data_3BFO
# 
_entry.id   3BFO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3BFO         
RCSB  RCSB045461   
WWPDB D_1000045461 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2G7R 
_pdbx_database_related.details        
'X-ray structure of the death domain of the human mucosa associated lymphoid tissue lymphoma translocation protein 1' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3BFO 
_pdbx_database_status.recvd_initial_deposition_date   2007-11-22 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Walker, J.R.'                         1  
'Akutsu, M.'                           2  
'Littler, D.R.'                        3  
'Li, Y.'                               4  
'Weigelt, J.'                          5  
'Arrowsmith, C.H.'                     6  
'Edwards, A.M.'                        7  
'Bochkarev, A.'                        8  
'Dhe-Paganon, S.'                      9  
'Structural Genomics Consortium (SGC)' 10 
# 
_citation.id                        primary 
_citation.title                     
'Structure of the Ig-like C2-type 2 domain of the human Mucosa-associated lymphoid tissue lymphoma translocation protein 1.' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Walker, J.R.'     1 
primary 'Akutsu, M.'       2 
primary 'Littler, D.R.'    3 
primary 'Li, Y.'           4 
primary 'Weigelt, J.'      5 
primary 'Arrowsmith, C.H.' 6 
primary 'Edwards, A.M.'    7 
primary 'Bochkarev, A.'    8 
primary 'Dhe-Paganon, S.'  9 
# 
_cell.entry_id           3BFO 
_cell.length_a           39.944 
_cell.length_b           43.640 
_cell.length_c           49.595 
_cell.angle_alpha        66.50 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.02 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3BFO 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (Isoform 2)' 10515.014 4   3.4.22.- ? 
'Ig-like C2-type 2 domain: Residues 226-314 of Isoform 2 (Q9UDY8-2)' ? 
2 water   nat water                                                                            18.015    398 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'MALT lymphoma-associated translocation, Paracaspase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQDSKK
VEIIIDELNNL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQDSKK
VEIIIDELNNL
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  LYS n 
1 4  LEU n 
1 5  GLN n 
1 6  ILE n 
1 7  CYS n 
1 8  VAL n 
1 9  GLU n 
1 10 PRO n 
1 11 THR n 
1 12 SER n 
1 13 GLN n 
1 14 LYS n 
1 15 LEU n 
1 16 MET n 
1 17 PRO n 
1 18 GLY n 
1 19 SER n 
1 20 THR n 
1 21 LEU n 
1 22 VAL n 
1 23 LEU n 
1 24 GLN n 
1 25 CYS n 
1 26 VAL n 
1 27 ALA n 
1 28 VAL n 
1 29 GLY n 
1 30 SER n 
1 31 PRO n 
1 32 ILE n 
1 33 PRO n 
1 34 HIS n 
1 35 TYR n 
1 36 GLN n 
1 37 TRP n 
1 38 PHE n 
1 39 LYS n 
1 40 ASN n 
1 41 GLU n 
1 42 LEU n 
1 43 PRO n 
1 44 LEU n 
1 45 THR n 
1 46 HIS n 
1 47 GLU n 
1 48 THR n 
1 49 LYS n 
1 50 LYS n 
1 51 LEU n 
1 52 TYR n 
1 53 MET n 
1 54 VAL n 
1 55 PRO n 
1 56 TYR n 
1 57 VAL n 
1 58 ASP n 
1 59 LEU n 
1 60 GLU n 
1 61 HIS n 
1 62 GLN n 
1 63 GLY n 
1 64 THR n 
1 65 TYR n 
1 66 TRP n 
1 67 CYS n 
1 68 HIS n 
1 69 VAL n 
1 70 TYR n 
1 71 ASN n 
1 72 ASP n 
1 73 ARG n 
1 74 ASP n 
1 75 SER n 
1 76 GLN n 
1 77 ASP n 
1 78 SER n 
1 79 LYS n 
1 80 LYS n 
1 81 VAL n 
1 82 GLU n 
1 83 ILE n 
1 84 ILE n 
1 85 ILE n 
1 86 ASP n 
1 87 GLU n 
1 88 LEU n 
1 89 ASN n 
1 90 ASN n 
1 91 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'MALT1, MLT' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a-LIC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MALT1_HUMAN 
_struct_ref.pdbx_db_accession          Q9UDY8 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;KLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQDSKKVE
IIIDELNNL
;
_struct_ref.pdbx_align_begin           226 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3BFO A 3 ? 91 ? Q9UDY8 226 ? 314 ? 226 314 
2 1 3BFO B 3 ? 91 ? Q9UDY8 226 ? 314 ? 226 314 
3 1 3BFO C 3 ? 91 ? Q9UDY8 226 ? 314 ? 226 314 
4 1 3BFO D 3 ? 91 ? Q9UDY8 226 ? 314 ? 226 314 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3BFO GLY A 1 ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 224 1 
1 3BFO SER A 2 ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 225 2 
2 3BFO GLY B 1 ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 224 3 
2 3BFO SER B 2 ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 225 4 
3 3BFO GLY C 1 ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 224 5 
3 3BFO SER C 2 ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 225 6 
4 3BFO GLY D 1 ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 224 7 
4 3BFO SER D 2 ? UNP Q9UDY8 ? ? 'EXPRESSION TAG' 225 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3BFO 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.88 
_exptl_crystal.density_percent_sol   34.75 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
;1:1 volume ratio of protein solution (50 mg/mL) and reservoir solution (30% PEG MME 550, 0.2 M Ammonium sulfate, 0.1 M Sodium cacodylate pH 6.5), VAPOR DIFFUSION, HANGING DROP, temperature 293K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 270' 
_diffrn_detector.pdbx_collection_date   2007-07-05 
_diffrn_detector.details                'Rh coated Si monochromatic mirrors' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Horizontal bent Si(111), asymmetrically cut with water cooled Cu Block' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.91790 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.91790 
# 
_reflns.entry_id                     3BFO 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3 
_reflns.d_resolution_high            1.15 
_reflns.d_resolution_low             25.00 
_reflns.number_all                   103829 
_reflns.number_obs                   103829 
_reflns.percent_possible_obs         94.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.060 
_reflns.pdbx_netI_over_sigmaI        22.0 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.15 
_reflns_shell.d_res_low              1.19 
_reflns_shell.percent_possible_all   91.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.651 
_reflns_shell.meanI_over_sigI_obs    2.48 
_reflns_shell.pdbx_redundancy        3.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      10043 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3BFO 
_refine.ls_number_reflns_obs                     98073 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             25.00 
_refine.ls_d_res_high                            1.15 
_refine.ls_percent_reflns_obs                    94.57 
_refine.ls_R_factor_obs                          0.17882 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.17708 
_refine.ls_R_factor_R_free                       0.21182 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  5145 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.972 
_refine.correlation_coeff_Fo_to_Fc_free          0.962 
_refine.B_iso_mean                               19.976 
_refine.aniso_B[1][1]                            0.93 
_refine.aniso_B[2][2]                            -0.67 
_refine.aniso_B[3][3]                            -0.76 
_refine.aniso_B[1][2]                            0.17 
_refine.aniso_B[1][3]                            -0.19 
_refine.aniso_B[2][3]                            0.63 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB entries 1U2H, 2AW2, 1CS6' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.048 
_refine.pdbx_overall_ESU_R_Free                  0.047 
_refine.overall_SU_ML                            0.031 
_refine.overall_SU_B                             1.486 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3040 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             401 
_refine_hist.number_atoms_total               3441 
_refine_hist.d_res_high                       1.15 
_refine_hist.d_res_low                        25.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.017  0.022  ? 3153 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.830  1.968  ? 4343 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   7.170  5.000  ? 410  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   32.076 25.161 ? 124  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   13.739 15.000 ? 579  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   23.895 15.000 ? 6    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.128  0.200  ? 475  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.011  0.020  ? 2438 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.226  0.200  ? 1408 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.313  0.200  ? 2213 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.133  0.200  ? 297  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.232  0.200  ? 102  'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.162  0.200  ? 48   'X-RAY DIFFRACTION' ? 
r_mcbond_it              2.535  1.500  ? 1990 'X-RAY DIFFRACTION' ? 
r_mcangle_it             3.337  2.000  ? 3226 'X-RAY DIFFRACTION' ? 
r_scbond_it              4.006  3.000  ? 1361 'X-RAY DIFFRACTION' ? 
r_scangle_it             5.090  4.500  ? 1117 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr       2.792  3.000  ? 3351 'X-RAY DIFFRACTION' ? 
r_sphericity_free        9.706  3.000  ? 401  'X-RAY DIFFRACTION' ? 
r_sphericity_bonded      6.543  3.000  ? 3040 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.150 
_refine_ls_shell.d_res_low                        1.180 
_refine_ls_shell.number_reflns_R_work             7040 
_refine_ls_shell.R_factor_R_work                  0.265 
_refine_ls_shell.percent_reflns_obs               91.66 
_refine_ls_shell.R_factor_R_free                  0.293 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             379 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3BFO 
_struct.title                     
'Crystal structure of Ig-like C2-type 2 domain of the human Mucosa-associated lymphoid tissue lymphoma translocation protein 1' 
_struct.pdbx_descriptor           'Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (Isoform 2) (E.C.3.4.22.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3BFO 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;Hydrolase, Immunoglobulin domain, Nucleus, Protease, Ubl conjugation pathway, Structural Genomics Consortium, SGC, Alternative splicing, Chromosomal rearrangement, Cytoplasm
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 58 ? GLN A 62 ? ASP A 281 GLN A 285 5 ? 5 
HELX_P HELX_P2 2 ASP B 58 ? GLN B 62 ? ASP B 281 GLN B 285 5 ? 5 
HELX_P HELX_P3 3 ASP C 58 ? GLN C 62 ? ASP C 281 GLN C 285 5 ? 5 
HELX_P HELX_P4 4 ASP D 58 ? GLN D 62 ? ASP D 281 GLN D 285 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 30 A . ? SER 253 A PRO 31 A ? PRO 254 A 1 1.23 
2 SER 30 B . ? SER 253 B PRO 31 B ? PRO 254 B 1 2.85 
3 SER 30 C . ? SER 253 C PRO 31 C ? PRO 254 C 1 0.85 
4 SER 30 D . ? SER 253 D PRO 31 D ? PRO 254 D 1 1.39 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 5 ? 
C ? 4 ? 
D ? 2 ? 
E ? 2 ? 
F ? 5 ? 
G ? 4 ? 
H ? 2 ? 
I ? 2 ? 
J ? 5 ? 
K ? 4 ? 
L ? 2 ? 
M ? 2 ? 
N ? 5 ? 
O ? 4 ? 
P ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? parallel      
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
J 4 5 ? anti-parallel 
K 1 2 ? parallel      
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? anti-parallel 
M 1 2 ? anti-parallel 
N 1 2 ? parallel      
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
N 4 5 ? anti-parallel 
O 1 2 ? parallel      
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
P 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 5  ? VAL A 8  ? GLN A 228 VAL A 231 
A 2 VAL A 26 ? VAL A 28 ? VAL A 249 VAL A 251 
B 1 GLN A 13 ? LEU A 15 ? GLN A 236 LEU A 238 
B 2 VAL A 81 ? ILE A 85 ? VAL A 304 ILE A 308 
B 3 GLY A 63 ? TYR A 70 ? GLY A 286 TYR A 293 
B 4 HIS A 34 ? LYS A 39 ? HIS A 257 LYS A 262 
B 5 LEU A 42 ? PRO A 43 ? LEU A 265 PRO A 266 
C 1 GLN A 13 ? LEU A 15 ? GLN A 236 LEU A 238 
C 2 VAL A 81 ? ILE A 85 ? VAL A 304 ILE A 308 
C 3 GLY A 63 ? TYR A 70 ? GLY A 286 TYR A 293 
C 4 SER A 75 ? ASP A 77 ? SER A 298 ASP A 300 
D 1 LEU A 21 ? GLN A 24 ? LEU A 244 GLN A 247 
D 2 LEU A 51 ? VAL A 54 ? LEU A 274 VAL A 277 
E 1 GLN B 5  ? VAL B 8  ? GLN B 228 VAL B 231 
E 2 VAL B 26 ? VAL B 28 ? VAL B 249 VAL B 251 
F 1 GLN B 13 ? LEU B 15 ? GLN B 236 LEU B 238 
F 2 VAL B 81 ? ILE B 85 ? VAL B 304 ILE B 308 
F 3 GLY B 63 ? TYR B 70 ? GLY B 286 TYR B 293 
F 4 HIS B 34 ? LYS B 39 ? HIS B 257 LYS B 262 
F 5 LEU B 42 ? PRO B 43 ? LEU B 265 PRO B 266 
G 1 GLN B 13 ? LEU B 15 ? GLN B 236 LEU B 238 
G 2 VAL B 81 ? ILE B 85 ? VAL B 304 ILE B 308 
G 3 GLY B 63 ? TYR B 70 ? GLY B 286 TYR B 293 
G 4 SER B 75 ? ASP B 77 ? SER B 298 ASP B 300 
H 1 LEU B 21 ? GLN B 24 ? LEU B 244 GLN B 247 
H 2 LEU B 51 ? VAL B 54 ? LEU B 274 VAL B 277 
I 1 GLN C 5  ? VAL C 8  ? GLN C 228 VAL C 231 
I 2 VAL C 26 ? VAL C 28 ? VAL C 249 VAL C 251 
J 1 GLN C 13 ? LEU C 15 ? GLN C 236 LEU C 238 
J 2 VAL C 81 ? ILE C 85 ? VAL C 304 ILE C 308 
J 3 GLY C 63 ? TYR C 70 ? GLY C 286 TYR C 293 
J 4 HIS C 34 ? LYS C 39 ? HIS C 257 LYS C 262 
J 5 LEU C 42 ? PRO C 43 ? LEU C 265 PRO C 266 
K 1 GLN C 13 ? LEU C 15 ? GLN C 236 LEU C 238 
K 2 VAL C 81 ? ILE C 85 ? VAL C 304 ILE C 308 
K 3 GLY C 63 ? TYR C 70 ? GLY C 286 TYR C 293 
K 4 SER C 75 ? ASP C 77 ? SER C 298 ASP C 300 
L 1 LEU C 21 ? GLN C 24 ? LEU C 244 GLN C 247 
L 2 LEU C 51 ? VAL C 54 ? LEU C 274 VAL C 277 
M 1 GLN D 5  ? VAL D 8  ? GLN D 228 VAL D 231 
M 2 VAL D 26 ? VAL D 28 ? VAL D 249 VAL D 251 
N 1 GLN D 13 ? LEU D 15 ? GLN D 236 LEU D 238 
N 2 VAL D 81 ? ILE D 85 ? VAL D 304 ILE D 308 
N 3 GLY D 63 ? TYR D 70 ? GLY D 286 TYR D 293 
N 4 HIS D 34 ? LYS D 39 ? HIS D 257 LYS D 262 
N 5 LEU D 42 ? PRO D 43 ? LEU D 265 PRO D 266 
O 1 GLN D 13 ? LEU D 15 ? GLN D 236 LEU D 238 
O 2 VAL D 81 ? ILE D 85 ? VAL D 304 ILE D 308 
O 3 GLY D 63 ? TYR D 70 ? GLY D 286 TYR D 293 
O 4 SER D 75 ? ASP D 77 ? SER D 298 ASP D 300 
P 1 LEU D 21 ? GLN D 24 ? LEU D 244 GLN D 247 
P 2 LEU D 51 ? VAL D 54 ? LEU D 274 VAL D 277 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N CYS A 7  ? N CYS A 230 O VAL A 26 ? O VAL A 249 
B 1 2 N LEU A 15 ? N LEU A 238 O ILE A 84 ? O ILE A 307 
B 2 3 O VAL A 81 ? O VAL A 304 N TYR A 65 ? N TYR A 288 
B 3 4 O TYR A 70 ? O TYR A 293 N HIS A 34 ? N HIS A 257 
B 4 5 N LYS A 39 ? N LYS A 262 O LEU A 42 ? O LEU A 265 
C 1 2 N LEU A 15 ? N LEU A 238 O ILE A 84 ? O ILE A 307 
C 2 3 O VAL A 81 ? O VAL A 304 N TYR A 65 ? N TYR A 288 
C 3 4 N VAL A 69 ? N VAL A 292 O GLN A 76 ? O GLN A 299 
D 1 2 N LEU A 23 ? N LEU A 246 O TYR A 52 ? O TYR A 275 
E 1 2 N CYS B 7  ? N CYS B 230 O VAL B 26 ? O VAL B 249 
F 1 2 N LEU B 15 ? N LEU B 238 O ILE B 84 ? O ILE B 307 
F 2 3 O ILE B 83 ? O ILE B 306 N GLY B 63 ? N GLY B 286 
F 3 4 O TRP B 66 ? O TRP B 289 N PHE B 38 ? N PHE B 261 
F 4 5 N LYS B 39 ? N LYS B 262 O LEU B 42 ? O LEU B 265 
G 1 2 N LEU B 15 ? N LEU B 238 O ILE B 84 ? O ILE B 307 
G 2 3 O ILE B 83 ? O ILE B 306 N GLY B 63 ? N GLY B 286 
G 3 4 N VAL B 69 ? N VAL B 292 O GLN B 76 ? O GLN B 299 
H 1 2 N LEU B 23 ? N LEU B 246 O TYR B 52 ? O TYR B 275 
I 1 2 N CYS C 7  ? N CYS C 230 O VAL C 26 ? O VAL C 249 
J 1 2 N LEU C 15 ? N LEU C 238 O ILE C 84 ? O ILE C 307 
J 2 3 O ILE C 83 ? O ILE C 306 N GLY C 63 ? N GLY C 286 
J 3 4 O TYR C 70 ? O TYR C 293 N HIS C 34 ? N HIS C 257 
J 4 5 N LYS C 39 ? N LYS C 262 O LEU C 42 ? O LEU C 265 
K 1 2 N LEU C 15 ? N LEU C 238 O ILE C 84 ? O ILE C 307 
K 2 3 O ILE C 83 ? O ILE C 306 N GLY C 63 ? N GLY C 286 
K 3 4 N VAL C 69 ? N VAL C 292 O GLN C 76 ? O GLN C 299 
L 1 2 N LEU C 21 ? N LEU C 244 O VAL C 54 ? O VAL C 277 
M 1 2 N CYS D 7  ? N CYS D 230 O VAL D 26 ? O VAL D 249 
N 1 2 N LEU D 15 ? N LEU D 238 O ILE D 84 ? O ILE D 307 
N 2 3 O ILE D 83 ? O ILE D 306 N GLY D 63 ? N GLY D 286 
N 3 4 O TRP D 66 ? O TRP D 289 N PHE D 38 ? N PHE D 261 
N 4 5 N LYS D 39 ? N LYS D 262 O LEU D 42 ? O LEU D 265 
O 1 2 N LEU D 15 ? N LEU D 238 O ILE D 84 ? O ILE D 307 
O 2 3 O ILE D 83 ? O ILE D 306 N GLY D 63 ? N GLY D 286 
O 3 4 N VAL D 69 ? N VAL D 292 O GLN D 76 ? O GLN D 299 
P 1 2 N LEU D 21 ? N LEU D 244 O VAL D 54 ? O VAL D 277 
# 
_database_PDB_matrix.entry_id          3BFO 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3BFO 
_atom_sites.fract_transf_matrix[1][1]   0.025035 
_atom_sites.fract_transf_matrix[1][2]   0.000008 
_atom_sites.fract_transf_matrix[1][3]   -0.000006 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.022915 
_atom_sites.fract_transf_matrix[2][3]   -0.009965 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.021987 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 2  ? 21.878  31.226 18.319  1.00 27.16 ? 225 SER A N   1 
ATOM   2    C CA  . SER A 1 2  ? 20.813  30.661 19.188  1.00 25.75 ? 225 SER A CA  1 
ATOM   3    C C   . SER A 1 2  ? 20.256  31.766 20.084  1.00 22.61 ? 225 SER A C   1 
ATOM   4    O O   . SER A 1 2  ? 20.985  32.665 20.561  1.00 21.33 ? 225 SER A O   1 
ATOM   5    C CB  . SER A 1 2  ? 21.319  29.425 19.950  1.00 28.32 ? 225 SER A CB  1 
ATOM   6    O OG  . SER A 1 2  ? 20.526  29.053 21.063  1.00 34.46 ? 225 SER A OG  1 
ATOM   7    N N   A LYS A 1 3  ? 18.940  31.688 20.305  0.50 21.35 ? 226 LYS A N   1 
ATOM   8    N N   B LYS A 1 3  ? 18.951  31.751 20.276  0.50 21.48 ? 226 LYS A N   1 
ATOM   9    C CA  A LYS A 1 3  ? 18.144  32.658 21.050  0.50 20.55 ? 226 LYS A CA  1 
ATOM   10   C CA  B LYS A 1 3  ? 18.329  32.888 20.875  0.50 20.93 ? 226 LYS A CA  1 
ATOM   11   C C   A LYS A 1 3  ? 18.813  32.927 22.394  0.50 19.40 ? 226 LYS A C   1 
ATOM   12   C C   B LYS A 1 3  ? 18.715  32.981 22.344  0.50 19.57 ? 226 LYS A C   1 
ATOM   13   O O   A LYS A 1 3  ? 19.138  31.979 23.136  0.50 19.04 ? 226 LYS A O   1 
ATOM   14   O O   B LYS A 1 3  ? 18.749  31.998 23.102  0.50 19.50 ? 226 LYS A O   1 
ATOM   15   C CB  A LYS A 1 3  ? 16.722  32.118 21.290  0.50 20.11 ? 226 LYS A CB  1 
ATOM   16   C CB  B LYS A 1 3  ? 16.821  32.881 20.700  0.50 21.06 ? 226 LYS A CB  1 
ATOM   17   C CG  A LYS A 1 3  ? 15.765  33.089 22.000  0.50 20.61 ? 226 LYS A CG  1 
ATOM   18   C CG  B LYS A 1 3  ? 16.137  34.177 21.093  0.50 22.41 ? 226 LYS A CG  1 
ATOM   19   C CD  A LYS A 1 3  ? 14.437  32.440 22.421  0.50 21.33 ? 226 LYS A CD  1 
ATOM   20   C CD  B LYS A 1 3  ? 15.168  34.605 20.003  0.50 24.49 ? 226 LYS A CD  1 
ATOM   21   C CE  A LYS A 1 3  ? 13.640  33.380 23.307  0.50 21.08 ? 226 LYS A CE  1 
ATOM   22   C CE  B LYS A 1 3  ? 13.833  35.109 20.545  0.50 25.03 ? 226 LYS A CE  1 
ATOM   23   N NZ  A LYS A 1 3  ? 12.179  33.023 23.386  0.50 21.76 ? 226 LYS A NZ  1 
ATOM   24   N NZ  B LYS A 1 3  ? 13.815  35.789 21.864  0.50 26.82 ? 226 LYS A NZ  1 
ATOM   25   N N   . LEU A 1 4  ? 19.001  34.205 22.724  1.00 19.01 ? 227 LEU A N   1 
ATOM   26   C CA  . LEU A 1 4  ? 19.467  34.554 24.066  1.00 17.10 ? 227 LEU A CA  1 
ATOM   27   C C   . LEU A 1 4  ? 18.301  34.341 24.983  1.00 16.47 ? 227 LEU A C   1 
ATOM   28   O O   . LEU A 1 4  ? 17.170  34.832 24.755  1.00 18.90 ? 227 LEU A O   1 
ATOM   29   C CB  . LEU A 1 4  ? 19.936  35.999 24.078  1.00 18.40 ? 227 LEU A CB  1 
ATOM   30   C CG  . LEU A 1 4  ? 20.480  36.470 25.402  1.00 16.65 ? 227 LEU A CG  1 
ATOM   31   C CD1 . LEU A 1 4  ? 21.549  37.536 25.167  1.00 18.38 ? 227 LEU A CD1 1 
ATOM   32   C CD2 . LEU A 1 4  ? 19.391  37.025 26.299  1.00 21.60 ? 227 LEU A CD2 1 
ATOM   33   N N   . GLN A 1 5  ? 18.535  33.606 26.062  1.00 16.56 ? 228 GLN A N   1 
ATOM   34   C CA  . GLN A 1 5  ? 17.456  33.337 27.002  1.00 17.69 ? 228 GLN A CA  1 
ATOM   35   C C   . GLN A 1 5  ? 18.009  33.188 28.434  1.00 17.08 ? 228 GLN A C   1 
ATOM   36   O O   . GLN A 1 5  ? 18.912  32.392 28.670  1.00 17.58 ? 228 GLN A O   1 
ATOM   37   C CB  . GLN A 1 5  ? 16.726  32.042 26.591  1.00 19.65 ? 228 GLN A CB  1 
ATOM   38   C CG  . GLN A 1 5  ? 15.611  31.681 27.569  1.00 21.52 ? 228 GLN A CG  1 
ATOM   39   C CD  . GLN A 1 5  ? 14.567  32.759 27.665  1.00 23.27 ? 228 GLN A CD  1 
ATOM   40   O OE1 . GLN A 1 5  ? 13.969  33.175 26.652  1.00 24.93 ? 228 GLN A OE1 1 
ATOM   41   N NE2 . GLN A 1 5  ? 14.301  33.212 28.890  1.00 24.10 ? 228 GLN A NE2 1 
ATOM   42   N N   . ILE A 1 6  ? 17.450  33.933 29.353  1.00 16.93 ? 229 ILE A N   1 
ATOM   43   C CA  . ILE A 1 6  ? 17.802  33.783 30.775  1.00 16.29 ? 229 ILE A CA  1 
ATOM   44   C C   . ILE A 1 6  ? 17.140  32.482 31.269  1.00 16.60 ? 229 ILE A C   1 
ATOM   45   O O   . ILE A 1 6  ? 15.879  32.287 31.158  1.00 20.82 ? 229 ILE A O   1 
ATOM   46   C CB  . ILE A 1 6  ? 17.312  34.997 31.596  1.00 16.79 ? 229 ILE A CB  1 
ATOM   47   C CG1 . ILE A 1 6  ? 18.085  36.251 31.138  1.00 17.23 ? 229 ILE A CG1 1 
ATOM   48   C CG2 . ILE A 1 6  ? 17.554  34.751 33.122  1.00 17.57 ? 229 ILE A CG2 1 
ATOM   49   C CD1 . ILE A 1 6  ? 17.634  37.495 31.790  1.00 15.80 ? 229 ILE A CD1 1 
ATOM   50   N N   A CYS A 1 7  ? 17.977  31.640 31.881  0.50 17.03 ? 230 CYS A N   1 
ATOM   51   N N   B CYS A 1 7  ? 18.009  31.619 31.840  0.50 17.95 ? 230 CYS A N   1 
ATOM   52   C CA  A CYS A 1 7  ? 17.510  30.355 32.403  0.50 18.36 ? 230 CYS A CA  1 
ATOM   53   C CA  B CYS A 1 7  ? 17.617  30.285 32.366  0.50 19.64 ? 230 CYS A CA  1 
ATOM   54   C C   A CYS A 1 7  ? 17.554  30.336 33.913  0.50 19.08 ? 230 CYS A C   1 
ATOM   55   C C   B CYS A 1 7  ? 17.800  30.122 33.876  0.50 19.38 ? 230 CYS A C   1 
ATOM   56   O O   A CYS A 1 7  ? 16.738  29.644 34.513  0.50 17.11 ? 230 CYS A O   1 
ATOM   57   O O   B CYS A 1 7  ? 17.295  29.148 34.432  0.50 15.87 ? 230 CYS A O   1 
ATOM   58   C CB  A CYS A 1 7  ? 18.374  29.252 31.837  0.50 19.17 ? 230 CYS A CB  1 
ATOM   59   C CB  B CYS A 1 7  ? 18.359  29.153 31.643  0.50 21.48 ? 230 CYS A CB  1 
ATOM   60   S SG  A CYS A 1 7  ? 18.063  29.090 30.053  0.50 21.12 ? 230 CYS A SG  1 
ATOM   61   S SG  B CYS A 1 7  ? 20.178  29.186 31.620  0.50 29.62 ? 230 CYS A SG  1 
ATOM   62   N N   . VAL A 1 8  ? 18.512  31.039 34.537  1.00 18.14 ? 231 VAL A N   1 
ATOM   63   C CA  . VAL A 1 8  ? 18.606  31.108 36.012  1.00 17.85 ? 231 VAL A CA  1 
ATOM   64   C C   . VAL A 1 8  ? 18.349  32.566 36.333  1.00 16.79 ? 231 VAL A C   1 
ATOM   65   O O   . VAL A 1 8  ? 19.064  33.471 35.869  1.00 16.30 ? 231 VAL A O   1 
ATOM   66   C CB  . VAL A 1 8  ? 19.948  30.680 36.582  1.00 18.51 ? 231 VAL A CB  1 
ATOM   67   C CG1 . VAL A 1 8  ? 20.006  30.879 38.123  1.00 20.24 ? 231 VAL A CG1 1 
ATOM   68   C CG2 . VAL A 1 8  ? 20.257  29.232 36.238  1.00 20.24 ? 231 VAL A CG2 1 
ATOM   69   N N   . GLU A 1 9  ? 17.260  32.791 37.076  1.00 17.73 ? 232 GLU A N   1 
ATOM   70   C CA  . GLU A 1 9  ? 16.807  34.078 37.539  1.00 19.03 ? 232 GLU A CA  1 
ATOM   71   C C   . GLU A 1 9  ? 17.358  34.346 38.955  1.00 18.59 ? 232 GLU A C   1 
ATOM   72   O O   . GLU A 1 9  ? 17.427  33.412 39.756  1.00 21.45 ? 232 GLU A O   1 
ATOM   73   C CB  . GLU A 1 9  ? 15.278  34.202 37.508  1.00 20.31 ? 232 GLU A CB  1 
ATOM   74   C CG  . GLU A 1 9  ? 14.739  34.255 36.111  1.00 20.33 ? 232 GLU A CG  1 
ATOM   75   C CD  . GLU A 1 9  ? 14.830  35.627 35.394  1.00 20.12 ? 232 GLU A CD  1 
ATOM   76   O OE1 . GLU A 1 9  ? 15.398  36.579 35.919  1.00 24.32 ? 232 GLU A OE1 1 
ATOM   77   O OE2 . GLU A 1 9  ? 14.276  35.722 34.256  1.00 23.15 ? 232 GLU A OE2 1 
ATOM   78   N N   . PRO A 1 10 ? 17.701  35.617 39.304  1.00 18.26 ? 233 PRO A N   1 
ATOM   79   C CA  . PRO A 1 10 ? 18.111  35.926 40.661  1.00 18.80 ? 233 PRO A CA  1 
ATOM   80   C C   . PRO A 1 10 ? 16.914  35.744 41.604  1.00 19.25 ? 233 PRO A C   1 
ATOM   81   O O   . PRO A 1 10 ? 15.766  35.715 41.165  1.00 19.98 ? 233 PRO A O   1 
ATOM   82   C CB  . PRO A 1 10 ? 18.576  37.391 40.581  1.00 17.96 ? 233 PRO A CB  1 
ATOM   83   C CG  . PRO A 1 10 ? 17.842  37.965 39.399  1.00 18.69 ? 233 PRO A CG  1 
ATOM   84   C CD  . PRO A 1 10 ? 17.668  36.805 38.438  1.00 17.80 ? 233 PRO A CD  1 
ATOM   85   N N   . THR A 1 11 ? 17.246  35.649 42.894  1.00 20.33 ? 234 THR A N   1 
ATOM   86   C CA  . THR A 1 11 ? 16.314  35.446 44.004  1.00 21.50 ? 234 THR A CA  1 
ATOM   87   C C   . THR A 1 11 ? 16.395  36.605 45.021  1.00 19.10 ? 234 THR A C   1 
ATOM   88   O O   . THR A 1 11 ? 17.481  37.065 45.367  1.00 21.28 ? 234 THR A O   1 
ATOM   89   C CB  . THR A 1 11 ? 16.601  34.132 44.791  1.00 22.47 ? 234 THR A CB  1 
ATOM   90   O OG1 . THR A 1 11 ? 16.688  33.014 43.869  1.00 27.38 ? 234 THR A OG1 1 
ATOM   91   C CG2 . THR A 1 11 ? 15.466  33.810 45.779  1.00 27.80 ? 234 THR A CG2 1 
ATOM   92   N N   . SER A 1 12 ? 15.214  37.066 45.480  1.00 20.83 ? 235 SER A N   1 
ATOM   93   C CA  . SER A 1 12 ? 15.178  38.026 46.586  1.00 19.21 ? 235 SER A CA  1 
ATOM   94   C C   . SER A 1 12 ? 15.681  37.339 47.857  1.00 19.19 ? 235 SER A C   1 
ATOM   95   O O   . SER A 1 12 ? 15.636  36.102 47.983  1.00 21.12 ? 235 SER A O   1 
ATOM   96   C CB  . SER A 1 12 ? 13.745  38.508 46.811  1.00 20.73 ? 235 SER A CB  1 
ATOM   97   O OG  . SER A 1 12 ? 13.319  39.374 45.763  1.00 25.64 ? 235 SER A OG  1 
ATOM   98   N N   . GLN A 1 13 ? 16.210  38.154 48.758  1.00 18.24 ? 236 GLN A N   1 
ATOM   99   C CA  . GLN A 1 13 ? 16.812  37.648 49.998  1.00 18.25 ? 236 GLN A CA  1 
ATOM   100  C C   . GLN A 1 13 ? 16.472  38.631 51.094  1.00 19.01 ? 236 GLN A C   1 
ATOM   101  O O   . GLN A 1 13 ? 16.400  39.849 50.889  1.00 19.11 ? 236 GLN A O   1 
ATOM   102  C CB  . GLN A 1 13 ? 18.327  37.513 49.922  1.00 18.04 ? 236 GLN A CB  1 
ATOM   103  C CG  . GLN A 1 13 ? 18.904  36.530 48.867  1.00 19.08 ? 236 GLN A CG  1 
ATOM   104  C CD  . GLN A 1 13 ? 18.706  35.097 49.236  1.00 20.01 ? 236 GLN A CD  1 
ATOM   105  O OE1 . GLN A 1 13 ? 18.397  34.745 50.391  1.00 20.78 ? 236 GLN A OE1 1 
ATOM   106  N NE2 . GLN A 1 13 ? 18.892  34.213 48.256  1.00 20.89 ? 236 GLN A NE2 1 
ATOM   107  N N   . LYS A 1 14 ? 16.343  38.066 52.290  1.00 18.17 ? 237 LYS A N   1 
ATOM   108  C CA  . LYS A 1 14 ? 16.246  38.829 53.527  1.00 19.24 ? 237 LYS A CA  1 
ATOM   109  C C   . LYS A 1 14 ? 17.450  38.488 54.364  1.00 17.06 ? 237 LYS A C   1 
ATOM   110  O O   . LYS A 1 14 ? 17.629  37.351 54.801  1.00 18.35 ? 237 LYS A O   1 
ATOM   111  C CB  . LYS A 1 14 ? 14.952  38.483 54.308  1.00 20.47 ? 237 LYS A CB  1 
