data_3BDW
# 
_entry.id   3BDW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3BDW         
RCSB  RCSB045397   
WWPDB D_1000045397 
# 
_pdbx_database_status.entry_id                        3BDW 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2007-11-15 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sullivan, L.C.' 1 
'Clements, C.S.' 2 
# 
_citation.id                        primary 
_citation.title                     
'The Heterodimeric Assembly of the CD94-NKG2 Receptor Family and Implications for Human Leukocyte Antigen-E Recognition' 
_citation.journal_abbrev            Immunity 
_citation.journal_volume            27 
_citation.page_first                900 
_citation.page_last                 911 
_citation.year                      2007 
_citation.journal_id_ASTM           IUNIEH 
_citation.country                   US 
_citation.journal_id_ISSN           1074-7613 
_citation.journal_id_CSD            2048 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18083576 
_citation.pdbx_database_id_DOI      10.1016/j.immuni.2007.10.013 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Sullivan, L.C.' 1  
primary 'Clements, C.S.' 2  
primary 'Beddoe, T.'     3  
primary 'Johnson, D.'    4  
primary 'Hoare, H.L.'    5  
primary 'Lin, J.'        6  
primary 'Huyton, T.'     7  
primary 'Hopkins, E.J.'  8  
primary 'Reid, H.H.'     9  
primary 'Wilce, M.C.J.'  10 
primary 'Kabat, J.'      11 
primary 'Borrego, F.'    12 
primary 'Coligan, J.E.'  13 
primary 'Rossjohn, J.'   14 
primary 'Brooks, A.G.'   15 
# 
_cell.length_a           44.651 
_cell.length_b           34.730 
_cell.length_c           152.896 
_cell.angle_alpha        90.000 
_cell.angle_beta         89.720 
_cell.angle_gamma        90.000 
_cell.entry_id           3BDW 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         3BDW 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                4 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Natural killer cells antigen CD94'               14431.896 2  ? ? 'Residues UNP 57-179'  ? 
2 polymer man 'NKG2-A/NKG2-B type II integral membrane protein' 13754.549 2  ? ? 'Residues UNP 113-232' ? 
3 water   nat water                                             18.015    51 ? ? ?                      ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'NK cell receptor, Killer cell lectin-like receptor subfamily D member 1, KP43' 
2 'NKG2-A/B-activating NK receptor, NK cell receptor A, CD159a antigen'           
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;DCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSAL
SQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI
;
;DCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSAL
SQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI
;
A,C ? 
2 'polypeptide(L)' no no 
;ARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGL
AFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHK
;
;ARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGL
AFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHK
;
B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   CYS n 
1 3   CYS n 
1 4   SER n 
1 5   CYS n 
1 6   GLN n 
1 7   GLU n 
1 8   LYS n 
1 9   TRP n 
1 10  VAL n 
1 11  GLY n 
1 12  TYR n 
1 13  ARG n 
1 14  CYS n 
1 15  ASN n 
1 16  CYS n 
1 17  TYR n 
1 18  PHE n 
1 19  ILE n 
1 20  SER n 
1 21  SER n 
1 22  GLU n 
1 23  GLN n 
1 24  LYS n 
1 25  THR n 
1 26  TRP n 
1 27  ASN n 
1 28  GLU n 
1 29  SER n 
1 30  ARG n 
1 31  HIS n 
1 32  LEU n 
1 33  CYS n 
1 34  ALA n 
1 35  SER n 
1 36  GLN n 
1 37  LYS n 
1 38  SER n 
1 39  SER n 
1 40  LEU n 
1 41  LEU n 
1 42  GLN n 
1 43  LEU n 
1 44  GLN n 
1 45  ASN n 
1 46  THR n 
1 47  ASP n 
1 48  GLU n 
1 49  LEU n 
1 50  ASP n 
1 51  PHE n 
1 52  MET n 
1 53  SER n 
1 54  SER n 
1 55  SER n 
1 56  GLN n 
1 57  GLN n 
1 58  PHE n 
1 59  TYR n 
1 60  TRP n 
1 61  ILE n 
1 62  GLY n 
1 63  LEU n 
1 64  SER n 
1 65  TYR n 
1 66  SER n 
1 67  GLU n 
1 68  GLU n 
1 69  HIS n 
1 70  THR n 
1 71  ALA n 
1 72  TRP n 
1 73  LEU n 
1 74  TRP n 
1 75  GLU n 
1 76  ASN n 
1 77  GLY n 
1 78  SER n 
1 79  ALA n 
1 80  LEU n 
1 81  SER n 
1 82  GLN n 
1 83  TYR n 
1 84  LEU n 
1 85  PHE n 
1 86  PRO n 
1 87  SER n 
1 88  PHE n 
1 89  GLU n 
1 90  THR n 
1 91  PHE n 
1 92  ASN n 
1 93  THR n 
1 94  LYS n 
1 95  ASN n 
1 96  CYS n 
1 97  ILE n 
1 98  ALA n 
1 99  TYR n 
1 100 ASN n 
1 101 PRO n 
1 102 ASN n 
1 103 GLY n 
1 104 ASN n 
1 105 ALA n 
1 106 LEU n 
1 107 ASP n 
1 108 GLU n 
1 109 SER n 
1 110 CYS n 
1 111 GLU n 
1 112 ASP n 
1 113 LYS n 
1 114 ASN n 
1 115 ARG n 
1 116 TYR n 
1 117 ILE n 
1 118 CYS n 
1 119 LYS n 
1 120 GLN n 
1 121 GLN n 
1 122 LEU n 
1 123 ILE n 
2 1   ALA n 
2 2   ARG n 
2 3   HIS n 
2 4   CYS n 
2 5   GLY n 
2 6   HIS n 
2 7   CYS n 
2 8   PRO n 
2 9   GLU n 
2 10  GLU n 
2 11  TRP n 
2 12  ILE n 
2 13  THR n 
2 14  TYR n 
2 15  SER n 
2 16  ASN n 
2 17  SER n 
2 18  CYS n 
2 19  TYR n 
2 20  TYR n 
2 21  ILE n 
2 22  GLY n 
2 23  LYS n 
2 24  GLU n 
2 25  ARG n 
2 26  ARG n 
2 27  THR n 
2 28  TRP n 
2 29  GLU n 
2 30  GLU n 
2 31  SER n 
2 32  LEU n 
2 33  LEU n 
2 34  ALA n 
2 35  CYS n 
2 36  THR n 
2 37  SER n 
2 38  LYS n 
2 39  ASN n 
2 40  SER n 
2 41  SER n 
2 42  LEU n 
2 43  LEU n 
2 44  SER n 
2 45  ILE n 
2 46  ASP n 
2 47  ASN n 
2 48  GLU n 
2 49  GLU n 
2 50  GLU n 
2 51  MET n 
2 52  LYS n 
2 53  PHE n 
2 54  LEU n 
2 55  SER n 
2 56  ILE n 
2 57  ILE n 
2 58  SER n 
2 59  PRO n 
2 60  SER n 
2 61  SER n 
2 62  TRP n 
2 63  ILE n 
2 64  GLY n 
2 65  VAL n 
2 66  PHE n 
2 67  ARG n 
2 68  ASN n 
2 69  SER n 
2 70  SER n 
2 71  HIS n 
2 72  HIS n 
2 73  PRO n 
2 74  TRP n 
2 75  VAL n 
2 76  THR n 
2 77  MET n 
2 78  ASN n 
2 79  GLY n 
2 80  LEU n 
2 81  ALA n 
2 82  PHE n 
2 83  LYS n 
2 84  HIS n 
2 85  GLU n 
2 86  ILE n 
2 87  LYS n 
2 88  ASP n 
2 89  SER n 
2 90  ASP n 
2 91  ASN n 
2 92  ALA n 
2 93  GLU n 
2 94  LEU n 
2 95  ASN n 
2 96  CYS n 
2 97  ALA n 
2 98  VAL n 
2 99  LEU n 
2 100 GLN n 
2 101 VAL n 
2 102 ASN n 
2 103 ARG n 
2 104 LEU n 
2 105 LYS n 
2 106 SER n 
2 107 ALA n 
2 108 GLN n 
2 109 CYS n 
2 110 GLY n 
2 111 SER n 
2 112 SER n 
2 113 ILE n 
2 114 ILE n 
2 115 TYR n 
2 116 HIS n 
2 117 CYS n 
2 118 LYS n 
2 119 HIS n 
2 120 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo 'KLRD1, CD94'  ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? 
? ? ? DE3 ? ? ? ? ? ? ? plasmid ? ? ? pET-30 ? ? 
2 1 sample ? ? ? human Homo 'KLRC1, NKG2A' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? 
? ? ? DE3 ? ? ? ? ? ? ? plasmid ? ? ? pET-30 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP KLRD1_HUMAN Q13241 1 
;DCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSAL
SQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI
;
57  ? 
2 UNP NKG2A_HUMAN P26715 2 
;ARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGL
AFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHK
;
113 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3BDW A 1 ? 123 ? Q13241 57  ? 179 ? 57  179 
2 2 3BDW B 1 ? 120 ? P26715 113 ? 232 ? 113 232 
3 1 3BDW C 1 ? 123 ? Q13241 57  ? 179 ? 57  179 
4 2 3BDW D 1 ? 120 ? P26715 113 ? 232 ? 113 232 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3BDW 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.10 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   41.51 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.9 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    '1.0M tri-sodium citrate, 0.1M HEPES, pH 6.9, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2007-03-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-BM' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-BM 
# 
_reflns.entry_id                     3BDW 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.5 
_reflns.d_resolution_low             76.5 
_reflns.number_all                   ? 
_reflns.number_obs                   16457 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.122 
_reflns.pdbx_netI_over_sigmaI        10.1 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.5 
_reflns_shell.d_res_low              2.64 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.meanI_over_sigI_obs    2.2 
_reflns_shell.pdbx_Rsym_value        0.219 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.number_unique_all      2242 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3BDW 
_refine.ls_d_res_high                            2.500 
_refine.ls_d_res_low                             30.590 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    98.360 
_refine.ls_number_reflns_obs                     16445 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.236 
_refine.ls_R_factor_R_work                       0.234 
_refine.ls_R_factor_R_free                       0.270 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  826 
_refine.B_iso_mean                               35.419 
_refine.aniso_B[1][1]                            -0.270 
_refine.aniso_B[2][2]                            0.120 
_refine.aniso_B[3][3]                            0.140 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.920 
_refine.correlation_coeff_Fo_to_Fc_free          0.898 
_refine.pdbx_overall_ESU_R_Free                  0.347 
_refine.overall_SU_ML                            0.280 
_refine.overall_SU_B                             26.382 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1B6E' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3871 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             51 
_refine_hist.number_atoms_total               3922 
_refine_hist.d_res_high                       2.500 
_refine_hist.d_res_low                        30.590 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         3992 0.009  0.021  ? 'X-RAY DIFFRACTION' ? 
r_bond_other_d           2716 0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      5407 1.234  1.912  ? 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        6553 0.830  3.010  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   471  7.468  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   200  37.500 24.600 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   686  18.998 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   16   15.481 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           555  0.083  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     4409 0.003  0.020  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       829  0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            784  0.214  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbd_other              2719 0.183  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          1834 0.187  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_other            2138 0.086  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    108  0.150  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   68   0.232  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     108  0.228  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 14   0.199  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              3034 0.402  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_other           968  0.066  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             3807 0.520  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              1975 0.787  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             1586 1.199  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 'TIGHT POSITIONAL' A 1684 0.010 0.050 1 'X-RAY DIFFRACTION' 1 ? ? ? 
1 'TIGHT THERMAL'    A 1684 0.030 0.500 1 'X-RAY DIFFRACTION' 2 ? ? ? 
1 'TIGHT POSITIONAL' B 1593 0.010 0.050 2 'X-RAY DIFFRACTION' 3 ? ? ? 
1 'TIGHT THERMAL'    B 1593 0.020 0.500 2 'X-RAY DIFFRACTION' 4 ? ? ? 
# 
_refine_ls_shell.d_res_high                       2.500 
_refine_ls_shell.d_res_low                        2.565 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               90.420 
_refine_ls_shell.number_reflns_R_work             1013 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.267 
_refine_ls_shell.R_factor_R_free                  0.394 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             63 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                1076 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 C 
2 1 B 
2 2 D 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 1 A 2 A 122 1 . . CYS LEU A 58  A 178 1 ? 
2 1 C 2 C 122 1 . . CYS LEU C 58  C 178 1 ? 
1 1 B 1 B 120 1 . . ALA LYS B 113 B 232 2 ? 
2 1 D 1 D 120 1 . . ALA LYS D 113 D 232 2 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
# 
_struct.entry_id                  3BDW 
_struct.title                     'Human CD94/NKG2A' 
_struct.pdbx_descriptor           'Natural killer cells antigen CD94, NKG2-A/NKG2-B type II integral membrane protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3BDW 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM RECEPTOR' 
_struct_keywords.text            
'NK cells, receptor, Glycoprotein, Lectin, Membrane, Signal-anchor, Transmembrane, IMMUNE SYSTEM RECEPTOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 25 ? GLN A 36 ? THR A 81  GLN A 92  1 ? 12 
HELX_P HELX_P2  2  ASN A 45 ? SER A 53 ? ASN A 101 SER A 109 5 ? 9  
HELX_P HELX_P3  3  PHE A 85 ? PHE A 91 ? PHE A 141 PHE A 147 5 ? 7  
HELX_P HELX_P4  4  THR B 27 ? LYS B 38 ? THR B 139 LYS B 150 1 ? 12 
HELX_P HELX_P5  5  ASN B 47 ? SER B 58 ? ASN B 159 SER B 170 1 ? 12 
HELX_P HELX_P6  6  THR C 25 ? GLN C 36 ? THR C 81  GLN C 92  1 ? 12 
HELX_P HELX_P7  7  ASN C 45 ? SER C 53 ? ASN C 101 SER C 109 5 ? 9  
HELX_P HELX_P8  8  PHE C 85 ? PHE C 91 ? PHE C 141 PHE C 147 5 ? 7  
HELX_P HELX_P9  9  THR D 27 ? LYS D 38 ? THR D 139 LYS D 150 1 ? 12 
HELX_P HELX_P10 10 ASN D 47 ? SER D 58 ? ASN D 159 SER D 170 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 2  SG ? ? ? 1_555 A CYS 14  SG ? ? A CYS 58  A CYS 70  1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf2  disulf ? ? A CYS 3  SG ? ? ? 1_555 B CYS 4   SG ? ? A CYS 59  B CYS 116 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf3  disulf ? ? A CYS 5  SG ? ? ? 1_555 A CYS 16  SG ? ? A CYS 61  A CYS 72  1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf4  disulf ? ? A CYS 33 SG ? ? ? 1_555 A CYS 118 SG ? ? A CYS 89  A CYS 174 1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf5  disulf ? ? A CYS 96 SG ? ? ? 1_555 A CYS 110 SG ? ? A CYS 152 A CYS 166 1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf6  disulf ? ? B CYS 7  SG ? ? ? 1_555 B CYS 18  SG ? ? B CYS 119 B CYS 130 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf7  disulf ? ? B CYS 35 SG ? ? ? 1_555 B CYS 117 SG ? ? B CYS 147 B CYS 229 1_555 ? ? ? ? ? ? ? 2.050 ? 
disulf8  disulf ? ? B CYS 96 SG ? ? ? 1_555 B CYS 109 SG ? ? B CYS 208 B CYS 221 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf9  disulf ? ? C CYS 2  SG ? ? ? 1_555 C CYS 14  SG ? ? C CYS 58  C CYS 70  1_555 ? ? ? ? ? ? ? 2.041 ? 
disulf10 disulf ? ? C CYS 3  SG ? ? ? 1_555 D CYS 4   SG ? ? C CYS 59  D CYS 116 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf11 disulf ? ? C CYS 5  SG ? ? ? 1_555 C CYS 16  SG ? ? C CYS 61  C CYS 72  1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf12 disulf ? ? C CYS 33 SG ? ? ? 1_555 C CYS 118 SG ? ? C CYS 89  C CYS 174 1_555 ? ? ? ? ? ? ? 2.054 ? 
disulf13 disulf ? ? C CYS 96 SG ? ? ? 1_555 C CYS 110 SG ? ? C CYS 152 C CYS 166 1_555 ? ? ? ? ? ? ? 2.021 ? 
disulf14 disulf ? ? D CYS 7  SG ? ? ? 1_555 D CYS 18  SG ? ? D CYS 119 D CYS 130 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf15 disulf ? ? D CYS 35 SG ? ? ? 1_555 D CYS 117 SG ? ? D CYS 147 D CYS 229 1_555 ? ? ? ? ? ? ? 2.069 ? 
disulf16 disulf ? ? D CYS 96 SG ? ? ? 1_555 D CYS 109 SG ? ? D CYS 208 D CYS 221 1_555 ? ? ? ? ? ? ? 2.042 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 6 ? 
C ? 2 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
G ? 6 ? 
H ? 2 ? 
I ? 4 ? 
J ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? parallel      
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 10  ? TYR A 12  ? VAL A 66  TYR A 68  
A 2 ASN A 15  ? ILE A 19  ? ASN A 71  ILE A 75  
A 3 ARG A 115 ? GLN A 120 ? ARG A 171 GLN A 176 
A 4 SER A 39  ? LEU A 40  ? SER A 95  LEU A 96  
B 1 VAL A 10  ? TYR A 12  ? VAL A 66  TYR A 68  
B 2 ASN A 15  ? ILE A 19  ? ASN A 71  ILE A 75  
B 3 ARG A 115 ? GLN A 120 ? ARG A 171 GLN A 176 
B 4 TYR A 59  ? TRP A 60  ? TYR A 115 TRP A 116 
B 5 CYS A 96  ? ASN A 100 ? CYS A 152 ASN A 156 
B 6 ASN A 104 ? GLU A 108 ? ASN A 160 GLU A 164 
C 1 LEU A 63  ? SER A 66  ? LEU A 119 SER A 122 
C 2 ALA A 71  ? TRP A 74  ? ALA A 127 TRP A 130 
D 1 ILE B 12  ? THR B 13  ? ILE B 124 THR B 125 
D 2 CYS B 18  ? ARG B 26  ? CYS B 130 ARG B 138 
D 3 ILE B 113 ? LYS B 118 ? ILE B 225 LYS B 230 
D 4 SER B 41  ? LEU B 42  ? SER B 153 LEU B 154 
E 1 VAL B 75  ? THR B 76  ? VAL B 187 THR B 188 
E 2 SER B 60  ? PHE B 66  ? SER B 172 PHE B 178 
E 3 CYS B 96  ? GLN B 100 ? CYS B 208 GLN B 212 
E 4 LEU B 104 ? ALA B 107 ? LEU B 216 ALA B 219 
F 1 VAL C 10  ? TYR C 12  ? VAL C 66  TYR C 68  
F 2 ASN C 15  ? ILE C 19  ? ASN C 71  ILE C 75  
F 3 ARG C 115 ? GLN C 120 ? ARG C 171 GLN C 176 
F 4 SER C 39  ? LEU C 40  ? SER C 95  LEU C 96  
G 1 VAL C 10  ? TYR C 12  ? VAL C 66  TYR C 68  
G 2 ASN C 15  ? ILE C 19  ? ASN C 71  ILE C 75  
G 3 ARG C 115 ? GLN C 120 ? ARG C 171 GLN C 176 
G 4 TYR C 59  ? TRP C 60  ? TYR C 115 TRP C 116 
G 5 CYS C 96  ? ASN C 100 ? CYS C 152 ASN C 156 
G 6 ASN C 104 ? GLU C 108 ? ASN C 160 GLU C 164 
H 1 LEU C 63  ? SER C 66  ? LEU C 119 SER C 122 
H 2 ALA C 71  ? TRP C 74  ? ALA C 127 TRP C 130 
I 1 ILE D 12  ? THR D 13  ? ILE D 124 THR D 125 
I 2 CYS D 18  ? ARG D 26  ? CYS D 130 ARG D 138 
I 3 ILE D 113 ? LYS D 118 ? ILE D 225 LYS D 230 
I 4 SER D 41  ? LEU D 42  ? SER D 153 LEU D 154 
J 1 VAL D 75  ? THR D 76  ? VAL D 187 THR D 188 
J 2 SER D 60  ? PHE D 66  ? SER D 172 PHE D 178 
J 3 CYS D 96  ? GLN D 100 ? CYS D 208 GLN D 212 
J 4 LEU D 104 ? ALA D 107 ? LEU D 216 ALA D 219 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 10  ? N VAL A 66  O TYR A 17  ? O TYR A 73  
A 2 3 N CYS A 16  ? N CYS A 72  O GLN A 120 ? O GLN A 176 
A 3 4 O LYS A 119 ? O LYS A 175 N SER A 39  ? N SER A 95  
B 1 2 N VAL A 10  ? N VAL A 66  O TYR A 17  ? O TYR A 73  
B 2 3 N CYS A 16  ? N CYS A 72  O GLN A 120 ? O GLN A 176 
B 3 4 O ARG A 115 ? O ARG A 171 N TRP A 60  ? N TRP A 116 
B 4 5 N TYR A 59  ? N TYR A 115 O TYR A 99  ? O TYR A 155 
B 5 6 N ALA A 98  ? N ALA A 154 O LEU A 106 ? O LEU A 162 
C 1 2 N SER A 66  ? N SER A 122 O ALA A 71  ? O ALA A 127 
D 1 2 N ILE B 12  ? N ILE B 124 O TYR B 19  ? O TYR B 131 
D 2 3 N ARG B 26  ? N ARG B 138 O ILE B 113 ? O ILE B 225 
D 3 4 O LYS B 118 ? O LYS B 230 N SER B 41  ? N SER B 153 
E 1 2 O VAL B 75  ? O VAL B 187 N PHE B 66  ? N PHE B 178 
E 2 3 N SER B 61  ? N SER B 173 O LEU B 99  ? O LEU B 211 
E 3 4 N VAL B 98  ? N VAL B 210 O LYS B 105 ? O LYS B 217 
F 1 2 N VAL C 10  ? N VAL C 66  O TYR C 17  ? O TYR C 73  
F 2 3 N CYS C 16  ? N CYS C 72  O GLN C 120 ? O GLN C 176 
F 3 4 O LYS C 119 ? O LYS C 175 N SER C 39  ? N SER C 95  
G 1 2 N VAL C 10  ? N VAL C 66  O TYR C 17  ? O TYR C 73  
G 2 3 N CYS C 16  ? N CYS C 72  O GLN C 120 ? O GLN C 176 
G 3 4 O ARG C 115 ? O ARG C 171 N TRP C 60  ? N TRP C 116 
G 4 5 N TYR C 59  ? N TYR C 115 O TYR C 99  ? O TYR C 155 
G 5 6 N CYS C 96  ? N CYS C 152 O GLU C 108 ? O GLU C 164 
H 1 2 N SER C 66  ? N SER C 122 O ALA C 71  ? O ALA C 127 
I 1 2 N ILE D 12  ? N ILE D 124 O TYR D 19  ? O TYR D 131 
I 2 3 N ARG D 26  ? N ARG D 138 O ILE D 113 ? O ILE D 225 
I 3 4 O LYS D 118 ? O LYS D 230 N SER D 41  ? N SER D 153 
J 1 2 O VAL D 75  ? O VAL D 187 N PHE D 66  ? N PHE D 178 
J 2 3 N SER D 61  ? N SER D 173 O LEU D 99  ? O LEU D 211 
J 3 4 N VAL D 98  ? N VAL D 210 O LYS D 105 ? O LYS D 217 
# 
_atom_sites.entry_id                    3BDW 
_atom_sites.fract_transf_matrix[1][1]   0.022396 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   -0.000109 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.028793 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006540 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 1   ? 5.502   0.390   -54.869 1.00 47.76 ? 57  ASP A N   1 
ATOM   2    C CA  . ASP A 1 1   ? 4.999   1.776   -54.639 1.00 47.54 ? 57  ASP A CA  1 
ATOM   3    C C   . ASP A 1 1   ? 3.494   1.766   -54.407 1.00 47.56 ? 57  ASP A C   1 
ATOM   4    O O   . ASP A 1 1   ? 3.006   2.335   -53.426 1.00 48.45 ? 57  ASP A O   1 
ATOM   5    C CB  . ASP A 1 1   ? 5.339   2.675   -55.837 1.00 47.93 ? 57  ASP A CB  1 
ATOM   6    N N   . CYS A 1 2   ? 2.773   1.131   -55.332 1.00 46.67 ? 58  CYS A N   1 
ATOM   7    C CA  . CYS A 1 2   ? 1.297   1.003   -55.328 1.00 46.17 ? 58  CYS A CA  1 
ATOM   8    C C   . CYS A 1 2   ? 0.426   2.259   -55.311 1.00 45.81 ? 58  CYS A C   1 
ATOM   9    O O   . CYS A 1 2   ? -0.792  2.160   -55.463 1.00 45.97 ? 58  CYS A O   1 
ATOM   10   C CB  . CYS A 1 2   ? 0.780   0.256   -54.092 1.00 46.14 ? 58  CYS A CB  1 
ATOM   11   S SG  . CYS A 1 2   ? 1.157   -1.510  -54.071 1.00 46.59 ? 58  CYS A SG  1 
ATOM   12   N N   . CYS A 1 3   ? 1.033   3.427   -55.126 1.00 45.26 ? 59  CYS A N   1 
ATOM   13   C CA  . CYS A 1 3   ? 0.287   4.671   -54.978 1.00 45.04 ? 59  CYS A CA  1 
ATOM   14   C C   . CYS A 1 3   ? 0.843   5.516   -56.134 1.00 44.76 ? 59  CYS A C   1 
ATOM   15   O O   . CYS A 1 3   ? 1.325   6.633   -55.938 1.00 44.31 ? 59  CYS A O   1 
ATOM   16   C CB  . CYS A 1 3   ? 0.375   5.405   -53.641 1.00 44.80 ? 59  CYS A CB  1 
ATOM   17   S SG  . CYS A 1 3   ? 0.009   4.326   -52.221 1.00 45.13 ? 59  CYS A SG  1 
ATOM   18   N N   . SER A 1 4   ? 0.757   4.953   -57.338 1.00 44.62 ? 60  SER A N   1 
ATOM   19   C CA  . SER A 1 4   ? 1.079   5.644   -58.582 1.00 44.72 ? 60  SER A CA  1 
ATOM   20   C C   . SER A 1 4   ? -0.232  6.280   -59.098 1.00 44.77 ? 60  SER A C   1 
ATOM   21   O O   . SER A 1 4   ? -0.912  6.979   -58.345 1.00 45.21 ? 60  SER A O   1 
ATOM   22   C CB  . SER A 1 4   ? 1.679   4.625   -59.564 1.00 44.84 ? 60  SER A CB  1 
ATOM   23   O OG  . SER A 1 4   ? 2.334   5.243   -60.656 1.00 45.50 ? 60  SER A OG  1 
ATOM   24   N N   . CYS A 1 5   ? -0.578  6.068   -60.367 1.00 44.79 ? 61  CYS A N   1 
ATOM   25   C CA  . CYS A 1 5   ? -1.950  6.294   -60.885 1.00 44.41 ? 61  CYS A CA  1 
ATOM   26   C C   . CYS A 1 5   ? -2.304  7.729   -61.253 1.00 44.30 ? 61  CYS A C   1 
ATOM   27   O O   . CYS A 1 5   ? -3.351  8.222   -60.826 1.00 44.64 ? 61  CYS A O   1 
ATOM   28   C CB  . CYS A 1 5   ? -3.022  5.805   -59.893 1.00 44.34 ? 61  CYS A CB  1 
ATOM   29   S SG  . CYS A 1 5   ? -2.853  4.155   -59.223 1.00 44.38 ? 61  CYS A SG  1 
ATOM   30   N N   . GLN A 1 6   ? -1.475  8.399   -62.048 1.00 43.98 ? 62  GLN A N   1 
ATOM   31   C CA  . GLN A 1 6   ? -1.784  9.765   -62.504 1.00 43.82 ? 62  GLN A CA  1 
ATOM   32   C C   . GLN A 1 6   ? -2.464  10.672  -61.469 1.00 43.59 ? 62  GLN A C   1 
ATOM   33   O O   . GLN A 1 6   ? -2.393  10.431  -60.265 1.00 43.58 ? 62  GLN A O   1 
ATOM   34   C CB  . GLN A 1 6   ? -2.523  9.736   -63.848 1.00 43.68 ? 62  GLN A CB  1 
ATOM   35   C CG  . GLN A 1 6   ? -2.147  8.598   -64.783 1.00 44.19 ? 62  GLN A CG  1 
ATOM   36   C CD  . GLN A 1 6   ? -0.678  8.564   -65.131 1.00 44.64 ? 62  GLN A CD  1 
ATOM   37   O OE1 . GLN A 1 6   ? 0.024   9.570   -65.019 1.00 45.75 ? 62  GLN A OE1 1 
ATOM   38   N NE2 . GLN A 1 6   ? -0.204  7.401   -65.568 1.00 44.80 ? 62  GLN A NE2 1 
ATOM   39   N N   . GLU A 1 7   ? -3.219  11.673  -61.999 1.00 43.55 ? 63  GLU A N   1 
ATOM   40   C CA  . GLU A 1 7   ? -4.247  12.329  -61.200 1.00 43.29 ? 63  GLU A CA  1 
ATOM   41   C C   . GLU A 1 7   ? -5.514  11.882  -61.909 1.00 42.93 ? 63  GLU A C   1 
ATOM   42   O O   . GLU A 1 7   ? -5.558  11.849  -63.143 1.00 42.97 ? 63  GLU A O   1 
ATOM   43   C CB  . GLU A 1 7   ? -4.149  13.860  -61.188 1.00 43.34 ? 63  GLU A CB  1 
ATOM   44   C CG  . GLU A 1 7   ? -4.417  14.566  -62.521 1.00 43.62 ? 63  GLU A CG  1 
ATOM   45   C CD  . GLU A 1 7   ? -4.017  16.040  -62.487 1.00 44.13 ? 63  GLU A CD  1 
ATOM   46   O OE1 . GLU A 1 7   ? -3.180  16.439  -63.333 1.00 45.98 ? 63  GLU A OE1 1 
ATOM   47   O OE2 . GLU A 1 7   ? -4.512  16.791  -61.605 1.00 44.77 ? 63  GLU A OE2 1 
ATOM   48   N N   . LYS A 1 8   ? -6.514  11.490  -61.126 1.00 42.42 ? 64  LYS A N   1 
ATOM   49   C CA  . LYS A 1 8   ? -7.826  11.105  -61.652 1.00 42.13 ? 64  LYS A CA  1 
ATOM   50   C C   . LYS A 1 8   ? -7.903  9.735   -62.366 1.00 41.61 ? 64  LYS A C   1 
ATOM   51   O O   . LYS A 1 8   ? -8.834  9.480   -63.121 1.00 41.75 ? 64  LYS A O   1 
ATOM   52   C CB  . LYS A 1 8   ? -8.401  12.228  -62.528 1.00 42.20 ? 64  LYS A CB  1 
ATOM   53   C CG  . LYS A 1 8   ? -8.453  13.570  -61.797 1.00 42.51 ? 64  LYS A CG  1 
ATOM   54   C CD  . LYS A 1 8   ? -9.264  14.613  -62.559 1.00 42.62 ? 64  LYS A CD  1 
ATOM   55   C CE  . LYS A 1 8   ? -8.369  15.543  -63.367 1.00 43.12 ? 64  LYS A CE  1 
ATOM   56   N NZ  . LYS A 1 8   ? -7.607  16.480  -62.483 1.00 43.03 ? 64  LYS A NZ  1 
ATOM   57   N N   . TRP A 1 9   ? -6.934  8.864   -62.113 1.00 40.91 ? 65  TRP A N   1 
ATOM   58   C CA  . TRP A 1 9   ? -7.124  7.425   -62.296 1.00 40.47 ? 65  TRP A CA  1 
ATOM   59   C C   . TRP A 1 9   ? -7.539  6.888   -60.929 1.00 40.09 ? 65  TRP A C   1 
ATOM   60   O O   . TRP A 1 9   ? -7.280  7.531   -59.923 1.00 40.30 ? 65  TRP A O   1 
ATOM   61   C CB  . TRP A 1 9   ? -5.827  6.755   -62.749 1.00 40.19 ? 65  TRP A CB  1 
ATOM   62   C CG  . TRP A 1 9   ? -5.513  6.975   -64.173 1.00 39.78 ? 65  TRP A CG  1 
ATOM   63   C CD1 . TRP A 1 9   ? -5.454  8.168   -64.824 1.00 39.95 ? 65  TRP A CD1 1 
ATOM   64   C CD2 . TRP A 1 9   ? -5.201  5.974   -65.141 1.00 39.98 ? 65  TRP A CD2 1 
ATOM   65   N NE1 . TRP A 1 9   ? -5.131  7.976   -66.142 1.00 39.77 ? 65  TRP A NE1 1 
ATOM   66   C CE2 . TRP A 1 9   ? -4.968  6.636   -66.364 1.00 40.36 ? 65  TRP A CE2 1 
ATOM   67   C CE3 . TRP A 1 9   ? -5.095  4.581   -65.094 1.00 39.07 ? 65  TRP A CE3 1 
ATOM   68   C CZ2 . TRP A 1 9   ? -4.642  5.948   -67.535 1.00 40.01 ? 65  TRP A CZ2 1 
ATOM   69   C CZ3 . TRP A 1 9   ? -4.771  3.908   -66.245 1.00 39.66 ? 65  TRP A CZ3 1 
ATOM   70   C CH2 . TRP A 1 9   ? -4.549  4.590   -67.455 1.00 39.72 ? 65  TRP A CH2 1 
ATOM   71   N N   . VAL A 1 10  ? -8.184  5.729   -60.872 1.00 39.70 ? 66  VAL A N   1 
ATOM   72   C CA  . VAL A 1 10  ? -8.612  5.193   -59.583 1.00 39.42 ? 66  VAL A CA  1 
ATOM   73   C C   . VAL A 1 10  ? -7.679  4.051   -59.228 1.00 39.20 ? 66  VAL A C   1 
ATOM   74   O O   . VAL A 1 10  ? -7.410  3.194   -60.055 1.00 39.13 ? 66  VAL A O   1 
ATOM   75   C CB  . VAL A 1 10  ? -10.118 4.755   -59.575 1.00 39.46 ? 66  VAL A CB  1 
ATOM   76   C CG1 . VAL A 1 10  ? -10.918 5.485   -60.677 1.00 38.61 ? 66  VAL A CG1 1 
ATOM   77   C CG2 . VAL A 1 10  ? -10.268 3.259   -59.709 1.00 39.22 ? 66  VAL A CG2 1 
ATOM   78   N N   . GLY A 1 11  ? -7.156  4.067   -58.011 1.00 39.24 ? 67  GLY A N   1 
ATOM   79   C CA  . GLY A 1 11  ? -6.242  3.033   -57.543 1.00 39.31 ? 67  GLY A CA  1 
ATOM   80   C C   . GLY A 1 11  ? -6.958  2.049   -56.647 1.00 39.35 ? 67  GLY A C   1 
ATOM   81   O O   . GLY A 1 11  ? -7.701  2.462   -55.763 1.00 39.55 ? 67  GLY A O   1 
ATOM   82   N N   . TYR A 1 12  ? -6.726  0.754   -56.859 1.00 39.33 ? 68  TYR A N   1 
ATOM   83   C CA  . TYR A 1 12  ? -7.431  -0.301  -56.120 1.00 39.44 ? 68  TYR A CA  1 
ATOM   84   C C   . TYR A 1 12  ? -6.673  -1.614  -56.258 1.00 39.61 ? 68  TYR A C   1 
ATOM   85   O O   . TYR A 1 12  ? -6.408  -2.059  -57.376 1.00 39.79 ? 68  TYR A O   1 
ATOM   86   C CB  . TYR A 1 12  ? -8.866  -0.443  -56.655 1.00 38.99 ? 68  TYR A CB  1 
ATOM   87   C CG  . TYR A 1 12  ? -9.716  -1.516  -55.996 1.00 38.78 ? 68  TYR A CG  1 
ATOM   88   C CD1 . TYR A 1 12  ? -9.986  -1.480  -54.628 1.00 38.54 ? 68  TYR A CD1 1 
ATOM   89   C CD2 . TYR A 1 12  ? -10.279 -2.544  -56.744 1.00 38.05 ? 68  TYR A CD2 1 
ATOM   90   C CE1 . TYR A 1 12  ? -10.774 -2.456  -54.015 1.00 38.52 ? 68  TYR A CE1 1 
ATOM   91   C CE2 . TYR A 1 12  ? -11.076 -3.518  -56.150 1.00 38.35 ? 68  TYR A CE2 1 
ATOM   92   C CZ  . TYR A 1 12  ? -11.319 -3.471  -54.780 1.00 38.98 ? 68  TYR A CZ  1 
ATOM   93   O OH  . TYR A 1 12  ? -12.095 -4.437  -54.170 1.00 37.86 ? 68  TYR A OH  1 
ATOM   94   N N   . ARG A 1 13  ? -6.314  -2.215  -55.122 1.00 40.08 ? 69  ARG A N   1 
ATOM   95   C CA  . ARG A 1 13  ? -5.562  -3.474  -55.081 1.00 40.54 ? 69  ARG A CA  1 
ATOM   96   C C   . ARG A 1 13  ? -4.219  -3.333  -55.820 1.00 40.79 ? 69  ARG A C   1 
ATOM   97   O O   . ARG A 1 13  ? -3.820  -4.196  -56.609 1.00 40.63 ? 69  ARG A O   1 
ATOM   98   C CB  . ARG A 1 13  ? -6.398  -4.627  -55.662 1.00 41.05 ? 69  ARG A CB  1 
ATOM   99   C CG  . ARG A 1 13  ? -7.836  -4.728  -55.123 1.00 41.76 ? 69  ARG A CG  1 
ATOM   100  C CD  . ARG A 1 13  ? -7.956  -5.631  -53.867 1.00 43.75 ? 69  ARG A CD  1 
ATOM   101  N NE  . ARG A 1 13  ? -9.344  -6.036  -53.606 1.00 44.10 ? 69  ARG A NE  1 
ATOM   102  C CZ  . ARG A 1 13  ? -10.055 -6.868  -54.383 1.00 45.46 ? 69  ARG A CZ  1 
ATOM   103  N NH1 . ARG A 1 13  ? -9.530  -7.405  -55.489 1.00 45.33 ? 69  ARG A NH1 1 
ATOM   104  N NH2 . ARG A 1 13  ? -11.314 -7.161  -54.062 1.00 45.80 ? 69  ARG A NH2 1 
ATOM   105  N N   . CYS A 1 14  ? -3.541  -2.217  -55.562 1.00 41.15 ? 70  CYS A N   1 
ATOM   106  C CA  . CYS A 1 14  ? -2.260  -1.897  -56.182 1.00 41.09 ? 70  CYS A CA  1 
ATOM   107  C C   . CYS A 1 14  ? -2.303  -1.950  -57.704 1.00 40.99 ? 70  CYS A C   1 
ATOM   108  O O   . CYS A 1 14  ? -1.313  -2.311  -58.338 1.00 40.84 ? 70  CYS A O   1 
ATOM   109  C CB  . CYS A 1 14  ? -1.153  -2.814  -55.637 1.00 41.65 ? 70  CYS A CB  1 
ATOM   110  S SG  . CYS A 1 14  ? 0.557   -2.195  -55.895 1.00 42.55 ? 70  CYS A SG  1 
ATOM   111  N N   . ASN A 1 15  ? -3.459  -1.599  -58.273 1.00 40.80 ? 71  ASN A N   1 
ATOM   112  C CA  . ASN A 1 15  ? -3.599  -1.319  -59.699 1.00 40.72 ? 71  ASN A CA  1 
ATOM   113  C C   . ASN A 1 15  ? -4.144  0.088   -59.873 1.00 40.62 ? 71  ASN A C   1 
ATOM   114  O O   . ASN A 1 15  ? -4.607  0.695   -58.909 1.00 40.61 ? 71  ASN A O   1 
ATOM   115  C CB  . ASN A 1 15  ? -4.556  -2.301  -60.368 1.00 40.94 ? 71  ASN A CB  1 
ATOM   116  C CG  . ASN A 1 15  ? -4.028  -3.712  -60.390 1.00 41.07 ? 71  ASN A CG  1 
ATOM   117  O OD1 . ASN A 1 15  ? -2.820  -3.938  -60.344 1.00 41.28 ? 71  ASN A OD1 1 
ATOM   118  N ND2 . ASN A 1 15  ? -4.935  -4.674  -60.471 1.00 41.26 ? 71  ASN A ND2 1 
ATOM   119  N N   . CYS A 1 16  ? -4.080  0.599   -61.101 1.00 40.35 ? 72  CYS A N   1 
ATOM   120  C CA  . CYS A 1 16  ? -4.645  1.897   -61.430 1.00 40.12 ? 72  CYS A CA  1 
ATOM   121  C C   . CYS A 1 16  ? -5.627  1.693   -62.553 1.00 39.60 ? 72  CYS A C   1 
ATOM   122  O O   . CYS A 1 16  ? -5.308  1.015   -63.509 1.00 39.35 ? 72  CYS A O   1 
ATOM   123  C CB  . CYS A 1 16  ? -3.565  2.872   -61.881 1.00 40.34 ? 72  CYS A CB  1 
ATOM   124  S SG  . CYS A 1 16  ? -2.168  3.015   -60.772 1.00 42.04 ? 72  CYS A SG  1 
ATOM   125  N N   . TYR A 1 17  ? -6.814  2.283   -62.429 1.00 39.23 ? 73  TYR A N   1 
ATOM   126  C CA  . TYR A 1 17  ? -7.844  2.186   -63.444 1.00 39.02 ? 73  TYR A CA  1 
ATOM   127  C C   . TYR A 1 17  ? -8.243  3.566   -63.976 1.00 38.82 ? 73  TYR A C   1 
ATOM   128  O O   . TYR A 1 17  ? -8.261  4.555   -63.236 1.00 38.73 ? 73  TYR A O   1 
ATOM   129  C CB  . TYR A 1 17  ? -9.066  1.464   -62.866 1.00 39.03 ? 73  TYR A CB  1 
ATOM   130  C CG  . TYR A 1 17  ? -8.777  0.051   -62.429 1.00 38.65 ? 73  TYR A CG  1 
ATOM   131  C CD1 . TYR A 1 17  ? -8.453  -0.233  -61.108 1.00 39.06 ? 73  TYR A CD1 1 
ATOM   132  C CD2 . TYR A 1 17  ? -8.814  -1.002  -63.339 1.00 38.75 ? 73  TYR A CD2 1 
ATOM   133  C CE1 . TYR A 1 17  ? -8.177  -1.528  -60.699 1.00 38.95 ? 73  TYR A CE1 1 
ATOM   134  C CE2 . TYR A 1 17  ? -8.537  -2.302  -62.945 1.00 39.00 ? 73  TYR A CE2 1 
ATOM   135  C CZ  . TYR A 1 17  ? -8.222  -2.560  -61.622 1.00 39.16 ? 73  TYR A CZ  1 
ATOM   136  O OH  . TYR A 1 17  ? -7.937  -3.847  -61.225 1.00 39.21 ? 73  TYR A OH  1 
ATOM   137  N N   . PHE A 1 18  ? -8.548  3.617   -65.269 1.00 38.94 ? 74  PHE A N   1 
ATOM   138  C CA  . PHE A 1 18  ? -9.120  4.798   -65.918 1.00 38.91 ? 74  PHE A CA  1 
ATOM   139  C C   . PHE A 1 18  ? -10.431 4.389   -66.572 1.00 38.66 ? 74  PHE A C   1 
ATOM   140  O O   . PHE A 1 18  ? -10.432 3.605   -67.504 1.00 38.14 ? 74  PHE A O   1 
ATOM   141  C CB  . PHE A 1 18  ? -8.144  5.331   -66.958 1.00 39.42 ? 74  PHE A CB  1 
ATOM   142  C CG  . PHE A 1 18  ? -8.697  6.429   -67.836 1.00 39.47 ? 74  PHE A CG  1 
ATOM   143  C CD1 . PHE A 1 18  ? -9.175  6.145   -69.103 1.00 39.43 ? 74  PHE A CD1 1 
ATOM   144  C CD2 . PHE A 1 18  ? -8.693  7.749   -67.412 1.00 41.27 ? 74  PHE A CD2 1 
ATOM   145  C CE1 . PHE A 1 18  ? -9.657  7.141   -69.925 1.00 40.10 ? 74  PHE A CE1 1 
ATOM   146  C CE2 . PHE A 1 18  ? -9.190  8.763   -68.239 1.00 40.84 ? 74  PHE A CE2 1 
ATOM   147  C CZ  . PHE A 1 18  ? -9.662  8.453   -69.497 1.00 40.23 ? 74  PHE A CZ  1 
ATOM   148  N N   . ILE A 1 19  ? -11.545 4.912   -66.063 1.00 38.91 ? 75  ILE A N   1 
ATOM   149  C CA  . ILE A 1 19  ? -12.869 4.581   -66.582 1.00 38.83 ? 75  ILE A CA  1 
ATOM   150  C C   . ILE A 1 19  ? -13.293 5.730   -67.468 1.00 38.78 ? 75  ILE A C   1 
ATOM   151  O O   . ILE A 1 19  ? -13.450 6.860   -66.997 1.00 38.53 ? 75  ILE A O   1 
ATOM   152  C CB  . ILE A 1 19  ? -13.914 4.406   -65.462 1.00 38.71 ? 75  ILE A CB  1 
ATOM   153  C CG1 . ILE A 1 19  ? -13.314 3.730   -64.226 1.00 39.05 ? 75  ILE A CG1 1 
ATOM   154  C CG2 . ILE A 1 19  ? -15.103 3.608   -65.973 1.00 38.96 ? 75  ILE A CG2 1 
ATOM   155  C CD1 . ILE A 1 19  ? -12.559 2.462   -64.508 1.00 38.84 ? 75  ILE A CD1 1 
ATOM   156  N N   . SER A 1 20  ? -13.459 5.456   -68.753 1.00 39.22 ? 76  SER A N   1 
ATOM   157  C CA  . SER A 1 20  ? -13.733 6.524   -69.717 1.00 39.71 ? 76  SER A CA  1 
ATOM   158  C C   . SER A 1 20  ? -15.175 7.031   -69.642 1.00 39.89 ? 76  SER A C   1 
ATOM   159  O O   . SER A 1 20  ? -16.078 6.332   -69.201 1.00 40.05 ? 76  SER A O   1 
ATOM   160  C CB  . SER A 1 20  ? -13.446 6.050   -71.143 1.00 39.91 ? 76  SER A CB  1 
ATOM   161  O OG  . SER A 1 20  ? -14.571 5.397   -71.703 1.00 40.27 ? 76  SER A OG  1 
ATOM   162  N N   . SER A 1 21  ? -15.356 8.278   -70.042 1.00 40.47 ? 77  SER A N   1 
ATOM   163  C CA  . SER A 1 21  ? -16.661 8.869   -70.319 1.00 40.58 ? 77  SER A CA  1 
ATOM   164  C C   . SER A 1 21  ? -16.854 8.976   -71.831 1.00 40.66 ? 77  SER A C   1 
ATOM   165  O O   . SER A 1 21  ? -17.974 8.979   -72.334 1.00 40.72 ? 77  SER A O   1 
ATOM   166  C CB  . SER A 1 21  ? -16.717 10.247  -69.687 1.00 40.60 ? 77  SER A CB  1 
ATOM   167  O OG  . SER A 1 21  ? -16.426 10.132  -68.304 1.00 41.99 ? 77  SER A OG  1 
ATOM   168  N N   . GLU A 1 22  ? -15.725 9.044   -72.527 1.00 40.71 ? 78  GLU A N   1 
ATOM   169  C CA  . GLU A 1 22  ? -15.629 9.141   -73.968 1.00 40.57 ? 78  GLU A CA  1 
ATOM   170  C C   . GLU A 1 22  ? -15.835 7.756   -74.563 1.00 40.48 ? 78  GLU A C   1 
ATOM   171  O O   . GLU A 1 22  ? -15.353 6.763   -74.005 1.00 40.66 ? 78  GLU A O   1 
ATOM   172  C CB  . GLU A 1 22  ? -14.214 9.605   -74.275 1.00 40.70 ? 78  GLU A CB  1 
ATOM   173  C CG  . GLU A 1 22  ? -13.945 10.193  -75.617 1.00 41.23 ? 78  GLU A CG  1 
ATOM   174  C CD  . GLU A 1 22  ? -12.450 10.372  -75.810 1.00 41.80 ? 78  GLU A CD  1 
ATOM   175  O OE1 . GLU A 1 22  ? -11.695 9.627   -75.131 1.00 42.94 ? 78  GLU A OE1 1 
ATOM   176  O OE2 . GLU A 1 22  ? -12.031 11.237  -76.625 1.00 43.23 ? 78  GLU A OE2 1 
ATOM   177  N N   . GLN A 1 23  ? -16.530 7.686   -75.695 1.00 39.90 ? 79  GLN A N   1 
ATOM   178  C CA  . GLN A 1 23  ? -16.830 6.413   -76.331 1.00 39.53 ? 79  GLN A CA  1 
ATOM   179  C C   . GLN A 1 23  ? -16.064 6.273   -77.615 1.00 39.07 ? 79  GLN A C   1 
ATOM   180  O O   . GLN A 1 23  ? -16.152 7.119   -78.483 1.00 39.43 ? 79  GLN A O   1 
ATOM   181  C CB  . GLN A 1 23  ? -18.322 6.267   -76.598 1.00 39.53 ? 79  GLN A CB  1 
ATOM   182  C CG  . GLN A 1 23  ? -19.146 6.138   -75.332 1.00 39.59 ? 79  GLN A CG  1 
ATOM   183  C CD  . GLN A 1 23  ? -20.630 6.202   -75.597 1.00 39.49 ? 79  GLN A CD  1 
ATOM   184  O OE1 . GLN A 1 23  ? -21.302 7.164   -75.220 1.00 39.51 ? 79  GLN A OE1 1 
ATOM   185  N NE2 . GLN A 1 23  ? -21.149 5.189   -76.273 1.00 41.09 ? 79  GLN A NE2 1 
ATOM   186  N N   . LYS A 1 24  ? -15.314 5.185   -77.728 1.00 38.87 ? 80  LYS A N   1 
ATOM   187  C CA  . LYS A 1 24  ? -14.429 4.976   -78.843 1.00 38.71 ? 80  LYS A CA  1 
ATOM   188  C C   . LYS A 1 24  ? -14.499 3.531   -79.318 1.00 38.67 ? 80  LYS A C   1 
ATOM   189  O O   . LYS A 1 24  ? -15.009 2.633   -78.631 1.00 39.20 ? 80  LYS A O   1 
ATOM   190  C CB  . LYS A 1 24  ? -12.980 5.313   -78.458 1.00 38.80 ? 80  LYS A CB  1 
ATOM   191  C CG  . LYS A 1 24  ? -12.748 6.713   -77.897 1.00 38.90 ? 80  LYS A CG  1 
ATOM   192  C CD  . LYS A 1 24  ? -12.938 7.827   -78.914 1.00 39.74 ? 80  LYS A CD  1 
ATOM   193  C CE  . LYS A 1 24  ? -11.597 8.429   -79.383 1.00 40.22 ? 80  LYS A CE  1 
ATOM   194  N NZ  . LYS A 1 24  ? -11.771 9.689   -80.172 1.00 38.55 ? 80  LYS A NZ  1 
ATOM   195  N N   . THR A 1 25  ? -13.943 3.322   -80.494 1.00 38.20 ? 81  THR A N   1 
ATOM   196  C CA  . THR A 1 25  ? -13.893 2.024   -81.121 1.00 38.21 ? 81  THR A CA  1 
ATOM   197  C C   . THR A 1 25  ? -12.997 1.134   -80.256 1.00 37.94 ? 81  THR A C   1 
ATOM   198  O O   . THR A 1 25  ? -12.275 1.631   -79.392 1.00 37.52 ? 81  THR A O   1 
ATOM   199  C CB  . THR A 1 25  ? -13.361 2.177   -82.595 1.00 38.04 ? 81  THR A CB  1 
ATOM   200  O OG1 . THR A 1 25  ? -14.336 1.693   -83.524 1.00 37.73 ? 81  THR A OG1 1 
ATOM   201  C CG2 . THR A 1 25  ? -12.041 1.480   -82.788 1.00 37.58 ? 81  THR A CG2 1 
ATOM   202  N N   . TRP A 1 26  ? -13.055 -0.174  -80.469 1.00 38.29 ? 82  TRP A N   1 
ATOM   203  C CA  . TRP A 1 26  ? -12.244 -1.101  -79.694 1.00 38.72 ? 82  TRP A CA  1 
ATOM   204  C C   . TRP A 1 26  ? -10.751 -0.821  -79.913 1.00 39.41 ? 82  TRP A C   1 
ATOM   205  O O   . TRP A 1 26  ? -9.987  -0.719  -78.938 1.00 39.63 ? 82  TRP A O   1 
ATOM   206  C CB  . TRP A 1 26  ? -12.565 -2.561  -80.048 1.00 38.37 ? 82  TRP A CB  1 
ATOM   207  C CG  . TRP A 1 26  ? -11.752 -3.525  -79.224 1.00 37.97 ? 82  TRP A CG  1 
ATOM   208  C CD1 . TRP A 1 26  ? -12.034 -3.958  -77.972 1.00 37.72 ? 82  TRP A CD1 1 
ATOM   209  C CD2 . TRP A 1 26  ? -10.506 -4.121  -79.582 1.00 37.88 ? 82  TRP A CD2 1 
ATOM   210  N NE1 . TRP A 1 26  ? -11.056 -4.804  -77.534 1.00 37.58 ? 82  TRP A NE1 1 
ATOM   211  C CE2 . TRP A 1 26  ? -10.103 -4.921  -78.504 1.00 37.37 ? 82  TRP A CE2 1 
ATOM   212  C CE3 . TRP A 1 26  ? -9.692  -4.064  -80.719 1.00 38.30 ? 82  TRP A CE3 1 
ATOM   213  C CZ2 . TRP A 1 26  ? -8.914  -5.654  -78.517 1.00 37.86 ? 82  TRP A CZ2 1 
ATOM   214  C CZ3 . TRP A 1 26  ? -8.514  -4.799  -80.731 1.00 37.49 ? 82  TRP A CZ3 1 
ATOM   215  C CH2 . TRP A 1 26  ? -8.146  -5.586  -79.643 1.00 37.46 ? 82  TRP A CH2 1 
ATOM   216  N N   . ASN A 1 27  ? -10.347 -0.690  -81.180 1.00 39.71 ? 83  ASN A N   1 
ATOM   217  C CA  . ASN A 1 27  ? -8.972  -0.306  -81.513 1.00 40.21 ? 83  ASN A CA  1 
ATOM   218  C C   . ASN A 1 27  ? -8.537  1.078   -81.056 1.00 40.33 ? 83  ASN A C   1 
ATOM   219  O O   . ASN A 1 27  ? -7.399  1.258   -80.630 1.00 40.37 ? 83  ASN A O   1 
ATOM   220  C CB  . ASN A 1 27  ? -8.720  -0.403  -83.017 1.00 40.72 ? 83  ASN A CB  1 
ATOM   221  C CG  . ASN A 1 27  ? -7.774  -1.499  -83.350 1.00 41.63 ? 83  ASN A CG  1 
ATOM   222  O OD1 . ASN A 1 27  ? -8.110  -2.686  -83.235 1.00 43.70 ? 83  ASN A OD1 1 
ATOM   223  N ND2 . ASN A 1 27  ? -6.558  -1.124  -83.728 1.00 42.10 ? 83  ASN A ND2 1 
ATOM   224  N N   . GLU A 1 28  ? -9.420  2.058   -81.185 1.00 40.57 ? 84  GLU A N   1 
ATOM   225  C CA  . GLU A 1 28  ? -9.131  3.409   -80.705 1.00 40.80 ? 84  GLU A CA  1 
ATOM   226  C C   . GLU A 1 28  ? -8.954  3.362   -79.185 1.00 41.07 ? 84  GLU A C   1 
ATOM   227  O O   . GLU A 1 28  ? -8.088  4.050   -78.639 1.00 41.36 ? 84  GLU A O   1 
ATOM   228  C CB  . GLU A 1 28  ? -10.248 4.388   -81.080 1.00 40.77 ? 84  GLU A CB  1 
ATOM   229  C CG  . GLU A 1 28  ? -10.395 4.674   -82.582 1.00 40.42 ? 84  GLU A CG  1 
ATOM   230  C CD  . GLU A 1 28  ? -11.704 5.411   -82.927 1.00 41.01 ? 84  GLU A CD  1 
ATOM   231  O OE1 . GLU A 1 28  ? -12.626 5.467   -82.077 1.00 39.79 ? 84  GLU A OE1 1 
ATOM   232  O OE2 . GLU A 1 28  ? -11.818 5.931   -84.060 1.00 41.35 ? 84  GLU A OE2 1 
ATOM   233  N N   . SER A 1 29  ? -9.751  2.537   -78.506 1.00 41.03 ? 85  SER A N   1 
ATOM   234  C CA  . SER A 1 29  ? -9.622  2.390   -77.046 1.00 41.20 ? 85  SER A CA  1 
ATOM   235  C C   . SER A 1 29  ? -8.282  1.755   -76.728 1.00 41.71 ? 85  SER A C   1 
ATOM   236  O O   . SER A 1 29  ? -7.582  2.170   -75.785 1.00 42.07 ? 85  SER A O   1 
ATOM   237  C CB  . SER A 1 29  ? -10.748 1.529   -76.468 1.00 41.00 ? 85  SER A CB  1 
ATOM   238  O OG  . SER A 1 29  ? -12.019 2.104   -76.733 1.00 39.53 ? 85  SER A OG  1 
ATOM   239  N N   . ARG A 1 30  ? -7.932  0.755   -77.535 1.00 41.68 ? 86  ARG A N   1 
ATOM   240  C CA  . ARG A 1 30  ? -6.703  0.005   -77.366 1.00 41.59 ? 86  ARG A CA  1 
ATOM   241  C C   . ARG A 1 30  ? -5.489  0.928   -77.453 1.00 41.46 ? 86  ARG A C   1 
ATOM   242  O O   . ARG A 1 30  ? -4.525  0.764   -76.708 1.00 41.21 ? 86  ARG A O   1 
ATOM   243  C CB  . ARG A 1 30  ? -6.645  -1.107  -78.425 1.00 41.91 ? 86  ARG A CB  1 
ATOM   244  C CG  . ARG A 1 30  ? -5.450  -2.038  -78.329 1.00 42.41 ? 86  ARG A CG  1 
ATOM   245  C CD  . ARG A 1 30  ? -5.507  -3.158  -79.375 1.00 43.23 ? 86  ARG A CD  1 
ATOM   246  N NE  . ARG A 1 30  ? -4.180  -3.419  -79.945 1.00 44.83 ? 86  ARG A NE  1 
ATOM   247  C CZ  . ARG A 1 30  ? -3.733  -2.924  -81.101 1.00 46.11 ? 86  ARG A CZ  1 
ATOM   248  N NH1 . ARG A 1 30  ? -4.505  -2.152  -81.862 1.00 46.59 ? 86  ARG A NH1 1 
ATOM   249  N NH2 . ARG A 1 30  ? -2.499  -3.218  -81.518 1.00 46.61 ? 86  ARG A NH2 1 
ATOM   250  N N   . HIS A 1 31  ? -5.543  1.902   -78.362 1.00 41.57 ? 87  HIS A N   1 
ATOM   251  C CA  . HIS A 1 31  ? -4.425  2.821   -78.595 1.00 41.19 ? 87  HIS A CA  1 
ATOM   252  C C   . HIS A 1 31  ? -4.374  3.949   -77.550 1.00 40.73 ? 87  HIS A C   1 
ATOM   253  O O   . HIS A 1 31  ? -3.300  4.346   -77.105 1.00 40.39 ? 87  HIS A O   1 
ATOM   254  C CB  . HIS A 1 31  ? -4.511  3.401   -80.004 1.00 41.75 ? 87  HIS A CB  1 
ATOM   255  C CG  . HIS A 1 31  ? -4.283  2.390   -81.087 1.00 43.12 ? 87  HIS A CG  1 
ATOM   256  N ND1 . HIS A 1 31  ? -3.116  1.661   -81.192 1.00 44.06 ? 87  HIS A ND1 1 
ATOM   257  C CD2 . HIS A 1 31  ? -5.063  2.001   -82.123 1.00 44.61 ? 87  HIS A CD2 1 
ATOM   258  C CE1 . HIS A 1 31  ? -3.198  0.852   -82.233 1.00 44.41 ? 87  HIS A CE1 1 
ATOM   259  N NE2 . HIS A 1 31  ? -4.371  1.036   -82.814 1.00 44.72 ? 87  HIS A NE2 1 
ATOM   260  N N   . LEU A 1 32  ? -5.536  4.455   -77.154 1.00 40.29 ? 88  LEU A N   1 
ATOM   261  C CA  . LEU A 1 32  ? -5.614  5.458   -76.087 1.00 39.99 ? 88  LEU A CA  1 
ATOM   262  C C   . LEU A 1 32  ? -5.017  4.932   -74.782 1.00 39.83 ? 88  LEU A C   1 
ATOM   263  O O   . LEU A 1 32  ? -4.224  5.625   -74.144 1.00 39.92 ? 88  LEU A O   1 
ATOM   264  C CB  . LEU A 1 32  ? -7.058  5.908   -75.853 1.00 39.69 ? 88  LEU A CB  1 
ATOM   265  C CG  . LEU A 1 32  ? -7.658  6.807   -76.943 1.00 40.19 ? 88  LEU A CG  1 
ATOM   266  C CD1 . LEU A 1 32  ? -9.181  6.781   -76.887 1.00 41.01 ? 88  LEU A CD1 1 
ATOM   267  C CD2 . LEU A 1 32  ? -7.151  8.250   -76.828 1.00 39.85 ? 88  LEU A CD2 1 
ATOM   268  N N   . CYS A 1 33  ? -5.382  3.713   -74.389 1.00 39.44 ? 89  CYS A N   1 
ATOM   269  C CA  . CYS A 1 33  ? -4.755  3.088   -73.226 1.00 39.28 ? 89  CYS A CA  1 
ATOM   270  C C   . CYS A 1 33  ? -3.267  2.957   -73.453 1.00 38.89 ? 89  CYS A C   1 
ATOM   271  O O   . CYS A 1 33  ? -2.483  3.243   -72.562 1.00 39.36 ? 89  CYS A O   1 
ATOM   272  C CB  . CYS A 1 33  ? -5.345  1.702   -72.933 1.00 39.04 ? 89  CYS A CB  1 
ATOM   273  S SG  . CYS A 1 33  ? -7.086  1.689   -72.444 1.00 39.29 ? 89  CYS A SG  1 
ATOM   274  N N   . ALA A 1 34  ? -2.876  2.518   -74.641 1.00 38.62 ? 90  ALA A N   1 
ATOM   275  C CA  . ALA A 1 34  ? -1.452  2.429   -74.984 1.00 38.88 ? 90  ALA A CA  1 
ATOM   276  C C   . ALA A 1 34  ? -0.749  3.804   -74.942 1.00 38.59 ? 90  ALA A C   1 
ATOM   277  O O   . ALA A 1 34  ? 0.411   3.893   -74.555 1.00 38.73 ? 90  ALA A O   1 
ATOM   278  C CB  . ALA A 1 34  ? -1.256  1.743   -76.358 1.00 38.33 ? 90  ALA A CB  1 
ATOM   279  N N   . SER A 1 35  ? -1.457  4.869   -75.317 1.00 38.84 ? 91  SER A N   1 
ATOM   280  C CA  . SER A 1 35  ? -0.913  6.239   -75.221 1.00 39.04 ? 91  SER A CA  1 
ATOM   281  C C   . SER A 1 35  ? -0.748  6.704   -73.772 1.00 39.05 ? 91  SER A C   1 
ATOM   282  O O   . SER A 1 35  ? 0.034   7.596   -73.492 1.00 38.72 ? 91  SER A O   1 
ATOM   283  C CB  . SER A 1 35  ? -1.793  7.233   -75.985 1.00 38.88 ? 91  SER A CB  1 
ATOM   284  O OG  . SER A 1 35  ? -2.946  7.606   -75.245 1.00 39.06 ? 91  SER A OG  1 
ATOM   285  N N   . GLN A 1 36  ? -1.498  6.098   -72.856 1.00 39.52 ? 92  GLN A N   1 
ATOM   286  C CA  . GLN A 1 36  ? -1.360  6.379   -71.423 1.00 39.90 ? 92  GLN A CA  1 
ATOM   287  C C   . GLN A 1 36  ? -0.426  5.385   -70.753 1.00 40.06 ? 92  GLN A C   1 
ATOM   288  O O   . GLN A 1 36  ? -0.358  5.342   -69.522 1.00 40.14 ? 92  GLN A O   1 
ATOM   289  C CB  . GLN A 1 36  ? -2.726  6.300   -70.736 1.00 39.95 ? 92  GLN A CB  1 
ATOM   290  C CG  . GLN A 1 36  ? -3.763  7.191   -71.336 1.00 40.36 ? 92  GLN A CG  1 
ATOM   291  C CD  . GLN A 1 36  ? -3.430  8.630   -71.118 1.00 42.17 ? 92  GLN A CD  1 
ATOM   292  O OE1 . GLN A 1 36  ? -3.505  9.128   -69.989 1.00 43.75 ? 92  GLN A OE1 1 
ATOM   293  N NE2 . GLN A 1 36  ? -3.045  9.319   -72.191 1.00 42.40 ? 92  GLN A NE2 1 
ATOM   294  N N   . LYS A 1 37  ? 0.282   4.592   -71.562 1.00 40.49 ? 93  LYS A N   1 
ATOM   295  C CA  . LYS A 1 37  ? 1.185   3.540   -71.083 1.00 40.78 ? 93  LYS A CA  1 
ATOM   296  C C   . LYS A 1 37  ? 0.443   2.544   -70.214 1.00 41.01 ? 93  LYS A C   1 
ATOM   297  O O   . LYS A 1 37  ? 0.858   2.243   -69.099 1.00 41.65 ? 93  LYS A O   1 
ATOM   298  C CB  . LYS A 1 37  ? 2.365   4.140   -70.315 1.00 40.75 ? 93  LYS A CB  1 
ATOM   299  C CG  . LYS A 1 37  ? 3.233   5.080   -71.148 1.00 41.01 ? 93  LYS A CG  1 
ATOM   300  C CD  . LYS A 1 37  ? 3.821   6.226   -70.313 1.00 41.41 ? 93  LYS A CD  1 
ATOM   301  C CE  . LYS A 1 37  ? 4.543   5.747   -69.044 1.00 41.84 ? 93  LYS A CE  1 
ATOM   302  N NZ  . LYS A 1 37  ? 3.636   5.692   -67.852 1.00 41.93 ? 93  LYS A NZ  1 
ATOM   303  N N   . SER A 1 38  ? -0.675  2.047   -70.724 1.00 41.15 ? 94  SER A N   1 
ATOM   304  C CA  . SER A 1 38  ? -1.462  1.050   -70.018 1.00 41.12 ? 94  SER A CA  1 
ATOM   305  C C   . SER A 1 38  ? -2.162  0.167   -71.031 1.00 41.27 ? 94  SER A C   1 
ATOM   306  O O   . SER A 1 38  ? -2.089  0.424   -72.226 1.00 41.39 ? 94  SER A O   1 
ATOM   307  C CB  . SER A 1 38  ? -2.486  1.727   -69.109 1.00 40.97 ? 94  SER A CB  1 
ATOM   308  O OG  . SER A 1 38  ? -3.452  2.426   -69.868 1.00 41.09 ? 94  SER A OG  1 
ATOM   309  N N   . SER A 1 39  ? -2.851  -0.859  -70.539 1.00 41.53 ? 95  SER A N   1 
ATOM   310  C CA  . SER A 1 39  ? -3.585  -1.791  -71.379 1.00 41.43 ? 95  SER A CA  1 
ATOM   311  C C   . SER A 1 39  ? -5.087  -1.666  -71.187 1.00 41.38 ? 95  SER A C   1 
ATOM   312  O O   . SER A 1 39  ? -5.566  -1.236  -70.135 1.00 41.19 ? 95  SER A O   1 
ATOM   313  C CB  . SER A 1 39  ? -3.184  -3.222  -71.040 1.00 41.47 ? 95  SER A CB  1 
ATOM   314  O OG  . SER A 1 39  ? -1.845  -3.456  -71.386 1.00 42.44 ? 95  SER A OG  1 
ATOM   315  N N   . LEU A 1 40  ? -5.820  -2.084  -72.212 1.00 41.28 ? 96  LEU A N   1 
ATOM   316  C CA  . LEU A 1 40  ? -7.254  -2.234  -72.114 1.00 41.40 ? 96  LEU A CA  1 
ATOM   317  C C   . LEU A 1 40  ? -7.513  -3.338  -71.087 1.00 41.98 ? 96  LEU A C   1 
ATOM   318  O O   . LEU A 1 40  ? -6.813  -4.345  -71.058 1.00 42.02 ? 96  LEU A O   1 
ATOM   319  C CB  . LEU A 1 40  ? -7.818  -2.597  -73.487 1.00 41.61 ? 96  LEU A CB  1 
ATOM   320  C CG  . LEU A 1 40  ? -9.261  -2.270  -73.888 1.00 41.11 ? 96  LEU A CG  1 
ATOM   321  C CD1 . LEU A 1 40  ? -9.776  -0.919  -73.356 1.00 39.25 ? 96  LEU A CD1 1 
ATOM   322  C CD2 . LEU A 1 40  ? -9.343  -2.347  -75.412 1.00 39.92 ? 96  LEU A CD2 1 
ATOM   323  N N   . LEU A 1 41  ? -8.509  -3.129  -70.235 1.00 42.04 ? 97  LEU A N   1 
ATOM   324  C CA  . LEU A 1 41  ? -8.752  -3.995  -69.087 1.00 42.19 ? 97  LEU A CA  1 
