3 291 ? 26.070  41.730 31.460  1.00 23.46 ? 587  TYR A OH    1 
ATOM   2704 N N     . ILE C 3 292 ? 33.139  44.333 26.922  1.00 26.55 ? 588  ILE A N     1 
ATOM   2705 C CA    . ILE C 3 292 ? 34.039  45.071 26.039  1.00 26.25 ? 588  ILE A CA    1 
ATOM   2706 C C     . ILE C 3 292 ? 34.508  44.079 24.966  1.00 26.15 ? 588  ILE A C     1 
ATOM   2707 O O     . ILE C 3 292 ? 34.241  44.262 23.776  1.00 26.57 ? 588  ILE A O     1 
ATOM   2708 C CB    . ILE C 3 292 ? 35.312  45.604 26.732  1.00 25.60 ? 588  ILE A CB    1 
ATOM   2709 C CG1   . ILE C 3 292 ? 34.961  46.602 27.836  1.00 25.54 ? 588  ILE A CG1   1 
ATOM   2710 C CG2   . ILE C 3 292 ? 36.211  46.252 25.683  1.00 24.57 ? 588  ILE A CG2   1 
ATOM   2711 C CD1   . ILE C 3 292 ? 34.066  47.703 27.396  1.00 26.67 ? 588  ILE A CD1   1 
ATOM   2712 N N     . GLU C 3 293 ? 35.197  43.025 25.408  1.00 25.41 ? 589  GLU A N     1 
ATOM   2713 C CA    . GLU C 3 293 ? 35.732  41.999 24.515  1.00 25.08 ? 589  GLU A CA    1 
ATOM   2714 C C     . GLU C 3 293 ? 34.645  41.212 23.798  1.00 24.36 ? 589  GLU A C     1 
ATOM   2715 O O     . GLU C 3 293 ? 34.700  41.005 22.578  1.00 23.92 ? 589  GLU A O     1 
ATOM   2716 C CB    . GLU C 3 293 ? 36.622  41.044 25.303  1.00 26.47 ? 589  GLU A CB    1 
ATOM   2717 C CG    . GLU C 3 293 ? 37.968  41.634 25.716  1.00 28.50 ? 589  GLU A CG    1 
ATOM   2718 C CD    . GLU C 3 293 ? 38.737  40.726 26.690  1.00 30.20 ? 589  GLU A CD    1 
ATOM   2719 O OE1   . GLU C 3 293 ? 38.179  39.690 27.134  1.00 31.72 ? 589  GLU A OE1   1 
ATOM   2720 O OE2   . GLU C 3 293 ? 39.898  41.048 27.013  1.00 30.82 ? 589  GLU A OE2   1 
ATOM   2721 N N     . GLY C 3 294 ? 33.650  40.776 24.554  1.00 22.63 ? 590  GLY A N     1 
ATOM   2722 C CA    . GLY C 3 294 ? 32.568  40.031 23.955  1.00 23.16 ? 590  GLY A CA    1 
ATOM   2723 C C     . GLY C 3 294 ? 31.758  40.867 22.985  1.00 23.78 ? 590  GLY A C     1 
ATOM   2724 O O     . GLY C 3 294 ? 31.378  40.391 21.914  1.00 24.22 ? 590  GLY A O     1 
ATOM   2725 N N     . LEU C 3 295 ? 31.476  42.111 23.362  1.00 23.72 ? 591  LEU A N     1 
ATOM   2726 C CA    . LEU C 3 295 ? 30.707  43.022 22.521  1.00 24.22 ? 591  LEU A CA    1 
ATOM   2727 C C     . LEU C 3 295 ? 31.460  43.251 21.212  1.00 24.38 ? 591  LEU A C     1 
ATOM   2728 O O     . LEU C 3 295 ? 30.918  43.067 20.122  1.00 24.94 ? 591  LEU A O     1 
ATOM   2729 C CB    . LEU C 3 295 ? 30.519  44.353 23.249  1.00 23.39 ? 591  LEU A CB    1 
ATOM   2730 C CG    . LEU C 3 295 ? 29.385  45.246 22.796  1.00 23.02 ? 591  LEU A CG    1 
ATOM   2731 C CD1   . LEU C 3 295 ? 28.186  44.395 22.459  1.00 23.31 ? 591  LEU A CD1   1 
ATOM   2732 C CD2   . LEU C 3 295 ? 29.036  46.220 23.910  1.00 23.47 ? 591  LEU A CD2   1 
ATOM   2733 N N     . LEU C 3 296 ? 32.719  43.652 21.346  1.00 24.69 ? 592  LEU A N     1 
ATOM   2734 C CA    . LEU C 3 296 ? 33.570  43.914 20.208  1.00 25.56 ? 592  LEU A CA    1 
ATOM   2735 C C     . LEU C 3 296 ? 33.588  42.724 19.236  1.00 26.39 ? 592  LEU A C     1 
ATOM   2736 O O     . LEU C 3 296 ? 33.622  42.911 18.023  1.00 27.64 ? 592  LEU A O     1 
ATOM   2737 C CB    . LEU C 3 296 ? 34.978  44.263 20.695  1.00 25.00 ? 592  LEU A CB    1 
ATOM   2738 C CG    . LEU C 3 296 ? 35.091  45.624 21.403  1.00 25.50 ? 592  LEU A CG    1 
ATOM   2739 C CD1   . LEU C 3 296 ? 36.531  45.907 21.823  1.00 25.21 ? 592  LEU A CD1   1 
ATOM   2740 C CD2   . LEU C 3 296 ? 34.615  46.708 20.471  1.00 25.76 ? 592  LEU A CD2   1 
ATOM   2741 N N     . LYS C 3 297 ? 33.539  41.499 19.740  1.00 25.73 ? 593  LYS A N     1 
ATOM   2742 C CA    . LYS C 3 297 ? 33.537  40.358 18.832  1.00 25.02 ? 593  LYS A CA    1 
ATOM   2743 C C     . LYS C 3 297 ? 32.313  40.292 17.933  1.00 23.96 ? 593  LYS A C     1 
ATOM   2744 O O     . LYS C 3 297 ? 32.414  39.823 16.807  1.00 25.02 ? 593  LYS A O     1 
ATOM   2745 C CB    . LYS C 3 297 ? 33.618  39.046 19.601  1.00 26.43 ? 593  LYS A CB    1 
ATOM   2746 C CG    . LYS C 3 297 ? 34.932  38.825 20.273  1.00 29.57 ? 593  LYS A CG    1 
ATOM   2747 C CD    . LYS C 3 297 ? 34.900  37.576 21.140  1.00 32.33 ? 593  LYS A CD    1 
ATOM   2748 C CE    . LYS C 3 297 ? 36.289  37.315 21.718  1.00 34.88 ? 593  LYS A CE    1 
ATOM   2749 N NZ    . LYS C 3 297 ? 36.304  36.053 22.512  1.00 37.77 ? 593  LYS A NZ    1 
ATOM   2750 N N     . VAL C 3 298 ? 31.152  40.735 18.406  1.00 22.29 ? 594  VAL A N     1 
ATOM   2751 C CA    . VAL C 3 298 ? 29.965  40.637 17.565  1.00 21.33 ? 594  VAL A CA    1 
ATOM   2752 C C     . VAL C 3 298 ? 29.567  41.912 16.843  1.00 21.41 ? 594  VAL A C     1 
ATOM   2753 O O     . VAL C 3 298 ? 28.472  41.991 16.280  1.00 21.27 ? 594  VAL A O     1 
ATOM   2754 C CB    . VAL C 3 298 ? 28.704  40.146 18.334  1.00 21.53 ? 594  VAL A CB    1 
ATOM   2755 C CG1   . VAL C 3 298 ? 28.777  38.659 18.538  1.00 21.46 ? 594  VAL A CG1   1 
ATOM   2756 C CG2   . VAL C 3 298 ? 28.537  40.911 19.645  1.00 20.99 ? 594  VAL A CG2   1 
ATOM   2757 N N     . VAL C 3 299 ? 30.428  42.918 16.862  1.00 20.82 ? 595  VAL A N     1 
ATOM   2758 C CA    . VAL C 3 299 ? 30.105  44.140 16.143  1.00 21.06 ? 595  VAL A CA    1 
ATOM   2759 C C     . VAL C 3 299 ? 30.476  43.895 14.666  1.00 20.15 ? 595  VAL A C     1 
ATOM   2760 O O     . VAL C 3 299 ? 31.520  43.318 14.395  1.00 19.19 ? 595  VAL A O     1 
ATOM   2761 C CB    . VAL C 3 299 ? 30.924  45.324 16.693  1.00 20.92 ? 595  VAL A CB    1 
ATOM   2762 C CG1   . VAL C 3 299 ? 30.744  46.554 15.788  1.00 20.71 ? 595  VAL A CG1   1 
ATOM   2763 C CG2   . VAL C 3 299 ? 30.473  45.631 18.141  1.00 21.70 ? 595  VAL A CG2   1 
ATOM   2764 N N     . ARG C 3 300 ? 29.623  44.284 13.718  1.00 20.98 ? 596  ARG A N     1 
ATOM   2765 C CA    . ARG C 3 300 ? 29.989  44.111 12.300  1.00 21.70 ? 596  ARG A CA    1 
ATOM   2766 C C     . ARG C 3 300 ? 30.937  45.257 11.975  1.00 21.88 ? 596  ARG A C     1 
ATOM   2767 O O     . ARG C 3 300 ? 30.617  46.420 12.192  1.00 21.45 ? 596  ARG A O     1 
ATOM   2768 C CB    . ARG C 3 300 ? 28.770  44.158 11.379  1.00 21.45 ? 596  ARG A CB    1 
ATOM   2769 C CG    . ARG C 3 300 ? 27.592  43.387 11.911  1.00 23.48 ? 596  ARG A CG    1 
ATOM   2770 C CD    . ARG C 3 300 ? 26.980  42.436 10.905  1.00 24.76 ? 596  ARG A CD    1 
ATOM   2771 N NE    . ARG C 3 300 ? 26.342  41.331 11.620  1.00 26.86 ? 596  ARG A NE    1 
ATOM   2772 C CZ    . ARG C 3 300 ? 26.065  40.129 11.107  1.00 26.66 ? 596  ARG A CZ    1 
ATOM   2773 N NH1   . ARG C 3 300 ? 26.359  39.828 9.844   1.00 24.36 ? 596  ARG A NH1   1 
ATOM   2774 N NH2   . ARG C 3 300 ? 25.512  39.210 11.889  1.00 27.37 ? 596  ARG A NH2   1 
ATOM   2775 N N     . PRO C 3 301 ? 32.127  44.937 11.459  1.00 22.69 ? 597  PRO A N     1 
ATOM   2776 C CA    . PRO C 3 301 ? 33.103  45.975 11.126  1.00 23.96 ? 597  PRO A CA    1 
ATOM   2777 C C     . PRO C 3 301 ? 32.684  46.955 10.024  1.00 24.74 ? 597  PRO A C     1 
ATOM   2778 O O     . PRO C 3 301 ? 33.129  48.105 9.994   1.00 25.52 ? 597  PRO A O     1 
ATOM   2779 C CB    . PRO C 3 301 ? 34.355  45.185 10.752  1.00 24.08 ? 597  PRO A CB    1 
ATOM   2780 C CG    . PRO C 3 301 ? 33.862  43.834 10.379  1.00 24.11 ? 597  PRO A CG    1 
ATOM   2781 C CD    . PRO C 3 301 ? 32.616  43.583 11.148  1.00 22.82 ? 597  PRO A CD    1 
ATOM   2782 N N     . ASP C 3 302 ? 31.822  46.508 9.126   1.00 24.60 ? 598  ASP A N     1 
ATOM   2783 C CA    . ASP C 3 302 ? 31.418  47.364 8.040   1.00 24.22 ? 598  ASP A CA    1 
ATOM   2784 C C     . ASP C 3 302 ? 30.462  48.438 8.517   1.00 24.02 ? 598  ASP A C     1 
ATOM   2785 O O     . ASP C 3 302 ? 30.525  49.567 8.048   1.00 25.09 ? 598  ASP A O     1 
ATOM   2786 C CB    . ASP C 3 302 ? 30.778  46.529 6.916   1.00 23.94 ? 598  ASP A CB    1 
ATOM   2787 C CG    . ASP C 3 302 ? 29.755  45.542 7.436   1.00 23.80 ? 598  ASP A CG    1 
ATOM   2788 O OD1   . ASP C 3 302 ? 30.077  44.800 8.383   1.00 24.15 ? 598  ASP A OD1   1 
ATOM   2789 O OD2   . ASP C 3 302 ? 28.629  45.515 6.907   1.00 23.35 ? 598  ASP A OD2   1 
ATOM   2790 N N     . THR C 3 303 ? 29.591  48.112 9.459   1.00 22.92 ? 599  THR A N     1 
ATOM   2791 C CA    . THR C 3 303 ? 28.631  49.101 9.933   1.00 21.42 ? 599  THR A CA    1 
ATOM   2792 C C     . THR C 3 303 ? 28.778  49.518 11.401  1.00 21.42 ? 599  THR A C     1 
ATOM   2793 O O     . THR C 3 303 ? 28.091  50.430 11.857  1.00 21.25 ? 599  THR A O     1 
ATOM   2794 C CB    . THR C 3 303 ? 27.197  48.601 9.746   1.00 20.69 ? 599  THR A CB    1 
ATOM   2795 O OG1   . THR C 3 303 ? 27.026  47.403 10.509  1.00 20.19 ? 599  THR A OG1   1 
ATOM   2796 C CG2   . THR C 3 303 ? 26.891  48.333 8.258   1.00 18.95 ? 599  THR A CG2   1 
ATOM   2797 N N     . LYS C 3 304 ? 29.677  48.869 12.127  1.00 21.20 ? 600  LYS A N     1 
ATOM   2798 C CA    . LYS C 3 304 ? 29.858  49.146 13.548  1.00 21.37 ? 600  LYS A CA    1 
ATOM   2799 C C     . LYS C 3 304 ? 28.523  48.929 14.276  1.00 20.64 ? 600  LYS A C     1 
ATOM   2800 O O     . LYS C 3 304 ? 28.251  49.536 15.313  1.00 21.16 ? 600  LYS A O     1 
ATOM   2801 C CB    . LYS C 3 304 ? 30.387  50.565 13.765  1.00 22.97 ? 600  LYS A CB    1 
ATOM   2802 C CG    . LYS C 3 304 ? 31.927  50.682 13.687  1.00 25.65 ? 600  LYS A CG    1 
ATOM   2803 C CD    . LYS C 3 304 ? 32.410  52.132 14.021  1.00 28.88 ? 600  LYS A CD    1 
ATOM   2804 C CE    . LYS C 3 304 ? 33.874  52.429 13.571  1.00 29.15 ? 600  LYS A CE    1 
ATOM   2805 N NZ    . LYS C 3 304 ? 34.643  53.375 14.490  1.00 29.83 ? 600  LYS A NZ    1 
ATOM   2806 N N     . LYS C 3 305 ? 27.693  48.043 13.722  1.00 19.30 ? 601  LYS A N     1 
ATOM   2807 C CA    . LYS C 3 305 ? 26.412  47.697 14.324  1.00 19.20 ? 601  LYS A CA    1 
ATOM   2808 C C     . LYS C 3 305 ? 26.425  46.282 14.929  1.00 19.20 ? 601  LYS A C     1 
ATOM   2809 O O     . LYS C 3 305 ? 27.188  45.398 14.515  1.00 18.58 ? 601  LYS A O     1 
ATOM   2810 C CB    . LYS C 3 305 ? 25.270  47.771 13.318  1.00 18.39 ? 601  LYS A CB    1 
ATOM   2811 C CG    . LYS C 3 305 ? 24.648  49.147 13.159  1.00 19.62 ? 601  LYS A CG    1 
ATOM   2812 C CD    . LYS C 3 305 ? 23.669  49.106 11.994  1.00 20.74 ? 601  LYS A CD    1 
ATOM   2813 C CE    . LYS C 3 305 ? 22.846  50.363 11.884  1.00 21.16 ? 601  LYS A CE    1 
ATOM   2814 N NZ    . LYS C 3 305 ? 21.746  50.062 10.937  1.00 22.79 ? 601  LYS A NZ    1 
ATOM   2815 N N     . VAL C 3 306 ? 25.560  46.102 15.923  1.00 18.90 ? 602  VAL A N     1 
ATOM   2816 C CA    . VAL C 3 306 ? 25.405  44.848 16.621  1.00 17.71 ? 602  VAL A CA    1 
ATOM   2817 C C     . VAL C 3 306 ? 23.955  44.431 16.341  1.00 16.79 ? 602  VAL A C     1 
ATOM   2818 O O     . VAL C 3 306 ? 23.025  45.237 16.489  1.00 17.16 ? 602  VAL A O     1 
ATOM   2819 C CB    . VAL C 3 306 ? 25.726  45.098 18.122  1.00 18.29 ? 602  VAL A CB    1 
ATOM   2820 C CG1   . VAL C 3 306 ? 24.475  45.112 18.958  1.00 18.17 ? 602  VAL A CG1   1 
ATOM   2821 C CG2   . VAL C 3 306 ? 26.756  44.130 18.587  1.00 18.15 ? 602  VAL A CG2   1 
ATOM   2822 N N     . HIS C 3 307 ? 23.764  43.195 15.865  1.00 16.41 ? 603  HIS A N     1 
ATOM   2823 C CA    . HIS C 3 307 ? 22.422  42.681 15.547  1.00 15.87 ? 603  HIS A CA    1 
ATOM   2824 C C     . HIS C 3 307 ? 22.053  41.478 16.400  1.00 16.15 ? 603  HIS A C     1 
ATOM   2825 O O     . HIS C 3 307 ? 22.431  40.347 16.088  1.00 16.09 ? 603  HIS A O     1 
ATOM   2826 C CB    . HIS C 3 307 ? 22.310  42.262 14.080  1.00 15.39 ? 603  HIS A CB    1 
ATOM   2827 C CG    . HIS C 3 307 ? 22.625  43.358 13.120  1.00 14.98 ? 603  HIS A CG    1 
ATOM   2828 N ND1   . HIS C 3 307 ? 21.647  44.128 12.526  1.00 15.31 ? 603  HIS A ND1   1 
ATOM   2829 C CD2   . HIS C 3 307 ? 23.812  43.841 12.681  1.00 14.71 ? 603  HIS A CD2   1 
ATOM   2830 C CE1   . HIS C 3 307 ? 22.220  45.040 11.757  1.00 14.99 ? 603  HIS A CE1   1 
ATOM   2831 N NE2   . HIS C 3 307 ? 23.531  44.886 11.835  1.00 15.83 ? 603  HIS A NE2   1 
ATOM   2832 N N     . THR C 3 308 ? 21.296  41.732 17.459  1.00 15.68 ? 604  THR A N     1 
ATOM   2833 C CA    . THR C 3 308 ? 20.845  40.678 18.364  1.00 15.36 ? 604  THR A CA    1 
ATOM   2834 C C     . THR C 3 308 ? 19.791  39.804 17.679  1.00 15.93 ? 604  THR A C     1 
ATOM   2835 O O     . THR C 3 308 ? 19.257  40.158 16.621  1.00 15.67 ? 604  THR A O     1 
ATOM   2836 C CB    . THR C 3 308 ? 20.207  41.297 19.671  1.00 14.06 ? 604  THR A CB    1 
ATOM   2837 O OG1   . THR C 3 308 ? 20.109  40.297 20.692  1.00 13.37 ? 604  THR A OG1   1 
ATOM   2838 C CG2   . THR C 3 308 ? 18.821  41.841 19.403  1.00 11.02 ? 604  THR A CG2   1 
ATOM   2839 N N     . ILE C 3 309 ? 19.517  38.646 18.272  1.00 15.88 ? 605  ILE A N     1 
ATOM   2840 C CA    . ILE C 3 309 ? 18.455  37.782 17.784  1.00 14.49 ? 605  ILE A CA    1 
ATOM   2841 C C     . ILE C 3 309 ? 17.586  37.619 19.020  1.00 14.89 ? 605  ILE A C     1 
ATOM   2842 O O     . ILE C 3 309 ? 18.082  37.218 20.070  1.00 14.25 ? 605  ILE A O     1 
ATOM   2843 C CB    . ILE C 3 309 ? 18.982  36.410 17.309  1.00 14.58 ? 605  ILE A CB    1 
ATOM   2844 C CG1   . ILE C 3 309 ? 19.673  36.573 15.948  1.00 14.77 ? 605  ILE A CG1   1 
ATOM   2845 C CG2   . ILE C 3 309 ? 17.831  35.432 17.206  1.00 14.53 ? 605  ILE A CG2   1 
ATOM   2846 C CD1   . ILE C 3 309 ? 20.097  35.280 15.277  1.00 14.73 ? 605  ILE A CD1   1 
ATOM   2847 N N     . PHE C 3 310 ? 16.313  37.978 18.921  1.00 15.46 ? 606  PHE A N     1 
ATOM   2848 C CA    . PHE C 3 310 ? 15.405  37.838 20.061  1.00 17.22 ? 606  PHE A CA    1 
ATOM   2849 C C     . PHE C 3 310 ? 14.756  36.475 19.988  1.00 17.36 ? 606  PHE A C     1 
ATOM   2850 O O     . PHE C 3 310 ? 14.029  36.205 19.028  1.00 18.46 ? 606  PHE A O     1 
ATOM   2851 C CB    . PHE C 3 310 ? 14.279  38.888 20.041  1.00 17.94 ? 606  PHE A CB    1 
ATOM   2852 C CG    . PHE C 3 310 ? 14.722  40.267 20.461  1.00 20.30 ? 606  PHE A CG    1 
ATOM   2853 C CD1   . PHE C 3 310 ? 15.056  40.536 21.783  1.00 19.21 ? 606  PHE A CD1   1 
ATOM   2854 C CD2   . PHE C 3 310 ? 14.832  41.295 19.519  1.00 20.60 ? 606  PHE A CD2   1 
ATOM   2855 C CE1   . PHE C 3 310 ? 15.492  41.795 22.163  1.00 19.88 ? 606  PHE A CE1   1 
ATOM   2856 C CE2   . PHE C 3 310 ? 15.266  42.554 19.901  1.00 20.53 ? 606  PHE A CE2   1 
ATOM   2857 C CZ    . PHE C 3 310 ? 15.598  42.807 21.224  1.00 19.72 ? 606  PHE A CZ    1 
ATOM   2858 N N     . ASN C 3 311 ? 15.033  35.611 20.964  1.00 15.45 ? 607  ASN A N     1 
ATOM   2859 C CA    . ASN C 3 311 ? 14.390  34.317 20.967  1.00 13.82 ? 607  ASN A CA    1 
ATOM   2860 C C     . ASN C 3 311 ? 12.996  34.583 21.484  1.00 13.88 ? 607  ASN A C     1 
ATOM   2861 O O     . ASN C 3 311 ? 12.819  34.916 22.649  1.00 15.40 ? 607  ASN A O     1 
ATOM   2862 C CB    . ASN C 3 311 ? 15.126  33.340 21.882  1.00 13.90 ? 607  ASN A CB    1 
ATOM   2863 C CG    . ASN C 3 311 ? 14.681  31.905 21.665  1.00 13.69 ? 607  ASN A CG    1 
ATOM   2864 O OD1   . ASN C 3 311 ? 13.506  31.638 21.427  1.00 12.79 ? 607  ASN A OD1   1 
ATOM   2865 N ND2   . ASN C 3 311 ? 15.621  30.976 21.737  1.00 14.95 ? 607  ASN A ND2   1 
ATOM   2866 N N     . GLN C 3 312 ? 11.994  34.422 20.630  1.00 13.55 ? 608  GLN A N     1 
ATOM   2867 C CA    . GLN C 3 312 ? 10.604  34.681 21.002  1.00 12.96 ? 608  GLN A CA    1 
ATOM   2868 C C     . GLN C 3 312 ? 9.847   33.431 21.493  1.00 13.80 ? 608  GLN A C     1 
ATOM   2869 O O     . GLN C 3 312 ? 8.689   33.532 21.921  1.00 13.57 ? 608  GLN A O     1 
ATOM   2870 C CB    . GLN C 3 312 ? 9.878   35.284 19.781  1.00 12.14 ? 608  GLN A CB    1 
ATOM   2871 C CG    . GLN C 3 312 ? 8.433   35.739 19.993  1.00 11.40 ? 608  GLN A CG    1 
ATOM   2872 C CD    . GLN C 3 312 ? 7.777   36.218 18.701  1.00 10.59 ? 608  GLN A CD    1 
ATOM   2873 O OE1   . GLN C 3 312 ? 8.435   36.316 17.688  1.00 13.74 ? 608  GLN A OE1   1 
ATOM   2874 N NE2   . GLN C 3 312 ? 6.492   36.503 18.739  1.00 9.80  ? 608  GLN A NE2   1 
ATOM   2875 N N     . ALA C 3 313 ? 10.486  32.261 21.440  1.00 14.23 ? 609  ALA A N     1 
ATOM   2876 C CA    . ALA C 3 313 ? 9.787   31.032 21.827  1.00 15.14 ? 609  ALA A CA    1 
ATOM   2877 C C     . ALA C 3 313 ? 10.605  30.166 22.773  1.00 16.35 ? 609  ALA A C     1 
ATOM   2878 O O     . ALA C 3 313 ? 10.709  28.956 22.597  1.00 16.93 ? 609  ALA A O     1 
ATOM   2879 C CB    . ALA C 3 313 ? 9.432   30.247 20.574  1.00 14.84 ? 609  ALA A CB    1 
ATOM   2880 N N     . LEU C 3 314 ? 11.174  30.791 23.795  1.00 16.15 ? 610  LEU A N     1 
ATOM   2881 C CA    . LEU C 3 314 ? 12.007  30.081 24.741  1.00 16.48 ? 610  LEU A CA    1 
ATOM   2882 C C     . LEU C 3 314 ? 11.546  30.174 26.213  1.00 17.67 ? 610  LEU A C     1 
ATOM   2883 O O     . LEU C 3 314 ? 11.381  29.148 26.881  1.00 17.22 ? 610  LEU A O     1 
ATOM   2884 C CB    . LEU C 3 314 ? 13.437  30.595 24.613  1.00 16.11 ? 610  LEU A CB    1 
ATOM   2885 C CG    . LEU C 3 314 ? 14.398  30.109 25.690  1.00 17.91 ? 610  LEU A CG    1 
ATOM   2886 C CD1   . LEU C 3 314 ? 14.705  28.664 25.412  1.00 20.81 ? 610  LEU A CD1   1 
ATOM   2887 C CD2   . LEU C 3 314 ? 15.674  30.879 25.672  1.00 18.97 ? 610  LEU A CD2   1 
ATOM   2888 N N     . THR C 3 315 ? 11.319  31.387 26.717  1.00 17.44 ? 611  THR A N     1 
ATOM   2889 C CA    . THR C 3 315 ? 10.956  31.535 28.121  1.00 17.75 ? 611  THR A CA    1 
ATOM   2890 C C     . THR C 3 315 ? 9.640   30.929 28.553  1.00 17.61 ? 611  THR A C     1 
ATOM   2891 O O     . THR C 3 315 ? 8.672   30.881 27.810  1.00 17.93 ? 611  THR A O     1 
ATOM   2892 C CB    . THR C 3 315 ? 11.002  33.027 28.569  1.00 17.53 ? 611  THR A CB    1 
ATOM   2893 O OG1   . THR C 3 315 ? 9.794   33.693 28.171  1.00 17.62 ? 611  THR A OG1   1 
ATOM   2894 C CG2   . THR C 3 315 ? 12.210  33.719 27.966  1.00 16.52 ? 611  THR A CG2   1 
ATOM   2895 N N     . GLN C 3 316 ? 9.617   30.473 29.794  1.00 18.45 ? 612  GLN A N     1 
ATOM   2896 C CA    . GLN C 3 316 ? 8.436   29.855 30.348  1.00 19.24 ? 612  GLN A CA    1 
ATOM   2897 C C     . GLN C 3 316 ? 7.350   30.850 30.728  1.00 19.75 ? 612  GLN A C     1 
ATOM   2898 O O     . GLN C 3 316 ? 6.216   30.447 30.969  1.00 21.08 ? 612  GLN A O     1 
ATOM   2899 C CB    . GLN C 3 316 ? 8.844   29.029 31.561  1.00 20.34 ? 612  GLN A CB    1 
ATOM   2900 C CG    . GLN C 3 316 ? 9.930   28.039 31.221  1.00 20.64 ? 612  GLN A CG    1 
ATOM   2901 C CD    . GLN C 3 316 ? 9.482   27.121 30.105  1.00 22.06 ? 612  GLN A CD    1 
ATOM   2902 O OE1   . GLN C 3 316 ? 8.436   26.485 30.201  1.00 21.55 ? 612  GLN A OE1   1 
ATOM   2903 N NE2   . GLN C 3 316 ? 10.262  27.066 29.029  1.00 23.12 ? 612  GLN A NE2   1 
ATOM   2904 N N     . THR C 3 317 ? 7.682   32.143 30.765  1.00 20.11 ? 613  THR A N     1 
ATOM   2905 C CA    . THR C 3 317 ? 6.702   33.188 31.125  1.00 20.33 ? 613  THR A CA    1 
ATOM   2906 C C     . THR C 3 317 ? 6.136   34.050 29.987  1.00 20.24 ? 613  THR A C     1 
ATOM   2907 O O     . THR C 3 317 ? 5.189   34.805 30.205  1.00 21.44 ? 613  THR A O     1 
ATOM   2908 C CB    . THR C 3 317 ? 7.280   34.183 32.151  1.00 19.91 ? 613  THR A CB    1 
ATOM   2909 O OG1   . THR C 3 317 ? 8.558   34.659 31.699  1.00 18.24 ? 613  THR A OG1   1 
ATOM   2910 C CG2   . THR C 3 317 ? 7.425   33.502 33.518  1.00 20.39 ? 613  THR A CG2   1 
ATOM   2911 N N     . GLY C 3 318 ? 6.703   33.949 28.787  1.00 19.51 ? 614  GLY A N     1 
ATOM   2912 C CA    . GLY C 3 318 ? 6.208   34.771 27.701  1.00 18.41 ? 614  GLY A CA    1 
ATOM   2913 C C     . GLY C 3 318 ? 7.152   35.931 27.430  1.00 17.88 ? 614  GLY A C     1 
ATOM   2914 O O     . GLY C 3 318 ? 6.886   36.770 26.577  1.00 17.80 ? 614  GLY A O     1 
ATOM   2915 N N     . ARG C 3 319 ? 8.252   35.987 28.177  1.00 17.46 ? 615  ARG A N     1 
ATOM   2916 C CA    . ARG C 3 319 ? 9.256   37.022 27.994  1.00 16.75 ? 615  ARG A CA    1 
ATOM   2917 C C     . ARG C 3 319 ? 10.096  36.619 26.787  1.00 17.06 ? 615  ARG A C     1 
ATOM   2918 O O     . ARG C 3 319 ? 10.051  35.472 26.337  1.00 17.17 ? 615  ARG A O     1 
ATOM   2919 C CB    . ARG C 3 319 ? 10.198  37.090 29.193  1.00 17.92 ? 615  ARG A CB    1 
ATOM   2920 C CG    . ARG C 3 319 ? 9.784   37.988 30.356  1.00 17.40 ? 615  ARG A CG    1 
ATOM   2921 C CD    . ARG C 3 319 ? 10.945  38.056 31.345  1.00 17.61 ? 615  ARG A CD    1 
ATOM   2922 N NE    . ARG C 3 319 ? 10.706  39.013 32.429  1.00 20.33 ? 615  ARG A NE    1 
ATOM   2923 C CZ    . ARG C 3 319 ? 11.620  39.387 33.334  1.00 20.00 ? 615  ARG A CZ    1 
ATOM   2924 N NH1   . ARG C 3 319 ? 12.865  38.904 33.324  1.00 17.50 ? 615  ARG A NH1   1 
ATOM   2925 N NH2   . ARG C 3 319 ? 11.276  40.262 34.265  1.00 20.33 ? 615  ARG A NH2   1 
ATOM   2926 N N     . LEU C 3 320 ? 10.860  37.568 26.266  1.00 16.84 ? 616  LEU A N     1 
ATOM   2927 C CA    . LEU C 3 320 ? 11.763  37.306 25.153  1.00 16.63 ? 616  LEU A CA    1 
ATOM   2928 C C     . LEU C 3 320 ? 13.108  37.102 25.813  1.00 17.40 ? 616  LEU A C     1 
ATOM   2929 O O     . LEU C 3 320 ? 13.263  37.385 27.021  1.00 17.48 ? 616  LEU A O     1 
ATOM   2930 C CB    . LEU C 3 320 ? 11.897  38.531 24.238  1.00 14.66 ? 616  LEU A CB    1 
ATOM   2931 C CG    . LEU C 3 320 ? 10.630  39.209 23.738  1.00 13.53 ? 616  LEU A CG    1 
ATOM   2932 C CD1   . LEU C 3 320 ? 11.030  40.550 23.060  1.00 12.11 ? 616  LEU A CD1   1 
ATOM   2933 C CD2   . LEU C 3 320 ? 9.888   38.275 22.771  1.00 11.40 ? 616  LEU A CD2   1 
ATOM   2934 N N     . SER C 3 321 ? 14.067  36.595 25.036  1.00 16.29 ? 617  SER A N     1 
ATOM   2935 C CA    . SER C 3 321 ? 15.429  36.478 25.514  1.00 16.30 ? 617  SER A CA    1 
ATOM   2936 C C     . SER C 3 321 ? 16.198  37.088 24.341  1.00 16.22 ? 617  SER A C     1 
ATOM   2937 O O     . SER C 3 321 ? 15.640  37.234 23.242  1.00 14.81 ? 617  SER A O     1 
ATOM   2938 C CB    . SER C 3 321 ? 15.826  35.028 25.819  1.00 15.94 ? 617  SER A CB    1 
ATOM   2939 O OG    . SER C 3 321 ? 16.107  34.287 24.651  1.00 18.58 ? 617  SER A OG    1 
ATOM   2940 N N     . SER C 3 322 ? 17.445  37.471 24.589  1.00 15.97 ? 618  SER A N     1 
ATOM   2941 C CA    . SER C 3 322 ? 18.271  38.126 23.596  1.00 16.59 ? 618  SER A CA    1 
ATOM   2942 C C     . SER C 3 322 ? 19.656  37.486 23.569  1.00 17.18 ? 618  SER A C     1 
ATOM   2943 O O     . SER C 3 322 ? 20.223  37.154 24.618  1.00 17.09 ? 618  SER A O     1 
ATOM   2944 C CB    . SER C 3 322 ? 18.335  39.634 23.936  1.00 15.27 ? 618  SER A CB    1 
ATOM   2945 O OG    . SER C 3 322 ? 19.463  40.280 23.382  1.00 14.80 ? 618  SER A OG    1 
ATOM   2946 N N     . THR C 3 323 ? 20.194  37.286 22.364  1.00 17.64 ? 619  THR A N     1 
ATOM   2947 C CA    . THR C 3 323 ? 21.508  36.659 22.207  1.00 17.89 ? 619  THR A CA    1 
ATOM   2948 C C     . THR C 3 323 ? 22.366  37.238 21.098  1.00 18.02 ? 619  THR A C     1 
ATOM   2949 O O     . THR C 3 323 ? 21.862  37.832 20.161  1.00 18.18 ? 619  THR A O     1 
ATOM   2950 C CB    . THR C 3 323 ? 21.386  35.166 21.863  1.00 18.21 ? 619  THR A CB    1 
ATOM   2951 O OG1   . THR C 3 323 ? 20.636  35.033 20.647  1.00 19.40 ? 619  THR A OG1   1 
ATOM   2952 C CG2   . THR C 3 323 ? 20.692  34.392 22.962  1.00 17.60 ? 619  THR A CG2   1 
ATOM   2953 N N     . GLU C 3 324 ? 23.670  37.023 21.218  1.00 19.95 ? 620  GLU A N     1 
ATOM   2954 C CA    . GLU C 3 324 ? 24.666  37.435 20.230  1.00 22.08 ? 620  GLU A CA    1 
ATOM   2955 C C     . GLU C 3 324 ? 24.598  38.824 19.643  1.00 22.46 ? 620  GLU A C     1 
ATOM   2956 O O     . GLU C 3 324 ? 24.516  38.972 18.420  1.00 22.75 ? 620  GLU A O     1 
ATOM   2957 C CB    . GLU C 3 324 ? 24.647  36.477 19.066  1.00 24.35 ? 620  GLU A CB    1 
ATOM   2958 C CG    . GLU C 3 324 ? 25.081  35.085 19.410  1.00 28.33 ? 620  GLU A CG    1 
ATOM   2959 C CD    . GLU C 3 324 ? 25.303  34.272 18.161  1.00 31.19 ? 620  GLU A CD    1 
ATOM   2960 O OE1   . GLU C 3 324 ? 26.331  34.526 17.485  1.00 32.62 ? 620  GLU A OE1   1 
ATOM   2961 O OE2   . GLU C 3 324 ? 24.444  33.404 17.852  1.00 32.47 ? 620  GLU A OE2   1 
ATOM   2962 N N     . PRO C 3 325 ? 24.692  39.858 20.493  1.00 22.62 ? 621  PRO A N     1 
ATOM   2963 C CA    . PRO C 3 325 ? 24.858  39.733 21.956  1.00 21.23 ? 621  PRO A CA    1 
ATOM   2964 C C     . PRO C 3 325 ? 23.537  39.833 22.731  1.00 19.95 ? 621  PRO A C     1 
ATOM   2965 O O     . PRO C 3 325 ? 22.486  40.113 22.149  1.00 19.74 ? 621  PRO A O     1 
ATOM   2966 C CB    . PRO C 3 325 ? 25.765  40.909 22.289  1.00 21.34 ? 621  PRO A CB    1 
ATOM   2967 C CG    . PRO C 3 325 ? 25.290  42.011 21.268  1.00 22.46 ? 621  PRO A CG    1 
ATOM   2968 C CD    . PRO C 3 325 ? 24.691  41.273 20.062  1.00 21.83 ? 621  PRO A CD    1 
ATOM   2969 N N     . ASN C 3 326 ? 23.591  39.584 24.042  1.00 19.02 ? 622  ASN A N     1 
ATOM   2970 C CA    . ASN C 3 326 ? 22.410  39.742 24.893  1.00 17.76 ? 622  ASN A CA    1 
ATOM   2971 C C     . ASN C 3 326 ? 22.351  41.248 25.187  1.00 17.20 ? 622  ASN A C     1 
ATOM   2972 O O     . ASN C 3 326 ? 23.215  41.809 25.858  1.00 16.61 ? 622  ASN A O     1 
ATOM   2973 C CB    . ASN C 3 326 ? 22.553  38.970 26.202  1.00 16.36 ? 622  ASN A CB    1 
ATOM   2974 C CG    . ASN C 3 326 ? 21.341  39.132 27.112  1.00 16.67 ? 622  ASN A CG    1 
ATOM   2975 O OD1   . ASN C 3 326 ? 20.456  39.965 26.875  1.00 15.49 ? 622  ASN A OD1   1 
ATOM   2976 N ND2   . ASN C 3 326 ? 21.290  38.317 28.161  1.00 16.47 ? 622  ASN A ND2   1 
ATOM   2977 N N     . LEU C 3 327 ? 21.334  41.904 24.673  1.00 16.90 ? 623  LEU A N     1 
ATOM   2978 C CA    . LEU C 3 327 ? 21.223  43.338 24.870  1.00 18.09 ? 623  LEU A CA    1 
ATOM   2979 C C     . LEU C 3 327 ? 20.228  43.644 25.981  1.00 18.03 ? 623  LEU A C     1 
ATOM   2980 O O     . LEU C 3 327 ? 19.861  44.785 26.195  1.00 17.94 ? 623  LEU A O     1 
ATOM   2981 C CB    . LEU C 3 327 ? 20.780  43.992 23.555  1.00 18.95 ? 623  LEU A CB    1 
ATOM   2982 C CG    . LEU C 3 327 ? 21.840  44.610 22.627  1.00 20.40 ? 623  LEU A CG    1 
ATOM   2983 C CD1   . LEU C 3 327 ? 23.224  44.075 22.940  1.00 20.83 ? 623  LEU A CD1   1 
ATOM   2984 C CD2   . LEU C 3 327 ? 21.459  44.361 21.179  1.00 19.87 ? 623  LEU A CD2   1 
ATOM   2985 N N     . GLN C 3 328 ? 19.795  42.605 26.692  1.00 18.14 ? 624  GLN A N     1 
ATOM   2986 C CA    . GLN C 3 328 ? 18.847  42.781 27.780  1.00 16.91 ? 624  GLN A CA    1 
ATOM   2987 C C     . GLN C 3 328 ? 19.539  42.712 29.127  1.00 16.51 ? 624  GLN A C     1 
ATOM   2988 O O     . GLN C 3 328 ? 18.875  42.644 30.157  1.00 16.63 ? 624  GLN A O     1 
ATOM   2989 C CB    . GLN C 3 328 ? 17.748  41.715 27.717  1.00 16.04 ? 624  GLN A CB    1 
ATOM   2990 C CG    . GLN C 3 328 ? 16.881  41.829 26.486  1.00 14.95 ? 624  GLN A CG    1 
ATOM   2991 C CD    . GLN C 3 328 ? 15.768  40.821 26.446  1.00 14.70 ? 624  GLN A CD    1 
ATOM   2992 O OE1   . GLN C 3 328 ? 15.989  39.628 26.662  1.00 14.11 ? 624  GLN A OE1   1 
ATOM   2993 N NE2   . GLN C 3 328 ? 14.557  41.287 26.156  1.00 14.19 ? 624  GLN A NE2   1 
ATOM   2994 N N     . ASN C 3 329 ? 20.865  42.695 29.125  1.00 17.00 ? 625  ASN A N     1 
ATOM   2995 C CA    . ASN C 3 329 ? 21.589  42.661 30.387  1.00 18.09 ? 625  ASN A CA    1 
ATOM   2996 C C     . ASN C 3 329 ? 22.838  43.549 30.395  1.00 18.17 ? 625  ASN A C     1 
ATOM   2997 O O     . ASN C 3 329 ? 23.846  43.249 31.041  1.00 17.96 ? 625  ASN A O     1 
ATOM   2998 C CB    . ASN C 3 329 ? 21.892  41.199 30.811  1.00 18.69 ? 625  ASN A CB    1 
ATOM   2999 C CG    . ASN C 3 329 ? 23.079  40.599 30.099  1.00 20.10 ? 625  ASN A CG    1 
ATOM   3000 O OD1   . ASN C 3 329 ? 23.387  40.959 28.966  1.00 22.01 ? 625  ASN A OD1   1 
ATOM   3001 N ND2   . ASN C 3 329 ? 23.758  39.670 30.766  1.00 20.47 ? 625  ASN A ND2   1 
ATOM   3002 N N     . ILE C 3 330 ? 22.756  44.678 29.689  1.00 18.12 ? 626  ILE A N     1 
ATOM   3003 C CA    . ILE C 3 330 ? 23.879  45.617 29.653  1.00 17.48 ? 626  ILE A CA    1 
ATOM   3004 C C     . ILE C 3 330 ? 23.878  46.262 31.043  1.00 17.75 ? 626  ILE A C     1 
ATOM   3005 O O     . ILE C 3 330 ? 22.816  46.588 31.570  1.00 16.78 ? 626  ILE A O     1 
ATOM   3006 C CB    . ILE C 3 330 ? 23.686  46.695 28.531  1.00 16.53 ? 626  ILE A CB    1 
ATOM   3007 C CG1   . ILE C 3 330 ? 23.514  46.005 27.169  1.00 15.74 ? 626  ILE A CG1   1 
ATOM   3008 C CG2   . ILE C 3 330 ? 24.928  47.569 28.433  1.00 15.88 ? 626  ILE A CG2   1 
ATOM   3009 C CD1   . ILE C 3 330 ? 24.786  45.268 26.728  1.00 15.84 ? 626  ILE A CD1   1 
ATOM   3010 N N     . PRO C 3 331 ? 25.067  46.453 31.649  1.00 18.93 ? 627  PRO A N     1 
ATOM   3011 C CA    . PRO C 3 331 ? 25.198  47.051 32.991  1.00 19.79 ? 627  PRO A CA    1 
ATOM   3012 C C     . PRO C 3 331 ? 24.533  48.421 33.202  1.00 20.77 ? 627  PRO A C     1 
ATOM   3013 O O     . PRO C 3 331 ? 24.550  49.276 32.318  1.00 20.04 ? 627  PRO A O     1 
ATOM   3014 C CB    . PRO C 3 331 ? 26.712  47.110 33.227  1.00 19.64 ? 627  PRO A CB    1 
ATOM   3015 C CG    . PRO C 3 331 ? 27.302  46.140 32.259  1.00 19.73 ? 627  PRO A CG    1 
ATOM   3016 C CD    . PRO C 3 331 ? 26.377  46.123 31.062  1.00 19.42 ? 627  PRO A CD    1 
ATOM   3017 N N     . ILE C 3 332 ? 23.959  48.617 34.389  1.00 21.62 ? 628  ILE A N     1 
ATOM   3018 C CA    . ILE C 3 332 ? 23.303  49.872 34.741  1.00 23.14 ? 628  ILE A CA    1 
ATOM   3019 C C     . ILE C 3 332 ? 23.319  50.154 36.254  1.00 25.50 ? 628  ILE A C     1 
ATOM   3020 O O     . ILE C 3 332 ? 23.381  51.312 36.678  1.00 25.55 ? 628  ILE A O     1 
ATOM   3021 C CB    . ILE C 3 332 ? 21.844  49.886 34.233  1.00 21.31 ? 628  ILE A CB    1 
ATOM   3022 C CG1   . ILE C 3 332 ? 21.404  51.325 33.957  1.00 20.61 ? 628  ILE A CG1   1 
ATOM   3023 C CG2   . ILE C 3 332 ? 20.933  49.203 35.227  1.00 22.30 ? 628  ILE A CG2   1 
ATOM   3024 C CD1   . ILE C 3 332 ? 19.908  51.512 33.818  1.00 19.35 ? 628  ILE A CD1   1 
ATOM   3025 N N     . ARG C 3 333 ? 23.274  49.097 37.064  1.00 27.49 ? 629  ARG A N     1 
ATOM   3026 C CA    . ARG C 3 333 ? 23.259  49.240 38.519  1.00 29.83 ? 629  ARG A CA    1 
ATOM   3027 C C     . ARG C 3 333 ? 24.486  49.976 39.093  1.00 29.28 ? 629  ARG A C     1 
ATOM   3028 O O     . ARG C 3 333 ? 24.342  51.027 39.696  1.00 29.82 ? 629  ARG A O     1 
ATOM   3029 C CB    . ARG C 3 333 ? 23.091  47.857 39.172  1.00 32.49 ? 629  ARG A CB    1 
ATOM   3030 C CG    . ARG C 3 333 ? 23.352  47.819 40.677  1.00 37.46 ? 629  ARG A CG    1 
ATOM   3031 C CD    . ARG C 3 333 ? 22.085  48.055 41.506  1.00 41.88 ? 629  ARG A CD    1 
ATOM   3032 N NE    . ARG C 3 333 ? 22.204  47.590 42.903  1.00 46.39 ? 629  ARG A NE    1 
ATOM   3033 C CZ    . ARG C 3 333 ? 22.870  48.230 43.874  1.00 47.89 ? 629  ARG A CZ    1 
ATOM   3034 N NH1   . ARG C 3 333 ? 23.495  49.380 43.621  1.00 48.27 ? 629  ARG A NH1   1 
ATOM   3035 N NH2   . ARG C 3 333 ? 22.908  47.724 45.107  1.00 48.47 ? 629  ARG A NH2   1 
ATOM   3036 N N     . LEU C 3 334 ? 25.684  49.437 38.917  1.00 28.82 ? 630  LEU A N     1 
ATOM   3037 C CA    . LEU C 3 334 ? 26.883  50.095 39.433  1.00 28.57 ? 630  LEU A CA    1 
ATOM   3038 C C     . LEU C 3 334 ? 27.379  51.068 38.376  1.00 29.35 ? 630  LEU A C     1 
ATOM   3039 O O     . LEU C 3 334 ? 27.450  50.722 37.196  1.00 29.84 ? 630  LEU A O     1 
ATOM   3040 C CB    . LEU C 3 334 ? 27.976  49.068 39.723  1.00 27.58 ? 630  LEU A CB    1 
ATOM   3041 C CG    . LEU C 3 334 ? 27.846  48.182 40.969  1.00 27.63 ? 630  LEU A CG    1 
ATOM   3042 C CD1   . LEU C 3 334 ? 26.767  48.698 41.906  1.00 26.81 ? 630  LEU A CD1   1 
ATOM   3043 C CD2   . LEU C 3 334 ? 27.532  46.776 40.530  1.00 28.39 ? 630  LEU A CD2   1 
ATOM   3044 N N     . GLU C 3 335 ? 27.744  52.276 38.794  1.00 29.96 ? 631  GLU A N     1 
ATOM   3045 C CA    . GLU C 3 335 ? 28.210  53.298 37.858  1.00 30.28 ? 631  GLU A CA    1 
ATOM   3046 C C     . GLU C 3 335 ? 29.342  52.917 36.885  1.00 30.67 ? 631  GLU A C     1 
ATOM   3047 O O     . GLU C 3 335 ? 29.353  53.381 35.738  1.00 31.16 ? 631  GLU A O     1 
ATOM   3048 C CB    . GLU C 3 335 ? 28.601  54.569 38.614  1.00 29.91 ? 631  GLU A CB    1 
ATOM   3049 C CG    . GLU C 3 335 ? 29.166  55.653 37.707  1.00 30.12 ? 631  GLU A CG    1 
ATOM   3050 C CD    . GLU C 3 335 ? 28.169  56.127 36.653  1.00 31.00 ? 631  GLU A CD    1 
ATOM   3051 O OE1   . GLU C 3 335 ? 26.938  56.045 36.890  1.00 32.24 ? 631  GLU A OE1   1 
ATOM   3052 O OE2   . GLU C 3 335 ? 28.621  56.591 35.584  1.00 31.48 ? 631  GLU A OE2   1 
ATOM   3053 N N     . GLU C 3 336 ? 30.295  52.091 37.306  1.00 30.90 ? 632  GLU A N     1 
ATOM   3054 C CA    . GLU C 3 336 ? 31.373  51.721 36.384  1.00 31.25 ? 632  GLU A CA    1 
ATOM   3055 C C     . GLU C 3 336 ? 30.929  50.853 35.209  1.00 29.90 ? 632  GLU A C     1 
ATOM   3056 O O     . GLU C 3 336 ? 31.495  50.936 34.113  1.00 30.75 ? 632  GLU A O     1 
ATOM   3057 C CB    . GLU C 3 336 ? 32.492  51.003 37.113  1.00 33.60 ? 632  GLU A CB    1 
ATOM   3058 C CG    . GLU C 3 336 ? 33.160  51.839 38.152  1.00 36.23 ? 632  GLU A CG    1 
ATOM   3059 C CD    . GLU C 3 336 ? 33.015  51.197 39.493  1.00 38.69 ? 632  GLU A CD    1 
ATOM   3060 O OE1   . GLU C 3 336 ? 31.850  51.149 39.994  1.00 39.57 ? 632  GLU A OE1   1 
ATOM   3061 O OE2   . GLU C 3 336 ? 34.063  50.729 40.013  1.00 38.87 ? 632  GLU A OE2   1 
ATOM   3062 N N     . GLY C 3 337 ? 29.938  50.007 35.436  1.00 28.10 ? 633  GLY A N     1 
ATOM   3063 C CA    . GLY C 3 337 ? 29.454  49.171 34.361  1.00 26.38 ? 633  GLY A CA    1 
ATOM   3064 C C     . GLY C 3 337 ? 28.488  49.971 33.521  1.00 25.15 ? 633  GLY A C     1 
ATOM   3065 O O     . GLY C 3 337 ? 28.405  49.787 32.310  1.00 24.93 ? 633  GLY A O     1 
ATOM   3066 N N     . ARG C 3 338 ? 27.754  50.866 34.177  1.00 24.49 ? 634  ARG A N     1 
ATOM   3067 C CA    . ARG C 3 338 ? 26.786  51.712 33.499  1.00 24.03 ? 634  ARG A CA    1 
ATOM   3068 C C     . ARG C 3 338 ? 27.430  52.500 32.360  1.00 24.37 ? 634  ARG A C     1 
ATOM   3069 O O     . ARG C 3 338 ? 26.816  52.736 31.324  1.00 23.61 ? 634  ARG A O     1 
ATOM   3070 C CB    . ARG C 3 338 ? 26.169  52.685 34.486  1.00 23.73 ? 634  ARG A CB    1 
ATOM   3071 C CG    . ARG C 3 338 ? 25.077  53.529 33.884  1.00 24.86 ? 634  ARG A CG    1 
ATOM   3072 C CD    . ARG C 3 338 ? 24.408  54.339 34.939  1.00 25.80 ? 634  ARG A CD    1 
ATOM   3073 N NE    . ARG C 3 338 ? 23.096  54.761 34.503  1.00 27.47 ? 634  ARG A NE    1 
ATOM   3074 C CZ    . ARG C 3 338 ? 22.046  54.835 35.310  1.00 29.32 ? 634  ARG A CZ    1 
ATOM   3075 N NH1   . ARG C 3 338 ? 22.188  54.507 36.585  1.00 30.52 ? 634  ARG A NH1   1 
ATOM   3076 N NH2   . ARG C 3 338 ? 20.863  55.240 34.854  1.00 28.78 ? 634  ARG A NH2   1 
ATOM   3077 N N     . LYS C 3 339 ? 28.675  52.902 32.557  1.00 24.66 ? 635  LYS A N     1 
ATOM   3078 C CA    . LYS C 3 339 ? 29.386  53.658 31.554  1.00 25.66 ? 635  LYS A CA    1 
ATOM   3079 C C     . LYS C 3 339 ? 29.505  52.934 30.226  1.00 25.73 ? 635  LYS A C     1 
ATOM   3080 O O     . LYS C 3 339 ? 29.745  53.565 29.187  1.00 26.05 ? 635  LYS A O     1 
ATOM   3081 C CB    . LYS C 3 339 ? 30.757  54.036 32.092  1.00 27.06 ? 635  LYS A CB    1 
ATOM   3082 C CG    . LYS C 3 339 ? 30.654  55.149 33.128  1.00 28.78 ? 635  LYS A CG    1 
ATOM   3083 C CD    . LYS C 3 339 ? 31.905  55.222 33.960  1.00 31.91 ? 635  LYS A CD    1 
ATOM   3084 C CE    . LYS C 3 339 ? 32.284  56.671 34.260  1.00 34.52 ? 635  LYS A CE    1 
ATOM   3085 N NZ    . LYS C 3 339 ? 31.316  57.343 35.204  1.00 35.93 ? 635  LYS A NZ    1 
ATOM   3086 N N     . ILE C 3 340 ? 29.338  51.614 30.258  1.00 25.08 ? 636  ILE A N     1 
ATOM   3087 C CA    . ILE C 3 340 ? 29.405  50.798 29.045  1.00 24.06 ? 636  ILE A CA    1 
ATOM   3088 C C     . ILE C 3 340 ? 28.337  51.306 28.063  1.00 23.03 ? 636  ILE A C     1 
ATOM   3089 O O     . ILE C 3 340 ? 28.536  51.271 26.854  1.00 22.85 ? 636  ILE A O     1 
ATOM   3090 C CB    . ILE C 3 340 ? 29.126  49.269 29.353  1.00 25.22 ? 636  ILE A CB    1 
ATOM   3091 C CG1   . ILE C 3 340 ? 30.338  48.612 30.039  1.00 25.10 ? 636  ILE A CG1   1 
ATOM   3092 C CG2   . ILE C 3 340 ? 28.811  48.510 28.061  1.00 24.43 ? 636  ILE A CG2   1 
ATOM   3093 C CD1   . ILE C 3 340 ? 31.675  48.919 29.408  1.00 25.30 ? 636  ILE A CD1   1 
ATOM   3094 N N     . ARG C 3 341 ? 27.217  51.792 28.595  1.00 21.68 ? 637  ARG A N     1 
ATOM   3095 C CA    . ARG C 3 341 ? 26.109  52.287 27.782  1.00 21.66 ? 637  ARG A CA    1 
ATOM   3096 C C     . ARG C 3 341 ? 26.391  53.533 26.960  1.00 22.02 ? 637  ARG A C     1 
ATOM   3097 O O     . ARG C 3 341 ? 25.553  53.970 26.171  1.00 22.10 ? 637  ARG A O     1 
ATOM   3098 C CB    . ARG C 3 341 ? 24.907  52.557 28.659  1.00 21.57 ? 637  ARG A CB    1 
ATOM   3099 C CG    . ARG C 3 341 ? 24.337  51.306 29.256  1.00 21.71 ? 637  ARG A CG    1 
ATOM   3100 C CD    . ARG C 3 341 ? 23.024  51.563 29.968  1.00 21.85 ? 637  ARG A CD    1 
ATOM   3101 N NE    . ARG C 3 341 ? 22.516  50.304 30.489  1.00 22.04 ? 637  ARG A NE    1 
ATOM   3102 C CZ    . ARG C 3 341 ? 21.238  49.976 30.517  1.00 21.19 ? 637  ARG A CZ    1 
ATOM   3103 N NH1   . ARG C 3 341 ? 20.327  50.823 30.054  1.00 19.83 ? 637  ARG A NH1   1 
ATOM   3104 N NH2   . ARG C 3 341 ? 20.880  48.780 30.968  1.00 22.11 ? 637  ARG A NH2   1 
ATOM   3105 N N     . GLN C 3 342 ? 27.569  54.107 27.164  1.00 23.26 ? 638  GLN A N     1 
ATOM   3106 C CA    . GLN C 3 342 ? 27.998  55.284 26.431  1.00 23.38 ? 638  GLN A CA    1 
ATOM   3107 C C     . GLN C 3 342 ? 28.418  54.838 25.041  1.00 22.80 ? 638  GLN A C     1 
ATOM   3108 O O     . GLN C 3 342 ? 28.456  55.638 24.118  1.00 22.38 ? 638  GLN A O     1 
ATOM   3109 C CB    . GLN C 3 342 ? 29.183  55.938 27.131  1.00 24.62 ? 638  GLN A CB    1 
ATOM   3110 C CG    . GLN C 3 342 ? 28.779  56.867 28.253  1.00 26.90 ? 638  GLN A CG    1 
ATOM   3111 C CD    . GLN C 3 342 ? 29.941  57.192 29.138  1.00 27.47 ? 638  GLN A CD    1 
ATOM   3112 O OE1   . GLN C 3 342 ? 31.067  56.801 28.853  1.00 29.84 ? 638  GLN A OE1   1 
ATOM   3113 N NE2   . GLN C 3 342 ? 29.683  57.907 30.217  1.00 28.89 ? 638  GLN A NE2   1 
ATOM   3114 N N     . ALA C 3 343 ? 28.730  53.551 24.908  1.00 22.22 ? 639  ALA A N     1 