ATOM   112  C CG  . LYS A 1 14 ? 14.677  39.414 55.508  1.00 26.70 ? 237 LYS A CG  1 
ATOM   113  C CD  . LYS A 1 14 ? 13.645  38.895 56.528  1.00 26.74 ? 237 LYS A CD  1 
ATOM   114  N N   . LEU A 1 15 ? 18.340  39.465 54.524  1.00 16.63 ? 238 LEU A N   1 
ATOM   115  C CA  . LEU A 1 15 ? 19.665  39.235 55.100  1.00 15.59 ? 238 LEU A CA  1 
ATOM   116  C C   . LEU A 1 15 ? 19.849  40.058 56.353  1.00 17.73 ? 238 LEU A C   1 
ATOM   117  O O   . LEU A 1 15 ? 19.191  41.066 56.542  1.00 21.06 ? 238 LEU A O   1 
ATOM   118  C CB  . LEU A 1 15 ? 20.750  39.648 54.089  1.00 15.96 ? 238 LEU A CB  1 
ATOM   119  C CG  . LEU A 1 15 ? 20.701  38.839 52.786  1.00 15.59 ? 238 LEU A CG  1 
ATOM   120  C CD1 . LEU A 1 15 ? 21.765  39.373 51.829  1.00 15.94 ? 238 LEU A CD1 1 
ATOM   121  C CD2 . LEU A 1 15 ? 20.888  37.338 53.016  1.00 15.70 ? 238 LEU A CD2 1 
ATOM   122  N N   A MET A 1 16 ? 20.790  39.634 57.189  0.50 17.21 ? 239 MET A N   1 
ATOM   123  N N   B MET A 1 16 ? 20.738  39.652 57.238  0.50 18.78 ? 239 MET A N   1 
ATOM   124  C CA  A MET A 1 16 ? 21.199  40.442 58.336  0.50 18.94 ? 239 MET A CA  1 
ATOM   125  C CA  B MET A 1 16 ? 21.070  40.604 58.291  0.50 21.24 ? 239 MET A CA  1 
ATOM   126  C C   A MET A 1 16 ? 22.539  41.122 58.044  0.50 17.50 ? 239 MET A C   1 
ATOM   127  C C   B MET A 1 16 ? 22.503  41.107 58.102  0.50 18.94 ? 239 MET A C   1 
ATOM   128  O O   A MET A 1 16 ? 23.322  40.625 57.217  0.50 15.45 ? 239 MET A O   1 
ATOM   129  O O   B MET A 1 16 ? 23.300  40.491 57.377  0.50 16.95 ? 239 MET A O   1 
ATOM   130  C CB  A MET A 1 16 ? 21.285  39.562 59.567  0.50 18.83 ? 239 MET A CB  1 
ATOM   131  C CB  B MET A 1 16 ? 20.739  40.070 59.690  0.50 23.24 ? 239 MET A CB  1 
ATOM   132  C CG  A MET A 1 16 ? 22.339  38.529 59.656  0.50 21.01 ? 239 MET A CG  1 
ATOM   133  C CG  B MET A 1 16 ? 21.289  38.718 60.040  0.50 25.58 ? 239 MET A CG  1 
ATOM   134  S SD  A MET A 1 16 ? 22.103  37.615 61.208  0.50 27.09 ? 239 MET A SD  1 
ATOM   135  S SD  B MET A 1 16 ? 20.983  38.382 61.788  0.50 29.33 ? 239 MET A SD  1 
ATOM   136  C CE  A MET A 1 16 ? 22.166  38.943 62.413  0.50 25.34 ? 239 MET A CE  1 
ATOM   137  C CE  B MET A 1 16 ? 22.629  37.772 62.193  0.50 29.39 ? 239 MET A CE  1 
ATOM   138  N N   . PRO A 1 17 ? 22.851  42.242 58.723  1.00 18.93 ? 240 PRO A N   1 
ATOM   139  C CA  . PRO A 1 17 ? 24.183  42.794 58.522  1.00 18.25 ? 240 PRO A CA  1 
ATOM   140  C C   . PRO A 1 17 ? 25.223  41.681 58.823  1.00 17.43 ? 240 PRO A C   1 
ATOM   141  O O   . PRO A 1 17 ? 25.075  40.938 59.783  1.00 19.46 ? 240 PRO A O   1 
ATOM   142  C CB  . PRO A 1 17 ? 24.231  43.976 59.512  1.00 20.97 ? 240 PRO A CB  1 
ATOM   143  C CG  . PRO A 1 17 ? 22.799  44.362 59.626  1.00 22.04 ? 240 PRO A CG  1 
ATOM   144  C CD  . PRO A 1 17 ? 22.032  43.072 59.633  1.00 20.94 ? 240 PRO A CD  1 
ATOM   145  N N   . GLY A 1 18 ? 26.275  41.607 58.026  1.00 17.64 ? 241 GLY A N   1 
ATOM   146  C CA  . GLY A 1 18 ? 27.297  40.616 58.234  1.00 17.33 ? 241 GLY A CA  1 
ATOM   147  C C   . GLY A 1 18 ? 27.108  39.374 57.389  1.00 16.60 ? 241 GLY A C   1 
ATOM   148  O O   . GLY A 1 18 ? 28.051  38.618 57.226  1.00 19.01 ? 241 GLY A O   1 
ATOM   149  N N   A SER A 1 19 ? 25.887  39.157 56.867  0.50 14.49 ? 242 SER A N   1 
ATOM   150  N N   B SER A 1 19 ? 25.909  39.154 56.857  0.50 14.35 ? 242 SER A N   1 
ATOM   151  C CA  A SER A 1 19 ? 25.533  37.997 55.995  0.50 14.14 ? 242 SER A CA  1 
ATOM   152  C CA  B SER A 1 19 ? 25.665  37.953 56.046  0.50 13.72 ? 242 SER A CA  1 
ATOM   153  C C   A SER A 1 19 ? 26.170  38.195 54.630  0.50 13.91 ? 242 SER A C   1 
ATOM   154  C C   B SER A 1 19 ? 26.028  38.242 54.575  0.50 13.64 ? 242 SER A C   1 
ATOM   155  O O   A SER A 1 19 ? 26.806  39.219 54.376  0.50 13.45 ? 242 SER A O   1 
ATOM   156  O O   B SER A 1 19 ? 26.385  39.372 54.199  0.50 14.37 ? 242 SER A O   1 
ATOM   157  C CB  A SER A 1 19 ? 24.018  37.951 55.785  0.50 14.53 ? 242 SER A CB  1 
ATOM   158  C CB  B SER A 1 19 ? 24.235  37.489 56.255  0.50 14.69 ? 242 SER A CB  1 
ATOM   159  O OG  A SER A 1 19 ? 23.347  37.598 56.983  0.50 16.32 ? 242 SER A OG  1 
ATOM   160  O OG  B SER A 1 19 ? 23.276  38.400 55.732  0.50 14.84 ? 242 SER A OG  1 
ATOM   161  N N   . THR A 1 20 ? 26.041  37.199 53.761  1.00 14.15 ? 243 THR A N   1 
ATOM   162  C CA  . THR A 1 20 ? 26.545  37.290 52.420  1.00 14.18 ? 243 THR A CA  1 
ATOM   163  C C   . THR A 1 20 ? 25.403  37.525 51.442  1.00 13.64 ? 243 THR A C   1 
ATOM   164  O O   . THR A 1 20 ? 24.352  36.872 51.513  1.00 13.83 ? 243 THR A O   1 
ATOM   165  C CB  . THR A 1 20 ? 27.310  35.998 52.056  1.00 15.06 ? 243 THR A CB  1 
ATOM   166  O OG1 . THR A 1 20 ? 28.439  35.884 52.952  1.00 18.57 ? 243 THR A OG1 1 
ATOM   167  C CG2 . THR A 1 20 ? 27.796  36.011 50.621  1.00 16.98 ? 243 THR A CG2 1 
ATOM   168  N N   . LEU A 1 21 ? 25.605  38.452 50.511  1.00 13.19 ? 244 LEU A N   1 
ATOM   169  C CA  . LEU A 1 21 ? 24.706  38.621 49.394  1.00 14.17 ? 244 LEU A CA  1 
ATOM   170  C C   . LEU A 1 21 ? 25.222  37.854 48.207  1.00 13.71 ? 244 LEU A C   1 
ATOM   171  O O   . LEU A 1 21 ? 26.340  38.071 47.801  1.00 13.99 ? 244 LEU A O   1 
ATOM   172  C CB  . LEU A 1 21 ? 24.604  40.114 49.065  1.00 14.31 ? 244 LEU A CB  1 
ATOM   173  C CG  . LEU A 1 21 ? 23.784  40.418 47.817  1.00 16.16 ? 244 LEU A CG  1 
ATOM   174  C CD1 . LEU A 1 21 ? 22.388  39.780 47.853  1.00 17.03 ? 244 LEU A CD1 1 
ATOM   175  C CD2 . LEU A 1 21 ? 23.731  41.960 47.624  1.00 17.90 ? 244 LEU A CD2 1 
ATOM   176  N N   A VAL A 1 22 ? 24.386  36.976 47.655  0.50 15.39 ? 245 VAL A N   1 
ATOM   177  N N   B VAL A 1 22 ? 24.445  36.931 47.667  0.50 15.47 ? 245 VAL A N   1 
ATOM   178  C CA  A VAL A 1 22 ? 24.735  36.239 46.427  0.50 15.68 ? 245 VAL A CA  1 
ATOM   179  C CA  B VAL A 1 22 ? 24.783  36.421 46.332  0.50 16.01 ? 245 VAL A CA  1 
ATOM   180  C C   A VAL A 1 22 ? 23.581  36.334 45.439  0.50 15.04 ? 245 VAL A C   1 
ATOM   181  C C   B VAL A 1 22 ? 23.518  36.542 45.498  0.50 15.15 ? 245 VAL A C   1 
ATOM   182  O O   A VAL A 1 22 ? 22.520  35.827 45.727  0.50 14.12 ? 245 VAL A O   1 
ATOM   183  O O   B VAL A 1 22 ? 22.365  36.284 45.930  0.50 14.60 ? 245 VAL A O   1 
ATOM   184  C CB  A VAL A 1 22 ? 24.994  34.749 46.749  0.50 17.03 ? 245 VAL A CB  1 
ATOM   185  C CB  B VAL A 1 22 ? 25.326  34.996 46.357  0.50 16.88 ? 245 VAL A CB  1 
ATOM   186  C CG1 A VAL A 1 22 ? 25.195  33.945 45.499  0.50 18.31 ? 245 VAL A CG1 1 
ATOM   187  C CG1 B VAL A 1 22 ? 24.366  34.179 47.149  0.50 20.37 ? 245 VAL A CG1 1 
ATOM   188  C CG2 A VAL A 1 22 ? 26.206  34.620 47.629  0.50 17.85 ? 245 VAL A CG2 1 
ATOM   189  C CG2 B VAL A 1 22 ? 25.611  34.424 44.923  0.50 18.30 ? 245 VAL A CG2 1 
ATOM   190  N N   . LEU A 1 23 ? 23.779  37.002 44.290  1.00 13.86 ? 246 LEU A N   1 
ATOM   191  C CA  . LEU A 1 23 ? 22.794  37.088 43.224  1.00 14.11 ? 246 LEU A CA  1 
ATOM   192  C C   . LEU A 1 23 ? 23.372  36.401 42.007  1.00 14.01 ? 246 LEU A C   1 
ATOM   193  O O   . LEU A 1 23 ? 24.554  36.507 41.719  1.00 14.79 ? 246 LEU A O   1 
ATOM   194  C CB  . LEU A 1 23 ? 22.469  38.564 42.933  1.00 15.49 ? 246 LEU A CB  1 
ATOM   195  C CG  . LEU A 1 23 ? 21.655  39.261 43.998  1.00 15.72 ? 246 LEU A CG  1 
ATOM   196  C CD1 . LEU A 1 23 ? 21.626  40.776 43.750  1.00 19.20 ? 246 LEU A CD1 1 
ATOM   197  C CD2 . LEU A 1 23 ? 20.241  38.725 44.039  1.00 18.81 ? 246 LEU A CD2 1 
ATOM   198  N N   . GLN A 1 24 ? 22.526  35.670 41.286  1.00 13.71 ? 247 GLN A N   1 
ATOM   199  C CA  . GLN A 1 24 ? 22.981  34.944 40.125  1.00 13.28 ? 247 GLN A CA  1 
ATOM   200  C C   . GLN A 1 24 ? 21.988  35.119 38.979  1.00 13.05 ? 247 GLN A C   1 
ATOM   201  O O   . GLN A 1 24 ? 20.767  35.057 39.199  1.00 14.53 ? 247 GLN A O   1 
ATOM   202  C CB  . GLN A 1 24 ? 23.119  33.456 40.472  1.00 14.41 ? 247 GLN A CB  1 
ATOM   203  C CG  . GLN A 1 24 ? 23.779  32.608 39.325  1.00 16.33 ? 247 GLN A CG  1 
ATOM   204  C CD  . GLN A 1 24 ? 24.190  31.177 39.743  1.00 15.83 ? 247 GLN A CD  1 
ATOM   205  O OE1 . GLN A 1 24 ? 23.628  30.646 40.681  1.00 21.71 ? 247 GLN A OE1 1 
ATOM   206  N NE2 . GLN A 1 24 ? 25.151  30.606 39.098  1.00 16.42 ? 247 GLN A NE2 1 
ATOM   207  N N   . CYS A 1 25 ? 22.521  35.247 37.778  1.00 12.83 ? 248 CYS A N   1 
ATOM   208  C CA  . CYS A 1 25 ? 21.696  35.257 36.557  1.00 12.79 ? 248 CYS A CA  1 
ATOM   209  C C   . CYS A 1 25 ? 22.504  34.508 35.530  1.00 13.00 ? 248 CYS A C   1 
ATOM   210  O O   . CYS A 1 25 ? 23.663  34.810 35.326  1.00 14.02 ? 248 CYS A O   1 
ATOM   211  C CB  . CYS A 1 25 ? 21.438  36.726 36.157  1.00 14.18 ? 248 CYS A CB  1 
ATOM   212  S SG  . CYS A 1 25 ? 20.400  36.799 34.661  1.00 15.10 ? 248 CYS A SG  1 
ATOM   213  N N   . VAL A 1 26 ? 21.896  33.494 34.887  1.00 14.20 ? 249 VAL A N   1 
ATOM   214  C CA  . VAL A 1 26 ? 22.593  32.699 33.880  1.00 14.94 ? 249 VAL A CA  1 
ATOM   215  C C   . VAL A 1 26 ? 21.746  32.634 32.644  1.00 14.86 ? 249 VAL A C   1 
ATOM   216  O O   . VAL A 1 26 ? 20.549  32.344 32.742  1.00 15.95 ? 249 VAL A O   1 
ATOM   217  C CB  . VAL A 1 26 ? 22.873  31.263 34.347  1.00 16.81 ? 249 VAL A CB  1 
ATOM   218  C CG1 . VAL A 1 26 ? 23.721  30.503 33.281  1.00 19.10 ? 249 VAL A CG1 1 
ATOM   219  C CG2 . VAL A 1 26 ? 23.556  31.255 35.683  1.00 18.70 ? 249 VAL A CG2 1 
ATOM   220  N N   . ALA A 1 27 ? 22.331  32.916 31.501  1.00 15.15 ? 250 ALA A N   1 
ATOM   221  C CA  . ALA A 1 27 ? 21.647  32.858 30.235  1.00 15.62 ? 250 ALA A CA  1 
ATOM   222  C C   . ALA A 1 27 ? 22.391  31.929 29.300  1.00 15.30 ? 250 ALA A C   1 
ATOM   223  O O   . ALA A 1 27 ? 23.583  31.685 29.463  1.00 16.70 ? 250 ALA A O   1 
ATOM   224  C CB  . ALA A 1 27 ? 21.548  34.241 29.602  1.00 15.66 ? 250 ALA A CB  1 
ATOM   225  N N   . VAL A 1 28 ? 21.672  31.442 28.293  1.00 17.26 ? 251 VAL A N   1 
ATOM   226  C CA  . VAL A 1 28 ? 22.242  30.747 27.157  1.00 18.40 ? 251 VAL A CA  1 
ATOM   227  C C   . VAL A 1 28 ? 22.026  31.617 25.906  1.00 17.23 ? 251 VAL A C   1 
ATOM   228  O O   . VAL A 1 28 ? 21.265  32.571 25.914  1.00 17.19 ? 251 VAL A O   1 
ATOM   229  C CB  . VAL A 1 28 ? 21.586  29.339 26.968  1.00 20.61 ? 251 VAL A CB  1 
ATOM   230  C CG1 . VAL A 1 28 ? 21.836  28.434 28.184  1.00 25.47 ? 251 VAL A CG1 1 
ATOM   231  C CG2 . VAL A 1 28 ? 20.071  29.466 26.696  1.00 22.46 ? 251 VAL A CG2 1 
ATOM   232  N N   . GLY A 1 29 ? 22.747  31.300 24.851  1.00 19.33 ? 252 GLY A N   1 
ATOM   233  C CA  . GLY A 1 29 ? 22.581  31.995 23.590  1.00 18.58 ? 252 GLY A CA  1 
ATOM   234  C C   . GLY A 1 29 ? 23.870  31.998 22.823  1.00 17.09 ? 252 GLY A C   1 
ATOM   235  O O   . GLY A 1 29 ? 24.949  31.782 23.381  1.00 17.39 ? 252 GLY A O   1 
ATOM   236  N N   . SER A 1 30 ? 23.754  32.289 21.535  1.00 16.50 ? 253 SER A N   1 
ATOM   237  C CA  . SER A 1 30 ? 24.952  32.512 20.737  1.00 17.36 ? 253 SER A CA  1 
ATOM   238  C C   . SER A 1 30 ? 24.633  33.655 19.803  1.00 16.72 ? 253 SER A C   1 
ATOM   239  O O   . SER A 1 30 ? 23.632  33.540 19.049  1.00 18.79 ? 253 SER A O   1 
ATOM   240  C CB  . SER A 1 30 ? 25.258  31.236 19.925  1.00 18.43 ? 253 SER A CB  1 
ATOM   241  O OG  . SER A 1 30 ? 26.415  31.429 19.116  1.00 22.61 ? 253 SER A OG  1 
ATOM   242  N N   . PRO A 1 31 ? 25.484  34.697 19.759  1.00 16.79 ? 254 PRO A N   1 
ATOM   243  C CA  . PRO A 1 31 ? 26.729  34.822 20.527  1.00 16.34 ? 254 PRO A CA  1 
ATOM   244  C C   . PRO A 1 31 ? 26.531  34.755 22.036  1.00 14.18 ? 254 PRO A C   1 
ATOM   245  O O   . PRO A 1 31 ? 25.445  35.034 22.585  1.00 13.78 ? 254 PRO A O   1 
ATOM   246  C CB  . PRO A 1 31 ? 27.237  36.227 20.145  1.00 17.79 ? 254 PRO A CB  1 
ATOM   247  C CG  . PRO A 1 31 ? 26.633  36.446 18.771  1.00 18.07 ? 254 PRO A CG  1 
ATOM   248  C CD  . PRO A 1 31 ? 25.291  35.822 18.828  1.00 17.58 ? 254 PRO A CD  1 
ATOM   249  N N   . ILE A 1 32 ? 27.612  34.412 22.697  1.00 14.94 ? 255 ILE A N   1 
ATOM   250  C CA  . ILE A 1 32 ? 27.594  34.168 24.134  1.00 14.84 ? 255 ILE A CA  1 
ATOM   251  C C   . ILE A 1 32 ? 27.088  35.410 24.876  1.00 13.63 ? 255 ILE A C   1 
ATOM   252  O O   . ILE A 1 32 ? 27.550  36.506 24.634  1.00 15.87 ? 255 ILE A O   1 
ATOM   253  C CB  . ILE A 1 32 ? 28.978  33.794 24.624  1.00 15.55 ? 255 ILE A CB  1 
ATOM   254  C CG1 . ILE A 1 32 ? 29.480  32.518 24.010  1.00 19.06 ? 255 ILE A CG1 1 
ATOM   255  C CG2 . ILE A 1 32 ? 29.076  33.737 26.154  1.00 17.84 ? 255 ILE A CG2 1 
ATOM   256  C CD1 . ILE A 1 32 ? 30.981  32.469 24.055  1.00 20.30 ? 255 ILE A CD1 1 
ATOM   257  N N   . PRO A 1 33 ? 26.111  35.263 25.772  1.00 13.60 ? 256 PRO A N   1 
ATOM   258  C CA  . PRO A 1 33 ? 25.601  36.434 26.512  1.00 13.54 ? 256 PRO A CA  1 
ATOM   259  C C   . PRO A 1 33 ? 26.636  37.105 27.376  1.00 12.22 ? 256 PRO A C   1 
ATOM   260  O O   . PRO A 1 33 ? 27.490  36.448 27.989  1.00 14.66 ? 256 PRO A O   1 
ATOM   261  C CB  . PRO A 1 33 ? 24.463  35.871 27.344  1.00 15.54 ? 256 PRO A CB  1 
ATOM   262  C CG  . PRO A 1 33 ? 24.050  34.618 26.594  1.00 18.99 ? 256 PRO A CG  1 
ATOM   263  C CD  . PRO A 1 33 ? 25.301  34.067 26.020  1.00 16.26 ? 256 PRO A CD  1 
ATOM   264  N N   . HIS A 1 34 ? 26.494  38.422 27.471  1.00 12.09 ? 257 HIS A N   1 
ATOM   265  C CA  . HIS A 1 34 ? 27.163  39.277 28.427  1.00 12.80 ? 257 HIS A CA  1 
ATOM   266  C C   . HIS A 1 34 ? 26.150  39.741 29.472  1.00 11.37 ? 257 HIS A C   1 
ATOM   267  O O   . HIS A 1 34 ? 24.941  39.698 29.263  1.00 12.31 ? 257 HIS A O   1 
ATOM   268  C CB  . HIS A 1 34 ? 27.676  40.509 27.691  1.00 15.61 ? 257 HIS A CB  1 
ATOM   269  C CG  . HIS A 1 34 ? 28.737  40.211 26.707  1.00 20.00 ? 257 HIS A CG  1 
ATOM   270  N ND1 . HIS A 1 34 ? 28.490  39.893 25.387  1.00 24.54 ? 257 HIS A ND1 1 
ATOM   271  C CD2 . HIS A 1 34 ? 30.079  40.219 26.851  1.00 20.75 ? 257 HIS A CD2 1 
ATOM   272  C CE1 . HIS A 1 34 ? 29.642  39.727 24.759  1.00 24.31 ? 257 HIS A CE1 1 
ATOM   273  N NE2 . HIS A 1 34 ? 30.625  39.897 25.629  1.00 27.40 ? 257 HIS A NE2 1 
ATOM   274  N N   . TYR A 1 35 ? 26.727  40.197 30.588  1.00 12.27 ? 258 TYR A N   1 
ATOM   275  C CA  . TYR A 1 35 ? 25.921  40.519 31.785  1.00 11.45 ? 258 TYR A CA  1 
ATOM   276  C C   . TYR A 1 35 ? 26.356  41.888 32.311  1.00 12.61 ? 258 TYR A C   1 
ATOM   277  O O   . TYR A 1 35 ? 27.539  42.243 32.266  1.00 13.21 ? 258 TYR A O   1 
ATOM   278  C CB  . TYR A 1 35 ? 26.212  39.488 32.901  1.00 12.28 ? 258 TYR A CB  1 
ATOM   279  C CG  . TYR A 1 35 ? 25.852  38.073 32.493  1.00 11.84 ? 258 TYR A CG  1 
ATOM   280  C CD1 . TYR A 1 35 ? 24.597  37.536 32.750  1.00 12.43 ? 258 TYR A CD1 1 
ATOM   281  C CD2 . TYR A 1 35 ? 26.756  37.306 31.765  1.00 12.83 ? 258 TYR A CD2 1 
ATOM   282  C CE1 . TYR A 1 35 ? 24.273  36.268 32.305  1.00 12.99 ? 258 TYR A CE1 1 
ATOM   283  C CE2 . TYR A 1 35 ? 26.451  36.070 31.293  1.00 14.38 ? 258 TYR A CE2 1 
ATOM   284  C CZ  . TYR A 1 35 ? 25.190  35.534 31.560  1.00 12.48 ? 258 TYR A CZ  1 
ATOM   285  O OH  . TYR A 1 35 ? 24.873  34.269 31.073  1.00 14.77 ? 258 TYR A OH  1 
ATOM   286  N N   . GLN A 1 36 ? 25.402  42.593 32.906  1.00 11.83 ? 259 GLN A N   1 
ATOM   287  C CA  . GLN A 1 36 ? 25.741  43.804 33.661  1.00 11.67 ? 259 GLN A CA  1 
ATOM   288  C C   . GLN A 1 36 ? 24.685  43.961 34.766  1.00 12.23 ? 259 GLN A C   1 
ATOM   289  O O   . GLN A 1 36 ? 23.505  44.024 34.475  1.00 12.12 ? 259 GLN A O   1 
ATOM   290  C CB  . GLN A 1 36 ? 25.738  45.038 32.764  1.00 13.82 ? 259 GLN A CB  1 
ATOM   291  C CG  . GLN A 1 36 ? 25.941  46.380 33.571  1.00 14.85 ? 259 GLN A CG  1 
ATOM   292  C CD  . GLN A 1 36 ? 27.260  46.488 34.305  1.00 14.26 ? 259 GLN A CD  1 
ATOM   293  O OE1 . GLN A 1 36 ? 28.343  46.422 33.735  1.00 17.84 ? 259 GLN A OE1 1 
ATOM   294  N NE2 . GLN A 1 36 ? 27.168  46.634 35.608  1.00 16.68 ? 259 GLN A NE2 1 
ATOM   295  N N   . TRP A 1 37 ? 25.150  43.999 36.021  1.00 11.26 ? 260 TRP A N   1 
ATOM   296  C CA  . TRP A 1 37 ? 24.245  44.145 37.139  1.00 12.14 ? 260 TRP A CA  1 
ATOM   297  C C   . TRP A 1 37 ? 23.948  45.603 37.443  1.00 13.57 ? 260 TRP A C   1 
ATOM   298  O O   . TRP A 1 37 ? 24.775  46.498 37.245  1.00 14.37 ? 260 TRP A O   1 
ATOM   299  C CB  . TRP A 1 37 ? 24.870  43.522 38.403  1.00 13.01 ? 260 TRP A CB  1 
ATOM   300  C CG  . TRP A 1 37 ? 24.833  42.010 38.353  1.00 11.74 ? 260 TRP A CG  1 
ATOM   301  C CD1 . TRP A 1 37 ? 25.801  41.180 37.867  1.00 12.11 ? 260 TRP A CD1 1 
ATOM   302  C CD2 . TRP A 1 37 ? 23.748  41.180 38.736  1.00 12.19 ? 260 TRP A CD2 1 
ATOM   303  N NE1 . TRP A 1 37 ? 25.391  39.851 37.957  1.00 12.13 ? 260 TRP A NE1 1 
ATOM   304  C CE2 . TRP A 1 37 ? 24.128  39.846 38.471  1.00 11.26 ? 260 TRP A CE2 1 
ATOM   305  C CE3 . TRP A 1 37 ? 22.514  41.407 39.305  1.00 12.48 ? 260 TRP A CE3 1 
ATOM   306  C CZ2 . TRP A 1 37 ? 23.280  38.746 38.743  1.00 13.16 ? 260 TRP A CZ2 1 
ATOM   307  C CZ3 . TRP A 1 37 ? 21.674  40.325 39.550  1.00 13.43 ? 260 TRP A CZ3 1 
ATOM   308  C CH2 . TRP A 1 37 ? 22.044  39.018 39.260  1.00 13.08 ? 260 TRP A CH2 1 
ATOM   309  N N   . PHE A 1 38 ? 22.746  45.832 37.966  1.00 14.27 ? 261 PHE A N   1 
ATOM   310  C CA  . PHE A 1 38 ? 22.264  47.150 38.339  1.00 15.16 ? 261 PHE A CA  1 
ATOM   311  C C   . PHE A 1 38 ? 21.693  47.084 39.730  1.00 15.83 ? 261 PHE A C   1 
ATOM   312  O O   . PHE A 1 38 ? 21.137  46.077 40.140  1.00 15.98 ? 261 PHE A O   1 
ATOM   313  C CB  . PHE A 1 38 ? 21.179  47.615 37.370  1.00 16.37 ? 261 PHE A CB  1 
ATOM   314  C CG  . PHE A 1 38 ? 21.725  47.897 35.988  1.00 16.32 ? 261 PHE A CG  1 
ATOM   315  C CD1 . PHE A 1 38 ? 22.094  49.183 35.609  1.00 18.13 ? 261 PHE A CD1 1 
ATOM   316  C CD2 . PHE A 1 38 ? 21.918  46.864 35.070  1.00 15.27 ? 261 PHE A CD2 1 
ATOM   317  C CE1 . PHE A 1 38 ? 22.672  49.455 34.333  1.00 19.17 ? 261 PHE A CE1 1 
ATOM   318  C CE2 . PHE A 1 38 ? 22.474  47.128 33.813  1.00 17.14 ? 261 PHE A CE2 1 
ATOM   319  C CZ  . PHE A 1 38 ? 22.883  48.414 33.449  1.00 17.35 ? 261 PHE A CZ  1 
ATOM   320  N N   A LYS A 1 39 ? 21.884  48.158 40.477  0.50 18.17 ? 262 LYS A N   1 
ATOM   321  N N   B LYS A 1 39 ? 21.833  48.204 40.445  0.50 17.10 ? 262 LYS A N   1 
ATOM   322  C CA  A LYS A 1 39 ? 21.148  48.336 41.720  0.50 19.57 ? 262 LYS A CA  1 
ATOM   323  C CA  B LYS A 1 39 ? 21.319  48.399 41.816  0.50 17.91 ? 262 LYS A CA  1 
ATOM   324  C C   A LYS A 1 39 ? 20.585  49.751 41.691  0.50 20.61 ? 262 LYS A C   1 
ATOM   325  C C   B LYS A 1 39 ? 20.660  49.796 41.836  0.50 19.42 ? 262 LYS A C   1 
ATOM   326  O O   A LYS A 1 39 ? 21.251  50.698 41.299  0.50 21.15 ? 262 LYS A O   1 
ATOM   327  O O   B LYS A 1 39 ? 21.348  50.788 41.589  0.50 18.69 ? 262 LYS A O   1 
ATOM   328  C CB  A LYS A 1 39 ? 22.038  48.169 42.938  0.50 19.37 ? 262 LYS A CB  1 
ATOM   329  C CB  B LYS A 1 39 ? 22.489  48.374 42.807  0.50 16.88 ? 262 LYS A CB  1 
ATOM   330  C CG  A LYS A 1 39 ? 21.291  48.445 44.241  0.50 21.06 ? 262 LYS A CG  1 
ATOM   331  C CG  B LYS A 1 39 ? 22.112  48.742 44.242  0.50 17.79 ? 262 LYS A CG  1 
ATOM   332  C CD  A LYS A 1 39 ? 22.183  48.412 45.479  0.50 24.26 ? 262 LYS A CD  1 
ATOM   333  C CD  B LYS A 1 39 ? 23.341  49.004 45.122  0.50 19.44 ? 262 LYS A CD  1 
ATOM   334  C CE  A LYS A 1 39 ? 23.370  49.386 45.466  0.50 26.06 ? 262 LYS A CE  1 
ATOM   335  C CE  B LYS A 1 39 ? 23.052  49.046 46.625  0.50 20.04 ? 262 LYS A CE  1 
ATOM   336  N NZ  A LYS A 1 39 ? 24.457  48.953 46.434  0.50 26.78 ? 262 LYS A NZ  1 
ATOM   337  N NZ  B LYS A 1 39 ? 21.894  49.837 47.009  0.50 24.49 ? 262 LYS A NZ  1 
ATOM   338  N N   . ASN A 1 40 ? 19.359  49.881 42.164  1.00 22.44 ? 263 ASN A N   1 
ATOM   339  C CA  . ASN A 1 40 ? 18.691  51.221 42.288  1.00 23.36 ? 263 ASN A CA  1 
ATOM   340  C C   . ASN A 1 40 ? 18.997  52.089 41.064  1.00 24.47 ? 263 ASN A C   1 
ATOM   341  O O   . ASN A 1 40 ? 19.423  53.278 41.188  1.00 25.32 ? 263 ASN A O   1 
ATOM   342  C CB  . ASN A 1 40 ? 19.135  51.926 43.563  1.00 24.91 ? 263 ASN A CB  1 
ATOM   343  C CG  . ASN A 1 40 ? 18.771  51.165 44.818  1.00 25.66 ? 263 ASN A CG  1 
ATOM   344  O OD1 . ASN A 1 40 ? 17.889  50.321 44.802  1.00 27.06 ? 263 ASN A OD1 1 
ATOM   345  N ND2 . ASN A 1 40 ? 19.457  51.466 45.917  1.00 31.47 ? 263 ASN A ND2 1 
ATOM   346  N N   . GLU A 1 41 ? 18.802  51.472 39.902  1.00 25.42 ? 264 GLU A N   1 
ATOM   347  C CA  . GLU A 1 41 ? 18.825  52.117 38.569  1.00 25.55 ? 264 GLU A CA  1 
ATOM   348  C C   . GLU A 1 41 ? 20.212  52.486 38.080  1.00 25.64 ? 264 GLU A C   1 
ATOM   349  O O   . GLU A 1 41 ? 20.360  53.107 37.017  1.00 27.60 ? 264 GLU A O   1 
ATOM   350  C CB  . GLU A 1 41 ? 17.832  53.300 38.475  1.00 27.17 ? 264 GLU A CB  1 
ATOM   351  C CG  . GLU A 1 41 ? 16.421  52.872 38.801  1.00 29.21 ? 264 GLU A CG  1 
ATOM   352  C CD  . GLU A 1 41 ? 15.766  52.016 37.729  1.00 30.99 ? 264 GLU A CD  1 
ATOM   353  O OE1 . GLU A 1 41 ? 16.172  52.083 36.548  1.00 35.61 ? 264 GLU A OE1 1 
ATOM   354  O OE2 . GLU A 1 41 ? 14.791  51.307 38.043  1.00 34.68 ? 264 GLU A OE2 1 
ATOM   355  N N   . LEU A 1 42 ? 21.233  52.125 38.821  1.00 21.50 ? 265 LEU A N   1 
ATOM   356  C CA  . LEU A 1 42 ? 22.604  52.469 38.478  1.00 21.29 ? 265 LEU A CA  1 
ATOM   357  C C   . LEU A 1 42 ? 23.431  51.196 38.215  1.00 19.90 ? 265 LEU A C   1 
ATOM   358  O O   . LEU A 1 42 ? 23.297  50.206 38.944  1.00 18.66 ? 265 LEU A O   1 
ATOM   359  C CB  . LEU A 1 42 ? 23.224  53.261 39.629  1.00 22.76 ? 265 LEU A CB  1 
ATOM   360  C CG  . LEU A 1 42 ? 22.486  54.511 40.133  1.00 26.20 ? 265 LEU A CG  1 
ATOM   361  C CD1 . LEU A 1 42 ? 23.075  55.064 41.430  1.00 28.55 ? 265 LEU A CD1 1 
ATOM   362  C CD2 . LEU A 1 42 ? 22.526  55.536 39.044  1.00 30.45 ? 265 LEU A CD2 1 
ATOM   363  N N   . PRO A 1 43 ? 24.345  51.229 37.224  1.00 19.77 ? 266 PRO A N   1 
ATOM   364  C CA  . PRO A 1 43 ? 25.154  50.024 37.007  1.00 19.68 ? 266 PRO A CA  1 
ATOM   365  C C   . PRO A 1 43 ? 26.094  49.814 38.162  1.00 19.26 ? 266 PRO A C   1 
ATOM   366  O O   . PRO A 1 43 ? 26.649  50.805 38.676  1.00 21.12 ? 266 PRO A O   1 
ATOM   367  C CB  . PRO A 1 43 ? 25.944  50.355 35.727  1.00 20.93 ? 266 PRO A CB  1 
ATOM   368  C CG  . PRO A 1 43 ? 25.874  51.843 35.602  1.00 22.25 ? 266 PRO A CG  1 
ATOM   369  C CD  . PRO A 1 43 ? 24.586  52.281 36.245  1.00 20.28 ? 266 PRO A CD  1 
ATOM   370  N N   . LEU A 1 44 ? 26.293  48.596 38.585  1.00 17.61 ? 267 LEU A N   1 
ATOM   371  C CA  . LEU A 1 44 ? 27.298  48.247 39.563  1.00 18.12 ? 267 LEU A CA  1 
ATOM   372  C C   . LEU A 1 44 ? 28.590  48.067 38.796  1.00 19.69 ? 267 LEU A C   1 
ATOM   373  O O   . LEU A 1 44 ? 28.715  47.091 38.013  1.00 18.93 ? 267 LEU A O   1 
ATOM   374  C CB  . LEU A 1 44 ? 26.973  46.958 40.276  1.00 17.73 ? 267 LEU A CB  1 
ATOM   375  C CG  . LEU A 1 44 ? 25.824  47.125 41.250  1.00 17.22 ? 267 LEU A CG  1 
ATOM   376  C CD1 . LEU A 1 44 ? 25.163  45.804 41.587  1.00 18.23 ? 267 LEU A CD1 1 
ATOM   377  C CD2 . LEU A 1 44 ? 26.368  47.756 42.500  1.00 20.70 ? 267 LEU A CD2 1 
ATOM   378  N N   A THR A 1 45 ? 29.526  48.984 39.011  0.50 20.47 ? 268 THR A N   1 
ATOM   379  N N   B THR A 1 45 ? 29.570  48.974 39.035  0.50 21.71 ? 268 THR A N   1 
ATOM   380  C CA  A THR A 1 45 ? 30.724  48.963 38.230  0.50 21.69 ? 268 THR A CA  1 
ATOM   381  C CA  B THR A 1 45 ? 30.861  49.016 38.294  0.50 24.31 ? 268 THR A CA  1 
ATOM   382  C C   A THR A 1 45 ? 31.477  47.638 38.345  0.50 21.89 ? 268 THR A C   1 
ATOM   383  C C   B THR A 1 45 ? 31.737  47.784 38.360  0.50 24.32 ? 268 THR A C   1 
ATOM   384  O O   A THR A 1 45 ? 31.578  47.020 39.428  0.50 28.58 ? 268 THR A O   1 
ATOM   385  O O   B THR A 1 45 ? 32.338  47.483 39.426  0.50 27.63 ? 268 THR A O   1 
ATOM   386  C CB  A THR A 1 45 ? 31.575  50.188 38.561  0.50 23.19 ? 268 THR A CB  1 
ATOM   387  C CB  B THR A 1 45 ? 31.845  50.156 38.764  0.50 25.21 ? 268 THR A CB  1 
ATOM   388  O OG1 A THR A 1 45 ? 30.702  51.319 38.587  0.50 25.97 ? 268 THR A OG1 1 
ATOM   389  O OG1 B THR A 1 45 ? 32.201  49.980 40.140  0.50 26.94 ? 268 THR A OG1 1 
ATOM   390  C CG2 A THR A 1 45 ? 32.601  50.391 37.487  0.50 20.88 ? 268 THR A CG2 1 
ATOM   391  C CG2 B THR A 1 45 ? 31.287  51.515 38.547  0.50 26.71 ? 268 THR A CG2 1 
ATOM   392  N N   . HIS A 1 46 ? 31.886  47.140 37.185  1.00 23.21 ? 269 HIS A N   1 
ATOM   393  C CA  . HIS A 1 46 ? 32.631  45.916 37.031  1.00 21.99 ? 269 HIS A CA  1 
ATOM   394  C C   . HIS A 1 46 ? 31.836  44.689 37.521  1.00 20.14 ? 269 HIS A C   1 
ATOM   395  O O   . HIS A 1 46 ? 32.472  43.701 37.860  1.00 31.32 ? 269 HIS A O   1 
ATOM   396  C CB  . HIS A 1 46 ? 34.104  46.025 37.570  1.00 24.40 ? 269 HIS A CB  1 
ATOM   397  N N   . GLU A 1 47 ? 30.545  44.773 37.532  1.00 20.70 ? 270 GLU A N   1 
ATOM   398  C CA  . GLU A 1 47 ? 29.859  43.580 37.871  1.00 16.36 ? 270 GLU A CA  1 
ATOM   399  C C   . GLU A 1 47 ? 29.193  43.079 36.608  1.00 12.75 ? 270 GLU A C   1 
ATOM   400  O O   . GLU A 1 47 ? 28.056  43.378 36.316  1.00 14.74 ? 270 GLU A O   1 
ATOM   401  C CB  . GLU A 1 47 ? 28.891  43.845 39.002  1.00 14.18 ? 270 GLU A CB  1 
ATOM   402  C CG  . GLU A 1 47 ? 29.569  44.247 40.286  1.00 15.98 ? 270 GLU A CG  1 
ATOM   403  C CD  . GLU A 1 47 ? 30.478  43.210 40.889  1.00 16.37 ? 270 GLU A CD  1 
ATOM   404  O OE1 . GLU A 1 47 ? 30.454  42.054 40.508  1.00 16.42 ? 270 GLU A OE1 1 
ATOM   405  O OE2 . GLU A 1 47 ? 31.259  43.606 41.827  1.00 21.04 ? 270 GLU A OE2 1 
ATOM   406  N N   . THR A 1 48 ? 30.002  42.296 35.891  1.00 14.31 ? 271 THR A N   1 
ATOM   407  C CA  . THR A 1 48 ? 29.654  41.816 34.549  1.00 15.04 ? 271 THR A CA  1 
ATOM   408  C C   . THR A 1 48 ? 29.696  40.305 34.501  1.00 13.72 ? 271 THR A C   1 
ATOM   409  O O   . THR A 1 48 ? 29.860  39.713 33.441  1.00 15.72 ? 271 THR A O   1 
ATOM   410  C CB  . THR A 1 48 ? 30.591  42.406 33.490  1.00 17.13 ? 271 THR A CB  1 
ATOM   411  O OG1 . THR A 1 48 ? 31.928  42.043 33.815  1.00 17.61 ? 271 THR A OG1 1 
ATOM   412  C CG2 . THR A 1 48 ? 30.456  43.889 33.415  1.00 18.14 ? 271 THR A CG2 1 
ATOM   413  N N   A LYS A 1 49 ? 29.546  39.676 35.655  0.70 14.44 ? 272 LYS A N   1 
ATOM   414  N N   B LYS A 1 49 ? 29.580  39.658 35.650  0.30 15.13 ? 272 LYS A N   1 
ATOM   415  C CA  A LYS A 1 49 ? 29.576  38.226 35.784  0.70 14.78 ? 272 LYS A CA  1 