ATOM   325  C C   . LEU A 1 41  ? -8.565  -5.494  -69.350 1.00 42.44 ? 97  LEU A C   1 
ATOM   326  O O   . LEU A 1 41  ? -9.296  -6.103  -70.133 1.00 42.01 ? 97  LEU A O   1 
ATOM   327  C CB  . LEU A 1 41  ? -10.161 -3.747  -68.552 1.00 42.20 ? 97  LEU A CB  1 
ATOM   328  C CG  . LEU A 1 41  ? -10.612 -4.606  -67.382 1.00 41.84 ? 97  LEU A CG  1 
ATOM   329  C CD1 . LEU A 1 41  ? -9.733  -4.348  -66.197 1.00 43.44 ? 97  LEU A CD1 1 
ATOM   330  C CD2 . LEU A 1 41  ? -12.036 -4.284  -67.073 1.00 42.37 ? 97  LEU A CD2 1 
ATOM   331  N N   . GLN A 1 42  ? -7.574  -6.065  -68.675 1.00 43.09 ? 98  GLN A N   1 
ATOM   332  C CA  . GLN A 1 42  ? -7.458  -7.507  -68.497 1.00 43.18 ? 98  GLN A CA  1 
ATOM   333  C C   . GLN A 1 42  ? -8.105  -7.845  -67.162 1.00 43.32 ? 98  GLN A C   1 
ATOM   334  O O   . GLN A 1 42  ? -7.669  -7.361  -66.114 1.00 43.17 ? 98  GLN A O   1 
ATOM   335  C CB  . GLN A 1 42  ? -5.985  -7.937  -68.510 1.00 43.14 ? 98  GLN A CB  1 
ATOM   336  C CG  . GLN A 1 42  ? -5.723  -9.397  -68.083 1.00 43.67 ? 98  GLN A CG  1 
ATOM   337  C CD  . GLN A 1 42  ? -4.247  -9.828  -68.202 1.00 43.99 ? 98  GLN A CD  1 
ATOM   338  O OE1 . GLN A 1 42  ? -3.867  -10.898 -67.718 1.00 45.54 ? 98  GLN A OE1 1 
ATOM   339  N NE2 . GLN A 1 42  ? -3.426  -9.001  -68.839 1.00 44.04 ? 98  GLN A NE2 1 
ATOM   340  N N   . LEU A 1 43  ? -9.151  -8.665  -67.204 1.00 43.85 ? 99  LEU A N   1 
ATOM   341  C CA  . LEU A 1 43  ? -9.886  -9.070  -66.004 1.00 44.00 ? 99  LEU A CA  1 
ATOM   342  C C   . LEU A 1 43  ? -9.325  -10.381 -65.499 1.00 44.31 ? 99  LEU A C   1 
ATOM   343  O O   . LEU A 1 43  ? -9.366  -11.382 -66.207 1.00 44.97 ? 99  LEU A O   1 
ATOM   344  C CB  . LEU A 1 43  ? -11.384 -9.251  -66.304 1.00 44.18 ? 99  LEU A CB  1 
ATOM   345  C CG  . LEU A 1 43  ? -12.418 -8.219  -65.824 1.00 44.64 ? 99  LEU A CG  1 
ATOM   346  C CD1 . LEU A 1 43  ? -13.808 -8.769  -66.083 1.00 46.08 ? 99  LEU A CD1 1 
ATOM   347  C CD2 . LEU A 1 43  ? -12.280 -7.882  -64.353 1.00 44.12 ? 99  LEU A CD2 1 
ATOM   348  N N   . GLN A 1 44  ? -8.819  -10.388 -64.272 1.00 44.54 ? 100 GLN A N   1 
ATOM   349  C CA  . GLN A 1 44  ? -8.272  -11.609 -63.666 1.00 44.54 ? 100 GLN A CA  1 
ATOM   350  C C   . GLN A 1 44  ? -9.385  -12.339 -62.897 1.00 44.27 ? 100 GLN A C   1 
ATOM   351  O O   . GLN A 1 44  ? -9.323  -13.542 -62.702 1.00 44.21 ? 100 GLN A O   1 
ATOM   352  C CB  . GLN A 1 44  ? -7.071  -11.272 -62.749 1.00 45.06 ? 100 GLN A CB  1 
ATOM   353  C CG  . GLN A 1 44  ? -6.041  -10.230 -63.330 1.00 45.84 ? 100 GLN A CG  1 
ATOM   354  C CD  . GLN A 1 44  ? -4.786  -10.859 -63.975 1.00 47.96 ? 100 GLN A CD  1 
ATOM   355  O OE1 . GLN A 1 44  ? -4.269  -11.888 -63.506 1.00 49.37 ? 100 GLN A OE1 1 
ATOM   356  N NE2 . GLN A 1 44  ? -4.277  -10.217 -65.036 1.00 46.81 ? 100 GLN A NE2 1 
ATOM   357  N N   . ASN A 1 45  ? -10.382 -11.575 -62.450 1.00 44.27 ? 101 ASN A N   1 
ATOM   358  C CA  . ASN A 1 45  ? -11.640 -12.086 -61.882 1.00 43.91 ? 101 ASN A CA  1 
ATOM   359  C C   . ASN A 1 45  ? -12.626 -10.918 -61.704 1.00 43.42 ? 101 ASN A C   1 
ATOM   360  O O   . ASN A 1 45  ? -12.234 -9.753  -61.788 1.00 43.40 ? 101 ASN A O   1 
ATOM   361  C CB  . ASN A 1 45  ? -11.403 -12.808 -60.553 1.00 44.19 ? 101 ASN A CB  1 
ATOM   362  C CG  . ASN A 1 45  ? -10.599 -11.978 -59.571 1.00 45.36 ? 101 ASN A CG  1 
ATOM   363  O OD1 . ASN A 1 45  ? -11.136 -11.065 -58.931 1.00 47.04 ? 101 ASN A OD1 1 
ATOM   364  N ND2 . ASN A 1 45  ? -9.306  -12.297 -59.431 1.00 45.25 ? 101 ASN A ND2 1 
ATOM   365  N N   . THR A 1 46  ? -13.896 -11.218 -61.469 1.00 42.87 ? 102 THR A N   1 
ATOM   366  C CA  . THR A 1 46  ? -14.922 -10.174 -61.403 1.00 42.71 ? 102 THR A CA  1 
ATOM   367  C C   . THR A 1 46  ? -14.805 -9.235  -60.186 1.00 42.37 ? 102 THR A C   1 
ATOM   368  O O   . THR A 1 46  ? -15.176 -8.068  -60.266 1.00 42.06 ? 102 THR A O   1 
ATOM   369  C CB  . THR A 1 46  ? -16.337 -10.781 -61.469 1.00 42.72 ? 102 THR A CB  1 
ATOM   370  O OG1 . THR A 1 46  ? -16.482 -11.787 -60.456 1.00 42.91 ? 102 THR A OG1 1 
ATOM   371  C CG2 . THR A 1 46  ? -16.578 -11.407 -62.850 1.00 42.17 ? 102 THR A CG2 1 
ATOM   372  N N   . ASP A 1 47  ? -14.257 -9.722  -59.080 1.00 42.36 ? 103 ASP A N   1 
ATOM   373  C CA  . ASP A 1 47  ? -14.084 -8.886  -57.872 1.00 42.37 ? 103 ASP A CA  1 
ATOM   374  C C   . ASP A 1 47  ? -13.143 -7.700  -58.094 1.00 42.23 ? 103 ASP A C   1 
ATOM   375  O O   . ASP A 1 47  ? -13.089 -6.765  -57.274 1.00 41.93 ? 103 ASP A O   1 
ATOM   376  C CB  . ASP A 1 47  ? -13.533 -9.723  -56.710 1.00 42.44 ? 103 ASP A CB  1 
ATOM   377  C CG  . ASP A 1 47  ? -14.509 -10.758 -56.223 1.00 42.82 ? 103 ASP A CG  1 
ATOM   378  O OD1 . ASP A 1 47  ? -14.108 -11.598 -55.386 1.00 44.53 ? 103 ASP A OD1 1 
ATOM   379  O OD2 . ASP A 1 47  ? -15.676 -10.737 -56.668 1.00 43.18 ? 103 ASP A OD2 1 
ATOM   380  N N   . GLU A 1 48  ? -12.385 -7.768  -59.182 1.00 41.78 ? 104 GLU A N   1 
ATOM   381  C CA  . GLU A 1 48  ? -11.420 -6.747  -59.535 1.00 41.95 ? 104 GLU A CA  1 
ATOM   382  C C   . GLU A 1 48  ? -12.030 -5.335  -59.675 1.00 41.58 ? 104 GLU A C   1 
ATOM   383  O O   . GLU A 1 48  ? -11.382 -4.353  -59.319 1.00 41.19 ? 104 GLU A O   1 
ATOM   384  C CB  . GLU A 1 48  ? -10.730 -7.163  -60.846 1.00 42.27 ? 104 GLU A CB  1 
ATOM   385  C CG  . GLU A 1 48  ? -9.604  -6.253  -61.273 1.00 42.39 ? 104 GLU A CG  1 
ATOM   386  C CD  . GLU A 1 48  ? -8.791  -6.821  -62.399 1.00 42.87 ? 104 GLU A CD  1 
ATOM   387  O OE1 . GLU A 1 48  ? -8.557  -8.051  -62.419 1.00 45.18 ? 104 GLU A OE1 1 
ATOM   388  O OE2 . GLU A 1 48  ? -8.374  -6.029  -63.265 1.00 45.42 ? 104 GLU A OE2 1 
ATOM   389  N N   . LEU A 1 49  ? -13.247 -5.246  -60.223 1.00 41.40 ? 105 LEU A N   1 
ATOM   390  C CA  . LEU A 1 49  ? -13.994 -3.982  -60.323 1.00 41.29 ? 105 LEU A CA  1 
ATOM   391  C C   . LEU A 1 49  ? -15.179 -3.994  -59.369 1.00 41.05 ? 105 LEU A C   1 
ATOM   392  O O   . LEU A 1 49  ? -16.249 -3.488  -59.691 1.00 41.14 ? 105 LEU A O   1 
ATOM   393  C CB  . LEU A 1 49  ? -14.478 -3.735  -61.768 1.00 41.13 ? 105 LEU A CB  1 
ATOM   394  C CG  . LEU A 1 49  ? -13.416 -3.675  -62.875 1.00 40.83 ? 105 LEU A CG  1 
ATOM   395  C CD1 . LEU A 1 49  ? -14.028 -3.340  -64.226 1.00 39.84 ? 105 LEU A CD1 1 
ATOM   396  C CD2 . LEU A 1 49  ? -12.337 -2.671  -62.542 1.00 40.08 ? 105 LEU A CD2 1 
ATOM   397  N N   . ASP A 1 50  ? -14.980 -4.573  -58.189 1.00 41.31 ? 106 ASP A N   1 
ATOM   398  C CA  . ASP A 1 50  ? -15.998 -4.562  -57.127 1.00 41.32 ? 106 ASP A CA  1 
ATOM   399  C C   . ASP A 1 50  ? -16.435 -3.124  -56.836 1.00 41.19 ? 106 ASP A C   1 
ATOM   400  O O   . ASP A 1 50  ? -17.629 -2.830  -56.835 1.00 41.13 ? 106 ASP A O   1 
ATOM   401  C CB  . ASP A 1 50  ? -15.465 -5.229  -55.848 1.00 41.17 ? 106 ASP A CB  1 
ATOM   402  C CG  . ASP A 1 50  ? -16.556 -5.873  -55.019 1.00 41.90 ? 106 ASP A CG  1 
ATOM   403  O OD1 . ASP A 1 50  ? -17.510 -6.423  -55.620 1.00 43.07 ? 106 ASP A OD1 1 
ATOM   404  O OD2 . ASP A 1 50  ? -16.462 -5.845  -53.760 1.00 42.72 ? 106 ASP A OD2 1 
ATOM   405  N N   . PHE A 1 51  ? -15.466 -2.223  -56.652 1.00 41.31 ? 107 PHE A N   1 
ATOM   406  C CA  . PHE A 1 51  ? -15.753 -0.799  -56.373 1.00 41.45 ? 107 PHE A CA  1 
ATOM   407  C C   . PHE A 1 51  ? -16.744 -0.149  -57.337 1.00 41.66 ? 107 PHE A C   1 
ATOM   408  O O   . PHE A 1 51  ? -17.341 0.864   -57.013 1.00 41.67 ? 107 PHE A O   1 
ATOM   409  C CB  . PHE A 1 51  ? -14.459 0.027   -56.345 1.00 40.96 ? 107 PHE A CB  1 
ATOM   410  C CG  . PHE A 1 51  ? -13.777 0.167   -57.689 1.00 40.37 ? 107 PHE A CG  1 
ATOM   411  C CD1 . PHE A 1 51  ? -12.786 -0.710  -58.068 1.00 39.96 ? 107 PHE A CD1 1 
ATOM   412  C CD2 . PHE A 1 51  ? -14.106 1.202   -58.546 1.00 39.22 ? 107 PHE A CD2 1 
ATOM   413  C CE1 . PHE A 1 51  ? -12.150 -0.575  -59.295 1.00 40.55 ? 107 PHE A CE1 1 
ATOM   414  C CE2 . PHE A 1 51  ? -13.484 1.345   -59.757 1.00 39.43 ? 107 PHE A CE2 1 
ATOM   415  C CZ  . PHE A 1 51  ? -12.503 0.454   -60.139 1.00 40.19 ? 107 PHE A CZ  1 
ATOM   416  N N   . MET A 1 52  ? -16.903 -0.744  -58.514 1.00 42.37 ? 108 MET A N   1 
ATOM   417  C CA  . MET A 1 52  ? -17.738 -0.217  -59.582 1.00 42.72 ? 108 MET A CA  1 
ATOM   418  C C   . MET A 1 52  ? -18.876 -1.183  -59.933 1.00 42.90 ? 108 MET A C   1 
ATOM   419  O O   . MET A 1 52  ? -19.425 -1.113  -61.028 1.00 43.04 ? 108 MET A O   1 
ATOM   420  C CB  . MET A 1 52  ? -16.836 -0.016  -60.785 1.00 42.67 ? 108 MET A CB  1 
ATOM   421  C CG  . MET A 1 52  ? -17.423 0.716   -61.957 1.00 43.07 ? 108 MET A CG  1 
ATOM   422  S SD  . MET A 1 52  ? -16.145 0.983   -63.197 1.00 44.95 ? 108 MET A SD  1 
ATOM   423  C CE  . MET A 1 52  ? -14.932 -0.261  -62.777 1.00 44.00 ? 108 MET A CE  1 
ATOM   424  N N   . SER A 1 53  ? -19.259 -2.054  -58.992 1.00 43.08 ? 109 SER A N   1 
ATOM   425  C CA  . SER A 1 53  ? -20.205 -3.151  -59.279 1.00 43.17 ? 109 SER A CA  1 
ATOM   426  C C   . SER A 1 53  ? -21.647 -2.696  -59.531 1.00 43.36 ? 109 SER A C   1 
ATOM   427  O O   . SER A 1 53  ? -22.465 -3.466  -60.049 1.00 43.29 ? 109 SER A O   1 
ATOM   428  C CB  . SER A 1 53  ? -20.197 -4.191  -58.143 1.00 43.27 ? 109 SER A CB  1 
ATOM   429  O OG  . SER A 1 53  ? -20.573 -3.619  -56.908 1.00 42.85 ? 109 SER A OG  1 
ATOM   430  N N   . SER A 1 54  ? -21.961 -1.462  -59.146 1.00 43.45 ? 110 SER A N   1 
ATOM   431  C CA  . SER A 1 54  ? -23.290 -0.909  -59.370 1.00 43.54 ? 110 SER A CA  1 
ATOM   432  C C   . SER A 1 54  ? -23.477 -0.399  -60.800 1.00 43.43 ? 110 SER A C   1 
ATOM   433  O O   . SER A 1 54  ? -24.593 -0.172  -61.226 1.00 43.81 ? 110 SER A O   1 
ATOM   434  C CB  . SER A 1 54  ? -23.548 0.237   -58.401 1.00 43.41 ? 110 SER A CB  1 
ATOM   435  O OG  . SER A 1 54  ? -22.647 1.290   -58.680 1.00 43.55 ? 110 SER A OG  1 
ATOM   436  N N   . SER A 1 55  ? -22.403 -0.200  -61.542 1.00 43.61 ? 111 SER A N   1 
ATOM   437  C CA  . SER A 1 55  ? -22.537 0.340   -62.894 1.00 43.69 ? 111 SER A CA  1 
ATOM   438  C C   . SER A 1 55  ? -23.432 -0.505  -63.787 1.00 43.66 ? 111 SER A C   1 
ATOM   439  O O   . SER A 1 55  ? -23.401 -1.735  -63.735 1.00 43.84 ? 111 SER A O   1 
ATOM   440  C CB  . SER A 1 55  ? -21.186 0.448   -63.586 1.00 43.86 ? 111 SER A CB  1 
ATOM   441  O OG  . SER A 1 55  ? -21.359 0.767   -64.961 1.00 44.08 ? 111 SER A OG  1 
ATOM   442  N N   . GLN A 1 56  ? -24.215 0.172   -64.618 1.00 43.37 ? 112 GLN A N   1 
ATOM   443  C CA  . GLN A 1 56  ? -24.925 -0.491  -65.685 1.00 43.36 ? 112 GLN A CA  1 
ATOM   444  C C   . GLN A 1 56  ? -24.440 0.069   -67.026 1.00 43.09 ? 112 GLN A C   1 
ATOM   445  O O   . GLN A 1 56  ? -25.237 0.362   -67.916 1.00 43.66 ? 112 GLN A O   1 
ATOM   446  C CB  . GLN A 1 56  ? -26.457 -0.438  -65.486 1.00 43.68 ? 112 GLN A CB  1 
ATOM   447  C CG  . GLN A 1 56  ? -27.018 0.778   -64.761 1.00 44.88 ? 112 GLN A CG  1 
ATOM   448  C CD  . GLN A 1 56  ? -27.133 1.992   -65.654 1.00 46.68 ? 112 GLN A CD  1 
ATOM   449  O OE1 . GLN A 1 56  ? -26.354 2.948   -65.547 1.00 47.21 ? 112 GLN A OE1 1 
ATOM   450  N NE2 . GLN A 1 56  ? -28.113 1.962   -66.548 1.00 47.78 ? 112 GLN A NE2 1 
ATOM   451  N N   . GLN A 1 57  ? -23.115 0.198   -67.139 1.00 42.39 ? 113 GLN A N   1 
ATOM   452  C CA  . GLN A 1 57  ? -22.415 0.586   -68.368 1.00 41.85 ? 113 GLN A CA  1 
ATOM   453  C C   . GLN A 1 57  ? -21.560 -0.586  -68.854 1.00 40.95 ? 113 GLN A C   1 
ATOM   454  O O   . GLN A 1 57  ? -20.928 -1.281  -68.061 1.00 40.31 ? 113 GLN A O   1 
ATOM   455  C CB  . GLN A 1 57  ? -21.453 1.749   -68.108 1.00 41.98 ? 113 GLN A CB  1 
ATOM   456  C CG  . GLN A 1 57  ? -22.053 2.951   -67.415 1.00 44.29 ? 113 GLN A CG  1 
ATOM   457  C CD  . GLN A 1 57  ? -22.150 4.167   -68.314 1.00 46.43 ? 113 GLN A CD  1 
ATOM   458  O OE1 . GLN A 1 57  ? -22.573 4.061   -69.459 1.00 48.77 ? 113 GLN A OE1 1 
ATOM   459  N NE2 . GLN A 1 57  ? -21.772 5.333   -67.792 1.00 46.76 ? 113 GLN A NE2 1 
ATOM   460  N N   . PHE A 1 58  ? -21.517 -0.775  -70.162 1.00 40.07 ? 114 PHE A N   1 
ATOM   461  C CA  . PHE A 1 58  ? -20.610 -1.732  -70.771 1.00 39.72 ? 114 PHE A CA  1 
ATOM   462  C C   . PHE A 1 58  ? -19.353 -0.985  -71.191 1.00 39.21 ? 114 PHE A C   1 
ATOM   463  O O   . PHE A 1 58  ? -19.445 0.139   -71.682 1.00 39.31 ? 114 PHE A O   1 
ATOM   464  C CB  . PHE A 1 58  ? -21.265 -2.416  -71.967 1.00 39.29 ? 114 PHE A CB  1 
ATOM   465  C CG  . PHE A 1 58  ? -22.313 -3.401  -71.579 1.00 39.05 ? 114 PHE A CG  1 
ATOM   466  C CD1 . PHE A 1 58  ? -23.607 -2.981  -71.302 1.00 39.26 ? 114 PHE A CD1 1 
ATOM   467  C CD2 . PHE A 1 58  ? -22.006 -4.747  -71.460 1.00 37.86 ? 114 PHE A CD2 1 
ATOM   468  C CE1 . PHE A 1 58  ? -24.587 -3.898  -70.918 1.00 39.00 ? 114 PHE A CE1 1 
ATOM   469  C CE2 . PHE A 1 58  ? -22.969 -5.662  -71.092 1.00 38.49 ? 114 PHE A CE2 1 
ATOM   470  C CZ  . PHE A 1 58  ? -24.264 -5.239  -70.815 1.00 38.64 ? 114 PHE A CZ  1 
ATOM   471  N N   . TYR A 1 59  ? -18.199 -1.612  -70.967 1.00 38.43 ? 115 TYR A N   1 
ATOM   472  C CA  . TYR A 1 59  ? -16.906 -1.062  -71.324 1.00 38.40 ? 115 TYR A CA  1 
ATOM   473  C C   . TYR A 1 59  ? -16.135 -2.059  -72.183 1.00 38.19 ? 115 TYR A C   1 
ATOM   474  O O   . TYR A 1 59  ? -16.048 -3.237  -71.854 1.00 38.24 ? 115 TYR A O   1 
ATOM   475  C CB  . TYR A 1 59  ? -16.094 -0.777  -70.059 1.00 38.25 ? 115 TYR A CB  1 
ATOM   476  C CG  . TYR A 1 59  ? -16.700 0.281   -69.161 1.00 37.98 ? 115 TYR A CG  1 
ATOM   477  C CD1 . TYR A 1 59  ? -17.587 -0.063  -68.151 1.00 36.56 ? 115 TYR A CD1 1 
ATOM   478  C CD2 . TYR A 1 59  ? -16.374 1.621   -69.320 1.00 38.36 ? 115 TYR A CD2 1 
ATOM   479  C CE1 . TYR A 1 59  ? -18.140 0.894   -67.332 1.00 37.37 ? 115 TYR A CE1 1 
ATOM   480  C CE2 . TYR A 1 59  ? -16.921 2.597   -68.493 1.00 38.62 ? 115 TYR A CE2 1 
ATOM   481  C CZ  . TYR A 1 59  ? -17.806 2.221   -67.502 1.00 37.88 ? 115 TYR A CZ  1 
ATOM   482  O OH  . TYR A 1 59  ? -18.361 3.179   -66.702 1.00 37.84 ? 115 TYR A OH  1 
ATOM   483  N N   . TRP A 1 60  ? -15.561 -1.598  -73.278 1.00 38.06 ? 116 TRP A N   1 
ATOM   484  C CA  . TRP A 1 60  ? -14.622 -2.423  -74.016 1.00 38.20 ? 116 TRP A CA  1 
ATOM   485  C C   . TRP A 1 60  ? -13.554 -2.930  -73.048 1.00 38.01 ? 116 TRP A C   1 
ATOM   486  O O   . TRP A 1 60  ? -13.027 -2.157  -72.260 1.00 37.08 ? 116 TRP A O   1 
ATOM   487  C CB  . TRP A 1 60  ? -13.933 -1.616  -75.123 1.00 38.26 ? 116 TRP A CB  1 
ATOM   488  C CG  . TRP A 1 60  ? -14.718 -1.357  -76.392 1.00 38.17 ? 116 TRP A CG  1 
ATOM   489  C CD1 . TRP A 1 60  ? -14.834 -0.159  -77.046 1.00 38.33 ? 116 TRP A CD1 1 
ATOM   490  C CD2 . TRP A 1 60  ? -15.430 -2.310  -77.188 1.00 38.36 ? 116 TRP A CD2 1 
ATOM   491  N NE1 . TRP A 1 60  ? -15.587 -0.309  -78.180 1.00 38.13 ? 116 TRP A NE1 1 
ATOM   492  C CE2 . TRP A 1 60  ? -15.968 -1.618  -78.291 1.00 38.55 ? 116 TRP A CE2 1 
ATOM   493  C CE3 . TRP A 1 60  ? -15.665 -3.684  -77.082 1.00 38.84 ? 116 TRP A CE3 1 
ATOM   494  C CZ2 . TRP A 1 60  ? -16.737 -2.256  -79.276 1.00 39.14 ? 116 TRP A CZ2 1 
ATOM   495  C CZ3 . TRP A 1 60  ? -16.426 -4.316  -78.065 1.00 38.38 ? 116 TRP A CZ3 1 
ATOM   496  C CH2 . TRP A 1 60  ? -16.948 -3.605  -79.144 1.00 37.96 ? 116 TRP A CH2 1 
ATOM   497  N N   . ILE A 1 61  ? -13.248 -4.227  -73.098 1.00 38.65 ? 117 ILE A N   1 
ATOM   498  C CA  . ILE A 1 61  ? -12.128 -4.792  -72.330 1.00 38.79 ? 117 ILE A CA  1 
ATOM   499  C C   . ILE A 1 61  ? -11.083 -5.384  -73.275 1.00 39.05 ? 117 ILE A C   1 
ATOM   500  O O   . ILE A 1 61  ? -11.297 -5.431  -74.481 1.00 39.67 ? 117 ILE A O   1 
ATOM   501  C CB  . ILE A 1 61  ? -12.597 -5.830  -71.251 1.00 39.03 ? 117 ILE A CB  1 
ATOM   502  C CG1 . ILE A 1 61  ? -13.280 -7.040  -71.883 1.00 38.99 ? 117 ILE A CG1 1 
ATOM   503  C CG2 . ILE A 1 61  ? -13.526 -5.178  -70.242 1.00 38.09 ? 117 ILE A CG2 1 
ATOM   504  C CD1 . ILE A 1 61  ? -13.681 -8.066  -70.863 1.00 38.33 ? 117 ILE A CD1 1 
ATOM   505  N N   . GLY A 1 62  ? -9.949  -5.829  -72.744 1.00 39.25 ? 118 GLY A N   1 
ATOM   506  C CA  . GLY A 1 62  ? -8.806  -6.181  -73.584 1.00 39.55 ? 118 GLY A CA  1 
ATOM   507  C C   . GLY A 1 62  ? -8.771  -7.577  -74.190 1.00 39.88 ? 118 GLY A C   1 
ATOM   508  O O   . GLY A 1 62  ? -7.691  -8.095  -74.446 1.00 39.84 ? 118 GLY A O   1 
ATOM   509  N N   . LEU A 1 63  ? -9.935  -8.174  -74.442 1.00 40.44 ? 119 LEU A N   1 
ATOM   510  C CA  . LEU A 1 63  ? -10.032 -9.559  -74.935 1.00 40.56 ? 119 LEU A CA  1 
ATOM   511  C C   . LEU A 1 63  ? -10.380 -9.623  -76.420 1.00 41.00 ? 119 LEU A C   1 
ATOM   512  O O   . LEU A 1 63  ? -11.417 -9.087  -76.837 1.00 41.49 ? 119 LEU A O   1 
ATOM   513  C CB  . LEU A 1 63  ? -11.114 -10.297 -74.142 1.00 40.72 ? 119 LEU A CB  1 
ATOM   514  C CG  . LEU A 1 63  ? -11.188 -11.816 -74.277 1.00 40.73 ? 119 LEU A CG  1 
ATOM   515  C CD1 . LEU A 1 63  ? -9.895  -12.462 -73.788 1.00 40.42 ? 119 LEU A CD1 1 
ATOM   516  C CD2 . LEU A 1 63  ? -12.398 -12.350 -73.503 1.00 40.66 ? 119 LEU A CD2 1 
ATOM   517  N N   . SER A 1 64  ? -9.526  -10.277 -77.213 1.00 41.06 ? 120 SER A N   1 
ATOM   518  C CA  . SER A 1 64  ? -9.811  -10.525 -78.636 1.00 41.05 ? 120 SER A CA  1 
ATOM   519  C C   . SER A 1 64  ? -9.402  -11.933 -79.066 1.00 40.88 ? 120 SER A C   1 
ATOM   520  O O   . SER A 1 64  ? -8.500  -12.531 -78.479 1.00 40.93 ? 120 SER A O   1 
ATOM   521  C CB  . SER A 1 64  ? -9.093  -9.505  -79.505 1.00 41.04 ? 120 SER A CB  1 
ATOM   522  O OG  . SER A 1 64  ? -7.757  -9.351  -79.061 1.00 43.00 ? 120 SER A OG  1 
ATOM   523  N N   . TYR A 1 65  ? -10.053 -12.443 -80.110 1.00 40.73 ? 121 TYR A N   1 
ATOM   524  C CA  . TYR A 1 65  ? -9.843  -13.816 -80.572 1.00 40.61 ? 121 TYR A CA  1 
ATOM   525  C C   . TYR A 1 65  ? -8.550  -13.959 -81.349 1.00 40.26 ? 121 TYR A C   1 
ATOM   526  O O   . TYR A 1 65  ? -8.185  -13.069 -82.109 1.00 40.20 ? 121 TYR A O   1 
ATOM   527  C CB  . TYR A 1 65  ? -10.997 -14.268 -81.465 1.00 40.75 ? 121 TYR A CB  1 
ATOM   528  C CG  . TYR A 1 65  ? -11.062 -15.764 -81.695 1.00 40.84 ? 121 TYR A CG  1 
ATOM   529  C CD1 . TYR A 1 65  ? -11.463 -16.632 -80.668 1.00 41.38 ? 121 TYR A CD1 1 
ATOM   530  C CD2 . TYR A 1 65  ? -10.741 -16.318 -82.936 1.00 40.68 ? 121 TYR A CD2 1 
ATOM   531  C CE1 . TYR A 1 65  ? -11.544 -18.018 -80.879 1.00 41.30 ? 121 TYR A CE1 1 
ATOM   532  C CE2 . TYR A 1 65  ? -10.805 -17.692 -83.157 1.00 40.31 ? 121 TYR A CE2 1 
ATOM   533  C CZ  . TYR A 1 65  ? -11.206 -18.542 -82.127 1.00 41.63 ? 121 TYR A CZ  1 
ATOM   534  O OH  . TYR A 1 65  ? -11.279 -19.911 -82.345 1.00 41.92 ? 121 TYR A OH  1 
ATOM   535  N N   . SER A 1 66  ? -7.884  -15.098 -81.162 1.00 40.01 ? 122 SER A N   1 
ATOM   536  C CA  . SER A 1 66  ? -6.668  -15.445 -81.892 1.00 39.85 ? 122 SER A CA  1 
ATOM   537  C C   . SER A 1 66  ? -6.958  -16.668 -82.751 1.00 39.70 ? 122 SER A C   1 
ATOM   538  O O   . SER A 1 66  ? -7.188  -17.760 -82.232 1.00 39.49 ? 122 SER A O   1 
ATOM   539  C CB  . SER A 1 66  ? -5.517  -15.721 -80.923 1.00 39.45 ? 122 SER A CB  1 
ATOM   540  O OG  . SER A 1 66  ? -4.372  -16.215 -81.593 1.00 39.62 ? 122 SER A OG  1 
ATOM   541  N N   . GLU A 1 67  ? -6.969  -16.465 -84.069 1.00 39.93 ? 123 GLU A N   1 
ATOM   542  C CA  . GLU A 1 67  ? -7.173  -17.552 -85.018 1.00 40.10 ? 123 GLU A CA  1 
ATOM   543  C C   . GLU A 1 67  ? -6.149  -18.648 -84.760 1.00 39.95 ? 123 GLU A C   1 
ATOM   544  O O   . GLU A 1 67  ? -6.493  -19.826 -84.758 1.00 40.27 ? 123 GLU A O   1 
ATOM   545  C CB  . GLU A 1 67  ? -7.047  -17.054 -86.471 1.00 40.73 ? 123 GLU A CB  1 
ATOM   546  C CG  . GLU A 1 67  ? -8.223  -16.192 -86.998 1.00 42.40 ? 123 GLU A CG  1 
ATOM   547  C CD  . GLU A 1 67  ? -9.425  -17.022 -87.447 1.00 45.30 ? 123 GLU A CD  1 
ATOM   548  O OE1 . GLU A 1 67  ? -9.605  -17.216 -88.667 1.00 48.26 ? 123 GLU A OE1 1 
ATOM   549  O OE2 . GLU A 1 67  ? -10.190 -17.500 -86.582 1.00 47.95 ? 123 GLU A OE2 1 
ATOM   550  N N   . GLU A 1 68  ? -4.899  -18.249 -84.532 1.00 39.49 ? 124 GLU A N   1 
ATOM   551  C CA  . GLU A 1 68  ? -3.809  -19.186 -84.269 1.00 39.35 ? 124 GLU A CA  1 
ATOM   552  C C   . GLU A 1 68  ? -4.033  -20.139 -83.086 1.00 39.13 ? 124 GLU A C   1 
ATOM   553  O O   . GLU A 1 68  ? -3.818  -21.335 -83.212 1.00 38.90 ? 124 GLU A O   1 
ATOM   554  C CB  . GLU A 1 68  ? -2.503  -18.423 -84.049 1.00 39.38 ? 124 GLU A CB  1 
ATOM   555  C CG  . GLU A 1 68  ? -1.537  -18.572 -85.199 1.00 39.97 ? 124 GLU A CG  1 
ATOM   556  C CD  . GLU A 1 68  ? -0.916  -19.949 -85.264 1.00 39.38 ? 124 GLU A CD  1 
ATOM   557  O OE1 . GLU A 1 68  ? -0.379  -20.425 -84.242 1.00 39.32 ? 124 GLU A OE1 1 
ATOM   558  O OE2 . GLU A 1 68  ? -0.953  -20.554 -86.347 1.00 40.14 ? 124 GLU A OE2 1 
ATOM   559  N N   . HIS A 1 69  ? -4.455  -19.593 -81.948 1.00 38.85 ? 125 HIS A N   1 
ATOM   560  C CA  . HIS A 1 69  ? -4.652  -20.363 -80.733 1.00 38.59 ? 125 HIS A CA  1 
ATOM   561  C C   . HIS A 1 69  ? -6.062  -20.912 -80.621 1.00 38.16 ? 125 HIS A C   1 
ATOM   562  O O   . HIS A 1 69  ? -6.396  -21.572 -79.639 1.00 37.05 ? 125 HIS A O   1 
ATOM   563  C CB  . HIS A 1 69  ? -4.388  -19.480 -79.517 1.00 38.91 ? 125 HIS A CB  1 
ATOM   564  C CG  . HIS A 1 69  ? -3.001  -18.937 -79.461 1.00 38.93 ? 125 HIS A CG  1 
ATOM   565  N ND1 . HIS A 1 69  ? -2.653  -17.742 -80.048 1.00 39.33 ? 125 HIS A ND1 1 
ATOM   566  C CD2 . HIS A 1 69  ? -1.875  -19.425 -78.894 1.00 39.36 ? 125 HIS A CD2 1 
ATOM   567  C CE1 . HIS A 1 69  ? -1.370  -17.514 -79.839 1.00 40.22 ? 125 HIS A CE1 1 
ATOM   568  N NE2 . HIS A 1 69  ? -0.873  -18.523 -79.145 1.00 39.99 ? 125 HIS A NE2 1 
ATOM   569  N N   . THR A 1 70  ? -6.897  -20.615 -81.609 1.00 38.31 ? 126 THR A N   1 
ATOM   570  C CA  . THR A 1 70  ? -8.294  -21.049 -81.604 1.00 38.65 ? 126 THR A CA  1 
ATOM   571  C C   . THR A 1 70  ? -8.989  -20.666 -80.280 1.00 38.78 ? 126 THR A C   1 
ATOM   572  O O   . THR A 1 70  ? -9.898  -21.354 -79.832 1.00 38.90 ? 126 THR A O   1 
ATOM   573  C CB  . THR A 1 70  ? -8.416  -22.598 -81.867 1.00 38.56 ? 126 THR A CB  1 
ATOM   574  O OG1 . THR A 1 70  ? -7.122  -23.169 -82.111 1.00 38.12 ? 126 THR A OG1 1 
ATOM   575  C CG2 . THR A 1 70  ? -9.321  -22.873 -83.052 1.00 38.16 ? 126 THR A CG2 1 
ATOM   576  N N   . ALA A 1 71  ? -8.555  -19.554 -79.678 1.00 39.13 ? 127 ALA A N   1 
ATOM   577  C CA  . ALA A 1 71  ? -8.956  -19.166 -78.323 1.00 38.80 ? 127 ALA A CA  1 
ATOM   578  C C   . ALA A 1 71  ? -8.994  -17.645 -78.174 1.00 38.73 ? 127 ALA A C   1 
ATOM   579  O O   . ALA A 1 71  ? -8.392  -16.920 -78.967 1.00 38.40 ? 127 ALA A O   1 
ATOM   580  C CB  . ALA A 1 71  ? -7.993  -19.772 -77.297 1.00 38.78 ? 127 ALA A CB  1 
ATOM   581  N N   . TRP A 1 72  ? -9.710  -17.176 -77.153 1.00 38.68 ? 128 TRP A N   1 
ATOM   582  C CA  . TRP A 1 72  ? -9.731  -15.753 -76.801 1.00 38.72 ? 128 TRP A CA  1 
ATOM   583  C C   . TRP A 1 72  ? -8.575  -15.455 -75.854 1.00 38.49 ? 128 TRP A C   1 
ATOM   584  O O   . TRP A 1 72  ? -8.365  -16.191 -74.895 1.00 38.33 ? 128 TRP A O   1 
ATOM   585  C CB  . TRP A 1 72  ? -11.057 -15.374 -76.135 1.00 39.00 ? 128 TRP A CB  1 
ATOM   586  C CG  . TRP A 1 72  ? -12.242 -15.536 -77.031 1.00 39.42 ? 128 TRP A CG  1 
ATOM   587  C CD1 . TRP A 1 72  ? -12.940 -16.686 -77.278 1.00 39.63 ? 128 TRP A CD1 1 
ATOM   588  C CD2 . TRP A 1 72  ? -12.878 -14.511 -77.795 1.00 39.49 ? 128 TRP A CD2 1 
ATOM   589  N NE1 . TRP A 1 72  ? -13.964 -16.434 -78.160 1.00 39.42 ? 128 TRP A NE1 1 
ATOM   590  C CE2 . TRP A 1 72  ? -13.944 -15.106 -78.490 1.00 38.76 ? 128 TRP A CE2 1 
ATOM   591  C CE3 . TRP A 1 72  ? -12.634 -13.144 -77.976 1.00 40.24 ? 128 TRP A CE3 1 
ATOM   592  C CZ2 . TRP A 1 72  ? -14.764 -14.388 -79.341 1.00 39.61 ? 128 TRP A CZ2 1 
ATOM   593  C CZ3 . TRP A 1 72  ? -13.459 -12.427 -78.822 1.00 39.44 ? 128 TRP A CZ3 1 
ATOM   594  C CH2 . TRP A 1 72  ? -14.507 -13.050 -79.494 1.00 39.46 ? 128 TRP A CH2 1 
ATOM   595  N N   . LEU A 1 73  ? -7.856  -14.363 -76.112 1.00 38.28 ? 129 LEU A N   1 
ATOM   596  C CA  . LEU A 1 73  ? -6.672  -13.984 -75.328 1.00 38.56 ? 129 LEU A CA  1 
ATOM   597  C C   . LEU A 1 73  ? -6.725  -12.518 -74.916 1.00 38.71 ? 129 LEU A C   1 
ATOM   598  O O   . LEU A 1 73  ? -7.341  -11.703 -75.602 1.00 38.73 ? 129 LEU A O   1 
ATOM   599  C CB  . LEU A 1 73  ? -5.377  -14.193 -76.128 1.00 37.88 ? 129 LEU A CB  1 
ATOM   600  C CG  . LEU A 1 73  ? -5.059  -15.575 -76.708 1.00 37.64 ? 129 LEU A CG  1 
ATOM   601  C CD1 . LEU A 1 73  ? -3.710  -15.525 -77.466 1.00 35.19 ? 129 LEU A CD1 1 
ATOM   602  C CD2 . LEU A 1 73  ? -5.046  -16.653 -75.614 1.00 34.62 ? 129 LEU A CD2 1 
ATOM   603  N N   . TRP A 1 74  ? -6.045  -12.187 -73.817 1.00 38.92 ? 130 TRP A N   1 
ATOM   604  C CA  . TRP A 1 74  ? -5.865  -10.786 -73.425 1.00 39.33 ? 130 TRP A CA  1 
ATOM   605  C C   . TRP A 1 74  ? -4.761  -10.161 -74.286 1.00 39.83 ? 130 TRP A C   1 
ATOM   606  O O   . TRP A 1 74  ? -4.051  -10.855 -75.021 1.00 39.89 ? 130 TRP A O   1 
ATOM   607  C CB  . TRP A 1 74  ? -5.532  -10.654 -71.941 1.00 38.72 ? 130 TRP A CB  1 
ATOM   608  C CG  . TRP A 1 74  ? -6.569  -11.242 -71.064 1.00 38.33 ? 130 TRP A CG  1 
ATOM   609  C CD1 . TRP A 1 74  ? -6.481  -12.408 -70.377 1.00 38.26 ? 130 TRP A CD1 1 
ATOM   610  C CD2 . TRP A 1 74  ? -7.881  -10.717 -70.802 1.00 37.73 ? 130 TRP A CD2 1 
ATOM   611  N NE1 . TRP A 1 74  ? -7.642  -12.637 -69.681 1.00 38.46 ? 130 TRP A NE1 1 
ATOM   612  C CE2 . TRP A 1 74  ? -8.521  -11.618 -69.928 1.00 37.83 ? 130 TRP A CE2 1 
ATOM   613  C CE3 . TRP A 1 74  ? -8.570  -9.567  -71.214 1.00 37.54 ? 130 TRP A CE3 1 
ATOM   614  C CZ2 . TRP A 1 74  ? -9.818  -11.408 -69.450 1.00 38.49 ? 130 TRP A CZ2 1 
ATOM   615  C CZ3 . TRP A 1 74  ? -9.853  -9.354  -70.745 1.00 38.26 ? 130 TRP A CZ3 1 
ATOM   616  C CH2 . TRP A 1 74  ? -10.468 -10.270 -69.865 1.00 38.74 ? 130 TRP A CH2 1 
ATOM   617  N N   . GLU A 1 75  ? -4.630  -8.849  -74.219 1.00 40.10 ? 131 GLU A N   1 
ATOM   618  C CA  . GLU A 1 75  ? -3.661  -8.190  -75.065 1.00 40.75 ? 131 GLU A CA  1 
ATOM   619  C C   . GLU A 1 75  ? -2.221  -8.609  -74.755 1.00 40.50 ? 131 GLU A C   1 
ATOM   620  O O   . GLU A 1 75  ? -1.361  -8.522  -75.624 1.00 40.36 ? 131 GLU A O   1 
ATOM   621  C CB  . GLU A 1 75  ? -3.799  -6.690  -74.954 1.00 41.00 ? 131 GLU A CB  1 
ATOM   622  C CG  . GLU A 1 75  ? -4.970  -6.139  -75.716 1.00 42.35 ? 131 GLU A CG  1 
ATOM   623  C CD  . GLU A 1 75  ? -4.692  -4.729  -76.171 1.00 43.16 ? 131 GLU A CD  1 
ATOM   624  O OE1 . GLU A 1 75  ? -3.931  -4.567  -77.154 1.00 46.53 ? 131 GLU A OE1 1 
ATOM   625  O OE2 . GLU A 1 75  ? -5.209  -3.785  -75.533 1.00 46.53 ? 131 GLU A OE2 1 
ATOM   626  N N   . ASN A 1 76  ? -1.971  -9.069  -73.532 1.00 40.38 ? 132 ASN A N   1 
ATOM   627  C CA  . ASN A 1 76  ? -0.643  -9.519  -73.151 1.00 40.43 ? 132 ASN A CA  1 
ATOM   628  C C   . ASN A 1 76  ? -0.315  -10.930 -73.665 1.00 40.44 ? 132 ASN A C   1 
ATOM   629  O O   . ASN A 1 76  ? 0.860   -11.350 -73.661 1.00 39.85 ? 132 ASN A O   1 
ATOM   630  C CB  . ASN A 1 76  ? -0.424  -9.391  -71.630 1.00 40.40 ? 132 ASN A CB  1 
ATOM   631  C CG  . ASN A 1 76  ? -1.259  -10.367 -70.817 1.00 40.63 ? 132 ASN A CG  1 
ATOM   632  O OD1 . ASN A 1 76  ? -0.995  -10.591 -69.629 1.00 41.04 ? 132 ASN A OD1 1 
ATOM   633  N ND2 . ASN A 1 76  ? -2.268  -10.939 -71.436 1.00 40.63 ? 132 ASN A ND2 1 
ATOM   634  N N   . GLY A 1 77  ? -1.351  -11.643 -74.111 1.00 40.33 ? 133 GLY A N   1 
ATOM   635  C CA  . GLY A 1 77  ? -1.193  -12.984 -74.669 1.00 40.54 ? 133 GLY A CA  1 
ATOM   636  C C   . GLY A 1 77  ? -1.652  -14.117 -73.761 1.00 40.63 ? 133 GLY A C   1 
ATOM   637  O O   . GLY A 1 77  ? -1.820  -15.247 -74.218 1.00 40.67 ? 133 GLY A O   1 
ATOM   638  N N   . SER A 1 78  ? -1.842  -13.837 -72.476 1.00 40.89 ? 134 SER A N   1 
ATOM   639  C CA  . SER A 1 78  ? -2.343  -14.849 -71.539 1.00 41.28 ? 134 SER A CA  1 
ATOM   640  C C   . SER A 1 78  ? -3.787  -15.256 -71.859 1.00 41.30 ? 134 SER A C   1 
ATOM   641  O O   . SER A 1 78  ? -4.571  -14.470 -72.362 1.00 41.75 ? 134 SER A O   1 
ATOM   642  C CB  . SER A 1 78  ? -2.215  -14.367 -70.086 1.00 41.33 ? 134 SER A CB  1 
ATOM   643  O OG  . SER A 1 78  ? -2.631  -13.016 -69.940 1.00 42.41 ? 134 SER A OG  1 
ATOM   644  N N   . ALA A 1 79  ? -4.122  -16.501 -71.564 1.00 41.69 ? 135 ALA A N   1 
ATOM   645  C CA  . ALA A 1 79  ? -5.412  -17.074 -71.946 1.00 41.70 ? 135 ALA A CA  1 
ATOM   646  C C   . ALA A 1 79  ? -6.549  -16.639 -71.020 1.00 41.70 ? 135 ALA A C   1 
ATOM   647  O O   . ALA A 1 79  ? -6.316  -16.207 -69.891 1.00 41.67 ? 135 ALA A O   1 
ATOM   648  C CB  . ALA A 1 79  ? -5.306  -18.617 -71.986 1.00 41.81 ? 135 ALA A CB  1 
ATOM   649  N N   . LEU A 1 80  ? -7.776  -16.744 -71.533 1.00 41.82 ? 136 LEU A N   1 
ATOM   650  C CA  . LEU A 1 80  ? -8.996  -16.513 -70.757 1.00 41.64 ? 136 LEU A CA  1 
ATOM   651  C C   . LEU A 1 80  ? -9.285  -17.780 -69.990 1.00 41.91 ? 136 LEU A C   1 
ATOM   652  O O   . LEU A 1 80  ? -9.174  -18.868 -70.544 1.00 42.32 ? 136 LEU A O   1 
ATOM   653  C CB  . LEU A 1 80  ? -10.176 -16.213 -71.692 1.00 41.66 ? 136 LEU A CB  1 
ATOM   654  C CG  . LEU A 1 80  ? -11.569 -15.914 -71.108 1.00 41.60 ? 136 LEU A CG  1 
ATOM   655  C CD1 . LEU A 1 80  ? -11.659 -14.494 -70.552 1.00 40.88 ? 136 LEU A CD1 1 
ATOM   656  C CD2 . LEU A 1 80  ? -12.651 -16.127 -72.143 1.00 41.24 ? 136 LEU A CD2 1 
ATOM   657  N N   . SER A 1 81  ? -9.630  -17.653 -68.712 1.00 42.22 ? 137 SER A N   1 
ATOM   658  C CA  . SER A 1 81  ? -10.162 -18.784 -67.965 1.00 42.25 ? 137 SER A CA  1 
ATOM   659  C C   . SER A 1 81  ? -11.565 -19.109 -68.459 1.00 42.42 ? 137 SER A C   1 
ATOM   660  O O   . SER A 1 81  ? -12.334 -18.215 -68.836 1.00 42.42 ? 137 SER A O   1 
ATOM   661  C CB  . SER A 1 81  ? -10.226 -18.499 -66.474 1.00 42.38 ? 137 SER A CB  1 
ATOM   662  O OG  . SER A 1 81  ? -10.762 -19.633 -65.799 1.00 42.90 ? 137 SER A OG  1 
ATOM   663  N N   . GLN A 1 82  ? -11.894 -20.394 -68.438 1.00 42.45 ? 138 GLN A N   1 
ATOM   664  C CA  . GLN A 1 82  ? -13.181 -20.849 -68.929 1.00 42.44 ? 138 GLN A CA  1 
ATOM   665  C C   . GLN A 1 82  ? -14.292 -20.336 -68.027 1.00 42.57 ? 138 GLN A C   1 
ATOM   666  O O   . GLN A 1 82  ? -15.340 -19.896 -68.512 1.00 43.03 ? 138 GLN A O   1 
ATOM   667  C CB  . GLN A 1 82  ? -13.203 -22.375 -69.032 1.00 42.57 ? 138 GLN A CB  1 
ATOM   668  C CG  . GLN A 1 82  ? -12.262 -22.926 -70.125 1.00 42.51 ? 138 GLN A CG  1 
ATOM   669  C CD  . GLN A 1 82  ? -12.455 -24.417 -70.363 1.00 42.50 ? 138 GLN A CD  1 
ATOM   670  O OE1 . GLN A 1 82  ? -12.457 -24.892 -71.503 1.00 41.02 ? 138 GLN A OE1 1 
ATOM   671  N NE2 . GLN A 1 82  ? -12.621 -25.164 -69.274 1.00 42.72 ? 138 GLN A NE2 1 
ATOM   672  N N   . TYR A 1 83  ? -14.034 -20.332 -66.723 1.00 42.44 ? 139 TYR A N   1 
ATOM   673  C CA  . TYR A 1 83  ? -15.049 -19.978 -65.747 1.00 42.42 ? 139 TYR A CA  1 
ATOM   674  C C   . TYR A 1 83  ? -15.312 -18.466 -65.679 1.00 42.59 ? 139 TYR A C   1 
ATOM   675  O O   . TYR A 1 83  ? -16.350 -18.044 -65.181 1.00 42.77 ? 139 TYR A O   1 
ATOM   676  C CB  . TYR A 1 83  ? -14.652 -20.507 -64.369 1.00 42.76 ? 139 TYR A CB  1 
ATOM   677  C CG  . TYR A 1 83  ? -14.379 -22.003 -64.292 1.00 42.66 ? 139 TYR A CG  1 
ATOM   678  C CD1 . TYR A 1 83  ? -15.284 -22.929 -64.801 1.00 43.44 ? 139 TYR A CD1 1 
ATOM   679  C CD2 . TYR A 1 83  ? -13.228 -22.488 -63.684 1.00 42.86 ? 139 TYR A CD2 1 
ATOM   680  C CE1 . TYR A 1 83  ? -15.040 -24.309 -64.719 1.00 43.38 ? 139 TYR A CE1 1 
ATOM   681  C CE2 . TYR A 1 83  ? -12.976 -23.869 -63.590 1.00 43.06 ? 139 TYR A CE2 1 
ATOM   682  C CZ  . TYR A 1 83  ? -13.889 -24.771 -64.112 1.00 43.09 ? 139 TYR A CZ  1 
ATOM   683  O OH  . TYR A 1 83  ? -13.650 -26.128 -64.047 1.00 42.59 ? 139 TYR A OH  1 
ATOM   684  N N   . LEU A 1 84  ? -14.396 -17.646 -66.197 1.00 42.60 ? 140 LEU A N   1 
ATOM   685  C CA  . LEU A 1 84  ? -14.563 -16.188 -66.130 1.00 42.40 ? 140 LEU A CA  1 
ATOM   686  C C   . LEU A 1 84  ? -15.847 -15.719 -66.819 1.00 42.51 ? 140 LEU A C   1 
ATOM   687  O O   . LEU A 1 84  ? -16.683 -15.068 -66.210 1.00 43.26 ? 140 LEU A O   1 
ATOM   688  C CB  . LEU A 1 84  ? -13.366 -15.469 -66.756 1.00 42.45 ? 140 LEU A CB  1 
ATOM   689  C CG  . LEU A 1 84  ? -13.028 -14.069 -66.224 1.00 42.35 ? 140 LEU A CG  1 
ATOM   690  C CD1 . LEU A 1 84  ? -12.557 -13.158 -67.356 1.00 40.93 ? 140 LEU A CD1 1 
ATOM   691  C CD2 . LEU A 1 84  ? -14.188 -13.415 -65.455 1.00 41.76 ? 140 LEU A CD2 1 
ATOM   692  N N   . PHE A 1 85  ? -15.977 -16.027 -68.098 1.00 42.38 ? 141 PHE A N   1 
ATOM   693  C CA  . PHE A 1 85  ? -17.173 -15.732 -68.861 1.00 42.17 ? 141 PHE A CA  1 
ATOM   694  C C   . PHE A 1 85  ? -17.692 -17.085 -69.345 1.00 42.47 ? 141 PHE A C   1 
ATOM   695  O O   . PHE A 1 85  ? -17.029 -17.733 -70.166 1.00 42.50 ? 141 PHE A O   1 
ATOM   696  C CB  . PHE A 1 85  ? -16.838 -14.851 -70.071 1.00 42.08 ? 141 PHE A CB  1 
ATOM   697  C CG  . PHE A 1 85  ? -16.148 -13.558 -69.725 1.00 41.75 ? 141 PHE A CG  1 
ATOM   698  C CD1 . PHE A 1 85  ? -16.722 -12.662 -68.830 1.00 41.78 ? 141 PHE A CD1 1 
ATOM   699  C CD2 . PHE A 1 85  ? -14.934 -13.227 -70.301 1.00 41.52 ? 141 PHE A CD2 1 
ATOM   700  C CE1 . PHE A 1 85  ? -16.094 -11.463 -68.516 1.00 41.37 ? 141 PHE A CE1 1 
ATOM   701  C CE2 . PHE A 1 85  ? -14.305 -12.019 -69.993 1.00 42.30 ? 141 PHE A CE2 1 
ATOM   702  C CZ  . PHE A 1 85  ? -14.888 -11.141 -69.091 1.00 41.34 ? 141 PHE A CZ  1 
ATOM   703  N N   . PRO A 1 86  ? -18.852 -17.542 -68.821 1.00 42.69 ? 142 PRO A N   1 
ATOM   704  C CA  . PRO A 1 86  ? -19.339 -18.894 -69.180 1.00 42.62 ? 142 PRO A CA  1 
ATOM   705  C C   . PRO A 1 86  ? -19.957 -19.012 -70.593 1.00 42.84 ? 142 PRO A C   1 
ATOM   706  O O   . PRO A 1 86  ? -19.877 -20.080 -71.227 1.00 42.89 ? 142 PRO A O   1 
ATOM   707  C CB  . PRO A 1 86  ? -20.383 -19.199 -68.093 1.00 42.75 ? 142 PRO A CB  1 
ATOM   708  C CG  . PRO A 1 86  ? -20.417 -17.991 -67.168 1.00 42.39 ? 142 PRO A CG  1 
ATOM   709  C CD  . PRO A 1 86  ? -19.762 -16.864 -67.877 1.00 42.46 ? 142 PRO A CD  1 
ATOM   710  N N   . SER A 1 87  ? -20.543 -17.924 -71.091 1.00 42.83 ? 143 SER A N   1 
ATOM   711  C CA  . SER A 1 87  ? -21.089 -17.897 -72.451 1.00 42.81 ? 143 SER A CA  1 
ATOM   712  C C   . SER A 1 87  ? -20.023 -17.911 -73.563 1.00 42.89 ? 143 SER A C   1 
ATOM   713  O O   . SER A 1 87  ? -20.380 -17.999 -74.743 1.00 43.07 ? 143 SER A O   1 
ATOM   714  C CB  . SER A 1 87  ? -22.025 -16.693 -72.625 1.00 42.86 ? 143 SER A CB  1 
ATOM   715  O OG  . SER A 1 87  ? -21.605 -15.581 -71.841 1.00 44.49 ? 143 SER A OG  1 
ATOM   716  N N   . PHE A 1 88  ? -18.734 -17.861 -73.193 1.00 42.68 ? 144 PHE A N   1 
ATOM   717  C CA  . PHE A 1 88  ? -17.633 -17.611 -74.150 1.00 42.21 ? 144 PHE A CA  1 
ATOM   718  C C   . PHE A 1 88  ? -17.663 -18.549 -75.346 1.00 42.02 ? 144 PHE A C   1 
ATOM   719  O O   . PHE A 1 88  ? -17.213 -18.189 -76.448 1.00 42.00 ? 144 PHE A O   1 
ATOM   720  C CB  . PHE A 1 88  ? -16.262 -17.652 -73.451 1.00 41.97 ? 144 PHE A CB  1 
ATOM   721  C CG  . PHE A 1 88  ? -15.700 -19.038 -73.265 1.00 41.62 ? 144 PHE A CG  1 
ATOM   722  C CD1 . PHE A 1 88  ? -16.299 -19.939 -72.400 1.00 41.75 ? 144 PHE A CD1 1 
ATOM   723  C CD2 . PHE A 1 88  ? -14.543 -19.427 -73.935 1.00 41.25 ? 144 PHE A CD2 1 
ATOM   724  C CE1 . PHE A 1 88  ? -15.771 -21.217 -72.232 1.00 41.67 ? 144 PHE A CE1 1 
ATOM   725  C CE2 . PHE A 1 88  ? -14.005 -20.692 -73.762 1.00 41.32 ? 144 PHE A CE2 1 
ATOM   726  C CZ  . PHE A 1 88  ? -14.620 -21.590 -72.912 1.00 41.17 ? 144 PHE A CZ  1 
ATOM   727  N N   . GLU A 1 89  ? -18.202 -19.743 -75.110 1.00 41.81 ? 145 GLU A N   1 
ATOM   728  C CA  . GLU A 1 89  ? -18.535 -20.695 -76.165 1.00 41.56 ? 145 GLU A CA  1 
ATOM   729  C C   . GLU A 1 89  ? -19.246 -20.015 -77.327 1.00 41.08 ? 145 GLU A C   1 
ATOM   730  O O   . GLU A 1 89  ? -18.856 -20.183 -78.486 1.00 40.88 ? 145 GLU A O   1 
ATOM   731  C CB  . GLU A 1 89  ? -19.431 -21.803 -75.592 1.00 41.85 ? 145 GLU A CB  1 
ATOM   732  C CG  . GLU A 1 89  ? -18.671 -22.986 -74.961 1.00 42.62 ? 145 GLU A CG  1 
ATOM   733  C CD  . GLU A 1 89  ? -18.834 -24.286 -75.742 1.00 44.11 ? 145 GLU A CD  1 
ATOM   734  O OE1 . GLU A 1 89  ? -19.957 -24.827 -75.792 1.00 45.31 ? 145 GLU A OE1 1 
ATOM   735  O OE2 . GLU A 1 89  ? -17.839 -24.791 -76.297 1.00 45.70 ? 145 GLU A OE2 1 
ATOM   736  N N   . THR A 1 90  ? -20.273 -19.232 -76.999 1.00 40.41 ? 146 THR A N   1 
ATOM   737  C CA  . THR A 1 90  ? -21.118 -18.580 -77.998 1.00 40.06 ? 146 THR A CA  1 
ATOM   738  C C   . THR A 1 90  ? -20.661 -17.182 -78.484 1.00 39.85 ? 146 THR A C   1 
ATOM   739  O O   . THR A 1 90  ? -21.360 -16.578 -79.300 1.00 39.60 ? 146 THR A O   1 
ATOM   740  C CB  . THR A 1 90  ? -22.564 -18.478 -77.483 1.00 39.81 ? 146 THR A CB  1 
ATOM   741  O OG1 . THR A 1 90  ? -22.609 -17.673 -76.296 1.00 39.61 ? 146 THR A OG1 1 
ATOM   742  C CG2 . THR A 1 90  ? -23.111 -19.857 -77.168 1.00 39.75 ? 146 THR A CG2 1 
ATOM   743  N N   . PHE A 1 91  ? -19.521 -16.668 -78.006 1.00 39.51 ? 147 PHE A N   1 
ATOM   744  C CA  . PHE A 1 91  ? -18.968 -15.415 -78.547 1.00 39.61 ? 147 PHE A CA  1 
ATOM   745  C C   . PHE A 1 91  ? -18.625 -15.531 -80.025 1.00 39.68 ? 147 PHE A C   1 
ATOM   746  O O   . PHE A 1 91  ? -17.934 -16.456 -80.435 1.00 40.23 ? 147 PHE A O   1 
ATOM   747  C CB  . PHE A 1 91  ? -17.663 -15.003 -77.857 1.00 39.89 ? 147 PHE A CB  1 
ATOM   748  C CG  . PHE A 1 91  ? -17.804 -14.528 -76.428 1.00 39.53 ? 147 PHE A CG  1 
ATOM   749  C CD1 . PHE A 1 91  ? -19.034 -14.266 -75.851 1.00 40.31 ? 147 PHE A CD1 1 
ATOM   750  C CD2 . PHE A 1 91  ? -16.662 -14.329 -75.668 1.00 39.37 ? 147 PHE A CD2 1 
ATOM   751  C CE1 . PHE A 1 91  ? -19.123 -13.831 -74.517 1.00 40.00 ? 147 PHE A CE1 1 
ATOM   752  C CE2 . PHE A 1 91  ? -16.740 -13.886 -74.346 1.00 40.05 ? 147 PHE A CE2 1 
ATOM   753  C CZ  . PHE A 1 91  ? -17.977 -13.634 -73.775 1.00 40.16 ? 147 PHE A CZ  1 
ATOM   754  N N   . ASN A 1 92  ? -19.069 -14.564 -80.814 1.00 39.85 ? 148 ASN A N   1 
ATOM   755  C CA  . ASN A 1 92  ? -18.759 -14.498 -82.239 1.00 39.76 ? 148 ASN A CA  1 
ATOM   756  C C   . ASN A 1 92  ? -17.300 -14.060 -82.429 1.00 39.86 ? 148 ASN A C   1 
ATOM   757  O O   . ASN A 1 92  ? -16.920 -12.961 -82.031 1.00 39.99 ? 148 ASN A O   1 
ATOM   758  C CB  . ASN A 1 92  ? -19.737 -13.510 -82.878 1.00 39.88 ? 148 ASN A CB  1 
ATOM   759  C CG  . ASN A 1 92  ? -19.509 -13.286 -84.370 1.00 40.24 ? 148 ASN A CG  1 
ATOM   760  O OD1 . ASN A 1 92  ? -20.460 -13.036 -85.106 1.00 42.35 ? 148 ASN A OD1 1 
ATOM   761  N ND2 . ASN A 1 92  ? -18.263 -13.323 -84.810 1.00 38.07 ? 148 ASN A ND2 1 
ATOM   762  N N   . THR A 1 93  ? -16.497 -14.926 -83.047 1.00 40.06 ? 149 THR A N   1 
ATOM   763  C CA  . THR A 1 93  ? -15.030 -14.741 -83.140 1.00 40.21 ? 149 THR A CA  1 
ATOM   764  C C   . THR A 1 93  ? -14.540 -13.509 -83.944 1.00 40.18 ? 149 THR A C   1 
ATOM   765  O O   . THR A 1 93  ? -13.392 -13.105 -83.807 1.00 40.35 ? 149 THR A O   1 
ATOM   766  C CB  . THR A 1 93  ? -14.328 -16.023 -83.695 1.00 40.29 ? 149 THR A CB  1 
ATOM   767  O OG1 . THR A 1 93  ? -14.741 -16.268 -85.047 1.00 40.67 ? 149 THR A OG1 1 
ATOM   768  C CG2 . THR A 1 93  ? -14.640 -17.251 -82.828 1.00 39.22 ? 149 THR A CG2 1 
ATOM   769  N N   . LYS A 1 94  ? -15.397 -12.928 -84.777 1.00 40.20 ? 150 LYS A N   1 
ATOM   770  C CA  . LYS A 1 94  ? -15.114 -11.643 -85.422 1.00 40.33 ? 150 LYS A CA  1 
ATOM   771  C C   . LYS A 1 94  ? -15.395 -10.423 -84.520 1.00 40.41 ? 150 LYS A C   1 
ATOM   772  O O   . LYS A 1 94  ? -15.037 -9.308  -84.873 1.00 40.23 ? 150 LYS A O   1 
ATOM   773  C CB  . LYS A 1 94  ? -15.920 -11.511 -86.720 1.00 40.48 ? 150 LYS A CB  1 
ATOM   774  C CG  . LYS A 1 94  ? -15.632 -12.603 -87.778 1.00 40.47 ? 150 LYS A CG  1 
ATOM   775  C CD  . LYS A 1 94  ? -14.293 -12.384 -88.483 1.00 40.76 ? 150 LYS A CD  1 
ATOM   776  C CE  . LYS A 1 94  ? -13.669 -13.699 -89.003 1.00 41.09 ? 150 LYS A CE  1 
ATOM   777  N NZ  . LYS A 1 94  ? -14.412 -14.328 -90.144 1.00 40.06 ? 150 LYS A NZ  1 
ATOM   778  N N   . ASN A 1 95  ? -16.029 -10.628 -83.364 1.00 40.58 ? 151 ASN A N   1 
ATOM   779  C CA  . ASN A 1 95  ? -16.401 -9.515  -82.472 1.00 40.56 ? 151 ASN A CA  1 
ATOM   780  C C   . ASN A 1 95  ? -15.410 -9.252  -81.352 1.00 40.57 ? 151 ASN A C   1 
ATOM   781  O O   . ASN A 1 95  ? -14.587 -10.103 -81.022 1.00 40.42 ? 151 ASN A O   1 
ATOM   782  C CB  . ASN A 1 95  ? -17.772 -9.755  -81.855 1.00 40.00 ? 151 ASN A CB  1 
ATOM   783  C CG  . ASN A 1 95  ? -18.902 -9.573  -82.848 1.00 40.10 ? 151 ASN A CG  1 
ATOM   784  O OD1 . ASN A 1 95  ? -18.701 -9.140  -84.004 1.00 36.50 ? 151 ASN A OD1 1 
ATOM   785  N ND2 . ASN A 1 95  ? -20.113 -9.885  -82.398 1.00 39.24 ? 151 ASN A ND2 1 
ATOM   786  N N   . CYS A 1 96  ? -15.506 -8.058  -80.775 1.00 40.60 ? 152 CYS A N   1 
ATOM   787  C CA  . CYS A 1 96  ? -14.762 -7.718  -79.572 1.00 40.86 ? 152 CYS A CA  1 
ATOM   788  C C   . CYS A 1 96  ? -15.703 -7.861  -78.369 1.00 40.16 ? 152 CYS A C   1 
ATOM   789  O O   . CYS A 1 96  ? -16.922 -7.900  -78.544 1.00 39.88 ? 152 CYS A O   1 
ATOM   790  C CB  . CYS A 1 96  ? -14.235 -6.302  -79.675 1.00 41.66 ? 152 CYS A CB  1 
ATOM   791  S SG  . CYS A 1 96  ? -12.958 -6.004  -80.918 1.00 45.57 ? 152 CYS A SG  1 
ATOM   792  N N   . ILE A 1 97  ? -15.144 -7.939  -77.164 1.00 39.40 ? 153 ILE A N   1 
ATOM   793  C CA  . ILE A 1 97  ? -15.944 -8.130  -75.947 1.00 39.69 ? 153 ILE A CA  1 
ATOM   794  C C   . ILE A 1 97  ? -16.137 -6.822  -75.164 1.00 39.67 ? 153 ILE A C   1 
ATOM   795  O O   . ILE A 1 97  ? -15.166 -6.132  -74.832 1.00 39.62 ? 153 ILE A O   1 
ATOM   796  C CB  . ILE A 1 97  ? -15.316 -9.200  -74.980 1.00 39.39 ? 153 ILE A CB  1 
ATOM   797  C CG1 . ILE A 1 97  ? -14.833 -10.447 -75.742 1.00 39.09 ? 153 ILE A CG1 1 
ATOM   798  C CG2 . ILE A 1 97  ? -16.318 -9.642  -73.936 1.00 38.57 ? 153 ILE A CG2 1 
ATOM   799  C CD1 . ILE A 1 97  ? -15.911 -11.178 -76.504 1.00 37.18 ? 153 ILE A CD1 1 
ATOM   800  N N   . ALA A 1 98  ? -17.395 -6.494  -74.865 1.00 39.98 ? 154 ALA A N   1 
ATOM   801  C CA  . ALA A 1 98  ? -17.732 -5.415  -73.907 1.00 40.05 ? 154 ALA A CA  1 
ATOM   802  C C   . ALA A 1 98  ? -18.169 -6.049  -72.600 1.00 40.13 ? 154 ALA A C   1 
ATOM   803  O O   . ALA A 1 98  ? -18.679 -7.159  -72.596 1.00 40.15 ? 154 ALA A O   1 
ATOM   804  C CB  . ALA A 1 98  ? -18.827 -4.541  -74.435 1.00 39.66 ? 154 ALA A CB  1 
ATOM   805  N N   . TYR A 1 99  ? -17.978 -5.329  -71.497 1.00 40.56 ? 155 TYR A N   1 
ATOM   806  C CA  . TYR A 1 99  ? -18.186 -5.875  -70.162 1.00 40.75 ? 155 TYR A CA  1 
ATOM   807  C C   . TYR A 1 99  ? -18.820 -4.865  -69.215 1.00 41.14 ? 155 TYR A C   1 
ATOM   808  O O   . TYR A 1 99  ? -18.425 -3.707  -69.154 1.00 41.39 ? 155 TYR A O   1 
ATOM   809  C CB  . TYR A 1 99  ? -16.855 -6.361  -69.584 1.00 40.66 ? 155 TYR A CB  1 
ATOM   810  C CG  . TYR A 1 99  ? -16.956 -6.953  -68.195 1.00 40.54 ? 155 TYR A CG  1 
ATOM   811  C CD1 . TYR A 1 99  ? -17.540 -8.187  -67.985 1.00 39.66 ? 155 TYR A CD1 1 
ATOM   812  C CD2 . TYR A 1 99  ? -16.453 -6.266  -67.087 1.00 41.59 ? 155 TYR A CD2 1 
ATOM   813  C CE1 . TYR A 1 99  ? -17.626 -8.723  -66.715 1.00 40.58 ? 155 TYR A CE1 1 
ATOM   814  C CE2 . TYR A 1 99  ? -16.541 -6.792  -65.807 1.00 40.28 ? 155 TYR A CE2 1 
ATOM   815  C CZ  . TYR A 1 99  ? -17.129 -8.022  -65.625 1.00 40.80 ? 155 TYR A CZ  1 
ATOM   816  O OH  . TYR A 1 99  ? -17.221 -8.557  -64.352 1.00 40.37 ? 155 TYR A OH  1 
ATOM   817  N N   . ASN A 1 100 ? -19.805 -5.350  -68.469 1.00 41.67 ? 156 ASN A N   1 
ATOM   818  C CA  . ASN A 1 100 ? -20.519 -4.598  -67.468 1.00 41.72 ? 156 ASN A CA  1 
ATOM   819  C C   . ASN A 1 100 ? -20.023 -5.062  -66.111 1.00 42.02 ? 156 ASN A C   1 
ATOM   820  O O   . ASN A 1 100 ? -20.105 -6.245  -65.786 1.00 41.78 ? 156 ASN A O   1 
ATOM   821  C CB  . ASN A 1 100 ? -22.013 -4.893  -67.598 1.00 41.86 ? 156 ASN A CB  1 
ATOM   822  C CG  . ASN A 1 100 ? -22.874 -3.907  -66.852 1.00 42.37 ? 156 ASN A CG  1 
ATOM   823  O OD1 . ASN A 1 100 ? -22.750 -3.736  -65.640 1.00 42.65 ? 156 ASN A OD1 1 
ATOM   824  N ND2 . ASN A 1 100 ? -23.762 -3.247  -67.580 1.00 44.46 ? 156 ASN A ND2 1 
ATOM   825  N N   . PRO A 1 101 ? -19.513 -4.134  -65.296 1.00 42.56 ? 157 PRO A N   1 
ATOM   826  C CA  . PRO A 1 101 ? -19.059 -4.491  -63.951 1.00 42.84 ? 157 PRO A CA  1 
ATOM   827  C C   . PRO A 1 101 ? -20.043 -5.344  -63.133 1.00 43.38 ? 157 PRO A C   1 
ATOM   828  O O   . PRO A 1 101 ? -19.638 -5.974  -62.161 1.00 43.95 ? 157 PRO A O   1 
ATOM   829  C CB  . PRO A 1 101 ? -18.832 -3.134  -63.306 1.00 42.99 ? 157 PRO A CB  1 
ATOM   830  C CG  . PRO A 1 101 ? -18.452 -2.240  -64.458 1.00 42.66 ? 157 PRO A CG  1 
ATOM   831  C CD  . PRO A 1 101 ? -19.303 -2.704  -65.594 1.00 42.37 ? 157 PRO A CD  1 
ATOM   832  N N   . ASN A 1 102 ? -21.317 -5.363  -63.515 1.00 43.81 ? 158 ASN A N   1 
ATOM   833  C CA  . ASN A 1 102 ? -22.262 -6.405  -63.065 1.00 44.04 ? 158 ASN A CA  1 
ATOM   834  C C   . ASN A 1 102 ? -21.683 -7.820  -62.997 1.00 44.04 ? 158 ASN A C   1 
ATOM   835  O O   . ASN A 1 102 ? -21.949 -8.561  -62.055 1.00 44.44 ? 158 ASN A O   1 
ATOM   836  C CB  . ASN A 1 102 ? -23.456 -6.481  -64.031 1.00 44.46 ? 158 ASN A CB  1 
ATOM   837  C CG  . ASN A 1 102 ? -24.440 -5.348  -63.844 1.00 45.61 ? 158 ASN A CG  1 
ATOM   838  O OD1 . ASN A 1 102 ? -24.214 -4.415  -63.060 1.00 47.23 ? 158 ASN A OD1 1 
ATOM   839  N ND2 . ASN A 1 102 ? -25.545 -5.417  -64.577 1.00 47.65 ? 158 ASN A ND2 1 
ATOM   840  N N   . GLY A 1 103 ? -20.915 -8.185  -64.019 1.00 43.96 ? 159 GLY A N   1 
ATOM   841  C CA  . GLY A 1 103 ? -20.512 -9.571  -64.269 1.00 43.58 ? 159 GLY A CA  1 
ATOM   842  C C   . GLY A 1 103 ? -20.862 -10.056 -65.674 1.00 43.46 ? 159 GLY A C   1 
ATOM   843  O O   . GLY A 1 103 ? -20.505 -11.173 -66.043 1.00 43.86 ? 159 GLY A O   1 
ATOM   844  N N   . ASN A 1 104 ? -21.551 -9.229  -66.464 1.00 43.05 ? 160 ASN A N   1 
ATOM   845  C CA  . ASN A 1 104 ? -22.058 -9.648  -67.763 1.00 42.59 ? 160 ASN A CA  1 
ATOM   846  C C   . ASN A 1 104 ? -21.180 -9.185  -68.927 1.00 42.12 ? 160 ASN A C   1 
ATOM   847  O O   . ASN A 1 104 ? -20.917 -7.991  -69.083 1.00 42.27 ? 160 ASN A O   1 
ATOM   848  C CB  . ASN A 1 104 ? -23.501 -9.160  -67.950 1.00 42.81 ? 160 ASN A CB  1 
ATOM   849  C CG  . ASN A 1 104 ? -24.257 -9.960  -69.017 1.00 43.72 ? 160 ASN A CG  1 
ATOM   850  O OD1 . ASN A 1 104 ? -23.908 -9.924  -70.209 1.00 44.29 ? 160 ASN A OD1 1 
ATOM   851  N ND2 . ASN A 1 104 ? -25.296 -10.692 -68.588 1.00 44.13 ? 160 ASN A ND2 1 
ATOM   852  N N   . ALA A 1 105 ? -20.723 -10.136 -69.738 1.00 41.49 ? 161 ALA A N   1 
ATOM   853  C CA  . ALA A 1 105 ? -19.962 -9.828  -70.959 1.00 41.25 ? 161 ALA A CA  1 
ATOM   854  C C   . ALA A 1 105 ? -20.842 -9.963  -72.184 1.00 40.74 ? 161 ALA A C   1 
ATOM   855  O O   . ALA A 1 105 ? -21.709 -10.836 -72.245 1.00 40.52 ? 161 ALA A O   1 
ATOM   856  C CB  . ALA A 1 105 ? -18.760 -10.751 -71.108 1.00 41.29 ? 161 ALA A CB  1 
ATOM   857  N N   . LEU A 1 106 ? -20.608 -9.099  -73.161 1.00 40.22 ? 162 LEU A N   1 
ATOM   858  C CA  . LEU A 1 106 ? -21.289 -9.176  -74.436 1.00 40.36 ? 162 LEU A CA  1 
ATOM   859  C C   . LEU A 1 106 ? -20.271 -9.035  -75.566 1.00 40.05 ? 162 LEU A C   1 
ATOM   860  O O   . LEU A 1 106 ? -19.390 -8.176  -75.520 1.00 39.94 ? 162 LEU A O   1 
ATOM   861  C CB  . LEU A 1 106 ? -22.354 -8.076  -74.555 1.00 40.00 ? 162 LEU A CB  1 
ATOM   862  C CG  . LEU A 1 106 ? -23.676 -8.252  -73.800 1.00 40.50 ? 162 LEU A CG  1 
ATOM   863  C CD1 . LEU A 1 106 ? -24.501 -6.951  -73.757 1.00 39.48 ? 162 LEU A CD1 1 
ATOM   864  C CD2 . LEU A 1 106 ? -24.524 -9.374  -74.392 1.00 39.53 ? 162 LEU A CD2 1 
ATOM   865  N N   . ASP A 1 107 ? -20.404 -9.867  -76.586 1.00 40.02 ? 163 ASP A N   1 
ATOM   866  C CA  . ASP A 1 107 ? -19.584 -9.722  -77.780 1.00 40.59 ? 163 ASP A CA  1 
ATOM   867  C C   . ASP A 1 107 ? -20.259 -8.730  -78.728 1.00 40.66 ? 163 ASP A C   1 
ATOM   868  O O   . ASP A 1 107 ? -21.471 -8.784  -78.925 1.00 41.18 ? 163 ASP A O   1 
ATOM   869  C CB  . ASP A 1 107 ? -19.349 -11.067 -78.457 1.00 40.43 ? 163 ASP A CB  1 
ATOM   870  C CG  . ASP A 1 107 ? -20.634 -11.793 -78.786 1.00 41.46 ? 163 ASP A CG  1 
ATOM   871  O OD1 . ASP A 1 107 ? -21.621 -11.663 -78.021 1.00 42.22 ? 163 ASP A OD1 1 
ATOM   872  O OD2 . ASP A 1 107 ? -20.651 -12.510 -79.808 1.00 41.83 ? 163 ASP A OD2 1 
ATOM   873  N N   . GLU A 1 108 ? -19.482 -7.808  -79.286 1.00 40.58 ? 164 GLU A N   1 
ATOM   874  C CA  . GLU A 1 108 ? -20.035 -6.730  -80.106 1.00 40.83 ? 164 GLU A CA  1 
ATOM   875  C C   . GLU A 1 108 ? -19.099 -6.380  -81.243 1.00 40.77 ? 164 GLU A C   1 
ATOM   876  O O   . GLU A 1 108 ? -17.882 -6.565  -81.139 1.00 40.63 ? 164 GLU A O   1 
ATOM   877  C CB  . GLU A 1 108 ? -20.233 -5.461  -79.271 1.00 41.07 ? 164 GLU A CB  1 