ATOM   3115 C CA    . ALA C 3 343 ? 29.154  52.977 23.635  1.00 21.36 ? 639  ALA A CA    1 
ATOM   3116 C C     . ALA C 3 343 ? 27.978  52.656 22.705  1.00 20.87 ? 639  ALA A C     1 
ATOM   3117 O O     . ALA C 3 343 ? 28.197  52.338 21.535  1.00 21.10 ? 639  ALA A O     1 
ATOM   3118 C CB    . ALA C 3 343 ? 29.982  51.720 23.881  1.00 21.16 ? 639  ALA A CB    1 
ATOM   3119 N N     . PHE C 3 344 ? 26.750  52.732 23.218  1.00 19.30 ? 640  PHE A N     1 
ATOM   3120 C CA    . PHE C 3 344 ? 25.563  52.465 22.422  1.00 19.05 ? 640  PHE A CA    1 
ATOM   3121 C C     . PHE C 3 344 ? 25.030  53.823 21.979  1.00 19.07 ? 640  PHE A C     1 
ATOM   3122 O O     . PHE C 3 344 ? 24.524  54.602 22.784  1.00 17.71 ? 640  PHE A O     1 
ATOM   3123 C CB    . PHE C 3 344 ? 24.539  51.679 23.247  1.00 20.18 ? 640  PHE A CB    1 
ATOM   3124 C CG    . PHE C 3 344 ? 24.927  50.234 23.457  1.00 21.80 ? 640  PHE A CG    1 
ATOM   3125 C CD1   . PHE C 3 344 ? 25.763  49.869 24.507  1.00 21.70 ? 640  PHE A CD1   1 
ATOM   3126 C CD2   . PHE C 3 344 ? 24.533  49.249 22.546  1.00 22.71 ? 640  PHE A CD2   1 
ATOM   3127 C CE1   . PHE C 3 344 ? 26.209  48.550 24.641  1.00 22.59 ? 640  PHE A CE1   1 
ATOM   3128 C CE2   . PHE C 3 344 ? 24.978  47.925 22.676  1.00 22.37 ? 640  PHE A CE2   1 
ATOM   3129 C CZ    . PHE C 3 344 ? 25.816  47.579 23.722  1.00 22.57 ? 640  PHE A CZ    1 
ATOM   3130 N N     . VAL C 3 345 ? 25.133  54.080 20.675  1.00 18.77 ? 641  VAL A N     1 
ATOM   3131 C CA    . VAL C 3 345 ? 24.786  55.379 20.103  1.00 18.62 ? 641  VAL A CA    1 
ATOM   3132 C C     . VAL C 3 345 ? 23.773  55.321 18.967  1.00 19.12 ? 641  VAL A C     1 
ATOM   3133 O O     . VAL C 3 345 ? 23.451  54.237 18.470  1.00 19.66 ? 641  VAL A O     1 
ATOM   3134 C CB    . VAL C 3 345 ? 26.088  56.033 19.589  1.00 17.65 ? 641  VAL A CB    1 
ATOM   3135 C CG1   . VAL C 3 345 ? 27.099  56.162 20.740  1.00 16.13 ? 641  VAL A CG1   1 
ATOM   3136 C CG2   . VAL C 3 345 ? 26.706  55.154 18.499  1.00 16.42 ? 641  VAL A CG2   1 
ATOM   3137 N N     . PRO C 3 346 ? 23.208  56.485 18.571  1.00 19.15 ? 642  PRO A N     1 
ATOM   3138 C CA    . PRO C 3 346 ? 22.232  56.482 17.465  1.00 19.01 ? 642  PRO A CA    1 
ATOM   3139 C C     . PRO C 3 346 ? 22.909  56.075 16.141  1.00 18.96 ? 642  PRO A C     1 
ATOM   3140 O O     . PRO C 3 346 ? 24.102  56.286 15.946  1.00 17.33 ? 642  PRO A O     1 
ATOM   3141 C CB    . PRO C 3 346 ? 21.681  57.917 17.450  1.00 18.57 ? 642  PRO A CB    1 
ATOM   3142 C CG    . PRO C 3 346 ? 22.042  58.477 18.799  1.00 17.25 ? 642  PRO A CG    1 
ATOM   3143 C CD    . PRO C 3 346 ? 23.365  57.833 19.146  1.00 17.71 ? 642  PRO A CD    1 
ATOM   3144 N N     . SER C 3 347 ? 22.152  55.472 15.240  1.00 19.90 ? 643  SER A N     1 
ATOM   3145 C CA    . SER C 3 347 ? 22.746  55.022 13.987  1.00 22.27 ? 643  SER A CA    1 
ATOM   3146 C C     . SER C 3 347 ? 22.852  56.120 12.924  1.00 24.22 ? 643  SER A C     1 
ATOM   3147 O O     . SER C 3 347 ? 23.384  55.888 11.838  1.00 24.73 ? 643  SER A O     1 
ATOM   3148 C CB    . SER C 3 347 ? 21.940  53.865 13.425  1.00 21.24 ? 643  SER A CB    1 
ATOM   3149 O OG    . SER C 3 347 ? 20.591  54.262 13.250  1.00 21.86 ? 643  SER A OG    1 
ATOM   3150 N N     . GLU C 3 348 ? 22.340  57.305 13.232  1.00 25.57 ? 644  GLU A N     1 
ATOM   3151 C CA    . GLU C 3 348 ? 22.383  58.405 12.284  1.00 27.95 ? 644  GLU A CA    1 
ATOM   3152 C C     . GLU C 3 348 ? 22.756  59.685 13.010  1.00 27.78 ? 644  GLU A C     1 
ATOM   3153 O O     . GLU C 3 348 ? 22.451  59.846 14.189  1.00 27.57 ? 644  GLU A O     1 
ATOM   3154 C CB    . GLU C 3 348 ? 21.018  58.588 11.653  1.00 30.54 ? 644  GLU A CB    1 
ATOM   3155 C CG    . GLU C 3 348 ? 20.712  57.660 10.517  1.00 36.43 ? 644  GLU A CG    1 
ATOM   3156 C CD    . GLU C 3 348 ? 19.726  58.302 9.557   1.00 40.41 ? 644  GLU A CD    1 
ATOM   3157 O OE1   . GLU C 3 348 ? 20.028  59.424 9.067   1.00 42.23 ? 644  GLU A OE1   1 
ATOM   3158 O OE2   . GLU C 3 348 ? 18.650  57.702 9.295   1.00 42.73 ? 644  GLU A OE2   1 
ATOM   3159 N N     . SER C 3 349 ? 23.405  60.609 12.308  1.00 27.80 ? 645  SER A N     1 
ATOM   3160 C CA    . SER C 3 349 ? 23.777  61.871 12.932  1.00 26.47 ? 645  SER A CA    1 
ATOM   3161 C C     . SER C 3 349 ? 22.508  62.677 13.214  1.00 25.13 ? 645  SER A C     1 
ATOM   3162 O O     . SER C 3 349 ? 21.519  62.610 12.468  1.00 23.30 ? 645  SER A O     1 
ATOM   3163 C CB    . SER C 3 349 ? 24.750  62.666 12.041  1.00 27.29 ? 645  SER A CB    1 
ATOM   3164 O OG    . SER C 3 349 ? 24.397  62.591 10.670  1.00 29.63 ? 645  SER A OG    1 
ATOM   3165 N N     . ASP C 3 350 ? 22.540  63.404 14.328  1.00 24.71 ? 646  ASP A N     1 
ATOM   3166 C CA    . ASP C 3 350 ? 21.422  64.240 14.751  1.00 24.95 ? 646  ASP A CA    1 
ATOM   3167 C C     . ASP C 3 350 ? 20.195  63.442 15.220  1.00 23.51 ? 646  ASP A C     1 
ATOM   3168 O O     . ASP C 3 350 ? 19.077  63.961 15.307  1.00 23.63 ? 646  ASP A O     1 
ATOM   3169 C CB    . ASP C 3 350 ? 21.077  65.221 13.625  1.00 26.31 ? 646  ASP A CB    1 
ATOM   3170 C CG    . ASP C 3 350 ? 22.258  66.143 13.280  1.00 28.32 ? 646  ASP A CG    1 
ATOM   3171 O OD1   . ASP C 3 350 ? 22.915  66.665 14.203  1.00 29.12 ? 646  ASP A OD1   1 
ATOM   3172 O OD2   . ASP C 3 350 ? 22.542  66.343 12.080  1.00 31.77 ? 646  ASP A OD2   1 
ATOM   3173 N N     . TRP C 3 351 ? 20.433  62.170 15.525  1.00 21.77 ? 647  TRP A N     1 
ATOM   3174 C CA    . TRP C 3 351 ? 19.401  61.275 16.024  1.00 19.92 ? 647  TRP A CA    1 
ATOM   3175 C C     . TRP C 3 351 ? 19.738  61.088 17.503  1.00 19.46 ? 647  TRP A C     1 
ATOM   3176 O O     . TRP C 3 351 ? 20.873  61.336 17.924  1.00 19.03 ? 647  TRP A O     1 
ATOM   3177 C CB    . TRP C 3 351 ? 19.474  59.913 15.311  1.00 20.29 ? 647  TRP A CB    1 
ATOM   3178 C CG    . TRP C 3 351 ? 18.734  59.865 14.026  1.00 20.33 ? 647  TRP A CG    1 
ATOM   3179 C CD1   . TRP C 3 351 ? 18.757  60.809 13.033  1.00 21.49 ? 647  TRP A CD1   1 
ATOM   3180 C CD2   . TRP C 3 351 ? 17.817  58.853 13.596  1.00 21.13 ? 647  TRP A CD2   1 
ATOM   3181 N NE1   . TRP C 3 351 ? 17.909  60.446 12.017  1.00 21.10 ? 647  TRP A NE1   1 
ATOM   3182 C CE2   . TRP C 3 351 ? 17.319  59.250 12.334  1.00 21.43 ? 647  TRP A CE2   1 
ATOM   3183 C CE3   . TRP C 3 351 ? 17.363  57.646 14.154  1.00 21.62 ? 647  TRP A CE3   1 
ATOM   3184 C CZ2   . TRP C 3 351 ? 16.391  58.486 11.619  1.00 22.12 ? 647  TRP A CZ2   1 
ATOM   3185 C CZ3   . TRP C 3 351 ? 16.439  56.889 13.447  1.00 21.27 ? 647  TRP A CZ3   1 
ATOM   3186 C CH2   . TRP C 3 351 ? 15.961  57.312 12.188  1.00 21.61 ? 647  TRP A CH2   1 
ATOM   3187 N N     . LEU C 3 352 ? 18.768  60.647 18.297  1.00 19.06 ? 648  LEU A N     1 
ATOM   3188 C CA    . LEU C 3 352 ? 19.024  60.429 19.723  1.00 18.74 ? 648  LEU A CA    1 
ATOM   3189 C C     . LEU C 3 352 ? 18.392  59.118 20.226  1.00 19.31 ? 648  LEU A C     1 
ATOM   3190 O O     . LEU C 3 352 ? 17.505  58.543 19.575  1.00 20.70 ? 648  LEU A O     1 
ATOM   3191 C CB    . LEU C 3 352 ? 18.463  61.608 20.527  1.00 17.21 ? 648  LEU A CB    1 
ATOM   3192 C CG    . LEU C 3 352 ? 19.048  63.011 20.312  1.00 16.24 ? 648  LEU A CG    1 
ATOM   3193 C CD1   . LEU C 3 352 ? 18.080  64.036 20.875  1.00 15.94 ? 648  LEU A CD1   1 
ATOM   3194 C CD2   . LEU C 3 352 ? 20.391  63.123 20.976  1.00 15.22 ? 648  LEU A CD2   1 
ATOM   3195 N N     . ILE C 3 353 ? 18.844  58.662 21.394  1.00 19.27 ? 649  ILE A N     1 
ATOM   3196 C CA    . ILE C 3 353 ? 18.311  57.454 22.022  1.00 18.16 ? 649  ILE A CA    1 
ATOM   3197 C C     . ILE C 3 353 ? 17.146  57.841 22.944  1.00 17.19 ? 649  ILE A C     1 
ATOM   3198 O O     . ILE C 3 353 ? 17.283  58.741 23.769  1.00 17.51 ? 649  ILE A O     1 
ATOM   3199 C CB    . ILE C 3 353 ? 19.417  56.720 22.848  1.00 18.26 ? 649  ILE A CB    1 
ATOM   3200 C CG1   . ILE C 3 353 ? 20.554  56.284 21.910  1.00 18.49 ? 649  ILE A CG1   1 
ATOM   3201 C CG2   . ILE C 3 353 ? 18.816  55.509 23.603  1.00 17.87 ? 649  ILE A CG2   1 
ATOM   3202 C CD1   . ILE C 3 353 ? 20.077  55.658 20.582  1.00 18.20 ? 649  ILE A CD1   1 
ATOM   3203 N N     . PHE C 3 354 ? 16.006  57.172 22.774  1.00 16.24 ? 650  PHE A N     1 
ATOM   3204 C CA    . PHE C 3 354 ? 14.801  57.410 23.574  1.00 16.28 ? 650  PHE A CA    1 
ATOM   3205 C C     . PHE C 3 354 ? 14.424  56.094 24.284  1.00 16.47 ? 650  PHE A C     1 
ATOM   3206 O O     . PHE C 3 354 ? 14.162  55.087 23.631  1.00 15.44 ? 650  PHE A O     1 
ATOM   3207 C CB    . PHE C 3 354 ? 13.647  57.849 22.665  1.00 15.63 ? 650  PHE A CB    1 
ATOM   3208 C CG    . PHE C 3 354 ? 12.427  58.292 23.405  1.00 15.72 ? 650  PHE A CG    1 
ATOM   3209 C CD1   . PHE C 3 354 ? 11.496  57.363 23.861  1.00 15.22 ? 650  PHE A CD1   1 
ATOM   3210 C CD2   . PHE C 3 354 ? 12.205  59.639 23.651  1.00 16.01 ? 650  PHE A CD2   1 
ATOM   3211 C CE1   . PHE C 3 354 ? 10.358  57.765 24.552  1.00 16.36 ? 650  PHE A CE1   1 
ATOM   3212 C CE2   . PHE C 3 354 ? 11.073  60.057 24.338  1.00 15.45 ? 650  PHE A CE2   1 
ATOM   3213 C CZ    . PHE C 3 354 ? 10.142  59.131 24.793  1.00 15.86 ? 650  PHE A CZ    1 
ATOM   3214 N N     . ALA C 3 355 ? 14.392  56.117 25.619  1.00 16.24 ? 651  ALA A N     1 
ATOM   3215 C CA    . ALA C 3 355 ? 14.073  54.931 26.418  1.00 16.06 ? 651  ALA A CA    1 
ATOM   3216 C C     . ALA C 3 355 ? 12.868  55.168 27.332  1.00 16.69 ? 651  ALA A C     1 
ATOM   3217 O O     . ALA C 3 355 ? 12.845  56.139 28.103  1.00 16.85 ? 651  ALA A O     1 
ATOM   3218 C CB    . ALA C 3 355 ? 15.289  54.538 27.245  1.00 15.83 ? 651  ALA A CB    1 
ATOM   3219 N N     . ALA C 3 356 ? 11.862  54.298 27.230  1.00 15.54 ? 652  ALA A N     1 
ATOM   3220 C CA    . ALA C 3 356 ? 10.670  54.405 28.057  1.00 15.82 ? 652  ALA A CA    1 
ATOM   3221 C C     . ALA C 3 356 ? 10.483  53.128 28.869  1.00 16.52 ? 652  ALA A C     1 
ATOM   3222 O O     . ALA C 3 356 ? 10.615  52.018 28.348  1.00 16.90 ? 652  ALA A O     1 
ATOM   3223 C CB    . ALA C 3 356 ? 9.447   54.667 27.204  1.00 14.43 ? 652  ALA A CB    1 
ATOM   3224 N N     . ASP C 3 357 ? 10.167  53.283 30.147  1.00 16.46 ? 653  ASP A N     1 
ATOM   3225 C CA    . ASP C 3 357 ? 9.992   52.119 31.010  1.00 16.93 ? 653  ASP A CA    1 
ATOM   3226 C C     . ASP C 3 357 ? 8.755   52.156 31.903  1.00 16.77 ? 653  ASP A C     1 
ATOM   3227 O O     . ASP C 3 357 ? 8.390   53.208 32.449  1.00 17.05 ? 653  ASP A O     1 
ATOM   3228 C CB    . ASP C 3 357 ? 11.243  51.946 31.877  1.00 18.03 ? 653  ASP A CB    1 
ATOM   3229 C CG    . ASP C 3 357 ? 11.337  53.005 32.981  1.00 22.29 ? 653  ASP A CG    1 
ATOM   3230 O OD1   . ASP C 3 357 ? 11.675  54.179 32.688  1.00 21.87 ? 653  ASP A OD1   1 
ATOM   3231 O OD2   . ASP C 3 357 ? 11.061  52.666 34.155  1.00 22.70 ? 653  ASP A OD2   1 
ATOM   3232 N N     . TYR C 3 358 ? 8.096   51.008 32.035  1.00 15.41 ? 654  TYR A N     1 
ATOM   3233 C CA    . TYR C 3 358 ? 6.942   50.899 32.913  1.00 15.38 ? 654  TYR A CA    1 
ATOM   3234 C C     . TYR C 3 358 ? 7.428   51.017 34.370  1.00 14.91 ? 654  TYR A C     1 
ATOM   3235 O O     . TYR C 3 358 ? 8.452   50.440 34.759  1.00 14.49 ? 654  TYR A O     1 
ATOM   3236 C CB    . TYR C 3 358 ? 6.264   49.541 32.769  1.00 15.28 ? 654  TYR A CB    1 
ATOM   3237 C CG    . TYR C 3 358 ? 5.408   49.391 31.546  1.00 15.37 ? 654  TYR A CG    1 
ATOM   3238 C CD1   . TYR C 3 358 ? 4.150   49.978 31.478  1.00 15.74 ? 654  TYR A CD1   1 
ATOM   3239 C CD2   . TYR C 3 358 ? 5.856   48.643 30.451  1.00 14.87 ? 654  TYR A CD2   1 
ATOM   3240 C CE1   . TYR C 3 358 ? 3.350   49.828 30.336  1.00 15.69 ? 654  TYR A CE1   1 
ATOM   3241 C CE2   . TYR C 3 358 ? 5.074   48.488 29.322  1.00 14.12 ? 654  TYR A CE2   1 
ATOM   3242 C CZ    . TYR C 3 358 ? 3.829   49.081 29.267  1.00 15.47 ? 654  TYR A CZ    1 
ATOM   3243 O OH    . TYR C 3 358 ? 3.061   48.943 28.128  1.00 16.32 ? 654  TYR A OH    1 
ATOM   3244 N N     . SER C 3 359 ? 6.682   51.769 35.165  1.00 15.04 ? 655  SER A N     1 
ATOM   3245 C CA    . SER C 3 359 ? 7.003   51.931 36.577  1.00 15.32 ? 655  SER A CA    1 
ATOM   3246 C C     . SER C 3 359 ? 6.207   50.868 37.337  1.00 13.07 ? 655  SER A C     1 
ATOM   3247 O O     . SER C 3 359 ? 4.982   50.918 37.384  1.00 13.50 ? 655  SER A O     1 
ATOM   3248 C CB    . SER C 3 359 ? 6.610   53.337 37.050  1.00 15.89 ? 655  SER A CB    1 
ATOM   3249 O OG    . SER C 3 359 ? 7.086   53.552 38.361  1.00 19.69 ? 655  SER A OG    1 
ATOM   3250 N N     . GLN C 3 360 ? 6.905   49.889 37.900  1.00 13.51 ? 656  GLN A N     1 
ATOM   3251 C CA    . GLN C 3 360 ? 6.239   48.817 38.662  1.00 13.89 ? 656  GLN A CA    1 
ATOM   3252 C C     . GLN C 3 360 ? 5.069   48.139 37.960  1.00 12.62 ? 656  GLN A C     1 
ATOM   3253 O O     . GLN C 3 360 ? 4.018   47.992 38.529  1.00 12.86 ? 656  GLN A O     1 
ATOM   3254 C CB    . GLN C 3 360 ? 5.736   49.363 40.003  1.00 14.82 ? 656  GLN A CB    1 
ATOM   3255 C CG    . GLN C 3 360 ? 6.804   50.051 40.847  1.00 17.19 ? 656  GLN A CG    1 
ATOM   3256 C CD    . GLN C 3 360 ? 7.896   49.098 41.327  1.00 18.23 ? 656  GLN A CD    1 
ATOM   3257 O OE1   . GLN C 3 360 ? 9.029   49.501 41.554  1.00 20.17 ? 656  GLN A OE1   1 
ATOM   3258 N NE2   . GLN C 3 360 ? 7.554   47.836 41.479  1.00 19.53 ? 656  GLN A NE2   1 
ATOM   3259 N N     . ILE C 3 361 ? 5.247   47.702 36.720  1.00 14.12 ? 657  ILE A N     1 
ATOM   3260 C CA    . ILE C 3 361 ? 4.141   47.056 36.020  1.00 13.56 ? 657  ILE A CA    1 
ATOM   3261 C C     . ILE C 3 361 ? 3.691   45.760 36.721  1.00 12.81 ? 657  ILE A C     1 
ATOM   3262 O O     . ILE C 3 361 ? 2.498   45.454 36.769  1.00 12.63 ? 657  ILE A O     1 
ATOM   3263 C CB    . ILE C 3 361 ? 4.506   46.754 34.484  1.00 11.47 ? 657  ILE A CB    1 
ATOM   3264 C CG1   . ILE C 3 361 ? 3.278   46.192 33.755  1.00 11.88 ? 657  ILE A CG1   1 
ATOM   3265 C CG2   . ILE C 3 361 ? 5.715   45.838 34.379  1.00 10.94 ? 657  ILE A CG2   1 
ATOM   3266 C CD1   . ILE C 3 361 ? 3.424   46.173 32.245  1.00 12.09 ? 657  ILE A CD1   1 
ATOM   3267 N N     . GLU C 3 362 ? 4.643   45.031 37.293  1.00 13.80 ? 658  GLU A N     1 
ATOM   3268 C CA    . GLU C 3 362 ? 4.336   43.749 37.937  1.00 14.65 ? 658  GLU A CA    1 
ATOM   3269 C C     . GLU C 3 362 ? 3.439   43.915 39.152  1.00 14.14 ? 658  GLU A C     1 
ATOM   3270 O O     . GLU C 3 362 ? 2.399   43.257 39.272  1.00 14.42 ? 658  GLU A O     1 
ATOM   3271 C CB    . GLU C 3 362 ? 5.631   43.033 38.316  1.00 15.20 ? 658  GLU A CB    1 
ATOM   3272 C CG    . GLU C 3 362 ? 6.547   42.733 37.102  1.00 19.99 ? 658  GLU A CG    1 
ATOM   3273 C CD    . GLU C 3 362 ? 7.494   43.909 36.707  1.00 23.08 ? 658  GLU A CD    1 
ATOM   3274 O OE1   . GLU C 3 362 ? 7.393   45.037 37.297  1.00 23.81 ? 658  GLU A OE1   1 
ATOM   3275 O OE2   . GLU C 3 362 ? 8.353   43.702 35.799  1.00 23.47 ? 658  GLU A OE2   1 
ATOM   3276 N N     . LEU C 3 363 ? 3.821   44.813 40.048  1.00 14.23 ? 659  LEU A N     1 
ATOM   3277 C CA    . LEU C 3 363 ? 3.012   45.036 41.240  1.00 14.41 ? 659  LEU A CA    1 
ATOM   3278 C C     . LEU C 3 363 ? 1.665   45.620 40.840  1.00 13.41 ? 659  LEU A C     1 
ATOM   3279 O O     . LEU C 3 363 ? 0.656   45.342 41.489  1.00 13.62 ? 659  LEU A O     1 
ATOM   3280 C CB    . LEU C 3 363 ? 3.755   45.966 42.208  1.00 15.38 ? 659  LEU A CB    1 
ATOM   3281 C CG    . LEU C 3 363 ? 4.358   45.404 43.498  1.00 17.02 ? 659  LEU A CG    1 
ATOM   3282 C CD1   . LEU C 3 363 ? 4.335   43.877 43.493  1.00 17.28 ? 659  LEU A CD1   1 
ATOM   3283 C CD2   . LEU C 3 363 ? 5.760   45.925 43.677  1.00 16.72 ? 659  LEU A CD2   1 
ATOM   3284 N N     . ARG C 3 364 ? 1.643   46.431 39.770  1.00 13.23 ? 660  ARG A N     1 
ATOM   3285 C CA    . ARG C 3 364 ? 0.393   47.012 39.279  1.00 12.79 ? 660  ARG A CA    1 
ATOM   3286 C C     . ARG C 3 364 ? -0.464  45.885 38.698  1.00 12.83 ? 660  ARG A C     1 
ATOM   3287 O O     . ARG C 3 364 ? -1.686  45.858 38.872  1.00 12.39 ? 660  ARG A O     1 
ATOM   3288 C CB    . ARG C 3 364 ? 0.649   48.073 38.189  1.00 13.22 ? 660  ARG A CB    1 
ATOM   3289 C CG    . ARG C 3 364 ? 0.976   49.466 38.731  1.00 13.98 ? 660  ARG A CG    1 
ATOM   3290 C CD    . ARG C 3 364 ? 1.528   50.399 37.633  1.00 15.05 ? 660  ARG A CD    1 
ATOM   3291 N NE    . ARG C 3 364 ? 2.212   51.576 38.198  1.00 16.48 ? 660  ARG A NE    1 
ATOM   3292 C CZ    . ARG C 3 364 ? 1.614   52.726 38.533  1.00 13.71 ? 660  ARG A CZ    1 
ATOM   3293 N NH1   . ARG C 3 364 ? 0.308   52.888 38.365  1.00 13.12 ? 660  ARG A NH1   1 
ATOM   3294 N NH2   . ARG C 3 364 ? 2.324   53.704 39.084  1.00 13.97 ? 660  ARG A NH2   1 
ATOM   3295 N N     . VAL C 3 365 ? 0.174   44.960 37.987  1.00 12.98 ? 661  VAL A N     1 
ATOM   3296 C CA    . VAL C 3 365 ? -0.576  43.839 37.447  1.00 12.84 ? 661  VAL A CA    1 
ATOM   3297 C C     . VAL C 3 365 ? -1.091  43.012 38.644  1.00 12.37 ? 661  VAL A C     1 
ATOM   3298 O O     . VAL C 3 365 ? -2.230  42.564 38.637  1.00 13.68 ? 661  VAL A O     1 
ATOM   3299 C CB    . VAL C 3 365 ? 0.305   42.972 36.536  1.00 12.87 ? 661  VAL A CB    1 
ATOM   3300 C CG1   . VAL C 3 365 ? -0.297  41.554 36.409  1.00 12.49 ? 661  VAL A CG1   1 
ATOM   3301 C CG2   . VAL C 3 365 ? 0.443   43.655 35.164  1.00 14.50 ? 661  VAL A CG2   1 
ATOM   3302 N N     . LEU C 3 366 ? -0.266  42.821 39.667  1.00 12.35 ? 662  LEU A N     1 
ATOM   3303 C CA    . LEU C 3 366 ? -0.709  42.059 40.854  1.00 13.32 ? 662  LEU A CA    1 
ATOM   3304 C C     . LEU C 3 366 ? -1.926  42.726 41.519  1.00 13.23 ? 662  LEU A C     1 
ATOM   3305 O O     . LEU C 3 366 ? -2.915  42.053 41.858  1.00 12.07 ? 662  LEU A O     1 
ATOM   3306 C CB    . LEU C 3 366 ? 0.434   41.918 41.869  1.00 13.73 ? 662  LEU A CB    1 
ATOM   3307 C CG    . LEU C 3 366 ? 0.124   41.305 43.249  1.00 13.60 ? 662  LEU A CG    1 
ATOM   3308 C CD1   . LEU C 3 366 ? -0.463  39.883 43.103  1.00 12.34 ? 662  LEU A CD1   1 
ATOM   3309 C CD2   . LEU C 3 366 ? 1.411   41.302 44.055  1.00 13.37 ? 662  LEU A CD2   1 
ATOM   3310 N N     . ALA C 3 367 ? -1.871  44.057 41.664  1.00 14.18 ? 663  ALA A N     1 
ATOM   3311 C CA    . ALA C 3 367 ? -2.980  44.806 42.265  1.00 14.04 ? 663  ALA A CA    1 
ATOM   3312 C C     . ALA C 3 367 ? -4.238  44.543 41.452  1.00 14.79 ? 663  ALA A C     1 
ATOM   3313 O O     . ALA C 3 367 ? -5.329  44.393 41.994  1.00 14.51 ? 663  ALA A O     1 
ATOM   3314 C CB    . ALA C 3 367 ? -2.664  46.327 42.285  1.00 13.60 ? 663  ALA A CB    1 
ATOM   3315 N N     . HIS C 3 368 ? -4.078  44.463 40.136  1.00 15.33 ? 664  HIS A N     1 
ATOM   3316 C CA    . HIS C 3 368 ? -5.212  44.233 39.259  1.00 15.91 ? 664  HIS A CA    1 
ATOM   3317 C C     . HIS C 3 368 ? -5.802  42.830 39.346  1.00 16.12 ? 664  HIS A C     1 
ATOM   3318 O O     . HIS C 3 368 ? -7.012  42.678 39.484  1.00 15.77 ? 664  HIS A O     1 
ATOM   3319 C CB    . HIS C 3 368 ? -4.804  44.512 37.804  1.00 17.46 ? 664  HIS A CB    1 
ATOM   3320 C CG    . HIS C 3 368 ? -5.828  44.074 36.802  1.00 17.54 ? 664  HIS A CG    1 
ATOM   3321 N ND1   . HIS C 3 368 ? -6.917  44.851 36.461  1.00 17.96 ? 664  HIS A ND1   1 
ATOM   3322 C CD2   . HIS C 3 368 ? -5.937  42.935 36.080  1.00 17.12 ? 664  HIS A CD2   1 
ATOM   3323 C CE1   . HIS C 3 368 ? -7.653  44.210 35.573  1.00 18.20 ? 664  HIS A CE1   1 
ATOM   3324 N NE2   . HIS C 3 368 ? -7.080  43.045 35.326  1.00 17.97 ? 664  HIS A NE2   1 
ATOM   3325 N N     . ILE C 3 369 ? -4.953  41.804 39.250  1.00 17.82 ? 665  ILE A N     1 
ATOM   3326 C CA    . ILE C 3 369 ? -5.448  40.422 39.291  1.00 18.59 ? 665  ILE A CA    1 
ATOM   3327 C C     . ILE C 3 369 ? -5.944  39.980 40.668  1.00 19.38 ? 665  ILE A C     1 
ATOM   3328 O O     . ILE C 3 369 ? -6.913  39.232 40.745  1.00 19.47 ? 665  ILE A O     1 
ATOM   3329 C CB    . ILE C 3 369 ? -4.402  39.374 38.752  1.00 17.82 ? 665  ILE A CB    1 
ATOM   3330 C CG1   . ILE C 3 369 ? -3.229  39.238 39.709  1.00 18.60 ? 665  ILE A CG1   1 
ATOM   3331 C CG2   . ILE C 3 369 ? -3.903  39.780 37.372  1.00 17.09 ? 665  ILE A CG2   1 
ATOM   3332 C CD1   . ILE C 3 369 ? -1.999  38.531 39.116  1.00 17.94 ? 665  ILE A CD1   1 
ATOM   3333 N N     . ALA C 3 370 ? -5.305  40.440 41.748  1.00 20.11 ? 666  ALA A N     1 
ATOM   3334 C CA    . ALA C 3 370 ? -5.746  40.076 43.104  1.00 19.84 ? 666  ALA A CA    1 
ATOM   3335 C C     . ALA C 3 370 ? -6.892  41.001 43.552  1.00 21.34 ? 666  ALA A C     1 
ATOM   3336 O O     . ALA C 3 370 ? -7.685  40.662 44.443  1.00 21.71 ? 666  ALA A O     1 
ATOM   3337 C CB    . ALA C 3 370 ? -4.565  40.175 44.102  1.00 18.81 ? 666  ALA A CB    1 
ATOM   3338 N N     . GLU C 3 371 ? -6.997  42.163 42.915  1.00 21.71 ? 667  GLU A N     1 
ATOM   3339 C CA    . GLU C 3 371 ? -8.013  43.143 43.277  1.00 22.23 ? 667  GLU A CA    1 
ATOM   3340 C C     . GLU C 3 371 ? -7.910  43.469 44.765  1.00 21.49 ? 667  GLU A C     1 
ATOM   3341 O O     . GLU C 3 371 ? -8.911  43.510 45.492  1.00 20.59 ? 667  GLU A O     1 
ATOM   3342 C CB    . GLU C 3 371 ? -9.400  42.632 42.960  1.00 23.98 ? 667  GLU A CB    1 
ATOM   3343 C CG    . GLU C 3 371 ? -9.665  42.516 41.482  1.00 27.46 ? 667  GLU A CG    1 
ATOM   3344 C CD    . GLU C 3 371 ? -11.069 42.065 41.223  1.00 29.20 ? 667  GLU A CD    1 
ATOM   3345 O OE1   . GLU C 3 371 ? -11.988 42.902 41.336  1.00 30.89 ? 667  GLU A OE1   1 
ATOM   3346 O OE2   . GLU C 3 371 ? -11.260 40.866 40.922  1.00 31.39 ? 667  GLU A OE2   1 
ATOM   3347 N N     . ASP C 3 372 ? -6.680  43.694 45.206  1.00 19.97 ? 668  ASP A N     1 
ATOM   3348 C CA    . ASP C 3 372 ? -6.428  44.053 46.578  1.00 20.31 ? 668  ASP A CA    1 
ATOM   3349 C C     . ASP C 3 372 ? -6.739  45.550 46.757  1.00 20.54 ? 668  ASP A C     1 
ATOM   3350 O O     . ASP C 3 372 ? -6.083  46.403 46.159  1.00 19.75 ? 668  ASP A O     1 
ATOM   3351 C CB    . ASP C 3 372 ? -4.968  43.792 46.899  1.00 19.93 ? 668  ASP A CB    1 
ATOM   3352 C CG    . ASP C 3 372 ? -4.643  44.047 48.361  1.00 20.70 ? 668  ASP A CG    1 
ATOM   3353 O OD1   . ASP C 3 372 ? -4.516  45.230 48.770  1.00 18.05 ? 668  ASP A OD1   1 
ATOM   3354 O OD2   . ASP C 3 372 ? -4.525  43.044 49.087  1.00 19.74 ? 668  ASP A OD2   1 
ATOM   3355 N N     . ASP C 3 373 ? -7.734  45.872 47.576  1.00 21.53 ? 669  ASP A N     1 
ATOM   3356 C CA    . ASP C 3 373 ? -8.098  47.274 47.804  1.00 22.20 ? 669  ASP A CA    1 
ATOM   3357 C C     . ASP C 3 373 ? -6.924  48.174 48.202  1.00 21.34 ? 669  ASP A C     1 
ATOM   3358 O O     . ASP C 3 373 ? -6.761  49.255 47.651  1.00 20.96 ? 669  ASP A O     1 
ATOM   3359 C CB    . ASP C 3 373 ? -9.167  47.369 48.883  1.00 24.30 ? 669  ASP A CB    1 
ATOM   3360 C CG    . ASP C 3 373 ? -10.544 47.001 48.373  1.00 28.18 ? 669  ASP A CG    1 
ATOM   3361 O OD1   . ASP C 3 373 ? -10.668 46.663 47.178  1.00 29.68 ? 669  ASP A OD1   1 
ATOM   3362 O OD2   . ASP C 3 373 ? -11.519 47.048 49.167  1.00 31.15 ? 669  ASP A OD2   1 
ATOM   3363 N N     . ASN C 3 374 ? -6.117  47.736 49.162  1.00 20.70 ? 670  ASN A N     1 
ATOM   3364 C CA    . ASN C 3 374 ? -4.988  48.532 49.636  1.00 21.08 ? 670  ASN A CA    1 
ATOM   3365 C C     . ASN C 3 374 ? -3.970  48.749 48.533  1.00 20.34 ? 670  ASN A C     1 
ATOM   3366 O O     . ASN C 3 374 ? -3.507  49.872 48.310  1.00 19.80 ? 670  ASN A O     1 
ATOM   3367 C CB    . ASN C 3 374 ? -4.327  47.848 50.857  1.00 22.31 ? 670  ASN A CB    1 
ATOM   3368 C CG    . ASN C 3 374 ? -3.319  48.761 51.606  1.00 23.98 ? 670  ASN A CG    1 
ATOM   3369 O OD1   . ASN C 3 374 ? -3.450  50.001 51.635  1.00 25.31 ? 670  ASN A OD1   1 
ATOM   3370 N ND2   . ASN C 3 374 ? -2.306  48.134 52.220  1.00 24.08 ? 670  ASN A ND2   1 
ATOM   3371 N N     . LEU C 3 375 ? -3.607  47.669 47.852  1.00 19.69 ? 671  LEU A N     1 
ATOM   3372 C CA    . LEU C 3 375 ? -2.631  47.738 46.761  1.00 18.91 ? 671  LEU A CA    1 
ATOM   3373 C C     . LEU C 3 375 ? -3.141  48.625 45.601  1.00 17.22 ? 671  LEU A C     1 
ATOM   3374 O O     . LEU C 3 375 ? -2.382  49.425 45.058  1.00 16.49 ? 671  LEU A O     1 
ATOM   3375 C CB    . LEU C 3 375 ? -2.342  46.318 46.236  1.00 19.94 ? 671  LEU A CB    1 
ATOM   3376 C CG    . LEU C 3 375 ? -0.899  45.872 46.039  1.00 21.55 ? 671  LEU A CG    1 
ATOM   3377 C CD1   . LEU C 3 375 ? -0.757  45.297 44.656  1.00 22.55 ? 671  LEU A CD1   1 
ATOM   3378 C CD2   . LEU C 3 375 ? 0.047   47.032 46.235  1.00 22.36 ? 671  LEU A CD2   1 
ATOM   3379 N N     . MET C 3 376 ? -4.414  48.472 45.218  1.00 17.29 ? 672  MET A N     1 
ATOM   3380 C CA    . MET C 3 376 ? -4.983  49.273 44.126  1.00 17.32 ? 672  MET A CA    1 
ATOM   3381 C C     . MET C 3 376 ? -5.027  50.757 44.507  1.00 18.17 ? 672  MET A C     1 
ATOM   3382 O O     . MET C 3 376 ? -4.738  51.618 43.674  1.00 18.04 ? 672  MET A O     1 
ATOM   3383 C CB    . MET C 3 376 ? -6.390  48.807 43.781  1.00 16.40 ? 672  MET A CB    1 
ATOM   3384 C CG    . MET C 3 376 ? -6.465  47.379 43.249  1.00 17.31 ? 672  MET A CG    1 
ATOM   3385 S SD    . MET C 3 376 ? -8.114  47.020 42.625  1.00 17.59 ? 672  MET A SD    1 
ATOM   3386 C CE    . MET C 3 376 ? -9.027  46.800 44.130  1.00 17.14 ? 672  MET A CE    1 
ATOM   3387 N N     . GLU C 3 377 ? -5.386  51.044 45.759  1.00 17.39 ? 673  GLU A N     1 
ATOM   3388 C CA    . GLU C 3 377 ? -5.442  52.421 46.239  1.00 17.70 ? 673  GLU A CA    1 
ATOM   3389 C C     . GLU C 3 377 ? -4.041  53.018 46.226  1.00 17.25 ? 673  GLU A C     1 
ATOM   3390 O O     . GLU C 3 377 ? -3.860  54.190 45.861  1.00 18.50 ? 673  GLU A O     1 
ATOM   3391 C CB    . GLU C 3 377 ? -6.049  52.498 47.647  1.00 17.24 ? 673  GLU A CB    1 
ATOM   3392 C CG    . GLU C 3 377 ? -6.018  53.906 48.285  1.00 18.98 ? 673  GLU A CG    1 
ATOM   3393 C CD    . GLU C 3 377 ? -7.008  54.923 47.654  1.00 20.37 ? 673  GLU A CD    1 
ATOM   3394 O OE1   . GLU C 3 377 ? -7.840  54.550 46.795  1.00 19.19 ? 673  GLU A OE1   1 
ATOM   3395 O OE2   . GLU C 3 377 ? -6.950  56.117 48.033  1.00 22.07 ? 673  GLU A OE2   1 
ATOM   3396 N N     . ALA C 3 378 ? -3.043  52.225 46.582  1.00 16.47 ? 674  ALA A N     1 
ATOM   3397 C CA    . ALA C 3 378 ? -1.670  52.731 46.580  1.00 16.98 ? 674  ALA A CA    1 
ATOM   3398 C C     . ALA C 3 378 ? -1.219  53.167 45.174  1.00 17.73 ? 674  ALA A C     1 
ATOM   3399 O O     . ALA C 3 378 ? -0.556  54.198 45.006  1.00 17.75 ? 674  ALA A O     1 
ATOM   3400 C CB    . ALA C 3 378 ? -0.710  51.677 47.127  1.00 16.24 ? 674  ALA A CB    1 
ATOM   3401 N N     . PHE C 3 379 ? -1.566  52.387 44.158  1.00 17.18 ? 675  PHE A N     1 
ATOM   3402 C CA    . PHE C 3 379 ? -1.171  52.748 42.815  1.00 16.77 ? 675  PHE A CA    1 
ATOM   3403 C C     . PHE C 3 379 ? -2.040  53.875 42.257  1.00 16.83 ? 675  PHE A C     1 
ATOM   3404 O O     . PHE C 3 379 ? -1.568  54.677 41.457  1.00 18.05 ? 675  PHE A O     1 
ATOM   3405 C CB    . PHE C 3 379 ? -1.191  51.501 41.927  1.00 15.83 ? 675  PHE A CB    1 
ATOM   3406 C CG    . PHE C 3 379 ? 0.032   50.668 42.082  1.00 13.94 ? 675  PHE A CG    1 
ATOM   3407 C CD1   . PHE C 3 379 ? 1.269   51.207 41.824  1.00 13.29 ? 675  PHE A CD1   1 
ATOM   3408 C CD2   . PHE C 3 379 ? -0.052  49.367 42.538  1.00 14.68 ? 675  PHE A CD2   1 
ATOM   3409 C CE1   . PHE C 3 379 ? 2.419   50.478 42.020  1.00 14.47 ? 675  PHE A CE1   1 
ATOM   3410 C CE2   . PHE C 3 379 ? 1.090   48.618 42.740  1.00 13.56 ? 675  PHE A CE2   1 
ATOM   3411 C CZ    . PHE C 3 379 ? 2.330   49.165 42.485  1.00 14.53 ? 675  PHE A CZ    1 
ATOM   3412 N N     . ARG C 3 380 ? -3.299  53.936 42.688  1.00 17.01 ? 676  ARG A N     1 
ATOM   3413 C CA    . ARG C 3 380 ? -4.209  55.002 42.274  1.00 18.32 ? 676  ARG A CA    1 
ATOM   3414 C C     . ARG C 3 380 ? -3.702  56.374 42.778  1.00 19.06 ? 676  ARG A C     1 
ATOM   3415 O O     . ARG C 3 380 ? -3.970  57.416 42.160  1.00 19.41 ? 676  ARG A O     1 
ATOM   3416 C CB    . ARG C 3 380 ? -5.621  54.724 42.796  1.00 17.81 ? 676  ARG A CB    1 
ATOM   3417 C CG    . ARG C 3 380 ? -6.369  53.760 41.898  1.00 18.25 ? 676  ARG A CG    1 
ATOM   3418 C CD    . ARG C 3 380 ? -7.708  53.313 42.453  1.00 19.72 ? 676  ARG A CD    1 
ATOM   3419 N NE    . ARG C 3 380 ? -8.230  52.226 41.634  1.00 22.67 ? 676  ARG A NE    1 
ATOM   3420 C CZ    . ARG C 3 380 ? -9.089  51.286 42.040  1.00 25.39 ? 676  ARG A CZ    1 
ATOM   3421 N NH1   . ARG C 3 380 ? -9.561  51.268 43.291  1.00 25.24 ? 676  ARG A NH1   1 
ATOM   3422 N NH2   . ARG C 3 380 ? -9.489  50.356 41.172  1.00 25.10 ? 676  ARG A NH2   1 
ATOM   3423 N N     . ARG C 3 381 ? -2.938  56.342 43.873  1.00 18.51 ? 677  ARG A N     1 
ATOM   3424 C CA    . ARG C 3 381 ? -2.328  57.519 44.493  1.00 17.65 ? 677  ARG A CA    1 
ATOM   3425 C C     . ARG C 3 381 ? -0.901  57.701 43.970  1.00 17.40 ? 677  ARG A C     1 
ATOM   3426 O O     . ARG C 3 381 ? -0.223  58.653 44.330  1.00 18.06 ? 677  ARG A O     1 
ATOM   3427 C CB    . ARG C 3 381 ? -2.257  57.336 46.018  1.00 17.52 ? 677  ARG A CB    1 
ATOM   3428 C CG    . ARG C 3 381 ? -3.585  57.481 46.765  1.00 18.30 ? 677  ARG A CG    1 
ATOM   3429 C CD    . ARG C 3 381 ? -3.375  57.440 48.287  1.00 19.04 ? 677  ARG A CD    1 
ATOM   3430 N NE    . ARG C 3 381 ? -4.596  57.089 49.026  1.00 19.40 ? 677  ARG A NE    1 
ATOM   3431 C CZ    . ARG C 3 381 ? -4.666  57.063 50.359  1.00 19.14 ? 677  ARG A CZ    1 
ATOM   3432 N NH1   . ARG C 3 381 ? -3.592  57.377 51.073  1.00 18.07 ? 677  ARG A NH1   1 
ATOM   3433 N NH2   . ARG C 3 381 ? -5.798  56.721 50.974  1.00 17.99 ? 677  ARG A NH2   1 
ATOM   3434 N N     . ASP C 3 382 ? -0.454  56.790 43.115  1.00 17.39 ? 678  ASP A N     1 
ATOM   3435 C CA    . ASP C 3 382 ? 0.904   56.812 42.582  1.00 18.03 ? 678  ASP A CA    1 
ATOM   3436 C C     . ASP C 3 382 ? 1.919   56.963 43.706  1.00 18.56 ? 678  ASP A C     1 
ATOM   3437 O O     . ASP C 3 382 ? 2.890   57.712 43.617  1.00 18.23 ? 678  ASP A O     1 
ATOM   3438 C CB    . ASP C 3 382 ? 1.099   57.923 41.539  1.00 19.07 ? 678  ASP A CB    1 
ATOM   3439 C CG    . ASP C 3 382 ? 2.363   57.712 40.688  1.00 19.23 ? 678  ASP A CG    1 
ATOM   3440 O OD1   . ASP C 3 382 ? 2.782   56.559 40.477  1.00 19.83 ? 678  ASP A OD1   1 
ATOM   3441 O OD2   . ASP C 3 382 ? 2.957   58.696 40.225  1.00 19.79 ? 678  ASP A OD2   1 
ATOM   3442 N N     . LEU C 3 383 ? 1.698   56.201 44.764  1.00 19.76 ? 679  LEU A N     1 
ATOM   3443 C CA    . LEU C 3 383 ? 2.567   56.217 45.937  1.00 19.46 ? 679  LEU A CA    1 
ATOM   3444 C C     . LEU C 3 383 ? 3.897   55.520 45.696  1.00 19.11 ? 679  LEU A C     1 
ATOM   3445 O O     . LEU C 3 383 ? 4.023   54.726 44.768  1.00 19.49 ? 679  LEU A O     1 
ATOM   3446 C CB    . LEU C 3 383 ? 1.860   55.511 47.101  1.00 19.58 ? 679  LEU A CB    1 
ATOM   3447 C CG    . LEU C 3 383 ? 0.595   56.119 47.697  1.00 20.22 ? 679  LEU A CG    1 
ATOM   3448 C CD1   . LEU C 3 383 ? 0.105   55.252 48.874  1.00 21.30 ? 679  LEU A CD1   1 
ATOM   3449 C CD2   . LEU C 3 383 ? 0.905   57.524 48.168  1.00 19.24 ? 679  LEU A CD2   1 
ATOM   3450 N N     . ASP C 3 384 ? 4.896   55.831 46.514  1.00 18.07 ? 680  ASP A N     1 
ATOM   3451 C CA    . ASP C 3 384 ? 6.156   55.129 46.417  1.00 18.84 ? 680  ASP A CA    1 
ATOM   3452 C C     . ASP C 3 384 ? 5.730   53.780 47.041  1.00 19.29 ? 680  ASP A C     1 
ATOM   3453 O O     . ASP C 3 384 ? 5.409   53.700 48.238  1.00 19.25 ? 680  ASP A O     1 
ATOM   3454 C CB    . ASP C 3 384 ? 7.227   55.797 47.271  1.00 19.12 ? 680  ASP A CB    1 
ATOM   3455 C CG    . ASP C 3 384 ? 8.510   55.005 47.289  1.00 19.92 ? 680  ASP A CG    1 
ATOM   3456 O OD1   . ASP C 3 384 ? 8.432   53.772 47.404  1.00 21.60 ? 680  ASP A OD1   1 
ATOM   3457 O OD2   . ASP C 3 384 ? 9.603   55.584 47.180  1.00 22.87 ? 680  ASP A OD2   1 
ATOM   3458 N N     . ILE C 3 385 ? 5.693   52.729 46.225  1.00 18.94 ? 681  ILE A N     1 
ATOM   3459 C CA    . ILE C 3 385 ? 5.217   51.436 46.698  1.00 18.32 ? 681  ILE A CA    1 
ATOM   3460 C C     . ILE C 3 385 ? 6.076   50.777 47.774  1.00 17.51 ? 681  ILE A C     1 
ATOM   3461 O O     . ILE C 3 385 ? 5.556   50.061 48.624  1.00 17.34 ? 681  ILE A O     1 
ATOM   3462 C CB    . ILE C 3 385 ? 4.977   50.456 45.480  1.00 18.69 ? 681  ILE A CB    1 
ATOM   3463 C CG1   . ILE C 3 385 ? 4.001   49.341 45.881  1.00 19.00 ? 681  ILE A CG1   1 
ATOM   3464 C CG2   . ILE C 3 385 ? 6.295   49.918 44.973  1.00 18.24 ? 681  ILE A CG2   1 
ATOM   3465 C CD1   . ILE C 3 385 ? 2.638   49.837 46.392  1.00 18.17 ? 681  ILE A CD1   1 
ATOM   3466 N N     . HIS C 3 386 ? 7.379   51.015 47.749  1.00 17.51 ? 682  HIS A N     1 
ATOM   3467 C CA    . HIS C 3 386 ? 8.231   50.439 48.774  1.00 18.80 ? 682  HIS A CA    1 
ATOM   3468 C C     . HIS C 3 386 ? 8.086   51.160 50.135  1.00 18.63 ? 682  HIS A C     1 
ATOM   3469 O O     . HIS C 3 386 ? 8.156   50.531 51.192  1.00 18.54 ? 682  HIS A O     1 
ATOM   3470 C CB    . HIS C 3 386 ? 9.667   50.450 48.296  1.00 19.52 ? 682  HIS A CB    1 
ATOM   3471 C CG    . HIS C 3 386 ? 9.853   49.710 47.017  1.00 22.98 ? 682  HIS A CG    1 
ATOM   3472 N ND1   . HIS C 3 386 ? 10.616  50.196 45.976  1.00 24.37 ? 682  HIS A ND1   1 
ATOM   3473 C CD2   . HIS C 3 386 ? 9.338   48.531 46.592  1.00 22.56 ? 682  HIS A CD2   1 
ATOM   3474 C CE1   . HIS C 3 386 ? 10.565  49.348 44.964  1.00 23.15 ? 682  HIS A CE1   1 
ATOM   3475 N NE2   . HIS C 3 386 ? 9.797   48.332 45.314  1.00 23.82 ? 682  HIS A NE2   1 
ATOM   3476 N N     . THR C 3 387 ? 7.884   52.472 50.104  1.00 18.52 ? 683  THR A N     1 
ATOM   3477 C CA    . THR C 3 387 ? 7.692   53.252 51.330  1.00 16.88 ? 683  THR A CA    1 
ATOM   3478 C C     . THR C 3 387 ? 6.313   52.868 51.866  1.00 17.32 ? 683  THR A C     1 
ATOM   3479 O O     . THR C 3 387 ? 6.134   52.650 53.064  1.00 16.80 ? 683  THR A O     1 
ATOM   3480 C CB    . THR C 3 387 ? 7.777   54.776 51.018  1.00 15.58 ? 683  THR A CB    1 
ATOM   3481 O OG1   . THR C 3 387 ? 9.143   55.108 50.769  1.00 15.42 ? 683  THR A OG1   1 
ATOM   3482 C CG2   . THR C 3 387 ? 7.261   55.634 52.181  1.00 14.50 ? 683  THR A CG2   1 
ATOM   3483 N N     . LYS C 3 388 ? 5.334   52.753 50.976  1.00 17.58 ? 684  LYS A N     1 
ATOM   3484 C CA    . LYS C 3 388 ? 3.995   52.374 51.404  1.00 18.65 ? 684  LYS A CA    1 
ATOM   3485 C C     . LYS C 3 388 ? 3.962   50.946 52.035  1.00 19.03 ? 684  LYS A C     1 
ATOM   3486 O O     . LYS C 3 388 ? 3.261   50.694 53.040  1.00 18.78 ? 684  LYS A O     1 
ATOM   3487 C CB    . LYS C 3 388 ? 3.051   52.469 50.208  1.00 19.37 ? 684  LYS A CB    1 
ATOM   3488 C CG    . LYS C 3 388 ? 1.771   51.686 50.358  1.00 19.96 ? 684  LYS A CG    1 
ATOM   3489 C CD    . LYS C 3 388 ? 0.881   52.233 51.466  1.00 20.23 ? 684  LYS A CD    1 
ATOM   3490 C CE    . LYS C 3 388 ? -0.466  51.537 51.434  1.00 20.83 ? 684  LYS A CE    1 
ATOM   3491 N NZ    . LYS C 3 388 ? -1.346  51.988 52.515  1.00 21.66 ? 684  LYS A NZ    1 
ATOM   3492 N N     . THR C 3 389 ? 4.718   50.019 51.452  1.00 18.11 ? 685  THR A N     1 
ATOM   3493 C CA    . THR C 3 389 ? 4.777   48.659 51.983  1.00 18.04 ? 685  THR A CA    1 
ATOM   3494 C C     . THR C 3 389 ? 5.466   48.685 53.364  1.00 17.70 ? 685  THR A C     1 
ATOM   3495 O O     . THR C 3 389 ? 5.018   48.009 54.290  1.00 17.22 ? 685  THR A O     1 
ATOM   3496 C CB    . THR C 3 389 ? 5.511   47.714 50.976  1.00 18.26 ? 685  THR A CB    1 
ATOM   3497 O OG1   . THR C 3 389 ? 4.796   47.721 49.734  1.00 19.10 ? 685  THR A OG1   1 
ATOM   3498 C CG2   . THR C 3 389 ? 5.554   46.282 51.484  1.00 17.62 ? 685  THR A CG2   1 
ATOM   3499 N N     . ALA C 3 390 ? 6.541   49.468 53.499  1.00 17.79 ? 686  ALA A N     1 
ATOM   3500 C CA    . ALA C 3 390 ? 7.244   49.613 54.783  1.00 18.17 ? 686  ALA A CA    1 
ATOM   3501 C C     . ALA C 3 390 ? 6.253   50.174 55.811  1.00 19.23 ? 686  ALA A C     1 
ATOM   3502 O O     . ALA C 3 390 ? 6.113   49.649 56.905  1.00 20.41 ? 686  ALA A O     1 
ATOM   3503 C CB    . ALA C 3 390 ? 8.441   50.554 54.638  1.00 16.64 ? 686  ALA A CB    1 
ATOM   3504 N N     . MET C 3 391 ? 5.560   51.248 55.461  1.00 20.36 ? 687  MET A N     1 
ATOM   3505 C CA    . MET C 3 391 ? 4.578   51.824 56.364  1.00 21.49 ? 687  MET A CA    1 
ATOM   3506 C C     . MET C 3 391 ? 3.608   50.753 56.860  1.00 22.50 ? 687  MET A C     1 
ATOM   3507 O O     . MET C 3 391 ? 3.294   50.666 58.053  1.00 21.69 ? 687  MET A O     1 
ATOM   3508 C CB    . MET C 3 391 ? 3.773   52.902 55.646  1.00 21.62 ? 687  MET A CB    1 
ATOM   3509 C CG    . MET C 3 391 ? 4.506   54.215 55.471  1.00 22.10 ? 687  MET A CG    1 
ATOM   3510 S SD    . MET C 3 391 ? 3.581   55.326 54.386  1.00 23.99 ? 687  MET A SD    1 
ATOM   3511 C CE    . MET C 3 391 ? 1.891   55.101 54.955  1.00 22.56 ? 687  MET A CE    1 
ATOM   3512 N N     . ASP C 3 392 ? 3.117   49.936 55.936  1.00 23.49 ? 688  ASP A N     1 
ATOM   3513 C CA    . ASP C 3 392 ? 2.151   48.900 56.297  1.00 24.81 ? 688  ASP A CA    1 
ATOM   3514 C C     . ASP C 3 392 ? 2.675   47.714 57.121  1.00 24.74 ? 688  ASP A C     1 
ATOM   3515 O O     . ASP C 3 392 ? 2.069   47.345 58.129  1.00 24.35 ? 688  ASP A O     1 
ATOM   3516 C CB    . ASP C 3 392 ? 1.456   48.374 55.035  1.00 25.04 ? 688  ASP A CB    1 
ATOM   3517 C CG    . ASP C 3 392 ? 0.363   49.290 54.564  1.00 26.43 ? 688  ASP A CG    1 
ATOM   3518 O OD1   . ASP C 3 392 ? 0.001   50.216 55.309  1.00 27.14 ? 688  ASP A OD1   1 
ATOM   3519 O OD2   . ASP C 3 392 ? -0.140  49.092 53.443  1.00 29.03 ? 688  ASP A OD2   1 
ATOM   3520 N N     . ILE C 3 393 ? 3.780   47.107 56.706  1.00 24.48 ? 689  ILE A N     1 
ATOM   3521 C CA    . ILE C 3 393 ? 4.259   45.968 57.456  1.00 25.24 ? 689  ILE A CA    1 
ATOM   3522 C C     . ILE C 3 393 ? 4.941   46.376 58.759  1.00 25.44 ? 689  ILE A C     1 
ATOM   3523 O O     . ILE C 3 393 ? 4.879   45.642 59.737  1.00 25.49 ? 689  ILE A O     1 
ATOM   3524 C CB    . ILE C 3 393 ? 5.182   45.044 56.594  1.00 24.85 ? 689  ILE A CB    1 
ATOM   3525 C CG1   . ILE C 3 393 ? 6.522   45.695 56.330  1.00 25.63 ? 689  ILE A CG1   1 