ATOM   416  C CA  B LYS A 1 49 ? 29.596  38.201 35.689  0.30 15.71 ? 272 LYS A CA  1 
ATOM   417  C C   A LYS A 1 49 ? 28.198  37.683 36.140  0.70 13.57 ? 272 LYS A C   1 
ATOM   418  C C   B LYS A 1 49 ? 28.248  37.665 36.162  0.30 14.56 ? 272 LYS A C   1 
ATOM   419  O O   A LYS A 1 49 ? 27.337  38.437 36.563  0.70 13.02 ? 272 LYS A O   1 
ATOM   420  O O   B LYS A 1 49 ? 27.449  38.407 36.730  0.30 14.97 ? 272 LYS A O   1 
ATOM   421  C CB  A LYS A 1 49 ? 30.602  37.802 36.848  0.70 16.09 ? 272 LYS A CB  1 
ATOM   422  C CB  B LYS A 1 49 ? 30.742  37.686 36.571  0.30 16.21 ? 272 LYS A CB  1 
ATOM   423  C CG  A LYS A 1 49 ? 31.994  38.224 36.566  0.70 21.14 ? 272 LYS A CG  1 
ATOM   424  C CG  B LYS A 1 49 ? 32.139  38.060 36.091  0.30 18.44 ? 272 LYS A CG  1 
ATOM   425  C CD  A LYS A 1 49 ? 32.526  37.528 35.309  0.70 23.87 ? 272 LYS A CD  1 
ATOM   426  C CD  B LYS A 1 49 ? 33.169  37.580 37.101  0.30 17.35 ? 272 LYS A CD  1 
ATOM   427  C CE  A LYS A 1 49 ? 34.020  37.805 35.123  0.70 25.19 ? 272 LYS A CE  1 
ATOM   428  C CE  B LYS A 1 49 ? 34.558  38.115 36.778  0.30 21.51 ? 272 LYS A CE  1 
ATOM   429  N NZ  A LYS A 1 49 ? 34.851  37.148 36.183  0.70 28.22 ? 272 LYS A NZ  1 
ATOM   430  N NZ  B LYS A 1 49 ? 35.025  37.733 35.411  0.30 22.15 ? 272 LYS A NZ  1 
ATOM   431  N N   . LYS A 1 50 ? 28.012  36.377 35.899  1.00 14.34 ? 273 LYS A N   1 
ATOM   432  C CA  . LYS A 1 50 ? 26.760  35.726 36.235  1.00 14.43 ? 273 LYS A CA  1 
ATOM   433  C C   . LYS A 1 50 ? 26.458  35.836 37.739  1.00 13.53 ? 273 LYS A C   1 
ATOM   434  O O   . LYS A 1 50 ? 25.288  35.896 38.124  1.00 15.16 ? 273 LYS A O   1 
ATOM   435  C CB  . LYS A 1 50 ? 26.823  34.243 35.837  1.00 15.81 ? 273 LYS A CB  1 
ATOM   436  C CG  . LYS A 1 50 ? 26.862  34.044 34.348  1.00 17.00 ? 273 LYS A CG  1 
ATOM   437  C CD  . LYS A 1 50 ? 27.137  32.568 34.011  1.00 21.10 ? 273 LYS A CD  1 
ATOM   438  C CE  . LYS A 1 50 ? 27.096  32.269 32.515  1.00 24.96 ? 273 LYS A CE  1 
ATOM   439  N NZ  . LYS A 1 50 ? 27.476  30.849 32.247  1.00 29.85 ? 273 LYS A NZ  1 
ATOM   440  N N   . LEU A 1 51 ? 27.510  35.862 38.577  1.00 14.73 ? 274 LEU A N   1 
ATOM   441  C CA  . LEU A 1 51 ? 27.360  36.039 40.003  1.00 14.98 ? 274 LEU A CA  1 
ATOM   442  C C   . LEU A 1 51 ? 27.697  37.453 40.431  1.00 14.88 ? 274 LEU A C   1 
ATOM   443  O O   . LEU A 1 51 ? 28.690  38.029 39.960  1.00 15.86 ? 274 LEU A O   1 
ATOM   444  C CB  . LEU A 1 51 ? 28.322  35.115 40.750  1.00 17.83 ? 274 LEU A CB  1 
ATOM   445  C CG  . LEU A 1 51 ? 27.989  33.656 40.677  1.00 18.46 ? 274 LEU A CG  1 
ATOM   446  C CD1 . LEU A 1 51 ? 29.109  32.886 41.368  1.00 22.23 ? 274 LEU A CD1 1 
ATOM   447  C CD2 . LEU A 1 51 ? 26.647  33.364 41.386  1.00 22.23 ? 274 LEU A CD2 1 
ATOM   448  N N   . TYR A 1 52 ? 26.907  37.991 41.338  1.00 15.00 ? 275 TYR A N   1 
ATOM   449  C CA  . TYR A 1 52 ? 27.246  39.240 42.043  1.00 15.46 ? 275 TYR A CA  1 
ATOM   450  C C   . TYR A 1 52 ? 27.260  38.857 43.515  1.00 15.71 ? 275 TYR A C   1 
ATOM   451  O O   . TYR A 1 52 ? 26.261  38.349 44.035  1.00 15.20 ? 275 TYR A O   1 
ATOM   452  C CB  . TYR A 1 52 ? 26.225  40.350 41.779  1.00 16.44 ? 275 TYR A CB  1 
ATOM   453  C CG  . TYR A 1 52 ? 26.453  41.546 42.643  1.00 16.97 ? 275 TYR A CG  1 
ATOM   454  C CD1 . TYR A 1 52 ? 27.630  42.265 42.544  1.00 18.26 ? 275 TYR A CD1 1 
ATOM   455  C CD2 . TYR A 1 52 ? 25.560  41.951 43.606  1.00 16.29 ? 275 TYR A CD2 1 
ATOM   456  C CE1 . TYR A 1 52 ? 27.891  43.375 43.359  1.00 17.44 ? 275 TYR A CE1 1 
ATOM   457  C CE2 . TYR A 1 52 ? 25.783  43.035 44.412  1.00 17.11 ? 275 TYR A CE2 1 
ATOM   458  C CZ  . TYR A 1 52 ? 26.947  43.759 44.293  1.00 15.88 ? 275 TYR A CZ  1 
ATOM   459  O OH  . TYR A 1 52 ? 27.195  44.842 45.108  1.00 17.86 ? 275 TYR A OH  1 
ATOM   460  N N   A MET A 1 53 ? 28.383  39.179 44.161  0.25 16.18 ? 276 MET A N   1 
ATOM   461  N N   B MET A 1 53 ? 28.382  39.148 44.167  0.25 15.45 ? 276 MET A N   1 
ATOM   462  N N   C MET A 1 53 ? 28.391  39.056 44.210  0.50 16.59 ? 276 MET A N   1 
ATOM   463  C CA  A MET A 1 53 ? 28.713  38.706 45.497  0.25 17.79 ? 276 MET A CA  1 
ATOM   464  C CA  B MET A 1 53 ? 28.608  38.707 45.526  0.25 15.84 ? 276 MET A CA  1 
ATOM   465  C CA  C MET A 1 53 ? 28.469  38.603 45.616  0.50 18.83 ? 276 MET A CA  1 
ATOM   466  C C   A MET A 1 53 ? 29.128  39.886 46.386  0.25 16.39 ? 276 MET A C   1 
ATOM   467  C C   B MET A 1 53 ? 29.083  39.886 46.372  0.25 15.60 ? 276 MET A C   1 
ATOM   468  C C   C MET A 1 53 ? 29.197  39.609 46.463  0.50 17.12 ? 276 MET A C   1 
ATOM   469  O O   A MET A 1 53 ? 29.919  40.754 45.972  0.25 17.34 ? 276 MET A O   1 
ATOM   470  O O   B MET A 1 53 ? 29.871  40.736 45.921  0.25 16.48 ? 276 MET A O   1 
ATOM   471  O O   C MET A 1 53 ? 30.284  40.032 46.100  0.50 18.39 ? 276 MET A O   1 
ATOM   472  C CB  A MET A 1 53 ? 29.862  37.680 45.402  0.25 17.76 ? 276 MET A CB  1 
ATOM   473  C CB  B MET A 1 53 ? 29.656  37.581 45.534  0.25 16.57 ? 276 MET A CB  1 
ATOM   474  C CB  C MET A 1 53 ? 29.222  37.282 45.732  0.50 19.75 ? 276 MET A CB  1 
ATOM   475  C CG  A MET A 1 53 ? 29.406  36.321 44.833  0.25 19.20 ? 276 MET A CG  1 
ATOM   476  C CG  B MET A 1 53 ? 29.752  36.851 46.862  0.25 15.95 ? 276 MET A CG  1 
ATOM   477  C CG  C MET A 1 53 ? 28.565  36.178 45.023  0.50 21.83 ? 276 MET A CG  1 
ATOM   478  S SD  A MET A 1 53 ? 30.689  35.078 44.531  0.25 22.58 ? 276 MET A SD  1 
ATOM   479  S SD  B MET A 1 53 ? 30.895  37.709 47.966  0.25 18.69 ? 276 MET A SD  1 
ATOM   480  S SD  C MET A 1 53 ? 29.596  34.744 44.963  0.50 28.10 ? 276 MET A SD  1 
ATOM   481  C CE  A MET A 1 53 ? 31.468  35.724 43.058  0.25 23.64 ? 276 MET A CE  1 
ATOM   482  C CE  B MET A 1 53 ? 32.500  37.107 47.431  0.25 19.05 ? 276 MET A CE  1 
ATOM   483  C CE  C MET A 1 53 ? 29.144  34.067 46.550  0.50 22.04 ? 276 MET A CE  1 
ATOM   484  N N   . VAL A 1 54 ? 28.573  39.925 47.596  1.00 15.78 ? 277 VAL A N   1 
ATOM   485  C CA  . VAL A 1 54 ? 29.079  40.863 48.595  1.00 15.03 ? 277 VAL A CA  1 
ATOM   486  C C   . VAL A 1 54 ? 29.244  40.064 49.888  1.00 15.88 ? 277 VAL A C   1 
ATOM   487  O O   . VAL A 1 54 ? 28.275  39.565 50.443  1.00 16.11 ? 277 VAL A O   1 
ATOM   488  C CB  . VAL A 1 54 ? 28.115  42.036 48.841  1.00 16.46 ? 277 VAL A CB  1 
ATOM   489  C CG1 . VAL A 1 54 ? 28.617  42.949 49.976  1.00 18.83 ? 277 VAL A CG1 1 
ATOM   490  C CG2 . VAL A 1 54 ? 27.858  42.817 47.565  1.00 19.44 ? 277 VAL A CG2 1 
ATOM   491  N N   . PRO A 1 55 ? 30.475  39.941 50.389  1.00 17.93 ? 278 PRO A N   1 
ATOM   492  C CA  . PRO A 1 55 ? 30.686  39.009 51.479  1.00 20.94 ? 278 PRO A CA  1 
ATOM   493  C C   . PRO A 1 55 ? 30.081  39.285 52.778  1.00 21.73 ? 278 PRO A C   1 
ATOM   494  O O   . PRO A 1 55 ? 29.593  38.376 53.438  1.00 22.79 ? 278 PRO A O   1 
ATOM   495  C CB  . PRO A 1 55 ? 32.208  38.916 51.620  1.00 22.55 ? 278 PRO A CB  1 
ATOM   496  C CG  . PRO A 1 55 ? 32.757  40.110 50.948  1.00 21.79 ? 278 PRO A CG  1 
ATOM   497  C CD  . PRO A 1 55 ? 31.748  40.504 49.871  1.00 18.92 ? 278 PRO A CD  1 
ATOM   498  N N   . TYR A 1 56 ? 30.091  40.541 53.187  1.00 20.18 ? 279 TYR A N   1 
ATOM   499  C CA  . TYR A 1 56 ? 29.605  40.949 54.502  1.00 22.19 ? 279 TYR A CA  1 
ATOM   500  C C   . TYR A 1 56 ? 28.742  42.159 54.178  1.00 21.43 ? 279 TYR A C   1 
ATOM   501  O O   . TYR A 1 56 ? 29.265  43.255 53.857  1.00 23.13 ? 279 TYR A O   1 
ATOM   502  C CB  . TYR A 1 56 ? 30.758  41.476 55.417  1.00 25.45 ? 279 TYR A CB  1 
ATOM   503  C CG  . TYR A 1 56 ? 31.834  40.466 55.787  1.00 27.63 ? 279 TYR A CG  1 
ATOM   504  C CD1 . TYR A 1 56 ? 31.672  39.605 56.874  1.00 31.49 ? 279 TYR A CD1 1 
ATOM   505  C CD2 . TYR A 1 56 ? 33.006  40.392 55.054  1.00 27.81 ? 279 TYR A CD2 1 
ATOM   506  C CE1 . TYR A 1 56 ? 32.675  38.672 57.201  1.00 33.03 ? 279 TYR A CE1 1 
ATOM   507  C CE2 . TYR A 1 56 ? 33.976  39.462 55.343  1.00 30.25 ? 279 TYR A CE2 1 
ATOM   508  C CZ  . TYR A 1 56 ? 33.820  38.624 56.414  1.00 31.66 ? 279 TYR A CZ  1 
ATOM   509  O OH  . TYR A 1 56 ? 34.824  37.714 56.672  1.00 33.97 ? 279 TYR A OH  1 
ATOM   510  N N   . VAL A 1 57 ? 27.446  42.011 54.214  1.00 17.90 ? 280 VAL A N   1 
ATOM   511  C CA  . VAL A 1 57 ? 26.547  43.096 53.845  1.00 19.12 ? 280 VAL A CA  1 
ATOM   512  C C   . VAL A 1 57 ? 26.265  44.046 54.978  1.00 19.63 ? 280 VAL A C   1 
ATOM   513  O O   . VAL A 1 57 ? 26.420  43.743 56.172  1.00 19.14 ? 280 VAL A O   1 
ATOM   514  C CB  . VAL A 1 57 ? 25.217  42.598 53.331  1.00 18.78 ? 280 VAL A CB  1 
ATOM   515  C CG1 . VAL A 1 57 ? 25.367  41.774 52.101  1.00 19.86 ? 280 VAL A CG1 1 
ATOM   516  C CG2 . VAL A 1 57 ? 24.396  41.821 54.387  1.00 19.04 ? 280 VAL A CG2 1 
ATOM   517  N N   . ASP A 1 58 ? 25.871  45.249 54.575  1.00 21.01 ? 281 ASP A N   1 
ATOM   518  C CA  . ASP A 1 58 ? 25.337  46.210 55.540  1.00 22.96 ? 281 ASP A CA  1 
ATOM   519  C C   . ASP A 1 58 ? 24.203  46.940 54.872  1.00 21.57 ? 281 ASP A C   1 
ATOM   520  O O   . ASP A 1 58 ? 23.802  46.597 53.747  1.00 20.86 ? 281 ASP A O   1 
ATOM   521  C CB  . ASP A 1 58 ? 26.428  47.139 56.091  1.00 24.99 ? 281 ASP A CB  1 
ATOM   522  C CG  . ASP A 1 58 ? 26.191  47.510 57.550  1.00 29.85 ? 281 ASP A CG  1 
ATOM   523  O OD1 . ASP A 1 58 ? 25.022  47.568 58.036  1.00 33.95 ? 281 ASP A OD1 1 
ATOM   524  O OD2 . ASP A 1 58 ? 27.213  47.726 58.239  1.00 34.29 ? 281 ASP A OD2 1 
ATOM   525  N N   . LEU A 1 59 ? 23.668  47.964 55.537  1.00 21.73 ? 282 LEU A N   1 
ATOM   526  C CA  . LEU A 1 59 ? 22.432  48.585 55.038  1.00 21.21 ? 282 LEU A CA  1 
ATOM   527  C C   . LEU A 1 59 ? 22.619  49.179 53.651  1.00 21.14 ? 282 LEU A C   1 
ATOM   528  O O   . LEU A 1 59 ? 21.660  49.287 52.888  1.00 21.86 ? 282 LEU A O   1 
ATOM   529  C CB  . LEU A 1 59 ? 21.921  49.664 56.016  1.00 22.77 ? 282 LEU A CB  1 
ATOM   530  C CG  . LEU A 1 59 ? 21.655  49.172 57.444  1.00 25.80 ? 282 LEU A CG  1 
ATOM   531  C CD1 . LEU A 1 59 ? 21.109  50.334 58.265  1.00 29.05 ? 282 LEU A CD1 1 
ATOM   532  C CD2 . LEU A 1 59 ? 20.701  47.991 57.473  1.00 28.55 ? 282 LEU A CD2 1 
ATOM   533  N N   . GLU A 1 60 ? 23.849  49.573 53.330  1.00 20.69 ? 283 GLU A N   1 
ATOM   534  C CA  . GLU A 1 60 ? 24.110  50.157 52.016  1.00 22.31 ? 283 GLU A CA  1 
ATOM   535  C C   . GLU A 1 60 ? 23.819  49.186 50.875  1.00 21.36 ? 283 GLU A C   1 
ATOM   536  O O   . GLU A 1 60 ? 23.613  49.600 49.736  1.00 22.82 ? 283 GLU A O   1 
ATOM   537  C CB  . GLU A 1 60 ? 25.551  50.659 51.888  1.00 24.09 ? 283 GLU A CB  1 
ATOM   538  C CG  . GLU A 1 60 ? 26.592  49.550 51.954  1.00 28.56 ? 283 GLU A CG  1 
ATOM   539  C CD  . GLU A 1 60 ? 27.982  50.019 51.560  1.00 35.42 ? 283 GLU A CD  1 
ATOM   540  O OE1 . GLU A 1 60 ? 28.131  50.654 50.500  1.00 38.88 ? 283 GLU A OE1 1 
ATOM   541  O OE2 . GLU A 1 60 ? 28.929  49.751 52.315  1.00 38.78 ? 283 GLU A OE2 1 
ATOM   542  N N   . HIS A 1 61 ? 23.790  47.884 51.165  1.00 18.73 ? 284 HIS A N   1 
ATOM   543  C CA  . HIS A 1 61 ? 23.529  46.904 50.096  1.00 18.03 ? 284 HIS A CA  1 
ATOM   544  C C   . HIS A 1 61 ? 22.047  46.614 49.893  1.00 19.02 ? 284 HIS A C   1 
ATOM   545  O O   . HIS A 1 61 ? 21.690  45.860 48.978  1.00 19.72 ? 284 HIS A O   1 
ATOM   546  C CB  . HIS A 1 61 ? 24.265  45.621 50.412  1.00 17.93 ? 284 HIS A CB  1 
ATOM   547  C CG  . HIS A 1 61 ? 25.716  45.830 50.625  1.00 18.47 ? 284 HIS A CG  1 
ATOM   548  N ND1 . HIS A 1 61 ? 26.615  46.123 49.614  1.00 22.14 ? 284 HIS A ND1 1 
ATOM   549  C CD2 . HIS A 1 61 ? 26.408  45.833 51.777  1.00 17.36 ? 284 HIS A CD2 1 
ATOM   550  C CE1 . HIS A 1 61 ? 27.805  46.313 50.156  1.00 21.29 ? 284 HIS A CE1 1 
ATOM   551  N NE2 . HIS A 1 61 ? 27.705  46.133 51.459  1.00 22.73 ? 284 HIS A NE2 1 
ATOM   552  N N   . GLN A 1 62 ? 21.161  47.214 50.698  1.00 19.51 ? 285 GLN A N   1 
ATOM   553  C CA  . GLN A 1 62 ? 19.736  47.044 50.492  1.00 20.33 ? 285 GLN A CA  1 
ATOM   554  C C   . GLN A 1 62 ? 19.366  47.709 49.173  1.00 21.20 ? 285 GLN A C   1 
ATOM   555  O O   . GLN A 1 62 ? 19.939  48.743 48.802  1.00 24.18 ? 285 GLN A O   1 
ATOM   556  C CB  . GLN A 1 62 ? 18.976  47.725 51.625  1.00 21.63 ? 285 GLN A CB  1 
ATOM   557  C CG  . GLN A 1 62 ? 17.471  47.502 51.642  1.00 25.91 ? 285 GLN A CG  1 
ATOM   558  C CD  . GLN A 1 62 ? 16.901  47.751 53.030  1.00 27.73 ? 285 GLN A CD  1 
ATOM   559  O OE1 . GLN A 1 62 ? 16.556  46.819 53.766  1.00 26.89 ? 285 GLN A OE1 1 
ATOM   560  N NE2 . GLN A 1 62 ? 16.820  49.022 53.403  1.00 31.95 ? 285 GLN A NE2 1 
ATOM   561  N N   . GLY A 1 63 ? 18.445  47.112 48.442  1.00 19.72 ? 286 GLY A N   1 
ATOM   562  C CA  . GLY A 1 63 ? 17.972  47.775 47.229  1.00 20.75 ? 286 GLY A CA  1 
ATOM   563  C C   . GLY A 1 63 ? 17.342  46.789 46.289  1.00 20.61 ? 286 GLY A C   1 
ATOM   564  O O   . GLY A 1 63 ? 17.126  45.600 46.616  1.00 21.42 ? 286 GLY A O   1 
ATOM   565  N N   . THR A 1 64 ? 17.057  47.314 45.089  1.00 19.98 ? 287 THR A N   1 
ATOM   566  C CA  . THR A 1 64 ? 16.386  46.553 44.074  1.00 18.34 ? 287 THR A CA  1 
ATOM   567  C C   . THR A 1 64 ? 17.444  46.287 43.005  1.00 17.77 ? 287 THR A C   1 
ATOM   568  O O   . THR A 1 64 ? 18.057  47.254 42.547  1.00 22.92 ? 287 THR A O   1 
ATOM   569  C CB  . THR A 1 64 ? 15.198  47.343 43.451  1.00 27.77 ? 287 THR A CB  1 
ATOM   570  O OG1 . THR A 1 64 ? 14.295  47.671 44.500  1.00 32.73 ? 287 THR A OG1 1 
ATOM   571  C CG2 . THR A 1 64 ? 14.539  46.432 42.436  1.00 26.56 ? 287 THR A CG2 1 
ATOM   572  N N   . TYR A 1 65 ? 17.642  45.009 42.648  1.00 18.84 ? 288 TYR A N   1 
ATOM   573  C CA  . TYR A 1 65 ? 18.727  44.613 41.701  1.00 18.00 ? 288 TYR A CA  1 
ATOM   574  C C   . TYR A 1 65 ? 18.150  43.909 40.514  1.00 18.24 ? 288 TYR A C   1 
ATOM   575  O O   . TYR A 1 65 ? 17.114  43.267 40.581  1.00 18.64 ? 288 TYR A O   1 
ATOM   576  C CB  . TYR A 1 65 ? 19.677  43.630 42.369  1.00 16.59 ? 288 TYR A CB  1 
ATOM   577  C CG  . TYR A 1 65 ? 20.509  44.169 43.538  1.00 15.39 ? 288 TYR A CG  1 
ATOM   578  C CD1 . TYR A 1 65 ? 21.873  44.437 43.377  1.00 15.01 ? 288 TYR A CD1 1 
ATOM   579  C CD2 . TYR A 1 65 ? 19.933  44.407 44.792  1.00 16.01 ? 288 TYR A CD2 1 
ATOM   580  C CE1 . TYR A 1 65 ? 22.663  44.902 44.421  1.00 17.07 ? 288 TYR A CE1 1 
ATOM   581  C CE2 . TYR A 1 65 ? 20.737  44.879 45.840  1.00 15.27 ? 288 TYR A CE2 1 
ATOM   582  C CZ  . TYR A 1 65 ? 22.065  45.099 45.652  1.00 16.70 ? 288 TYR A CZ  1 
ATOM   583  O OH  . TYR A 1 65 ? 22.865  45.520 46.684  1.00 18.43 ? 288 TYR A OH  1 
ATOM   584  N N   . TRP A 1 66 ? 18.877  43.985 39.407  1.00 17.28 ? 289 TRP A N   1 
ATOM   585  C CA  . TRP A 1 66 ? 18.566  43.172 38.235  1.00 16.01 ? 289 TRP A CA  1 
ATOM   586  C C   . TRP A 1 66 ? 19.818  43.135 37.361  1.00 13.63 ? 289 TRP A C   1 
ATOM   587  O O   . TRP A 1 66 ? 20.767  43.872 37.588  1.00 14.43 ? 289 TRP A O   1 
ATOM   588  C CB  . TRP A 1 66 ? 17.404  43.749 37.439  1.00 19.22 ? 289 TRP A CB  1 
ATOM   589  C CG  . TRP A 1 66 ? 17.594  45.167 37.225  1.00 22.17 ? 289 TRP A CG  1 
ATOM   590  C CD1 . TRP A 1 66 ? 17.381  46.219 38.147  1.00 24.52 ? 289 TRP A CD1 1 
ATOM   591  C CD2 . TRP A 1 66 ? 17.849  45.758 36.005  1.00 23.42 ? 289 TRP A CD2 1 
ATOM   592  N NE1 . TRP A 1 66 ? 17.629  47.408 37.537  1.00 24.09 ? 289 TRP A NE1 1 
ATOM   593  C CE2 . TRP A 1 66 ? 17.934  47.154 36.215  1.00 25.01 ? 289 TRP A CE2 1 
ATOM   594  C CE3 . TRP A 1 66 ? 18.147  45.250 34.737  1.00 21.57 ? 289 TRP A CE3 1 
ATOM   595  C CZ2 . TRP A 1 66 ? 18.259  48.067 35.156  1.00 23.21 ? 289 TRP A CZ2 1 
ATOM   596  C CZ3 . TRP A 1 66 ? 18.460  46.151 33.709  1.00 23.19 ? 289 TRP A CZ3 1 
ATOM   597  C CH2 . TRP A 1 66 ? 18.499  47.541 33.920  1.00 25.65 ? 289 TRP A CH2 1 
ATOM   598  N N   . CYS A 1 67 ? 19.779  42.223 36.402  1.00 13.14 ? 290 CYS A N   1 
ATOM   599  C CA  . CYS A 1 67 ? 20.893  42.023 35.494  1.00 12.57 ? 290 CYS A CA  1 
ATOM   600  C C   . CYS A 1 67 ? 20.409  42.203 34.078  1.00 12.11 ? 290 CYS A C   1 
ATOM   601  O O   . CYS A 1 67 ? 19.409  41.604 33.696  1.00 13.68 ? 290 CYS A O   1 
ATOM   602  C CB  . CYS A 1 67 ? 21.468  40.619 35.721  1.00 12.74 ? 290 CYS A CB  1 
ATOM   603  S SG  . CYS A 1 67 ? 22.999  40.297 34.867  1.00 12.57 ? 290 CYS A SG  1 
ATOM   604  N N   . HIS A 1 68 ? 21.136  43.006 33.307  1.00 12.14 ? 291 HIS A N   1 
ATOM   605  C CA  . HIS A 1 68 ? 20.891  43.106 31.868  1.00 12.34 ? 291 HIS A CA  1 
ATOM   606  C C   . HIS A 1 68 ? 21.755  42.088 31.167  1.00 11.76 ? 291 HIS A C   1 
ATOM   607  O O   . HIS A 1 68 ? 22.966  42.026 31.396  1.00 13.21 ? 291 HIS A O   1 
ATOM   608  C CB  . HIS A 1 68 ? 21.219  44.515 31.361  1.00 13.19 ? 291 HIS A CB  1 
ATOM   609  C CG  . HIS A 1 68 ? 20.871  44.706 29.928  1.00 13.83 ? 291 HIS A CG  1 
ATOM   610  N ND1 . HIS A 1 68 ? 19.576  44.683 29.475  1.00 15.24 ? 291 HIS A ND1 1 
ATOM   611  C CD2 . HIS A 1 68 ? 21.643  44.879 28.828  1.00 14.69 ? 291 HIS A CD2 1 
ATOM   612  C CE1 . HIS A 1 68 ? 19.547  44.891 28.171  1.00 16.32 ? 291 HIS A CE1 1 
ATOM   613  N NE2 . HIS A 1 68 ? 20.791  44.970 27.739  1.00 14.53 ? 291 HIS A NE2 1 
ATOM   614  N N   . VAL A 1 69 ? 21.119  41.262 30.337  1.00 11.63 ? 292 VAL A N   1 
ATOM   615  C CA  . VAL A 1 69 ? 21.804  40.170 29.658  1.00 12.13 ? 292 VAL A CA  1 
ATOM   616  C C   . VAL A 1 69 ? 21.689  40.414 28.168  1.00 11.93 ? 292 VAL A C   1 
ATOM   617  O O   . VAL A 1 69 ? 20.621  40.723 27.666  1.00 13.72 ? 292 VAL A O   1 
ATOM   618  C CB  . VAL A 1 69 ? 21.185  38.816 30.033  1.00 12.74 ? 292 VAL A CB  1 
ATOM   619  C CG1 . VAL A 1 69 ? 21.973  37.702 29.438  1.00 15.83 ? 292 VAL A CG1 1 
ATOM   620  C CG2 . VAL A 1 69 ? 21.152  38.656 31.551  1.00 13.92 ? 292 VAL A CG2 1 
ATOM   621  N N   . TYR A 1 70 ? 22.816  40.333 27.439  1.00 11.69 ? 293 TYR A N   1 
ATOM   622  C CA  . TYR A 1 70 ? 22.747  40.832 26.065  1.00 11.56 ? 293 TYR A CA  1 
ATOM   623  C C   . TYR A 1 70 ? 23.821  40.241 25.181  1.00 11.78 ? 293 TYR A C   1 
ATOM   624  O O   . TYR A 1 70 ? 24.912  39.824 25.655  1.00 12.44 ? 293 TYR A O   1 
ATOM   625  C CB  . TYR A 1 70 ? 22.864  42.375 26.043  1.00 13.03 ? 293 TYR A CB  1 
ATOM   626  C CG  . TYR A 1 70 ? 24.188  42.908 26.506  1.00 12.84 ? 293 TYR A CG  1 
ATOM   627  C CD1 . TYR A 1 70 ? 25.152  43.308 25.588  1.00 13.69 ? 293 TYR A CD1 1 
ATOM   628  C CD2 . TYR A 1 70 ? 24.514  42.976 27.865  1.00 13.53 ? 293 TYR A CD2 1 
ATOM   629  C CE1 . TYR A 1 70 ? 26.353  43.778 25.993  1.00 15.31 ? 293 TYR A CE1 1 
ATOM   630  C CE2 . TYR A 1 70 ? 25.732  43.468 28.284  1.00 13.10 ? 293 TYR A CE2 1 
ATOM   631  C CZ  . TYR A 1 70 ? 26.655  43.836 27.343  1.00 14.57 ? 293 TYR A CZ  1 
ATOM   632  O OH  . TYR A 1 70 ? 27.880  44.295 27.715  1.00 16.05 ? 293 TYR A OH  1 
ATOM   633  N N   . ASN A 1 71 ? 23.538  40.253 23.896  1.00 12.46 ? 294 ASN A N   1 
ATOM   634  C CA  . ASN A 1 71 ? 24.582  40.045 22.903  1.00 12.42 ? 294 ASN A CA  1 
ATOM   635  C C   . ASN A 1 71 ? 24.327  41.021 21.767  1.00 12.42 ? 294 ASN A C   1 
ATOM   636  O O   . ASN A 1 71 ? 23.634  42.010 21.955  1.00 13.56 ? 294 ASN A O   1 
ATOM   637  C CB  . ASN A 1 71 ? 24.658  38.588 22.489  1.00 12.67 ? 294 ASN A CB  1 
ATOM   638  C CG  . ASN A 1 71 ? 23.404  38.080 21.820  1.00 12.61 ? 294 ASN A CG  1 
ATOM   639  O OD1 . ASN A 1 71 ? 22.586  38.860 21.332  1.00 13.29 ? 294 ASN A OD1 1 
ATOM   640  N ND2 . ASN A 1 71 ? 23.254  36.760 21.751  1.00 13.87 ? 294 ASN A ND2 1 
ATOM   641  N N   . ASP A 1 72 ? 24.972  40.815 20.604  1.00 12.38 ? 295 ASP A N   1 
ATOM   642  C CA  . ASP A 1 72 ? 24.843  41.751 19.498  1.00 13.02 ? 295 ASP A CA  1 
ATOM   643  C C   . ASP A 1 72 ? 23.582  41.595 18.676  1.00 13.62 ? 295 ASP A C   1 
ATOM   644  O O   . ASP A 1 72 ? 23.455  42.245 17.647  1.00 14.48 ? 295 ASP A O   1 
ATOM   645  C CB  . ASP A 1 72 ? 26.132  41.719 18.640  1.00 14.24 ? 295 ASP A CB  1 
ATOM   646  C CG  . ASP A 1 72 ? 26.329  40.415 17.911  1.00 15.53 ? 295 ASP A CG  1 
ATOM   647  O OD1 . ASP A 1 72 ? 25.422  39.566 17.958  1.00 17.62 ? 295 ASP A OD1 1 
ATOM   648  O OD2 . ASP A 1 72 ? 27.372  40.275 17.220  1.00 18.04 ? 295 ASP A OD2 1 
ATOM   649  N N   A ARG A 1 73 ? 22.619  40.784 19.136  0.50 13.37 ? 296 ARG A N   1 
ATOM   650  N N   B ARG A 1 73 ? 22.660  40.764 19.166  0.50 14.13 ? 296 ARG A N   1 
ATOM   651  C CA  A ARG A 1 73 ? 21.294  40.744 18.513  0.50 13.79 ? 296 ARG A CA  1 
ATOM   652  C CA  B ARG A 1 73 ? 21.422  40.489 18.482  0.50 15.01 ? 296 ARG A CA  1 
ATOM   653  C C   A ARG A 1 73 ? 20.143  41.016 19.471  0.50 14.62 ? 296 ARG A C   1 
ATOM   654  C C   B ARG A 1 73 ? 20.173  40.727 19.347  0.50 15.67 ? 296 ARG A C   1 
ATOM   655  O O   A ARG A 1 73 ? 19.149  41.668 19.137  0.50 13.98 ? 296 ARG A O   1 
ATOM   656  O O   B ARG A 1 73 ? 19.151  41.162 18.821  0.50 16.56 ? 296 ARG A O   1 
ATOM   657  C CB  A ARG A 1 73 ? 21.038  39.409 17.822  0.50 13.86 ? 296 ARG A CB  1 
ATOM   658  C CB  B ARG A 1 73 ? 21.435  39.054 17.935  0.50 14.81 ? 296 ARG A CB  1 
ATOM   659  C CG  A ARG A 1 73 ? 19.747  39.417 16.986  0.50 14.50 ? 296 ARG A CG  1 
ATOM   660  C CG  B ARG A 1 73 ? 20.321  38.813 16.910  0.50 15.75 ? 296 ARG A CG  1 
ATOM   661  C CD  A ARG A 1 73 ? 19.425  38.091 16.440  0.50 16.45 ? 296 ARG A CD  1 
ATOM   662  C CD  B ARG A 1 73 ? 20.132  37.347 16.493  0.50 17.80 ? 296 ARG A CD  1 
ATOM   663  N NE  A ARG A 1 73 ? 18.718  37.272 17.423  0.50 15.88 ? 296 ARG A NE  1 
ATOM   664  N NE  B ARG A 1 73 ? 19.155  37.283 15.417  0.50 23.70 ? 296 ARG A NE  1 
ATOM   665  C CZ  A ARG A 1 73 ? 18.225  36.065 17.182  0.50 16.32 ? 296 ARG A CZ  1 
ATOM   666  C CZ  B ARG A 1 73 ? 19.425  36.844 14.197  0.50 24.27 ? 296 ARG A CZ  1 
ATOM   667  N NH1 A ARG A 1 73 ? 18.438  35.458 16.021  0.50 18.42 ? 296 ARG A NH1 1 
ATOM   668  N NH1 B ARG A 1 73 ? 20.606  36.303 13.909  0.50 19.42 ? 296 ARG A NH1 1 
ATOM   669  N NH2 A ARG A 1 73 ? 17.629  35.421 18.145  0.50 17.01 ? 296 ARG A NH2 1 
ATOM   670  N NH2 B ARG A 1 73 ? 18.462  36.860 13.285  0.50 27.20 ? 296 ARG A NH2 1 
ATOM   671  N N   . ASP A 1 74 ? 20.256  40.454 20.663  1.00 14.52 ? 297 ASP A N   1 
ATOM   672  C CA  . ASP A 1 74 ? 19.111  40.303 21.556  1.00 16.34 ? 297 ASP A CA  1 
ATOM   673  C C   . ASP A 1 74 ? 19.525  40.773 22.950  1.00 14.88 ? 297 ASP A C   1 
ATOM   674  O O   . ASP A 1 74 ? 20.689  40.717 23.334  1.00 14.69 ? 297 ASP A O   1 
ATOM   675  C CB  . ASP A 1 74 ? 18.835  38.778 21.814  1.00 19.31 ? 297 ASP A CB  1 
ATOM   676  C CG  . ASP A 1 74 ? 18.299  37.980 20.644  1.00 21.68 ? 297 ASP A CG  1 
ATOM   677  O OD1 . ASP A 1 74 ? 17.801  38.591 19.712  1.00 24.63 ? 297 ASP A OD1 1 
ATOM   678  O OD2 . ASP A 1 74 ? 18.357  36.681 20.741  1.00 25.87 ? 297 ASP A OD2 1 
ATOM   679  N N   A SER A 1 75 ? 18.529  41.132 23.751  0.50 13.84 ? 298 SER A N   1 
ATOM   680  N N   B SER A 1 75 ? 18.509  41.169 23.725  0.50 15.18 ? 298 SER A N   1 
ATOM   681  C CA  A SER A 1 75 ? 18.797  41.373 25.168  0.50 13.21 ? 298 SER A CA  1 
ATOM   682  C CA  B SER A 1 75 ? 18.678  41.507 25.146  0.50 15.73 ? 298 SER A CA  1 
ATOM   683  C C   A SER A 1 75 ? 17.532  41.133 25.976  0.50 13.07 ? 298 SER A C   1 
ATOM   684  C C   B SER A 1 75 ? 17.519  40.939 25.930  0.50 14.84 ? 298 SER A C   1 
ATOM   685  O O   A SER A 1 75 ? 16.392  41.300 25.488  0.50 13.40 ? 298 SER A O   1 
ATOM   686  O O   B SER A 1 75 ? 16.420  40.749 25.391  0.50 14.49 ? 298 SER A O   1 
ATOM   687  C CB  A SER A 1 75 ? 19.341  42.803 25.404  0.50 13.28 ? 298 SER A CB  1 
ATOM   688  C CB  B SER A 1 75 ? 18.627  43.027 25.368  0.50 16.51 ? 298 SER A CB  1 
ATOM   689  O OG  A SER A 1 75 ? 18.314  43.785 25.224  0.50 13.69 ? 298 SER A OG  1 
ATOM   690  O OG  B SER A 1 75 ? 19.595  43.730 24.632  0.50 19.26 ? 298 SER A OG  1 
ATOM   691  N N   . GLN A 1 76 ? 17.771  40.728 27.219  1.00 14.52 ? 299 GLN A N   1 
ATOM   692  C CA  . GLN A 1 76 ? 16.723  40.482 28.164  1.00 15.91 ? 299 GLN A CA  1 
ATOM   693  C C   . GLN A 1 76 ? 17.207  41.064 29.490  1.00 13.89 ? 299 GLN A C   1 
ATOM   694  O O   . GLN A 1 76 ? 18.354  40.981 29.844  1.00 18.07 ? 299 GLN A O   1 
ATOM   695  C CB  . GLN A 1 76 ? 16.509  38.960 28.313  1.00 16.78 ? 299 GLN A CB  1 
ATOM   696  C CG  . GLN A 1 76 ? 15.807  38.264 27.153  1.00 20.62 ? 299 GLN A CG  1 
ATOM   697  C CD  . GLN A 1 76 ? 15.405  36.806 27.431  1.00 21.23 ? 299 GLN A CD  1 
ATOM   698  O OE1 . GLN A 1 76 ? 15.844  36.191 28.424  1.00 21.56 ? 299 GLN A OE1 1 
ATOM   699  N NE2 . GLN A 1 76 ? 14.520  36.262 26.574  1.00 23.74 ? 299 GLN A NE2 1 
ATOM   700  N N   . ASP A 1 77 ? 16.208  41.535 30.286  1.00 16.52 ? 300 ASP A N   1 
ATOM   701  C CA  . ASP A 1 77 ? 16.481  41.910 31.679  1.00 16.74 ? 300 ASP A CA  1 
ATOM   702  C C   . ASP A 1 77 ? 15.984  40.782 32.576  1.00 15.74 ? 300 ASP A C   1 
ATOM   703  O O   . ASP A 1 77 ? 14.876  40.229 32.381  1.00 19.19 ? 300 ASP A O   1 
ATOM   704  C CB  . ASP A 1 77 ? 15.759  43.219 32.072  1.00 17.98 ? 300 ASP A CB  1 
ATOM   705  C CG  . ASP A 1 77 ? 16.432  44.423 31.441  1.00 20.12 ? 300 ASP A CG  1 
ATOM   706  O OD1 . ASP A 1 77 ? 17.682  44.447 31.267  1.00 22.83 ? 300 ASP A OD1 1 
ATOM   707  O OD2 . ASP A 1 77 ? 15.699  45.349 31.103  1.00 28.56 ? 300 ASP A OD2 1 
ATOM   708  N N   . SER A 1 78 ? 16.797  40.465 33.588  1.00 16.72 ? 301 SER A N   1 
ATOM   709  C CA  . SER A 1 78 ? 16.332  39.542 34.595  1.00 17.71 ? 301 SER A CA  1 
ATOM   710  C C   . SER A 1 78 ? 15.183  40.150 35.293  1.00 19.73 ? 301 SER A C   1 
ATOM   711  O O   . SER A 1 78 ? 14.938  41.365 35.276  1.00 21.70 ? 301 SER A O   1 
ATOM   712  C CB  . SER A 1 78 ? 17.405  39.252 35.639  1.00 17.12 ? 301 SER A CB  1 
ATOM   713  O OG  . SER A 1 78 ? 17.611  40.358 36.549  1.00 16.93 ? 301 SER A OG  1 
ATOM   714  N N   . LYS A 1 79 ? 14.505  39.287 36.027  1.00 17.48 ? 302 LYS A N   1 
ATOM   715  C CA  . LYS A 1 79 ? 13.579  39.737 37.046  1.00 20.86 ? 302 LYS A CA  1 
ATOM   716  C C   . LYS A 1 79 ? 14.291  40.723 38.017  1.00 19.63 ? 302 LYS A C   1 
ATOM   717  O O   . LYS A 1 79 ? 15.507  40.593 38.290  1.00 20.82 ? 302 LYS A O   1 
ATOM   718  C CB  . LYS A 1 79 ? 12.990  38.550 37.835  1.00 25.38 ? 302 LYS A CB  1 
ATOM   719  C CG  . LYS A 1 79 ? 11.637  38.120 37.324  1.00 31.07 ? 302 LYS A CG  1 