ATOM   878  C CG  . GLU A 1 108 ? -21.137 -5.582  -78.061 1.00 41.81 ? 164 GLU A CG  1 
ATOM   879  C CD  . GLU A 1 108 ? -22.594 -5.804  -78.407 1.00 42.43 ? 164 GLU A CD  1 
ATOM   880  O OE1 . GLU A 1 108 ? -23.133 -5.070  -79.252 1.00 42.79 ? 164 GLU A OE1 1 
ATOM   881  O OE2 . GLU A 1 108 ? -23.205 -6.709  -77.806 1.00 43.10 ? 164 GLU A OE2 1 
ATOM   882  N N   . SER A 1 109 ? -19.664 -5.822  -82.313 1.00 41.27 ? 165 SER A N   1 
ATOM   883  C CA  . SER A 1 109 ? -18.879 -5.388  -83.471 1.00 41.43 ? 165 SER A CA  1 
ATOM   884  C C   . SER A 1 109 ? -17.796 -4.447  -82.978 1.00 41.65 ? 165 SER A C   1 
ATOM   885  O O   . SER A 1 109 ? -18.089 -3.494  -82.271 1.00 42.10 ? 165 SER A O   1 
ATOM   886  C CB  . SER A 1 109 ? -19.772 -4.686  -84.493 1.00 41.59 ? 165 SER A CB  1 
ATOM   887  O OG  . SER A 1 109 ? -19.016 -3.949  -85.453 1.00 42.41 ? 165 SER A OG  1 
ATOM   888  N N   . CYS A 1 110 ? -16.548 -4.714  -83.336 1.00 41.68 ? 166 CYS A N   1 
ATOM   889  C CA  . CYS A 1 110 ? -15.430 -3.941  -82.815 1.00 42.16 ? 166 CYS A CA  1 
ATOM   890  C C   . CYS A 1 110 ? -15.493 -2.492  -83.223 1.00 41.95 ? 166 CYS A C   1 
ATOM   891  O O   . CYS A 1 110 ? -14.921 -1.641  -82.540 1.00 42.13 ? 166 CYS A O   1 
ATOM   892  C CB  . CYS A 1 110 ? -14.105 -4.531  -83.279 1.00 42.76 ? 166 CYS A CB  1 
ATOM   893  S SG  . CYS A 1 110 ? -13.904 -6.199  -82.694 1.00 46.85 ? 166 CYS A SG  1 
ATOM   894  N N   . GLU A 1 111 ? -16.182 -2.211  -84.329 1.00 41.72 ? 167 GLU A N   1 
ATOM   895  C CA  . GLU A 1 111 ? -16.363 -0.843  -84.798 1.00 41.73 ? 167 GLU A CA  1 
ATOM   896  C C   . GLU A 1 111 ? -17.477 -0.077  -84.067 1.00 41.18 ? 167 GLU A C   1 
ATOM   897  O O   . GLU A 1 111 ? -17.719 1.088   -84.379 1.00 40.72 ? 167 GLU A O   1 
ATOM   898  C CB  . GLU A 1 111 ? -16.595 -0.816  -86.314 1.00 42.00 ? 167 GLU A CB  1 
ATOM   899  C CG  . GLU A 1 111 ? -15.474 -1.478  -87.113 1.00 44.04 ? 167 GLU A CG  1 
ATOM   900  C CD  . GLU A 1 111 ? -14.105 -0.837  -86.884 1.00 47.03 ? 167 GLU A CD  1 
ATOM   901  O OE1 . GLU A 1 111 ? -13.972 0.380   -87.141 1.00 49.51 ? 167 GLU A OE1 1 
ATOM   902  O OE2 . GLU A 1 111 ? -13.159 -1.547  -86.459 1.00 48.41 ? 167 GLU A OE2 1 
ATOM   903  N N   . ASP A 1 112 ? -18.139 -0.710  -83.097 1.00 40.81 ? 168 ASP A N   1 
ATOM   904  C CA  . ASP A 1 112 ? -19.064 0.017   -82.211 1.00 40.77 ? 168 ASP A CA  1 
ATOM   905  C C   . ASP A 1 112 ? -18.291 0.900   -81.259 1.00 40.48 ? 168 ASP A C   1 
ATOM   906  O O   . ASP A 1 112 ? -17.188 0.566   -80.849 1.00 40.64 ? 168 ASP A O   1 
ATOM   907  C CB  . ASP A 1 112 ? -19.918 -0.918  -81.366 1.00 40.72 ? 168 ASP A CB  1 
ATOM   908  C CG  . ASP A 1 112 ? -21.016 -1.572  -82.144 1.00 41.32 ? 168 ASP A CG  1 
ATOM   909  O OD1 . ASP A 1 112 ? -21.106 -1.358  -83.381 1.00 42.08 ? 168 ASP A OD1 1 
ATOM   910  O OD2 . ASP A 1 112 ? -21.783 -2.326  -81.501 1.00 41.75 ? 168 ASP A OD2 1 
ATOM   911  N N   . LYS A 1 113 ? -18.885 2.023   -80.891 1.00 40.41 ? 169 LYS A N   1 
ATOM   912  C CA  . LYS A 1 113 ? -18.255 2.928   -79.952 1.00 40.24 ? 169 LYS A CA  1 
ATOM   913  C C   . LYS A 1 113 ? -18.778 2.599   -78.571 1.00 40.04 ? 169 LYS A C   1 
ATOM   914  O O   . LYS A 1 113 ? -19.993 2.456   -78.363 1.00 40.47 ? 169 LYS A O   1 
ATOM   915  C CB  . LYS A 1 113 ? -18.536 4.381   -80.326 1.00 40.19 ? 169 LYS A CB  1 
ATOM   916  C CG  . LYS A 1 113 ? -17.973 4.774   -81.690 1.00 40.24 ? 169 LYS A CG  1 
ATOM   917  C CD  . LYS A 1 113 ? -17.478 6.219   -81.729 1.00 40.97 ? 169 LYS A CD  1 
ATOM   918  C CE  . LYS A 1 113 ? -16.623 6.517   -82.993 1.00 41.42 ? 169 LYS A CE  1 
ATOM   919  N NZ  . LYS A 1 113 ? -15.676 7.667   -82.788 1.00 41.37 ? 169 LYS A NZ  1 
ATOM   920  N N   . ASN A 1 114 ? -17.850 2.438   -77.639 1.00 39.58 ? 170 ASN A N   1 
ATOM   921  C CA  . ASN A 1 114 ? -18.175 2.186   -76.256 1.00 39.31 ? 170 ASN A CA  1 
ATOM   922  C C   . ASN A 1 114 ? -17.196 2.918   -75.378 1.00 39.45 ? 170 ASN A C   1 
ATOM   923  O O   . ASN A 1 114 ? -16.101 3.286   -75.815 1.00 39.16 ? 170 ASN A O   1 
ATOM   924  C CB  . ASN A 1 114 ? -18.094 0.698   -75.941 1.00 38.89 ? 170 ASN A CB  1 
ATOM   925  C CG  . ASN A 1 114 ? -19.310 -0.055  -76.391 1.00 39.10 ? 170 ASN A CG  1 
ATOM   926  O OD1 . ASN A 1 114 ? -20.429 0.380   -76.163 1.00 37.77 ? 170 ASN A OD1 1 
ATOM   927  N ND2 . ASN A 1 114 ? -19.100 -1.204  -77.043 1.00 40.47 ? 170 ASN A ND2 1 
ATOM   928  N N   . ARG A 1 115 ? -17.585 3.104   -74.121 1.00 39.82 ? 171 ARG A N   1 
ATOM   929  C CA  . ARG A 1 115 ? -16.628 3.494   -73.105 1.00 39.95 ? 171 ARG A CA  1 
ATOM   930  C C   . ARG A 1 115 ? -15.630 2.359   -72.974 1.00 39.39 ? 171 ARG A C   1 
ATOM   931  O O   . ARG A 1 115 ? -15.889 1.265   -73.456 1.00 39.34 ? 171 ARG A O   1 
ATOM   932  C CB  . ARG A 1 115 ? -17.331 3.777   -71.788 1.00 40.27 ? 171 ARG A CB  1 
ATOM   933  C CG  . ARG A 1 115 ? -18.087 5.097   -71.804 1.00 41.21 ? 171 ARG A CG  1 
ATOM   934  C CD  . ARG A 1 115 ? -19.045 5.197   -70.642 1.00 41.80 ? 171 ARG A CD  1 
ATOM   935  N NE  . ARG A 1 115 ? -20.365 4.724   -71.041 1.00 43.80 ? 171 ARG A NE  1 
ATOM   936  C CZ  . ARG A 1 115 ? -21.323 5.492   -71.559 1.00 44.28 ? 171 ARG A CZ  1 
ATOM   937  N NH1 . ARG A 1 115 ? -21.151 6.802   -71.752 1.00 44.07 ? 171 ARG A NH1 1 
ATOM   938  N NH2 . ARG A 1 115 ? -22.479 4.937   -71.888 1.00 45.01 ? 171 ARG A NH2 1 
ATOM   939  N N   . TYR A 1 116 ? -14.474 2.644   -72.376 1.00 39.00 ? 172 TYR A N   1 
ATOM   940  C CA  . TYR A 1 116 ? -13.393 1.667   -72.234 1.00 38.65 ? 172 TYR A CA  1 
ATOM   941  C C   . TYR A 1 116 ? -12.747 1.830   -70.871 1.00 38.47 ? 172 TYR A C   1 
ATOM   942  O O   . TYR A 1 116 ? -12.879 2.876   -70.258 1.00 39.05 ? 172 TYR A O   1 
ATOM   943  C CB  . TYR A 1 116 ? -12.358 1.841   -73.353 1.00 38.06 ? 172 TYR A CB  1 
ATOM   944  C CG  . TYR A 1 116 ? -11.740 3.212   -73.430 1.00 38.21 ? 172 TYR A CG  1 
ATOM   945  C CD1 . TYR A 1 116 ? -12.343 4.235   -74.156 1.00 38.77 ? 172 TYR A CD1 1 
ATOM   946  C CD2 . TYR A 1 116 ? -10.557 3.498   -72.774 1.00 37.64 ? 172 TYR A CD2 1 
ATOM   947  C CE1 . TYR A 1 116 ? -11.781 5.499   -74.211 1.00 37.86 ? 172 TYR A CE1 1 
ATOM   948  C CE2 . TYR A 1 116 ? -9.994  4.762   -72.830 1.00 36.85 ? 172 TYR A CE2 1 
ATOM   949  C CZ  . TYR A 1 116 ? -10.605 5.748   -73.542 1.00 37.46 ? 172 TYR A CZ  1 
ATOM   950  O OH  . TYR A 1 116 ? -10.025 6.999   -73.584 1.00 39.02 ? 172 TYR A OH  1 
ATOM   951  N N   . ILE A 1 117 ? -12.081 0.792   -70.384 1.00 38.27 ? 173 ILE A N   1 
ATOM   952  C CA  . ILE A 1 117 ? -11.338 0.874   -69.139 1.00 38.69 ? 173 ILE A CA  1 
ATOM   953  C C   . ILE A 1 117 ? -9.880  0.496   -69.386 1.00 38.65 ? 173 ILE A C   1 
ATOM   954  O O   . ILE A 1 117 ? -9.623  -0.570  -69.911 1.00 38.61 ? 173 ILE A O   1 
ATOM   955  C CB  . ILE A 1 117 ? -11.898 -0.100  -68.089 1.00 38.63 ? 173 ILE A CB  1 
ATOM   956  C CG1 . ILE A 1 117 ? -13.334 0.242   -67.739 1.00 38.89 ? 173 ILE A CG1 1 
ATOM   957  C CG2 . ILE A 1 117 ? -11.060 -0.098  -66.821 1.00 38.06 ? 173 ILE A CG2 1 
ATOM   958  C CD1 . ILE A 1 117 ? -14.011 -0.871  -66.914 1.00 38.98 ? 173 ILE A CD1 1 
ATOM   959  N N   . CYS A 1 118 ? -8.943  1.364   -69.003 1.00 38.90 ? 174 CYS A N   1 
ATOM   960  C CA  . CYS A 1 118 ? -7.517  1.053   -69.069 1.00 39.32 ? 174 CYS A CA  1 
ATOM   961  C C   . CYS A 1 118 ? -7.072  0.621   -67.683 1.00 39.42 ? 174 CYS A C   1 
ATOM   962  O O   . CYS A 1 118 ? -7.686  1.002   -66.681 1.00 39.19 ? 174 CYS A O   1 
ATOM   963  C CB  . CYS A 1 118 ? -6.683  2.268   -69.501 1.00 39.45 ? 174 CYS A CB  1 
ATOM   964  S SG  . CYS A 1 118 ? -7.225  3.116   -70.997 1.00 41.16 ? 174 CYS A SG  1 
ATOM   965  N N   . LYS A 1 119 ? -5.995  -0.156  -67.632 1.00 39.50 ? 175 LYS A N   1 
ATOM   966  C CA  . LYS A 1 119 ? -5.465  -0.684  -66.380 1.00 39.80 ? 175 LYS A CA  1 
ATOM   967  C C   . LYS A 1 119 ? -3.961  -0.752  -66.422 1.00 40.27 ? 175 LYS A C   1 
ATOM   968  O O   . LYS A 1 119 ? -3.387  -1.227  -67.404 1.00 40.25 ? 175 LYS A O   1 
ATOM   969  C CB  . LYS A 1 119 ? -5.973  -2.102  -66.154 1.00 39.70 ? 175 LYS A CB  1 
ATOM   970  C CG  . LYS A 1 119 ? -5.446  -2.778  -64.882 1.00 39.08 ? 175 LYS A CG  1 
ATOM   971  C CD  . LYS A 1 119 ? -5.678  -4.266  -64.968 1.00 38.86 ? 175 LYS A CD  1 
ATOM   972  C CE  . LYS A 1 119 ? -5.434  -4.959  -63.674 1.00 38.80 ? 175 LYS A CE  1 
ATOM   973  N NZ  . LYS A 1 119 ? -5.422  -6.432  -63.870 1.00 39.26 ? 175 LYS A NZ  1 
ATOM   974  N N   . GLN A 1 120 ? -3.336  -0.310  -65.340 1.00 40.82 ? 176 GLN A N   1 
ATOM   975  C CA  . GLN A 1 120 ? -1.913  -0.467  -65.140 1.00 41.67 ? 176 GLN A CA  1 
ATOM   976  C C   . GLN A 1 120 ? -1.688  -1.425  -63.983 1.00 42.52 ? 176 GLN A C   1 
ATOM   977  O O   . GLN A 1 120 ? -2.278  -1.264  -62.911 1.00 42.52 ? 176 GLN A O   1 
ATOM   978  C CB  . GLN A 1 120 ? -1.269  0.873   -64.797 1.00 41.55 ? 176 GLN A CB  1 
ATOM   979  C CG  . GLN A 1 120 ? -1.128  1.816   -65.958 1.00 41.56 ? 176 GLN A CG  1 
ATOM   980  C CD  . GLN A 1 120 ? -0.536  3.151   -65.557 1.00 41.52 ? 176 GLN A CD  1 
ATOM   981  O OE1 . GLN A 1 120 ? -0.436  3.467   -64.368 1.00 41.55 ? 176 GLN A OE1 1 
ATOM   982  N NE2 . GLN A 1 120 ? -0.146  3.951   -66.553 1.00 40.46 ? 176 GLN A NE2 1 
ATOM   983  N N   . GLN A 1 121 ? -0.841  -2.424  -64.211 1.00 43.71 ? 177 GLN A N   1 
ATOM   984  C CA  . GLN A 1 121 ? -0.320  -3.273  -63.143 1.00 44.40 ? 177 GLN A CA  1 
ATOM   985  C C   . GLN A 1 121 ? 0.762   -2.515  -62.391 1.00 45.26 ? 177 GLN A C   1 
ATOM   986  O O   . GLN A 1 121 ? 1.250   -1.491  -62.871 1.00 45.71 ? 177 GLN A O   1 
ATOM   987  C CB  . GLN A 1 121 ? 0.305   -4.534  -63.722 1.00 44.53 ? 177 GLN A CB  1 
ATOM   988  C CG  . GLN A 1 121 ? -0.691  -5.523  -64.267 1.00 45.15 ? 177 GLN A CG  1 
ATOM   989  C CD  . GLN A 1 121 ? -0.945  -6.659  -63.303 1.00 45.82 ? 177 GLN A CD  1 
ATOM   990  O OE1 . GLN A 1 121 ? -0.811  -7.819  -63.670 1.00 46.74 ? 177 GLN A OE1 1 
ATOM   991  N NE2 . GLN A 1 121 ? -1.288  -6.331  -62.057 1.00 45.84 ? 177 GLN A NE2 1 
ATOM   992  N N   . LEU A 1 122 ? 1.133   -3.028  -61.219 1.00 45.95 ? 178 LEU A N   1 
ATOM   993  C CA  . LEU A 1 122 ? 2.287   -2.530  -60.476 1.00 46.45 ? 178 LEU A CA  1 
ATOM   994  C C   . LEU A 1 122 ? 2.996   -3.685  -59.715 1.00 47.26 ? 178 LEU A C   1 
ATOM   995  O O   . LEU A 1 122 ? 2.666   -3.975  -58.565 1.00 47.46 ? 178 LEU A O   1 
ATOM   996  C CB  . LEU A 1 122 ? 1.866   -1.404  -59.513 1.00 46.38 ? 178 LEU A CB  1 
ATOM   997  C CG  . LEU A 1 122 ? 1.001   -0.232  -60.011 1.00 46.15 ? 178 LEU A CG  1 
ATOM   998  C CD1 . LEU A 1 122 ? 0.524   0.606   -58.835 1.00 46.24 ? 178 LEU A CD1 1 
ATOM   999  C CD2 . LEU A 1 122 ? 1.721   0.655   -61.010 1.00 45.86 ? 178 LEU A CD2 1 
ATOM   1000 N N   . ILE A 1 123 ? 3.958   -4.321  -60.375 1.00 48.13 ? 179 ILE A N   1 
ATOM   1001 C CA  . ILE A 1 123 ? 4.962   -5.121  -59.684 1.00 48.29 ? 179 ILE A CA  1 
ATOM   1002 C C   . ILE A 1 123 ? 6.240   -5.234  -60.507 1.00 48.78 ? 179 ILE A C   1 
ATOM   1003 O O   . ILE A 1 123 ? 7.111   -4.367  -60.442 1.00 49.06 ? 179 ILE A O   1 
ATOM   1004 C CB  . ILE A 1 123 ? 4.438   -6.535  -59.369 1.00 48.68 ? 179 ILE A CB  1 
ATOM   1005 C CG1 . ILE A 1 123 ? 3.709   -7.115  -60.582 1.00 49.04 ? 179 ILE A CG1 1 
ATOM   1006 C CG2 . ILE A 1 123 ? 3.523   -6.506  -58.154 1.00 48.57 ? 179 ILE A CG2 1 
ATOM   1007 C CD1 . ILE A 1 123 ? 2.241   -6.750  -60.644 1.00 48.83 ? 179 ILE A CD1 1 
ATOM   1008 N N   . ALA B 2 1   ? -2.025  -10.017 -52.723 1.00 41.35 ? 113 ALA B N   1 
ATOM   1009 C CA  . ALA B 2 1   ? -3.073  -9.155  -52.105 1.00 41.42 ? 113 ALA B CA  1 
ATOM   1010 C C   . ALA B 2 1   ? -2.444  -7.880  -51.529 1.00 41.48 ? 113 ALA B C   1 
ATOM   1011 O O   . ALA B 2 1   ? -2.547  -7.613  -50.329 1.00 41.34 ? 113 ALA B O   1 
ATOM   1012 C CB  . ALA B 2 1   ? -3.828  -9.929  -51.024 1.00 41.27 ? 113 ALA B CB  1 
ATOM   1013 N N   . ARG B 2 2   ? -1.803  -7.100  -52.404 1.00 41.60 ? 114 ARG B N   1 
ATOM   1014 C CA  . ARG B 2 2   ? -1.101  -5.868  -52.020 1.00 41.60 ? 114 ARG B CA  1 
ATOM   1015 C C   . ARG B 2 2   ? -1.943  -4.638  -52.319 1.00 41.73 ? 114 ARG B C   1 
ATOM   1016 O O   . ARG B 2 2   ? -2.818  -4.675  -53.189 1.00 41.77 ? 114 ARG B O   1 
ATOM   1017 C CB  . ARG B 2 2   ? 0.246   -5.760  -52.745 1.00 41.52 ? 114 ARG B CB  1 
ATOM   1018 C CG  . ARG B 2 2   ? 1.385   -6.461  -52.024 1.00 41.39 ? 114 ARG B CG  1 
ATOM   1019 C CD  . ARG B 2 2   ? 1.934   -5.607  -50.891 1.00 41.27 ? 114 ARG B CD  1 
ATOM   1020 N NE  . ARG B 2 2   ? 2.392   -6.422  -49.767 1.00 41.34 ? 114 ARG B NE  1 
ATOM   1021 C CZ  . ARG B 2 2   ? 3.521   -7.129  -49.737 1.00 41.40 ? 114 ARG B CZ  1 
ATOM   1022 N NH1 . ARG B 2 2   ? 4.350   -7.145  -50.780 1.00 41.77 ? 114 ARG B NH1 1 
ATOM   1023 N NH2 . ARG B 2 2   ? 3.826   -7.835  -48.652 1.00 41.37 ? 114 ARG B NH2 1 
ATOM   1024 N N   . HIS B 2 3   ? -1.664  -3.550  -51.600 1.00 41.86 ? 115 HIS B N   1 
ATOM   1025 C CA  . HIS B 2 3   ? -2.435  -2.313  -51.732 1.00 41.92 ? 115 HIS B CA  1 
ATOM   1026 C C   . HIS B 2 3   ? -1.638  -1.036  -51.418 1.00 41.97 ? 115 HIS B C   1 
ATOM   1027 O O   . HIS B 2 3   ? -0.678  -1.051  -50.637 1.00 41.75 ? 115 HIS B O   1 
ATOM   1028 C CB  . HIS B 2 3   ? -3.670  -2.378  -50.833 1.00 42.00 ? 115 HIS B CB  1 
ATOM   1029 C CG  . HIS B 2 3   ? -3.350  -2.526  -49.378 1.00 42.25 ? 115 HIS B CG  1 
ATOM   1030 N ND1 . HIS B 2 3   ? -3.263  -1.448  -48.521 1.00 42.66 ? 115 HIS B ND1 1 
ATOM   1031 C CD2 . HIS B 2 3   ? -3.099  -3.624  -48.627 1.00 42.74 ? 115 HIS B CD2 1 
ATOM   1032 C CE1 . HIS B 2 3   ? -2.972  -1.876  -47.305 1.00 42.64 ? 115 HIS B CE1 1 
ATOM   1033 N NE2 . HIS B 2 3   ? -2.867  -3.193  -47.342 1.00 42.87 ? 115 HIS B NE2 1 
ATOM   1034 N N   . CYS B 2 4   ? -2.056  0.058   -52.055 1.00 42.06 ? 116 CYS B N   1 
ATOM   1035 C CA  . CYS B 2 4   ? -1.534  1.395   -51.788 1.00 42.01 ? 116 CYS B CA  1 
ATOM   1036 C C   . CYS B 2 4   ? -1.640  1.676   -50.294 1.00 41.94 ? 116 CYS B C   1 
ATOM   1037 O O   . CYS B 2 4   ? -2.732  1.641   -49.725 1.00 41.77 ? 116 CYS B O   1 
ATOM   1038 C CB  . CYS B 2 4   ? -2.323  2.433   -52.599 1.00 42.12 ? 116 CYS B CB  1 
ATOM   1039 S SG  . CYS B 2 4   ? -2.016  4.169   -52.204 1.00 42.49 ? 116 CYS B SG  1 
ATOM   1040 N N   . GLY B 2 5   ? -0.495  1.924   -49.665 1.00 41.91 ? 117 GLY B N   1 
ATOM   1041 C CA  . GLY B 2 5   ? -0.420  2.079   -48.214 1.00 41.96 ? 117 GLY B CA  1 
ATOM   1042 C C   . GLY B 2 5   ? -1.257  3.213   -47.656 1.00 41.94 ? 117 GLY B C   1 
ATOM   1043 O O   . GLY B 2 5   ? -1.811  3.095   -46.565 1.00 42.05 ? 117 GLY B O   1 
ATOM   1044 N N   . HIS B 2 6   ? -1.360  4.305   -48.412 1.00 41.91 ? 118 HIS B N   1 
ATOM   1045 C CA  . HIS B 2 6   ? -2.045  5.513   -47.943 1.00 41.85 ? 118 HIS B CA  1 
ATOM   1046 C C   . HIS B 2 6   ? -3.511  5.269   -47.575 1.00 41.92 ? 118 HIS B C   1 
ATOM   1047 O O   . HIS B 2 6   ? -4.043  5.945   -46.691 1.00 42.15 ? 118 HIS B O   1 
ATOM   1048 C CB  . HIS B 2 6   ? -1.930  6.632   -48.987 1.00 41.73 ? 118 HIS B CB  1 
ATOM   1049 C CG  . HIS B 2 6   ? -0.521  7.082   -49.228 1.00 41.62 ? 118 HIS B CG  1 
ATOM   1050 N ND1 . HIS B 2 6   ? 0.192   6.725   -50.353 1.00 41.43 ? 118 HIS B ND1 1 
ATOM   1051 C CD2 . HIS B 2 6   ? 0.315   7.840   -48.478 1.00 41.32 ? 118 HIS B CD2 1 
ATOM   1052 C CE1 . HIS B 2 6   ? 1.402   7.253   -50.291 1.00 41.31 ? 118 HIS B CE1 1 
ATOM   1053 N NE2 . HIS B 2 6   ? 1.503   7.934   -49.163 1.00 41.40 ? 118 HIS B NE2 1 
ATOM   1054 N N   . CYS B 2 7   ? -4.155  4.308   -48.245 1.00 41.92 ? 119 CYS B N   1 
ATOM   1055 C CA  . CYS B 2 7   ? -5.547  3.934   -47.950 1.00 41.96 ? 119 CYS B CA  1 
ATOM   1056 C C   . CYS B 2 7   ? -5.610  2.520   -47.380 1.00 41.71 ? 119 CYS B C   1 
ATOM   1057 O O   . CYS B 2 7   ? -4.635  1.778   -47.486 1.00 41.84 ? 119 CYS B O   1 
ATOM   1058 C CB  . CYS B 2 7   ? -6.399  4.001   -49.219 1.00 42.13 ? 119 CYS B CB  1 
ATOM   1059 S SG  . CYS B 2 7   ? -6.423  5.622   -49.992 1.00 43.46 ? 119 CYS B SG  1 
ATOM   1060 N N   . PRO B 2 8   ? -6.749  2.144   -46.763 1.00 41.38 ? 120 PRO B N   1 
ATOM   1061 C CA  . PRO B 2 8   ? -6.934  0.774   -46.260 1.00 41.32 ? 120 PRO B CA  1 
ATOM   1062 C C   . PRO B 2 8   ? -7.058  -0.306  -47.343 1.00 41.26 ? 120 PRO B C   1 
ATOM   1063 O O   . PRO B 2 8   ? -7.071  -0.001  -48.535 1.00 41.38 ? 120 PRO B O   1 
ATOM   1064 C CB  . PRO B 2 8   ? -8.234  0.862   -45.446 1.00 41.36 ? 120 PRO B CB  1 
ATOM   1065 C CG  . PRO B 2 8   ? -8.516  2.323   -45.283 1.00 41.19 ? 120 PRO B CG  1 
ATOM   1066 C CD  . PRO B 2 8   ? -7.911  2.997   -46.453 1.00 41.28 ? 120 PRO B CD  1 
ATOM   1067 N N   . GLU B 2 9   ? -7.194  -1.552  -46.895 1.00 41.14 ? 121 GLU B N   1 
ATOM   1068 C CA  . GLU B 2 9   ? -7.019  -2.754  -47.727 1.00 40.99 ? 121 GLU B CA  1 
ATOM   1069 C C   . GLU B 2 9   ? -8.062  -2.953  -48.832 1.00 40.93 ? 121 GLU B C   1 
ATOM   1070 O O   . GLU B 2 9   ? -7.787  -3.625  -49.822 1.00 41.00 ? 121 GLU B O   1 
ATOM   1071 C CB  . GLU B 2 9   ? -7.019  -3.987  -46.808 1.00 41.08 ? 121 GLU B CB  1 
ATOM   1072 C CG  . GLU B 2 9   ? -6.418  -5.273  -47.384 1.00 41.16 ? 121 GLU B CG  1 
ATOM   1073 C CD  . GLU B 2 9   ? -6.170  -6.333  -46.301 1.00 41.05 ? 121 GLU B CD  1 
ATOM   1074 O OE1 . GLU B 2 9   ? -5.335  -7.241  -46.526 1.00 40.28 ? 121 GLU B OE1 1 
ATOM   1075 O OE2 . GLU B 2 9   ? -6.804  -6.251  -45.221 1.00 40.62 ? 121 GLU B OE2 1 
ATOM   1076 N N   . GLU B 2 10  ? -9.251  -2.383  -48.668 1.00 40.73 ? 122 GLU B N   1 
ATOM   1077 C CA  . GLU B 2 10  ? -10.348 -2.631  -49.604 1.00 40.57 ? 122 GLU B CA  1 
ATOM   1078 C C   . GLU B 2 10  ? -10.996 -1.337  -50.137 1.00 40.48 ? 122 GLU B C   1 
ATOM   1079 O O   . GLU B 2 10  ? -12.120 -1.360  -50.645 1.00 40.18 ? 122 GLU B O   1 
ATOM   1080 C CB  . GLU B 2 10  ? -11.390 -3.544  -48.941 1.00 40.62 ? 122 GLU B CB  1 
ATOM   1081 C CG  . GLU B 2 10  ? -11.977 -3.026  -47.611 1.00 41.15 ? 122 GLU B CG  1 
ATOM   1082 C CD  . GLU B 2 10  ? -11.362 -3.652  -46.350 1.00 41.47 ? 122 GLU B CD  1 
ATOM   1083 O OE1 . GLU B 2 10  ? -10.878 -4.805  -46.404 1.00 40.30 ? 122 GLU B OE1 1 
ATOM   1084 O OE2 . GLU B 2 10  ? -11.397 -2.986  -45.288 1.00 42.07 ? 122 GLU B OE2 1 
ATOM   1085 N N   . TRP B 2 11  ? -10.261 -0.225  -50.043 1.00 40.39 ? 123 TRP B N   1 
ATOM   1086 C CA  . TRP B 2 11  ? -10.745 1.112   -50.420 1.00 40.13 ? 123 TRP B CA  1 
ATOM   1087 C C   . TRP B 2 11  ? -10.086 1.489   -51.732 1.00 39.89 ? 123 TRP B C   1 
ATOM   1088 O O   . TRP B 2 11  ? -9.221  0.759   -52.208 1.00 39.90 ? 123 TRP B O   1 
ATOM   1089 C CB  . TRP B 2 11  ? -10.348 2.147   -49.362 1.00 40.04 ? 123 TRP B CB  1 
ATOM   1090 C CG  . TRP B 2 11  ? -11.011 1.998   -48.027 1.00 39.96 ? 123 TRP B CG  1 
ATOM   1091 C CD1 . TRP B 2 11  ? -11.172 0.852   -47.313 1.00 40.26 ? 123 TRP B CD1 1 
ATOM   1092 C CD2 . TRP B 2 11  ? -11.558 3.052   -47.220 1.00 39.98 ? 123 TRP B CD2 1 
ATOM   1093 N NE1 . TRP B 2 11  ? -11.808 1.118   -46.124 1.00 40.40 ? 123 TRP B NE1 1 
ATOM   1094 C CE2 . TRP B 2 11  ? -12.057 2.461   -46.043 1.00 39.73 ? 123 TRP B CE2 1 
ATOM   1095 C CE3 . TRP B 2 11  ? -11.689 4.438   -47.388 1.00 40.11 ? 123 TRP B CE3 1 
ATOM   1096 C CZ2 . TRP B 2 11  ? -12.671 3.203   -45.036 1.00 39.92 ? 123 TRP B CZ2 1 
ATOM   1097 C CZ3 . TRP B 2 11  ? -12.304 5.177   -46.387 1.00 40.05 ? 123 TRP B CZ3 1 
ATOM   1098 C CH2 . TRP B 2 11  ? -12.789 4.558   -45.226 1.00 40.04 ? 123 TRP B CH2 1 
ATOM   1099 N N   . ILE B 2 12  ? -10.473 2.629   -52.302 1.00 39.65 ? 124 ILE B N   1 
ATOM   1100 C CA  . ILE B 2 12  ? -9.846  3.124   -53.535 1.00 39.67 ? 124 ILE B CA  1 
ATOM   1101 C C   . ILE B 2 12  ? -9.285  4.530   -53.372 1.00 39.66 ? 124 ILE B C   1 
ATOM   1102 O O   . ILE B 2 12  ? -9.802  5.333   -52.587 1.00 39.58 ? 124 ILE B O   1 
ATOM   1103 C CB  . ILE B 2 12  ? -10.814 3.130   -54.747 1.00 39.54 ? 124 ILE B CB  1 
ATOM   1104 C CG1 . ILE B 2 12  ? -11.985 4.088   -54.519 1.00 39.28 ? 124 ILE B CG1 1 
ATOM   1105 C CG2 . ILE B 2 12  ? -11.330 1.731   -55.028 1.00 39.56 ? 124 ILE B CG2 1 
ATOM   1106 C CD1 . ILE B 2 12  ? -12.995 4.076   -55.646 1.00 39.83 ? 124 ILE B CD1 1 
ATOM   1107 N N   . THR B 2 13  ? -8.224  4.815   -54.123 1.00 39.58 ? 125 THR B N   1 
ATOM   1108 C CA  . THR B 2 13  ? -7.681  6.163   -54.204 1.00 39.69 ? 125 THR B CA  1 
ATOM   1109 C C   . THR B 2 13  ? -8.281  6.810   -55.441 1.00 39.89 ? 125 THR B C   1 
ATOM   1110 O O   . THR B 2 13  ? -8.627  6.101   -56.389 1.00 40.07 ? 125 THR B O   1 
ATOM   1111 C CB  . THR B 2 13  ? -6.165  6.155   -54.352 1.00 39.37 ? 125 THR B CB  1 
ATOM   1112 O OG1 . THR B 2 13  ? -5.820  5.744   -55.682 1.00 39.52 ? 125 THR B OG1 1 
ATOM   1113 C CG2 . THR B 2 13  ? -5.535  5.224   -53.329 1.00 39.00 ? 125 THR B CG2 1 
ATOM   1114 N N   . TYR B 2 14  ? -8.414  8.136   -55.431 1.00 39.83 ? 126 TYR B N   1 
ATOM   1115 C CA  . TYR B 2 14  ? -8.831  8.867   -56.630 1.00 40.00 ? 126 TYR B CA  1 
ATOM   1116 C C   . TYR B 2 14  ? -8.108  10.214  -56.795 1.00 40.40 ? 126 TYR B C   1 
ATOM   1117 O O   . TYR B 2 14  ? -7.230  10.359  -57.672 1.00 40.93 ? 126 TYR B O   1 
ATOM   1118 C CB  . TYR B 2 14  ? -10.348 9.051   -56.655 1.00 40.00 ? 126 TYR B CB  1 
ATOM   1119 C CG  . TYR B 2 14  ? -10.804 9.907   -57.796 1.00 39.72 ? 126 TYR B CG  1 
ATOM   1120 C CD1 . TYR B 2 14  ? -10.548 9.532   -59.105 1.00 40.07 ? 126 TYR B CD1 1 
ATOM   1121 C CD2 . TYR B 2 14  ? -11.463 11.104  -57.574 1.00 39.77 ? 126 TYR B CD2 1 
ATOM   1122 C CE1 . TYR B 2 14  ? -10.945 10.319  -60.160 1.00 39.83 ? 126 TYR B CE1 1 
ATOM   1123 C CE2 . TYR B 2 14  ? -11.865 11.898  -58.624 1.00 39.68 ? 126 TYR B CE2 1 
ATOM   1124 C CZ  . TYR B 2 14  ? -11.601 11.495  -59.913 1.00 39.60 ? 126 TYR B CZ  1 
ATOM   1125 O OH  . TYR B 2 14  ? -11.993 12.264  -60.968 1.00 40.32 ? 126 TYR B OH  1 
ATOM   1126 N N   . SER B 2 15  ? -8.465  11.200  -55.981 1.00 40.18 ? 127 SER B N   1 
ATOM   1127 C CA  . SER B 2 15  ? -7.766  12.472  -56.032 1.00 40.36 ? 127 SER B CA  1 
ATOM   1128 C C   . SER B 2 15  ? -7.373  12.865  -54.620 1.00 40.57 ? 127 SER B C   1 
ATOM   1129 O O   . SER B 2 15  ? -8.100  13.573  -53.929 1.00 40.44 ? 127 SER B O   1 
ATOM   1130 C CB  . SER B 2 15  ? -8.626  13.544  -56.699 1.00 40.38 ? 127 SER B CB  1 
ATOM   1131 O OG  . SER B 2 15  ? -7.850  14.688  -57.006 1.00 39.66 ? 127 SER B OG  1 
ATOM   1132 N N   . ASN B 2 16  ? -6.221  12.356  -54.194 1.00 40.99 ? 128 ASN B N   1 
ATOM   1133 C CA  . ASN B 2 16  ? -5.677  12.620  -52.863 1.00 41.20 ? 128 ASN B CA  1 
ATOM   1134 C C   . ASN B 2 16  ? -6.714  12.423  -51.767 1.00 41.35 ? 128 ASN B C   1 
ATOM   1135 O O   . ASN B 2 16  ? -6.770  13.176  -50.800 1.00 41.39 ? 128 ASN B O   1 
ATOM   1136 C CB  . ASN B 2 16  ? -5.080  14.021  -52.820 1.00 41.20 ? 128 ASN B CB  1 
ATOM   1137 C CG  . ASN B 2 16  ? -4.078  14.244  -53.934 1.00 41.50 ? 128 ASN B CG  1 
ATOM   1138 O OD1 . ASN B 2 16  ? -3.187  13.414  -54.167 1.00 41.33 ? 128 ASN B OD1 1 
ATOM   1139 N ND2 . ASN B 2 16  ? -4.226  15.355  -54.643 1.00 42.20 ? 128 ASN B ND2 1 
ATOM   1140 N N   . SER B 2 17  ? -7.531  11.393  -51.948 1.00 41.56 ? 129 SER B N   1 
ATOM   1141 C CA  . SER B 2 17  ? -8.562  11.035  -50.996 1.00 41.83 ? 129 SER B CA  1 
ATOM   1142 C C   . SER B 2 17  ? -8.939  9.575   -51.225 1.00 41.95 ? 129 SER B C   1 
ATOM   1143 O O   . SER B 2 17  ? -8.975  9.115   -52.377 1.00 42.09 ? 129 SER B O   1 
ATOM   1144 C CB  . SER B 2 17  ? -9.774  11.954  -51.163 1.00 42.12 ? 129 SER B CB  1 
ATOM   1145 O OG  . SER B 2 17  ? -9.935  12.337  -52.522 1.00 43.52 ? 129 SER B OG  1 
ATOM   1146 N N   . CYS B 2 18  ? -9.173  8.852   -50.126 1.00 41.81 ? 130 CYS B N   1 
ATOM   1147 C CA  . CYS B 2 18  ? -9.585  7.450   -50.170 1.00 41.76 ? 130 CYS B CA  1 
ATOM   1148 C C   . CYS B 2 18  ? -11.104 7.360   -50.202 1.00 41.48 ? 130 CYS B C   1 
ATOM   1149 O O   . CYS B 2 18  ? -11.787 8.211   -49.651 1.00 41.35 ? 130 CYS B O   1 
ATOM   1150 C CB  . CYS B 2 18  ? -9.077  6.689   -48.942 1.00 41.88 ? 130 CYS B CB  1 
ATOM   1151 S SG  . CYS B 2 18  ? -7.297  6.820   -48.603 1.00 43.62 ? 130 CYS B SG  1 
ATOM   1152 N N   . TYR B 2 19  ? -11.631 6.310   -50.818 1.00 41.34 ? 131 TYR B N   1 
ATOM   1153 C CA  . TYR B 2 19  ? -13.067 6.099   -50.857 1.00 41.21 ? 131 TYR B CA  1 
ATOM   1154 C C   . TYR B 2 19  ? -13.423 4.674   -50.478 1.00 41.36 ? 131 TYR B C   1 
ATOM   1155 O O   . TYR B 2 19  ? -12.680 3.743   -50.759 1.00 41.75 ? 131 TYR B O   1 
ATOM   1156 C CB  . TYR B 2 19  ? -13.611 6.378   -52.248 1.00 40.77 ? 131 TYR B CB  1 
ATOM   1157 C CG  . TYR B 2 19  ? -13.548 7.818   -52.685 1.00 40.22 ? 131 TYR B CG  1 
ATOM   1158 C CD1 . TYR B 2 19  ? -12.379 8.365   -53.188 1.00 39.57 ? 131 TYR B CD1 1 
ATOM   1159 C CD2 . TYR B 2 19  ? -14.670 8.624   -52.626 1.00 40.17 ? 131 TYR B CD2 1 
ATOM   1160 C CE1 . TYR B 2 19  ? -12.331 9.685   -53.604 1.00 40.03 ? 131 TYR B CE1 1 
ATOM   1161 C CE2 . TYR B 2 19  ? -14.633 9.941   -53.041 1.00 40.04 ? 131 TYR B CE2 1 
ATOM   1162 C CZ  . TYR B 2 19  ? -13.468 10.464  -53.532 1.00 40.19 ? 131 TYR B CZ  1 
ATOM   1163 O OH  . TYR B 2 19  ? -13.442 11.775  -53.942 1.00 40.49 ? 131 TYR B OH  1 
ATOM   1164 N N   . TYR B 2 20  ? -14.569 4.526   -49.827 1.00 41.55 ? 132 TYR B N   1 
ATOM   1165 C CA  . TYR B 2 20  ? -15.175 3.238   -49.561 1.00 41.62 ? 132 TYR B CA  1 
ATOM   1166 C C   . TYR B 2 20  ? -16.522 3.276   -50.252 1.00 41.87 ? 132 TYR B C   1 
ATOM   1167 O O   . TYR B 2 20  ? -17.374 4.073   -49.878 1.00 42.37 ? 132 TYR B O   1 
ATOM   1168 C CB  . TYR B 2 20  ? -15.356 3.048   -48.047 1.00 41.50 ? 132 TYR B CB  1 
ATOM   1169 C CG  . TYR B 2 20  ? -15.777 1.657   -47.621 1.00 41.52 ? 132 TYR B CG  1 
ATOM   1170 C CD1 . TYR B 2 20  ? -14.859 0.613   -47.604 1.00 40.96 ? 132 TYR B CD1 1 
ATOM   1171 C CD2 . TYR B 2 20  ? -17.089 1.385   -47.219 1.00 41.41 ? 132 TYR B CD2 1 
ATOM   1172 C CE1 . TYR B 2 20  ? -15.230 -0.666  -47.212 1.00 41.06 ? 132 TYR B CE1 1 
ATOM   1173 C CE2 . TYR B 2 20  ? -17.468 0.096   -46.818 1.00 41.21 ? 132 TYR B CE2 1 
ATOM   1174 C CZ  . TYR B 2 20  ? -16.527 -0.922  -46.818 1.00 41.25 ? 132 TYR B CZ  1 
ATOM   1175 O OH  . TYR B 2 20  ? -16.862 -2.207  -46.430 1.00 41.60 ? 132 TYR B OH  1 
ATOM   1176 N N   . ILE B 2 21  ? -16.701 2.460   -51.285 1.00 42.17 ? 133 ILE B N   1 
ATOM   1177 C CA  . ILE B 2 21  ? -18.004 2.299   -51.914 1.00 42.07 ? 133 ILE B CA  1 
ATOM   1178 C C   . ILE B 2 21  ? -18.735 1.197   -51.151 1.00 42.25 ? 133 ILE B C   1 
ATOM   1179 O O   . ILE B 2 21  ? -18.467 0.013   -51.333 1.00 42.26 ? 133 ILE B O   1 
ATOM   1180 C CB  . ILE B 2 21  ? -17.889 1.982   -53.413 1.00 41.98 ? 133 ILE B CB  1 
ATOM   1181 C CG1 . ILE B 2 21  ? -17.342 3.193   -54.170 1.00 41.65 ? 133 ILE B CG1 1 
ATOM   1182 C CG2 . ILE B 2 21  ? -19.246 1.642   -53.980 1.00 42.00 ? 133 ILE B CG2 1 
ATOM   1183 C CD1 . ILE B 2 21  ? -15.876 3.371   -54.044 1.00 42.38 ? 133 ILE B CD1 1 
ATOM   1184 N N   . GLY B 2 22  ? -19.684 1.614   -50.317 1.00 42.53 ? 134 GLY B N   1 
ATOM   1185 C CA  . GLY B 2 22  ? -20.154 0.830   -49.183 1.00 42.58 ? 134 GLY B CA  1 
ATOM   1186 C C   . GLY B 2 22  ? -20.960 -0.423  -49.454 1.00 42.85 ? 134 GLY B C   1 
ATOM   1187 O O   . GLY B 2 22  ? -20.705 -1.458  -48.816 1.00 42.96 ? 134 GLY B O   1 
ATOM   1188 N N   . LYS B 2 23  ? -21.940 -0.319  -50.364 1.00 42.71 ? 135 LYS B N   1 
ATOM   1189 C CA  . LYS B 2 23  ? -22.877 -1.423  -50.722 1.00 42.59 ? 135 LYS B CA  1 
ATOM   1190 C C   . LYS B 2 23  ? -23.862 -1.920  -49.630 1.00 42.48 ? 135 LYS B C   1 
ATOM   1191 O O   . LYS B 2 23  ? -24.572 -2.898  -49.861 1.00 42.57 ? 135 LYS B O   1 
ATOM   1192 C CB  . LYS B 2 23  ? -22.116 -2.612  -51.345 1.00 42.55 ? 135 LYS B CB  1 
ATOM   1193 C CG  . LYS B 2 23  ? -21.607 -2.334  -52.779 1.00 42.71 ? 135 LYS B CG  1 
ATOM   1194 C CD  . LYS B 2 23  ? -20.180 -2.874  -53.023 1.00 42.87 ? 135 LYS B CD  1 
ATOM   1195 C CE  . LYS B 2 23  ? -19.348 -1.965  -53.955 1.00 42.82 ? 135 LYS B CE  1 
ATOM   1196 N NZ  . LYS B 2 23  ? -17.957 -1.708  -53.413 1.00 42.47 ? 135 LYS B NZ  1 
ATOM   1197 N N   . GLU B 2 24  ? -23.920 -1.252  -48.473 1.00 42.35 ? 136 GLU B N   1 
ATOM   1198 C CA  . GLU B 2 24  ? -24.940 -1.535  -47.446 1.00 42.38 ? 136 GLU B CA  1 
ATOM   1199 C C   . GLU B 2 24  ? -25.806 -0.305  -47.222 1.00 42.20 ? 136 GLU B C   1 
ATOM   1200 O O   . GLU B 2 24  ? -25.284 0.771   -46.964 1.00 41.88 ? 136 GLU B O   1 
ATOM   1201 C CB  . GLU B 2 24  ? -24.300 -1.921  -46.104 1.00 42.47 ? 136 GLU B CB  1 
ATOM   1202 C CG  . GLU B 2 24  ? -23.346 -3.105  -46.180 1.00 42.55 ? 136 GLU B CG  1 
ATOM   1203 C CD  . GLU B 2 24  ? -22.730 -3.430  -44.842 1.00 42.20 ? 136 GLU B CD  1 
ATOM   1204 O OE1 . GLU B 2 24  ? -21.649 -2.878  -44.539 1.00 41.52 ? 136 GLU B OE1 1 
ATOM   1205 O OE2 . GLU B 2 24  ? -23.340 -4.223  -44.093 1.00 42.58 ? 136 GLU B OE2 1 
ATOM   1206 N N   . ARG B 2 25  ? -27.124 -0.470  -47.312 1.00 42.19 ? 137 ARG B N   1 
ATOM   1207 C CA  . ARG B 2 25  ? -28.051 0.632   -47.073 1.00 42.27 ? 137 ARG B CA  1 
ATOM   1208 C C   . ARG B 2 25  ? -28.210 0.925   -45.568 1.00 42.26 ? 137 ARG B C   1 
ATOM   1209 O O   . ARG B 2 25  ? -28.259 0.008   -44.737 1.00 42.28 ? 137 ARG B O   1 
ATOM   1210 C CB  . ARG B 2 25  ? -29.413 0.339   -47.705 1.00 42.36 ? 137 ARG B CB  1 
ATOM   1211 C CG  . ARG B 2 25  ? -29.426 0.366   -49.229 1.00 42.46 ? 137 ARG B CG  1 
ATOM   1212 C CD  . ARG B 2 25  ? -30.850 0.138   -49.766 1.00 42.60 ? 137 ARG B CD  1 
ATOM   1213 N NE  . ARG B 2 25  ? -30.944 0.330   -51.218 1.00 42.64 ? 137 ARG B NE  1 
ATOM   1214 C CZ  . ARG B 2 25  ? -32.084 0.421   -51.907 1.00 42.91 ? 137 ARG B CZ  1 
ATOM   1215 N NH1 . ARG B 2 25  ? -33.269 0.329   -51.295 1.00 43.13 ? 137 ARG B NH1 1 
ATOM   1216 N NH2 . ARG B 2 25  ? -32.041 0.601   -53.230 1.00 43.66 ? 137 ARG B NH2 1 
ATOM   1217 N N   . ARG B 2 26  ? -28.291 2.212   -45.237 1.00 42.17 ? 138 ARG B N   1 
ATOM   1218 C CA  . ARG B 2 26  ? -28.336 2.680   -43.849 1.00 42.02 ? 138 ARG B CA  1 
ATOM   1219 C C   . ARG B 2 26  ? -29.071 4.014   -43.743 1.00 41.87 ? 138 ARG B C   1 
ATOM   1220 O O   . ARG B 2 26  ? -29.230 4.722   -44.737 1.00 41.65 ? 138 ARG B O   1 
ATOM   1221 C CB  . ARG B 2 26  ? -26.911 2.868   -43.321 1.00 42.01 ? 138 ARG B CB  1 
ATOM   1222 C CG  . ARG B 2 26  ? -26.247 1.610   -42.812 1.00 42.36 ? 138 ARG B CG  1 
ATOM   1223 C CD  . ARG B 2 26  ? -26.657 1.289   -41.394 1.00 43.44 ? 138 ARG B CD  1 
ATOM   1224 N NE  . ARG B 2 26  ? -26.643 -0.143  -41.112 1.00 44.29 ? 138 ARG B NE  1 
ATOM   1225 C CZ  . ARG B 2 26  ? -25.551 -0.908  -41.075 1.00 45.22 ? 138 ARG B CZ  1 
ATOM   1226 N NH1 . ARG B 2 26  ? -24.340 -0.395  -41.315 1.00 45.40 ? 138 ARG B NH1 1 
ATOM   1227 N NH2 . ARG B 2 26  ? -25.673 -2.210  -40.809 1.00 45.15 ? 138 ARG B NH2 1 
ATOM   1228 N N   . THR B 2 27  ? -29.494 4.357   -42.526 1.00 41.78 ? 139 THR B N   1 
ATOM   1229 C CA  . THR B 2 27  ? -30.102 5.664   -42.246 1.00 41.70 ? 139 THR B CA  1 
ATOM   1230 C C   . THR B 2 27  ? -29.003 6.725   -42.359 1.00 41.47 ? 139 THR B C   1 
ATOM   1231 O O   . THR B 2 27  ? -27.820 6.384   -42.392 1.00 41.56 ? 139 THR B O   1 
ATOM   1232 C CB  . THR B 2 27  ? -30.784 5.673   -40.842 1.00 41.86 ? 139 THR B CB  1 
ATOM   1233 O OG1 . THR B 2 27  ? -32.175 5.974   -40.977 1.00 42.88 ? 139 THR B OG1 1 
ATOM   1234 C CG2 . THR B 2 27  ? -30.141 6.664   -39.894 1.00 42.08 ? 139 THR B CG2 1 
ATOM   1235 N N   . TRP B 2 28  ? -29.368 8.001   -42.434 1.00 41.31 ? 140 TRP B N   1 
ATOM   1236 C CA  . TRP B 2 28  ? -28.350 9.046   -42.600 1.00 41.16 ? 140 TRP B CA  1 
ATOM   1237 C C   . TRP B 2 28  ? -27.391 9.078   -41.412 1.00 41.08 ? 140 TRP B C   1 
ATOM   1238 O O   . TRP B 2 28  ? -26.173 9.025   -41.597 1.00 41.14 ? 140 TRP B O   1 
ATOM   1239 C CB  . TRP B 2 28  ? -28.965 10.434  -42.808 1.00 41.20 ? 140 TRP B CB  1 
ATOM   1240 C CG  . TRP B 2 28  ? -27.906 11.493  -43.015 1.00 41.24 ? 140 TRP B CG  1 
ATOM   1241 C CD1 . TRP B 2 28  ? -27.307 11.840  -44.193 1.00 41.20 ? 140 TRP B CD1 1 
ATOM   1242 C CD2 . TRP B 2 28  ? -27.305 12.314  -42.007 1.00 41.34 ? 140 TRP B CD2 1 
ATOM   1243 N NE1 . TRP B 2 28  ? -26.379 12.830  -43.983 1.00 41.16 ? 140 TRP B NE1 1 
ATOM   1244 C CE2 . TRP B 2 28  ? -26.359 13.143  -42.650 1.00 41.42 ? 140 TRP B CE2 1 
ATOM   1245 C CE3 . TRP B 2 28  ? -27.480 12.438  -40.623 1.00 41.16 ? 140 TRP B CE3 1 
ATOM   1246 C CZ2 . TRP B 2 28  ? -25.593 14.087  -41.956 1.00 41.20 ? 140 TRP B CZ2 1 
ATOM   1247 C CZ3 . TRP B 2 28  ? -26.720 13.374  -39.935 1.00 41.14 ? 140 TRP B CZ3 1 
ATOM   1248 C CH2 . TRP B 2 28  ? -25.785 14.184  -40.604 1.00 41.32 ? 140 TRP B CH2 1 
ATOM   1249 N N   . GLU B 2 29  ? -27.944 9.162   -40.204 1.00 40.78 ? 141 GLU B N   1 
ATOM   1250 C CA  . GLU B 2 29  ? -27.135 9.125   -38.991 1.00 40.69 ? 141 GLU B CA  1 
ATOM   1251 C C   . GLU B 2 29  ? -26.387 7.799   -38.876 1.00 40.98 ? 141 GLU B C   1 
ATOM   1252 O O   . GLU B 2 29  ? -25.235 7.772   -38.446 1.00 41.52 ? 141 GLU B O   1 
ATOM   1253 C CB  . GLU B 2 29  ? -27.983 9.373   -37.732 1.00 40.50 ? 141 GLU B CB  1 
ATOM   1254 C CG  . GLU B 2 29  ? -28.463 10.824  -37.581 1.00 39.84 ? 141 GLU B CG  1 
ATOM   1255 C CD  . GLU B 2 29  ? -29.110 11.134  -36.227 1.00 39.89 ? 141 GLU B CD  1 
ATOM   1256 O OE1 . GLU B 2 29  ? -28.873 10.391  -35.244 1.00 37.00 ? 141 GLU B OE1 1 
ATOM   1257 O OE2 . GLU B 2 29  ? -29.862 12.136  -36.153 1.00 38.94 ? 141 GLU B OE2 1 
ATOM   1258 N N   . GLU B 2 30  ? -27.024 6.704   -39.281 1.00 40.94 ? 142 GLU B N   1 
ATOM   1259 C CA  . GLU B 2 30  ? -26.375 5.393   -39.243 1.00 40.96 ? 142 GLU B CA  1 
ATOM   1260 C C   . GLU B 2 30  ? -25.176 5.344   -40.190 1.00 40.80 ? 142 GLU B C   1 
ATOM   1261 O O   . GLU B 2 30  ? -24.178 4.684   -39.903 1.00 40.85 ? 142 GLU B O   1 
ATOM   1262 C CB  . GLU B 2 30  ? -27.369 4.285   -39.609 1.00 41.18 ? 142 GLU B CB  1 
ATOM   1263 C CG  . GLU B 2 30  ? -28.444 4.027   -38.548 1.00 41.18 ? 142 GLU B CG  1 
ATOM   1264 C CD  . GLU B 2 30  ? -29.496 2.996   -38.983 1.00 41.39 ? 142 GLU B CD  1 
ATOM   1265 O OE1 . GLU B 2 30  ? -29.494 2.547   -40.158 1.00 41.67 ? 142 GLU B OE1 1 
ATOM   1266 O OE2 . GLU B 2 30  ? -30.342 2.636   -38.135 1.00 41.74 ? 142 GLU B OE2 1 
ATOM   1267 N N   . SER B 2 31  ? -25.278 6.049   -41.315 1.00 40.69 ? 143 SER B N   1 
ATOM   1268 C CA  . SER B 2 31  ? -24.180 6.130   -42.279 1.00 40.57 ? 143 SER B CA  1 
ATOM   1269 C C   . SER B 2 31  ? -23.021 6.948   -41.721 1.00 40.30 ? 143 SER B C   1 
ATOM   1270 O O   . SER B 2 31  ? -21.868 6.509   -41.742 1.00 40.03 ? 143 SER B O   1 
ATOM   1271 C CB  . SER B 2 31  ? -24.668 6.757   -43.583 1.00 40.88 ? 143 SER B CB  1 
ATOM   1272 O OG  . SER B 2 31  ? -25.713 5.983   -44.154 1.00 41.75 ? 143 SER B OG  1 
ATOM   1273 N N   . LEU B 2 32  ? -23.353 8.139   -41.227 1.00 39.96 ? 144 LEU B N   1 
ATOM   1274 C CA  . LEU B 2 32  ? -22.408 9.025   -40.549 1.00 39.63 ? 144 LEU B CA  1 
ATOM   1275 C C   . LEU B 2 32  ? -21.592 8.281   -39.480 1.00 39.44 ? 144 LEU B C   1 
ATOM   1276 O O   . LEU B 2 32  ? -20.361 8.289   -39.513 1.00 39.50 ? 144 LEU B O   1 
ATOM   1277 C CB  . LEU B 2 32  ? -23.172 10.175  -39.894 1.00 39.50 ? 144 LEU B CB  1 
ATOM   1278 C CG  . LEU B 2 32  ? -22.324 11.299  -39.311 1.00 39.51 ? 144 LEU B CG  1 
ATOM   1279 C CD1 . LEU B 2 32  ? -22.068 12.342  -40.379 1.00 38.17 ? 144 LEU B CD1 1 
ATOM   1280 C CD2 . LEU B 2 32  ? -23.036 11.908  -38.111 1.00 39.30 ? 144 LEU B CD2 1 
ATOM   1281 N N   . LEU B 2 33  ? -22.276 7.637   -38.538 1.00 39.08 ? 145 LEU B N   1 
ATOM   1282 C CA  . LEU B 2 33  ? -21.595 6.874   -37.491 1.00 39.15 ? 145 LEU B CA  1 
ATOM   1283 C C   . LEU B 2 33  ? -20.843 5.665   -38.053 1.00 38.95 ? 145 LEU B C   1 
ATOM   1284 O O   . LEU B 2 33  ? -19.777 5.302   -37.561 1.00 38.73 ? 145 LEU B O   1 
ATOM   1285 C CB  . LEU B 2 33  ? -22.592 6.417   -36.426 1.00 39.17 ? 145 LEU B CB  1 
ATOM   1286 C CG  . LEU B 2 33  ? -23.282 7.542   -35.657 1.00 39.33 ? 145 LEU B CG  1 
ATOM   1287 C CD1 . LEU B 2 33  ? -24.433 6.997   -34.820 1.00 39.56 ? 145 LEU B CD1 1 
ATOM   1288 C CD2 . LEU B 2 33  ? -22.270 8.275   -34.806 1.00 38.94 ? 145 LEU B CD2 1 
ATOM   1289 N N   . ALA B 2 34  ? -21.399 5.046   -39.088 1.00 38.97 ? 146 ALA B N   1 
ATOM   1290 C CA  . ALA B 2 34  ? -20.729 3.939   -39.757 1.00 39.15 ? 146 ALA B CA  1 
ATOM   1291 C C   . ALA B 2 34  ? -19.366 4.365   -40.324 1.00 38.98 ? 146 ALA B C   1 
ATOM   1292 O O   . ALA B 2 34  ? -18.361 3.697   -40.093 1.00 38.63 ? 146 ALA B O   1 
ATOM   1293 C CB  . ALA B 2 34  ? -21.611 3.373   -40.852 1.00 39.32 ? 146 ALA B CB  1 
ATOM   1294 N N   . CYS B 2 35  ? -19.331 5.478   -41.054 1.00 39.10 ? 147 CYS B N   1 
ATOM   1295 C CA  . CYS B 2 35  ? -18.062 5.991   -41.583 1.00 39.35 ? 147 CYS B CA  1 
ATOM   1296 C C   . CYS B 2 35  ? -17.071 6.405   -40.477 1.00 39.19 ? 147 CYS B C   1 
ATOM   1297 O O   . CYS B 2 35  ? -15.901 6.039   -40.531 1.00 38.86 ? 147 CYS B O   1 
ATOM   1298 C CB  . CYS B 2 35  ? -18.292 7.149   -42.558 1.00 39.41 ? 147 CYS B CB  1 
ATOM   1299 S SG  . CYS B 2 35  ? -19.075 6.699   -44.154 1.00 40.71 ? 147 CYS B SG  1 
ATOM   1300 N N   . THR B 2 36  ? -17.534 7.154   -39.476 1.00 39.31 ? 148 THR B N   1 
ATOM   1301 C CA  . THR B 2 36  ? -16.649 7.609   -38.397 1.00 39.57 ? 148 THR B CA  1 
ATOM   1302 C C   . THR B 2 36  ? -16.016 6.432   -37.654 1.00 39.64 ? 148 THR B C   1 
ATOM   1303 O O   . THR B 2 36  ? -14.852 6.489   -37.252 1.00 39.52 ? 148 THR B O   1 
ATOM   1304 C CB  . THR B 2 36  ? -17.379 8.506   -37.384 1.00 39.67 ? 148 THR B CB  1 
ATOM   1305 O OG1 . THR B 2 36  ? -18.162 9.482   -38.077 1.00 40.26 ? 148 THR B OG1 1 
ATOM   1306 C CG2 . THR B 2 36  ? -16.388 9.220   -36.498 1.00 39.34 ? 148 THR B CG2 1 
ATOM   1307 N N   . SER B 2 37  ? -16.789 5.367   -37.477 1.00 39.68 ? 149 SER B N   1 
ATOM   1308 C CA  . SER B 2 37  ? -16.265 4.126   -36.926 1.00 39.79 ? 149 SER B CA  1 
ATOM   1309 C C   . SER B 2 37  ? -15.100 3.591   -37.767 1.00 39.94 ? 149 SER B C   1 
ATOM   1310 O O   . SER B 2 37  ? -14.094 3.120   -37.220 1.00 39.73 ? 149 SER B O   1 
ATOM   1311 C CB  . SER B 2 37  ? -17.371 3.080   -36.854 1.00 39.73 ? 149 SER B CB  1 
ATOM   1312 O OG  . SER B 2 37  ? -16.821 1.784   -36.923 1.00 40.63 ? 149 SER B OG  1 
ATOM   1313 N N   . LYS B 2 38  ? -15.239 3.670   -39.093 1.00 39.79 ? 150 LYS B N   1 
ATOM   1314 C CA  . LYS B 2 38  ? -14.177 3.256   -40.008 1.00 39.94 ? 150 LYS B CA  1 
ATOM   1315 C C   . LYS B 2 38  ? -13.041 4.284   -40.114 1.00 39.88 ? 150 LYS B C   1 
ATOM   1316 O O   . LYS B 2 38  ? -12.245 4.230   -41.055 1.00 39.66 ? 150 LYS B O   1 
ATOM   1317 C CB  . LYS B 2 38  ? -14.750 2.972   -41.403 1.00 40.14 ? 150 LYS B CB  1 
ATOM   1318 C CG  . LYS B 2 38  ? -15.650 1.735   -41.482 1.00 40.54 ? 150 LYS B CG  1 
ATOM   1319 C CD  . LYS B 2 38  ? -16.524 1.756   -42.736 1.00 40.41 ? 150 LYS B CD  1 
ATOM   1320 C CE  . LYS B 2 38  ? -17.346 0.478   -42.873 1.00 41.07 ? 150 LYS B CE  1 
ATOM   1321 N NZ  . LYS B 2 38  ? -18.570 0.686   -43.701 1.00 40.51 ? 150 LYS B NZ  1 
ATOM   1322 N N   . ASN B 2 39  ? -12.971 5.212   -39.160 1.00 39.94 ? 151 ASN B N   1 
ATOM   1323 C CA  . ASN B 2 39  ? -11.895 6.204   -39.085 1.00 40.00 ? 151 ASN B CA  1 
ATOM   1324 C C   . ASN B 2 39  ? -11.852 7.133   -40.295 1.00 39.96 ? 151 ASN B C   1 
ATOM   1325 O O   . ASN B 2 39  ? -10.777 7.463   -40.806 1.00 39.45 ? 151 ASN B O   1 
ATOM   1326 C CB  . ASN B 2 39  ? -10.539 5.519   -38.865 1.00 40.02 ? 151 ASN B CB  1 
ATOM   1327 C CG  . ASN B 2 39  ? -10.558 4.553   -37.683 1.00 40.60 ? 151 ASN B CG  1 
ATOM   1328 O OD1 . ASN B 2 39  ? -10.911 4.932   -36.565 1.00 41.09 ? 151 ASN B OD1 1 
ATOM   1329 N ND2 . ASN B 2 39  ? -10.175 3.302   -37.927 1.00 40.80 ? 151 ASN B ND2 1 
ATOM   1330 N N   . SER B 2 40  ? -13.036 7.542   -40.753 1.00 40.12 ? 152 SER B N   1 
ATOM   1331 C CA  . SER B 2 40  ? -13.153 8.590   -41.765 1.00 40.29 ? 152 SER B CA  1 
ATOM   1332 C C   . SER B 2 40  ? -14.527 9.235   -41.676 1.00 40.48 ? 152 SER B C   1 
ATOM   1333 O O   . SER B 2 40  ? -15.178 9.162   -40.642 1.00 40.94 ? 152 SER B O   1 
ATOM   1334 C CB  . SER B 2 40  ? -12.854 8.052   -43.168 1.00 40.20 ? 152 SER B CB  1 
ATOM   1335 O OG  . SER B 2 40  ? -13.987 7.541   -43.821 1.00 40.82 ? 152 SER B OG  1 
ATOM   1336 N N   . SER B 2 41  ? -14.965 9.882   -42.745 1.00 40.64 ? 153 SER B N   1 
ATOM   1337 C CA  . SER B 2 41  ? -16.173 10.672  -42.695 1.00 40.50 ? 153 SER B CA  1 
ATOM   1338 C C   . SER B 2 41  ? -17.083 10.261  -43.823 1.00 40.71 ? 153 SER B C   1 
ATOM   1339 O O   . SER B 2 41  ? -16.613 9.831   -44.868 1.00 40.99 ? 153 SER B O   1 
ATOM   1340 C CB  . SER B 2 41  ? -15.820 12.152  -42.817 1.00 40.51 ? 153 SER B CB  1 
ATOM   1341 O OG  . SER B 2 41  ? -14.786 12.488  -41.908 1.00 40.44 ? 153 SER B OG  1 
ATOM   1342 N N   . LEU B 2 42  ? -18.387 10.387  -43.588 1.00 40.75 ? 154 LEU B N   1 
ATOM   1343 C CA  . LEU B 2 42  ? -19.409 10.200  -44.601 1.00 40.56 ? 154 LEU B CA  1 
ATOM   1344 C C   . LEU B 2 42  ? -19.028 10.995  -45.841 1.00 40.60 ? 154 LEU B C   1 
ATOM   1345 O O   . LEU B 2 42  ? -18.289 11.963  -45.753 1.00 40.81 ? 154 LEU B O   1 
ATOM   1346 C CB  . LEU B 2 42  ? -20.769 10.658  -44.048 1.00 40.45 ? 154 LEU B CB  1 
ATOM   1347 C CG  . LEU B 2 42  ? -22.051 10.382  -44.847 1.00 40.79 ? 154 LEU B CG  1 
ATOM   1348 C CD1 . LEU B 2 42  ? -22.178 8.899   -45.216 1.00 38.94 ? 154 LEU B CD1 1 
ATOM   1349 C CD2 . LEU B 2 42  ? -23.281 10.854  -44.056 1.00 40.39 ? 154 LEU B CD2 1 
ATOM   1350 N N   . LEU B 2 43  ? -19.516 10.571  -46.998 1.00 40.89 ? 155 LEU B N   1 
ATOM   1351 C CA  . LEU B 2 43  ? -19.112 11.180  -48.257 1.00 41.10 ? 155 LEU B CA  1 
ATOM   1352 C C   . LEU B 2 43  ? -19.319 12.683  -48.238 1.00 41.39 ? 155 LEU B C   1 
ATOM   1353 O O   . LEU B 2 43  ? -20.408 13.167  -47.940 1.00 41.62 ? 155 LEU B O   1 
ATOM   1354 C CB  . LEU B 2 43  ? -19.876 10.564  -49.437 1.00 41.19 ? 155 LEU B CB  1 
ATOM   1355 C CG  . LEU B 2 43  ? -19.615 11.134  -50.838 1.00 40.77 ? 155 LEU B CG  1 
ATOM   1356 C CD1 . LEU B 2 43  ? -18.121 11.208  -51.129 1.00 40.39 ? 155 LEU B CD1 1 
ATOM   1357 C CD2 . LEU B 2 43  ? -20.331 10.297  -51.881 1.00 40.40 ? 155 LEU B CD2 1 
ATOM   1358 N N   . SER B 2 44  ? -18.251 13.411  -48.526 1.00 41.65 ? 156 SER B N   1 
ATOM   1359 C CA  . SER B 2 44  ? -18.321 14.842  -48.701 1.00 42.02 ? 156 SER B CA  1 
ATOM   1360 C C   . SER B 2 44  ? -18.147 15.074  -50.175 1.00 42.44 ? 156 SER B C   1 
ATOM   1361 O O   . SER B 2 44  ? -17.554 14.239  -50.876 1.00 42.82 ? 156 SER B O   1 
ATOM   1362 C CB  . SER B 2 44  ? -17.198 15.527  -47.938 1.00 42.16 ? 156 SER B CB  1 
ATOM   1363 O OG  . SER B 2 44  ? -15.933 15.105  -48.430 1.00 42.88 ? 156 SER B OG  1 
ATOM   1364 N N   . ILE B 2 45  ? -18.661 16.196  -50.655 1.00 42.64 ? 157 ILE B N   1 
ATOM   1365 C CA  . ILE B 2 45  ? -18.545 16.543  -52.063 1.00 42.76 ? 157 ILE B CA  1 
ATOM   1366 C C   . ILE B 2 45  ? -17.824 17.878  -52.148 1.00 43.00 ? 157 ILE B C   1 
ATOM   1367 O O   . ILE B 2 45  ? -18.228 18.834  -51.487 1.00 43.22 ? 157 ILE B O   1 
ATOM   1368 C CB  . ILE B 2 45  ? -19.934 16.638  -52.721 1.00 42.66 ? 157 ILE B CB  1 
ATOM   1369 C CG1 . ILE B 2 45  ? -20.570 15.252  -52.833 1.00 42.36 ? 157 ILE B CG1 1 
ATOM   1370 C CG2 . ILE B 2 45  ? -19.829 17.278  -54.102 1.00 42.67 ? 157 ILE B CG2 1 
ATOM   1371 C CD1 . ILE B 2 45  ? -20.040 14.434  -54.012 1.00 41.57 ? 157 ILE B CD1 1 
ATOM   1372 N N   . ASP B 2 46  ? -16.758 17.934  -52.946 1.00 43.40 ? 158 ASP B N   1 
ATOM   1373 C CA  . ASP B 2 46  ? -15.900 19.129  -53.047 1.00 43.71 ? 158 ASP B CA  1 
ATOM   1374 C C   . ASP B 2 46  ? -16.177 19.945  -54.299 1.00 43.83 ? 158 ASP B C   1 
ATOM   1375 O O   . ASP B 2 46  ? -16.428 21.151  -54.220 1.00 44.25 ? 158 ASP B O   1 
ATOM   1376 C CB  . ASP B 2 46  ? -14.431 18.716  -53.049 1.00 43.96 ? 158 ASP B CB  1 
ATOM   1377 C CG  . ASP B 2 46  ? -14.071 17.869  -51.852 1.00 45.13 ? 158 ASP B CG  1 
ATOM   1378 O OD1 . ASP B 2 46  ? -13.439 16.807  -52.048 1.00 46.82 ? 158 ASP B OD1 1 
ATOM   1379 O OD2 . ASP B 2 46  ? -14.433 18.261  -50.717 1.00 47.03 ? 158 ASP B OD2 1 
ATOM   1380 N N   . ASN B 2 47  ? -16.110 19.273  -55.446 1.00 43.81 ? 159 ASN B N   1 
ATOM   1381 C CA  . ASN B 2 47  ? -16.338 19.878  -56.753 1.00 43.76 ? 159 ASN B CA  1 
ATOM   1382 C C   . ASN B 2 47  ? -17.624 19.308  -57.379 1.00 43.60 ? 159 ASN B C   1 
ATOM   1383 O O   . ASN B 2 47  ? -18.276 18.439  -56.799 1.00 43.41 ? 159 ASN B O   1 
ATOM   1384 C CB  . ASN B 2 47  ? -15.127 19.578  -57.662 1.00 43.98 ? 159 ASN B CB  1 
ATOM   1385 C CG  . ASN B 2 47  ? -14.798 20.718  -58.631 1.00 44.77 ? 159 ASN B CG  1 
ATOM   1386 O OD1 . ASN B 2 47  ? -14.383 20.484  -59.776 1.00 46.19 ? 159 ASN B OD1 1 
ATOM   1387 N ND2 . ASN B 2 47  ? -14.966 21.954  -58.171 1.00 44.37 ? 159 ASN B ND2 1 
ATOM   1388 N N   . GLU B 2 48  ? -17.988 19.837  -58.548 1.00 43.48 ? 160 GLU B N   1 
ATOM   1389 C CA  . GLU B 2 48  ? -19.032 19.268  -59.419 1.00 43.20 ? 160 GLU B CA  1 
ATOM   1390 C C   . GLU B 2 48  ? -18.458 18.096  -60.224 1.00 42.97 ? 160 GLU B C   1 
ATOM   1391 O O   . GLU B 2 48  ? -19.187 17.195  -60.665 1.00 42.59 ? 160 GLU B O   1 
ATOM   1392 C CB  . GLU B 2 48  ? -19.571 20.344  -60.387 1.00 43.43 ? 160 GLU B CB  1 
ATOM   1393 C CG  . GLU B 2 48  ? -21.003 20.821  -60.114 1.00 43.98 ? 160 GLU B CG  1 
ATOM   1394 C CD  . GLU B 2 48  ? -22.042 19.879  -60.712 1.00 45.14 ? 160 GLU B CD  1 
ATOM   1395 O OE1 . GLU B 2 48  ? -22.680 20.257  -61.720 1.00 45.53 ? 160 GLU B OE1 1 
ATOM   1396 O OE2 . GLU B 2 48  ? -22.197 18.747  -60.191 1.00 45.07 ? 160 GLU B OE2 1 
ATOM   1397 N N   . GLU B 2 49  ? -17.140 18.134  -60.415 1.00 42.68 ? 161 GLU B N   1 
ATOM   1398 C CA  . GLU B 2 49  ? -16.419 17.143  -61.206 1.00 42.37 ? 161 GLU B CA  1 
ATOM   1399 C C   . GLU B 2 49  ? -16.229 15.837  -60.429 1.00 42.00 ? 161 GLU B C   1 
ATOM   1400 O O   . GLU B 2 49  ? -16.370 14.754  -60.996 1.00 42.22 ? 161 GLU B O   1 
ATOM   1401 C CB  . GLU B 2 49  ? -15.071 17.718  -61.655 1.00 42.34 ? 161 GLU B CB  1 
ATOM   1402 C CG  . GLU B 2 49  ? -13.980 16.684  -61.899 1.00 42.78 ? 161 GLU B CG  1 
ATOM   1403 C CD  . GLU B 2 49  ? -12.682 17.300  -62.376 1.00 42.95 ? 161 GLU B CD  1 
ATOM   1404 O OE1 . GLU B 2 49  ? -12.404 18.460  -61.980 1.00 45.29 ? 161 GLU B OE1 1 
ATOM   1405 O OE2 . GLU B 2 49  ? -11.941 16.628  -63.134 1.00 42.57 ? 161 GLU B OE2 1 
ATOM   1406 N N   . GLU B 2 50  ? -15.885 15.935  -59.149 1.00 41.35 ? 162 GLU B N   1 
ATOM   1407 C CA  . GLU B 2 50  ? -15.905 14.776  -58.266 1.00 41.12 ? 162 GLU B CA  1 
ATOM   1408 C C   . GLU B 2 50  ? -17.249 14.070  -58.398 1.00 40.74 ? 162 GLU B C   1 
ATOM   1409 O O   . GLU B 2 50  ? -17.316 12.856  -58.534 1.00 40.76 ? 162 GLU B O   1 
ATOM   1410 C CB  . GLU B 2 50  ? -15.702 15.213  -56.816 1.00 41.19 ? 162 GLU B CB  1 
ATOM   1411 C CG  . GLU B 2 50  ? -15.613 14.067  -55.799 1.00 41.27 ? 162 GLU B CG  1 
ATOM   1412 C CD  . GLU B 2 50  ? -15.571 14.559  -54.354 1.00 41.01 ? 162 GLU B CD  1 
ATOM   1413 O OE1 . GLU B 2 50  ? -15.341 13.736  -53.441 1.00 40.82 ? 162 GLU B OE1 1 
ATOM   1414 O OE2 . GLU B 2 50  ? -15.766 15.771  -54.132 1.00 41.29 ? 162 GLU B OE2 1 
ATOM   1415 N N   . MET B 2 51  ? -18.313 14.862  -58.360 1.00 40.45 ? 163 MET B N   1 
ATOM   1416 C CA  . MET B 2 51  ? -19.686 14.371  -58.433 1.00 40.20 ? 163 MET B CA  1 
ATOM   1417 C C   . MET B 2 51  ? -19.870 13.497  -59.671 1.00 39.45 ? 163 MET B C   1 
ATOM   1418 O O   . MET B 2 51  ? -20.371 12.377  -59.580 1.00 38.95 ? 163 MET B O   1 
ATOM   1419 C CB  . MET B 2 51  ? -20.657 15.568  -58.460 1.00 40.39 ? 163 MET B CB  1 
ATOM   1420 C CG  . MET B 2 51  ? -21.955 15.381  -57.687 1.00 41.10 ? 163 MET B CG  1 
ATOM   1421 S SD  . MET B 2 51  ? -22.994 16.886  -57.632 1.00 41.58 ? 163 MET B SD  1 
ATOM   1422 C CE  . MET B 2 51  ? -22.093 17.895  -56.456 1.00 41.35 ? 163 MET B CE  1 
ATOM   1423 N N   . LYS B 2 52  ? -19.436 14.009  -60.821 1.00 39.05 ? 164 LYS B N   1 
ATOM   1424 C CA  . LYS B 2 52  ? -19.551 13.279  -62.091 1.00 38.57 ? 164 LYS B CA  1 
ATOM   1425 C C   . LYS B 2 52  ? -18.775 11.969  -62.057 1.00 37.92 ? 164 LYS B C   1 
ATOM   1426 O O   . LYS B 2 52  ? -19.261 10.951  -62.526 1.00 37.57 ? 164 LYS B O   1 
ATOM   1427 C CB  . LYS B 2 52  ? -19.081 14.146  -63.258 1.00 38.59 ? 164 LYS B CB  1 
ATOM   1428 C CG  . LYS B 2 52  ? -19.033 13.427  -64.618 1.00 39.00 ? 164 LYS B CG  1 
ATOM   1429 C CD  . LYS B 2 52  ? -20.391 12.891  -65.061 1.00 38.78 ? 164 LYS B CD  1 
ATOM   1430 C CE  . LYS B 2 52  ? -20.248 11.992  -66.272 1.00 39.04 ? 164 LYS B CE  1 
ATOM   1431 N NZ  . LYS B 2 52  ? -21.564 11.533  -66.812 1.00 39.28 ? 164 LYS B NZ  1 