ATOM   3526 C CG2   . ILE C 3 393 ? 4.505   44.719 55.276  1.00 25.35 ? 689  ILE A CG2   1 
ATOM   3527 C CD1   . ILE C 3 393 ? 7.442   44.827 55.490  1.00 26.99 ? 689  ILE A CD1   1 
ATOM   3528 N N     . PHE C 3 394 ? 5.562   47.553 58.806  1.00 26.15 ? 690  PHE A N     1 
ATOM   3529 C CA    . PHE C 3 394 ? 6.218   47.972 60.044  1.00 25.98 ? 690  PHE A CA    1 
ATOM   3530 C C     . PHE C 3 394 ? 5.316   48.860 60.903  1.00 26.86 ? 690  PHE A C     1 
ATOM   3531 O O     . PHE C 3 394 ? 5.706   49.324 61.974  1.00 26.72 ? 690  PHE A O     1 
ATOM   3532 C CB    . PHE C 3 394 ? 7.530   48.674 59.736  1.00 24.76 ? 690  PHE A CB    1 
ATOM   3533 C CG    . PHE C 3 394 ? 8.481   47.841 58.935  1.00 25.21 ? 690  PHE A CG    1 
ATOM   3534 C CD1   . PHE C 3 394 ? 8.806   46.558 59.334  1.00 25.37 ? 690  PHE A CD1   1 
ATOM   3535 C CD2   . PHE C 3 394 ? 9.075   48.347 57.790  1.00 24.90 ? 690  PHE A CD2   1 
ATOM   3536 C CE1   . PHE C 3 394 ? 9.712   45.793 58.601  1.00 25.49 ? 690  PHE A CE1   1 
ATOM   3537 C CE2   . PHE C 3 394 ? 9.977   47.593 57.057  1.00 24.69 ? 690  PHE A CE2   1 
ATOM   3538 C CZ    . PHE C 3 394 ? 10.300  46.314 57.460  1.00 25.20 ? 690  PHE A CZ    1 
ATOM   3539 N N     . GLN C 3 395 ? 4.101   49.089 60.429  1.00 27.85 ? 691  GLN A N     1 
ATOM   3540 C CA    . GLN C 3 395 ? 3.147   49.897 61.164  1.00 30.05 ? 691  GLN A CA    1 
ATOM   3541 C C     . GLN C 3 395 ? 3.666   51.242 61.665  1.00 30.36 ? 691  GLN A C     1 
ATOM   3542 O O     . GLN C 3 395 ? 3.673   51.510 62.870  1.00 30.91 ? 691  GLN A O     1 
ATOM   3543 C CB    . GLN C 3 395 ? 2.622   49.108 62.346  1.00 32.29 ? 691  GLN A CB    1 
ATOM   3544 C CG    . GLN C 3 395 ? 1.196   48.673 62.183  1.00 35.97 ? 691  GLN A CG    1 
ATOM   3545 C CD    . GLN C 3 395 ? 0.955   47.290 62.754  1.00 39.06 ? 691  GLN A CD    1 
ATOM   3546 O OE1   . GLN C 3 395 ? 1.904   46.536 63.042  1.00 39.97 ? 691  GLN A OE1   1 
ATOM   3547 N NE2   . GLN C 3 395 ? -0.320  46.943 62.930  1.00 40.60 ? 691  GLN A NE2   1 
ATOM   3548 N N     . VAL C 3 396 ? 4.086   52.092 60.734  1.00 29.32 ? 692  VAL A N     1 
ATOM   3549 C CA    . VAL C 3 396 ? 4.586   53.411 61.066  1.00 28.12 ? 692  VAL A CA    1 
ATOM   3550 C C     . VAL C 3 396 ? 4.063   54.365 59.994  1.00 28.21 ? 692  VAL A C     1 
ATOM   3551 O O     . VAL C 3 396 ? 3.458   53.930 59.004  1.00 28.25 ? 692  VAL A O     1 
ATOM   3552 C CB    . VAL C 3 396 ? 6.127   53.429 61.105  1.00 27.91 ? 692  VAL A CB    1 
ATOM   3553 C CG1   . VAL C 3 396 ? 6.627   52.337 62.052  1.00 27.54 ? 692  VAL A CG1   1 
ATOM   3554 C CG2   . VAL C 3 396 ? 6.699   53.244 59.702  1.00 27.45 ? 692  VAL A CG2   1 
ATOM   3555 N N     . SER C 3 397 ? 4.268   55.661 60.201  1.00 27.46 ? 693  SER A N     1 
ATOM   3556 C CA    . SER C 3 397 ? 3.802   56.662 59.255  1.00 27.21 ? 693  SER A CA    1 
ATOM   3557 C C     . SER C 3 397 ? 4.866   56.825 58.200  1.00 27.51 ? 693  SER A C     1 
ATOM   3558 O O     . SER C 3 397 ? 5.970   56.278 58.343  1.00 27.38 ? 693  SER A O     1 
ATOM   3559 C CB    . SER C 3 397 ? 3.556   57.999 59.965  1.00 26.42 ? 693  SER A CB    1 
ATOM   3560 O OG    . SER C 3 397 ? 4.762   58.571 60.435  1.00 25.42 ? 693  SER A OG    1 
ATOM   3561 N N     . GLU C 3 398 ? 4.546   57.569 57.142  1.00 27.47 ? 694  GLU A N     1 
ATOM   3562 C CA    . GLU C 3 398 ? 5.514   57.771 56.085  1.00 27.84 ? 694  GLU A CA    1 
ATOM   3563 C C     . GLU C 3 398 ? 6.726   58.440 56.701  1.00 27.62 ? 694  GLU A C     1 
ATOM   3564 O O     . GLU C 3 398 ? 7.865   58.180 56.314  1.00 27.31 ? 694  GLU A O     1 
ATOM   3565 C CB    . GLU C 3 398 ? 4.945   58.647 54.963  1.00 27.66 ? 694  GLU A CB    1 
ATOM   3566 C CG    . GLU C 3 398 ? 6.007   58.990 53.925  1.00 28.94 ? 694  GLU A CG    1 
ATOM   3567 C CD    . GLU C 3 398 ? 5.459   59.687 52.689  1.00 29.55 ? 694  GLU A CD    1 
ATOM   3568 O OE1   . GLU C 3 398 ? 4.230   59.696 52.495  1.00 29.45 ? 694  GLU A OE1   1 
ATOM   3569 O OE2   . GLU C 3 398 ? 6.273   60.220 51.905  1.00 31.14 ? 694  GLU A OE2   1 
ATOM   3570 N N     . ASP C 3 399 ? 6.469   59.297 57.678  1.00 28.50 ? 695  ASP A N     1 
ATOM   3571 C CA    . ASP C 3 399 ? 7.527   60.021 58.373  1.00 29.37 ? 695  ASP A CA    1 
ATOM   3572 C C     . ASP C 3 399 ? 8.493   59.134 59.096  1.00 27.98 ? 695  ASP A C     1 
ATOM   3573 O O     . ASP C 3 399 ? 9.691   59.402 59.123  1.00 28.03 ? 695  ASP A O     1 
ATOM   3574 C CB    . ASP C 3 399 ? 6.938   60.976 59.394  1.00 32.83 ? 695  ASP A CB    1 
ATOM   3575 C CG    . ASP C 3 399 ? 6.753   62.333 58.832  1.00 36.06 ? 695  ASP A CG    1 
ATOM   3576 O OD1   . ASP C 3 399 ? 6.450   62.413 57.610  1.00 38.68 ? 695  ASP A OD1   1 
ATOM   3577 O OD2   . ASP C 3 399 ? 6.920   63.309 59.595  1.00 38.95 ? 695  ASP A OD2   1 
ATOM   3578 N N     . GLU C 3 400 ? 7.975   58.075 59.693  1.00 26.80 ? 696  GLU A N     1 
ATOM   3579 C CA    . GLU C 3 400 ? 8.845   57.198 60.424  1.00 26.17 ? 696  GLU A CA    1 
ATOM   3580 C C     . GLU C 3 400 ? 9.447   56.046 59.636  1.00 25.65 ? 696  GLU A C     1 
ATOM   3581 O O     . GLU C 3 400 ? 10.135  55.224 60.227  1.00 25.29 ? 696  GLU A O     1 
ATOM   3582 C CB    . GLU C 3 400 ? 8.153   56.669 61.685  1.00 27.74 ? 696  GLU A CB    1 
ATOM   3583 C CG    . GLU C 3 400 ? 6.658   56.478 61.590  1.00 31.95 ? 696  GLU A CG    1 
ATOM   3584 C CD    . GLU C 3 400 ? 5.914   56.894 62.864  1.00 32.61 ? 696  GLU A CD    1 
ATOM   3585 O OE1   . GLU C 3 400 ? 6.378   57.847 63.521  1.00 33.91 ? 696  GLU A OE1   1 
ATOM   3586 O OE2   . GLU C 3 400 ? 4.872   56.278 63.199  1.00 33.00 ? 696  GLU A OE2   1 
ATOM   3587 N N     . VAL C 3 401 ? 9.226   55.939 58.321  1.00 23.78 ? 697  VAL A N     1 
ATOM   3588 C CA    . VAL C 3 401 ? 9.900   54.829 57.658  1.00 22.17 ? 697  VAL A CA    1 
ATOM   3589 C C     . VAL C 3 401 ? 11.313  55.292 57.352  1.00 20.71 ? 697  VAL A C     1 
ATOM   3590 O O     . VAL C 3 401 ? 11.536  56.328 56.739  1.00 20.51 ? 697  VAL A O     1 
ATOM   3591 C CB    . VAL C 3 401 ? 9.155   54.275 56.376  1.00 22.79 ? 697  VAL A CB    1 
ATOM   3592 C CG1   . VAL C 3 401 ? 7.889   55.032 56.117  1.00 22.25 ? 697  VAL A CG1   1 
ATOM   3593 C CG2   . VAL C 3 401 ? 10.091  54.238 55.188  1.00 22.58 ? 697  VAL A CG2   1 
ATOM   3594 N N     . THR C 3 402 ? 12.274  54.529 57.853  1.00 19.14 ? 698  THR A N     1 
ATOM   3595 C CA    . THR C 3 402 ? 13.685  54.830 57.682  1.00 18.60 ? 698  THR A CA    1 
ATOM   3596 C C     . THR C 3 402 ? 14.221  54.160 56.422  1.00 18.78 ? 698  THR A C     1 
ATOM   3597 O O     . THR C 3 402 ? 13.554  53.308 55.819  1.00 19.40 ? 698  THR A O     1 
ATOM   3598 C CB    . THR C 3 402 ? 14.500  54.285 58.870  1.00 18.53 ? 698  THR A CB    1 
ATOM   3599 O OG1   . THR C 3 402 ? 14.461  52.851 58.843  1.00 18.40 ? 698  THR A OG1   1 
ATOM   3600 C CG2   . THR C 3 402 ? 13.919  54.743 60.182  1.00 17.25 ? 698  THR A CG2   1 
ATOM   3601 N N     . PRO C 3 403 ? 15.416  54.559 55.986  1.00 17.97 ? 699  PRO A N     1 
ATOM   3602 C CA    . PRO C 3 403 ? 15.969  53.924 54.795  1.00 18.16 ? 699  PRO A CA    1 
ATOM   3603 C C     . PRO C 3 403 ? 16.079  52.398 54.932  1.00 18.65 ? 699  PRO A C     1 
ATOM   3604 O O     . PRO C 3 403 ? 15.828  51.679 53.970  1.00 18.05 ? 699  PRO A O     1 
ATOM   3605 C CB    . PRO C 3 403 ? 17.331  54.585 54.622  1.00 17.64 ? 699  PRO A CB    1 
ATOM   3606 C CG    . PRO C 3 403 ? 17.200  55.909 55.328  1.00 18.95 ? 699  PRO A CG    1 
ATOM   3607 C CD    . PRO C 3 403 ? 16.272  55.643 56.491  1.00 18.53 ? 699  PRO A CD    1 
ATOM   3608 N N     . ASN C 3 404 ? 16.431  51.891 56.114  1.00 17.78 ? 700  ASN A N     1 
ATOM   3609 C CA    . ASN C 3 404 ? 16.560  50.449 56.260  1.00 18.02 ? 700  ASN A CA    1 
ATOM   3610 C C     . ASN C 3 404 ? 15.203  49.752 56.156  1.00 17.72 ? 700  ASN A C     1 
ATOM   3611 O O     . ASN C 3 404 ? 15.103  48.621 55.672  1.00 16.89 ? 700  ASN A O     1 
ATOM   3612 C CB    . ASN C 3 404 ? 17.250  50.105 57.581  1.00 17.61 ? 700  ASN A CB    1 
ATOM   3613 C CG    . ASN C 3 404 ? 17.803  48.692 57.595  1.00 19.86 ? 700  ASN A CG    1 
ATOM   3614 O OD1   . ASN C 3 404 ? 17.667  47.973 58.586  1.00 20.27 ? 700  ASN A OD1   1 
ATOM   3615 N ND2   . ASN C 3 404 ? 18.419  48.280 56.491  1.00 18.20 ? 700  ASN A ND2   1 
ATOM   3616 N N     . MET C 3 405 ? 14.161  50.427 56.612  1.00 17.33 ? 701  MET A N     1 
ATOM   3617 C CA    . MET C 3 405 ? 12.831  49.876 56.540  1.00 18.81 ? 701  MET A CA    1 
ATOM   3618 C C     . MET C 3 405 ? 12.379  49.793 55.080  1.00 20.12 ? 701  MET A C     1 
ATOM   3619 O O     . MET C 3 405 ? 11.799  48.788 54.656  1.00 20.40 ? 701  MET A O     1 
ATOM   3620 C CB    . MET C 3 405 ? 11.861  50.759 57.304  1.00 19.83 ? 701  MET A CB    1 
ATOM   3621 C CG    . MET C 3 405 ? 11.825  50.466 58.784  1.00 21.79 ? 701  MET A CG    1 
ATOM   3622 S SD    . MET C 3 405 ? 10.907  51.725 59.666  1.00 22.92 ? 701  MET A SD    1 
ATOM   3623 C CE    . MET C 3 405 ? 9.315   51.192 59.507  1.00 22.38 ? 701  MET A CE    1 
ATOM   3624 N N     . ARG C 3 406 ? 12.619  50.859 54.317  1.00 20.11 ? 702  ARG A N     1 
ATOM   3625 C CA    . ARG C 3 406 ? 12.227  50.865 52.914  1.00 20.74 ? 702  ARG A CA    1 
ATOM   3626 C C     . ARG C 3 406 ? 12.989  49.797 52.133  1.00 20.18 ? 702  ARG A C     1 
ATOM   3627 O O     . ARG C 3 406 ? 12.393  49.106 51.314  1.00 19.71 ? 702  ARG A O     1 
ATOM   3628 C CB    . ARG C 3 406 ? 12.482  52.224 52.270  1.00 21.10 ? 702  ARG A CB    1 
ATOM   3629 C CG    . ARG C 3 406 ? 11.884  52.321 50.853  1.00 21.87 ? 702  ARG A CG    1 
ATOM   3630 C CD    . ARG C 3 406 ? 12.289  53.622 50.168  1.00 22.87 ? 702  ARG A CD    1 
ATOM   3631 N NE    . ARG C 3 406 ? 11.680  53.759 48.857  1.00 22.94 ? 702  ARG A NE    1 
ATOM   3632 C CZ    . ARG C 3 406 ? 12.259  53.367 47.728  1.00 23.61 ? 702  ARG A CZ    1 
ATOM   3633 N NH1   . ARG C 3 406 ? 13.462  52.813 47.742  1.00 23.21 ? 702  ARG A NH1   1 
ATOM   3634 N NH2   . ARG C 3 406 ? 11.614  53.498 46.579  1.00 25.00 ? 702  ARG A NH2   1 
ATOM   3635 N N     . ARG C 3 407 ? 14.294  49.663 52.389  1.00 19.93 ? 703  ARG A N     1 
ATOM   3636 C CA    . ARG C 3 407 ? 15.105  48.659 51.710  1.00 21.28 ? 703  ARG A CA    1 
ATOM   3637 C C     . ARG C 3 407 ? 14.563  47.242 51.916  1.00 21.81 ? 703  ARG A C     1 
ATOM   3638 O O     . ARG C 3 407 ? 14.584  46.409 50.992  1.00 21.96 ? 703  ARG A O     1 
ATOM   3639 C CB    . ARG C 3 407 ? 16.561  48.705 52.171  1.00 21.91 ? 703  ARG A CB    1 
ATOM   3640 C CG    . ARG C 3 407 ? 17.424  47.645 51.486  1.00 22.10 ? 703  ARG A CG    1 
ATOM   3641 C CD    . ARG C 3 407 ? 18.810  47.594 52.071  1.00 23.42 ? 703  ARG A CD    1 
ATOM   3642 N NE    . ARG C 3 407 ? 18.753  47.235 53.483  1.00 25.52 ? 703  ARG A NE    1 
ATOM   3643 C CZ    . ARG C 3 407 ? 18.610  45.994 53.938  1.00 26.63 ? 703  ARG A CZ    1 
ATOM   3644 N NH1   . ARG C 3 407 ? 18.510  44.973 53.098  1.00 27.07 ? 703  ARG A NH1   1 
ATOM   3645 N NH2   . ARG C 3 407 ? 18.561  45.769 55.244  1.00 27.42 ? 703  ARG A NH2   1 
ATOM   3646 N N     . GLN C 3 408 ? 14.054  46.978 53.111  1.00 21.56 ? 704  GLN A N     1 
ATOM   3647 C CA    . GLN C 3 408 ? 13.504  45.671 53.417  1.00 22.24 ? 704  GLN A CA    1 
ATOM   3648 C C     . GLN C 3 408 ? 12.111  45.424 52.851  1.00 21.63 ? 704  GLN A C     1 
ATOM   3649 O O     . GLN C 3 408 ? 11.797  44.282 52.456  1.00 21.44 ? 704  GLN A O     1 
ATOM   3650 C CB    . GLN C 3 408 ? 13.518  45.460 54.924  1.00 23.92 ? 704  GLN A CB    1 
ATOM   3651 C CG    . GLN C 3 408 ? 14.935  45.330 55.445  1.00 25.88 ? 704  GLN A CG    1 
ATOM   3652 C CD    . GLN C 3 408 ? 14.969  44.878 56.866  1.00 27.58 ? 704  GLN A CD    1 
ATOM   3653 O OE1   . GLN C 3 408 ? 14.814  45.676 57.782  1.00 28.72 ? 704  GLN A OE1   1 
ATOM   3654 N NE2   . GLN C 3 408 ? 15.164  43.585 57.066  1.00 28.67 ? 704  GLN A NE2   1 
ATOM   3655 N N     . ALA C 3 409 ? 11.282  46.470 52.811  1.00 20.44 ? 705  ALA A N     1 
ATOM   3656 C CA    . ALA C 3 409 ? 9.936   46.369 52.241  1.00 20.63 ? 705  ALA A CA    1 
ATOM   3657 C C     . ALA C 3 409 ? 10.124  46.186 50.722  1.00 21.23 ? 705  ALA A C     1 
ATOM   3658 O O     . ALA C 3 409 ? 9.335   45.511 50.055  1.00 21.31 ? 705  ALA A O     1 
ATOM   3659 C CB    . ALA C 3 409 ? 9.130   47.642 52.532  1.00 19.23 ? 705  ALA A CB    1 
ATOM   3660 N N     . LYS C 3 410 ? 11.184  46.795 50.193  1.00 21.37 ? 706  LYS A N     1 
ATOM   3661 C CA    . LYS C 3 410 ? 11.513  46.686 48.786  1.00 22.33 ? 706  LYS A CA    1 
ATOM   3662 C C     . LYS C 3 410 ? 11.913  45.235 48.496  1.00 23.57 ? 706  LYS A C     1 
ATOM   3663 O O     . LYS C 3 410 ? 11.547  44.669 47.457  1.00 23.61 ? 706  LYS A O     1 
ATOM   3664 C CB    . LYS C 3 410 ? 12.660  47.622 48.452  1.00 21.60 ? 706  LYS A CB    1 
ATOM   3665 C CG    . LYS C 3 410 ? 13.266  47.379 47.092  1.00 22.44 ? 706  LYS A CG    1 
ATOM   3666 C CD    . LYS C 3 410 ? 13.852  48.654 46.552  1.00 23.00 ? 706  LYS A CD    1 
ATOM   3667 C CE    . LYS C 3 410 ? 14.684  48.382 45.312  1.00 24.76 ? 706  LYS A CE    1 
ATOM   3668 N NZ    . LYS C 3 410 ? 14.924  49.622 44.524  1.00 25.23 ? 706  LYS A NZ    1 
ATOM   3669 N N     . ALA C 3 411 ? 12.654  44.641 49.428  1.00 23.90 ? 707  ALA A N     1 
ATOM   3670 C CA    . ALA C 3 411 ? 13.097  43.256 49.318  1.00 24.68 ? 707  ALA A CA    1 
ATOM   3671 C C     . ALA C 3 411 ? 11.890  42.302 49.311  1.00 25.36 ? 707  ALA A C     1 
ATOM   3672 O O     . ALA C 3 411 ? 11.887  41.292 48.603  1.00 25.05 ? 707  ALA A O     1 
ATOM   3673 C CB    . ALA C 3 411 ? 14.036  42.914 50.471  1.00 24.85 ? 707  ALA A CB    1 
ATOM   3674 N N     . VAL C 3 412 ? 10.877  42.613 50.110  1.00 25.34 ? 708  VAL A N     1 
ATOM   3675 C CA    . VAL C 3 412 ? 9.679   41.795 50.145  1.00 25.63 ? 708  VAL A CA    1 
ATOM   3676 C C     . VAL C 3 412 ? 8.916   41.992 48.832  1.00 27.24 ? 708  VAL A C     1 
ATOM   3677 O O     . VAL C 3 412 ? 8.330   41.046 48.316  1.00 28.18 ? 708  VAL A O     1 
ATOM   3678 C CB    . VAL C 3 412 ? 8.766   42.178 51.315  1.00 25.37 ? 708  VAL A CB    1 
ATOM   3679 C CG1   . VAL C 3 412 ? 7.451   41.428 51.225  1.00 23.48 ? 708  VAL A CG1   1 
ATOM   3680 C CG2   . VAL C 3 412 ? 9.469   41.879 52.624  1.00 25.29 ? 708  VAL A CG2   1 
ATOM   3681 N N     . ASN C 3 413 ? 8.922   43.207 48.280  1.00 27.36 ? 709  ASN A N     1 
ATOM   3682 C CA    . ASN C 3 413 ? 8.224   43.445 47.009  1.00 27.81 ? 709  ASN A CA    1 
ATOM   3683 C C     . ASN C 3 413 ? 8.984   42.741 45.853  1.00 29.13 ? 709  ASN A C     1 
ATOM   3684 O O     . ASN C 3 413 ? 8.365   42.126 44.978  1.00 28.86 ? 709  ASN A O     1 
ATOM   3685 C CB    . ASN C 3 413 ? 8.117   44.948 46.707  1.00 25.32 ? 709  ASN A CB    1 
ATOM   3686 C CG    . ASN C 3 413 ? 7.036   45.664 47.520  1.00 22.64 ? 709  ASN A CG    1 
ATOM   3687 O OD1   . ASN C 3 413 ? 6.025   45.087 47.913  1.00 20.28 ? 709  ASN A OD1   1 
ATOM   3688 N ND2   . ASN C 3 413 ? 7.255   46.956 47.752  1.00 21.81 ? 709  ASN A ND2   1 
ATOM   3689 N N     . PHE C 3 414 ? 10.317  42.838 45.829  1.00 31.37 ? 710  PHE A N     1 
ATOM   3690 C CA    . PHE C 3 414 ? 11.101  42.160 44.773  1.00 33.34 ? 710  PHE A CA    1 
ATOM   3691 C C     . PHE C 3 414 ? 10.798  40.658 44.853  1.00 35.13 ? 710  PHE A C     1 
ATOM   3692 O O     . PHE C 3 414 ? 10.538  40.000 43.839  1.00 34.95 ? 710  PHE A O     1 
ATOM   3693 C CB    . PHE C 3 414 ? 12.610  42.394 44.960  1.00 32.69 ? 710  PHE A CB    1 
ATOM   3694 C CG    . PHE C 3 414 ? 13.505  41.515 44.078  1.00 34.08 ? 710  PHE A CG    1 
ATOM   3695 C CD1   . PHE C 3 414 ? 13.824  40.199 44.450  1.00 34.61 ? 710  PHE A CD1   1 
ATOM   3696 C CD2   . PHE C 3 414 ? 14.090  42.024 42.923  1.00 33.08 ? 710  PHE A CD2   1 
ATOM   3697 C CE1   . PHE C 3 414 ? 14.713  39.427 43.686  1.00 33.69 ? 710  PHE A CE1   1 
ATOM   3698 C CE2   . PHE C 3 414 ? 14.979  41.253 42.162  1.00 33.21 ? 710  PHE A CE2   1 
ATOM   3699 C CZ    . PHE C 3 414 ? 15.287  39.959 42.546  1.00 33.26 ? 710  PHE A CZ    1 
ATOM   3700 N N     . GLY C 3 415 ? 10.820  40.130 46.073  1.00 36.68 ? 711  GLY A N     1 
ATOM   3701 C CA    . GLY C 3 415 ? 10.542  38.729 46.272  1.00 38.65 ? 711  GLY A CA    1 
ATOM   3702 C C     . GLY C 3 415 ? 9.087   38.435 46.027  1.00 40.49 ? 711  GLY A C     1 
ATOM   3703 O O     . GLY C 3 415 ? 8.757   37.505 45.291  1.00 40.22 ? 711  GLY A O     1 
ATOM   3704 N N     . ILE C 3 416 ? 8.214   39.236 46.631  1.00 42.66 ? 712  ILE A N     1 
ATOM   3705 C CA    . ILE C 3 416 ? 6.769   39.038 46.492  1.00 44.53 ? 712  ILE A CA    1 
ATOM   3706 C C     . ILE C 3 416 ? 6.454   38.593 45.074  1.00 45.60 ? 712  ILE A C     1 
ATOM   3707 O O     . ILE C 3 416 ? 5.851   37.532 44.864  1.00 46.85 ? 712  ILE A O     1 
ATOM   3708 C CB    . ILE C 3 416 ? 5.957   40.331 46.788  1.00 44.30 ? 712  ILE A CB    1 
ATOM   3709 C CG1   . ILE C 3 416 ? 5.046   40.095 47.995  1.00 44.11 ? 712  ILE A CG1   1 
ATOM   3710 C CG2   . ILE C 3 416 ? 5.083   40.693 45.587  1.00 43.91 ? 712  ILE A CG2   1 
ATOM   3711 C CD1   . ILE C 3 416 ? 4.104   38.902 47.845  1.00 43.41 ? 712  ILE A CD1   1 
ATOM   3712 N N     . VAL C 3 417 ? 6.865   39.414 44.113  1.00 45.86 ? 713  VAL A N     1 
ATOM   3713 C CA    . VAL C 3 417 ? 6.661   39.122 42.713  1.00 45.74 ? 713  VAL A CA    1 
ATOM   3714 C C     . VAL C 3 417 ? 6.810   37.619 42.473  1.00 47.19 ? 713  VAL A C     1 
ATOM   3715 O O     . VAL C 3 417 ? 5.809   36.897 42.343  1.00 47.58 ? 713  VAL A O     1 
ATOM   3716 C CB    . VAL C 3 417 ? 7.701   39.863 41.857  1.00 45.04 ? 713  VAL A CB    1 
ATOM   3717 C CG1   . VAL C 3 417 ? 7.957   39.099 40.546  1.00 43.70 ? 713  VAL A CG1   1 
ATOM   3718 C CG2   . VAL C 3 417 ? 7.233   41.281 41.604  1.00 45.11 ? 713  VAL A CG2   1 
ATOM   3719 N N     . TYR C 3 418 ? 8.063   37.150 42.430  1.00 48.36 ? 714  TYR A N     1 
ATOM   3720 C CA    . TYR C 3 418 ? 8.361   35.740 42.174  1.00 48.78 ? 714  TYR A CA    1 
ATOM   3721 C C     . TYR C 3 418 ? 7.926   34.725 43.242  1.00 49.98 ? 714  TYR A C     1 
ATOM   3722 O O     . TYR C 3 418 ? 8.755   34.011 43.822  1.00 48.79 ? 714  TYR A O     1 
ATOM   3723 C CB    . TYR C 3 418 ? 9.848   35.562 41.865  1.00 47.55 ? 714  TYR A CB    1 
ATOM   3724 C CG    . TYR C 3 418 ? 10.558  36.818 41.416  1.00 46.73 ? 714  TYR A CG    1 
ATOM   3725 C CD1   . TYR C 3 418 ? 11.138  37.677 42.333  1.00 47.17 ? 714  TYR A CD1   1 
ATOM   3726 C CD2   . TYR C 3 418 ? 10.725  37.102 40.077  1.00 47.27 ? 714  TYR A CD2   1 
ATOM   3727 C CE1   . TYR C 3 418 ? 11.873  38.784 41.921  1.00 46.75 ? 714  TYR A CE1   1 
ATOM   3728 C CE2   . TYR C 3 418 ? 11.460  38.211 39.652  1.00 46.61 ? 714  TYR A CE2   1 
ATOM   3729 C CZ    . TYR C 3 418 ? 12.031  39.044 40.580  1.00 45.86 ? 714  TYR A CZ    1 
ATOM   3730 O OH    . TYR C 3 418 ? 12.758  40.137 40.168  1.00 44.56 ? 714  TYR A OH    1 
ATOM   3731 N N     . GLY C 3 419 ? 6.606   34.665 43.459  1.00 52.58 ? 715  GLY A N     1 
ATOM   3732 C CA    . GLY C 3 419 ? 5.987   33.745 44.404  1.00 55.00 ? 715  GLY A CA    1 
ATOM   3733 C C     . GLY C 3 419 ? 6.337   33.911 45.875  1.00 57.16 ? 715  GLY A C     1 
ATOM   3734 O O     . GLY C 3 419 ? 5.966   33.075 46.705  1.00 57.66 ? 715  GLY A O     1 
ATOM   3735 N N     . ILE C 3 420 ? 7.053   34.981 46.207  1.00 58.65 ? 716  ILE A N     1 
ATOM   3736 C CA    . ILE C 3 420 ? 7.453   35.234 47.588  1.00 59.75 ? 716  ILE A CA    1 
ATOM   3737 C C     . ILE C 3 420 ? 8.016   33.993 48.331  1.00 60.03 ? 716  ILE A C     1 
ATOM   3738 O O     . ILE C 3 420 ? 7.329   33.411 49.192  1.00 60.58 ? 716  ILE A O     1 
ATOM   3739 C CB    . ILE C 3 420 ? 6.260   35.841 48.412  1.00 60.52 ? 716  ILE A CB    1 
ATOM   3740 C CG1   . ILE C 3 420 ? 6.698   36.073 49.864  1.00 60.85 ? 716  ILE A CG1   1 
ATOM   3741 C CG2   . ILE C 3 420 ? 5.030   34.919 48.359  1.00 60.01 ? 716  ILE A CG2   1 
ATOM   3742 C CD1   . ILE C 3 420 ? 7.672   37.235 50.029  1.00 61.16 ? 716  ILE A CD1   1 
ATOM   3743 N N     . SER C 3 421 ? 9.253   33.594 47.997  1.00 59.29 ? 717  SER A N     1 
ATOM   3744 C CA    . SER C 3 421 ? 9.918   32.455 48.665  1.00 58.53 ? 717  SER A CA    1 
ATOM   3745 C C     . SER C 3 421 ? 10.597  32.975 49.954  1.00 57.93 ? 717  SER A C     1 
ATOM   3746 O O     . SER C 3 421 ? 11.529  33.778 49.866  1.00 57.86 ? 717  SER A O     1 
ATOM   3747 C CB    . SER C 3 421 ? 10.976  31.844 47.738  1.00 58.01 ? 717  SER A CB    1 
ATOM   3748 O OG    . SER C 3 421 ? 11.698  30.817 48.410  1.00 57.85 ? 717  SER A OG    1 
ATOM   3749 N N     . ASP C 3 422 ? 10.149  32.531 51.135  1.00 56.72 ? 718  ASP A N     1 
ATOM   3750 C CA    . ASP C 3 422 ? 10.722  33.016 52.410  1.00 56.11 ? 718  ASP A CA    1 
ATOM   3751 C C     . ASP C 3 422 ? 12.146  32.561 52.718  1.00 55.27 ? 718  ASP A C     1 
ATOM   3752 O O     . ASP C 3 422 ? 12.861  33.192 53.500  1.00 55.56 ? 718  ASP A O     1 
ATOM   3753 C CB    . ASP C 3 422 ? 9.839   32.609 53.579  1.00 56.87 ? 718  ASP A CB    1 
ATOM   3754 C CG    . ASP C 3 422 ? 9.609   31.142 53.613  1.00 57.85 ? 718  ASP A CG    1 
ATOM   3755 O OD1   . ASP C 3 422 ? 9.047   30.634 52.619  1.00 59.07 ? 718  ASP A OD1   1 
ATOM   3756 O OD2   . ASP C 3 422 ? 9.996   30.499 54.613  1.00 58.76 ? 718  ASP A OD2   1 
ATOM   3757 N N     . TYR C 3 423 ? 12.550  31.460 52.104  1.00 54.09 ? 719  TYR A N     1 
ATOM   3758 C CA    . TYR C 3 423 ? 13.887  30.923 52.295  1.00 52.33 ? 719  TYR A CA    1 
ATOM   3759 C C     . TYR C 3 423 ? 14.778  31.879 51.521  1.00 50.51 ? 719  TYR A C     1 
ATOM   3760 O O     . TYR C 3 423 ? 15.799  32.340 52.022  1.00 50.62 ? 719  TYR A O     1 
ATOM   3761 C CB    . TYR C 3 423 ? 13.971  29.498 51.720  1.00 54.02 ? 719  TYR A CB    1 
ATOM   3762 C CG    . TYR C 3 423 ? 12.726  28.650 51.992  1.00 56.15 ? 719  TYR A CG    1 
ATOM   3763 C CD1   . TYR C 3 423 ? 11.437  29.204 51.913  1.00 56.28 ? 719  TYR A CD1   1 
ATOM   3764 C CD2   . TYR C 3 423 ? 12.835  27.307 52.374  1.00 56.84 ? 719  TYR A CD2   1 
ATOM   3765 C CE1   . TYR C 3 423 ? 10.305  28.461 52.212  1.00 56.38 ? 719  TYR A CE1   1 
ATOM   3766 C CE2   . TYR C 3 423 ? 11.690  26.549 52.678  1.00 57.04 ? 719  TYR A CE2   1 
ATOM   3767 C CZ    . TYR C 3 423 ? 10.433  27.142 52.597  1.00 56.75 ? 719  TYR A CZ    1 
ATOM   3768 O OH    . TYR C 3 423 ? 9.299   26.439 52.931  1.00 57.44 ? 719  TYR A OH    1 
ATOM   3769 N N     . GLY C 3 424 ? 14.359  32.191 50.297  1.00 48.61 ? 720  GLY A N     1 
ATOM   3770 C CA    . GLY C 3 424 ? 15.102  33.113 49.449  1.00 46.42 ? 720  GLY A CA    1 
ATOM   3771 C C     . GLY C 3 424 ? 15.053  34.556 49.935  1.00 44.55 ? 720  GLY A C     1 
ATOM   3772 O O     . GLY C 3 424 ? 15.969  35.335 49.648  1.00 44.54 ? 720  GLY A O     1 
ATOM   3773 N N     . LEU C 3 425 ? 13.982  34.915 50.647  1.00 42.91 ? 721  LEU A N     1 
ATOM   3774 C CA    . LEU C 3 425 ? 13.829  36.260 51.206  1.00 41.30 ? 721  LEU A CA    1 
ATOM   3775 C C     . LEU C 3 425 ? 14.923  36.387 52.260  1.00 40.42 ? 721  LEU A C     1 
ATOM   3776 O O     . LEU C 3 425 ? 15.806  37.252 52.169  1.00 39.63 ? 721  LEU A O     1 
ATOM   3777 C CB    . LEU C 3 425 ? 12.445  36.416 51.867  1.00 40.51 ? 721  LEU A CB    1 
ATOM   3778 C CG    . LEU C 3 425 ? 12.050  37.732 52.575  1.00 39.98 ? 721  LEU A CG    1 
ATOM   3779 C CD1   . LEU C 3 425 ? 12.151  38.904 51.623  1.00 39.21 ? 721  LEU A CD1   1 
ATOM   3780 C CD2   . LEU C 3 425 ? 10.627  37.630 53.098  1.00 39.12 ? 721  LEU A CD2   1 
ATOM   3781 N N     . ALA C 3 426 ? 14.850  35.483 53.237  1.00 39.81 ? 722  ALA A N     1 
ATOM   3782 C CA    . ALA C 3 426 ? 15.790  35.409 54.353  1.00 39.65 ? 722  ALA A CA    1 
ATOM   3783 C C     . ALA C 3 426 ? 17.242  35.528 53.903  1.00 39.66 ? 722  ALA A C     1 
ATOM   3784 O O     . ALA C 3 426 ? 18.050  36.154 54.575  1.00 39.45 ? 722  ALA A O     1 
ATOM   3785 C CB    . ALA C 3 426 ? 15.581  34.099 55.118  1.00 39.06 ? 722  ALA A CB    1 
ATOM   3786 N N     . GLN C 3 427 ? 17.579  34.939 52.764  1.00 39.82 ? 723  GLN A N     1 
ATOM   3787 C CA    . GLN C 3 427 ? 18.946  35.020 52.292  1.00 40.46 ? 723  GLN A CA    1 
ATOM   3788 C C     . GLN C 3 427 ? 19.201  36.386 51.693  1.00 39.87 ? 723  GLN A C     1 
ATOM   3789 O O     . GLN C 3 427 ? 20.309  36.922 51.790  1.00 39.78 ? 723  GLN A O     1 
ATOM   3790 C CB    . GLN C 3 427 ? 19.235  33.939 51.243  1.00 43.12 ? 723  GLN A CB    1 
ATOM   3791 C CG    . GLN C 3 427 ? 20.463  34.252 50.352  1.00 46.59 ? 723  GLN A CG    1 
ATOM   3792 C CD    . GLN C 3 427 ? 21.822  33.834 50.972  1.00 49.13 ? 723  GLN A CD    1 
ATOM   3793 O OE1   . GLN C 3 427 ? 22.646  33.188 50.306  1.00 50.75 ? 723  GLN A OE1   1 
ATOM   3794 N NE2   . GLN C 3 427 ? 22.055  34.209 52.239  1.00 49.99 ? 723  GLN A NE2   1 
ATOM   3795 N N     . ASN C 3 428 ? 18.176  36.947 51.063  1.00 39.00 ? 724  ASN A N     1 
ATOM   3796 C CA    . ASN C 3 428 ? 18.309  38.257 50.447  1.00 38.42 ? 724  ASN A CA    1 
ATOM   3797 C C     . ASN C 3 428 ? 18.430  39.303 51.534  1.00 37.82 ? 724  ASN A C     1 
ATOM   3798 O O     . ASN C 3 428 ? 19.265  40.200 51.448  1.00 38.39 ? 724  ASN A O     1 
ATOM   3799 C CB    . ASN C 3 428 ? 17.087  38.586 49.588  1.00 38.48 ? 724  ASN A CB    1 
ATOM   3800 C CG    . ASN C 3 428 ? 17.142  37.930 48.234  1.00 38.26 ? 724  ASN A CG    1 
ATOM   3801 O OD1   . ASN C 3 428 ? 18.150  37.321 47.867  1.00 38.58 ? 724  ASN A OD1   1 
ATOM   3802 N ND2   . ASN C 3 428 ? 16.055  38.045 47.479  1.00 37.72 ? 724  ASN A ND2   1 
ATOM   3803 N N     . LEU C 3 429 ? 17.581  39.192 52.551  1.00 36.84 ? 725  LEU A N     1 
ATOM   3804 C CA    . LEU C 3 429 ? 17.591  40.147 53.647  1.00 35.66 ? 725  LEU A CA    1 
ATOM   3805 C C     . LEU C 3 429 ? 18.635  39.729 54.684  1.00 35.86 ? 725  LEU A C     1 
ATOM   3806 O O     . LEU C 3 429 ? 18.832  40.396 55.700  1.00 35.85 ? 725  LEU A O     1 
ATOM   3807 C CB    . LEU C 3 429 ? 16.190  40.219 54.276  1.00 34.47 ? 725  LEU A CB    1 
ATOM   3808 C CG    . LEU C 3 429 ? 15.112  40.911 53.418  1.00 33.46 ? 725  LEU A CG    1 
ATOM   3809 C CD1   . LEU C 3 429 ? 13.800  41.022 54.178  1.00 32.67 ? 725  LEU A CD1   1 
ATOM   3810 C CD2   . LEU C 3 429 ? 15.594  42.290 53.016  1.00 33.20 ? 725  LEU A CD2   1 
ATOM   3811 N N     . ASN C 3 430 ? 19.318  38.627 54.409  1.00 36.01 ? 726  ASN A N     1 
ATOM   3812 C CA    . ASN C 3 430 ? 20.312  38.094 55.328  1.00 36.28 ? 726  ASN A CA    1 
ATOM   3813 C C     . ASN C 3 430 ? 19.744  38.048 56.762  1.00 36.24 ? 726  ASN A C     1 
ATOM   3814 O O     . ASN C 3 430 ? 20.348  38.541 57.716  1.00 35.40 ? 726  ASN A O     1 
ATOM   3815 C CB    . ASN C 3 430 ? 21.589  38.925 55.248  1.00 37.11 ? 726  ASN A CB    1 
ATOM   3816 C CG    . ASN C 3 430 ? 22.706  38.342 56.083  1.00 39.82 ? 726  ASN A CG    1 
ATOM   3817 O OD1   . ASN C 3 430 ? 22.571  37.257 56.667  1.00 40.86 ? 726  ASN A OD1   1 
ATOM   3818 N ND2   . ASN C 3 430 ? 23.820  39.063 56.161  1.00 40.70 ? 726  ASN A ND2   1 
ATOM   3819 N N     . ILE C 3 431 ? 18.561  37.449 56.891  1.00 36.36 ? 727  ILE A N     1 
ATOM   3820 C CA    . ILE C 3 431 ? 17.881  37.316 58.173  1.00 37.65 ? 727  ILE A CA    1 
ATOM   3821 C C     . ILE C 3 431 ? 17.461  35.865 58.342  1.00 39.02 ? 727  ILE A C     1 
ATOM   3822 O O     . ILE C 3 431 ? 17.644  35.055 57.434  1.00 39.70 ? 727  ILE A O     1 
ATOM   3823 C CB    . ILE C 3 431 ? 16.621  38.212 58.253  1.00 36.06 ? 727  ILE A CB    1 
ATOM   3824 C CG1   . ILE C 3 431 ? 15.623  37.836 57.159  1.00 34.96 ? 727  ILE A CG1   1 
ATOM   3825 C CG2   . ILE C 3 431 ? 17.029  39.659 58.135  1.00 35.86 ? 727  ILE A CG2   1 
ATOM   3826 C CD1   . ILE C 3 431 ? 14.336  38.619 57.220  1.00 33.49 ? 727  ILE A CD1   1 
ATOM   3827 N N     . SER C 3 432 ? 16.920  35.518 59.498  1.00 40.02 ? 728  SER A N     1 
ATOM   3828 C CA    . SER C 3 432 ? 16.508  34.144 59.671  1.00 42.23 ? 728  SER A CA    1 
ATOM   3829 C C     . SER C 3 432 ? 15.208  33.886 58.931  1.00 44.19 ? 728  SER A C     1 
ATOM   3830 O O     . SER C 3 432 ? 14.454  34.803 58.592  1.00 44.08 ? 728  SER A O     1 
ATOM   3831 C CB    . SER C 3 432 ? 16.349  33.793 61.153  1.00 41.70 ? 728  SER A CB    1 
ATOM   3832 O OG    . SER C 3 432 ? 15.281  34.493 61.751  1.00 42.06 ? 728  SER A OG    1 
ATOM   3833 N N     . ARG C 3 433 ? 14.960  32.613 58.671  1.00 46.65 ? 729  ARG A N     1 
ATOM   3834 C CA    . ARG C 3 433 ? 13.761  32.194 57.975  1.00 48.31 ? 729  ARG A CA    1 
ATOM   3835 C C     . ARG C 3 433 ? 12.551  32.589 58.803  1.00 47.83 ? 729  ARG A C     1 
ATOM   3836 O O     . ARG C 3 433 ? 11.575  33.112 58.275  1.00 48.43 ? 729  ARG A O     1 
ATOM   3837 C CB    . ARG C 3 433 ? 13.783  30.674 57.771  1.00 50.43 ? 729  ARG A CB    1 
ATOM   3838 C CG    . ARG C 3 433 ? 13.657  30.241 56.329  1.00 53.33 ? 729  ARG A CG    1 
ATOM   3839 C CD    . ARG C 3 433 ? 12.415  29.382 56.130  1.00 56.48 ? 729  ARG A CD    1 
ATOM   3840 N NE    . ARG C 3 433 ? 12.702  28.217 55.294  1.00 59.79 ? 729  ARG A NE    1 
ATOM   3841 C CZ    . ARG C 3 433 ? 13.324  27.118 55.724  1.00 61.30 ? 729  ARG A CZ    1 
ATOM   3842 N NH1   . ARG C 3 433 ? 13.727  27.032 56.992  1.00 61.89 ? 729  ARG A NH1   1 
ATOM   3843 N NH2   . ARG C 3 433 ? 13.556  26.108 54.885  1.00 62.23 ? 729  ARG A NH2   1 
ATOM   3844 N N     . LYS C 3 434 ? 12.618  32.348 60.105  1.00 46.99 ? 730  LYS A N     1 
ATOM   3845 C CA    . LYS C 3 434 ? 11.498  32.678 60.971  1.00 46.55 ? 730  LYS A CA    1 
ATOM   3846 C C     . LYS C 3 434 ? 11.152  34.157 60.915  1.00 45.96 ? 730  LYS A C     1 
ATOM   3847 O O     . LYS C 3 434 ? 10.008  34.543 61.180  1.00 46.13 ? 730  LYS A O     1 
ATOM   3848 C CB    . LYS C 3 434 ? 11.806  32.286 62.411  1.00 47.39 ? 730  LYS A CB    1 
ATOM   3849 C CG    . LYS C 3 434 ? 11.080  33.145 63.431  1.00 49.09 ? 730  LYS A CG    1 
ATOM   3850 C CD    . LYS C 3 434 ? 9.668   32.634 63.692  1.00 50.25 ? 730  LYS A CD    1 
ATOM   3851 C CE    . LYS C 3 434 ? 8.616   33.698 63.353  1.00 50.45 ? 730  LYS A CE    1 
ATOM   3852 N NZ    . LYS C 3 434 ? 7.656   33.228 62.310  1.00 49.94 ? 730  LYS A NZ    1 
ATOM   3853 N N     . GLU C 3 435 ? 12.143  34.983 60.578  1.00 45.03 ? 731  GLU A N     1 
ATOM   3854 C CA    . GLU C 3 435 ? 11.944  36.432 60.487  1.00 43.60 ? 731  GLU A CA    1 
ATOM   3855 C C     . GLU C 3 435 ? 11.420  36.782 59.105  1.00 42.55 ? 731  GLU A C     1 
ATOM   3856 O O     . GLU C 3 435 ? 10.539  37.626 58.957  1.00 42.17 ? 731  GLU A O     1 
ATOM   3857 C CB    . GLU C 3 435 ? 13.259  37.163 60.767  1.00 42.99 ? 731  GLU A CB    1 
ATOM   3858 C CG    . GLU C 3 435 ? 13.749  36.924 62.179  1.00 43.28 ? 731  GLU A CG    1 
ATOM   3859 C CD    . GLU C 3 435 ? 14.878  37.837 62.594  1.00 42.93 ? 731  GLU A CD    1 
ATOM   3860 O OE1   . GLU C 3 435 ? 16.014  37.682 62.076  1.00 42.90 ? 731  GLU A OE1   1 
ATOM   3861 O OE2   . GLU C 3 435 ? 14.620  38.703 63.457  1.00 43.52 ? 731  GLU A OE2   1 
ATOM   3862 N N     . ALA C 3 436 ? 11.973  36.123 58.097  1.00 41.84 ? 732  ALA A N     1 
ATOM   3863 C CA    . ALA C 3 436 ? 11.542  36.340 56.732  1.00 41.14 ? 732  ALA A CA    1 
ATOM   3864 C C     . ALA C 3 436 ? 10.067  35.961 56.677  1.00 40.95 ? 732  ALA A C     1 
ATOM   3865 O O     . ALA C 3 436 ? 9.244   36.697 56.146  1.00 41.13 ? 732  ALA A O     1 
ATOM   3866 C CB    . ALA C 3 436 ? 12.346  35.468 55.787  1.00 40.82 ? 732  ALA A CB    1 
ATOM   3867 N N     . ALA C 3 437 ? 9.733   34.812 57.255  1.00 40.86 ? 733  ALA A N     1 
ATOM   3868 C CA    . ALA C 3 437 ? 8.358   34.338 57.259  1.00 39.98 ? 733  ALA A CA    1 
ATOM   3869 C C     . ALA C 3 437 ? 7.481   35.329 57.995  1.00 39.70 ? 733  ALA A C     1 
ATOM   3870 O O     . ALA C 3 437 ? 6.290   35.458 57.701  1.00 39.48 ? 733  ALA A O     1 
ATOM   3871 C CB    . ALA C 3 437 ? 8.278   32.972 57.915  1.00 39.69 ? 733  ALA A CB    1 
ATOM   3872 N N     . GLU C 3 438 ? 8.071   36.033 58.954  1.00 39.72 ? 734  GLU A N     1 
ATOM   3873 C CA    . GLU C 3 438 ? 7.329   37.024 59.729  1.00 39.57 ? 734  GLU A CA    1 
ATOM   3874 C C     . GLU C 3 438 ? 7.009   38.242 58.862  1.00 37.96 ? 734  GLU A C     1 
ATOM   3875 O O     . GLU C 3 438 ? 5.956   38.850 59.004  1.00 37.23 ? 734  GLU A O     1 
ATOM   3876 C CB    . GLU C 3 438 ? 8.140   37.460 60.946  1.00 42.06 ? 734  GLU A CB    1 
ATOM   3877 C CG    . GLU C 3 438 ? 7.489   37.126 62.275  1.00 44.97 ? 734  GLU A CG    1 
ATOM   3878 C CD    . GLU C 3 438 ? 8.411   37.422 63.444  1.00 47.24 ? 734  GLU A CD    1 
ATOM   3879 O OE1   . GLU C 3 438 ? 9.262   36.561 63.780  1.00 47.74 ? 734  GLU A OE1   1 
ATOM   3880 O OE2   . GLU C 3 438 ? 8.285   38.525 64.022  1.00 48.79 ? 734  GLU A OE2   1 
ATOM   3881 N N     . PHE C 3 439 ? 7.927   38.595 57.970  1.00 36.50 ? 735  PHE A N     1 
ATOM   3882 C CA    . PHE C 3 439 ? 7.716   39.724 57.076  1.00 35.62 ? 735  PHE A CA    1 
ATOM   3883 C C     . PHE C 3 439 ? 6.525   39.406 56.184  1.00 34.20 ? 735  PHE A C     1 
ATOM   3884 O O     . PHE C 3 439 ? 5.614   40.213 56.033  1.00 33.68 ? 735  PHE A O     1 
ATOM   3885 C CB    . PHE C 3 439 ? 8.956   39.945 56.206  1.00 36.80 ? 735  PHE A CB    1 
ATOM   3886 C CG    . PHE C 3 439 ? 10.042  40.708 56.891  1.00 38.59 ? 735  PHE A CG    1 
ATOM   3887 C CD1   . PHE C 3 439 ? 9.767   41.463 58.018  1.00 39.56 ? 735  PHE A CD1   1 
ATOM   3888 C CD2   . PHE C 3 439 ? 11.341  40.666 56.418  1.00 39.64 ? 735  PHE A CD2   1 
ATOM   3889 C CE1   . PHE C 3 439 ? 10.772  42.165 58.666  1.00 40.06 ? 735  PHE A CE1   1 
ATOM   3890 C CE2   . PHE C 3 439 ? 12.346  41.361 57.059  1.00 40.24 ? 735  PHE A CE2   1 
ATOM   3891 C CZ    . PHE C 3 439 ? 12.062  42.113 58.185  1.00 39.92 ? 735  PHE A CZ    1 
ATOM   3892 N N     . ILE C 3 440 ? 6.555   38.209 55.607  1.00 32.98 ? 736  ILE A N     1 
ATOM   3893 C CA    . ILE C 3 440 ? 5.519   37.735 54.716  1.00 31.91 ? 736  ILE A CA    1 
ATOM   3894 C C     . ILE C 3 440 ? 4.143   37.772 55.348  1.00 32.15 ? 736  ILE A C     1 
ATOM   3895 O O     . ILE C 3 440 ? 3.180   38.249 54.736  1.00 31.19 ? 736  ILE A O     1 
ATOM   3896 C CB    . ILE C 3 440 ? 5.828   36.311 54.236  1.00 31.89 ? 736  ILE A CB    1 
ATOM   3897 C CG1   . ILE C 3 440 ? 6.861   36.373 53.107  1.00 30.83 ? 736  ILE A CG1   1 
ATOM   3898 C CG2   . ILE C 3 440 ? 4.558   35.652 53.701  1.00 30.96 ? 736  ILE A CG2   1 
ATOM   3899 C CD1   . ILE C 3 440 ? 8.109   35.588 53.367  1.00 31.47 ? 736  ILE A CD1   1 
ATOM   3900 N N     . GLU C 3 441 ? 4.042   37.281 56.577  1.00 32.48 ? 737  GLU A N     1 
ATOM   3901 C CA    . GLU C 3 441 ? 2.763   37.288 57.273  1.00 33.24 ? 737  GLU A CA    1 
ATOM   3902 C C     . GLU C 3 441 ? 2.233   38.713 57.521  1.00 32.06 ? 737  GLU A C     1 
ATOM   3903 O O     . GLU C 3 441 ? 1.029   38.958 57.482  1.00 31.17 ? 737  GLU A O     1 
ATOM   3904 C CB    . GLU C 3 441 ? 2.892   36.541 58.595  1.00 35.90 ? 737  GLU A CB    1 
ATOM   3905 C CG    . GLU C 3 441 ? 1.572   36.372 59.310  1.00 41.19 ? 737  GLU A CG    1 
ATOM   3906 C CD    . GLU C 3 441 ? 1.660   36.698 60.805  1.00 44.96 ? 737  GLU A CD    1 
ATOM   3907 O OE1   . GLU C 3 441 ? 2.696   36.347 61.434  1.00 46.32 ? 737  GLU A OE1   1 
ATOM   3908 O OE2   . GLU C 3 441 ? 0.692   37.303 61.344  1.00 46.15 ? 737  GLU A OE2   1 
ATOM   3909 N N     . ARG C 3 442 ? 3.127   39.657 57.783  1.00 31.61 ? 738  ARG A N     1 
ATOM   3910 C CA    . ARG C 3 442 ? 2.687   41.025 58.009  1.00 31.55 ? 738  ARG A CA    1 
ATOM   3911 C C     . ARG C 3 442 ? 2.236   41.616 56.672  1.00 30.42 ? 738  ARG A C     1 
ATOM   3912 O O     . ARG C 3 442 ? 1.338   42.460 56.631  1.00 30.34 ? 738  ARG A O     1 
ATOM   3913 C CB    . ARG C 3 442 ? 3.816   41.866 58.616  1.00 32.87 ? 738  ARG A CB    1 
ATOM   3914 C CG    . ARG C 3 442 ? 4.051   41.638 60.123  1.00 36.45 ? 738  ARG A CG    1 
ATOM   3915 C CD    . ARG C 3 442 ? 3.144   42.493 61.015  1.00 39.50 ? 738  ARG A CD    1 
ATOM   3916 N NE    . ARG C 3 442 ? 1.930   42.930 60.316  1.00 43.83 ? 738  ARG A NE    1 
ATOM   3917 C CZ    . ARG C 3 442 ? 1.663   44.193 59.975  1.00 44.91 ? 738  ARG A CZ    1 
ATOM   3918 N NH1   . ARG C 3 442 ? 2.526   45.167 60.267  1.00 45.80 ? 738  ARG A NH1   1 
ATOM   3919 N NH2   . ARG C 3 442 ? 0.533   44.482 59.338  1.00 44.82 ? 738  ARG A NH2   1 
ATOM   3920 N N     . TYR C 3 443 ? 2.859   41.166 55.577  1.00 29.30 ? 739  TYR A N     1 
ATOM   3921 C CA    . TYR C 3 443 ? 2.484   41.646 54.241  1.00 27.74 ? 739  TYR A CA    1 
ATOM   3922 C C     . TYR C 3 443 ? 1.056   41.220 53.931  1.00 26.57 ? 739  TYR A C     1 
ATOM   3923 O O     . TYR C 3 443 ? 0.232   42.041 53.517  1.00 26.26 ? 739  TYR A O     1 
ATOM   3924 C CB    . TYR C 3 443 ? 3.410   41.089 53.142  1.00 27.36 ? 739  TYR A CB    1 
ATOM   3925 C CG    . TYR C 3 443 ? 3.075   41.622 51.749  1.00 26.40 ? 739  TYR A CG    1 
ATOM   3926 C CD1   . TYR C 3 443 ? 2.045   41.061 50.995  1.00 25.85 ? 739  TYR A CD1   1 
ATOM   3927 C CD2   . TYR C 3 443 ? 3.752   42.718 51.215  1.00 26.42 ? 739  TYR A CD2   1 
ATOM   3928 C CE1   . TYR C 3 443 ? 1.692   41.573 49.756  1.00 25.44 ? 739  TYR A CE1   1 
ATOM   3929 C CE2   . TYR C 3 443 ? 3.408   43.243 49.966  1.00 25.84 ? 739  TYR A CE2   1 
ATOM   3930 C CZ    . TYR C 3 443 ? 2.375   42.666 49.243  1.00 26.08 ? 739  TYR A CZ    1 
ATOM   3931 O OH    . TYR C 3 443 ? 2.016   43.183 48.015  1.00 26.16 ? 739  TYR A OH    1 
ATOM   3932 N N     . PHE C 3 444 ? 0.759   39.939 54.150  1.00 25.42 ? 740  PHE A N     1 
ATOM   3933 C CA    . PHE C 3 444 ? -0.573  39.412 53.865  1.00 24.92 ? 740  PHE A CA    1 
ATOM   3934 C C     . PHE C 3 444 ? -1.661  39.996 54.745  1.00 25.26 ? 740  PHE A C     1 
ATOM   3935 O O     . PHE C 3 444 ? -2.841  39.991 54.376  1.00 24.70 ? 740  PHE A O     1 
ATOM   3936 C CB    . PHE C 3 444 ? -0.569  37.892 53.973  1.00 25.01 ? 740  PHE A CB    1 