ATOM   720  C CD  . LYS A 1 79 ? 11.654  37.323 36.038  1.00 35.43 ? 302 LYS A CD  1 
ATOM   721  C CE  . LYS A 1 79 ? 10.395  37.577 35.264  1.00 35.99 ? 302 LYS A CE  1 
ATOM   722  N NZ  . LYS A 1 79 ? 9.823   36.339 34.663  1.00 39.51 ? 302 LYS A NZ  1 
ATOM   723  N N   . LYS A 1 80 ? 13.488  41.674 38.547  1.00 21.31 ? 303 LYS A N   1 
ATOM   724  C CA  . LYS A 1 80 ? 13.954  42.574 39.573  1.00 22.11 ? 303 LYS A CA  1 
ATOM   725  C C   . LYS A 1 80 ? 13.704  41.863 40.910  1.00 19.51 ? 303 LYS A C   1 
ATOM   726  O O   . LYS A 1 80 ? 12.622  41.336 41.195  1.00 26.34 ? 303 LYS A O   1 
ATOM   727  C CB  . LYS A 1 80 ? 13.250  43.929 39.554  1.00 23.53 ? 303 LYS A CB  1 
ATOM   728  C CG  . LYS A 1 80 ? 13.875  45.066 38.704  1.00 26.21 ? 303 LYS A CG  1 
ATOM   729  C CD  . LYS A 1 80 ? 13.084  46.406 38.914  1.00 25.21 ? 303 LYS A CD  1 
ATOM   730  C CE  . LYS A 1 80 ? 13.896  47.559 38.328  1.00 28.76 ? 303 LYS A CE  1 
ATOM   731  N N   . VAL A 1 81 ? 14.754  41.920 41.730  1.00 20.38 ? 304 VAL A N   1 
ATOM   732  C CA  . VAL A 1 81 ? 14.741  41.281 43.035  1.00 20.11 ? 304 VAL A CA  1 
ATOM   733  C C   . VAL A 1 81 ? 15.138  42.295 44.067  1.00 22.70 ? 304 VAL A C   1 
ATOM   734  O O   . VAL A 1 81 ? 15.791  43.282 43.822  1.00 20.17 ? 304 VAL A O   1 
ATOM   735  C CB  . VAL A 1 81 ? 15.621  40.023 43.164  1.00 22.69 ? 304 VAL A CB  1 
ATOM   736  C CG1 . VAL A 1 81 ? 15.137  38.890 42.239  1.00 23.46 ? 304 VAL A CG1 1 
ATOM   737  C CG2 . VAL A 1 81 ? 17.061  40.343 42.972  1.00 24.07 ? 304 VAL A CG2 1 
ATOM   738  N N   . GLU A 1 82 ? 14.562  42.109 45.271  1.00 18.44 ? 305 GLU A N   1 
ATOM   739  C CA  . GLU A 1 82 ? 14.784  43.031 46.419  1.00 22.31 ? 305 GLU A CA  1 
ATOM   740  C C   . GLU A 1 82 ? 15.657  42.318 47.463  1.00 20.54 ? 305 GLU A C   1 
ATOM   741  O O   . GLU A 1 82 ? 15.422  41.163 47.839  1.00 20.92 ? 305 GLU A O   1 
ATOM   742  C CB  . GLU A 1 82 ? 13.449  43.557 47.017  1.00 25.23 ? 305 GLU A CB  1 
ATOM   743  C CG  . GLU A 1 82 ? 12.732  44.607 46.075  1.00 23.79 ? 305 GLU A CG  1 
ATOM   744  C CD  . GLU A 1 82 ? 11.350  45.098 46.590  1.00 21.28 ? 305 GLU A CD  1 
ATOM   745  O OE1 . GLU A 1 82 ? 10.455  44.221 46.630  1.00 26.56 ? 305 GLU A OE1 1 
ATOM   746  O OE2 . GLU A 1 82 ? 11.156  46.328 46.885  1.00 30.59 ? 305 GLU A OE2 1 
ATOM   747  N N   . ILE A 1 83 ? 16.705  43.020 47.863  1.00 20.03 ? 306 ILE A N   1 
ATOM   748  C CA  . ILE A 1 83 ? 17.540  42.570 48.955  1.00 20.05 ? 306 ILE A CA  1 
ATOM   749  C C   . ILE A 1 83 ? 17.186  43.471 50.119  1.00 19.99 ? 306 ILE A C   1 
ATOM   750  O O   . ILE A 1 83 ? 17.330  44.711 50.063  1.00 20.93 ? 306 ILE A O   1 
ATOM   751  C CB  . ILE A 1 83 ? 19.038  42.686 48.590  1.00 19.78 ? 306 ILE A CB  1 
ATOM   752  C CG1 . ILE A 1 83 ? 19.340  41.846 47.331  1.00 20.78 ? 306 ILE A CG1 1 
ATOM   753  C CG2 . ILE A 1 83 ? 19.890  42.284 49.786  1.00 21.25 ? 306 ILE A CG2 1 
ATOM   754  C CD1 . ILE A 1 83 ? 18.904  40.371 47.394  1.00 22.82 ? 306 ILE A CD1 1 
ATOM   755  N N   . ILE A 1 84 ? 16.693  42.827 51.174  1.00 19.22 ? 307 ILE A N   1 
ATOM   756  C CA  . ILE A 1 84 ? 16.292  43.504 52.403  1.00 20.92 ? 307 ILE A CA  1 
ATOM   757  C C   . ILE A 1 84 ? 17.298  43.194 53.479  1.00 21.11 ? 307 ILE A C   1 
ATOM   758  O O   . ILE A 1 84 ? 17.691  42.046 53.653  1.00 20.59 ? 307 ILE A O   1 
ATOM   759  C CB  . ILE A 1 84 ? 14.882  43.038 52.922  1.00 23.55 ? 307 ILE A CB  1 
ATOM   760  C CG1 . ILE A 1 84 ? 13.819  43.414 51.903  1.00 27.03 ? 307 ILE A CG1 1 
ATOM   761  C CG2 . ILE A 1 84 ? 14.582  43.613 54.313  1.00 25.35 ? 307 ILE A CG2 1 
ATOM   762  C CD1 . ILE A 1 84 ? 13.523  42.294 51.002  1.00 32.01 ? 307 ILE A CD1 1 
ATOM   763  N N   . ILE A 1 85 ? 17.754  44.222 54.163  1.00 22.56 ? 308 ILE A N   1 
ATOM   764  C CA  . ILE A 1 85 ? 18.770  44.052 55.180  1.00 25.83 ? 308 ILE A CA  1 
ATOM   765  C C   . ILE A 1 85 ? 18.219  44.539 56.510  1.00 27.52 ? 308 ILE A C   1 
ATOM   766  O O   . ILE A 1 85 ? 18.020  45.745 56.713  1.00 29.29 ? 308 ILE A O   1 
ATOM   767  C CB  . ILE A 1 85 ? 20.150  44.648 54.713  1.00 25.82 ? 308 ILE A CB  1 
ATOM   768  C CG1 . ILE A 1 85 ? 20.718  43.735 53.570  1.00 27.76 ? 308 ILE A CG1 1 
ATOM   769  C CG2 . ILE A 1 85 ? 21.112  44.690 55.901  1.00 29.09 ? 308 ILE A CG2 1 
ATOM   770  C CD1 . ILE A 1 85 ? 21.854  44.252 52.784  1.00 27.50 ? 308 ILE A CD1 1 
ATOM   771  N N   . ASP A 1 86 ? 17.934  43.561 57.373  1.00 29.25 ? 309 ASP A N   1 
ATOM   772  C CA  . ASP A 1 86 ? 17.176  43.734 58.608  1.00 31.24 ? 309 ASP A CA  1 
ATOM   773  C C   . ASP A 1 86 ? 18.049  43.550 59.845  1.00 31.73 ? 309 ASP A C   1 
ATOM   774  O O   . ASP A 1 86 ? 18.756  42.546 59.963  1.00 32.47 ? 309 ASP A O   1 
ATOM   775  C CB  . ASP A 1 86 ? 16.030  42.715 58.626  1.00 33.17 ? 309 ASP A CB  1 
ATOM   776  N N   . SER B 1 2  ? 1.885   68.105 54.894  1.00 28.04 ? 225 SER B N   1 
ATOM   777  C CA  . SER B 1 2  ? 0.910   68.625 53.879  1.00 27.47 ? 225 SER B CA  1 
ATOM   778  C C   . SER B 1 2  ? 0.312   67.500 53.022  1.00 24.21 ? 225 SER B C   1 
ATOM   779  O O   . SER B 1 2  ? 1.009   66.591 52.560  1.00 22.43 ? 225 SER B O   1 
ATOM   780  C CB  . SER B 1 2  ? 1.528   69.764 53.043  1.00 29.75 ? 225 SER B CB  1 
ATOM   781  O OG  . SER B 1 2  ? 0.977   69.904 51.738  1.00 35.64 ? 225 SER B OG  1 
ATOM   782  N N   . LYS B 1 3  ? -1.003  67.547 52.846  1.00 22.76 ? 226 LYS B N   1 
ATOM   783  C CA  . LYS B 1 3  ? -1.740  66.495 52.170  1.00 22.19 ? 226 LYS B CA  1 
ATOM   784  C C   . LYS B 1 3  ? -1.193  66.298 50.765  1.00 19.52 ? 226 LYS B C   1 
ATOM   785  O O   . LYS B 1 3  ? -1.029  67.255 49.990  1.00 20.84 ? 226 LYS B O   1 
ATOM   786  C CB  . LYS B 1 3  ? -3.219  66.879 52.072  1.00 24.32 ? 226 LYS B CB  1 
ATOM   787  C CG  . LYS B 1 3  ? -4.050  66.083 51.062  1.00 25.54 ? 226 LYS B CG  1 
ATOM   788  C CD  . LYS B 1 3  ? -5.461  66.636 50.922  1.00 27.60 ? 226 LYS B CD  1 
ATOM   789  C CE  . LYS B 1 3  ? -6.097  66.250 49.615  1.00 31.15 ? 226 LYS B CE  1 
ATOM   790  N NZ  . LYS B 1 3  ? -5.352  65.190 48.888  1.00 35.63 ? 226 LYS B NZ  1 
ATOM   791  N N   . LEU B 1 4  ? -0.986  65.053 50.398  1.00 18.49 ? 227 LEU B N   1 
ATOM   792  C CA  . LEU B 1 4  ? -0.542  64.699 49.042  1.00 17.06 ? 227 LEU B CA  1 
ATOM   793  C C   . LEU B 1 4  ? -1.701  64.900 48.112  1.00 16.84 ? 227 LEU B C   1 
ATOM   794  O O   . LEU B 1 4  ? -2.826  64.418 48.361  1.00 18.58 ? 227 LEU B O   1 
ATOM   795  C CB  . LEU B 1 4  ? -0.055  63.262 49.029  1.00 18.25 ? 227 LEU B CB  1 
ATOM   796  C CG  . LEU B 1 4  ? 0.498   62.795 47.696  1.00 17.62 ? 227 LEU B CG  1 
ATOM   797  C CD1 . LEU B 1 4  ? 1.581   61.736 47.982  1.00 19.66 ? 227 LEU B CD1 1 
ATOM   798  C CD2 . LEU B 1 4  ? -0.582  62.196 46.807  1.00 21.38 ? 227 LEU B CD2 1 
ATOM   799  N N   . GLN B 1 5  ? -1.483  65.669 47.059  1.00 16.90 ? 228 GLN B N   1 
ATOM   800  C CA  . GLN B 1 5  ? -2.584  65.928 46.127  1.00 17.45 ? 228 GLN B CA  1 
ATOM   801  C C   . GLN B 1 5  ? -1.996  66.056 44.689  1.00 16.66 ? 228 GLN B C   1 
ATOM   802  O O   . GLN B 1 5  ? -1.064  66.815 44.475  1.00 17.78 ? 228 GLN B O   1 
ATOM   803  C CB  . GLN B 1 5  ? -3.288  67.235 46.527  1.00 20.50 ? 228 GLN B CB  1 
ATOM   804  C CG  . GLN B 1 5  ? -4.373  67.574 45.522  1.00 21.93 ? 228 GLN B CG  1 
ATOM   805  C CD  . GLN B 1 5  ? -5.410  66.474 45.441  1.00 21.96 ? 228 GLN B CD  1 
ATOM   806  O OE1 . GLN B 1 5  ? -6.015  66.094 46.472  1.00 25.67 ? 228 GLN B OE1 1 
ATOM   807  N NE2 . GLN B 1 5  ? -5.680  65.994 44.221  1.00 23.18 ? 228 GLN B NE2 1 
ATOM   808  N N   . ILE B 1 6  ? -2.564  65.316 43.767  1.00 17.35 ? 229 ILE B N   1 
ATOM   809  C CA  . ILE B 1 6  ? -2.202  65.468 42.350  1.00 17.00 ? 229 ILE B CA  1 
ATOM   810  C C   . ILE B 1 6  ? -2.783  66.778 41.842  1.00 17.91 ? 229 ILE B C   1 
ATOM   811  O O   . ILE B 1 6  ? -4.005  66.983 41.978  1.00 19.31 ? 229 ILE B O   1 
ATOM   812  C CB  . ILE B 1 6  ? -2.680  64.247 41.539  1.00 16.95 ? 229 ILE B CB  1 
ATOM   813  C CG1 . ILE B 1 6  ? -1.912  62.985 42.008  1.00 16.74 ? 229 ILE B CG1 1 
ATOM   814  C CG2 . ILE B 1 6  ? -2.471  64.522 40.008  1.00 17.02 ? 229 ILE B CG2 1 
ATOM   815  C CD1 . ILE B 1 6  ? -2.370  61.725 41.319  1.00 16.91 ? 229 ILE B CD1 1 
ATOM   816  N N   A CYS B 1 7  ? -1.957  67.631 41.245  0.70 17.63 ? 230 CYS B N   1 
ATOM   817  N N   B CYS B 1 7  ? -1.938  67.673 41.322  0.30 18.36 ? 230 CYS B N   1 
ATOM   818  C CA  A CYS B 1 7  ? -2.375  68.937 40.722  0.70 19.34 ? 230 CYS B CA  1 
ATOM   819  C CA  B CYS B 1 7  ? -2.404  68.934 40.717  0.30 19.30 ? 230 CYS B CA  1 
ATOM   820  C C   A CYS B 1 7  ? -2.242  69.102 39.226  0.70 18.77 ? 230 CYS B C   1 
ATOM   821  C C   B CYS B 1 7  ? -2.460  68.882 39.185  0.30 19.04 ? 230 CYS B C   1 
ATOM   822  O O   A CYS B 1 7  ? -2.819  70.035 38.681  0.70 17.61 ? 230 CYS B O   1 
ATOM   823  O O   B CYS B 1 7  ? -3.398  69.418 38.569  0.30 17.87 ? 230 CYS B O   1 
ATOM   824  C CB  A CYS B 1 7  ? -1.525  69.986 41.367  0.70 19.78 ? 230 CYS B CB  1 
ATOM   825  C CB  B CYS B 1 7  ? -1.588  70.148 41.207  0.30 19.96 ? 230 CYS B CB  1 
ATOM   826  S SG  A CYS B 1 7  ? -1.936  70.169 43.087  0.70 24.25 ? 230 CYS B SG  1 
ATOM   827  S SG  B CYS B 1 7  ? 0.233   69.989 41.454  0.30 23.21 ? 230 CYS B SG  1 
ATOM   828  N N   . VAL B 1 8  ? -1.462  68.245 38.567  1.00 18.18 ? 231 VAL B N   1 
ATOM   829  C CA  . VAL B 1 8  ? -1.400  68.160 37.110  1.00 17.76 ? 231 VAL B CA  1 
ATOM   830  C C   . VAL B 1 8  ? -1.668  66.700 36.813  1.00 16.59 ? 231 VAL B C   1 
ATOM   831  O O   . VAL B 1 8  ? -0.935  65.796 37.271  1.00 15.95 ? 231 VAL B O   1 
ATOM   832  C CB  . VAL B 1 8  ? -0.042  68.564 36.537  1.00 18.01 ? 231 VAL B CB  1 
ATOM   833  C CG1 . VAL B 1 8  ? 0.007   68.328 34.978  1.00 20.01 ? 231 VAL B CG1 1 
ATOM   834  C CG2 . VAL B 1 8  ? 0.287   70.034 36.873  1.00 19.34 ? 231 VAL B CG2 1 
ATOM   835  N N   . GLU B 1 9  ? -2.729  66.456 36.052  1.00 18.13 ? 232 GLU B N   1 
ATOM   836  C CA  . GLU B 1 9  ? -3.145  65.147 35.583  1.00 18.40 ? 232 GLU B CA  1 
ATOM   837  C C   . GLU B 1 9  ? -2.630  64.891 34.167  1.00 17.32 ? 232 GLU B C   1 
ATOM   838  O O   . GLU B 1 9  ? -2.585  65.823 33.362  1.00 21.06 ? 232 GLU B O   1 
ATOM   839  C CB  . GLU B 1 9  ? -4.673  64.997 35.595  1.00 20.30 ? 232 GLU B CB  1 
ATOM   840  C CG  . GLU B 1 9  ? -5.280  64.976 36.995  1.00 20.49 ? 232 GLU B CG  1 
ATOM   841  C CD  . GLU B 1 9  ? -5.190  63.631 37.781  1.00 19.74 ? 232 GLU B CD  1 
ATOM   842  O OE1 . GLU B 1 9  ? -4.575  62.650 37.272  1.00 24.26 ? 232 GLU B OE1 1 
ATOM   843  O OE2 . GLU B 1 9  ? -5.796  63.608 38.913  1.00 26.30 ? 232 GLU B OE2 1 
ATOM   844  N N   . PRO B 1 10 ? -2.305  63.628 33.828  1.00 18.52 ? 233 PRO B N   1 
ATOM   845  C CA  . PRO B 1 10 ? -1.859  63.309 32.473  1.00 18.77 ? 233 PRO B CA  1 
ATOM   846  C C   . PRO B 1 10 ? -3.027  63.481 31.510  1.00 19.87 ? 233 PRO B C   1 
ATOM   847  O O   . PRO B 1 10 ? -4.205  63.525 31.941  1.00 20.89 ? 233 PRO B O   1 
ATOM   848  C CB  . PRO B 1 10 ? -1.439  61.837 32.559  1.00 18.26 ? 233 PRO B CB  1 
ATOM   849  C CG  . PRO B 1 10 ? -2.150  61.313 33.778  1.00 18.70 ? 233 PRO B CG  1 
ATOM   850  C CD  . PRO B 1 10 ? -2.210  62.488 34.745  1.00 18.04 ? 233 PRO B CD  1 
ATOM   851  N N   . THR B 1 11 ? -2.678  63.582 30.231  1.00 20.88 ? 234 THR B N   1 
ATOM   852  C CA  . THR B 1 11 ? -3.679  63.772 29.158  1.00 21.20 ? 234 THR B CA  1 
ATOM   853  C C   . THR B 1 11 ? -3.585  62.643 28.132  1.00 20.78 ? 234 THR B C   1 
ATOM   854  O O   . THR B 1 11 ? -2.501  62.216 27.757  1.00 19.84 ? 234 THR B O   1 
ATOM   855  C CB  . THR B 1 11 ? -3.446  65.112 28.406  1.00 22.82 ? 234 THR B CB  1 
ATOM   856  O OG1 . THR B 1 11 ? -3.440  66.210 29.363  1.00 25.90 ? 234 THR B OG1 1 
ATOM   857  C CG2 . THR B 1 11 ? -4.537  65.397 27.406  1.00 27.61 ? 234 THR B CG2 1 
ATOM   858  N N   . SER B 1 12 ? -4.738  62.173 27.663  1.00 21.07 ? 235 SER B N   1 
ATOM   859  C CA  . SER B 1 12 ? -4.830  61.261 26.509  1.00 19.72 ? 235 SER B CA  1 
ATOM   860  C C   . SER B 1 12 ? -4.303  61.924 25.251  1.00 19.72 ? 235 SER B C   1 
ATOM   861  O O   . SER B 1 12 ? -4.339  63.160 25.130  1.00 21.12 ? 235 SER B O   1 
ATOM   862  C CB  . SER B 1 12 ? -6.271  60.803 26.301  1.00 20.57 ? 235 SER B CB  1 
ATOM   863  O OG  . SER B 1 12 ? -6.601  59.891 27.335  1.00 25.00 ? 235 SER B OG  1 
ATOM   864  N N   . GLN B 1 13 ? -3.738  61.096 24.372  1.00 18.33 ? 236 GLN B N   1 
ATOM   865  C CA  . GLN B 1 13 ? -3.140  61.594 23.132  1.00 17.67 ? 236 GLN B CA  1 
ATOM   866  C C   . GLN B 1 13 ? -3.491  60.619 22.015  1.00 19.65 ? 236 GLN B C   1 
ATOM   867  O O   . GLN B 1 13 ? -3.566  59.391 22.210  1.00 19.04 ? 236 GLN B O   1 
ATOM   868  C CB  . GLN B 1 13 ? -1.614  61.749 23.207  1.00 18.19 ? 236 GLN B CB  1 
ATOM   869  C CG  . GLN B 1 13 ? -1.072  62.737 24.253  1.00 18.91 ? 236 GLN B CG  1 
ATOM   870  C CD  . GLN B 1 13 ? -1.318  64.175 23.886  1.00 20.89 ? 236 GLN B CD  1 
ATOM   871  O OE1 . GLN B 1 13 ? -1.629  64.517 22.745  1.00 21.04 ? 236 GLN B OE1 1 
ATOM   872  N NE2 . GLN B 1 13 ? -1.091  65.062 24.845  1.00 22.52 ? 236 GLN B NE2 1 
ATOM   873  N N   . LYS B 1 14 ? -3.643  61.186 20.820  1.00 19.31 ? 237 LYS B N   1 
ATOM   874  C CA  . LYS B 1 14 ? -3.733  60.431 19.574  1.00 19.32 ? 237 LYS B CA  1 
ATOM   875  C C   . LYS B 1 14 ? -2.523  60.775 18.762  1.00 17.43 ? 237 LYS B C   1 
ATOM   876  O O   . LYS B 1 14 ? -2.369  61.895 18.296  1.00 18.42 ? 237 LYS B O   1 
ATOM   877  C CB  . LYS B 1 14 ? -5.009  60.842 18.806  1.00 21.09 ? 237 LYS B CB  1 
ATOM   878  C CG  . LYS B 1 14 ? -5.212  60.061 17.547  1.00 26.82 ? 237 LYS B CG  1 
ATOM   879  C CD  . LYS B 1 14 ? -6.527  60.385 16.834  1.00 32.78 ? 237 LYS B CD  1 
ATOM   880  C CE  . LYS B 1 14 ? -6.584  59.764 15.481  1.00 33.11 ? 237 LYS B CE  1 
ATOM   881  N NZ  . LYS B 1 14 ? -5.762  60.516 14.502  1.00 37.36 ? 237 LYS B NZ  1 
ATOM   882  N N   . LEU B 1 15 ? -1.644  59.800 18.619  1.00 17.23 ? 238 LEU B N   1 
ATOM   883  C CA  . LEU B 1 15 ? -0.327  60.013 18.032  1.00 15.70 ? 238 LEU B CA  1 
ATOM   884  C C   . LEU B 1 15 ? -0.138  59.180 16.780  1.00 17.86 ? 238 LEU B C   1 
ATOM   885  O O   . LEU B 1 15 ? -0.785  58.167 16.575  1.00 21.06 ? 238 LEU B O   1 
ATOM   886  C CB  . LEU B 1 15 ? 0.738   59.618 19.046  1.00 17.08 ? 238 LEU B CB  1 
ATOM   887  C CG  . LEU B 1 15 ? 0.691   60.422 20.357  1.00 14.87 ? 238 LEU B CG  1 
ATOM   888  C CD1 . LEU B 1 15 ? 1.766   59.858 21.303  1.00 15.53 ? 238 LEU B CD1 1 
ATOM   889  C CD2 . LEU B 1 15 ? 0.891   61.928 20.159  1.00 15.07 ? 238 LEU B CD2 1 
ATOM   890  N N   A MET B 1 16 ? 0.778   59.629 15.932  0.50 17.45 ? 239 MET B N   1 
ATOM   891  N N   B MET B 1 16 ? 0.748   59.612 15.904  0.50 18.64 ? 239 MET B N   1 
ATOM   892  C CA  A MET B 1 16 ? 1.178   58.846 14.766  0.50 19.71 ? 239 MET B CA  1 
ATOM   893  C CA  B MET B 1 16 ? 1.108   58.704 14.825  0.50 21.81 ? 239 MET B CA  1 
ATOM   894  C C   A MET B 1 16 ? 2.535   58.178 15.052  0.50 18.25 ? 239 MET B C   1 
ATOM   895  C C   B MET B 1 16 ? 2.513   58.164 15.041  0.50 19.38 ? 239 MET B C   1 
ATOM   896  O O   A MET B 1 16 ? 3.310   58.674 15.864  0.50 17.82 ? 239 MET B O   1 
ATOM   897  O O   B MET B 1 16 ? 3.296   58.729 15.798  0.50 19.15 ? 239 MET B O   1 
ATOM   898  C CB  A MET B 1 16 ? 1.184   59.744 13.536  0.50 20.21 ? 239 MET B CB  1 
ATOM   899  C CB  B MET B 1 16 ? 0.880   59.329 13.456  0.50 22.91 ? 239 MET B CB  1 
ATOM   900  C CG  A MET B 1 16 ? 2.291   60.724 13.424  0.50 21.28 ? 239 MET B CG  1 
ATOM   901  C CG  B MET B 1 16 ? 1.429   60.692 13.274  0.50 25.34 ? 239 MET B CG  1 
ATOM   902  S SD  A MET B 1 16 ? 2.138   61.687 11.890  0.50 26.52 ? 239 MET B SD  1 
ATOM   903  S SD  B MET B 1 16 ? 1.113   61.162 11.566  0.50 29.66 ? 239 MET B SD  1 
ATOM   904  C CE  A MET B 1 16 ? 1.426   60.488 10.749  0.50 23.70 ? 239 MET B CE  1 
ATOM   905  C CE  B MET B 1 16 ? 2.793   61.073 10.927  0.50 29.54 ? 239 MET B CE  1 
ATOM   906  N N   . PRO B 1 17 ? 2.850   57.046 14.398  1.00 19.47 ? 240 PRO B N   1 
ATOM   907  C CA  . PRO B 1 17 ? 4.173   56.474 14.592  1.00 19.16 ? 240 PRO B CA  1 
ATOM   908  C C   . PRO B 1 17 ? 5.230   57.577 14.310  1.00 18.48 ? 240 PRO B C   1 
ATOM   909  O O   . PRO B 1 17 ? 5.105   58.321 13.345  1.00 18.78 ? 240 PRO B O   1 
ATOM   910  C CB  . PRO B 1 17 ? 4.208   55.298 13.573  1.00 21.16 ? 240 PRO B CB  1 
ATOM   911  C CG  . PRO B 1 17 ? 2.800   54.898 13.547  1.00 21.71 ? 240 PRO B CG  1 
ATOM   912  C CD  . PRO B 1 17 ? 2.038   56.219 13.483  1.00 21.00 ? 240 PRO B CD  1 
ATOM   913  N N   . GLY B 1 18 ? 6.281   57.644 15.118  1.00 17.21 ? 241 GLY B N   1 
ATOM   914  C CA  . GLY B 1 18 ? 7.339   58.615 14.921  1.00 18.07 ? 241 GLY B CA  1 
ATOM   915  C C   . GLY B 1 18 ? 7.129   59.877 15.731  1.00 17.08 ? 241 GLY B C   1 
ATOM   916  O O   . GLY B 1 18 ? 8.083   60.638 15.892  1.00 19.09 ? 241 GLY B O   1 
ATOM   917  N N   A SER B 1 19 ? 5.926   60.096 16.269  0.50 14.51 ? 242 SER B N   1 
ATOM   918  N N   B SER B 1 19 ? 5.900   60.093 16.250  0.50 14.81 ? 242 SER B N   1 
ATOM   919  C CA  A SER B 1 19 ? 5.680   61.300 17.077  0.50 13.55 ? 242 SER B CA  1 
ATOM   920  C CA  B SER B 1 19 ? 5.533   61.251 17.120  0.50 14.11 ? 242 SER B CA  1 
ATOM   921  C C   A SER B 1 19 ? 6.066   61.026 18.540  0.50 14.58 ? 242 SER B C   1 
ATOM   922  C C   B SER B 1 19 ? 6.192   61.069 18.484  0.50 15.08 ? 242 SER B C   1 
ATOM   923  O O   A SER B 1 19 ? 6.438   59.891 18.905  0.50 12.78 ? 242 SER B O   1 
ATOM   924  O O   B SER B 1 19 ? 6.794   60.024 18.752  0.50 13.70 ? 242 SER B O   1 
ATOM   925  C CB  A SER B 1 19 ? 4.256   61.775 16.888  0.50 14.52 ? 242 SER B CB  1 
ATOM   926  C CB  B SER B 1 19 ? 4.014   61.303 17.320  0.50 14.91 ? 242 SER B CB  1 
ATOM   927  O OG  A SER B 1 19 ? 3.293   60.847 17.379  0.50 14.20 ? 242 SER B OG  1 
ATOM   928  O OG  B SER B 1 19 ? 3.345   61.640 16.120  0.50 17.33 ? 242 SER B OG  1 
ATOM   929  N N   . THR B 1 20 ? 6.053   62.060 19.353  1.00 14.49 ? 243 THR B N   1 
ATOM   930  C CA  . THR B 1 20 ? 6.562   61.953 20.689  1.00 13.95 ? 243 THR B CA  1 
ATOM   931  C C   . THR B 1 20 ? 5.408   61.718 21.662  1.00 13.89 ? 243 THR B C   1 
ATOM   932  O O   . THR B 1 20 ? 4.378   62.384 21.618  1.00 13.78 ? 243 THR B O   1 
ATOM   933  C CB  . THR B 1 20 ? 7.300   63.245 21.051  1.00 14.56 ? 243 THR B CB  1 
ATOM   934  O OG1 . THR B 1 20 ? 8.425   63.375 20.157  1.00 17.80 ? 243 THR B OG1 1 
ATOM   935  C CG2 . THR B 1 20 ? 7.808   63.229 22.474  1.00 17.29 ? 243 THR B CG2 1 
ATOM   936  N N   . LEU B 1 21 ? 5.625   60.815 22.624  1.00 13.28 ? 244 LEU B N   1 
ATOM   937  C CA  . LEU B 1 21 ? 4.705   60.635 23.740  1.00 14.09 ? 244 LEU B CA  1 
ATOM   938  C C   . LEU B 1 21 ? 5.254   61.397 24.922  1.00 13.66 ? 244 LEU B C   1 
ATOM   939  O O   . LEU B 1 21 ? 6.365   61.180 25.332  1.00 13.82 ? 244 LEU B O   1 
ATOM   940  C CB  . LEU B 1 21 ? 4.599   59.164 24.080  1.00 14.49 ? 244 LEU B CB  1 
ATOM   941  C CG  . LEU B 1 21 ? 3.782   58.849 25.331  1.00 16.86 ? 244 LEU B CG  1 
ATOM   942  C CD1 . LEU B 1 21 ? 2.356   59.460 25.315  1.00 17.71 ? 244 LEU B CD1 1 
ATOM   943  C CD2 . LEU B 1 21 ? 3.730   57.320 25.521  1.00 18.76 ? 244 LEU B CD2 1 
ATOM   944  N N   A VAL B 1 22 ? 4.423   62.302 25.455  0.50 15.15 ? 245 VAL B N   1 
ATOM   945  N N   B VAL B 1 22 ? 4.481   62.332 25.452  0.50 15.46 ? 245 VAL B N   1 
ATOM   946  C CA  A VAL B 1 22 ? 4.743   63.016 26.711  0.50 15.13 ? 245 VAL B CA  1 
ATOM   947  C CA  B VAL B 1 22 ? 4.824   62.875 26.777  0.50 16.05 ? 245 VAL B CA  1 
ATOM   948  C C   A VAL B 1 22 ? 3.597   62.901 27.684  0.50 15.15 ? 245 VAL B C   1 
ATOM   949  C C   B VAL B 1 22 ? 3.570   62.739 27.627  0.50 15.88 ? 245 VAL B C   1 
ATOM   950  O O   A VAL B 1 22 ? 2.545   63.391 27.392  0.50 14.24 ? 245 VAL B O   1 
ATOM   951  O O   B VAL B 1 22 ? 2.442   62.971 27.179  0.50 15.76 ? 245 VAL B O   1 
ATOM   952  C CB  A VAL B 1 22 ? 4.991   64.514 26.479  0.50 16.92 ? 245 VAL B CB  1 
ATOM   953  C CB  B VAL B 1 22 ? 5.362   64.312 26.706  0.50 17.36 ? 245 VAL B CB  1 
ATOM   954  C CG1 A VAL B 1 22 ? 5.476   65.123 27.806  0.50 18.09 ? 245 VAL B CG1 1 
ATOM   955  C CG1 B VAL B 1 22 ? 6.751   64.399 26.004  0.50 17.47 ? 245 VAL B CG1 1 
ATOM   956  C CG2 A VAL B 1 22 ? 5.995   64.744 25.351  0.50 17.73 ? 245 VAL B CG2 1 
ATOM   957  C CG2 B VAL B 1 22 ? 4.374   65.116 25.963  0.50 20.29 ? 245 VAL B CG2 1 
ATOM   958  N N   . LEU B 1 23 ? 3.805   62.243 28.828  1.00 14.39 ? 246 LEU B N   1 
ATOM   959  C CA  . LEU B 1 23 ? 2.808   62.154 29.892  1.00 13.94 ? 246 LEU B CA  1 
ATOM   960  C C   . LEU B 1 23 ? 3.383   62.855 31.112  1.00 13.74 ? 246 LEU B C   1 
ATOM   961  O O   . LEU B 1 23 ? 4.572   62.735 31.397  1.00 14.28 ? 246 LEU B O   1 
ATOM   962  C CB  . LEU B 1 23 ? 2.520   60.677 30.197  1.00 15.44 ? 246 LEU B CB  1 
ATOM   963  C CG  . LEU B 1 23 ? 1.667   59.985 29.161  1.00 16.22 ? 246 LEU B CG  1 
ATOM   964  C CD1 . LEU B 1 23 ? 1.645   58.476 29.366  1.00 18.97 ? 246 LEU B CD1 1 
ATOM   965  C CD2 . LEU B 1 23 ? 0.202   60.503 29.162  1.00 20.42 ? 246 LEU B CD2 1 
ATOM   966  N N   . GLN B 1 24 ? 2.535   63.589 31.834  1.00 13.75 ? 247 GLN B N   1 
ATOM   967  C CA  . GLN B 1 24 ? 3.002   64.315 32.987  1.00 13.24 ? 247 GLN B CA  1 
ATOM   968  C C   . GLN B 1 24 ? 2.004   64.160 34.145  1.00 13.08 ? 247 GLN B C   1 
ATOM   969  O O   . GLN B 1 24 ? 0.804   64.173 33.919  1.00 14.68 ? 247 GLN B O   1 
ATOM   970  C CB  . GLN B 1 24 ? 3.130   65.816 32.645  1.00 14.38 ? 247 GLN B CB  1 
ATOM   971  C CG  . GLN B 1 24 ? 3.770   66.644 33.775  1.00 15.88 ? 247 GLN B CG  1 
ATOM   972  C CD  . GLN B 1 24 ? 4.186   68.082 33.351  1.00 16.33 ? 247 GLN B CD  1 
ATOM   973  O OE1 . GLN B 1 24 ? 3.660   68.614 32.377  1.00 22.32 ? 247 GLN B OE1 1 
ATOM   974  N NE2 . GLN B 1 24 ? 5.138   68.644 34.022  1.00 16.28 ? 247 GLN B NE2 1 
ATOM   975  N N   . CYS B 1 25 ? 2.546   64.010 35.347  1.00 12.98 ? 248 CYS B N   1 
ATOM   976  C CA  . CYS B 1 25 ? 1.721   64.006 36.573  1.00 13.38 ? 248 CYS B CA  1 
ATOM   977  C C   . CYS B 1 25 ? 2.521   64.742 37.608  1.00 13.86 ? 248 CYS B C   1 
ATOM   978  O O   . CYS B 1 25 ? 3.700   64.450 37.812  1.00 14.24 ? 248 CYS B O   1 
ATOM   979  C CB  . CYS B 1 25 ? 1.495   62.540 37.013  1.00 13.95 ? 248 CYS B CB  1 
ATOM   980  S SG  . CYS B 1 25 ? 0.426   62.459 38.464  1.00 15.40 ? 248 CYS B SG  1 
ATOM   981  N N   . VAL B 1 26 ? 1.904   65.758 38.221  1.00 14.71 ? 249 VAL B N   1 
ATOM   982  C CA  . VAL B 1 26 ? 2.601   66.559 39.239  1.00 15.34 ? 249 VAL B CA  1 
ATOM   983  C C   . VAL B 1 26 ? 1.745   66.603 40.480  1.00 14.85 ? 249 VAL B C   1 
ATOM   984  O O   . VAL B 1 26 ? 0.538   66.887 40.387  1.00 16.37 ? 249 VAL B O   1 
ATOM   985  C CB  . VAL B 1 26 ? 2.873   67.996 38.763  1.00 16.52 ? 249 VAL B CB  1 
ATOM   986  C CG1 . VAL B 1 26 ? 3.698   68.753 39.825  1.00 19.15 ? 249 VAL B CG1 1 
ATOM   987  C CG2 . VAL B 1 26 ? 3.602   68.011 37.439  1.00 18.24 ? 249 VAL B CG2 1 
ATOM   988  N N   . ALA B 1 27 ? 2.345   66.331 41.633  1.00 14.90 ? 250 ALA B N   1 
ATOM   989  C CA  . ALA B 1 27 ? 1.661   66.387 42.894  1.00 15.88 ? 250 ALA B CA  1 
ATOM   990  C C   . ALA B 1 27 ? 2.428   67.318 43.849  1.00 15.55 ? 250 ALA B C   1 
ATOM   991  O O   . ALA B 1 27 ? 3.606   67.590 43.669  1.00 16.99 ? 250 ALA B O   1 
ATOM   992  C CB  . ALA B 1 27 ? 1.549   65.013 43.523  1.00 16.01 ? 250 ALA B CB  1 
ATOM   993  N N   . VAL B 1 28 ? 1.684   67.779 44.843  1.00 17.62 ? 251 VAL B N   1 
ATOM   994  C CA  . VAL B 1 28 ? 2.216   68.504 45.975  1.00 19.29 ? 251 VAL B CA  1 
ATOM   995  C C   . VAL B 1 28 ? 2.028   67.633 47.219  1.00 17.60 ? 251 VAL B C   1 
ATOM   996  O O   . VAL B 1 28 ? 1.248   66.695 47.199  1.00 17.77 ? 251 VAL B O   1 
ATOM   997  C CB  . VAL B 1 28 ? 1.492   69.901 46.172  1.00 20.75 ? 251 VAL B CB  1 
ATOM   998  C CG1 . VAL B 1 28 ? 1.697   70.834 44.963  1.00 25.36 ? 251 VAL B CG1 1 
ATOM   999  C CG2 . VAL B 1 28 ? 0.010   69.743 46.469  1.00 22.19 ? 251 VAL B CG2 1 
ATOM   1000 N N   . GLY B 1 29 ? 2.741   67.964 48.279  1.00 19.11 ? 252 GLY B N   1 
ATOM   1001 C CA  . GLY B 1 29 ? 2.582   67.271 49.545  1.00 18.46 ? 252 GLY B CA  1 
ATOM   1002 C C   . GLY B 1 29 ? 3.879   67.273 50.301  1.00 17.78 ? 252 GLY B C   1 
ATOM   1003 O O   . GLY B 1 29 ? 4.967   67.465 49.739  1.00 17.61 ? 252 GLY B O   1 
ATOM   1004 N N   . SER B 1 30 ? 3.784   66.957 51.577  1.00 16.80 ? 253 SER B N   1 
ATOM   1005 C CA  . SER B 1 30 ? 4.969   66.754 52.384  1.00 17.82 ? 253 SER B CA  1 
ATOM   1006 C C   . SER B 1 30 ? 4.647   65.602 53.307  1.00 16.95 ? 253 SER B C   1 
ATOM   1007 O O   . SER B 1 30 ? 3.678   65.722 54.065  1.00 19.28 ? 253 SER B O   1 
ATOM   1008 C CB  . SER B 1 30 ? 5.297   68.020 53.204  1.00 18.43 ? 253 SER B CB  1 
ATOM   1009 O OG  . SER B 1 30 ? 6.444   67.790 54.023  1.00 23.43 ? 253 SER B OG  1 
ATOM   1010 N N   . PRO B 1 31 ? 5.479   64.546 53.346  1.00 16.40 ? 254 PRO B N   1 
ATOM   1011 C CA  . PRO B 1 31 ? 6.740   64.424 52.598  1.00 15.43 ? 254 PRO B CA  1 
ATOM   1012 C C   . PRO B 1 31 ? 6.521   64.493 51.089  1.00 13.69 ? 254 PRO B C   1 
ATOM   1013 O O   . PRO B 1 31 ? 5.444   64.230 50.552  1.00 13.98 ? 254 PRO B O   1 
ATOM   1014 C CB  . PRO B 1 31 ? 7.286   63.046 52.991  1.00 17.74 ? 254 PRO B CB  1 
ATOM   1015 C CG  . PRO B 1 31 ? 6.663   62.810 54.353  1.00 18.84 ? 254 PRO B CG  1 
ATOM   1016 C CD  . PRO B 1 31 ? 5.282   63.429 54.284  1.00 17.43 ? 254 PRO B CD  1 
ATOM   1017 N N   . ILE B 1 32 ? 7.622   64.837 50.435  1.00 14.47 ? 255 ILE B N   1 
ATOM   1018 C CA  . ILE B 1 32 ? 7.619   65.081 48.985  1.00 15.24 ? 255 ILE B CA  1 
ATOM   1019 C C   . ILE B 1 32 ? 7.117   63.842 48.251  1.00 13.79 ? 255 ILE B C   1 
ATOM   1020 O O   . ILE B 1 32 ? 7.618   62.750 48.488  1.00 15.54 ? 255 ILE B O   1 
ATOM   1021 C CB  . ILE B 1 32 ? 9.020   65.449 48.476  1.00 15.74 ? 255 ILE B CB  1 
ATOM   1022 C CG1 . ILE B 1 32 ? 9.468   66.698 49.134  1.00 17.87 ? 255 ILE B CG1 1 
ATOM   1023 C CG2 . ILE B 1 32 ? 9.034   65.579 46.962  1.00 18.24 ? 255 ILE B CG2 1 
ATOM   1024 C CD1 . ILE B 1 32 ? 10.975  66.852 49.020  1.00 20.37 ? 255 ILE B CD1 1 