ATOM   1432 N N   . PHE B 2 53  ? -17.573 11.998  -61.496 1.00 37.69 ? 165 PHE B N   1 
ATOM   1433 C CA  . PHE B 2 53  ? -16.790 10.787  -61.322 1.00 37.68 ? 165 PHE B CA  1 
ATOM   1434 C C   . PHE B 2 53  ? -17.517 9.783   -60.440 1.00 37.57 ? 165 PHE B C   1 
ATOM   1435 O O   . PHE B 2 53  ? -17.634 8.614   -60.787 1.00 37.43 ? 165 PHE B O   1 
ATOM   1436 C CB  . PHE B 2 53  ? -15.434 11.090  -60.703 1.00 37.78 ? 165 PHE B CB  1 
ATOM   1437 C CG  . PHE B 2 53  ? -14.815 9.903   -60.043 1.00 37.83 ? 165 PHE B CG  1 
ATOM   1438 C CD1 . PHE B 2 53  ? -14.398 8.820   -60.806 1.00 37.95 ? 165 PHE B CD1 1 
ATOM   1439 C CD2 . PHE B 2 53  ? -14.684 9.845   -58.660 1.00 37.84 ? 165 PHE B CD2 1 
ATOM   1440 C CE1 . PHE B 2 53  ? -13.843 7.704   -60.210 1.00 38.02 ? 165 PHE B CE1 1 
ATOM   1441 C CE2 . PHE B 2 53  ? -14.134 8.729   -58.050 1.00 38.28 ? 165 PHE B CE2 1 
ATOM   1442 C CZ  . PHE B 2 53  ? -13.713 7.653   -58.825 1.00 38.31 ? 165 PHE B CZ  1 
ATOM   1443 N N   . LEU B 2 54  ? -17.997 10.258  -59.295 1.00 37.40 ? 166 LEU B N   1 
ATOM   1444 C CA  . LEU B 2 54  ? -18.705 9.425   -58.325 1.00 37.39 ? 166 LEU B CA  1 
ATOM   1445 C C   . LEU B 2 54  ? -20.004 8.813   -58.910 1.00 37.41 ? 166 LEU B C   1 
ATOM   1446 O O   . LEU B 2 54  ? -20.498 7.774   -58.435 1.00 37.04 ? 166 LEU B O   1 
ATOM   1447 C CB  . LEU B 2 54  ? -19.021 10.266  -57.081 1.00 37.45 ? 166 LEU B CB  1 
ATOM   1448 C CG  . LEU B 2 54  ? -18.601 9.809   -55.677 1.00 37.82 ? 166 LEU B CG  1 
ATOM   1449 C CD1 . LEU B 2 54  ? -17.363 8.919   -55.647 1.00 37.28 ? 166 LEU B CD1 1 
ATOM   1450 C CD2 . LEU B 2 54  ? -18.379 11.049  -54.820 1.00 37.21 ? 166 LEU B CD2 1 
ATOM   1451 N N   . SER B 2 55  ? -20.538 9.455   -59.946 1.00 37.19 ? 167 SER B N   1 
ATOM   1452 C CA  . SER B 2 55  ? -21.750 8.990   -60.617 1.00 37.30 ? 167 SER B CA  1 
ATOM   1453 C C   . SER B 2 55  ? -21.506 7.829   -61.591 1.00 37.42 ? 167 SER B C   1 
ATOM   1454 O O   . SER B 2 55  ? -22.467 7.198   -62.040 1.00 37.11 ? 167 SER B O   1 
ATOM   1455 C CB  . SER B 2 55  ? -22.427 10.152  -61.358 1.00 37.02 ? 167 SER B CB  1 
ATOM   1456 O OG  . SER B 2 55  ? -21.765 10.453  -62.574 1.00 35.77 ? 167 SER B OG  1 
ATOM   1457 N N   . ILE B 2 56  ? -20.238 7.579   -61.926 1.00 37.48 ? 168 ILE B N   1 
ATOM   1458 C CA  . ILE B 2 56  ? -19.841 6.415   -62.729 1.00 37.95 ? 168 ILE B CA  1 
ATOM   1459 C C   . ILE B 2 56  ? -19.710 5.177   -61.826 1.00 38.09 ? 168 ILE B C   1 
ATOM   1460 O O   . ILE B 2 56  ? -20.003 4.054   -62.226 1.00 37.80 ? 168 ILE B O   1 
ATOM   1461 C CB  . ILE B 2 56  ? -18.475 6.651   -63.446 1.00 37.83 ? 168 ILE B CB  1 
ATOM   1462 C CG1 . ILE B 2 56  ? -18.554 7.865   -64.381 1.00 38.20 ? 168 ILE B CG1 1 
ATOM   1463 C CG2 . ILE B 2 56  ? -18.049 5.409   -64.226 1.00 37.35 ? 168 ILE B CG2 1 
ATOM   1464 C CD1 . ILE B 2 56  ? -17.307 8.072   -65.227 1.00 38.11 ? 168 ILE B CD1 1 
ATOM   1465 N N   . ILE B 2 57  ? -19.275 5.417   -60.598 1.00 38.60 ? 169 ILE B N   1 
ATOM   1466 C CA  . ILE B 2 57  ? -18.891 4.363   -59.671 1.00 39.08 ? 169 ILE B CA  1 
ATOM   1467 C C   . ILE B 2 57  ? -20.060 3.856   -58.820 1.00 39.22 ? 169 ILE B C   1 
ATOM   1468 O O   . ILE B 2 57  ? -20.069 2.698   -58.424 1.00 39.28 ? 169 ILE B O   1 
ATOM   1469 C CB  . ILE B 2 57  ? -17.716 4.871   -58.777 1.00 39.12 ? 169 ILE B CB  1 
ATOM   1470 C CG1 . ILE B 2 57  ? -16.481 5.091   -59.649 1.00 39.32 ? 169 ILE B CG1 1 
ATOM   1471 C CG2 . ILE B 2 57  ? -17.384 3.899   -57.681 1.00 38.56 ? 169 ILE B CG2 1 
ATOM   1472 C CD1 . ILE B 2 57  ? -16.100 3.863   -60.487 1.00 39.02 ? 169 ILE B CD1 1 
ATOM   1473 N N   . SER B 2 58  ? -21.046 4.712   -58.561 1.00 39.69 ? 170 SER B N   1 
ATOM   1474 C CA  . SER B 2 58  ? -22.196 4.343   -57.740 1.00 39.96 ? 170 SER B CA  1 
ATOM   1475 C C   . SER B 2 58  ? -23.364 5.309   -57.920 1.00 40.28 ? 170 SER B C   1 
ATOM   1476 O O   . SER B 2 58  ? -23.178 6.515   -57.815 1.00 40.61 ? 170 SER B O   1 
ATOM   1477 C CB  . SER B 2 58  ? -21.772 4.321   -56.283 1.00 40.18 ? 170 SER B CB  1 
ATOM   1478 O OG  . SER B 2 58  ? -21.005 3.161   -55.992 1.00 40.31 ? 170 SER B OG  1 
ATOM   1479 N N   . PRO B 2 59  ? -24.580 4.785   -58.164 1.00 40.62 ? 171 PRO B N   1 
ATOM   1480 C CA  . PRO B 2 59  ? -25.716 5.656   -58.478 1.00 40.55 ? 171 PRO B CA  1 
ATOM   1481 C C   . PRO B 2 59  ? -26.210 6.519   -57.312 1.00 40.55 ? 171 PRO B C   1 
ATOM   1482 O O   . PRO B 2 59  ? -26.499 7.692   -57.529 1.00 40.83 ? 171 PRO B O   1 
ATOM   1483 C CB  . PRO B 2 59  ? -26.812 4.673   -58.926 1.00 40.64 ? 171 PRO B CB  1 
ATOM   1484 C CG  . PRO B 2 59  ? -26.492 3.406   -58.244 1.00 40.75 ? 171 PRO B CG  1 
ATOM   1485 C CD  . PRO B 2 59  ? -24.976 3.365   -58.151 1.00 40.96 ? 171 PRO B CD  1 
ATOM   1486 N N   . SER B 2 60  ? -26.312 5.959   -56.105 1.00 40.16 ? 172 SER B N   1 
ATOM   1487 C CA  . SER B 2 60  ? -26.891 6.696   -54.975 1.00 39.89 ? 172 SER B CA  1 
ATOM   1488 C C   . SER B 2 60  ? -25.990 6.680   -53.739 1.00 39.62 ? 172 SER B C   1 
ATOM   1489 O O   . SER B 2 60  ? -25.398 5.653   -53.413 1.00 39.55 ? 172 SER B O   1 
ATOM   1490 C CB  . SER B 2 60  ? -28.280 6.138   -54.612 1.00 40.04 ? 172 SER B CB  1 
ATOM   1491 O OG  . SER B 2 60  ? -28.217 5.189   -53.559 1.00 39.61 ? 172 SER B OG  1 
ATOM   1492 N N   . SER B 2 61  ? -25.902 7.821   -53.051 1.00 39.26 ? 173 SER B N   1 
ATOM   1493 C CA  . SER B 2 61  ? -25.254 7.876   -51.738 1.00 38.86 ? 173 SER B CA  1 
ATOM   1494 C C   . SER B 2 61  ? -25.647 9.079   -50.905 1.00 38.30 ? 173 SER B C   1 
ATOM   1495 O O   . SER B 2 61  ? -25.848 10.166  -51.432 1.00 38.10 ? 173 SER B O   1 
ATOM   1496 C CB  . SER B 2 61  ? -23.729 7.867   -51.879 1.00 39.09 ? 173 SER B CB  1 
ATOM   1497 O OG  . SER B 2 61  ? -23.114 8.154   -50.630 1.00 38.39 ? 173 SER B OG  1 
ATOM   1498 N N   . TRP B 2 62  ? -25.729 8.867   -49.594 1.00 38.03 ? 174 TRP B N   1 
ATOM   1499 C CA  . TRP B 2 62  ? -25.822 9.950   -48.632 1.00 37.85 ? 174 TRP B CA  1 
ATOM   1500 C C   . TRP B 2 62  ? -24.564 10.796  -48.739 1.00 37.71 ? 174 TRP B C   1 
ATOM   1501 O O   . TRP B 2 62  ? -23.473 10.277  -48.969 1.00 37.34 ? 174 TRP B O   1 
ATOM   1502 C CB  . TRP B 2 62  ? -25.859 9.411   -47.205 1.00 37.80 ? 174 TRP B CB  1 
ATOM   1503 C CG  . TRP B 2 62  ? -27.149 8.798   -46.739 1.00 37.91 ? 174 TRP B CG  1 
ATOM   1504 C CD1 . TRP B 2 62  ? -27.311 7.554   -46.199 1.00 37.49 ? 174 TRP B CD1 1 
ATOM   1505 C CD2 . TRP B 2 62  ? -28.440 9.416   -46.711 1.00 37.49 ? 174 TRP B CD2 1 
ATOM   1506 N NE1 . TRP B 2 62  ? -28.622 7.355   -45.853 1.00 37.35 ? 174 TRP B NE1 1 
ATOM   1507 C CE2 . TRP B 2 62  ? -29.338 8.481   -46.159 1.00 37.40 ? 174 TRP B CE2 1 
ATOM   1508 C CE3 . TRP B 2 62  ? -28.926 10.664  -47.110 1.00 37.33 ? 174 TRP B CE3 1 
ATOM   1509 C CZ2 . TRP B 2 62  ? -30.695 8.756   -45.998 1.00 37.69 ? 174 TRP B CZ2 1 
ATOM   1510 C CZ3 . TRP B 2 62  ? -30.272 10.938  -46.952 1.00 37.41 ? 174 TRP B CZ3 1 
ATOM   1511 C CH2 . TRP B 2 62  ? -31.142 9.990   -46.397 1.00 37.61 ? 174 TRP B CH2 1 
ATOM   1512 N N   . ILE B 2 63  ? -24.697 12.098  -48.562 1.00 37.57 ? 175 ILE B N   1 
ATOM   1513 C CA  . ILE B 2 63  ? -23.521 12.918  -48.380 1.00 37.81 ? 175 ILE B CA  1 
ATOM   1514 C C   . ILE B 2 63  ? -23.660 13.620  -47.035 1.00 37.93 ? 175 ILE B C   1 
ATOM   1515 O O   . ILE B 2 63  ? -24.769 13.754  -46.517 1.00 37.88 ? 175 ILE B O   1 
ATOM   1516 C CB  . ILE B 2 63  ? -23.288 13.904  -49.547 1.00 37.70 ? 175 ILE B CB  1 
ATOM   1517 C CG1 . ILE B 2 63  ? -24.487 14.819  -49.778 1.00 37.89 ? 175 ILE B CG1 1 
ATOM   1518 C CG2 . ILE B 2 63  ? -23.003 13.153  -50.816 1.00 37.16 ? 175 ILE B CG2 1 
ATOM   1519 C CD1 . ILE B 2 63  ? -24.143 16.011  -50.645 1.00 37.88 ? 175 ILE B CD1 1 
ATOM   1520 N N   . GLY B 2 64  ? -22.537 14.046  -46.462 1.00 38.07 ? 176 GLY B N   1 
ATOM   1521 C CA  . GLY B 2 64  ? -22.545 14.701  -45.145 1.00 38.36 ? 176 GLY B CA  1 
ATOM   1522 C C   . GLY B 2 64  ? -23.076 16.123  -45.188 1.00 38.48 ? 176 GLY B C   1 
ATOM   1523 O O   . GLY B 2 64  ? -22.328 17.065  -44.956 1.00 39.00 ? 176 GLY B O   1 
ATOM   1524 N N   . VAL B 2 65  ? -24.367 16.272  -45.484 1.00 38.56 ? 177 VAL B N   1 
ATOM   1525 C CA  . VAL B 2 65  ? -25.030 17.580  -45.580 1.00 38.67 ? 177 VAL B CA  1 
ATOM   1526 C C   . VAL B 2 65  ? -26.451 17.464  -45.015 1.00 39.00 ? 177 VAL B C   1 
ATOM   1527 O O   . VAL B 2 65  ? -27.135 16.470  -45.280 1.00 39.28 ? 177 VAL B O   1 
ATOM   1528 C CB  . VAL B 2 65  ? -25.101 18.065  -47.041 1.00 38.47 ? 177 VAL B CB  1 
ATOM   1529 C CG1 . VAL B 2 65  ? -25.958 19.321  -47.152 1.00 38.00 ? 177 VAL B CG1 1 
ATOM   1530 C CG2 . VAL B 2 65  ? -23.698 18.307  -47.592 1.00 37.84 ? 177 VAL B CG2 1 
ATOM   1531 N N   . PHE B 2 66  ? -26.900 18.451  -44.238 1.00 39.03 ? 178 PHE B N   1 
ATOM   1532 C CA  . PHE B 2 66  ? -28.199 18.321  -43.556 1.00 39.21 ? 178 PHE B CA  1 
ATOM   1533 C C   . PHE B 2 66  ? -28.879 19.621  -43.127 1.00 39.31 ? 178 PHE B C   1 
ATOM   1534 O O   . PHE B 2 66  ? -28.283 20.700  -43.154 1.00 38.90 ? 178 PHE B O   1 
ATOM   1535 C CB  . PHE B 2 66  ? -28.067 17.398  -42.327 1.00 39.06 ? 178 PHE B CB  1 
ATOM   1536 C CG  . PHE B 2 66  ? -27.374 18.032  -41.158 1.00 38.69 ? 178 PHE B CG  1 
ATOM   1537 C CD1 . PHE B 2 66  ? -25.990 18.148  -41.137 1.00 38.80 ? 178 PHE B CD1 1 
ATOM   1538 C CD2 . PHE B 2 66  ? -28.104 18.510  -40.076 1.00 39.18 ? 178 PHE B CD2 1 
ATOM   1539 C CE1 . PHE B 2 66  ? -25.336 18.729  -40.064 1.00 38.36 ? 178 PHE B CE1 1 
ATOM   1540 C CE2 . PHE B 2 66  ? -27.462 19.101  -38.986 1.00 38.91 ? 178 PHE B CE2 1 
ATOM   1541 C CZ  . PHE B 2 66  ? -26.074 19.212  -38.980 1.00 38.93 ? 178 PHE B CZ  1 
ATOM   1542 N N   . ARG B 2 67  ? -30.146 19.472  -42.734 1.00 39.59 ? 179 ARG B N   1 
ATOM   1543 C CA  . ARG B 2 67  ? -30.934 20.534  -42.113 1.00 39.87 ? 179 ARG B CA  1 
ATOM   1544 C C   . ARG B 2 67  ? -31.584 20.022  -40.838 1.00 39.97 ? 179 ARG B C   1 
ATOM   1545 O O   . ARG B 2 67  ? -31.923 18.833  -40.738 1.00 39.79 ? 179 ARG B O   1 
ATOM   1546 C CB  . ARG B 2 67  ? -32.052 21.008  -43.046 1.00 40.10 ? 179 ARG B CB  1 
ATOM   1547 C CG  . ARG B 2 67  ? -31.576 21.594  -44.349 1.00 40.44 ? 179 ARG B CG  1 
ATOM   1548 C CD  . ARG B 2 67  ? -32.690 22.296  -45.106 1.00 39.98 ? 179 ARG B CD  1 
ATOM   1549 N NE  . ARG B 2 67  ? -33.667 21.368  -45.665 1.00 39.46 ? 179 ARG B NE  1 
ATOM   1550 C CZ  . ARG B 2 67  ? -34.523 21.683  -46.634 1.00 39.84 ? 179 ARG B CZ  1 
ATOM   1551 N NH1 . ARG B 2 67  ? -34.527 22.900  -47.171 1.00 39.96 ? 179 ARG B NH1 1 
ATOM   1552 N NH2 . ARG B 2 67  ? -35.383 20.780  -47.081 1.00 39.84 ? 179 ARG B NH2 1 
ATOM   1553 N N   . ASN B 2 68  ? -31.759 20.930  -39.876 1.00 39.97 ? 180 ASN B N   1 
ATOM   1554 C CA  . ASN B 2 68  ? -32.584 20.674  -38.698 1.00 40.03 ? 180 ASN B CA  1 
ATOM   1555 C C   . ASN B 2 68  ? -34.060 20.658  -39.084 1.00 40.15 ? 180 ASN B C   1 
ATOM   1556 O O   . ASN B 2 68  ? -34.837 19.865  -38.551 1.00 40.05 ? 180 ASN B O   1 
ATOM   1557 C CB  . ASN B 2 68  ? -32.360 21.745  -37.621 1.00 40.02 ? 180 ASN B CB  1 
ATOM   1558 C CG  . ASN B 2 68  ? -30.941 21.730  -37.039 1.00 39.82 ? 180 ASN B CG  1 
ATOM   1559 O OD1 . ASN B 2 68  ? -30.299 20.679  -36.924 1.00 39.61 ? 180 ASN B OD1 1 
ATOM   1560 N ND2 . ASN B 2 68  ? -30.462 22.905  -36.648 1.00 38.14 ? 180 ASN B ND2 1 
ATOM   1561 N N   . SER B 2 69  ? -34.436 21.549  -40.004 1.00 40.31 ? 181 SER B N   1 
ATOM   1562 C CA  . SER B 2 69  ? -35.813 21.636  -40.508 1.00 40.29 ? 181 SER B CA  1 
ATOM   1563 C C   . SER B 2 69  ? -35.901 22.279  -41.898 1.00 40.38 ? 181 SER B C   1 
ATOM   1564 O O   . SER B 2 69  ? -34.929 22.830  -42.419 1.00 39.98 ? 181 SER B O   1 
ATOM   1565 C CB  . SER B 2 69  ? -36.697 22.435  -39.547 1.00 40.03 ? 181 SER B CB  1 
ATOM   1566 O OG  . SER B 2 69  ? -36.887 23.758  -40.019 1.00 39.20 ? 181 SER B OG  1 
ATOM   1567 N N   . SER B 2 70  ? -37.110 22.232  -42.452 1.00 40.83 ? 182 SER B N   1 
ATOM   1568 C CA  . SER B 2 70  ? -37.402 22.655  -43.826 1.00 41.03 ? 182 SER B CA  1 
ATOM   1569 C C   . SER B 2 70  ? -36.701 23.935  -44.262 1.00 41.23 ? 182 SER B C   1 
ATOM   1570 O O   . SER B 2 70  ? -36.302 24.042  -45.424 1.00 41.38 ? 182 SER B O   1 
ATOM   1571 C CB  . SER B 2 70  ? -38.915 22.803  -44.024 1.00 41.11 ? 182 SER B CB  1 
ATOM   1572 O OG  . SER B 2 70  ? -39.562 21.558  -43.836 1.00 41.35 ? 182 SER B OG  1 
ATOM   1573 N N   . HIS B 2 71  ? -36.563 24.916  -43.369 1.00 41.22 ? 183 HIS B N   1 
ATOM   1574 C CA  . HIS B 2 71  ? -35.660 26.015  -43.692 1.00 41.13 ? 183 HIS B CA  1 
ATOM   1575 C C   . HIS B 2 71  ? -34.860 26.637  -42.563 1.00 40.89 ? 183 HIS B C   1 
ATOM   1576 O O   . HIS B 2 71  ? -35.229 27.645  -41.955 1.00 40.80 ? 183 HIS B O   1 
ATOM   1577 C CB  . HIS B 2 71  ? -36.310 27.100  -44.544 1.00 41.31 ? 183 HIS B CB  1 
ATOM   1578 C CG  . HIS B 2 71  ? -35.308 27.932  -45.279 1.00 41.68 ? 183 HIS B CG  1 
ATOM   1579 N ND1 . HIS B 2 71  ? -34.184 27.383  -45.862 1.00 42.30 ? 183 HIS B ND1 1 
ATOM   1580 C CD2 . HIS B 2 71  ? -35.243 29.264  -45.516 1.00 42.46 ? 183 HIS B CD2 1 
ATOM   1581 C CE1 . HIS B 2 71  ? -33.473 28.339  -46.431 1.00 42.69 ? 183 HIS B CE1 1 
ATOM   1582 N NE2 . HIS B 2 71  ? -34.095 29.490  -46.238 1.00 42.88 ? 183 HIS B NE2 1 
ATOM   1583 N N   . HIS B 2 72  ? -33.757 25.962  -42.298 1.00 40.59 ? 184 HIS B N   1 
ATOM   1584 C CA  . HIS B 2 72  ? -32.497 26.601  -42.019 1.00 40.42 ? 184 HIS B CA  1 
ATOM   1585 C C   . HIS B 2 72  ? -31.654 26.138  -43.215 1.00 40.32 ? 184 HIS B C   1 
ATOM   1586 O O   . HIS B 2 72  ? -32.026 25.171  -43.887 1.00 40.24 ? 184 HIS B O   1 
ATOM   1587 C CB  . HIS B 2 72  ? -31.937 26.103  -40.699 1.00 40.53 ? 184 HIS B CB  1 
ATOM   1588 C CG  . HIS B 2 72  ? -32.921 26.153  -39.571 1.00 40.69 ? 184 HIS B CG  1 
ATOM   1589 N ND1 . HIS B 2 72  ? -33.027 27.233  -38.722 1.00 40.65 ? 184 HIS B ND1 1 
ATOM   1590 C CD2 . HIS B 2 72  ? -33.848 25.257  -39.160 1.00 40.54 ? 184 HIS B CD2 1 
ATOM   1591 C CE1 . HIS B 2 72  ? -33.974 26.996  -37.833 1.00 40.32 ? 184 HIS B CE1 1 
ATOM   1592 N NE2 . HIS B 2 72  ? -34.486 25.804  -38.075 1.00 40.03 ? 184 HIS B NE2 1 
ATOM   1593 N N   . PRO B 2 73  ? -30.540 26.822  -43.509 1.00 40.16 ? 185 PRO B N   1 
ATOM   1594 C CA  . PRO B 2 73  ? -29.760 26.441  -44.693 1.00 40.08 ? 185 PRO B CA  1 
ATOM   1595 C C   . PRO B 2 73  ? -29.106 25.065  -44.586 1.00 39.96 ? 185 PRO B C   1 
ATOM   1596 O O   . PRO B 2 73  ? -28.947 24.543  -43.485 1.00 39.97 ? 185 PRO B O   1 
ATOM   1597 C CB  . PRO B 2 73  ? -28.691 27.528  -44.769 1.00 40.11 ? 185 PRO B CB  1 
ATOM   1598 C CG  . PRO B 2 73  ? -28.578 28.053  -43.388 1.00 40.24 ? 185 PRO B CG  1 
ATOM   1599 C CD  . PRO B 2 73  ? -29.944 27.963  -42.798 1.00 40.13 ? 185 PRO B CD  1 
ATOM   1600 N N   . TRP B 2 74  ? -28.742 24.479  -45.726 1.00 39.91 ? 186 TRP B N   1 
ATOM   1601 C CA  . TRP B 2 74  ? -28.018 23.202  -45.728 1.00 39.84 ? 186 TRP B CA  1 
ATOM   1602 C C   . TRP B 2 74  ? -26.598 23.372  -45.158 1.00 39.80 ? 186 TRP B C   1 
ATOM   1603 O O   . TRP B 2 74  ? -25.860 24.288  -45.547 1.00 39.84 ? 186 TRP B O   1 
ATOM   1604 C CB  . TRP B 2 74  ? -27.963 22.586  -47.130 1.00 39.91 ? 186 TRP B CB  1 
ATOM   1605 C CG  . TRP B 2 74  ? -29.289 22.093  -47.623 1.00 40.23 ? 186 TRP B CG  1 
ATOM   1606 C CD1 . TRP B 2 74  ? -30.158 22.763  -48.430 1.00 40.17 ? 186 TRP B CD1 1 
ATOM   1607 C CD2 . TRP B 2 74  ? -29.902 20.828  -47.336 1.00 40.15 ? 186 TRP B CD2 1 
ATOM   1608 N NE1 . TRP B 2 74  ? -31.272 22.002  -48.658 1.00 40.28 ? 186 TRP B NE1 1 
ATOM   1609 C CE2 . TRP B 2 74  ? -31.142 20.807  -48.001 1.00 40.07 ? 186 TRP B CE2 1 
ATOM   1610 C CE3 . TRP B 2 74  ? -29.526 19.715  -46.575 1.00 40.42 ? 186 TRP B CE3 1 
ATOM   1611 C CZ2 . TRP B 2 74  ? -32.015 19.714  -47.933 1.00 40.22 ? 186 TRP B CZ2 1 
ATOM   1612 C CZ3 . TRP B 2 74  ? -30.396 18.621  -46.511 1.00 40.31 ? 186 TRP B CZ3 1 
ATOM   1613 C CH2 . TRP B 2 74  ? -31.621 18.631  -47.189 1.00 40.22 ? 186 TRP B CH2 1 
ATOM   1614 N N   . VAL B 2 75  ? -26.234 22.473  -44.243 1.00 39.51 ? 187 VAL B N   1 
ATOM   1615 C CA  . VAL B 2 75  ? -24.994 22.566  -43.471 1.00 39.41 ? 187 VAL B CA  1 
ATOM   1616 C C   . VAL B 2 75  ? -24.157 21.313  -43.697 1.00 39.22 ? 187 VAL B C   1 
ATOM   1617 O O   . VAL B 2 75  ? -24.708 20.217  -43.815 1.00 39.22 ? 187 VAL B O   1 
ATOM   1618 C CB  . VAL B 2 75  ? -25.310 22.690  -41.952 1.00 39.19 ? 187 VAL B CB  1 
ATOM   1619 C CG1 . VAL B 2 75  ? -24.043 22.789  -41.135 1.00 39.70 ? 187 VAL B CG1 1 
ATOM   1620 C CG2 . VAL B 2 75  ? -26.169 23.891  -41.695 1.00 39.09 ? 187 VAL B CG2 1 
ATOM   1621 N N   . THR B 2 76  ? -22.837 21.473  -43.766 1.00 39.03 ? 188 THR B N   1 
ATOM   1622 C CA  . THR B 2 76  ? -21.930 20.318  -43.851 1.00 39.15 ? 188 THR B CA  1 
ATOM   1623 C C   . THR B 2 76  ? -21.594 19.804  -42.450 1.00 39.26 ? 188 THR B C   1 
ATOM   1624 O O   . THR B 2 76  ? -21.980 20.405  -41.451 1.00 38.97 ? 188 THR B O   1 
ATOM   1625 C CB  . THR B 2 76  ? -20.599 20.666  -44.540 1.00 38.91 ? 188 THR B CB  1 
ATOM   1626 O OG1 . THR B 2 76  ? -19.836 21.524  -43.686 1.00 38.32 ? 188 THR B OG1 1 
ATOM   1627 C CG2 . THR B 2 76  ? -20.833 21.344  -45.875 1.00 38.62 ? 188 THR B CG2 1 
ATOM   1628 N N   . MET B 2 77  ? -20.859 18.699  -42.386 1.00 39.43 ? 189 MET B N   1 
ATOM   1629 C CA  . MET B 2 77  ? -20.357 18.180  -41.119 1.00 39.57 ? 189 MET B CA  1 
ATOM   1630 C C   . MET B 2 77  ? -19.047 18.855  -40.703 1.00 39.74 ? 189 MET B C   1 
ATOM   1631 O O   . MET B 2 77  ? -18.580 18.656  -39.578 1.00 40.05 ? 189 MET B O   1 
ATOM   1632 C CB  . MET B 2 77  ? -20.178 16.666  -41.194 1.00 39.82 ? 189 MET B CB  1 
ATOM   1633 C CG  . MET B 2 77  ? -21.475 15.912  -41.323 1.00 39.90 ? 189 MET B CG  1 
ATOM   1634 S SD  . MET B 2 77  ? -22.529 16.101  -39.876 1.00 43.74 ? 189 MET B SD  1 
ATOM   1635 C CE  . MET B 2 77  ? -21.575 15.251  -38.615 1.00 41.13 ? 189 MET B CE  1 
ATOM   1636 N N   . ASN B 2 78  ? -18.461 19.657  -41.597 1.00 39.66 ? 190 ASN B N   1 
ATOM   1637 C CA  . ASN B 2 78  ? -17.359 20.561  -41.221 1.00 39.52 ? 190 ASN B CA  1 
ATOM   1638 C C   . ASN B 2 78  ? -17.849 21.887  -40.643 1.00 39.39 ? 190 ASN B C   1 
ATOM   1639 O O   . ASN B 2 78  ? -17.032 22.747  -40.317 1.00 39.42 ? 190 ASN B O   1 
ATOM   1640 C CB  . ASN B 2 78  ? -16.453 20.859  -42.423 1.00 39.62 ? 190 ASN B CB  1 
ATOM   1641 C CG  . ASN B 2 78  ? -15.543 19.702  -42.778 1.00 40.18 ? 190 ASN B CG  1 
ATOM   1642 O OD1 . ASN B 2 78  ? -15.366 18.756  -41.995 1.00 40.33 ? 190 ASN B OD1 1 
ATOM   1643 N ND2 . ASN B 2 78  ? -14.956 19.768  -43.972 1.00 39.88 ? 190 ASN B ND2 1 
ATOM   1644 N N   . GLY B 2 79  ? -19.168 22.064  -40.541 1.00 39.34 ? 191 GLY B N   1 
ATOM   1645 C CA  . GLY B 2 79  ? -19.751 23.267  -39.956 1.00 39.45 ? 191 GLY B CA  1 
ATOM   1646 C C   . GLY B 2 79  ? -19.813 24.466  -40.886 1.00 39.58 ? 191 GLY B C   1 
ATOM   1647 O O   . GLY B 2 79  ? -19.731 25.604  -40.432 1.00 39.72 ? 191 GLY B O   1 
ATOM   1648 N N   . LEU B 2 80  ? -19.989 24.213  -42.180 1.00 39.93 ? 192 LEU B N   1 
ATOM   1649 C CA  . LEU B 2 80  ? -20.022 25.252  -43.207 1.00 40.09 ? 192 LEU B CA  1 
ATOM   1650 C C   . LEU B 2 80  ? -21.332 25.215  -43.989 1.00 40.41 ? 192 LEU B C   1 
ATOM   1651 O O   . LEU B 2 80  ? -22.051 24.206  -43.979 1.00 40.75 ? 192 LEU B O   1 
ATOM   1652 C CB  . LEU B 2 80  ? -18.893 25.019  -44.199 1.00 40.13 ? 192 LEU B CB  1 
ATOM   1653 C CG  . LEU B 2 80  ? -17.467 25.222  -43.722 1.00 40.13 ? 192 LEU B CG  1 
ATOM   1654 C CD1 . LEU B 2 80  ? -16.507 24.659  -44.757 1.00 39.88 ? 192 LEU B CD1 1 
ATOM   1655 C CD2 . LEU B 2 80  ? -17.213 26.703  -43.483 1.00 40.39 ? 192 LEU B CD2 1 
ATOM   1656 N N   . ALA B 2 81  ? -21.617 26.306  -44.694 1.00 40.53 ? 193 ALA B N   1 
ATOM   1657 C CA  . ALA B 2 81  ? -22.773 26.372  -45.585 1.00 40.80 ? 193 ALA B CA  1 
ATOM   1658 C C   . ALA B 2 81  ? -22.460 25.629  -46.882 1.00 40.95 ? 193 ALA B C   1 
ATOM   1659 O O   . ALA B 2 81  ? -21.436 25.881  -47.505 1.00 41.01 ? 193 ALA B O   1 
ATOM   1660 C CB  . ALA B 2 81  ? -23.135 27.820  -45.876 1.00 40.56 ? 193 ALA B CB  1 
ATOM   1661 N N   . PHE B 2 82  ? -23.343 24.712  -47.274 1.00 41.56 ? 194 PHE B N   1 
ATOM   1662 C CA  . PHE B 2 82  ? -23.138 23.877  -48.465 1.00 41.80 ? 194 PHE B CA  1 
ATOM   1663 C C   . PHE B 2 82  ? -23.495 24.663  -49.729 1.00 42.08 ? 194 PHE B C   1 
ATOM   1664 O O   . PHE B 2 82  ? -24.664 24.951  -49.982 1.00 42.33 ? 194 PHE B O   1 
ATOM   1665 C CB  . PHE B 2 82  ? -23.983 22.610  -48.365 1.00 42.01 ? 194 PHE B CB  1 
ATOM   1666 C CG  . PHE B 2 82  ? -23.731 21.616  -49.469 1.00 42.10 ? 194 PHE B CG  1 
ATOM   1667 C CD1 . PHE B 2 82  ? -24.725 21.308  -50.385 1.00 42.57 ? 194 PHE B CD1 1 
ATOM   1668 C CD2 . PHE B 2 82  ? -22.499 20.974  -49.579 1.00 42.34 ? 194 PHE B CD2 1 
ATOM   1669 C CE1 . PHE B 2 82  ? -24.491 20.376  -51.403 1.00 42.84 ? 194 PHE B CE1 1 
ATOM   1670 C CE2 . PHE B 2 82  ? -22.259 20.046  -50.591 1.00 42.48 ? 194 PHE B CE2 1 
ATOM   1671 C CZ  . PHE B 2 82  ? -23.254 19.746  -51.501 1.00 42.36 ? 194 PHE B CZ  1 
ATOM   1672 N N   . LYS B 2 83  ? -22.485 25.000  -50.525 1.00 42.21 ? 195 LYS B N   1 
ATOM   1673 C CA  . LYS B 2 83  ? -22.655 25.961  -51.619 1.00 42.28 ? 195 LYS B CA  1 
ATOM   1674 C C   . LYS B 2 83  ? -23.163 25.370  -52.944 1.00 42.10 ? 195 LYS B C   1 
ATOM   1675 O O   . LYS B 2 83  ? -23.354 26.116  -53.908 1.00 42.04 ? 195 LYS B O   1 
ATOM   1676 C CB  . LYS B 2 83  ? -21.349 26.749  -51.833 1.00 42.37 ? 195 LYS B CB  1 
ATOM   1677 C CG  . LYS B 2 83  ? -21.376 28.184  -51.255 1.00 43.09 ? 195 LYS B CG  1 
ATOM   1678 C CD  . LYS B 2 83  ? -20.125 28.532  -50.423 1.00 43.24 ? 195 LYS B CD  1 
ATOM   1679 C CE  . LYS B 2 83  ? -18.816 28.415  -51.221 1.00 44.19 ? 195 LYS B CE  1 
ATOM   1680 N NZ  . LYS B 2 83  ? -17.633 28.246  -50.318 1.00 44.12 ? 195 LYS B NZ  1 
ATOM   1681 N N   . HIS B 2 84  ? -23.389 24.057  -52.997 1.00 41.96 ? 196 HIS B N   1 
ATOM   1682 C CA  . HIS B 2 84  ? -24.031 23.436  -54.169 1.00 41.94 ? 196 HIS B CA  1 
ATOM   1683 C C   . HIS B 2 84  ? -25.530 23.297  -53.935 1.00 41.80 ? 196 HIS B C   1 
ATOM   1684 O O   . HIS B 2 84  ? -25.970 22.924  -52.841 1.00 41.57 ? 196 HIS B O   1 
ATOM   1685 C CB  . HIS B 2 84  ? -23.449 22.057  -54.474 1.00 42.01 ? 196 HIS B CB  1 
ATOM   1686 C CG  . HIS B 2 84  ? -21.957 22.035  -54.559 1.00 42.20 ? 196 HIS B CG  1 
ATOM   1687 N ND1 . HIS B 2 84  ? -21.159 21.672  -53.495 1.00 42.49 ? 196 HIS B ND1 1 
ATOM   1688 C CD2 . HIS B 2 84  ? -21.118 22.331  -55.578 1.00 41.95 ? 196 HIS B CD2 1 
ATOM   1689 C CE1 . HIS B 2 84  ? -19.890 21.744  -53.857 1.00 42.42 ? 196 HIS B CE1 1 
ATOM   1690 N NE2 . HIS B 2 84  ? -19.839 22.140  -55.116 1.00 42.21 ? 196 HIS B NE2 1 
ATOM   1691 N N   . GLU B 2 85  ? -26.311 23.593  -54.970 1.00 41.67 ? 197 GLU B N   1 
ATOM   1692 C CA  . GLU B 2 85  ? -27.762 23.529  -54.865 1.00 41.61 ? 197 GLU B CA  1 
ATOM   1693 C C   . GLU B 2 85  ? -28.176 22.070  -54.745 1.00 41.51 ? 197 GLU B C   1 
ATOM   1694 O O   . GLU B 2 85  ? -27.591 21.194  -55.387 1.00 41.60 ? 197 GLU B O   1 
ATOM   1695 C CB  . GLU B 2 85  ? -28.440 24.183  -56.078 1.00 41.58 ? 197 GLU B CB  1 
ATOM   1696 C CG  . GLU B 2 85  ? -28.196 25.692  -56.199 1.00 41.71 ? 197 GLU B CG  1 
ATOM   1697 C CD  . GLU B 2 85  ? -28.734 26.295  -57.491 1.00 41.86 ? 197 GLU B CD  1 
ATOM   1698 O OE1 . GLU B 2 85  ? -29.229 27.442  -57.450 1.00 43.27 ? 197 GLU B OE1 1 
ATOM   1699 O OE2 . GLU B 2 85  ? -28.668 25.637  -58.551 1.00 42.32 ? 197 GLU B OE2 1 
ATOM   1700 N N   . ILE B 2 86  ? -29.176 21.820  -53.906 1.00 41.43 ? 198 ILE B N   1 
ATOM   1701 C CA  . ILE B 2 86  ? -29.729 20.481  -53.721 1.00 41.30 ? 198 ILE B CA  1 
ATOM   1702 C C   . ILE B 2 86  ? -31.263 20.538  -53.926 1.00 41.32 ? 198 ILE B C   1 
ATOM   1703 O O   . ILE B 2 86  ? -31.938 21.448  -53.437 1.00 41.55 ? 198 ILE B O   1 
ATOM   1704 C CB  . ILE B 2 86  ? -29.250 19.845  -52.354 1.00 41.18 ? 198 ILE B CB  1 
ATOM   1705 C CG1 . ILE B 2 86  ? -30.061 18.588  -51.975 1.00 41.08 ? 198 ILE B CG1 1 
ATOM   1706 C CG2 . ILE B 2 86  ? -29.228 20.875  -51.239 1.00 41.39 ? 198 ILE B CG2 1 
ATOM   1707 C CD1 . ILE B 2 86  ? -31.408 18.836  -51.350 1.00 40.93 ? 198 ILE B CD1 1 
ATOM   1708 N N   . LYS B 2 87  ? -31.783 19.574  -54.686 1.00 41.15 ? 199 LYS B N   1 
ATOM   1709 C CA  . LYS B 2 87  ? -33.184 19.535  -55.091 1.00 40.90 ? 199 LYS B CA  1 
ATOM   1710 C C   . LYS B 2 87  ? -34.112 19.226  -53.922 1.00 40.85 ? 199 LYS B C   1 
ATOM   1711 O O   . LYS B 2 87  ? -35.037 19.994  -53.634 1.00 41.15 ? 199 LYS B O   1 
ATOM   1712 C CB  . LYS B 2 87  ? -33.363 18.485  -56.196 1.00 40.91 ? 199 LYS B CB  1 
ATOM   1713 C CG  . LYS B 2 87  ? -32.760 18.895  -57.550 1.00 40.81 ? 199 LYS B CG  1 
ATOM   1714 C CD  . LYS B 2 87  ? -32.015 17.751  -58.248 1.00 40.83 ? 199 LYS B CD  1 
ATOM   1715 C CE  . LYS B 2 87  ? -32.928 16.579  -58.597 1.00 40.85 ? 199 LYS B CE  1 
ATOM   1716 N NZ  . LYS B 2 87  ? -32.158 15.379  -59.026 1.00 40.84 ? 199 LYS B NZ  1 
ATOM   1717 N N   . ALA B 2 92  ? -41.206 17.631  -48.993 1.00 42.14 ? 204 ALA B N   1 
ATOM   1718 C CA  . ALA B 2 92  ? -42.107 17.607  -47.851 1.00 42.16 ? 204 ALA B CA  1 
ATOM   1719 C C   . ALA B 2 92  ? -41.316 17.609  -46.544 1.00 42.19 ? 204 ALA B C   1 
ATOM   1720 O O   . ALA B 2 92  ? -41.178 18.658  -45.915 1.00 42.33 ? 204 ALA B O   1 
ATOM   1721 C CB  . ALA B 2 92  ? -43.038 16.400  -47.926 1.00 42.21 ? 204 ALA B CB  1 
ATOM   1722 N N   . GLU B 2 93  ? -40.782 16.453  -46.147 1.00 42.21 ? 205 GLU B N   1 
ATOM   1723 C CA  . GLU B 2 93  ? -40.094 16.311  -44.851 1.00 42.15 ? 205 GLU B CA  1 
ATOM   1724 C C   . GLU B 2 93  ? -38.656 15.822  -45.027 1.00 42.12 ? 205 GLU B C   1 
ATOM   1725 O O   . GLU B 2 93  ? -38.184 14.957  -44.287 1.00 42.33 ? 205 GLU B O   1 
ATOM   1726 C CB  . GLU B 2 93  ? -40.872 15.337  -43.965 1.00 42.28 ? 205 GLU B CB  1 
ATOM   1727 C CG  . GLU B 2 93  ? -40.581 15.456  -42.471 1.00 42.34 ? 205 GLU B CG  1 
ATOM   1728 C CD  . GLU B 2 93  ? -41.419 14.495  -41.641 1.00 42.36 ? 205 GLU B CD  1 
ATOM   1729 O OE1 . GLU B 2 93  ? -42.336 13.852  -42.194 1.00 42.65 ? 205 GLU B OE1 1 
ATOM   1730 O OE2 . GLU B 2 93  ? -41.160 14.382  -40.429 1.00 43.46 ? 205 GLU B OE2 1 
ATOM   1731 N N   . LEU B 2 94  ? -37.959 16.397  -46.000 1.00 41.88 ? 206 LEU B N   1 
ATOM   1732 C CA  . LEU B 2 94  ? -36.640 15.926  -46.398 1.00 41.63 ? 206 LEU B CA  1 
ATOM   1733 C C   . LEU B 2 94  ? -35.575 16.862  -45.844 1.00 41.36 ? 206 LEU B C   1 
ATOM   1734 O O   . LEU B 2 94  ? -35.476 18.003  -46.277 1.00 41.25 ? 206 LEU B O   1 
ATOM   1735 C CB  . LEU B 2 94  ? -36.553 15.867  -47.930 1.00 41.67 ? 206 LEU B CB  1 
ATOM   1736 C CG  . LEU B 2 94  ? -37.720 15.191  -48.665 1.00 42.00 ? 206 LEU B CG  1 
ATOM   1737 C CD1 . LEU B 2 94  ? -37.762 15.635  -50.123 1.00 42.26 ? 206 LEU B CD1 1 
ATOM   1738 C CD2 . LEU B 2 94  ? -37.652 13.670  -48.559 1.00 41.91 ? 206 LEU B CD2 1 
ATOM   1739 N N   . ASN B 2 95  ? -34.776 16.378  -44.897 1.00 41.14 ? 207 ASN B N   1 
ATOM   1740 C CA  . ASN B 2 95  ? -33.791 17.216  -44.207 1.00 41.07 ? 207 ASN B CA  1 
ATOM   1741 C C   . ASN B 2 95  ? -32.331 16.727  -44.284 1.00 40.97 ? 207 ASN B C   1 
ATOM   1742 O O   . ASN B 2 95  ? -31.453 17.268  -43.613 1.00 40.74 ? 207 ASN B O   1 
ATOM   1743 C CB  . ASN B 2 95  ? -34.222 17.368  -42.746 1.00 41.18 ? 207 ASN B CB  1 
ATOM   1744 C CG  . ASN B 2 95  ? -35.604 17.999  -42.606 1.00 41.11 ? 207 ASN B CG  1 
ATOM   1745 O OD1 . ASN B 2 95  ? -35.917 18.991  -43.263 1.00 41.54 ? 207 ASN B OD1 1 
ATOM   1746 N ND2 . ASN B 2 95  ? -36.434 17.424  -41.745 1.00 41.01 ? 207 ASN B ND2 1 
ATOM   1747 N N   . CYS B 2 96  ? -32.074 15.720  -45.119 1.00 41.18 ? 208 CYS B N   1 
ATOM   1748 C CA  . CYS B 2 96  ? -30.727 15.166  -45.324 1.00 41.05 ? 208 CYS B CA  1 
ATOM   1749 C C   . CYS B 2 96  ? -30.466 15.032  -46.817 1.00 40.98 ? 208 CYS B C   1 
ATOM   1750 O O   . CYS B 2 96  ? -31.380 14.721  -47.576 1.00 41.13 ? 208 CYS B O   1 
ATOM   1751 C CB  . CYS B 2 96  ? -30.603 13.782  -44.673 1.00 41.22 ? 208 CYS B CB  1 
ATOM   1752 S SG  . CYS B 2 96  ? -30.687 13.717  -42.857 1.00 41.45 ? 208 CYS B SG  1 
ATOM   1753 N N   . ALA B 2 97  ? -29.221 15.237  -47.240 1.00 40.87 ? 209 ALA B N   1 
ATOM   1754 C CA  . ALA B 2 97  ? -28.892 15.228  -48.665 1.00 40.71 ? 209 ALA B CA  1 
ATOM   1755 C C   . ALA B 2 97  ? -28.370 13.871  -49.127 1.00 40.77 ? 209 ALA B C   1 
ATOM   1756 O O   . ALA B 2 97  ? -27.737 13.150  -48.362 1.00 40.96 ? 209 ALA B O   1 
ATOM   1757 C CB  . ALA B 2 97  ? -27.886 16.313  -48.981 1.00 40.57 ? 209 ALA B CB  1 
ATOM   1758 N N   . VAL B 2 98  ? -28.655 13.545  -50.385 1.00 40.72 ? 210 VAL B N   1 
ATOM   1759 C CA  . VAL B 2 98  ? -28.184 12.333  -51.048 1.00 40.85 ? 210 VAL B CA  1 
ATOM   1760 C C   . VAL B 2 98  ? -27.747 12.694  -52.462 1.00 41.04 ? 210 VAL B C   1 
ATOM   1761 O O   . VAL B 2 98  ? -28.417 13.480  -53.136 1.00 41.04 ? 210 VAL B O   1 
ATOM   1762 C CB  . VAL B 2 98  ? -29.298 11.246  -51.179 1.00 40.81 ? 210 VAL B CB  1 
ATOM   1763 C CG1 . VAL B 2 98  ? -29.017 10.056  -50.290 1.00 40.35 ? 210 VAL B CG1 1 
ATOM   1764 C CG2 . VAL B 2 98  ? -30.682 11.832  -50.901 1.00 40.50 ? 210 VAL B CG2 1 
ATOM   1765 N N   . LEU B 2 99  ? -26.632 12.116  -52.900 1.00 41.29 ? 211 LEU B N   1 
ATOM   1766 C CA  . LEU B 2 99  ? -26.186 12.221  -54.293 1.00 41.46 ? 211 LEU B CA  1 
ATOM   1767 C C   . LEU B 2 99  ? -26.737 11.030  -55.066 1.00 41.62 ? 211 LEU B C   1 
ATOM   1768 O O   . LEU B 2 99  ? -26.379 9.897   -54.761 1.00 41.38 ? 211 LEU B O   1 
ATOM   1769 C CB  . LEU B 2 99  ? -24.655 12.223  -54.369 1.00 41.35 ? 211 LEU B CB  1 
ATOM   1770 C CG  . LEU B 2 99  ? -23.990 12.238  -55.747 1.00 41.39 ? 211 LEU B CG  1 
ATOM   1771 C CD1 . LEU B 2 99  ? -24.231 13.561  -56.447 1.00 40.75 ? 211 LEU B CD1 1 
ATOM   1772 C CD2 . LEU B 2 99  ? -22.493 11.964  -55.616 1.00 41.61 ? 211 LEU B CD2 1 
ATOM   1773 N N   . GLN B 2 100 ? -27.607 11.299  -56.048 1.00 42.14 ? 212 GLN B N   1 
ATOM   1774 C CA  . GLN B 2 100 ? -28.208 10.265  -56.908 1.00 42.40 ? 212 GLN B CA  1 
ATOM   1775 C C   . GLN B 2 100 ? -28.034 10.566  -58.401 1.00 42.72 ? 212 GLN B C   1 
ATOM   1776 O O   . GLN B 2 100 ? -28.717 11.445  -58.938 1.00 42.93 ? 212 GLN B O   1 
ATOM   1777 C CB  . GLN B 2 100 ? -29.694 10.123  -56.604 1.00 42.41 ? 212 GLN B CB  1 
ATOM   1778 C CG  . GLN B 2 100 ? -29.969 9.492   -55.254 1.00 42.94 ? 212 GLN B CG  1 
ATOM   1779 C CD  . GLN B 2 100 ? -31.353 8.873   -55.155 1.00 43.01 ? 212 GLN B CD  1 
ATOM   1780 O OE1 . GLN B 2 100 ? -32.017 8.962   -54.115 1.00 44.28 ? 212 GLN B OE1 1 
ATOM   1781 N NE2 . GLN B 2 100 ? -31.792 8.239   -56.233 1.00 43.40 ? 212 GLN B NE2 1 
ATOM   1782 N N   . VAL B 2 101 ? -27.150 9.810   -59.063 1.00 42.92 ? 213 VAL B N   1 
ATOM   1783 C CA  . VAL B 2 101 ? -26.743 10.038  -60.470 1.00 42.91 ? 213 VAL B CA  1 
ATOM   1784 C C   . VAL B 2 101 ? -26.527 11.522  -60.837 1.00 42.95 ? 213 VAL B C   1 
ATOM   1785 O O   . VAL B 2 101 ? -27.412 12.191  -61.381 1.00 42.89 ? 213 VAL B O   1 
ATOM   1786 C CB  . VAL B 2 101 ? -27.688 9.340   -61.500 1.00 43.16 ? 213 VAL B CB  1 
ATOM   1787 C CG1 . VAL B 2 101 ? -27.217 7.903   -61.786 1.00 43.09 ? 213 VAL B CG1 1 
ATOM   1788 C CG2 . VAL B 2 101 ? -29.147 9.369   -61.027 1.00 43.56 ? 213 VAL B CG2 1 
ATOM   1789 N N   . ASN B 2 102 ? -25.332 12.012  -60.509 1.00 42.81 ? 214 ASN B N   1 
ATOM   1790 C CA  . ASN B 2 102 ? -24.906 13.390  -60.787 1.00 42.52 ? 214 ASN B CA  1 
ATOM   1791 C C   . ASN B 2 102 ? -25.928 14.482  -60.456 1.00 42.25 ? 214 ASN B C   1 
ATOM   1792 O O   . ASN B 2 102 ? -26.004 15.499  -61.145 1.00 42.18 ? 214 ASN B O   1 
ATOM   1793 C CB  . ASN B 2 102 ? -24.409 13.533  -62.241 1.00 42.63 ? 214 ASN B CB  1 
ATOM   1794 C CG  . ASN B 2 102 ? -23.280 14.560  -62.378 1.00 43.08 ? 214 ASN B CG  1 
ATOM   1795 O OD1 . ASN B 2 102 ? -22.745 14.770  -63.463 1.00 43.83 ? 214 ASN B OD1 1 
ATOM   1796 N ND2 . ASN B 2 102 ? -22.910 15.192  -61.266 1.00 45.28 ? 214 ASN B ND2 1 
ATOM   1797 N N   . ARG B 2 103 ? -26.699 14.270  -59.394 1.00 41.99 ? 215 ARG B N   1 
ATOM   1798 C CA  . ARG B 2 103 ? -27.523 15.328  -58.824 1.00 41.83 ? 215 ARG B CA  1 
ATOM   1799 C C   . ARG B 2 103 ? -27.648 15.213  -57.298 1.00 41.60 ? 215 ARG B C   1 
ATOM   1800 O O   . ARG B 2 103 ? -27.616 14.111  -56.726 1.00 41.18 ? 215 ARG B O   1 
ATOM   1801 C CB  . ARG B 2 103 ? -28.908 15.386  -59.491 1.00 41.80 ? 215 ARG B CB  1 
ATOM   1802 C CG  . ARG B 2 103 ? -28.988 16.301  -60.726 1.00 42.14 ? 215 ARG B CG  1 
ATOM   1803 C CD  . ARG B 2 103 ? -28.248 17.640  -60.527 1.00 42.45 ? 215 ARG B CD  1 
ATOM   1804 N NE  . ARG B 2 103 ? -28.634 18.672  -61.494 1.00 42.83 ? 215 ARG B NE  1 
ATOM   1805 C CZ  . ARG B 2 103 ? -27.977 19.822  -61.685 1.00 42.69 ? 215 ARG B CZ  1 
ATOM   1806 N NH1 . ARG B 2 103 ? -28.419 20.691  -62.583 1.00 42.70 ? 215 ARG B NH1 1 
ATOM   1807 N NH2 . ARG B 2 103 ? -26.872 20.115  -60.995 1.00 43.00 ? 215 ARG B NH2 1 
ATOM   1808 N N   . LEU B 2 104 ? -27.775 16.373  -56.657 1.00 41.14 ? 216 LEU B N   1 
ATOM   1809 C CA  . LEU B 2 104 ? -27.922 16.451  -55.207 1.00 41.15 ? 216 LEU B CA  1 
ATOM   1810 C C   . LEU B 2 104 ? -29.409 16.503  -54.865 1.00 41.01 ? 216 LEU B C   1 
ATOM   1811 O O   . LEU B 2 104 ? -30.109 17.451  -55.238 1.00 40.70 ? 216 LEU B O   1 
ATOM   1812 C CB  . LEU B 2 104 ? -27.195 17.683  -54.680 1.00 41.02 ? 216 LEU B CB  1 
ATOM   1813 C CG  . LEU B 2 104 ? -25.714 17.735  -55.078 1.00 40.95 ? 216 LEU B CG  1 
ATOM   1814 C CD1 . LEU B 2 104 ? -25.232 19.178  -55.275 1.00 41.53 ? 216 LEU B CD1 1 
ATOM   1815 C CD2 . LEU B 2 104 ? -24.862 17.011  -54.059 1.00 39.76 ? 216 LEU B CD2 1 
ATOM   1816 N N   . LYS B 2 105 ? -29.883 15.469  -54.171 1.00 40.99 ? 217 LYS B N   1 
ATOM   1817 C CA  . LYS B 2 105 ? -31.306 15.274  -53.914 1.00 40.97 ? 217 LYS B CA  1 
ATOM   1818 C C   . LYS B 2 105 ? -31.598 15.377  -52.420 1.00 40.86 ? 217 LYS B C   1 
ATOM   1819 O O   . LYS B 2 105 ? -30.793 14.973  -51.595 1.00 40.84 ? 217 LYS B O   1 
ATOM   1820 C CB  . LYS B 2 105 ? -31.735 13.901  -54.447 1.00 41.01 ? 217 LYS B CB  1 
ATOM   1821 C CG  . LYS B 2 105 ? -33.227 13.578  -54.318 1.00 40.99 ? 217 LYS B CG  1 
ATOM   1822 C CD  . LYS B 2 105 ? -33.584 12.266  -55.025 1.00 41.09 ? 217 LYS B CD  1 
ATOM   1823 C CE  . LYS B 2 105 ? -35.102 12.086  -55.179 1.00 41.26 ? 217 LYS B CE  1 
ATOM   1824 N NZ  . LYS B 2 105 ? -35.471 10.998  -56.149 1.00 40.89 ? 217 LYS B NZ  1 
ATOM   1825 N N   . SER B 2 106 ? -32.757 15.921  -52.079 1.00 40.91 ? 218 SER B N   1 
ATOM   1826 C CA  . SER B 2 106 ? -33.218 15.946  -50.694 1.00 41.01 ? 218 SER B CA  1 
ATOM   1827 C C   . SER B 2 106 ? -33.879 14.603  -50.414 1.00 40.93 ? 218 SER B C   1 
ATOM   1828 O O   . SER B 2 106 ? -34.595 14.087  -51.272 1.00 41.25 ? 218 SER B O   1 
ATOM   1829 C CB  . SER B 2 106 ? -34.222 17.079  -50.495 1.00 40.98 ? 218 SER B CB  1 
ATOM   1830 O OG  . SER B 2 106 ? -34.168 17.585  -49.173 1.00 42.13 ? 218 SER B OG  1 
ATOM   1831 N N   . ALA B 2 107 ? -33.645 14.030  -49.237 1.00 40.71 ? 219 ALA B N   1 
ATOM   1832 C CA  . ALA B 2 107 ? -34.263 12.747  -48.892 1.00 40.78 ? 219 ALA B CA  1 
ATOM   1833 C C   . ALA B 2 107 ? -34.595 12.640  -47.416 1.00 40.87 ? 219 ALA B C   1 
ATOM   1834 O O   . ALA B 2 107 ? -33.959 13.280  -46.586 1.00 40.97 ? 219 ALA B O   1 
ATOM   1835 C CB  . ALA B 2 107 ? -33.375 11.619  -49.293 1.00 40.66 ? 219 ALA B CB  1 
ATOM   1836 N N   . GLN B 2 108 ? -35.606 11.831  -47.106 1.00 41.00 ? 220 GLN B N   1 
ATOM   1837 C CA  . GLN B 2 108 ? -36.036 11.601  -45.728 1.00 41.05 ? 220 GLN B CA  1 
ATOM   1838 C C   . GLN B 2 108 ? -34.917 10.878  -44.980 1.00 41.09 ? 220 GLN B C   1 
ATOM   1839 O O   . GLN B 2 108 ? -34.471 9.811   -45.395 1.00 40.95 ? 220 GLN B O   1 
ATOM   1840 C CB  . GLN B 2 108 ? -37.365 10.815  -45.692 1.00 41.06 ? 220 GLN B CB  1 
ATOM   1841 C CG  . GLN B 2 108 ? -37.719 10.109  -44.369 1.00 41.10 ? 220 GLN B CG  1 
ATOM   1842 C CD  . GLN B 2 108 ? -37.939 11.056  -43.184 1.00 42.05 ? 220 GLN B CD  1 
ATOM   1843 O OE1 . GLN B 2 108 ? -37.707 12.266  -43.267 1.00 42.71 ? 220 GLN B OE1 1 
ATOM   1844 N NE2 . GLN B 2 108 ? -38.391 10.493  -42.067 1.00 41.98 ? 220 GLN B NE2 1 
ATOM   1845 N N   . CYS B 2 109 ? -34.474 11.478  -43.877 1.00 41.32 ? 221 CYS B N   1 
ATOM   1846 C CA  . CYS B 2 109 ? -33.288 11.024  -43.147 1.00 41.41 ? 221 CYS B CA  1 
ATOM   1847 C C   . CYS B 2 109 ? -33.391 9.582   -42.655 1.00 41.36 ? 221 CYS B C   1 
ATOM   1848 O O   . CYS B 2 109 ? -32.370 8.920   -42.466 1.00 41.54 ? 221 CYS B O   1 
ATOM   1849 C CB  . CYS B 2 109 ? -33.012 11.963  -41.967 1.00 41.62 ? 221 CYS B CB  1 
ATOM   1850 S SG  . CYS B 2 109 ? -32.680 13.689  -42.458 1.00 42.57 ? 221 CYS B SG  1 
ATOM   1851 N N   . GLY B 2 110 ? -34.618 9.106   -42.449 1.00 41.27 ? 222 GLY B N   1 
ATOM   1852 C CA  . GLY B 2 110 ? -34.866 7.729   -42.026 1.00 41.30 ? 222 GLY B CA  1 
ATOM   1853 C C   . GLY B 2 110 ? -34.901 6.684   -43.138 1.00 41.30 ? 222 GLY B C   1 
ATOM   1854 O O   . GLY B 2 110 ? -35.098 5.493   -42.869 1.00 41.41 ? 222 GLY B O   1 
ATOM   1855 N N   . SER B 2 111 ? -34.736 7.114   -44.387 1.00 41.16 ? 223 SER B N   1 
ATOM   1856 C CA  . SER B 2 111 ? -34.657 6.176   -45.507 1.00 41.00 ? 223 SER B CA  1 
ATOM   1857 C C   . SER B 2 111 ? -33.382 5.379   -45.393 1.00 40.98 ? 223 SER B C   1 
ATOM   1858 O O   . SER B 2 111 ? -32.349 5.919   -45.030 1.00 41.47 ? 223 SER B O   1 
ATOM   1859 C CB  . SER B 2 111 ? -34.630 6.918   -46.839 1.00 40.97 ? 223 SER B CB  1 
ATOM   1860 O OG  . SER B 2 111 ? -35.831 7.626   -47.065 1.00 41.23 ? 223 SER B OG  1 
ATOM   1861 N N   . SER B 2 112 ? -33.437 4.095   -45.704 1.00 40.94 ? 224 SER B N   1 
ATOM   1862 C CA  . SER B 2 112 ? -32.211 3.318   -45.818 1.00 40.51 ? 224 SER B CA  1 
ATOM   1863 C C   . SER B 2 112 ? -31.671 3.559   -47.221 1.00 40.17 ? 224 SER B C   1 
ATOM   1864 O O   . SER B 2 112 ? -32.367 3.335   -48.212 1.00 40.02 ? 224 SER B O   1 
ATOM   1865 C CB  . SER B 2 112 ? -32.460 1.831   -45.546 1.00 40.66 ? 224 SER B CB  1 
ATOM   1866 O OG  . SER B 2 112 ? -32.650 1.598   -44.155 1.00 40.99 ? 224 SER B OG  1 
ATOM   1867 N N   . ILE B 2 113 ? -30.451 4.076   -47.290 1.00 39.85 ? 225 ILE B N   1 
ATOM   1868 C CA  . ILE B 2 113 ? -29.784 4.361   -48.551 1.00 39.62 ? 225 ILE B CA  1 
ATOM   1869 C C   . ILE B 2 113 ? -28.298 3.993   -48.436 1.00 39.40 ? 225 ILE B C   1 
ATOM   1870 O O   . ILE B 2 113 ? -27.730 4.024   -47.334 1.00 39.10 ? 225 ILE B O   1 
ATOM   1871 C CB  . ILE B 2 113 ? -29.922 5.858   -48.936 1.00 39.65 ? 225 ILE B CB  1 
ATOM   1872 C CG1 . ILE B 2 113 ? -31.395 6.277   -48.998 1.00 39.60 ? 225 ILE B CG1 1 
ATOM   1873 C CG2 . ILE B 2 113 ? -29.239 6.147   -50.290 1.00 39.77 ? 225 ILE B CG2 1 
ATOM   1874 C CD1 . ILE B 2 113 ? -31.595 7.762   -49.272 1.00 39.63 ? 225 ILE B CD1 1 
ATOM   1875 N N   . ILE B 2 114 ? -27.691 3.633   -49.570 1.00 38.90 ? 226 ILE B N   1 
ATOM   1876 C CA  . ILE B 2 114 ? -26.254 3.364   -49.668 1.00 38.82 ? 226 ILE B CA  1 
ATOM   1877 C C   . ILE B 2 114 ? -25.477 4.569   -49.163 1.00 38.59 ? 226 ILE B C   1 
ATOM   1878 O O   . ILE B 2 114 ? -25.911 5.698   -49.357 1.00 38.11 ? 226 ILE B O   1 
ATOM   1879 C CB  . ILE B 2 114 ? -25.811 3.134   -51.153 1.00 38.83 ? 226 ILE B CB  1 
ATOM   1880 C CG1 . ILE B 2 114 ? -26.453 1.876   -51.753 1.00 38.76 ? 226 ILE B CG1 1 
ATOM   1881 C CG2 . ILE B 2 114 ? -24.283 3.059   -51.266 1.00 38.60 ? 226 ILE B CG2 1 
ATOM   1882 C CD1 . ILE B 2 114 ? -25.918 0.586   -51.188 1.00 38.74 ? 226 ILE B CD1 1 
ATOM   1883 N N   . TYR B 2 115 ? -24.331 4.323   -48.528 1.00 38.74 ? 227 TYR B N   1 
ATOM   1884 C CA  . TYR B 2 115 ? -23.441 5.394   -48.070 1.00 39.24 ? 227 TYR B CA  1 
ATOM   1885 C C   . TYR B 2 115 ? -22.012 5.074   -48.431 1.00 39.29 ? 227 TYR B C   1 
ATOM   1886 O O   . TYR B 2 115 ? -21.601 3.926   -48.345 1.00 39.15 ? 227 TYR B O   1 
ATOM   1887 C CB  . TYR B 2 115 ? -23.535 5.591   -46.545 1.00 39.12 ? 227 TYR B CB  1 
ATOM   1888 C CG  . TYR B 2 115 ? -23.030 4.407   -45.733 1.00 39.06 ? 227 TYR B CG  1 
ATOM   1889 C CD1 . TYR B 2 115 ? -23.856 3.324   -45.459 1.00 39.41 ? 227 TYR B CD1 1 
ATOM   1890 C CD2 . TYR B 2 115 ? -21.727 4.364   -45.253 1.00 38.57 ? 227 TYR B CD2 1 
ATOM   1891 C CE1 . TYR B 2 115 ? -23.398 2.226   -44.713 1.00 38.98 ? 227 TYR B CE1 1 
ATOM   1892 C CE2 . TYR B 2 115 ? -21.260 3.268   -44.508 1.00 39.07 ? 227 TYR B CE2 1 
ATOM   1893 C CZ  . TYR B 2 115 ? -22.103 2.202   -44.245 1.00 38.98 ? 227 TYR B CZ  1 
ATOM   1894 O OH  . TYR B 2 115 ? -21.659 1.116   -43.511 1.00 39.10 ? 227 TYR B OH  1 
ATOM   1895 N N   . HIS B 2 116 ? -21.264 6.103   -48.817 1.00 39.82 ? 228 HIS B N   1 
ATOM   1896 C CA  . HIS B 2 116 ? -19.821 6.007   -49.003 1.00 40.18 ? 228 HIS B CA  1 
ATOM   1897 C C   . HIS B 2 116 ? -19.075 6.832   -47.965 1.00 40.50 ? 228 HIS B C   1 
ATOM   1898 O O   . HIS B 2 116 ? -19.629 7.766   -47.393 1.00 40.95 ? 228 HIS B O   1 
ATOM   1899 C CB  . HIS B 2 116 ? -19.430 6.517   -50.374 1.00 40.26 ? 228 HIS B CB  1 
ATOM   1900 C CG  . HIS B 2 116 ? -20.136 5.831   -51.493 1.00 40.68 ? 228 HIS B CG  1 
ATOM   1901 N ND1 . HIS B 2 116 ? -20.414 6.459   -52.687 1.00 40.77 ? 228 HIS B ND1 1 
ATOM   1902 C CD2 . HIS B 2 116 ? -20.626 4.575   -51.600 1.00 40.39 ? 228 HIS B CD2 1 
ATOM   1903 C CE1 . HIS B 2 116 ? -21.043 5.616   -53.485 1.00 40.59 ? 228 HIS B CE1 1 
ATOM   1904 N NE2 . HIS B 2 116 ? -21.186 4.465   -52.849 1.00 40.46 ? 228 HIS B NE2 1 
ATOM   1905 N N   . CYS B 2 117 ? -17.806 6.496   -47.753 1.00 40.76 ? 229 CYS B N   1 
ATOM   1906 C CA  . CYS B 2 117 ? -16.933 7.217   -46.833 1.00 40.80 ? 229 CYS B CA  1 
ATOM   1907 C C   . CYS B 2 117 ? -15.724 7.817   -47.582 1.00 40.71 ? 229 CYS B C   1 
ATOM   1908 O O   . CYS B 2 117 ? -15.313 7.294   -48.600 1.00 40.43 ? 229 CYS B O   1 
ATOM   1909 C CB  . CYS B 2 117 ? -16.481 6.252   -45.733 1.00 40.89 ? 229 CYS B CB  1 
ATOM   1910 S SG  . CYS B 2 117 ? -17.852 5.287   -44.998 1.00 41.60 ? 229 CYS B SG  1 
ATOM   1911 N N   . LYS B 2 118 ? -15.159 8.908   -47.070 1.00 41.20 ? 230 LYS B N   1 
ATOM   1912 C CA  . LYS B 2 118 ? -14.085 9.627   -47.762 1.00 41.39 ? 230 LYS B CA  1 
ATOM   1913 C C   . LYS B 2 118 ? -13.073 10.282  -46.802 1.00 41.70 ? 230 LYS B C   1 
ATOM   1914 O O   . LYS B 2 118 ? -13.457 10.832  -45.776 1.00 41.73 ? 230 LYS B O   1 
ATOM   1915 C CB  . LYS B 2 118 ? -14.700 10.674  -48.684 1.00 41.22 ? 230 LYS B CB  1 
ATOM   1916 C CG  . LYS B 2 118 ? -13.705 11.563  -49.406 1.00 41.19 ? 230 LYS B CG  1 
ATOM   1917 C CD  . LYS B 2 118 ? -14.442 12.514  -50.323 1.00 41.03 ? 230 LYS B CD  1 
ATOM   1918 C CE  . LYS B 2 118 ? -13.573 13.634  -50.819 1.00 40.87 ? 230 LYS B CE  1 
ATOM   1919 N NZ  . LYS B 2 118 ? -14.412 14.833  -51.060 1.00 41.53 ? 230 LYS B NZ  1 
ATOM   1920 N N   . HIS B 2 119 ? -11.788 10.226  -47.172 1.00 42.10 ? 231 HIS B N   1 
ATOM   1921 C CA  . HIS B 2 119 ? -10.666 10.679  -46.329 1.00 42.37 ? 231 HIS B CA  1 
ATOM   1922 C C   . HIS B 2 119 ? -10.162 12.033  -46.746 1.00 42.57 ? 231 HIS B C   1 
ATOM   1923 O O   . HIS B 2 119 ? -10.048 12.318  -47.929 1.00 42.74 ? 231 HIS B O   1 
ATOM   1924 C CB  . HIS B 2 119 ? -9.450  9.776   -46.503 1.00 42.55 ? 231 HIS B CB  1 
ATOM   1925 C CG  . HIS B 2 119 ? -9.363  8.649   -45.528 1.00 42.84 ? 231 HIS B CG  1 
ATOM   1926 N ND1 . HIS B 2 119 ? -10.465 7.966   -45.065 1.00 42.66 ? 231 HIS B ND1 1 
ATOM   1927 C CD2 . HIS B 2 119 ? -8.284  8.043   -44.979 1.00 43.44 ? 231 HIS B CD2 1 
ATOM   1928 C CE1 . HIS B 2 119 ? -10.070 7.002   -44.252 1.00 43.44 ? 231 HIS B CE1 1 
ATOM   1929 N NE2 . HIS B 2 119 ? -8.752  7.029   -44.181 1.00 44.32 ? 231 HIS B NE2 1 
ATOM   1930 N N   . LYS B 2 120 ? -9.762  12.825  -45.766 1.00 43.00 ? 232 LYS B N   1 
ATOM   1931 C CA  . LYS B 2 120 ? -9.142  14.119  -46.027 1.00 43.28 ? 232 LYS B CA  1 
ATOM   1932 C C   . LYS B 2 120 ? -7.760  13.947  -46.680 1.00 43.21 ? 232 LYS B C   1 
ATOM   1933 O O   . LYS B 2 120 ? -7.515  12.973  -47.405 1.00 43.19 ? 232 LYS B O   1 
ATOM   1934 C CB  . LYS B 2 120 ? -9.030  14.923  -44.718 1.00 43.54 ? 232 LYS B CB  1 
ATOM   1935 C CG  . LYS B 2 120 ? -10.373 15.135  -43.997 1.00 44.34 ? 232 LYS B CG  1 
ATOM   1936 C CD  . LYS B 2 120 ? -10.546 14.248  -42.747 1.00 44.84 ? 232 LYS B CD  1 
ATOM   1937 C CE  . LYS B 2 120 ? -11.741 14.708  -41.890 1.00 44.59 ? 232 LYS B CE  1 
ATOM   1938 N NZ  . LYS B 2 120 ? -11.666 14.222  -40.474 1.00 44.74 ? 232 LYS B NZ  1 
ATOM   1939 N N   . CYS C 1 2   ? 3.021   -0.508  -21.336 1.00 46.30 ? 58  CYS C N   1 
ATOM   1940 C CA  . CYS C 1 2   ? 1.543   -0.290  -21.202 1.00 45.96 ? 58  CYS C CA  1 
ATOM   1941 C C   . CYS C 1 2   ? 0.748   -1.584  -21.018 1.00 45.77 ? 58  CYS C C   1 
ATOM   1942 O O   . CYS C 1 2   ? -0.272  -1.590  -20.326 1.00 45.91 ? 58  CYS C O   1 
ATOM   1943 C CB  . CYS C 1 2   ? 1.004   0.462   -22.418 1.00 46.08 ? 58  CYS C CB  1 
ATOM   1944 S SG  . CYS C 1 2   ? 1.404   2.224   -22.434 1.00 46.62 ? 58  CYS C SG  1 
ATOM   1945 N N   . CYS C 1 3   ? 1.208   -2.671  -21.632 1.00 45.22 ? 59  CYS C N   1 
ATOM   1946 C CA  . CYS C 1 3   ? 0.523   -3.956  -21.530 1.00 44.99 ? 59  CYS C CA  1 
ATOM   1947 C C   . CYS C 1 3   ? 1.078   -4.808  -20.380 1.00 44.71 ? 59  CYS C C   1 
ATOM   1948 O O   . CYS C 1 3   ? 1.542   -5.929  -20.576 1.00 44.28 ? 59  CYS C O   1 
ATOM   1949 C CB  . CYS C 1 3   ? 0.593   -4.683  -22.871 1.00 44.82 ? 59  CYS C CB  1 
ATOM   1950 S SG  . CYS C 1 3   ? 0.174   -3.582  -24.261 1.00 45.00 ? 59  CYS C SG  1 
ATOM   1951 N N   . SER C 1 4   ? 1.011   -4.243  -19.176 1.00 44.65 ? 60  SER C N   1 
ATOM   1952 C CA  . SER C 1 4   ? 1.341   -4.933  -17.930 1.00 44.73 ? 60  SER C CA  1 
ATOM   1953 C C   . SER C 1 4   ? 0.038   -5.580  -17.402 1.00 44.81 ? 60  SER C C   1 
ATOM   1954 O O   . SER C 1 4   ? -0.638  -6.292  -18.149 1.00 45.25 ? 60  SER C O   1 
ATOM   1955 C CB  . SER C 1 4   ? 1.944   -3.912  -16.948 1.00 44.87 ? 60  SER C CB  1 
ATOM   1956 O OG  . SER C 1 4   ? 2.593   -4.527  -15.848 1.00 45.49 ? 60  SER C OG  1 
ATOM   1957 N N   . CYS C 1 5   ? -0.308  -5.353  -16.132 1.00 44.78 ? 61  CYS C N   1 
ATOM   1958 C CA  . CYS C 1 5   ? -1.678  -5.576  -15.604 1.00 44.40 ? 61  CYS C CA  1 
ATOM   1959 C C   . CYS C 1 5   ? -2.034  -7.002  -15.216 1.00 44.29 ? 61  CYS C C   1 
ATOM   1960 O O   . CYS C 1 5   ? -3.101  -7.480  -15.601 1.00 44.70 ? 61  CYS C O   1 
ATOM   1961 C CB  . CYS C 1 5   ? -2.757  -5.104  -16.598 1.00 44.29 ? 61  CYS C CB  1 
ATOM   1962 S SG  . CYS C 1 5   ? -2.586  -3.467  -17.283 1.00 44.39 ? 61  CYS C SG  1 
ATOM   1963 N N   . GLN C 1 6   ? -1.187  -7.681  -14.451 1.00 43.98 ? 62  GLN C N   1 
ATOM   1964 C CA  . GLN C 1 6   ? -1.492  -9.051  -14.001 1.00 43.85 ? 62  GLN C CA  1 
ATOM   1965 C C   . GLN C 1 6   ? -2.361  -9.828  -15.003 1.00 43.60 ? 62  GLN C C   1 
ATOM   1966 O O   . GLN C 1 6   ? -2.577  -9.392  -16.133 1.00 43.59 ? 62  GLN C O   1 
ATOM   1967 C CB  . GLN C 1 6   ? -2.225  -9.029  -12.650 1.00 43.67 ? 62  GLN C CB  1 
ATOM   1968 C CG  . GLN C 1 6   ? -1.841  -7.902  -11.718 1.00 44.14 ? 62  GLN C CG  1 
ATOM   1969 C CD  . GLN C 1 6   ? -0.360  -7.866  -11.379 1.00 44.66 ? 62  GLN C CD  1 
ATOM   1970 O OE1 . GLN C 1 6   ? 0.342   -8.872  -11.481 1.00 45.79 ? 62  GLN C OE1 1 
ATOM   1971 N NE2 . GLN C 1 6   ? 0.118   -6.700  -10.958 1.00 44.78 ? 62  GLN C NE2 1 
ATOM   1972 N N   . GLU C 1 7   ? -2.847  -10.995 -14.593 1.00 43.55 ? 63  GLU C N   1 
ATOM   1973 C CA  . GLU C 1 7   ? -3.962  -11.619 -15.297 1.00 43.29 ? 63  GLU C CA  1 
ATOM   1974 C C   . GLU C 1 7   ? -5.220  -11.139 -14.584 1.00 42.93 ? 63  GLU C C   1 
ATOM   1975 O O   . GLU C 1 7   ? -5.238  -11.030 -13.351 1.00 42.86 ? 63  GLU C O   1 
ATOM   1976 C CB  . GLU C 1 7   ? -3.857  -13.152 -15.308 1.00 43.34 ? 63  GLU C CB  1 
ATOM   1977 C CG  . GLU C 1 7   ? -4.120  -13.854 -13.966 1.00 43.65 ? 63  GLU C CG  1 
ATOM   1978 C CD  . GLU C 1 7   ? -3.720  -15.323 -13.992 1.00 44.10 ? 63  GLU C CD  1 
ATOM   1979 O OE1 . GLU C 1 7   ? -2.863  -15.719 -13.168 1.00 45.89 ? 63  GLU C OE1 1 
ATOM   1980 O OE2 . GLU C 1 7   ? -4.243  -16.079 -14.848 1.00 44.94 ? 63  GLU C OE2 1 
ATOM   1981 N N   . LYS C 1 8   ? -6.237  -10.791 -15.366 1.00 42.39 ? 64  LYS C N   1 
ATOM   1982 C CA  . LYS C 1 8   ? -7.543  -10.402 -14.832 1.00 42.12 ? 64  LYS C CA  1 
ATOM   1983 C C   . LYS C 1 8   ? -7.599  -9.034  -14.111 1.00 41.60 ? 64  LYS C C   1 
ATOM   1984 O O   . LYS C 1 8   ? -8.516  -8.769  -13.341 1.00 41.72 ? 64  LYS C O   1 