ATOM   3937 C CG    . PHE C 3 444 ? 0.111   37.216 52.818  1.00 25.82 ? 740  PHE A CG    1 
ATOM   3938 C CD1   . PHE C 3 444 ? -0.070  37.687 51.518  1.00 25.93 ? 740  PHE A CD1   1 
ATOM   3939 C CD2   . PHE C 3 444 ? 0.945   36.123 53.025  1.00 26.03 ? 740  PHE A CD2   1 
ATOM   3940 C CE1   . PHE C 3 444 ? 0.570   37.081 50.451  1.00 25.85 ? 740  PHE A CE1   1 
ATOM   3941 C CE2   . PHE C 3 444 ? 1.586   35.513 51.964  1.00 25.84 ? 740  PHE A CE2   1 
ATOM   3942 C CZ    . PHE C 3 444 ? 1.399   35.993 50.675  1.00 26.12 ? 740  PHE A CZ    1 
ATOM   3943 N N     . GLU C 3 445 ? -1.267  40.504 55.909  1.00 25.51 ? 741  GLU A N     1 
ATOM   3944 C CA    . GLU C 3 445 ? -2.223  41.113 56.809  1.00 26.20 ? 741  GLU A CA    1 
ATOM   3945 C C     . GLU C 3 445 ? -2.589  42.461 56.208  1.00 25.26 ? 741  GLU A C     1 
ATOM   3946 O O     . GLU C 3 445 ? -3.744  42.858 56.223  1.00 25.29 ? 741  GLU A O     1 
ATOM   3947 C CB    . GLU C 3 445 ? -1.603  41.297 58.191  1.00 29.86 ? 741  GLU A CB    1 
ATOM   3948 C CG    . GLU C 3 445 ? -1.290  39.992 58.926  1.00 34.57 ? 741  GLU A CG    1 
ATOM   3949 C CD    . GLU C 3 445 ? -0.505  40.202 60.240  1.00 37.71 ? 741  GLU A CD    1 
ATOM   3950 O OE1   . GLU C 3 445 ? -1.114  40.634 61.253  1.00 39.61 ? 741  GLU A OE1   1 
ATOM   3951 O OE2   . GLU C 3 445 ? 0.725   39.933 60.261  1.00 39.69 ? 741  GLU A OE2   1 
ATOM   3952 N N     . SER C 3 446 ? -1.590  43.151 55.665  1.00 24.78 ? 742  SER A N     1 
ATOM   3953 C CA    . SER C 3 446 ? -1.788  44.458 55.039  1.00 24.69 ? 742  SER A CA    1 
ATOM   3954 C C     . SER C 3 446 ? -2.386  44.370 53.639  1.00 23.23 ? 742  SER A C     1 
ATOM   3955 O O     . SER C 3 446 ? -3.076  45.286 53.205  1.00 22.00 ? 742  SER A O     1 
ATOM   3956 C CB    . SER C 3 446 ? -0.463  45.192 54.958  1.00 26.05 ? 742  SER A CB    1 
ATOM   3957 O OG    . SER C 3 446 ? 0.027   45.407 56.258  1.00 29.65 ? 742  SER A OG    1 
ATOM   3958 N N     . PHE C 3 447 ? -2.100  43.263 52.945  1.00 21.95 ? 743  PHE A N     1 
ATOM   3959 C CA    . PHE C 3 447 ? -2.588  43.012 51.588  1.00 20.49 ? 743  PHE A CA    1 
ATOM   3960 C C     . PHE C 3 447 ? -3.323  41.660 51.506  1.00 19.85 ? 743  PHE A C     1 
ATOM   3961 O O     . PHE C 3 447 ? -2.875  40.725 50.837  1.00 18.39 ? 743  PHE A O     1 
ATOM   3962 C CB    . PHE C 3 447 ? -1.402  43.036 50.625  1.00 19.81 ? 743  PHE A CB    1 
ATOM   3963 C CG    . PHE C 3 447 ? -0.700  44.358 50.574  1.00 19.91 ? 743  PHE A CG    1 
ATOM   3964 C CD1   . PHE C 3 447 ? -1.260  45.429 49.872  1.00 20.12 ? 743  PHE A CD1   1 
ATOM   3965 C CD2   . PHE C 3 447 ? 0.500   44.548 51.253  1.00 19.69 ? 743  PHE A CD2   1 
ATOM   3966 C CE1   . PHE C 3 447 ? -0.639  46.676 49.848  1.00 19.70 ? 743  PHE A CE1   1 
ATOM   3967 C CE2   . PHE C 3 447 ? 1.139   45.800 51.234  1.00 20.95 ? 743  PHE A CE2   1 
ATOM   3968 C CZ    . PHE C 3 447 ? 0.562   46.866 50.528  1.00 19.98 ? 743  PHE A CZ    1 
ATOM   3969 N N     . PRO C 3 448 ? -4.476  41.559 52.178  1.00 19.18 ? 744  PRO A N     1 
ATOM   3970 C CA    . PRO C 3 448 ? -5.358  40.385 52.267  1.00 20.03 ? 744  PRO A CA    1 
ATOM   3971 C C     . PRO C 3 448 ? -5.823  39.850 50.906  1.00 19.50 ? 744  PRO A C     1 
ATOM   3972 O O     . PRO C 3 448 ? -5.967  38.636 50.720  1.00 18.52 ? 744  PRO A O     1 
ATOM   3973 C CB    . PRO C 3 448 ? -6.532  40.885 53.112  1.00 19.77 ? 744  PRO A CB    1 
ATOM   3974 C CG    . PRO C 3 448 ? -6.492  42.379 52.929  1.00 19.37 ? 744  PRO A CG    1 
ATOM   3975 C CD    . PRO C 3 448 ? -5.039  42.702 52.904  1.00 18.98 ? 744  PRO A CD    1 
ATOM   3976 N N     . GLY C 3 449 ? -6.089  40.776 49.985  1.00 18.81 ? 745  GLY A N     1 
ATOM   3977 C CA    . GLY C 3 449 ? -6.495  40.423 48.634  1.00 17.93 ? 745  GLY A CA    1 
ATOM   3978 C C     . GLY C 3 449 ? -5.376  39.670 47.931  1.00 17.60 ? 745  GLY A C     1 
ATOM   3979 O O     . GLY C 3 449 ? -5.633  38.711 47.219  1.00 17.86 ? 745  GLY A O     1 
ATOM   3980 N N     . VAL C 3 450 ? -4.137  40.116 48.113  1.00 17.26 ? 746  VAL A N     1 
ATOM   3981 C CA    . VAL C 3 450 ? -2.985  39.439 47.524  1.00 17.33 ? 746  VAL A CA    1 
ATOM   3982 C C     . VAL C 3 450 ? -2.842  38.050 48.159  1.00 18.65 ? 746  VAL A C     1 
ATOM   3983 O O     . VAL C 3 450 ? -2.453  37.086 47.492  1.00 17.49 ? 746  VAL A O     1 
ATOM   3984 C CB    . VAL C 3 450 ? -1.664  40.197 47.780  1.00 16.60 ? 746  VAL A CB    1 
ATOM   3985 C CG1   . VAL C 3 450 ? -0.510  39.337 47.328  1.00 16.49 ? 746  VAL A CG1   1 
ATOM   3986 C CG2   . VAL C 3 450 ? -1.654  41.570 47.065  1.00 14.55 ? 746  VAL A CG2   1 
ATOM   3987 N N     . LYS C 3 451 ? -3.143  37.946 49.455  1.00 19.41 ? 747  LYS A N     1 
ATOM   3988 C CA    . LYS C 3 451 ? -3.035  36.653 50.130  1.00 20.45 ? 747  LYS A CA    1 
ATOM   3989 C C     . LYS C 3 451 ? -4.055  35.696 49.539  1.00 19.84 ? 747  LYS A C     1 
ATOM   3990 O O     . LYS C 3 451 ? -3.746  34.546 49.259  1.00 19.17 ? 747  LYS A O     1 
ATOM   3991 C CB    . LYS C 3 451 ? -3.298  36.772 51.641  1.00 22.13 ? 747  LYS A CB    1 
ATOM   3992 C CG    . LYS C 3 451 ? -3.020  35.467 52.399  1.00 22.12 ? 747  LYS A CG    1 
ATOM   3993 C CD    . LYS C 3 451 ? -3.732  35.449 53.741  1.00 25.28 ? 747  LYS A CD    1 
ATOM   3994 C CE    . LYS C 3 451 ? -3.162  34.379 54.687  1.00 26.33 ? 747  LYS A CE    1 
ATOM   3995 N NZ    . LYS C 3 451 ? -4.180  33.973 55.733  1.00 28.16 ? 747  LYS A NZ    1 
ATOM   3996 N N     . ARG C 3 452 ? -5.276  36.183 49.368  1.00 20.41 ? 748  ARG A N     1 
ATOM   3997 C CA    . ARG C 3 452 ? -6.339  35.370 48.811  1.00 22.09 ? 748  ARG A CA    1 
ATOM   3998 C C     . ARG C 3 452 ? -6.004  34.918 47.383  1.00 21.65 ? 748  ARG A C     1 
ATOM   3999 O O     . ARG C 3 452 ? -6.220  33.760 47.024  1.00 19.90 ? 748  ARG A O     1 
ATOM   4000 C CB    . ARG C 3 452 ? -7.644  36.151 48.817  1.00 24.29 ? 748  ARG A CB    1 
ATOM   4001 C CG    . ARG C 3 452 ? -8.853  35.260 48.792  1.00 29.96 ? 748  ARG A CG    1 
ATOM   4002 C CD    . ARG C 3 452 ? -9.988  35.936 48.054  1.00 35.52 ? 748  ARG A CD    1 
ATOM   4003 N NE    . ARG C 3 452 ? -9.640  37.326 47.748  1.00 40.92 ? 748  ARG A NE    1 
ATOM   4004 C CZ    . ARG C 3 452 ? -10.225 38.053 46.800  1.00 42.70 ? 748  ARG A CZ    1 
ATOM   4005 N NH1   . ARG C 3 452 ? -11.195 37.513 46.063  1.00 44.25 ? 748  ARG A NH1   1 
ATOM   4006 N NH2   . ARG C 3 452 ? -9.832  39.312 46.578  1.00 44.30 ? 748  ARG A NH2   1 
ATOM   4007 N N     . TYR C 3 453 ? -5.472  35.831 46.577  1.00 20.57 ? 749  TYR A N     1 
ATOM   4008 C CA    . TYR C 3 453 ? -5.106  35.479 45.214  1.00 21.06 ? 749  TYR A CA    1 
ATOM   4009 C C     . TYR C 3 453 ? -4.048  34.366 45.203  1.00 21.34 ? 749  TYR A C     1 
ATOM   4010 O O     . TYR C 3 453 ? -4.158  33.406 44.425  1.00 21.64 ? 749  TYR A O     1 
ATOM   4011 C CB    . TYR C 3 453 ? -4.588  36.715 44.436  1.00 20.27 ? 749  TYR A CB    1 
ATOM   4012 C CG    . TYR C 3 453 ? -3.713  36.373 43.241  1.00 20.68 ? 749  TYR A CG    1 
ATOM   4013 C CD1   . TYR C 3 453 ? -4.267  35.903 42.045  1.00 21.42 ? 749  TYR A CD1   1 
ATOM   4014 C CD2   . TYR C 3 453 ? -2.332  36.426 43.340  1.00 21.75 ? 749  TYR A CD2   1 
ATOM   4015 C CE1   . TYR C 3 453 ? -3.456  35.480 40.982  1.00 20.56 ? 749  TYR A CE1   1 
ATOM   4016 C CE2   . TYR C 3 453 ? -1.517  36.007 42.293  1.00 22.93 ? 749  TYR A CE2   1 
ATOM   4017 C CZ    . TYR C 3 453 ? -2.087  35.528 41.114  1.00 22.21 ? 749  TYR A CZ    1 
ATOM   4018 O OH    . TYR C 3 453 ? -1.244  35.059 40.102  1.00 24.29 ? 749  TYR A OH    1 
ATOM   4019 N N     . MET C 3 454 ? -3.029  34.479 46.045  1.00 21.03 ? 750  MET A N     1 
ATOM   4020 C CA    . MET C 3 454 ? -1.992  33.464 46.053  1.00 22.93 ? 750  MET A CA    1 
ATOM   4021 C C     . MET C 3 454 ? -2.588  32.100 46.384  1.00 23.48 ? 750  MET A C     1 
ATOM   4022 O O     . MET C 3 454 ? -2.221  31.086 45.780  1.00 23.61 ? 750  MET A O     1 
ATOM   4023 C CB    . MET C 3 454 ? -0.878  33.808 47.052  1.00 24.88 ? 750  MET A CB    1 
ATOM   4024 C CG    . MET C 3 454 ? -0.081  35.115 46.763  1.00 28.58 ? 750  MET A CG    1 
ATOM   4025 S SD    . MET C 3 454 ? 0.751   35.281 45.125  1.00 32.73 ? 750  MET A SD    1 
ATOM   4026 C CE    . MET C 3 454 ? 1.511   36.936 45.300  1.00 30.36 ? 750  MET A CE    1 
ATOM   4027 N N     . GLU C 3 455 ? -3.517  32.080 47.334  1.00 23.75 ? 751  GLU A N     1 
ATOM   4028 C CA    . GLU C 3 455 ? -4.159  30.833 47.732  1.00 23.93 ? 751  GLU A CA    1 
ATOM   4029 C C     . GLU C 3 455 ? -5.036  30.309 46.603  1.00 24.39 ? 751  GLU A C     1 
ATOM   4030 O O     . GLU C 3 455 ? -4.929  29.145 46.205  1.00 23.63 ? 751  GLU A O     1 
ATOM   4031 C CB    . GLU C 3 455 ? -5.004  31.057 48.980  1.00 23.98 ? 751  GLU A CB    1 
ATOM   4032 C CG    . GLU C 3 455 ? -4.185  31.521 50.175  1.00 24.55 ? 751  GLU A CG    1 
ATOM   4033 C CD    . GLU C 3 455 ? -5.056  31.867 51.365  1.00 25.55 ? 751  GLU A CD    1 
ATOM   4034 O OE1   . GLU C 3 455 ? -6.248  32.203 51.159  1.00 24.01 ? 751  GLU A OE1   1 
ATOM   4035 O OE2   . GLU C 3 455 ? -4.536  31.795 52.505  1.00 27.12 ? 751  GLU A OE2   1 
ATOM   4036 N N     . ASN C 3 456 ? -5.899  31.181 46.089  1.00 24.06 ? 752  ASN A N     1 
ATOM   4037 C CA    . ASN C 3 456 ? -6.809  30.818 45.007  1.00 24.26 ? 752  ASN A CA    1 
ATOM   4038 C C     . ASN C 3 456 ? -6.119  30.379 43.728  1.00 23.05 ? 752  ASN A C     1 
ATOM   4039 O O     . ASN C 3 456 ? -6.616  29.501 43.025  1.00 22.99 ? 752  ASN A O     1 
ATOM   4040 C CB    . ASN C 3 456 ? -7.736  31.986 44.667  1.00 25.89 ? 752  ASN A CB    1 
ATOM   4041 C CG    . ASN C 3 456 ? -8.834  32.167 45.687  1.00 28.12 ? 752  ASN A CG    1 
ATOM   4042 O OD1   . ASN C 3 456 ? -8.879  31.460 46.694  1.00 29.75 ? 752  ASN A OD1   1 
ATOM   4043 N ND2   . ASN C 3 456 ? -9.725  33.120 45.439  1.00 29.55 ? 752  ASN A ND2   1 
ATOM   4044 N N     . ILE C 3 457 ? -4.983  30.988 43.421  1.00 21.86 ? 753  ILE A N     1 
ATOM   4045 C CA    . ILE C 3 457 ? -4.302  30.645 42.191  1.00 21.30 ? 753  ILE A CA    1 
ATOM   4046 C C     . ILE C 3 457 ? -3.643  29.266 42.306  1.00 21.40 ? 753  ILE A C     1 
ATOM   4047 O O     . ILE C 3 457 ? -3.649  28.488 41.338  1.00 20.01 ? 753  ILE A O     1 
ATOM   4048 C CB    . ILE C 3 457 ? -3.275  31.770 41.776  1.00 19.85 ? 753  ILE A CB    1 
ATOM   4049 C CG1   . ILE C 3 457 ? -2.809  31.546 40.334  1.00 19.82 ? 753  ILE A CG1   1 
ATOM   4050 C CG2   . ILE C 3 457 ? -2.092  31.806 42.722  1.00 20.30 ? 753  ILE A CG2   1 
ATOM   4051 C CD1   . ILE C 3 457 ? -3.890  31.769 39.321  1.00 17.92 ? 753  ILE A CD1   1 
ATOM   4052 N N     . VAL C 3 458 ? -3.109  28.953 43.487  1.00 21.18 ? 754  VAL A N     1 
ATOM   4053 C CA    . VAL C 3 458 ? -2.474  27.666 43.703  1.00 21.65 ? 754  VAL A CA    1 
ATOM   4054 C C     . VAL C 3 458 ? -3.556  26.586 43.583  1.00 22.28 ? 754  VAL A C     1 
ATOM   4055 O O     . VAL C 3 458 ? -3.335  25.522 42.991  1.00 21.62 ? 754  VAL A O     1 
ATOM   4056 C CB    . VAL C 3 458 ? -1.783  27.611 45.078  1.00 21.33 ? 754  VAL A CB    1 
ATOM   4057 C CG1   . VAL C 3 458 ? -1.417  26.189 45.420  1.00 20.41 ? 754  VAL A CG1   1 
ATOM   4058 C CG2   . VAL C 3 458 ? -0.526  28.446 45.039  1.00 20.89 ? 754  VAL A CG2   1 
ATOM   4059 N N     . GLN C 3 459 ? -4.739  26.878 44.103  1.00 22.54 ? 755  GLN A N     1 
ATOM   4060 C CA    . GLN C 3 459 ? -5.836  25.936 44.012  1.00 24.72 ? 755  GLN A CA    1 
ATOM   4061 C C     . GLN C 3 459 ? -6.221  25.712 42.540  1.00 25.17 ? 755  GLN A C     1 
ATOM   4062 O O     . GLN C 3 459 ? -6.488  24.587 42.120  1.00 24.61 ? 755  GLN A O     1 
ATOM   4063 C CB    . GLN C 3 459 ? -7.052  26.460 44.788  1.00 26.67 ? 755  GLN A CB    1 
ATOM   4064 C CG    . GLN C 3 459 ? -8.235  25.484 44.871  1.00 31.38 ? 755  GLN A CG    1 
ATOM   4065 C CD    . GLN C 3 459 ? -7.786  24.014 44.951  1.00 35.37 ? 755  GLN A CD    1 
ATOM   4066 O OE1   . GLN C 3 459 ? -8.081  23.194 44.055  1.00 35.12 ? 755  GLN A OE1   1 
ATOM   4067 N NE2   . GLN C 3 459 ? -7.060  23.674 46.032  1.00 36.64 ? 755  GLN A NE2   1 
ATOM   4068 N N     . GLU C 3 460 ? -6.252  26.794 41.763  1.00 25.28 ? 756  GLU A N     1 
ATOM   4069 C CA    . GLU C 3 460 ? -6.603  26.734 40.339  1.00 25.01 ? 756  GLU A CA    1 
ATOM   4070 C C     . GLU C 3 460 ? -5.616  25.933 39.520  1.00 22.39 ? 756  GLU A C     1 
ATOM   4071 O O     . GLU C 3 460 ? -6.012  25.147 38.654  1.00 21.26 ? 756  GLU A O     1 
ATOM   4072 C CB    . GLU C 3 460 ? -6.683  28.138 39.749  1.00 26.85 ? 756  GLU A CB    1 
ATOM   4073 C CG    . GLU C 3 460 ? -8.006  28.397 39.112  1.00 32.37 ? 756  GLU A CG    1 
ATOM   4074 C CD    . GLU C 3 460 ? -7.901  29.156 37.815  1.00 34.73 ? 756  GLU A CD    1 
ATOM   4075 O OE1   . GLU C 3 460 ? -6.922  29.915 37.642  1.00 35.55 ? 756  GLU A OE1   1 
ATOM   4076 O OE2   . GLU C 3 460 ? -8.813  28.987 36.968  1.00 37.05 ? 756  GLU A OE2   1 
ATOM   4077 N N     . ALA C 3 461 ? -4.334  26.162 39.790  1.00 20.62 ? 757  ALA A N     1 
ATOM   4078 C CA    . ALA C 3 461 ? -3.258  25.481 39.094  1.00 20.46 ? 757  ALA A CA    1 
ATOM   4079 C C     . ALA C 3 461 ? -3.387  23.969 39.341  1.00 21.48 ? 757  ALA A C     1 
ATOM   4080 O O     . ALA C 3 461 ? -3.131  23.143 38.453  1.00 20.13 ? 757  ALA A O     1 
ATOM   4081 C CB    . ALA C 3 461 ? -1.919  26.002 39.596  1.00 18.35 ? 757  ALA A CB    1 
ATOM   4082 N N     . LYS C 3 462 ? -3.807  23.628 40.560  1.00 21.84 ? 758  LYS A N     1 
ATOM   4083 C CA    . LYS C 3 462 ? -3.982  22.248 40.970  1.00 22.47 ? 758  LYS A CA    1 
ATOM   4084 C C     . LYS C 3 462 ? -5.175  21.676 40.227  1.00 20.91 ? 758  LYS A C     1 
ATOM   4085 O O     . LYS C 3 462 ? -5.110  20.598 39.652  1.00 21.17 ? 758  LYS A O     1 
ATOM   4086 C CB    . LYS C 3 462 ? -4.237  22.170 42.498  1.00 24.44 ? 758  LYS A CB    1 
ATOM   4087 C CG    . LYS C 3 462 ? -3.020  21.764 43.365  1.00 27.12 ? 758  LYS A CG    1 
ATOM   4088 C CD    . LYS C 3 462 ? -2.483  22.922 44.265  1.00 28.14 ? 758  LYS A CD    1 
ATOM   4089 C CE    . LYS C 3 462 ? -1.728  22.417 45.538  1.00 30.19 ? 758  LYS A CE    1 
ATOM   4090 N NZ    . LYS C 3 462 ? -0.220  22.571 45.573  1.00 28.00 ? 758  LYS A NZ    1 
ATOM   4091 N N     . GLN C 3 463 ? -6.263  22.419 40.229  1.00 20.24 ? 759  GLN A N     1 
ATOM   4092 C CA    . GLN C 3 463 ? -7.485  21.973 39.598  1.00 21.01 ? 759  GLN A CA    1 
ATOM   4093 C C     . GLN C 3 463 ? -7.396  21.820 38.081  1.00 21.02 ? 759  GLN A C     1 
ATOM   4094 O O     . GLN C 3 463 ? -7.779  20.777 37.544  1.00 20.31 ? 759  GLN A O     1 
ATOM   4095 C CB    . GLN C 3 463 ? -8.616  22.926 39.965  1.00 21.72 ? 759  GLN A CB    1 
ATOM   4096 C CG    . GLN C 3 463 ? -9.959  22.500 39.455  1.00 24.41 ? 759  GLN A CG    1 
ATOM   4097 C CD    . GLN C 3 463 ? -10.404 23.283 38.217  1.00 26.62 ? 759  GLN A CD    1 
ATOM   4098 O OE1   . GLN C 3 463 ? -10.746 24.451 38.306  1.00 28.58 ? 759  GLN A OE1   1 
ATOM   4099 N NE2   . GLN C 3 463 ? -10.412 22.628 37.060  1.00 27.25 ? 759  GLN A NE2   1 
ATOM   4100 N N     . LYS C 3 464 ? -6.871  22.846 37.405  1.00 20.13 ? 760  LYS A N     1 
ATOM   4101 C CA    . LYS C 3 464 ? -6.750  22.857 35.940  1.00 19.85 ? 760  LYS A CA    1 
ATOM   4102 C C     . LYS C 3 464 ? -5.502  22.201 35.391  1.00 18.51 ? 760  LYS A C     1 
ATOM   4103 O O     . LYS C 3 464 ? -5.546  21.611 34.321  1.00 19.77 ? 760  LYS A O     1 
ATOM   4104 C CB    . LYS C 3 464 ? -6.798  24.294 35.410  1.00 20.70 ? 760  LYS A CB    1 
ATOM   4105 C CG    . LYS C 3 464 ? -8.172  24.853 35.313  1.00 21.41 ? 760  LYS A CG    1 
ATOM   4106 C CD    . LYS C 3 464 ? -8.114  26.315 34.969  1.00 23.56 ? 760  LYS A CD    1 
ATOM   4107 C CE    . LYS C 3 464 ? -9.494  26.841 34.609  1.00 24.49 ? 760  LYS A CE    1 
ATOM   4108 N NZ    . LYS C 3 464 ? -10.489 26.680 35.703  1.00 25.52 ? 760  LYS A NZ    1 
ATOM   4109 N N     . GLY C 3 465 ? -4.395  22.316 36.111  1.00 16.98 ? 761  GLY A N     1 
ATOM   4110 C CA    . GLY C 3 465 ? -3.145  21.741 35.658  1.00 15.60 ? 761  GLY A CA    1 
ATOM   4111 C C     . GLY C 3 465 ? -2.210  22.819 35.126  1.00 15.73 ? 761  GLY A C     1 
ATOM   4112 O O     . GLY C 3 465 ? -1.040  22.565 34.832  1.00 15.63 ? 761  GLY A O     1 
ATOM   4113 N N     . TYR C 3 466 ? -2.720  24.042 35.021  1.00 15.61 ? 762  TYR A N     1 
ATOM   4114 C CA    . TYR C 3 466 ? -1.915  25.148 34.508  1.00 15.56 ? 762  TYR A CA    1 
ATOM   4115 C C     . TYR C 3 466 ? -2.464  26.483 35.014  1.00 15.42 ? 762  TYR A C     1 
ATOM   4116 O O     . TYR C 3 466 ? -3.567  26.544 35.558  1.00 15.33 ? 762  TYR A O     1 
ATOM   4117 C CB    . TYR C 3 466 ? -1.973  25.155 32.952  1.00 14.67 ? 762  TYR A CB    1 
ATOM   4118 C CG    . TYR C 3 466 ? -3.385  25.325 32.411  1.00 13.66 ? 762  TYR A CG    1 
ATOM   4119 C CD1   . TYR C 3 466 ? -4.233  24.225 32.258  1.00 12.87 ? 762  TYR A CD1   1 
ATOM   4120 C CD2   . TYR C 3 466 ? -3.907  26.590 32.146  1.00 13.89 ? 762  TYR A CD2   1 
ATOM   4121 C CE1   . TYR C 3 466 ? -5.555  24.389 31.871  1.00 12.64 ? 762  TYR A CE1   1 
ATOM   4122 C CE2   . TYR C 3 466 ? -5.239  26.761 31.757  1.00 12.16 ? 762  TYR A CE2   1 
ATOM   4123 C CZ    . TYR C 3 466 ? -6.047  25.665 31.631  1.00 12.44 ? 762  TYR A CZ    1 
ATOM   4124 O OH    . TYR C 3 466 ? -7.375  25.836 31.348  1.00 13.65 ? 762  TYR A OH    1 
ATOM   4125 N N     . VAL C 3 467 ? -1.685  27.542 34.811  1.00 15.79 ? 763  VAL A N     1 
ATOM   4126 C CA    . VAL C 3 467 ? -2.120  28.895 35.151  1.00 16.69 ? 763  VAL A CA    1 
ATOM   4127 C C     . VAL C 3 467 ? -2.037  29.718 33.833  1.00 18.34 ? 763  VAL A C     1 
ATOM   4128 O O     . VAL C 3 467 ? -1.297  29.352 32.911  1.00 18.60 ? 763  VAL A O     1 
ATOM   4129 C CB    . VAL C 3 467 ? -1.236  29.544 36.296  1.00 15.75 ? 763  VAL A CB    1 
ATOM   4130 C CG1   . VAL C 3 467 ? -1.417  28.733 37.636  1.00 15.23 ? 763  VAL A CG1   1 
ATOM   4131 C CG2   . VAL C 3 467 ? 0.232   29.609 35.886  1.00 14.28 ? 763  VAL A CG2   1 
ATOM   4132 N N     . THR C 3 468 ? -2.811  30.796 33.724  1.00 19.19 ? 764  THR A N     1 
ATOM   4133 C CA    . THR C 3 468 ? -2.787  31.620 32.507  1.00 20.23 ? 764  THR A CA    1 
ATOM   4134 C C     . THR C 3 468 ? -2.563  33.111 32.782  1.00 20.10 ? 764  THR A C     1 
ATOM   4135 O O     . THR C 3 468 ? -2.691  33.574 33.917  1.00 20.66 ? 764  THR A O     1 
ATOM   4136 C CB    . THR C 3 468 ? -4.104  31.494 31.721  1.00 21.30 ? 764  THR A CB    1 
ATOM   4137 O OG1   . THR C 3 468 ? -5.169  32.007 32.526  1.00 23.54 ? 764  THR A OG1   1 
ATOM   4138 C CG2   . THR C 3 468 ? -4.398  30.034 31.355  1.00 21.27 ? 764  THR A CG2   1 
ATOM   4139 N N     . THR C 3 469 ? -2.242  33.863 31.734  1.00 19.55 ? 765  THR A N     1 
ATOM   4140 C CA    . THR C 3 469 ? -2.014  35.293 31.856  1.00 18.56 ? 765  THR A CA    1 
ATOM   4141 C C     . THR C 3 469 ? -3.186  36.112 31.323  1.00 19.55 ? 765  THR A C     1 
ATOM   4142 O O     . THR C 3 469 ? -4.164  35.574 30.790  1.00 19.36 ? 765  THR A O     1 
ATOM   4143 C CB    . THR C 3 469 ? -0.779  35.724 31.072  1.00 17.87 ? 765  THR A CB    1 
ATOM   4144 O OG1   . THR C 3 469 ? -1.023  35.493 29.683  1.00 16.92 ? 765  THR A OG1   1 
ATOM   4145 C CG2   . THR C 3 469 ? 0.458   34.939 31.522  1.00 16.46 ? 765  THR A CG2   1 
ATOM   4146 N N     . LEU C 3 470 ? -3.071  37.433 31.462  1.00 20.24 ? 766  LEU A N     1 
ATOM   4147 C CA    . LEU C 3 470 ? -4.102  38.358 30.994  1.00 20.18 ? 766  LEU A CA    1 
ATOM   4148 C C     . LEU C 3 470 ? -4.547  38.047 29.569  1.00 18.85 ? 766  LEU A C     1 
ATOM   4149 O O     . LEU C 3 470 ? -5.735  37.959 29.286  1.00 18.02 ? 766  LEU A O     1 
ATOM   4150 C CB    . LEU C 3 470 ? -3.571  39.785 31.035  1.00 21.77 ? 766  LEU A CB    1 
ATOM   4151 C CG    . LEU C 3 470 ? -4.340  40.808 31.868  1.00 24.84 ? 766  LEU A CG    1 
ATOM   4152 C CD1   . LEU C 3 470 ? -5.415  40.150 32.730  1.00 25.16 ? 766  LEU A CD1   1 
ATOM   4153 C CD2   . LEU C 3 470 ? -3.336  41.529 32.764  1.00 25.39 ? 766  LEU A CD2   1 
ATOM   4154 N N     . LEU C 3 471 ? -3.581  37.879 28.677  1.00 18.46 ? 767  LEU A N     1 
ATOM   4155 C CA    . LEU C 3 471 ? -3.896  37.606 27.277  1.00 19.04 ? 767  LEU A CA    1 
ATOM   4156 C C     . LEU C 3 471 ? -3.951  36.103 26.922  1.00 18.92 ? 767  LEU A C     1 
ATOM   4157 O O     . LEU C 3 471 ? -3.852  35.723 25.746  1.00 18.12 ? 767  LEU A O     1 
ATOM   4158 C CB    . LEU C 3 471 ? -2.901  38.359 26.362  1.00 18.49 ? 767  LEU A CB    1 
ATOM   4159 C CG    . LEU C 3 471 ? -2.854  39.907 26.461  1.00 19.63 ? 767  LEU A CG    1 
ATOM   4160 C CD1   . LEU C 3 471 ? -2.231  40.508 25.204  1.00 19.08 ? 767  LEU A CD1   1 
ATOM   4161 C CD2   . LEU C 3 471 ? -4.238  40.462 26.665  1.00 18.55 ? 767  LEU A CD2   1 
ATOM   4162 N N     . HIS C 3 472 ? -4.112  35.257 27.948  1.00 18.88 ? 768  HIS A N     1 
ATOM   4163 C CA    . HIS C 3 472 ? -4.249  33.804 27.764  1.00 17.84 ? 768  HIS A CA    1 
ATOM   4164 C C     . HIS C 3 472 ? -3.010  32.984 27.500  1.00 16.34 ? 768  HIS A C     1 
ATOM   4165 O O     . HIS C 3 472 ? -3.114  31.876 26.970  1.00 16.28 ? 768  HIS A O     1 
ATOM   4166 C CB    . HIS C 3 472 ? -5.268  33.480 26.666  1.00 19.28 ? 768  HIS A CB    1 
ATOM   4167 C CG    . HIS C 3 472 ? -6.600  34.114 26.878  1.00 21.24 ? 768  HIS A CG    1 
ATOM   4168 N ND1   . HIS C 3 472 ? -7.141  34.304 28.131  1.00 23.85 ? 768  HIS A ND1   1 
ATOM   4169 C CD2   . HIS C 3 472 ? -7.466  34.680 26.006  1.00 23.29 ? 768  HIS A CD2   1 
ATOM   4170 C CE1   . HIS C 3 472 ? -8.279  34.966 28.023  1.00 23.69 ? 768  HIS A CE1   1 
ATOM   4171 N NE2   . HIS C 3 472 ? -8.499  35.206 26.744  1.00 24.28 ? 768  HIS A NE2   1 
ATOM   4172 N N     . ARG C 3 473 ? -1.845  33.520 27.823  1.00 14.80 ? 769  ARG A N     1 
ATOM   4173 C CA    . ARG C 3 473 ? -0.633  32.740 27.703  1.00 15.04 ? 769  ARG A CA    1 
ATOM   4174 C C     . ARG C 3 473 ? -0.859  31.634 28.794  1.00 16.25 ? 769  ARG A C     1 
ATOM   4175 O O     . ARG C 3 473 ? -1.598  31.849 29.765  1.00 16.14 ? 769  ARG A O     1 
ATOM   4176 C CB    . ARG C 3 473 ? 0.580   33.607 28.032  1.00 14.07 ? 769  ARG A CB    1 
ATOM   4177 C CG    . ARG C 3 473 ? 1.915   32.912 27.840  1.00 13.95 ? 769  ARG A CG    1 
ATOM   4178 C CD    . ARG C 3 473 ? 3.066   33.874 27.996  1.00 14.11 ? 769  ARG A CD    1 
ATOM   4179 N NE    . ARG C 3 473 ? 2.755   35.089 27.261  1.00 14.73 ? 769  ARG A NE    1 
ATOM   4180 C CZ    . ARG C 3 473 ? 3.034   35.285 25.966  1.00 14.90 ? 769  ARG A CZ    1 
ATOM   4181 N NH1   . ARG C 3 473 ? 3.645   34.335 25.245  1.00 12.84 ? 769  ARG A NH1   1 
ATOM   4182 N NH2   . ARG C 3 473 ? 2.660   36.426 25.383  1.00 12.79 ? 769  ARG A NH2   1 
ATOM   4183 N N     . ARG C 3 474 ? -0.235  30.472 28.637  1.00 15.58 ? 770  ARG A N     1 
ATOM   4184 C CA    . ARG C 3 474 ? -0.456  29.371 29.562  1.00 15.23 ? 770  ARG A CA    1 
ATOM   4185 C C     . ARG C 3 474 ? 0.832   28.697 30.001  1.00 15.35 ? 770  ARG A C     1 
ATOM   4186 O O     . ARG C 3 474 ? 1.800   28.617 29.237  1.00 14.20 ? 770  ARG A O     1 
ATOM   4187 C CB    . ARG C 3 474 ? -1.373  28.363 28.859  1.00 16.16 ? 770  ARG A CB    1 
ATOM   4188 C CG    . ARG C 3 474 ? -1.659  27.090 29.557  1.00 17.32 ? 770  ARG A CG    1 
ATOM   4189 C CD    . ARG C 3 474 ? -2.516  26.195 28.645  1.00 17.31 ? 770  ARG A CD    1 
ATOM   4190 N NE    . ARG C 3 474 ? -3.888  26.685 28.478  1.00 16.94 ? 770  ARG A NE    1 
ATOM   4191 C CZ    . ARG C 3 474 ? -4.955  25.903 28.307  1.00 15.63 ? 770  ARG A CZ    1 
ATOM   4192 N NH1   . ARG C 3 474 ? -4.824  24.585 28.280  1.00 18.66 ? 770  ARG A NH1   1 
ATOM   4193 N NH2   . ARG C 3 474 ? -6.149  26.430 28.148  1.00 14.98 ? 770  ARG A NH2   1 
ATOM   4194 N N     . ARG C 3 475 ? 0.848   28.228 31.251  1.00 15.28 ? 771  ARG A N     1 
ATOM   4195 C CA    . ARG C 3 475 ? 1.990   27.497 31.796  1.00 15.87 ? 771  ARG A CA    1 
ATOM   4196 C C     . ARG C 3 475 ? 1.461   26.312 32.611  1.00 15.89 ? 771  ARG A C     1 
ATOM   4197 O O     . ARG C 3 475 ? 0.721   26.488 33.583  1.00 16.09 ? 771  ARG A O     1 
ATOM   4198 C CB    . ARG C 3 475 ? 2.861   28.377 32.693  1.00 16.31 ? 771  ARG A CB    1 
ATOM   4199 C CG    . ARG C 3 475 ? 4.184   27.712 33.038  1.00 16.87 ? 771  ARG A CG    1 
ATOM   4200 C CD    . ARG C 3 475 ? 4.969   28.526 34.036  1.00 18.09 ? 771  ARG A CD    1 
ATOM   4201 N NE    . ARG C 3 475 ? 6.296   27.975 34.261  1.00 18.64 ? 771  ARG A NE    1 
ATOM   4202 C CZ    . ARG C 3 475 ? 7.283   28.617 34.878  1.00 19.50 ? 771  ARG A CZ    1 
ATOM   4203 N NH1   . ARG C 3 475 ? 7.102   29.842 35.343  1.00 21.74 ? 771  ARG A NH1   1 
ATOM   4204 N NH2   . ARG C 3 475 ? 8.467   28.045 35.013  1.00 20.77 ? 771  ARG A NH2   1 
ATOM   4205 N N     . TYR C 3 476 ? 1.820   25.104 32.187  1.00 15.62 ? 772  TYR A N     1 
ATOM   4206 C CA    . TYR C 3 476 ? 1.383   23.892 32.878  1.00 15.72 ? 772  TYR A CA    1 
ATOM   4207 C C     . TYR C 3 476 ? 2.265   23.688 34.095  1.00 14.68 ? 772  TYR A C     1 
ATOM   4208 O O     . TYR C 3 476 ? 3.465   23.921 34.046  1.00 14.77 ? 772  TYR A O     1 
ATOM   4209 C CB    . TYR C 3 476 ? 1.479   22.667 31.942  1.00 15.17 ? 772  TYR A CB    1 
ATOM   4210 C CG    . TYR C 3 476 ? 0.400   22.664 30.884  1.00 15.44 ? 772  TYR A CG    1 
ATOM   4211 C CD1   . TYR C 3 476 ? -0.877  22.197 31.179  1.00 14.55 ? 772  TYR A CD1   1 
ATOM   4212 C CD2   . TYR C 3 476 ? 0.645   23.173 29.601  1.00 14.90 ? 772  TYR A CD2   1 
ATOM   4213 C CE1   . TYR C 3 476 ? -1.884  22.233 30.248  1.00 14.25 ? 772  TYR A CE1   1 
ATOM   4214 C CE2   . TYR C 3 476 ? -0.366  23.217 28.644  1.00 15.16 ? 772  TYR A CE2   1 
ATOM   4215 C CZ    . TYR C 3 476 ? -1.627  22.746 28.981  1.00 15.63 ? 772  TYR A CZ    1 
ATOM   4216 O OH    . TYR C 3 476 ? -2.662  22.793 28.072  1.00 16.23 ? 772  TYR A OH    1 
ATOM   4217 N N     . LEU C 3 477 ? 1.674   23.257 35.194  1.00 15.49 ? 773  LEU A N     1 
ATOM   4218 C CA    . LEU C 3 477 ? 2.472   23.045 36.396  1.00 16.63 ? 773  LEU A CA    1 
ATOM   4219 C C     . LEU C 3 477 ? 2.254   21.651 36.980  1.00 18.55 ? 773  LEU A C     1 
ATOM   4220 O O     . LEU C 3 477 ? 1.596   21.507 38.016  1.00 18.13 ? 773  LEU A O     1 
ATOM   4221 C CB    . LEU C 3 477 ? 2.137   24.117 37.445  1.00 15.39 ? 773  LEU A CB    1 
ATOM   4222 C CG    . LEU C 3 477 ? 2.406   25.574 37.043  1.00 13.92 ? 773  LEU A CG    1 
ATOM   4223 C CD1   . LEU C 3 477 ? 1.619   26.495 37.966  1.00 14.60 ? 773  LEU A CD1   1 
ATOM   4224 C CD2   . LEU C 3 477 ? 3.877   25.861 37.118  1.00 12.06 ? 773  LEU A CD2   1 
ATOM   4225 N N     . PRO C 3 478 ? 2.793   20.606 36.313  1.00 20.23 ? 774  PRO A N     1 
ATOM   4226 C CA    . PRO C 3 478 ? 2.653   19.219 36.780  1.00 21.85 ? 774  PRO A CA    1 
ATOM   4227 C C     . PRO C 3 478 ? 3.153   18.996 38.222  1.00 22.32 ? 774  PRO A C     1 
ATOM   4228 O O     . PRO C 3 478 ? 2.560   18.221 38.950  1.00 22.44 ? 774  PRO A O     1 
ATOM   4229 C CB    . PRO C 3 478 ? 3.458   18.406 35.746  1.00 21.60 ? 774  PRO A CB    1 
ATOM   4230 C CG    . PRO C 3 478 ? 4.402   19.411 35.126  1.00 21.03 ? 774  PRO A CG    1 
ATOM   4231 C CD    . PRO C 3 478 ? 3.569   20.659 35.063  1.00 20.23 ? 774  PRO A CD    1 
ATOM   4232 N N     . ASP C 3 479 ? 4.226   19.683 38.620  1.00 22.95 ? 775  ASP A N     1 
ATOM   4233 C CA    . ASP C 3 479 ? 4.793   19.544 39.960  1.00 23.77 ? 775  ASP A CA    1 
ATOM   4234 C C     . ASP C 3 479 ? 3.961   20.090 41.130  1.00 24.29 ? 775  ASP A C     1 
ATOM   4235 O O     . ASP C 3 479 ? 4.300   19.871 42.302  1.00 24.43 ? 775  ASP A O     1 
ATOM   4236 C CB    . ASP C 3 479 ? 6.167   20.204 40.009  1.00 25.10 ? 775  ASP A CB    1 
ATOM   4237 C CG    . ASP C 3 479 ? 7.206   19.437 39.234  1.00 26.43 ? 775  ASP A CG    1 
ATOM   4238 O OD1   . ASP C 3 479 ? 6.852   18.403 38.637  1.00 28.20 ? 775  ASP A OD1   1 
ATOM   4239 O OD2   . ASP C 3 479 ? 8.380   19.867 39.213  1.00 28.19 ? 775  ASP A OD2   1 
ATOM   4240 N N     . ILE C 3 480 ? 2.890   20.812 40.834  1.00 24.40 ? 776  ILE A N     1 
ATOM   4241 C CA    . ILE C 3 480 ? 2.071   21.370 41.895  1.00 24.82 ? 776  ILE A CA    1 
ATOM   4242 C C     . ILE C 3 480 ? 1.350   20.266 42.681  1.00 25.26 ? 776  ILE A C     1 
ATOM   4243 O O     . ILE C 3 480 ? 0.711   20.543 43.692  1.00 24.59 ? 776  ILE A O     1 
ATOM   4244 C CB    . ILE C 3 480 ? 1.051   22.406 41.324  1.00 24.72 ? 776  ILE A CB    1 
ATOM   4245 C CG1   . ILE C 3 480 ? 1.052   23.671 42.198  1.00 24.10 ? 776  ILE A CG1   1 
ATOM   4246 C CG2   . ILE C 3 480 ? -0.328  21.790 41.220  1.00 24.68 ? 776  ILE A CG2   1 
ATOM   4247 C CD1   . ILE C 3 480 ? -0.042  24.649 41.863  1.00 24.91 ? 776  ILE A CD1   1 
ATOM   4248 N N     . THR C 3 481 ? 1.450   19.021 42.210  1.00 25.97 ? 777  THR A N     1 
ATOM   4249 C CA    . THR C 3 481 ? 0.822   17.878 42.902  1.00 27.00 ? 777  THR A CA    1 
ATOM   4250 C C     . THR C 3 481 ? 1.861   16.965 43.541  1.00 26.87 ? 777  THR A C     1 
ATOM   4251 O O     . THR C 3 481 ? 1.519   15.934 44.118  1.00 26.81 ? 777  THR A O     1 
ATOM   4252 C CB    . THR C 3 481 ? -0.043  16.991 41.958  1.00 27.62 ? 777  THR A CB    1 
ATOM   4253 O OG1   . THR C 3 481 ? 0.777   16.437 40.917  1.00 27.12 ? 777  THR A OG1   1 
ATOM   4254 C CG2   . THR C 3 481 ? -1.189  17.802 41.357  1.00 28.02 ? 777  THR A CG2   1 
ATOM   4255 N N     . SER C 3 482 ? 3.128   17.349 43.440  1.00 26.81 ? 778  SER A N     1 
ATOM   4256 C CA    . SER C 3 482 ? 4.197   16.553 44.006  1.00 28.47 ? 778  SER A CA    1 
ATOM   4257 C C     . SER C 3 482 ? 4.033   16.371 45.520  1.00 30.08 ? 778  SER A C     1 
ATOM   4258 O O     . SER C 3 482 ? 3.558   17.264 46.228  1.00 30.30 ? 778  SER A O     1 
ATOM   4259 C CB    . SER C 3 482 ? 5.538   17.208 43.694  1.00 27.45 ? 778  SER A CB    1 
ATOM   4260 O OG    . SER C 3 482 ? 6.613   16.494 44.263  1.00 27.73 ? 778  SER A OG    1 
ATOM   4261 N N     . ARG C 3 483 ? 4.406   15.195 46.013  1.00 31.68 ? 779  ARG A N     1 
ATOM   4262 C CA    . ARG C 3 483 ? 4.309   14.927 47.437  1.00 33.36 ? 779  ARG A CA    1 
ATOM   4263 C C     . ARG C 3 483 ? 5.655   15.284 48.049  1.00 34.33 ? 779  ARG A C     1 
ATOM   4264 O O     . ARG C 3 483 ? 5.912   14.997 49.217  1.00 34.86 ? 779  ARG A O     1 
ATOM   4265 C CB    . ARG C 3 483 ? 3.957   13.454 47.700  1.00 33.77 ? 779  ARG A CB    1 
ATOM   4266 C CG    . ARG C 3 483 ? 2.454   13.195 47.811  1.00 34.26 ? 779  ARG A CG    1 
ATOM   4267 C CD    . ARG C 3 483 ? 1.802   13.118 46.436  1.00 35.16 ? 779  ARG A CD    1 
ATOM   4268 N NE    . ARG C 3 483 ? 2.255   11.934 45.702  1.00 36.93 ? 779  ARG A NE    1 
ATOM   4269 C CZ    . ARG C 3 483 ? 2.524   11.895 44.394  1.00 36.55 ? 779  ARG A CZ    1 
ATOM   4270 N NH1   . ARG C 3 483 ? 2.390   12.976 43.640  1.00 35.96 ? 779  ARG A NH1   1 
ATOM   4271 N NH2   . ARG C 3 483 ? 2.938   10.763 43.839  1.00 36.65 ? 779  ARG A NH2   1 
ATOM   4272 N N     . ASN C 3 484 ? 6.516   15.890 47.233  1.00 34.34 ? 780  ASN A N     1 
ATOM   4273 C CA    . ASN C 3 484 ? 7.823   16.341 47.692  1.00 34.96 ? 780  ASN A CA    1 
ATOM   4274 C C     . ASN C 3 484 ? 7.623   17.827 47.997  1.00 35.62 ? 780  ASN A C     1 
ATOM   4275 O O     . ASN C 3 484 ? 7.256   18.606 47.101  1.00 35.48 ? 780  ASN A O     1 
ATOM   4276 C CB    . ASN C 3 484 ? 8.885   16.169 46.601  1.00 35.37 ? 780  ASN A CB    1 
ATOM   4277 C CG    . ASN C 3 484 ? 10.166  16.958 46.895  1.00 37.02 ? 780  ASN A CG    1 
ATOM   4278 O OD1   . ASN C 3 484 ? 10.115  18.080 47.403  1.00 38.25 ? 780  ASN A OD1   1 
ATOM   4279 N ND2   . ASN C 3 484 ? 11.318  16.373 46.576  1.00 37.34 ? 780  ASN A ND2   1 
ATOM   4280 N N     . PHE C 3 485 ? 7.857   18.216 49.254  1.00 34.78 ? 781  PHE A N     1 
ATOM   4281 C CA    . PHE C 3 485 ? 7.671   19.601 49.686  1.00 34.15 ? 781  PHE A CA    1 
ATOM   4282 C C     . PHE C 3 485 ? 8.294   20.686 48.813  1.00 34.55 ? 781  PHE A C     1 
ATOM   4283 O O     . PHE C 3 485 ? 7.635   21.654 48.409  1.00 34.10 ? 781  PHE A O     1 
ATOM   4284 C CB    . PHE C 3 485 ? 8.200   19.802 51.097  1.00 32.41 ? 781  PHE A CB    1 
ATOM   4285 C CG    . PHE C 3 485 ? 7.968   21.180 51.610  1.00 30.47 ? 781  PHE A CG    1 
ATOM   4286 C CD1   . PHE C 3 485 ? 6.696   21.580 51.989  1.00 30.03 ? 781  PHE A CD1   1 
ATOM   4287 C CD2   . PHE C 3 485 ? 9.001   22.100 51.652  1.00 29.99 ? 781  PHE A CD2   1 
ATOM   4288 C CE1   . PHE C 3 485 ? 6.452   22.880 52.397  1.00 29.99 ? 781  PHE A CE1   1 
ATOM   4289 C CE2   . PHE C 3 485 ? 8.770   23.413 52.061  1.00 28.86 ? 781  PHE A CE2   1 
ATOM   4290 C CZ    . PHE C 3 485 ? 7.496   23.804 52.433  1.00 29.01 ? 781  PHE A CZ    1 
ATOM   4291 N N     . ASN C 3 486 ? 9.582   20.532 48.550  1.00 35.08 ? 782  ASN A N     1 
ATOM   4292 C CA    . ASN C 3 486 ? 10.304  21.508 47.759  1.00 35.42 ? 782  ASN A CA    1 
ATOM   4293 C C     . ASN C 3 486 ? 9.786   21.600 46.343  1.00 35.00 ? 782  ASN A C     1 
ATOM   4294 O O     . ASN C 3 486 ? 9.457   22.689 45.874  1.00 36.35 ? 782  ASN A O     1 
ATOM   4295 C CB    . ASN C 3 486 ? 11.787  21.163 47.747  1.00 35.82 ? 782  ASN A CB    1 
ATOM   4296 C CG    . ASN C 3 486 ? 12.467  21.575 49.021  1.00 37.21 ? 782  ASN A CG    1 
ATOM   4297 O OD1   . ASN C 3 486 ? 12.070  22.560 49.663  1.00 37.93 ? 782  ASN A OD1   1 
ATOM   4298 N ND2   . ASN C 3 486 ? 13.492  20.827 49.410  1.00 38.25 ? 782  ASN A ND2   1 
ATOM   4299 N N     . VAL C 3 487 ? 9.719   20.455 45.670  1.00 33.49 ? 783  VAL A N     1 
ATOM   4300 C CA    . VAL C 3 487 ? 9.249   20.403 44.293  1.00 31.53 ? 783  VAL A CA    1 
ATOM   4301 C C     . VAL C 3 487 ? 7.863   21.003 44.189  1.00 29.95 ? 783  VAL A C     1 
ATOM   4302 O O     . VAL C 3 487 ? 7.618   21.825 43.317  1.00 29.69 ? 783  VAL A O     1 
ATOM   4303 C CB    . VAL C 3 487 ? 9.234   18.955 43.758  1.00 30.75 ? 783  VAL A CB    1 
ATOM   4304 C CG1   . VAL C 3 487 ? 8.316   18.854 42.583  1.00 31.55 ? 783  VAL A CG1   1 
ATOM   4305 C CG2   . VAL C 3 487 ? 10.631  18.539 43.343  1.00 30.35 ? 783  VAL A CG2   1 
ATOM   4306 N N     . ARG C 3 488 ? 6.963   20.611 45.083  1.00 29.00 ? 784  ARG A N     1 
ATOM   4307 C CA    . ARG C 3 488 ? 5.613   21.138 45.053  1.00 28.99 ? 784  ARG A CA    1 
ATOM   4308 C C     . ARG C 3 488 ? 5.645   22.655 45.316  1.00 30.24 ? 784  ARG A C     1 
ATOM   4309 O O     . ARG C 3 488 ? 4.927   23.427 44.662  1.00 29.27 ? 784  ARG A O     1 
ATOM   4310 C CB    . ARG C 3 488 ? 4.729   20.439 46.095  1.00 27.67 ? 784  ARG A CB    1 
ATOM   4311 C CG    . ARG C 3 488 ? 3.308   20.987 46.129  1.00 29.11 ? 784  ARG A CG    1 
ATOM   4312 C CD    . ARG C 3 488 ? 2.372   20.290 47.118  1.00 30.14 ? 784  ARG A CD    1 
ATOM   4313 N NE    . ARG C 3 488 ? 2.795   20.472 48.499  1.00 32.61 ? 784  ARG A NE    1 
ATOM   4314 C CZ    . ARG C 3 488 ? 3.484   19.567 49.201  1.00 33.88 ? 784  ARG A CZ    1 
ATOM   4315 N NH1   . ARG C 3 488 ? 3.834   18.399 48.662  1.00 32.57 ? 784  ARG A NH1   1 
ATOM   4316 N NH2   . ARG C 3 488 ? 3.855   19.847 50.445  1.00 33.65 ? 784  ARG A NH2   1 
ATOM   4317 N N     . SER C 3 489 ? 6.490   23.078 46.262  1.00 31.02 ? 785  SER A N     1 
ATOM   4318 C CA    . SER C 3 489 ? 6.612   24.491 46.630  1.00 31.92 ? 785  SER A CA    1 
ATOM   4319 C C     . SER C 3 489 ? 7.021   25.418 45.477  1.00 31.92 ? 785  SER A C     1 
ATOM   4320 O O     . SER C 3 489 ? 6.469   26.505 45.309  1.00 31.73 ? 785  SER A O     1 
ATOM   4321 C CB    . SER C 3 489 ? 7.590   24.619 47.787  1.00 32.71 ? 785  SER A CB    1 
ATOM   4322 O OG    . SER C 3 489 ? 7.043   23.960 48.922  1.00 34.74 ? 785  SER A OG    1 
ATOM   4323 N N     . PHE C 3 490 ? 7.987   24.991 44.682  1.00 31.85 ? 786  PHE A N     1 
ATOM   4324 C CA    . PHE C 3 490 ? 8.388   25.791 43.550  1.00 32.13 ? 786  PHE A CA    1 
ATOM   4325 C C     . PHE C 3 490 ? 7.212   26.007 42.577  1.00 31.56 ? 786  PHE A C     1 
ATOM   4326 O O     . PHE C 3 490 ? 6.939   27.136 42.154  1.00 31.01 ? 786  PHE A O     1 
ATOM   4327 C CB    . PHE C 3 490 ? 9.530   25.126 42.810  1.00 34.14 ? 786  PHE A CB    1 
ATOM   4328 C CG    . PHE C 3 490 ? 10.176  26.025 41.818  1.00 37.43 ? 786  PHE A CG    1 
ATOM   4329 C CD1   . PHE C 3 490 ? 9.722   27.334 41.669  1.00 38.89 ? 786  PHE A CD1   1 
ATOM   4330 C CD2   . PHE C 3 490 ? 11.247  25.599 41.062  1.00 38.96 ? 786  PHE A CD2   1 
ATOM   4331 C CE1   . PHE C 3 490 ? 10.320  28.203 40.793  1.00 38.24 ? 786  PHE A CE1   1 
ATOM   4332 C CE2   . PHE C 3 490 ? 11.857  26.468 40.176  1.00 39.95 ? 786  PHE A CE2   1 
ATOM   4333 C CZ    . PHE C 3 490 ? 11.386  27.777 40.046  1.00 39.10 ? 786  PHE A CZ    1 
ATOM   4334 N N     . ALA C 3 491 ? 6.524   24.914 42.235  1.00 30.01 ? 787  ALA A N     1 
ATOM   4335 C CA    . ALA C 3 491 ? 5.386   24.955 41.326  1.00 28.11 ? 787  ALA A CA    1 
ATOM   4336 C C     . ALA C 3 491 ? 4.309   25.916 41.838  1.00 27.54 ? 787  ALA A C     1 
ATOM   4337 O O     . ALA C 3 491 ? 3.626   26.590 41.049  1.00 25.73 ? 787  ALA A O     1 
ATOM   4338 C CB    . ALA C 3 491 ? 4.803   23.543 41.158  1.00 26.70 ? 787  ALA A CB    1 
ATOM   4339 N N     . GLU C 3 492 ? 4.142   25.969 43.159  1.00 26.37 ? 788  GLU A N     1 
ATOM   4340 C CA    . GLU C 3 492 ? 3.144   26.854 43.754  1.00 26.07 ? 788  GLU A CA    1 
ATOM   4341 C C     . GLU C 3 492 ? 3.568   28.305 43.589  1.00 24.70 ? 788  GLU A C     1 
ATOM   4342 O O     . GLU C 3 492 ? 2.728   29.182 43.442  1.00 25.02 ? 788  GLU A O     1 
ATOM   4343 C CB    . GLU C 3 492 ? 2.973   26.557 45.239  1.00 26.77 ? 788  GLU A CB    1 
ATOM   4344 C CG    . GLU C 3 492 ? 1.878   25.567 45.564  1.00 28.03 ? 788  GLU A CG    1 
ATOM   4345 C CD    . GLU C 3 492 ? 2.136   24.856 46.893  1.00 29.66 ? 788  GLU A CD    1 
ATOM   4346 O OE1   . GLU C 3 492 ? 3.129   25.216 47.576  1.00 29.10 ? 788  GLU A OE1   1 
ATOM   4347 O OE2   . GLU C 3 492 ? 1.350   23.943 47.247  1.00 29.65 ? 788  GLU A OE2   1 