ATOM   1025 N N   . PRO B 1 33 ? 6.140   63.993 47.341  1.00 13.40 ? 256 PRO B N   1 
ATOM   1026 C CA  . PRO B 1 33 ? 5.617   62.805 46.615  1.00 13.82 ? 256 PRO B CA  1 
ATOM   1027 C C   . PRO B 1 33 ? 6.654   62.138 45.752  1.00 12.66 ? 256 PRO B C   1 
ATOM   1028 O O   . PRO B 1 33 ? 7.527   62.786 45.146  1.00 14.31 ? 256 PRO B O   1 
ATOM   1029 C CB  . PRO B 1 33 ? 4.496   63.367 45.763  1.00 15.99 ? 256 PRO B CB  1 
ATOM   1030 C CG  . PRO B 1 33 ? 4.112   64.677 46.466  1.00 18.77 ? 256 PRO B CG  1 
ATOM   1031 C CD  . PRO B 1 33 ? 5.325   65.201 47.118  1.00 15.73 ? 256 PRO B CD  1 
ATOM   1032 N N   . HIS B 1 34 ? 6.524   60.824 45.649  1.00 12.07 ? 257 HIS B N   1 
ATOM   1033 C CA  . HIS B 1 34 ? 7.216   59.989 44.700  1.00 12.44 ? 257 HIS B CA  1 
ATOM   1034 C C   . HIS B 1 34 ? 6.218   59.529 43.644  1.00 11.25 ? 257 HIS B C   1 
ATOM   1035 O O   . HIS B 1 34 ? 5.012   59.545 43.855  1.00 12.22 ? 257 HIS B O   1 
ATOM   1036 C CB  . HIS B 1 34 ? 7.734   58.744 45.387  1.00 15.74 ? 257 HIS B CB  1 
ATOM   1037 C CG  . HIS B 1 34 ? 8.666   59.029 46.491  1.00 19.29 ? 257 HIS B CG  1 
ATOM   1038 N ND1 . HIS B 1 34 ? 10.015  59.052 46.282  1.00 22.70 ? 257 HIS B ND1 1 
ATOM   1039 C CD2 . HIS B 1 34 ? 8.466   59.381 47.781  1.00 22.98 ? 257 HIS B CD2 1 
ATOM   1040 C CE1 . HIS B 1 34 ? 10.623  59.357 47.420  1.00 25.50 ? 257 HIS B CE1 1 
ATOM   1041 N NE2 . HIS B 1 34 ? 9.699   59.551 48.347  1.00 25.41 ? 257 HIS B NE2 1 
ATOM   1042 N N   . TYR B 1 35 ? 6.750   59.043 42.524  1.00 11.99 ? 258 TYR B N   1 
ATOM   1043 C CA  . TYR B 1 35 ? 5.940   58.732 41.324  1.00 11.46 ? 258 TYR B CA  1 
ATOM   1044 C C   . TYR B 1 35 ? 6.352   57.366 40.814  1.00 12.97 ? 258 TYR B C   1 
ATOM   1045 O O   . TYR B 1 35 ? 7.549   57.002 40.847  1.00 13.11 ? 258 TYR B O   1 
ATOM   1046 C CB  . TYR B 1 35 ? 6.241   59.765 40.236  1.00 12.35 ? 258 TYR B CB  1 
ATOM   1047 C CG  . TYR B 1 35 ? 5.883   61.169 40.640  1.00 11.46 ? 258 TYR B CG  1 
ATOM   1048 C CD1 . TYR B 1 35 ? 4.639   61.688 40.383  1.00 12.36 ? 258 TYR B CD1 1 
ATOM   1049 C CD2 . TYR B 1 35 ? 6.774   61.941 41.362  1.00 13.09 ? 258 TYR B CD2 1 
ATOM   1050 C CE1 . TYR B 1 35 ? 4.295   62.987 40.844  1.00 13.05 ? 258 TYR B CE1 1 
ATOM   1051 C CE2 . TYR B 1 35 ? 6.488   63.197 41.845  1.00 13.74 ? 258 TYR B CE2 1 
ATOM   1052 C CZ  . TYR B 1 35 ? 5.234   63.726 41.593  1.00 12.67 ? 258 TYR B CZ  1 
ATOM   1053 O OH  . TYR B 1 35 ? 4.885   64.999 42.059  1.00 15.01 ? 258 TYR B OH  1 
ATOM   1054 N N   . GLN B 1 36 ? 5.417   56.644 40.194  1.00 11.94 ? 259 GLN B N   1 
ATOM   1055 C CA  . GLN B 1 36 ? 5.781   55.442 39.449  1.00 11.86 ? 259 GLN B CA  1 
ATOM   1056 C C   . GLN B 1 36 ? 4.720   55.320 38.348  1.00 12.28 ? 259 GLN B C   1 
ATOM   1057 O O   . GLN B 1 36 ? 3.535   55.233 38.637  1.00 12.22 ? 259 GLN B O   1 
ATOM   1058 C CB  . GLN B 1 36 ? 5.737   54.217 40.335  1.00 14.31 ? 259 GLN B CB  1 
ATOM   1059 C CG  . GLN B 1 36 ? 5.955   52.869 39.558  1.00 15.17 ? 259 GLN B CG  1 
ATOM   1060 C CD  . GLN B 1 36 ? 7.262   52.764 38.799  1.00 15.18 ? 259 GLN B CD  1 
ATOM   1061 O OE1 . GLN B 1 36 ? 8.346   52.840 39.370  1.00 16.67 ? 259 GLN B OE1 1 
ATOM   1062 N NE2 . GLN B 1 36 ? 7.157   52.607 37.479  1.00 17.61 ? 259 GLN B NE2 1 
ATOM   1063 N N   . TRP B 1 37 ? 5.169   55.269 37.092  1.00 11.58 ? 260 TRP B N   1 
ATOM   1064 C CA  . TRP B 1 37 ? 4.258   55.119 35.973  1.00 12.92 ? 260 TRP B CA  1 
ATOM   1065 C C   . TRP B 1 37 ? 3.957   53.658 35.660  1.00 13.50 ? 260 TRP B C   1 
ATOM   1066 O O   . TRP B 1 37 ? 4.800   52.758 35.867  1.00 14.80 ? 260 TRP B O   1 
ATOM   1067 C CB  . TRP B 1 37 ? 4.872   55.774 34.734  1.00 12.75 ? 260 TRP B CB  1 
ATOM   1068 C CG  . TRP B 1 37 ? 4.854   57.255 34.774  1.00 11.76 ? 260 TRP B CG  1 
ATOM   1069 C CD1 . TRP B 1 37 ? 5.842   58.086 35.251  1.00 11.61 ? 260 TRP B CD1 1 
ATOM   1070 C CD2 . TRP B 1 37 ? 3.779   58.093 34.377  1.00 12.24 ? 260 TRP B CD2 1 
ATOM   1071 N NE1 . TRP B 1 37 ? 5.425   59.383 35.148  1.00 12.00 ? 260 TRP B NE1 1 
ATOM   1072 C CE2 . TRP B 1 37 ? 4.158   59.406 34.646  1.00 11.92 ? 260 TRP B CE2 1 
ATOM   1073 C CE3 . TRP B 1 37 ? 2.527   57.861 33.815  1.00 12.88 ? 260 TRP B CE3 1 
ATOM   1074 C CZ2 . TRP B 1 37 ? 3.351   60.503 34.371  1.00 13.42 ? 260 TRP B CZ2 1 
ATOM   1075 C CZ3 . TRP B 1 37 ? 1.701   58.949 33.586  1.00 12.96 ? 260 TRP B CZ3 1 
ATOM   1076 C CH2 . TRP B 1 37 ? 2.100   60.246 33.879  1.00 13.38 ? 260 TRP B CH2 1 
ATOM   1077 N N   . PHE B 1 38 ? 2.748   53.442 35.146  1.00 14.31 ? 261 PHE B N   1 
ATOM   1078 C CA  . PHE B 1 38 ? 2.270   52.102 34.788  1.00 15.77 ? 261 PHE B CA  1 
ATOM   1079 C C   . PHE B 1 38 ? 1.701   52.172 33.401  1.00 16.07 ? 261 PHE B C   1 
ATOM   1080 O O   . PHE B 1 38 ? 1.113   53.171 32.990  1.00 15.96 ? 261 PHE B O   1 
ATOM   1081 C CB  . PHE B 1 38 ? 1.185   51.638 35.754  1.00 16.66 ? 261 PHE B CB  1 
ATOM   1082 C CG  . PHE B 1 38 ? 1.720   51.357 37.147  1.00 16.60 ? 261 PHE B CG  1 
ATOM   1083 C CD1 . PHE B 1 38 ? 2.111   50.071 37.520  1.00 18.64 ? 261 PHE B CD1 1 
ATOM   1084 C CD2 . PHE B 1 38 ? 1.938   52.392 38.053  1.00 15.40 ? 261 PHE B CD2 1 
ATOM   1085 C CE1 . PHE B 1 38 ? 2.673   49.805 38.803  1.00 19.54 ? 261 PHE B CE1 1 
ATOM   1086 C CE2 . PHE B 1 38 ? 2.481   52.115 39.321  1.00 16.59 ? 261 PHE B CE2 1 
ATOM   1087 C CZ  . PHE B 1 38 ? 2.902   50.840 39.665  1.00 17.60 ? 261 PHE B CZ  1 
ATOM   1088 N N   . LYS B 1 39 ? 1.896   51.073 32.682  1.00 17.27 ? 262 LYS B N   1 
ATOM   1089 C CA  . LYS B 1 39 ? 1.262   50.887 31.358  1.00 19.50 ? 262 LYS B CA  1 
ATOM   1090 C C   . LYS B 1 39 ? 0.636   49.483 31.377  1.00 21.83 ? 262 LYS B C   1 
ATOM   1091 O O   . LYS B 1 39 ? 1.311   48.505 31.678  1.00 20.73 ? 262 LYS B O   1 
ATOM   1092 C CB  . LYS B 1 39 ? 2.306   50.983 30.269  1.00 19.39 ? 262 LYS B CB  1 
ATOM   1093 C CG  . LYS B 1 39 ? 1.797   50.641 28.900  1.00 23.10 ? 262 LYS B CG  1 
ATOM   1094 C CD  . LYS B 1 39 ? 3.003   50.377 28.011  1.00 28.07 ? 262 LYS B CD  1 
ATOM   1095 C CE  . LYS B 1 39 ? 2.793   49.146 27.187  1.00 34.60 ? 262 LYS B CE  1 
ATOM   1096 N NZ  . LYS B 1 39 ? 2.241   49.570 25.887  1.00 36.32 ? 262 LYS B NZ  1 
ATOM   1097 N N   . ASN B 1 40 ? -0.625  49.365 30.960  1.00 22.24 ? 263 ASN B N   1 
ATOM   1098 C CA  . ASN B 1 40 ? -1.268  48.011 30.827  1.00 23.53 ? 263 ASN B CA  1 
ATOM   1099 C C   . ASN B 1 40 ? -0.988  47.166 32.065  1.00 25.26 ? 263 ASN B C   1 
ATOM   1100 O O   . ASN B 1 40 ? -0.555  45.993 31.962  1.00 26.32 ? 263 ASN B O   1 
ATOM   1101 C CB  . ASN B 1 40 ? -0.757  47.336 29.562  1.00 25.90 ? 263 ASN B CB  1 
ATOM   1102 C CG  . ASN B 1 40 ? -1.138  48.090 28.318  1.00 25.32 ? 263 ASN B CG  1 
ATOM   1103 O OD1 . ASN B 1 40 ? -2.052  48.896 28.351  1.00 26.71 ? 263 ASN B OD1 1 
ATOM   1104 N ND2 . ASN B 1 40 ? -0.440  47.835 27.213  1.00 32.11 ? 263 ASN B ND2 1 
ATOM   1105 N N   . GLU B 1 41 ? -1.203  47.789 33.219  1.00 25.36 ? 264 GLU B N   1 
ATOM   1106 C CA  . GLU B 1 41 ? -1.172  47.123 34.551  1.00 25.44 ? 264 GLU B CA  1 
ATOM   1107 C C   . GLU B 1 41 ? 0.212   46.752 35.055  1.00 25.24 ? 264 GLU B C   1 
ATOM   1108 O O   . GLU B 1 41 ? 0.344   46.170 36.148  1.00 27.30 ? 264 GLU B O   1 
ATOM   1109 C CB  . GLU B 1 41 ? -2.159  45.941 34.636  1.00 27.24 ? 264 GLU B CB  1 
ATOM   1110 C CG  . GLU B 1 41 ? -3.590  46.376 34.375  1.00 28.99 ? 264 GLU B CG  1 
ATOM   1111 C CD  . GLU B 1 41 ? -4.167  47.245 35.463  1.00 33.45 ? 264 GLU B CD  1 
ATOM   1112 O OE1 . GLU B 1 41 ? -3.723  47.135 36.628  1.00 37.74 ? 264 GLU B OE1 1 
ATOM   1113 O OE2 . GLU B 1 41 ? -5.115  48.013 35.182  1.00 35.69 ? 264 GLU B OE2 1 
ATOM   1114 N N   . LEU B 1 42 ? 1.237   47.135 34.320  1.00 21.08 ? 265 LEU B N   1 
ATOM   1115 C CA  . LEU B 1 42 ? 2.612   46.808 34.649  1.00 21.77 ? 265 LEU B CA  1 
ATOM   1116 C C   . LEU B 1 42 ? 3.444   48.078 34.918  1.00 20.29 ? 265 LEU B C   1 
ATOM   1117 O O   . LEU B 1 42 ? 3.327   49.046 34.181  1.00 18.77 ? 265 LEU B O   1 
ATOM   1118 C CB  . LEU B 1 42 ? 3.255   46.005 33.501  1.00 22.88 ? 265 LEU B CB  1 
ATOM   1119 C CG  . LEU B 1 42 ? 2.658   44.697 32.952  1.00 25.63 ? 265 LEU B CG  1 
ATOM   1120 C CD1 . LEU B 1 42 ? 3.284   44.259 31.621  1.00 28.82 ? 265 LEU B CD1 1 
ATOM   1121 C CD2 . LEU B 1 42 ? 2.827   43.623 33.976  1.00 28.77 ? 265 LEU B CD2 1 
ATOM   1122 N N   . PRO B 1 43 ? 4.368   48.035 35.906  1.00 20.28 ? 266 PRO B N   1 
ATOM   1123 C CA  . PRO B 1 43 ? 5.193   49.229 36.129  1.00 19.87 ? 266 PRO B CA  1 
ATOM   1124 C C   . PRO B 1 43 ? 6.172   49.427 34.981  1.00 19.63 ? 266 PRO B C   1 
ATOM   1125 O O   . PRO B 1 43 ? 6.746   48.442 34.473  1.00 21.11 ? 266 PRO B O   1 
ATOM   1126 C CB  . PRO B 1 43 ? 5.965   48.895 37.433  1.00 20.50 ? 266 PRO B CB  1 
ATOM   1127 C CG  . PRO B 1 43 ? 5.936   47.425 37.518  1.00 22.38 ? 266 PRO B CG  1 
ATOM   1128 C CD  . PRO B 1 43 ? 4.667   46.969 36.870  1.00 21.00 ? 266 PRO B CD  1 
ATOM   1129 N N   . LEU B 1 44 ? 6.332   50.663 34.552  1.00 17.73 ? 267 LEU B N   1 
ATOM   1130 C CA  . LEU B 1 44 ? 7.338   51.014 33.573  1.00 17.90 ? 267 LEU B CA  1 
ATOM   1131 C C   . LEU B 1 44 ? 8.618   51.195 34.325  1.00 19.80 ? 267 LEU B C   1 
ATOM   1132 O O   . LEU B 1 44 ? 8.765   52.157 35.104  1.00 19.24 ? 267 LEU B O   1 
ATOM   1133 C CB  . LEU B 1 44 ? 6.977   52.278 32.841  1.00 17.48 ? 267 LEU B CB  1 
ATOM   1134 C CG  . LEU B 1 44 ? 5.795   52.120 31.911  1.00 17.26 ? 267 LEU B CG  1 
ATOM   1135 C CD1 . LEU B 1 44 ? 5.177   53.453 31.544  1.00 18.22 ? 267 LEU B CD1 1 
ATOM   1136 C CD2 . LEU B 1 44 ? 6.320   51.492 30.623  1.00 21.05 ? 267 LEU B CD2 1 
ATOM   1137 N N   . THR B 1 45 ? 9.540   50.263 34.093  1.00 21.87 ? 268 THR B N   1 
ATOM   1138 C CA  . THR B 1 45 ? 10.728  50.239 34.879  1.00 23.61 ? 268 THR B CA  1 
ATOM   1139 C C   . THR B 1 45 ? 11.479  51.562 34.817  1.00 22.55 ? 268 THR B C   1 
ATOM   1140 O O   . THR B 1 45 ? 11.701  52.135 33.747  1.00 25.61 ? 268 THR B O   1 
ATOM   1141 C CB  . THR B 1 45 ? 11.622  48.999 34.542  1.00 24.12 ? 268 THR B CB  1 
ATOM   1142 O OG1 . THR B 1 45 ? 12.664  48.935 35.520  1.00 29.09 ? 268 THR B OG1 1 
ATOM   1143 C CG2 . THR B 1 45 ? 12.226  49.090 33.147  1.00 28.40 ? 268 THR B CG2 1 
ATOM   1144 N N   . HIS B 1 46 ? 11.873  52.047 35.973  1.00 22.64 ? 269 HIS B N   1 
ATOM   1145 C CA  . HIS B 1 46 ? 12.703  53.227 36.106  1.00 23.42 ? 269 HIS B CA  1 
ATOM   1146 C C   . HIS B 1 46 ? 11.985  54.469 35.644  1.00 21.54 ? 269 HIS B C   1 
ATOM   1147 O O   . HIS B 1 46 ? 12.637  55.457 35.399  1.00 25.92 ? 269 HIS B O   1 
ATOM   1148 C CB  . HIS B 1 46 ? 14.086  53.097 35.438  1.00 26.04 ? 269 HIS B CB  1 
ATOM   1149 N N   . GLU B 1 47 ? 10.649  54.439 35.582  1.00 17.14 ? 270 GLU B N   1 
ATOM   1150 C CA  . GLU B 1 47 ? 9.912   55.651 35.238  1.00 14.62 ? 270 GLU B CA  1 
ATOM   1151 C C   . GLU B 1 47 ? 9.275   56.184 36.488  1.00 13.96 ? 270 GLU B C   1 
ATOM   1152 O O   . GLU B 1 47 ? 8.125   55.898 36.800  1.00 14.63 ? 270 GLU B O   1 
ATOM   1153 C CB  . GLU B 1 47 ? 8.918   55.408 34.113  1.00 14.74 ? 270 GLU B CB  1 
ATOM   1154 C CG  . GLU B 1 47 ? 9.617   55.014 32.800  1.00 16.07 ? 270 GLU B CG  1 
ATOM   1155 C CD  . GLU B 1 47 ? 10.603  56.015 32.148  1.00 16.08 ? 270 GLU B CD  1 
ATOM   1156 O OE1 . GLU B 1 47 ? 10.475  57.218 32.581  1.00 17.51 ? 270 GLU B OE1 1 
ATOM   1157 O OE2 . GLU B 1 47 ? 11.382  55.609 31.232  1.00 27.86 ? 270 GLU B OE2 1 
ATOM   1158 N N   . THR B 1 48 ? 10.077  56.971 37.222  1.00 14.64 ? 271 THR B N   1 
ATOM   1159 C CA  . THR B 1 48 ? 9.714   57.457 38.567  1.00 14.77 ? 271 THR B CA  1 
ATOM   1160 C C   . THR B 1 48 ? 9.734   58.948 38.619  1.00 14.55 ? 271 THR B C   1 
ATOM   1161 O O   . THR B 1 48 ? 9.900   59.546 39.683  1.00 16.03 ? 271 THR B O   1 
ATOM   1162 C CB  . THR B 1 48 ? 10.656  56.844 39.602  1.00 16.31 ? 271 THR B CB  1 
ATOM   1163 O OG1 . THR B 1 48 ? 11.998  57.222 39.275  1.00 18.61 ? 271 THR B OG1 1 
ATOM   1164 C CG2 . THR B 1 48 ? 10.489  55.346 39.646  1.00 17.49 ? 271 THR B CG2 1 
ATOM   1165 N N   A LYS B 1 49 ? 9.559   59.583 37.475  0.50 15.34 ? 272 LYS B N   1 
ATOM   1166 N N   B LYS B 1 49 ? 9.614   59.577 37.452  0.50 14.54 ? 272 LYS B N   1 
ATOM   1167 C CA  A LYS B 1 49 ? 9.568   61.028 37.438  0.50 16.37 ? 272 LYS B CA  1 
ATOM   1168 C CA  B LYS B 1 49 ? 9.611   61.040 37.318  0.50 14.65 ? 272 LYS B CA  1 
ATOM   1169 C C   A LYS B 1 49 ? 8.253   61.595 36.936  0.50 14.26 ? 272 LYS B C   1 
ATOM   1170 C C   B LYS B 1 49 ? 8.233   61.577 37.027  0.50 13.45 ? 272 LYS B C   1 
ATOM   1171 O O   A LYS B 1 49 ? 7.409   60.863 36.362  0.50 12.90 ? 272 LYS B O   1 
ATOM   1172 O O   B LYS B 1 49 ? 7.342   60.809 36.661  0.50 11.63 ? 272 LYS B O   1 
ATOM   1173 C CB  A LYS B 1 49 ? 10.773  61.526 36.623  0.50 17.02 ? 272 LYS B CB  1 
ATOM   1174 C CB  B LYS B 1 49 ? 10.565  61.476 36.205  0.50 15.42 ? 272 LYS B CB  1 
ATOM   1175 C CG  A LYS B 1 49 ? 12.128  61.037 37.125  0.50 18.75 ? 272 LYS B CG  1 
ATOM   1176 C CG  B LYS B 1 49 ? 11.997  61.150 36.468  0.50 16.88 ? 272 LYS B CG  1 
ATOM   1177 C CD  A LYS B 1 49 ? 13.253  61.707 36.349  0.50 19.11 ? 272 LYS B CD  1 
ATOM   1178 C CD  B LYS B 1 49 ? 12.497  61.724 37.795  0.50 21.16 ? 272 LYS B CD  1 
ATOM   1179 C CE  A LYS B 1 49 ? 14.632  61.506 37.019  0.50 21.46 ? 272 LYS B CE  1 
ATOM   1180 C CE  B LYS B 1 49 ? 13.983  61.483 37.962  0.50 24.59 ? 272 LYS B CE  1 
ATOM   1181 N NZ  A LYS B 1 49 ? 14.536  61.377 38.505  0.50 27.28 ? 272 LYS B NZ  1 
ATOM   1182 N NZ  B LYS B 1 49 ? 14.850  62.321 37.080  0.50 26.11 ? 272 LYS B NZ  1 
ATOM   1183 N N   . LYS B 1 50 ? 8.041   62.888 37.200  1.00 14.74 ? 273 LYS B N   1 
ATOM   1184 C CA  . LYS B 1 50 ? 6.797   63.532 36.870  1.00 15.14 ? 273 LYS B CA  1 
ATOM   1185 C C   . LYS B 1 50 ? 6.472   63.407 35.380  1.00 14.03 ? 273 LYS B C   1 
ATOM   1186 O O   . LYS B 1 50 ? 5.302   63.365 35.003  1.00 15.22 ? 273 LYS B O   1 
ATOM   1187 C CB  . LYS B 1 50 ? 6.825   65.017 37.272  1.00 15.74 ? 273 LYS B CB  1 
ATOM   1188 C CG  . LYS B 1 50 ? 6.876   65.223 38.783  1.00 16.59 ? 273 LYS B CG  1 
ATOM   1189 C CD  . LYS B 1 50 ? 7.104   66.722 39.145  1.00 18.51 ? 273 LYS B CD  1 
ATOM   1190 C CE  . LYS B 1 50 ? 8.519   67.168 39.048  1.00 23.48 ? 273 LYS B CE  1 
ATOM   1191 N NZ  . LYS B 1 50 ? 9.365   66.499 40.083  1.00 26.44 ? 273 LYS B NZ  1 
ATOM   1192 N N   . LEU B 1 51 ? 7.518   63.376 34.543  1.00 14.49 ? 274 LEU B N   1 
ATOM   1193 C CA  . LEU B 1 51 ? 7.349   63.221 33.107  1.00 15.09 ? 274 LEU B CA  1 
ATOM   1194 C C   . LEU B 1 51 ? 7.725   61.812 32.681  1.00 14.65 ? 274 LEU B C   1 
ATOM   1195 O O   . LEU B 1 51 ? 8.710   61.235 33.178  1.00 15.67 ? 274 LEU B O   1 
ATOM   1196 C CB  . LEU B 1 51 ? 8.299   64.127 32.355  1.00 16.76 ? 274 LEU B CB  1 
ATOM   1197 C CG  . LEU B 1 51 ? 8.002   65.592 32.469  1.00 18.51 ? 274 LEU B CG  1 
ATOM   1198 C CD1 . LEU B 1 51 ? 9.129   66.323 31.767  1.00 22.45 ? 274 LEU B CD1 1 
ATOM   1199 C CD2 . LEU B 1 51 ? 6.712   65.902 31.769  1.00 21.32 ? 274 LEU B CD2 1 
ATOM   1200 N N   . TYR B 1 52 ? 6.921   61.249 31.776  1.00 14.77 ? 275 TYR B N   1 
ATOM   1201 C CA  . TYR B 1 52 ? 7.273   60.006 31.102  1.00 15.22 ? 275 TYR B CA  1 
ATOM   1202 C C   . TYR B 1 52 ? 7.289   60.389 29.622  1.00 15.95 ? 275 TYR B C   1 
ATOM   1203 O O   . TYR B 1 52 ? 6.306   60.903 29.099  1.00 15.10 ? 275 TYR B O   1 
ATOM   1204 C CB  . TYR B 1 52 ? 6.237   58.915 31.362  1.00 16.48 ? 275 TYR B CB  1 
ATOM   1205 C CG  . TYR B 1 52 ? 6.476   57.700 30.493  1.00 15.41 ? 275 TYR B CG  1 
ATOM   1206 C CD1 . TYR B 1 52 ? 7.663   56.984 30.577  1.00 17.91 ? 275 TYR B CD1 1 
ATOM   1207 C CD2 . TYR B 1 52 ? 5.575   57.308 29.515  1.00 17.04 ? 275 TYR B CD2 1 
ATOM   1208 C CE1 . TYR B 1 52 ? 7.912   55.900 29.761  1.00 18.02 ? 275 TYR B CE1 1 
ATOM   1209 C CE2 . TYR B 1 52 ? 5.804   56.220 28.717  1.00 17.88 ? 275 TYR B CE2 1 
ATOM   1210 C CZ  . TYR B 1 52 ? 6.966   55.509 28.846  1.00 16.29 ? 275 TYR B CZ  1 
ATOM   1211 O OH  . TYR B 1 52 ? 7.204   54.439 28.016  1.00 18.14 ? 275 TYR B OH  1 
ATOM   1212 N N   A MET B 1 53 ? 8.394   60.033 28.972  0.35 17.78 ? 276 MET B N   1 
ATOM   1213 N N   B MET B 1 53 ? 8.419   60.261 28.926  0.35 17.68 ? 276 MET B N   1 
ATOM   1214 N N   C MET B 1 53 ? 8.406   60.110 28.959  0.30 16.89 ? 276 MET B N   1 
ATOM   1215 C CA  A MET B 1 53 ? 8.693   60.502 27.642  0.35 18.84 ? 276 MET B CA  1 
ATOM   1216 C CA  B MET B 1 53 ? 8.447   60.684 27.508  0.35 17.96 ? 276 MET B CA  1 
ATOM   1217 C CA  C MET B 1 53 ? 8.614   60.585 27.607  0.30 16.15 ? 276 MET B CA  1 
ATOM   1218 C C   A MET B 1 53 ? 9.118   59.332 26.758  0.35 16.46 ? 276 MET B C   1 
ATOM   1219 C C   B MET B 1 53 ? 9.213   59.690 26.662  0.35 15.93 ? 276 MET B C   1 
ATOM   1220 C C   C MET B 1 53 ? 9.150   59.444 26.745  0.30 15.32 ? 276 MET B C   1 
ATOM   1221 O O   A MET B 1 53 ? 9.894   58.443 27.171  0.35 20.19 ? 276 MET B O   1 
ATOM   1222 O O   B MET B 1 53 ? 10.327  59.312 27.020  0.35 17.73 ? 276 MET B O   1 
ATOM   1223 O O   C MET B 1 53 ? 10.050  58.699 27.168  0.30 19.06 ? 276 MET B O   1 
ATOM   1224 C CB  A MET B 1 53 ? 9.820   61.554 27.690  0.35 19.23 ? 276 MET B CB  1 
ATOM   1225 C CB  B MET B 1 53 ? 9.114   62.049 27.317  0.35 18.88 ? 276 MET B CB  1 
ATOM   1226 C CB  C MET B 1 53 ? 9.630   61.739 27.610  0.30 17.70 ? 276 MET B CB  1 
ATOM   1227 C CG  A MET B 1 53 ? 9.384   62.840 28.401  0.35 20.65 ? 276 MET B CG  1 
ATOM   1228 C CG  B MET B 1 53 ? 8.421   63.178 27.976  0.35 21.38 ? 276 MET B CG  1 
ATOM   1229 C CG  C MET B 1 53 ? 9.784   62.425 26.264  0.30 17.23 ? 276 MET B CG  1 
ATOM   1230 S SD  A MET B 1 53 ? 10.399  64.270 28.036  0.35 25.59 ? 276 MET B SD  1 
ATOM   1231 S SD  B MET B 1 53 ? 9.453   64.619 28.212  0.35 24.51 ? 276 MET B SD  1 
ATOM   1232 S SD  C MET B 1 53 ? 10.934  61.549 25.183  0.30 20.06 ? 276 MET B SD  1 
ATOM   1233 C CE  A MET B 1 53 ? 9.299   65.059 26.850  0.35 17.47 ? 276 MET B CE  1 
ATOM   1234 C CE  B MET B 1 53 ? 10.915  63.958 29.022  0.35 23.81 ? 276 MET B CE  1 
ATOM   1235 C CE  C MET B 1 53 ? 12.539  62.041 25.822  0.30 18.44 ? 276 MET B CE  1 
ATOM   1236 N N   . VAL B 1 54 ? 8.587   59.326 25.543  1.00 15.92 ? 277 VAL B N   1 
ATOM   1237 C CA  . VAL B 1 54 ? 9.101   58.397 24.537  1.00 15.80 ? 277 VAL B CA  1 
ATOM   1238 C C   . VAL B 1 54 ? 9.249   59.178 23.239  1.00 16.57 ? 277 VAL B C   1 
ATOM   1239 O O   . VAL B 1 54 ? 8.295   59.677 22.699  1.00 16.36 ? 277 VAL B O   1 
ATOM   1240 C CB  . VAL B 1 54 ? 8.129   57.214 24.276  1.00 16.65 ? 277 VAL B CB  1 
ATOM   1241 C CG1 . VAL B 1 54 ? 8.673   56.278 23.166  1.00 19.31 ? 277 VAL B CG1 1 
ATOM   1242 C CG2 . VAL B 1 54 ? 7.847   56.411 25.541  1.00 19.17 ? 277 VAL B CG2 1 
ATOM   1243 N N   . PRO B 1 55 ? 10.482  59.315 22.733  1.00 17.29 ? 278 PRO B N   1 
ATOM   1244 C CA  . PRO B 1 55 ? 10.745  60.221 21.631  1.00 19.81 ? 278 PRO B CA  1 
ATOM   1245 C C   . PRO B 1 55 ? 10.119  59.957 20.347  1.00 21.06 ? 278 PRO B C   1 
ATOM   1246 O O   . PRO B 1 55 ? 9.673   60.892 19.686  1.00 21.98 ? 278 PRO B O   1 
ATOM   1247 C CB  . PRO B 1 55 ? 12.266  60.264 21.499  1.00 21.84 ? 278 PRO B CB  1 
ATOM   1248 C CG  . PRO B 1 55 ? 12.761  59.074 22.158  1.00 21.61 ? 278 PRO B CG  1 
ATOM   1249 C CD  . PRO B 1 55 ? 11.741  58.759 23.268  1.00 19.40 ? 278 PRO B CD  1 
ATOM   1250 N N   . TYR B 1 56 ? 10.103  58.692 19.938  1.00 19.32 ? 279 TYR B N   1 
ATOM   1251 C CA  . TYR B 1 56 ? 9.602   58.300 18.632  1.00 21.60 ? 279 TYR B CA  1 
ATOM   1252 C C   . TYR B 1 56 ? 8.747   57.088 18.943  1.00 20.53 ? 279 TYR B C   1 
ATOM   1253 O O   . TYR B 1 56 ? 9.284   55.985 19.266  1.00 23.08 ? 279 TYR B O   1 
ATOM   1254 C CB  . TYR B 1 56 ? 10.728  57.797 17.673  1.00 24.44 ? 279 TYR B CB  1 
ATOM   1255 C CG  . TYR B 1 56 ? 11.779  58.803 17.278  1.00 27.69 ? 279 TYR B CG  1 
ATOM   1256 C CD1 . TYR B 1 56 ? 11.558  59.680 16.226  1.00 30.55 ? 279 TYR B CD1 1 
ATOM   1257 C CD2 . TYR B 1 56 ? 13.004  58.840 17.930  1.00 26.74 ? 279 TYR B CD2 1 
ATOM   1258 C CE1 . TYR B 1 56 ? 12.521  60.598 15.866  1.00 33.63 ? 279 TYR B CE1 1 
ATOM   1259 C CE2 . TYR B 1 56 ? 13.949  59.779 17.611  1.00 30.03 ? 279 TYR B CE2 1 
ATOM   1260 C CZ  . TYR B 1 56 ? 13.713  60.627 16.573  1.00 31.16 ? 279 TYR B CZ  1 
ATOM   1261 O OH  . TYR B 1 56 ? 14.670  61.543 16.245  1.00 33.34 ? 279 TYR B OH  1 
ATOM   1262 N N   . VAL B 1 57 ? 7.451   57.250 18.900  1.00 18.09 ? 280 VAL B N   1 
ATOM   1263 C CA  . VAL B 1 57 ? 6.553   56.161 19.277  1.00 19.49 ? 280 VAL B CA  1 
ATOM   1264 C C   . VAL B 1 57 ? 6.255   55.212 18.143  1.00 20.13 ? 280 VAL B C   1 
ATOM   1265 O O   . VAL B 1 57 ? 6.423   55.515 16.946  1.00 19.41 ? 280 VAL B O   1 
ATOM   1266 C CB  . VAL B 1 57 ? 5.258   56.644 19.796  1.00 19.02 ? 280 VAL B CB  1 
ATOM   1267 C CG1 . VAL B 1 57 ? 5.432   57.453 21.047  1.00 20.32 ? 280 VAL B CG1 1 
ATOM   1268 C CG2 . VAL B 1 57 ? 4.448   57.450 18.736  1.00 19.23 ? 280 VAL B CG2 1 
ATOM   1269 N N   . ASP B 1 58 ? 5.839   54.023 18.546  1.00 21.36 ? 281 ASP B N   1 
ATOM   1270 C CA  . ASP B 1 58 ? 5.342   53.047 17.591  1.00 22.67 ? 281 ASP B CA  1 
ATOM   1271 C C   . ASP B 1 58 ? 4.210   52.326 18.253  1.00 22.15 ? 281 ASP B C   1 
ATOM   1272 O O   . ASP B 1 58 ? 3.777   52.663 19.354  1.00 20.67 ? 281 ASP B O   1 
ATOM   1273 C CB  . ASP B 1 58 ? 6.453   52.134 17.046  1.00 25.23 ? 281 ASP B CB  1 
ATOM   1274 C CG  . ASP B 1 58 ? 6.219   51.750 15.590  1.00 31.07 ? 281 ASP B CG  1 
ATOM   1275 O OD1 . ASP B 1 58 ? 5.039   51.704 15.119  1.00 34.34 ? 281 ASP B OD1 1 
ATOM   1276 O OD2 . ASP B 1 58 ? 7.240   51.502 14.902  1.00 36.21 ? 281 ASP B OD2 1 
ATOM   1277 N N   . LEU B 1 59 ? 3.700   51.313 17.587  1.00 21.89 ? 282 LEU B N   1 
ATOM   1278 C CA  . LEU B 1 59 ? 2.475   50.688 18.068  1.00 21.91 ? 282 LEU B CA  1 
ATOM   1279 C C   . LEU B 1 59 ? 2.653   50.081 19.455  1.00 20.92 ? 282 LEU B C   1 
ATOM   1280 O O   . LEU B 1 59 ? 1.692   49.998 20.207  1.00 23.03 ? 282 LEU B O   1 
ATOM   1281 C CB  . LEU B 1 59 ? 1.997   49.600 17.085  1.00 22.55 ? 282 LEU B CB  1 
ATOM   1282 C CG  . LEU B 1 59 ? 1.725   50.101 15.660  1.00 25.65 ? 282 LEU B CG  1 
ATOM   1283 C CD1 . LEU B 1 59 ? 1.108   48.998 14.825  1.00 27.84 ? 282 LEU B CD1 1 
ATOM   1284 C CD2 . LEU B 1 59 ? 0.826   51.326 15.637  1.00 29.39 ? 282 LEU B CD2 1 
ATOM   1285 N N   . GLU B 1 60 ? 3.877   49.671 19.785  1.00 21.23 ? 283 GLU B N   1 
ATOM   1286 C CA  . GLU B 1 60 ? 4.116   49.070 21.112  1.00 23.47 ? 283 GLU B CA  1 
ATOM   1287 C C   . GLU B 1 60 ? 3.830   50.065 22.246  1.00 21.54 ? 283 GLU B C   1 
ATOM   1288 O O   . GLU B 1 60 ? 3.634   49.636 23.396  1.00 23.10 ? 283 GLU B O   1 
ATOM   1289 C CB  . GLU B 1 60 ? 5.556   48.573 21.270  1.00 24.85 ? 283 GLU B CB  1 
ATOM   1290 C CG  . GLU B 1 60 ? 6.589   49.732 21.328  1.00 28.45 ? 283 GLU B CG  1 
ATOM   1291 C CD  . GLU B 1 60 ? 8.039   49.272 21.458  1.00 30.03 ? 283 GLU B CD  1 
ATOM   1292 O OE1 . GLU B 1 60 ? 8.487   48.947 22.570  1.00 37.12 ? 283 GLU B OE1 1 
ATOM   1293 O OE2 . GLU B 1 60 ? 8.739   49.260 20.429  1.00 37.73 ? 283 GLU B OE2 1 
ATOM   1294 N N   . HIS B 1 61 ? 3.817   51.371 21.940  1.00 19.45 ? 284 HIS B N   1 
ATOM   1295 C CA  . HIS B 1 61 ? 3.530   52.353 22.992  1.00 18.51 ? 284 HIS B CA  1 
ATOM   1296 C C   . HIS B 1 61 ? 2.056   52.635 23.234  1.00 19.62 ? 284 HIS B C   1 
ATOM   1297 O O   . HIS B 1 61 ? 1.702   53.361 24.152  1.00 19.73 ? 284 HIS B O   1 
ATOM   1298 C CB  . HIS B 1 61 ? 4.290   53.642 22.690  1.00 18.08 ? 284 HIS B CB  1 
ATOM   1299 C CG  . HIS B 1 61 ? 5.756   53.413 22.571  1.00 18.81 ? 284 HIS B CG  1 
ATOM   1300 N ND1 . HIS B 1 61 ? 6.403   53.393 21.356  1.00 19.57 ? 284 HIS B ND1 1 
ATOM   1301 C CD2 . HIS B 1 61 ? 6.685   53.104 23.502  1.00 20.05 ? 284 HIS B CD2 1 
ATOM   1302 C CE1 . HIS B 1 61 ? 7.678   53.125 21.547  1.00 20.94 ? 284 HIS B CE1 1 
ATOM   1303 N NE2 . HIS B 1 61 ? 7.872   52.918 22.834  1.00 22.43 ? 284 HIS B NE2 1 
ATOM   1304 N N   . GLN B 1 62 ? 1.175   52.066 22.427  1.00 20.04 ? 285 GLN B N   1 
ATOM   1305 C CA  . GLN B 1 62 ? -0.244  52.228 22.632  1.00 20.29 ? 285 GLN B CA  1 
ATOM   1306 C C   . GLN B 1 62 ? -0.632  51.564 23.950  1.00 20.89 ? 285 GLN B C   1 
ATOM   1307 O O   . GLN B 1 62 ? -0.097  50.508 24.314  1.00 23.67 ? 285 GLN B O   1 
ATOM   1308 C CB  . GLN B 1 62 ? -0.996  51.564 21.471  1.00 22.10 ? 285 GLN B CB  1 
ATOM   1309 C CG  . GLN B 1 62 ? -2.504  51.766 21.477  1.00 26.36 ? 285 GLN B CG  1 
ATOM   1310 C CD  . GLN B 1 62 ? -3.092  51.487 20.106  1.00 28.63 ? 285 GLN B CD  1 
ATOM   1311 O OE1 . GLN B 1 62 ? -3.345  52.404 19.322  1.00 25.63 ? 285 GLN B OE1 1 
ATOM   1312 N NE2 . GLN B 1 62 ? -3.259  50.204 19.785  1.00 31.35 ? 285 GLN B NE2 1 
ATOM   1313 N N   . GLY B 1 63 ? -1.556  52.156 24.681  1.00 19.70 ? 286 GLY B N   1 
ATOM   1314 C CA  . GLY B 1 63 ? -2.034  51.508 25.883  1.00 19.87 ? 286 GLY B CA  1 
ATOM   1315 C C   . GLY B 1 63 ? -2.617  52.492 26.830  1.00 19.27 ? 286 GLY B C   1 
ATOM   1316 O O   . GLY B 1 63 ? -2.862  53.665 26.504  1.00 21.20 ? 286 GLY B O   1 
ATOM   1317 N N   . THR B 1 64 ? -2.950  51.931 28.008  1.00 18.97 ? 287 THR B N   1 
ATOM   1318 C CA  . THR B 1 64 ? -3.540  52.706 29.059  1.00 21.29 ? 287 THR B CA  1 
ATOM   1319 C C   . THR B 1 64 ? -2.509  52.939 30.124  1.00 21.69 ? 287 THR B C   1 
ATOM   1320 O O   . THR B 1 64 ? -1.880  52.001 30.611  1.00 22.65 ? 287 THR B O   1 
ATOM   1321 C CB  . THR B 1 64 ? -4.674  51.983 29.702  1.00 24.00 ? 287 THR B CB  1 
ATOM   1322 O OG1 . THR B 1 64 ? -5.601  51.665 28.658  1.00 23.53 ? 287 THR B OG1 1 
ATOM   1323 C CG2 . THR B 1 64 ? -5.380  52.905 30.635  1.00 23.43 ? 287 THR B CG2 1 
ATOM   1324 N N   . TYR B 1 65 ? -2.325  54.225 30.474  1.00 17.19 ? 288 TYR B N   1 
ATOM   1325 C CA  . TYR B 1 65 ? -1.241  54.644 31.424  1.00 16.78 ? 288 TYR B CA  1 
ATOM   1326 C C   . TYR B 1 65 ? -1.816  55.338 32.611  1.00 17.23 ? 288 TYR B C   1 
ATOM   1327 O O   . TYR B 1 65 ? -2.841  55.985 32.536  1.00 19.99 ? 288 TYR B O   1 
ATOM   1328 C CB  . TYR B 1 65 ? -0.301  55.635 30.733  1.00 17.96 ? 288 TYR B CB  1 