ATOM   1985 C CB  . LYS C 1 8   ? -8.114  -11.527 -13.957 1.00 42.21 ? 64  LYS C CB  1 
ATOM   1986 C CG  . LYS C 1 8   ? -8.158  -12.874 -14.694 1.00 42.49 ? 64  LYS C CG  1 
ATOM   1987 C CD  . LYS C 1 8   ? -8.958  -13.925 -13.940 1.00 42.62 ? 64  LYS C CD  1 
ATOM   1988 C CE  . LYS C 1 8   ? -8.060  -14.844 -13.132 1.00 43.11 ? 64  LYS C CE  1 
ATOM   1989 N NZ  . LYS C 1 8   ? -7.293  -15.784 -14.005 1.00 43.14 ? 64  LYS C NZ  1 
ATOM   1990 N N   . TRP C 1 9   ? -6.630  -8.166  -14.378 1.00 40.86 ? 65  TRP C N   1 
ATOM   1991 C CA  . TRP C 1 9   ? -6.830  -6.724  -14.199 1.00 40.50 ? 65  TRP C CA  1 
ATOM   1992 C C   . TRP C 1 9   ? -7.258  -6.186  -15.561 1.00 40.11 ? 65  TRP C C   1 
ATOM   1993 O O   . TRP C 1 9   ? -6.999  -6.825  -16.575 1.00 40.46 ? 65  TRP C O   1 
ATOM   1994 C CB  . TRP C 1 9   ? -5.540  -6.041  -13.744 1.00 40.18 ? 65  TRP C CB  1 
ATOM   1995 C CG  . TRP C 1 9   ? -5.219  -6.267  -12.313 1.00 39.80 ? 65  TRP C CG  1 
ATOM   1996 C CD1 . TRP C 1 9   ? -5.165  -7.462  -11.660 1.00 39.92 ? 65  TRP C CD1 1 
ATOM   1997 C CD2 . TRP C 1 9   ? -4.899  -5.267  -11.345 1.00 40.03 ? 65  TRP C CD2 1 
ATOM   1998 N NE1 . TRP C 1 9   ? -4.833  -7.270  -10.343 1.00 39.75 ? 65  TRP C NE1 1 
ATOM   1999 C CE2 . TRP C 1 9   ? -4.661  -5.930  -10.124 1.00 40.28 ? 65  TRP C CE2 1 
ATOM   2000 C CE3 . TRP C 1 9   ? -4.793  -3.873  -11.391 1.00 39.08 ? 65  TRP C CE3 1 
ATOM   2001 C CZ2 . TRP C 1 9   ? -4.327  -5.244  -8.957  1.00 40.06 ? 65  TRP C CZ2 1 
ATOM   2002 C CZ3 . TRP C 1 9   ? -4.460  -3.203  -10.246 1.00 39.68 ? 65  TRP C CZ3 1 
ATOM   2003 C CH2 . TRP C 1 9   ? -4.232  -3.886  -9.037  1.00 39.71 ? 65  TRP C CH2 1 
ATOM   2004 N N   . VAL C 1 10  ? -7.910  -5.030  -15.611 1.00 39.71 ? 66  VAL C N   1 
ATOM   2005 C CA  . VAL C 1 10  ? -8.344  -4.494  -16.897 1.00 39.39 ? 66  VAL C CA  1 
ATOM   2006 C C   . VAL C 1 10  ? -7.407  -3.353  -17.247 1.00 39.32 ? 66  VAL C C   1 
ATOM   2007 O O   . VAL C 1 10  ? -7.120  -2.502  -16.400 1.00 39.10 ? 66  VAL C O   1 
ATOM   2008 C CB  . VAL C 1 10  ? -9.847  -4.063  -16.901 1.00 39.45 ? 66  VAL C CB  1 
ATOM   2009 C CG1 . VAL C 1 10  ? -10.646 -4.825  -15.820 1.00 38.69 ? 66  VAL C CG1 1 
ATOM   2010 C CG2 . VAL C 1 10  ? -10.011 -2.568  -16.732 1.00 39.16 ? 66  VAL C CG2 1 
ATOM   2011 N N   . GLY C 1 11  ? -6.894  -3.367  -18.476 1.00 39.25 ? 67  GLY C N   1 
ATOM   2012 C CA  . GLY C 1 11  ? -5.987  -2.331  -18.954 1.00 39.28 ? 67  GLY C CA  1 
ATOM   2013 C C   . GLY C 1 11  ? -6.731  -1.338  -19.819 1.00 39.35 ? 67  GLY C C   1 
ATOM   2014 O O   . GLY C 1 11  ? -7.544  -1.740  -20.641 1.00 39.54 ? 67  GLY C O   1 
ATOM   2015 N N   . TYR C 1 12  ? -6.465  -0.045  -19.637 1.00 39.31 ? 68  TYR C N   1 
ATOM   2016 C CA  . TYR C 1 12  ? -7.180  1.010   -20.370 1.00 39.43 ? 68  TYR C CA  1 
ATOM   2017 C C   . TYR C 1 12  ? -6.427  2.332   -20.226 1.00 39.61 ? 68  TYR C C   1 
ATOM   2018 O O   . TYR C 1 12  ? -6.169  2.781   -19.106 1.00 39.79 ? 68  TYR C O   1 
ATOM   2019 C CB  . TYR C 1 12  ? -8.619  1.138   -19.838 1.00 38.99 ? 68  TYR C CB  1 
ATOM   2020 C CG  . TYR C 1 12  ? -9.472  2.212   -20.478 1.00 38.71 ? 68  TYR C CG  1 
ATOM   2021 C CD1 . TYR C 1 12  ? -9.749  2.189   -21.834 1.00 38.45 ? 68  TYR C CD1 1 
ATOM   2022 C CD2 . TYR C 1 12  ? -10.033 3.233   -19.717 1.00 38.19 ? 68  TYR C CD2 1 
ATOM   2023 C CE1 . TYR C 1 12  ? -10.541 3.170   -22.433 1.00 38.59 ? 68  TYR C CE1 1 
ATOM   2024 C CE2 . TYR C 1 12  ? -10.836 4.215   -20.299 1.00 38.37 ? 68  TYR C CE2 1 
ATOM   2025 C CZ  . TYR C 1 12  ? -11.086 4.183   -21.659 1.00 38.93 ? 68  TYR C CZ  1 
ATOM   2026 O OH  . TYR C 1 12  ? -11.876 5.157   -22.240 1.00 37.77 ? 68  TYR C OH  1 
ATOM   2027 N N   . ARG C 1 13  ? -6.069  2.934   -21.362 1.00 40.07 ? 69  ARG C N   1 
ATOM   2028 C CA  . ARG C 1 13  ? -5.317  4.194   -21.409 1.00 40.52 ? 69  ARG C CA  1 
ATOM   2029 C C   . ARG C 1 13  ? -3.973  4.062   -20.679 1.00 40.78 ? 69  ARG C C   1 
ATOM   2030 O O   . ARG C 1 13  ? -3.571  4.945   -19.912 1.00 40.66 ? 69  ARG C O   1 
ATOM   2031 C CB  . ARG C 1 13  ? -6.146  5.349   -20.825 1.00 41.03 ? 69  ARG C CB  1 
ATOM   2032 C CG  . ARG C 1 13  ? -7.585  5.448   -21.355 1.00 41.75 ? 69  ARG C CG  1 
ATOM   2033 C CD  . ARG C 1 13  ? -7.713  6.352   -22.592 1.00 43.66 ? 69  ARG C CD  1 
ATOM   2034 N NE  . ARG C 1 13  ? -9.102  6.748   -22.843 1.00 44.01 ? 69  ARG C NE  1 
ATOM   2035 C CZ  . ARG C 1 13  ? -9.808  7.581   -22.069 1.00 45.40 ? 69  ARG C CZ  1 
ATOM   2036 N NH1 . ARG C 1 13  ? -9.276  8.126   -20.974 1.00 45.43 ? 69  ARG C NH1 1 
ATOM   2037 N NH2 . ARG C 1 13  ? -11.071 7.865   -22.379 1.00 45.78 ? 69  ARG C NH2 1 
ATOM   2038 N N   . CYS C 1 14  ? -3.299  2.939   -20.925 1.00 41.14 ? 70  CYS C N   1 
ATOM   2039 C CA  . CYS C 1 14  ? -2.015  2.614   -20.307 1.00 41.08 ? 70  CYS C CA  1 
ATOM   2040 C C   . CYS C 1 14  ? -2.051  2.664   -18.780 1.00 41.02 ? 70  CYS C C   1 
ATOM   2041 O O   . CYS C 1 14  ? -1.061  3.026   -18.148 1.00 40.91 ? 70  CYS C O   1 
ATOM   2042 C CB  . CYS C 1 14  ? -0.909  3.524   -20.859 1.00 41.60 ? 70  CYS C CB  1 
ATOM   2043 S SG  . CYS C 1 14  ? 0.795   2.897   -20.606 1.00 42.50 ? 70  CYS C SG  1 
ATOM   2044 N N   . ASN C 1 15  ? -3.204  2.312   -18.207 1.00 40.78 ? 71  ASN C N   1 
ATOM   2045 C CA  . ASN C 1 15  ? -3.334  2.029   -16.778 1.00 40.73 ? 71  ASN C CA  1 
ATOM   2046 C C   . ASN C 1 15  ? -3.876  0.613   -16.596 1.00 40.63 ? 71  ASN C C   1 
ATOM   2047 O O   . ASN C 1 15  ? -4.320  -0.010  -17.559 1.00 40.71 ? 71  ASN C O   1 
ATOM   2048 C CB  . ASN C 1 15  ? -4.289  3.009   -16.100 1.00 40.96 ? 71  ASN C CB  1 
ATOM   2049 C CG  . ASN C 1 15  ? -3.758  4.422   -16.062 1.00 41.13 ? 71  ASN C CG  1 
ATOM   2050 O OD1 . ASN C 1 15  ? -2.552  4.652   -16.119 1.00 41.38 ? 71  ASN C OD1 1 
ATOM   2051 N ND2 . ASN C 1 15  ? -4.663  5.380   -15.961 1.00 41.36 ? 71  ASN C ND2 1 
ATOM   2052 N N   . CYS C 1 16  ? -3.822  0.109   -15.369 1.00 40.24 ? 72  CYS C N   1 
ATOM   2053 C CA  . CYS C 1 16  ? -4.378  -1.190  -15.049 1.00 40.10 ? 72  CYS C CA  1 
ATOM   2054 C C   . CYS C 1 16  ? -5.352  -1.015  -13.915 1.00 39.65 ? 72  CYS C C   1 
ATOM   2055 O O   . CYS C 1 16  ? -5.029  -0.369  -12.930 1.00 39.51 ? 72  CYS C O   1 
ATOM   2056 C CB  . CYS C 1 16  ? -3.287  -2.163  -14.615 1.00 40.33 ? 72  CYS C CB  1 
ATOM   2057 S SG  . CYS C 1 16  ? -1.906  -2.295  -15.753 1.00 42.15 ? 72  CYS C SG  1 
ATOM   2058 N N   . TYR C 1 17  ? -6.538  -1.597  -14.050 1.00 39.30 ? 73  TYR C N   1 
ATOM   2059 C CA  . TYR C 1 17  ? -7.566  -1.487  -13.031 1.00 39.06 ? 73  TYR C CA  1 
ATOM   2060 C C   . TYR C 1 17  ? -7.964  -2.855  -12.494 1.00 38.86 ? 73  TYR C C   1 
ATOM   2061 O O   . TYR C 1 17  ? -7.981  -3.845  -13.230 1.00 38.87 ? 73  TYR C O   1 
ATOM   2062 C CB  . TYR C 1 17  ? -8.787  -0.764  -13.606 1.00 39.00 ? 73  TYR C CB  1 
ATOM   2063 C CG  . TYR C 1 17  ? -8.501  0.654   -14.044 1.00 38.61 ? 73  TYR C CG  1 
ATOM   2064 C CD1 . TYR C 1 17  ? -8.176  0.935   -15.363 1.00 39.09 ? 73  TYR C CD1 1 
ATOM   2065 C CD2 . TYR C 1 17  ? -8.546  1.712   -13.137 1.00 38.72 ? 73  TYR C CD2 1 
ATOM   2066 C CE1 . TYR C 1 17  ? -7.907  2.227   -15.779 1.00 39.02 ? 73  TYR C CE1 1 
ATOM   2067 C CE2 . TYR C 1 17  ? -8.280  3.015   -13.537 1.00 38.88 ? 73  TYR C CE2 1 
ATOM   2068 C CZ  . TYR C 1 17  ? -7.962  3.262   -14.866 1.00 39.20 ? 73  TYR C CZ  1 
ATOM   2069 O OH  . TYR C 1 17  ? -7.682  4.530   -15.306 1.00 39.23 ? 73  TYR C OH  1 
ATOM   2070 N N   . PHE C 1 18  ? -8.267  -2.902  -11.202 1.00 38.92 ? 74  PHE C N   1 
ATOM   2071 C CA  . PHE C 1 18  ? -8.823  -4.093  -10.556 1.00 38.93 ? 74  PHE C CA  1 
ATOM   2072 C C   . PHE C 1 18  ? -10.125 -3.690  -9.881  1.00 38.60 ? 74  PHE C C   1 
ATOM   2073 O O   . PHE C 1 18  ? -10.113 -2.914  -8.940  1.00 38.08 ? 74  PHE C O   1 
ATOM   2074 C CB  . PHE C 1 18  ? -7.828  -4.636  -9.529  1.00 39.46 ? 74  PHE C CB  1 
ATOM   2075 C CG  . PHE C 1 18  ? -8.376  -5.731  -8.637  1.00 39.44 ? 74  PHE C CG  1 
ATOM   2076 C CD1 . PHE C 1 18  ? -8.854  -5.442  -7.371  1.00 39.40 ? 74  PHE C CD1 1 
ATOM   2077 C CD2 . PHE C 1 18  ? -8.372  -7.051  -9.053  1.00 41.24 ? 74  PHE C CD2 1 
ATOM   2078 C CE1 . PHE C 1 18  ? -9.338  -6.440  -6.544  1.00 40.09 ? 74  PHE C CE1 1 
ATOM   2079 C CE2 . PHE C 1 18  ? -8.868  -8.063  -8.226  1.00 40.83 ? 74  PHE C CE2 1 
ATOM   2080 C CZ  . PHE C 1 18  ? -9.343  -7.752  -6.969  1.00 40.12 ? 74  PHE C CZ  1 
ATOM   2081 N N   . ILE C 1 19  ? -11.243 -4.218  -10.375 1.00 38.85 ? 75  ILE C N   1 
ATOM   2082 C CA  . ILE C 1 19  ? -12.568 -3.880  -9.862  1.00 38.72 ? 75  ILE C CA  1 
ATOM   2083 C C   . ILE C 1 19  ? -12.987 -5.025  -8.981  1.00 38.73 ? 75  ILE C C   1 
ATOM   2084 O O   . ILE C 1 19  ? -13.132 -6.155  -9.445  1.00 38.49 ? 75  ILE C O   1 
ATOM   2085 C CB  . ILE C 1 19  ? -13.615 -3.713  -10.984 1.00 38.68 ? 75  ILE C CB  1 
ATOM   2086 C CG1 . ILE C 1 19  ? -13.022 -3.028  -12.223 1.00 39.02 ? 75  ILE C CG1 1 
ATOM   2087 C CG2 . ILE C 1 19  ? -14.799 -2.932  -10.478 1.00 38.99 ? 75  ILE C CG2 1 
ATOM   2088 C CD1 . ILE C 1 19  ? -12.264 -1.758  -11.931 1.00 38.81 ? 75  ILE C CD1 1 
ATOM   2089 N N   . SER C 1 20  ? -13.166 -4.748  -7.698  1.00 39.23 ? 76  SER C N   1 
ATOM   2090 C CA  . SER C 1 20  ? -13.416 -5.819  -6.733  1.00 39.71 ? 76  SER C CA  1 
ATOM   2091 C C   . SER C 1 20  ? -14.859 -6.327  -6.785  1.00 39.89 ? 76  SER C C   1 
ATOM   2092 O O   . SER C 1 20  ? -15.779 -5.605  -7.148  1.00 39.92 ? 76  SER C O   1 
ATOM   2093 C CB  . SER C 1 20  ? -13.106 -5.342  -5.315  1.00 39.81 ? 76  SER C CB  1 
ATOM   2094 O OG  . SER C 1 20  ? -14.215 -4.654  -4.759  1.00 40.22 ? 76  SER C OG  1 
ATOM   2095 N N   . SER C 1 21  ? -15.030 -7.588  -6.427  1.00 40.41 ? 77  SER C N   1 
ATOM   2096 C CA  . SER C 1 21  ? -16.336 -8.173  -6.138  1.00 40.61 ? 77  SER C CA  1 
ATOM   2097 C C   . SER C 1 21  ? -16.521 -8.279  -4.626  1.00 40.68 ? 77  SER C C   1 
ATOM   2098 O O   . SER C 1 21  ? -17.640 -8.277  -4.121  1.00 40.77 ? 77  SER C O   1 
ATOM   2099 C CB  . SER C 1 21  ? -16.402 -9.547  -6.775  1.00 40.71 ? 77  SER C CB  1 
ATOM   2100 O OG  . SER C 1 21  ? -16.121 -9.429  -8.165  1.00 41.97 ? 77  SER C OG  1 
ATOM   2101 N N   . GLU C 1 22  ? -15.386 -8.346  -3.935  1.00 40.78 ? 78  GLU C N   1 
ATOM   2102 C CA  . GLU C 1 22  ? -15.276 -8.433  -2.488  1.00 40.62 ? 78  GLU C CA  1 
ATOM   2103 C C   . GLU C 1 22  ? -15.490 -7.044  -1.900  1.00 40.42 ? 78  GLU C C   1 
ATOM   2104 O O   . GLU C 1 22  ? -15.043 -6.053  -2.478  1.00 40.52 ? 78  GLU C O   1 
ATOM   2105 C CB  . GLU C 1 22  ? -13.860 -8.893  -2.176  1.00 40.66 ? 78  GLU C CB  1 
ATOM   2106 C CG  . GLU C 1 22  ? -13.597 -9.482  -0.828  1.00 41.14 ? 78  GLU C CG  1 
ATOM   2107 C CD  . GLU C 1 22  ? -12.106 -9.693  -0.634  1.00 41.77 ? 78  GLU C CD  1 
ATOM   2108 O OE1 . GLU C 1 22  ? -11.331 -8.974  -1.317  1.00 43.07 ? 78  GLU C OE1 1 
ATOM   2109 O OE2 . GLU C 1 22  ? -11.712 -10.566 0.183   1.00 43.18 ? 78  GLU C OE2 1 
ATOM   2110 N N   . GLN C 1 23  ? -16.167 -6.979  -0.758  1.00 39.79 ? 79  GLN C N   1 
ATOM   2111 C CA  . GLN C 1 23  ? -16.464 -5.710  -0.123  1.00 39.56 ? 79  GLN C CA  1 
ATOM   2112 C C   . GLN C 1 23  ? -15.691 -5.567  1.160   1.00 39.08 ? 79  GLN C C   1 
ATOM   2113 O O   . GLN C 1 23  ? -15.782 -6.406  2.043   1.00 39.47 ? 79  GLN C O   1 
ATOM   2114 C CB  . GLN C 1 23  ? -17.956 -5.563  0.151   1.00 39.56 ? 79  GLN C CB  1 
ATOM   2115 C CG  . GLN C 1 23  ? -18.788 -5.445  -1.111  1.00 39.61 ? 79  GLN C CG  1 
ATOM   2116 C CD  . GLN C 1 23  ? -20.265 -5.523  -0.837  1.00 39.48 ? 79  GLN C CD  1 
ATOM   2117 O OE1 . GLN C 1 23  ? -20.928 -6.503  -1.190  1.00 39.38 ? 79  GLN C OE1 1 
ATOM   2118 N NE2 . GLN C 1 23  ? -20.789 -4.501  -0.171  1.00 41.11 ? 79  GLN C NE2 1 
ATOM   2119 N N   . LYS C 1 24  ? -14.937 -4.482  1.262   1.00 38.82 ? 80  LYS C N   1 
ATOM   2120 C CA  . LYS C 1 24  ? -14.051 -4.275  2.379   1.00 38.72 ? 80  LYS C CA  1 
ATOM   2121 C C   . LYS C 1 24  ? -14.109 -2.829  2.864   1.00 38.71 ? 80  LYS C C   1 
ATOM   2122 O O   . LYS C 1 24  ? -14.595 -1.925  2.174   1.00 39.07 ? 80  LYS C O   1 
ATOM   2123 C CB  . LYS C 1 24  ? -12.608 -4.624  1.994   1.00 38.84 ? 80  LYS C CB  1 
ATOM   2124 C CG  . LYS C 1 24  ? -12.382 -6.026  1.428   1.00 38.95 ? 80  LYS C CG  1 
ATOM   2125 C CD  . LYS C 1 24  ? -12.563 -7.144  2.445   1.00 39.81 ? 80  LYS C CD  1 
ATOM   2126 C CE  . LYS C 1 24  ? -11.223 -7.749  2.909   1.00 40.16 ? 80  LYS C CE  1 
ATOM   2127 N NZ  . LYS C 1 24  ? -11.404 -9.000  3.717   1.00 38.57 ? 80  LYS C NZ  1 
ATOM   2128 N N   . THR C 1 25  ? -13.566 -2.632  4.054   1.00 38.34 ? 81  THR C N   1 
ATOM   2129 C CA  . THR C 1 25  ? -13.508 -1.337  4.699   1.00 38.27 ? 81  THR C CA  1 
ATOM   2130 C C   . THR C 1 25  ? -12.603 -0.453  3.835   1.00 38.05 ? 81  THR C C   1 
ATOM   2131 O O   . THR C 1 25  ? -11.892 -0.961  2.968   1.00 37.66 ? 81  THR C O   1 
ATOM   2132 C CB  . THR C 1 25  ? -12.983 -1.508  6.173   1.00 38.09 ? 81  THR C CB  1 
ATOM   2133 O OG1 . THR C 1 25  ? -13.966 -1.058  7.111   1.00 37.76 ? 81  THR C OG1 1 
ATOM   2134 C CG2 . THR C 1 25  ? -11.664 -0.801  6.402   1.00 37.76 ? 81  THR C CG2 1 
ATOM   2135 N N   . TRP C 1 26  ? -12.659 0.859   4.041   1.00 38.35 ? 82  TRP C N   1 
ATOM   2136 C CA  . TRP C 1 26  ? -11.866 1.787   3.252   1.00 38.74 ? 82  TRP C CA  1 
ATOM   2137 C C   . TRP C 1 26  ? -10.372 1.515   3.458   1.00 39.35 ? 82  TRP C C   1 
ATOM   2138 O O   . TRP C 1 26  ? -9.605  1.450   2.491   1.00 39.65 ? 82  TRP C O   1 
ATOM   2139 C CB  . TRP C 1 26  ? -12.198 3.245   3.605   1.00 38.43 ? 82  TRP C CB  1 
ATOM   2140 C CG  . TRP C 1 26  ? -11.399 4.217   2.783   1.00 38.05 ? 82  TRP C CG  1 
ATOM   2141 C CD1 . TRP C 1 26  ? -11.700 4.669   1.542   1.00 37.68 ? 82  TRP C CD1 1 
ATOM   2142 C CD2 . TRP C 1 26  ? -10.145 4.814   3.134   1.00 38.00 ? 82  TRP C CD2 1 
ATOM   2143 N NE1 . TRP C 1 26  ? -10.724 5.522   1.104   1.00 37.60 ? 82  TRP C NE1 1 
ATOM   2144 C CE2 . TRP C 1 26  ? -9.757  5.629   2.059   1.00 37.29 ? 82  TRP C CE2 1 
ATOM   2145 C CE3 . TRP C 1 26  ? -9.315  4.744   4.259   1.00 38.21 ? 82  TRP C CE3 1 
ATOM   2146 C CZ2 . TRP C 1 26  ? -8.572  6.360   2.062   1.00 37.83 ? 82  TRP C CZ2 1 
ATOM   2147 C CZ3 . TRP C 1 26  ? -8.144  5.476   4.264   1.00 37.57 ? 82  TRP C CZ3 1 
ATOM   2148 C CH2 . TRP C 1 26  ? -7.786  6.277   3.172   1.00 37.57 ? 82  TRP C CH2 1 
ATOM   2149 N N   . ASN C 1 27  ? -9.968  1.361   4.717   1.00 39.80 ? 83  ASN C N   1 
ATOM   2150 C CA  . ASN C 1 27  ? -8.592  0.991   5.041   1.00 40.26 ? 83  ASN C CA  1 
ATOM   2151 C C   . ASN C 1 27  ? -8.166  -0.389  4.571   1.00 40.35 ? 83  ASN C C   1 
ATOM   2152 O O   . ASN C 1 27  ? -7.034  -0.568  4.136   1.00 40.62 ? 83  ASN C O   1 
ATOM   2153 C CB  . ASN C 1 27  ? -8.337  1.078   6.544   1.00 40.75 ? 83  ASN C CB  1 
ATOM   2154 C CG  . ASN C 1 27  ? -7.396  2.186   6.892   1.00 41.67 ? 83  ASN C CG  1 
ATOM   2155 O OD1 . ASN C 1 27  ? -7.751  3.363   6.804   1.00 43.88 ? 83  ASN C OD1 1 
ATOM   2156 N ND2 . ASN C 1 27  ? -6.175  1.827   7.268   1.00 42.11 ? 83  ASN C ND2 1 
ATOM   2157 N N   . GLU C 1 28  ? -9.049  -1.367  4.698   1.00 40.55 ? 84  GLU C N   1 
ATOM   2158 C CA  . GLU C 1 28  ? -8.760  -2.720  4.241   1.00 40.79 ? 84  GLU C CA  1 
ATOM   2159 C C   . GLU C 1 28  ? -8.584  -2.699  2.726   1.00 41.07 ? 84  GLU C C   1 
ATOM   2160 O O   . GLU C 1 28  ? -7.732  -3.415  2.193   1.00 41.35 ? 84  GLU C O   1 
ATOM   2161 C CB  . GLU C 1 28  ? -9.877  -3.694  4.625   1.00 40.80 ? 84  GLU C CB  1 
ATOM   2162 C CG  . GLU C 1 28  ? -10.016 -3.983  6.115   1.00 40.39 ? 84  GLU C CG  1 
ATOM   2163 C CD  . GLU C 1 28  ? -11.313 -4.738  6.470   1.00 41.03 ? 84  GLU C CD  1 
ATOM   2164 O OE1 . GLU C 1 28  ? -12.247 -4.814  5.635   1.00 39.90 ? 84  GLU C OE1 1 
ATOM   2165 O OE2 . GLU C 1 28  ? -11.411 -5.253  7.605   1.00 41.44 ? 84  GLU C OE2 1 
ATOM   2166 N N   . SER C 1 29  ? -9.372  -1.868  2.041   1.00 41.07 ? 85  SER C N   1 
ATOM   2167 C CA  . SER C 1 29  ? -9.249  -1.710  0.589   1.00 41.13 ? 85  SER C CA  1 
ATOM   2168 C C   . SER C 1 29  ? -7.904  -1.069  0.283   1.00 41.64 ? 85  SER C C   1 
ATOM   2169 O O   . SER C 1 29  ? -7.172  -1.493  -0.630  1.00 41.83 ? 85  SER C O   1 
ATOM   2170 C CB  . SER C 1 29  ? -10.382 -0.833  0.027   1.00 41.10 ? 85  SER C CB  1 
ATOM   2171 O OG  . SER C 1 29  ? -11.667 -1.383  0.291   1.00 39.60 ? 85  SER C OG  1 
ATOM   2172 N N   . ARG C 1 30  ? -7.576  -0.050  1.074   1.00 41.72 ? 86  ARG C N   1 
ATOM   2173 C CA  . ARG C 1 30  ? -6.343  0.694   0.902   1.00 41.64 ? 86  ARG C CA  1 
ATOM   2174 C C   . ARG C 1 30  ? -5.120  -0.220  1.006   1.00 41.39 ? 86  ARG C C   1 
ATOM   2175 O O   . ARG C 1 30  ? -4.132  -0.041  0.294   1.00 41.06 ? 86  ARG C O   1 
ATOM   2176 C CB  . ARG C 1 30  ? -6.282  1.803   1.953   1.00 41.94 ? 86  ARG C CB  1 
ATOM   2177 C CG  . ARG C 1 30  ? -5.080  2.729   1.842   1.00 42.43 ? 86  ARG C CG  1 
ATOM   2178 C CD  . ARG C 1 30  ? -5.128  3.847   2.882   1.00 43.35 ? 86  ARG C CD  1 
ATOM   2179 N NE  . ARG C 1 30  ? -3.802  4.112   3.443   1.00 44.66 ? 86  ARG C NE  1 
ATOM   2180 C CZ  . ARG C 1 30  ? -3.346  3.609   4.592   1.00 46.21 ? 86  ARG C CZ  1 
ATOM   2181 N NH1 . ARG C 1 30  ? -4.111  2.820   5.351   1.00 46.75 ? 86  ARG C NH1 1 
ATOM   2182 N NH2 . ARG C 1 30  ? -2.109  3.909   5.005   1.00 46.63 ? 86  ARG C NH2 1 
ATOM   2183 N N   . HIS C 1 31  ? -5.192  -1.204  1.891   1.00 41.41 ? 87  HIS C N   1 
ATOM   2184 C CA  . HIS C 1 31  ? -4.070  -2.120  2.112   1.00 41.25 ? 87  HIS C CA  1 
ATOM   2185 C C   . HIS C 1 31  ? -4.006  -3.232  1.068   1.00 40.72 ? 87  HIS C C   1 
ATOM   2186 O O   . HIS C 1 31  ? -2.922  -3.617  0.642   1.00 40.41 ? 87  HIS C O   1 
ATOM   2187 C CB  . HIS C 1 31  ? -4.147  -2.707  3.515   1.00 41.75 ? 87  HIS C CB  1 
ATOM   2188 C CG  . HIS C 1 31  ? -3.916  -1.699  4.599   1.00 43.10 ? 87  HIS C CG  1 
ATOM   2189 N ND1 . HIS C 1 31  ? -2.753  -0.967  4.698   1.00 44.09 ? 87  HIS C ND1 1 
ATOM   2190 C CD2 . HIS C 1 31  ? -4.690  -1.316  5.642   1.00 44.60 ? 87  HIS C CD2 1 
ATOM   2191 C CE1 . HIS C 1 31  ? -2.825  -0.166  5.746   1.00 44.40 ? 87  HIS C CE1 1 
ATOM   2192 N NE2 . HIS C 1 31  ? -3.992  -0.356  6.335   1.00 44.75 ? 87  HIS C NE2 1 
ATOM   2193 N N   . LEU C 1 32  ? -5.168  -3.741  0.663   1.00 40.37 ? 88  LEU C N   1 
ATOM   2194 C CA  . LEU C 1 32  ? -5.252  -4.757  -0.391  1.00 40.00 ? 88  LEU C CA  1 
ATOM   2195 C C   . LEU C 1 32  ? -4.650  -4.244  -1.692  1.00 39.81 ? 88  LEU C C   1 
ATOM   2196 O O   . LEU C 1 32  ? -3.856  -4.944  -2.324  1.00 39.81 ? 88  LEU C O   1 
ATOM   2197 C CB  . LEU C 1 32  ? -6.699  -5.201  -0.614  1.00 39.72 ? 88  LEU C CB  1 
ATOM   2198 C CG  . LEU C 1 32  ? -7.299  -6.090  0.480   1.00 40.08 ? 88  LEU C CG  1 
ATOM   2199 C CD1 . LEU C 1 32  ? -8.816  -6.070  0.394   1.00 41.01 ? 88  LEU C CD1 1 
ATOM   2200 C CD2 . LEU C 1 32  ? -6.787  -7.528  0.385   1.00 39.93 ? 88  LEU C CD2 1 
ATOM   2201 N N   . CYS C 1 33  ? -5.019  -3.027  -2.088  1.00 39.59 ? 89  CYS C N   1 
ATOM   2202 C CA  . CYS C 1 33  ? -4.407  -2.396  -3.260  1.00 39.30 ? 89  CYS C CA  1 
ATOM   2203 C C   . CYS C 1 33  ? -2.921  -2.249  -3.040  1.00 38.96 ? 89  CYS C C   1 
ATOM   2204 O O   . CYS C 1 33  ? -2.137  -2.535  -3.929  1.00 39.63 ? 89  CYS C O   1 
ATOM   2205 C CB  . CYS C 1 33  ? -5.006  -1.017  -3.537  1.00 39.05 ? 89  CYS C CB  1 
ATOM   2206 S SG  . CYS C 1 33  ? -6.750  -1.044  -3.964  1.00 39.01 ? 89  CYS C SG  1 
ATOM   2207 N N   . ALA C 1 34  ? -2.527  -1.803  -1.859  1.00 38.64 ? 90  ALA C N   1 
ATOM   2208 C CA  . ALA C 1 34  ? -1.105  -1.713  -1.535  1.00 38.87 ? 90  ALA C CA  1 
ATOM   2209 C C   . ALA C 1 34  ? -0.415  -3.093  -1.577  1.00 38.58 ? 90  ALA C C   1 
ATOM   2210 O O   . ALA C 1 34  ? 0.732   -3.184  -1.978  1.00 38.79 ? 90  ALA C O   1 
ATOM   2211 C CB  . ALA C 1 34  ? -0.896  -1.016  -0.162  1.00 38.37 ? 90  ALA C CB  1 
ATOM   2212 N N   . SER C 1 35  ? -1.115  -4.160  -1.187  1.00 38.80 ? 91  SER C N   1 
ATOM   2213 C CA  . SER C 1 35  ? -0.563  -5.532  -1.285  1.00 39.05 ? 91  SER C CA  1 
ATOM   2214 C C   . SER C 1 35  ? -0.393  -5.999  -2.736  1.00 39.12 ? 91  SER C C   1 
ATOM   2215 O O   . SER C 1 35  ? 0.416   -6.883  -3.017  1.00 38.78 ? 91  SER C O   1 
ATOM   2216 C CB  . SER C 1 35  ? -1.428  -6.537  -0.515  1.00 38.83 ? 91  SER C CB  1 
ATOM   2217 O OG  . SER C 1 35  ? -2.570  -6.937  -1.252  1.00 39.17 ? 91  SER C OG  1 
ATOM   2218 N N   . GLN C 1 36  ? -1.165  -5.409  -3.648  1.00 39.46 ? 92  GLN C N   1 
ATOM   2219 C CA  . GLN C 1 36  ? -1.029  -5.678  -5.074  1.00 39.89 ? 92  GLN C CA  1 
ATOM   2220 C C   . GLN C 1 36  ? -0.091  -4.679  -5.740  1.00 40.01 ? 92  GLN C C   1 
ATOM   2221 O O   . GLN C 1 36  ? -0.032  -4.617  -6.965  1.00 40.07 ? 92  GLN C O   1 
ATOM   2222 C CB  . GLN C 1 36  ? -2.396  -5.602  -5.754  1.00 39.99 ? 92  GLN C CB  1 
ATOM   2223 C CG  . GLN C 1 36  ? -3.432  -6.505  -5.154  1.00 40.48 ? 92  GLN C CG  1 
ATOM   2224 C CD  . GLN C 1 36  ? -3.099  -7.944  -5.390  1.00 42.20 ? 92  GLN C CD  1 
ATOM   2225 O OE1 . GLN C 1 36  ? -3.148  -8.421  -6.526  1.00 43.74 ? 92  GLN C OE1 1 
ATOM   2226 N NE2 . GLN C 1 36  ? -2.741  -8.653  -4.326  1.00 42.42 ? 92  GLN C NE2 1 
ATOM   2227 N N   . LYS C 1 37  ? 0.632   -3.902  -4.933  1.00 40.47 ? 93  LYS C N   1 
ATOM   2228 C CA  . LYS C 1 37  ? 1.522   -2.844  -5.424  1.00 40.79 ? 93  LYS C CA  1 
ATOM   2229 C C   . LYS C 1 37  ? 0.768   -1.851  -6.301  1.00 40.99 ? 93  LYS C C   1 
ATOM   2230 O O   . LYS C 1 37  ? 1.175   -1.559  -7.422  1.00 41.47 ? 93  LYS C O   1 
ATOM   2231 C CB  . LYS C 1 37  ? 2.696   -3.438  -6.197  1.00 40.75 ? 93  LYS C CB  1 
ATOM   2232 C CG  . LYS C 1 37  ? 3.563   -4.378  -5.373  1.00 41.03 ? 93  LYS C CG  1 
ATOM   2233 C CD  . LYS C 1 37  ? 4.138   -5.518  -6.219  1.00 41.41 ? 93  LYS C CD  1 
ATOM   2234 C CE  . LYS C 1 37  ? 4.858   -5.030  -7.489  1.00 41.87 ? 93  LYS C CE  1 
ATOM   2235 N NZ  . LYS C 1 37  ? 3.935   -4.932  -8.663  1.00 41.89 ? 93  LYS C NZ  1 
ATOM   2236 N N   . SER C 1 38  ? -0.343  -1.346  -5.782  1.00 41.14 ? 94  SER C N   1 
ATOM   2237 C CA  . SER C 1 38  ? -1.138  -0.349  -6.481  1.00 41.14 ? 94  SER C CA  1 
ATOM   2238 C C   . SER C 1 38  ? -1.834  0.548   -5.470  1.00 41.30 ? 94  SER C C   1 
ATOM   2239 O O   . SER C 1 38  ? -1.738  0.318   -4.275  1.00 41.44 ? 94  SER C O   1 
ATOM   2240 C CB  . SER C 1 38  ? -2.171  -1.033  -7.370  1.00 40.93 ? 94  SER C CB  1 
ATOM   2241 O OG  . SER C 1 38  ? -3.123  -1.713  -6.580  1.00 40.81 ? 94  SER C OG  1 
ATOM   2242 N N   . SER C 1 39  ? -2.545  1.560   -5.966  1.00 41.53 ? 95  SER C N   1 
ATOM   2243 C CA  . SER C 1 39  ? -3.271  2.490   -5.126  1.00 41.44 ? 95  SER C CA  1 
ATOM   2244 C C   . SER C 1 39  ? -4.778  2.373   -5.305  1.00 41.37 ? 95  SER C C   1 
ATOM   2245 O O   . SER C 1 39  ? -5.274  1.940   -6.344  1.00 41.16 ? 95  SER C O   1 
ATOM   2246 C CB  . SER C 1 39  ? -2.855  3.918   -5.459  1.00 41.49 ? 95  SER C CB  1 
ATOM   2247 O OG  . SER C 1 39  ? -1.520  4.130   -5.081  1.00 42.47 ? 95  SER C OG  1 
ATOM   2248 N N   . LEU C 1 40  ? -5.496  2.787   -4.272  1.00 41.25 ? 96  LEU C N   1 
ATOM   2249 C CA  . LEU C 1 40  ? -6.928  2.936   -4.353  1.00 41.51 ? 96  LEU C CA  1 
ATOM   2250 C C   . LEU C 1 40  ? -7.189  4.041   -5.382  1.00 42.08 ? 96  LEU C C   1 
ATOM   2251 O O   . LEU C 1 40  ? -6.477  5.043   -5.427  1.00 42.18 ? 96  LEU C O   1 
ATOM   2252 C CB  . LEU C 1 40  ? -7.479  3.291   -2.974  1.00 41.55 ? 96  LEU C CB  1 
ATOM   2253 C CG  . LEU C 1 40  ? -8.913  2.978   -2.556  1.00 41.06 ? 96  LEU C CG  1 
ATOM   2254 C CD1 . LEU C 1 40  ? -9.420  1.608   -3.027  1.00 39.22 ? 96  LEU C CD1 1 
ATOM   2255 C CD2 . LEU C 1 40  ? -8.978  3.118   -1.022  1.00 40.04 ? 96  LEU C CD2 1 
ATOM   2256 N N   . LEU C 1 41  ? -8.186  3.827   -6.231  1.00 42.10 ? 97  LEU C N   1 
ATOM   2257 C CA  . LEU C 1 41  ? -8.428  4.684   -7.381  1.00 42.21 ? 97  LEU C CA  1 
ATOM   2258 C C   . LEU C 1 41  ? -8.249  6.172   -7.105  1.00 42.39 ? 97  LEU C C   1 
ATOM   2259 O O   . LEU C 1 41  ? -8.992  6.762   -6.329  1.00 42.06 ? 97  LEU C O   1 
ATOM   2260 C CB  . LEU C 1 41  ? -9.848  4.438   -7.915  1.00 42.28 ? 97  LEU C CB  1 
ATOM   2261 C CG  . LEU C 1 41  ? -10.317 5.287   -9.094  1.00 41.90 ? 97  LEU C CG  1 
ATOM   2262 C CD1 . LEU C 1 41  ? -9.454  5.034   -10.298 1.00 43.34 ? 97  LEU C CD1 1 
ATOM   2263 C CD2 . LEU C 1 41  ? -11.751 4.984   -9.403  1.00 42.31 ? 97  LEU C CD2 1 
ATOM   2264 N N   . GLN C 1 42  ? -7.255  6.755   -7.764  1.00 43.10 ? 98  GLN C N   1 
ATOM   2265 C CA  . GLN C 1 42  ? -7.150  8.204   -7.947  1.00 43.24 ? 98  GLN C CA  1 
ATOM   2266 C C   . GLN C 1 42  ? -7.809  8.536   -9.271  1.00 43.38 ? 98  GLN C C   1 
ATOM   2267 O O   . GLN C 1 42  ? -7.381  8.042   -10.312 1.00 43.34 ? 98  GLN C O   1 
ATOM   2268 C CB  . GLN C 1 42  ? -5.678  8.644   -7.959  1.00 43.16 ? 98  GLN C CB  1 
ATOM   2269 C CG  . GLN C 1 42  ? -5.424  10.104  -8.377  1.00 43.57 ? 98  GLN C CG  1 
ATOM   2270 C CD  . GLN C 1 42  ? -3.940  10.521  -8.281  1.00 44.12 ? 98  GLN C CD  1 
ATOM   2271 O OE1 . GLN C 1 42  ? -3.557  11.594  -8.754  1.00 45.50 ? 98  GLN C OE1 1 
ATOM   2272 N NE2 . GLN C 1 42  ? -3.113  9.671   -7.674  1.00 44.17 ? 98  GLN C NE2 1 
ATOM   2273 N N   . LEU C 1 43  ? -8.851  9.365   -9.229  1.00 43.86 ? 99  LEU C N   1 
ATOM   2274 C CA  . LEU C 1 43  ? -9.588  9.772   -10.427 1.00 44.01 ? 99  LEU C CA  1 
ATOM   2275 C C   . LEU C 1 43  ? -9.030  11.086  -10.941 1.00 44.32 ? 99  LEU C C   1 
ATOM   2276 O O   . LEU C 1 43  ? -9.075  12.087  -10.232 1.00 44.92 ? 99  LEU C O   1 
ATOM   2277 C CB  . LEU C 1 43  ? -11.082 9.959   -10.118 1.00 44.07 ? 99  LEU C CB  1 
ATOM   2278 C CG  . LEU C 1 43  ? -12.118 8.934   -10.605 1.00 44.73 ? 99  LEU C CG  1 
ATOM   2279 C CD1 . LEU C 1 43  ? -13.510 9.497   -10.331 1.00 46.14 ? 99  LEU C CD1 1 
ATOM   2280 C CD2 . LEU C 1 43  ? -11.996 8.604   -12.093 1.00 44.13 ? 99  LEU C CD2 1 
ATOM   2281 N N   . GLN C 1 44  ? -8.528  11.092  -12.175 1.00 44.57 ? 100 GLN C N   1 
ATOM   2282 C CA  . GLN C 1 44  ? -7.991  12.313  -12.804 1.00 44.54 ? 100 GLN C CA  1 
ATOM   2283 C C   . GLN C 1 44  ? -9.111  13.040  -13.582 1.00 44.30 ? 100 GLN C C   1 
ATOM   2284 O O   . GLN C 1 44  ? -9.052  14.248  -13.790 1.00 44.22 ? 100 GLN C O   1 
ATOM   2285 C CB  . GLN C 1 44  ? -6.793  11.975  -13.726 1.00 45.07 ? 100 GLN C CB  1 
ATOM   2286 C CG  . GLN C 1 44  ? -5.756  10.931  -13.148 1.00 45.92 ? 100 GLN C CG  1 
ATOM   2287 C CD  . GLN C 1 44  ? -4.484  11.553  -12.521 1.00 47.93 ? 100 GLN C CD  1 
ATOM   2288 O OE1 . GLN C 1 44  ? -3.953  12.568  -13.003 1.00 49.19 ? 100 GLN C OE1 1 
ATOM   2289 N NE2 . GLN C 1 44  ? -3.983  10.920  -11.456 1.00 46.85 ? 100 GLN C NE2 1 
ATOM   2290 N N   . ASN C 1 45  ? -10.111 12.272  -14.019 1.00 44.21 ? 101 ASN C N   1 
ATOM   2291 C CA  . ASN C 1 45  ? -11.371 12.782  -14.578 1.00 43.87 ? 101 ASN C CA  1 
ATOM   2292 C C   . ASN C 1 45  ? -12.360 11.617  -14.770 1.00 43.41 ? 101 ASN C C   1 
ATOM   2293 O O   . ASN C 1 45  ? -11.968 10.456  -14.734 1.00 43.40 ? 101 ASN C O   1 
ATOM   2294 C CB  . ASN C 1 45  ? -11.134 13.517  -15.900 1.00 44.26 ? 101 ASN C CB  1 
ATOM   2295 C CG  . ASN C 1 45  ? -10.339 12.690  -16.898 1.00 45.26 ? 101 ASN C CG  1 
ATOM   2296 O OD1 . ASN C 1 45  ? -10.877 11.770  -17.515 1.00 46.95 ? 101 ASN C OD1 1 
ATOM   2297 N ND2 . ASN C 1 45  ? -9.057  13.021  -17.070 1.00 45.18 ? 101 ASN C ND2 1 
ATOM   2298 N N   . THR C 1 46  ? -13.635 11.913  -14.980 1.00 42.88 ? 102 THR C N   1 
ATOM   2299 C CA  . THR C 1 46  ? -14.658 10.861  -15.035 1.00 42.70 ? 102 THR C CA  1 
ATOM   2300 C C   . THR C 1 46  ? -14.554 9.923   -16.262 1.00 42.45 ? 102 THR C C   1 
ATOM   2301 O O   . THR C 1 46  ? -14.934 8.753   -16.195 1.00 42.14 ? 102 THR C O   1 
ATOM   2302 C CB  . THR C 1 46  ? -16.071 11.468  -14.963 1.00 42.68 ? 102 THR C CB  1 
ATOM   2303 O OG1 . THR C 1 46  ? -16.202 12.487  -15.965 1.00 42.89 ? 102 THR C OG1 1 
ATOM   2304 C CG2 . THR C 1 46  ? -16.324 12.074  -13.577 1.00 42.17 ? 102 THR C CG2 1 
ATOM   2305 N N   . ASP C 1 47  ? -14.007 10.415  -17.368 1.00 42.35 ? 103 ASP C N   1 
ATOM   2306 C CA  . ASP C 1 47  ? -13.826 9.584   -18.565 1.00 42.30 ? 103 ASP C CA  1 
ATOM   2307 C C   . ASP C 1 47  ? -12.879 8.406   -18.348 1.00 42.12 ? 103 ASP C C   1 
ATOM   2308 O O   . ASP C 1 47  ? -12.827 7.476   -19.153 1.00 41.79 ? 103 ASP C O   1 
ATOM   2309 C CB  . ASP C 1 47  ? -13.285 10.432  -19.716 1.00 42.55 ? 103 ASP C CB  1 
ATOM   2310 C CG  . ASP C 1 47  ? -14.274 11.471  -20.189 1.00 42.82 ? 103 ASP C CG  1 
ATOM   2311 O OD1 . ASP C 1 47  ? -13.890 12.304  -21.038 1.00 44.45 ? 103 ASP C OD1 1 
ATOM   2312 O OD2 . ASP C 1 47  ? -15.431 11.453  -19.717 1.00 42.98 ? 103 ASP C OD2 1 
ATOM   2313 N N   . GLU C 1 48  ? -12.122 8.467   -17.262 1.00 41.94 ? 104 GLU C N   1 
ATOM   2314 C CA  . GLU C 1 48  ? -11.162 7.437   -16.906 1.00 42.03 ? 104 GLU C CA  1 
ATOM   2315 C C   . GLU C 1 48  ? -11.772 6.025   -16.748 1.00 41.60 ? 104 GLU C C   1 
ATOM   2316 O O   . GLU C 1 48  ? -11.123 5.031   -17.086 1.00 41.09 ? 104 GLU C O   1 
ATOM   2317 C CB  . GLU C 1 48  ? -10.464 7.858   -15.601 1.00 42.31 ? 104 GLU C CB  1 
ATOM   2318 C CG  . GLU C 1 48  ? -9.327  6.955   -15.194 1.00 42.39 ? 104 GLU C CG  1 
ATOM   2319 C CD  . GLU C 1 48  ? -8.511  7.525   -14.072 1.00 42.81 ? 104 GLU C CD  1 
ATOM   2320 O OE1 . GLU C 1 48  ? -8.296  8.754   -14.053 1.00 45.03 ? 104 GLU C OE1 1 
ATOM   2321 O OE2 . GLU C 1 48  ? -8.077  6.737   -13.212 1.00 45.20 ? 104 GLU C OE2 1 
ATOM   2322 N N   . LEU C 1 49  ? -12.992 5.949   -16.207 1.00 41.27 ? 105 LEU C N   1 
ATOM   2323 C CA  . LEU C 1 49  ? -13.732 4.688   -16.108 1.00 41.26 ? 105 LEU C CA  1 
ATOM   2324 C C   . LEU C 1 49  ? -14.927 4.689   -17.048 1.00 41.14 ? 105 LEU C C   1 
ATOM   2325 O O   . LEU C 1 49  ? -16.000 4.192   -16.695 1.00 41.16 ? 105 LEU C O   1 
ATOM   2326 C CB  . LEU C 1 49  ? -14.204 4.434   -14.670 1.00 41.13 ? 105 LEU C CB  1 
ATOM   2327 C CG  . LEU C 1 49  ? -13.131 4.373   -13.574 1.00 40.82 ? 105 LEU C CG  1 
ATOM   2328 C CD1 . LEU C 1 49  ? -13.730 4.018   -12.228 1.00 39.79 ? 105 LEU C CD1 1 
ATOM   2329 C CD2 . LEU C 1 49  ? -12.044 3.384   -13.935 1.00 40.11 ? 105 LEU C CD2 1 
ATOM   2330 N N   . ASP C 1 50  ? -14.732 5.245   -18.246 1.00 41.35 ? 106 ASP C N   1 
ATOM   2331 C CA  . ASP C 1 50  ? -15.755 5.248   -19.305 1.00 41.32 ? 106 ASP C CA  1 
ATOM   2332 C C   . ASP C 1 50  ? -16.194 3.821   -19.621 1.00 41.18 ? 106 ASP C C   1 
ATOM   2333 O O   . ASP C 1 50  ? -17.385 3.536   -19.678 1.00 41.16 ? 106 ASP C O   1 
ATOM   2334 C CB  . ASP C 1 50  ? -15.227 5.927   -20.586 1.00 41.29 ? 106 ASP C CB  1 
ATOM   2335 C CG  . ASP C 1 50  ? -16.326 6.560   -21.416 1.00 41.84 ? 106 ASP C CG  1 
ATOM   2336 O OD1 . ASP C 1 50  ? -17.306 7.064   -20.819 1.00 43.11 ? 106 ASP C OD1 1 
ATOM   2337 O OD2 . ASP C 1 50  ? -16.210 6.573   -22.666 1.00 42.55 ? 106 ASP C OD2 1 
ATOM   2338 N N   . PHE C 1 51  ? -15.227 2.920   -19.787 1.00 41.33 ? 107 PHE C N   1 
ATOM   2339 C CA  . PHE C 1 51  ? -15.515 1.496   -20.061 1.00 41.49 ? 107 PHE C CA  1 
ATOM   2340 C C   . PHE C 1 51  ? -16.498 0.833   -19.089 1.00 41.64 ? 107 PHE C C   1 
ATOM   2341 O O   . PHE C 1 51  ? -17.085 -0.194  -19.398 1.00 41.71 ? 107 PHE C O   1 
ATOM   2342 C CB  . PHE C 1 51  ? -14.218 0.679   -20.096 1.00 40.97 ? 107 PHE C CB  1 
ATOM   2343 C CG  . PHE C 1 51  ? -13.539 0.540   -18.762 1.00 40.34 ? 107 PHE C CG  1 
ATOM   2344 C CD1 . PHE C 1 51  ? -12.552 1.429   -18.382 1.00 39.90 ? 107 PHE C CD1 1 
ATOM   2345 C CD2 . PHE C 1 51  ? -13.861 -0.501  -17.912 1.00 39.16 ? 107 PHE C CD2 1 
ATOM   2346 C CE1 . PHE C 1 51  ? -11.911 1.292   -17.172 1.00 40.48 ? 107 PHE C CE1 1 
ATOM   2347 C CE2 . PHE C 1 51  ? -13.233 -0.643  -16.707 1.00 39.49 ? 107 PHE C CE2 1 
ATOM   2348 C CZ  . PHE C 1 51  ? -12.258 0.258   -16.327 1.00 40.27 ? 107 PHE C CZ  1 
ATOM   2349 N N   . MET C 1 52  ? -16.663 1.431   -17.921 1.00 42.31 ? 108 MET C N   1 
ATOM   2350 C CA  . MET C 1 52  ? -17.488 0.893   -16.854 1.00 42.73 ? 108 MET C CA  1 
ATOM   2351 C C   . MET C 1 52  ? -18.633 1.860   -16.510 1.00 42.90 ? 108 MET C C   1 
ATOM   2352 O O   . MET C 1 52  ? -19.188 1.794   -15.412 1.00 43.12 ? 108 MET C O   1 
ATOM   2353 C CB  . MET C 1 52  ? -16.574 0.708   -15.645 1.00 42.71 ? 108 MET C CB  1 
ATOM   2354 C CG  . MET C 1 52  ? -17.153 -0.007  -14.457 1.00 43.07 ? 108 MET C CG  1 
ATOM   2355 S SD  . MET C 1 52  ? -15.874 -0.287  -13.226 1.00 45.06 ? 108 MET C SD  1 
ATOM   2356 C CE  . MET C 1 52  ? -14.645 0.932   -13.685 1.00 44.05 ? 108 MET C CE  1 
ATOM   2357 N N   . SER C 1 53  ? -19.000 2.741   -17.447 1.00 43.01 ? 109 SER C N   1 
ATOM   2358 C CA  . SER C 1 53  ? -19.938 3.839   -17.160 1.00 43.14 ? 109 SER C CA  1 
ATOM   2359 C C   . SER C 1 53  ? -21.369 3.380   -16.904 1.00 43.31 ? 109 SER C C   1 
ATOM   2360 O O   . SER C 1 53  ? -22.175 4.134   -16.362 1.00 43.31 ? 109 SER C O   1 
ATOM   2361 C CB  . SER C 1 53  ? -19.934 4.888   -18.285 1.00 43.25 ? 109 SER C CB  1 
ATOM   2362 O OG  . SER C 1 53  ? -20.297 4.330   -19.536 1.00 42.93 ? 109 SER C OG  1 
ATOM   2363 N N   . SER C 1 54  ? -21.682 2.147   -17.286 1.00 43.38 ? 110 SER C N   1 
ATOM   2364 C CA  . SER C 1 54  ? -23.014 1.597   -17.050 1.00 43.54 ? 110 SER C CA  1 
ATOM   2365 C C   . SER C 1 54  ? -23.205 1.080   -15.623 1.00 43.41 ? 110 SER C C   1 
ATOM   2366 O O   . SER C 1 54  ? -24.321 0.819   -15.222 1.00 43.63 ? 110 SER C O   1 
ATOM   2367 C CB  . SER C 1 54  ? -23.290 0.457   -18.031 1.00 43.44 ? 110 SER C CB  1 
ATOM   2368 O OG  . SER C 1 54  ? -22.378 -0.601  -17.809 1.00 43.53 ? 110 SER C OG  1 
ATOM   2369 N N   . SER C 1 55  ? -22.131 0.906   -14.864 1.00 43.63 ? 111 SER C N   1 
ATOM   2370 C CA  . SER C 1 55  ? -22.255 0.346   -13.517 1.00 43.65 ? 111 SER C CA  1 
ATOM   2371 C C   . SER C 1 55  ? -23.153 1.183   -12.634 1.00 43.56 ? 111 SER C C   1 
ATOM   2372 O O   . SER C 1 55  ? -23.141 2.403   -12.706 1.00 43.80 ? 111 SER C O   1 
ATOM   2373 C CB  . SER C 1 55  ? -20.904 0.239   -12.829 1.00 43.85 ? 111 SER C CB  1 
ATOM   2374 O OG  . SER C 1 55  ? -21.073 -0.066  -11.448 1.00 44.07 ? 111 SER C OG  1 
ATOM   2375 N N   . GLN C 1 56  ? -23.926 0.511   -11.795 1.00 43.41 ? 112 GLN C N   1 
ATOM   2376 C CA  . GLN C 1 56  ? -24.632 1.181   -10.716 1.00 43.39 ? 112 GLN C CA  1 
ATOM   2377 C C   . GLN C 1 56  ? -24.149 0.598   -9.384  1.00 43.08 ? 112 GLN C C   1 
ATOM   2378 O O   . GLN C 1 56  ? -24.943 0.272   -8.508  1.00 43.59 ? 112 GLN C O   1 
ATOM   2379 C CB  . GLN C 1 56  ? -26.162 1.140   -10.908 1.00 43.70 ? 112 GLN C CB  1 
ATOM   2380 C CG  . GLN C 1 56  ? -26.728 -0.081  -11.649 1.00 44.93 ? 112 GLN C CG  1 
ATOM   2381 C CD  . GLN C 1 56  ? -26.839 -1.304  -10.763 1.00 46.77 ? 112 GLN C CD  1 
ATOM   2382 O OE1 . GLN C 1 56  ? -26.062 -2.265  -10.886 1.00 47.20 ? 112 GLN C OE1 1 
ATOM   2383 N NE2 . GLN C 1 56  ? -27.808 -1.273  -9.851  1.00 47.82 ? 112 GLN C NE2 1 
ATOM   2384 N N   . GLN C 1 57  ? -22.821 0.484   -9.271  1.00 42.42 ? 113 GLN C N   1 
ATOM   2385 C CA  . GLN C 1 57  ? -22.117 0.099   -8.048  1.00 41.86 ? 113 GLN C CA  1 
ATOM   2386 C C   . GLN C 1 57  ? -21.261 1.281   -7.570  1.00 41.00 ? 113 GLN C C   1 
ATOM   2387 O O   . GLN C 1 57  ? -20.633 1.970   -8.381  1.00 40.33 ? 113 GLN C O   1 
ATOM   2388 C CB  . GLN C 1 57  ? -21.154 -1.054  -8.324  1.00 42.04 ? 113 GLN C CB  1 
ATOM   2389 C CG  . GLN C 1 57  ? -21.753 -2.256  -9.018  1.00 44.26 ? 113 GLN C CG  1 
ATOM   2390 C CD  . GLN C 1 57  ? -21.824 -3.474  -8.114  1.00 46.58 ? 113 GLN C CD  1 
ATOM   2391 O OE1 . GLN C 1 57  ? -22.177 -3.364  -6.935  1.00 48.76 ? 113 GLN C OE1 1 
ATOM   2392 N NE2 . GLN C 1 57  ? -21.494 -4.647  -8.664  1.00 46.79 ? 113 GLN C NE2 1 
ATOM   2393 N N   . PHE C 1 58  ? -21.209 1.473   -6.256  1.00 40.01 ? 114 PHE C N   1 
ATOM   2394 C CA  . PHE C 1 58  ? -20.293 2.417   -5.649  1.00 39.68 ? 114 PHE C CA  1 
ATOM   2395 C C   . PHE C 1 58  ? -19.039 1.671   -5.233  1.00 39.18 ? 114 PHE C C   1 
ATOM   2396 O O   . PHE C 1 58  ? -19.129 0.544   -4.750  1.00 39.07 ? 114 PHE C O   1 
ATOM   2397 C CB  . PHE C 1 58  ? -20.942 3.102   -4.444  1.00 39.38 ? 114 PHE C CB  1 
ATOM   2398 C CG  . PHE C 1 58  ? -21.994 4.091   -4.829  1.00 39.19 ? 114 PHE C CG  1 
ATOM   2399 C CD1 . PHE C 1 58  ? -23.289 3.674   -5.105  1.00 39.26 ? 114 PHE C CD1 1 
ATOM   2400 C CD2 . PHE C 1 58  ? -21.684 5.438   -4.955  1.00 38.03 ? 114 PHE C CD2 1 
ATOM   2401 C CE1 . PHE C 1 58  ? -24.270 4.591   -5.485  1.00 38.91 ? 114 PHE C CE1 1 
ATOM   2402 C CE2 . PHE C 1 58  ? -22.654 6.352   -5.333  1.00 38.53 ? 114 PHE C CE2 1 
ATOM   2403 C CZ  . PHE C 1 58  ? -23.950 5.925   -5.601  1.00 38.56 ? 114 PHE C CZ  1 
ATOM   2404 N N   . TYR C 1 59  ? -17.887 2.309   -5.447  1.00 38.52 ? 115 TYR C N   1 
ATOM   2405 C CA  . TYR C 1 59  ? -16.583 1.760   -5.107  1.00 38.37 ? 115 TYR C CA  1 
ATOM   2406 C C   . TYR C 1 59  ? -15.810 2.764   -4.262  1.00 38.18 ? 115 TYR C C   1 
ATOM   2407 O O   . TYR C 1 59  ? -15.723 3.947   -4.599  1.00 37.98 ? 115 TYR C O   1 
ATOM   2408 C CB  . TYR C 1 59  ? -15.772 1.470   -6.379  1.00 38.13 ? 115 TYR C CB  1 
ATOM   2409 C CG  . TYR C 1 59  ? -16.382 0.421   -7.277  1.00 37.87 ? 115 TYR C CG  1 
ATOM   2410 C CD1 . TYR C 1 59  ? -17.274 0.767   -8.270  1.00 36.48 ? 115 TYR C CD1 1 
ATOM   2411 C CD2 . TYR C 1 59  ? -16.052 -0.927  -7.129  1.00 38.49 ? 115 TYR C CD2 1 
ATOM   2412 C CE1 . TYR C 1 59  ? -17.833 -0.193  -9.100  1.00 37.50 ? 115 TYR C CE1 1 
ATOM   2413 C CE2 . TYR C 1 59  ? -16.599 -1.906  -7.964  1.00 38.51 ? 115 TYR C CE2 1 
ATOM   2414 C CZ  . TYR C 1 59  ? -17.499 -1.526  -8.944  1.00 37.97 ? 115 TYR C CZ  1 
ATOM   2415 O OH  . TYR C 1 59  ? -18.072 -2.472  -9.756  1.00 37.81 ? 115 TYR C OH  1 
ATOM   2416 N N   . TRP C 1 60  ? -15.227 2.296   -3.169  1.00 38.16 ? 116 TRP C N   1 
ATOM   2417 C CA  . TRP C 1 60  ? -14.287 3.118   -2.428  1.00 38.21 ? 116 TRP C CA  1 
ATOM   2418 C C   . TRP C 1 60  ? -13.224 3.633   -3.409  1.00 37.97 ? 116 TRP C C   1 
ATOM   2419 O O   . TRP C 1 60  ? -12.693 2.868   -4.194  1.00 36.92 ? 116 TRP C O   1 
ATOM   2420 C CB  . TRP C 1 60  ? -13.601 2.306   -1.323  1.00 38.32 ? 116 TRP C CB  1 
ATOM   2421 C CG  . TRP C 1 60  ? -14.382 2.043   -0.058  1.00 38.20 ? 116 TRP C CG  1 
ATOM   2422 C CD1 . TRP C 1 60  ? -14.487 0.851   0.595   1.00 38.24 ? 116 TRP C CD1 1 
ATOM   2423 C CD2 . TRP C 1 60  ? -15.094 2.997   0.744   1.00 38.42 ? 116 TRP C CD2 1 
ATOM   2424 N NE1 . TRP C 1 60  ? -15.234 1.000   1.738   1.00 38.21 ? 116 TRP C NE1 1 
ATOM   2425 C CE2 . TRP C 1 60  ? -15.620 2.307   1.849   1.00 38.49 ? 116 TRP C CE2 1 
ATOM   2426 C CE3 . TRP C 1 60  ? -15.338 4.366   0.636   1.00 38.79 ? 116 TRP C CE3 1 
ATOM   2427 C CZ2 . TRP C 1 60  ? -16.381 2.941   2.833   1.00 39.08 ? 116 TRP C CZ2 1 
ATOM   2428 C CZ3 . TRP C 1 60  ? -16.096 4.988   1.615   1.00 38.33 ? 116 TRP C CZ3 1 
ATOM   2429 C CH2 . TRP C 1 60  ? -16.604 4.282   2.692   1.00 37.92 ? 116 TRP C CH2 1 
ATOM   2430 N N   . ILE C 1 61  ? -12.924 4.929   -3.364  1.00 38.59 ? 117 ILE C N   1 
ATOM   2431 C CA  . ILE C 1 61  ? -11.797 5.490   -4.127  1.00 38.73 ? 117 ILE C CA  1 
ATOM   2432 C C   . ILE C 1 61  ? -10.739 6.074   -3.175  1.00 39.00 ? 117 ILE C C   1 
ATOM   2433 O O   . ILE C 1 61  ? -10.950 6.129   -1.964  1.00 39.30 ? 117 ILE C O   1 
ATOM   2434 C CB  . ILE C 1 61  ? -12.266 6.529   -5.197  1.00 38.82 ? 117 ILE C CB  1 
ATOM   2435 C CG1 . ILE C 1 61  ? -12.962 7.732   -4.569  1.00 38.88 ? 117 ILE C CG1 1 
ATOM   2436 C CG2 . ILE C 1 61  ? -13.188 5.878   -6.198  1.00 38.17 ? 117 ILE C CG2 1 
ATOM   2437 C CD1 . ILE C 1 61  ? -13.373 8.758   -5.584  1.00 38.25 ? 117 ILE C CD1 1 
ATOM   2438 N N   . GLY C 1 62  ? -9.608  6.522   -3.715  1.00 39.23 ? 118 GLY C N   1 
ATOM   2439 C CA  . GLY C 1 62  ? -8.456  6.874   -2.878  1.00 39.54 ? 118 GLY C CA  1 
ATOM   2440 C C   . GLY C 1 62  ? -8.424  8.260   -2.247  1.00 39.77 ? 118 GLY C C   1 
ATOM   2441 O O   . GLY C 1 62  ? -7.354  8.764   -1.942  1.00 39.58 ? 118 GLY C O   1 
ATOM   2442 N N   . LEU C 1 63  ? -9.589  8.865   -2.032  1.00 40.41 ? 119 LEU C N   1 
ATOM   2443 C CA  . LEU C 1 63  ? -9.685  10.246  -1.543  1.00 40.59 ? 119 LEU C CA  1 
ATOM   2444 C C   . LEU C 1 63  ? -10.014 10.303  -0.038  1.00 41.00 ? 119 LEU C C   1 
ATOM   2445 O O   . LEU C 1 63  ? -11.041 9.754   0.401   1.00 41.22 ? 119 LEU C O   1 
ATOM   2446 C CB  . LEU C 1 63  ? -10.769 10.982  -2.338  1.00 40.60 ? 119 LEU C CB  1 
ATOM   2447 C CG  . LEU C 1 63  ? -10.860 12.500  -2.203  1.00 40.77 ? 119 LEU C CG  1 
ATOM   2448 C CD1 . LEU C 1 63  ? -9.570  13.169  -2.647  1.00 40.42 ? 119 LEU C CD1 1 
ATOM   2449 C CD2 . LEU C 1 63  ? -12.079 13.025  -3.004  1.00 40.52 ? 119 LEU C CD2 1 
ATOM   2450 N N   . SER C 1 64  ? -9.155  10.964  0.743   1.00 40.90 ? 120 SER C N   1 
ATOM   2451 C CA  . SER C 1 64  ? -9.441  11.209  2.169   1.00 41.05 ? 120 SER C CA  1 
ATOM   2452 C C   . SER C 1 64  ? -9.053  12.624  2.590   1.00 40.73 ? 120 SER C C   1 
ATOM   2453 O O   . SER C 1 64  ? -8.199  13.237  1.972   1.00 40.72 ? 120 SER C O   1 
ATOM   2454 C CB  . SER C 1 64  ? -8.725  10.186  3.040   1.00 40.98 ? 120 SER C CB  1 
ATOM   2455 O OG  . SER C 1 64  ? -7.383  10.037  2.608   1.00 42.99 ? 120 SER C OG  1 
ATOM   2456 N N   . TYR C 1 65  ? -9.691  13.128  3.646   1.00 40.64 ? 121 TYR C N   1 
ATOM   2457 C CA  . TYR C 1 65  ? -9.485  14.508  4.101   1.00 40.60 ? 121 TYR C CA  1 
ATOM   2458 C C   . TYR C 1 65  ? -8.189  14.656  4.874   1.00 40.19 ? 121 TYR C C   1 
ATOM   2459 O O   . TYR C 1 65  ? -7.810  13.762  5.613   1.00 40.41 ? 121 TYR C O   1 
ATOM   2460 C CB  . TYR C 1 65  ? -10.641 14.958  4.992   1.00 40.68 ? 121 TYR C CB  1 
ATOM   2461 C CG  . TYR C 1 65  ? -10.702 16.451  5.228   1.00 40.80 ? 121 TYR C CG  1 
ATOM   2462 C CD1 . TYR C 1 65  ? -11.104 17.321  4.211   1.00 41.41 ? 121 TYR C CD1 1 
ATOM   2463 C CD2 . TYR C 1 65  ? -10.374 17.002  6.473   1.00 40.86 ? 121 TYR C CD2 1 
ATOM   2464 C CE1 . TYR C 1 65  ? -11.179 18.705  4.428   1.00 41.20 ? 121 TYR C CE1 1 
ATOM   2465 C CE2 . TYR C 1 65  ? -10.437 18.382  6.697   1.00 40.43 ? 121 TYR C CE2 1 
ATOM   2466 C CZ  . TYR C 1 65  ? -10.841 19.229  5.671   1.00 41.51 ? 121 TYR C CZ  1 
ATOM   2467 O OH  . TYR C 1 65  ? -10.914 20.601  5.888   1.00 41.89 ? 121 TYR C OH  1 
ATOM   2468 N N   . SER C 1 66  ? -7.532  15.798  4.709   1.00 39.98 ? 122 SER C N   1 
ATOM   2469 C CA  . SER C 1 66  ? -6.304  16.124  5.439   1.00 39.85 ? 122 SER C CA  1 
ATOM   2470 C C   . SER C 1 66  ? -6.582  17.335  6.296   1.00 39.70 ? 122 SER C C   1 
ATOM   2471 O O   . SER C 1 66  ? -6.810  18.419  5.775   1.00 39.81 ? 122 SER C O   1 
ATOM   2472 C CB  . SER C 1 66  ? -5.155  16.409  4.469   1.00 39.47 ? 122 SER C CB  1 
ATOM   2473 O OG  . SER C 1 66  ? -4.008  16.891  5.142   1.00 39.64 ? 122 SER C OG  1 
ATOM   2474 N N   . GLU C 1 67  ? -6.589  17.141  7.612   1.00 39.93 ? 123 GLU C N   1 
ATOM   2475 C CA  . GLU C 1 67  ? -6.796  18.228  8.551   1.00 40.11 ? 123 GLU C CA  1 
ATOM   2476 C C   . GLU C 1 67  ? -5.781  19.329  8.284   1.00 39.99 ? 123 GLU C C   1 
ATOM   2477 O O   . GLU C 1 67  ? -6.135  20.503  8.289   1.00 40.41 ? 123 GLU C O   1 
ATOM   2478 C CB  . GLU C 1 67  ? -6.663  17.737  10.004  1.00 40.68 ? 123 GLU C CB  1 
ATOM   2479 C CG  . GLU C 1 67  ? -7.831  16.869  10.525  1.00 42.35 ? 123 GLU C CG  1 
ATOM   2480 C CD  . GLU C 1 67  ? -9.031  17.690  10.975  1.00 45.28 ? 123 GLU C CD  1 
ATOM   2481 O OE1 . GLU C 1 67  ? -9.190  17.919  12.197  1.00 48.42 ? 123 GLU C OE1 1 
ATOM   2482 O OE2 . GLU C 1 67  ? -9.820  18.124  10.110  1.00 47.94 ? 123 GLU C OE2 1 
ATOM   2483 N N   . GLU C 1 68  ? -4.529  18.936  8.046   1.00 39.55 ? 124 GLU C N   1 
ATOM   2484 C CA  . GLU C 1 68  ? -3.433  19.874  7.783   1.00 39.39 ? 124 GLU C CA  1 
ATOM   2485 C C   . GLU C 1 68  ? -3.647  20.826  6.599   1.00 39.15 ? 124 GLU C C   1 
ATOM   2486 O O   . GLU C 1 68  ? -3.401  22.020  6.715   1.00 38.87 ? 124 GLU C O   1 
ATOM   2487 C CB  . GLU C 1 68  ? -2.125  19.110  7.562   1.00 39.46 ? 124 GLU C CB  1 
ATOM   2488 C CG  . GLU C 1 68  ? -1.152  19.256  8.709   1.00 39.96 ? 124 GLU C CG  1 
ATOM   2489 C CD  . GLU C 1 68  ? -0.529  20.634  8.784   1.00 39.33 ? 124 GLU C CD  1 
ATOM   2490 O OE1 . GLU C 1 68  ? 0.034   21.106  7.776   1.00 39.17 ? 124 GLU C OE1 1 
ATOM   2491 O OE2 . GLU C 1 68  ? -0.590  21.242  9.867   1.00 40.14 ? 124 GLU C OE2 1 
ATOM   2492 N N   . HIS C 1 69  ? -4.083  20.281  5.467   1.00 38.88 ? 125 HIS C N   1 
ATOM   2493 C CA  . HIS C 1 69  ? -4.292  21.055  4.243   1.00 38.67 ? 125 HIS C CA  1 
ATOM   2494 C C   . HIS C 1 69  ? -5.706  21.605  4.137   1.00 38.22 ? 125 HIS C C   1 
ATOM   2495 O O   . HIS C 1 69  ? -6.050  22.260  3.150   1.00 36.98 ? 125 HIS C O   1 
ATOM   2496 C CB  . HIS C 1 69  ? -4.035  20.181  3.019   1.00 38.89 ? 125 HIS C CB  1 
ATOM   2497 C CG  . HIS C 1 69  ? -2.649  19.638  2.952   1.00 38.87 ? 125 HIS C CG  1 
ATOM   2498 N ND1 . HIS C 1 69  ? -2.299  18.441  3.534   1.00 39.48 ? 125 HIS C ND1 1 
ATOM   2499 C CD2 . HIS C 1 69  ? -1.528  20.123  2.374   1.00 39.33 ? 125 HIS C CD2 1 
ATOM   2500 C CE1 . HIS C 1 69  ? -1.018  18.211  3.313   1.00 40.36 ? 125 HIS C CE1 1 
ATOM   2501 N NE2 . HIS C 1 69  ? -0.525  19.217  2.613   1.00 39.92 ? 125 HIS C NE2 1 
ATOM   2502 N N   . THR C 1 70  ? -6.530  21.315  5.141   1.00 38.31 ? 126 THR C N   1 
ATOM   2503 C CA  . THR C 1 70  ? -7.929  21.741  5.140   1.00 38.69 ? 126 THR C CA  1 
ATOM   2504 C C   . THR C 1 70  ? -8.625  21.352  3.812   1.00 38.78 ? 126 THR C C   1 
ATOM   2505 O O   . THR C 1 70  ? -9.541  22.029  3.366   1.00 38.95 ? 126 THR C O   1 
ATOM   2506 C CB  . THR C 1 70  ? -8.059  23.290  5.413   1.00 38.56 ? 126 THR C CB  1 
ATOM   2507 O OG1 . THR C 1 70  ? -6.765  23.874  5.629   1.00 38.22 ? 126 THR C OG1 1 
ATOM   2508 C CG2 . THR C 1 70  ? -8.929  23.549  6.623   1.00 38.11 ? 126 THR C CG2 1 
ATOM   2509 N N   . ALA C 1 71  ? -8.189  20.239  3.210   1.00 39.15 ? 127 ALA C N   1 
ATOM   2510 C CA  . ALA C 1 71  ? -8.596  19.847  1.855   1.00 38.79 ? 127 ALA C CA  1 
ATOM   2511 C C   . ALA C 1 71  ? -8.648  18.333  1.714   1.00 38.75 ? 127 ALA C C   1 
ATOM   2512 O O   . ALA C 1 71  ? -8.044  17.611  2.500   1.00 38.58 ? 127 ALA C O   1 
ATOM   2513 C CB  . ALA C 1 71  ? -7.625  20.433  0.824   1.00 38.83 ? 127 ALA C CB  1 
ATOM   2514 N N   . TRP C 1 72  ? -9.377  17.862  0.704   1.00 38.87 ? 128 TRP C N   1 
ATOM   2515 C CA  . TRP C 1 72  ? -9.404  16.437  0.336   1.00 38.76 ? 128 TRP C CA  1 
ATOM   2516 C C   . TRP C 1 72  ? -8.257  16.147  -0.619  1.00 38.52 ? 128 TRP C C   1 
ATOM   2517 O O   . TRP C 1 72  ? -8.066  16.887  -1.577  1.00 38.32 ? 128 TRP C O   1 
ATOM   2518 C CB  . TRP C 1 72  ? -10.734 16.069  -0.340  1.00 39.05 ? 128 TRP C CB  1 
ATOM   2519 C CG  . TRP C 1 72  ? -11.914 16.223  0.555   1.00 39.38 ? 128 TRP C CG  1 
ATOM   2520 C CD1 . TRP C 1 72  ? -12.615 17.368  0.805   1.00 39.65 ? 128 TRP C CD1 1 
ATOM   2521 C CD2 . TRP C 1 72  ? -12.534 15.196  1.334   1.00 39.45 ? 128 TRP C CD2 1 
ATOM   2522 N NE1 . TRP C 1 72  ? -13.634 17.112  1.698   1.00 39.49 ? 128 TRP C NE1 1 
ATOM   2523 C CE2 . TRP C 1 72  ? -13.594 15.789  2.043   1.00 38.78 ? 128 TRP C CE2 1 
ATOM   2524 C CE3 . TRP C 1 72  ? -12.284 13.833  1.513   1.00 40.14 ? 128 TRP C CE3 1 
ATOM   2525 C CZ2 . TRP C 1 72  ? -14.402 15.070  2.909   1.00 39.54 ? 128 TRP C CZ2 1 
ATOM   2526 C CZ3 . TRP C 1 72  ? -13.101 13.116  2.381   1.00 39.49 ? 128 TRP C CZ3 1 
ATOM   2527 C CH2 . TRP C 1 72  ? -14.145 13.737  3.059   1.00 39.23 ? 128 TRP C CH2 1 
ATOM   2528 N N   . LEU C 1 73  ? -7.521  15.061  -0.364  1.00 38.32 ? 129 LEU C N   1 
ATOM   2529 C CA  . LEU C 1 73  ? -6.346  14.687  -1.154  1.00 38.46 ? 129 LEU C CA  1 
ATOM   2530 C C   . LEU C 1 73  ? -6.405  13.218  -1.561  1.00 38.70 ? 129 LEU C C   1 
ATOM   2531 O O   . LEU C 1 73  ? -7.028  12.402  -0.873  1.00 38.63 ? 129 LEU C O   1 
ATOM   2532 C CB  . LEU C 1 73  ? -5.047  14.898  -0.359  1.00 37.90 ? 129 LEU C CB  1 
ATOM   2533 C CG  . LEU C 1 73  ? -4.713  16.274  0.232   1.00 37.52 ? 129 LEU C CG  1 
ATOM   2534 C CD1 . LEU C 1 73  ? -3.357  16.201  0.945   1.00 35.24 ? 129 LEU C CD1 1 
ATOM   2535 C CD2 . LEU C 1 73  ? -4.704  17.368  -0.826  1.00 34.75 ? 129 LEU C CD2 1 
ATOM   2536 N N   . TRP C 1 74  ? -5.718  12.883  -2.657  1.00 38.87 ? 130 TRP C N   1 
ATOM   2537 C CA  . TRP C 1 74  ? -5.541  11.484  -3.048  1.00 39.29 ? 130 TRP C CA  1 