ATOM   4348 N N     . ARG C 3 493 ? 4.874   28.540 43.633  1.00 24.29 ? 789  ARG A N     1 
ATOM   4349 C CA    . ARG C 3 493 ? 5.427   29.879 43.470  1.00 25.44 ? 789  ARG A CA    1 
ATOM   4350 C C     . ARG C 3 493 ? 5.313   30.313 41.989  1.00 25.56 ? 789  ARG A C     1 
ATOM   4351 O O     . ARG C 3 493 ? 5.138   31.495 41.704  1.00 24.93 ? 789  ARG A O     1 
ATOM   4352 C CB    . ARG C 3 493 ? 6.889   29.891 43.932  1.00 26.46 ? 789  ARG A CB    1 
ATOM   4353 C CG    . ARG C 3 493 ? 7.068   30.281 45.418  1.00 28.89 ? 789  ARG A CG    1 
ATOM   4354 C CD    . ARG C 3 493 ? 8.532   30.287 45.825  1.00 29.43 ? 789  ARG A CD    1 
ATOM   4355 N NE    . ARG C 3 493 ? 8.960   28.939 46.155  1.00 32.48 ? 789  ARG A NE    1 
ATOM   4356 C CZ    . ARG C 3 493 ? 10.035  28.348 45.648  1.00 33.78 ? 789  ARG A CZ    1 
ATOM   4357 N NH1   . ARG C 3 493 ? 10.805  28.989 44.777  1.00 33.60 ? 789  ARG A NH1   1 
ATOM   4358 N NH2   . ARG C 3 493 ? 10.328  27.102 46.005  1.00 34.43 ? 789  ARG A NH2   1 
ATOM   4359 N N     . MET C 3 494 ? 5.410   29.342 41.068  1.00 25.36 ? 790  MET A N     1 
ATOM   4360 C CA    . MET C 3 494 ? 5.274   29.569 39.621  1.00 24.10 ? 790  MET A CA    1 
ATOM   4361 C C     . MET C 3 494 ? 3.797   29.877 39.337  1.00 22.83 ? 790  MET A C     1 
ATOM   4362 O O     . MET C 3 494 ? 3.476   30.695 38.483  1.00 22.79 ? 790  MET A O     1 
ATOM   4363 C CB    . MET C 3 494 ? 5.711   28.319 38.828  1.00 25.49 ? 790  MET A CB    1 
ATOM   4364 C CG    . MET C 3 494 ? 7.226   28.065 38.769  1.00 28.25 ? 790  MET A CG    1 
ATOM   4365 S SD    . MET C 3 494 ? 7.729   26.587 37.752  1.00 34.40 ? 790  MET A SD    1 
ATOM   4366 C CE    . MET C 3 494 ? 9.371   26.155 38.448  1.00 33.06 ? 790  MET A CE    1 
ATOM   4367 N N     . ALA C 3 495 ? 2.894   29.234 40.070  1.00 20.96 ? 791  ALA A N     1 
ATOM   4368 C CA    . ALA C 3 495 ? 1.467   29.461 39.895  1.00 20.60 ? 791  ALA A CA    1 
ATOM   4369 C C     . ALA C 3 495 ? 1.102   30.898 40.260  1.00 20.93 ? 791  ALA A C     1 
ATOM   4370 O O     . ALA C 3 495 ? 0.252   31.534 39.615  1.00 19.40 ? 791  ALA A O     1 
ATOM   4371 C CB    . ALA C 3 495 ? 0.674   28.497 40.773  1.00 19.57 ? 791  ALA A CB    1 
ATOM   4372 N N     . MET C 3 496 ? 1.734   31.381 41.330  1.00 21.59 ? 792  MET A N     1 
ATOM   4373 C CA    . MET C 3 496 ? 1.504   32.730 41.830  1.00 22.99 ? 792  MET A CA    1 
ATOM   4374 C C     . MET C 3 496 ? 2.145   33.773 40.912  1.00 22.13 ? 792  MET A C     1 
ATOM   4375 O O     . MET C 3 496 ? 1.493   34.738 40.511  1.00 22.52 ? 792  MET A O     1 
ATOM   4376 C CB    . MET C 3 496 ? 2.093   32.878 43.247  1.00 24.24 ? 792  MET A CB    1 
ATOM   4377 C CG    . MET C 3 496 ? 1.682   31.798 44.234  1.00 27.68 ? 792  MET A CG    1 
ATOM   4378 S SD    . MET C 3 496 ? 2.356   31.995 45.969  1.00 30.81 ? 792  MET A SD    1 
ATOM   4379 C CE    . MET C 3 496 ? 3.887   31.063 45.840  1.00 30.99 ? 792  MET A CE    1 
ATOM   4380 N N     . ASN C 3 497 ? 3.411   33.531 40.571  1.00 21.42 ? 793  ASN A N     1 
ATOM   4381 C CA    . ASN C 3 497 ? 4.233   34.432 39.765  1.00 21.84 ? 793  ASN A CA    1 
ATOM   4382 C C     . ASN C 3 497 ? 4.032   34.508 38.261  1.00 21.61 ? 793  ASN A C     1 
ATOM   4383 O O     . ASN C 3 497 ? 4.204   35.583 37.657  1.00 20.53 ? 793  ASN A O     1 
ATOM   4384 C CB    . ASN C 3 497 ? 5.707   34.126 39.989  1.00 21.60 ? 793  ASN A CB    1 
ATOM   4385 C CG    . ASN C 3 497 ? 6.609   35.127 39.305  1.00 23.40 ? 793  ASN A CG    1 
ATOM   4386 O OD1   . ASN C 3 497 ? 7.237   34.841 38.274  1.00 22.77 ? 793  ASN A OD1   1 
ATOM   4387 N ND2   . ASN C 3 497 ? 6.685   36.322 39.882  1.00 25.22 ? 793  ASN A ND2   1 
ATOM   4388 N N     . THR C 3 498 ? 3.698   33.380 37.644  1.00 20.66 ? 794  THR A N     1 
ATOM   4389 C CA    . THR C 3 498 ? 3.543   33.386 36.197  1.00 19.72 ? 794  THR A CA    1 
ATOM   4390 C C     . THR C 3 498 ? 2.464   34.347 35.726  1.00 18.77 ? 794  THR A C     1 
ATOM   4391 O O     . THR C 3 498 ? 2.673   35.095 34.791  1.00 19.84 ? 794  THR A O     1 
ATOM   4392 C CB    . THR C 3 498 ? 3.323   31.959 35.664  1.00 18.64 ? 794  THR A CB    1 
ATOM   4393 O OG1   . THR C 3 498 ? 4.538   31.220 35.849  1.00 18.45 ? 794  THR A OG1   1 
ATOM   4394 C CG2   . THR C 3 498 ? 2.983   31.979 34.175  1.00 18.92 ? 794  THR A CG2   1 
ATOM   4395 N N     . PRO C 3 499 ? 1.284   34.318 36.338  1.00 17.68 ? 795  PRO A N     1 
ATOM   4396 C CA    . PRO C 3 499 ? 0.295   35.274 35.855  1.00 18.25 ? 795  PRO A CA    1 
ATOM   4397 C C     . PRO C 3 499 ? 0.788   36.731 35.998  1.00 19.43 ? 795  PRO A C     1 
ATOM   4398 O O     . PRO C 3 499 ? 0.302   37.643 35.293  1.00 19.83 ? 795  PRO A O     1 
ATOM   4399 C CB    . PRO C 3 499 ? -0.933  34.980 36.715  1.00 17.00 ? 795  PRO A CB    1 
ATOM   4400 C CG    . PRO C 3 499 ? -0.744  33.554 37.129  1.00 17.41 ? 795  PRO A CG    1 
ATOM   4401 C CD    . PRO C 3 499 ? 0.730   33.431 37.366  1.00 18.06 ? 795  PRO A CD    1 
ATOM   4402 N N     . ILE C 3 500 ? 1.751   36.962 36.895  1.00 19.05 ? 796  ILE A N     1 
ATOM   4403 C CA    . ILE C 3 500 ? 2.252   38.326 37.081  1.00 18.66 ? 796  ILE A CA    1 
ATOM   4404 C C     . ILE C 3 500 ? 3.298   38.698 36.019  1.00 17.86 ? 796  ILE A C     1 
ATOM   4405 O O     . ILE C 3 500 ? 3.087   39.645 35.245  1.00 16.63 ? 796  ILE A O     1 
ATOM   4406 C CB    . ILE C 3 500 ? 2.845   38.538 38.520  1.00 18.58 ? 796  ILE A CB    1 
ATOM   4407 C CG1   . ILE C 3 500 ? 1.724   38.458 39.574  1.00 17.93 ? 796  ILE A CG1   1 
ATOM   4408 C CG2   . ILE C 3 500 ? 3.555   39.910 38.608  1.00 17.94 ? 796  ILE A CG2   1 
ATOM   4409 C CD1   . ILE C 3 500 ? 2.244   38.446 41.007  1.00 17.83 ? 796  ILE A CD1   1 
ATOM   4410 N N     . GLN C 3 501 ? 4.407   37.960 35.980  1.00 17.42 ? 797  GLN A N     1 
ATOM   4411 C CA    . GLN C 3 501 ? 5.484   38.217 35.005  1.00 19.25 ? 797  GLN A CA    1 
ATOM   4412 C C     . GLN C 3 501 ? 4.961   38.010 33.550  1.00 18.29 ? 797  GLN A C     1 
ATOM   4413 O O     . GLN C 3 501 ? 5.328   38.759 32.632  1.00 16.57 ? 797  GLN A O     1 
ATOM   4414 C CB    . GLN C 3 501 ? 6.692   37.286 35.287  1.00 20.76 ? 797  GLN A CB    1 
ATOM   4415 C CG    . GLN C 3 501 ? 8.044   37.744 34.656  1.00 25.31 ? 797  GLN A CG    1 
ATOM   4416 C CD    . GLN C 3 501 ? 9.173   36.653 34.682  1.00 28.12 ? 797  GLN A CD    1 
ATOM   4417 O OE1   . GLN C 3 501 ? 9.426   35.956 33.686  1.00 26.68 ? 797  GLN A OE1   1 
ATOM   4418 N NE2   . GLN C 3 501 ? 9.856   36.526 35.833  1.00 30.33 ? 797  GLN A NE2   1 
ATOM   4419 N N     . GLY C 3 502 ? 4.094   37.002 33.386  1.00 17.13 ? 798  GLY A N     1 
ATOM   4420 C CA    . GLY C 3 502 ? 3.509   36.669 32.095  1.00 16.56 ? 798  GLY A CA    1 
ATOM   4421 C C     . GLY C 3 502 ? 2.530   37.704 31.562  1.00 15.72 ? 798  GLY A C     1 
ATOM   4422 O O     . GLY C 3 502 ? 2.496   37.961 30.355  1.00 14.79 ? 798  GLY A O     1 
ATOM   4423 N N     . SER C 3 503 ? 1.717   38.284 32.445  1.00 14.56 ? 799  SER A N     1 
ATOM   4424 C CA    . SER C 3 503 ? 0.776   39.304 32.024  1.00 13.76 ? 799  SER A CA    1 
ATOM   4425 C C     . SER C 3 503 ? 1.545   40.595 31.712  1.00 14.30 ? 799  SER A C     1 
ATOM   4426 O O     . SER C 3 503 ? 1.163   41.351 30.809  1.00 14.73 ? 799  SER A O     1 
ATOM   4427 C CB    . SER C 3 503 ? -0.240  39.556 33.106  1.00 12.89 ? 799  SER A CB    1 
ATOM   4428 O OG    . SER C 3 503 ? -1.223  38.554 33.090  1.00 13.70 ? 799  SER A OG    1 
ATOM   4429 N N     . ALA C 3 504 ? 2.625   40.857 32.442  1.00 14.01 ? 800  ALA A N     1 
ATOM   4430 C CA    . ALA C 3 504 ? 3.422   42.046 32.159  1.00 15.40 ? 800  ALA A CA    1 
ATOM   4431 C C     . ALA C 3 504 ? 4.111   41.854 30.778  1.00 16.31 ? 800  ALA A C     1 
ATOM   4432 O O     . ALA C 3 504 ? 4.285   42.825 30.023  1.00 15.81 ? 800  ALA A O     1 
ATOM   4433 C CB    . ALA C 3 504 ? 4.465   42.276 33.261  1.00 14.87 ? 800  ALA A CB    1 
ATOM   4434 N N     . ALA C 3 505 ? 4.479   40.606 30.448  1.00 14.47 ? 801  ALA A N     1 
ATOM   4435 C CA    . ALA C 3 505 ? 5.096   40.314 29.157  1.00 14.73 ? 801  ALA A CA    1 
ATOM   4436 C C     . ALA C 3 505 ? 4.065   40.558 28.053  1.00 14.68 ? 801  ALA A C     1 
ATOM   4437 O O     . ALA C 3 505 ? 4.384   41.124 26.995  1.00 15.87 ? 801  ALA A O     1 
ATOM   4438 C CB    . ALA C 3 505 ? 5.589   38.853 29.110  1.00 13.82 ? 801  ALA A CB    1 
ATOM   4439 N N     . ASP C 3 506 ? 2.833   40.122 28.305  1.00 14.00 ? 802  ASP A N     1 
ATOM   4440 C CA    . ASP C 3 506 ? 1.737   40.284 27.363  1.00 13.91 ? 802  ASP A CA    1 
ATOM   4441 C C     . ASP C 3 506 ? 1.542   41.780 27.083  1.00 15.37 ? 802  ASP A C     1 
ATOM   4442 O O     . ASP C 3 506 ? 1.471   42.198 25.922  1.00 15.46 ? 802  ASP A O     1 
ATOM   4443 C CB    . ASP C 3 506 ? 0.412   39.752 27.938  1.00 14.02 ? 802  ASP A CB    1 
ATOM   4444 C CG    . ASP C 3 506 ? 0.375   38.233 28.114  1.00 13.55 ? 802  ASP A CG    1 
ATOM   4445 O OD1   . ASP C 3 506 ? 1.262   37.520 27.614  1.00 12.78 ? 802  ASP A OD1   1 
ATOM   4446 O OD2   . ASP C 3 506 ? -0.577  37.766 28.770  1.00 14.37 ? 802  ASP A OD2   1 
ATOM   4447 N N     . ILE C 3 507 ? 1.454   42.572 28.154  1.00 13.19 ? 803  ILE A N     1 
ATOM   4448 C CA    . ILE C 3 507 ? 1.219   43.988 28.029  1.00 12.81 ? 803  ILE A CA    1 
ATOM   4449 C C     . ILE C 3 507 ? 2.256   44.726 27.194  1.00 12.91 ? 803  ILE A C     1 
ATOM   4450 O O     . ILE C 3 507 ? 1.885   45.505 26.313  1.00 12.88 ? 803  ILE A O     1 
ATOM   4451 C CB    . ILE C 3 507 ? 1.104   44.675 29.426  1.00 12.98 ? 803  ILE A CB    1 
ATOM   4452 C CG1   . ILE C 3 507 ? -0.153  44.170 30.161  1.00 12.32 ? 803  ILE A CG1   1 
ATOM   4453 C CG2   . ILE C 3 507 ? 0.997   46.213 29.240  1.00 10.65 ? 803  ILE A CG2   1 
ATOM   4454 C CD1   . ILE C 3 507 ? -0.155  44.395 31.692  1.00 10.71 ? 803  ILE A CD1   1 
ATOM   4455 N N     . ILE C 3 508 ? 3.539   44.501 27.459  1.00 12.15 ? 804  ILE A N     1 
ATOM   4456 C CA    . ILE C 3 508 ? 4.577   45.211 26.725  1.00 13.11 ? 804  ILE A CA    1 
ATOM   4457 C C     . ILE C 3 508 ? 4.652   44.754 25.244  1.00 14.57 ? 804  ILE A C     1 
ATOM   4458 O O     . ILE C 3 508 ? 5.016   45.550 24.364  1.00 13.63 ? 804  ILE A O     1 
ATOM   4459 C CB    . ILE C 3 508 ? 5.986   45.145 27.477  1.00 12.05 ? 804  ILE A CB    1 
ATOM   4460 C CG1   . ILE C 3 508 ? 7.002   46.067 26.775  1.00 11.78 ? 804  ILE A CG1   1 
ATOM   4461 C CG2   . ILE C 3 508 ? 6.491   43.697 27.605  1.00 11.32 ? 804  ILE A CG2   1 
ATOM   4462 C CD1   . ILE C 3 508 ? 8.207   46.456 27.597  1.00 10.18 ? 804  ILE A CD1   1 
ATOM   4463 N N     . LYS C 3 509 ? 4.268   43.502 24.963  1.00 14.51 ? 805  LYS A N     1 
ATOM   4464 C CA    . LYS C 3 509 ? 4.275   42.999 23.569  1.00 15.19 ? 805  LYS A CA    1 
ATOM   4465 C C     . LYS C 3 509 ? 3.171   43.711 22.793  1.00 14.57 ? 805  LYS A C     1 
ATOM   4466 O O     . LYS C 3 509 ? 3.387   44.153 21.666  1.00 15.61 ? 805  LYS A O     1 
ATOM   4467 C CB    . LYS C 3 509 ? 4.050   41.467 23.512  1.00 14.47 ? 805  LYS A CB    1 
ATOM   4468 C CG    . LYS C 3 509 ? 5.289   40.650 23.864  1.00 13.83 ? 805  LYS A CG    1 
ATOM   4469 C CD    . LYS C 3 509 ? 4.981   39.151 23.905  1.00 13.87 ? 805  LYS A CD    1 
ATOM   4470 C CE    . LYS C 3 509 ? 6.260   38.334 23.973  1.00 13.64 ? 805  LYS A CE    1 
ATOM   4471 N NZ    . LYS C 3 509 ? 5.978   36.853 24.051  1.00 16.21 ? 805  LYS A NZ    1 
ATOM   4472 N N     . LYS C 3 510 ? 1.992   43.829 23.394  1.00 13.53 ? 806  LYS A N     1 
ATOM   4473 C CA    . LYS C 3 510 ? 0.908   44.513 22.734  1.00 14.29 ? 806  LYS A CA    1 
ATOM   4474 C C     . LYS C 3 510 ? 1.266   45.995 22.550  1.00 15.20 ? 806  LYS A C     1 
ATOM   4475 O O     . LYS C 3 510 ? 0.911   46.595 21.546  1.00 15.61 ? 806  LYS A O     1 
ATOM   4476 C CB    . LYS C 3 510 ? -0.381  44.383 23.537  1.00 13.71 ? 806  LYS A CB    1 
ATOM   4477 C CG    . LYS C 3 510 ? -1.502  45.216 22.959  1.00 15.80 ? 806  LYS A CG    1 
ATOM   4478 C CD    . LYS C 3 510 ? -2.848  44.748 23.429  1.00 17.60 ? 806  LYS A CD    1 
ATOM   4479 C CE    . LYS C 3 510 ? -3.972  45.479 22.698  1.00 19.77 ? 806  LYS A CE    1 
ATOM   4480 N NZ    . LYS C 3 510 ? -3.915  46.973 22.898  1.00 20.28 ? 806  LYS A NZ    1 
ATOM   4481 N N     . ALA C 3 511 ? 1.973   46.582 23.513  1.00 14.90 ? 807  ALA A N     1 
ATOM   4482 C CA    . ALA C 3 511 ? 2.375   47.992 23.412  1.00 14.54 ? 807  ALA A CA    1 
ATOM   4483 C C     . ALA C 3 511 ? 3.289   48.192 22.183  1.00 14.38 ? 807  ALA A C     1 
ATOM   4484 O O     . ALA C 3 511 ? 3.176   49.198 21.465  1.00 13.46 ? 807  ALA A O     1 
ATOM   4485 C CB    . ALA C 3 511 ? 3.126   48.436 24.694  1.00 13.12 ? 807  ALA A CB    1 
ATOM   4486 N N     . MET C 3 512 ? 4.210   47.249 21.977  1.00 13.90 ? 808  MET A N     1 
ATOM   4487 C CA    . MET C 3 512 ? 5.130   47.307 20.849  1.00 14.20 ? 808  MET A CA    1 
ATOM   4488 C C     . MET C 3 512 ? 4.353   47.339 19.528  1.00 14.35 ? 808  MET A C     1 
ATOM   4489 O O     . MET C 3 512 ? 4.685   48.122 18.627  1.00 13.86 ? 808  MET A O     1 
ATOM   4490 C CB    . MET C 3 512 ? 6.074   46.111 20.875  1.00 13.62 ? 808  MET A CB    1 
ATOM   4491 C CG    . MET C 3 512 ? 7.094   46.202 21.980  1.00 14.45 ? 808  MET A CG    1 
ATOM   4492 S SD    . MET C 3 512 ? 8.046   44.687 22.176  1.00 15.38 ? 808  MET A SD    1 
ATOM   4493 C CE    . MET C 3 512 ? 9.314   44.812 20.873  1.00 12.63 ? 808  MET A CE    1 
ATOM   4494 N N     . ILE C 3 513 ? 3.329   46.491 19.431  1.00 14.46 ? 809  ILE A N     1 
ATOM   4495 C CA    . ILE C 3 513 ? 2.471   46.426 18.248  1.00 16.05 ? 809  ILE A CA    1 
ATOM   4496 C C     . ILE C 3 513 ? 1.707   47.748 18.084  1.00 15.99 ? 809  ILE A C     1 
ATOM   4497 O O     . ILE C 3 513 ? 1.667   48.340 16.995  1.00 14.90 ? 809  ILE A O     1 
ATOM   4498 C CB    . ILE C 3 513 ? 1.449   45.235 18.346  1.00 15.50 ? 809  ILE A CB    1 
ATOM   4499 C CG1   . ILE C 3 513 ? 2.180   43.893 18.171  1.00 15.56 ? 809  ILE A CG1   1 
ATOM   4500 C CG2   . ILE C 3 513 ? 0.388   45.360 17.268  1.00 15.31 ? 809  ILE A CG2   1 
ATOM   4501 C CD1   . ILE C 3 513 ? 1.443   42.703 18.810  1.00 14.76 ? 809  ILE A CD1   1 
ATOM   4502 N N     . ASP C 3 514 ? 1.107   48.215 19.175  1.00 15.70 ? 810  ASP A N     1 
ATOM   4503 C CA    . ASP C 3 514 ? 0.360   49.463 19.132  1.00 16.40 ? 810  ASP A CA    1 
ATOM   4504 C C     . ASP C 3 514 ? 1.277   50.618 18.770  1.00 15.84 ? 810  ASP A C     1 
ATOM   4505 O O     . ASP C 3 514 ? 0.890   51.484 18.010  1.00 16.25 ? 810  ASP A O     1 
ATOM   4506 C CB    . ASP C 3 514 ? -0.293  49.751 20.480  1.00 16.84 ? 810  ASP A CB    1 
ATOM   4507 C CG    . ASP C 3 514 ? -1.421  48.811 20.787  1.00 18.31 ? 810  ASP A CG    1 
ATOM   4508 O OD1   . ASP C 3 514 ? -1.887  48.099 19.883  1.00 19.03 ? 810  ASP A OD1   1 
ATOM   4509 O OD2   . ASP C 3 514 ? -1.852  48.776 21.948  1.00 21.15 ? 810  ASP A OD2   1 
ATOM   4510 N N     . LEU C 3 515 ? 2.488   50.622 19.312  1.00 15.80 ? 811  LEU A N     1 
ATOM   4511 C CA    . LEU C 3 515 ? 3.445   51.688 19.038  1.00 16.25 ? 811  LEU A CA    1 
ATOM   4512 C C     . LEU C 3 515 ? 3.837   51.763 17.572  1.00 17.00 ? 811  LEU A C     1 
ATOM   4513 O O     . LEU C 3 515 ? 3.859   52.850 16.972  1.00 16.94 ? 811  LEU A O     1 
ATOM   4514 C CB    . LEU C 3 515 ? 4.708   51.496 19.859  1.00 15.51 ? 811  LEU A CB    1 
ATOM   4515 C CG    . LEU C 3 515 ? 5.809   52.532 19.626  1.00 17.30 ? 811  LEU A CG    1 
ATOM   4516 C CD1   . LEU C 3 515 ? 5.299   53.919 20.030  1.00 16.87 ? 811  LEU A CD1   1 
ATOM   4517 C CD2   . LEU C 3 515 ? 7.060   52.162 20.410  1.00 16.95 ? 811  LEU A CD2   1 
ATOM   4518 N N     . ASN C 3 516 ? 4.171   50.615 16.993  1.00 16.51 ? 812  ASN A N     1 
ATOM   4519 C CA    . ASN C 3 516 ? 4.557   50.604 15.594  1.00 16.89 ? 812  ASN A CA    1 
ATOM   4520 C C     . ASN C 3 516 ? 3.405   51.044 14.710  1.00 16.23 ? 812  ASN A C     1 
ATOM   4521 O O     . ASN C 3 516 ? 3.619   51.656 13.671  1.00 17.90 ? 812  ASN A O     1 
ATOM   4522 C CB    . ASN C 3 516 ? 5.060   49.225 15.194  1.00 17.54 ? 812  ASN A CB    1 
ATOM   4523 C CG    . ASN C 3 516 ? 6.563   49.123 15.294  1.00 21.04 ? 812  ASN A CG    1 
ATOM   4524 O OD1   . ASN C 3 516 ? 7.200   48.439 14.497  1.00 23.06 ? 812  ASN A OD1   1 
ATOM   4525 N ND2   . ASN C 3 516 ? 7.150   49.809 16.283  1.00 22.17 ? 812  ASN A ND2   1 
ATOM   4526 N N     . ALA C 3 517 ? 2.179   50.756 15.108  1.00 15.44 ? 813  ALA A N     1 
ATOM   4527 C CA    . ALA C 3 517 ? 1.072   51.185 14.300  1.00 15.51 ? 813  ALA A CA    1 
ATOM   4528 C C     . ALA C 3 517 ? 0.982   52.722 14.371  1.00 17.41 ? 813  ALA A C     1 
ATOM   4529 O O     . ALA C 3 517 ? 0.698   53.371 13.366  1.00 16.66 ? 813  ALA A O     1 
ATOM   4530 C CB    . ALA C 3 517 ? -0.219  50.535 14.771  1.00 13.94 ? 813  ALA A CB    1 
ATOM   4531 N N     . ARG C 3 518 ? 1.247   53.308 15.540  1.00 16.85 ? 814  ARG A N     1 
ATOM   4532 C CA    . ARG C 3 518 ? 1.191   54.769 15.676  1.00 18.65 ? 814  ARG A CA    1 
ATOM   4533 C C     . ARG C 3 518 ? 2.335   55.487 14.940  1.00 17.14 ? 814  ARG A C     1 
ATOM   4534 O O     . ARG C 3 518 ? 2.128   56.538 14.331  1.00 16.46 ? 814  ARG A O     1 
ATOM   4535 C CB    . ARG C 3 518 ? 1.230   55.181 17.157  1.00 19.17 ? 814  ARG A CB    1 
ATOM   4536 C CG    . ARG C 3 518 ? 0.170   54.538 18.003  1.00 23.40 ? 814  ARG A CG    1 
ATOM   4537 C CD    . ARG C 3 518 ? -1.187  55.125 17.700  1.00 27.89 ? 814  ARG A CD    1 
ATOM   4538 N NE    . ARG C 3 518 ? -1.047  56.543 17.441  1.00 30.87 ? 814  ARG A NE    1 
ATOM   4539 C CZ    . ARG C 3 518 ? -1.250  57.490 18.347  1.00 33.61 ? 814  ARG A CZ    1 
ATOM   4540 N NH1   . ARG C 3 518 ? -1.613  57.158 19.589  1.00 34.43 ? 814  ARG A NH1   1 
ATOM   4541 N NH2   . ARG C 3 518 ? -1.048  58.769 18.018  1.00 34.88 ? 814  ARG A NH2   1 
ATOM   4542 N N     . LEU C 3 519 ? 3.535   54.923 15.043  1.00 16.91 ? 815  LEU A N     1 
ATOM   4543 C CA    . LEU C 3 519 ? 4.737   55.461 14.412  1.00 18.48 ? 815  LEU A CA    1 
ATOM   4544 C C     . LEU C 3 519 ? 4.519   55.537 12.887  1.00 20.04 ? 815  LEU A C     1 
ATOM   4545 O O     . LEU C 3 519 ? 4.928   56.507 12.237  1.00 19.48 ? 815  LEU A O     1 
ATOM   4546 C CB    . LEU C 3 519 ? 5.937   54.559 14.723  1.00 18.10 ? 815  LEU A CB    1 
ATOM   4547 C CG    . LEU C 3 519 ? 7.091   54.980 15.651  1.00 19.73 ? 815  LEU A CG    1 
ATOM   4548 C CD1   . LEU C 3 519 ? 6.679   56.048 16.622  1.00 18.43 ? 815  LEU A CD1   1 
ATOM   4549 C CD2   . LEU C 3 519 ? 7.597   53.764 16.368  1.00 17.68 ? 815  LEU A CD2   1 
ATOM   4550 N N     . LYS C 3 520 ? 3.861   54.516 12.340  1.00 20.36 ? 816  LYS A N     1 
ATOM   4551 C CA    . LYS C 3 520 ? 3.553   54.432 10.911  1.00 22.73 ? 816  LYS A CA    1 
ATOM   4552 C C     . LYS C 3 520 ? 2.476   55.453 10.493  1.00 23.02 ? 816  LYS A C     1 
ATOM   4553 O O     . LYS C 3 520 ? 2.637   56.150 9.492   1.00 22.27 ? 816  LYS A O     1 
ATOM   4554 C CB    . LYS C 3 520 ? 3.075   53.022 10.574  1.00 23.47 ? 816  LYS A CB    1 
ATOM   4555 C CG    . LYS C 3 520 ? 3.520   52.515 9.230   1.00 27.68 ? 816  LYS A CG    1 
ATOM   4556 C CD    . LYS C 3 520 ? 2.474   51.560 8.644   1.00 30.38 ? 816  LYS A CD    1 
ATOM   4557 C CE    . LYS C 3 520 ? 2.872   51.065 7.256   1.00 31.80 ? 816  LYS A CE    1 
ATOM   4558 N NZ    . LYS C 3 520 ? 4.303   50.668 7.236   1.00 34.23 ? 816  LYS A NZ    1 
ATOM   4559 N N     . GLU C 3 521 ? 1.380   55.527 11.251  1.00 23.29 ? 817  GLU A N     1 
ATOM   4560 C CA    . GLU C 3 521 ? 0.316   56.476 10.964  1.00 24.07 ? 817  GLU A CA    1 
ATOM   4561 C C     . GLU C 3 521 ? 0.905   57.888 10.951  1.00 24.00 ? 817  GLU A C     1 
ATOM   4562 O O     . GLU C 3 521 ? 0.482   58.741 10.166  1.00 24.50 ? 817  GLU A O     1 
ATOM   4563 C CB    . GLU C 3 521 ? -0.746  56.455 12.053  1.00 25.70 ? 817  GLU A CB    1 
ATOM   4564 C CG    . GLU C 3 521 ? -1.689  55.296 12.083  1.00 29.01 ? 817  GLU A CG    1 
ATOM   4565 C CD    . GLU C 3 521 ? -2.300  55.114 13.490  1.00 32.20 ? 817  GLU A CD    1 
ATOM   4566 O OE1   . GLU C 3 521 ? -2.440  56.111 14.250  1.00 32.05 ? 817  GLU A OE1   1 
ATOM   4567 O OE2   . GLU C 3 521 ? -2.637  53.962 13.851  1.00 35.21 ? 817  GLU A OE2   1 
ATOM   4568 N N     . GLU C 3 522 ? 1.857   58.135 11.852  1.00 22.94 ? 818  GLU A N     1 
ATOM   4569 C CA    . GLU C 3 522 ? 2.502   59.444 11.986  1.00 23.02 ? 818  GLU A CA    1 
ATOM   4570 C C     . GLU C 3 522 ? 3.670   59.648 11.019  1.00 22.75 ? 818  GLU A C     1 
ATOM   4571 O O     . GLU C 3 522 ? 4.209   60.745 10.913  1.00 23.29 ? 818  GLU A O     1 
ATOM   4572 C CB    . GLU C 3 522 ? 3.019   59.639 13.426  1.00 22.53 ? 818  GLU A CB    1 
ATOM   4573 C CG    . GLU C 3 522 ? 1.951   59.659 14.478  1.00 22.88 ? 818  GLU A CG    1 
ATOM   4574 C CD    . GLU C 3 522 ? 0.886   60.697 14.218  1.00 25.31 ? 818  GLU A CD    1 
ATOM   4575 O OE1   . GLU C 3 522 ? 1.224   61.838 13.821  1.00 27.55 ? 818  GLU A OE1   1 
ATOM   4576 O OE2   . GLU C 3 522 ? -0.308  60.377 14.408  1.00 26.38 ? 818  GLU A OE2   1 
ATOM   4577 N N     . ARG C 3 523 ? 4.043   58.590 10.310  1.00 21.90 ? 819  ARG A N     1 
ATOM   4578 C CA    . ARG C 3 523 ? 5.159   58.629 9.388   1.00 21.64 ? 819  ARG A CA    1 
ATOM   4579 C C     . ARG C 3 523 ? 6.391   59.159 10.097  1.00 21.49 ? 819  ARG A C     1 
ATOM   4580 O O     . ARG C 3 523 ? 7.203   59.891 9.520   1.00 21.17 ? 819  ARG A O     1 
ATOM   4581 C CB    . ARG C 3 523 ? 4.835   59.481 8.143   1.00 23.66 ? 819  ARG A CB    1 
ATOM   4582 C CG    . ARG C 3 523 ? 3.948   58.774 7.113   1.00 22.63 ? 819  ARG A CG    1 
ATOM   4583 C CD    . ARG C 3 523 ? 2.511   58.939 7.479   1.00 21.72 ? 819  ARG A CD    1 
ATOM   4584 N NE    . ARG C 3 523 ? 1.618   58.712 6.353   1.00 22.51 ? 819  ARG A NE    1 
ATOM   4585 C CZ    . ARG C 3 523 ? 0.906   57.598 6.167   1.00 23.99 ? 819  ARG A CZ    1 
ATOM   4586 N NH1   . ARG C 3 523 ? 0.986   56.600 7.046   1.00 23.76 ? 819  ARG A NH1   1 
ATOM   4587 N NH2   . ARG C 3 523 ? 0.081   57.491 5.123   1.00 22.35 ? 819  ARG A NH2   1 
ATOM   4588 N N     . LEU C 3 524 ? 6.539   58.779 11.364  1.00 20.21 ? 820  LEU A N     1 
ATOM   4589 C CA    . LEU C 3 524 ? 7.714   59.198 12.115  1.00 18.83 ? 820  LEU A CA    1 
ATOM   4590 C C     . LEU C 3 524 ? 8.864   58.307 11.674  1.00 18.26 ? 820  LEU A C     1 
ATOM   4591 O O     . LEU C 3 524 ? 8.639   57.158 11.308  1.00 19.13 ? 820  LEU A O     1 
ATOM   4592 C CB    . LEU C 3 524 ? 7.459   59.040 13.622  1.00 17.58 ? 820  LEU A CB    1 
ATOM   4593 C CG    . LEU C 3 524 ? 6.533   60.112 14.181  1.00 16.63 ? 820  LEU A CG    1 
ATOM   4594 C CD1   . LEU C 3 524 ? 5.961   59.681 15.488  1.00 17.96 ? 820  LEU A CD1   1 
ATOM   4595 C CD2   . LEU C 3 524 ? 7.318   61.374 14.374  1.00 16.49 ? 820  LEU A CD2   1 
ATOM   4596 N N     . GLN C 3 525 ? 10.081  58.839 11.679  1.00 17.49 ? 821  GLN A N     1 
ATOM   4597 C CA    . GLN C 3 525 ? 11.263  58.068 11.323  1.00 17.90 ? 821  GLN A CA    1 
ATOM   4598 C C     . GLN C 3 525 ? 11.762  57.230 12.520  1.00 17.78 ? 821  GLN A C     1 
ATOM   4599 O O     . GLN C 3 525 ? 12.639  56.381 12.374  1.00 16.53 ? 821  GLN A O     1 
ATOM   4600 C CB    . GLN C 3 525 ? 12.377  59.003 10.862  1.00 18.71 ? 821  GLN A CB    1 
ATOM   4601 C CG    . GLN C 3 525 ? 12.074  59.678 9.535   1.00 22.63 ? 821  GLN A CG    1 
ATOM   4602 C CD    . GLN C 3 525 ? 13.260  60.442 8.959   1.00 25.15 ? 821  GLN A CD    1 
ATOM   4603 O OE1   . GLN C 3 525 ? 13.191  61.662 8.782   1.00 29.77 ? 821  GLN A OE1   1 
ATOM   4604 N NE2   . GLN C 3 525 ? 14.348  59.736 8.657   1.00 26.34 ? 821  GLN A NE2   1 
ATOM   4605 N N     . ALA C 3 526 ? 11.191  57.495 13.695  1.00 17.24 ? 822  ALA A N     1 
ATOM   4606 C CA    . ALA C 3 526 ? 11.538  56.809 14.937  1.00 16.84 ? 822  ALA A CA    1 
ATOM   4607 C C     . ALA C 3 526 ? 11.199  55.324 14.838  1.00 15.68 ? 822  ALA A C     1 
ATOM   4608 O O     . ALA C 3 526 ? 10.156  54.944 14.288  1.00 14.36 ? 822  ALA A O     1 
ATOM   4609 C CB    . ALA C 3 526 ? 10.755  57.420 16.100  1.00 15.98 ? 822  ALA A CB    1 
ATOM   4610 N N     . HIS C 3 527 ? 12.077  54.493 15.386  1.00 16.23 ? 823  HIS A N     1 
ATOM   4611 C CA    . HIS C 3 527 ? 11.821  53.060 15.389  1.00 15.64 ? 823  HIS A CA    1 
ATOM   4612 C C     . HIS C 3 527 ? 12.405  52.365 16.604  1.00 15.01 ? 823  HIS A C     1 
ATOM   4613 O O     . HIS C 3 527 ? 13.376  52.839 17.197  1.00 14.52 ? 823  HIS A O     1 
ATOM   4614 C CB    . HIS C 3 527 ? 12.390  52.408 14.116  1.00 16.22 ? 823  HIS A CB    1 
ATOM   4615 C CG    . HIS C 3 527 ? 13.852  52.655 13.904  1.00 17.79 ? 823  HIS A CG    1 
ATOM   4616 N ND1   . HIS C 3 527 ? 14.330  53.457 12.886  1.00 18.73 ? 823  HIS A ND1   1 
ATOM   4617 C CD2   . HIS C 3 527 ? 14.941  52.191 14.559  1.00 17.76 ? 823  HIS A CD2   1 
ATOM   4618 C CE1   . HIS C 3 527 ? 15.651  53.476 12.922  1.00 18.23 ? 823  HIS A CE1   1 
ATOM   4619 N NE2   . HIS C 3 527 ? 16.048  52.718 13.929  1.00 19.11 ? 823  HIS A NE2   1 
ATOM   4620 N N     . LEU C 3 528 ? 11.795  51.233 16.952  1.00 14.41 ? 824  LEU A N     1 
ATOM   4621 C CA    . LEU C 3 528 ? 12.247  50.385 18.053  1.00 15.08 ? 824  LEU A CA    1 
ATOM   4622 C C     . LEU C 3 528 ? 13.619  49.779 17.759  1.00 14.88 ? 824  LEU A C     1 
ATOM   4623 O O     . LEU C 3 528 ? 13.909  49.379 16.627  1.00 16.56 ? 824  LEU A O     1 
ATOM   4624 C CB    . LEU C 3 528 ? 11.277  49.234 18.263  1.00 14.20 ? 824  LEU A CB    1 
ATOM   4625 C CG    . LEU C 3 528 ? 9.990   49.571 18.982  1.00 14.46 ? 824  LEU A CG    1 
ATOM   4626 C CD1   . LEU C 3 528 ? 8.931   48.487 18.707  1.00 14.91 ? 824  LEU A CD1   1 
ATOM   4627 C CD2   . LEU C 3 528 ? 10.303  49.741 20.462  1.00 13.82 ? 824  LEU A CD2   1 
ATOM   4628 N N     . LEU C 3 529 ? 14.457  49.714 18.784  1.00 14.51 ? 825  LEU A N     1 
ATOM   4629 C CA    . LEU C 3 529 ? 15.782  49.113 18.690  1.00 14.61 ? 825  LEU A CA    1 
ATOM   4630 C C     . LEU C 3 529 ? 15.806  47.884 19.613  1.00 16.51 ? 825  LEU A C     1 
ATOM   4631 O O     . LEU C 3 529 ? 16.253  46.792 19.207  1.00 15.62 ? 825  LEU A O     1 
ATOM   4632 C CB    . LEU C 3 529 ? 16.859  50.080 19.173  1.00 14.83 ? 825  LEU A CB    1 
ATOM   4633 C CG    . LEU C 3 529 ? 17.247  51.223 18.246  1.00 13.90 ? 825  LEU A CG    1 
ATOM   4634 C CD1   . LEU C 3 529 ? 18.411  51.954 18.868  1.00 14.13 ? 825  LEU A CD1   1 
ATOM   4635 C CD2   . LEU C 3 529 ? 17.610  50.671 16.847  1.00 14.59 ? 825  LEU A CD2   1 
ATOM   4636 N N     . LEU C 3 530 ? 15.307  48.070 20.845  1.00 16.40 ? 826  LEU A N     1 
ATOM   4637 C CA    . LEU C 3 530 ? 15.318  47.004 21.840  1.00 17.03 ? 826  LEU A CA    1 
ATOM   4638 C C     . LEU C 3 530 ? 14.137  46.969 22.773  1.00 16.34 ? 826  LEU A C     1 
ATOM   4639 O O     . LEU C 3 530 ? 13.414  47.945 22.923  1.00 16.45 ? 826  LEU A O     1 
ATOM   4640 C CB    . LEU C 3 530 ? 16.565  47.117 22.720  1.00 17.88 ? 826  LEU A CB    1 
ATOM   4641 C CG    . LEU C 3 530 ? 17.961  47.160 22.097  1.00 19.71 ? 826  LEU A CG    1 
ATOM   4642 C CD1   . LEU C 3 530 ? 19.000  47.455 23.173  1.00 19.55 ? 826  LEU A CD1   1 
ATOM   4643 C CD2   . LEU C 3 530 ? 18.272  45.812 21.445  1.00 20.57 ? 826  LEU A CD2   1 
ATOM   4644 N N     . GLN C 3 531 ? 13.946  45.812 23.397  1.00 15.64 ? 827  GLN A N     1 
ATOM   4645 C CA    . GLN C 3 531 ? 12.923  45.658 24.419  1.00 15.64 ? 827  GLN A CA    1 
ATOM   4646 C C     . GLN C 3 531 ? 13.647  44.964 25.577  1.00 16.42 ? 827  GLN A C     1 
ATOM   4647 O O     . GLN C 3 531 ? 14.317  43.945 25.359  1.00 16.82 ? 827  GLN A O     1 
ATOM   4648 C CB    . GLN C 3 531 ? 11.768  44.760 23.964  1.00 14.95 ? 827  GLN A CB    1 
ATOM   4649 C CG    . GLN C 3 531 ? 10.624  44.665 25.002  1.00 15.36 ? 827  GLN A CG    1 
ATOM   4650 C CD    . GLN C 3 531 ? 10.452  43.255 25.602  1.00 15.89 ? 827  GLN A CD    1 
ATOM   4651 O OE1   . GLN C 3 531 ? 9.356   42.681 25.581  1.00 17.44 ? 827  GLN A OE1   1 
ATOM   4652 N NE2   . GLN C 3 531 ? 11.530  42.705 26.130  1.00 14.51 ? 827  GLN A NE2   1 
ATOM   4653 N N     . VAL C 3 532 ? 13.602  45.510 26.789  1.00 15.94 ? 828  VAL A N     1 
ATOM   4654 C CA    . VAL C 3 532 ? 14.224  44.744 27.858  1.00 16.06 ? 828  VAL A CA    1 
ATOM   4655 C C     . VAL C 3 532 ? 13.251  44.536 29.038  1.00 16.49 ? 828  VAL A C     1 
ATOM   4656 O O     . VAL C 3 532 ? 13.273  45.186 30.094  1.00 17.07 ? 828  VAL A O     1 
ATOM   4657 C CB    . VAL C 3 532 ? 15.714  45.235 28.176  1.00 16.34 ? 828  VAL A CB    1 
ATOM   4658 C CG1   . VAL C 3 532 ? 16.011  46.519 27.486  1.00 16.07 ? 828  VAL A CG1   1 
ATOM   4659 C CG2   . VAL C 3 532 ? 16.022  45.225 29.637  1.00 16.35 ? 828  VAL A CG2   1 
ATOM   4660 N N     . HIS C 3 533 ? 12.322  43.623 28.742  1.00 16.28 ? 829  HIS A N     1 
ATOM   4661 C CA    . HIS C 3 533 ? 11.260  43.144 29.632  1.00 15.94 ? 829  HIS A CA    1 
ATOM   4662 C C     . HIS C 3 533 ? 10.176  44.131 30.026  1.00 15.96 ? 829  HIS A C     1 
ATOM   4663 O O     . HIS C 3 533 ? 8.980   43.866 29.819  1.00 15.40 ? 829  HIS A O     1 
ATOM   4664 C CB    . HIS C 3 533 ? 11.891  42.477 30.876  1.00 14.83 ? 829  HIS A CB    1 
ATOM   4665 C CG    . HIS C 3 533 ? 13.059  41.590 30.552  1.00 13.58 ? 829  HIS A CG    1 
ATOM   4666 N ND1   . HIS C 3 533 ? 12.955  40.507 29.708  1.00 13.28 ? 829  HIS A ND1   1 
ATOM   4667 C CD2   . HIS C 3 533 ? 14.357  41.647 30.931  1.00 14.01 ? 829  HIS A CD2   1 
ATOM   4668 C CE1   . HIS C 3 533 ? 14.137  39.938 29.578  1.00 13.47 ? 829  HIS A CE1   1 
ATOM   4669 N NE2   . HIS C 3 533 ? 15.007  40.611 30.310  1.00 14.74 ? 829  HIS A NE2   1 
ATOM   4670 N N     . ASP C 3 534 ? 10.567  45.272 30.583  1.00 16.70 ? 830  ASP A N     1 
ATOM   4671 C CA    . ASP C 3 534 ? 9.569   46.271 30.971  1.00 17.70 ? 830  ASP A CA    1 
ATOM   4672 C C     . ASP C 3 534 ? 9.887   47.652 30.409  1.00 17.89 ? 830  ASP A C     1 
ATOM   4673 O O     . ASP C 3 534 ? 9.294   48.647 30.816  1.00 16.83 ? 830  ASP A O     1 
ATOM   4674 C CB    . ASP C 3 534 ? 9.459   46.356 32.493  1.00 18.76 ? 830  ASP A CB    1 
ATOM   4675 C CG    . ASP C 3 534 ? 10.710  46.938 33.146  1.00 20.72 ? 830  ASP A CG    1 
ATOM   4676 O OD1   . ASP C 3 534 ? 11.811  46.916 32.544  1.00 19.62 ? 830  ASP A OD1   1 
ATOM   4677 O OD2   . ASP C 3 534 ? 10.581  47.426 34.293  1.00 23.54 ? 830  ASP A OD2   1 
ATOM   4678 N N     . GLU C 3 535 ? 10.837  47.703 29.481  1.00 17.51 ? 831  GLU A N     1 
ATOM   4679 C CA    . GLU C 3 535 ? 11.216  48.967 28.858  1.00 17.87 ? 831  GLU A CA    1 
ATOM   4680 C C     . GLU C 3 535 ? 11.402  48.804 27.349  1.00 17.29 ? 831  GLU A C     1 
ATOM   4681 O O     . GLU C 3 535 ? 11.720  47.710 26.861  1.00 17.59 ? 831  GLU A O     1 
ATOM   4682 C CB    . GLU C 3 535 ? 12.500  49.520 29.484  1.00 17.49 ? 831  GLU A CB    1 
ATOM   4683 C CG    . GLU C 3 535 ? 13.691  48.638 29.322  1.00 20.34 ? 831  GLU A CG    1 
ATOM   4684 C CD    . GLU C 3 535 ? 14.860  49.089 30.164  1.00 23.02 ? 831  GLU A CD    1 
ATOM   4685 O OE1   . GLU C 3 535 ? 14.627  49.645 31.260  1.00 26.31 ? 831  GLU A OE1   1 
ATOM   4686 O OE2   . GLU C 3 535 ? 16.019  48.892 29.744  1.00 24.86 ? 831  GLU A OE2   1 
ATOM   4687 N N     . LEU C 3 536 ? 11.178  49.902 26.628  1.00 16.65 ? 832  LEU A N     1 
ATOM   4688 C CA    . LEU C 3 536 ? 11.329  49.951 25.181  1.00 15.74 ? 832  LEU A CA    1 
ATOM   4689 C C     . LEU C 3 536 ? 12.380  51.013 24.842  1.00 16.77 ? 832  LEU A C     1 
ATOM   4690 O O     . LEU C 3 536 ? 12.340  52.137 25.358  1.00 17.40 ? 832  LEU A O     1 
ATOM   4691 C CB    . LEU C 3 536 ? 9.991   50.305 24.533  1.00 14.20 ? 832  LEU A CB    1 
ATOM   4692 C CG    . LEU C 3 536 ? 8.873   49.272 24.671  1.00 13.12 ? 832  LEU A CG    1 
ATOM   4693 C CD1   . LEU C 3 536 ? 7.643   49.719 23.873  1.00 11.64 ? 832  LEU A CD1   1 
ATOM   4694 C CD2   . LEU C 3 536 ? 9.402   47.899 24.190  1.00 13.24 ? 832  LEU A CD2   1 
ATOM   4695 N N     . ILE C 3 537 ? 13.331  50.659 23.986  1.00 16.50 ? 833  ILE A N     1 
ATOM   4696 C CA    . ILE C 3 537 ? 14.370  51.596 23.608  1.00 16.32 ? 833  ILE A CA    1 
ATOM   4697 C C     . ILE C 3 537 ? 14.291  51.880 22.112  1.00 17.00 ? 833  ILE A C     1 
ATOM   4698 O O     . ILE C 3 537 ? 14.236  50.952 21.297  1.00 16.04 ? 833  ILE A O     1 
ATOM   4699 C CB    . ILE C 3 537 ? 15.748  51.040 23.964  1.00 16.93 ? 833  ILE A CB    1 
ATOM   4700 C CG1   . ILE C 3 537 ? 15.858  50.926 25.490  1.00 17.89 ? 833  ILE A CG1   1 
ATOM   4701 C CG2   . ILE C 3 537 ? 16.843  51.946 23.459  1.00 16.08 ? 833  ILE A CG2   1 
ATOM   4702 C CD1   . ILE C 3 537 ? 16.433  49.646 25.887  1.00 20.85 ? 833  ILE A CD1   1 
ATOM   4703 N N     . LEU C 3 538 ? 14.228  53.160 21.753  1.00 16.11 ? 834  LEU A N     1 
ATOM   4704 C CA    . LEU C 3 538 ? 14.179  53.521 20.347  1.00 16.36 ? 834  LEU A CA    1 
ATOM   4705 C C     . LEU C 3 538 ? 15.244  54.557 20.023  1.00 16.57 ? 834  LEU A C     1 
ATOM   4706 O O     . LEU C 3 538 ? 16.029  54.967 20.898  1.00 15.02 ? 834  LEU A O     1 
ATOM   4707 C CB    . LEU C 3 538 ? 12.795  54.062 19.913  1.00 16.01 ? 834  LEU A CB    1 
ATOM   4708 C CG    . LEU C 3 538 ? 11.465  54.260 20.655  1.00 15.87 ? 834  LEU A CG    1 
ATOM   4709 C CD1   . LEU C 3 538 ? 10.364  54.317 19.639  1.00 15.62 ? 834  LEU A CD1   1 
ATOM   4710 C CD2   . LEU C 3 538 ? 11.179  53.184 21.672  1.00 15.78 ? 834  LEU A CD2   1 
ATOM   4711 N N     . GLU C 3 539 ? 15.321  54.912 18.738  1.00 16.17 ? 835  GLU A N     1 
ATOM   4712 C CA    . GLU C 3 539 ? 16.225  55.958 18.283  1.00 15.54 ? 835  GLU A CA    1 
ATOM   4713 C C     . GLU C 3 539 ? 15.417  56.778 17.265  1.00 16.76 ? 835  GLU A C     1 
ATOM   4714 O O     . GLU C 3 539 ? 14.495  56.266 16.606  1.00 16.47 ? 835  GLU A O     1 
ATOM   4715 C CB    . GLU C 3 539 ? 17.502  55.398 17.668  1.00 14.69 ? 835  GLU A CB    1 
ATOM   4716 C CG    . GLU C 3 539 ? 17.305  54.615 16.379  1.00 13.72 ? 835  GLU A CG    1 
ATOM   4717 C CD    . GLU C 3 539 ? 18.610  54.219 15.744  1.00 14.30 ? 835  GLU A CD    1 
ATOM   4718 O OE1   . GLU C 3 539 ? 19.688  54.603 16.246  1.00 13.24 ? 835  GLU A OE1   1 
ATOM   4719 O OE2   . GLU C 3 539 ? 18.563  53.519 14.712  1.00 17.21 ? 835  GLU A OE2   1 
ATOM   4720 N N     . ALA C 3 540 ? 15.707  58.070 17.177  1.00 16.64 ? 836  ALA A N     1 
ATOM   4721 C CA    . ALA C 3 540 ? 14.973  58.894 16.242  1.00 15.98 ? 836  ALA A CA    1 
ATOM   4722 C C     . ALA C 3 540 ? 15.644  60.232 16.057  1.00 15.98 ? 836  ALA A C     1 
ATOM   4723 O O     . ALA C 3 540 ? 16.520  60.606 16.838  1.00 16.80 ? 836  ALA A O     1 
ATOM   4724 C CB    . ALA C 3 540 ? 13.577  59.093 16.739  1.00 15.16 ? 836  ALA A CB    1 
ATOM   4725 N N     . PRO C 3 541 ? 15.270  60.956 14.988  1.00 16.19 ? 837  PRO A N     1 
ATOM   4726 C CA    . PRO C 3 541 ? 15.833  62.284 14.704  1.00 16.34 ? 837  PRO A CA    1 
ATOM   4727 C C     . PRO C 3 541 ? 15.588  63.128 15.947  1.00 17.85 ? 837  PRO A C     1 
ATOM   4728 O O     . PRO C 3 541 ? 14.551  62.968 16.608  1.00 17.37 ? 837  PRO A O     1 
ATOM   4729 C CB    . PRO C 3 541 ? 14.995  62.788 13.539  1.00 15.12 ? 837  PRO A CB    1 
ATOM   4730 C CG    . PRO C 3 541 ? 14.545  61.538 12.832  1.00 16.02 ? 837  PRO A CG    1 
ATOM   4731 C CD    . PRO C 3 541 ? 14.326  60.516 13.948  1.00 15.72 ? 837  PRO A CD    1 
ATOM   4732 N N     . LYS C 3 542 ? 16.517  64.020 16.287  1.00 19.64 ? 838  LYS A N     1 
ATOM   4733 C CA    . LYS C 3 542 ? 16.300  64.858 17.467  1.00 20.78 ? 838  LYS A CA    1 
ATOM   4734 C C     . LYS C 3 542 ? 15.001  65.664 17.306  1.00 20.98 ? 838  LYS A C     1 
ATOM   4735 O O     . LYS C 3 542 ? 14.368  66.028 18.285  1.00 20.92 ? 838  LYS A O     1 
ATOM   4736 C CB    . LYS C 3 542 ? 17.493  65.790 17.696  1.00 21.97 ? 838  LYS A CB    1 
ATOM   4737 C CG    . LYS C 3 542 ? 17.810  66.733 16.542  1.00 24.36 ? 838  LYS A CG    1 
ATOM   4738 C CD    . LYS C 3 542 ? 19.260  67.243 16.626  1.00 26.95 ? 838  LYS A CD    1 
ATOM   4739 C CE    . LYS C 3 542 ? 19.491  68.500 15.761  1.00 29.10 ? 838  LYS A CE    1 
ATOM   4740 N NZ    . LYS C 3 542 ? 20.679  69.314 16.224  1.00 30.58 ? 838  LYS A NZ    1 
ATOM   4741 N N     . GLU C 3 543 ? 14.590  65.905 16.061  1.00 20.92 ? 839  GLU A N     1 
ATOM   4742 C CA    . GLU C 3 543 ? 13.373  66.663 15.785  1.00 20.60 ? 839  GLU A CA    1 
ATOM   4743 C C     . GLU C 3 543 ? 12.084  65.940 16.105  1.00 20.39 ? 839  GLU A C     1 
ATOM   4744 O O     . GLU C 3 543 ? 11.006  66.548 16.036  1.00 19.18 ? 839  GLU A O     1 
ATOM   4745 C CB    . GLU C 3 543 ? 13.316  67.084 14.322  1.00 22.88 ? 839  GLU A CB    1 
ATOM   4746 C CG    . GLU C 3 543 ? 14.374  68.068 13.967  1.00 26.21 ? 839  GLU A CG    1 
ATOM   4747 C CD    . GLU C 3 543 ? 15.696  67.389 13.679  1.00 29.37 ? 839  GLU A CD    1 
ATOM   4748 O OE1   . GLU C 3 543 ? 15.725  66.132 13.597  1.00 29.71 ? 839  GLU A OE1   1 
ATOM   4749 O OE2   . GLU C 3 543 ? 16.708  68.121 13.536  1.00 31.63 ? 839  GLU A OE2   1 
ATOM   4750 N N     . GLU C 3 544 ? 12.170  64.647 16.429  1.00 18.67 ? 840  GLU A N     1 
ATOM   4751 C CA    . GLU C 3 544 ? 10.963  63.892 16.760  1.00 17.75 ? 840  GLU A CA    1 
ATOM   4752 C C     . GLU C 3 544 ? 10.812  63.649 18.270  1.00 16.73 ? 840  GLU A C     1 
ATOM   4753 O O     . GLU C 3 544 ? 9.820   63.062 18.694  1.00 16.77 ? 840  GLU A O     1 
ATOM   4754 C CB    . GLU C 3 544 ? 10.966  62.536 16.041  1.00 17.70 ? 840  GLU A CB    1 
ATOM   4755 C CG    . GLU C 3 544 ? 10.867  62.637 14.556  1.00 17.22 ? 840  GLU A CG    1 
ATOM   4756 C CD    . GLU C 3 544 ? 10.745  61.291 13.886  1.00 18.75 ? 840  GLU A CD    1 
ATOM   4757 O OE1   . GLU C 3 544 ? 10.886  60.249 14.576  1.00 17.45 ? 840  GLU A OE1   1 
ATOM   4758 O OE2   . GLU C 3 544 ? 10.508  61.280 12.656  1.00 18.14 ? 840  GLU A OE2   1 