ATOM   1329 C CG  . TYR B 1 65 ? 0.536   55.078 29.583  1.00 15.30 ? 288 TYR B CG  1 
ATOM   1330 C CD1 . TYR B 1 65 ? 1.890   54.813 29.751  1.00 15.90 ? 288 TYR B CD1 1 
ATOM   1331 C CD2 . TYR B 1 65 ? -0.030  54.849 28.323  1.00 16.28 ? 288 TYR B CD2 1 
ATOM   1332 C CE1 . TYR B 1 65 ? 2.684   54.346 28.718  1.00 16.88 ? 288 TYR B CE1 1 
ATOM   1333 C CE2 . TYR B 1 65 ? 0.765   54.353 27.275  1.00 16.17 ? 288 TYR B CE2 1 
ATOM   1334 C CZ  . TYR B 1 65 ? 2.113   54.147 27.471  1.00 16.11 ? 288 TYR B CZ  1 
ATOM   1335 O OH  . TYR B 1 65 ? 2.899   53.714 26.449  1.00 18.15 ? 288 TYR B OH  1 
ATOM   1336 N N   . TRP B 1 66 ? -1.098  55.243 33.724  1.00 17.62 ? 289 TRP B N   1 
ATOM   1337 C CA  . TRP B 1 66 ? -1.435  56.068 34.887  1.00 16.53 ? 289 TRP B CA  1 
ATOM   1338 C C   . TRP B 1 66 ? -0.184  56.127 35.751  1.00 13.73 ? 289 TRP B C   1 
ATOM   1339 O O   . TRP B 1 66 ? 0.793   55.371 35.547  1.00 14.27 ? 289 TRP B O   1 
ATOM   1340 C CB  . TRP B 1 66 ? -2.598  55.503 35.693  1.00 17.49 ? 289 TRP B CB  1 
ATOM   1341 C CG  . TRP B 1 66 ? -2.408  54.104 35.913  1.00 22.81 ? 289 TRP B CG  1 
ATOM   1342 C CD1 . TRP B 1 66 ? -2.602  53.053 34.994  1.00 24.33 ? 289 TRP B CD1 1 
ATOM   1343 C CD2 . TRP B 1 66 ? -2.044  53.519 37.113  1.00 20.13 ? 289 TRP B CD2 1 
ATOM   1344 N NE1 . TRP B 1 66 ? -2.321  51.861 35.588  1.00 22.87 ? 289 TRP B NE1 1 
ATOM   1345 C CE2 . TRP B 1 66 ? -1.969  52.117 36.898  1.00 24.13 ? 289 TRP B CE2 1 
ATOM   1346 C CE3 . TRP B 1 66 ? -1.725  54.032 38.381  1.00 24.74 ? 289 TRP B CE3 1 
ATOM   1347 C CZ2 . TRP B 1 66 ? -1.644  51.192 37.943  1.00 22.04 ? 289 TRP B CZ2 1 
ATOM   1348 C CZ3 . TRP B 1 66 ? -1.385  53.116 39.401  1.00 23.54 ? 289 TRP B CZ3 1 
ATOM   1349 C CH2 . TRP B 1 66 ? -1.362  51.713 39.178  1.00 24.88 ? 289 TRP B CH2 1 
ATOM   1350 N N   . CYS B 1 67 ? -0.234  57.040 36.719  1.00 13.18 ? 290 CYS B N   1 
ATOM   1351 C CA  . CYS B 1 67 ? 0.921   57.232 37.605  1.00 12.66 ? 290 CYS B CA  1 
ATOM   1352 C C   . CYS B 1 67 ? 0.422   57.052 39.041  1.00 12.39 ? 290 CYS B C   1 
ATOM   1353 O O   . CYS B 1 67 ? -0.584  57.648 39.431  1.00 14.04 ? 290 CYS B O   1 
ATOM   1354 C CB  . CYS B 1 67 ? 1.474   58.645 37.412  1.00 12.96 ? 290 CYS B CB  1 
ATOM   1355 S SG  . CYS B 1 67 ? 3.015   58.961 38.257  1.00 12.69 ? 290 CYS B SG  1 
ATOM   1356 N N   . HIS B 1 68 ? 1.148   56.273 39.833  1.00 12.74 ? 291 HIS B N   1 
ATOM   1357 C CA  . HIS B 1 68 ? 0.910   56.147 41.266  1.00 12.67 ? 291 HIS B CA  1 
ATOM   1358 C C   . HIS B 1 68 ? 1.781   57.158 41.979  1.00 12.26 ? 291 HIS B C   1 
ATOM   1359 O O   . HIS B 1 68 ? 3.004   57.215 41.751  1.00 13.32 ? 291 HIS B O   1 
ATOM   1360 C CB  . HIS B 1 68 ? 1.245   54.739 41.756  1.00 13.39 ? 291 HIS B CB  1 
ATOM   1361 C CG  . HIS B 1 68 ? 0.912   54.537 43.194  1.00 13.42 ? 291 HIS B CG  1 
ATOM   1362 N ND1 . HIS B 1 68 ? -0.395  54.556 43.640  1.00 15.33 ? 291 HIS B ND1 1 
ATOM   1363 C CD2 . HIS B 1 68 ? 1.685   54.363 44.302  1.00 14.25 ? 291 HIS B CD2 1 
ATOM   1364 C CE1 . HIS B 1 68 ? -0.411  54.357 44.952  1.00 15.86 ? 291 HIS B CE1 1 
ATOM   1365 N NE2 . HIS B 1 68 ? 0.836   54.261 45.382  1.00 15.12 ? 291 HIS B NE2 1 
ATOM   1366 N N   . VAL B 1 69 ? 1.151   58.008 42.773  1.00 11.87 ? 292 VAL B N   1 
ATOM   1367 C CA  . VAL B 1 69 ? 1.808   59.076 43.463  1.00 11.37 ? 292 VAL B CA  1 
ATOM   1368 C C   . VAL B 1 69 ? 1.704   58.820 44.956  1.00 10.91 ? 292 VAL B C   1 
ATOM   1369 O O   . VAL B 1 69 ? 0.636   58.538 45.462  1.00 13.17 ? 292 VAL B O   1 
ATOM   1370 C CB  . VAL B 1 69 ? 1.192   60.416 43.092  1.00 12.09 ? 292 VAL B CB  1 
ATOM   1371 C CG1 . VAL B 1 69 ? 1.948   61.537 43.701  1.00 16.66 ? 292 VAL B CG1 1 
ATOM   1372 C CG2 . VAL B 1 69 ? 1.173   60.567 41.580  1.00 14.45 ? 292 VAL B CG2 1 
ATOM   1373 N N   . TYR B 1 70 ? 2.836   58.930 45.684  1.00 11.16 ? 293 TYR B N   1 
ATOM   1374 C CA  . TYR B 1 70 ? 2.761   58.406 47.062  1.00 11.62 ? 293 TYR B CA  1 
ATOM   1375 C C   . TYR B 1 70 ? 3.836   59.012 47.930  1.00 11.64 ? 293 TYR B C   1 
ATOM   1376 O O   . TYR B 1 70 ? 4.933   59.431 47.475  1.00 12.23 ? 293 TYR B O   1 
ATOM   1377 C CB  . TYR B 1 70 ? 2.871   56.877 47.076  1.00 13.13 ? 293 TYR B CB  1 
ATOM   1378 C CG  . TYR B 1 70 ? 4.195   56.357 46.625  1.00 12.38 ? 293 TYR B CG  1 
ATOM   1379 C CD1 . TYR B 1 70 ? 5.149   55.933 47.538  1.00 14.03 ? 293 TYR B CD1 1 
ATOM   1380 C CD2 . TYR B 1 70 ? 4.519   56.296 45.279  1.00 13.47 ? 293 TYR B CD2 1 
ATOM   1381 C CE1 . TYR B 1 70 ? 6.379   55.476 47.134  1.00 15.07 ? 293 TYR B CE1 1 
ATOM   1382 C CE2 . TYR B 1 70 ? 5.753   55.836 44.848  1.00 13.80 ? 293 TYR B CE2 1 
ATOM   1383 C CZ  . TYR B 1 70 ? 6.689   55.418 45.791  1.00 14.53 ? 293 TYR B CZ  1 
ATOM   1384 O OH  . TYR B 1 70 ? 7.937   54.968 45.391  1.00 16.64 ? 293 TYR B OH  1 
ATOM   1385 N N   . ASN B 1 71 ? 3.549   59.012 49.227  1.00 12.68 ? 294 ASN B N   1 
ATOM   1386 C CA  . ASN B 1 71 ? 4.619   59.220 50.233  1.00 12.36 ? 294 ASN B CA  1 
ATOM   1387 C C   . ASN B 1 71 ? 4.367   58.223 51.357  1.00 11.86 ? 294 ASN B C   1 
ATOM   1388 O O   . ASN B 1 71 ? 3.666   57.237 51.160  1.00 13.53 ? 294 ASN B O   1 
ATOM   1389 C CB  . ASN B 1 71 ? 4.695   60.683 50.653  1.00 12.50 ? 294 ASN B CB  1 
ATOM   1390 C CG  . ASN B 1 71 ? 3.434   61.164 51.318  1.00 11.90 ? 294 ASN B CG  1 
ATOM   1391 O OD1 . ASN B 1 71 ? 2.601   60.385 51.780  1.00 12.58 ? 294 ASN B OD1 1 
ATOM   1392 N ND2 . ASN B 1 71 ? 3.251   62.490 51.378  1.00 13.48 ? 294 ASN B ND2 1 
ATOM   1393 N N   . ASP B 1 72 ? 4.997   58.426 52.524  1.00 12.73 ? 295 ASP B N   1 
ATOM   1394 C CA  . ASP B 1 72 ? 4.883   57.477 53.617  1.00 13.18 ? 295 ASP B CA  1 
ATOM   1395 C C   . ASP B 1 72 ? 3.600   57.639 54.439  1.00 13.59 ? 295 ASP B C   1 
ATOM   1396 O O   . ASP B 1 72 ? 3.479   57.002 55.488  1.00 13.94 ? 295 ASP B O   1 
ATOM   1397 C CB  . ASP B 1 72 ? 6.136   57.538 54.506  1.00 14.20 ? 295 ASP B CB  1 
ATOM   1398 C CG  . ASP B 1 72 ? 6.322   58.846 55.227  1.00 15.70 ? 295 ASP B CG  1 
ATOM   1399 O OD1 . ASP B 1 72 ? 5.440   59.693 55.140  1.00 17.18 ? 295 ASP B OD1 1 
ATOM   1400 O OD2 . ASP B 1 72 ? 7.391   58.980 55.924  1.00 18.81 ? 295 ASP B OD2 1 
ATOM   1401 N N   . ARG B 1 73 ? 2.681   58.502 53.991  1.00 13.31 ? 296 ARG B N   1 
ATOM   1402 C CA  . ARG B 1 73 ? 1.362   58.639 54.621  1.00 14.48 ? 296 ARG B CA  1 
ATOM   1403 C C   . ARG B 1 73 ? 0.200   58.358 53.696  1.00 15.85 ? 296 ARG B C   1 
ATOM   1404 O O   . ARG B 1 73 ? -0.809  57.792 54.103  1.00 17.89 ? 296 ARG B O   1 
ATOM   1405 C CB  . ARG B 1 73 ? 1.212   60.005 55.249  1.00 15.57 ? 296 ARG B CB  1 
ATOM   1406 C CG  . ARG B 1 73 ? -0.022  60.047 56.153  1.00 18.69 ? 296 ARG B CG  1 
ATOM   1407 C CD  . ARG B 1 73 ? -0.346  61.332 56.662  1.00 23.44 ? 296 ARG B CD  1 
ATOM   1408 N NE  . ARG B 1 73 ? -1.168  62.019 55.689  1.00 21.94 ? 296 ARG B NE  1 
ATOM   1409 C CZ  . ARG B 1 73 ? -1.788  63.159 55.942  1.00 21.25 ? 296 ARG B CZ  1 
ATOM   1410 N NH1 . ARG B 1 73 ? -1.645  63.729 57.128  1.00 27.44 ? 296 ARG B NH1 1 
ATOM   1411 N NH2 . ARG B 1 73 ? -2.442  63.764 54.989  1.00 24.92 ? 296 ARG B NH2 1 
ATOM   1412 N N   . ASP B 1 74 ? 0.281   58.788 52.453  1.00 14.33 ? 297 ASP B N   1 
ATOM   1413 C CA  . ASP B 1 74 ? -0.877  58.941 51.563  1.00 17.19 ? 297 ASP B CA  1 
ATOM   1414 C C   . ASP B 1 74 ? -0.462  58.464 50.181  1.00 14.47 ? 297 ASP B C   1 
ATOM   1415 O O   . ASP B 1 74 ? 0.733   58.550 49.812  1.00 14.12 ? 297 ASP B O   1 
ATOM   1416 C CB  . ASP B 1 74 ? -1.213  60.470 51.274  1.00 19.06 ? 297 ASP B CB  1 
ATOM   1417 C CG  . ASP B 1 74 ? -1.678  61.304 52.451  1.00 22.49 ? 297 ASP B CG  1 
ATOM   1418 O OD1 . ASP B 1 74 ? -2.229  60.705 53.372  1.00 24.19 ? 297 ASP B OD1 1 
ATOM   1419 O OD2 . ASP B 1 74 ? -1.582  62.610 52.368  1.00 24.63 ? 297 ASP B OD2 1 
ATOM   1420 N N   . SER B 1 75 ? -1.459  58.105 49.381  1.00 14.79 ? 298 SER B N   1 
ATOM   1421 C CA  . SER B 1 75 ? -1.185  57.870 47.990  1.00 14.27 ? 298 SER B CA  1 
ATOM   1422 C C   . SER B 1 75 ? -2.457  58.210 47.188  1.00 14.59 ? 298 SER B C   1 
ATOM   1423 O O   . SER B 1 75 ? -3.570  58.234 47.716  1.00 17.31 ? 298 SER B O   1 
ATOM   1424 C CB  . SER B 1 75 ? -0.698  56.428 47.731  1.00 16.59 ? 298 SER B CB  1 
ATOM   1425 O OG  . SER B 1 75 ? -1.748  55.508 47.871  1.00 20.45 ? 298 SER B OG  1 
ATOM   1426 N N   . GLN B 1 76 ? -2.199  58.516 45.905  1.00 14.34 ? 299 GLN B N   1 
ATOM   1427 C CA  . GLN B 1 76 ? -3.267  58.749 44.954  1.00 15.55 ? 299 GLN B CA  1 
ATOM   1428 C C   . GLN B 1 76 ? -2.807  58.190 43.622  1.00 15.98 ? 299 GLN B C   1 
ATOM   1429 O O   . GLN B 1 76 ? -1.644  58.271 43.262  1.00 18.11 ? 299 GLN B O   1 
ATOM   1430 C CB  . GLN B 1 76 ? -3.484  60.261 44.814  1.00 16.81 ? 299 GLN B CB  1 
ATOM   1431 C CG  . GLN B 1 76 ? -4.074  60.973 45.989  1.00 21.03 ? 299 GLN B CG  1 
ATOM   1432 C CD  . GLN B 1 76 ? -4.541  62.408 45.688  1.00 20.04 ? 299 GLN B CD  1 
ATOM   1433 O OE1 . GLN B 1 76 ? -4.166  63.029 44.676  1.00 22.02 ? 299 GLN B OE1 1 
ATOM   1434 N NE2 . GLN B 1 76 ? -5.387  62.945 46.575  1.00 24.39 ? 299 GLN B NE2 1 
ATOM   1435 N N   . ASP B 1 77 ? -3.762  57.681 42.846  1.00 16.22 ? 300 ASP B N   1 
ATOM   1436 C CA  . ASP B 1 77 ? -3.488  57.313 41.437  1.00 16.62 ? 300 ASP B CA  1 
ATOM   1437 C C   . ASP B 1 77 ? -3.951  58.457 40.558  1.00 16.52 ? 300 ASP B C   1 
ATOM   1438 O O   . ASP B 1 77 ? -5.056  59.016 40.745  1.00 18.68 ? 300 ASP B O   1 
ATOM   1439 C CB  . ASP B 1 77 ? -4.190  56.001 41.048  1.00 18.10 ? 300 ASP B CB  1 
ATOM   1440 C CG  . ASP B 1 77 ? -3.507  54.795 41.661  1.00 22.03 ? 300 ASP B CG  1 
ATOM   1441 O OD1 . ASP B 1 77 ? -2.267  54.751 41.817  1.00 22.86 ? 300 ASP B OD1 1 
ATOM   1442 O OD2 . ASP B 1 77 ? -4.253  53.865 42.009  1.00 27.67 ? 300 ASP B OD2 1 
ATOM   1443 N N   . SER B 1 78 ? -3.156  58.797 39.563  1.00 16.30 ? 301 SER B N   1 
ATOM   1444 C CA  . SER B 1 78 ? -3.608  59.712 38.533  1.00 15.56 ? 301 SER B CA  1 
ATOM   1445 C C   . SER B 1 78 ? -4.797  59.127 37.810  1.00 18.93 ? 301 SER B C   1 
ATOM   1446 O O   . SER B 1 78 ? -5.098  57.919 37.862  1.00 22.79 ? 301 SER B O   1 
ATOM   1447 C CB  . SER B 1 78 ? -2.509  59.979 37.487  1.00 15.27 ? 301 SER B CB  1 
ATOM   1448 O OG  . SER B 1 78 ? -2.359  58.885 36.585  1.00 17.27 ? 301 SER B OG  1 
ATOM   1449 N N   . LYS B 1 79 ? -5.499  59.981 37.085  1.00 19.28 ? 302 LYS B N   1 
ATOM   1450 C CA  . LYS B 1 79 ? -6.399  59.488 36.096  1.00 20.73 ? 302 LYS B CA  1 
ATOM   1451 C C   . LYS B 1 79 ? -5.736  58.520 35.107  1.00 20.54 ? 302 LYS B C   1 
ATOM   1452 O O   . LYS B 1 79 ? -4.528  58.660 34.833  1.00 19.65 ? 302 LYS B O   1 
ATOM   1453 C CB  . LYS B 1 79 ? -7.002  60.666 35.295  1.00 24.34 ? 302 LYS B CB  1 
ATOM   1454 C CG  . LYS B 1 79 ? -7.668  61.788 36.113  1.00 27.69 ? 302 LYS B CG  1 
ATOM   1455 C CD  . LYS B 1 79 ? -8.734  61.299 37.151  1.00 30.88 ? 302 LYS B CD  1 
ATOM   1456 C CE  . LYS B 1 79 ? -9.293  62.450 38.033  1.00 30.49 ? 302 LYS B CE  1 
ATOM   1457 N NZ  . LYS B 1 79 ? -10.546 62.279 38.876  1.00 31.23 ? 302 LYS B NZ  1 
ATOM   1458 N N   A LYS B 1 80 ? -6.504  57.573 34.567  0.70 21.13 ? 303 LYS B N   1 
ATOM   1459 N N   B LYS B 1 80 ? -6.490  57.526 34.634  0.30 19.83 ? 303 LYS B N   1 
ATOM   1460 C CA  A LYS B 1 80 ? -5.986  56.648 33.570  0.70 22.51 ? 303 LYS B CA  1 
ATOM   1461 C CA  B LYS B 1 80 ? -6.028  56.696 33.535  0.30 19.08 ? 303 LYS B CA  1 
ATOM   1462 C C   A LYS B 1 80 ? -6.259  57.255 32.204  0.70 20.36 ? 303 LYS B C   1 
ATOM   1463 C C   B LYS B 1 80 ? -6.181  57.498 32.259  0.30 19.15 ? 303 LYS B C   1 
ATOM   1464 O O   A LYS B 1 80 ? -7.422  57.602 31.890  0.70 22.75 ? 303 LYS B O   1 
ATOM   1465 O O   B LYS B 1 80 ? -7.137  58.261 32.078  0.30 19.96 ? 303 LYS B O   1 
ATOM   1466 C CB  A LYS B 1 80 ? -6.682  55.296 33.645  0.70 24.78 ? 303 LYS B CB  1 
ATOM   1467 C CB  B LYS B 1 80 ? -6.793  55.369 33.421  0.30 19.86 ? 303 LYS B CB  1 
ATOM   1468 C CG  A LYS B 1 80 ? -6.231  54.372 34.769  0.70 25.01 ? 303 LYS B CG  1 
ATOM   1469 C CG  B LYS B 1 80 ? -6.038  54.159 34.007  0.30 16.81 ? 303 LYS B CG  1 
ATOM   1470 C CD  A LYS B 1 80 ? -7.127  53.111 34.799  0.70 27.57 ? 303 LYS B CD  1 
ATOM   1471 C CD  B LYS B 1 80 ? -6.899  52.898 34.060  0.30 18.58 ? 303 LYS B CD  1 
ATOM   1472 C CE  A LYS B 1 80 ? -6.938  52.248 33.559  0.70 30.68 ? 303 LYS B CE  1 
ATOM   1473 C CE  B LYS B 1 80 ? -6.146  51.745 34.742  0.30 15.70 ? 303 LYS B CE  1 
ATOM   1474 N NZ  A LYS B 1 80 ? -8.024  51.239 33.339  0.70 31.60 ? 303 LYS B NZ  1 
ATOM   1475 N NZ  B LYS B 1 80 ? -5.047  51.249 33.900  0.30 21.30 ? 303 LYS B NZ  1 
ATOM   1476 N N   . VAL B 1 81 ? -5.197  57.356 31.386  1.00 19.96 ? 304 VAL B N   1 
ATOM   1477 C CA  . VAL B 1 81 ? -5.288  57.970 30.057  1.00 21.25 ? 304 VAL B CA  1 
ATOM   1478 C C   . VAL B 1 81 ? -4.946  56.957 28.999  1.00 20.08 ? 304 VAL B C   1 
ATOM   1479 O O   . VAL B 1 81 ? -4.276  55.976 29.237  1.00 21.53 ? 304 VAL B O   1 
ATOM   1480 C CB  . VAL B 1 81 ? -4.383  59.203 29.897  1.00 21.29 ? 304 VAL B CB  1 
ATOM   1481 C CG1 . VAL B 1 81 ? -4.851  60.348 30.827  1.00 23.67 ? 304 VAL B CG1 1 
ATOM   1482 C CG2 . VAL B 1 81 ? -2.946  58.861 30.148  1.00 22.69 ? 304 VAL B CG2 1 
ATOM   1483 N N   . GLU B 1 82 ? -5.462  57.182 27.796  1.00 19.50 ? 305 GLU B N   1 
ATOM   1484 C CA  . GLU B 1 82 ? -5.216  56.255 26.709  1.00 20.37 ? 305 GLU B CA  1 
ATOM   1485 C C   . GLU B 1 82 ? -4.354  56.943 25.657  1.00 19.83 ? 305 GLU B C   1 
ATOM   1486 O O   . GLU B 1 82 ? -4.527  58.105 25.305  1.00 20.76 ? 305 GLU B O   1 
ATOM   1487 C CB  . GLU B 1 82 ? -6.542  55.735 26.125  1.00 21.93 ? 305 GLU B CB  1 
ATOM   1488 C CG  . GLU B 1 82 ? -7.222  54.680 27.052  1.00 20.54 ? 305 GLU B CG  1 
ATOM   1489 C CD  . GLU B 1 82 ? -8.610  54.171 26.533  1.00 20.34 ? 305 GLU B CD  1 
ATOM   1490 O OE1 . GLU B 1 82 ? -9.518  55.026 26.483  1.00 26.16 ? 305 GLU B OE1 1 
ATOM   1491 O OE2 . GLU B 1 82 ? -8.864  52.931 26.254  1.00 27.60 ? 305 GLU B OE2 1 
ATOM   1492 N N   . ILE B 1 83 ? -3.344  56.217 25.250  1.00 19.53 ? 306 ILE B N   1 
ATOM   1493 C CA  . ILE B 1 83 ? -2.477  56.679 24.162  1.00 19.60 ? 306 ILE B CA  1 
ATOM   1494 C C   . ILE B 1 83 ? -2.816  55.794 22.993  1.00 19.97 ? 306 ILE B C   1 
ATOM   1495 O O   . ILE B 1 83 ? -2.628  54.568 23.050  1.00 20.77 ? 306 ILE B O   1 
ATOM   1496 C CB  . ILE B 1 83 ? -0.989  56.550 24.514  1.00 19.87 ? 306 ILE B CB  1 
ATOM   1497 C CG1 . ILE B 1 83 ? -0.660  57.391 25.767  1.00 20.86 ? 306 ILE B CG1 1 
ATOM   1498 C CG2 . ILE B 1 83 ? -0.124  56.933 23.293  1.00 19.53 ? 306 ILE B CG2 1 
ATOM   1499 C CD1 . ILE B 1 83 ? -1.127  58.886 25.715  1.00 22.97 ? 306 ILE B CD1 1 
ATOM   1500 N N   . ILE B 1 84 ? -3.325  56.429 21.942  1.00 19.47 ? 307 ILE B N   1 
ATOM   1501 C CA  . ILE B 1 84 ? -3.709  55.756 20.703  1.00 21.36 ? 307 ILE B CA  1 
ATOM   1502 C C   . ILE B 1 84 ? -2.649  56.050 19.640  1.00 21.59 ? 307 ILE B C   1 
ATOM   1503 O O   . ILE B 1 84 ? -2.265  57.196 19.472  1.00 21.47 ? 307 ILE B O   1 
ATOM   1504 C CB  . ILE B 1 84 ? -5.113  56.277 20.206  1.00 24.40 ? 307 ILE B CB  1 
ATOM   1505 C CG1 . ILE B 1 84 ? -6.198  56.083 21.275  1.00 27.20 ? 307 ILE B CG1 1 
ATOM   1506 C CG2 . ILE B 1 84 ? -5.478  55.671 18.845  1.00 27.32 ? 307 ILE B CG2 1 
ATOM   1507 C CD1 . ILE B 1 84 ? -6.540  57.365 21.998  1.00 32.79 ? 307 ILE B CD1 1 
ATOM   1508 N N   . ILE B 1 85 ? -2.168  55.019 18.961  1.00 22.58 ? 308 ILE B N   1 
ATOM   1509 C CA  . ILE B 1 85 ? -1.178  55.205 17.893  1.00 25.89 ? 308 ILE B CA  1 
ATOM   1510 C C   . ILE B 1 85 ? -1.849  54.782 16.620  1.00 28.04 ? 308 ILE B C   1 
ATOM   1511 O O   . ILE B 1 85 ? -2.109  53.582 16.446  1.00 29.86 ? 308 ILE B O   1 
ATOM   1512 C CB  . ILE B 1 85 ? 0.097   54.326 18.073  1.00 26.84 ? 308 ILE B CB  1 
ATOM   1513 C CG1 . ILE B 1 85 ? 0.615   54.355 19.499  1.00 27.73 ? 308 ILE B CG1 1 
ATOM   1514 C CG2 . ILE B 1 85 ? 1.174   54.730 17.065  1.00 28.97 ? 308 ILE B CG2 1 
ATOM   1515 C CD1 . ILE B 1 85 ? 1.244   55.621 19.895  1.00 26.29 ? 308 ILE B CD1 1 
ATOM   1516 N N   . ASP B 1 86 ? -2.133  55.755 15.752  1.00 30.45 ? 309 ASP B N   1 
ATOM   1517 C CA  . ASP B 1 86 ? -2.843  55.499 14.490  1.00 33.18 ? 309 ASP B CA  1 
ATOM   1518 C C   . ASP B 1 86 ? -1.948  55.673 13.260  1.00 33.06 ? 309 ASP B C   1 
ATOM   1519 O O   . ASP B 1 86 ? -1.164  56.631 13.175  1.00 33.62 ? 309 ASP B O   1 
ATOM   1520 C CB  . ASP B 1 86 ? -4.081  56.391 14.398  1.00 35.01 ? 309 ASP B CB  1 
ATOM   1521 C CG  . ASP B 1 86 ? -3.753  57.861 14.507  1.00 37.86 ? 309 ASP B CG  1 
ATOM   1522 O OD1 . ASP B 1 86 ? -3.205  58.454 13.546  1.00 42.43 ? 309 ASP B OD1 1 
ATOM   1523 O OD2 . ASP B 1 86 ? -4.031  58.439 15.572  1.00 41.26 ? 309 ASP B OD2 1 
ATOM   1524 N N   . SER C 1 2  ? 1.150   19.357 -0.139  1.00 31.41 ? 225 SER C N   1 
ATOM   1525 C CA  . SER C 1 2  ? 1.804   20.647 -0.523  1.00 30.91 ? 225 SER C CA  1 
ATOM   1526 C C   . SER C 1 2  ? 1.065   21.943 -0.133  1.00 27.86 ? 225 SER C C   1 
ATOM   1527 O O   . SER C 1 2  ? 1.709   22.977 0.125   1.00 26.02 ? 225 SER C O   1 
ATOM   1528 C CB  . SER C 1 2  ? 2.050   20.690 -2.001  1.00 31.97 ? 225 SER C CB  1 
ATOM   1529 O OG  . SER C 1 2  ? 2.796   21.825 -2.296  1.00 35.40 ? 225 SER C OG  1 
ATOM   1530 N N   . LYS C 1 3  ? -0.269  21.930 -0.130  1.00 25.57 ? 226 LYS C N   1 
ATOM   1531 C CA  . LYS C 1 3  ? -1.018  23.068 0.419   1.00 24.86 ? 226 LYS C CA  1 
ATOM   1532 C C   . LYS C 1 3  ? -0.690  23.275 1.882   1.00 22.53 ? 226 LYS C C   1 
ATOM   1533 O O   . LYS C 1 3  ? -0.639  22.362 2.699   1.00 23.58 ? 226 LYS C O   1 
ATOM   1534 C CB  . LYS C 1 3  ? -2.526  22.899 0.289   1.00 26.48 ? 226 LYS C CB  1 
ATOM   1535 C CG  . LYS C 1 3  ? -3.268  24.247 0.313   1.00 30.07 ? 226 LYS C CG  1 
ATOM   1536 C CD  . LYS C 1 3  ? -4.712  24.110 -0.173  1.00 35.41 ? 226 LYS C CD  1 
ATOM   1537 C CE  . LYS C 1 3  ? -5.419  25.449 -0.274  1.00 36.50 ? 226 LYS C CE  1 
ATOM   1538 N NZ  . LYS C 1 3  ? -5.776  26.070 1.034   1.00 40.66 ? 226 LYS C NZ  1 
ATOM   1539 N N   . LEU C 1 4  ? -0.495  24.523 2.225   1.00 20.64 ? 227 LEU C N   1 
ATOM   1540 C CA  . LEU C 1 4  ? -0.149  24.895 3.595   1.00 17.76 ? 227 LEU C CA  1 
ATOM   1541 C C   . LEU C 1 4  ? -1.370  24.665 4.486   1.00 17.35 ? 227 LEU C C   1 
ATOM   1542 O O   . LEU C 1 4  ? -2.474  25.071 4.147   1.00 18.97 ? 227 LEU C O   1 
ATOM   1543 C CB  . LEU C 1 4  ? 0.308   26.351 3.577   1.00 18.12 ? 227 LEU C CB  1 
ATOM   1544 C CG  . LEU C 1 4  ? 0.733   26.897 4.938   1.00 17.40 ? 227 LEU C CG  1 
ATOM   1545 C CD1 . LEU C 1 4  ? 1.827   27.931 4.794   1.00 19.57 ? 227 LEU C CD1 1 
ATOM   1546 C CD2 . LEU C 1 4  ? -0.462  27.510 5.684   1.00 23.00 ? 227 LEU C CD2 1 
ATOM   1547 N N   . GLN C 1 5  ? -1.157  24.003 5.614   1.00 15.48 ? 228 GLN C N   1 
ATOM   1548 C CA  . GLN C 1 5  ? -2.256  23.703 6.521   1.00 15.59 ? 228 GLN C CA  1 
ATOM   1549 C C   . GLN C 1 5  ? -1.727  23.604 7.941   1.00 15.04 ? 228 GLN C C   1 
ATOM   1550 O O   . GLN C 1 5  ? -0.801  22.826 8.206   1.00 14.94 ? 228 GLN C O   1 
ATOM   1551 C CB  . GLN C 1 5  ? -2.961  22.370 6.135   1.00 16.42 ? 228 GLN C CB  1 
ATOM   1552 C CG  . GLN C 1 5  ? -4.043  22.004 7.139   1.00 19.91 ? 228 GLN C CG  1 
ATOM   1553 C CD  . GLN C 1 5  ? -5.156  23.057 7.228   1.00 20.97 ? 228 GLN C CD  1 
ATOM   1554 O OE1 . GLN C 1 5  ? -5.674  23.519 6.197   1.00 21.52 ? 228 GLN C OE1 1 
ATOM   1555 N NE2 . GLN C 1 5  ? -5.528  23.433 8.446   1.00 21.66 ? 228 GLN C NE2 1 
ATOM   1556 N N   . ILE C 1 6  ? -2.315  24.380 8.837   1.00 14.29 ? 229 ILE C N   1 
ATOM   1557 C CA  . ILE C 1 6  ? -2.017  24.205 10.263  1.00 14.51 ? 229 ILE C CA  1 
ATOM   1558 C C   . ILE C 1 6  ? -2.660  22.897 10.776  1.00 14.91 ? 229 ILE C C   1 
ATOM   1559 O O   . ILE C 1 6  ? -3.883  22.665 10.627  1.00 18.86 ? 229 ILE C O   1 
ATOM   1560 C CB  . ILE C 1 6  ? -2.546  25.402 11.042  1.00 14.37 ? 229 ILE C CB  1 
ATOM   1561 C CG1 . ILE C 1 6  ? -1.761  26.678 10.620  1.00 13.94 ? 229 ILE C CG1 1 
ATOM   1562 C CG2 . ILE C 1 6  ? -2.375  25.171 12.552  1.00 15.21 ? 229 ILE C CG2 1 
ATOM   1563 C CD1 . ILE C 1 6  ? -2.327  27.916 11.307  1.00 14.32 ? 229 ILE C CD1 1 
ATOM   1564 N N   A CYS C 1 7  ? -1.791  22.104 11.423  0.50 12.96 ? 230 CYS C N   1 
ATOM   1565 N N   B CYS C 1 7  ? -1.815  22.076 11.386  0.50 14.68 ? 230 CYS C N   1 
ATOM   1566 C CA  A CYS C 1 7  ? -2.083  20.768 11.956  0.50 14.71 ? 230 CYS C CA  1 
ATOM   1567 C CA  B CYS C 1 7  ? -2.312  20.858 11.988  0.50 17.38 ? 230 CYS C CA  1 
ATOM   1568 C C   A CYS C 1 7  ? -2.028  20.622 13.456  0.50 15.58 ? 230 CYS C C   1 
ATOM   1569 C C   B CYS C 1 7  ? -2.310  20.899 13.497  0.50 17.63 ? 230 CYS C C   1 
ATOM   1570 O O   A CYS C 1 7  ? -2.672  19.733 14.008  0.50 14.30 ? 230 CYS C O   1 
ATOM   1571 O O   B CYS C 1 7  ? -3.247  20.347 14.095  0.50 16.59 ? 230 CYS C O   1 
ATOM   1572 C CB  A CYS C 1 7  ? -1.131  19.753 11.373  0.50 16.05 ? 230 CYS C CB  1 
ATOM   1573 C CB  B CYS C 1 7  ? -1.597  19.603 11.461  0.50 18.69 ? 230 CYS C CB  1 
ATOM   1574 S SG  A CYS C 1 7  ? -1.484  19.523 9.652   0.50 17.26 ? 230 CYS C SG  1 
ATOM   1575 S SG  B CYS C 1 7  ? 0.170   19.780 11.136  0.50 27.93 ? 230 CYS C SG  1 
ATOM   1576 N N   . VAL C 1 8  ? -1.288  21.482 14.123  1.00 14.93 ? 231 VAL C N   1 
ATOM   1577 C CA  . VAL C 1 8  ? -1.267  21.563 15.593  1.00 14.76 ? 231 VAL C CA  1 
ATOM   1578 C C   . VAL C 1 8  ? -1.507  23.046 15.907  1.00 14.71 ? 231 VAL C C   1 
ATOM   1579 O O   . VAL C 1 8  ? -0.790  23.925 15.440  1.00 13.37 ? 231 VAL C O   1 
ATOM   1580 C CB  . VAL C 1 8  ? 0.087   21.122 16.202  1.00 15.79 ? 231 VAL C CB  1 
ATOM   1581 C CG1 . VAL C 1 8  ? 0.117   21.355 17.728  1.00 16.73 ? 231 VAL C CG1 1 
ATOM   1582 C CG2 . VAL C 1 8  ? 0.407   19.657 15.810  1.00 16.61 ? 231 VAL C CG2 1 
ATOM   1583 N N   . GLU C 1 9  ? -2.541  23.286 16.694  1.00 14.94 ? 232 GLU C N   1 
ATOM   1584 C CA  . GLU C 1 9  ? -2.928  24.595 17.159  1.00 14.93 ? 232 GLU C CA  1 
ATOM   1585 C C   . GLU C 1 9  ? -2.421  24.825 18.583  1.00 14.54 ? 232 GLU C C   1 
ATOM   1586 O O   . GLU C 1 9  ? -2.307  23.901 19.363  1.00 15.84 ? 232 GLU C O   1 
ATOM   1587 C CB  . GLU C 1 9  ? -4.454  24.723 17.181  1.00 16.50 ? 232 GLU C CB  1 
ATOM   1588 C CG  . GLU C 1 9  ? -5.063  24.663 15.780  1.00 17.34 ? 232 GLU C CG  1 
ATOM   1589 C CD  . GLU C 1 9  ? -4.997  25.976 15.033  1.00 16.56 ? 232 GLU C CD  1 
ATOM   1590 O OE1 . GLU C 1 9  ? -4.379  26.931 15.509  1.00 17.83 ? 232 GLU C OE1 1 
ATOM   1591 O OE2 . GLU C 1 9  ? -5.585  26.054 13.923  1.00 19.49 ? 232 GLU C OE2 1 
ATOM   1592 N N   . PRO C 1 10 ? -2.160  26.097 18.961  1.00 14.55 ? 233 PRO C N   1 
ATOM   1593 C CA  . PRO C 1 10 ? -1.735  26.394 20.326  1.00 14.26 ? 233 PRO C CA  1 
ATOM   1594 C C   . PRO C 1 10 ? -2.916  26.261 21.296  1.00 14.35 ? 233 PRO C C   1 
ATOM   1595 O O   . PRO C 1 10 ? -4.078  26.170 20.873  1.00 15.10 ? 233 PRO C O   1 
ATOM   1596 C CB  . PRO C 1 10 ? -1.284  27.859 20.248  1.00 14.11 ? 233 PRO C CB  1 
ATOM   1597 C CG  . PRO C 1 10 ? -2.073  28.448 19.068  1.00 13.69 ? 233 PRO C CG  1 
ATOM   1598 C CD  . PRO C 1 10 ? -2.138  27.307 18.083  1.00 14.25 ? 233 PRO C CD  1 
ATOM   1599 N N   . THR C 1 11 ? -2.606  26.220 22.596  1.00 15.00 ? 234 THR C N   1 
ATOM   1600 C CA  . THR C 1 11 ? -3.562  26.067 23.673  1.00 15.93 ? 234 THR C CA  1 
ATOM   1601 C C   . THR C 1 11 ? -3.515  27.166 24.678  1.00 13.87 ? 234 THR C C   1 
ATOM   1602 O O   . THR C 1 11 ? -2.468  27.633 25.078  1.00 14.37 ? 234 THR C O   1 
ATOM   1603 C CB  . THR C 1 11 ? -3.312  24.704 24.387  1.00 16.67 ? 234 THR C CB  1 
ATOM   1604 O OG1 . THR C 1 11 ? -1.978  24.558 24.893  1.00 24.23 ? 234 THR C OG1 1 
ATOM   1605 C CG2 . THR C 1 11 ? -3.588  23.584 23.427  1.00 19.20 ? 234 THR C CG2 1 
ATOM   1606 N N   . SER C 1 12 ? -4.700  27.616 25.110  1.00 14.43 ? 235 SER C N   1 
ATOM   1607 C CA  . SER C 1 12 ? -4.798  28.589 26.204  1.00 14.10 ? 235 SER C CA  1 
ATOM   1608 C C   . SER C 1 12 ? -4.342  27.924 27.491  1.00 15.81 ? 235 SER C C   1 
ATOM   1609 O O   . SER C 1 12 ? -4.557  26.727 27.688  1.00 17.84 ? 235 SER C O   1 
ATOM   1610 C CB  . SER C 1 12 ? -6.233  29.070 26.391  1.00 15.25 ? 235 SER C CB  1 
ATOM   1611 O OG  . SER C 1 12 ? -6.663  29.793 25.255  1.00 16.02 ? 235 SER C OG  1 
ATOM   1612 N N   . GLN C 1 13 ? -3.792  28.723 28.391  1.00 14.30 ? 236 GLN C N   1 
ATOM   1613 C CA  . GLN C 1 13 ? -3.258  28.226 29.647  1.00 14.85 ? 236 GLN C CA  1 
ATOM   1614 C C   . GLN C 1 13 ? -3.408  29.247 30.728  1.00 15.35 ? 236 GLN C C   1 
ATOM   1615 O O   . GLN C 1 13 ? -3.339  30.455 30.473  1.00 17.40 ? 236 GLN C O   1 
ATOM   1616 C CB  . GLN C 1 13 ? -1.791  27.953 29.498  1.00 14.59 ? 236 GLN C CB  1 
ATOM   1617 C CG  . GLN C 1 13 ? -1.521  26.933 28.385  1.00 18.61 ? 236 GLN C CG  1 
ATOM   1618 C CD  . GLN C 1 13 ? -0.131  26.755 28.083  1.00 17.03 ? 236 GLN C CD  1 
ATOM   1619 O OE1 . GLN C 1 13 ? 0.686   26.497 28.979  1.00 21.96 ? 236 GLN C OE1 1 
ATOM   1620 N NE2 . GLN C 1 13 ? 0.203   26.855 26.786  1.00 16.99 ? 236 GLN C NE2 1 
ATOM   1621 N N   . LYS C 1 14 ? -3.557  28.733 31.937  1.00 16.54 ? 237 LYS C N   1 
ATOM   1622 C CA  . LYS C 1 14 ? -3.516  29.569 33.150  1.00 17.71 ? 237 LYS C CA  1 
ATOM   1623 C C   . LYS C 1 14 ? -2.321  29.111 33.960  1.00 16.97 ? 237 LYS C C   1 
ATOM   1624 O O   . LYS C 1 14 ? -2.236  27.943 34.368  1.00 18.83 ? 237 LYS C O   1 
ATOM   1625 C CB  . LYS C 1 14 ? -4.803  29.435 33.947  1.00 20.75 ? 237 LYS C CB  1 
ATOM   1626 C CG  . LYS C 1 14 ? -4.894  30.404 35.186  1.00 21.84 ? 237 LYS C CG  1 
ATOM   1627 C CD  . LYS C 1 14 ? -6.254  30.319 35.920  1.00 23.25 ? 237 LYS C CD  1 
ATOM   1628 C CE  . LYS C 1 14 ? -6.250  30.972 37.278  1.00 29.69 ? 237 LYS C CE  1 
ATOM   1629 N NZ  . LYS C 1 14 ? -5.391  30.272 38.256  1.00 35.20 ? 237 LYS C NZ  1 
ATOM   1630 N N   . LEU C 1 15 ? -1.375  30.014 34.131  1.00 16.20 ? 238 LEU C N   1 
ATOM   1631 C CA  . LEU C 1 15 ? -0.086  29.706 34.725  1.00 16.87 ? 238 LEU C CA  1 
ATOM   1632 C C   . LEU C 1 15 ? 0.178   30.520 35.964  1.00 18.99 ? 238 LEU C C   1 