ATOM   2538 C C   . TRP C 1 74  ? -4.443  10.863  -2.188  1.00 39.81 ? 130 TRP C C   1 
ATOM   2539 O O   . TRP C 1 74  ? -3.726  11.559  -1.468  1.00 40.00 ? 130 TRP C O   1 
ATOM   2540 C CB  . TRP C 1 74  ? -5.206  11.357  -4.529  1.00 38.72 ? 130 TRP C CB  1 
ATOM   2541 C CG  . TRP C 1 74  ? -6.251  11.952  -5.391  1.00 38.40 ? 130 TRP C CG  1 
ATOM   2542 C CD1 . TRP C 1 74  ? -6.173  13.125  -6.064  1.00 38.15 ? 130 TRP C CD1 1 
ATOM   2543 C CD2 . TRP C 1 74  ? -7.570  11.431  -5.634  1.00 37.82 ? 130 TRP C CD2 1 
ATOM   2544 N NE1 . TRP C 1 74  ? -7.343  13.361  -6.734  1.00 38.45 ? 130 TRP C NE1 1 
ATOM   2545 C CE2 . TRP C 1 74  ? -8.219  12.338  -6.490  1.00 37.83 ? 130 TRP C CE2 1 
ATOM   2546 C CE3 . TRP C 1 74  ? -8.253  10.274  -5.224  1.00 37.56 ? 130 TRP C CE3 1 
ATOM   2547 C CZ2 . TRP C 1 74  ? -9.526  12.134  -6.954  1.00 38.55 ? 130 TRP C CZ2 1 
ATOM   2548 C CZ3 . TRP C 1 74  ? -9.548  10.063  -5.685  1.00 38.24 ? 130 TRP C CZ3 1 
ATOM   2549 C CH2 . TRP C 1 74  ? -10.175 10.992  -6.539  1.00 38.74 ? 130 TRP C CH2 1 
ATOM   2550 N N   . GLU C 1 75  ? -4.310  9.554   -2.247  1.00 40.13 ? 131 GLU C N   1 
ATOM   2551 C CA  . GLU C 1 75  ? -3.323  8.902   -1.414  1.00 40.76 ? 131 GLU C CA  1 
ATOM   2552 C C   . GLU C 1 75  ? -1.884  9.296   -1.741  1.00 40.47 ? 131 GLU C C   1 
ATOM   2553 O O   . GLU C 1 75  ? -1.011  9.166   -0.897  1.00 40.33 ? 131 GLU C O   1 
ATOM   2554 C CB  . GLU C 1 75  ? -3.465  7.400   -1.527  1.00 41.10 ? 131 GLU C CB  1 
ATOM   2555 C CG  . GLU C 1 75  ? -4.628  6.845   -0.758  1.00 42.38 ? 131 GLU C CG  1 
ATOM   2556 C CD  . GLU C 1 75  ? -4.343  5.433   -0.340  1.00 43.26 ? 131 GLU C CD  1 
ATOM   2557 O OE1 . GLU C 1 75  ? -3.550  5.255   0.621   1.00 46.76 ? 131 GLU C OE1 1 
ATOM   2558 O OE2 . GLU C 1 75  ? -4.880  4.508   -0.994  1.00 46.45 ? 131 GLU C OE2 1 
ATOM   2559 N N   . ASN C 1 76  ? -1.640  9.759   -2.963  1.00 40.43 ? 132 ASN C N   1 
ATOM   2560 C CA  . ASN C 1 76  ? -0.307  10.205  -3.355  1.00 40.43 ? 132 ASN C CA  1 
ATOM   2561 C C   . ASN C 1 76  ? 0.006   11.623  -2.854  1.00 40.46 ? 132 ASN C C   1 
ATOM   2562 O O   . ASN C 1 76  ? 1.171   12.058  -2.878  1.00 39.88 ? 132 ASN C O   1 
ATOM   2563 C CB  . ASN C 1 76  ? -0.096  10.078  -4.876  1.00 40.35 ? 132 ASN C CB  1 
ATOM   2564 C CG  . ASN C 1 76  ? -0.946  11.050  -5.685  1.00 40.65 ? 132 ASN C CG  1 
ATOM   2565 O OD1 . ASN C 1 76  ? -0.686  11.290  -6.867  1.00 40.92 ? 132 ASN C OD1 1 
ATOM   2566 N ND2 . ASN C 1 76  ? -1.964  11.610  -5.058  1.00 40.68 ? 132 ASN C ND2 1 
ATOM   2567 N N   . GLY C 1 77  ? -1.029  12.330  -2.397  1.00 40.37 ? 133 GLY C N   1 
ATOM   2568 C CA  . GLY C 1 77  ? -0.867  13.672  -1.829  1.00 40.55 ? 133 GLY C CA  1 
ATOM   2569 C C   . GLY C 1 77  ? -1.343  14.803  -2.725  1.00 40.60 ? 133 GLY C C   1 
ATOM   2570 O O   . GLY C 1 77  ? -1.518  15.921  -2.259  1.00 40.67 ? 133 GLY C O   1 
ATOM   2571 N N   . SER C 1 78  ? -1.533  14.533  -4.013  1.00 40.95 ? 134 SER C N   1 
ATOM   2572 C CA  . SER C 1 78  ? -2.031  15.552  -4.943  1.00 41.28 ? 134 SER C CA  1 
ATOM   2573 C C   . SER C 1 78  ? -3.476  15.967  -4.610  1.00 41.36 ? 134 SER C C   1 
ATOM   2574 O O   . SER C 1 78  ? -4.262  15.181  -4.091  1.00 41.71 ? 134 SER C O   1 
ATOM   2575 C CB  . SER C 1 78  ? -1.899  15.080  -6.398  1.00 41.30 ? 134 SER C CB  1 
ATOM   2576 O OG  . SER C 1 78  ? -2.303  13.732  -6.554  1.00 42.57 ? 134 SER C OG  1 
ATOM   2577 N N   . ALA C 1 79  ? -3.807  17.215  -4.909  1.00 41.64 ? 135 ALA C N   1 
ATOM   2578 C CA  . ALA C 1 79  ? -5.091  17.794  -4.526  1.00 41.67 ? 135 ALA C CA  1 
ATOM   2579 C C   . ALA C 1 79  ? -6.223  17.349  -5.440  1.00 41.72 ? 135 ALA C C   1 
ATOM   2580 O O   . ALA C 1 79  ? -5.988  16.931  -6.577  1.00 41.80 ? 135 ALA C O   1 
ATOM   2581 C CB  . ALA C 1 79  ? -4.989  19.332  -4.516  1.00 41.81 ? 135 ALA C CB  1 
ATOM   2582 N N   . LEU C 1 80  ? -7.449  17.435  -4.919  1.00 41.79 ? 136 LEU C N   1 
ATOM   2583 C CA  . LEU C 1 80  ? -8.669  17.208  -5.697  1.00 41.68 ? 136 LEU C CA  1 
ATOM   2584 C C   . LEU C 1 80  ? -8.933  18.482  -6.483  1.00 41.98 ? 136 LEU C C   1 
ATOM   2585 O O   . LEU C 1 80  ? -8.739  19.581  -5.965  1.00 42.33 ? 136 LEU C O   1 
ATOM   2586 C CB  . LEU C 1 80  ? -9.853  16.910  -4.763  1.00 41.67 ? 136 LEU C CB  1 
ATOM   2587 C CG  . LEU C 1 80  ? -11.246 16.601  -5.339  1.00 41.61 ? 136 LEU C CG  1 
ATOM   2588 C CD1 . LEU C 1 80  ? -11.322 15.200  -5.892  1.00 40.86 ? 136 LEU C CD1 1 
ATOM   2589 C CD2 . LEU C 1 80  ? -12.338 16.782  -4.295  1.00 41.27 ? 136 LEU C CD2 1 
ATOM   2590 N N   . SER C 1 81  ? -9.324  18.347  -7.746  1.00 42.27 ? 137 SER C N   1 
ATOM   2591 C CA  . SER C 1 81  ? -9.868  19.479  -8.483  1.00 42.26 ? 137 SER C CA  1 
ATOM   2592 C C   . SER C 1 81  ? -11.270 19.805  -7.973  1.00 42.40 ? 137 SER C C   1 
ATOM   2593 O O   . SER C 1 81  ? -12.037 18.911  -7.574  1.00 42.40 ? 137 SER C O   1 
ATOM   2594 C CB  . SER C 1 81  ? -9.934  19.205  -9.974  1.00 42.29 ? 137 SER C CB  1 
ATOM   2595 O OG  . SER C 1 81  ? -10.489 20.336  -10.626 1.00 42.72 ? 137 SER C OG  1 
ATOM   2596 N N   . GLN C 1 82  ? -11.601 21.090  -7.994  1.00 42.38 ? 138 GLN C N   1 
ATOM   2597 C CA  . GLN C 1 82  ? -12.888 21.545  -7.504  1.00 42.41 ? 138 GLN C CA  1 
ATOM   2598 C C   . GLN C 1 82  ? -14.003 21.038  -8.407  1.00 42.53 ? 138 GLN C C   1 
ATOM   2599 O O   . GLN C 1 82  ? -15.054 20.598  -7.927  1.00 42.96 ? 138 GLN C O   1 
ATOM   2600 C CB  . GLN C 1 82  ? -12.905 23.068  -7.396  1.00 42.55 ? 138 GLN C CB  1 
ATOM   2601 C CG  . GLN C 1 82  ? -11.950 23.614  -6.311  1.00 42.47 ? 138 GLN C CG  1 
ATOM   2602 C CD  . GLN C 1 82  ? -12.123 25.106  -6.078  1.00 42.42 ? 138 GLN C CD  1 
ATOM   2603 O OE1 . GLN C 1 82  ? -12.091 25.592  -4.939  1.00 40.88 ? 138 GLN C OE1 1 
ATOM   2604 N NE2 . GLN C 1 82  ? -12.311 25.845  -7.168  1.00 42.69 ? 138 GLN C NE2 1 
ATOM   2605 N N   . TYR C 1 83  ? -13.747 21.036  -9.709  1.00 42.47 ? 139 TYR C N   1 
ATOM   2606 C CA  . TYR C 1 83  ? -14.767 20.675  -10.686 1.00 42.47 ? 139 TYR C CA  1 
ATOM   2607 C C   . TYR C 1 83  ? -15.032 19.158  -10.766 1.00 42.60 ? 139 TYR C C   1 
ATOM   2608 O O   . TYR C 1 83  ? -16.074 18.734  -11.269 1.00 42.76 ? 139 TYR C O   1 
ATOM   2609 C CB  . TYR C 1 83  ? -14.378 21.211  -12.067 1.00 42.76 ? 139 TYR C CB  1 
ATOM   2610 C CG  . TYR C 1 83  ? -14.104 22.707  -12.139 1.00 42.66 ? 139 TYR C CG  1 
ATOM   2611 C CD1 . TYR C 1 83  ? -15.003 23.632  -11.616 1.00 43.41 ? 139 TYR C CD1 1 
ATOM   2612 C CD2 . TYR C 1 83  ? -12.955 23.193  -12.754 1.00 42.84 ? 139 TYR C CD2 1 
ATOM   2613 C CE1 . TYR C 1 83  ? -14.757 25.012  -11.697 1.00 43.32 ? 139 TYR C CE1 1 
ATOM   2614 C CE2 . TYR C 1 83  ? -12.700 24.568  -12.842 1.00 42.98 ? 139 TYR C CE2 1 
ATOM   2615 C CZ  . TYR C 1 83  ? -13.608 25.471  -12.313 1.00 43.05 ? 139 TYR C CZ  1 
ATOM   2616 O OH  . TYR C 1 83  ? -13.358 26.826  -12.379 1.00 42.54 ? 139 TYR C OH  1 
ATOM   2617 N N   . LEU C 1 84  ? -14.114 18.340  -10.254 1.00 42.59 ? 140 LEU C N   1 
ATOM   2618 C CA  . LEU C 1 84  ? -14.268 16.883  -10.323 1.00 42.39 ? 140 LEU C CA  1 
ATOM   2619 C C   . LEU C 1 84  ? -15.545 16.408  -9.631  1.00 42.48 ? 140 LEU C C   1 
ATOM   2620 O O   . LEU C 1 84  ? -16.378 15.758  -10.250 1.00 43.09 ? 140 LEU C O   1 
ATOM   2621 C CB  . LEU C 1 84  ? -13.062 16.178  -9.704  1.00 42.36 ? 140 LEU C CB  1 
ATOM   2622 C CG  . LEU C 1 84  ? -12.729 14.779  -10.234 1.00 42.40 ? 140 LEU C CG  1 
ATOM   2623 C CD1 . LEU C 1 84  ? -12.269 13.889  -9.071  1.00 41.09 ? 140 LEU C CD1 1 
ATOM   2624 C CD2 . LEU C 1 84  ? -13.880 14.111  -10.997 1.00 41.72 ? 140 LEU C CD2 1 
ATOM   2625 N N   . PHE C 1 85  ? -15.671 16.711  -8.342  1.00 42.40 ? 141 PHE C N   1 
ATOM   2626 C CA  . PHE C 1 85  ? -16.867 16.428  -7.568  1.00 42.13 ? 141 PHE C CA  1 
ATOM   2627 C C   . PHE C 1 85  ? -17.379 17.788  -7.081  1.00 42.41 ? 141 PHE C C   1 
ATOM   2628 O O   . PHE C 1 85  ? -16.707 18.438  -6.275  1.00 42.41 ? 141 PHE C O   1 
ATOM   2629 C CB  . PHE C 1 85  ? -16.526 15.543  -6.371  1.00 42.08 ? 141 PHE C CB  1 
ATOM   2630 C CG  . PHE C 1 85  ? -15.832 14.254  -6.728  1.00 41.76 ? 141 PHE C CG  1 
ATOM   2631 C CD1 . PHE C 1 85  ? -16.411 13.359  -7.619  1.00 41.75 ? 141 PHE C CD1 1 
ATOM   2632 C CD2 . PHE C 1 85  ? -14.616 13.919  -6.149  1.00 41.51 ? 141 PHE C CD2 1 
ATOM   2633 C CE1 . PHE C 1 85  ? -15.785 12.161  -7.938  1.00 41.33 ? 141 PHE C CE1 1 
ATOM   2634 C CE2 . PHE C 1 85  ? -13.988 12.717  -6.461  1.00 42.23 ? 141 PHE C CE2 1 
ATOM   2635 C CZ  . PHE C 1 85  ? -14.574 11.837  -7.360  1.00 41.42 ? 141 PHE C CZ  1 
ATOM   2636 N N   . PRO C 1 86  ? -18.543 18.248  -7.592  1.00 42.65 ? 142 PRO C N   1 
ATOM   2637 C CA  . PRO C 1 86  ? -19.034 19.590  -7.229  1.00 42.56 ? 142 PRO C CA  1 
ATOM   2638 C C   . PRO C 1 86  ? -19.635 19.701  -5.810  1.00 42.83 ? 142 PRO C C   1 
ATOM   2639 O O   . PRO C 1 86  ? -19.532 20.761  -5.168  1.00 42.82 ? 142 PRO C O   1 
ATOM   2640 C CB  . PRO C 1 86  ? -20.092 19.886  -8.297  1.00 42.71 ? 142 PRO C CB  1 
ATOM   2641 C CG  . PRO C 1 86  ? -20.129 18.683  -9.222  1.00 42.40 ? 142 PRO C CG  1 
ATOM   2642 C CD  . PRO C 1 86  ? -19.462 17.565  -8.526  1.00 42.59 ? 142 PRO C CD  1 
ATOM   2643 N N   . SER C 1 87  ? -20.229 18.615  -5.313  1.00 42.88 ? 143 SER C N   1 
ATOM   2644 C CA  . SER C 1 87  ? -20.767 18.585  -3.941  1.00 42.83 ? 143 SER C CA  1 
ATOM   2645 C C   . SER C 1 87  ? -19.696 18.583  -2.833  1.00 42.91 ? 143 SER C C   1 
ATOM   2646 O O   . SER C 1 87  ? -20.047 18.661  -1.650  1.00 43.09 ? 143 SER C O   1 
ATOM   2647 C CB  . SER C 1 87  ? -21.716 17.385  -3.753  1.00 42.93 ? 143 SER C CB  1 
ATOM   2648 O OG  . SER C 1 87  ? -21.318 16.254  -4.525  1.00 44.72 ? 143 SER C OG  1 
ATOM   2649 N N   . PHE C 1 88  ? -18.406 18.536  -3.206  1.00 42.74 ? 144 PHE C N   1 
ATOM   2650 C CA  . PHE C 1 88  ? -17.302 18.290  -2.249  1.00 42.14 ? 144 PHE C CA  1 
ATOM   2651 C C   . PHE C 1 88  ? -17.330 19.233  -1.051  1.00 42.00 ? 144 PHE C C   1 
ATOM   2652 O O   . PHE C 1 88  ? -16.875 18.883  0.047   1.00 42.00 ? 144 PHE C O   1 
ATOM   2653 C CB  . PHE C 1 88  ? -15.935 18.338  -2.952  1.00 41.92 ? 144 PHE C CB  1 
ATOM   2654 C CG  . PHE C 1 88  ? -15.375 19.726  -3.135  1.00 41.55 ? 144 PHE C CG  1 
ATOM   2655 C CD1 . PHE C 1 88  ? -15.984 20.632  -3.997  1.00 41.86 ? 144 PHE C CD1 1 
ATOM   2656 C CD2 . PHE C 1 88  ? -14.216 20.111  -2.473  1.00 41.14 ? 144 PHE C CD2 1 
ATOM   2657 C CE1 . PHE C 1 88  ? -15.461 21.913  -4.171  1.00 41.64 ? 144 PHE C CE1 1 
ATOM   2658 C CE2 . PHE C 1 88  ? -13.680 21.378  -2.648  1.00 41.35 ? 144 PHE C CE2 1 
ATOM   2659 C CZ  . PHE C 1 88  ? -14.305 22.284  -3.499  1.00 41.22 ? 144 PHE C CZ  1 
ATOM   2660 N N   . GLU C 1 89  ? -17.870 20.426  -1.284  1.00 41.78 ? 145 GLU C N   1 
ATOM   2661 C CA  . GLU C 1 89  ? -18.195 21.381  -0.234  1.00 41.50 ? 145 GLU C CA  1 
ATOM   2662 C C   . GLU C 1 89  ? -18.907 20.708  0.935   1.00 41.06 ? 145 GLU C C   1 
ATOM   2663 O O   . GLU C 1 89  ? -18.541 20.916  2.098   1.00 40.82 ? 145 GLU C O   1 
ATOM   2664 C CB  . GLU C 1 89  ? -19.091 22.488  -0.811  1.00 41.86 ? 145 GLU C CB  1 
ATOM   2665 C CG  . GLU C 1 89  ? -18.339 23.675  -1.441  1.00 42.66 ? 145 GLU C CG  1 
ATOM   2666 C CD  . GLU C 1 89  ? -18.503 24.978  -0.645  1.00 44.17 ? 145 GLU C CD  1 
ATOM   2667 O OE1 . GLU C 1 89  ? -19.626 25.527  -0.607  1.00 45.27 ? 145 GLU C OE1 1 
ATOM   2668 O OE2 . GLU C 1 89  ? -17.510 25.474  -0.070  1.00 45.56 ? 145 GLU C OE2 1 
ATOM   2669 N N   . THR C 1 90  ? -19.921 19.905  0.610   1.00 40.43 ? 146 THR C N   1 
ATOM   2670 C CA  . THR C 1 90  ? -20.766 19.262  1.612   1.00 40.05 ? 146 THR C CA  1 
ATOM   2671 C C   . THR C 1 90  ? -20.296 17.866  2.100   1.00 39.93 ? 146 THR C C   1 
ATOM   2672 O O   . THR C 1 90  ? -20.972 17.265  2.952   1.00 39.60 ? 146 THR C O   1 
ATOM   2673 C CB  . THR C 1 90  ? -22.214 19.162  1.101   1.00 39.77 ? 146 THR C CB  1 
ATOM   2674 O OG1 . THR C 1 90  ? -22.262 18.343  -0.071  1.00 39.67 ? 146 THR C OG1 1 
ATOM   2675 C CG2 . THR C 1 90  ? -22.755 20.538  0.767   1.00 39.64 ? 146 THR C CG2 1 
ATOM   2676 N N   . PHE C 1 91  ? -19.165 17.351  1.594   1.00 39.50 ? 147 PHE C N   1 
ATOM   2677 C CA  . PHE C 1 91  ? -18.601 16.099  2.129   1.00 39.66 ? 147 PHE C CA  1 
ATOM   2678 C C   . PHE C 1 91  ? -18.266 16.214  3.614   1.00 39.68 ? 147 PHE C C   1 
ATOM   2679 O O   . PHE C 1 91  ? -17.589 17.142  4.030   1.00 40.21 ? 147 PHE C O   1 
ATOM   2680 C CB  . PHE C 1 91  ? -17.297 15.686  1.437   1.00 39.74 ? 147 PHE C CB  1 
ATOM   2681 C CG  . PHE C 1 91  ? -17.445 15.209  0.013   1.00 39.65 ? 147 PHE C CG  1 
ATOM   2682 C CD1 . PHE C 1 91  ? -18.684 14.954  -0.563  1.00 40.46 ? 147 PHE C CD1 1 
ATOM   2683 C CD2 . PHE C 1 91  ? -16.310 14.995  -0.752  1.00 39.37 ? 147 PHE C CD2 1 
ATOM   2684 C CE1 . PHE C 1 91  ? -18.781 14.517  -1.893  1.00 40.04 ? 147 PHE C CE1 1 
ATOM   2685 C CE2 . PHE C 1 91  ? -16.399 14.551  -2.065  1.00 39.96 ? 147 PHE C CE2 1 
ATOM   2686 C CZ  . PHE C 1 91  ? -17.641 14.307  -2.633  1.00 40.22 ? 147 PHE C CZ  1 
ATOM   2687 N N   . ASN C 1 92  ? -18.700 15.238  4.395   1.00 39.74 ? 148 ASN C N   1 
ATOM   2688 C CA  . ASN C 1 92  ? -18.376 15.163  5.812   1.00 39.83 ? 148 ASN C CA  1 
ATOM   2689 C C   . ASN C 1 92  ? -16.910 14.727  6.009   1.00 39.96 ? 148 ASN C C   1 
ATOM   2690 O O   . ASN C 1 92  ? -16.533 13.604  5.660   1.00 39.97 ? 148 ASN C O   1 
ATOM   2691 C CB  . ASN C 1 92  ? -19.357 14.183  6.459   1.00 39.97 ? 148 ASN C CB  1 
ATOM   2692 C CG  . ASN C 1 92  ? -19.116 13.957  7.943   1.00 40.12 ? 148 ASN C CG  1 
ATOM   2693 O OD1 . ASN C 1 92  ? -20.061 13.704  8.688   1.00 42.23 ? 148 ASN C OD1 1 
ATOM   2694 N ND2 . ASN C 1 92  ? -17.870 13.987  8.366   1.00 37.78 ? 148 ASN C ND2 1 
ATOM   2695 N N   . THR C 1 93  ? -16.103 15.609  6.600   1.00 40.02 ? 149 THR C N   1 
ATOM   2696 C CA  . THR C 1 93  ? -14.642 15.422  6.684   1.00 40.16 ? 149 THR C CA  1 
ATOM   2697 C C   . THR C 1 93  ? -14.153 14.179  7.470   1.00 40.31 ? 149 THR C C   1 
ATOM   2698 O O   . THR C 1 93  ? -13.011 13.763  7.289   1.00 40.50 ? 149 THR C O   1 
ATOM   2699 C CB  . THR C 1 93  ? -13.929 16.695  7.254   1.00 40.22 ? 149 THR C CB  1 
ATOM   2700 O OG1 . THR C 1 93  ? -14.361 16.941  8.597   1.00 40.66 ? 149 THR C OG1 1 
ATOM   2701 C CG2 . THR C 1 93  ? -14.214 17.933  6.396   1.00 39.24 ? 149 THR C CG2 1 
ATOM   2702 N N   . LYS C 1 94  ? -14.993 13.609  8.339   1.00 40.30 ? 150 LYS C N   1 
ATOM   2703 C CA  . LYS C 1 94  ? -14.708 12.324  8.999   1.00 40.34 ? 150 LYS C CA  1 
ATOM   2704 C C   . LYS C 1 94  ? -14.993 11.096  8.121   1.00 40.40 ? 150 LYS C C   1 
ATOM   2705 O O   . LYS C 1 94  ? -14.621 9.982   8.492   1.00 40.19 ? 150 LYS C O   1 
ATOM   2706 C CB  . LYS C 1 94  ? -15.518 12.187  10.302  1.00 40.50 ? 150 LYS C CB  1 
ATOM   2707 C CG  . LYS C 1 94  ? -15.237 13.276  11.360  1.00 40.47 ? 150 LYS C CG  1 
ATOM   2708 C CD  . LYS C 1 94  ? -13.889 13.067  12.056  1.00 40.71 ? 150 LYS C CD  1 
ATOM   2709 C CE  . LYS C 1 94  ? -13.269 14.388  12.558  1.00 40.95 ? 150 LYS C CE  1 
ATOM   2710 N NZ  . LYS C 1 94  ? -14.020 15.021  13.699  1.00 39.98 ? 150 LYS C NZ  1 
ATOM   2711 N N   . ASN C 1 95  ? -15.651 11.292  6.972   1.00 40.62 ? 151 ASN C N   1 
ATOM   2712 C CA  . ASN C 1 95  ? -16.024 10.174  6.076   1.00 40.60 ? 151 ASN C CA  1 
ATOM   2713 C C   . ASN C 1 95  ? -15.024 9.929   4.966   1.00 40.59 ? 151 ASN C C   1 
ATOM   2714 O O   . ASN C 1 95  ? -14.168 10.769  4.685   1.00 40.42 ? 151 ASN C O   1 
ATOM   2715 C CB  . ASN C 1 95  ? -17.393 10.411  5.442   1.00 40.19 ? 151 ASN C CB  1 
ATOM   2716 C CG  . ASN C 1 95  ? -18.533 10.246  6.427   1.00 40.13 ? 151 ASN C CG  1 
ATOM   2717 O OD1 . ASN C 1 95  ? -18.350 9.764   7.558   1.00 36.45 ? 151 ASN C OD1 1 
ATOM   2718 N ND2 . ASN C 1 95  ? -19.729 10.634  5.993   1.00 39.22 ? 151 ASN C ND2 1 
ATOM   2719 N N   . CYS C 1 96  ? -15.143 8.754   4.357   1.00 40.76 ? 152 CYS C N   1 
ATOM   2720 C CA  . CYS C 1 96  ? -14.415 8.410   3.137   1.00 40.89 ? 152 CYS C CA  1 
ATOM   2721 C C   . CYS C 1 96  ? -15.360 8.505   1.942   1.00 40.19 ? 152 CYS C C   1 
ATOM   2722 O O   . CYS C 1 96  ? -16.581 8.463   2.119   1.00 39.72 ? 152 CYS C O   1 
ATOM   2723 C CB  . CYS C 1 96  ? -13.895 6.991   3.252   1.00 41.82 ? 152 CYS C CB  1 
ATOM   2724 S SG  . CYS C 1 96  ? -12.619 6.722   4.491   1.00 45.21 ? 152 CYS C SG  1 
ATOM   2725 N N   . ILE C 1 97  ? -14.804 8.624   0.735   1.00 39.49 ? 153 ILE C N   1 
ATOM   2726 C CA  . ILE C 1 97  ? -15.607 8.820   -0.472  1.00 39.67 ? 153 ILE C CA  1 
ATOM   2727 C C   . ILE C 1 97  ? -15.803 7.507   -1.235  1.00 39.69 ? 153 ILE C C   1 
ATOM   2728 O O   . ILE C 1 97  ? -14.833 6.821   -1.566  1.00 39.76 ? 153 ILE C O   1 
ATOM   2729 C CB  . ILE C 1 97  ? -14.966 9.878   -1.452  1.00 39.41 ? 153 ILE C CB  1 
ATOM   2730 C CG1 . ILE C 1 97  ? -14.493 11.127  -0.700  1.00 39.13 ? 153 ILE C CG1 1 
ATOM   2731 C CG2 . ILE C 1 97  ? -15.954 10.311  -2.514  1.00 38.47 ? 153 ILE C CG2 1 
ATOM   2732 C CD1 . ILE C 1 97  ? -15.581 11.813  0.103   1.00 37.35 ? 153 ILE C CD1 1 
ATOM   2733 N N   . ALA C 1 98  ? -17.059 7.175   -1.533  1.00 40.04 ? 154 ALA C N   1 
ATOM   2734 C CA  . ALA C 1 98  ? -17.394 6.104   -2.503  1.00 40.08 ? 154 ALA C CA  1 
ATOM   2735 C C   . ALA C 1 98  ? -17.832 6.740   -3.816  1.00 40.08 ? 154 ALA C C   1 
ATOM   2736 O O   . ALA C 1 98  ? -18.333 7.854   -3.816  1.00 40.13 ? 154 ALA C O   1 
ATOM   2737 C CB  . ALA C 1 98  ? -18.486 5.213   -1.964  1.00 39.60 ? 154 ALA C CB  1 
ATOM   2738 N N   . TYR C 1 99  ? -17.652 6.021   -4.922  1.00 40.46 ? 155 TYR C N   1 
ATOM   2739 C CA  . TYR C 1 99  ? -17.866 6.564   -6.257  1.00 40.75 ? 155 TYR C CA  1 
ATOM   2740 C C   . TYR C 1 99  ? -18.509 5.561   -7.225  1.00 41.16 ? 155 TYR C C   1 
ATOM   2741 O O   . TYR C 1 99  ? -18.090 4.410   -7.336  1.00 41.42 ? 155 TYR C O   1 
ATOM   2742 C CB  . TYR C 1 99  ? -16.538 7.055   -6.840  1.00 40.59 ? 155 TYR C CB  1 
ATOM   2743 C CG  . TYR C 1 99  ? -16.651 7.639   -8.240  1.00 40.59 ? 155 TYR C CG  1 
ATOM   2744 C CD1 . TYR C 1 99  ? -17.250 8.864   -8.453  1.00 39.71 ? 155 TYR C CD1 1 
ATOM   2745 C CD2 . TYR C 1 99  ? -16.145 6.955   -9.348  1.00 41.65 ? 155 TYR C CD2 1 
ATOM   2746 C CE1 . TYR C 1 99  ? -17.351 9.394   -9.724  1.00 40.56 ? 155 TYR C CE1 1 
ATOM   2747 C CE2 . TYR C 1 99  ? -16.241 7.476   -10.627 1.00 40.22 ? 155 TYR C CE2 1 
ATOM   2748 C CZ  . TYR C 1 99  ? -16.848 8.699   -10.810 1.00 40.86 ? 155 TYR C CZ  1 
ATOM   2749 O OH  . TYR C 1 99  ? -16.948 9.233   -12.085 1.00 40.57 ? 155 TYR C OH  1 
ATOM   2750 N N   . ASN C 1 100 ? -19.516 6.045   -7.939  1.00 41.66 ? 156 ASN C N   1 
ATOM   2751 C CA  . ASN C 1 100 ? -20.229 5.297   -8.944  1.00 41.72 ? 156 ASN C CA  1 
ATOM   2752 C C   . ASN C 1 100 ? -19.734 5.748   -10.312 1.00 41.95 ? 156 ASN C C   1 
ATOM   2753 O O   . ASN C 1 100 ? -19.833 6.921   -10.658 1.00 41.71 ? 156 ASN C O   1 
ATOM   2754 C CB  . ASN C 1 100 ? -21.722 5.596   -8.815  1.00 41.83 ? 156 ASN C CB  1 
ATOM   2755 C CG  . ASN C 1 100 ? -22.591 4.604   -9.560  1.00 42.21 ? 156 ASN C CG  1 
ATOM   2756 O OD1 . ASN C 1 100 ? -22.459 4.405   -10.768 1.00 42.58 ? 156 ASN C OD1 1 
ATOM   2757 N ND2 . ASN C 1 100 ? -23.488 3.969   -8.830  1.00 44.38 ? 156 ASN C ND2 1 
ATOM   2758 N N   . PRO C 1 101 ? -19.215 4.818   -11.114 1.00 42.43 ? 157 PRO C N   1 
ATOM   2759 C CA  . PRO C 1 101 ? -18.764 5.176   -12.461 1.00 42.89 ? 157 PRO C CA  1 
ATOM   2760 C C   . PRO C 1 101 ? -19.750 6.022   -13.288 1.00 43.35 ? 157 PRO C C   1 
ATOM   2761 O O   . PRO C 1 101 ? -19.346 6.606   -14.290 1.00 43.85 ? 157 PRO C O   1 
ATOM   2762 C CB  . PRO C 1 101 ? -18.537 3.819   -13.109 1.00 43.07 ? 157 PRO C CB  1 
ATOM   2763 C CG  . PRO C 1 101 ? -18.165 2.931   -11.955 1.00 42.69 ? 157 PRO C CG  1 
ATOM   2764 C CD  . PRO C 1 101 ? -19.007 3.390   -10.821 1.00 42.27 ? 157 PRO C CD  1 
ATOM   2765 N N   . ASN C 1 102 ? -21.024 6.061   -12.889 1.00 43.83 ? 158 ASN C N   1 
ATOM   2766 C CA  . ASN C 1 102 ? -21.981 7.105   -13.337 1.00 44.07 ? 158 ASN C CA  1 
ATOM   2767 C C   . ASN C 1 102 ? -21.413 8.527   -13.404 1.00 44.09 ? 158 ASN C C   1 
ATOM   2768 O O   . ASN C 1 102 ? -21.697 9.271   -14.342 1.00 44.40 ? 158 ASN C O   1 
ATOM   2769 C CB  . ASN C 1 102 ? -23.172 7.178   -12.363 1.00 44.54 ? 158 ASN C CB  1 
ATOM   2770 C CG  . ASN C 1 102 ? -24.165 6.051   -12.553 1.00 45.58 ? 158 ASN C CG  1 
ATOM   2771 O OD1 . ASN C 1 102 ? -23.946 5.128   -13.344 1.00 47.21 ? 158 ASN C OD1 1 
ATOM   2772 N ND2 . ASN C 1 102 ? -25.267 6.117   -11.817 1.00 47.44 ? 158 ASN C ND2 1 
ATOM   2773 N N   . GLY C 1 103 ? -20.635 8.892   -12.386 1.00 43.89 ? 159 GLY C N   1 
ATOM   2774 C CA  . GLY C 1 103 ? -20.228 10.274  -12.146 1.00 43.54 ? 159 GLY C CA  1 
ATOM   2775 C C   . GLY C 1 103 ? -20.592 10.761  -10.745 1.00 43.50 ? 159 GLY C C   1 
ATOM   2776 O O   . GLY C 1 103 ? -20.235 11.880  -10.367 1.00 43.90 ? 159 GLY C O   1 
ATOM   2777 N N   . ASN C 1 104 ? -21.285 9.934   -9.963  1.00 43.02 ? 160 ASN C N   1 
ATOM   2778 C CA  . ASN C 1 104 ? -21.772 10.347  -8.657  1.00 42.57 ? 160 ASN C CA  1 
ATOM   2779 C C   . ASN C 1 104 ? -20.873 9.871   -7.527  1.00 42.10 ? 160 ASN C C   1 
ATOM   2780 O O   . ASN C 1 104 ? -20.584 8.677   -7.426  1.00 42.21 ? 160 ASN C O   1 
ATOM   2781 C CB  . ASN C 1 104 ? -23.204 9.852   -8.445  1.00 42.76 ? 160 ASN C CB  1 
ATOM   2782 C CG  . ASN C 1 104 ? -23.944 10.656  -7.381  1.00 43.65 ? 160 ASN C CG  1 
ATOM   2783 O OD1 . ASN C 1 104 ? -23.590 10.621  -6.195  1.00 44.45 ? 160 ASN C OD1 1 
ATOM   2784 N ND2 . ASN C 1 104 ? -24.973 11.395  -7.805  1.00 44.23 ? 160 ASN C ND2 1 
ATOM   2785 N N   . ALA C 1 105 ? -20.423 10.811  -6.692  1.00 41.50 ? 161 ALA C N   1 
ATOM   2786 C CA  . ALA C 1 105 ? -19.657 10.495  -5.483  1.00 41.28 ? 161 ALA C CA  1 
ATOM   2787 C C   . ALA C 1 105 ? -20.536 10.645  -4.255  1.00 40.84 ? 161 ALA C C   1 
ATOM   2788 O O   . ALA C 1 105 ? -21.412 11.509  -4.216  1.00 40.61 ? 161 ALA C O   1 
ATOM   2789 C CB  . ALA C 1 105 ? -18.434 11.409  -5.356  1.00 41.39 ? 161 ALA C CB  1 
ATOM   2790 N N   . LEU C 1 106 ? -20.287 9.802   -3.256  1.00 40.40 ? 162 LEU C N   1 
ATOM   2791 C CA  . LEU C 1 106 ? -20.965 9.885   -1.974  1.00 40.35 ? 162 LEU C CA  1 
ATOM   2792 C C   . LEU C 1 106 ? -19.930 9.738   -0.874  1.00 40.05 ? 162 LEU C C   1 
ATOM   2793 O O   . LEU C 1 106 ? -19.059 8.882   -0.950  1.00 40.02 ? 162 LEU C O   1 
ATOM   2794 C CB  . LEU C 1 106 ? -22.022 8.777   -1.842  1.00 40.03 ? 162 LEU C CB  1 
ATOM   2795 C CG  . LEU C 1 106 ? -23.346 8.932   -2.609  1.00 40.44 ? 162 LEU C CG  1 
ATOM   2796 C CD1 . LEU C 1 106 ? -24.147 7.623   -2.617  1.00 39.34 ? 162 LEU C CD1 1 
ATOM   2797 C CD2 . LEU C 1 106 ? -24.209 10.058  -2.069  1.00 39.52 ? 162 LEU C CD2 1 
ATOM   2798 N N   . ASP C 1 107 ? -20.045 10.558  0.158   1.00 40.12 ? 163 ASP C N   1 
ATOM   2799 C CA  . ASP C 1 107 ? -19.224 10.403  1.352   1.00 40.58 ? 163 ASP C CA  1 
ATOM   2800 C C   . ASP C 1 107 ? -19.911 9.420   2.288   1.00 40.58 ? 163 ASP C C   1 
ATOM   2801 O O   . ASP C 1 107 ? -21.122 9.477   2.451   1.00 41.03 ? 163 ASP C O   1 
ATOM   2802 C CB  . ASP C 1 107 ? -18.985 11.745  2.040   1.00 40.49 ? 163 ASP C CB  1 
ATOM   2803 C CG  . ASP C 1 107 ? -20.267 12.484  2.356   1.00 41.47 ? 163 ASP C CG  1 
ATOM   2804 O OD1 . ASP C 1 107 ? -21.254 12.378  1.585   1.00 42.12 ? 163 ASP C OD1 1 
ATOM   2805 O OD2 . ASP C 1 107 ? -20.281 13.195  3.380   1.00 42.09 ? 163 ASP C OD2 1 
ATOM   2806 N N   . GLU C 1 108 ? -19.139 8.502   2.865   1.00 40.62 ? 164 GLU C N   1 
ATOM   2807 C CA  . GLU C 1 108 ? -19.680 7.415   3.679   1.00 40.84 ? 164 GLU C CA  1 
ATOM   2808 C C   . GLU C 1 108 ? -18.744 7.055   4.821   1.00 40.77 ? 164 GLU C C   1 
ATOM   2809 O O   . GLU C 1 108 ? -17.532 7.237   4.725   1.00 40.56 ? 164 GLU C O   1 
ATOM   2810 C CB  . GLU C 1 108 ? -19.860 6.150   2.830   1.00 41.14 ? 164 GLU C CB  1 
ATOM   2811 C CG  . GLU C 1 108 ? -20.774 6.275   1.620   1.00 41.85 ? 164 GLU C CG  1 
ATOM   2812 C CD  . GLU C 1 108 ? -22.219 6.510   1.988   1.00 42.43 ? 164 GLU C CD  1 
ATOM   2813 O OE1 . GLU C 1 108 ? -22.731 5.801   2.881   1.00 42.84 ? 164 GLU C OE1 1 
ATOM   2814 O OE2 . GLU C 1 108 ? -22.840 7.402   1.376   1.00 42.93 ? 164 GLU C OE2 1 
ATOM   2815 N N   . SER C 1 109 ? -19.305 6.494   5.887   1.00 41.20 ? 165 SER C N   1 
ATOM   2816 C CA  . SER C 1 109 ? -18.503 6.057   7.031   1.00 41.47 ? 165 SER C CA  1 
ATOM   2817 C C   . SER C 1 109 ? -17.403 5.140   6.514   1.00 41.66 ? 165 SER C C   1 
ATOM   2818 O O   . SER C 1 109 ? -17.681 4.210   5.767   1.00 41.98 ? 165 SER C O   1 
ATOM   2819 C CB  . SER C 1 109 ? -19.384 5.339   8.060   1.00 41.56 ? 165 SER C CB  1 
ATOM   2820 O OG  . SER C 1 109 ? -18.616 4.573   8.981   1.00 42.53 ? 165 SER C OG  1 
ATOM   2821 N N   . CYS C 1 110 ? -16.160 5.401   6.895   1.00 41.68 ? 166 CYS C N   1 
ATOM   2822 C CA  . CYS C 1 110 ? -15.040 4.622   6.391   1.00 42.13 ? 166 CYS C CA  1 
ATOM   2823 C C   . CYS C 1 110 ? -15.095 3.170   6.801   1.00 41.86 ? 166 CYS C C   1 
ATOM   2824 O O   . CYS C 1 110 ? -14.501 2.321   6.135   1.00 41.93 ? 166 CYS C O   1 
ATOM   2825 C CB  . CYS C 1 110 ? -13.723 5.216   6.863   1.00 42.60 ? 166 CYS C CB  1 
ATOM   2826 S SG  . CYS C 1 110 ? -13.541 6.884   6.282   1.00 46.98 ? 166 CYS C SG  1 
ATOM   2827 N N   . GLU C 1 111 ? -15.795 2.889   7.897   1.00 41.64 ? 167 GLU C N   1 
ATOM   2828 C CA  . GLU C 1 111 ? -15.970 1.518   8.364   1.00 41.76 ? 167 GLU C CA  1 
ATOM   2829 C C   . GLU C 1 111 ? -17.086 0.745   7.633   1.00 41.24 ? 167 GLU C C   1 
ATOM   2830 O O   . GLU C 1 111 ? -17.337 -0.423  7.955   1.00 40.80 ? 167 GLU C O   1 
ATOM   2831 C CB  . GLU C 1 111 ? -16.200 1.493   9.882   1.00 42.01 ? 167 GLU C CB  1 
ATOM   2832 C CG  . GLU C 1 111 ? -15.079 2.161   10.673  1.00 44.02 ? 167 GLU C CG  1 
ATOM   2833 C CD  . GLU C 1 111 ? -13.709 1.516   10.444  1.00 47.07 ? 167 GLU C CD  1 
ATOM   2834 O OE1 . GLU C 1 111 ? -13.567 0.306   10.735  1.00 49.62 ? 167 GLU C OE1 1 
ATOM   2835 O OE2 . GLU C 1 111 ? -12.772 2.217   9.988   1.00 48.61 ? 167 GLU C OE2 1 
ATOM   2836 N N   . ASP C 1 112 ? -17.745 1.379   6.662   1.00 40.77 ? 168 ASP C N   1 
ATOM   2837 C CA  . ASP C 1 112 ? -18.675 0.660   5.785   1.00 40.81 ? 168 ASP C CA  1 
ATOM   2838 C C   . ASP C 1 112 ? -17.904 -0.221  4.836   1.00 40.48 ? 168 ASP C C   1 
ATOM   2839 O O   . ASP C 1 112 ? -16.797 0.113   4.433   1.00 40.52 ? 168 ASP C O   1 
ATOM   2840 C CB  . ASP C 1 112 ? -19.527 1.600   4.937   1.00 40.79 ? 168 ASP C CB  1 
ATOM   2841 C CG  . ASP C 1 112 ? -20.622 2.256   5.714   1.00 41.18 ? 168 ASP C CG  1 
ATOM   2842 O OD1 . ASP C 1 112 ? -20.746 1.989   6.933   1.00 42.16 ? 168 ASP C OD1 1 
ATOM   2843 O OD2 . ASP C 1 112 ? -21.347 3.061   5.092   1.00 41.59 ? 168 ASP C OD2 1 
ATOM   2844 N N   . LYS C 1 113 ? -18.513 -1.339  4.464   1.00 40.38 ? 169 LYS C N   1 
ATOM   2845 C CA  . LYS C 1 113 ? -17.904 -2.244  3.512   1.00 40.25 ? 169 LYS C CA  1 
ATOM   2846 C C   . LYS C 1 113 ? -18.420 -1.899  2.128   1.00 39.97 ? 169 LYS C C   1 
ATOM   2847 O O   . LYS C 1 113 ? -19.622 -1.725  1.914   1.00 40.35 ? 169 LYS C O   1 
ATOM   2848 C CB  . LYS C 1 113 ? -18.181 -3.701  3.887   1.00 40.15 ? 169 LYS C CB  1 
ATOM   2849 C CG  . LYS C 1 113 ? -17.595 -4.094  5.250   1.00 40.31 ? 169 LYS C CG  1 
ATOM   2850 C CD  . LYS C 1 113 ? -17.098 -5.536  5.285   1.00 40.93 ? 169 LYS C CD  1 
ATOM   2851 C CE  . LYS C 1 113 ? -16.238 -5.832  6.537   1.00 41.38 ? 169 LYS C CE  1 
ATOM   2852 N NZ  . LYS C 1 113 ? -15.290 -6.974  6.291   1.00 41.39 ? 169 LYS C NZ  1 
ATOM   2853 N N   . ASN C 1 114 ? -17.490 -1.748  1.198   1.00 39.55 ? 170 ASN C N   1 
ATOM   2854 C CA  . ASN C 1 114 ? -17.822 -1.499  -0.186  1.00 39.41 ? 170 ASN C CA  1 
ATOM   2855 C C   . ASN C 1 114 ? -16.844 -2.217  -1.062  1.00 39.49 ? 170 ASN C C   1 
ATOM   2856 O O   . ASN C 1 114 ? -15.744 -2.575  -0.624  1.00 39.44 ? 170 ASN C O   1 
ATOM   2857 C CB  . ASN C 1 114 ? -17.745 -0.011  -0.510  1.00 38.97 ? 170 ASN C CB  1 
ATOM   2858 C CG  . ASN C 1 114 ? -18.946 0.742   -0.050  1.00 39.10 ? 170 ASN C CG  1 
ATOM   2859 O OD1 . ASN C 1 114 ? -20.070 0.291   -0.237  1.00 37.96 ? 170 ASN C OD1 1 
ATOM   2860 N ND2 . ASN C 1 114 ? -18.726 1.910   0.559   1.00 40.27 ? 170 ASN C ND2 1 
ATOM   2861 N N   . ARG C 1 115 ? -17.235 -2.407  -2.313  1.00 39.72 ? 171 ARG C N   1 
ATOM   2862 C CA  . ARG C 1 115 ? -16.289 -2.798  -3.332  1.00 39.94 ? 171 ARG C CA  1 
ATOM   2863 C C   . ARG C 1 115 ? -15.273 -1.674  -3.466  1.00 39.26 ? 171 ARG C C   1 
ATOM   2864 O O   . ARG C 1 115 ? -15.515 -0.576  -2.991  1.00 39.09 ? 171 ARG C O   1 
ATOM   2865 C CB  . ARG C 1 115 ? -17.010 -3.069  -4.649  1.00 40.11 ? 171 ARG C CB  1 
ATOM   2866 C CG  . ARG C 1 115 ? -17.767 -4.378  -4.626  1.00 41.10 ? 171 ARG C CG  1 
ATOM   2867 C CD  . ARG C 1 115 ? -18.724 -4.491  -5.787  1.00 41.93 ? 171 ARG C CD  1 
ATOM   2868 N NE  . ARG C 1 115 ? -20.050 -4.031  -5.393  1.00 43.89 ? 171 ARG C NE  1 
ATOM   2869 C CZ  . ARG C 1 115 ? -21.001 -4.805  -4.871  1.00 44.26 ? 171 ARG C CZ  1 
ATOM   2870 N NH1 . ARG C 1 115 ? -20.824 -6.113  -4.674  1.00 44.06 ? 171 ARG C NH1 1 
ATOM   2871 N NH2 . ARG C 1 115 ? -22.158 -4.256  -4.547  1.00 44.96 ? 171 ARG C NH2 1 
ATOM   2872 N N   . TYR C 1 116 ? -14.126 -1.972  -4.063  1.00 38.79 ? 172 TYR C N   1 
ATOM   2873 C CA  . TYR C 1 116 ? -13.056 -0.997  -4.223  1.00 38.66 ? 172 TYR C CA  1 
ATOM   2874 C C   . TYR C 1 116 ? -12.414 -1.150  -5.599  1.00 38.52 ? 172 TYR C C   1 
ATOM   2875 O O   . TYR C 1 116 ? -12.540 -2.191  -6.227  1.00 39.04 ? 172 TYR C O   1 
ATOM   2876 C CB  . TYR C 1 116 ? -12.016 -1.159  -3.118  1.00 38.17 ? 172 TYR C CB  1 
ATOM   2877 C CG  . TYR C 1 116 ? -11.403 -2.533  -3.050  1.00 38.29 ? 172 TYR C CG  1 
ATOM   2878 C CD1 . TYR C 1 116 ? -12.001 -3.552  -2.314  1.00 38.90 ? 172 TYR C CD1 1 
ATOM   2879 C CD2 . TYR C 1 116 ? -10.227 -2.823  -3.720  1.00 37.69 ? 172 TYR C CD2 1 
ATOM   2880 C CE1 . TYR C 1 116 ? -11.442 -4.812  -2.260  1.00 38.01 ? 172 TYR C CE1 1 
ATOM   2881 C CE2 . TYR C 1 116 ? -9.673  -4.083  -3.674  1.00 36.84 ? 172 TYR C CE2 1 
ATOM   2882 C CZ  . TYR C 1 116 ? -10.276 -5.064  -2.948  1.00 37.44 ? 172 TYR C CZ  1 
ATOM   2883 O OH  . TYR C 1 116 ? -9.712  -6.314  -2.916  1.00 39.02 ? 172 TYR C OH  1 
ATOM   2884 N N   . ILE C 1 117 ? -11.758 -0.105  -6.076  1.00 38.31 ? 173 ILE C N   1 
ATOM   2885 C CA  . ILE C 1 117 ? -11.011 -0.172  -7.324  1.00 38.78 ? 173 ILE C CA  1 
ATOM   2886 C C   . ILE C 1 117 ? -9.536  0.193   -7.081  1.00 38.74 ? 173 ILE C C   1 
ATOM   2887 O O   . ILE C 1 117 ? -9.249  1.239   -6.525  1.00 38.73 ? 173 ILE C O   1 
ATOM   2888 C CB  . ILE C 1 117 ? -11.575 0.807   -8.356  1.00 38.57 ? 173 ILE C CB  1 
ATOM   2889 C CG1 . ILE C 1 117 ? -13.017 0.458   -8.703  1.00 38.98 ? 173 ILE C CG1 1 
ATOM   2890 C CG2 . ILE C 1 117 ? -10.744 0.795   -9.617  1.00 38.23 ? 173 ILE C CG2 1 
ATOM   2891 C CD1 . ILE C 1 117 ? -13.725 1.566   -9.498  1.00 38.82 ? 173 ILE C CD1 1 
ATOM   2892 N N   . CYS C 1 118 ? -8.613  -0.674  -7.484  1.00 38.89 ? 174 CYS C N   1 
ATOM   2893 C CA  . CYS C 1 118 ? -7.191  -0.364  -7.406  1.00 39.34 ? 174 CYS C CA  1 
ATOM   2894 C C   . CYS C 1 118 ? -6.753  0.080   -8.786  1.00 39.37 ? 174 CYS C C   1 
ATOM   2895 O O   . CYS C 1 118 ? -7.372  -0.291  -9.782  1.00 39.18 ? 174 CYS C O   1 
ATOM   2896 C CB  . CYS C 1 118 ? -6.357  -1.580  -6.976  1.00 39.44 ? 174 CYS C CB  1 
ATOM   2897 S SG  . CYS C 1 118 ? -6.895  -2.454  -5.451  1.00 41.43 ? 174 CYS C SG  1 
ATOM   2898 N N   . LYS C 1 119 ? -5.682  0.861   -8.837  1.00 39.46 ? 175 LYS C N   1 
ATOM   2899 C CA  . LYS C 1 119 ? -5.161  1.392   -10.089 1.00 39.85 ? 175 LYS C CA  1 
ATOM   2900 C C   . LYS C 1 119 ? -3.652  1.453   -10.054 1.00 40.31 ? 175 LYS C C   1 
ATOM   2901 O O   . LYS C 1 119 ? -3.070  1.901   -9.064  1.00 40.24 ? 175 LYS C O   1 
ATOM   2902 C CB  . LYS C 1 119 ? -5.679  2.804   -10.324 1.00 39.64 ? 175 LYS C CB  1 
ATOM   2903 C CG  . LYS C 1 119 ? -5.163  3.473   -11.608 1.00 39.07 ? 175 LYS C CG  1 
ATOM   2904 C CD  . LYS C 1 119 ? -5.389  4.966   -11.525 1.00 38.85 ? 175 LYS C CD  1 
ATOM   2905 C CE  . LYS C 1 119 ? -5.152  5.653   -12.824 1.00 38.76 ? 175 LYS C CE  1 
ATOM   2906 N NZ  . LYS C 1 119 ? -5.138  7.126   -12.649 1.00 39.23 ? 175 LYS C NZ  1 
ATOM   2907 N N   . GLN C 1 120 ? -3.036  1.021   -11.147 1.00 40.77 ? 176 GLN C N   1 
ATOM   2908 C CA  . GLN C 1 120 ? -1.616  1.177   -11.346 1.00 41.66 ? 176 GLN C CA  1 
ATOM   2909 C C   . GLN C 1 120 ? -1.399  2.127   -12.498 1.00 42.46 ? 176 GLN C C   1 
ATOM   2910 O O   . GLN C 1 120 ? -2.004  1.967   -13.555 1.00 42.64 ? 176 GLN C O   1 
ATOM   2911 C CB  . GLN C 1 120 ? -0.973  -0.160  -11.697 1.00 41.64 ? 176 GLN C CB  1 
ATOM   2912 C CG  . GLN C 1 120 ? -0.822  -1.113  -10.538 1.00 41.53 ? 176 GLN C CG  1 
ATOM   2913 C CD  . GLN C 1 120 ? -0.224  -2.437  -10.962 1.00 41.49 ? 176 GLN C CD  1 
ATOM   2914 O OE1 . GLN C 1 120 ? -0.116  -2.723  -12.156 1.00 41.54 ? 176 GLN C OE1 1 
ATOM   2915 N NE2 . GLN C 1 120 ? 0.166   -3.253  -9.988  1.00 40.50 ? 176 GLN C NE2 1 
ATOM   2916 N N   . GLN C 1 121 ? -0.547  3.122   -12.285 1.00 43.69 ? 177 GLN C N   1 
ATOM   2917 C CA  . GLN C 1 121 ? -0.034  3.969   -13.362 1.00 44.42 ? 177 GLN C CA  1 
ATOM   2918 C C   . GLN C 1 121 ? 1.034   3.209   -14.121 1.00 45.28 ? 177 GLN C C   1 
ATOM   2919 O O   . GLN C 1 121 ? 1.518   2.178   -13.652 1.00 45.79 ? 177 GLN C O   1 
ATOM   2920 C CB  . GLN C 1 121 ? 0.594   5.232   -12.784 1.00 44.62 ? 177 GLN C CB  1 
ATOM   2921 C CG  . GLN C 1 121 ? -0.405  6.223   -12.222 1.00 45.17 ? 177 GLN C CG  1 
ATOM   2922 C CD  . GLN C 1 121 ? -0.686  7.349   -13.187 1.00 45.80 ? 177 GLN C CD  1 
ATOM   2923 O OE1 . GLN C 1 121 ? -0.545  8.516   -12.842 1.00 46.72 ? 177 GLN C OE1 1 
ATOM   2924 N NE2 . GLN C 1 121 ? -1.059  7.003   -14.415 1.00 45.95 ? 177 GLN C NE2 1 
ATOM   2925 N N   . LEU C 1 122 ? 1.398   3.717   -15.293 1.00 46.02 ? 178 LEU C N   1 
ATOM   2926 C CA  . LEU C 1 122 ? 2.546   3.214   -16.032 1.00 46.45 ? 178 LEU C CA  1 
ATOM   2927 C C   . LEU C 1 122 ? 3.226   4.387   -16.760 1.00 47.31 ? 178 LEU C C   1 
ATOM   2928 O O   . LEU C 1 122 ? 2.912   4.693   -17.913 1.00 47.50 ? 178 LEU C O   1 
ATOM   2929 C CB  . LEU C 1 122 ? 2.125   2.107   -17.009 1.00 46.42 ? 178 LEU C CB  1 
ATOM   2930 C CG  . LEU C 1 122 ? 1.258   0.937   -16.515 1.00 46.21 ? 178 LEU C CG  1 
ATOM   2931 C CD1 . LEU C 1 122 ? 0.775   0.094   -17.691 1.00 46.26 ? 178 LEU C CD1 1 
ATOM   2932 C CD2 . LEU C 1 122 ? 1.976   0.055   -15.513 1.00 45.92 ? 178 LEU C CD2 1 
ATOM   2933 N N   . ILE C 1 123 ? 4.117   5.075   -16.042 1.00 48.29 ? 179 ILE C N   1 
ATOM   2934 C CA  . ILE C 1 123 ? 5.017   6.086   -16.627 1.00 48.52 ? 179 ILE C CA  1 
ATOM   2935 C C   . ILE C 1 123 ? 6.227   6.275   -15.707 1.00 48.92 ? 179 ILE C C   1 
ATOM   2936 O O   . ILE C 1 123 ? 7.053   5.367   -15.566 1.00 49.10 ? 179 ILE C O   1 
ATOM   2937 C CB  . ILE C 1 123 ? 4.326   7.487   -16.921 1.00 49.05 ? 179 ILE C CB  1 
ATOM   2938 C CG1 . ILE C 1 123 ? 3.065   7.717   -16.063 1.00 49.72 ? 179 ILE C CG1 1 
ATOM   2939 C CG2 . ILE C 1 123 ? 3.988   7.634   -18.410 1.00 48.86 ? 179 ILE C CG2 1 
ATOM   2940 C CD1 . ILE C 1 123 ? 3.354   8.013   -14.577 1.00 50.86 ? 179 ILE C CD1 1 
ATOM   2941 N N   . ALA D 2 1   ? -1.943  10.723  -23.789 1.00 41.35 ? 113 ALA D N   1 
ATOM   2942 C CA  . ALA D 2 1   ? -2.992  9.871   -24.410 1.00 41.43 ? 113 ALA D CA  1 
ATOM   2943 C C   . ALA D 2 1   ? -2.366  8.596   -24.991 1.00 41.47 ? 113 ALA D C   1 
ATOM   2944 O O   . ALA D 2 1   ? -2.476  8.325   -26.191 1.00 41.38 ? 113 ALA D O   1 
ATOM   2945 C CB  . ALA D 2 1   ? -3.741  10.655  -25.487 1.00 41.30 ? 113 ALA D CB  1 
ATOM   2946 N N   . ARG D 2 2   ? -1.714  7.822   -24.120 1.00 41.58 ? 114 ARG D N   1 
ATOM   2947 C CA  . ARG D 2 2   ? -1.015  6.588   -24.508 1.00 41.61 ? 114 ARG D CA  1 
ATOM   2948 C C   . ARG D 2 2   ? -1.853  5.351   -24.207 1.00 41.74 ? 114 ARG D C   1 
ATOM   2949 O O   . ARG D 2 2   ? -2.721  5.382   -23.335 1.00 41.77 ? 114 ARG D O   1 
ATOM   2950 C CB  . ARG D 2 2   ? 0.335   6.482   -23.789 1.00 41.51 ? 114 ARG D CB  1 
ATOM   2951 C CG  . ARG D 2 2   ? 1.470   7.184   -24.519 1.00 41.43 ? 114 ARG D CG  1 
ATOM   2952 C CD  . ARG D 2 2   ? 2.014   6.329   -25.658 1.00 41.27 ? 114 ARG D CD  1 
ATOM   2953 N NE  . ARG D 2 2   ? 2.464   7.143   -26.787 1.00 41.37 ? 114 ARG D NE  1 
ATOM   2954 C CZ  . ARG D 2 2   ? 3.590   7.855   -26.825 1.00 41.41 ? 114 ARG D CZ  1 
ATOM   2955 N NH1 . ARG D 2 2   ? 4.424   7.877   -25.786 1.00 41.79 ? 114 ARG D NH1 1 
ATOM   2956 N NH2 . ARG D 2 2   ? 3.887   8.559   -27.914 1.00 41.37 ? 114 ARG D NH2 1 
ATOM   2957 N N   . HIS D 2 3   ? -1.575  4.265   -24.926 1.00 41.82 ? 115 HIS D N   1 
ATOM   2958 C CA  . HIS D 2 3   ? -2.344  3.031   -24.785 1.00 41.90 ? 115 HIS D CA  1 
ATOM   2959 C C   . HIS D 2 3   ? -1.547  1.754   -25.103 1.00 42.00 ? 115 HIS D C   1 
ATOM   2960 O O   . HIS D 2 3   ? -0.598  1.766   -25.902 1.00 41.76 ? 115 HIS D O   1 
ATOM   2961 C CB  . HIS D 2 3   ? -3.585  3.096   -25.676 1.00 42.04 ? 115 HIS D CB  1 
ATOM   2962 C CG  . HIS D 2 3   ? -3.277  3.242   -27.134 1.00 42.24 ? 115 HIS D CG  1 
ATOM   2963 N ND1 . HIS D 2 3   ? -3.193  2.164   -27.988 1.00 42.57 ? 115 HIS D ND1 1 
ATOM   2964 C CD2 . HIS D 2 3   ? -3.035  4.341   -27.889 1.00 42.77 ? 115 HIS D CD2 1 
ATOM   2965 C CE1 . HIS D 2 3   ? -2.913  2.591   -29.207 1.00 42.70 ? 115 HIS D CE1 1 
ATOM   2966 N NE2 . HIS D 2 3   ? -2.809  3.908   -29.174 1.00 42.87 ? 115 HIS D NE2 1 
ATOM   2967 N N   . CYS D 2 4   ? -1.954  0.660   -24.454 1.00 42.06 ? 116 CYS D N   1 
ATOM   2968 C CA  . CYS D 2 4   ? -1.430  -0.677  -24.733 1.00 42.02 ? 116 CYS D CA  1 
ATOM   2969 C C   . CYS D 2 4   ? -1.546  -0.955  -26.230 1.00 41.93 ? 116 CYS D C   1 
ATOM   2970 O O   . CYS D 2 4   ? -2.640  -0.924  -26.794 1.00 41.75 ? 116 CYS D O   1 
ATOM   2971 C CB  . CYS D 2 4   ? -2.209  -1.722  -23.921 1.00 42.14 ? 116 CYS D CB  1 
ATOM   2972 S SG  . CYS D 2 4   ? -1.860  -3.465  -24.297 1.00 42.47 ? 116 CYS D SG  1 
ATOM   2973 N N   . GLY D 2 5   ? -0.405  -1.200  -26.868 1.00 41.92 ? 117 GLY D N   1 
ATOM   2974 C CA  . GLY D 2 5   ? -0.340  -1.359  -28.320 1.00 41.95 ? 117 GLY D CA  1 
ATOM   2975 C C   . GLY D 2 5   ? -1.176  -2.496  -28.871 1.00 41.95 ? 117 GLY D C   1 
ATOM   2976 O O   . GLY D 2 5   ? -1.734  -2.382  -29.961 1.00 42.09 ? 117 GLY D O   1 
ATOM   2977 N N   . HIS D 2 6   ? -1.276  -3.586  -28.112 1.00 41.91 ? 118 HIS D N   1 
ATOM   2978 C CA  . HIS D 2 6   ? -1.962  -4.798  -28.575 1.00 41.88 ? 118 HIS D CA  1 
ATOM   2979 C C   . HIS D 2 6   ? -3.435  -4.564  -28.938 1.00 41.95 ? 118 HIS D C   1 
ATOM   2980 O O   . HIS D 2 6   ? -3.968  -5.248  -29.814 1.00 42.09 ? 118 HIS D O   1 
ATOM   2981 C CB  . HIS D 2 6   ? -1.838  -5.915  -27.528 1.00 41.79 ? 118 HIS D CB  1 
ATOM   2982 C CG  . HIS D 2 6   ? -0.426  -6.364  -27.291 1.00 41.63 ? 118 HIS D CG  1 
ATOM   2983 N ND1 . HIS D 2 6   ? 0.291   -6.009  -26.170 1.00 41.44 ? 118 HIS D ND1 1 
ATOM   2984 C CD2 . HIS D 2 6   ? 0.404   -7.128  -28.042 1.00 41.36 ? 118 HIS D CD2 1 
ATOM   2985 C CE1 . HIS D 2 6   ? 1.501   -6.536  -26.236 1.00 41.30 ? 118 HIS D CE1 1 
ATOM   2986 N NE2 . HIS D 2 6   ? 1.596   -7.220  -27.362 1.00 41.46 ? 118 HIS D NE2 1 
ATOM   2987 N N   . CYS D 2 7   ? -4.081  -3.605  -28.264 1.00 41.99 ? 119 CYS D N   1 
ATOM   2988 C CA  . CYS D 2 7   ? -5.475  -3.227  -28.546 1.00 41.97 ? 119 CYS D CA  1 
ATOM   2989 C C   . CYS D 2 7   ? -5.548  -1.807  -29.110 1.00 41.69 ? 119 CYS D C   1 
ATOM   2990 O O   . CYS D 2 7   ? -4.581  -1.056  -29.006 1.00 41.86 ? 119 CYS D O   1 
ATOM   2991 C CB  . CYS D 2 7   ? -6.318  -3.302  -27.272 1.00 42.15 ? 119 CYS D CB  1 
ATOM   2992 S SG  . CYS D 2 7   ? -6.345  -4.931  -26.507 1.00 43.64 ? 119 CYS D SG  1 
ATOM   2993 N N   . PRO D 2 8   ? -6.692  -1.435  -29.715 1.00 41.35 ? 120 PRO D N   1 
ATOM   2994 C CA  . PRO D 2 8   ? -6.876  -0.067  -30.217 1.00 41.31 ? 120 PRO D CA  1 
ATOM   2995 C C   . PRO D 2 8   ? -6.982  1.025   -29.139 1.00 41.26 ? 120 PRO D C   1 
ATOM   2996 O O   . PRO D 2 8   ? -6.966  0.739   -27.940 1.00 41.35 ? 120 PRO D O   1 
ATOM   2997 C CB  . PRO D 2 8   ? -8.184  -0.154  -31.022 1.00 41.36 ? 120 PRO D CB  1 
ATOM   2998 C CG  . PRO D 2 8   ? -8.464  -1.616  -31.187 1.00 41.20 ? 120 PRO D CG  1 
ATOM   2999 C CD  . PRO D 2 8   ? -7.855  -2.287  -30.019 1.00 41.29 ? 120 PRO D CD  1 
ATOM   3000 N N   . GLU D 2 9   ? -7.133  2.264   -29.596 1.00 41.12 ? 121 GLU D N   1 
ATOM   3001 C CA  . GLU D 2 9   ? -6.954  3.465   -28.769 1.00 41.00 ? 121 GLU D CA  1 
ATOM   3002 C C   . GLU D 2 9   ? -7.992  3.654   -27.656 1.00 40.93 ? 121 GLU D C   1 
ATOM   3003 O O   . GLU D 2 9   ? -7.715  4.318   -26.660 1.00 40.95 ? 121 GLU D O   1 
ATOM   3004 C CB  . GLU D 2 9   ? -6.963  4.695   -29.688 1.00 41.06 ? 121 GLU D CB  1 
ATOM   3005 C CG  . GLU D 2 9   ? -6.355  5.978   -29.121 1.00 41.18 ? 121 GLU D CG  1 
ATOM   3006 C CD  . GLU D 2 9   ? -6.116  7.036   -30.208 1.00 41.01 ? 121 GLU D CD  1 
ATOM   3007 O OE1 . GLU D 2 9   ? -5.282  7.946   -29.996 1.00 40.22 ? 121 GLU D OE1 1 
ATOM   3008 O OE2 . GLU D 2 9   ? -6.762  6.947   -31.279 1.00 40.58 ? 121 GLU D OE2 1 
ATOM   3009 N N   . GLU D 2 10  ? -9.180  3.081   -27.818 1.00 40.68 ? 122 GLU D N   1 
ATOM   3010 C CA  . GLU D 2 10  ? -10.270 3.325   -26.876 1.00 40.59 ? 122 GLU D CA  1 
ATOM   3011 C C   . GLU D 2 10  ? -10.910 2.031   -26.321 1.00 40.46 ? 122 GLU D C   1 
ATOM   3012 O O   . GLU D 2 10  ? -12.029 2.052   -25.806 1.00 40.17 ? 122 GLU D O   1 
ATOM   3013 C CB  . GLU D 2 10  ? -11.319 4.237   -27.537 1.00 40.64 ? 122 GLU D CB  1 
ATOM   3014 C CG  . GLU D 2 10  ? -11.914 3.723   -28.856 1.00 41.08 ? 122 GLU D CG  1 
ATOM   3015 C CD  . GLU D 2 10  ? -11.302 4.343   -30.111 1.00 41.42 ? 122 GLU D CD  1 
ATOM   3016 O OE1 . GLU D 2 10  ? -10.838 5.500   -30.064 1.00 40.34 ? 122 GLU D OE1 1 
ATOM   3017 O OE2 . GLU D 2 10  ? -11.313 3.668   -31.165 1.00 42.11 ? 122 GLU D OE2 1 
ATOM   3018 N N   . TRP D 2 11  ? -10.171 0.923   -26.411 1.00 40.35 ? 123 TRP D N   1 
ATOM   3019 C CA  . TRP D 2 11  ? -10.652 -0.412  -26.037 1.00 40.12 ? 123 TRP D CA  1 
ATOM   3020 C C   . TRP D 2 11  ? -9.984  -0.781  -24.732 1.00 39.90 ? 123 TRP D C   1 
ATOM   3021 O O   . TRP D 2 11  ? -9.116  -0.049  -24.266 1.00 39.89 ? 123 TRP D O   1 
ATOM   3022 C CB  . TRP D 2 11  ? -10.259 -1.447  -27.101 1.00 40.06 ? 123 TRP D CB  1 
ATOM   3023 C CG  . TRP D 2 11  ? -10.934 -1.302  -28.430 1.00 39.97 ? 123 TRP D CG  1 
ATOM   3024 C CD1 . TRP D 2 11  ? -11.110 -0.154  -29.143 1.00 40.26 ? 123 TRP D CD1 1 
ATOM   3025 C CD2 . TRP D 2 11  ? -11.484 -2.359  -29.233 1.00 39.90 ? 123 TRP D CD2 1 
ATOM   3026 N NE1 . TRP D 2 11  ? -11.753 -0.424  -30.330 1.00 40.44 ? 123 TRP D NE1 1 
ATOM   3027 C CE2 . TRP D 2 11  ? -11.995 -1.769  -30.408 1.00 39.68 ? 123 TRP D CE2 1 
ATOM   3028 C CE3 . TRP D 2 11  ? -11.610 -3.743  -29.063 1.00 40.04 ? 123 TRP D CE3 1 
ATOM   3029 C CZ2 . TRP D 2 11  ? -12.613 -2.512  -31.410 1.00 40.02 ? 123 TRP D CZ2 1 
ATOM   3030 C CZ3 . TRP D 2 11  ? -12.231 -4.485  -30.061 1.00 40.08 ? 123 TRP D CZ3 1 
ATOM   3031 C CH2 . TRP D 2 11  ? -12.723 -3.868  -31.220 1.00 40.10 ? 123 TRP D CH2 1 
ATOM   3032 N N   . ILE D 2 12  ? -10.364 -1.920  -24.157 1.00 39.64 ? 124 ILE D N   1 
ATOM   3033 C CA  . ILE D 2 12  ? -9.732  -2.412  -22.931 1.00 39.63 ? 124 ILE D CA  1 
ATOM   3034 C C   . ILE D 2 12  ? -9.169  -3.814  -23.097 1.00 39.64 ? 124 ILE D C   1 
ATOM   3035 O O   . ILE D 2 12  ? -9.689  -4.615  -23.874 1.00 39.61 ? 124 ILE D O   1 
ATOM   3036 C CB  . ILE D 2 12  ? -10.699 -2.431  -21.717 1.00 39.49 ? 124 ILE D CB  1 
ATOM   3037 C CG1 . ILE D 2 12  ? -11.867 -3.393  -21.947 1.00 39.08 ? 124 ILE D CG1 1 
ATOM   3038 C CG2 . ILE D 2 12  ? -11.208 -1.033  -21.411 1.00 39.58 ? 124 ILE D CG2 1 
ATOM   3039 C CD1 . ILE D 2 12  ? -12.876 -3.399  -20.818 1.00 39.77 ? 124 ILE D CD1 1 
ATOM   3040 N N   . THR D 2 13  ? -8.105  -4.101  -22.353 1.00 39.62 ? 125 THR D N   1 
ATOM   3041 C CA  . THR D 2 13  ? -7.558  -5.448  -22.274 1.00 39.70 ? 125 THR D CA  1 
ATOM   3042 C C   . THR D 2 13  ? -8.138  -6.100  -21.033 1.00 39.85 ? 125 THR D C   1 
ATOM   3043 O O   . THR D 2 13  ? -8.476  -5.397  -20.080 1.00 40.07 ? 125 THR D O   1 
ATOM   3044 C CB  . THR D 2 13  ? -6.039  -5.436  -22.151 1.00 39.35 ? 125 THR D CB  1 
ATOM   3045 O OG1 . THR D 2 13  ? -5.678  -5.010  -20.834 1.00 39.50 ? 125 THR D OG1 1 
ATOM   3046 C CG2 . THR D 2 13  ? -5.424  -4.512  -23.189 1.00 38.96 ? 125 THR D CG2 1 
ATOM   3047 N N   . TYR D 2 14  ? -8.268  -7.425  -21.044 1.00 39.82 ? 126 TYR D N   1 
ATOM   3048 C CA  . TYR D 2 14  ? -8.684  -8.154  -19.846 1.00 40.01 ? 126 TYR D CA  1 
ATOM   3049 C C   . TYR D 2 14  ? -7.953  -9.497  -19.703 1.00 40.34 ? 126 TYR D C   1 
ATOM   3050 O O   . TYR D 2 14  ? -7.049  -9.629  -18.861 1.00 40.94 ? 126 TYR D O   1 
ATOM   3051 C CB  . TYR D 2 14  ? -10.208 -8.333  -19.808 1.00 40.02 ? 126 TYR D CB  1 
ATOM   3052 C CG  . TYR D 2 14  ? -10.654 -9.192  -18.663 1.00 39.77 ? 126 TYR D CG  1 
ATOM   3053 C CD1 . TYR D 2 14  ? -10.386 -8.820  -17.353 1.00 40.09 ? 126 TYR D CD1 1 
ATOM   3054 C CD2 . TYR D 2 14  ? -11.310 -10.393 -18.884 1.00 39.83 ? 126 TYR D CD2 1 
ATOM   3055 C CE1 . TYR D 2 14  ? -10.772 -9.616  -16.291 1.00 39.79 ? 126 TYR D CE1 1 
ATOM   3056 C CE2 . TYR D 2 14  ? -11.698 -11.194 -17.833 1.00 39.70 ? 126 TYR D CE2 1 
ATOM   3057 C CZ  . TYR D 2 14  ? -11.426 -10.799 -16.540 1.00 39.65 ? 126 TYR D CZ  1 
ATOM   3058 O OH  . TYR D 2 14  ? -11.809 -11.593 -15.494 1.00 40.28 ? 126 TYR D OH  1 
ATOM   3059 N N   . SER D 2 15  ? -8.324  -10.491 -20.501 1.00 40.20 ? 127 SER D N   1 
ATOM   3060 C CA  . SER D 2 15  ? -7.625  -11.769 -20.457 1.00 40.37 ? 127 SER D CA  1 
ATOM   3061 C C   . SER D 2 15  ? -7.243  -12.166 -21.870 1.00 40.54 ? 127 SER D C   1 
ATOM   3062 O O   . SER D 2 15  ? -7.972  -12.881 -22.553 1.00 40.37 ? 127 SER D O   1 
ATOM   3063 C CB  . SER D 2 15  ? -8.484  -12.843 -19.785 1.00 40.39 ? 127 SER D CB  1 
ATOM   3064 O OG  . SER D 2 15  ? -7.715  -13.995 -19.491 1.00 39.60 ? 127 SER D OG  1 
ATOM   3065 N N   . ASN D 2 16  ? -6.093  -11.658 -22.303 1.00 40.97 ? 128 ASN D N   1 
ATOM   3066 C CA  . ASN D 2 16  ? -5.554  -11.916 -23.639 1.00 41.19 ? 128 ASN D CA  1 
ATOM   3067 C C   . ASN D 2 16  ? -6.600  -11.709 -24.725 1.00 41.36 ? 128 ASN D C   1 
ATOM   3068 O O   . ASN D 2 16  ? -6.672  -12.455 -25.698 1.00 41.40 ? 128 ASN D O   1 
ATOM   3069 C CB  . ASN D 2 16  ? -4.953  -13.317 -23.694 1.00 41.22 ? 128 ASN D CB  1 
ATOM   3070 C CG  . ASN D 2 16  ? -3.942  -13.548 -22.588 1.00 41.54 ? 128 ASN D CG  1 
ATOM   3071 O OD1 . ASN D 2 16  ? -3.038  -12.731 -22.366 1.00 41.36 ? 128 ASN D OD1 1 
ATOM   3072 N ND2 . ASN D 2 16  ? -4.095  -14.655 -21.877 1.00 42.25 ? 128 ASN D ND2 1 
ATOM   3073 N N   . SER D 2 17  ? -7.415  -10.679 -24.531 1.00 41.58 ? 129 SER D N   1 
ATOM   3074 C CA  . SER D 2 17  ? -8.455  -10.327 -25.476 1.00 41.85 ? 129 SER D CA  1 
ATOM   3075 C C   . SER D 2 17  ? -8.843  -8.871  -25.248 1.00 41.92 ? 129 SER D C   1 
ATOM   3076 O O   . SER D 2 17  ? -8.884  -8.415  -24.104 1.00 41.98 ? 129 SER D O   1 
ATOM   3077 C CB  . SER D 2 17  ? -9.660  -11.255 -25.305 1.00 42.07 ? 129 SER D CB  1 
ATOM   3078 O OG  . SER D 2 17  ? -9.820  -11.635 -23.945 1.00 43.48 ? 129 SER D OG  1 
ATOM   3079 N N   . CYS D 2 18  ? -9.080  -8.149  -26.345 1.00 41.85 ? 130 CYS D N   1 
ATOM   3080 C CA  . CYS D 2 18  ? -9.492  -6.748  -26.305 1.00 41.77 ? 130 CYS D CA  1 
ATOM   3081 C C   . CYS D 2 18  ? -11.006 -6.666  -26.246 1.00 41.50 ? 130 CYS D C   1 
ATOM   3082 O O   . CYS D 2 18  ? -11.699 -7.540  -26.744 1.00 41.41 ? 130 CYS D O   1 
ATOM   3083 C CB  . CYS D 2 18  ? -9.004  -5.994  -27.551 1.00 41.94 ? 130 CYS D CB  1 
ATOM   3084 S SG  . CYS D 2 18  ? -7.221  -6.121  -27.908 1.00 43.69 ? 130 CYS D SG  1 
ATOM   3085 N N   . TYR D 2 19  ? -11.522 -5.604  -25.646 1.00 41.36 ? 131 TYR D N   1 
ATOM   3086 C CA  . TYR D 2 19  ? -12.956 -5.393  -25.600 1.00 41.26 ? 131 TYR D CA  1 
ATOM   3087 C C   . TYR D 2 19  ? -13.321 -3.965  -25.996 1.00 41.40 ? 131 TYR D C   1 
ATOM   3088 O O   . TYR D 2 19  ? -12.577 -3.022  -25.731 1.00 41.69 ? 131 TYR D O   1 
ATOM   3089 C CB  . TYR D 2 19  ? -13.491 -5.677  -24.202 1.00 40.77 ? 131 TYR D CB  1 
ATOM   3090 C CG  . TYR D 2 19  ? -13.427 -7.120  -23.763 1.00 40.17 ? 131 TYR D CG  1 