ATOM   4759 N N     . MET C 3 545 ? 11.791  64.081 19.066  1.00 16.15 ? 841  MET A N     1 
ATOM   4760 C CA    . MET C 3 545 ? 11.733  63.874 20.521  1.00 16.66 ? 841  MET A CA    1 
ATOM   4761 C C     . MET C 3 545 ? 10.450  64.371 21.193  1.00 16.34 ? 841  MET A C     1 
ATOM   4762 O O     . MET C 3 545 ? 9.792   63.641 21.923  1.00 15.71 ? 841  MET A O     1 
ATOM   4763 C CB    . MET C 3 545 ? 12.943  64.513 21.209  1.00 16.07 ? 841  MET A CB    1 
ATOM   4764 C CG    . MET C 3 545 ? 14.278  63.837 20.955  1.00 17.07 ? 841  MET A CG    1 
ATOM   4765 S SD    . MET C 3 545 ? 14.390  62.061 21.390  1.00 19.70 ? 841  MET A SD    1 
ATOM   4766 C CE    . MET C 3 545 ? 14.417  61.363 19.721  1.00 18.92 ? 841  MET A CE    1 
ATOM   4767 N N     . GLU C 3 546 ? 10.077  65.617 20.947  1.00 17.13 ? 842  GLU A N     1 
ATOM   4768 C CA    . GLU C 3 546 ? 8.880   66.140 21.573  1.00 17.41 ? 842  GLU A CA    1 
ATOM   4769 C C     . GLU C 3 546 ? 7.647   65.304 21.257  1.00 18.56 ? 842  GLU A C     1 
ATOM   4770 O O     . GLU C 3 546 ? 6.814   65.067 22.141  1.00 18.28 ? 842  GLU A O     1 
ATOM   4771 C CB    . GLU C 3 546 ? 8.674   67.606 21.170  1.00 16.11 ? 842  GLU A CB    1 
ATOM   4772 C CG    . GLU C 3 546 ? 9.788   68.471 21.705  1.00 16.28 ? 842  GLU A CG    1 
ATOM   4773 C CD    . GLU C 3 546 ? 9.456   69.941 21.657  1.00 18.35 ? 842  GLU A CD    1 
ATOM   4774 O OE1   . GLU C 3 546 ? 8.670   70.406 22.502  1.00 18.29 ? 842  GLU A OE1   1 
ATOM   4775 O OE2   . GLU C 3 546 ? 9.984   70.635 20.765  1.00 19.37 ? 842  GLU A OE2   1 
ATOM   4776 N N     . ARG C 3 547 ? 7.505   64.854 20.011  1.00 18.70 ? 843  ARG A N     1 
ATOM   4777 C CA    . ARG C 3 547 ? 6.333   64.049 19.672  1.00 19.03 ? 843  ARG A CA    1 
ATOM   4778 C C     . ARG C 3 547 ? 6.415   62.706 20.383  1.00 18.26 ? 843  ARG A C     1 
ATOM   4779 O O     . ARG C 3 547 ? 5.415   62.176 20.848  1.00 18.13 ? 843  ARG A O     1 
ATOM   4780 C CB    . ARG C 3 547 ? 6.253   63.840 18.169  1.00 21.41 ? 843  ARG A CB    1 
ATOM   4781 C CG    . ARG C 3 547 ? 5.998   65.136 17.435  1.00 25.45 ? 843  ARG A CG    1 
ATOM   4782 C CD    . ARG C 3 547 ? 4.905   64.978 16.422  1.00 28.51 ? 843  ARG A CD    1 
ATOM   4783 N NE    . ARG C 3 547 ? 5.477   64.861 15.090  1.00 32.39 ? 843  ARG A NE    1 
ATOM   4784 C CZ    . ARG C 3 547 ? 4.957   64.134 14.103  1.00 33.49 ? 843  ARG A CZ    1 
ATOM   4785 N NH1   . ARG C 3 547 ? 3.827   63.442 14.287  1.00 33.96 ? 843  ARG A NH1   1 
ATOM   4786 N NH2   . ARG C 3 547 ? 5.575   64.109 12.923  1.00 33.35 ? 843  ARG A NH2   1 
ATOM   4787 N N     . LEU C 3 548 ? 7.623   62.168 20.466  1.00 18.16 ? 844  LEU A N     1 
ATOM   4788 C CA    . LEU C 3 548 ? 7.853   60.882 21.126  1.00 18.16 ? 844  LEU A CA    1 
ATOM   4789 C C     . LEU C 3 548 ? 7.562   60.948 22.630  1.00 18.45 ? 844  LEU A C     1 
ATOM   4790 O O     . LEU C 3 548 ? 6.995   60.015 23.208  1.00 17.32 ? 844  LEU A O     1 
ATOM   4791 C CB    . LEU C 3 548 ? 9.300   60.461 20.895  1.00 17.68 ? 844  LEU A CB    1 
ATOM   4792 C CG    . LEU C 3 548 ? 9.567   59.311 19.922  1.00 18.01 ? 844  LEU A CG    1 
ATOM   4793 C CD1   . LEU C 3 548 ? 8.467   59.152 18.864  1.00 16.88 ? 844  LEU A CD1   1 
ATOM   4794 C CD2   . LEU C 3 548 ? 10.913  59.550 19.319  1.00 18.81 ? 844  LEU A CD2   1 
ATOM   4795 N N     . CYS C 3 549 ? 7.961   62.061 23.252  1.00 18.57 ? 845  CYS A N     1 
ATOM   4796 C CA    . CYS C 3 549 ? 7.750   62.272 24.682  1.00 19.04 ? 845  CYS A CA    1 
ATOM   4797 C C     . CYS C 3 549 ? 6.285   62.117 24.986  1.00 19.51 ? 845  CYS A C     1 
ATOM   4798 O O     . CYS C 3 549 ? 5.914   61.640 26.057  1.00 20.75 ? 845  CYS A O     1 
ATOM   4799 C CB    . CYS C 3 549 ? 8.206   63.675 25.105  1.00 17.51 ? 845  CYS A CB    1 
ATOM   4800 S SG    . CYS C 3 549 ? 9.948   63.790 25.343  1.00 19.51 ? 845  CYS A SG    1 
ATOM   4801 N N     . ARG C 3 550 ? 5.448   62.524 24.039  1.00 19.50 ? 846  ARG A N     1 
ATOM   4802 C CA    . ARG C 3 550 ? 4.013   62.420 24.204  1.00 19.17 ? 846  ARG A CA    1 
ATOM   4803 C C     . ARG C 3 550 ? 3.445   61.098 23.690  1.00 18.86 ? 846  ARG A C     1 
ATOM   4804 O O     . ARG C 3 550 ? 2.590   60.499 24.326  1.00 18.69 ? 846  ARG A O     1 
ATOM   4805 C CB    . ARG C 3 550 ? 3.310   63.567 23.472  1.00 20.71 ? 846  ARG A CB    1 
ATOM   4806 C CG    . ARG C 3 550 ? 2.965   64.750 24.364  1.00 23.08 ? 846  ARG A CG    1 
ATOM   4807 C CD    . ARG C 3 550 ? 2.356   65.924 23.586  1.00 23.49 ? 846  ARG A CD    1 
ATOM   4808 N NE    . ARG C 3 550 ? 0.927   65.796 23.277  1.00 25.40 ? 846  ARG A NE    1 
ATOM   4809 C CZ    . ARG C 3 550 ? -0.063  66.016 24.144  1.00 27.29 ? 846  ARG A CZ    1 
ATOM   4810 N NH1   . ARG C 3 550 ? 0.209   66.369 25.396  1.00 28.40 ? 846  ARG A NH1   1 
ATOM   4811 N NH2   . ARG C 3 550 ? -1.332  65.958 23.750  1.00 27.37 ? 846  ARG A NH2   1 
ATOM   4812 N N     . LEU C 3 551 ? 3.917   60.636 22.542  1.00 18.03 ? 847  LEU A N     1 
ATOM   4813 C CA    . LEU C 3 551 ? 3.379   59.415 21.965  1.00 18.00 ? 847  LEU A CA    1 
ATOM   4814 C C     . LEU C 3 551 ? 3.768   58.094 22.643  1.00 16.57 ? 847  LEU A C     1 
ATOM   4815 O O     . LEU C 3 551 ? 2.909   57.271 22.940  1.00 16.97 ? 847  LEU A O     1 
ATOM   4816 C CB    . LEU C 3 551 ? 3.739   59.345 20.460  1.00 19.84 ? 847  LEU A CB    1 
ATOM   4817 C CG    . LEU C 3 551 ? 3.438   58.024 19.716  1.00 21.22 ? 847  LEU A CG    1 
ATOM   4818 C CD1   . LEU C 3 551 ? 1.953   57.924 19.458  1.00 21.60 ? 847  LEU A CD1   1 
ATOM   4819 C CD2   . LEU C 3 551 ? 4.180   57.966 18.402  1.00 21.71 ? 847  LEU A CD2   1 
ATOM   4820 N N     . VAL C 3 552 ? 5.048   57.890 22.886  1.00 15.33 ? 848  VAL A N     1 
ATOM   4821 C CA    . VAL C 3 552 ? 5.492   56.629 23.455  1.00 16.09 ? 848  VAL A CA    1 
ATOM   4822 C C     . VAL C 3 552 ? 4.843   56.225 24.797  1.00 16.92 ? 848  VAL A C     1 
ATOM   4823 O O     . VAL C 3 552 ? 4.211   55.171 24.878  1.00 15.49 ? 848  VAL A O     1 
ATOM   4824 C CB    . VAL C 3 552 ? 7.029   56.605 23.539  1.00 15.83 ? 848  VAL A CB    1 
ATOM   4825 C CG1   . VAL C 3 552 ? 7.503   55.264 24.090  1.00 15.71 ? 848  VAL A CG1   1 
ATOM   4826 C CG2   . VAL C 3 552 ? 7.631   56.844 22.126  1.00 14.89 ? 848  VAL A CG2   1 
ATOM   4827 N N     . PRO C 3 553 ? 4.942   57.076 25.849  1.00 17.78 ? 849  PRO A N     1 
ATOM   4828 C CA    . PRO C 3 553 ? 4.335   56.735 27.157  1.00 18.12 ? 849  PRO A CA    1 
ATOM   4829 C C     . PRO C 3 553 ? 2.844   56.440 27.064  1.00 17.83 ? 849  PRO A C     1 
ATOM   4830 O O     . PRO C 3 553 ? 2.342   55.488 27.653  1.00 18.38 ? 849  PRO A O     1 
ATOM   4831 C CB    . PRO C 3 553 ? 4.599   57.965 28.033  1.00 17.91 ? 849  PRO A CB    1 
ATOM   4832 C CG    . PRO C 3 553 ? 5.701   58.710 27.346  1.00 19.19 ? 849  PRO A CG    1 
ATOM   4833 C CD    . PRO C 3 553 ? 5.611   58.389 25.865  1.00 17.45 ? 849  PRO A CD    1 
ATOM   4834 N N     . GLU C 3 554 ? 2.139   57.261 26.303  1.00 17.88 ? 850  GLU A N     1 
ATOM   4835 C CA    . GLU C 3 554 ? 0.711   57.104 26.144  1.00 18.16 ? 850  GLU A CA    1 
ATOM   4836 C C     . GLU C 3 554 ? 0.333   55.761 25.523  1.00 18.26 ? 850  GLU A C     1 
ATOM   4837 O O     . GLU C 3 554 ? -0.599  55.098 25.989  1.00 16.83 ? 850  GLU A O     1 
ATOM   4838 C CB    . GLU C 3 554 ? 0.169   58.268 25.293  1.00 20.55 ? 850  GLU A CB    1 
ATOM   4839 C CG    . GLU C 3 554 ? -1.254  58.121 24.786  1.00 24.04 ? 850  GLU A CG    1 
ATOM   4840 C CD    . GLU C 3 554 ? -2.280  58.331 25.877  1.00 28.34 ? 850  GLU A CD    1 
ATOM   4841 O OE1   . GLU C 3 554 ? -1.886  58.709 27.015  1.00 30.91 ? 850  GLU A OE1   1 
ATOM   4842 O OE2   . GLU C 3 554 ? -3.485  58.117 25.605  1.00 30.97 ? 850  GLU A OE2   1 
ATOM   4843 N N     . VAL C 3 555 ? 1.035   55.358 24.462  1.00 17.57 ? 851  VAL A N     1 
ATOM   4844 C CA    . VAL C 3 555 ? 0.708   54.087 23.820  1.00 16.94 ? 851  VAL A CA    1 
ATOM   4845 C C     . VAL C 3 555 ? 1.012   52.935 24.790  1.00 15.92 ? 851  VAL A C     1 
ATOM   4846 O O     . VAL C 3 555 ? 0.218   51.994 24.922  1.00 16.01 ? 851  VAL A O     1 
ATOM   4847 C CB    . VAL C 3 555 ? 1.500   53.906 22.507  1.00 17.20 ? 851  VAL A CB    1 
ATOM   4848 C CG1   . VAL C 3 555 ? 1.357   52.504 22.011  1.00 16.86 ? 851  VAL A CG1   1 
ATOM   4849 C CG2   . VAL C 3 555 ? 0.972   54.870 21.459  1.00 17.37 ? 851  VAL A CG2   1 
ATOM   4850 N N     . MET C 3 556 ? 2.145   53.032 25.483  1.00 15.31 ? 852  MET A N     1 
ATOM   4851 C CA    . MET C 3 556 ? 2.532   52.000 26.443  1.00 15.93 ? 852  MET A CA    1 
ATOM   4852 C C     . MET C 3 556 ? 1.535   51.916 27.606  1.00 16.60 ? 852  MET A C     1 
ATOM   4853 O O     . MET C 3 556 ? 1.131   50.818 28.006  1.00 15.77 ? 852  MET A O     1 
ATOM   4854 C CB    . MET C 3 556 ? 3.952   52.254 26.966  1.00 14.91 ? 852  MET A CB    1 
ATOM   4855 C CG    . MET C 3 556 ? 5.030   52.247 25.885  1.00 14.37 ? 852  MET A CG    1 
ATOM   4856 S SD    . MET C 3 556 ? 6.625   52.296 26.590  1.00 16.80 ? 852  MET A SD    1 
ATOM   4857 C CE    . MET C 3 556 ? 7.651   52.785 25.401  1.00 21.42 ? 852  MET A CE    1 
ATOM   4858 N N     . GLU C 3 557 ? 1.122   53.076 28.127  1.00 16.94 ? 853  GLU A N     1 
ATOM   4859 C CA    . GLU C 3 557 ? 0.174   53.138 29.238  1.00 16.71 ? 853  GLU A CA    1 
ATOM   4860 C C     . GLU C 3 557 ? -1.205  52.651 28.861  1.00 17.58 ? 853  GLU A C     1 
ATOM   4861 O O     . GLU C 3 557 ? -1.893  52.032 29.679  1.00 18.40 ? 853  GLU A O     1 
ATOM   4862 C CB    . GLU C 3 557 ? 0.072   54.566 29.762  1.00 15.73 ? 853  GLU A CB    1 
ATOM   4863 C CG    . GLU C 3 557 ? 1.322   54.984 30.506  1.00 17.03 ? 853  GLU A CG    1 
ATOM   4864 C CD    . GLU C 3 557 ? 1.337   56.451 30.885  1.00 18.71 ? 853  GLU A CD    1 
ATOM   4865 O OE1   . GLU C 3 557 ? 0.424   57.196 30.451  1.00 17.71 ? 853  GLU A OE1   1 
ATOM   4866 O OE2   . GLU C 3 557 ? 2.277   56.842 31.625  1.00 19.69 ? 853  GLU A OE2   1 
ATOM   4867 N N     . GLN C 3 558 ? -1.602  52.888 27.609  1.00 17.02 ? 854  GLN A N     1 
ATOM   4868 C CA    . GLN C 3 558 ? -2.932  52.498 27.163  1.00 16.80 ? 854  GLN A CA    1 
ATOM   4869 C C     . GLN C 3 558 ? -3.037  51.142 26.518  1.00 16.00 ? 854  GLN A C     1 
ATOM   4870 O O     . GLN C 3 558 ? -4.120  50.759 26.136  1.00 15.97 ? 854  GLN A O     1 
ATOM   4871 C CB    . GLN C 3 558 ? -3.490  53.536 26.184  1.00 17.69 ? 854  GLN A CB    1 
ATOM   4872 C CG    . GLN C 3 558 ? -3.629  54.926 26.775  1.00 20.90 ? 854  GLN A CG    1 
ATOM   4873 C CD    . GLN C 3 558 ? -4.467  54.944 28.046  1.00 21.94 ? 854  GLN A CD    1 
ATOM   4874 O OE1   . GLN C 3 558 ? -4.036  55.461 29.086  1.00 25.40 ? 854  GLN A OE1   1 
ATOM   4875 N NE2   . GLN C 3 558 ? -5.665  54.384 27.972  1.00 21.36 ? 854  GLN A NE2   1 
ATOM   4876 N N     . ALA C 3 559 ? -1.935  50.418 26.394  1.00 17.12 ? 855  ALA A N     1 
ATOM   4877 C CA    . ALA C 3 559 ? -1.942  49.097 25.744  1.00 18.02 ? 855  ALA A CA    1 
ATOM   4878 C C     . ALA C 3 559 ? -3.038  48.146 26.250  1.00 19.87 ? 855  ALA A C     1 
ATOM   4879 O O     . ALA C 3 559 ? -3.625  47.381 25.474  1.00 19.33 ? 855  ALA A O     1 
ATOM   4880 C CB    . ALA C 3 559 ? -0.580  48.454 25.893  1.00 18.22 ? 855  ALA A CB    1 
ATOM   4881 N N     . VAL C 3 560 ? -3.298  48.184 27.555  1.00 20.42 ? 856  VAL A N     1 
ATOM   4882 C CA    . VAL C 3 560 ? -4.344  47.371 28.166  1.00 21.35 ? 856  VAL A CA    1 
ATOM   4883 C C     . VAL C 3 560 ? -4.995  48.235 29.246  1.00 21.31 ? 856  VAL A C     1 
ATOM   4884 O O     . VAL C 3 560 ? -4.367  49.163 29.752  1.00 22.44 ? 856  VAL A O     1 
ATOM   4885 C CB    . VAL C 3 560 ? -3.760  46.105 28.828  1.00 22.34 ? 856  VAL A CB    1 
ATOM   4886 C CG1   . VAL C 3 560 ? -4.855  45.368 29.538  1.00 24.63 ? 856  VAL A CG1   1 
ATOM   4887 C CG2   . VAL C 3 560 ? -3.126  45.189 27.779  1.00 22.28 ? 856  VAL A CG2   1 
ATOM   4888 N N     . THR C 3 561 ? -6.247  47.961 29.582  1.00 21.12 ? 857  THR A N     1 
ATOM   4889 C CA    . THR C 3 561 ? -6.930  48.713 30.639  1.00 22.01 ? 857  THR A CA    1 
ATOM   4890 C C     . THR C 3 561 ? -7.051  47.877 31.933  1.00 21.16 ? 857  THR A C     1 
ATOM   4891 O O     . THR C 3 561 ? -7.770  46.878 31.975  1.00 21.03 ? 857  THR A O     1 
ATOM   4892 C CB    . THR C 3 561 ? -8.331  49.163 30.176  1.00 22.99 ? 857  THR A CB    1 
ATOM   4893 O OG1   . THR C 3 561 ? -8.199  50.347 29.376  1.00 26.14 ? 857  THR A OG1   1 
ATOM   4894 C CG2   . THR C 3 561 ? -9.224  49.482 31.361  1.00 24.09 ? 857  THR A CG2   1 
ATOM   4895 N N     . LEU C 3 562 ? -6.318  48.278 32.972  1.00 20.99 ? 858  LEU A N     1 
ATOM   4896 C CA    . LEU C 3 562 ? -6.335  47.581 34.274  1.00 19.89 ? 858  LEU A CA    1 
ATOM   4897 C C     . LEU C 3 562 ? -7.111  48.384 35.336  1.00 20.86 ? 858  LEU A C     1 
ATOM   4898 O O     . LEU C 3 562 ? -7.448  49.562 35.128  1.00 21.18 ? 858  LEU A O     1 
ATOM   4899 C CB    . LEU C 3 562 ? -4.902  47.340 34.778  1.00 18.15 ? 858  LEU A CB    1 
ATOM   4900 C CG    . LEU C 3 562 ? -3.888  46.619 33.874  1.00 18.42 ? 858  LEU A CG    1 
ATOM   4901 C CD1   . LEU C 3 562 ? -2.556  46.417 34.609  1.00 18.32 ? 858  LEU A CD1   1 
ATOM   4902 C CD2   . LEU C 3 562 ? -4.439  45.282 33.446  1.00 17.76 ? 858  LEU A CD2   1 
ATOM   4903 N N     . ARG C 3 563 ? -7.379  47.739 36.471  1.00 20.19 ? 859  ARG A N     1 
ATOM   4904 C CA    . ARG C 3 563 ? -8.090  48.349 37.586  1.00 20.00 ? 859  ARG A CA    1 
ATOM   4905 C C     . ARG C 3 563 ? -7.291  49.498 38.205  1.00 19.59 ? 859  ARG A C     1 
ATOM   4906 O O     . ARG C 3 563 ? -7.808  50.265 39.009  1.00 19.25 ? 859  ARG A O     1 
ATOM   4907 C CB    . ARG C 3 563 ? -8.337  47.305 38.650  1.00 20.39 ? 859  ARG A CB    1 
ATOM   4908 C CG    . ARG C 3 563 ? -9.613  46.595 38.472  1.00 21.68 ? 859  ARG A CG    1 
ATOM   4909 C CD    . ARG C 3 563 ? -9.545  45.226 39.118  1.00 22.58 ? 859  ARG A CD    1 
ATOM   4910 N NE    . ARG C 3 563 ? -10.563 44.395 38.510  1.00 24.20 ? 859  ARG A NE    1 
ATOM   4911 C CZ    . ARG C 3 563 ? -10.345 43.182 38.023  1.00 24.42 ? 859  ARG A CZ    1 
ATOM   4912 N NH1   . ARG C 3 563 ? -9.138  42.631 38.071  1.00 24.18 ? 859  ARG A NH1   1 
ATOM   4913 N NH2   . ARG C 3 563 ? -11.340 42.547 37.436  1.00 25.91 ? 859  ARG A NH2   1 
ATOM   4914 N N     . VAL C 3 564 ? -6.015  49.574 37.860  1.00 19.33 ? 860  VAL A N     1 
ATOM   4915 C CA    . VAL C 3 564 ? -5.159  50.640 38.336  1.00 20.19 ? 860  VAL A CA    1 
ATOM   4916 C C     . VAL C 3 564 ? -4.492  51.235 37.102  1.00 20.55 ? 860  VAL A C     1 
ATOM   4917 O O     . VAL C 3 564 ? -4.477  50.610 36.047  1.00 21.04 ? 860  VAL A O     1 
ATOM   4918 C CB    . VAL C 3 564 ? -4.069  50.120 39.305  1.00 19.56 ? 860  VAL A CB    1 
ATOM   4919 C CG1   . VAL C 3 564 ? -4.738  49.460 40.496  1.00 17.82 ? 860  VAL A CG1   1 
ATOM   4920 C CG2   . VAL C 3 564 ? -3.144  49.134 38.592  1.00 19.14 ? 860  VAL A CG2   1 
ATOM   4921 N N     . PRO C 3 565 ? -3.978  52.464 37.201  1.00 19.98 ? 861  PRO A N     1 
ATOM   4922 C CA    . PRO C 3 565 ? -3.321  53.045 36.027  1.00 19.56 ? 861  PRO A CA    1 
ATOM   4923 C C     . PRO C 3 565 ? -1.966  52.396 35.743  1.00 18.64 ? 861  PRO A C     1 
ATOM   4924 O O     . PRO C 3 565 ? -1.359  51.777 36.627  1.00 18.08 ? 861  PRO A O     1 
ATOM   4925 C CB    . PRO C 3 565 ? -3.143  54.535 36.405  1.00 20.38 ? 861  PRO A CB    1 
ATOM   4926 C CG    . PRO C 3 565 ? -4.008  54.753 37.631  1.00 19.66 ? 861  PRO A CG    1 
ATOM   4927 C CD    . PRO C 3 565 ? -4.022  53.408 38.330  1.00 19.87 ? 861  PRO A CD    1 
ATOM   4928 N N     . LEU C 3 566 ? -1.503  52.531 34.500  1.00 17.38 ? 862  LEU A N     1 
ATOM   4929 C CA    . LEU C 3 566 ? -0.176  52.055 34.126  1.00 17.12 ? 862  LEU A CA    1 
ATOM   4930 C C     . LEU C 3 566 ? 0.593   53.375 33.991  1.00 16.58 ? 862  LEU A C     1 
ATOM   4931 O O     . LEU C 3 566 ? 0.042   54.372 33.541  1.00 17.50 ? 862  LEU A O     1 
ATOM   4932 C CB    . LEU C 3 566 ? -0.190  51.277 32.793  1.00 16.93 ? 862  LEU A CB    1 
ATOM   4933 C CG    . LEU C 3 566 ? -0.566  49.779 32.870  1.00 17.31 ? 862  LEU A CG    1 
ATOM   4934 C CD1   . LEU C 3 566 ? -0.484  49.142 31.487  1.00 16.27 ? 862  LEU A CD1   1 
ATOM   4935 C CD2   . LEU C 3 566 ? 0.369   49.052 33.860  1.00 16.65 ? 862  LEU A CD2   1 
ATOM   4936 N N     . LYS C 3 567 ? 1.848   53.388 34.400  1.00 16.66 ? 863  LYS A N     1 
ATOM   4937 C CA    . LYS C 3 567 ? 2.654   54.596 34.351  1.00 16.94 ? 863  LYS A CA    1 
ATOM   4938 C C     . LYS C 3 567 ? 3.984   54.288 33.680  1.00 16.28 ? 863  LYS A C     1 
ATOM   4939 O O     . LYS C 3 567 ? 4.661   53.310 34.025  1.00 15.93 ? 863  LYS A O     1 
ATOM   4940 C CB    . LYS C 3 567 ? 2.870   55.123 35.788  1.00 17.73 ? 863  LYS A CB    1 
ATOM   4941 C CG    . LYS C 3 567 ? 3.833   56.287 35.943  1.00 21.10 ? 863  LYS A CG    1 
ATOM   4942 C CD    . LYS C 3 567 ? 3.814   56.845 37.368  1.00 24.33 ? 863  LYS A CD    1 
ATOM   4943 C CE    . LYS C 3 567 ? 5.187   57.346 37.826  1.00 26.39 ? 863  LYS A CE    1 
ATOM   4944 N NZ    . LYS C 3 567 ? 5.525   56.825 39.199  1.00 29.97 ? 863  LYS A NZ    1 
ATOM   4945 N N     . VAL C 3 568 ? 4.367   55.132 32.726  1.00 15.08 ? 864  VAL A N     1 
ATOM   4946 C CA    . VAL C 3 568 ? 5.603   54.924 32.001  1.00 13.99 ? 864  VAL A CA    1 
ATOM   4947 C C     . VAL C 3 568 ? 6.505   56.134 32.141  1.00 15.17 ? 864  VAL A C     1 
ATOM   4948 O O     . VAL C 3 568 ? 6.053   57.254 31.962  1.00 16.12 ? 864  VAL A O     1 
ATOM   4949 C CB    . VAL C 3 568 ? 5.290   54.652 30.493  1.00 13.43 ? 864  VAL A CB    1 
ATOM   4950 C CG1   . VAL C 3 568 ? 6.513   54.812 29.640  1.00 12.22 ? 864  VAL A CG1   1 
ATOM   4951 C CG2   . VAL C 3 568 ? 4.773   53.246 30.331  1.00 13.37 ? 864  VAL A CG2   1 
ATOM   4952 N N     . ASP C 3 569 ? 7.764   55.922 32.487  1.00 15.16 ? 865  ASP A N     1 
ATOM   4953 C CA    . ASP C 3 569 ? 8.702   57.026 32.591  1.00 17.05 ? 865  ASP A CA    1 
ATOM   4954 C C     . ASP C 3 569 ? 9.529   56.978 31.319  1.00 17.18 ? 865  ASP A C     1 
ATOM   4955 O O     . ASP C 3 569 ? 9.597   55.938 30.670  1.00 15.67 ? 865  ASP A O     1 
ATOM   4956 C CB    . ASP C 3 569 ? 9.613   56.870 33.807  1.00 18.39 ? 865  ASP A CB    1 
ATOM   4957 C CG    . ASP C 3 569 ? 8.846   56.932 35.103  1.00 21.59 ? 865  ASP A CG    1 
ATOM   4958 O OD1   . ASP C 3 569 ? 7.890   57.732 35.205  1.00 22.86 ? 865  ASP A OD1   1 
ATOM   4959 O OD2   . ASP C 3 569 ? 9.190   56.174 36.023  1.00 23.57 ? 865  ASP A OD2   1 
ATOM   4960 N N     . TYR C 3 570 ? 10.162  58.093 30.960  1.00 17.60 ? 866  TYR A N     1 
ATOM   4961 C CA    . TYR C 3 570 ? 10.953  58.118 29.733  1.00 18.65 ? 866  TYR A CA    1 
ATOM   4962 C C     . TYR C 3 570 ? 12.047  59.154 29.785  1.00 19.65 ? 866  TYR A C     1 
ATOM   4963 O O     . TYR C 3 570 ? 11.943  60.146 30.502  1.00 19.77 ? 866  TYR A O     1 
ATOM   4964 C CB    . TYR C 3 570 ? 10.048  58.399 28.542  1.00 18.85 ? 866  TYR A CB    1 
ATOM   4965 C CG    . TYR C 3 570 ? 9.184   59.596 28.755  1.00 20.02 ? 866  TYR A CG    1 
ATOM   4966 C CD1   . TYR C 3 570 ? 7.990   59.483 29.425  1.00 20.07 ? 866  TYR A CD1   1 
ATOM   4967 C CD2   . TYR C 3 570 ? 9.582   60.856 28.307  1.00 21.62 ? 866  TYR A CD2   1 
ATOM   4968 C CE1   . TYR C 3 570 ? 7.204   60.579 29.655  1.00 22.79 ? 866  TYR A CE1   1 
ATOM   4969 C CE2   . TYR C 3 570 ? 8.799   61.984 28.531  1.00 22.23 ? 866  TYR A CE2   1 
ATOM   4970 C CZ    . TYR C 3 570 ? 7.609   61.838 29.208  1.00 22.94 ? 866  TYR A CZ    1 
ATOM   4971 O OH    . TYR C 3 570 ? 6.804   62.938 29.456  1.00 24.08 ? 866  TYR A OH    1 
ATOM   4972 N N     . HIS C 3 571 ? 13.113  58.903 29.038  1.00 19.77 ? 867  HIS A N     1 
ATOM   4973 C CA    . HIS C 3 571 ? 14.246  59.811 28.969  1.00 20.48 ? 867  HIS A CA    1 
ATOM   4974 C C     . HIS C 3 571 ? 14.859  59.657 27.588  1.00 20.74 ? 867  HIS A C     1 
ATOM   4975 O O     . HIS C 3 571 ? 14.562  58.703 26.864  1.00 19.80 ? 867  HIS A O     1 
ATOM   4976 C CB    . HIS C 3 571 ? 15.323  59.457 30.018  1.00 22.03 ? 867  HIS A CB    1 
ATOM   4977 C CG    . HIS C 3 571 ? 14.775  59.110 31.364  1.00 23.03 ? 867  HIS A CG    1 
ATOM   4978 N ND1   . HIS C 3 571 ? 14.585  60.048 32.355  1.00 24.73 ? 867  HIS A ND1   1 
ATOM   4979 C CD2   . HIS C 3 571 ? 14.358  57.927 31.879  1.00 23.87 ? 867  HIS A CD2   1 
ATOM   4980 C CE1   . HIS C 3 571 ? 14.070  59.460 33.421  1.00 24.44 ? 867  HIS A CE1   1 
ATOM   4981 N NE2   . HIS C 3 571 ? 13.924  58.173 33.157  1.00 24.17 ? 867  HIS A NE2   1 
ATOM   4982 N N     . TYR C 3 572 ? 15.717  60.597 27.222  1.00 19.90 ? 868  TYR A N     1 
ATOM   4983 C CA    . TYR C 3 572 ? 16.384  60.503 25.939  1.00 20.79 ? 868  TYR A CA    1 
ATOM   4984 C C     . TYR C 3 572 ? 17.713  61.237 26.004  1.00 20.43 ? 868  TYR A C     1 
ATOM   4985 O O     . TYR C 3 572 ? 17.916  62.125 26.847  1.00 19.19 ? 868  TYR A O     1 
ATOM   4986 C CB    . TYR C 3 572 ? 15.479  61.027 24.815  1.00 22.34 ? 868  TYR A CB    1 
ATOM   4987 C CG    . TYR C 3 572 ? 15.176  62.485 24.905  1.00 24.24 ? 868  TYR A CG    1 
ATOM   4988 C CD1   . TYR C 3 572 ? 16.158  63.437 24.635  1.00 25.05 ? 868  TYR A CD1   1 
ATOM   4989 C CD2   . TYR C 3 572 ? 13.899  62.917 25.210  1.00 25.40 ? 868  TYR A CD2   1 
ATOM   4990 C CE1   . TYR C 3 572 ? 15.860  64.786 24.659  1.00 26.36 ? 868  TYR A CE1   1 
ATOM   4991 C CE2   . TYR C 3 572 ? 13.591  64.256 25.239  1.00 26.59 ? 868  TYR A CE2   1 
ATOM   4992 C CZ    . TYR C 3 572 ? 14.568  65.188 24.957  1.00 26.19 ? 868  TYR A CZ    1 
ATOM   4993 O OH    . TYR C 3 572 ? 14.225  66.518 24.934  1.00 27.57 ? 868  TYR A OH    1 
ATOM   4994 N N     . GLY C 3 573 ? 18.631  60.842 25.130  1.00 19.31 ? 869  GLY A N     1 
ATOM   4995 C CA    . GLY C 3 573 ? 19.941  61.440 25.166  1.00 18.85 ? 869  GLY A CA    1 
ATOM   4996 C C     . GLY C 3 573 ? 20.724  61.044 23.956  1.00 18.86 ? 869  GLY A C     1 
ATOM   4997 O O     . GLY C 3 573 ? 20.191  60.404 23.070  1.00 19.07 ? 869  GLY A O     1 
ATOM   4998 N N     . SER C 3 574 ? 21.991  61.416 23.939  1.00 19.37 ? 870  SER A N     1 
ATOM   4999 C CA    . SER C 3 574 ? 22.859  61.153 22.810  1.00 20.67 ? 870  SER A CA    1 
ATOM   5000 C C     . SER C 3 574 ? 23.502  59.758 22.768  1.00 20.92 ? 870  SER A C     1 
ATOM   5001 O O     . SER C 3 574 ? 24.091  59.376 21.753  1.00 21.18 ? 870  SER A O     1 
ATOM   5002 C CB    . SER C 3 574 ? 23.929  62.254 22.737  1.00 21.43 ? 870  SER A CB    1 
ATOM   5003 O OG    . SER C 3 574 ? 24.882  62.126 23.778  1.00 23.62 ? 870  SER A OG    1 
ATOM   5004 N N     . THR C 3 575 ? 23.404  59.024 23.879  1.00 20.36 ? 871  THR A N     1 
ATOM   5005 C CA    . THR C 3 575 ? 23.900  57.648 24.001  1.00 19.07 ? 871  THR A CA    1 
ATOM   5006 C C     . THR C 3 575 ? 22.881  56.952 24.894  1.00 18.78 ? 871  THR A C     1 
ATOM   5007 O O     . THR C 3 575 ? 22.022  57.605 25.489  1.00 18.00 ? 871  THR A O     1 
ATOM   5008 C CB    . THR C 3 575 ? 25.282  57.545 24.675  1.00 19.53 ? 871  THR A CB    1 
ATOM   5009 O OG1   . THR C 3 575 ? 25.171  57.861 26.073  1.00 19.79 ? 871  THR A OG1   1 
ATOM   5010 C CG2   . THR C 3 575 ? 26.281  58.469 23.987  1.00 18.18 ? 871  THR A CG2   1 
ATOM   5011 N N     . TRP C 3 576 ? 22.946  55.633 24.974  1.00 18.64 ? 872  TRP A N     1 
ATOM   5012 C CA    . TRP C 3 576 ? 22.000  54.905 25.810  1.00 19.46 ? 872  TRP A CA    1 
ATOM   5013 C C     . TRP C 3 576 ? 22.224  55.369 27.269  1.00 20.18 ? 872  TRP A C     1 
ATOM   5014 O O     . TRP C 3 576 ? 21.273  55.540 28.040  1.00 20.13 ? 872  TRP A O     1 
ATOM   5015 C CB    . TRP C 3 576 ? 22.251  53.400 25.668  1.00 17.96 ? 872  TRP A CB    1 
ATOM   5016 C CG    . TRP C 3 576 ? 21.147  52.530 26.207  1.00 17.59 ? 872  TRP A CG    1 
ATOM   5017 C CD1   . TRP C 3 576 ? 19.987  52.932 26.806  1.00 17.15 ? 872  TRP A CD1   1 
ATOM   5018 C CD2   . TRP C 3 576 ? 21.106  51.102 26.182  1.00 17.67 ? 872  TRP A CD2   1 
ATOM   5019 N NE1   . TRP C 3 576 ? 19.222  51.837 27.155  1.00 16.59 ? 872  TRP A NE1   1 
ATOM   5020 C CE2   . TRP C 3 576 ? 19.889  50.703 26.784  1.00 16.92 ? 872  TRP A CE2   1 
ATOM   5021 C CE3   . TRP C 3 576 ? 21.982  50.118 25.706  1.00 17.03 ? 872  TRP A CE3   1 
ATOM   5022 C CZ2   . TRP C 3 576 ? 19.530  49.363 26.922  1.00 17.07 ? 872  TRP A CZ2   1 
ATOM   5023 C CZ3   . TRP C 3 576 ? 21.622  48.784 25.842  1.00 17.35 ? 872  TRP A CZ3   1 
ATOM   5024 C CH2   . TRP C 3 576 ? 20.411  48.419 26.443  1.00 15.48 ? 872  TRP A CH2   1 
ATOM   5025 N N     . TYR C 3 577 ? 23.488  55.579 27.619  1.00 20.61 ? 873  TYR A N     1 
ATOM   5026 C CA    . TYR C 3 577 ? 23.864  56.029 28.940  1.00 22.27 ? 873  TYR A CA    1 
ATOM   5027 C C     . TYR C 3 577 ? 23.147  57.320 29.337  1.00 23.74 ? 873  TYR A C     1 
ATOM   5028 O O     . TYR C 3 577 ? 22.750  57.487 30.491  1.00 23.60 ? 873  TYR A O     1 
ATOM   5029 C CB    . TYR C 3 577 ? 25.359  56.271 28.995  1.00 22.34 ? 873  TYR A CB    1 
ATOM   5030 C CG    . TYR C 3 577 ? 25.823  56.814 30.326  1.00 24.31 ? 873  TYR A CG    1 
ATOM   5031 C CD1   . TYR C 3 577 ? 26.174  55.948 31.372  1.00 25.28 ? 873  TYR A CD1   1 
ATOM   5032 C CD2   . TYR C 3 577 ? 25.940  58.188 30.540  1.00 24.70 ? 873  TYR A CD2   1 
ATOM   5033 C CE1   . TYR C 3 577 ? 26.635  56.427 32.595  1.00 25.31 ? 873  TYR A CE1   1 
ATOM   5034 C CE2   . TYR C 3 577 ? 26.400  58.681 31.759  1.00 25.80 ? 873  TYR A CE2   1 
ATOM   5035 C CZ    . TYR C 3 577 ? 26.751  57.791 32.782  1.00 26.23 ? 873  TYR A CZ    1 
ATOM   5036 O OH    . TYR C 3 577 ? 27.267  58.266 33.965  1.00 25.58 ? 873  TYR A OH    1 
ATOM   5037 N N     . ASP C 3 578 ? 22.969  58.225 28.380  1.00 23.84 ? 874  ASP A N     1 
ATOM   5038 C CA    . ASP C 3 578 ? 22.335  59.506 28.664  1.00 24.68 ? 874  ASP A CA    1 
ATOM   5039 C C     . ASP C 3 578 ? 20.821  59.508 28.626  1.00 24.92 ? 874  ASP A C     1 
ATOM   5040 O O     . ASP C 3 578 ? 20.204  60.475 29.080  1.00 25.44 ? 874  ASP A O     1 
ATOM   5041 C CB    . ASP C 3 578 ? 22.881  60.586 27.713  1.00 25.12 ? 874  ASP A CB    1 
ATOM   5042 C CG    . ASP C 3 578 ? 24.370  60.753 27.839  1.00 25.53 ? 874  ASP A CG    1 
ATOM   5043 O OD1   . ASP C 3 578 ? 24.810  61.366 28.827  1.00 27.24 ? 874  ASP A OD1   1 
ATOM   5044 O OD2   . ASP C 3 578 ? 25.115  60.261 26.970  1.00 27.44 ? 874  ASP A OD2   1 
ATOM   5045 N N     . ALA C 3 579 ? 20.224  58.445 28.081  1.00 25.11 ? 875  ALA A N     1 
ATOM   5046 C CA    . ALA C 3 579 ? 18.768  58.340 28.000  1.00 25.67 ? 875  ALA A CA    1 
ATOM   5047 C C     . ALA C 3 579 ? 18.298  57.995 29.403  1.00 27.61 ? 875  ALA A C     1 
ATOM   5048 O O     . ALA C 3 579 ? 17.568  57.024 29.609  1.00 27.52 ? 875  ALA A O     1 
ATOM   5049 C CB    . ALA C 3 579 ? 18.340  57.236 26.999  1.00 24.18 ? 875  ALA A CB    1 
ATOM   5050 N N     . LYS C 3 580 ? 18.730  58.804 30.370  1.00 29.40 ? 876  LYS A N     1 
ATOM   5051 C CA    . LYS C 3 580 ? 18.392  58.600 31.779  1.00 30.31 ? 876  LYS A CA    1 
ATOM   5052 C C     . LYS C 3 580 ? 17.965  59.886 32.467  1.00 31.58 ? 876  LYS A C     1 
ATOM   5053 O O     . LYS C 3 580 ? 17.759  60.919 31.781  1.00 32.55 ? 876  LYS A O     1 
ATOM   5054 C CB    . LYS C 3 580 ? 19.589  58.036 32.526  1.00 30.08 ? 876  LYS A CB    1 
ATOM   5055 C CG    . LYS C 3 580 ? 20.579  59.101 32.930  1.00 31.26 ? 876  LYS A CG    1 
ATOM   5056 C CD    . LYS C 3 580 ? 22.009  58.575 32.858  1.00 33.34 ? 876  LYS A CD    1 
ATOM   5057 C CE    . LYS C 3 580 ? 22.877  59.098 33.995  1.00 34.28 ? 876  LYS A CE    1 
ATOM   5058 N NZ    . LYS C 3 580 ? 23.495  60.434 33.693  1.00 35.50 ? 876  LYS A NZ    1 
ATOM   5059 O OXT   . LYS C 3 580 ? 17.843  59.830 33.709  1.00 33.53 ? 876  LYS A OXT   1 
HETATM 5060 S S     . SO4 D 4 .   ? 14.036  52.785 43.813  1.00 46.09 ? 910  SO4 A S     1 
HETATM 5061 O O1    . SO4 D 4 .   ? 15.147  52.997 42.705  1.00 45.82 ? 910  SO4 A O1    1 
HETATM 5062 O O2    . SO4 D 4 .   ? 12.818  51.910 43.269  1.00 45.70 ? 910  SO4 A O2    1 
HETATM 5063 O O3    . SO4 D 4 .   ? 14.728  51.991 45.129  1.00 45.82 ? 910  SO4 A O3    1 
HETATM 5064 O O4    . SO4 D 4 .   ? 13.455  54.304 44.256  1.00 46.56 ? 910  SO4 A O4    1 
HETATM 5065 S S     . SO4 E 4 .   ? 4.165   9.861  -1.404  1.00 39.43 ? 912  SO4 A S     1 
HETATM 5066 O O1    . SO4 E 4 .   ? 5.091   11.078 -1.014  1.00 41.22 ? 912  SO4 A O1    1 
HETATM 5067 O O2    . SO4 E 4 .   ? 4.680   9.198  -2.743  1.00 41.37 ? 912  SO4 A O2    1 
HETATM 5068 O O3    . SO4 E 4 .   ? 4.263   8.692  -0.207  1.00 41.48 ? 912  SO4 A O3    1 
HETATM 5069 O O4    . SO4 E 4 .   ? 2.589   10.410 -1.612  1.00 39.38 ? 912  SO4 A O4    1 
HETATM 5070 S S     . SO4 F 4 .   ? 10.344  51.963 38.983  1.00 44.61 ? 915  SO4 A S     1 
HETATM 5071 O O1    . SO4 F 4 .   ? 11.894  52.119 38.623  1.00 44.72 ? 915  SO4 A O1    1 
HETATM 5072 O O2    . SO4 F 4 .   ? 9.762   50.601 38.343  1.00 44.38 ? 915  SO4 A O2    1 
HETATM 5073 O O3    . SO4 F 4 .   ? 10.192  51.895 40.665  1.00 45.97 ? 915  SO4 A O3    1 
HETATM 5074 O O4    . SO4 F 4 .   ? 9.465   53.275 38.392  1.00 44.04 ? 915  SO4 A O4    1 
HETATM 5075 S S     . SO4 G 4 .   ? 45.946  38.316 59.340  1.00 52.43 ? 920  SO4 A S     1 
HETATM 5076 O O1    . SO4 G 4 .   ? 46.362  36.917 58.693  1.00 52.98 ? 920  SO4 A O1    1 
HETATM 5077 O O2    . SO4 G 4 .   ? 46.282  38.333 60.906  1.00 52.36 ? 920  SO4 A O2    1 
HETATM 5078 O O3    . SO4 G 4 .   ? 46.794  39.549 58.563  1.00 52.44 ? 920  SO4 A O3    1 
HETATM 5079 O O4    . SO4 G 4 .   ? 44.284  38.542 59.147  1.00 52.85 ? 920  SO4 A O4    1 
HETATM 5080 O O     . HOH H 5 .   ? 31.121  40.503 42.191  1.00 31.75 ? 1049 HOH P O     1 
HETATM 5081 O O     . HOH H 5 .   ? 30.451  44.377 36.706  1.00 37.21 ? 2060 HOH P O     1 
HETATM 5082 O O     . HOH H 5 .   ? 25.829  44.901 39.327  1.00 26.82 ? 2147 HOH P O     1 
HETATM 5083 O O     . HOH H 5 .   ? 21.041  35.665 39.346  1.00 47.80 ? 2284 HOH P O     1 
HETATM 5084 O O     . HOH H 5 .   ? 32.749  27.644 44.032  1.00 41.00 ? 2435 HOH P O     1 
HETATM 5085 O O     . HOH H 5 .   ? 23.894  41.832 38.882  1.00 40.74 ? 2510 HOH P O     1 
HETATM 5086 O O     . HOH H 5 .   ? 23.493  37.756 39.409  1.00 31.83 ? 2511 HOH P O     1 
HETATM 5087 O O     . HOH H 5 .   ? 27.085  34.395 43.221  1.00 30.64 ? 2517 HOH P O     1 
HETATM 5088 O O     . HOH H 5 .   ? 27.243  40.498 42.387  1.00 40.53 ? 2526 HOH P O     1 
HETATM 5089 O O     . HOH H 5 .   ? 27.500  31.338 42.258  1.00 33.56 ? 2666 HOH P O     1 
HETATM 5090 O O     . HOH H 5 .   ? 26.165  37.691 41.339  1.00 42.11 ? 2667 HOH P O     1 
HETATM 5091 O O     . HOH H 5 .   ? 15.683  46.420 37.665  1.00 34.52 ? 2694 HOH P O     1 
HETATM 5092 O O     . HOH H 5 .   ? 32.986  29.296 38.012  1.00 36.21 ? 2757 HOH P O     1 
HETATM 5093 O O     . HOH H 5 .   ? 25.582  28.066 33.574  1.00 44.07 ? 2809 HOH P O     1 
HETATM 5094 O O     . HOH H 5 .   ? 33.299  32.079 37.714  1.00 45.15 ? 2878 HOH P O     1 
HETATM 5095 O O     . HOH I 5 .   ? 27.098  37.271 22.168  1.00 41.15 ? 1007 HOH T O     1 
HETATM 5096 O O     . HOH I 5 .   ? 19.014  38.049 29.919  1.00 13.21 ? 1010 HOH T O     1 
HETATM 5097 O O     . HOH I 5 .   ? 25.975  37.735 30.003  1.00 26.80 ? 1050 HOH T O     1 
HETATM 5098 O O     . HOH I 5 .   ? 12.899  27.912 28.912  1.00 29.90 ? 2047 HOH T O     1 
HETATM 5099 O O     . HOH I 5 .   ? 28.898  39.289 24.424  1.00 48.50 ? 2289 HOH T O     1 
HETATM 5100 O O     . HOH I 5 .   ? 22.304  31.030 24.533  1.00 34.75 ? 2290 HOH T O     1 
HETATM 5101 O O     . HOH I 5 .   ? 21.615  30.649 28.006  1.00 29.88 ? 2291 HOH T O     1 
HETATM 5102 O O     . HOH I 5 .   ? 27.508  28.735 28.814  1.00 34.50 ? 2294 HOH T O     1 
HETATM 5103 O O     . HOH I 5 .   ? 25.856  31.749 26.113  1.00 34.29 ? 2295 HOH T O     1 
HETATM 5104 O O     . HOH I 5 .   ? 24.729  31.955 21.930  1.00 38.65 ? 2355 HOH T O     1 
HETATM 5105 O O     . HOH I 5 .   ? 15.594  30.015 37.651  1.00 39.45 ? 2678 HOH T O     1 
HETATM 5106 O O     . HOH I 5 .   ? 13.772  34.270 31.834  1.00 39.46 ? 2689 HOH T O     1 
HETATM 5107 O O     . HOH I 5 .   ? 35.213  29.967 36.368  1.00 36.29 ? 2711 HOH T O     1 
HETATM 5108 O O     . HOH I 5 .   ? 17.775  28.908 28.157  1.00 42.44 ? 2719 HOH T O     1 
HETATM 5109 O O     . HOH I 5 .   ? 32.751  29.055 28.019  1.00 38.89 ? 2747 HOH T O     1 
HETATM 5110 O O     . HOH I 5 .   ? 33.996  36.770 24.801  1.00 35.17 ? 2808 HOH T O     1 
HETATM 5111 O O     . HOH I 5 .   ? 12.707  35.315 34.900  1.00 46.49 ? 2814 HOH T O     1 
HETATM 5112 O O     . HOH J 5 .   ? 6.655   44.335 31.255  1.00 18.09 ? 1001 HOH A O     1 
HETATM 5113 O O     . HOH J 5 .   ? 8.442   39.067 37.158  1.00 26.09 ? 1002 HOH A O     1 
HETATM 5114 O O     . HOH J 5 .   ? 6.438   45.904 39.918  1.00 16.05 ? 1003 HOH A O     1 
HETATM 5115 O O     . HOH J 5 .   ? 8.390   35.329 23.847  1.00 14.89 ? 1004 HOH A O     1 
HETATM 5116 O O     . HOH J 5 .   ? 7.949   40.099 32.198  1.00 16.07 ? 1005 HOH A O     1 
HETATM 5117 O O     . HOH J 5 .   ? 17.729  40.535 31.051  1.00 16.83 ? 1006 HOH A O     1 
HETATM 5118 O O     . HOH J 5 .   ? 9.384   27.211 7.536   1.00 15.68 ? 1008 HOH A O     1 
HETATM 5119 O O     . HOH J 5 .   ? 17.559  37.566 27.740  1.00 15.32 ? 1009 HOH A O     1 
HETATM 5120 O O     . HOH J 5 .   ? 8.144   42.756 33.092  1.00 25.21 ? 1011 HOH A O     1 
HETATM 5121 O O     . HOH J 5 .   ? 8.238   47.704 36.066  1.00 17.80 ? 1012 HOH A O     1 
HETATM 5122 O O     . HOH J 5 .   ? 18.010  47.868 31.074  1.00 23.27 ? 1013 HOH A O     1 
HETATM 5123 O O     . HOH J 5 .   ? 3.442   50.851 34.907  1.00 16.96 ? 1016 HOH A O     1 
HETATM 5124 O O     . HOH J 5 .   ? -5.103  50.560 33.272  1.00 18.79 ? 1017 HOH A O     1 
HETATM 5125 O O     . HOH J 5 .   ? 26.405  47.281 37.355  1.00 26.29 ? 1018 HOH A O     1 
HETATM 5126 O O     . HOH J 5 .   ? 13.248  48.735 33.496  1.00 21.00 ? 1021 HOH A O     1 
HETATM 5127 O O     . HOH J 5 .   ? 12.837  41.529 38.055  1.00 33.89 ? 1025 HOH A O     1 
HETATM 5128 O O     . HOH J 5 .   ? 15.134  36.617 28.827  1.00 18.43 ? 1028 HOH A O     1 
HETATM 5129 O O     . HOH J 5 .   ? 15.908  31.276 15.138  1.00 26.39 ? 1029 HOH A O     1 
HETATM 5130 O O     . HOH J 5 .   ? 18.233  45.950 17.524  1.00 17.36 ? 1030 HOH A O     1 
HETATM 5131 O O     . HOH J 5 .   ? 13.699  33.774 15.045  1.00 18.27 ? 1031 HOH A O     1 
HETATM 5132 O O     . HOH J 5 .   ? 9.944   34.192 16.393  1.00 18.31 ? 1032 HOH A O     1 
HETATM 5133 O O     . HOH J 5 .   ? 8.751   33.685 13.921  1.00 15.17 ? 1033 HOH A O     1 
HETATM 5134 O O     . HOH J 5 .   ? 12.307  30.321 8.631   1.00 22.96 ? 1034 HOH A O     1 
HETATM 5135 O O     . HOH J 5 .   ? 11.404  28.420 6.799   1.00 16.69 ? 1035 HOH A O     1 
HETATM 5136 O O     . HOH J 5 .   ? 11.204  40.179 27.357  1.00 19.64 ? 1037 HOH A O     1 
HETATM 5137 O O     . HOH J 5 .   ? 11.199  33.532 24.661  1.00 14.64 ? 1039 HOH A O     1 
HETATM 5138 O O     . HOH J 5 .   ? 3.955   31.305 25.779  1.00 17.36 ? 1040 HOH A O     1 
HETATM 5139 O O     . HOH J 5 .   ? 1.715   29.773 26.529  1.00 15.69 ? 1041 HOH A O     1 
HETATM 5140 O O     . HOH J 5 .   ? 3.939   24.910 30.247  1.00 18.83 ? 1042 HOH A O     1 
HETATM 5141 O O     . HOH J 5 .   ? 5.557   23.567 32.405  1.00 46.14 ? 1043 HOH A O     1 
HETATM 5142 O O     . HOH J 5 .   ? 12.141  33.470 17.785  1.00 19.36 ? 1045 HOH A O     1 
HETATM 5143 O O     . HOH J 5 .   ? 14.448  37.107 31.474  1.00 14.89 ? 1046 HOH A O     1 
HETATM 5144 O O     . HOH J 5 .   ? 15.706  25.103 -8.484  1.00 25.97 ? 2001 HOH A O     1 
HETATM 5145 O O     . HOH J 5 .   ? 2.317   28.053 -3.274  1.00 19.00 ? 2002 HOH A O     1 
HETATM 5146 O O     . HOH J 5 .   ? 9.295   40.083 -1.918  1.00 18.24 ? 2003 HOH A O     1 
HETATM 5147 O O     . HOH J 5 .   ? 5.275   43.395 -0.395  1.00 31.92 ? 2004 HOH A O     1 
HETATM 5148 O O     . HOH J 5 .   ? 26.027  34.537 3.888   1.00 33.05 ? 2005 HOH A O     1 
HETATM 5149 O O     . HOH J 5 .   ? 2.530   14.185 5.285   1.00 23.26 ? 2006 HOH A O     1 
HETATM 5150 O O     . HOH J 5 .   ? 20.931  36.629 4.466   1.00 14.10 ? 2007 HOH A O     1 
HETATM 5151 O O     . HOH J 5 .   ? 11.957  39.570 4.449   1.00 15.68 ? 2008 HOH A O     1 
HETATM 5152 O O     . HOH J 5 .   ? -1.581  24.174 5.874   1.00 29.42 ? 2009 HOH A O     1 
HETATM 5153 O O     . HOH J 5 .   ? 24.744  28.166 5.532   1.00 26.36 ? 2010 HOH A O     1 
HETATM 5154 O O     . HOH J 5 .   ? 6.633   15.153 6.661   1.00 16.05 ? 2011 HOH A O     1 
HETATM 5155 O O     . HOH J 5 .   ? 26.740  41.518 7.673   1.00 17.89 ? 2013 HOH A O     1 
HETATM 5156 O O     . HOH J 5 .   ? -3.461  30.050 8.313   1.00 40.58 ? 2015 HOH A O     1 
HETATM 5157 O O     . HOH J 5 .   ? 14.431  47.385 10.141  1.00 17.86 ? 2016 HOH A O     1 
HETATM 5158 O O     . HOH J 5 .   ? 2.954   41.325 10.175  1.00 35.71 ? 2017 HOH A O     1 
HETATM 5159 O O     . HOH J 5 .   ? 12.930  19.096 12.160  1.00 16.58 ? 2018 HOH A O     1 
HETATM 5160 O O     . HOH J 5 .   ? 13.035  22.814 12.242  1.00 20.31 ? 2019 HOH A O     1 
HETATM 5161 O O     . HOH J 5 .   ? -0.981  37.021 12.168  1.00 16.45 ? 2020 HOH A O     1 
HETATM 5162 O O     . HOH J 5 .   ? 12.869  48.495 14.247  1.00 13.07 ? 2021 HOH A O     1 
HETATM 5163 O O     . HOH J 5 .   ? 1.764   47.377 14.440  1.00 13.00 ? 2022 HOH A O     1 
HETATM 5164 O O     . HOH J 5 .   ? 8.199   14.259 14.973  1.00 17.63 ? 2023 HOH A O     1 
HETATM 5165 O O     . HOH J 5 .   ? 9.504   50.365 15.219  1.00 19.29 ? 2024 HOH A O     1 
HETATM 5166 O O     . HOH J 5 .   ? 16.850  19.197 16.148  1.00 22.89 ? 2025 HOH A O     1 
HETATM 5167 O O     . HOH J 5 .   ? 25.723  41.491 14.596  1.00 32.27 ? 2026 HOH A O     1 
HETATM 5168 O O     . HOH J 5 .   ? 21.745  52.780 17.077  1.00 17.74 ? 2028 HOH A O     1 
HETATM 5169 O O     . HOH J 5 .   ? -5.452  17.908 25.204  1.00 43.81 ? 2029 HOH A O     1 
HETATM 5170 O O     . HOH J 5 .   ? 20.628  44.541 17.766  1.00 13.74 ? 2031 HOH A O     1 