ATOM   1633 O O   . LEU C 1 15 ? -0.387  31.578 36.141  1.00 19.93 ? 238 LEU C O   1 
ATOM   1634 C CB  . LEU C 1 15 ? 1.020   30.022 33.690  1.00 16.11 ? 238 LEU C CB  1 
ATOM   1635 C CG  . LEU C 1 15 ? 0.886   29.274 32.366  1.00 16.11 ? 238 LEU C CG  1 
ATOM   1636 C CD1 . LEU C 1 15 ? 1.945   29.775 31.419  1.00 16.58 ? 238 LEU C CD1 1 
ATOM   1637 C CD2 . LEU C 1 15 ? 1.054   27.749 32.633  1.00 17.08 ? 238 LEU C CD2 1 
ATOM   1638 N N   A MET C 1 16 ? 1.012   29.984 36.847  0.50 21.59 ? 239 MET C N   1 
ATOM   1639 N N   B MET C 1 16 ? 1.057   30.009 36.805  0.50 20.53 ? 239 MET C N   1 
ATOM   1640 C CA  A MET C 1 16 ? 1.561   30.729 37.990  0.50 24.81 ? 239 MET C CA  1 
ATOM   1641 C CA  B MET C 1 16 ? 1.530   30.728 37.978  0.50 22.09 ? 239 MET C CA  1 
ATOM   1642 C C   A MET C 1 16 ? 2.809   31.492 37.597  0.50 23.24 ? 239 MET C C   1 
ATOM   1643 C C   B MET C 1 16 ? 2.828   31.460 37.637  0.50 22.01 ? 239 MET C C   1 
ATOM   1644 O O   A MET C 1 16 ? 3.594   31.015 36.787  0.50 21.44 ? 239 MET C O   1 
ATOM   1645 O O   B MET C 1 16 ? 3.647   30.945 36.871  0.50 18.94 ? 239 MET C O   1 
ATOM   1646 C CB  A MET C 1 16 ? 1.999   29.769 39.098  0.50 25.40 ? 239 MET C CB  1 
ATOM   1647 C CB  B MET C 1 16 ? 1.760   29.731 39.133  0.50 23.91 ? 239 MET C CB  1 
ATOM   1648 C CG  A MET C 1 16 ? 0.943   29.297 40.021  0.50 28.71 ? 239 MET C CG  1 
ATOM   1649 C CG  B MET C 1 16 ? 0.530   28.936 39.499  0.50 26.46 ? 239 MET C CG  1 
ATOM   1650 S SD  A MET C 1 16 ? 1.614   27.825 40.793  0.50 31.73 ? 239 MET C SD  1 
ATOM   1651 S SD  B MET C 1 16 ? -0.192  29.721 40.927  0.50 30.94 ? 239 MET C SD  1 
ATOM   1652 C CE  A MET C 1 16 ? 3.093   28.417 41.626  0.50 30.19 ? 239 MET C CE  1 
ATOM   1653 C CE  B MET C 1 16 ? -1.930  29.791 40.512  0.50 29.42 ? 239 MET C CE  1 
ATOM   1654 N N   . PRO C 1 17 ? 3.071   32.642 38.233  1.00 22.75 ? 240 PRO C N   1 
ATOM   1655 C CA  . PRO C 1 17 ? 4.376   33.211 38.025  1.00 22.40 ? 240 PRO C CA  1 
ATOM   1656 C C   . PRO C 1 17 ? 5.500   32.171 38.347  1.00 21.96 ? 240 PRO C C   1 
ATOM   1657 O O   . PRO C 1 17 ? 5.399   31.395 39.299  1.00 22.85 ? 240 PRO C O   1 
ATOM   1658 C CB  . PRO C 1 17 ? 4.395   34.401 39.018  1.00 23.28 ? 240 PRO C CB  1 
ATOM   1659 C CG  . PRO C 1 17 ? 2.968   34.754 39.163  1.00 25.83 ? 240 PRO C CG  1 
ATOM   1660 C CD  . PRO C 1 17 ? 2.220   33.477 39.105  1.00 24.65 ? 240 PRO C CD  1 
ATOM   1661 N N   . GLY C 1 18 ? 6.488   32.090 37.482  1.00 20.68 ? 241 GLY C N   1 
ATOM   1662 C CA  . GLY C 1 18 ? 7.610   31.159 37.607  1.00 21.66 ? 241 GLY C CA  1 
ATOM   1663 C C   . GLY C 1 18 ? 7.394   29.855 36.825  1.00 21.01 ? 241 GLY C C   1 
ATOM   1664 O O   . GLY C 1 18 ? 8.327   29.076 36.634  1.00 22.82 ? 241 GLY C O   1 
ATOM   1665 N N   A SER C 1 19 ? 6.155   29.616 36.386  0.50 19.18 ? 242 SER C N   1 
ATOM   1666 N N   B SER C 1 19 ? 6.179   29.592 36.380  0.50 19.77 ? 242 SER C N   1 
ATOM   1667 C CA  A SER C 1 19 ? 5.832   28.468 35.506  0.50 17.73 ? 242 SER C CA  1 
ATOM   1668 C CA  B SER C 1 19 ? 5.986   28.387 35.574  0.50 18.66 ? 242 SER C CA  1 
ATOM   1669 C C   A SER C 1 19 ? 6.483   28.646 34.144  0.50 16.75 ? 242 SER C C   1 
ATOM   1670 C C   B SER C 1 19 ? 6.351   28.665 34.118  0.50 17.22 ? 242 SER C C   1 
ATOM   1671 O O   A SER C 1 19 ? 7.020   29.720 33.828  0.50 17.11 ? 242 SER C O   1 
ATOM   1672 O O   B SER C 1 19 ? 6.575   29.828 33.717  0.50 17.97 ? 242 SER C O   1 
ATOM   1673 C CB  A SER C 1 19 ? 4.325   28.363 35.298  0.50 17.79 ? 242 SER C CB  1 
ATOM   1674 C CB  B SER C 1 19 ? 4.571   27.884 35.722  0.50 19.64 ? 242 SER C CB  1 
ATOM   1675 O OG  A SER C 1 19 ? 3.658   27.958 36.485  0.50 18.00 ? 242 SER C OG  1 
ATOM   1676 O OG  B SER C 1 19 ? 3.669   28.869 35.262  0.50 21.00 ? 242 SER C OG  1 
ATOM   1677 N N   . THR C 1 20 ? 6.466   27.601 33.331  1.00 17.09 ? 243 THR C N   1 
ATOM   1678 C CA  . THR C 1 20 ? 6.954   27.694 31.970  1.00 16.43 ? 243 THR C CA  1 
ATOM   1679 C C   . THR C 1 20 ? 5.789   27.910 31.006  1.00 15.27 ? 243 THR C C   1 
ATOM   1680 O O   . THR C 1 20 ? 4.748   27.239 31.102  1.00 15.55 ? 243 THR C O   1 
ATOM   1681 C CB  . THR C 1 20 ? 7.738   26.421 31.614  1.00 17.22 ? 243 THR C CB  1 
ATOM   1682 O OG1 . THR C 1 20 ? 8.910   26.378 32.454  1.00 21.84 ? 243 THR C OG1 1 
ATOM   1683 C CG2 . THR C 1 20 ? 8.163   26.472 30.172  1.00 17.77 ? 243 THR C CG2 1 
ATOM   1684 N N   . LEU C 1 21 ? 5.974   28.796 30.041  1.00 14.70 ? 244 LEU C N   1 
ATOM   1685 C CA  . LEU C 1 21 ? 5.035   28.974 28.965  1.00 14.32 ? 244 LEU C CA  1 
ATOM   1686 C C   . LEU C 1 21 ? 5.569   28.308 27.728  1.00 13.47 ? 244 LEU C C   1 
ATOM   1687 O O   . LEU C 1 21 ? 6.648   28.644 27.291  1.00 14.16 ? 244 LEU C O   1 
ATOM   1688 C CB  . LEU C 1 21 ? 4.814   30.485 28.707  1.00 15.01 ? 244 LEU C CB  1 
ATOM   1689 C CG  . LEU C 1 21 ? 3.945   30.799 27.478  1.00 15.78 ? 244 LEU C CG  1 
ATOM   1690 C CD1 . LEU C 1 21 ? 2.557   30.154 27.528  1.00 16.19 ? 244 LEU C CD1 1 
ATOM   1691 C CD2 . LEU C 1 21 ? 3.854   32.334 27.283  1.00 17.53 ? 244 LEU C CD2 1 
ATOM   1692 N N   . VAL C 1 22 ? 4.815   27.350 27.177  1.00 13.53 ? 245 VAL C N   1 
ATOM   1693 C CA  . VAL C 1 22 ? 5.099   26.814 25.840  1.00 13.98 ? 245 VAL C CA  1 
ATOM   1694 C C   . VAL C 1 22 ? 3.866   26.946 24.991  1.00 12.67 ? 245 VAL C C   1 
ATOM   1695 O O   . VAL C 1 22 ? 2.819   26.475 25.389  1.00 13.90 ? 245 VAL C O   1 
ATOM   1696 C CB  . VAL C 1 22 ? 5.578   25.307 25.841  1.00 15.73 ? 245 VAL C CB  1 
ATOM   1697 C CG1 . VAL C 1 22 ? 5.891   24.852 24.411  1.00 19.40 ? 245 VAL C CG1 1 
ATOM   1698 C CG2 . VAL C 1 22 ? 6.786   25.162 26.751  1.00 18.87 ? 245 VAL C CG2 1 
ATOM   1699 N N   . LEU C 1 23 ? 3.989   27.609 23.849  1.00 11.73 ? 246 LEU C N   1 
ATOM   1700 C CA  . LEU C 1 23 ? 2.940   27.645 22.812  1.00 12.24 ? 246 LEU C CA  1 
ATOM   1701 C C   . LEU C 1 23 ? 3.507   26.995 21.574  1.00 11.21 ? 246 LEU C C   1 
ATOM   1702 O O   . LEU C 1 23 ? 4.676   27.154 21.238  1.00 12.83 ? 246 LEU C O   1 
ATOM   1703 C CB  . LEU C 1 23 ? 2.504   29.097 22.538  1.00 12.69 ? 246 LEU C CB  1 
ATOM   1704 C CG  . LEU C 1 23 ? 1.768   29.745 23.637  1.00 13.32 ? 246 LEU C CG  1 
ATOM   1705 C CD1 . LEU C 1 23 ? 1.578   31.244 23.389  1.00 15.90 ? 246 LEU C CD1 1 
ATOM   1706 C CD2 . LEU C 1 23 ? 0.381   29.070 23.751  1.00 18.34 ? 246 LEU C CD2 1 
ATOM   1707 N N   . GLN C 1 24 ? 2.663   26.212 20.904  1.00 10.54 ? 247 GLN C N   1 
ATOM   1708 C CA  . GLN C 1 24 ? 3.079   25.455 19.749  1.00 11.09 ? 247 GLN C CA  1 
ATOM   1709 C C   . GLN C 1 24 ? 2.083   25.633 18.603  1.00 10.74 ? 247 GLN C C   1 
ATOM   1710 O O   . GLN C 1 24 ? 0.870   25.600 18.791  1.00 12.22 ? 247 GLN C O   1 
ATOM   1711 C CB  . GLN C 1 24 ? 3.222   23.971 20.082  1.00 12.03 ? 247 GLN C CB  1 
ATOM   1712 C CG  . GLN C 1 24 ? 3.703   23.106 18.917  1.00 12.94 ? 247 GLN C CG  1 
ATOM   1713 C CD  . GLN C 1 24 ? 4.049   21.675 19.352  1.00 12.83 ? 247 GLN C CD  1 
ATOM   1714 O OE1 . GLN C 1 24 ? 3.554   21.195 20.407  1.00 17.78 ? 247 GLN C OE1 1 
ATOM   1715 N NE2 . GLN C 1 24 ? 4.925   21.050 18.660  1.00 11.74 ? 247 GLN C NE2 1 
ATOM   1716 N N   . CYS C 1 25 ? 2.638   25.774 17.395  1.00 10.94 ? 248 CYS C N   1 
ATOM   1717 C CA  . CYS C 1 25 ? 1.836   25.762 16.165  1.00 11.28 ? 248 CYS C CA  1 
ATOM   1718 C C   . CYS C 1 25 ? 2.658   25.009 15.134  1.00 11.60 ? 248 CYS C C   1 
ATOM   1719 O O   . CYS C 1 25 ? 3.820   25.342 14.941  1.00 12.39 ? 248 CYS C O   1 
ATOM   1720 C CB  . CYS C 1 25 ? 1.510   27.195 15.723  1.00 11.38 ? 248 CYS C CB  1 
ATOM   1721 S SG  . CYS C 1 25 ? 0.497   27.250 14.229  1.00 12.99 ? 248 CYS C SG  1 
ATOM   1722 N N   . VAL C 1 26 ? 2.048   23.994 14.491  1.00 12.30 ? 249 VAL C N   1 
ATOM   1723 C CA  . VAL C 1 26 ? 2.779   23.218 13.507  1.00 13.01 ? 249 VAL C CA  1 
ATOM   1724 C C   . VAL C 1 26 ? 1.911   23.175 12.256  1.00 12.89 ? 249 VAL C C   1 
ATOM   1725 O O   . VAL C 1 26 ? 0.736   22.837 12.318  1.00 14.27 ? 249 VAL C O   1 
ATOM   1726 C CB  . VAL C 1 26 ? 3.080   21.781 13.948  1.00 14.75 ? 249 VAL C CB  1 
ATOM   1727 C CG1 . VAL C 1 26 ? 3.966   21.048 12.890  1.00 16.35 ? 249 VAL C CG1 1 
ATOM   1728 C CG2 . VAL C 1 26 ? 3.785   21.775 15.280  1.00 16.05 ? 249 VAL C CG2 1 
ATOM   1729 N N   . ALA C 1 27 ? 2.537   23.400 11.106  1.00 12.91 ? 250 ALA C N   1 
ATOM   1730 C CA  . ALA C 1 27 ? 1.869   23.292 9.826   1.00 12.81 ? 250 ALA C CA  1 
ATOM   1731 C C   . ALA C 1 27 ? 2.667   22.388 8.907   1.00 13.92 ? 250 ALA C C   1 
ATOM   1732 O O   . ALA C 1 27 ? 3.878   22.186 9.081   1.00 16.16 ? 250 ALA C O   1 
ATOM   1733 C CB  . ALA C 1 27 ? 1.662   24.706 9.219   1.00 14.48 ? 250 ALA C CB  1 
ATOM   1734 N N   . VAL C 1 28 ? 1.978   21.923 7.875   1.00 15.59 ? 251 VAL C N   1 
ATOM   1735 C CA  . VAL C 1 28 ? 2.623   21.224 6.771   1.00 16.60 ? 251 VAL C CA  1 
ATOM   1736 C C   . VAL C 1 28 ? 2.475   22.065 5.531   1.00 17.17 ? 251 VAL C C   1 
ATOM   1737 O O   . VAL C 1 28 ? 1.653   22.960 5.500   1.00 17.59 ? 251 VAL C O   1 
ATOM   1738 C CB  . VAL C 1 28 ? 1.996   19.822 6.523   1.00 18.67 ? 251 VAL C CB  1 
ATOM   1739 C CG1 . VAL C 1 28 ? 2.174   18.926 7.754   1.00 22.91 ? 251 VAL C CG1 1 
ATOM   1740 C CG2 . VAL C 1 28 ? 0.518   19.925 6.203   1.00 19.98 ? 251 VAL C CG2 1 
ATOM   1741 N N   . GLY C 1 29 ? 3.273   21.776 4.511   1.00 18.15 ? 252 GLY C N   1 
ATOM   1742 C CA  . GLY C 1 29 ? 3.172   22.440 3.235   1.00 19.90 ? 252 GLY C CA  1 
ATOM   1743 C C   . GLY C 1 29 ? 4.493   22.409 2.519   1.00 19.14 ? 252 GLY C C   1 
ATOM   1744 O O   . GLY C 1 29 ? 5.534   22.242 3.136   1.00 18.92 ? 252 GLY C O   1 
ATOM   1745 N N   . SER C 1 30 ? 4.440   22.670 1.220   1.00 19.48 ? 253 SER C N   1 
ATOM   1746 C CA  . SER C 1 30 ? 5.637   22.871 0.423   1.00 19.77 ? 253 SER C CA  1 
ATOM   1747 C C   . SER C 1 30 ? 5.304   23.957 -0.575  1.00 19.98 ? 253 SER C C   1 
ATOM   1748 O O   . SER C 1 30 ? 4.341   23.792 -1.316  1.00 22.09 ? 253 SER C O   1 
ATOM   1749 C CB  . SER C 1 30 ? 6.021   21.575 -0.296  1.00 20.88 ? 253 SER C CB  1 
ATOM   1750 O OG  . SER C 1 30 ? 7.151   21.775 -1.108  1.00 26.32 ? 253 SER C OG  1 
ATOM   1751 N N   . PRO C 1 31 ? 6.088   25.053 -0.606  1.00 19.07 ? 254 PRO C N   1 
ATOM   1752 C CA  . PRO C 1 31 ? 7.252   25.289 0.229   1.00 17.41 ? 254 PRO C CA  1 
ATOM   1753 C C   . PRO C 1 31 ? 6.947   25.243 1.731   1.00 16.19 ? 254 PRO C C   1 
ATOM   1754 O O   . PRO C 1 31 ? 5.803   25.477 2.182   1.00 16.34 ? 254 PRO C O   1 
ATOM   1755 C CB  . PRO C 1 31 ? 7.718   26.685 -0.198  1.00 18.78 ? 254 PRO C CB  1 
ATOM   1756 C CG  . PRO C 1 31 ? 7.225   26.838 -1.597  1.00 19.80 ? 254 PRO C CG  1 
ATOM   1757 C CD  . PRO C 1 31 ? 5.929   26.092 -1.646  1.00 20.04 ? 254 PRO C CD  1 
ATOM   1758 N N   A ILE C 1 32 ? 7.972   24.927 2.501   0.50 14.82 ? 255 ILE C N   1 
ATOM   1759 N N   B ILE C 1 32 ? 7.977   24.928 2.509   0.50 16.00 ? 255 ILE C N   1 
ATOM   1760 C CA  A ILE C 1 32 ? 7.788   24.697 3.925   0.50 14.80 ? 255 ILE C CA  1 
ATOM   1761 C CA  B ILE C 1 32 ? 7.804   24.675 3.941   0.50 17.13 ? 255 ILE C CA  1 
ATOM   1762 C C   A ILE C 1 32 ? 7.213   25.949 4.603   0.50 14.44 ? 255 ILE C C   1 
ATOM   1763 C C   B ILE C 1 32 ? 7.307   25.921 4.682   0.50 15.97 ? 255 ILE C C   1 
ATOM   1764 O O   A ILE C 1 32 ? 7.488   27.062 4.200   0.50 13.90 ? 255 ILE C O   1 
ATOM   1765 O O   B ILE C 1 32 ? 7.822   27.006 4.471   0.50 16.13 ? 255 ILE C O   1 
ATOM   1766 C CB  A ILE C 1 32 ? 9.100   24.238 4.535   0.50 15.33 ? 255 ILE C CB  1 
ATOM   1767 C CB  B ILE C 1 32 ? 9.111   24.201 4.586   0.50 17.73 ? 255 ILE C CB  1 
ATOM   1768 C CG1 A ILE C 1 32 ? 9.446   22.853 3.952   0.50 15.74 ? 255 ILE C CG1 1 
ATOM   1769 C CG1 B ILE C 1 32 ? 8.823   23.607 5.971   0.50 19.31 ? 255 ILE C CG1 1 
ATOM   1770 C CG2 A ILE C 1 32 ? 9.013   24.179 6.040   0.50 17.26 ? 255 ILE C CG2 1 
ATOM   1771 C CG2 B ILE C 1 32 ? 10.181  25.326 4.564   0.50 17.99 ? 255 ILE C CG2 1 
ATOM   1772 C CD1 A ILE C 1 32 ? 10.901  22.552 3.849   0.50 20.80 ? 255 ILE C CD1 1 
ATOM   1773 C CD1 B ILE C 1 32 ? 10.056  23.221 6.770   0.50 20.40 ? 255 ILE C CD1 1 
ATOM   1774 N N   . PRO C 1 33 ? 6.294   25.754 5.549   1.00 14.55 ? 256 PRO C N   1 
ATOM   1775 C CA  . PRO C 1 33 ? 5.768   26.923 6.256   1.00 14.37 ? 256 PRO C CA  1 
ATOM   1776 C C   . PRO C 1 33 ? 6.805   27.649 7.106   1.00 13.97 ? 256 PRO C C   1 
ATOM   1777 O O   . PRO C 1 33 ? 7.693   27.038 7.717   1.00 15.16 ? 256 PRO C O   1 
ATOM   1778 C CB  . PRO C 1 33 ? 4.606   26.336 7.110   1.00 15.02 ? 256 PRO C CB  1 
ATOM   1779 C CG  . PRO C 1 33 ? 4.216   25.104 6.318   1.00 17.56 ? 256 PRO C CG  1 
ATOM   1780 C CD  . PRO C 1 33 ? 5.501   24.528 5.819   1.00 17.23 ? 256 PRO C CD  1 
ATOM   1781 N N   . HIS C 1 34 ? 6.620   28.964 7.190   1.00 13.05 ? 257 HIS C N   1 
ATOM   1782 C CA  . HIS C 1 34 ? 7.289   29.838 8.123   1.00 12.61 ? 257 HIS C CA  1 
ATOM   1783 C C   . HIS C 1 34 ? 6.271   30.330 9.145   1.00 11.74 ? 257 HIS C C   1 
ATOM   1784 O O   . HIS C 1 34 ? 5.057   30.257 8.933   1.00 12.56 ? 257 HIS C O   1 
ATOM   1785 C CB  . HIS C 1 34 ? 7.842   31.035 7.346   1.00 14.47 ? 257 HIS C CB  1 
ATOM   1786 C CG  . HIS C 1 34 ? 8.872   30.642 6.339   1.00 18.20 ? 257 HIS C CG  1 
ATOM   1787 N ND1 . HIS C 1 34 ? 10.188  30.859 6.578   1.00 23.93 ? 257 HIS C ND1 1 
ATOM   1788 C CD2 . HIS C 1 34 ? 8.829   29.970 5.127   1.00 19.53 ? 257 HIS C CD2 1 
ATOM   1789 C CE1 . HIS C 1 34 ? 10.925  30.407 5.551   1.00 21.81 ? 257 HIS C CE1 1 
ATOM   1790 N NE2 . HIS C 1 34 ? 10.118  29.842 4.652   1.00 31.41 ? 257 HIS C NE2 1 
ATOM   1791 N N   . TYR C 1 35 ? 6.827   30.816 10.260  1.00 12.38 ? 258 TYR C N   1 
ATOM   1792 C CA  . TYR C 1 35 ? 5.999   31.141 11.420  1.00 11.63 ? 258 TYR C CA  1 
ATOM   1793 C C   . TYR C 1 35 ? 6.375   32.534 11.962  1.00 12.04 ? 258 TYR C C   1 
ATOM   1794 O O   . TYR C 1 35 ? 7.536   32.939 11.874  1.00 12.09 ? 258 TYR C O   1 
ATOM   1795 C CB  . TYR C 1 35 ? 6.280   30.129 12.588  1.00 11.82 ? 258 TYR C CB  1 
ATOM   1796 C CG  . TYR C 1 35 ? 5.982   28.700 12.174  1.00 11.85 ? 258 TYR C CG  1 
ATOM   1797 C CD1 . TYR C 1 35 ? 4.720   28.141 12.371  1.00 12.13 ? 258 TYR C CD1 1 
ATOM   1798 C CD2 . TYR C 1 35 ? 6.925   27.946 11.497  1.00 12.58 ? 258 TYR C CD2 1 
ATOM   1799 C CE1 . TYR C 1 35 ? 4.442   26.873 11.943  1.00 12.05 ? 258 TYR C CE1 1 
ATOM   1800 C CE2 . TYR C 1 35 ? 6.655   26.648 11.058  1.00 12.57 ? 258 TYR C CE2 1 
ATOM   1801 C CZ  . TYR C 1 35 ? 5.390   26.124 11.254  1.00 12.30 ? 258 TYR C CZ  1 
ATOM   1802 O OH  . TYR C 1 35 ? 5.081   24.846 10.812  1.00 13.57 ? 258 TYR C OH  1 
ATOM   1803 N N   . GLN C 1 36 ? 5.393   33.230 12.566  1.00 11.34 ? 259 GLN C N   1 
ATOM   1804 C CA  . GLN C 1 36 ? 5.721   34.435 13.330  1.00 11.24 ? 259 GLN C CA  1 
ATOM   1805 C C   . GLN C 1 36 ? 4.651   34.527 14.427  1.00 11.05 ? 259 GLN C C   1 
ATOM   1806 O O   . GLN C 1 36 ? 3.458   34.575 14.123  1.00 11.26 ? 259 GLN C O   1 
ATOM   1807 C CB  . GLN C 1 36 ? 5.673   35.678 12.458  1.00 12.06 ? 259 GLN C CB  1 
ATOM   1808 C CG  . GLN C 1 36 ? 5.857   36.965 13.220  1.00 12.57 ? 259 GLN C CG  1 
ATOM   1809 C CD  . GLN C 1 36 ? 7.162   37.081 13.988  1.00 12.22 ? 259 GLN C CD  1 
ATOM   1810 O OE1 . GLN C 1 36 ? 8.258   37.041 13.411  1.00 13.83 ? 259 GLN C OE1 1 
ATOM   1811 N NE2 . GLN C 1 36 ? 7.038   37.253 15.284  1.00 13.74 ? 259 GLN C NE2 1 
ATOM   1812 N N   . TRP C 1 37 ? 5.086   34.572 15.685  1.00 11.16 ? 260 TRP C N   1 
ATOM   1813 C CA  . TRP C 1 37 ? 4.180   34.698 16.790  1.00 10.72 ? 260 TRP C CA  1 
ATOM   1814 C C   . TRP C 1 37 ? 3.859   36.145 17.114  1.00 11.29 ? 260 TRP C C   1 
ATOM   1815 O O   . TRP C 1 37 ? 4.716   37.056 16.963  1.00 12.22 ? 260 TRP C O   1 
ATOM   1816 C CB  . TRP C 1 37 ? 4.826   34.073 18.053  1.00 11.55 ? 260 TRP C CB  1 
ATOM   1817 C CG  . TRP C 1 37 ? 4.848   32.585 17.979  1.00 10.57 ? 260 TRP C CG  1 
ATOM   1818 C CD1 . TRP C 1 37 ? 5.824   31.788 17.490  1.00 11.01 ? 260 TRP C CD1 1 
ATOM   1819 C CD2 . TRP C 1 37 ? 3.785   31.711 18.337  1.00 10.58 ? 260 TRP C CD2 1 
ATOM   1820 N NE1 . TRP C 1 37 ? 5.461   30.447 17.544  1.00 11.07 ? 260 TRP C NE1 1 
ATOM   1821 C CE2 . TRP C 1 37 ? 4.203   30.392 18.053  1.00 10.42 ? 260 TRP C CE2 1 
ATOM   1822 C CE3 . TRP C 1 37 ? 2.520   31.906 18.885  1.00 11.18 ? 260 TRP C CE3 1 
ATOM   1823 C CZ2 . TRP C 1 37 ? 3.392   29.279 18.288  1.00 11.29 ? 260 TRP C CZ2 1 
ATOM   1824 C CZ3 . TRP C 1 37 ? 1.719   30.801 19.141  1.00 11.47 ? 260 TRP C CZ3 1 
ATOM   1825 C CH2 . TRP C 1 37 ? 2.167   29.501 18.818  1.00 11.39 ? 260 TRP C CH2 1 
ATOM   1826 N N   . PHE C 1 38 ? 2.643   36.362 17.595  1.00 11.11 ? 261 PHE C N   1 
ATOM   1827 C CA  . PHE C 1 38 ? 2.126   37.650 17.953  1.00 12.83 ? 261 PHE C CA  1 
ATOM   1828 C C   . PHE C 1 38 ? 1.545   37.563 19.345  1.00 13.70 ? 261 PHE C C   1 
ATOM   1829 O O   . PHE C 1 38 ? 0.921   36.556 19.721  1.00 13.45 ? 261 PHE C O   1 
ATOM   1830 C CB  . PHE C 1 38 ? 1.002   38.071 16.999  1.00 13.51 ? 261 PHE C CB  1 
ATOM   1831 C CG  . PHE C 1 38 ? 1.508   38.367 15.617  1.00 13.06 ? 261 PHE C CG  1 
ATOM   1832 C CD1 . PHE C 1 38 ? 1.773   39.662 15.208  1.00 15.39 ? 261 PHE C CD1 1 
ATOM   1833 C CD2 . PHE C 1 38 ? 1.713   37.331 14.724  1.00 12.73 ? 261 PHE C CD2 1 
ATOM   1834 C CE1 . PHE C 1 38 ? 2.312   39.938 13.919  1.00 16.02 ? 261 PHE C CE1 1 
ATOM   1835 C CE2 . PHE C 1 38 ? 2.232   37.585 13.454  1.00 14.13 ? 261 PHE C CE2 1 
ATOM   1836 C CZ  . PHE C 1 38 ? 2.550   38.886 13.052  1.00 14.89 ? 261 PHE C CZ  1 
ATOM   1837 N N   . LYS C 1 39 ? 1.701   38.660 20.086  1.00 13.99 ? 262 LYS C N   1 
ATOM   1838 C CA  . LYS C 1 39 ? 1.002   38.838 21.367  1.00 14.81 ? 262 LYS C CA  1 
ATOM   1839 C C   . LYS C 1 39 ? 0.290   40.163 21.331  1.00 17.46 ? 262 LYS C C   1 
ATOM   1840 O O   . LYS C 1 39 ? 0.898   41.174 21.034  1.00 18.05 ? 262 LYS C O   1 
ATOM   1841 C CB  . LYS C 1 39 ? 1.969   38.838 22.531  1.00 16.05 ? 262 LYS C CB  1 
ATOM   1842 C CG  . LYS C 1 39 ? 1.231   38.896 23.837  1.00 20.23 ? 262 LYS C CG  1 
ATOM   1843 C CD  . LYS C 1 39 ? 2.210   38.839 24.968  1.00 26.37 ? 262 LYS C CD  1 
ATOM   1844 C CE  . LYS C 1 39 ? 2.798   40.166 25.200  1.00 31.48 ? 262 LYS C CE  1 
ATOM   1845 N NZ  . LYS C 1 39 ? 2.322   40.483 26.575  1.00 32.34 ? 262 LYS C NZ  1 
ATOM   1846 N N   . ASN C 1 40 ? -1.004  40.140 21.646  1.00 17.83 ? 263 ASN C N   1 
ATOM   1847 C CA  . ASN C 1 40 ? -1.807  41.400 21.641  1.00 19.00 ? 263 ASN C CA  1 
ATOM   1848 C C   . ASN C 1 40 ? -1.545  42.191 20.366  1.00 20.04 ? 263 ASN C C   1 
ATOM   1849 O O   . ASN C 1 40 ? -1.349  43.403 20.372  1.00 22.05 ? 263 ASN C O   1 
ATOM   1850 C CB  . ASN C 1 40 ? -1.518  42.205 22.882  1.00 21.06 ? 263 ASN C CB  1 
ATOM   1851 C CG  . ASN C 1 40 ? -1.983  41.465 24.168  1.00 21.39 ? 263 ASN C CG  1 
ATOM   1852 O OD1 . ASN C 1 40 ? -2.815  40.513 24.138  1.00 21.62 ? 263 ASN C OD1 1 
ATOM   1853 N ND2 . ASN C 1 40 ? -1.410  41.849 25.279  1.00 25.62 ? 263 ASN C ND2 1 
ATOM   1854 N N   . GLU C 1 41 ? -1.631  41.443 19.269  1.00 20.43 ? 264 GLU C N   1 
ATOM   1855 C CA  . GLU C 1 41 ? -1.553  41.945 17.893  1.00 21.79 ? 264 GLU C CA  1 
ATOM   1856 C C   . GLU C 1 41 ? -0.172  42.445 17.453  1.00 21.01 ? 264 GLU C C   1 
ATOM   1857 O O   . GLU C 1 41 ? -0.051  42.904 16.309  1.00 24.75 ? 264 GLU C O   1 
ATOM   1858 C CB  . GLU C 1 41 ? -2.704  42.948 17.549  1.00 23.43 ? 264 GLU C CB  1 
ATOM   1859 C CG  . GLU C 1 41 ? -4.122  42.409 17.804  1.00 26.20 ? 264 GLU C CG  1 
ATOM   1860 C CD  . GLU C 1 41 ? -4.492  41.100 17.084  1.00 33.49 ? 264 GLU C CD  1 
ATOM   1861 O OE1 . GLU C 1 41 ? -3.765  40.650 16.168  1.00 32.69 ? 264 GLU C OE1 1 
ATOM   1862 O OE2 . GLU C 1 41 ? -5.545  40.512 17.443  1.00 36.49 ? 264 GLU C OE2 1 
ATOM   1863 N N   . LEU C 1 42 ? 0.859   42.389 18.321  1.00 18.31 ? 265 LEU C N   1 
ATOM   1864 C CA  . LEU C 1 42 ? 2.218   42.791 17.974  1.00 18.63 ? 265 LEU C CA  1 
ATOM   1865 C C   . LEU C 1 42 ? 3.176   41.606 17.826  1.00 16.79 ? 265 LEU C C   1 
ATOM   1866 O O   . LEU C 1 42 ? 3.126   40.663 18.598  1.00 15.58 ? 265 LEU C O   1 
ATOM   1867 C CB  . LEU C 1 42 ? 2.733   43.756 19.005  1.00 21.11 ? 265 LEU C CB  1 
ATOM   1868 C CG  . LEU C 1 42 ? 1.713   44.916 19.194  1.00 23.90 ? 265 LEU C CG  1 
ATOM   1869 C CD1 . LEU C 1 42 ? 2.103   45.885 20.291  1.00 29.77 ? 265 LEU C CD1 1 
ATOM   1870 C CD2 . LEU C 1 42 ? 1.386   45.658 17.871  1.00 27.48 ? 265 LEU C CD2 1 
ATOM   1871 N N   . PRO C 1 43 ? 4.057   41.673 16.833  1.00 16.21 ? 266 PRO C N   1 
ATOM   1872 C CA  . PRO C 1 43 ? 4.966   40.523 16.610  1.00 15.83 ? 266 PRO C CA  1 
ATOM   1873 C C   . PRO C 1 43 ? 6.002   40.418 17.730  1.00 15.38 ? 266 PRO C C   1 
ATOM   1874 O O   . PRO C 1 43 ? 6.559   41.420 18.189  1.00 17.74 ? 266 PRO C O   1 
ATOM   1875 C CB  . PRO C 1 43 ? 5.652   40.853 15.284  1.00 17.35 ? 266 PRO C CB  1 
ATOM   1876 C CG  . PRO C 1 43 ? 5.559   42.393 15.195  1.00 18.56 ? 266 PRO C CG  1 
ATOM   1877 C CD  . PRO C 1 43 ? 4.279   42.761 15.855  1.00 17.96 ? 266 PRO C CD  1 
ATOM   1878 N N   . LEU C 1 44 ? 6.310   39.198 18.134  1.00 14.28 ? 267 LEU C N   1 
ATOM   1879 C CA  . LEU C 1 44 ? 7.336   38.914 19.110  1.00 14.46 ? 267 LEU C CA  1 
ATOM   1880 C C   . LEU C 1 44 ? 8.671   38.733 18.320  1.00 13.04 ? 267 LEU C C   1 
ATOM   1881 O O   . LEU C 1 44 ? 8.829   37.781 17.561  1.00 15.20 ? 267 LEU C O   1 
ATOM   1882 C CB  . LEU C 1 44 ? 6.966   37.631 19.908  1.00 14.54 ? 267 LEU C CB  1 
ATOM   1883 C CG  . LEU C 1 44 ? 5.723   37.781 20.799  1.00 14.91 ? 267 LEU C CG  1 
ATOM   1884 C CD1 . LEU C 1 44 ? 5.245   36.434 21.268  1.00 16.35 ? 267 LEU C CD1 1 
ATOM   1885 C CD2 . LEU C 1 44 ? 5.986   38.736 21.951  1.00 20.73 ? 267 LEU C CD2 1 
ATOM   1886 N N   . THR C 1 45 ? 9.652   39.639 18.540  1.00 16.57 ? 268 THR C N   1 
ATOM   1887 C CA  . THR C 1 45 ? 10.840  39.650 17.684  1.00 22.12 ? 268 THR C CA  1 
ATOM   1888 C C   . THR C 1 45 ? 11.609  38.366 17.765  1.00 19.00 ? 268 THR C C   1 
ATOM   1889 O O   . THR C 1 45 ? 11.874  37.854 18.883  1.00 18.84 ? 268 THR C O   1 
ATOM   1890 C CB  . THR C 1 45 ? 11.738  40.789 18.054  1.00 23.37 ? 268 THR C CB  1 
ATOM   1891 O OG1 . THR C 1 45 ? 10.960  41.984 18.188  1.00 21.82 ? 268 THR C OG1 1 
ATOM   1892 C CG2 . THR C 1 45 ? 12.747  41.001 16.966  1.00 18.97 ? 268 THR C CG2 1 
ATOM   1893 N N   . HIS C 1 46 ? 11.916  37.799 16.574  1.00 20.27 ? 269 HIS C N   1 
ATOM   1894 C CA  . HIS C 1 46 ? 12.660  36.528 16.421  1.00 17.79 ? 269 HIS C CA  1 
ATOM   1895 C C   . HIS C 1 46 ? 11.877  35.288 16.762  1.00 17.17 ? 269 HIS C C   1 
ATOM   1896 O O   . HIS C 1 46 ? 12.436  34.200 16.633  1.00 18.04 ? 269 HIS C O   1 
ATOM   1897 C CB  . HIS C 1 46 ? 13.996  36.541 17.154  1.00 18.13 ? 269 HIS C CB  1 
ATOM   1898 C CG  . HIS C 1 46 ? 14.821  37.732 16.806  1.00 21.89 ? 269 HIS C CG  1 
ATOM   1899 N ND1 . HIS C 1 46 ? 15.321  38.605 17.747  1.00 25.76 ? 269 HIS C ND1 1 
ATOM   1900 C CD2 . HIS C 1 46 ? 15.141  38.247 15.600  1.00 26.35 ? 269 HIS C CD2 1 
ATOM   1901 C CE1 . HIS C 1 46 ? 15.948  39.586 17.131  1.00 23.93 ? 269 HIS C CE1 1 
ATOM   1902 N NE2 . HIS C 1 46 ? 15.878  39.387 15.828  1.00 24.69 ? 269 HIS C NE2 1 
ATOM   1903 N N   . GLU C 1 47 ? 10.621  35.432 17.093  1.00 16.26 ? 270 GLU C N   1 
ATOM   1904 C CA  . GLU C 1 47 ? 9.849   34.249 17.407  1.00 13.80 ? 270 GLU C CA  1 
ATOM   1905 C C   . GLU C 1 47 ? 9.170   33.701 16.166  1.00 11.81 ? 270 GLU C C   1 
ATOM   1906 O O   . GLU C 1 47 ? 8.008   33.919 15.882  1.00 13.69 ? 270 GLU C O   1 
ATOM   1907 C CB  . GLU C 1 47 ? 8.849   34.574 18.530  1.00 12.99 ? 270 GLU C CB  1 
ATOM   1908 C CG  . GLU C 1 47 ? 9.551   34.987 19.833  1.00 13.50 ? 270 GLU C CG  1 
ATOM   1909 C CD  . GLU C 1 47 ? 10.432  33.924 20.498  1.00 15.89 ? 270 GLU C CD  1 
ATOM   1910 O OE1 . GLU C 1 47 ? 10.410  32.758 20.069  1.00 16.23 ? 270 GLU C OE1 1 
ATOM   1911 O OE2 . GLU C 1 47 ? 11.085  34.325 21.483  1.00 19.15 ? 270 GLU C OE2 1 
ATOM   1912 N N   . THR C 1 48 ? 10.020  32.968 15.445  1.00 12.87 ? 271 THR C N   1 
ATOM   1913 C CA  . THR C 1 48 ? 9.697   32.459 14.100  1.00 13.72 ? 271 THR C CA  1 
ATOM   1914 C C   . THR C 1 48 ? 9.737   30.948 14.055  1.00 13.29 ? 271 THR C C   1 
ATOM   1915 O O   . THR C 1 48 ? 9.890   30.357 12.992  1.00 14.03 ? 271 THR C O   1 
ATOM   1916 C CB  . THR C 1 48 ? 10.628  33.050 13.036  1.00 14.83 ? 271 THR C CB  1 
ATOM   1917 O OG1 . THR C 1 48 ? 11.951  32.641 13.356  1.00 15.52 ? 271 THR C OG1 1 
ATOM   1918 C CG2 . THR C 1 48 ? 10.539  34.570 13.012  1.00 15.81 ? 271 THR C CG2 1 
ATOM   1919 N N   . LYS C 1 49 ? 9.629   30.327 15.226  1.00 13.59 ? 272 LYS C N   1 
ATOM   1920 C CA  . LYS C 1 49 ? 9.665   28.867 15.318  1.00 12.95 ? 272 LYS C CA  1 
ATOM   1921 C C   . LYS C 1 49 ? 8.284   28.305 15.674  1.00 12.68 ? 272 LYS C C   1 
ATOM   1922 O O   . LYS C 1 49 ? 7.422   29.021 16.150  1.00 12.59 ? 272 LYS C O   1 
ATOM   1923 C CB  . LYS C 1 49 ? 10.678  28.417 16.397  1.00 15.54 ? 272 LYS C CB  1 
ATOM   1924 C CG  . LYS C 1 49 ? 12.055  29.147 16.313  1.00 21.80 ? 272 LYS C CG  1 
ATOM   1925 C CD  . LYS C 1 49 ? 12.781  28.832 15.082  1.00 26.83 ? 272 LYS C CD  1 
ATOM   1926 C CE  . LYS C 1 49 ? 14.204  29.452 15.144  1.00 31.55 ? 272 LYS C CE  1 
ATOM   1927 N NZ  . LYS C 1 49 ? 14.279  30.919 14.791  1.00 34.50 ? 272 LYS C NZ  1 
ATOM   1928 N N   . LYS C 1 50 ? 8.125   26.989 15.461  1.00 13.46 ? 273 LYS C N   1 
ATOM   1929 C CA  . LYS C 1 50 ? 6.905   26.285 15.816  1.00 12.85 ? 273 LYS C CA  1 
ATOM   1930 C C   . LYS C 1 50 ? 6.599   26.421 17.325  1.00 12.20 ? 273 LYS C C   1 
ATOM   1931 O O   . LYS C 1 50 ? 5.429   26.429 17.711  1.00 13.02 ? 273 LYS C O   1 
ATOM   1932 C CB  . LYS C 1 50 ? 7.054   24.825 15.461  1.00 14.46 ? 273 LYS C CB  1 
ATOM   1933 C CG  . LYS C 1 50 ? 7.011   24.536 13.938  1.00 15.59 ? 273 LYS C CG  1 
ATOM   1934 C CD  . LYS C 1 50 ? 7.416   23.060 13.679  1.00 19.16 ? 273 LYS C CD  1 
ATOM   1935 C CE  . LYS C 1 50 ? 7.406   22.685 12.208  1.00 23.03 ? 273 LYS C CE  1 
ATOM   1936 N NZ  . LYS C 1 50 ? 8.110   21.378 12.043  1.00 28.88 ? 273 LYS C NZ  1 