ATOM   3091 C CD1 . TYR D 2 19  ? -12.258 -7.664  -23.257 1.00 39.53 ? 131 TYR D CD1 1 
ATOM   3092 C CD2 . TYR D 2 19  ? -14.551 -7.927  -23.812 1.00 40.19 ? 131 TYR D CD2 1 
ATOM   3093 C CE1 . TYR D 2 19  ? -12.207 -8.989  -22.831 1.00 39.99 ? 131 TYR D CE1 1 
ATOM   3094 C CE2 . TYR D 2 19  ? -14.509 -9.250  -23.388 1.00 40.18 ? 131 TYR D CE2 1 
ATOM   3095 C CZ  . TYR D 2 19  ? -13.339 -9.772  -22.894 1.00 40.11 ? 131 TYR D CZ  1 
ATOM   3096 O OH  . TYR D 2 19  ? -13.306 -11.081 -22.472 1.00 40.35 ? 131 TYR D OH  1 
ATOM   3097 N N   . TYR D 2 20  ? -14.474 -3.829  -26.638 1.00 41.52 ? 132 TYR D N   1 
ATOM   3098 C CA  . TYR D 2 20  ? -15.091 -2.547  -26.890 1.00 41.57 ? 132 TYR D CA  1 
ATOM   3099 C C   . TYR D 2 20  ? -16.433 -2.589  -26.191 1.00 41.87 ? 132 TYR D C   1 
ATOM   3100 O O   . TYR D 2 20  ? -17.298 -3.368  -26.572 1.00 42.26 ? 132 TYR D O   1 
ATOM   3101 C CB  . TYR D 2 20  ? -15.286 -2.351  -28.390 1.00 41.50 ? 132 TYR D CB  1 
ATOM   3102 C CG  . TYR D 2 20  ? -15.718 -0.958  -28.798 1.00 41.56 ? 132 TYR D CG  1 
ATOM   3103 C CD1 . TYR D 2 20  ? -14.802 0.092   -28.819 1.00 40.91 ? 132 TYR D CD1 1 
ATOM   3104 C CD2 . TYR D 2 20  ? -17.034 -0.692  -29.190 1.00 41.34 ? 132 TYR D CD2 1 
ATOM   3105 C CE1 . TYR D 2 20  ? -15.179 1.368   -29.200 1.00 40.95 ? 132 TYR D CE1 1 
ATOM   3106 C CE2 . TYR D 2 20  ? -17.418 0.595   -29.586 1.00 41.15 ? 132 TYR D CE2 1 
ATOM   3107 C CZ  . TYR D 2 20  ? -16.483 1.616   -29.582 1.00 41.11 ? 132 TYR D CZ  1 
ATOM   3108 O OH  . TYR D 2 20  ? -16.837 2.891   -29.960 1.00 41.33 ? 132 TYR D OH  1 
ATOM   3109 N N   . ILE D 2 21  ? -16.597 -1.787  -25.142 1.00 42.27 ? 133 ILE D N   1 
ATOM   3110 C CA  . ILE D 2 21  ? -17.898 -1.618  -24.507 1.00 42.12 ? 133 ILE D CA  1 
ATOM   3111 C C   . ILE D 2 21  ? -18.624 -0.511  -25.273 1.00 42.28 ? 133 ILE D C   1 
ATOM   3112 O O   . ILE D 2 21  ? -18.325 0.670   -25.112 1.00 42.34 ? 133 ILE D O   1 
ATOM   3113 C CB  . ILE D 2 21  ? -17.779 -1.301  -23.012 1.00 42.00 ? 133 ILE D CB  1 
ATOM   3114 C CG1 . ILE D 2 21  ? -17.229 -2.509  -22.256 1.00 41.67 ? 133 ILE D CG1 1 
ATOM   3115 C CG2 . ILE D 2 21  ? -19.137 -0.983  -22.444 1.00 42.07 ? 133 ILE D CG2 1 
ATOM   3116 C CD1 . ILE D 2 21  ? -15.766 -2.670  -22.363 1.00 42.46 ? 133 ILE D CD1 1 
ATOM   3117 N N   . GLY D 2 22  ? -19.592 -0.921  -26.092 1.00 42.58 ? 134 GLY D N   1 
ATOM   3118 C CA  . GLY D 2 22  ? -20.071 -0.142  -27.230 1.00 42.61 ? 134 GLY D CA  1 
ATOM   3119 C C   . GLY D 2 22  ? -20.892 1.102   -26.950 1.00 42.87 ? 134 GLY D C   1 
ATOM   3120 O O   . GLY D 2 22  ? -20.664 2.135   -27.591 1.00 43.10 ? 134 GLY D O   1 
ATOM   3121 N N   . LYS D 2 23  ? -21.860 0.994   -26.035 1.00 42.64 ? 135 LYS D N   1 
ATOM   3122 C CA  . LYS D 2 23  ? -22.794 2.101   -25.680 1.00 42.60 ? 135 LYS D CA  1 
ATOM   3123 C C   . LYS D 2 23  ? -23.782 2.600   -26.776 1.00 42.47 ? 135 LYS D C   1 
ATOM   3124 O O   . LYS D 2 23  ? -24.488 3.589   -26.556 1.00 42.50 ? 135 LYS D O   1 
ATOM   3125 C CB  . LYS D 2 23  ? -22.029 3.292   -25.059 1.00 42.54 ? 135 LYS D CB  1 
ATOM   3126 C CG  . LYS D 2 23  ? -21.516 3.021   -23.626 1.00 42.66 ? 135 LYS D CG  1 
ATOM   3127 C CD  . LYS D 2 23  ? -20.090 3.560   -23.396 1.00 42.87 ? 135 LYS D CD  1 
ATOM   3128 C CE  . LYS D 2 23  ? -19.252 2.649   -22.474 1.00 42.84 ? 135 LYS D CE  1 
ATOM   3129 N NZ  . LYS D 2 23  ? -17.871 2.394   -23.021 1.00 42.37 ? 135 LYS D NZ  1 
ATOM   3130 N N   . GLU D 2 24  ? -23.849 1.922   -27.926 1.00 42.34 ? 136 GLU D N   1 
ATOM   3131 C CA  . GLU D 2 24  ? -24.880 2.205   -28.949 1.00 42.36 ? 136 GLU D CA  1 
ATOM   3132 C C   . GLU D 2 24  ? -25.752 0.979   -29.194 1.00 42.21 ? 136 GLU D C   1 
ATOM   3133 O O   . GLU D 2 24  ? -25.236 -0.086  -29.517 1.00 41.89 ? 136 GLU D O   1 
ATOM   3134 C CB  . GLU D 2 24  ? -24.249 2.605   -30.287 1.00 42.48 ? 136 GLU D CB  1 
ATOM   3135 C CG  . GLU D 2 24  ? -23.297 3.784   -30.216 1.00 42.48 ? 136 GLU D CG  1 
ATOM   3136 C CD  . GLU D 2 24  ? -22.692 4.094   -31.562 1.00 42.21 ? 136 GLU D CD  1 
ATOM   3137 O OE1 . GLU D 2 24  ? -21.616 3.539   -31.876 1.00 41.44 ? 136 GLU D OE1 1 
ATOM   3138 O OE2 . GLU D 2 24  ? -23.312 4.877   -32.312 1.00 42.60 ? 136 GLU D OE2 1 
ATOM   3139 N N   . ARG D 2 25  ? -27.068 1.135   -29.070 1.00 42.17 ? 137 ARG D N   1 
ATOM   3140 C CA  . ARG D 2 25  ? -27.991 0.026   -29.297 1.00 42.24 ? 137 ARG D CA  1 
ATOM   3141 C C   . ARG D 2 25  ? -28.160 -0.270  -30.795 1.00 42.28 ? 137 ARG D C   1 
ATOM   3142 O O   . ARG D 2 25  ? -28.217 0.643   -31.623 1.00 42.40 ? 137 ARG D O   1 
ATOM   3143 C CB  . ARG D 2 25  ? -29.346 0.308   -28.657 1.00 42.35 ? 137 ARG D CB  1 
ATOM   3144 C CG  . ARG D 2 25  ? -29.346 0.288   -27.127 1.00 42.46 ? 137 ARG D CG  1 
ATOM   3145 C CD  . ARG D 2 25  ? -30.763 0.518   -26.580 1.00 42.57 ? 137 ARG D CD  1 
ATOM   3146 N NE  . ARG D 2 25  ? -30.850 0.330   -25.129 1.00 42.53 ? 137 ARG D NE  1 
ATOM   3147 C CZ  . ARG D 2 25  ? -31.986 0.239   -24.435 1.00 42.83 ? 137 ARG D CZ  1 
ATOM   3148 N NH1 . ARG D 2 25  ? -33.174 0.326   -25.036 1.00 43.17 ? 137 ARG D NH1 1 
ATOM   3149 N NH2 . ARG D 2 25  ? -31.939 0.068   -23.117 1.00 43.76 ? 137 ARG D NH2 1 
ATOM   3150 N N   . ARG D 2 26  ? -28.228 -1.557  -31.127 1.00 42.15 ? 138 ARG D N   1 
ATOM   3151 C CA  . ARG D 2 26  ? -28.279 -2.021  -32.514 1.00 42.06 ? 138 ARG D CA  1 
ATOM   3152 C C   . ARG D 2 26  ? -29.014 -3.355  -32.617 1.00 41.91 ? 138 ARG D C   1 
ATOM   3153 O O   . ARG D 2 26  ? -29.178 -4.055  -31.614 1.00 41.67 ? 138 ARG D O   1 
ATOM   3154 C CB  . ARG D 2 26  ? -26.862 -2.204  -33.050 1.00 42.06 ? 138 ARG D CB  1 
ATOM   3155 C CG  . ARG D 2 26  ? -26.209 -0.939  -33.558 1.00 42.46 ? 138 ARG D CG  1 
ATOM   3156 C CD  . ARG D 2 26  ? -26.633 -0.618  -34.975 1.00 43.44 ? 138 ARG D CD  1 
ATOM   3157 N NE  . ARG D 2 26  ? -26.620 0.814   -35.253 1.00 44.27 ? 138 ARG D NE  1 
ATOM   3158 C CZ  . ARG D 2 26  ? -25.528 1.581   -35.287 1.00 45.18 ? 138 ARG D CZ  1 
ATOM   3159 N NH1 . ARG D 2 26  ? -24.316 1.073   -35.042 1.00 45.42 ? 138 ARG D NH1 1 
ATOM   3160 N NH2 . ARG D 2 26  ? -25.649 2.880   -35.555 1.00 45.07 ? 138 ARG D NH2 1 
ATOM   3161 N N   . THR D 2 27  ? -29.440 -3.701  -33.833 1.00 41.74 ? 139 THR D N   1 
ATOM   3162 C CA  . THR D 2 27  ? -30.051 -5.010  -34.109 1.00 41.67 ? 139 THR D CA  1 
ATOM   3163 C C   . THR D 2 27  ? -28.954 -6.072  -33.990 1.00 41.52 ? 139 THR D C   1 
ATOM   3164 O O   . THR D 2 27  ? -27.769 -5.729  -33.919 1.00 41.65 ? 139 THR D O   1 
ATOM   3165 C CB  . THR D 2 27  ? -30.748 -5.024  -35.507 1.00 41.91 ? 139 THR D CB  1 
ATOM   3166 O OG1 . THR D 2 27  ? -32.147 -5.288  -35.358 1.00 42.83 ? 139 THR D OG1 1 
ATOM   3167 C CG2 . THR D 2 27  ? -30.125 -6.042  -36.466 1.00 42.05 ? 139 THR D CG2 1 
ATOM   3168 N N   . TRP D 2 28  ? -29.318 -7.350  -33.934 1.00 41.32 ? 140 TRP D N   1 
ATOM   3169 C CA  . TRP D 2 28  ? -28.296 -8.387  -33.771 1.00 41.14 ? 140 TRP D CA  1 
ATOM   3170 C C   . TRP D 2 28  ? -27.349 -8.423  -34.968 1.00 41.05 ? 140 TRP D C   1 
ATOM   3171 O O   . TRP D 2 28  ? -26.128 -8.393  -34.804 1.00 41.14 ? 140 TRP D O   1 
ATOM   3172 C CB  . TRP D 2 28  ? -28.907 -9.773  -33.551 1.00 41.19 ? 140 TRP D CB  1 
ATOM   3173 C CG  . TRP D 2 28  ? -27.846 -10.834 -33.348 1.00 41.27 ? 140 TRP D CG  1 
ATOM   3174 C CD1 . TRP D 2 28  ? -27.242 -11.184 -32.168 1.00 41.15 ? 140 TRP D CD1 1 
ATOM   3175 C CD2 . TRP D 2 28  ? -27.244 -11.650 -34.360 1.00 41.31 ? 140 TRP D CD2 1 
ATOM   3176 N NE1 . TRP D 2 28  ? -26.315 -12.174 -32.384 1.00 41.22 ? 140 TRP D NE1 1 
ATOM   3177 C CE2 . TRP D 2 28  ? -26.297 -12.482 -33.719 1.00 41.43 ? 140 TRP D CE2 1 
ATOM   3178 C CE3 . TRP D 2 28  ? -27.422 -11.772 -35.742 1.00 41.13 ? 140 TRP D CE3 1 
ATOM   3179 C CZ2 . TRP D 2 28  ? -25.534 -13.424 -34.417 1.00 41.28 ? 140 TRP D CZ2 1 
ATOM   3180 C CZ3 . TRP D 2 28  ? -26.664 -12.707 -36.433 1.00 41.12 ? 140 TRP D CZ3 1 
ATOM   3181 C CH2 . TRP D 2 28  ? -25.728 -13.516 -35.771 1.00 41.28 ? 140 TRP D CH2 1 
ATOM   3182 N N   . GLU D 2 29  ? -27.914 -8.492  -36.169 1.00 40.84 ? 141 GLU D N   1 
ATOM   3183 C CA  . GLU D 2 29  ? -27.108 -8.464  -37.384 1.00 40.69 ? 141 GLU D CA  1 
ATOM   3184 C C   . GLU D 2 29  ? -26.367 -7.140  -37.522 1.00 40.96 ? 141 GLU D C   1 
ATOM   3185 O O   . GLU D 2 29  ? -25.240 -7.112  -38.020 1.00 41.46 ? 141 GLU D O   1 
ATOM   3186 C CB  . GLU D 2 29  ? -27.962 -8.725  -38.634 1.00 40.61 ? 141 GLU D CB  1 
ATOM   3187 C CG  . GLU D 2 29  ? -28.446 -10.178 -38.769 1.00 39.89 ? 141 GLU D CG  1 
ATOM   3188 C CD  . GLU D 2 29  ? -29.132 -10.483 -40.096 1.00 39.87 ? 141 GLU D CD  1 
ATOM   3189 O OE1 . GLU D 2 29  ? -28.883 -9.769  -41.093 1.00 37.18 ? 141 GLU D OE1 1 
ATOM   3190 O OE2 . GLU D 2 29  ? -29.924 -11.451 -40.139 1.00 38.93 ? 141 GLU D OE2 1 
ATOM   3191 N N   . GLU D 2 30  ? -26.985 -6.048  -37.078 1.00 40.95 ? 142 GLU D N   1 
ATOM   3192 C CA  . GLU D 2 30  ? -26.340 -4.736  -37.128 1.00 40.93 ? 142 GLU D CA  1 
ATOM   3193 C C   . GLU D 2 30  ? -25.131 -4.695  -36.193 1.00 40.83 ? 142 GLU D C   1 
ATOM   3194 O O   . GLU D 2 30  ? -24.123 -4.051  -36.489 1.00 40.90 ? 142 GLU D O   1 
ATOM   3195 C CB  . GLU D 2 30  ? -27.334 -3.632  -36.759 1.00 41.12 ? 142 GLU D CB  1 
ATOM   3196 C CG  . GLU D 2 30  ? -28.417 -3.380  -37.812 1.00 41.19 ? 142 GLU D CG  1 
ATOM   3197 C CD  . GLU D 2 30  ? -29.460 -2.343  -37.383 1.00 41.36 ? 142 GLU D CD  1 
ATOM   3198 O OE1 . GLU D 2 30  ? -29.473 -1.905  -36.202 1.00 41.74 ? 142 GLU D OE1 1 
ATOM   3199 O OE2 . GLU D 2 30  ? -30.285 -1.965  -38.245 1.00 41.88 ? 142 GLU D OE2 1 
ATOM   3200 N N   . SER D 2 31  ? -25.234 -5.392  -35.066 1.00 40.69 ? 143 SER D N   1 
ATOM   3201 C CA  . SER D 2 31  ? -24.138 -5.470  -34.105 1.00 40.57 ? 143 SER D CA  1 
ATOM   3202 C C   . SER D 2 31  ? -22.988 -6.296  -34.658 1.00 40.29 ? 143 SER D C   1 
ATOM   3203 O O   . SER D 2 31  ? -21.833 -5.881  -34.611 1.00 40.09 ? 143 SER D O   1 
ATOM   3204 C CB  . SER D 2 31  ? -24.624 -6.097  -32.801 1.00 40.80 ? 143 SER D CB  1 
ATOM   3205 O OG  . SER D 2 31  ? -25.667 -5.323  -32.237 1.00 41.58 ? 143 SER D OG  1 
ATOM   3206 N N   . LEU D 2 32  ? -23.328 -7.477  -35.166 1.00 39.89 ? 144 LEU D N   1 
ATOM   3207 C CA  . LEU D 2 32  ? -22.383 -8.355  -35.843 1.00 39.61 ? 144 LEU D CA  1 
ATOM   3208 C C   . LEU D 2 32  ? -21.565 -7.601  -36.898 1.00 39.40 ? 144 LEU D C   1 
ATOM   3209 O O   . LEU D 2 32  ? -20.338 -7.593  -36.839 1.00 39.46 ? 144 LEU D O   1 
ATOM   3210 C CB  . LEU D 2 32  ? -23.142 -9.508  -36.497 1.00 39.49 ? 144 LEU D CB  1 
ATOM   3211 C CG  . LEU D 2 32  ? -22.301 -10.639 -37.067 1.00 39.56 ? 144 LEU D CG  1 
ATOM   3212 C CD1 . LEU D 2 32  ? -22.049 -11.673 -35.985 1.00 38.15 ? 144 LEU D CD1 1 
ATOM   3213 C CD2 . LEU D 2 32  ? -23.005 -11.261 -38.263 1.00 39.36 ? 144 LEU D CD2 1 
ATOM   3214 N N   . LEU D 2 33  ? -22.246 -6.966  -37.851 1.00 39.11 ? 145 LEU D N   1 
ATOM   3215 C CA  . LEU D 2 33  ? -21.568 -6.209  -38.918 1.00 39.16 ? 145 LEU D CA  1 
ATOM   3216 C C   . LEU D 2 33  ? -20.815 -4.996  -38.377 1.00 39.02 ? 145 LEU D C   1 
ATOM   3217 O O   . LEU D 2 33  ? -19.773 -4.614  -38.920 1.00 38.77 ? 145 LEU D O   1 
ATOM   3218 C CB  . LEU D 2 33  ? -22.571 -5.753  -39.980 1.00 39.17 ? 145 LEU D CB  1 
ATOM   3219 C CG  . LEU D 2 33  ? -23.271 -6.877  -40.753 1.00 39.33 ? 145 LEU D CG  1 
ATOM   3220 C CD1 . LEU D 2 33  ? -24.426 -6.341  -41.582 1.00 39.60 ? 145 LEU D CD1 1 
ATOM   3221 C CD2 . LEU D 2 33  ? -22.284 -7.604  -41.614 1.00 38.91 ? 145 LEU D CD2 1 
ATOM   3222 N N   . ALA D 2 34  ? -21.350 -4.393  -37.315 1.00 38.94 ? 146 ALA D N   1 
ATOM   3223 C CA  . ALA D 2 34  ? -20.693 -3.278  -36.661 1.00 39.10 ? 146 ALA D CA  1 
ATOM   3224 C C   . ALA D 2 34  ? -19.324 -3.696  -36.107 1.00 39.02 ? 146 ALA D C   1 
ATOM   3225 O O   . ALA D 2 34  ? -18.318 -3.035  -36.368 1.00 38.74 ? 146 ALA D O   1 
ATOM   3226 C CB  . ALA D 2 34  ? -21.579 -2.717  -35.556 1.00 39.36 ? 146 ALA D CB  1 
ATOM   3227 N N   . CYS D 2 35  ? -19.282 -4.798  -35.360 1.00 39.09 ? 147 CYS D N   1 
ATOM   3228 C CA  . CYS D 2 35  ? -18.012 -5.309  -34.838 1.00 39.32 ? 147 CYS D CA  1 
ATOM   3229 C C   . CYS D 2 35  ? -17.038 -5.724  -35.961 1.00 39.19 ? 147 CYS D C   1 
ATOM   3230 O O   . CYS D 2 35  ? -15.876 -5.348  -35.935 1.00 38.95 ? 147 CYS D O   1 
ATOM   3231 C CB  . CYS D 2 35  ? -18.240 -6.473  -33.872 1.00 39.36 ? 147 CYS D CB  1 
ATOM   3232 S SG  . CYS D 2 35  ? -19.014 -6.025  -32.299 1.00 40.80 ? 147 CYS D SG  1 
ATOM   3233 N N   . THR D 2 36  ? -17.508 -6.480  -36.948 1.00 39.23 ? 148 THR D N   1 
ATOM   3234 C CA  . THR D 2 36  ? -16.625 -6.930  -38.036 1.00 39.60 ? 148 THR D CA  1 
ATOM   3235 C C   . THR D 2 36  ? -15.996 -5.753  -38.776 1.00 39.61 ? 148 THR D C   1 
ATOM   3236 O O   . THR D 2 36  ? -14.836 -5.811  -39.179 1.00 39.49 ? 148 THR D O   1 
ATOM   3237 C CB  . THR D 2 36  ? -17.355 -7.821  -39.060 1.00 39.63 ? 148 THR D CB  1 
ATOM   3238 O OG1 . THR D 2 36  ? -18.141 -8.799  -38.374 1.00 40.26 ? 148 THR D OG1 1 
ATOM   3239 C CG2 . THR D 2 36  ? -16.361 -8.529  -39.948 1.00 39.28 ? 148 THR D CG2 1 
ATOM   3240 N N   . SER D 2 37  ? -16.769 -4.691  -38.951 1.00 39.70 ? 149 SER D N   1 
ATOM   3241 C CA  . SER D 2 37  ? -16.248 -3.454  -39.515 1.00 39.82 ? 149 SER D CA  1 
ATOM   3242 C C   . SER D 2 37  ? -15.075 -2.926  -38.686 1.00 39.91 ? 149 SER D C   1 
ATOM   3243 O O   . SER D 2 37  ? -14.063 -2.481  -39.245 1.00 39.65 ? 149 SER D O   1 
ATOM   3244 C CB  . SER D 2 37  ? -17.354 -2.404  -39.589 1.00 39.78 ? 149 SER D CB  1 
ATOM   3245 O OG  . SER D 2 37  ? -16.796 -1.111  -39.569 1.00 40.64 ? 149 SER D OG  1 
ATOM   3246 N N   . LYS D 2 38  ? -15.211 -2.991  -37.359 1.00 39.80 ? 150 LYS D N   1 
ATOM   3247 C CA  . LYS D 2 38  ? -14.144 -2.572  -36.442 1.00 39.93 ? 150 LYS D CA  1 
ATOM   3248 C C   . LYS D 2 38  ? -13.009 -3.603  -36.343 1.00 39.85 ? 150 LYS D C   1 
ATOM   3249 O O   . LYS D 2 38  ? -12.201 -3.545  -35.416 1.00 39.56 ? 150 LYS D O   1 
ATOM   3250 C CB  . LYS D 2 38  ? -14.714 -2.286  -35.044 1.00 40.13 ? 150 LYS D CB  1 
ATOM   3251 C CG  . LYS D 2 38  ? -15.620 -1.055  -34.966 1.00 40.45 ? 150 LYS D CG  1 
ATOM   3252 C CD  . LYS D 2 38  ? -16.490 -1.078  -33.711 1.00 40.51 ? 150 LYS D CD  1 
ATOM   3253 C CE  . LYS D 2 38  ? -17.302 0.213   -33.552 1.00 41.15 ? 150 LYS D CE  1 
ATOM   3254 N NZ  . LYS D 2 38  ? -18.491 0.037   -32.657 1.00 40.57 ? 150 LYS D NZ  1 
ATOM   3255 N N   . ASN D 2 39  ? -12.946 -4.534  -37.299 1.00 39.97 ? 151 ASN D N   1 
ATOM   3256 C CA  . ASN D 2 39  ? -11.870 -5.527  -37.378 1.00 40.01 ? 151 ASN D CA  1 
ATOM   3257 C C   . ASN D 2 39  ? -11.820 -6.443  -36.156 1.00 40.01 ? 151 ASN D C   1 
ATOM   3258 O O   . ASN D 2 39  ? -10.745 -6.752  -35.631 1.00 39.53 ? 151 ASN D O   1 
ATOM   3259 C CB  . ASN D 2 39  ? -10.520 -4.840  -37.607 1.00 40.02 ? 151 ASN D CB  1 
ATOM   3260 C CG  . ASN D 2 39  ? -10.557 -3.876  -38.776 1.00 40.63 ? 151 ASN D CG  1 
ATOM   3261 O OD1 . ASN D 2 39  ? -10.923 -4.258  -39.890 1.00 41.30 ? 151 ASN D OD1 1 
ATOM   3262 N ND2 . ASN D 2 39  ? -10.179 -2.618  -38.533 1.00 40.81 ? 151 ASN D ND2 1 
ATOM   3263 N N   . SER D 2 40  ? -13.000 -6.856  -35.695 1.00 40.15 ? 152 SER D N   1 
ATOM   3264 C CA  . SER D 2 40  ? -13.107 -7.904  -34.687 1.00 40.29 ? 152 SER D CA  1 
ATOM   3265 C C   . SER D 2 40  ? -14.479 -8.558  -34.771 1.00 40.46 ? 152 SER D C   1 
ATOM   3266 O O   . SER D 2 40  ? -15.136 -8.487  -35.797 1.00 40.83 ? 152 SER D O   1 
ATOM   3267 C CB  . SER D 2 40  ? -12.803 -7.359  -33.285 1.00 40.26 ? 152 SER D CB  1 
ATOM   3268 O OG  . SER D 2 40  ? -13.938 -6.856  -32.622 1.00 40.87 ? 152 SER D OG  1 
ATOM   3269 N N   . SER D 2 41  ? -14.910 -9.205  -33.699 1.00 40.63 ? 153 SER D N   1 
ATOM   3270 C CA  . SER D 2 41  ? -16.114 -9.995  -33.737 1.00 40.46 ? 153 SER D CA  1 
ATOM   3271 C C   . SER D 2 41  ? -17.020 -9.578  -32.608 1.00 40.73 ? 153 SER D C   1 
ATOM   3272 O O   . SER D 2 41  ? -16.546 -9.135  -31.567 1.00 40.98 ? 153 SER D O   1 
ATOM   3273 C CB  . SER D 2 41  ? -15.759 -11.467 -33.595 1.00 40.41 ? 153 SER D CB  1 
ATOM   3274 O OG  . SER D 2 41  ? -14.721 -11.810 -34.491 1.00 40.53 ? 153 SER D OG  1 
ATOM   3275 N N   . LEU D 2 42  ? -18.326 -9.712  -32.838 1.00 40.73 ? 154 LEU D N   1 
ATOM   3276 C CA  . LEU D 2 42  ? -19.343 -9.531  -31.822 1.00 40.55 ? 154 LEU D CA  1 
ATOM   3277 C C   . LEU D 2 42  ? -18.962 -10.332 -30.587 1.00 40.53 ? 154 LEU D C   1 
ATOM   3278 O O   . LEU D 2 42  ? -18.246 -11.321 -30.684 1.00 40.64 ? 154 LEU D O   1 
ATOM   3279 C CB  . LEU D 2 42  ? -20.705 -9.981  -32.373 1.00 40.37 ? 154 LEU D CB  1 
ATOM   3280 C CG  . LEU D 2 42  ? -21.984 -9.702  -31.568 1.00 40.88 ? 154 LEU D CG  1 
ATOM   3281 C CD1 . LEU D 2 42  ? -22.114 -8.227  -31.168 1.00 39.01 ? 154 LEU D CD1 1 
ATOM   3282 C CD2 . LEU D 2 42  ? -23.202 -10.161 -32.375 1.00 40.43 ? 154 LEU D CD2 1 
ATOM   3283 N N   . LEU D 2 43  ? -19.426 -9.889  -29.424 1.00 40.86 ? 155 LEU D N   1 
ATOM   3284 C CA  . LEU D 2 43  ? -19.013 -10.490 -28.160 1.00 41.08 ? 155 LEU D CA  1 
ATOM   3285 C C   . LEU D 2 43  ? -19.223 -11.992 -28.186 1.00 41.38 ? 155 LEU D C   1 
ATOM   3286 O O   . LEU D 2 43  ? -20.313 -12.472 -28.497 1.00 41.54 ? 155 LEU D O   1 
ATOM   3287 C CB  . LEU D 2 43  ? -19.776 -9.878  -26.975 1.00 41.18 ? 155 LEU D CB  1 
ATOM   3288 C CG  . LEU D 2 43  ? -19.513 -10.451 -25.569 1.00 40.79 ? 155 LEU D CG  1 
ATOM   3289 C CD1 . LEU D 2 43  ? -18.017 -10.514 -25.269 1.00 40.35 ? 155 LEU D CD1 1 
ATOM   3290 C CD2 . LEU D 2 43  ? -20.230 -9.621  -24.528 1.00 40.48 ? 155 LEU D CD2 1 
ATOM   3291 N N   . SER D 2 44  ? -18.157 -12.720 -27.893 1.00 41.68 ? 156 SER D N   1 
ATOM   3292 C CA  . SER D 2 44  ? -18.219 -14.157 -27.720 1.00 42.08 ? 156 SER D CA  1 
ATOM   3293 C C   . SER D 2 44  ? -18.024 -14.391 -26.248 1.00 42.38 ? 156 SER D C   1 
ATOM   3294 O O   . SER D 2 44  ? -17.411 -13.571 -25.567 1.00 42.75 ? 156 SER D O   1 
ATOM   3295 C CB  . SER D 2 44  ? -17.100 -14.841 -28.504 1.00 42.13 ? 156 SER D CB  1 
ATOM   3296 O OG  . SER D 2 44  ? -15.830 -14.421 -28.021 1.00 42.91 ? 156 SER D OG  1 
ATOM   3297 N N   . ILE D 2 45  ? -18.536 -15.506 -25.755 1.00 42.63 ? 157 ILE D N   1 
ATOM   3298 C CA  . ILE D 2 45  ? -18.404 -15.852 -24.347 1.00 42.75 ? 157 ILE D CA  1 
ATOM   3299 C C   . ILE D 2 45  ? -17.689 -17.188 -24.256 1.00 42.98 ? 157 ILE D C   1 
ATOM   3300 O O   . ILE D 2 45  ? -18.129 -18.156 -24.869 1.00 43.24 ? 157 ILE D O   1 
ATOM   3301 C CB  . ILE D 2 45  ? -19.790 -15.952 -23.679 1.00 42.69 ? 157 ILE D CB  1 
ATOM   3302 C CG1 . ILE D 2 45  ? -20.428 -14.567 -23.563 1.00 42.33 ? 157 ILE D CG1 1 
ATOM   3303 C CG2 . ILE D 2 45  ? -19.684 -16.606 -22.296 1.00 42.65 ? 157 ILE D CG2 1 
ATOM   3304 C CD1 . ILE D 2 45  ? -19.900 -13.750 -22.393 1.00 41.53 ? 157 ILE D CD1 1 
ATOM   3305 N N   . ASP D 2 46  ? -16.603 -17.240 -23.487 1.00 43.39 ? 158 ASP D N   1 
ATOM   3306 C CA  . ASP D 2 46  ? -15.752 -18.441 -23.388 1.00 43.70 ? 158 ASP D CA  1 
ATOM   3307 C C   . ASP D 2 46  ? -16.019 -19.261 -22.134 1.00 43.86 ? 158 ASP D C   1 
ATOM   3308 O O   . ASP D 2 46  ? -16.255 -20.474 -22.210 1.00 44.21 ? 158 ASP D O   1 
ATOM   3309 C CB  . ASP D 2 46  ? -14.285 -18.031 -23.390 1.00 43.93 ? 158 ASP D CB  1 
ATOM   3310 C CG  . ASP D 2 46  ? -13.929 -17.187 -24.582 1.00 45.14 ? 158 ASP D CG  1 
ATOM   3311 O OD1 . ASP D 2 46  ? -13.310 -16.118 -24.386 1.00 46.68 ? 158 ASP D OD1 1 
ATOM   3312 O OD2 . ASP D 2 46  ? -14.285 -17.593 -25.714 1.00 47.15 ? 158 ASP D OD2 1 
ATOM   3313 N N   . ASN D 2 47  ? -15.954 -18.586 -20.987 1.00 43.81 ? 159 ASN D N   1 
ATOM   3314 C CA  . ASN D 2 47  ? -16.176 -19.191 -19.676 1.00 43.73 ? 159 ASN D CA  1 
ATOM   3315 C C   . ASN D 2 47  ? -17.463 -18.633 -19.046 1.00 43.52 ? 159 ASN D C   1 
ATOM   3316 O O   . ASN D 2 47  ? -18.124 -17.772 -19.624 1.00 43.37 ? 159 ASN D O   1 
ATOM   3317 C CB  . ASN D 2 47  ? -14.961 -18.890 -18.773 1.00 43.94 ? 159 ASN D CB  1 
ATOM   3318 C CG  . ASN D 2 47  ? -14.631 -20.028 -17.796 1.00 44.74 ? 159 ASN D CG  1 
ATOM   3319 O OD1 . ASN D 2 47  ? -14.206 -19.789 -16.656 1.00 46.26 ? 159 ASN D OD1 1 
ATOM   3320 N ND2 . ASN D 2 47  ? -14.806 -21.263 -18.243 1.00 44.45 ? 159 ASN D ND2 1 
ATOM   3321 N N   . GLU D 2 48  ? -17.818 -19.163 -17.877 1.00 43.42 ? 160 GLU D N   1 
ATOM   3322 C CA  . GLU D 2 48  ? -18.859 -18.595 -17.003 1.00 43.19 ? 160 GLU D CA  1 
ATOM   3323 C C   . GLU D 2 48  ? -18.286 -17.419 -16.193 1.00 42.98 ? 160 GLU D C   1 
ATOM   3324 O O   . GLU D 2 48  ? -19.023 -16.532 -15.736 1.00 42.61 ? 160 GLU D O   1 
ATOM   3325 C CB  . GLU D 2 48  ? -19.389 -19.670 -16.039 1.00 43.39 ? 160 GLU D CB  1 
ATOM   3326 C CG  . GLU D 2 48  ? -20.813 -20.144 -16.310 1.00 43.93 ? 160 GLU D CG  1 
ATOM   3327 C CD  . GLU D 2 48  ? -21.849 -19.206 -15.711 1.00 45.18 ? 160 GLU D CD  1 
ATOM   3328 O OE1 . GLU D 2 48  ? -22.443 -19.563 -14.660 1.00 45.63 ? 160 GLU D OE1 1 
ATOM   3329 O OE2 . GLU D 2 48  ? -22.041 -18.100 -16.271 1.00 44.97 ? 160 GLU D OE2 1 
ATOM   3330 N N   . GLU D 2 49  ? -16.964 -17.448 -16.010 1.00 42.68 ? 161 GLU D N   1 
ATOM   3331 C CA  . GLU D 2 49  ? -16.235 -16.457 -15.223 1.00 42.36 ? 161 GLU D CA  1 
ATOM   3332 C C   . GLU D 2 49  ? -16.053 -15.154 -16.007 1.00 41.97 ? 161 GLU D C   1 
ATOM   3333 O O   . GLU D 2 49  ? -16.210 -14.074 -15.445 1.00 42.09 ? 161 GLU D O   1 
ATOM   3334 C CB  . GLU D 2 49  ? -14.883 -17.034 -14.774 1.00 42.34 ? 161 GLU D CB  1 
ATOM   3335 C CG  . GLU D 2 49  ? -13.788 -16.005 -14.531 1.00 42.76 ? 161 GLU D CG  1 
ATOM   3336 C CD  . GLU D 2 49  ? -12.481 -16.619 -14.061 1.00 42.94 ? 161 GLU D CD  1 
ATOM   3337 O OE1 . GLU D 2 49  ? -12.205 -17.785 -14.432 1.00 45.26 ? 161 GLU D OE1 1 
ATOM   3338 O OE2 . GLU D 2 49  ? -11.722 -15.934 -13.335 1.00 42.56 ? 161 GLU D OE2 1 
ATOM   3339 N N   . GLU D 2 50  ? -15.713 -15.252 -17.290 1.00 41.35 ? 162 GLU D N   1 
ATOM   3340 C CA  . GLU D 2 50  ? -15.749 -14.089 -18.176 1.00 41.11 ? 162 GLU D CA  1 
ATOM   3341 C C   . GLU D 2 50  ? -17.091 -13.388 -18.040 1.00 40.63 ? 162 GLU D C   1 
ATOM   3342 O O   . GLU D 2 50  ? -17.159 -12.180 -17.908 1.00 40.65 ? 162 GLU D O   1 
ATOM   3343 C CB  . GLU D 2 50  ? -15.548 -14.518 -19.626 1.00 41.15 ? 162 GLU D CB  1 
ATOM   3344 C CG  . GLU D 2 50  ? -15.464 -13.370 -20.631 1.00 41.18 ? 162 GLU D CG  1 
ATOM   3345 C CD  . GLU D 2 50  ? -15.423 -13.859 -22.067 1.00 41.02 ? 162 GLU D CD  1 
ATOM   3346 O OE1 . GLU D 2 50  ? -15.252 -13.032 -22.989 1.00 40.89 ? 162 GLU D OE1 1 
ATOM   3347 O OE2 . GLU D 2 50  ? -15.561 -15.078 -22.280 1.00 41.40 ? 162 GLU D OE2 1 
ATOM   3348 N N   . MET D 2 51  ? -18.151 -14.182 -18.064 1.00 40.36 ? 163 MET D N   1 
ATOM   3349 C CA  . MET D 2 51  ? -19.520 -13.692 -17.975 1.00 40.16 ? 163 MET D CA  1 
ATOM   3350 C C   . MET D 2 51  ? -19.692 -12.821 -16.728 1.00 39.46 ? 163 MET D C   1 
ATOM   3351 O O   . MET D 2 51  ? -20.185 -11.697 -16.807 1.00 39.09 ? 163 MET D O   1 
ATOM   3352 C CB  . MET D 2 51  ? -20.490 -14.891 -17.945 1.00 40.34 ? 163 MET D CB  1 
ATOM   3353 C CG  . MET D 2 51  ? -21.789 -14.707 -18.710 1.00 41.02 ? 163 MET D CG  1 
ATOM   3354 S SD  . MET D 2 51  ? -22.821 -16.213 -18.795 1.00 41.35 ? 163 MET D SD  1 
ATOM   3355 C CE  . MET D 2 51  ? -21.926 -17.203 -19.987 1.00 41.36 ? 163 MET D CE  1 
ATOM   3356 N N   . LYS D 2 52  ? -19.257 -13.334 -15.582 1.00 38.96 ? 164 LYS D N   1 
ATOM   3357 C CA  . LYS D 2 52  ? -19.366 -12.596 -14.323 1.00 38.64 ? 164 LYS D CA  1 
ATOM   3358 C C   . LYS D 2 52  ? -18.582 -11.283 -14.356 1.00 38.03 ? 164 LYS D C   1 
ATOM   3359 O O   . LYS D 2 52  ? -19.049 -10.268 -13.843 1.00 37.72 ? 164 LYS D O   1 
ATOM   3360 C CB  . LYS D 2 52  ? -18.903 -13.462 -13.149 1.00 38.62 ? 164 LYS D CB  1 
ATOM   3361 C CG  . LYS D 2 52  ? -18.843 -12.742 -11.802 1.00 38.96 ? 164 LYS D CG  1 
ATOM   3362 C CD  . LYS D 2 52  ? -20.194 -12.204 -11.351 1.00 38.89 ? 164 LYS D CD  1 
ATOM   3363 C CE  . LYS D 2 52  ? -20.035 -11.312 -10.134 1.00 39.00 ? 164 LYS D CE  1 
ATOM   3364 N NZ  . LYS D 2 52  ? -21.341 -10.860 -9.593  1.00 39.37 ? 164 LYS D NZ  1 
ATOM   3365 N N   . PHE D 2 53  ? -17.390 -11.308 -14.941 1.00 37.73 ? 165 PHE D N   1 
ATOM   3366 C CA  . PHE D 2 53  ? -16.603 -10.096 -15.108 1.00 37.74 ? 165 PHE D CA  1 
ATOM   3367 C C   . PHE D 2 53  ? -17.325 -9.079  -15.988 1.00 37.60 ? 165 PHE D C   1 
ATOM   3368 O O   . PHE D 2 53  ? -17.413 -7.894  -15.649 1.00 37.39 ? 165 PHE D O   1 
ATOM   3369 C CB  . PHE D 2 53  ? -15.250 -10.400 -15.735 1.00 37.77 ? 165 PHE D CB  1 
ATOM   3370 C CG  . PHE D 2 53  ? -14.636 -9.210  -16.395 1.00 37.85 ? 165 PHE D CG  1 
ATOM   3371 C CD1 . PHE D 2 53  ? -14.220 -8.124  -15.633 1.00 37.96 ? 165 PHE D CD1 1 
ATOM   3372 C CD2 . PHE D 2 53  ? -14.519 -9.147  -17.777 1.00 37.88 ? 165 PHE D CD2 1 
ATOM   3373 C CE1 . PHE D 2 53  ? -13.678 -7.005  -16.232 1.00 38.00 ? 165 PHE D CE1 1 
ATOM   3374 C CE2 . PHE D 2 53  ? -13.977 -8.032  -18.386 1.00 38.30 ? 165 PHE D CE2 1 
ATOM   3375 C CZ  . PHE D 2 53  ? -13.556 -6.956  -17.613 1.00 38.27 ? 165 PHE D CZ  1 
ATOM   3376 N N   . LEU D 2 54  ? -17.825 -9.562  -17.120 1.00 37.39 ? 166 LEU D N   1 
ATOM   3377 C CA  . LEU D 2 54  ? -18.538 -8.737  -18.091 1.00 37.41 ? 166 LEU D CA  1 
ATOM   3378 C C   . LEU D 2 54  ? -19.824 -8.120  -17.492 1.00 37.39 ? 166 LEU D C   1 
ATOM   3379 O O   . LEU D 2 54  ? -20.300 -7.069  -17.954 1.00 37.03 ? 166 LEU D O   1 
ATOM   3380 C CB  . LEU D 2 54  ? -18.867 -9.586  -19.325 1.00 37.32 ? 166 LEU D CB  1 
ATOM   3381 C CG  . LEU D 2 54  ? -18.440 -9.122  -20.720 1.00 37.88 ? 166 LEU D CG  1 
ATOM   3382 C CD1 . LEU D 2 54  ? -17.209 -8.225  -20.719 1.00 37.32 ? 166 LEU D CD1 1 
ATOM   3383 C CD2 . LEU D 2 54  ? -18.204 -10.347 -21.599 1.00 37.23 ? 166 LEU D CD2 1 
ATOM   3384 N N   . SER D 2 55  ? -20.363 -8.768  -16.459 1.00 37.13 ? 167 SER D N   1 
ATOM   3385 C CA  . SER D 2 55  ? -21.578 -8.303  -15.787 1.00 37.29 ? 167 SER D CA  1 
ATOM   3386 C C   . SER D 2 55  ? -21.332 -7.143  -14.812 1.00 37.43 ? 167 SER D C   1 
ATOM   3387 O O   . SER D 2 55  ? -22.292 -6.519  -14.353 1.00 37.17 ? 167 SER D O   1 
ATOM   3388 C CB  . SER D 2 55  ? -22.262 -9.466  -15.055 1.00 36.92 ? 167 SER D CB  1 
ATOM   3389 O OG  . SER D 2 55  ? -21.602 -9.780  -13.850 1.00 35.86 ? 167 SER D OG  1 
ATOM   3390 N N   . ILE D 2 56  ? -20.061 -6.888  -14.483 1.00 37.49 ? 168 ILE D N   1 
ATOM   3391 C CA  . ILE D 2 56  ? -19.661 -5.725  -13.680 1.00 37.96 ? 168 ILE D CA  1 
ATOM   3392 C C   . ILE D 2 56  ? -19.534 -4.483  -14.567 1.00 38.13 ? 168 ILE D C   1 
ATOM   3393 O O   . ILE D 2 56  ? -19.823 -3.362  -14.143 1.00 37.89 ? 168 ILE D O   1 
ATOM   3394 C CB  . ILE D 2 56  ? -18.290 -5.952  -12.982 1.00 37.90 ? 168 ILE D CB  1 
ATOM   3395 C CG1 . ILE D 2 56  ? -18.346 -7.166  -12.052 1.00 38.33 ? 168 ILE D CG1 1 
ATOM   3396 C CG2 . ILE D 2 56  ? -17.871 -4.721  -12.185 1.00 37.40 ? 168 ILE D CG2 1 
ATOM   3397 C CD1 . ILE D 2 56  ? -17.087 -7.352  -11.220 1.00 38.19 ? 168 ILE D CD1 1 
ATOM   3398 N N   . ILE D 2 57  ? -19.109 -4.716  -15.805 1.00 38.61 ? 169 ILE D N   1 
ATOM   3399 C CA  . ILE D 2 57  ? -18.738 -3.662  -16.742 1.00 39.03 ? 169 ILE D CA  1 
ATOM   3400 C C   . ILE D 2 57  ? -19.909 -3.171  -17.608 1.00 39.24 ? 169 ILE D C   1 
ATOM   3401 O O   . ILE D 2 57  ? -19.907 -2.026  -18.055 1.00 39.30 ? 169 ILE D O   1 
ATOM   3402 C CB  . ILE D 2 57  ? -17.568 -4.164  -17.643 1.00 39.11 ? 169 ILE D CB  1 
ATOM   3403 C CG1 . ILE D 2 57  ? -16.325 -4.390  -16.788 1.00 39.41 ? 169 ILE D CG1 1 
ATOM   3404 C CG2 . ILE D 2 57  ? -17.240 -3.186  -18.734 1.00 38.61 ? 169 ILE D CG2 1 
ATOM   3405 C CD1 . ILE D 2 57  ? -15.922 -3.170  -15.969 1.00 39.12 ? 169 ILE D CD1 1 
ATOM   3406 N N   . SER D 2 58  ? -20.902 -4.028  -17.841 1.00 39.63 ? 170 SER D N   1 
ATOM   3407 C CA  . SER D 2 58  ? -22.053 -3.661  -18.660 1.00 39.97 ? 170 SER D CA  1 
ATOM   3408 C C   . SER D 2 58  ? -23.218 -4.625  -18.472 1.00 40.31 ? 170 SER D C   1 
ATOM   3409 O O   . SER D 2 58  ? -23.031 -5.836  -18.567 1.00 40.62 ? 170 SER D O   1 
ATOM   3410 C CB  . SER D 2 58  ? -21.637 -3.649  -20.125 1.00 40.24 ? 170 SER D CB  1 
ATOM   3411 O OG  . SER D 2 58  ? -20.864 -2.500  -20.432 1.00 40.37 ? 170 SER D OG  1 
ATOM   3412 N N   . PRO D 2 59  ? -24.434 -4.098  -18.236 1.00 40.70 ? 171 PRO D N   1 
ATOM   3413 C CA  . PRO D 2 59  ? -25.565 -4.977  -17.909 1.00 40.62 ? 171 PRO D CA  1 
ATOM   3414 C C   . PRO D 2 59  ? -26.054 -5.852  -19.067 1.00 40.59 ? 171 PRO D C   1 
ATOM   3415 O O   . PRO D 2 59  ? -26.312 -7.035  -18.851 1.00 40.90 ? 171 PRO D O   1 
ATOM   3416 C CB  . PRO D 2 59  ? -26.663 -4.000  -17.463 1.00 40.65 ? 171 PRO D CB  1 
ATOM   3417 C CG  . PRO D 2 59  ? -26.348 -2.732  -18.153 1.00 40.74 ? 171 PRO D CG  1 
ATOM   3418 C CD  . PRO D 2 59  ? -24.836 -2.680  -18.252 1.00 40.97 ? 171 PRO D CD  1 
ATOM   3419 N N   . SER D 2 60  ? -26.181 -5.294  -20.269 1.00 40.29 ? 172 SER D N   1 
ATOM   3420 C CA  . SER D 2 60  ? -26.766 -6.040  -21.387 1.00 39.89 ? 172 SER D CA  1 
ATOM   3421 C C   . SER D 2 60  ? -25.862 -6.024  -22.605 1.00 39.59 ? 172 SER D C   1 
ATOM   3422 O O   . SER D 2 60  ? -25.240 -5.008  -22.891 1.00 39.60 ? 172 SER D O   1 
ATOM   3423 C CB  . SER D 2 60  ? -28.146 -5.473  -21.754 1.00 40.05 ? 172 SER D CB  1 
ATOM   3424 O OG  . SER D 2 60  ? -28.072 -4.525  -22.806 1.00 39.62 ? 172 SER D OG  1 
ATOM   3425 N N   . SER D 2 61  ? -25.797 -7.154  -23.317 1.00 39.25 ? 173 SER D N   1 
ATOM   3426 C CA  . SER D 2 61  ? -25.156 -7.200  -24.635 1.00 38.84 ? 173 SER D CA  1 
ATOM   3427 C C   . SER D 2 61  ? -25.549 -8.409  -25.462 1.00 38.34 ? 173 SER D C   1 
ATOM   3428 O O   . SER D 2 61  ? -25.744 -9.494  -24.932 1.00 38.15 ? 173 SER D O   1 
ATOM   3429 C CB  . SER D 2 61  ? -23.630 -7.183  -24.515 1.00 39.03 ? 173 SER D CB  1 
ATOM   3430 O OG  . SER D 2 61  ? -23.035 -7.461  -25.776 1.00 38.43 ? 173 SER D OG  1 
ATOM   3431 N N   . TRP D 2 62  ? -25.632 -8.202  -26.773 1.00 38.09 ? 174 TRP D N   1 
ATOM   3432 C CA  . TRP D 2 62  ? -25.718 -9.289  -27.747 1.00 37.88 ? 174 TRP D CA  1 
ATOM   3433 C C   . TRP D 2 62  ? -24.458 -10.129 -27.650 1.00 37.65 ? 174 TRP D C   1 
ATOM   3434 O O   . TRP D 2 62  ? -23.369 -9.606  -27.434 1.00 37.24 ? 174 TRP D O   1 
ATOM   3435 C CB  . TRP D 2 62  ? -25.771 -8.740  -29.171 1.00 37.66 ? 174 TRP D CB  1 
ATOM   3436 C CG  . TRP D 2 62  ? -27.063 -8.123  -29.608 1.00 37.67 ? 174 TRP D CG  1 
ATOM   3437 C CD1 . TRP D 2 62  ? -27.235 -6.871  -30.109 1.00 37.29 ? 174 TRP D CD1 1 
ATOM   3438 C CD2 . TRP D 2 62  ? -28.353 -8.747  -29.638 1.00 37.28 ? 174 TRP D CD2 1 
ATOM   3439 N NE1 . TRP D 2 62  ? -28.550 -6.671  -30.441 1.00 37.30 ? 174 TRP D NE1 1 
ATOM   3440 C CE2 . TRP D 2 62  ? -29.258 -7.807  -30.160 1.00 37.29 ? 174 TRP D CE2 1 
ATOM   3441 C CE3 . TRP D 2 62  ? -28.829 -10.005 -29.265 1.00 37.25 ? 174 TRP D CE3 1 
ATOM   3442 C CZ2 . TRP D 2 62  ? -30.618 -8.085  -30.318 1.00 37.61 ? 174 TRP D CZ2 1 
ATOM   3443 C CZ3 . TRP D 2 62  ? -30.181 -10.285 -29.421 1.00 37.35 ? 174 TRP D CZ3 1 
ATOM   3444 C CH2 . TRP D 2 62  ? -31.057 -9.331  -29.947 1.00 37.49 ? 174 TRP D CH2 1 
ATOM   3445 N N   . ILE D 2 63  ? -24.596 -11.430 -27.813 1.00 37.47 ? 175 ILE D N   1 
ATOM   3446 C CA  . ILE D 2 63  ? -23.431 -12.248 -28.008 1.00 37.80 ? 175 ILE D CA  1 
ATOM   3447 C C   . ILE D 2 63  ? -23.564 -12.964 -29.357 1.00 37.91 ? 175 ILE D C   1 
ATOM   3448 O O   . ILE D 2 63  ? -24.669 -13.120 -29.880 1.00 37.83 ? 175 ILE D O   1 
ATOM   3449 C CB  . ILE D 2 63  ? -23.185 -13.222 -26.835 1.00 37.72 ? 175 ILE D CB  1 
ATOM   3450 C CG1 . ILE D 2 63  ? -24.383 -14.134 -26.587 1.00 37.83 ? 175 ILE D CG1 1 
ATOM   3451 C CG2 . ILE D 2 63  ? -22.862 -12.462 -25.589 1.00 37.09 ? 175 ILE D CG2 1 
ATOM   3452 C CD1 . ILE D 2 63  ? -24.022 -15.322 -25.720 1.00 37.88 ? 175 ILE D CD1 1 
ATOM   3453 N N   . GLY D 2 64  ? -22.441 -13.382 -29.926 1.00 38.13 ? 176 GLY D N   1 
ATOM   3454 C CA  . GLY D 2 64  ? -22.447 -14.028 -31.253 1.00 38.39 ? 176 GLY D CA  1 
ATOM   3455 C C   . GLY D 2 64  ? -22.982 -15.450 -31.232 1.00 38.52 ? 176 GLY D C   1 
ATOM   3456 O O   . GLY D 2 64  ? -22.241 -16.383 -31.514 1.00 39.04 ? 176 GLY D O   1 
ATOM   3457 N N   . VAL D 2 65  ? -24.266 -15.606 -30.910 1.00 38.54 ? 177 VAL D N   1 
ATOM   3458 C CA  . VAL D 2 65  ? -24.924 -16.915 -30.810 1.00 38.66 ? 177 VAL D CA  1 
ATOM   3459 C C   . VAL D 2 65  ? -26.344 -16.794 -31.369 1.00 38.97 ? 177 VAL D C   1 
ATOM   3460 O O   . VAL D 2 65  ? -27.015 -15.793 -31.110 1.00 39.28 ? 177 VAL D O   1 
ATOM   3461 C CB  . VAL D 2 65  ? -24.991 -17.391 -29.343 1.00 38.47 ? 177 VAL D CB  1 
ATOM   3462 C CG1 . VAL D 2 65  ? -25.845 -18.648 -29.213 1.00 38.03 ? 177 VAL D CG1 1 
ATOM   3463 C CG2 . VAL D 2 65  ? -23.590 -17.627 -28.811 1.00 37.88 ? 177 VAL D CG2 1 
ATOM   3464 N N   . PHE D 2 66  ? -26.808 -17.787 -32.130 1.00 39.04 ? 178 PHE D N   1 
ATOM   3465 C CA  . PHE D 2 66  ? -28.117 -17.662 -32.791 1.00 39.18 ? 178 PHE D CA  1 
ATOM   3466 C C   . PHE D 2 66  ? -28.800 -18.968 -33.210 1.00 39.32 ? 178 PHE D C   1 
ATOM   3467 O O   . PHE D 2 66  ? -28.207 -20.049 -33.163 1.00 38.91 ? 178 PHE D O   1 
ATOM   3468 C CB  . PHE D 2 66  ? -27.997 -16.743 -34.023 1.00 39.08 ? 178 PHE D CB  1 
ATOM   3469 C CG  . PHE D 2 66  ? -27.308 -17.373 -35.188 1.00 38.70 ? 178 PHE D CG  1 
ATOM   3470 C CD1 . PHE D 2 66  ? -25.922 -17.469 -35.223 1.00 38.89 ? 178 PHE D CD1 1 
ATOM   3471 C CD2 . PHE D 2 66  ? -28.039 -17.862 -36.261 1.00 39.13 ? 178 PHE D CD2 1 
ATOM   3472 C CE1 . PHE D 2 66  ? -25.271 -18.049 -36.314 1.00 38.38 ? 178 PHE D CE1 1 
ATOM   3473 C CE2 . PHE D 2 66  ? -27.399 -18.440 -37.351 1.00 38.89 ? 178 PHE D CE2 1 
ATOM   3474 C CZ  . PHE D 2 66  ? -26.012 -18.538 -37.372 1.00 38.80 ? 178 PHE D CZ  1 
ATOM   3475 N N   . ARG D 2 67  ? -30.065 -18.820 -33.612 1.00 39.64 ? 179 ARG D N   1 
ATOM   3476 C CA  . ARG D 2 67  ? -30.857 -19.882 -34.224 1.00 39.87 ? 179 ARG D CA  1 
ATOM   3477 C C   . ARG D 2 67  ? -31.513 -19.372 -35.493 1.00 40.01 ? 179 ARG D C   1 
ATOM   3478 O O   . ARG D 2 67  ? -31.870 -18.190 -35.575 1.00 39.81 ? 179 ARG D O   1 
ATOM   3479 C CB  . ARG D 2 67  ? -31.972 -20.348 -33.286 1.00 40.10 ? 179 ARG D CB  1 
ATOM   3480 C CG  . ARG D 2 67  ? -31.495 -20.930 -31.987 1.00 40.47 ? 179 ARG D CG  1 
ATOM   3481 C CD  . ARG D 2 67  ? -32.600 -21.640 -31.232 1.00 40.00 ? 179 ARG D CD  1 
ATOM   3482 N NE  . ARG D 2 67  ? -33.578 -20.721 -30.661 1.00 39.65 ? 179 ARG D NE  1 
ATOM   3483 C CZ  . ARG D 2 67  ? -34.418 -21.038 -29.674 1.00 39.85 ? 179 ARG D CZ  1 
ATOM   3484 N NH1 . ARG D 2 67  ? -34.414 -22.254 -29.137 1.00 39.87 ? 179 ARG D NH1 1 
ATOM   3485 N NH2 . ARG D 2 67  ? -35.273 -20.136 -29.218 1.00 39.75 ? 179 ARG D NH2 1 
ATOM   3486 N N   . ASN D 2 68  ? -31.683 -20.276 -36.464 1.00 40.01 ? 180 ASN D N   1 
ATOM   3487 C CA  . ASN D 2 68  ? -32.518 -20.020 -37.636 1.00 40.02 ? 180 ASN D CA  1 
ATOM   3488 C C   . ASN D 2 68  ? -33.995 -20.010 -37.243 1.00 40.14 ? 180 ASN D C   1 
ATOM   3489 O O   . ASN D 2 68  ? -34.776 -19.228 -37.788 1.00 40.03 ? 180 ASN D O   1 
ATOM   3490 C CB  . ASN D 2 68  ? -32.308 -21.090 -38.716 1.00 40.06 ? 180 ASN D CB  1 
ATOM   3491 C CG  . ASN D 2 68  ? -30.905 -21.075 -39.323 1.00 39.78 ? 180 ASN D CG  1 
ATOM   3492 O OD1 . ASN D 2 68  ? -30.263 -20.027 -39.443 1.00 39.68 ? 180 ASN D OD1 1 
ATOM   3493 N ND2 . ASN D 2 68  ? -30.437 -22.247 -39.730 1.00 38.06 ? 180 ASN D ND2 1 
ATOM   3494 N N   . SER D 2 69  ? -34.367 -20.894 -36.311 1.00 40.30 ? 181 SER D N   1 
ATOM   3495 C CA  . SER D 2 69  ? -35.746 -20.986 -35.806 1.00 40.28 ? 181 SER D CA  1 
ATOM   3496 C C   . SER D 2 69  ? -35.824 -21.630 -34.418 1.00 40.41 ? 181 SER D C   1 
ATOM   3497 O O   . SER D 2 69  ? -34.850 -22.192 -33.915 1.00 40.10 ? 181 SER D O   1 
ATOM   3498 C CB  . SER D 2 69  ? -36.634 -21.790 -36.762 1.00 40.01 ? 181 SER D CB  1 
ATOM   3499 O OG  . SER D 2 69  ? -36.827 -23.113 -36.285 1.00 39.18 ? 181 SER D OG  1 
ATOM   3500 N N   . SER D 2 70  ? -37.027 -21.577 -33.848 1.00 40.82 ? 182 SER D N   1 
ATOM   3501 C CA  . SER D 2 70  ? -37.309 -22.006 -32.474 1.00 41.02 ? 182 SER D CA  1 
ATOM   3502 C C   . SER D 2 70  ? -36.603 -23.287 -32.041 1.00 41.23 ? 182 SER D C   1 
ATOM   3503 O O   . SER D 2 70  ? -36.200 -23.394 -30.880 1.00 41.45 ? 182 SER D O   1 
ATOM   3504 C CB  . SER D 2 70  ? -38.821 -22.156 -32.263 1.00 41.09 ? 182 SER D CB  1 
ATOM   3505 O OG  . SER D 2 70  ? -39.471 -20.911 -32.435 1.00 41.26 ? 182 SER D OG  1 
ATOM   3506 N N   . HIS D 2 71  ? -36.470 -24.270 -32.932 1.00 41.22 ? 183 HIS D N   1 
ATOM   3507 C CA  . HIS D 2 71  ? -35.564 -25.367 -32.615 1.00 41.12 ? 183 HIS D CA  1 
ATOM   3508 C C   . HIS D 2 71  ? -34.775 -25.999 -33.745 1.00 40.89 ? 183 HIS D C   1 
ATOM   3509 O O   . HIS D 2 71  ? -35.150 -27.009 -34.338 1.00 40.76 ? 183 HIS D O   1 
ATOM   3510 C CB  . HIS D 2 71  ? -36.201 -26.450 -31.754 1.00 41.30 ? 183 HIS D CB  1 
ATOM   3511 C CG  . HIS D 2 71  ? -35.186 -27.276 -31.026 1.00 41.67 ? 183 HIS D CG  1 
ATOM   3512 N ND1 . HIS D 2 71  ? -34.065 -26.720 -30.442 1.00 42.33 ? 183 HIS D ND1 1 
ATOM   3513 C CD2 . HIS D 2 71  ? -35.108 -28.608 -30.799 1.00 42.48 ? 183 HIS D CD2 1 
ATOM   3514 C CE1 . HIS D 2 71  ? -33.342 -27.675 -29.883 1.00 42.65 ? 183 HIS D CE1 1 
ATOM   3515 N NE2 . HIS D 2 71  ? -33.955 -28.829 -30.082 1.00 42.89 ? 183 HIS D NE2 1 
ATOM   3516 N N   . HIS D 2 72  ? -33.672 -25.325 -34.024 1.00 40.62 ? 184 HIS D N   1 
ATOM   3517 C CA  . HIS D 2 72  ? -32.413 -25.962 -34.308 1.00 40.43 ? 184 HIS D CA  1 
ATOM   3518 C C   . HIS D 2 72  ? -31.546 -25.471 -33.145 1.00 40.29 ? 184 HIS D C   1 
ATOM   3519 O O   . HIS D 2 72  ? -31.879 -24.460 -32.526 1.00 40.22 ? 184 HIS D O   1 
ATOM   3520 C CB  . HIS D 2 72  ? -31.857 -25.459 -35.629 1.00 40.50 ? 184 HIS D CB  1 
ATOM   3521 C CG  . HIS D 2 72  ? -32.844 -25.505 -36.752 1.00 40.70 ? 184 HIS D CG  1 
ATOM   3522 N ND1 . HIS D 2 72  ? -32.945 -26.578 -37.609 1.00 40.74 ? 184 HIS D ND1 1 
ATOM   3523 C CD2 . HIS D 2 72  ? -33.772 -24.608 -37.160 1.00 40.58 ? 184 HIS D CD2 1 
ATOM   3524 C CE1 . HIS D 2 72  ? -33.890 -26.338 -38.500 1.00 40.39 ? 184 HIS D CE1 1 
ATOM   3525 N NE2 . HIS D 2 72  ? -34.407 -25.149 -38.250 1.00 40.14 ? 184 HIS D NE2 1 
ATOM   3526 N N   . PRO D 2 73  ? -30.449 -26.174 -32.827 1.00 40.15 ? 185 PRO D N   1 
ATOM   3527 C CA  . PRO D 2 73  ? -29.659 -25.788 -31.653 1.00 40.07 ? 185 PRO D CA  1 
ATOM   3528 C C   . PRO D 2 73  ? -29.007 -24.414 -31.775 1.00 39.91 ? 185 PRO D C   1 
ATOM   3529 O O   . PRO D 2 73  ? -28.860 -23.900 -32.877 1.00 39.89 ? 185 PRO D O   1 
ATOM   3530 C CB  . PRO D 2 73  ? -28.590 -26.878 -31.581 1.00 40.11 ? 185 PRO D CB  1 
ATOM   3531 C CG  . PRO D 2 73  ? -28.478 -27.398 -32.959 1.00 40.23 ? 185 PRO D CG  1 
ATOM   3532 C CD  . PRO D 2 73  ? -29.851 -27.311 -33.544 1.00 40.15 ? 185 PRO D CD  1 
ATOM   3533 N N   . TRP D 2 74  ? -28.636 -23.821 -30.642 1.00 39.98 ? 186 TRP D N   1 
ATOM   3534 C CA  . TRP D 2 74  ? -27.918 -22.538 -30.645 1.00 39.87 ? 186 TRP D CA  1 
ATOM   3535 C C   . TRP D 2 74  ? -26.502 -22.698 -31.222 1.00 39.87 ? 186 TRP D C   1 
ATOM   3536 O O   . TRP D 2 74  ? -25.753 -23.600 -30.822 1.00 40.02 ? 186 TRP D O   1 
ATOM   3537 C CB  . TRP D 2 74  ? -27.858 -21.934 -29.242 1.00 39.91 ? 186 TRP D CB  1 
ATOM   3538 C CG  . TRP D 2 74  ? -29.179 -21.447 -28.749 1.00 40.24 ? 186 TRP D CG  1 
ATOM   3539 C CD1 . TRP D 2 74  ? -30.048 -22.121 -27.942 1.00 40.18 ? 186 TRP D CD1 1 
ATOM   3540 C CD2 . TRP D 2 74  ? -29.793 -20.179 -29.031 1.00 40.17 ? 186 TRP D CD2 1 
ATOM   3541 N NE1 . TRP D 2 74  ? -31.164 -21.359 -27.709 1.00 40.34 ? 186 TRP D NE1 1 
ATOM   3542 C CE2 . TRP D 2 74  ? -31.034 -20.162 -28.363 1.00 40.17 ? 186 TRP D CE2 1 
ATOM   3543 C CE3 . TRP D 2 74  ? -29.416 -19.060 -29.785 1.00 40.38 ? 186 TRP D CE3 1 
ATOM   3544 C CZ2 . TRP D 2 74  ? -31.905 -19.065 -28.422 1.00 40.29 ? 186 TRP D CZ2 1 
ATOM   3545 C CZ3 . TRP D 2 74  ? -30.290 -17.967 -29.849 1.00 40.31 ? 186 TRP D CZ3 1 
ATOM   3546 C CH2 . TRP D 2 74  ? -31.513 -17.978 -29.163 1.00 40.27 ? 186 TRP D CH2 1 
ATOM   3547 N N   . VAL D 2 75  ? -26.145 -21.805 -32.145 1.00 39.53 ? 187 VAL D N   1 
ATOM   3548 C CA  . VAL D 2 75  ? -24.905 -21.899 -32.912 1.00 39.39 ? 187 VAL D CA  1 
ATOM   3549 C C   . VAL D 2 75  ? -24.076 -20.638 -32.714 1.00 39.27 ? 187 VAL D C   1 
ATOM   3550 O O   . VAL D 2 75  ? -24.631 -19.538 -32.662 1.00 39.31 ? 187 VAL D O   1 
ATOM   3551 C CB  . VAL D 2 75  ? -25.207 -22.040 -34.430 1.00 39.28 ? 187 VAL D CB  1 
ATOM   3552 C CG1 . VAL D 2 75  ? -23.929 -22.119 -35.228 1.00 39.68 ? 187 VAL D CG1 1 
ATOM   3553 C CG2 . VAL D 2 75  ? -26.051 -23.266 -34.704 1.00 39.11 ? 187 VAL D CG2 1 
ATOM   3554 N N   . THR D 2 76  ? -22.756 -20.793 -32.618 1.00 39.13 ? 188 THR D N   1 
ATOM   3555 C CA  . THR D 2 76  ? -21.845 -19.644 -32.538 1.00 39.15 ? 188 THR D CA  1 
ATOM   3556 C C   . THR D 2 76  ? -21.509 -19.141 -33.945 1.00 39.35 ? 188 THR D C   1 
ATOM   3557 O O   . THR D 2 76  ? -21.878 -19.762 -34.941 1.00 38.96 ? 188 THR D O   1 
ATOM   3558 C CB  . THR D 2 76  ? -20.512 -20.006 -31.872 1.00 38.92 ? 188 THR D CB  1 
ATOM   3559 O OG1 . THR D 2 76  ? -19.775 -20.876 -32.743 1.00 38.33 ? 188 THR D OG1 1 
ATOM   3560 C CG2 . THR D 2 76  ? -20.737 -20.689 -30.539 1.00 38.65 ? 188 THR D CG2 1 
ATOM   3561 N N   . MET D 2 77  ? -20.787 -18.027 -34.017 1.00 39.50 ? 189 MET D N   1 
ATOM   3562 C CA  . MET D 2 77  ? -20.297 -17.511 -35.293 1.00 39.59 ? 189 MET D CA  1 
ATOM   3563 C C   . MET D 2 77  ? -18.992 -18.187 -35.715 1.00 39.68 ? 189 MET D C   1 
ATOM   3564 O O   . MET D 2 77  ? -18.522 -17.968 -36.829 1.00 40.01 ? 189 MET D O   1 
ATOM   3565 C CB  . MET D 2 77  ? -20.116 -15.992 -35.218 1.00 39.90 ? 189 MET D CB  1 
ATOM   3566 C CG  . MET D 2 77  ? -21.415 -15.236 -35.081 1.00 39.92 ? 189 MET D CG  1 
ATOM   3567 S SD  . MET D 2 77  ? -22.469 -15.432 -36.535 1.00 43.70 ? 189 MET D SD  1 
ATOM   3568 C CE  . MET D 2 77  ? -21.518 -14.576 -37.789 1.00 41.20 ? 189 MET D CE  1 
ATOM   3569 N N   . ASN D 2 78  ? -18.404 -18.994 -34.830 1.00 39.63 ? 190 ASN D N   1 
ATOM   3570 C CA  . ASN D 2 78  ? -17.294 -19.883 -35.211 1.00 39.50 ? 190 ASN D CA  1 
ATOM   3571 C C   . ASN D 2 78  ? -17.777 -21.210 -35.784 1.00 39.42 ? 190 ASN D C   1 
ATOM   3572 O O   . ASN D 2 78  ? -16.956 -22.063 -36.113 1.00 39.52 ? 190 ASN D O   1 
ATOM   3573 C CB  . ASN D 2 78  ? -16.380 -20.171 -34.013 1.00 39.67 ? 190 ASN D CB  1 
ATOM   3574 C CG  . ASN D 2 78  ? -15.474 -19.007 -33.663 1.00 40.13 ? 190 ASN D CG  1 
ATOM   3575 O OD1 . ASN D 2 78  ? -15.286 -18.072 -34.454 1.00 40.16 ? 190 ASN D OD1 1 
ATOM   3576 N ND2 . ASN D 2 78  ? -14.897 -19.062 -32.467 1.00 39.96 ? 190 ASN D ND2 1 
ATOM   3577 N N   . GLY D 2 79  ? -19.098 -21.392 -35.882 1.00 39.43 ? 191 GLY D N   1 
ATOM   3578 C CA  . GLY D 2 79  ? -19.687 -22.595 -36.459 1.00 39.45 ? 191 GLY D CA  1 
ATOM   3579 C C   . GLY D 2 79  ? -19.745 -23.795 -35.527 1.00 39.62 ? 191 GLY D C   1 
ATOM   3580 O O   . GLY D 2 79  ? -19.676 -24.937 -35.984 1.00 39.64 ? 191 GLY D O   1 
ATOM   3581 N N   . LEU D 2 80  ? -19.901 -23.537 -34.228 1.00 39.96 ? 192 LEU D N   1 
ATOM   3582 C CA  . LEU D 2 80  ? -19.928 -24.576 -33.197 1.00 40.10 ? 192 LEU D CA  1 
ATOM   3583 C C   . LEU D 2 80  ? -21.232 -24.546 -32.412 1.00 40.43 ? 192 LEU D C   1 
ATOM   3584 O O   . LEU D 2 80  ? -21.962 -23.547 -32.435 1.00 40.76 ? 192 LEU D O   1 
ATOM   3585 C CB  . LEU D 2 80  ? -18.798 -24.337 -32.207 1.00 40.14 ? 192 LEU D CB  1 
ATOM   3586 C CG  . LEU D 2 80  ? -17.377 -24.530 -32.700 1.00 40.16 ? 192 LEU D CG  1 
ATOM   3587 C CD1 . LEU D 2 80  ? -16.420 -23.968 -31.664 1.00 39.90 ? 192 LEU D CD1 1 
ATOM   3588 C CD2 . LEU D 2 80  ? -17.119 -26.005 -32.952 1.00 40.40 ? 192 LEU D CD2 1 
ATOM   3589 N N   . ALA D 2 81  ? -21.502 -25.634 -31.691 1.00 40.53 ? 193 ALA D N   1 
ATOM   3590 C CA  . ALA D 2 81  ? -22.652 -25.703 -30.790 1.00 40.81 ? 193 ALA D CA  1 
ATOM   3591 C C   . ALA D 2 81  ? -22.337 -24.957 -29.493 1.00 40.98 ? 193 ALA D C   1 
ATOM   3592 O O   . ALA D 2 81  ? -21.317 -25.216 -28.861 1.00 41.03 ? 193 ALA D O   1 
ATOM   3593 C CB  . ALA D 2 81  ? -23.012 -27.151 -30.492 1.00 40.57 ? 193 ALA D CB  1 
ATOM   3594 N N   . PHE D 2 82  ? -23.218 -24.035 -29.106 1.00 41.58 ? 194 PHE D N   1 
ATOM   3595 C CA  . PHE D 2 82  ? -23.008 -23.194 -27.922 1.00 41.76 ? 194 PHE D CA  1 
ATOM   3596 C C   . PHE D 2 82  ? -23.360 -23.989 -26.668 1.00 42.04 ? 194 PHE D C   1 
ATOM   3597 O O   . PHE D 2 82  ? -24.528 -24.296 -26.431 1.00 42.26 ? 194 PHE D O   1 
ATOM   3598 C CB  . PHE D 2 82  ? -23.863 -21.931 -28.023 1.00 41.97 ? 194 PHE D CB  1 
ATOM   3599 C CG  . PHE D 2 82  ? -23.610 -20.934 -26.930 1.00 42.12 ? 194 PHE D CG  1 
ATOM   3600 C CD1 . PHE D 2 82  ? -24.600 -20.633 -25.999 1.00 42.66 ? 194 PHE D CD1 1 
ATOM   3601 C CD2 . PHE D 2 82  ? -22.380 -20.290 -26.829 1.00 42.33 ? 194 PHE D CD2 1 
ATOM   3602 C CE1 . PHE D 2 82  ? -24.364 -19.700 -24.978 1.00 42.85 ? 194 PHE D CE1 1 
ATOM   3603 C CE2 . PHE D 2 82  ? -22.137 -19.360 -25.813 1.00 42.52 ? 194 PHE D CE2 1 
ATOM   3604 C CZ  . PHE D 2 82  ? -23.129 -19.064 -24.888 1.00 42.37 ? 194 PHE D CZ  1 
ATOM   3605 N N   . LYS D 2 83  ? -22.347 -24.316 -25.869 1.00 42.21 ? 195 LYS D N   1 
ATOM   3606 C CA  . LYS D 2 83  ? -22.507 -25.281 -24.771 1.00 42.27 ? 195 LYS D CA  1 
ATOM   3607 C C   . LYS D 2 83  ? -23.010 -24.697 -23.440 1.00 42.04 ? 195 LYS D C   1 
ATOM   3608 O O   . LYS D 2 83  ? -23.199 -25.443 -22.482 1.00 41.92 ? 195 LYS D O   1 
ATOM   3609 C CB  . LYS D 2 83  ? -21.201 -26.069 -24.568 1.00 42.34 ? 195 LYS D CB  1 
ATOM   3610 C CG  . LYS D 2 83  ? -21.231 -27.497 -25.149 1.00 43.06 ? 195 LYS D CG  1 
ATOM   3611 C CD  . LYS D 2 83  ? -19.986 -27.838 -25.983 1.00 43.25 ? 195 LYS D CD  1 
ATOM   3612 C CE  . LYS D 2 83  ? -18.675 -27.728 -25.189 1.00 44.18 ? 195 LYS D CE  1 
ATOM   3613 N NZ  . LYS D 2 83  ? -17.502 -27.560 -26.105 1.00 44.14 ? 195 LYS D NZ  1 
ATOM   3614 N N   . HIS D 2 84  ? -23.236 -23.384 -23.384 1.00 41.91 ? 196 HIS D N   1 
ATOM   3615 C CA  . HIS D 2 84  ? -23.871 -22.764 -22.213 1.00 41.94 ? 196 HIS D CA  1 
ATOM   3616 C C   . HIS D 2 84  ? -25.373 -22.640 -22.439 1.00 41.80 ? 196 HIS D C   1 
ATOM   3617 O O   . HIS D 2 84  ? -25.819 -22.288 -23.535 1.00 41.59 ? 196 HIS D O   1 
ATOM   3618 C CB  . HIS D 2 84  ? -23.290 -21.380 -21.909 1.00 42.00 ? 196 HIS D CB  1 
ATOM   3619 C CG  . HIS D 2 84  ? -21.796 -21.352 -21.829 1.00 42.28 ? 196 HIS D CG  1 
ATOM   3620 N ND1 . HIS D 2 84  ? -21.000 -21.004 -22.901 1.00 42.49 ? 196 HIS D ND1 1 
ATOM   3621 C CD2 . HIS D 2 84  ? -20.952 -21.630 -20.808 1.00 41.99 ? 196 HIS D CD2 1 
ATOM   3622 C CE1 . HIS D 2 84  ? -19.731 -21.069 -22.544 1.00 42.32 ? 196 HIS D CE1 1 
ATOM   3623 N NE2 . HIS D 2 84  ? -19.674 -21.446 -21.278 1.00 42.17 ? 196 HIS D NE2 1 
ATOM   3624 N N   . GLU D 2 85  ? -26.149 -22.924 -21.393 1.00 41.67 ? 197 GLU D N   1 
ATOM   3625 C CA  . GLU D 2 85  ? -27.601 -22.858 -21.485 1.00 41.58 ? 197 GLU D CA  1 
ATOM   3626 C C   . GLU D 2 85  ? -28.022 -21.401 -21.604 1.00 41.49 ? 197 GLU D C   1 
ATOM   3627 O O   . GLU D 2 85  ? -27.426 -20.520 -20.980 1.00 41.65 ? 197 GLU D O   1 
ATOM   3628 C CB  . GLU D 2 85  ? -28.267 -23.512 -20.272 1.00 41.54 ? 197 GLU D CB  1 
ATOM   3629 C CG  . GLU D 2 85  ? -28.020 -25.021 -20.150 1.00 41.74 ? 197 GLU D CG  1 
ATOM   3630 C CD  . GLU D 2 85  ? -28.548 -25.619 -18.846 1.00 41.87 ? 197 GLU D CD  1 
ATOM   3631 O OE1 . GLU D 2 85  ? -29.026 -26.774 -18.871 1.00 43.24 ? 197 GLU D OE1 1 
ATOM   3632 O OE2 . GLU D 2 85  ? -28.487 -24.943 -17.794 1.00 42.27 ? 197 GLU D OE2 1 
ATOM   3633 N N   . ILE D 2 86  ? -29.033 -21.155 -22.430 1.00 41.37 ? 198 ILE D N   1 
ATOM   3634 C CA  . ILE D 2 86  ? -29.587 -19.820 -22.617 1.00 41.26 ? 198 ILE D CA  1 
ATOM   3635 C C   . ILE D 2 86  ? -31.115 -19.875 -22.399 1.00 41.29 ? 198 ILE D C   1 
ATOM   3636 O O   . ILE D 2 86  ? -31.791 -20.796 -22.857 1.00 41.57 ? 198 ILE D O   1 
ATOM   3637 C CB  . ILE D 2 86  ? -29.122 -19.190 -23.989 1.00 41.15 ? 198 ILE D CB  1 
ATOM   3638 C CG1 . ILE D 2 86  ? -29.943 -17.940 -24.363 1.00 41.05 ? 198 ILE D CG1 1 
ATOM   3639 C CG2 . ILE D 2 86  ? -29.101 -20.217 -25.100 1.00 41.37 ? 198 ILE D CG2 1 
ATOM   3640 C CD1 . ILE D 2 86  ? -31.300 -18.197 -24.968 1.00 40.82 ? 198 ILE D CD1 1 
ATOM   3641 N N   . LYS D 2 87  ? -31.633 -18.900 -21.656 1.00 41.09 ? 199 LYS D N   1 
ATOM   3642 C CA  . LYS D 2 87  ? -33.032 -18.872 -21.248 1.00 40.91 ? 199 LYS D CA  1 
ATOM   3643 C C   . LYS D 2 87  ? -33.968 -18.575 -22.419 1.00 40.89 ? 199 LYS D C   1 
ATOM   3644 O O   . LYS D 2 87  ? -34.918 -19.327 -22.678 1.00 41.08 ? 199 LYS D O   1 