HETATM 5171 O O     . HOH J 5 .   ? 12.000  67.209 19.084  1.00 17.14 ? 2033 HOH A O     1 
HETATM 5172 O O     . HOH J 5 .   ? 3.238   62.906 19.829  1.00 18.45 ? 2034 HOH A O     1 
HETATM 5173 O O     . HOH J 5 .   ? 2.580   65.703 19.880  1.00 29.28 ? 2035 HOH A O     1 
HETATM 5174 O O     . HOH J 5 .   ? 12.347  27.291 20.969  1.00 32.86 ? 2036 HOH A O     1 
HETATM 5175 O O     . HOH J 5 .   ? -6.390  34.438 22.317  1.00 12.07 ? 2037 HOH A O     1 
HETATM 5176 O O     . HOH J 5 .   ? 7.595   24.440 23.232  1.00 25.52 ? 2038 HOH A O     1 
HETATM 5177 O O     . HOH J 5 .   ? -1.822  51.250 23.334  1.00 12.47 ? 2040 HOH A O     1 
HETATM 5178 O O     . HOH J 5 .   ? 5.778   67.294 23.517  1.00 19.00 ? 2041 HOH A O     1 
HETATM 5179 O O     . HOH J 5 .   ? 36.140  37.676 26.581  1.00 36.44 ? 2044 HOH A O     1 
HETATM 5180 O O     . HOH J 5 .   ? -4.372  29.259 27.599  1.00 19.44 ? 2045 HOH A O     1 
HETATM 5181 O O     . HOH J 5 .   ? -7.258  22.619 28.800  1.00 17.17 ? 2046 HOH A O     1 
HETATM 5182 O O     . HOH J 5 .   ? 20.202  45.728 28.806  1.00 17.48 ? 2048 HOH A O     1 
HETATM 5183 O O     . HOH J 5 .   ? 8.377   40.990 29.385  1.00 16.80 ? 2049 HOH A O     1 
HETATM 5184 O O     . HOH J 5 .   ? 20.658  54.021 30.248  1.00 18.47 ? 2050 HOH A O     1 
HETATM 5185 O O     . HOH J 5 .   ? -4.381  20.614 32.222  1.00 17.81 ? 2051 HOH A O     1 
HETATM 5186 O O     . HOH J 5 .   ? 9.874   60.217 33.039  1.00 19.78 ? 2053 HOH A O     1 
HETATM 5187 O O     . HOH J 5 .   ? 33.984  52.319 33.378  1.00 23.22 ? 2054 HOH A O     1 
HETATM 5188 O O     . HOH J 5 .   ? -0.412  19.949 34.420  1.00 15.44 ? 2055 HOH A O     1 
HETATM 5189 O O     . HOH J 5 .   ? -8.808  19.520 35.106  1.00 11.92 ? 2056 HOH A O     1 
HETATM 5190 O O     . HOH J 5 .   ? -7.611  29.109 33.329  1.00 29.66 ? 2057 HOH A O     1 
HETATM 5191 O O     . HOH J 5 .   ? -4.682  31.458 35.733  1.00 27.57 ? 2058 HOH A O     1 
HETATM 5192 O O     . HOH J 5 .   ? 5.517   21.849 37.361  1.00 19.84 ? 2059 HOH A O     1 
HETATM 5193 O O     . HOH J 5 .   ? 7.729   30.482 39.309  1.00 38.75 ? 2061 HOH A O     1 
HETATM 5194 O O     . HOH J 5 .   ? -2.769  19.750 38.499  1.00 37.53 ? 2062 HOH A O     1 
HETATM 5195 O O     . HOH J 5 .   ? 13.144  15.130 7.565   1.00 19.36 ? 2101 HOH A O     1 
HETATM 5196 O O     . HOH J 5 .   ? -8.988  50.207 46.514  1.00 31.47 ? 2102 HOH A O     1 
HETATM 5197 O O     . HOH J 5 .   ? 0.374   8.669  13.872  1.00 16.96 ? 2103 HOH A O     1 
HETATM 5198 O O     . HOH J 5 .   ? 22.790  37.877 2.920   1.00 14.33 ? 2105 HOH A O     1 
HETATM 5199 O O     . HOH J 5 .   ? 4.635   52.845 39.921  1.00 22.22 ? 2109 HOH A O     1 
HETATM 5200 O O     . HOH J 5 .   ? 2.040   16.562 2.844   1.00 47.47 ? 2110 HOH A O     1 
HETATM 5201 O O     . HOH J 5 .   ? 37.472  43.411 52.239  1.00 30.29 ? 2111 HOH A O     1 
HETATM 5202 O O     . HOH J 5 .   ? 10.284  12.821 14.237  1.00 23.06 ? 2112 HOH A O     1 
HETATM 5203 O O     . HOH J 5 .   ? 25.643  39.346 28.047  1.00 31.72 ? 2113 HOH A O     1 
HETATM 5204 O O     . HOH J 5 .   ? 3.558   43.504 12.550  1.00 17.76 ? 2115 HOH A O     1 
HETATM 5205 O O     . HOH J 5 .   ? 22.845  63.928 25.984  1.00 22.11 ? 2116 HOH A O     1 
HETATM 5206 O O     . HOH J 5 .   ? 7.190   53.133 43.279  1.00 27.76 ? 2123 HOH A O     1 
HETATM 5207 O O     . HOH J 5 .   ? 22.041  55.168 32.012  1.00 21.04 ? 2126 HOH A O     1 
HETATM 5208 O O     . HOH J 5 .   ? -2.639  54.257 50.434  1.00 26.29 ? 2131 HOH A O     1 
HETATM 5209 O O     . HOH J 5 .   ? -3.504  21.718 8.160   1.00 21.51 ? 2132 HOH A O     1 
HETATM 5210 O O     . HOH J 5 .   ? 7.653   6.718  14.626  1.00 19.95 ? 2135 HOH A O     1 
HETATM 5211 O O     . HOH J 5 .   ? -3.171  53.993 32.553  1.00 28.81 ? 2137 HOH A O     1 
HETATM 5212 O O     . HOH J 5 .   ? -7.647  38.449 45.964  1.00 32.95 ? 2138 HOH A O     1 
HETATM 5213 O O     . HOH J 5 .   ? -6.388  45.209 50.735  1.00 27.96 ? 2139 HOH A O     1 
HETATM 5214 O O     . HOH J 5 .   ? 8.758   22.446 40.997  1.00 31.75 ? 2140 HOH A O     1 
HETATM 5215 O O     . HOH J 5 .   ? 8.108   40.492 26.642  1.00 21.43 ? 2144 HOH A O     1 
HETATM 5216 O O     . HOH J 5 .   ? 15.207  28.845 8.202   1.00 18.23 ? 2145 HOH A O     1 
HETATM 5217 O O     . HOH J 5 .   ? 12.905  30.051 -12.072 1.00 32.83 ? 2148 HOH A O     1 
HETATM 5218 O O     . HOH J 5 .   ? 4.476   35.876 -8.764  1.00 21.94 ? 2149 HOH A O     1 
HETATM 5219 O O     . HOH J 5 .   ? 20.803  53.645 52.650  1.00 44.19 ? 2151 HOH A O     1 
HETATM 5220 O O     . HOH J 5 .   ? 16.336  52.764 51.567  1.00 18.49 ? 2154 HOH A O     1 
HETATM 5221 O O     . HOH J 5 .   ? 16.455  13.903 4.372   1.00 32.84 ? 2156 HOH A O     1 
HETATM 5222 O O     . HOH J 5 .   ? 25.590  31.183 13.584  1.00 33.44 ? 2157 HOH A O     1 
HETATM 5223 O O     . HOH J 5 .   ? 7.865   17.064 21.110  1.00 28.14 ? 2158 HOH A O     1 
HETATM 5224 O O     . HOH J 5 .   ? 9.464   54.467 11.780  1.00 25.24 ? 2159 HOH A O     1 
HETATM 5225 O O     . HOH J 5 .   ? -2.496  25.714 -2.110  1.00 23.18 ? 2160 HOH A O     1 
HETATM 5226 O O     . HOH J 5 .   ? 30.716  36.559 32.173  1.00 38.77 ? 2161 HOH A O     1 
HETATM 5227 O O     . HOH J 5 .   ? -5.475  36.857 23.597  1.00 25.17 ? 2163 HOH A O     1 
HETATM 5228 O O     . HOH J 5 .   ? 13.914  27.633 14.401  1.00 27.38 ? 2167 HOH A O     1 
HETATM 5229 O O     . HOH J 5 .   ? 29.155  46.923 36.816  1.00 30.26 ? 2170 HOH A O     1 
HETATM 5230 O O     . HOH J 5 .   ? 4.336   66.946 26.045  1.00 28.25 ? 2171 HOH A O     1 
HETATM 5231 O O     . HOH J 5 .   ? 24.355  53.639 10.925  1.00 28.29 ? 2172 HOH A O     1 
HETATM 5232 O O     . HOH J 5 .   ? 14.046  45.651 5.372   1.00 27.96 ? 2174 HOH A O     1 
HETATM 5233 O O     . HOH J 5 .   ? -3.455  30.936 11.135  1.00 25.34 ? 2178 HOH A O     1 
HETATM 5234 O O     . HOH J 5 .   ? -4.513  38.676 55.503  1.00 32.54 ? 2184 HOH A O     1 
HETATM 5235 O O     . HOH J 5 .   ? 32.164  31.892 54.169  1.00 33.18 ? 2187 HOH A O     1 
HETATM 5236 O O     . HOH J 5 .   ? 3.150   54.262 42.411  1.00 24.73 ? 2188 HOH A O     1 
HETATM 5237 O O     . HOH J 5 .   ? 21.350  64.863 17.768  1.00 42.15 ? 2189 HOH A O     1 
HETATM 5238 O O     . HOH J 5 .   ? 15.474  63.100 29.005  1.00 28.47 ? 2194 HOH A O     1 
HETATM 5239 O O     . HOH J 5 .   ? 0.489   61.836 20.734  1.00 34.56 ? 2196 HOH A O     1 
HETATM 5240 O O     . HOH J 5 .   ? -4.043  36.046 34.831  1.00 33.56 ? 2201 HOH A O     1 
HETATM 5241 O O     . HOH J 5 .   ? -6.829  37.375 52.845  1.00 40.44 ? 2202 HOH A O     1 
HETATM 5242 O O     . HOH J 5 .   ? -12.243 49.716 42.695  1.00 31.31 ? 2203 HOH A O     1 
HETATM 5243 O O     . HOH J 5 .   ? 10.397  47.993 14.114  1.00 21.49 ? 2204 HOH A O     1 
HETATM 5244 O O     . HOH J 5 .   ? -7.643  52.221 35.896  1.00 37.88 ? 2211 HOH A O     1 
HETATM 5245 O O     . HOH J 5 .   ? 17.480  51.326 29.444  1.00 21.69 ? 2212 HOH A O     1 
HETATM 5246 O O     . HOH J 5 .   ? -1.732  23.562 25.493  1.00 16.15 ? 2214 HOH A O     1 
HETATM 5247 O O     . HOH J 5 .   ? 9.342   40.469 8.641   1.00 24.21 ? 2216 HOH A O     1 
HETATM 5248 O O     . HOH J 5 .   ? 25.464  36.131 11.064  1.00 21.72 ? 2221 HOH A O     1 
HETATM 5249 O O     . HOH J 5 .   ? 21.175  46.072 3.802   1.00 42.10 ? 2227 HOH A O     1 
HETATM 5250 O O     . HOH J 5 .   ? 3.623   58.774 32.060  1.00 34.23 ? 2228 HOH A O     1 
HETATM 5251 O O     . HOH J 5 .   ? -11.545 23.297 34.494  1.00 27.68 ? 2229 HOH A O     1 
HETATM 5252 O O     . HOH J 5 .   ? 13.566  49.850 11.535  1.00 17.57 ? 2234 HOH A O     1 
HETATM 5253 O O     . HOH J 5 .   ? 17.085  25.913 10.701  1.00 33.58 ? 2236 HOH A O     1 
HETATM 5254 O O     . HOH J 5 .   ? 10.815  41.771 -2.069  1.00 30.10 ? 2237 HOH A O     1 
HETATM 5255 O O     . HOH J 5 .   ? 16.329  48.675 8.883   1.00 22.09 ? 2242 HOH A O     1 
HETATM 5256 O O     . HOH J 5 .   ? 8.523   51.858 13.182  1.00 24.87 ? 2244 HOH A O     1 
HETATM 5257 O O     . HOH J 5 .   ? -3.367  53.187 22.486  1.00 48.10 ? 2246 HOH A O     1 
HETATM 5258 O O     . HOH J 5 .   ? 5.463   22.693 -11.782 1.00 29.37 ? 2248 HOH A O     1 
HETATM 5259 O O     . HOH J 5 .   ? 0.929   31.025 -0.912  1.00 33.03 ? 2249 HOH A O     1 
HETATM 5260 O O     . HOH J 5 .   ? 13.370  26.552 7.819   1.00 25.90 ? 2250 HOH A O     1 
HETATM 5261 O O     . HOH J 5 .   ? 0.572   33.970 -8.067  1.00 39.74 ? 2251 HOH A O     1 
HETATM 5262 O O     . HOH J 5 .   ? 5.279   18.003 -6.933  1.00 22.61 ? 2253 HOH A O     1 
HETATM 5263 O O     . HOH J 5 .   ? -0.853  29.805 5.371   1.00 22.58 ? 2254 HOH A O     1 
HETATM 5264 O O     . HOH J 5 .   ? 7.481   36.752 11.151  1.00 18.87 ? 2255 HOH A O     1 
HETATM 5265 O O     . HOH J 5 .   ? 7.661   38.620 9.430   1.00 21.52 ? 2256 HOH A O     1 
HETATM 5266 O O     . HOH J 5 .   ? 4.376   41.851 8.043   1.00 38.90 ? 2257 HOH A O     1 
HETATM 5267 O O     . HOH J 5 .   ? 3.243   37.315 9.771   1.00 37.94 ? 2258 HOH A O     1 
HETATM 5268 O O     . HOH J 5 .   ? 3.821   38.098 7.095   1.00 23.20 ? 2259 HOH A O     1 
HETATM 5269 O O     . HOH J 5 .   ? -4.644  34.167 10.114  1.00 41.80 ? 2261 HOH A O     1 
HETATM 5270 O O     . HOH J 5 .   ? 11.354  11.434 8.142   1.00 29.90 ? 2264 HOH A O     1 
HETATM 5271 O O     . HOH J 5 .   ? 13.753  11.049 6.029   1.00 42.55 ? 2265 HOH A O     1 
HETATM 5272 O O     . HOH J 5 .   ? 14.276  13.560 5.723   1.00 16.93 ? 2266 HOH A O     1 
HETATM 5273 O O     . HOH J 5 .   ? 10.379  8.167  10.040  1.00 36.08 ? 2267 HOH A O     1 
HETATM 5274 O O     . HOH J 5 .   ? 18.687  26.474 12.284  1.00 43.32 ? 2270 HOH A O     1 
HETATM 5275 O O     . HOH J 5 .   ? 10.337  41.644 36.444  1.00 21.79 ? 2277 HOH A O     1 
HETATM 5276 O O     . HOH J 5 .   ? 10.729  54.262 36.278  1.00 23.88 ? 2279 HOH A O     1 
HETATM 5277 O O     . HOH J 5 .   ? 13.279  54.752 30.617  1.00 26.23 ? 2280 HOH A O     1 
HETATM 5278 O O     . HOH J 5 .   ? 25.977  39.177 25.353  1.00 35.59 ? 2288 HOH A O     1 
HETATM 5279 O O     . HOH J 5 .   ? 12.181  49.543 42.585  1.00 44.99 ? 2301 HOH A O     1 
HETATM 5280 O O     . HOH J 5 .   ? 3.416   45.333 47.824  1.00 23.30 ? 2302 HOH A O     1 
HETATM 5281 O O     . HOH J 5 .   ? 15.170  51.332 49.526  1.00 21.42 ? 2303 HOH A O     1 
HETATM 5282 O O     . HOH J 5 .   ? 15.953  46.036 48.887  1.00 27.04 ? 2304 HOH A O     1 
HETATM 5283 O O     . HOH J 5 .   ? 13.868  44.079 38.434  1.00 34.70 ? 2305 HOH A O     1 
HETATM 5284 O O     . HOH J 5 .   ? 8.195   41.802 5.780   1.00 34.54 ? 2306 HOH A O     1 
HETATM 5285 O O     . HOH J 5 .   ? 11.005  42.393 5.225   1.00 29.70 ? 2307 HOH A O     1 
HETATM 5286 O O     . HOH J 5 .   ? 1.007   38.790 11.663  1.00 25.69 ? 2308 HOH A O     1 
HETATM 5287 O O     . HOH J 5 .   ? 5.290   44.977 11.039  1.00 30.54 ? 2309 HOH A O     1 
HETATM 5288 O O     . HOH J 5 .   ? 6.207   47.415 12.399  1.00 29.83 ? 2310 HOH A O     1 
HETATM 5289 O O     . HOH J 5 .   ? -0.850  44.102 13.962  1.00 29.71 ? 2312 HOH A O     1 
HETATM 5290 O O     . HOH J 5 .   ? -2.564  42.812 16.160  1.00 24.13 ? 2313 HOH A O     1 
HETATM 5291 O O     . HOH J 5 .   ? -0.692  46.962 14.122  1.00 37.34 ? 2314 HOH A O     1 
HETATM 5292 O O     . HOH J 5 .   ? 5.213   49.221 10.867  1.00 33.72 ? 2315 HOH A O     1 
HETATM 5293 O O     . HOH J 5 .   ? 2.677   48.585 12.386  1.00 26.72 ? 2317 HOH A O     1 
HETATM 5294 O O     . HOH J 5 .   ? -2.659  49.271 17.209  1.00 40.41 ? 2318 HOH A O     1 
HETATM 5295 O O     . HOH J 5 .   ? -3.735  38.552 21.785  1.00 43.93 ? 2319 HOH A O     1 
HETATM 5296 O O     . HOH J 5 .   ? -2.085  42.620 19.892  1.00 28.78 ? 2321 HOH A O     1 
HETATM 5297 O O     . HOH J 5 .   ? -2.687  45.285 19.117  1.00 28.35 ? 2322 HOH A O     1 
HETATM 5298 O O     . HOH J 5 .   ? -2.041  52.015 17.523  1.00 28.42 ? 2323 HOH A O     1 
HETATM 5299 O O     . HOH J 5 .   ? 19.791  51.059 13.714  1.00 15.69 ? 2324 HOH A O     1 
HETATM 5300 O O     . HOH J 5 .   ? 18.398  51.333 11.366  1.00 19.78 ? 2325 HOH A O     1 
HETATM 5301 O O     . HOH J 5 .   ? 13.065  45.718 8.022   1.00 25.94 ? 2326 HOH A O     1 
HETATM 5302 O O     . HOH J 5 .   ? 26.833  44.531 8.094   1.00 17.32 ? 2327 HOH A O     1 
HETATM 5303 O O     . HOH J 5 .   ? 25.124  45.941 9.698   1.00 20.34 ? 2328 HOH A O     1 
HETATM 5304 O O     . HOH J 5 .   ? 23.069  47.059 8.434   1.00 31.05 ? 2329 HOH A O     1 
HETATM 5305 O O     . HOH J 5 .   ? 15.258  55.335 51.471  1.00 31.01 ? 2330 HOH A O     1 
HETATM 5306 O O     . HOH J 5 .   ? 13.641  56.065 52.874  1.00 32.84 ? 2331 HOH A O     1 
HETATM 5307 O O     . HOH J 5 .   ? 17.967  42.789 56.246  1.00 38.35 ? 2332 HOH A O     1 
HETATM 5308 O O     . HOH J 5 .   ? 15.279  44.455 46.591  1.00 24.10 ? 2333 HOH A O     1 
HETATM 5309 O O     . HOH J 5 .   ? 0.804   16.429 37.971  1.00 36.79 ? 2338 HOH A O     1 
HETATM 5310 O O     . HOH J 5 .   ? 0.947   18.133 32.541  1.00 30.94 ? 2339 HOH A O     1 
HETATM 5311 O O     . HOH J 5 .   ? 7.249   23.511 38.335  1.00 38.10 ? 2340 HOH A O     1 
HETATM 5312 O O     . HOH J 5 .   ? 7.459   25.976 32.702  1.00 36.84 ? 2341 HOH A O     1 
HETATM 5313 O O     . HOH J 5 .   ? 28.921  36.646 14.775  1.00 49.16 ? 2356 HOH A O     1 
HETATM 5314 O O     . HOH J 5 .   ? 0.081   13.512 6.700   1.00 20.84 ? 2358 HOH A O     1 
HETATM 5315 O O     . HOH J 5 .   ? -11.121 24.066 18.510  1.00 27.56 ? 2360 HOH A O     1 
HETATM 5316 O O     . HOH J 5 .   ? 21.595  53.390 10.113  1.00 44.03 ? 2363 HOH A O     1 
HETATM 5317 O O     . HOH J 5 .   ? 23.447  47.808 5.369   1.00 34.96 ? 2364 HOH A O     1 
HETATM 5318 O O     . HOH J 5 .   ? 13.412  42.651 -4.786  1.00 49.92 ? 2365 HOH A O     1 
HETATM 5319 O O     . HOH J 5 .   ? 15.758  44.718 3.424   1.00 26.66 ? 2366 HOH A O     1 
HETATM 5320 O O     . HOH J 5 .   ? 26.138  58.123 16.512  1.00 37.35 ? 2368 HOH A O     1 
HETATM 5321 O O     . HOH J 5 .   ? 25.869  60.592 20.102  1.00 41.37 ? 2369 HOH A O     1 
HETATM 5322 O O     . HOH J 5 .   ? 23.555  60.885 16.699  1.00 39.00 ? 2370 HOH A O     1 
HETATM 5323 O O     . HOH J 5 .   ? 26.678  53.757 12.420  1.00 47.14 ? 2371 HOH A O     1 
HETATM 5324 O O     . HOH J 5 .   ? -9.530  55.994 45.342  1.00 23.53 ? 2373 HOH A O     1 
HETATM 5325 O O     . HOH J 5 .   ? -4.964  58.830 27.534  1.00 42.31 ? 2374 HOH A O     1 
HETATM 5326 O O     . HOH J 5 .   ? -2.523  36.409 9.991   1.00 31.00 ? 2375 HOH A O     1 
HETATM 5327 O O     . HOH J 5 .   ? -1.036  37.107 7.339   1.00 33.07 ? 2376 HOH A O     1 
HETATM 5328 O O     . HOH J 5 .   ? -8.350  23.576 26.202  1.00 22.96 ? 2377 HOH A O     1 
HETATM 5329 O O     . HOH J 5 .   ? -7.491  20.927 23.902  1.00 37.82 ? 2378 HOH A O     1 
HETATM 5330 O O     . HOH J 5 .   ? -0.558  19.843 21.572  1.00 35.38 ? 2379 HOH A O     1 
HETATM 5331 O O     . HOH J 5 .   ? -1.000  21.259 24.389  1.00 22.97 ? 2380 HOH A O     1 
HETATM 5332 O O     . HOH J 5 .   ? -5.398  16.388 21.361  1.00 37.75 ? 2381 HOH A O     1 
HETATM 5333 O O     . HOH J 5 .   ? -5.630  18.836 21.589  1.00 30.09 ? 2382 HOH A O     1 
HETATM 5334 O O     . HOH J 5 .   ? -4.175  15.230 24.976  1.00 31.23 ? 2383 HOH A O     1 
HETATM 5335 O O     . HOH J 5 .   ? -2.259  19.740 26.765  1.00 29.99 ? 2385 HOH A O     1 
HETATM 5336 O O     . HOH J 5 .   ? -4.087  15.446 15.060  1.00 30.16 ? 2386 HOH A O     1 
HETATM 5337 O O     . HOH J 5 .   ? -6.440  56.172 31.206  1.00 40.45 ? 2390 HOH A O     1 
HETATM 5338 O O     . HOH J 5 .   ? 2.739   19.423 25.309  1.00 40.22 ? 2391 HOH A O     1 
HETATM 5339 O O     . HOH J 5 .   ? 2.410   25.836 -13.504 1.00 25.32 ? 2392 HOH A O     1 
HETATM 5340 O O     . HOH J 5 .   ? 2.508   35.734 -7.106  1.00 29.62 ? 2394 HOH A O     1 
HETATM 5341 O O     . HOH J 5 .   ? 2.059   37.946 -6.806  1.00 32.62 ? 2395 HOH A O     1 
HETATM 5342 O O     . HOH J 5 .   ? -1.809  32.507 -6.435  1.00 37.93 ? 2398 HOH A O     1 
HETATM 5343 O O     . HOH J 5 .   ? -4.922  31.657 1.009   1.00 32.95 ? 2399 HOH A O     1 
HETATM 5344 O O     . HOH J 5 .   ? -5.272  30.342 4.363   1.00 35.28 ? 2401 HOH A O     1 
HETATM 5345 O O     . HOH J 5 .   ? -3.755  29.470 -5.778  1.00 40.73 ? 2402 HOH A O     1 
HETATM 5346 O O     . HOH J 5 .   ? 26.456  33.325 8.177   1.00 27.40 ? 2403 HOH A O     1 
HETATM 5347 O O     . HOH J 5 .   ? 24.624  39.279 15.293  1.00 32.18 ? 2405 HOH A O     1 
HETATM 5348 O O     . HOH J 5 .   ? 13.530  53.380 66.568  1.00 34.14 ? 2406 HOH A O     1 
HETATM 5349 O O     . HOH J 5 .   ? 23.392  41.666 2.947   1.00 19.47 ? 2407 HOH A O     1 
HETATM 5350 O O     . HOH J 5 .   ? 24.143  43.205 0.814   1.00 23.11 ? 2408 HOH A O     1 
HETATM 5351 O O     . HOH J 5 .   ? 22.813  24.306 -0.219  1.00 33.99 ? 2410 HOH A O     1 
HETATM 5352 O O     . HOH J 5 .   ? 9.723   40.718 -8.467  1.00 24.60 ? 2414 HOH A O     1 
HETATM 5353 O O     . HOH J 5 .   ? 1.183   42.863 -0.584  1.00 31.70 ? 2415 HOH A O     1 
HETATM 5354 O O     . HOH J 5 .   ? 8.551   41.864 -6.144  1.00 31.66 ? 2416 HOH A O     1 
HETATM 5355 O O     . HOH J 5 .   ? 4.666   41.411 -4.559  1.00 34.70 ? 2417 HOH A O     1 
HETATM 5356 O O     . HOH J 5 .   ? 13.613  17.413 17.597  1.00 24.06 ? 2419 HOH A O     1 
HETATM 5357 O O     . HOH J 5 .   ? 15.436  10.578 12.690  1.00 31.39 ? 2420 HOH A O     1 
HETATM 5358 O O     . HOH J 5 .   ? 11.973  10.677 11.002  1.00 36.68 ? 2422 HOH A O     1 
HETATM 5359 O O     . HOH J 5 .   ? 4.280   11.030 18.482  1.00 23.63 ? 2424 HOH A O     1 
HETATM 5360 O O     . HOH J 5 .   ? -1.469  14.281 13.493  1.00 32.47 ? 2425 HOH A O     1 
HETATM 5361 O O     . HOH J 5 .   ? 22.698  13.955 6.671   1.00 46.09 ? 2426 HOH A O     1 
HETATM 5362 O O     . HOH J 5 .   ? 24.960  17.181 7.764   1.00 25.56 ? 2427 HOH A O     1 
HETATM 5363 O O     . HOH J 5 .   ? 16.684  12.322 1.745   1.00 43.19 ? 2428 HOH A O     1 
HETATM 5364 O O     . HOH J 5 .   ? -5.399  19.511 17.826  1.00 29.88 ? 2429 HOH A O     1 
HETATM 5365 O O     . HOH J 5 .   ? -5.172  22.014 24.971  1.00 18.92 ? 2430 HOH A O     1 
HETATM 5366 O O     . HOH J 5 .   ? 29.865  57.331 22.602  1.00 22.97 ? 2431 HOH A O     1 
HETATM 5367 O O     . HOH J 5 .   ? 35.806  28.002 46.180  1.00 50.31 ? 2436 HOH A O     1 
HETATM 5368 O O     . HOH J 5 .   ? 38.750  28.487 57.006  1.00 27.29 ? 2437 HOH A O     1 
HETATM 5369 O O     . HOH J 5 .   ? 46.928  39.733 54.201  1.00 43.69 ? 2441 HOH A O     1 
HETATM 5370 O O     . HOH J 5 .   ? 43.405  47.002 49.092  1.00 49.48 ? 2442 HOH A O     1 
HETATM 5371 O O     . HOH J 5 .   ? 28.605  51.083 6.559   1.00 41.07 ? 2446 HOH A O     1 
HETATM 5372 O O     . HOH J 5 .   ? 20.929  61.984 9.918   1.00 41.43 ? 2457 HOH A O     1 
HETATM 5373 O O     . HOH J 5 .   ? 18.057  64.877 13.022  1.00 27.69 ? 2459 HOH A O     1 
HETATM 5374 O O     . HOH J 5 .   ? 12.633  55.917 34.234  1.00 20.21 ? 2460 HOH A O     1 
HETATM 5375 O O     . HOH J 5 .   ? 16.525  57.950 34.687  1.00 30.78 ? 2461 HOH A O     1 
HETATM 5376 O O     . HOH J 5 .   ? -9.199  43.277 49.599  1.00 20.11 ? 2462 HOH A O     1 
HETATM 5377 O O     . HOH J 5 .   ? -9.138  52.507 45.543  1.00 22.49 ? 2463 HOH A O     1 
HETATM 5378 O O     . HOH J 5 .   ? 4.889   56.431 49.541  1.00 35.43 ? 2465 HOH A O     1 
HETATM 5379 O O     . HOH J 5 .   ? 10.945  56.402 52.724  1.00 33.82 ? 2466 HOH A O     1 
HETATM 5380 O O     . HOH J 5 .   ? 1.971   58.314 57.091  1.00 40.23 ? 2467 HOH A O     1 
HETATM 5381 O O     . HOH J 5 .   ? 16.303  42.137 46.738  1.00 47.79 ? 2471 HOH A O     1 
HETATM 5382 O O     . HOH J 5 .   ? 17.928  41.816 49.428  1.00 48.17 ? 2472 HOH A O     1 
HETATM 5383 O O     . HOH J 5 .   ? 3.480   28.050 48.347  1.00 38.01 ? 2476 HOH A O     1 
HETATM 5384 O O     . HOH J 5 .   ? 9.854   41.141 62.076  1.00 48.45 ? 2484 HOH A O     1 
HETATM 5385 O O     . HOH J 5 .   ? -1.246  36.679 57.208  1.00 34.52 ? 2486 HOH A O     1 
HETATM 5386 O O     . HOH J 5 .   ? -6.678  34.497 52.798  1.00 37.59 ? 2487 HOH A O     1 
HETATM 5387 O O     . HOH J 5 .   ? -8.250  31.881 41.155  1.00 44.79 ? 2490 HOH A O     1 
HETATM 5388 O O     . HOH J 5 .   ? -1.129  18.745 37.125  1.00 39.64 ? 2491 HOH A O     1 
HETATM 5389 O O     . HOH J 5 .   ? 2.075   13.443 41.011  1.00 44.90 ? 2496 HOH A O     1 
HETATM 5390 O O     . HOH J 5 .   ? 3.537   15.687 40.692  1.00 34.62 ? 2498 HOH A O     1 
HETATM 5391 O O     . HOH J 5 .   ? 5.767   12.943 44.885  1.00 36.32 ? 2501 HOH A O     1 
HETATM 5392 O O     . HOH J 5 .   ? 4.929   17.075 50.979  1.00 32.14 ? 2504 HOH A O     1 
HETATM 5393 O O     . HOH J 5 .   ? 2.754   22.467 51.529  1.00 33.51 ? 2506 HOH A O     1 
HETATM 5394 O O     . HOH J 5 .   ? 9.329   45.615 43.283  1.00 41.39 ? 2515 HOH A O     1 
HETATM 5395 O O     . HOH J 5 .   ? 12.397  57.724 36.305  1.00 37.21 ? 2516 HOH A O     1 
HETATM 5396 O O     . HOH J 5 .   ? 28.483  59.607 21.398  1.00 32.75 ? 2521 HOH A O     1 
HETATM 5397 O O     . HOH J 5 .   ? 27.791  61.749 23.394  1.00 32.72 ? 2522 HOH A O     1 
HETATM 5398 O O     . HOH J 5 .   ? 11.386  48.471 7.110   1.00 38.03 ? 2528 HOH A O     1 
HETATM 5399 O O     . HOH J 5 .   ? 16.151  51.074 10.386  1.00 32.89 ? 2529 HOH A O     1 
HETATM 5400 O O     . HOH J 5 .   ? 12.330  53.700 10.689  1.00 33.61 ? 2533 HOH A O     1 
HETATM 5401 O O     . HOH J 5 .   ? 15.454  49.012 6.181   1.00 36.93 ? 2534 HOH A O     1 
HETATM 5402 O O     . HOH J 5 .   ? 25.137  63.290 15.098  1.00 42.49 ? 2538 HOH A O     1 
HETATM 5403 O O     . HOH J 5 .   ? 14.982  56.960 8.429   1.00 39.82 ? 2539 HOH A O     1 
HETATM 5404 O O     . HOH J 5 .   ? 8.927   26.416 22.213  1.00 26.28 ? 2545 HOH A O     1 
HETATM 5405 O O     . HOH J 5 .   ? -2.480  16.245 20.818  1.00 39.33 ? 2547 HOH A O     1 
HETATM 5406 O O     . HOH J 5 .   ? -7.705  20.124 42.964  1.00 32.10 ? 2552 HOH A O     1 
HETATM 5407 O O     . HOH J 5 .   ? 6.118   51.634 12.596  1.00 29.09 ? 2553 HOH A O     1 
HETATM 5408 O O     . HOH J 5 .   ? -6.726  52.585 29.911  1.00 29.60 ? 2554 HOH A O     1 
HETATM 5409 O O     . HOH J 5 .   ? -9.886  46.582 33.905  1.00 33.81 ? 2555 HOH A O     1 
HETATM 5410 O O     . HOH J 5 .   ? -1.983  57.161 29.433  1.00 25.93 ? 2556 HOH A O     1 
HETATM 5411 O O     . HOH J 5 .   ? -6.346  14.002 14.101  1.00 43.11 ? 2560 HOH A O     1 
HETATM 5412 O O     . HOH J 5 .   ? 6.077   59.350 34.251  1.00 37.85 ? 2561 HOH A O     1 
HETATM 5413 O O     . HOH J 5 .   ? 7.728   56.379 38.587  1.00 28.22 ? 2562 HOH A O     1 
HETATM 5414 O O     . HOH J 5 .   ? -0.453  52.154 11.094  1.00 25.64 ? 2572 HOH A O     1 
HETATM 5415 O O     . HOH J 5 .   ? 0.883   61.153 8.890   1.00 26.23 ? 2574 HOH A O     1 
HETATM 5416 O O     . HOH J 5 .   ? 2.741   62.903 9.271   1.00 31.51 ? 2576 HOH A O     1 
HETATM 5417 O O     . HOH J 5 .   ? 5.584   62.863 7.344   1.00 48.92 ? 2577 HOH A O     1 
HETATM 5418 O O     . HOH J 5 .   ? 8.290   65.037 14.124  1.00 24.47 ? 2578 HOH A O     1 
HETATM 5419 O O     . HOH J 5 .   ? 10.668  63.222 10.945  1.00 31.45 ? 2579 HOH A O     1 
HETATM 5420 O O     . HOH J 5 .   ? -9.181  19.641 16.203  1.00 49.84 ? 2585 HOH A O     1 
HETATM 5421 O O     . HOH J 5 .   ? -3.324  18.171 23.820  1.00 34.43 ? 2589 HOH A O     1 
HETATM 5422 O O     . HOH J 5 .   ? 17.707  54.818 31.381  1.00 39.73 ? 2597 HOH A O     1 
HETATM 5423 O O     . HOH J 5 .   ? 18.564  14.297 16.646  1.00 31.59 ? 2598 HOH A O     1 
HETATM 5424 O O     . HOH J 5 .   ? 1.125   7.927  0.651   1.00 41.90 ? 2611 HOH A O     1 
HETATM 5425 O O     . HOH J 5 .   ? 18.917  51.822 51.884  1.00 38.61 ? 2615 HOH A O     1 
HETATM 5426 O O     . HOH J 5 .   ? 3.816   61.265 57.855  1.00 37.72 ? 2616 HOH A O     1 
HETATM 5427 O O     . HOH J 5 .   ? 6.240   50.231 64.626  1.00 42.02 ? 2617 HOH A O     1 
HETATM 5428 O O     . HOH J 5 .   ? -4.197  27.130 48.217  1.00 31.11 ? 2620 HOH A O     1 
HETATM 5429 O O     . HOH J 5 .   ? 10.959  50.266 35.366  1.00 21.63 ? 2663 HOH A O     1 
HETATM 5430 O O     . HOH J 5 .   ? -0.518  53.817 8.861   1.00 33.44 ? 2664 HOH A O     1 
HETATM 5431 O O     . HOH J 5 .   ? 0.867   53.102 58.905  1.00 28.53 ? 2669 HOH A O     1 
HETATM 5432 O O     . HOH J 5 .   ? 11.376  11.685 -3.764  1.00 43.62 ? 2670 HOH A O     1 
HETATM 5433 O O     . HOH J 5 .   ? 12.449  26.059 23.533  1.00 33.78 ? 2674 HOH A O     1 
HETATM 5434 O O     . HOH J 5 .   ? 13.469  30.909 18.709  1.00 31.93 ? 2675 HOH A O     1 
HETATM 5435 O O     . HOH J 5 .   ? 13.131  27.576 10.545  1.00 25.46 ? 2679 HOH A O     1 
HETATM 5436 O O     . HOH J 5 .   ? 13.024  52.440 63.257  1.00 28.62 ? 2680 HOH A O     1 
HETATM 5437 O O     . HOH J 5 .   ? 19.927  31.999 17.385  1.00 27.42 ? 2682 HOH A O     1 
HETATM 5438 O O     . HOH J 5 .   ? 19.212  48.326 8.448   1.00 37.72 ? 2683 HOH A O     1 
HETATM 5439 O O     . HOH J 5 .   ? 14.118  51.319 61.280  1.00 26.21 ? 2684 HOH A O     1 
HETATM 5440 O O     . HOH J 5 .   ? 39.558  44.573 26.338  1.00 41.59 ? 2685 HOH A O     1 
HETATM 5441 O O     . HOH J 5 .   ? 0.427   22.616 49.853  1.00 36.86 ? 2686 HOH A O     1 
HETATM 5442 O O     . HOH J 5 .   ? 18.403  56.572 51.933  1.00 44.20 ? 2687 HOH A O     1 
HETATM 5443 O O     . HOH J 5 .   ? 4.665   27.943 -15.907 1.00 30.52 ? 2688 HOH A O     1 
HETATM 5444 O O     . HOH J 5 .   ? 27.288  36.957 9.249   1.00 33.73 ? 2691 HOH A O     1 
HETATM 5445 O O     . HOH J 5 .   ? 9.586   42.802 9.537   1.00 27.19 ? 2693 HOH A O     1 
HETATM 5446 O O     . HOH J 5 .   ? 10.920  24.779 8.399   1.00 38.68 ? 2700 HOH A O     1 
HETATM 5447 O O     . HOH J 5 .   ? 37.715  27.061 39.870  1.00 45.77 ? 2701 HOH A O     1 
HETATM 5448 O O     . HOH J 5 .   ? 11.487  12.753 16.474  1.00 40.25 ? 2703 HOH A O     1 
HETATM 5449 O O     . HOH J 5 .   ? 3.245   18.469 -8.577  1.00 41.08 ? 2707 HOH A O     1 
HETATM 5450 O O     . HOH J 5 .   ? 0.808   63.706 57.122  1.00 42.60 ? 2708 HOH A O     1 
HETATM 5451 O O     . HOH J 5 .   ? 49.694  45.354 37.302  1.00 47.35 ? 2712 HOH A O     1 
HETATM 5452 O O     . HOH J 5 .   ? -3.948  39.885 13.114  1.00 44.77 ? 2722 HOH A O     1 
HETATM 5453 O O     . HOH J 5 .   ? -9.256  28.844 42.761  1.00 32.31 ? 2723 HOH A O     1 
HETATM 5454 O O     . HOH J 5 .   ? -1.552  21.910 48.464  1.00 39.18 ? 2726 HOH A O     1 
HETATM 5455 O O     . HOH J 5 .   ? -11.000 48.767 34.543  1.00 33.93 ? 2732 HOH A O     1 
HETATM 5456 O O     . HOH J 5 .   ? 24.422  45.309 41.517  1.00 38.15 ? 2735 HOH A O     1 
HETATM 5457 O O     . HOH J 5 .   ? 8.457   62.253 10.584  1.00 48.49 ? 2742 HOH A O     1 
HETATM 5458 O O     . HOH J 5 .   ? 39.238  25.308 46.926  1.00 38.69 ? 2748 HOH A O     1 
HETATM 5459 O O     . HOH J 5 .   ? 8.756   58.004 49.262  1.00 44.95 ? 2750 HOH A O     1 
HETATM 5460 O O     . HOH J 5 .   ? 0.326   11.711 -0.915  1.00 39.72 ? 2752 HOH A O     1 
HETATM 5461 O O     . HOH J 5 .   ? 7.422   42.002 -3.602  1.00 37.29 ? 2754 HOH A O     1 
HETATM 5462 O O     . HOH J 5 .   ? 24.113  21.090 -0.176  1.00 38.64 ? 2758 HOH A O     1 
HETATM 5463 O O     . HOH J 5 .   ? 39.603  54.275 21.327  1.00 48.42 ? 2762 HOH A O     1 
HETATM 5464 O O     . HOH J 5 .   ? 10.741  62.748 31.478  1.00 45.13 ? 2765 HOH A O     1 
HETATM 5465 O O     . HOH J 5 .   ? 17.126  17.191 18.369  1.00 45.67 ? 2767 HOH A O     1 
HETATM 5466 O O     . HOH J 5 .   ? 31.745  58.655 25.726  1.00 49.48 ? 2769 HOH A O     1 
HETATM 5467 O O     . HOH J 5 .   ? 4.410   60.089 42.934  1.00 34.25 ? 2771 HOH A O     1 
HETATM 5468 O O     . HOH J 5 .   ? 10.117  65.913 13.298  1.00 41.59 ? 2773 HOH A O     1 
HETATM 5469 O O     . HOH J 5 .   ? -0.874  19.557 -10.210 1.00 46.36 ? 2775 HOH A O     1 
HETATM 5470 O O     . HOH J 5 .   ? -5.344  49.498 23.229  1.00 40.86 ? 2779 HOH A O     1 
HETATM 5471 O O     . HOH J 5 .   ? 14.709  65.763 11.232  1.00 43.09 ? 2785 HOH A O     1 
HETATM 5472 O O     . HOH J 5 .   ? -6.147  28.463 34.678  1.00 28.09 ? 2793 HOH A O     1 
HETATM 5473 O O     . HOH J 5 .   ? 10.467  66.104 24.909  1.00 27.13 ? 2794 HOH A O     1 
HETATM 5474 O O     . HOH J 5 .   ? 9.279   54.038 41.841  1.00 35.10 ? 2796 HOH A O     1 
HETATM 5475 O O     . HOH J 5 .   ? 8.373   41.632 39.127  1.00 36.68 ? 2797 HOH A O     1 
HETATM 5476 O O     . HOH J 5 .   ? 20.752  45.656 8.416   1.00 27.68 ? 2800 HOH A O     1 
HETATM 5477 O O     . HOH J 5 .   ? 22.187  32.387 0.295   1.00 28.36 ? 2801 HOH A O     1 
HETATM 5478 O O     . HOH J 5 .   ? 19.453  64.957 24.186  1.00 30.84 ? 2802 HOH A O     1 
HETATM 5479 O O     . HOH J 5 .   ? 18.729  44.707 49.726  1.00 35.28 ? 2804 HOH A O     1 
HETATM 5480 O O     . HOH J 5 .   ? 19.969  33.966 62.730  1.00 38.37 ? 2805 HOH A O     1 
HETATM 5481 O O     . HOH J 5 .   ? 12.953  55.867 39.814  1.00 30.42 ? 2807 HOH A O     1 
HETATM 5482 O O     . HOH J 5 .   ? 36.652  33.683 41.559  1.00 36.05 ? 2810 HOH A O     1 
HETATM 5483 O O     . HOH J 5 .   ? 24.709  34.462 0.991   1.00 44.87 ? 2816 HOH A O     1 
HETATM 5484 O O     . HOH J 5 .   ? -9.731  27.470 27.177  1.00 31.99 ? 2818 HOH A O     1 
HETATM 5485 O O     . HOH J 5 .   ? 33.673  54.480 17.045  1.00 40.45 ? 2821 HOH A O     1 
HETATM 5486 O O     . HOH J 5 .   ? 39.471  27.258 60.338  1.00 44.18 ? 2822 HOH A O     1 
HETATM 5487 O O     . HOH J 5 .   ? 27.059  36.257 6.798   1.00 34.53 ? 2823 HOH A O     1 
HETATM 5488 O O     . HOH J 5 .   ? 28.136  52.772 41.493  1.00 39.78 ? 2824 HOH A O     1 
HETATM 5489 O O     . HOH J 5 .   ? -1.710  47.814 11.586  1.00 33.80 ? 2825 HOH A O     1 
HETATM 5490 O O     . HOH J 5 .   ? 24.657  51.666 42.756  1.00 37.54 ? 2827 HOH A O     1 
HETATM 5491 O O     . HOH J 5 .   ? 26.414  33.428 58.102  1.00 44.11 ? 2829 HOH A O     1 
HETATM 5492 O O     . HOH J 5 .   ? 17.617  48.524 47.768  1.00 35.17 ? 2832 HOH A O     1 
HETATM 5493 O O     . HOH J 5 .   ? 6.095   15.043 22.574  1.00 38.68 ? 2833 HOH A O     1 
HETATM 5494 O O     . HOH J 5 .   ? -3.906  51.837 31.005  1.00 36.76 ? 2834 HOH A O     1 
HETATM 5495 O O     . HOH J 5 .   ? 11.072  13.381 21.858  1.00 49.57 ? 2835 HOH A O     1 
HETATM 5496 O O     . HOH J 5 .   ? -6.364  54.071 34.426  1.00 32.60 ? 2837 HOH A O     1 
HETATM 5497 O O     . HOH J 5 .   ? 24.908  14.320 2.804   1.00 45.68 ? 2840 HOH A O     1 
HETATM 5498 O O     . HOH J 5 .   ? -1.005  58.191 15.632  1.00 40.01 ? 2847 HOH A O     1 
HETATM 5499 O O     . HOH J 5 .   ? 25.980  27.799 3.031   1.00 48.46 ? 2848 HOH A O     1 
HETATM 5500 O O     . HOH J 5 .   ? 20.495  66.821 20.436  1.00 45.07 ? 2853 HOH A O     1 
HETATM 5501 O O     . HOH J 5 .   ? 2.968   19.458 31.355  1.00 44.01 ? 2855 HOH A O     1 
HETATM 5502 O O     . HOH J 5 .   ? 49.295  46.707 53.058  1.00 44.42 ? 2861 HOH A O     1 
HETATM 5503 O O     . HOH J 5 .   ? -13.075 25.600 20.192  1.00 40.63 ? 2884 HOH A O     1 
HETATM 5504 O O     . HOH J 5 .   ? -7.544  34.534 15.793  1.00 47.90 ? 2885 HOH A O     1 
HETATM 5505 O O     . HOH J 5 .   ? 3.551   34.726 -10.942 1.00 38.39 ? 2886 HOH A O     1 
HETATM 5506 O O     . HOH J 5 .   ? 28.053  33.459 4.010   1.00 42.32 ? 2888 HOH A O     1 
HETATM 5507 O O     . HOH J 5 .   ? 17.601  35.907 64.081  1.00 48.56 ? 2889 HOH A O     1 
HETATM 5508 O O     . HOH J 5 .   ? -10.379 39.110 42.458  1.00 44.19 ? 2892 HOH A O     1 
HETATM 5509 O O     . HOH J 5 .   ? 22.871  36.964 52.964  1.00 38.74 ? 2899 HOH A O     1 
HETATM 5510 O O     . HOH J 5 .   ? -5.554  31.600 11.948  1.00 36.39 ? 2903 HOH A O     1 
HETATM 5511 O O     . HOH J 5 .   ? 27.761  61.505 29.486  1.00 41.91 ? 2911 HOH A O     1 
HETATM 5512 O O     . HOH J 5 .   ? 12.007  15.793 -9.858  1.00 38.08 ? 2914 HOH A O     1 
HETATM 5513 O O     . HOH J 5 .   ? 12.478  24.186 10.273  1.00 33.75 ? 2918 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   7   7   DG  G   P . n 
A 1 2   DC  2   8   8   DC  C   P . n 
A 1 3   DA  3   9   9   DA  A   P . n 
A 1 4   DT  4   10  10  DT  T   P . n 
A 1 5   DG  5   11  11  DG  G   P . n 
A 1 6   DA  6   12  12  DA  A   P . n 
A 1 7   DT  7   13  13  DT  T   P . n 
A 1 8   DG  8   14  14  DG  G   P . n 
A 1 9   DC  9   15  15  DC  C   P . n 
A 1 10  2DT 10  16  16  2DT 2DT P . n 
B 2 1   DA  1   18  18  DA  A   T . n 
B 2 2   DG  2   19  19  DG  G   T . n 
B 2 3   DC  3   20  20  DC  C   T . n 
B 2 4   DA  4   21  21  DA  A   T . n 
B 2 5   DT  5   22  22  DT  T   T . n 
B 2 6   DC  6   23  23  DC  C   T . n 
B 2 7   DA  7   24  24  DA  A   T . n 
B 2 8   DT  8   25  25  DT  T   T . n 
B 2 9   DG  9   26  26  DG  G   T . n 
B 2 10  DC  10  27  27  DC  C   T . n 
C 3 1   ALA 1   297 297 ALA ALA A . n 
C 3 2   ALA 2   298 298 ALA ALA A . n 
C 3 3   MET 3   299 299 MET MET A . n 
C 3 4   ALA 4   300 300 ALA ALA A . n 
C 3 5   PHE 5   301 301 PHE PHE A . n 
C 3 6   THR 6   302 302 THR THR A . n 
C 3 7   LEU 7   303 303 LEU LEU A . n 
C 3 8   ALA 8   304 304 ALA ALA A . n 
C 3 9   ASP 9   305 305 ASP ASP A . n 
C 3 10  ARG 10  306 306 ARG ARG A . n 
C 3 11  VAL 11  307 307 VAL VAL A . n 
C 3 12  THR 12  308 308 THR THR A . n 
C 3 13  GLU 13  309 309 GLU GLU A . n 
C 3 14  GLU 14  310 310 GLU GLU A . n 
C 3 15  MET 15  311 311 MET MET A . n 
C 3 16  LEU 16  312 312 LEU LEU A . n 
C 3 17  ALA 17  313 313 ALA ALA A . n 
C 3 18  ASP 18  314 314 ASP ASP A . n 
C 3 19  LYS 19  315 315 LYS LYS A . n 
C 3 20  ALA 20  316 316 ALA ALA A . n 
C 3 21  ALA 21  317 317 ALA ALA A . n 
C 3 22  LEU 22  318 318 LEU LEU A . n 
C 3 23  VAL 23  319 319 VAL VAL A . n 
C 3 24  VAL 24  320 320 VAL VAL A . n 
C 3 25  GLU 25  321 321 GLU GLU A . n 
C 3 26  VAL 26  322 322 VAL VAL A . n 
C 3 27  VAL 27  323 323 VAL VAL A . n 
C 3 28  GLU 28  324 324 GLU GLU A . n 
C 3 29  GLU 29  325 325 GLU GLU A . n 
C 3 30  ASN 30  326 326 ASN ASN A . n 
C 3 31  TYR 31  327 327 TYR TYR A . n 
C 3 32  HIS 32  328 328 HIS HIS A . n 
C 3 33  ASP 33  329 329 ASP ASP A . n 
C 3 34  ALA 34  330 330 ALA ALA A . n 
C 3 35  PRO 35  331 331 PRO PRO A . n 
C 3 36  ILE 36  332 332 ILE ILE A . n 
C 3 37  VAL 37  333 333 VAL VAL A . n 
C 3 38  GLY 38  334 334 GLY GLY A . n 
C 3 39  ILE 39  335 335 ILE ILE A . n 
C 3 40  ALA 40  336 336 ALA ALA A . n 
C 3 41  VAL 41  337 337 VAL VAL A . n 
C 3 42  VAL 42  338 338 VAL VAL A . n 
C 3 43  ASN 43  339 339 ASN ASN A . n 
C 3 44  GLU 44  340 340 GLU GLU A . n 
C 3 45  HIS 45  341 341 HIS HIS A . n 
C 3 46  GLY 46  342 342 GLY GLY A . n 
C 3 47  ARG 47  343 343 ARG ARG A . n 
C 3 48  PHE 48  344 344 PHE PHE A . n 
C 3 49  PHE 49  345 345 PHE PHE A . n 
C 3 50  LEU 50  346 346 LEU LEU A . n 
C 3 51  ARG 51  347 347 ARG ARG A . n 
C 3 52  PRO 52  348 348 PRO PRO A . n 
C 3 53  GLU 53  349 349 GLU GLU A . n 
C 3 54  THR 54  350 350 THR THR A . n 
C 3 55  ALA 55  351 351 ALA ALA A . n 
C 3 56  LEU 56  352 352 LEU LEU A . n 
C 3 57  ALA 57  353 353 ALA ALA A . n 
C 3 58  ASP 58  354 354 ASP ASP A . n 
C 3 59  PRO 59  355 355 PRO PRO A . n 
C 3 60  GLN 60  356 356 GLN GLN A . n 
C 3 61  PHE 61  357 357 PHE PHE A . n 
C 3 62  VAL 62  358 358 VAL VAL A . n 
C 3 63  ALA 63  359 359 ALA ALA A . n 
C 3 64  TRP 64  360 360 TRP TRP A . n 
C 3 65  LEU 65  361 361 LEU LEU A . n 
C 3 66  GLY 66  362 362 GLY GLY A . n 
C 3 67  ASP 67  363 363 ASP ASP A . n 
C 3 68  GLU 68  364 364 GLU GLU A . n 
C 3 69  THR 69  365 365 THR THR A . n 
C 3 70  LYS 70  366 366 LYS LYS A . n 
C 3 71  LYS 71  367 367 LYS LYS A . n 
C 3 72  LYS 72  368 368 LYS LYS A . n 
C 3 73  SER 73  369 369 SER SER A . n 
C 3 74  MET 74  370 370 MET MET A . n 
C 3 75  PHE 75  371 371 PHE PHE A . n 
C 3 76  ASP 76  372 372 ASP ASP A . n 
C 3 77  SER 77  373 373 SER SER A . n 
C 3 78  LYS 78  374 374 LYS LYS A . n 
C 3 79  ARG 79  375 375 ARG ARG A . n 
C 3 80  ALA 80  376 376 ALA ALA A . n 
C 3 81  ALA 81  377 377 ALA ALA A . n 
C 3 82  VAL 82  378 378 VAL VAL A . n 
C 3 83  ALA 83  379 379 ALA ALA A . n 
C 3 84  LEU 84  380 380 LEU LEU A . n 
C 3 85  LYS 85  381 381 LYS LYS A . n 
C 3 86  TRP 86  382 382 TRP TRP A . n 
C 3 87  LYS 87  383 383 LYS LYS A . n 
C 3 88  GLY 88  384 384 GLY GLY A . n 
C 3 89  ILE 89  385 385 ILE ILE A . n 
C 3 90  GLU 90  386 386 GLU GLU A . n 
C 3 91  LEU 91  387 387 LEU LEU A . n 
C 3 92  CYS 92  388 388 CYS CYS A . n 
C 3 93  GLY 93  389 389 GLY GLY A . n 
C 3 94  VAL 94  390 390 VAL VAL A . n 
C 3 95  SER 95  391 391 SER SER A . n 
C 3 96  PHE 96  392 392 PHE PHE A . n 
C 3 97  ASP 97  393 393 ASP ASP A . n 
C 3 98  LEU 98  394 394 LEU LEU A . n 
C 3 99  LEU 99  395 395 LEU LEU A . n 
C 3 100 LEU 100 396 396 LEU LEU A . n 
C 3 101 ALA 101 397 397 ALA ALA A . n 
C 3 102 ALA 102 398 398 ALA ALA A . n 
C 3 103 TYR 103 399 399 TYR TYR A . n 
C 3 104 LEU 104 400 400 LEU LEU A . n 
C 3 105 LEU 105 401 401 LEU LEU A . n 
C 3 106 ASP 106 402 402 ASP ASP A . n 
C 3 107 PRO 107 403 403 PRO PRO A . n 
C 3 108 ALA 108 404 404 ALA ALA A . n 
C 3 109 GLN 109 405 405 GLN GLN A . n 
C 3 110 GLY 110 406 406 GLY GLY A . n 
C 3 111 VAL 111 407 407 VAL VAL A . n 
C 3 112 ASP 112 408 408 ASP ASP A . n 
C 3 113 ASP 113 409 409 ASP ASP A . n 
C 3 114 VAL 114 410 410 VAL VAL A . n 
C 3 115 ARG 115 411 411 ARG ARG A . n 
C 3 116 ALA 116 412 412 ALA ALA A . n 
C 3 117 ALA 117 413 413 ALA ALA A . n 
C 3 118 ALA 118 414 414 ALA ALA A . n 
C 3 119 LYS 119 415 415 LYS LYS A . n 
C 3 120 MET 120 416 416 MET MET A . n 
C 3 121 LYS 121 417 417 LYS LYS A . n 
C 3 122 GLN 122 418 418 GLN GLN A . n 
C 3 123 TYR 123 419 419 TYR TYR A . n 
C 3 124 GLU 124 420 420 GLU GLU A . n 
C 3 125 ALA 125 421 421 ALA ALA A . n 
C 3 126 VAL 126 422 422 VAL VAL A . n 
C 3 127 ARG 127 423 423 ARG ARG A . n 
C 3 128 PRO 128 424 424 PRO PRO A . n 
C 3 129 ASP 129 425 425 ASP ASP A . n 
C 3 130 GLU 130 426 426 GLU GLU A . n 
C 3 131 ALA 131 427 427 ALA ALA A . n 
C 3 132 VAL 132 428 428 VAL VAL A . n 
C 3 133 TYR 133 429 429 TYR TYR A . n 
C 3 134 GLY 134 430 430 GLY GLY A . n 
C 3 135 LYS 135 431 431 LYS LYS A . n 
C 3 136 GLY 136 432 432 GLY GLY A . n 
C 3 137 ALA 137 433 433 ALA ALA A . n 
C 3 138 LYS 138 434 434 LYS LYS A . n 
C 3 139 ARG 139 435 435 ARG ARG A . n 