ATOM   3645 C CB  . LYS D 2 87  ? -33.218 -17.829 -20.134 1.00 40.90 ? 199 LYS D CB  1 
ATOM   3646 C CG  . LYS D 2 87  ? -32.601 -18.237 -18.785 1.00 40.76 ? 199 LYS D CG  1 
ATOM   3647 C CD  . LYS D 2 87  ? -31.848 -17.090 -18.100 1.00 40.84 ? 199 LYS D CD  1 
ATOM   3648 C CE  . LYS D 2 87  ? -32.755 -15.915 -17.743 1.00 40.87 ? 199 LYS D CE  1 
ATOM   3649 N NZ  . LYS D 2 87  ? -31.973 -14.716 -17.318 1.00 40.76 ? 199 LYS D NZ  1 
ATOM   3650 N N   . ALA D 2 92  ? -41.109 -17.006 -27.280 1.00 42.11 ? 204 ALA D N   1 
ATOM   3651 C CA  . ALA D 2 92  ? -42.007 -16.980 -28.426 1.00 42.14 ? 204 ALA D CA  1 
ATOM   3652 C C   . ALA D 2 92  ? -41.226 -16.981 -29.741 1.00 42.18 ? 204 ALA D C   1 
ATOM   3653 O O   . ALA D 2 92  ? -41.094 -18.028 -30.372 1.00 42.30 ? 204 ALA D O   1 
ATOM   3654 C CB  . ALA D 2 92  ? -42.946 -15.776 -28.346 1.00 42.24 ? 204 ALA D CB  1 
ATOM   3655 N N   . GLU D 2 93  ? -40.694 -15.825 -30.139 1.00 42.20 ? 205 GLU D N   1 
ATOM   3656 C CA  . GLU D 2 93  ? -40.010 -15.680 -31.436 1.00 42.14 ? 205 GLU D CA  1 
ATOM   3657 C C   . GLU D 2 93  ? -38.566 -15.194 -31.274 1.00 42.13 ? 205 GLU D C   1 
ATOM   3658 O O   . GLU D 2 93  ? -38.098 -14.337 -32.024 1.00 42.33 ? 205 GLU D O   1 
ATOM   3659 C CB  . GLU D 2 93  ? -40.794 -14.701 -32.314 1.00 42.27 ? 205 GLU D CB  1 
ATOM   3660 C CG  . GLU D 2 93  ? -40.511 -14.823 -33.810 1.00 42.34 ? 205 GLU D CG  1 
ATOM   3661 C CD  . GLU D 2 93  ? -41.344 -13.864 -34.637 1.00 42.36 ? 205 GLU D CD  1 
ATOM   3662 O OE1 . GLU D 2 93  ? -42.251 -13.206 -34.084 1.00 42.67 ? 205 GLU D OE1 1 
ATOM   3663 O OE2 . GLU D 2 93  ? -41.088 -13.768 -35.850 1.00 43.51 ? 205 GLU D OE2 1 
ATOM   3664 N N   . LEU D 2 94  ? -37.858 -15.766 -30.305 1.00 41.88 ? 206 LEU D N   1 
ATOM   3665 C CA  . LEU D 2 94  ? -36.541 -15.281 -29.912 1.00 41.63 ? 206 LEU D CA  1 
ATOM   3666 C C   . LEU D 2 94  ? -35.483 -16.215 -30.459 1.00 41.38 ? 206 LEU D C   1 
ATOM   3667 O O   . LEU D 2 94  ? -35.380 -17.349 -30.011 1.00 41.27 ? 206 LEU D O   1 
ATOM   3668 C CB  . LEU D 2 94  ? -36.444 -15.216 -28.384 1.00 41.71 ? 206 LEU D CB  1 
ATOM   3669 C CG  . LEU D 2 94  ? -37.611 -14.545 -27.645 1.00 42.00 ? 206 LEU D CG  1 
ATOM   3670 C CD1 . LEU D 2 94  ? -37.637 -14.990 -26.185 1.00 42.25 ? 206 LEU D CD1 1 
ATOM   3671 C CD2 . LEU D 2 94  ? -37.545 -13.026 -27.763 1.00 41.90 ? 206 LEU D CD2 1 
ATOM   3672 N N   . ASN D 2 95  ? -34.694 -15.734 -31.417 1.00 41.21 ? 207 ASN D N   1 
ATOM   3673 C CA  . ASN D 2 95  ? -33.714 -16.569 -32.118 1.00 41.10 ? 207 ASN D CA  1 
ATOM   3674 C C   . ASN D 2 95  ? -32.256 -16.068 -32.043 1.00 41.02 ? 207 ASN D C   1 
ATOM   3675 O O   . ASN D 2 95  ? -31.384 -16.589 -32.735 1.00 40.84 ? 207 ASN D O   1 
ATOM   3676 C CB  . ASN D 2 95  ? -34.145 -16.711 -33.577 1.00 41.16 ? 207 ASN D CB  1 
ATOM   3677 C CG  . ASN D 2 95  ? -35.502 -17.373 -33.723 1.00 41.16 ? 207 ASN D CG  1 
ATOM   3678 O OD1 . ASN D 2 95  ? -35.779 -18.387 -33.083 1.00 41.73 ? 207 ASN D OD1 1 
ATOM   3679 N ND2 . ASN D 2 95  ? -36.353 -16.810 -34.577 1.00 41.05 ? 207 ASN D ND2 1 
ATOM   3680 N N   . CYS D 2 96  ? -32.000 -15.067 -31.202 1.00 41.11 ? 208 CYS D N   1 
ATOM   3681 C CA  . CYS D 2 96  ? -30.657 -14.512 -31.009 1.00 41.08 ? 208 CYS D CA  1 
ATOM   3682 C C   . CYS D 2 96  ? -30.387 -14.369 -29.512 1.00 41.01 ? 208 CYS D C   1 
ATOM   3683 O O   . CYS D 2 96  ? -31.292 -14.043 -28.746 1.00 41.05 ? 208 CYS D O   1 
ATOM   3684 C CB  . CYS D 2 96  ? -30.533 -13.134 -31.677 1.00 41.33 ? 208 CYS D CB  1 
ATOM   3685 S SG  . CYS D 2 96  ? -30.590 -13.094 -33.498 1.00 41.30 ? 208 CYS D SG  1 
ATOM   3686 N N   . ALA D 2 97  ? -29.141 -14.588 -29.098 1.00 40.88 ? 209 ALA D N   1 
ATOM   3687 C CA  . ALA D 2 97  ? -28.799 -14.568 -27.679 1.00 40.65 ? 209 ALA D CA  1 
ATOM   3688 C C   . ALA D 2 97  ? -28.270 -13.212 -27.233 1.00 40.56 ? 209 ALA D C   1 
ATOM   3689 O O   . ALA D 2 97  ? -27.636 -12.501 -27.997 1.00 40.54 ? 209 ALA D O   1 
ATOM   3690 C CB  . ALA D 2 97  ? -27.795 -15.655 -27.364 1.00 40.54 ? 209 ALA D CB  1 
ATOM   3691 N N   . VAL D 2 98  ? -28.549 -12.879 -25.974 1.00 40.75 ? 210 VAL D N   1 
ATOM   3692 C CA  . VAL D 2 98  ? -28.072 -11.663 -25.314 1.00 40.81 ? 210 VAL D CA  1 
ATOM   3693 C C   . VAL D 2 98  ? -27.611 -12.037 -23.910 1.00 41.10 ? 210 VAL D C   1 
ATOM   3694 O O   . VAL D 2 98  ? -28.257 -12.849 -23.243 1.00 41.20 ? 210 VAL D O   1 
ATOM   3695 C CB  . VAL D 2 98  ? -29.189 -10.586 -25.174 1.00 40.68 ? 210 VAL D CB  1 
ATOM   3696 C CG1 . VAL D 2 98  ? -28.940 -9.409  -26.083 1.00 40.19 ? 210 VAL D CG1 1 
ATOM   3697 C CG2 . VAL D 2 98  ? -30.566 -11.188 -25.423 1.00 40.46 ? 210 VAL D CG2 1 
ATOM   3698 N N   . LEU D 2 99  ? -26.501 -11.446 -23.468 1.00 41.40 ? 211 LEU D N   1 
ATOM   3699 C CA  . LEU D 2 99  ? -26.050 -11.549 -22.080 1.00 41.40 ? 211 LEU D CA  1 
ATOM   3700 C C   . LEU D 2 99  ? -26.599 -10.360 -21.312 1.00 41.65 ? 211 LEU D C   1 
ATOM   3701 O O   . LEU D 2 99  ? -26.255 -9.228  -21.634 1.00 41.48 ? 211 LEU D O   1 
ATOM   3702 C CB  . LEU D 2 99  ? -24.523 -11.546 -22.005 1.00 41.36 ? 211 LEU D CB  1 
ATOM   3703 C CG  . LEU D 2 99  ? -23.855 -11.547 -20.622 1.00 41.34 ? 211 LEU D CG  1 
ATOM   3704 C CD1 . LEU D 2 99  ? -24.080 -12.870 -19.924 1.00 40.73 ? 211 LEU D CD1 1 
ATOM   3705 C CD2 . LEU D 2 99  ? -22.366 -11.248 -20.731 1.00 41.48 ? 211 LEU D CD2 1 
ATOM   3706 N N   . GLN D 2 100 ? -27.454 -10.628 -20.314 1.00 42.16 ? 212 GLN D N   1 
ATOM   3707 C CA  . GLN D 2 100 ? -28.056 -9.595  -19.452 1.00 42.42 ? 212 GLN D CA  1 
ATOM   3708 C C   . GLN D 2 100 ? -27.880 -9.899  -17.960 1.00 42.72 ? 212 GLN D C   1 
ATOM   3709 O O   . GLN D 2 100 ? -28.566 -10.773 -17.418 1.00 42.85 ? 212 GLN D O   1 
ATOM   3710 C CB  . GLN D 2 100 ? -29.545 -9.452  -19.749 1.00 42.43 ? 212 GLN D CB  1 
ATOM   3711 C CG  . GLN D 2 100 ? -29.824 -8.827  -21.101 1.00 42.92 ? 212 GLN D CG  1 
ATOM   3712 C CD  . GLN D 2 100 ? -31.204 -8.210  -21.197 1.00 43.05 ? 212 GLN D CD  1 
ATOM   3713 O OE1 . GLN D 2 100 ? -31.866 -8.305  -22.235 1.00 44.16 ? 212 GLN D OE1 1 
ATOM   3714 N NE2 . GLN D 2 100 ? -31.649 -7.571  -20.112 1.00 43.43 ? 212 GLN D NE2 1 
ATOM   3715 N N   . VAL D 2 101 ? -26.986 -9.147  -17.309 1.00 42.94 ? 213 VAL D N   1 
ATOM   3716 C CA  . VAL D 2 101 ? -26.570 -9.370  -15.908 1.00 42.93 ? 213 VAL D CA  1 
ATOM   3717 C C   . VAL D 2 101 ? -26.343 -10.849 -15.532 1.00 42.99 ? 213 VAL D C   1 
ATOM   3718 O O   . VAL D 2 101 ? -27.215 -11.515 -14.956 1.00 43.10 ? 213 VAL D O   1 
ATOM   3719 C CB  . VAL D 2 101 ? -27.517 -8.669  -14.880 1.00 43.20 ? 213 VAL D CB  1 
ATOM   3720 C CG1 . VAL D 2 101 ? -27.057 -7.220  -14.623 1.00 43.22 ? 213 VAL D CG1 1 
ATOM   3721 C CG2 . VAL D 2 101 ? -28.986 -8.724  -15.335 1.00 43.57 ? 213 VAL D CG2 1 
ATOM   3722 N N   . ASN D 2 102 ? -25.152 -11.340 -15.870 1.00 42.77 ? 214 ASN D N   1 
ATOM   3723 C CA  . ASN D 2 102 ? -24.722 -12.717 -15.598 1.00 42.51 ? 214 ASN D CA  1 
ATOM   3724 C C   . ASN D 2 102 ? -25.742 -13.818 -15.918 1.00 42.29 ? 214 ASN D C   1 
ATOM   3725 O O   . ASN D 2 102 ? -25.799 -14.841 -15.231 1.00 42.26 ? 214 ASN D O   1 
ATOM   3726 C CB  . ASN D 2 102 ? -24.208 -12.864 -14.154 1.00 42.59 ? 214 ASN D CB  1 
ATOM   3727 C CG  . ASN D 2 102 ? -23.065 -13.889 -14.035 1.00 43.10 ? 214 ASN D CG  1 
ATOM   3728 O OD1 . ASN D 2 102 ? -22.527 -14.109 -12.955 1.00 43.83 ? 214 ASN D OD1 1 
ATOM   3729 N ND2 . ASN D 2 102 ? -22.688 -14.505 -15.156 1.00 45.27 ? 214 ASN D ND2 1 
ATOM   3730 N N   . ARG D 2 103 ? -26.531 -13.606 -16.968 1.00 42.00 ? 215 ARG D N   1 
ATOM   3731 C CA  . ARG D 2 103 ? -27.351 -14.668 -17.538 1.00 41.82 ? 215 ARG D CA  1 
ATOM   3732 C C   . ARG D 2 103 ? -27.474 -14.548 -19.061 1.00 41.59 ? 215 ARG D C   1 
ATOM   3733 O O   . ARG D 2 103 ? -27.421 -13.444 -19.630 1.00 41.13 ? 215 ARG D O   1 
ATOM   3734 C CB  . ARG D 2 103 ? -28.734 -14.731 -16.876 1.00 41.78 ? 215 ARG D CB  1 
ATOM   3735 C CG  . ARG D 2 103 ? -28.801 -15.644 -15.646 1.00 42.19 ? 215 ARG D CG  1 
ATOM   3736 C CD  . ARG D 2 103 ? -28.056 -16.979 -15.852 1.00 42.39 ? 215 ARG D CD  1 
ATOM   3737 N NE  . ARG D 2 103 ? -28.432 -18.007 -14.876 1.00 42.84 ? 215 ARG D NE  1 
ATOM   3738 C CZ  . ARG D 2 103 ? -27.768 -19.149 -14.677 1.00 42.65 ? 215 ARG D CZ  1 
ATOM   3739 N NH1 . ARG D 2 103 ? -28.200 -20.012 -13.767 1.00 42.71 ? 215 ARG D NH1 1 
ATOM   3740 N NH2 . ARG D 2 103 ? -26.669 -19.438 -15.372 1.00 43.02 ? 215 ARG D NH2 1 
ATOM   3741 N N   . LEU D 2 104 ? -27.617 -15.706 -19.705 1.00 41.14 ? 216 LEU D N   1 
ATOM   3742 C CA  . LEU D 2 104 ? -27.771 -15.782 -21.146 1.00 41.11 ? 216 LEU D CA  1 
ATOM   3743 C C   . LEU D 2 104 ? -29.264 -15.830 -21.463 1.00 41.06 ? 216 LEU D C   1 
ATOM   3744 O O   . LEU D 2 104 ? -29.965 -16.764 -21.062 1.00 40.82 ? 216 LEU D O   1 
ATOM   3745 C CB  . LEU D 2 104 ? -27.052 -17.018 -21.675 1.00 41.04 ? 216 LEU D CB  1 
ATOM   3746 C CG  . LEU D 2 104 ? -25.566 -17.069 -21.291 1.00 40.94 ? 216 LEU D CG  1 
ATOM   3747 C CD1 . LEU D 2 104 ? -25.065 -18.509 -21.078 1.00 41.39 ? 216 LEU D CD1 1 
ATOM   3748 C CD2 . LEU D 2 104 ? -24.736 -16.340 -22.328 1.00 39.75 ? 216 LEU D CD2 1 
ATOM   3749 N N   . LYS D 2 105 ? -29.742 -14.803 -22.166 1.00 41.04 ? 217 LYS D N   1 
ATOM   3750 C CA  . LYS D 2 105 ? -31.165 -14.611 -22.427 1.00 40.98 ? 217 LYS D CA  1 
ATOM   3751 C C   . LYS D 2 105 ? -31.451 -14.705 -23.921 1.00 40.92 ? 217 LYS D C   1 
ATOM   3752 O O   . LYS D 2 105 ? -30.639 -14.294 -24.744 1.00 40.76 ? 217 LYS D O   1 
ATOM   3753 C CB  . LYS D 2 105 ? -31.595 -13.239 -21.895 1.00 41.10 ? 217 LYS D CB  1 
ATOM   3754 C CG  . LYS D 2 105 ? -33.089 -12.917 -22.028 1.00 41.01 ? 217 LYS D CG  1 
ATOM   3755 C CD  . LYS D 2 105 ? -33.442 -11.606 -21.307 1.00 41.16 ? 217 LYS D CD  1 
ATOM   3756 C CE  . LYS D 2 105 ? -34.964 -11.423 -21.138 1.00 41.30 ? 217 LYS D CE  1 
ATOM   3757 N NZ  . LYS D 2 105 ? -35.316 -10.332 -20.167 1.00 40.87 ? 217 LYS D NZ  1 
ATOM   3758 N N   . SER D 2 106 ? -32.613 -15.252 -24.261 1.00 40.96 ? 218 SER D N   1 
ATOM   3759 C CA  . SER D 2 106 ? -33.084 -15.287 -25.641 1.00 41.00 ? 218 SER D CA  1 
ATOM   3760 C C   . SER D 2 106 ? -33.758 -13.951 -25.920 1.00 40.90 ? 218 SER D C   1 
ATOM   3761 O O   . SER D 2 106 ? -34.474 -13.439 -25.061 1.00 41.35 ? 218 SER D O   1 
ATOM   3762 C CB  . SER D 2 106 ? -34.087 -16.428 -25.824 1.00 40.99 ? 218 SER D CB  1 
ATOM   3763 O OG  . SER D 2 106 ? -34.038 -16.945 -27.137 1.00 42.11 ? 218 SER D OG  1 
ATOM   3764 N N   . ALA D 2 107 ? -33.535 -13.375 -27.095 1.00 40.69 ? 219 ALA D N   1 
ATOM   3765 C CA  . ALA D 2 107 ? -34.163 -12.096 -27.431 1.00 40.79 ? 219 ALA D CA  1 
ATOM   3766 C C   . ALA D 2 107 ? -34.497 -11.986 -28.910 1.00 40.88 ? 219 ALA D C   1 
ATOM   3767 O O   . ALA D 2 107 ? -33.867 -12.625 -29.744 1.00 40.98 ? 219 ALA D O   1 
ATOM   3768 C CB  . ALA D 2 107 ? -33.284 -10.957 -27.019 1.00 40.67 ? 219 ALA D CB  1 
ATOM   3769 N N   . GLN D 2 108 ? -35.513 -11.181 -29.216 1.00 41.09 ? 220 GLN D N   1 
ATOM   3770 C CA  . GLN D 2 108 ? -35.953 -10.959 -30.593 1.00 41.06 ? 220 GLN D CA  1 
ATOM   3771 C C   . GLN D 2 108 ? -34.838 -10.236 -31.346 1.00 41.05 ? 220 GLN D C   1 
ATOM   3772 O O   . GLN D 2 108 ? -34.390 -9.167  -30.940 1.00 40.91 ? 220 GLN D O   1 
ATOM   3773 C CB  . GLN D 2 108 ? -37.283 -10.172 -30.620 1.00 41.09 ? 220 GLN D CB  1 
ATOM   3774 C CG  . GLN D 2 108 ? -37.648 -9.467  -31.941 1.00 41.14 ? 220 GLN D CG  1 
ATOM   3775 C CD  . GLN D 2 108 ? -37.869 -10.417 -33.121 1.00 42.06 ? 220 GLN D CD  1 
ATOM   3776 O OE1 . GLN D 2 108 ? -37.619 -11.619 -33.038 1.00 42.73 ? 220 GLN D OE1 1 
ATOM   3777 N NE2 . GLN D 2 108 ? -38.347 -9.867  -34.231 1.00 41.96 ? 220 GLN D NE2 1 
ATOM   3778 N N   . CYS D 2 109 ? -34.396 -10.842 -32.443 1.00 41.28 ? 221 CYS D N   1 
ATOM   3779 C CA  . CYS D 2 109 ? -33.222 -10.382 -33.191 1.00 41.38 ? 221 CYS D CA  1 
ATOM   3780 C C   . CYS D 2 109 ? -33.338 -8.941  -33.691 1.00 41.31 ? 221 CYS D C   1 
ATOM   3781 O O   . CYS D 2 109 ? -32.322 -8.276  -33.891 1.00 41.43 ? 221 CYS D O   1 
ATOM   3782 C CB  . CYS D 2 109 ? -32.946 -11.317 -34.377 1.00 41.54 ? 221 CYS D CB  1 
ATOM   3783 S SG  . CYS D 2 109 ? -32.587 -13.058 -33.922 1.00 42.56 ? 221 CYS D SG  1 
ATOM   3784 N N   . GLY D 2 110 ? -34.567 -8.470  -33.892 1.00 41.25 ? 222 GLY D N   1 
ATOM   3785 C CA  . GLY D 2 110 ? -34.821 -7.093  -34.309 1.00 41.28 ? 222 GLY D CA  1 
ATOM   3786 C C   . GLY D 2 110 ? -34.845 -6.047  -33.195 1.00 41.27 ? 222 GLY D C   1 
ATOM   3787 O O   . GLY D 2 110 ? -35.027 -4.856  -33.468 1.00 41.36 ? 222 GLY D O   1 
ATOM   3788 N N   . SER D 2 111 ? -34.681 -6.473  -31.944 1.00 41.13 ? 223 SER D N   1 
ATOM   3789 C CA  . SER D 2 111 ? -34.599 -5.530  -30.833 1.00 41.03 ? 223 SER D CA  1 
ATOM   3790 C C   . SER D 2 111 ? -33.328 -4.724  -30.992 1.00 41.01 ? 223 SER D C   1 
ATOM   3791 O O   . SER D 2 111 ? -32.316 -5.244  -31.445 1.00 41.34 ? 223 SER D O   1 
ATOM   3792 C CB  . SER D 2 111 ? -34.569 -6.262  -29.488 1.00 40.99 ? 223 SER D CB  1 
ATOM   3793 O OG  . SER D 2 111 ? -35.782 -6.951  -29.248 1.00 41.13 ? 223 SER D OG  1 
ATOM   3794 N N   . SER D 2 112 ? -33.375 -3.449  -30.643 1.00 40.95 ? 224 SER D N   1 
ATOM   3795 C CA  . SER D 2 112 ? -32.148 -2.671  -30.533 1.00 40.58 ? 224 SER D CA  1 
ATOM   3796 C C   . SER D 2 112 ? -31.592 -2.912  -29.132 1.00 40.17 ? 224 SER D C   1 
ATOM   3797 O O   . SER D 2 112 ? -32.270 -2.682  -28.134 1.00 40.13 ? 224 SER D O   1 
ATOM   3798 C CB  . SER D 2 112 ? -32.409 -1.187  -30.811 1.00 40.72 ? 224 SER D CB  1 
ATOM   3799 O OG  . SER D 2 112 ? -32.628 -0.981  -32.206 1.00 41.05 ? 224 SER D OG  1 
ATOM   3800 N N   . ILE D 2 113 ? -30.374 -3.434  -29.070 1.00 39.85 ? 225 ILE D N   1 
ATOM   3801 C CA  . ILE D 2 113 ? -29.701 -3.716  -27.806 1.00 39.62 ? 225 ILE D CA  1 
ATOM   3802 C C   . ILE D 2 113 ? -28.224 -3.325  -27.920 1.00 39.34 ? 225 ILE D C   1 
ATOM   3803 O O   . ILE D 2 113 ? -27.667 -3.311  -29.021 1.00 39.07 ? 225 ILE D O   1 
ATOM   3804 C CB  . ILE D 2 113 ? -29.827 -5.210  -27.427 1.00 39.61 ? 225 ILE D CB  1 
ATOM   3805 C CG1 . ILE D 2 113 ? -31.302 -5.633  -27.357 1.00 39.73 ? 225 ILE D CG1 1 
ATOM   3806 C CG2 . ILE D 2 113 ? -29.133 -5.499  -26.096 1.00 39.77 ? 225 ILE D CG2 1 
ATOM   3807 C CD1 . ILE D 2 113 ? -31.513 -7.132  -27.115 1.00 39.58 ? 225 ILE D CD1 1 
ATOM   3808 N N   . ILE D 2 114 ? -27.610 -2.985  -26.784 1.00 39.00 ? 226 ILE D N   1 
ATOM   3809 C CA  . ILE D 2 114 ? -26.173 -2.711  -26.703 1.00 38.86 ? 226 ILE D CA  1 
ATOM   3810 C C   . ILE D 2 114 ? -25.413 -3.919  -27.234 1.00 38.65 ? 226 ILE D C   1 
ATOM   3811 O O   . ILE D 2 114 ? -25.868 -5.048  -27.059 1.00 38.07 ? 226 ILE D O   1 
ATOM   3812 C CB  . ILE D 2 114 ? -25.717 -2.484  -25.238 1.00 38.76 ? 226 ILE D CB  1 
ATOM   3813 C CG1 . ILE D 2 114 ? -26.354 -1.217  -24.636 1.00 38.92 ? 226 ILE D CG1 1 
ATOM   3814 C CG2 . ILE D 2 114 ? -24.194 -2.420  -25.144 1.00 38.57 ? 226 ILE D CG2 1 
ATOM   3815 C CD1 . ILE D 2 114 ? -25.837 0.085   -25.226 1.00 38.91 ? 226 ILE D CD1 1 
ATOM   3816 N N   . TYR D 2 115 ? -24.269 -3.670  -27.877 1.00 38.69 ? 227 TYR D N   1 
ATOM   3817 C CA  . TYR D 2 115 ? -23.367 -4.728  -28.321 1.00 39.22 ? 227 TYR D CA  1 
ATOM   3818 C C   . TYR D 2 115 ? -21.934 -4.398  -27.952 1.00 39.39 ? 227 TYR D C   1 
ATOM   3819 O O   . TYR D 2 115 ? -21.526 -3.238  -28.019 1.00 39.19 ? 227 TYR D O   1 
ATOM   3820 C CB  . TYR D 2 115 ? -23.446 -4.927  -29.844 1.00 39.17 ? 227 TYR D CB  1 
ATOM   3821 C CG  . TYR D 2 115 ? -22.957 -3.743  -30.658 1.00 39.04 ? 227 TYR D CG  1 
ATOM   3822 C CD1 . TYR D 2 115 ? -23.798 -2.672  -30.945 1.00 39.45 ? 227 TYR D CD1 1 
ATOM   3823 C CD2 . TYR D 2 115 ? -21.660 -3.687  -31.135 1.00 38.65 ? 227 TYR D CD2 1 
ATOM   3824 C CE1 . TYR D 2 115 ? -23.358 -1.577  -31.702 1.00 39.03 ? 227 TYR D CE1 1 
ATOM   3825 C CE2 . TYR D 2 115 ? -21.207 -2.589  -31.891 1.00 39.25 ? 227 TYR D CE2 1 
ATOM   3826 C CZ  . TYR D 2 115 ? -22.066 -1.537  -32.165 1.00 39.07 ? 227 TYR D CZ  1 
ATOM   3827 O OH  . TYR D 2 115 ? -21.647 -0.446  -32.909 1.00 39.29 ? 227 TYR D OH  1 
ATOM   3828 N N   . HIS D 2 116 ? -21.177 -5.433  -27.585 1.00 39.83 ? 228 HIS D N   1 
ATOM   3829 C CA  . HIS D 2 116 ? -19.735 -5.330  -27.411 1.00 40.18 ? 228 HIS D CA  1 
ATOM   3830 C C   . HIS D 2 116 ? -18.990 -6.141  -28.470 1.00 40.53 ? 228 HIS D C   1 
ATOM   3831 O O   . HIS D 2 116 ? -19.549 -7.061  -29.065 1.00 40.88 ? 228 HIS D O   1 
ATOM   3832 C CB  . HIS D 2 116 ? -19.337 -5.838  -26.047 1.00 40.09 ? 228 HIS D CB  1 
ATOM   3833 C CG  . HIS D 2 116 ? -20.044 -5.156  -24.928 1.00 40.70 ? 228 HIS D CG  1 
ATOM   3834 N ND1 . HIS D 2 116 ? -20.322 -5.785  -23.735 1.00 40.59 ? 228 HIS D ND1 1 
ATOM   3835 C CD2 . HIS D 2 116 ? -20.529 -3.900  -24.816 1.00 40.36 ? 228 HIS D CD2 1 
ATOM   3836 C CE1 . HIS D 2 116 ? -20.943 -4.941  -22.936 1.00 40.58 ? 228 HIS D CE1 1 
ATOM   3837 N NE2 . HIS D 2 116 ? -21.083 -3.791  -23.570 1.00 40.34 ? 228 HIS D NE2 1 
ATOM   3838 N N   . CYS D 2 117 ? -17.720 -5.803  -28.677 1.00 40.69 ? 229 CYS D N   1 
ATOM   3839 C CA  . CYS D 2 117 ? -16.852 -6.526  -29.603 1.00 40.85 ? 229 CYS D CA  1 
ATOM   3840 C C   . CYS D 2 117 ? -15.644 -7.134  -28.856 1.00 40.76 ? 229 CYS D C   1 
ATOM   3841 O O   . CYS D 2 117 ? -15.236 -6.626  -27.830 1.00 40.57 ? 229 CYS D O   1 
ATOM   3842 C CB  . CYS D 2 117 ? -16.406 -5.566  -30.710 1.00 40.85 ? 229 CYS D CB  1 
ATOM   3843 S SG  . CYS D 2 117 ? -17.782 -4.603  -31.438 1.00 41.51 ? 229 CYS D SG  1 
ATOM   3844 N N   . LYS D 2 118 ? -15.080 -8.223  -29.372 1.00 41.26 ? 230 LYS D N   1 
ATOM   3845 C CA  . LYS D 2 118 ? -14.001 -8.941  -28.682 1.00 41.44 ? 230 LYS D CA  1 
ATOM   3846 C C   . LYS D 2 118 ? -12.993 -9.600  -29.642 1.00 41.66 ? 230 LYS D C   1 
ATOM   3847 O O   . LYS D 2 118 ? -13.383 -10.149 -30.661 1.00 41.76 ? 230 LYS D O   1 
ATOM   3848 C CB  . LYS D 2 118 ? -14.610 -9.986  -27.752 1.00 41.31 ? 230 LYS D CB  1 
ATOM   3849 C CG  . LYS D 2 118 ? -13.599 -10.875 -27.038 1.00 41.24 ? 230 LYS D CG  1 
ATOM   3850 C CD  . LYS D 2 118 ? -14.322 -11.819 -26.108 1.00 41.06 ? 230 LYS D CD  1 
ATOM   3851 C CE  . LYS D 2 118 ? -13.441 -12.925 -25.612 1.00 40.84 ? 230 LYS D CE  1 
ATOM   3852 N NZ  . LYS D 2 118 ? -14.290 -14.105 -25.317 1.00 41.70 ? 230 LYS D NZ  1 
ATOM   3853 N N   . HIS D 2 119 ? -11.706 -9.536  -29.287 1.00 42.12 ? 231 HIS D N   1 
ATOM   3854 C CA  . HIS D 2 119 ? -10.589 -9.992  -30.141 1.00 42.36 ? 231 HIS D CA  1 
ATOM   3855 C C   . HIS D 2 119 ? -10.077 -11.339 -29.719 1.00 42.55 ? 231 HIS D C   1 
ATOM   3856 O O   . HIS D 2 119 ? -9.939  -11.616 -28.536 1.00 42.58 ? 231 HIS D O   1 
ATOM   3857 C CB  . HIS D 2 119 ? -9.370  -9.089  -29.986 1.00 42.57 ? 231 HIS D CB  1 
ATOM   3858 C CG  . HIS D 2 119 ? -9.292  -7.960  -30.959 1.00 42.77 ? 231 HIS D CG  1 
ATOM   3859 N ND1 . HIS D 2 119 ? -10.399 -7.278  -31.414 1.00 42.62 ? 231 HIS D ND1 1 
ATOM   3860 C CD2 . HIS D 2 119 ? -8.218  -7.340  -31.499 1.00 43.38 ? 231 HIS D CD2 1 
ATOM   3861 C CE1 . HIS D 2 119 ? -10.010 -6.302  -32.213 1.00 43.40 ? 231 HIS D CE1 1 
ATOM   3862 N NE2 . HIS D 2 119 ? -8.692  -6.320  -32.286 1.00 44.22 ? 231 HIS D NE2 1 
ATOM   3863 N N   . LYS D 2 120 ? -9.686  -12.133 -30.700 1.00 43.05 ? 232 LYS D N   1 
ATOM   3864 C CA  . LYS D 2 120 ? -9.058  -13.422 -30.444 1.00 43.29 ? 232 LYS D CA  1 
ATOM   3865 C C   . LYS D 2 120 ? -7.674  -13.244 -29.791 1.00 43.21 ? 232 LYS D C   1 
ATOM   3866 O O   . LYS D 2 120 ? -7.421  -12.262 -29.082 1.00 43.15 ? 232 LYS D O   1 
ATOM   3867 C CB  . LYS D 2 120 ? -8.948  -14.223 -31.757 1.00 43.58 ? 232 LYS D CB  1 
ATOM   3868 C CG  . LYS D 2 120 ? -10.297 -14.443 -32.473 1.00 44.32 ? 232 LYS D CG  1 
ATOM   3869 C CD  . LYS D 2 120 ? -10.473 -13.558 -33.724 1.00 44.84 ? 232 LYS D CD  1 
ATOM   3870 C CE  . LYS D 2 120 ? -11.669 -14.014 -34.574 1.00 44.60 ? 232 LYS D CE  1 
ATOM   3871 N NZ  . LYS D 2 120 ? -11.604 -13.522 -35.987 1.00 44.68 ? 232 LYS D NZ  1 
HETATM 3872 O O   . HOH E 3 .   ? -12.380 -5.054  -51.462 1.00 42.06 ? 180 HOH A O   1 
HETATM 3873 O O   . HOH E 3 .   ? -12.509 -25.061 -66.480 1.00 39.27 ? 181 HOH A O   1 
HETATM 3874 O O   . HOH E 3 .   ? -22.147 2.370   -76.803 1.00 43.24 ? 182 HOH A O   1 
HETATM 3875 O O   . HOH E 3 .   ? -23.989 -19.605 -74.338 1.00 37.61 ? 183 HOH A O   1 
HETATM 3876 O O   . HOH E 3 .   ? -18.372 5.650   -66.992 1.00 35.65 ? 184 HOH A O   1 
HETATM 3877 O O   . HOH E 3 .   ? -6.693  -8.593  -76.578 1.00 38.72 ? 185 HOH A O   1 
HETATM 3878 O O   . HOH E 3 .   ? -11.255 7.287   -63.795 1.00 48.00 ? 186 HOH A O   1 
HETATM 3879 O O   . HOH E 3 .   ? -14.625 -17.327 -69.685 1.00 41.84 ? 187 HOH A O   1 
HETATM 3880 O O   . HOH E 3 .   ? -22.305 3.938   -78.970 1.00 60.11 ? 188 HOH A O   1 
HETATM 3881 O O   . HOH E 3 .   ? 2.094   5.720   -65.180 1.00 39.92 ? 189 HOH A O   1 
HETATM 3882 O O   . HOH E 3 .   ? -5.727  10.191  -68.533 1.00 41.95 ? 190 HOH A O   1 
HETATM 3883 O O   . HOH E 3 .   ? -26.489 -3.099  -61.340 1.00 47.44 ? 191 HOH A O   1 
HETATM 3884 O O   . HOH E 3 .   ? -20.799 -12.657 -68.673 1.00 43.67 ? 192 HOH A O   1 
HETATM 3885 O O   . HOH E 3 .   ? -24.499 -15.264 -79.437 1.00 39.55 ? 193 HOH A O   1 
HETATM 3886 O O   . HOH E 3 .   ? 1.593   4.713   -62.754 1.00 38.97 ? 194 HOH A O   1 
HETATM 3887 O O   . HOH E 3 .   ? -1.371  -13.049 -63.436 1.00 63.85 ? 195 HOH A O   1 
HETATM 3888 O O   . HOH F 3 .   ? -35.544 2.815   -46.734 1.00 49.09 ? 2   HOH B O   1 
HETATM 3889 O O   . HOH F 3 .   ? -22.944 1.129   -47.485 1.00 39.08 ? 5   HOH B O   1 
HETATM 3890 O O   . HOH F 3 .   ? -31.143 9.610   -39.472 1.00 61.77 ? 10  HOH B O   1 
HETATM 3891 O O   . HOH F 3 .   ? -16.362 11.318  -39.319 1.00 47.45 ? 19  HOH B O   1 
HETATM 3892 O O   . HOH F 3 .   ? -14.701 17.131  -48.465 1.00 55.58 ? 34  HOH B O   1 
HETATM 3893 O O   . HOH F 3 .   ? -31.289 17.953  -37.381 1.00 54.84 ? 39  HOH B O   1 
HETATM 3894 O O   . HOH F 3 .   ? -34.495 3.072   -42.875 1.00 58.03 ? 45  HOH B O   1 
HETATM 3895 O O   . HOH F 3 .   ? -42.408 22.491  -51.114 1.00 62.60 ? 54  HOH B O   1 
HETATM 3896 O O   . HOH G 3 .   ? -18.046 -5.075  -9.160  1.00 40.16 ? 180 HOH C O   1 
HETATM 3897 O O   . HOH G 3 .   ? -14.186 -9.308  4.904   1.00 49.43 ? 181 HOH C O   1 
HETATM 3898 O O   . HOH G 3 .   ? -12.188 25.568  -9.911  1.00 51.85 ? 182 HOH C O   1 
HETATM 3899 O O   . HOH G 3 .   ? -12.355 5.757   -25.041 1.00 36.80 ? 183 HOH C O   1 
HETATM 3900 O O   . HOH G 3 .   ? -14.332 17.991  -6.582  1.00 37.51 ? 184 HOH C O   1 
HETATM 3901 O O   . HOH G 3 .   ? 2.355   -5.221  -11.216 1.00 37.79 ? 185 HOH C O   1 
HETATM 3902 O O   . HOH G 3 .   ? -22.805 15.740  -0.237  1.00 34.29 ? 186 HOH C O   1 
HETATM 3903 O O   . HOH G 3 .   ? -21.047 2.562   2.400   1.00 33.01 ? 187 HOH C O   1 
HETATM 3904 O O   . HOH G 3 .   ? -7.191  24.806  2.692   1.00 38.75 ? 188 HOH C O   1 
HETATM 3905 O O   . HOH G 3 .   ? -6.220  9.569   0.226   1.00 54.03 ? 189 HOH C O   1 
HETATM 3906 O O   . HOH G 3 .   ? -9.922  16.596  -12.460 1.00 45.22 ? 190 HOH C O   1 
HETATM 3907 O O   . HOH G 3 .   ? -23.145 15.756  2.438   1.00 39.62 ? 191 HOH C O   1 
HETATM 3908 O O   . HOH G 3 .   ? -11.113 11.666  5.746   1.00 30.11 ? 192 HOH C O   1 
HETATM 3909 O O   . HOH G 3 .   ? -20.423 13.438  -7.865  1.00 41.61 ? 193 HOH C O   1 
HETATM 3910 O O   . HOH G 3 .   ? -3.256  11.855  1.028   1.00 43.86 ? 194 HOH C O   1 
HETATM 3911 O O   . HOH G 3 .   ? -11.023 -6.427  -12.387 1.00 47.67 ? 195 HOH C O   1 
HETATM 3912 O O   . HOH G 3 .   ? -6.226  17.704  -9.329  1.00 52.60 ? 196 HOH C O   1 
HETATM 3913 O O   . HOH G 3 .   ? -14.334 4.189   -25.451 1.00 50.93 ? 197 HOH C O   1 
HETATM 3914 O O   . HOH H 3 .   ? -35.655 -2.029  -29.443 1.00 55.18 ? 12  HOH D O   1 
HETATM 3915 O O   . HOH H 3 .   ? -16.229 -10.463 -37.301 1.00 43.55 ? 18  HOH D O   1 
HETATM 3916 O O   . HOH H 3 .   ? -13.013 -14.055 -16.900 1.00 61.26 ? 24  HOH D O   1 
HETATM 3917 O O   . HOH H 3 .   ? -22.803 -0.457  -29.014 1.00 41.41 ? 30  HOH D O   1 
HETATM 3918 O O   . HOH H 3 .   ? -14.611 -16.538 -27.950 1.00 47.69 ? 33  HOH D O   1 
HETATM 3919 O O   . HOH H 3 .   ? 0.946   11.106  -23.801 1.00 66.26 ? 40  HOH D O   1 
HETATM 3920 O O   . HOH H 3 .   ? -35.185 -2.383  -33.191 1.00 53.22 ? 43  HOH D O   1 
HETATM 3921 O O   . HOH H 3 .   ? -28.777 -25.886 -15.211 1.00 61.41 ? 47  HOH D O   1 
HETATM 3922 O O   . HOH H 3 .   ? -3.985  10.734  -31.670 1.00 57.91 ? 51  HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   57  57  ASP ALA A . n 
A 1 2   CYS 2   58  58  CYS CYS A . n 
A 1 3   CYS 3   59  59  CYS CYS A . n 
A 1 4   SER 4   60  60  SER SER A . n 
A 1 5   CYS 5   61  61  CYS CYS A . n 
A 1 6   GLN 6   62  62  GLN GLN A . n 
A 1 7   GLU 7   63  63  GLU GLU A . n 
A 1 8   LYS 8   64  64  LYS LYS A . n 
A 1 9   TRP 9   65  65  TRP TRP A . n 
A 1 10  VAL 10  66  66  VAL VAL A . n 
A 1 11  GLY 11  67  67  GLY GLY A . n 
A 1 12  TYR 12  68  68  TYR TYR A . n 
A 1 13  ARG 13  69  69  ARG ARG A . n 
A 1 14  CYS 14  70  70  CYS CYS A . n 
A 1 15  ASN 15  71  71  ASN ASN A . n 
A 1 16  CYS 16  72  72  CYS CYS A . n 
A 1 17  TYR 17  73  73  TYR TYR A . n 
A 1 18  PHE 18  74  74  PHE PHE A . n 
A 1 19  ILE 19  75  75  ILE ILE A . n 
A 1 20  SER 20  76  76  SER SER A . n 
A 1 21  SER 21  77  77  SER SER A . n 
A 1 22  GLU 22  78  78  GLU GLU A . n 
A 1 23  GLN 23  79  79  GLN GLN A . n 
A 1 24  LYS 24  80  80  LYS LYS A . n 
A 1 25  THR 25  81  81  THR THR A . n 
A 1 26  TRP 26  82  82  TRP TRP A . n 
A 1 27  ASN 27  83  83  ASN ASN A . n 
A 1 28  GLU 28  84  84  GLU GLU A . n 
A 1 29  SER 29  85  85  SER SER A . n 
A 1 30  ARG 30  86  86  ARG ARG A . n 
A 1 31  HIS 31  87  87  HIS HIS A . n 
A 1 32  LEU 32  88  88  LEU LEU A . n 
A 1 33  CYS 33  89  89  CYS CYS A . n 
A 1 34  ALA 34  90  90  ALA ALA A . n 
A 1 35  SER 35  91  91  SER SER A . n 
A 1 36  GLN 36  92  92  GLN GLN A . n 
A 1 37  LYS 37  93  93  LYS LYS A . n 
A 1 38  SER 38  94  94  SER SER A . n 
A 1 39  SER 39  95  95  SER SER A . n 
A 1 40  LEU 40  96  96  LEU LEU A . n 
A 1 41  LEU 41  97  97  LEU LEU A . n 
A 1 42  GLN 42  98  98  GLN GLN A . n 
A 1 43  LEU 43  99  99  LEU LEU A . n 
A 1 44  GLN 44  100 100 GLN GLN A . n 
A 1 45  ASN 45  101 101 ASN ASN A . n 
A 1 46  THR 46  102 102 THR THR A . n 
A 1 47  ASP 47  103 103 ASP ASP A . n 
A 1 48  GLU 48  104 104 GLU GLU A . n 
A 1 49  LEU 49  105 105 LEU LEU A . n 
A 1 50  ASP 50  106 106 ASP ASP A . n 
A 1 51  PHE 51  107 107 PHE PHE A . n 
A 1 52  MET 52  108 108 MET MET A . n 
A 1 53  SER 53  109 109 SER SER A . n 
A 1 54  SER 54  110 110 SER SER A . n 
A 1 55  SER 55  111 111 SER SER A . n 
A 1 56  GLN 56  112 112 GLN GLN A . n 
A 1 57  GLN 57  113 113 GLN GLN A . n 
A 1 58  PHE 58  114 114 PHE PHE A . n 
A 1 59  TYR 59  115 115 TYR TYR A . n 
A 1 60  TRP 60  116 116 TRP TRP A . n 
A 1 61  ILE 61  117 117 ILE ILE A . n 
A 1 62  GLY 62  118 118 GLY GLY A . n 
A 1 63  LEU 63  119 119 LEU LEU A . n 
A 1 64  SER 64  120 120 SER SER A . n 
A 1 65  TYR 65  121 121 TYR TYR A . n 
A 1 66  SER 66  122 122 SER SER A . n 
A 1 67  GLU 67  123 123 GLU GLU A . n 
A 1 68  GLU 68  124 124 GLU GLU A . n 
A 1 69  HIS 69  125 125 HIS HIS A . n 
A 1 70  THR 70  126 126 THR THR A . n 
A 1 71  ALA 71  127 127 ALA ALA A . n 
A 1 72  TRP 72  128 128 TRP TRP A . n 
A 1 73  LEU 73  129 129 LEU LEU A . n 
A 1 74  TRP 74  130 130 TRP TRP A . n 
A 1 75  GLU 75  131 131 GLU GLU A . n 
A 1 76  ASN 76  132 132 ASN ASN A . n 
A 1 77  GLY 77  133 133 GLY GLY A . n 
A 1 78  SER 78  134 134 SER SER A . n 
A 1 79  ALA 79  135 135 ALA ALA A . n 
A 1 80  LEU 80  136 136 LEU LEU A . n 
A 1 81  SER 81  137 137 SER SER A . n 
A 1 82  GLN 82  138 138 GLN GLN A . n 
A 1 83  TYR 83  139 139 TYR TYR A . n 
A 1 84  LEU 84  140 140 LEU LEU A . n 
A 1 85  PHE 85  141 141 PHE PHE A . n 
A 1 86  PRO 86  142 142 PRO PRO A . n 
A 1 87  SER 87  143 143 SER SER A . n 
A 1 88  PHE 88  144 144 PHE PHE A . n 
A 1 89  GLU 89  145 145 GLU GLU A . n 
A 1 90  THR 90  146 146 THR THR A . n 
A 1 91  PHE 91  147 147 PHE PHE A . n 
A 1 92  ASN 92  148 148 ASN ASN A . n 
A 1 93  THR 93  149 149 THR THR A . n 
A 1 94  LYS 94  150 150 LYS LYS A . n 
A 1 95  ASN 95  151 151 ASN ASN A . n 
A 1 96  CYS 96  152 152 CYS CYS A . n 
A 1 97  ILE 97  153 153 ILE ILE A . n 
A 1 98  ALA 98  154 154 ALA ALA A . n 
A 1 99  TYR 99  155 155 TYR TYR A . n 
A 1 100 ASN 100 156 156 ASN ASN A . n 
A 1 101 PRO 101 157 157 PRO PRO A . n 
A 1 102 ASN 102 158 158 ASN ASN A . n 
A 1 103 GLY 103 159 159 GLY GLY A . n 
A 1 104 ASN 104 160 160 ASN ASN A . n 
A 1 105 ALA 105 161 161 ALA ALA A . n 
A 1 106 LEU 106 162 162 LEU LEU A . n 
A 1 107 ASP 107 163 163 ASP ASP A . n 
A 1 108 GLU 108 164 164 GLU GLU A . n 
A 1 109 SER 109 165 165 SER SER A . n 
A 1 110 CYS 110 166 166 CYS CYS A . n 
A 1 111 GLU 111 167 167 GLU GLU A . n 
A 1 112 ASP 112 168 168 ASP ASP A . n 
A 1 113 LYS 113 169 169 LYS LYS A . n 
A 1 114 ASN 114 170 170 ASN ASN A . n 
A 1 115 ARG 115 171 171 ARG ARG A . n 
A 1 116 TYR 116 172 172 TYR TYR A . n 
A 1 117 ILE 117 173 173 ILE ILE A . n 
A 1 118 CYS 118 174 174 CYS CYS A . n 
A 1 119 LYS 119 175 175 LYS LYS A . n 
A 1 120 GLN 120 176 176 GLN GLN A . n 
A 1 121 GLN 121 177 177 GLN GLN A . n 
A 1 122 LEU 122 178 178 LEU LEU A . n 
A 1 123 ILE 123 179 179 ILE ILE A . n 
B 2 1   ALA 1   113 113 ALA ALA B . n 
B 2 2   ARG 2   114 114 ARG ARG B . n 
B 2 3   HIS 3   115 115 HIS HIS B . n 
B 2 4   CYS 4   116 116 CYS CYS B . n 
B 2 5   GLY 5   117 117 GLY GLY B . n 
B 2 6   HIS 6   118 118 HIS HIS B . n 
B 2 7   CYS 7   119 119 CYS CYS B . n 
B 2 8   PRO 8   120 120 PRO PRO B . n 
B 2 9   GLU 9   121 121 GLU GLU B . n 
B 2 10  GLU 10  122 122 GLU GLU B . n 
B 2 11  TRP 11  123 123 TRP TRP B . n 
B 2 12  ILE 12  124 124 ILE ILE B . n 
B 2 13  THR 13  125 125 THR THR B . n 
B 2 14  TYR 14  126 126 TYR TYR B . n 
B 2 15  SER 15  127 127 SER SER B . n 
B 2 16  ASN 16  128 128 ASN ASN B . n 
B 2 17  SER 17  129 129 SER SER B . n 
B 2 18  CYS 18  130 130 CYS CYS B . n 
B 2 19  TYR 19  131 131 TYR TYR B . n 
B 2 20  TYR 20  132 132 TYR TYR B . n 
B 2 21  ILE 21  133 133 ILE ILE B . n 
B 2 22  GLY 22  134 134 GLY GLY B . n 
B 2 23  LYS 23  135 135 LYS LYS B . n 
B 2 24  GLU 24  136 136 GLU GLU B . n 
B 2 25  ARG 25  137 137 ARG ARG B . n 
B 2 26  ARG 26  138 138 ARG ARG B . n 
B 2 27  THR 27  139 139 THR THR B . n 
B 2 28  TRP 28  140 140 TRP TRP B . n 
B 2 29  GLU 29  141 141 GLU GLU B . n 
B 2 30  GLU 30  142 142 GLU GLU B . n 
B 2 31  SER 31  143 143 SER SER B . n 
B 2 32  LEU 32  144 144 LEU LEU B . n 
B 2 33  LEU 33  145 145 LEU LEU B . n 
B 2 34  ALA 34  146 146 ALA ALA B . n 
B 2 35  CYS 35  147 147 CYS CYS B . n 
B 2 36  THR 36  148 148 THR THR B . n 
B 2 37  SER 37  149 149 SER SER B . n 
B 2 38  LYS 38  150 150 LYS LYS B . n 
B 2 39  ASN 39  151 151 ASN ASN B . n 
B 2 40  SER 40  152 152 SER SER B . n 
B 2 41  SER 41  153 153 SER SER B . n 
B 2 42  LEU 42  154 154 LEU LEU B . n 
B 2 43  LEU 43  155 155 LEU LEU B . n 
B 2 44  SER 44  156 156 SER SER B . n 
B 2 45  ILE 45  157 157 ILE ILE B . n 
B 2 46  ASP 46  158 158 ASP ASP B . n 
B 2 47  ASN 47  159 159 ASN ASN B . n 
B 2 48  GLU 48  160 160 GLU GLU B . n 
B 2 49  GLU 49  161 161 GLU GLU B . n 
B 2 50  GLU 50  162 162 GLU GLU B . n 
B 2 51  MET 51  163 163 MET MET B . n 
B 2 52  LYS 52  164 164 LYS LYS B . n 
B 2 53  PHE 53  165 165 PHE PHE B . n 
B 2 54  LEU 54  166 166 LEU LEU B . n 
B 2 55  SER 55  167 167 SER SER B . n 
B 2 56  ILE 56  168 168 ILE ILE B . n 
B 2 57  ILE 57  169 169 ILE ILE B . n 
B 2 58  SER 58  170 170 SER SER B . n 
B 2 59  PRO 59  171 171 PRO PRO B . n 
B 2 60  SER 60  172 172 SER SER B . n 
B 2 61  SER 61  173 173 SER SER B . n 
B 2 62  TRP 62  174 174 TRP TRP B . n 
B 2 63  ILE 63  175 175 ILE ILE B . n 
B 2 64  GLY 64  176 176 GLY GLY B . n 
B 2 65  VAL 65  177 177 VAL VAL B . n 
B 2 66  PHE 66  178 178 PHE PHE B . n 
B 2 67  ARG 67  179 179 ARG ARG B . n 
B 2 68  ASN 68  180 180 ASN ASN B . n 
B 2 69  SER 69  181 181 SER SER B . n 
B 2 70  SER 70  182 182 SER SER B . n 
B 2 71  HIS 71  183 183 HIS HIS B . n 
B 2 72  HIS 72  184 184 HIS HIS B . n 
B 2 73  PRO 73  185 185 PRO PRO B . n 
B 2 74  TRP 74  186 186 TRP TRP B . n 
B 2 75  VAL 75  187 187 VAL VAL B . n 
B 2 76  THR 76  188 188 THR THR B . n 
B 2 77  MET 77  189 189 MET MET B . n 
B 2 78  ASN 78  190 190 ASN ASN B . n 
B 2 79  GLY 79  191 191 GLY GLY B . n 
B 2 80  LEU 80  192 192 LEU LEU B . n 
B 2 81  ALA 81  193 193 ALA ALA B . n 
B 2 82  PHE 82  194 194 PHE PHE B . n 
B 2 83  LYS 83  195 195 LYS LYS B . n 
B 2 84  HIS 84  196 196 HIS HIS B . n 
B 2 85  GLU 85  197 197 GLU GLU B . n 
B 2 86  ILE 86  198 198 ILE ILE B . n 
B 2 87  LYS 87  199 199 LYS LYS B . n 
B 2 88  ASP 88  200 ?   ?   ?   B . n 
B 2 89  SER 89  201 ?   ?   ?   B . n 
B 2 90  ASP 90  202 ?   ?   ?   B . n 
B 2 91  ASN 91  203 ?   ?   ?   B . n 
B 2 92  ALA 92  204 204 ALA ALA B . n 
B 2 93  GLU 93  205 205 GLU GLU B . n 
B 2 94  LEU 94  206 206 LEU LEU B . n 
B 2 95  ASN 95  207 207 ASN ASN B . n 
B 2 96  CYS 96  208 208 CYS CYS B . n 
B 2 97  ALA 97  209 209 ALA ALA B . n 
B 2 98  VAL 98  210 210 VAL VAL B . n 
B 2 99  LEU 99  211 211 LEU LEU B . n 
B 2 100 GLN 100 212 212 GLN GLN B . n 
B 2 101 VAL 101 213 213 VAL VAL B . n 
B 2 102 ASN 102 214 214 ASN ASN B . n 
B 2 103 ARG 103 215 215 ARG ARG B . n 
B 2 104 LEU 104 216 216 LEU LEU B . n 
B 2 105 LYS 105 217 217 LYS LYS B . n 
B 2 106 SER 106 218 218 SER SER B . n 
B 2 107 ALA 107 219 219 ALA ALA B . n 
B 2 108 GLN 108 220 220 GLN GLN B . n 
B 2 109 CYS 109 221 221 CYS CYS B . n 
B 2 110 GLY 110 222 222 GLY GLY B . n 
B 2 111 SER 111 223 223 SER SER B . n 
B 2 112 SER 112 224 224 SER SER B . n 
B 2 113 ILE 113 225 225 ILE ILE B . n 
B 2 114 ILE 114 226 226 ILE ILE B . n 
B 2 115 TYR 115 227 227 TYR TYR B . n 
B 2 116 HIS 116 228 228 HIS HIS B . n 
B 2 117 CYS 117 229 229 CYS CYS B . n 
B 2 118 LYS 118 230 230 LYS LYS B . n 
B 2 119 HIS 119 231 231 HIS HIS B . n 
B 2 120 LYS 120 232 232 LYS LYS B . n 
C 1 1   ASP 1   57  ?   ?   ?   C . n 
C 1 2   CYS 2   58  58  CYS CYS C . n 
C 1 3   CYS 3   59  59  CYS CYS C . n 
C 1 4   SER 4   60  60  SER SER C . n 
C 1 5   CYS 5   61  61  CYS CYS C . n 
C 1 6   GLN 6   62  62  GLN GLN C . n 
C 1 7   GLU 7   63  63  GLU GLU C . n 
C 1 8   LYS 8   64  64  LYS LYS C . n 
C 1 9   TRP 9   65  65  TRP TRP C . n 
C 1 10  VAL 10  66  66  VAL VAL C . n 
C 1 11  GLY 11  67  67  GLY GLY C . n 
C 1 12  TYR 12  68  68  TYR TYR C . n 
C 1 13  ARG 13  69  69  ARG ARG C . n 
C 1 14  CYS 14  70  70  CYS CYS C . n 
C 1 15  ASN 15  71  71  ASN ASN C . n 
C 1 16  CYS 16  72  72  CYS CYS C . n 
C 1 17  TYR 17  73  73  TYR TYR C . n 
C 1 18  PHE 18  74  74  PHE PHE C . n 
C 1 19  ILE 19  75  75  ILE ILE C . n 
C 1 20  SER 20  76  76  SER SER C . n 
C 1 21  SER 21  77  77  SER SER C . n 
C 1 22  GLU 22  78  78  GLU GLU C . n 
C 1 23  GLN 23  79  79  GLN GLN C . n 
C 1 24  LYS 24  80  80  LYS LYS C . n 
C 1 25  THR 25  81  81  THR THR C . n 
C 1 26  TRP 26  82  82  TRP TRP C . n 
C 1 27  ASN 27  83  83  ASN ASN C . n 
C 1 28  GLU 28  84  84  GLU GLU C . n 
C 1 29  SER 29  85  85  SER SER C . n 
C 1 30  ARG 30  86  86  ARG ARG C . n 
C 1 31  HIS 31  87  87  HIS HIS C . n 
C 1 32  LEU 32  88  88  LEU LEU C . n 
C 1 33  CYS 33  89  89  CYS CYS C . n 
C 1 34  ALA 34  90  90  ALA ALA C . n 
C 1 35  SER 35  91  91  SER SER C . n 
C 1 36  GLN 36  92  92  GLN GLN C . n 
C 1 37  LYS 37  93  93  LYS LYS C . n 
C 1 38  SER 38  94  94  SER SER C . n 
C 1 39  SER 39  95  95  SER SER C . n 
C 1 40  LEU 40  96  96  LEU LEU C . n 
C 1 41  LEU 41  97  97  LEU LEU C . n 
C 1 42  GLN 42  98  98  GLN GLN C . n 
C 1 43  LEU 43  99  99  LEU LEU C . n 
C 1 44  GLN 44  100 100 GLN GLN C . n 
C 1 45  ASN 45  101 101 ASN ASN C . n 
C 1 46  THR 46  102 102 THR THR C . n 
C 1 47  ASP 47  103 103 ASP ASP C . n 
C 1 48  GLU 48  104 104 GLU GLU C . n 
C 1 49  LEU 49  105 105 LEU LEU C . n 
C 1 50  ASP 50  106 106 ASP ASP C . n 
C 1 51  PHE 51  107 107 PHE PHE C . n 
C 1 52  MET 52  108 108 MET MET C . n 
C 1 53  SER 53  109 109 SER SER C . n 
C 1 54  SER 54  110 110 SER SER C . n 
C 1 55  SER 55  111 111 SER SER C . n 
C 1 56  GLN 56  112 112 GLN GLN C . n 
C 1 57  GLN 57  113 113 GLN GLN C . n 
C 1 58  PHE 58  114 114 PHE PHE C . n 
C 1 59  TYR 59  115 115 TYR TYR C . n 
C 1 60  TRP 60  116 116 TRP TRP C . n 
C 1 61  ILE 61  117 117 ILE ILE C . n 
C 1 62  GLY 62  118 118 GLY GLY C . n 
C 1 63  LEU 63  119 119 LEU LEU C . n 
C 1 64  SER 64  120 120 SER SER C . n 
C 1 65  TYR 65  121 121 TYR TYR C . n 
C 1 66  SER 66  122 122 SER SER C . n 
C 1 67  GLU 67  123 123 GLU GLU C . n 
C 1 68  GLU 68  124 124 GLU GLU C . n 
C 1 69  HIS 69  125 125 HIS HIS C . n 
C 1 70  THR 70  126 126 THR THR C . n 
C 1 71  ALA 71  127 127 ALA ALA C . n 
C 1 72  TRP 72  128 128 TRP TRP C . n 
C 1 73  LEU 73  129 129 LEU LEU C . n 
C 1 74  TRP 74  130 130 TRP TRP C . n 
C 1 75  GLU 75  131 131 GLU GLU C . n 
C 1 76  ASN 76  132 132 ASN ASN C . n 
C 1 77  GLY 77  133 133 GLY GLY C . n 
C 1 78  SER 78  134 134 SER SER C . n 
C 1 79  ALA 79  135 135 ALA ALA C . n 
C 1 80  LEU 80  136 136 LEU LEU C . n 
C 1 81  SER 81  137 137 SER SER C . n 
C 1 82  GLN 82  138 138 GLN GLN C . n 
C 1 83  TYR 83  139 139 TYR TYR C . n 
C 1 84  LEU 84  140 140 LEU LEU C . n 
C 1 85  PHE 85  141 141 PHE PHE C . n 
C 1 86  PRO 86  142 142 PRO PRO C . n 
C 1 87  SER 87  143 143 SER SER C . n 
C 1 88  PHE 88  144 144 PHE PHE C . n 
C 1 89  GLU 89  145 145 GLU GLU C . n 
C 1 90  THR 90  146 146 THR THR C . n 
C 1 91  PHE 91  147 147 PHE PHE C . n 
C 1 92  ASN 92  148 148 ASN ASN C . n 
C 1 93  THR 93  149 149 THR THR C . n 
C 1 94  LYS 94  150 150 LYS LYS C . n 
C 1 95  ASN 95  151 151 ASN ASN C . n 
C 1 96  CYS 96  152 152 CYS CYS C . n 
C 1 97  ILE 97  153 153 ILE ILE C . n 
C 1 98  ALA 98  154 154 ALA ALA C . n 
C 1 99  TYR 99  155 155 TYR TYR C . n 
C 1 100 ASN 100 156 156 ASN ASN C . n 
C 1 101 PRO 101 157 157 PRO PRO C . n 
C 1 102 ASN 102 158 158 ASN ASN C . n 
C 1 103 GLY 103 159 159 GLY GLY C . n 
C 1 104 ASN 104 160 160 ASN ASN C . n 
C 1 105 ALA 105 161 161 ALA ALA C . n 
C 1 106 LEU 106 162 162 LEU LEU C . n 
C 1 107 ASP 107 163 163 ASP ASP C . n 
C 1 108 GLU 108 164 164 GLU GLU C . n 
C 1 109 SER 109 165 165 SER SER C . n 
C 1 110 CYS 110 166 166 CYS CYS C . n 
C 1 111 GLU 111 167 167 GLU GLU C . n 
C 1 112 ASP 112 168 168 ASP ASP C . n 
C 1 113 LYS 113 169 169 LYS LYS C . n 
C 1 114 ASN 114 170 170 ASN ASN C . n 
C 1 115 ARG 115 171 171 ARG ARG C . n 
C 1 116 TYR 116 172 172 TYR TYR C . n 
C 1 117 ILE 117 173 173 ILE ILE C . n 
C 1 118 CYS 118 174 174 CYS CYS C . n 
C 1 119 LYS 119 175 175 LYS LYS C . n 
C 1 120 GLN 120 176 176 GLN GLN C . n 
C 1 121 GLN 121 177 177 GLN GLN C . n 
C 1 122 LEU 122 178 178 LEU LEU C . n 
C 1 123 ILE 123 179 179 ILE ILE C . n 
D 2 1   ALA 1   113 113 ALA ALA D . n 
D 2 2   ARG 2   114 114 ARG ARG D . n 
D 2 3   HIS 3   115 115 HIS HIS D . n 
D 2 4   CYS 4   116 116 CYS CYS D . n 
D 2 5   GLY 5   117 117 GLY GLY D . n 
D 2 6   HIS 6   118 118 HIS HIS D . n 
D 2 7   CYS 7   119 119 CYS CYS D . n 
D 2 8   PRO 8   120 120 PRO PRO D . n 
D 2 9   GLU 9   121 121 GLU GLU D . n 
D 2 10  GLU 10  122 122 GLU GLU D . n 
D 2 11  TRP 11  123 123 TRP TRP D . n 
D 2 12  ILE 12  124 124 ILE ILE D . n 
D 2 13  THR 13  125 125 THR THR D . n 
D 2 14  TYR 14  126 126 TYR TYR D . n 
D 2 15  SER 15  127 127 SER SER D . n 
D 2 16  ASN 16  128 128 ASN ASN D . n 
D 2 17  SER 17  129 129 SER SER D . n 
D 2 18  CYS 18  130 130 CYS CYS D . n 
D 2 19  TYR 19  131 131 TYR TYR D . n 
D 2 20  TYR 20  132 132 TYR TYR D . n 
D 2 21  ILE 21  133 133 ILE ILE D . n 
D 2 22  GLY 22  134 134 GLY GLY D . n 
D 2 23  LYS 23  135 135 LYS LYS D . n 
D 2 24  GLU 24  136 136 GLU GLU D . n 
D 2 25  ARG 25  137 137 ARG ARG D . n 
D 2 26  ARG 26  138 138 ARG ARG D . n 
D 2 27  THR 27  139 139 THR THR D . n 
D 2 28  TRP 28  140 140 TRP TRP D . n 
D 2 29  GLU 29  141 141 GLU GLU D . n 
D 2 30  GLU 30  142 142 GLU GLU D . n 
D 2 31  SER 31  143 143 SER SER D . n 
D 2 32  LEU 32  144 144 LEU LEU D . n 
D 2 33  LEU 33  145 145 LEU LEU D . n 
D 2 34  ALA 34  146 146 ALA ALA D . n 
D 2 35  CYS 35  147 147 CYS CYS D . n 
D 2 36  THR 36  148 148 THR THR D . n 
D 2 37  SER 37  149 149 SER SER D . n 
D 2 38  LYS 38  150 150 LYS LYS D . n 
D 2 39  ASN 39  151 151 ASN ASN D . n 
D 2 40  SER 40  152 152 SER SER D . n 
D 2 41  SER 41  153 153 SER SER D . n 
D 2 42  LEU 42  154 154 LEU LEU D . n 
D 2 43  LEU 43  155 155 LEU LEU D . n 
D 2 44  SER 44  156 156 SER SER D . n 
D 2 45  ILE 45  157 157 ILE ILE D . n 
D 2 46  ASP 46  158 158 ASP ASP D . n 
D 2 47  ASN 47  159 159 ASN ASN D . n 
D 2 48  GLU 48  160 160 GLU GLU D . n 
D 2 49  GLU 49  161 161 GLU GLU D . n 
D 2 50  GLU 50  162 162 GLU GLU D . n 
D 2 51  MET 51  163 163 MET MET D . n 
D 2 52  LYS 52  164 164 LYS LYS D . n 
D 2 53  PHE 53  165 165 PHE PHE D . n 
D 2 54  LEU 54  166 166 LEU LEU D . n 
D 2 55  SER 55  167 167 SER SER D . n 
D 2 56  ILE 56  168 168 ILE ILE D . n 
D 2 57  ILE 57  169 169 ILE ILE D . n 
D 2 58  SER 58  170 170 SER SER D . n 
D 2 59  PRO 59  171 171 PRO PRO D . n 
D 2 60  SER 60  172 172 SER SER D . n 
D 2 61  SER 61  173 173 SER SER D . n 
D 2 62  TRP 62  174 174 TRP TRP D . n 
D 2 63  ILE 63  175 175 ILE ILE D . n 
D 2 64  GLY 64  176 176 GLY GLY D . n 
D 2 65  VAL 65  177 177 VAL VAL D . n 
D 2 66  PHE 66  178 178 PHE PHE D . n 
D 2 67  ARG 67  179 179 ARG ARG D . n 
D 2 68  ASN 68  180 180 ASN ASN D . n 
D 2 69  SER 69  181 181 SER SER D . n 
D 2 70  SER 70  182 182 SER SER D . n 
D 2 71  HIS 71  183 183 HIS HIS D . n 
D 2 72  HIS 72  184 184 HIS HIS D . n 
D 2 73  PRO 73  185 185 PRO PRO D . n 
D 2 74  TRP 74  186 186 TRP TRP D . n 
D 2 75  VAL 75  187 187 VAL VAL D . n 
D 2 76  THR 76  188 188 THR THR D . n 
D 2 77  MET 77  189 189 MET MET D . n 
D 2 78  ASN 78  190 190 ASN ASN D . n 
D 2 79  GLY 79  191 191 GLY GLY D . n 
D 2 80  LEU 80  192 192 LEU LEU D . n 
D 2 81  ALA 81  193 193 ALA ALA D . n 
D 2 82  PHE 82  194 194 PHE PHE D . n 
D 2 83  LYS 83  195 195 LYS LYS D . n 
D 2 84  HIS 84  196 196 HIS HIS D . n 
D 2 85  GLU 85  197 197 GLU GLU D . n 
D 2 86  ILE 86  198 198 ILE ILE D . n 
D 2 87  LYS 87  199 199 LYS LYS D . n 
D 2 88  ASP 88  200 ?   ?   ?   D . n 
D 2 89  SER 89  201 ?   ?   ?   D . n 
D 2 90  ASP 90  202 ?   ?   ?   D . n 
D 2 91  ASN 91  203 ?   ?   ?   D . n 
D 2 92  ALA 92  204 204 ALA ALA D . n 
D 2 93  GLU 93  205 205 GLU GLU D . n 
D 2 94  LEU 94  206 206 LEU LEU D . n 
D 2 95  ASN 95  207 207 ASN ASN D . n 
D 2 96  CYS 96  208 208 CYS CYS D . n 
D 2 97  ALA 97  209 209 ALA ALA D . n 
D 2 98  VAL 98  210 210 VAL VAL D . n 
D 2 99  LEU 99  211 211 LEU LEU D . n 
D 2 100 GLN 100 212 212 GLN GLN D . n 
D 2 101 VAL 101 213 213 VAL VAL D . n 
D 2 102 ASN 102 214 214 ASN ASN D . n 
D 2 103 ARG 103 215 215 ARG ARG D . n 
D 2 104 LEU 104 216 216 LEU LEU D . n 
D 2 105 LYS 105 217 217 LYS LYS D . n 
D 2 106 SER 106 218 218 SER SER D . n 
D 2 107 ALA 107 219 219 ALA ALA D . n 
D 2 108 GLN 108 220 220 GLN GLN D . n 
D 2 109 CYS 109 221 221 CYS CYS D . n 
D 2 110 GLY 110 222 222 GLY GLY D . n 
D 2 111 SER 111 223 223 SER SER D . n 
D 2 112 SER 112 224 224 SER SER D . n 
D 2 113 ILE 113 225 225 ILE ILE D . n 
D 2 114 ILE 114 226 226 ILE ILE D . n 
D 2 115 TYR 115 227 227 TYR TYR D . n 
D 2 116 HIS 116 228 228 HIS HIS D . n 
D 2 117 CYS 117 229 229 CYS CYS D . n 
D 2 118 LYS 118 230 230 LYS LYS D . n 
D 2 119 HIS 119 231 231 HIS HIS D . n 
D 2 120 LYS 120 232 232 LYS LYS D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1  180 1  HOH HOH A . 
E 3 HOH 2  181 3  HOH HOH A . 
E 3 HOH 3  182 6  HOH HOH A . 
E 3 HOH 4  183 11 HOH HOH A . 
E 3 HOH 5  184 17 HOH HOH A . 
E 3 HOH 6  185 23 HOH HOH A . 
E 3 HOH 7  186 29 HOH HOH A . 
E 3 HOH 8  187 32 HOH HOH A . 
E 3 HOH 9  188 41 HOH HOH A . 
E 3 HOH 10 189 42 HOH HOH A . 
E 3 HOH 11 190 46 HOH HOH A . 
E 3 HOH 12 191 48 HOH HOH A . 
E 3 HOH 13 192 52 HOH HOH A . 
E 3 HOH 14 193 56 HOH HOH A . 
E 3 HOH 15 194 57 HOH HOH A . 
E 3 HOH 16 195 60 HOH HOH A . 
F 3 HOH 1  2   2  HOH HOH B . 
F 3 HOH 2  5   5  HOH HOH B . 
F 3 HOH 3  10  10 HOH HOH B . 
F 3 HOH 4  19  19 HOH HOH B . 
F 3 HOH 5  34  34 HOH HOH B . 
F 3 HOH 6  39  39 HOH HOH B . 
F 3 HOH 7  45  45 HOH HOH B . 
F 3 HOH 8  54  54 HOH HOH B . 
G 3 HOH 1  180 7  HOH HOH C . 
G 3 HOH 2  181 15 HOH HOH C . 
G 3 HOH 3  182 16 HOH HOH C . 
G 3 HOH 4  183 21 HOH HOH C . 
G 3 HOH 5  184 22 HOH HOH C . 
G 3 HOH 6  185 27 HOH HOH C . 
G 3 HOH 7  186 31 HOH HOH C . 
G 3 HOH 8  187 35 HOH HOH C . 
G 3 HOH 9  188 36 HOH HOH C . 
G 3 HOH 10 189 37 HOH HOH C . 
G 3 HOH 11 190 38 HOH HOH C . 
G 3 HOH 12 191 44 HOH HOH C . 
G 3 HOH 13 192 49 HOH HOH C . 
G 3 HOH 14 193 50 HOH HOH C . 
G 3 HOH 15 194 53 HOH HOH C . 
G 3 HOH 16 195 55 HOH HOH C . 
G 3 HOH 17 196 58 HOH HOH C . 
G 3 HOH 18 197 59 HOH HOH C . 
H 3 HOH 1  12  12 HOH HOH D . 
H 3 HOH 2  18  18 HOH HOH D . 
H 3 HOH 3  24  24 HOH HOH D . 
H 3 HOH 4  30  30 HOH HOH D . 
H 3 HOH 5  33  33 HOH HOH D . 
H 3 HOH 6  40  40 HOH HOH D . 
H 3 HOH 7  43  43 HOH HOH D . 
H 3 HOH 8  47  47 HOH HOH D . 
H 3 HOH 9  51  51 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F 
2 1 C,D,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1500 ? 
2 'ABSA (A^2)' 1490 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-01-01 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-10-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined -11.4592 -4.5622  -70.7440 -0.1069 -0.0945 -0.1188 -0.0001 0.0633  -0.0011 3.1046 4.2652 2.9324 -0.5400 -0.0331 1.4226 
0.0538  -0.0327 -0.0211 -0.1677 0.0873  -0.1835 0.1786  0.0659  0.0785  'X-RAY DIFFRACTION' 
2 ? refined -11.1469 5.2822   -5.6900  -0.1202 -0.0901 -0.0852 -0.0049 -0.0555 -0.0021 3.3360 4.1112 3.0265 0.0579  -0.1811 1.4547 
0.0374  0.0048  -0.0423 0.2050  -0.0496 -0.1348 -0.1916 -0.0748 0.0970  'X-RAY DIFFRACTION' 
3 ? refined -21.5228 11.0652  -49.1285 0.0073  0.1327  -0.0421 -0.0110 -0.0337 -0.1073 1.1953 5.0613 6.3179 -0.7440 -2.1559 2.9137 
-0.0080 -0.0646 0.0726  -0.0710 0.1448  -0.1041 -0.0838 0.0412  -0.3333 'X-RAY DIFFRACTION' 
4 ? refined -21.4193 -10.3692 -27.2711 0.0118  0.1349  -0.0236 0.0422  0.0467  -0.1170 2.4318 4.2554 6.3080 1.0274  1.7351  2.5652 
0.0700  -0.1254 0.0554  0.0212  -0.1394 -0.0925 0.1534  -0.0853 -0.3408 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 2 A 122 ? A 58  A 178 'X-RAY DIFFRACTION' ? 
2 2 C 2 C 122 ? C 58  C 178 'X-RAY DIFFRACTION' ? 
3 3 B 1 B 120 ? B 113 B 232 'X-RAY DIFFRACTION' ? 
4 4 D 1 D 120 ? D 113 D 232 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC      5.2.0019 ?                    program 'Murshudov, G.N.' ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html  Fortran_77 ? 1 
PDB_EXTRACT 3.004    'September 10, 2007' package PDB               sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/ C++        ? 2 
DENZO       .        ?                    ?       ?                 ?                        'data reduction'  ? ?          ? 3 
SCALEPACK   .        ?                    ?       ?                 ?                        'data scaling'    ? ?          ? 4 
SCALA       .        ?                    ?       ?                 ?                        'data scaling'    ? ?          ? 5 
SOLVE       .        ?                    ?       ?                 ?                        phasing           ? ?          ? 6 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 CYS A 58  ? ? 57.75   -8.51   
2  1 SER A 60  ? ? -91.44  -129.96 
3  1 CYS A 61  ? ? 82.16   50.61   
4  1 GLN A 62  ? ? 37.91   -154.32 
5  1 PRO A 157 ? ? -47.92  -18.89  
6  1 TYR B 126 ? ? -142.11 -73.38  
7  1 SER B 152 ? ? -156.75 -159.08 
8  1 LEU B 154 ? ? -48.62  154.76  
9  1 VAL B 213 ? ? 41.31   82.77   
10 1 CYS C 59  ? ? -92.75  58.14   
11 1 SER C 60  ? ? -90.50  -129.12 
12 1 CYS C 61  ? ? 82.07   48.52   
13 1 GLN C 62  ? ? 30.48   -170.36 
14 1 PRO C 157 ? ? -47.62  -17.30  
15 1 TYR D 126 ? ? -142.41 -74.78  
16 1 SER D 152 ? ? -156.66 -158.84 
17 1 LEU D 154 ? ? -49.14  153.22  
18 1 VAL D 213 ? ? 42.01   82.35   
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 HIS B 183 ? ? HIS B 184 ? ? 138.42 
2 1 HIS D 183 ? ? HIS D 184 ? ? 138.41 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ASP 57 ? CG  ? A ASP 1 CG  
2 1 Y 1 A ASP 57 ? OD1 ? A ASP 1 OD1 
3 1 Y 1 A ASP 57 ? OD2 ? A ASP 1 OD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 B ASP 200 ? B ASP 88 
2 1 Y 1 B SER 201 ? B SER 89 
3 1 Y 1 B ASP 202 ? B ASP 90 
4 1 Y 1 B ASN 203 ? B ASN 91 
5 1 Y 1 C ASP 57  ? C ASP 1  
6 1 Y 1 D ASP 200 ? D ASP 88 
7 1 Y 1 D SER 201 ? D SER 89 
8 1 Y 1 D ASP 202 ? D ASP 90 
9 1 Y 1 D ASN 203 ? D ASN 91 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#