C 3 140 ALA 140 436 436 ALA ALA A . n 
C 3 141 VAL 141 437 437 VAL VAL A . n 
C 3 142 PRO 142 438 438 PRO PRO A . n 
C 3 143 ASP 143 439 439 ASP ASP A . n 
C 3 144 GLU 144 440 440 GLU GLU A . n 
C 3 145 PRO 145 441 441 PRO PRO A . n 
C 3 146 VAL 146 442 442 VAL VAL A . n 
C 3 147 LEU 147 443 443 LEU LEU A . n 
C 3 148 ALA 148 444 444 ALA ALA A . n 
C 3 149 GLU 149 445 445 GLU GLU A . n 
C 3 150 HIS 150 446 446 HIS HIS A . n 
C 3 151 LEU 151 447 447 LEU LEU A . n 
C 3 152 VAL 152 448 448 VAL VAL A . n 
C 3 153 ARG 153 449 449 ARG ARG A . n 
C 3 154 LYS 154 450 450 LYS LYS A . n 
C 3 155 ALA 155 451 451 ALA ALA A . n 
C 3 156 ALA 156 452 452 ALA ALA A . n 
C 3 157 ALA 157 453 453 ALA ALA A . n 
C 3 158 ILE 158 454 454 ILE ILE A . n 
C 3 159 TRP 159 455 455 TRP TRP A . n 
C 3 160 GLU 160 456 456 GLU GLU A . n 
C 3 161 LEU 161 457 457 LEU LEU A . n 
C 3 162 GLU 162 458 458 GLU GLU A . n 
C 3 163 ARG 163 459 459 ARG ARG A . n 
C 3 164 PRO 164 460 460 PRO PRO A . n 
C 3 165 PHE 165 461 461 PHE PHE A . n 
C 3 166 LEU 166 462 462 LEU LEU A . n 
C 3 167 ASP 167 463 463 ASP ASP A . n 
C 3 168 GLU 168 464 464 GLU GLU A . n 
C 3 169 LEU 169 465 465 LEU LEU A . n 
C 3 170 ARG 170 466 466 ARG ARG A . n 
C 3 171 ARG 171 467 467 ARG ARG A . n 
C 3 172 ASN 172 468 468 ASN ASN A . n 
C 3 173 GLU 173 469 469 GLU GLU A . n 
C 3 174 GLN 174 470 470 GLN GLN A . n 
C 3 175 ASP 175 471 471 ASP ASP A . n 
C 3 176 ARG 176 472 472 ARG ARG A . n 
C 3 177 LEU 177 473 473 LEU LEU A . n 
C 3 178 LEU 178 474 474 LEU LEU A . n 
C 3 179 VAL 179 475 475 VAL VAL A . n 
C 3 180 GLU 180 476 476 GLU GLU A . n 
C 3 181 LEU 181 477 477 LEU LEU A . n 
C 3 182 GLU 182 478 478 GLU GLU A . n 
C 3 183 GLN 183 479 479 GLN GLN A . n 
C 3 184 PRO 184 480 480 PRO PRO A . n 
C 3 185 LEU 185 481 481 LEU LEU A . n 
C 3 186 SER 186 482 482 SER SER A . n 
C 3 187 SER 187 483 483 SER SER A . n 
C 3 188 ILE 188 484 484 ILE ILE A . n 
C 3 189 LEU 189 485 485 LEU LEU A . n 
C 3 190 ALA 190 486 486 ALA ALA A . n 
C 3 191 GLU 191 487 487 GLU GLU A . n 
C 3 192 MET 192 488 488 MET MET A . n 
C 3 193 GLU 193 489 489 GLU GLU A . n 
C 3 194 PHE 194 490 490 PHE PHE A . n 
C 3 195 ALA 195 491 491 ALA ALA A . n 
C 3 196 GLY 196 492 492 GLY GLY A . n 
C 3 197 VAL 197 493 493 VAL VAL A . n 
C 3 198 LYS 198 494 494 LYS LYS A . n 
C 3 199 VAL 199 495 495 VAL VAL A . n 
C 3 200 ASP 200 496 496 ASP ASP A . n 
C 3 201 THR 201 497 497 THR THR A . n 
C 3 202 LYS 202 498 498 LYS LYS A . n 
C 3 203 ARG 203 499 499 ARG ARG A . n 
C 3 204 LEU 204 500 500 LEU LEU A . n 
C 3 205 GLU 205 501 501 GLU GLU A . n 
C 3 206 GLN 206 502 502 GLN GLN A . n 
C 3 207 MET 207 503 503 MET MET A . n 
C 3 208 GLY 208 504 504 GLY GLY A . n 
C 3 209 LYS 209 505 505 LYS LYS A . n 
C 3 210 GLU 210 506 506 GLU GLU A . n 
C 3 211 LEU 211 507 507 LEU LEU A . n 
C 3 212 ALA 212 508 508 ALA ALA A . n 
C 3 213 GLU 213 509 509 GLU GLU A . n 
C 3 214 GLN 214 510 510 GLN GLN A . n 
C 3 215 LEU 215 511 511 LEU LEU A . n 
C 3 216 GLY 216 512 512 GLY GLY A . n 
C 3 217 THR 217 513 513 THR THR A . n 
C 3 218 VAL 218 514 514 VAL VAL A . n 
C 3 219 GLU 219 515 515 GLU GLU A . n 
C 3 220 GLN 220 516 516 GLN GLN A . n 
C 3 221 ARG 221 517 517 ARG ARG A . n 
C 3 222 ILE 222 518 518 ILE ILE A . n 
C 3 223 TYR 223 519 519 TYR TYR A . n 
C 3 224 GLU 224 520 520 GLU GLU A . n 
C 3 225 LEU 225 521 521 LEU LEU A . n 
C 3 226 ALA 226 522 522 ALA ALA A . n 
C 3 227 GLY 227 523 523 GLY GLY A . n 
C 3 228 GLN 228 524 524 GLN GLN A . n 
C 3 229 GLU 229 525 525 GLU GLU A . n 
C 3 230 PHE 230 526 526 PHE PHE A . n 
C 3 231 ASN 231 527 527 ASN ASN A . n 
C 3 232 ILE 232 528 528 ILE ILE A . n 
C 3 233 ASN 233 529 529 ASN ASN A . n 
C 3 234 SER 234 530 530 SER SER A . n 
C 3 235 PRO 235 531 531 PRO PRO A . n 
C 3 236 LYS 236 532 532 LYS LYS A . n 
C 3 237 GLN 237 533 533 GLN GLN A . n 
C 3 238 LEU 238 534 534 LEU LEU A . n 
C 3 239 GLY 239 535 535 GLY GLY A . n 
C 3 240 VAL 240 536 536 VAL VAL A . n 
C 3 241 ILE 241 537 537 ILE ILE A . n 
C 3 242 LEU 242 538 538 LEU LEU A . n 
C 3 243 PHE 243 539 539 PHE PHE A . n 
C 3 244 GLU 244 540 540 GLU GLU A . n 
C 3 245 LYS 245 541 541 LYS LYS A . n 
C 3 246 LEU 246 542 542 LEU LEU A . n 
C 3 247 GLN 247 543 543 GLN GLN A . n 
C 3 248 LEU 248 544 544 LEU LEU A . n 
C 3 249 PRO 249 545 545 PRO PRO A . n 
C 3 250 VAL 250 546 546 VAL VAL A . n 
C 3 251 LEU 251 547 547 LEU LEU A . n 
C 3 252 LYS 252 548 548 LYS LYS A . n 
C 3 253 LYS 253 549 549 LYS LYS A . n 
C 3 254 THR 254 550 550 THR THR A . n 
C 3 255 LYS 255 551 551 LYS LYS A . n 
C 3 256 THR 256 552 552 THR THR A . n 
C 3 257 GLY 257 553 553 GLY GLY A . n 
C 3 258 TYR 258 554 554 TYR TYR A . n 
C 3 259 SER 259 555 555 SER SER A . n 
C 3 260 THR 260 556 556 THR THR A . n 
C 3 261 SER 261 557 557 SER SER A . n 
C 3 262 ALA 262 558 558 ALA ALA A . n 
C 3 263 ASP 263 559 559 ASP ASP A . n 
C 3 264 VAL 264 560 560 VAL VAL A . n 
C 3 265 LEU 265 561 561 LEU LEU A . n 
C 3 266 GLU 266 562 562 GLU GLU A . n 
C 3 267 LYS 267 563 563 LYS LYS A . n 
C 3 268 LEU 268 564 564 LEU LEU A . n 
C 3 269 ALA 269 565 565 ALA ALA A . n 
C 3 270 PRO 270 566 566 PRO PRO A . n 
C 3 271 TYR 271 567 567 TYR TYR A . n 
C 3 272 HIS 272 568 568 HIS HIS A . n 
C 3 273 GLU 273 569 569 GLU GLU A . n 
C 3 274 ILE 274 570 570 ILE ILE A . n 
C 3 275 VAL 275 571 571 VAL VAL A . n 
C 3 276 GLU 276 572 572 GLU GLU A . n 
C 3 277 ASN 277 573 573 ASN ASN A . n 
C 3 278 ILE 278 574 574 ILE ILE A . n 
C 3 279 LEU 279 575 575 LEU LEU A . n 
C 3 280 HIS 280 576 576 HIS HIS A . n 
C 3 281 TYR 281 577 577 TYR TYR A . n 
C 3 282 ARG 282 578 578 ARG ARG A . n 
C 3 283 GLN 283 579 579 GLN GLN A . n 
C 3 284 LEU 284 580 580 LEU LEU A . n 
C 3 285 GLY 285 581 581 GLY GLY A . n 
C 3 286 LYS 286 582 582 LYS LYS A . n 
C 3 287 LEU 287 583 583 LEU LEU A . n 
C 3 288 GLN 288 584 584 GLN GLN A . n 
C 3 289 SER 289 585 585 SER SER A . n 
C 3 290 THR 290 586 586 THR THR A . n 
C 3 291 TYR 291 587 587 TYR TYR A . n 
C 3 292 ILE 292 588 588 ILE ILE A . n 
C 3 293 GLU 293 589 589 GLU GLU A . n 
C 3 294 GLY 294 590 590 GLY GLY A . n 
C 3 295 LEU 295 591 591 LEU LEU A . n 
C 3 296 LEU 296 592 592 LEU LEU A . n 
C 3 297 LYS 297 593 593 LYS LYS A . n 
C 3 298 VAL 298 594 594 VAL VAL A . n 
C 3 299 VAL 299 595 595 VAL VAL A . n 
C 3 300 ARG 300 596 596 ARG ARG A . n 
C 3 301 PRO 301 597 597 PRO PRO A . n 
C 3 302 ASP 302 598 598 ASP ASP A . n 
C 3 303 THR 303 599 599 THR THR A . n 
C 3 304 LYS 304 600 600 LYS LYS A . n 
C 3 305 LYS 305 601 601 LYS LYS A . n 
C 3 306 VAL 306 602 602 VAL VAL A . n 
C 3 307 HIS 307 603 603 HIS HIS A . n 
C 3 308 THR 308 604 604 THR THR A . n 
C 3 309 ILE 309 605 605 ILE ILE A . n 
C 3 310 PHE 310 606 606 PHE PHE A . n 
C 3 311 ASN 311 607 607 ASN ASN A . n 
C 3 312 GLN 312 608 608 GLN GLN A . n 
C 3 313 ALA 313 609 609 ALA ALA A . n 
C 3 314 LEU 314 610 610 LEU LEU A . n 
C 3 315 THR 315 611 611 THR THR A . n 
C 3 316 GLN 316 612 612 GLN GLN A . n 
C 3 317 THR 317 613 613 THR THR A . n 
C 3 318 GLY 318 614 614 GLY GLY A . n 
C 3 319 ARG 319 615 615 ARG ARG A . n 
C 3 320 LEU 320 616 616 LEU LEU A . n 
C 3 321 SER 321 617 617 SER SER A . n 
C 3 322 SER 322 618 618 SER SER A . n 
C 3 323 THR 323 619 619 THR THR A . n 
C 3 324 GLU 324 620 620 GLU GLU A . n 
C 3 325 PRO 325 621 621 PRO PRO A . n 
C 3 326 ASN 326 622 622 ASN ASN A . n 
C 3 327 LEU 327 623 623 LEU LEU A . n 
C 3 328 GLN 328 624 624 GLN GLN A . n 
C 3 329 ASN 329 625 625 ASN ASN A . n 
C 3 330 ILE 330 626 626 ILE ILE A . n 
C 3 331 PRO 331 627 627 PRO PRO A . n 
C 3 332 ILE 332 628 628 ILE ILE A . n 
C 3 333 ARG 333 629 629 ARG ARG A . n 
C 3 334 LEU 334 630 630 LEU LEU A . n 
C 3 335 GLU 335 631 631 GLU GLU A . n 
C 3 336 GLU 336 632 632 GLU GLU A . n 
C 3 337 GLY 337 633 633 GLY GLY A . n 
C 3 338 ARG 338 634 634 ARG ARG A . n 
C 3 339 LYS 339 635 635 LYS LYS A . n 
C 3 340 ILE 340 636 636 ILE ILE A . n 
C 3 341 ARG 341 637 637 ARG ARG A . n 
C 3 342 GLN 342 638 638 GLN GLN A . n 
C 3 343 ALA 343 639 639 ALA ALA A . n 
C 3 344 PHE 344 640 640 PHE PHE A . n 
C 3 345 VAL 345 641 641 VAL VAL A . n 
C 3 346 PRO 346 642 642 PRO PRO A . n 
C 3 347 SER 347 643 643 SER SER A . n 
C 3 348 GLU 348 644 644 GLU GLU A . n 
C 3 349 SER 349 645 645 SER SER A . n 
C 3 350 ASP 350 646 646 ASP ASP A . n 
C 3 351 TRP 351 647 647 TRP TRP A . n 
C 3 352 LEU 352 648 648 LEU LEU A . n 
C 3 353 ILE 353 649 649 ILE ILE A . n 
C 3 354 PHE 354 650 650 PHE PHE A . n 
C 3 355 ALA 355 651 651 ALA ALA A . n 
C 3 356 ALA 356 652 652 ALA ALA A . n 
C 3 357 ASP 357 653 653 ASP ASP A . n 
C 3 358 TYR 358 654 654 TYR TYR A . n 
C 3 359 SER 359 655 655 SER SER A . n 
C 3 360 GLN 360 656 656 GLN GLN A . n 
C 3 361 ILE 361 657 657 ILE ILE A . n 
C 3 362 GLU 362 658 658 GLU GLU A . n 
C 3 363 LEU 363 659 659 LEU LEU A . n 
C 3 364 ARG 364 660 660 ARG ARG A . n 
C 3 365 VAL 365 661 661 VAL VAL A . n 
C 3 366 LEU 366 662 662 LEU LEU A . n 
C 3 367 ALA 367 663 663 ALA ALA A . n 
C 3 368 HIS 368 664 664 HIS HIS A . n 
C 3 369 ILE 369 665 665 ILE ILE A . n 
C 3 370 ALA 370 666 666 ALA ALA A . n 
C 3 371 GLU 371 667 667 GLU GLU A . n 
C 3 372 ASP 372 668 668 ASP ASP A . n 
C 3 373 ASP 373 669 669 ASP ASP A . n 
C 3 374 ASN 374 670 670 ASN ASN A . n 
C 3 375 LEU 375 671 671 LEU LEU A . n 
C 3 376 MET 376 672 672 MET MET A . n 
C 3 377 GLU 377 673 673 GLU GLU A . n 
C 3 378 ALA 378 674 674 ALA ALA A . n 
C 3 379 PHE 379 675 675 PHE PHE A . n 
C 3 380 ARG 380 676 676 ARG ARG A . n 
C 3 381 ARG 381 677 677 ARG ARG A . n 
C 3 382 ASP 382 678 678 ASP ASP A . n 
C 3 383 LEU 383 679 679 LEU LEU A . n 
C 3 384 ASP 384 680 680 ASP ASP A . n 
C 3 385 ILE 385 681 681 ILE ILE A . n 
C 3 386 HIS 386 682 682 HIS HIS A . n 
C 3 387 THR 387 683 683 THR THR A . n 
C 3 388 LYS 388 684 684 LYS LYS A . n 
C 3 389 THR 389 685 685 THR THR A . n 
C 3 390 ALA 390 686 686 ALA ALA A . n 
C 3 391 MET 391 687 687 MET MET A . n 
C 3 392 ASP 392 688 688 ASP ASP A . n 
C 3 393 ILE 393 689 689 ILE ILE A . n 
C 3 394 PHE 394 690 690 PHE PHE A . n 
C 3 395 GLN 395 691 691 GLN GLN A . n 
C 3 396 VAL 396 692 692 VAL VAL A . n 
C 3 397 SER 397 693 693 SER SER A . n 
C 3 398 GLU 398 694 694 GLU GLU A . n 
C 3 399 ASP 399 695 695 ASP ASP A . n 
C 3 400 GLU 400 696 696 GLU GLU A . n 
C 3 401 VAL 401 697 697 VAL VAL A . n 
C 3 402 THR 402 698 698 THR THR A . n 
C 3 403 PRO 403 699 699 PRO PRO A . n 
C 3 404 ASN 404 700 700 ASN ASN A . n 
C 3 405 MET 405 701 701 MET MET A . n 
C 3 406 ARG 406 702 702 ARG ARG A . n 
C 3 407 ARG 407 703 703 ARG ARG A . n 
C 3 408 GLN 408 704 704 GLN GLN A . n 
C 3 409 ALA 409 705 705 ALA ALA A . n 
C 3 410 LYS 410 706 706 LYS LYS A . n 
C 3 411 ALA 411 707 707 ALA ALA A . n 
C 3 412 VAL 412 708 708 VAL VAL A . n 
C 3 413 ASN 413 709 709 ASN ASN A . n 
C 3 414 PHE 414 710 710 PHE PHE A . n 
C 3 415 GLY 415 711 711 GLY GLY A . n 
C 3 416 ILE 416 712 712 ILE ILE A . n 
C 3 417 VAL 417 713 713 VAL VAL A . n 
C 3 418 TYR 418 714 714 TYR TYR A . n 
C 3 419 GLY 419 715 715 GLY GLY A . n 
C 3 420 ILE 420 716 716 ILE ILE A . n 
C 3 421 SER 421 717 717 SER SER A . n 
C 3 422 ASP 422 718 718 ASP ASP A . n 
C 3 423 TYR 423 719 719 TYR TYR A . n 
C 3 424 GLY 424 720 720 GLY GLY A . n 
C 3 425 LEU 425 721 721 LEU LEU A . n 
C 3 426 ALA 426 722 722 ALA ALA A . n 
C 3 427 GLN 427 723 723 GLN GLN A . n 
C 3 428 ASN 428 724 724 ASN ASN A . n 
C 3 429 LEU 429 725 725 LEU LEU A . n 
C 3 430 ASN 430 726 726 ASN ASN A . n 
C 3 431 ILE 431 727 727 ILE ILE A . n 
C 3 432 SER 432 728 728 SER SER A . n 
C 3 433 ARG 433 729 729 ARG ARG A . n 
C 3 434 LYS 434 730 730 LYS LYS A . n 
C 3 435 GLU 435 731 731 GLU GLU A . n 
C 3 436 ALA 436 732 732 ALA ALA A . n 
C 3 437 ALA 437 733 733 ALA ALA A . n 
C 3 438 GLU 438 734 734 GLU GLU A . n 
C 3 439 PHE 439 735 735 PHE PHE A . n 
C 3 440 ILE 440 736 736 ILE ILE A . n 
C 3 441 GLU 441 737 737 GLU GLU A . n 
C 3 442 ARG 442 738 738 ARG ARG A . n 
C 3 443 TYR 443 739 739 TYR TYR A . n 
C 3 444 PHE 444 740 740 PHE PHE A . n 
C 3 445 GLU 445 741 741 GLU GLU A . n 
C 3 446 SER 446 742 742 SER SER A . n 
C 3 447 PHE 447 743 743 PHE PHE A . n 
C 3 448 PRO 448 744 744 PRO PRO A . n 
C 3 449 GLY 449 745 745 GLY GLY A . n 
C 3 450 VAL 450 746 746 VAL VAL A . n 
C 3 451 LYS 451 747 747 LYS LYS A . n 
C 3 452 ARG 452 748 748 ARG ARG A . n 
C 3 453 TYR 453 749 749 TYR TYR A . n 
C 3 454 MET 454 750 750 MET MET A . n 
C 3 455 GLU 455 751 751 GLU GLU A . n 
C 3 456 ASN 456 752 752 ASN ASN A . n 
C 3 457 ILE 457 753 753 ILE ILE A . n 
C 3 458 VAL 458 754 754 VAL VAL A . n 
C 3 459 GLN 459 755 755 GLN GLN A . n 
C 3 460 GLU 460 756 756 GLU GLU A . n 
C 3 461 ALA 461 757 757 ALA ALA A . n 
C 3 462 LYS 462 758 758 LYS LYS A . n 
C 3 463 GLN 463 759 759 GLN GLN A . n 
C 3 464 LYS 464 760 760 LYS LYS A . n 
C 3 465 GLY 465 761 761 GLY GLY A . n 
C 3 466 TYR 466 762 762 TYR TYR A . n 
C 3 467 VAL 467 763 763 VAL VAL A . n 
C 3 468 THR 468 764 764 THR THR A . n 
C 3 469 THR 469 765 765 THR THR A . n 
C 3 470 LEU 470 766 766 LEU LEU A . n 
C 3 471 LEU 471 767 767 LEU LEU A . n 
C 3 472 HIS 472 768 768 HIS HIS A . n 
C 3 473 ARG 473 769 769 ARG ARG A . n 
C 3 474 ARG 474 770 770 ARG ARG A . n 
C 3 475 ARG 475 771 771 ARG ARG A . n 
C 3 476 TYR 476 772 772 TYR TYR A . n 
C 3 477 LEU 477 773 773 LEU LEU A . n 
C 3 478 PRO 478 774 774 PRO PRO A . n 
C 3 479 ASP 479 775 775 ASP ASP A . n 
C 3 480 ILE 480 776 776 ILE ILE A . n 
C 3 481 THR 481 777 777 THR THR A . n 
C 3 482 SER 482 778 778 SER SER A . n 
C 3 483 ARG 483 779 779 ARG ARG A . n 
C 3 484 ASN 484 780 780 ASN ASN A . n 
C 3 485 PHE 485 781 781 PHE PHE A . n 
C 3 486 ASN 486 782 782 ASN ASN A . n 
C 3 487 VAL 487 783 783 VAL VAL A . n 
C 3 488 ARG 488 784 784 ARG ARG A . n 
C 3 489 SER 489 785 785 SER SER A . n 
C 3 490 PHE 490 786 786 PHE PHE A . n 
C 3 491 ALA 491 787 787 ALA ALA A . n 
C 3 492 GLU 492 788 788 GLU GLU A . n 
C 3 493 ARG 493 789 789 ARG ARG A . n 
C 3 494 MET 494 790 790 MET MET A . n 
C 3 495 ALA 495 791 791 ALA ALA A . n 
C 3 496 MET 496 792 792 MET MET A . n 
C 3 497 ASN 497 793 793 ASN ASN A . n 
C 3 498 THR 498 794 794 THR THR A . n 
C 3 499 PRO 499 795 795 PRO PRO A . n 
C 3 500 ILE 500 796 796 ILE ILE A . n 
C 3 501 GLN 501 797 797 GLN GLN A . n 
C 3 502 GLY 502 798 798 GLY GLY A . n 
C 3 503 SER 503 799 799 SER SER A . n 
C 3 504 ALA 504 800 800 ALA ALA A . n 
C 3 505 ALA 505 801 801 ALA ALA A . n 
C 3 506 ASP 506 802 802 ASP ASP A . n 
C 3 507 ILE 507 803 803 ILE ILE A . n 
C 3 508 ILE 508 804 804 ILE ILE A . n 
C 3 509 LYS 509 805 805 LYS LYS A . n 
C 3 510 LYS 510 806 806 LYS LYS A . n 
C 3 511 ALA 511 807 807 ALA ALA A . n 
C 3 512 MET 512 808 808 MET MET A . n 
C 3 513 ILE 513 809 809 ILE ILE A . n 
C 3 514 ASP 514 810 810 ASP ASP A . n 
C 3 515 LEU 515 811 811 LEU LEU A . n 
C 3 516 ASN 516 812 812 ASN ASN A . n 
C 3 517 ALA 517 813 813 ALA ALA A . n 
C 3 518 ARG 518 814 814 ARG ARG A . n 
C 3 519 LEU 519 815 815 LEU LEU A . n 
C 3 520 LYS 520 816 816 LYS LYS A . n 
C 3 521 GLU 521 817 817 GLU GLU A . n 
C 3 522 GLU 522 818 818 GLU GLU A . n 
C 3 523 ARG 523 819 819 ARG ARG A . n 
C 3 524 LEU 524 820 820 LEU LEU A . n 
C 3 525 GLN 525 821 821 GLN GLN A . n 
C 3 526 ALA 526 822 822 ALA ALA A . n 
C 3 527 HIS 527 823 823 HIS HIS A . n 
C 3 528 LEU 528 824 824 LEU LEU A . n 
C 3 529 LEU 529 825 825 LEU LEU A . n 
C 3 530 LEU 530 826 826 LEU LEU A . n 
C 3 531 GLN 531 827 827 GLN GLN A . n 
C 3 532 VAL 532 828 828 VAL VAL A . n 
C 3 533 HIS 533 829 829 HIS HIS A . n 
C 3 534 ASP 534 830 830 ASP ASP A . n 
C 3 535 GLU 535 831 831 GLU GLU A . n 
C 3 536 LEU 536 832 832 LEU LEU A . n 
C 3 537 ILE 537 833 833 ILE ILE A . n 
C 3 538 LEU 538 834 834 LEU LEU A . n 
C 3 539 GLU 539 835 835 GLU GLU A . n 
C 3 540 ALA 540 836 836 ALA ALA A . n 
C 3 541 PRO 541 837 837 PRO PRO A . n 
C 3 542 LYS 542 838 838 LYS LYS A . n 
C 3 543 GLU 543 839 839 GLU GLU A . n 
C 3 544 GLU 544 840 840 GLU GLU A . n 
C 3 545 MET 545 841 841 MET MET A . n 
C 3 546 GLU 546 842 842 GLU GLU A . n 
C 3 547 ARG 547 843 843 ARG ARG A . n 
C 3 548 LEU 548 844 844 LEU LEU A . n 
C 3 549 CYS 549 845 845 CYS CYS A . n 
C 3 550 ARG 550 846 846 ARG ARG A . n 
C 3 551 LEU 551 847 847 LEU LEU A . n 
C 3 552 VAL 552 848 848 VAL VAL A . n 
C 3 553 PRO 553 849 849 PRO PRO A . n 
C 3 554 GLU 554 850 850 GLU GLU A . n 
C 3 555 VAL 555 851 851 VAL VAL A . n 
C 3 556 MET 556 852 852 MET MET A . n 
C 3 557 GLU 557 853 853 GLU GLU A . n 
C 3 558 GLN 558 854 854 GLN GLN A . n 
C 3 559 ALA 559 855 855 ALA ALA A . n 
C 3 560 VAL 560 856 856 VAL VAL A . n 
C 3 561 THR 561 857 857 THR THR A . n 
C 3 562 LEU 562 858 858 LEU LEU A . n 
C 3 563 ARG 563 859 859 ARG ARG A . n 
C 3 564 VAL 564 860 860 VAL VAL A . n 
C 3 565 PRO 565 861 861 PRO PRO A . n 
C 3 566 LEU 566 862 862 LEU LEU A . n 
C 3 567 LYS 567 863 863 LYS LYS A . n 
C 3 568 VAL 568 864 864 VAL VAL A . n 
C 3 569 ASP 569 865 865 ASP ASP A . n 
C 3 570 TYR 570 866 866 TYR TYR A . n 
C 3 571 HIS 571 867 867 HIS HIS A . n 
C 3 572 TYR 572 868 868 TYR TYR A . n 
C 3 573 GLY 573 869 869 GLY GLY A . n 
C 3 574 SER 574 870 870 SER SER A . n 
C 3 575 THR 575 871 871 THR THR A . n 
C 3 576 TRP 576 872 872 TRP TRP A . n 
C 3 577 TYR 577 873 873 TYR TYR A . n 
C 3 578 ASP 578 874 874 ASP ASP A . n 
C 3 579 ALA 579 875 875 ALA ALA A . n 
C 3 580 LYS 580 876 876 LYS LYS A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 SO4 1   910  910  SO4 SO4 A . 
E 4 SO4 1   912  912  SO4 SO4 A . 
F 4 SO4 1   915  915  SO4 SO4 A . 
G 4 SO4 1   920  920  SO4 SO4 A . 
H 5 HOH 1   1049 1049 HOH HOH P . 
H 5 HOH 2   2060 2060 HOH HOH P . 
H 5 HOH 3   2147 2147 HOH HOH P . 
H 5 HOH 4   2284 2284 HOH HOH P . 
H 5 HOH 5   2435 2435 HOH HOH P . 
H 5 HOH 6   2510 2510 HOH HOH P . 
H 5 HOH 7   2511 2511 HOH HOH P . 
H 5 HOH 8   2517 2517 HOH HOH P . 
H 5 HOH 9   2526 2526 HOH HOH P . 
H 5 HOH 10  2666 2666 HOH HOH P . 
H 5 HOH 11  2667 2667 HOH HOH P . 
H 5 HOH 12  2694 2694 HOH HOH P . 
H 5 HOH 13  2757 2757 HOH HOH P . 
H 5 HOH 14  2809 2809 HOH HOH P . 
H 5 HOH 15  2878 2878 HOH HOH P . 
I 5 HOH 1   1007 1007 HOH HOH T . 
I 5 HOH 2   1010 1010 HOH HOH T . 
I 5 HOH 3   1050 1050 HOH HOH T . 
I 5 HOH 4   2047 2047 HOH HOH T . 
I 5 HOH 5   2289 2289 HOH HOH T . 
I 5 HOH 6   2290 2290 HOH HOH T . 
I 5 HOH 7   2291 2291 HOH HOH T . 
I 5 HOH 8   2294 2294 HOH HOH T . 
I 5 HOH 9   2295 2295 HOH HOH T . 
I 5 HOH 10  2355 2355 HOH HOH T . 
I 5 HOH 11  2678 2678 HOH HOH T . 
I 5 HOH 12  2689 2689 HOH HOH T . 
I 5 HOH 13  2711 2711 HOH HOH T . 
I 5 HOH 14  2719 2719 HOH HOH T . 
I 5 HOH 15  2747 2747 HOH HOH T . 
I 5 HOH 16  2808 2808 HOH HOH T . 
I 5 HOH 17  2814 2814 HOH HOH T . 
J 5 HOH 1   1001 1001 HOH HOH A . 
J 5 HOH 2   1002 1002 HOH HOH A . 
J 5 HOH 3   1003 1003 HOH HOH A . 
J 5 HOH 4   1004 1004 HOH HOH A . 
J 5 HOH 5   1005 1005 HOH HOH A . 
J 5 HOH 6   1006 1006 HOH HOH A . 
J 5 HOH 7   1008 1008 HOH HOH A . 
J 5 HOH 8   1009 1009 HOH HOH A . 
J 5 HOH 9   1011 1011 HOH HOH A . 
J 5 HOH 10  1012 1012 HOH HOH A . 
J 5 HOH 11  1013 1013 HOH HOH A . 
J 5 HOH 12  1016 1016 HOH HOH A . 
J 5 HOH 13  1017 1017 HOH HOH A . 
J 5 HOH 14  1018 1018 HOH HOH A . 
J 5 HOH 15  1021 1021 HOH HOH A . 
J 5 HOH 16  1025 1025 HOH HOH A . 
J 5 HOH 17  1028 1028 HOH HOH A . 
J 5 HOH 18  1029 1029 HOH HOH A . 
J 5 HOH 19  1030 1030 HOH HOH A . 
J 5 HOH 20  1031 1031 HOH HOH A . 
J 5 HOH 21  1032 1032 HOH HOH A . 
J 5 HOH 22  1033 1033 HOH HOH A . 
J 5 HOH 23  1034 1034 HOH HOH A . 
J 5 HOH 24  1035 1035 HOH HOH A . 
J 5 HOH 25  1037 1037 HOH HOH A . 
J 5 HOH 26  1039 1039 HOH HOH A . 
J 5 HOH 27  1040 1040 HOH HOH A . 
J 5 HOH 28  1041 1041 HOH HOH A . 
J 5 HOH 29  1042 1042 HOH HOH A . 
J 5 HOH 30  1043 1043 HOH HOH A . 
J 5 HOH 31  1045 1045 HOH HOH A . 
J 5 HOH 32  1046 1046 HOH HOH A . 
J 5 HOH 33  2001 2001 HOH HOH A . 
J 5 HOH 34  2002 2002 HOH HOH A . 
J 5 HOH 35  2003 2003 HOH HOH A . 
J 5 HOH 36  2004 2004 HOH HOH A . 
J 5 HOH 37  2005 2005 HOH HOH A . 
J 5 HOH 38  2006 2006 HOH HOH A . 
J 5 HOH 39  2007 2007 HOH HOH A . 
J 5 HOH 40  2008 2008 HOH HOH A . 
J 5 HOH 41  2009 2009 HOH HOH A . 
J 5 HOH 42  2010 2010 HOH HOH A . 
J 5 HOH 43  2011 2011 HOH HOH A . 
J 5 HOH 44  2013 2013 HOH HOH A . 
J 5 HOH 45  2015 2015 HOH HOH A . 
J 5 HOH 46  2016 2016 HOH HOH A . 
J 5 HOH 47  2017 2017 HOH HOH A . 
J 5 HOH 48  2018 2018 HOH HOH A . 
J 5 HOH 49  2019 2019 HOH HOH A . 
J 5 HOH 50  2020 2020 HOH HOH A . 
J 5 HOH 51  2021 2021 HOH HOH A . 
J 5 HOH 52  2022 2022 HOH HOH A . 
J 5 HOH 53  2023 2023 HOH HOH A . 
J 5 HOH 54  2024 2024 HOH HOH A . 
J 5 HOH 55  2025 2025 HOH HOH A . 
J 5 HOH 56  2026 2026 HOH HOH A . 
J 5 HOH 57  2028 2028 HOH HOH A . 
J 5 HOH 58  2029 2029 HOH HOH A . 
J 5 HOH 59  2031 2031 HOH HOH A . 
J 5 HOH 60  2033 2033 HOH HOH A . 
J 5 HOH 61  2034 2034 HOH HOH A . 
J 5 HOH 62  2035 2035 HOH HOH A . 
J 5 HOH 63  2036 2036 HOH HOH A . 
J 5 HOH 64  2037 2037 HOH HOH A . 
J 5 HOH 65  2038 2038 HOH HOH A . 
J 5 HOH 66  2040 2040 HOH HOH A . 
J 5 HOH 67  2041 2041 HOH HOH A . 
J 5 HOH 68  2044 2044 HOH HOH A . 
J 5 HOH 69  2045 2045 HOH HOH A . 
J 5 HOH 70  2046 2046 HOH HOH A . 
J 5 HOH 71  2048 2048 HOH HOH A . 
J 5 HOH 72  2049 2049 HOH HOH A . 
J 5 HOH 73  2050 2050 HOH HOH A . 
J 5 HOH 74  2051 2051 HOH HOH A . 
J 5 HOH 75  2053 2053 HOH HOH A . 
J 5 HOH 76  2054 2054 HOH HOH A . 
J 5 HOH 77  2055 2055 HOH HOH A . 
J 5 HOH 78  2056 2056 HOH HOH A . 
J 5 HOH 79  2057 2057 HOH HOH A . 
J 5 HOH 80  2058 2058 HOH HOH A . 
J 5 HOH 81  2059 2059 HOH HOH A . 
J 5 HOH 82  2061 2061 HOH HOH A . 
J 5 HOH 83  2062 2062 HOH HOH A . 
J 5 HOH 84  2101 2101 HOH HOH A . 
J 5 HOH 85  2102 2102 HOH HOH A . 
J 5 HOH 86  2103 2103 HOH HOH A . 
J 5 HOH 87  2105 2105 HOH HOH A . 
J 5 HOH 88  2109 2109 HOH HOH A . 
J 5 HOH 89  2110 2110 HOH HOH A . 
J 5 HOH 90  2111 2111 HOH HOH A . 
J 5 HOH 91  2112 2112 HOH HOH A . 
J 5 HOH 92  2113 2113 HOH HOH A . 
J 5 HOH 93  2115 2115 HOH HOH A . 
J 5 HOH 94  2116 2116 HOH HOH A . 
J 5 HOH 95  2123 2123 HOH HOH A . 
J 5 HOH 96  2126 2126 HOH HOH A . 
J 5 HOH 97  2131 2131 HOH HOH A . 
J 5 HOH 98  2132 2132 HOH HOH A . 
J 5 HOH 99  2135 2135 HOH HOH A . 
J 5 HOH 100 2137 2137 HOH HOH A . 
J 5 HOH 101 2138 2138 HOH HOH A . 
J 5 HOH 102 2139 2139 HOH HOH A . 
J 5 HOH 103 2140 2140 HOH HOH A . 
J 5 HOH 104 2144 2144 HOH HOH A . 
J 5 HOH 105 2145 2145 HOH HOH A . 
J 5 HOH 106 2148 2148 HOH HOH A . 
J 5 HOH 107 2149 2149 HOH HOH A . 
J 5 HOH 108 2151 2151 HOH HOH A . 
J 5 HOH 109 2154 2154 HOH HOH A . 
J 5 HOH 110 2156 2156 HOH HOH A . 
J 5 HOH 111 2157 2157 HOH HOH A . 
J 5 HOH 112 2158 2158 HOH HOH A . 
J 5 HOH 113 2159 2159 HOH HOH A . 
J 5 HOH 114 2160 2160 HOH HOH A . 
J 5 HOH 115 2161 2161 HOH HOH A . 
J 5 HOH 116 2163 2163 HOH HOH A . 
J 5 HOH 117 2167 2167 HOH HOH A . 
J 5 HOH 118 2170 2170 HOH HOH A . 
J 5 HOH 119 2171 2171 HOH HOH A . 
J 5 HOH 120 2172 2172 HOH HOH A . 
J 5 HOH 121 2174 2174 HOH HOH A . 
J 5 HOH 122 2178 2178 HOH HOH A . 
J 5 HOH 123 2184 2184 HOH HOH A . 
J 5 HOH 124 2187 2187 HOH HOH A . 
J 5 HOH 125 2188 2188 HOH HOH A . 
J 5 HOH 126 2189 2189 HOH HOH A . 
J 5 HOH 127 2194 2194 HOH HOH A . 
J 5 HOH 128 2196 2196 HOH HOH A . 
J 5 HOH 129 2201 2201 HOH HOH A . 
J 5 HOH 130 2202 2202 HOH HOH A . 
J 5 HOH 131 2203 2203 HOH HOH A . 
J 5 HOH 132 2204 2204 HOH HOH A . 
J 5 HOH 133 2211 2211 HOH HOH A . 
J 5 HOH 134 2212 2212 HOH HOH A . 
J 5 HOH 135 2214 2214 HOH HOH A . 
J 5 HOH 136 2216 2216 HOH HOH A . 
J 5 HOH 137 2221 2221 HOH HOH A . 
J 5 HOH 138 2227 2227 HOH HOH A . 
J 5 HOH 139 2228 2228 HOH HOH A . 
J 5 HOH 140 2229 2229 HOH HOH A . 
J 5 HOH 141 2234 2234 HOH HOH A . 
J 5 HOH 142 2236 2236 HOH HOH A . 
J 5 HOH 143 2237 2237 HOH HOH A . 
J 5 HOH 144 2242 2242 HOH HOH A . 
J 5 HOH 145 2244 2244 HOH HOH A . 
J 5 HOH 146 2246 2246 HOH HOH A . 
J 5 HOH 147 2248 2248 HOH HOH A . 
J 5 HOH 148 2249 2249 HOH HOH A . 
J 5 HOH 149 2250 2250 HOH HOH A . 
J 5 HOH 150 2251 2251 HOH HOH A . 
J 5 HOH 151 2253 2253 HOH HOH A . 
J 5 HOH 152 2254 2254 HOH HOH A . 
J 5 HOH 153 2255 2255 HOH HOH A . 
J 5 HOH 154 2256 2256 HOH HOH A . 
J 5 HOH 155 2257 2257 HOH HOH A . 
J 5 HOH 156 2258 2258 HOH HOH A . 
J 5 HOH 157 2259 2259 HOH HOH A . 
J 5 HOH 158 2261 2261 HOH HOH A . 
J 5 HOH 159 2264 2264 HOH HOH A . 
J 5 HOH 160 2265 2265 HOH HOH A . 
J 5 HOH 161 2266 2266 HOH HOH A . 
J 5 HOH 162 2267 2267 HOH HOH A . 
J 5 HOH 163 2270 2270 HOH HOH A . 
J 5 HOH 164 2277 2277 HOH HOH A . 
J 5 HOH 165 2279 2279 HOH HOH A . 
J 5 HOH 166 2280 2280 HOH HOH A . 
J 5 HOH 167 2288 2288 HOH HOH A . 
J 5 HOH 168 2301 2301 HOH HOH A . 
J 5 HOH 169 2302 2302 HOH HOH A . 
J 5 HOH 170 2303 2303 HOH HOH A . 
J 5 HOH 171 2304 2304 HOH HOH A . 
J 5 HOH 172 2305 2305 HOH HOH A . 
J 5 HOH 173 2306 2306 HOH HOH A . 
J 5 HOH 174 2307 2307 HOH HOH A . 
J 5 HOH 175 2308 2308 HOH HOH A . 
J 5 HOH 176 2309 2309 HOH HOH A . 
J 5 HOH 177 2310 2310 HOH HOH A . 
J 5 HOH 178 2312 2312 HOH HOH A . 
J 5 HOH 179 2313 2313 HOH HOH A . 
J 5 HOH 180 2314 2314 HOH HOH A . 
J 5 HOH 181 2315 2315 HOH HOH A . 
J 5 HOH 182 2317 2317 HOH HOH A . 
J 5 HOH 183 2318 2318 HOH HOH A . 
J 5 HOH 184 2319 2319 HOH HOH A . 
J 5 HOH 185 2321 2321 HOH HOH A . 
J 5 HOH 186 2322 2322 HOH HOH A . 
J 5 HOH 187 2323 2323 HOH HOH A . 
J 5 HOH 188 2324 2324 HOH HOH A . 
J 5 HOH 189 2325 2325 HOH HOH A . 
J 5 HOH 190 2326 2326 HOH HOH A . 
J 5 HOH 191 2327 2327 HOH HOH A . 
J 5 HOH 192 2328 2328 HOH HOH A . 
J 5 HOH 193 2329 2329 HOH HOH A . 
J 5 HOH 194 2330 2330 HOH HOH A . 
J 5 HOH 195 2331 2331 HOH HOH A . 
J 5 HOH 196 2332 2332 HOH HOH A . 
J 5 HOH 197 2333 2333 HOH HOH A . 
J 5 HOH 198 2338 2338 HOH HOH A . 
J 5 HOH 199 2339 2339 HOH HOH A . 
J 5 HOH 200 2340 2340 HOH HOH A . 
J 5 HOH 201 2341 2341 HOH HOH A . 
J 5 HOH 202 2356 2356 HOH HOH A . 
J 5 HOH 203 2358 2358 HOH HOH A . 
J 5 HOH 204 2360 2360 HOH HOH A . 
J 5 HOH 205 2363 2363 HOH HOH A . 
J 5 HOH 206 2364 2364 HOH HOH A . 
J 5 HOH 207 2365 2365 HOH HOH A . 
J 5 HOH 208 2366 2366 HOH HOH A . 
J 5 HOH 209 2368 2368 HOH HOH A . 
J 5 HOH 210 2369 2369 HOH HOH A . 
J 5 HOH 211 2370 2370 HOH HOH A . 
J 5 HOH 212 2371 2371 HOH HOH A . 
J 5 HOH 213 2373 2373 HOH HOH A . 
J 5 HOH 214 2374 2374 HOH HOH A . 
J 5 HOH 215 2375 2375 HOH HOH A . 
J 5 HOH 216 2376 2376 HOH HOH A . 
J 5 HOH 217 2377 2377 HOH HOH A . 
J 5 HOH 218 2378 2378 HOH HOH A . 
J 5 HOH 219 2379 2379 HOH HOH A . 
J 5 HOH 220 2380 2380 HOH HOH A . 
J 5 HOH 221 2381 2381 HOH HOH A . 
J 5 HOH 222 2382 2382 HOH HOH A . 
J 5 HOH 223 2383 2383 HOH HOH A . 
J 5 HOH 224 2385 2385 HOH HOH A . 
J 5 HOH 225 2386 2386 HOH HOH A . 
J 5 HOH 226 2390 2390 HOH HOH A . 
J 5 HOH 227 2391 2391 HOH HOH A . 
J 5 HOH 228 2392 2392 HOH HOH A . 
J 5 HOH 229 2394 2394 HOH HOH A . 
J 5 HOH 230 2395 2395 HOH HOH A . 
J 5 HOH 231 2398 2398 HOH HOH A . 
J 5 HOH 232 2399 2399 HOH HOH A . 
J 5 HOH 233 2401 2401 HOH HOH A . 
J 5 HOH 234 2402 2402 HOH HOH A . 
J 5 HOH 235 2403 2403 HOH HOH A . 
J 5 HOH 236 2405 2405 HOH HOH A . 
J 5 HOH 237 2406 2406 HOH HOH A . 
J 5 HOH 238 2407 2407 HOH HOH A . 
J 5 HOH 239 2408 2408 HOH HOH A . 
J 5 HOH 240 2410 2410 HOH HOH A . 
J 5 HOH 241 2414 2414 HOH HOH A . 
J 5 HOH 242 2415 2415 HOH HOH A . 
J 5 HOH 243 2416 2416 HOH HOH A . 
J 5 HOH 244 2417 2417 HOH HOH A . 
J 5 HOH 245 2419 2419 HOH HOH A . 
J 5 HOH 246 2420 2420 HOH HOH A . 
J 5 HOH 247 2422 2422 HOH HOH A . 
J 5 HOH 248 2424 2424 HOH HOH A . 
J 5 HOH 249 2425 2425 HOH HOH A . 
J 5 HOH 250 2426 2426 HOH HOH A . 
J 5 HOH 251 2427 2427 HOH HOH A . 
J 5 HOH 252 2428 2428 HOH HOH A . 
J 5 HOH 253 2429 2429 HOH HOH A . 
J 5 HOH 254 2430 2430 HOH HOH A . 
J 5 HOH 255 2431 2431 HOH HOH A . 
J 5 HOH 256 2436 2436 HOH HOH A . 
J 5 HOH 257 2437 2437 HOH HOH A . 
J 5 HOH 258 2441 2441 HOH HOH A . 
J 5 HOH 259 2442 2442 HOH HOH A . 
J 5 HOH 260 2446 2446 HOH HOH A . 
J 5 HOH 261 2457 2457 HOH HOH A . 
J 5 HOH 262 2459 2459 HOH HOH A . 
J 5 HOH 263 2460 2460 HOH HOH A . 
J 5 HOH 264 2461 2461 HOH HOH A . 
J 5 HOH 265 2462 2462 HOH HOH A . 
J 5 HOH 266 2463 2463 HOH HOH A . 
J 5 HOH 267 2465 2465 HOH HOH A . 
J 5 HOH 268 2466 2466 HOH HOH A . 
J 5 HOH 269 2467 2467 HOH HOH A . 
J 5 HOH 270 2471 2471 HOH HOH A . 
J 5 HOH 271 2472 2472 HOH HOH A . 
J 5 HOH 272 2476 2476 HOH HOH A . 
J 5 HOH 273 2484 2484 HOH HOH A . 
J 5 HOH 274 2486 2486 HOH HOH A . 
J 5 HOH 275 2487 2487 HOH HOH A . 
J 5 HOH 276 2490 2490 HOH HOH A . 
J 5 HOH 277 2491 2491 HOH HOH A . 
J 5 HOH 278 2496 2496 HOH HOH A . 
J 5 HOH 279 2498 2498 HOH HOH A . 
J 5 HOH 280 2501 2501 HOH HOH A . 
J 5 HOH 281 2504 2504 HOH HOH A . 
J 5 HOH 282 2506 2506 HOH HOH A . 
J 5 HOH 283 2515 2515 HOH HOH A . 
J 5 HOH 284 2516 2516 HOH HOH A . 
J 5 HOH 285 2521 2521 HOH HOH A . 
J 5 HOH 286 2522 2522 HOH HOH A . 
J 5 HOH 287 2528 2528 HOH HOH A . 
J 5 HOH 288 2529 2529 HOH HOH A . 
J 5 HOH 289 2533 2533 HOH HOH A . 
J 5 HOH 290 2534 2534 HOH HOH A . 
J 5 HOH 291 2538 2538 HOH HOH A . 
J 5 HOH 292 2539 2539 HOH HOH A . 
J 5 HOH 293 2545 2545 HOH HOH A . 
J 5 HOH 294 2547 2547 HOH HOH A . 
J 5 HOH 295 2552 2552 HOH HOH A . 
J 5 HOH 296 2553 2553 HOH HOH A . 
J 5 HOH 297 2554 2554 HOH HOH A . 
J 5 HOH 298 2555 2555 HOH HOH A . 
J 5 HOH 299 2556 2556 HOH HOH A . 
J 5 HOH 300 2560 2560 HOH HOH A . 
J 5 HOH 301 2561 2561 HOH HOH A . 
J 5 HOH 302 2562 2562 HOH HOH A . 
J 5 HOH 303 2572 2572 HOH HOH A . 
J 5 HOH 304 2574 2574 HOH HOH A . 
J 5 HOH 305 2576 2576 HOH HOH A . 
J 5 HOH 306 2577 2577 HOH HOH A . 
J 5 HOH 307 2578 2578 HOH HOH A . 
J 5 HOH 308 2579 2579 HOH HOH A . 
J 5 HOH 309 2585 2585 HOH HOH A . 
J 5 HOH 310 2589 2589 HOH HOH A . 
J 5 HOH 311 2597 2597 HOH HOH A . 
J 5 HOH 312 2598 2598 HOH HOH A . 
J 5 HOH 313 2611 2611 HOH HOH A . 
J 5 HOH 314 2615 2615 HOH HOH A . 
J 5 HOH 315 2616 2616 HOH HOH A . 
J 5 HOH 316 2617 2617 HOH HOH A . 
J 5 HOH 317 2620 2620 HOH HOH A . 
J 5 HOH 318 2663 2663 HOH HOH A . 
J 5 HOH 319 2664 2664 HOH HOH A . 
J 5 HOH 320 2669 2669 HOH HOH A . 
J 5 HOH 321 2670 2670 HOH HOH A . 
J 5 HOH 322 2674 2674 HOH HOH A . 
J 5 HOH 323 2675 2675 HOH HOH A . 
J 5 HOH 324 2679 2679 HOH HOH A . 
J 5 HOH 325 2680 2680 HOH HOH A . 
J 5 HOH 326 2682 2682 HOH HOH A . 
J 5 HOH 327 2683 2683 HOH HOH A . 
J 5 HOH 328 2684 2684 HOH HOH A . 
J 5 HOH 329 2685 2685 HOH HOH A . 
J 5 HOH 330 2686 2686 HOH HOH A . 
J 5 HOH 331 2687 2687 HOH HOH A . 
J 5 HOH 332 2688 2688 HOH HOH A . 
J 5 HOH 333 2691 2691 HOH HOH A . 
J 5 HOH 334 2693 2693 HOH HOH A . 
J 5 HOH 335 2700 2700 HOH HOH A . 
J 5 HOH 336 2701 2701 HOH HOH A . 
J 5 HOH 337 2703 2703 HOH HOH A . 
J 5 HOH 338 2707 2707 HOH HOH A . 
J 5 HOH 339 2708 2708 HOH HOH A . 
J 5 HOH 340 2712 2712 HOH HOH A . 
J 5 HOH 341 2722 2722 HOH HOH A . 
J 5 HOH 342 2723 2723 HOH HOH A . 
J 5 HOH 343 2726 2726 HOH HOH A . 
J 5 HOH 344 2732 2732 HOH HOH A . 
J 5 HOH 345 2735 2735 HOH HOH A . 
J 5 HOH 346 2742 2742 HOH HOH A . 
J 5 HOH 347 2748 2748 HOH HOH A . 
J 5 HOH 348 2750 2750 HOH HOH A . 
J 5 HOH 349 2752 2752 HOH HOH A . 
J 5 HOH 350 2754 2754 HOH HOH A . 
J 5 HOH 351 2758 2758 HOH HOH A . 
J 5 HOH 352 2762 2762 HOH HOH A . 
J 5 HOH 353 2765 2765 HOH HOH A . 
J 5 HOH 354 2767 2767 HOH HOH A . 
J 5 HOH 355 2769 2769 HOH HOH A . 
J 5 HOH 356 2771 2771 HOH HOH A . 
J 5 HOH 357 2773 2773 HOH HOH A . 
J 5 HOH 358 2775 2775 HOH HOH A . 
J 5 HOH 359 2779 2779 HOH HOH A . 
J 5 HOH 360 2785 2785 HOH HOH A . 
J 5 HOH 361 2793 2793 HOH HOH A . 
J 5 HOH 362 2794 2794 HOH HOH A . 
J 5 HOH 363 2796 2796 HOH HOH A . 
J 5 HOH 364 2797 2797 HOH HOH A . 
J 5 HOH 365 2800 2800 HOH HOH A . 
J 5 HOH 366 2801 2801 HOH HOH A . 
J 5 HOH 367 2802 2802 HOH HOH A . 
J 5 HOH 368 2804 2804 HOH HOH A . 
J 5 HOH 369 2805 2805 HOH HOH A . 
J 5 HOH 370 2807 2807 HOH HOH A . 
J 5 HOH 371 2810 2810 HOH HOH A . 
J 5 HOH 372 2816 2816 HOH HOH A . 
J 5 HOH 373 2818 2818 HOH HOH A . 
J 5 HOH 374 2821 2821 HOH HOH A . 
J 5 HOH 375 2822 2822 HOH HOH A . 
J 5 HOH 376 2823 2823 HOH HOH A . 
J 5 HOH 377 2824 2824 HOH HOH A . 
J 5 HOH 378 2825 2825 HOH HOH A . 
J 5 HOH 379 2827 2827 HOH HOH A . 
J 5 HOH 380 2829 2829 HOH HOH A . 
J 5 HOH 381 2832 2832 HOH HOH A . 
J 5 HOH 382 2833 2833 HOH HOH A . 
J 5 HOH 383 2834 2834 HOH HOH A . 
J 5 HOH 384 2835 2835 HOH HOH A . 
J 5 HOH 385 2837 2837 HOH HOH A . 
J 5 HOH 386 2840 2840 HOH HOH A . 
J 5 HOH 387 2847 2847 HOH HOH A . 
J 5 HOH 388 2848 2848 HOH HOH A . 
J 5 HOH 389 2853 2853 HOH HOH A . 
J 5 HOH 390 2855 2855 HOH HOH A . 
J 5 HOH 391 2861 2861 HOH HOH A . 
J 5 HOH 392 2884 2884 HOH HOH A . 
J 5 HOH 393 2885 2885 HOH HOH A . 
J 5 HOH 394 2886 2886 HOH HOH A . 
J 5 HOH 395 2888 2888 HOH HOH A . 
J 5 HOH 396 2889 2889 HOH HOH A . 
J 5 HOH 397 2892 2892 HOH HOH A . 
J 5 HOH 398 2899 2899 HOH HOH A . 
J 5 HOH 399 2903 2903 HOH HOH A . 
J 5 HOH 400 2911 2911 HOH HOH A . 
J 5 HOH 401 2914 2914 HOH HOH A . 
J 5 HOH 402 2918 2918 HOH HOH A . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    2DT 
_pdbx_struct_mod_residue.label_seq_id     10 
_pdbx_struct_mod_residue.auth_asym_id     P 
_pdbx_struct_mod_residue.auth_comp_id     2DT 
_pdbx_struct_mod_residue.auth_seq_id      16 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   DT 
_pdbx_struct_mod_residue.details          "3'-DEOXYTHYMIDINE-5'-MONOPHOSPHATE" 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-01-13 
2 'Structure model' 1 1 2008-05-22 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR    'model building' .     ? 1 
X-PLOR    refinement       3.851 ? 2 
DENZO     'data reduction' .     ? 3 
SCALEPACK 'data scaling'   .     ? 4 
X-PLOR    phasing          .     ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A HOH 2057 ? ? O A HOH 2793 ? ? 2.09 
2 1 O A HOH 2578 ? ? O A HOH 2773 ? ? 2.19 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     2171 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     2385 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   3_555 
_pdbx_validate_symm_contact.dist              2.14 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              834 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              834 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              834 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                133.14 
_pdbx_validate_rmsd_angle.angle_target_value         115.30 
_pdbx_validate_rmsd_angle.angle_deviation            17.84 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 298 ? ? -42.26  152.82 
2  1 ASP A 402 ? ? -170.16 94.98  
3  1 ALA A 421 ? ? -85.81  39.71  
4  1 LYS A 434 ? ? -64.44  1.63   
5  1 ALA A 436 ? ? -179.35 147.32 
6  1 LEU A 477 ? ? -113.03 -73.96 
7  1 LEU A 610 ? ? -122.42 -52.03 
8  1 ASN A 625 ? ? -140.02 34.21  
9  1 ILE A 628 ? ? -152.36 -31.99 
10 1 VAL A 713 ? ? -36.25  -77.79 
11 1 TYR A 714 ? ? -66.50  62.01  
12 1 ILE A 716 ? ? 45.37   74.14  
13 1 HIS A 829 ? ? 66.98   -55.15 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DT P 13 ? ? 0.095 'SIDE CHAIN' 
2 1 DG T 19 ? ? 0.059 'SIDE CHAIN' 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
3BDP 'double helix'        
3BDP 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG  1  1_555 B DC 10 1_555 -1.906 0.185  -0.366 -22.502 -14.221 5.436  1  P_DG7:DC27_T   P 7  ? T 27 ? ?  1 
1 A DC  2  1_555 B DG 9  1_555 0.154  -0.297 -0.246 -1.201  -1.865  3.558  2  P_DC8:DG26_T   P 8  ? T 26 ? 19 1 
1 A DA  3  1_555 B DT 8  1_555 -0.410 -0.421 -0.570 -5.323  -1.638  -0.787 3  P_DA9:DT25_T   P 9  ? T 25 ? 20 1 
1 A DT  4  1_555 B DA 7  1_555 -0.175 -0.224 0.032  0.420   -11.514 2.342  4  P_DT10:DA24_T  P 10 ? T 24 ? 20 1 
1 A DG  5  1_555 B DC 6  1_555 -0.189 -0.188 -0.375 -4.482  -12.001 -1.686 5  P_DG11:DC23_T  P 11 ? T 23 ? 19 1 
1 A DA  6  1_555 B DT 5  1_555 0.204  -0.069 0.046  -11.938 -13.451 2.545  6  P_DA12:DT22_T  P 12 ? T 22 ? 20 1 
1 A DT  7  1_555 B DA 4  1_555 -0.189 -0.189 -0.253 1.062   0.921   -2.809 7  P_DT13:DA21_T  P 13 ? T 21 ? 20 1 
1 A DG  8  1_555 B DC 3  1_555 -0.151 -0.206 -0.011 -3.668  -20.205 3.797  8  P_DG14:DC20_T  P 14 ? T 20 ? 19 1 
1 A DC  9  1_555 B DG 2  1_555 -0.012 -0.369 0.045  -13.070 -3.224  -6.115 9  P_DC15:DG19_T  P 15 ? T 19 ? 19 1 
1 A 2DT 10 1_555 B DA 1  1_555 -0.170 -0.392 -0.239 11.543  -1.808  -0.145 10 P_2DT16:DA18_T P 16 ? T 18 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 1 1_555 B DC 10 1_555 A DC  2  1_555 B DG 9 1_555 0.424  1.058  2.722 -1.101 1.261  44.618 1.296  -0.642 2.738 1.660  1.450 
44.647 1 PP_DG7DC8:DG26DC27_TT    P 7  ? T 27 ? P 8  ? T 26 ? 
1 A DC 2 1_555 B DG 9  1_555 A DA  3  1_555 B DT 8 1_555 -1.109 0.518  3.356 -3.070 13.363 26.163 -2.079 1.467  3.329 27.266 6.265 
29.482 2 PP_DC8DA9:DT25DG26_TT    P 8  ? T 26 ? P 9  ? T 25 ? 
1 A DA 3 1_555 B DT 8  1_555 A DT  4  1_555 B DA 7 1_555 -0.033 -0.115 3.116 -4.917 -3.710 36.249 0.301  -0.589 3.090 -5.911 7.834 
36.751 3 PP_DA9DT10:DA24DT25_TT   P 9  ? T 25 ? P 10 ? T 24 ? 
1 A DT 4 1_555 B DA 7  1_555 A DG  5  1_555 B DC 6 1_555 0.618  0.378  3.587 4.451  10.271 33.808 -1.071 -0.280 3.596 17.091 
-7.406 35.561 4 PP_DT10DG11:DC23DA24_TT  P 10 ? T 24 ? P 11 ? T 23 ? 
1 A DG 5 1_555 B DC 6  1_555 A DA  6  1_555 B DT 5 1_555 0.399  -0.124 3.346 -3.426 4.287  34.442 -0.867 -1.194 3.254 7.183  5.741 
34.863 5 PP_DG11DA12:DT22DC23_TT  P 11 ? T 23 ? P 12 ? T 22 ? 
1 A DA 6 1_555 B DT 5  1_555 A DT  7  1_555 B DA 4 1_555 -0.175 -0.791 3.093 4.740  4.721  29.354 -2.415 1.232  2.871 9.166  
-9.204 30.091 6 PP_DA12DT13:DA21DT22_TT  P 12 ? T 22 ? P 13 ? T 21 ? 
1 A DT 7 1_555 B DA 4  1_555 A DG  8  1_555 B DC 3 1_555 0.355  -0.804 3.571 -5.246 14.899 34.729 -3.204 -1.238 2.917 23.515 8.280 
38.052 7 PP_DT13DG14:DC20DA21_TT  P 13 ? T 21 ? P 14 ? T 20 ? 
1 A DG 8 1_555 B DC 3  1_555 A DC  9  1_555 B DG 2 1_555 -0.257 -0.746 3.682 5.494  8.039  33.983 -2.534 1.315  3.344 13.416 
-9.169 35.311 8 PP_DG14DC15:DG19DC20_TT  P 14 ? T 20 ? P 15 ? T 19 ? 
1 A DC 9 1_555 B DG 2  1_555 A 2DT 10 1_555 B DA 1 1_555 -0.154 -0.188 3.016 0.269  6.384  25.627 -1.969 0.403  2.884 14.114 
-0.594 26.398 9 PP_DC152DT16:DA18DG19_TT P 15 ? T 19 ? P 16 ? T 18 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'SULFATE ION' SO4 
5 water         HOH 
#