ATOM   1937 N N   . LEU C 1 51 ? 7.637   26.527 18.162  1.00 12.93 ? 274 LEU C N   1 
ATOM   1938 C CA  . LEU C 1 51 ? 7.468   26.727 19.608  1.00 13.22 ? 274 LEU C CA  1 
ATOM   1939 C C   . LEU C 1 51 ? 7.799   28.147 19.988  1.00 13.07 ? 274 LEU C C   1 
ATOM   1940 O O   . LEU C 1 51 ? 8.814   28.686 19.512  1.00 13.75 ? 274 LEU C O   1 
ATOM   1941 C CB  . LEU C 1 51 ? 8.383   25.802 20.423  1.00 15.00 ? 274 LEU C CB  1 
ATOM   1942 C CG  . LEU C 1 51 ? 8.119   24.308 20.200  1.00 15.17 ? 274 LEU C CG  1 
ATOM   1943 C CD1 . LEU C 1 51 ? 9.209   23.484 20.916  1.00 20.43 ? 274 LEU C CD1 1 
ATOM   1944 C CD2 . LEU C 1 51 ? 6.741   23.941 20.728  1.00 17.53 ? 274 LEU C CD2 1 
ATOM   1945 N N   . TYR C 1 52 ? 6.996   28.720 20.855  1.00 12.77 ? 275 TYR C N   1 
ATOM   1946 C CA  . TYR C 1 52 ? 7.310   29.941 21.559  1.00 12.49 ? 275 TYR C CA  1 
ATOM   1947 C C   . TYR C 1 52 ? 7.415   29.554 23.035  1.00 13.88 ? 275 TYR C C   1 
ATOM   1948 O O   . TYR C 1 52 ? 6.454   29.009 23.597  1.00 13.62 ? 275 TYR C O   1 
ATOM   1949 C CB  . TYR C 1 52 ? 6.231   30.984 21.362  1.00 14.13 ? 275 TYR C CB  1 
ATOM   1950 C CG  . TYR C 1 52 ? 6.441   32.180 22.267  1.00 13.31 ? 275 TYR C CG  1 
ATOM   1951 C CD1 . TYR C 1 52 ? 7.601   32.939 22.162  1.00 15.48 ? 275 TYR C CD1 1 
ATOM   1952 C CD2 . TYR C 1 52 ? 5.576   32.497 23.271  1.00 14.18 ? 275 TYR C CD2 1 
ATOM   1953 C CE1 . TYR C 1 52 ? 7.832   34.039 23.011  1.00 14.43 ? 275 TYR C CE1 1 
ATOM   1954 C CE2 . TYR C 1 52 ? 5.778   33.594 24.123  1.00 15.27 ? 275 TYR C CE2 1 
ATOM   1955 C CZ  . TYR C 1 52 ? 6.912   34.341 23.989  1.00 15.06 ? 275 TYR C CZ  1 
ATOM   1956 O OH  . TYR C 1 52 ? 7.169   35.451 24.782  1.00 16.43 ? 275 TYR C OH  1 
ATOM   1957 N N   A MET C 1 53 ? 8.551   29.870 23.664  0.70 15.97 ? 276 MET C N   1 
ATOM   1958 N N   B MET C 1 53 ? 8.563   29.789 23.674  0.30 14.75 ? 276 MET C N   1 
ATOM   1959 C CA  A MET C 1 53 ? 8.816   29.379 25.027  0.70 18.87 ? 276 MET C CA  1 
ATOM   1960 C CA  B MET C 1 53 ? 8.750   29.298 25.056  0.30 14.73 ? 276 MET C CA  1 
ATOM   1961 C C   A MET C 1 53 ? 9.356   30.506 25.926  0.70 15.95 ? 276 MET C C   1 
ATOM   1962 C C   B MET C 1 53 ? 9.474   30.282 25.977  0.30 14.60 ? 276 MET C C   1 
ATOM   1963 O O   A MET C 1 53 ? 10.116  31.371 25.505  0.70 20.43 ? 276 MET C O   1 
ATOM   1964 O O   B MET C 1 53 ? 10.561  30.777 25.633  0.30 18.56 ? 276 MET C O   1 
ATOM   1965 C CB  A MET C 1 53 ? 9.815   28.225 24.993  0.70 21.49 ? 276 MET C CB  1 
ATOM   1966 C CB  B MET C 1 53 ? 9.451   27.928 25.068  0.30 17.47 ? 276 MET C CB  1 
ATOM   1967 C CG  A MET C 1 53 ? 9.245   27.082 24.209  0.70 24.17 ? 276 MET C CG  1 
ATOM   1968 C CG  B MET C 1 53 ? 9.660   27.315 26.452  0.30 19.65 ? 276 MET C CG  1 
ATOM   1969 S SD  A MET C 1 53 ? 10.151  25.543 24.284  0.70 29.77 ? 276 MET C SD  1 
ATOM   1970 S SD  B MET C 1 53 ? 11.057  27.982 27.392  0.30 24.01 ? 276 MET C SD  1 
ATOM   1971 C CE  A MET C 1 53 ? 10.271  25.273 26.037  0.70 29.97 ? 276 MET C CE  1 
ATOM   1972 C CE  B MET C 1 53 ? 11.452  26.537 28.371  0.30 21.09 ? 276 MET C CE  1 
ATOM   1973 N N   . VAL C 1 54 ? 8.839   30.500 27.135  1.00 16.60 ? 277 VAL C N   1 
ATOM   1974 C CA  . VAL C 1 54 ? 9.259   31.447 28.146  1.00 16.97 ? 277 VAL C CA  1 
ATOM   1975 C C   . VAL C 1 54 ? 9.476   30.558 29.392  1.00 17.63 ? 277 VAL C C   1 
ATOM   1976 O O   . VAL C 1 54 ? 8.521   30.002 29.955  1.00 18.78 ? 277 VAL C O   1 
ATOM   1977 C CB  . VAL C 1 54 ? 8.155   32.536 28.450  1.00 17.87 ? 277 VAL C CB  1 
ATOM   1978 C CG1 . VAL C 1 54 ? 8.602   33.437 29.586  1.00 20.10 ? 277 VAL C CG1 1 
ATOM   1979 C CG2 . VAL C 1 54 ? 7.843   33.334 27.241  1.00 19.48 ? 277 VAL C CG2 1 
ATOM   1980 N N   . PRO C 1 55 ? 10.728  30.403 29.860  1.00 19.50 ? 278 PRO C N   1 
ATOM   1981 C CA  . PRO C 1 55 ? 10.984  29.501 30.978  1.00 20.77 ? 278 PRO C CA  1 
ATOM   1982 C C   . PRO C 1 55 ? 10.426  29.896 32.306  1.00 20.16 ? 278 PRO C C   1 
ATOM   1983 O O   . PRO C 1 55 ? 10.064  29.021 33.063  1.00 22.26 ? 278 PRO C O   1 
ATOM   1984 C CB  . PRO C 1 55 ? 12.503  29.431 31.063  1.00 23.05 ? 278 PRO C CB  1 
ATOM   1985 C CG  . PRO C 1 55 ? 13.004  30.516 30.318  1.00 23.47 ? 278 PRO C CG  1 
ATOM   1986 C CD  . PRO C 1 55 ? 11.963  30.971 29.313  1.00 20.52 ? 278 PRO C CD  1 
ATOM   1987 N N   A TYR C 1 56 ? 10.397  31.189 32.616  0.70 19.91 ? 279 TYR C N   1 
ATOM   1988 N N   B TYR C 1 56 ? 10.315  31.204 32.537  0.30 19.19 ? 279 TYR C N   1 
ATOM   1989 C CA  A TYR C 1 56 ? 9.783   31.649 33.855  0.70 21.44 ? 279 TYR C CA  1 
ATOM   1990 C CA  B TYR C 1 56 ? 9.940   31.763 33.822  0.30 18.95 ? 279 TYR C CA  1 
ATOM   1991 C C   A TYR C 1 56 ? 8.848   32.768 33.465  0.70 20.90 ? 279 TYR C C   1 
ATOM   1992 C C   B TYR C 1 56 ? 8.838   32.850 33.671  0.30 19.09 ? 279 TYR C C   1 
ATOM   1993 O O   A TYR C 1 56 ? 9.297   33.860 33.037  0.70 21.10 ? 279 TYR C O   1 
ATOM   1994 O O   B TYR C 1 56 ? 9.164   34.030 33.643  0.30 19.00 ? 279 TYR C O   1 
ATOM   1995 C CB  A TYR C 1 56 ? 10.808  32.224 34.853  0.70 24.26 ? 279 TYR C CB  1 
ATOM   1996 C CB  B TYR C 1 56 ? 11.217  32.371 34.474  0.30 18.86 ? 279 TYR C CB  1 
ATOM   1997 C CG  A TYR C 1 56 ? 11.926  31.303 35.199  0.70 27.63 ? 279 TYR C CG  1 
ATOM   1998 C CG  B TYR C 1 56 ? 11.007  32.759 35.906  0.30 17.30 ? 279 TYR C CG  1 
ATOM   1999 C CD1 A TYR C 1 56 ? 11.809  30.387 36.238  0.70 30.58 ? 279 TYR C CD1 1 
ATOM   2000 C CD1 B TYR C 1 56 ? 11.607  32.041 36.934  0.30 17.60 ? 279 TYR C CD1 1 
ATOM   2001 C CD2 A TYR C 1 56 ? 13.119  31.369 34.508  0.70 27.78 ? 279 TYR C CD2 1 
ATOM   2002 C CD2 B TYR C 1 56 ? 10.194  33.829 36.241  0.30 17.83 ? 279 TYR C CD2 1 
ATOM   2003 C CE1 A TYR C 1 56 ? 12.865  29.549 36.559  0.70 28.96 ? 279 TYR C CE1 1 
ATOM   2004 C CE1 B TYR C 1 56 ? 11.382  32.386 38.269  0.30 19.70 ? 279 TYR C CE1 1 
ATOM   2005 C CE2 A TYR C 1 56 ? 14.174  30.538 34.804  0.70 28.50 ? 279 TYR C CE2 1 
ATOM   2006 C CE2 B TYR C 1 56 ? 9.975   34.185 37.544  0.30 19.35 ? 279 TYR C CE2 1 
ATOM   2007 C CZ  A TYR C 1 56 ? 14.038  29.629 35.850  0.70 28.24 ? 279 TYR C CZ  1 
ATOM   2008 C CZ  B TYR C 1 56 ? 10.561  33.460 38.563  0.30 19.80 ? 279 TYR C CZ  1 
ATOM   2009 O OH  A TYR C 1 56 ? 15.065  28.782 36.198  0.70 29.81 ? 279 TYR C OH  1 
ATOM   2010 O OH  B TYR C 1 56 ? 10.330  33.839 39.873  0.30 22.67 ? 279 TYR C OH  1 
ATOM   2011 N N   . VAL C 1 57 ? 7.549   32.487 33.561  1.00 19.63 ? 280 VAL C N   1 
ATOM   2012 C CA  . VAL C 1 57 ? 6.540   33.532 33.270  1.00 21.37 ? 280 VAL C CA  1 
ATOM   2013 C C   . VAL C 1 57 ? 6.241   34.469 34.395  1.00 23.56 ? 280 VAL C C   1 
ATOM   2014 O O   . VAL C 1 57 ? 6.422   34.161 35.555  1.00 24.01 ? 280 VAL C O   1 
ATOM   2015 C CB  . VAL C 1 57 ? 5.144   33.032 32.865  1.00 21.93 ? 280 VAL C CB  1 
ATOM   2016 C CG1 . VAL C 1 57 ? 5.235   32.395 31.639  1.00 22.16 ? 280 VAL C CG1 1 
ATOM   2017 C CG2 . VAL C 1 57 ? 4.482   32.115 33.912  1.00 20.70 ? 280 VAL C CG2 1 
ATOM   2018 N N   . ASP C 1 58 ? 5.756   35.639 34.008  1.00 24.75 ? 281 ASP C N   1 
ATOM   2019 C CA  . ASP C 1 58 ? 5.295   36.601 34.958  1.00 26.39 ? 281 ASP C CA  1 
ATOM   2020 C C   . ASP C 1 58 ? 4.172   37.343 34.304  1.00 25.53 ? 281 ASP C C   1 
ATOM   2021 O O   . ASP C 1 58 ? 3.769   37.018 33.161  1.00 21.76 ? 281 ASP C O   1 
ATOM   2022 C CB  . ASP C 1 58 ? 6.424   37.572 35.260  1.00 29.07 ? 281 ASP C CB  1 
ATOM   2023 C CG  . ASP C 1 58 ? 6.657   37.733 36.730  1.00 32.51 ? 281 ASP C CG  1 
ATOM   2024 O OD1 . ASP C 1 58 ? 5.750   37.377 37.503  1.00 38.90 ? 281 ASP C OD1 1 
ATOM   2025 O OD2 . ASP C 1 58 ? 7.747   38.209 37.116  1.00 39.77 ? 281 ASP C OD2 1 
ATOM   2026 N N   . LEU C 1 59 ? 3.663   38.346 35.014  1.00 25.39 ? 282 LEU C N   1 
ATOM   2027 C CA  . LEU C 1 59 ? 2.527   39.080 34.525  1.00 25.56 ? 282 LEU C CA  1 
ATOM   2028 C C   . LEU C 1 59 ? 2.730   39.672 33.142  1.00 23.05 ? 282 LEU C C   1 
ATOM   2029 O O   . LEU C 1 59 ? 1.757   39.791 32.418  1.00 22.98 ? 282 LEU C O   1 
ATOM   2030 C CB  . LEU C 1 59 ? 2.179   40.212 35.508  1.00 25.69 ? 282 LEU C CB  1 
ATOM   2031 C CG  . LEU C 1 59 ? 1.098   39.928 36.551  1.00 30.77 ? 282 LEU C CG  1 
ATOM   2032 C CD1 . LEU C 1 59 ? 1.329   38.656 37.280  1.00 32.89 ? 282 LEU C CD1 1 
ATOM   2033 C CD2 . LEU C 1 59 ? 1.025   41.079 37.537  1.00 30.48 ? 282 LEU C CD2 1 
ATOM   2034 N N   . GLU C 1 60 ? 3.972   40.019 32.778  1.00 22.33 ? 283 GLU C N   1 
ATOM   2035 C CA  . GLU C 1 60 ? 4.217   40.618 31.471  1.00 23.44 ? 283 GLU C CA  1 
ATOM   2036 C C   . GLU C 1 60 ? 3.840   39.675 30.343  1.00 20.99 ? 283 GLU C C   1 
ATOM   2037 O O   . GLU C 1 60 ? 3.610   40.120 29.232  1.00 21.48 ? 283 GLU C O   1 
ATOM   2038 C CB  . GLU C 1 60 ? 5.664   41.109 31.308  1.00 24.18 ? 283 GLU C CB  1 
ATOM   2039 C CG  . GLU C 1 60 ? 6.723   40.010 31.254  1.00 26.99 ? 283 GLU C CG  1 
ATOM   2040 C CD  . GLU C 1 60 ? 8.117   40.537 30.941  1.00 29.75 ? 283 GLU C CD  1 
ATOM   2041 O OE1 . GLU C 1 60 ? 8.255   41.312 29.992  1.00 36.53 ? 283 GLU C OE1 1 
ATOM   2042 O OE2 . GLU C 1 60 ? 9.078   40.142 31.626  1.00 37.62 ? 283 GLU C OE2 1 
ATOM   2043 N N   . HIS C 1 61 ? 3.757   38.366 30.632  1.00 18.81 ? 284 HIS C N   1 
ATOM   2044 C CA  . HIS C 1 61 ? 3.460   37.386 29.574  1.00 17.80 ? 284 HIS C CA  1 
ATOM   2045 C C   . HIS C 1 61 ? 1.979   37.155 29.380  1.00 17.15 ? 284 HIS C C   1 
ATOM   2046 O O   . HIS C 1 61 ? 1.557   36.415 28.468  1.00 17.31 ? 284 HIS C O   1 
ATOM   2047 C CB  . HIS C 1 61 ? 4.214   36.101 29.857  1.00 18.65 ? 284 HIS C CB  1 
ATOM   2048 C CG  . HIS C 1 61 ? 5.675   36.330 29.969  1.00 19.18 ? 284 HIS C CG  1 
ATOM   2049 N ND1 . HIS C 1 61 ? 6.336   36.310 31.171  1.00 19.73 ? 284 HIS C ND1 1 
ATOM   2050 C CD2 . HIS C 1 61 ? 6.590   36.665 29.037  1.00 21.80 ? 284 HIS C CD2 1 
ATOM   2051 C CE1 . HIS C 1 61 ? 7.605   36.617 30.981  1.00 22.58 ? 284 HIS C CE1 1 
ATOM   2052 N NE2 . HIS C 1 61 ? 7.792   36.811 29.691  1.00 24.14 ? 284 HIS C NE2 1 
ATOM   2053 N N   . GLN C 1 62 ? 1.153   37.751 30.227  1.00 17.48 ? 285 GLN C N   1 
ATOM   2054 C CA  . GLN C 1 62 ? -0.275  37.601 30.046  1.00 17.50 ? 285 GLN C CA  1 
ATOM   2055 C C   . GLN C 1 62 ? -0.721  38.216 28.728  1.00 17.90 ? 285 GLN C C   1 
ATOM   2056 O O   . GLN C 1 62 ? -0.209  39.290 28.337  1.00 21.25 ? 285 GLN C O   1 
ATOM   2057 C CB  . GLN C 1 62 ? -1.026  38.216 31.209  1.00 19.29 ? 285 GLN C CB  1 
ATOM   2058 C CG  . GLN C 1 62 ? -2.499  38.012 31.244  1.00 22.70 ? 285 GLN C CG  1 
ATOM   2059 C CD  . GLN C 1 62 ? -3.079  38.335 32.629  1.00 23.70 ? 285 GLN C CD  1 
ATOM   2060 O OE1 . GLN C 1 62 ? -3.161  37.453 33.505  1.00 26.27 ? 285 GLN C OE1 1 
ATOM   2061 N NE2 . GLN C 1 62 ? -3.425  39.599 32.858  1.00 28.56 ? 285 GLN C NE2 1 
ATOM   2062 N N   . GLY C 1 63 ? -1.652  37.592 28.041  1.00 16.06 ? 286 GLY C N   1 
ATOM   2063 C CA  . GLY C 1 63 ? -2.193  38.197 26.839  1.00 16.60 ? 286 GLY C CA  1 
ATOM   2064 C C   . GLY C 1 63 ? -2.731  37.169 25.874  1.00 15.99 ? 286 GLY C C   1 
ATOM   2065 O O   . GLY C 1 63 ? -2.850  35.983 26.179  1.00 16.11 ? 286 GLY C O   1 
ATOM   2066 N N   . THR C 1 64 ? -3.088  37.682 24.698  1.00 15.66 ? 287 THR C N   1 
ATOM   2067 C CA  . THR C 1 64 ? -3.686  36.908 23.634  1.00 14.57 ? 287 THR C CA  1 
ATOM   2068 C C   . THR C 1 64 ? -2.598  36.660 22.570  1.00 13.39 ? 287 THR C C   1 
ATOM   2069 O O   . THR C 1 64 ? -2.011  37.623 22.085  1.00 17.88 ? 287 THR C O   1 
ATOM   2070 C CB  . THR C 1 64 ? -4.887  37.672 23.018  1.00 21.92 ? 287 THR C CB  1 
ATOM   2071 O OG1 . THR C 1 64 ? -5.830  37.947 24.051  1.00 25.60 ? 287 THR C OG1 1 
ATOM   2072 C CG2 . THR C 1 64 ? -5.507  36.793 21.913  1.00 20.03 ? 287 THR C CG2 1 
ATOM   2073 N N   . TYR C 1 65 ? -2.341  35.383 22.225  1.00 14.81 ? 288 TYR C N   1 
ATOM   2074 C CA  . TYR C 1 65 ? -1.297  35.005 21.306  1.00 14.41 ? 288 TYR C CA  1 
ATOM   2075 C C   . TYR C 1 65 ? -1.873  34.286 20.099  1.00 13.36 ? 288 TYR C C   1 
ATOM   2076 O O   . TYR C 1 65 ? -2.883  33.579 20.191  1.00 13.61 ? 288 TYR C O   1 
ATOM   2077 C CB  . TYR C 1 65 ? -0.377  34.018 21.998  1.00 13.02 ? 288 TYR C CB  1 
ATOM   2078 C CG  . TYR C 1 65 ? 0.452   34.584 23.146  1.00 13.21 ? 288 TYR C CG  1 
ATOM   2079 C CD1 . TYR C 1 65 ? 1.811   34.869 22.958  1.00 13.79 ? 288 TYR C CD1 1 
ATOM   2080 C CD2 . TYR C 1 65 ? -0.111  34.836 24.389  1.00 13.21 ? 288 TYR C CD2 1 
ATOM   2081 C CE1 . TYR C 1 65 ? 2.608   35.308 23.979  1.00 15.31 ? 288 TYR C CE1 1 
ATOM   2082 C CE2 . TYR C 1 65 ? 0.715   35.297 25.432  1.00 14.07 ? 288 TYR C CE2 1 
ATOM   2083 C CZ  . TYR C 1 65 ? 2.044   35.519 25.215  1.00 14.04 ? 288 TYR C CZ  1 
ATOM   2084 O OH  . TYR C 1 65 ? 2.883   35.917 26.240  1.00 17.05 ? 288 TYR C OH  1 
ATOM   2085 N N   . TRP C 1 66 ? -1.170  34.411 18.986  1.00 13.30 ? 289 TRP C N   1 
ATOM   2086 C CA  . TRP C 1 66 ? -1.464  33.583 17.823  1.00 11.83 ? 289 TRP C CA  1 
ATOM   2087 C C   . TRP C 1 66 ? -0.240  33.602 16.952  1.00 11.58 ? 289 TRP C C   1 
ATOM   2088 O O   . TRP C 1 66 ? 0.704   34.352 17.177  1.00 11.85 ? 289 TRP C O   1 
ATOM   2089 C CB  . TRP C 1 66 ? -2.692  34.111 17.045  1.00 15.05 ? 289 TRP C CB  1 
ATOM   2090 C CG  . TRP C 1 66 ? -2.535  35.534 16.653  1.00 18.04 ? 289 TRP C CG  1 
ATOM   2091 C CD1 . TRP C 1 66 ? -2.724  36.623 17.457  1.00 20.57 ? 289 TRP C CD1 1 
ATOM   2092 C CD2 . TRP C 1 66 ? -2.218  36.031 15.384  1.00 19.12 ? 289 TRP C CD2 1 
ATOM   2093 N NE1 . TRP C 1 66 ? -2.549  37.754 16.754  1.00 23.32 ? 289 TRP C NE1 1 
ATOM   2094 C CE2 . TRP C 1 66 ? -2.220  37.436 15.467  1.00 19.66 ? 289 TRP C CE2 1 
ATOM   2095 C CE3 . TRP C 1 66 ? -1.977  35.438 14.161  1.00 18.19 ? 289 TRP C CE3 1 
ATOM   2096 C CZ2 . TRP C 1 66 ? -1.943  38.267 14.375  1.00 24.25 ? 289 TRP C CZ2 1 
ATOM   2097 C CZ3 . TRP C 1 66 ? -1.658  36.270 13.070  1.00 21.54 ? 289 TRP C CZ3 1 
ATOM   2098 C CH2 . TRP C 1 66 ? -1.677  37.658 13.188  1.00 20.51 ? 289 TRP C CH2 1 
ATOM   2099 N N   . CYS C 1 67 ? -0.238  32.710 15.982  1.00 11.70 ? 290 CYS C N   1 
ATOM   2100 C CA  . CYS C 1 67 ? 0.897   32.519 15.089  1.00 11.38 ? 290 CYS C CA  1 
ATOM   2101 C C   . CYS C 1 67 ? 0.421   32.644 13.637  1.00 10.94 ? 290 CYS C C   1 
ATOM   2102 O O   . CYS C 1 67 ? -0.535  31.997 13.235  1.00 11.94 ? 290 CYS C O   1 
ATOM   2103 C CB  . CYS C 1 67 ? 1.517   31.118 15.328  1.00 11.31 ? 290 CYS C CB  1 
ATOM   2104 S SG  . CYS C 1 67 ? 3.062   30.853 14.478  1.00 12.05 ? 290 CYS C SG  1 
ATOM   2105 N N   . HIS C 1 68 ? 1.130   33.458 12.852  1.00 11.01 ? 291 HIS C N   1 
ATOM   2106 C CA  . HIS C 1 68 ? 0.883   33.545 11.452  1.00 11.30 ? 291 HIS C CA  1 
ATOM   2107 C C   . HIS C 1 68 ? 1.766   32.525 10.755  1.00 11.00 ? 291 HIS C C   1 
ATOM   2108 O O   . HIS C 1 68 ? 2.956   32.474 11.008  1.00 12.84 ? 291 HIS C O   1 
ATOM   2109 C CB  . HIS C 1 68 ? 1.203   34.947 10.899  1.00 11.81 ? 291 HIS C CB  1 
ATOM   2110 C CG  . HIS C 1 68 ? 0.829   35.089 9.462   1.00 12.26 ? 291 HIS C CG  1 
ATOM   2111 N ND1 . HIS C 1 68 ? -0.478  34.985 9.028   1.00 14.54 ? 291 HIS C ND1 1 
ATOM   2112 C CD2 . HIS C 1 68 ? 1.578   35.280 8.345   1.00 12.87 ? 291 HIS C CD2 1 
ATOM   2113 C CE1 . HIS C 1 68 ? -0.527  35.172 7.712   1.00 14.40 ? 291 HIS C CE1 1 
ATOM   2114 N NE2 . HIS C 1 68 ? 0.705   35.349 7.270   1.00 13.44 ? 291 HIS C NE2 1 
ATOM   2115 N N   . VAL C 1 69 ? 1.175   31.708 9.891   1.00 11.16 ? 292 VAL C N   1 
ATOM   2116 C CA  . VAL C 1 69 ? 1.895   30.621 9.243   1.00 11.71 ? 292 VAL C CA  1 
ATOM   2117 C C   . VAL C 1 69 ? 1.819   30.860 7.738   1.00 11.61 ? 292 VAL C C   1 
ATOM   2118 O O   . VAL C 1 69 ? 0.729   31.085 7.210   1.00 12.79 ? 292 VAL C O   1 
ATOM   2119 C CB  . VAL C 1 69 ? 1.239   29.266 9.624   1.00 13.29 ? 292 VAL C CB  1 
ATOM   2120 C CG1 . VAL C 1 69 ? 2.021   28.148 9.020   1.00 15.30 ? 292 VAL C CG1 1 
ATOM   2121 C CG2 . VAL C 1 69 ? 1.226   29.106 11.165  1.00 13.92 ? 292 VAL C CG2 1 
ATOM   2122 N N   . TYR C 1 70 ? 2.963   30.792 7.047   1.00 11.36 ? 293 TYR C N   1 
ATOM   2123 C CA  . TYR C 1 70 ? 2.934   31.278 5.673   1.00 11.69 ? 293 TYR C CA  1 
ATOM   2124 C C   . TYR C 1 70 ? 4.054   30.731 4.838   1.00 11.98 ? 293 TYR C C   1 
ATOM   2125 O O   . TYR C 1 70 ? 5.101   30.358 5.354   1.00 13.24 ? 293 TYR C O   1 
ATOM   2126 C CB  . TYR C 1 70 ? 2.948   32.823 5.635   1.00 13.10 ? 293 TYR C CB  1 
ATOM   2127 C CG  . TYR C 1 70 ? 4.248   33.418 6.108   1.00 12.66 ? 293 TYR C CG  1 
ATOM   2128 C CD1 . TYR C 1 70 ? 5.204   33.852 5.205   1.00 14.14 ? 293 TYR C CD1 1 
ATOM   2129 C CD2 . TYR C 1 70 ? 4.573   33.478 7.470   1.00 12.83 ? 293 TYR C CD2 1 
ATOM   2130 C CE1 . TYR C 1 70 ? 6.367   34.394 5.619   1.00 15.06 ? 293 TYR C CE1 1 
ATOM   2131 C CE2 . TYR C 1 70 ? 5.764   34.018 7.905   1.00 12.92 ? 293 TYR C CE2 1 
ATOM   2132 C CZ  . TYR C 1 70 ? 6.691   34.432 6.981   1.00 13.70 ? 293 TYR C CZ  1 
ATOM   2133 O OH  . TYR C 1 70 ? 7.877   34.964 7.370   1.00 15.07 ? 293 TYR C OH  1 
ATOM   2134 N N   . ASN C 1 71 ? 3.829   30.724 3.535   1.00 13.22 ? 294 ASN C N   1 
ATOM   2135 C CA  . ASN C 1 71 ? 4.914   30.539 2.585   1.00 13.38 ? 294 ASN C CA  1 
ATOM   2136 C C   . ASN C 1 71 ? 4.682   31.528 1.446   1.00 13.75 ? 294 ASN C C   1 
ATOM   2137 O O   . ASN C 1 71 ? 3.966   32.516 1.638   1.00 14.55 ? 294 ASN C O   1 
ATOM   2138 C CB  . ASN C 1 71 ? 5.042   29.081 2.163   1.00 13.59 ? 294 ASN C CB  1 
ATOM   2139 C CG  . ASN C 1 71 ? 3.813   28.559 1.467   1.00 14.62 ? 294 ASN C CG  1 
ATOM   2140 O OD1 . ASN C 1 71 ? 2.973   29.325 0.990   1.00 16.07 ? 294 ASN C OD1 1 
ATOM   2141 N ND2 . ASN C 1 71 ? 3.722   27.230 1.313   1.00 15.08 ? 294 ASN C ND2 1 
ATOM   2142 N N   . ASP C 1 72 ? 5.332   31.329 0.297   1.00 14.31 ? 295 ASP C N   1 
ATOM   2143 C CA  . ASP C 1 72 ? 5.185   32.250 -0.828  1.00 14.63 ? 295 ASP C CA  1 
ATOM   2144 C C   . ASP C 1 72 ? 3.987   32.035 -1.675  1.00 14.40 ? 295 ASP C C   1 
ATOM   2145 O O   . ASP C 1 72 ? 3.858   32.705 -2.708  1.00 16.22 ? 295 ASP C O   1 
ATOM   2146 C CB  . ASP C 1 72 ? 6.500   32.279 -1.676  1.00 16.03 ? 295 ASP C CB  1 
ATOM   2147 C CG  . ASP C 1 72 ? 6.805   30.965 -2.365  1.00 16.77 ? 295 ASP C CG  1 
ATOM   2148 O OD1 . ASP C 1 72 ? 5.943   30.055 -2.282  1.00 20.27 ? 295 ASP C OD1 1 
ATOM   2149 O OD2 . ASP C 1 72 ? 7.903   30.821 -2.989  1.00 20.97 ? 295 ASP C OD2 1 
ATOM   2150 N N   . ARG C 1 73 ? 3.037   31.218 -1.199  1.00 15.78 ? 296 ARG C N   1 
ATOM   2151 C CA  . ARG C 1 73 ? 1.809   30.971 -1.919  1.00 16.13 ? 296 ARG C CA  1 
ATOM   2152 C C   . ARG C 1 73 ? 0.557   31.172 -1.073  1.00 16.61 ? 296 ARG C C   1 
ATOM   2153 O O   . ARG C 1 73 ? -0.482  31.602 -1.565  1.00 18.43 ? 296 ARG C O   1 
ATOM   2154 C CB  . ARG C 1 73 ? 1.828   29.527 -2.468  1.00 17.62 ? 296 ARG C CB  1 
ATOM   2155 C CG  . ARG C 1 73 ? 0.645   29.207 -3.381  1.00 20.66 ? 296 ARG C CG  1 
ATOM   2156 C CD  . ARG C 1 73 ? 0.714   27.826 -3.946  1.00 22.16 ? 296 ARG C CD  1 
ATOM   2157 N NE  . ARG C 1 73 ? -0.290  27.658 -4.987  1.00 27.70 ? 296 ARG C NE  1 
ATOM   2158 C CZ  . ARG C 1 73 ? -0.025  27.178 -6.199  1.00 23.94 ? 296 ARG C CZ  1 
ATOM   2159 N NH1 . ARG C 1 73 ? 1.193   26.775 -6.541  1.00 25.82 ? 296 ARG C NH1 1 
ATOM   2160 N NH2 . ARG C 1 73 ? -1.021  27.073 -7.073  1.00 29.22 ? 296 ARG C NH2 1 
ATOM   2161 N N   . ASP C 1 74 ? 0.638   30.811 0.222   1.00 16.38 ? 297 ASP C N   1 
ATOM   2162 C CA  . ASP C 1 74 ? -0.569  30.663 1.044   1.00 17.52 ? 297 ASP C CA  1 
ATOM   2163 C C   . ASP C 1 74 ? -0.227  31.052 2.478   1.00 14.86 ? 297 ASP C C   1 
ATOM   2164 O O   . ASP C 1 74 ? 0.922   31.066 2.854   1.00 15.17 ? 297 ASP C O   1 
ATOM   2165 C CB  . ASP C 1 74 ? -1.004  29.180 1.092   1.00 19.94 ? 297 ASP C CB  1 
ATOM   2166 C CG  . ASP C 1 74 ? -1.555  28.636 -0.220  1.00 23.72 ? 297 ASP C CG  1 
ATOM   2167 O OD1 . ASP C 1 74 ? -2.628  29.059 -0.619  1.00 26.25 ? 297 ASP C OD1 1 
ATOM   2168 O OD2 . ASP C 1 74 ? -0.920  27.754 -0.783  1.00 28.43 ? 297 ASP C OD2 1 
ATOM   2169 N N   A SER C 1 75 ? -1.250  31.355 3.262   0.50 13.67 ? 298 SER C N   1 
ATOM   2170 N N   B SER C 1 75 ? -1.237  31.422 3.253   0.50 15.22 ? 298 SER C N   1 
ATOM   2171 C CA  A SER C 1 75 ? -1.067  31.651 4.684   0.50 12.35 ? 298 SER C CA  1 
ATOM   2172 C CA  B SER C 1 75 ? -1.055  31.616 4.694   0.50 15.15 ? 298 SER C CA  1 
ATOM   2173 C C   A SER C 1 75 ? -2.346  31.384 5.492   0.50 12.64 ? 298 SER C C   1 
ATOM   2174 C C   B SER C 1 75 ? -2.300  31.193 5.442   0.50 14.41 ? 298 SER C C   1 
ATOM   2175 O O   A SER C 1 75 ? -3.482  31.479 4.995   0.50 13.26 ? 298 SER C O   1 
ATOM   2176 O O   B SER C 1 75 ? -3.371  31.032 4.854   0.50 14.28 ? 298 SER C O   1 
ATOM   2177 C CB  A SER C 1 75 ? -0.575  33.098 4.881   0.50 13.60 ? 298 SER C CB  1 
ATOM   2178 C CB  B SER C 1 75 ? -0.726  33.080 5.045   0.50 17.85 ? 298 SER C CB  1 
ATOM   2179 O OG  A SER C 1 75 ? -1.659  33.980 4.612   0.50 12.32 ? 298 SER C OG  1 
ATOM   2180 O OG  B SER C 1 75 ? 0.187   33.654 4.127   0.50 23.92 ? 298 SER C OG  1 
ATOM   2181 N N   . GLN C 1 76 ? -2.119  31.038 6.746   1.00 13.26 ? 299 GLN C N   1 
ATOM   2182 C CA  . GLN C 1 76 ? -3.200  30.825 7.683   1.00 13.32 ? 299 GLN C CA  1 
ATOM   2183 C C   . GLN C 1 76 ? -2.769  31.412 9.001   1.00 12.74 ? 299 GLN C C   1 
ATOM   2184 O O   . GLN C 1 76 ? -1.619  31.429 9.339   1.00 14.42 ? 299 GLN C O   1 
ATOM   2185 C CB  . GLN C 1 76 ? -3.419  29.327 7.867   1.00 13.94 ? 299 GLN C CB  1 
ATOM   2186 C CG  . GLN C 1 76 ? -4.044  28.647 6.695   1.00 18.23 ? 299 GLN C CG  1 
ATOM   2187 C CD  . GLN C 1 76 ? -4.372  27.188 6.943   1.00 17.28 ? 299 GLN C CD  1 
ATOM   2188 O OE1 . GLN C 1 76 ? -3.973  26.581 7.937   1.00 17.52 ? 299 GLN C OE1 1 
ATOM   2189 N NE2 . GLN C 1 76 ? -5.194  26.607 6.034   1.00 21.10 ? 299 GLN C NE2 1 
ATOM   2190 N N   . ASP C 1 77 ? -3.752  31.830 9.797   1.00 14.15 ? 300 ASP C N   1 
ATOM   2191 C CA  . ASP C 1 77 ? -3.507  32.212 11.172  1.00 14.65 ? 300 ASP C CA  1 
ATOM   2192 C C   . ASP C 1 77 ? -3.943  31.087 12.098  1.00 13.63 ? 300 ASP C C   1 
ATOM   2193 O O   . ASP C 1 77 ? -4.999  30.460 11.913  1.00 15.33 ? 300 ASP C O   1 
ATOM   2194 C CB  . ASP C 1 77 ? -4.309  33.443 11.519  1.00 15.58 ? 300 ASP C CB  1 
ATOM   2195 C CG  . ASP C 1 77 ? -3.745  34.699 10.816  1.00 18.00 ? 300 ASP C CG  1 
ATOM   2196 O OD1 . ASP C 1 77 ? -2.550  34.801 10.533  1.00 32.15 ? 300 ASP C OD1 1 
ATOM   2197 O OD2 . ASP C 1 77 ? -4.601  35.643 10.666  1.00 23.37 ? 300 ASP C OD2 1 
ATOM   2198 N N   . SER C 1 78 ? -3.128  30.848 13.112  1.00 13.78 ? 301 SER C N   1 
ATOM   2199 C CA  . SER C 1 78 ? -3.530  29.933 14.132  1.00 14.17 ? 301 SER C CA  1 
ATOM   2200 C C   . SER C 1 78 ? -4.718  30.468 14.843  1.00 15.11 ? 301 SER C C   1 
ATOM   2201 O O   . SER C 1 78 ? -5.050  31.654 14.823  1.00 14.92 ? 301 SER C O   1 
ATOM   2202 C CB  . SER C 1 78 ? -2.466  29.651 15.180  1.00 13.38 ? 301 SER C CB  1 
ATOM   2203 O OG  . SER C 1 78 ? -2.316  30.737 16.094  1.00 13.17 ? 301 SER C OG  1 
ATOM   2204 N N   . LYS C 1 79 ? -5.397  29.590 15.577  1.00 13.45 ? 302 LYS C N   1 
ATOM   2205 C CA  . LYS C 1 79 ? -6.330  30.048 16.606  1.00 16.47 ? 302 LYS C CA  1 
ATOM   2206 C C   . LYS C 1 79 ? -5.649  31.030 17.580  1.00 15.27 ? 302 LYS C C   1 
ATOM   2207 O O   . LYS C 1 79 ? -4.475  30.939 17.857  1.00 14.50 ? 302 LYS C O   1 
ATOM   2208 C CB  . LYS C 1 79 ? -6.905  28.839 17.353  1.00 20.34 ? 302 LYS C CB  1 
ATOM   2209 C CG  . LYS C 1 79 ? -7.842  28.005 16.426  1.00 22.62 ? 302 LYS C CG  1 
ATOM   2210 C CD  . LYS C 1 79 ? -8.388  26.737 17.086  1.00 23.42 ? 302 LYS C CD  1 
ATOM   2211 C CE  . LYS C 1 79 ? -9.043  25.799 16.028  1.00 27.39 ? 302 LYS C CE  1 
ATOM   2212 N NZ  . LYS C 1 79 ? -9.910  26.575 15.075  1.00 33.00 ? 302 LYS C NZ  1 
ATOM   2213 N N   . LYS C 1 80 ? -6.461  31.955 18.135  1.00 15.74 ? 303 LYS C N   1 
ATOM   2214 C CA  . LYS C 1 80 ? -6.018  32.863 19.161  1.00 15.59 ? 303 LYS C CA  1 
ATOM   2215 C C   . LYS C 1 80 ? -6.209  32.246 20.513  1.00 17.68 ? 303 LYS C C   1 
ATOM   2216 O O   . LYS C 1 80 ? -7.288  31.768 20.809  1.00 23.14 ? 303 LYS C O   1 
ATOM   2217 C CB  . LYS C 1 80 ? -6.715  34.213 19.133  1.00 19.24 ? 303 LYS C CB  1 
ATOM   2218 C CG  . LYS C 1 80 ? -6.307  35.058 17.985  1.00 20.54 ? 303 LYS C CG  1 
ATOM   2219 C CD  . LYS C 1 80 ? -7.071  36.365 18.026  1.00 25.29 ? 303 LYS C CD  1 
ATOM   2220 C CE  . LYS C 1 80 ? -6.488  37.295 17.007  1.00 30.41 ? 303 LYS C CE  1 
ATOM   2221 N NZ  . LYS C 1 80 ? -7.279  38.571 16.935  1.00 34.11 ? 303 LYS C NZ  1 
ATOM   2222 N N   . VAL C 1 81 ? -5.180  32.281 21.348  1.00 15.33 ? 304 VAL C N   1 
ATOM   2223 C CA  . VAL C 1 81 ? -5.256  31.658 22.662  1.00 15.16 ? 304 VAL C CA  1 
ATOM   2224 C C   . VAL C 1 81 ? -4.951  32.709 23.715  1.00 14.49 ? 304 VAL C C   1 
ATOM   2225 O O   . VAL C 1 81 ? -4.265  33.689 23.489  1.00 15.83 ? 304 VAL C O   1 
ATOM   2226 C CB  . VAL C 1 81 ? -4.369  30.432 22.792  1.00 15.69 ? 304 VAL C CB  1 
ATOM   2227 C CG1 . VAL C 1 81 ? -4.809  29.295 21.848  1.00 19.32 ? 304 VAL C CG1 1 
ATOM   2228 C CG2 . VAL C 1 81 ? -2.903  30.825 22.620  1.00 16.72 ? 304 VAL C CG2 1 
ATOM   2229 N N   . GLU C 1 82 ? -5.396  32.444 24.931  1.00 14.78 ? 305 GLU C N   1 
ATOM   2230 C CA  . GLU C 1 82 ? -5.147  33.374 26.026  1.00 15.48 ? 305 GLU C CA  1 
ATOM   2231 C C   . GLU C 1 82 ? -4.246  32.720 27.061  1.00 14.82 ? 305 GLU C C   1 
ATOM   2232 O O   . GLU C 1 82 ? -4.467  31.559 27.467  1.00 15.44 ? 305 GLU C O   1 
ATOM   2233 C CB  . GLU C 1 82 ? -6.409  33.800 26.755  1.00 17.66 ? 305 GLU C CB  1 
ATOM   2234 C CG  . GLU C 1 82 ? -6.022  34.930 27.703  1.00 19.99 ? 305 GLU C CG  1 
ATOM   2235 C CD  . GLU C 1 82 ? -7.216  35.634 28.308  1.00 23.76 ? 305 GLU C CD  1 
ATOM   2236 O OE1 . GLU C 1 82 ? -8.267  34.994 28.386  1.00 23.31 ? 305 GLU C OE1 1 
ATOM   2237 O OE2 . GLU C 1 82 ? -7.094  36.819 28.739  1.00 27.31 ? 305 GLU C OE2 1 
ATOM   2238 N N   . ILE C 1 83 ? -3.240  33.461 27.504  1.00 14.74 ? 306 ILE C N   1 
ATOM   2239 C CA  . ILE C 1 83 ? -2.387  33.073 28.623  1.00 14.83 ? 306 ILE C CA  1 
ATOM   2240 C C   . ILE C 1 83 ? -2.762  33.981 29.762  1.00 14.88 ? 306 ILE C C   1 
ATOM   2241 O O   . ILE C 1 83 ? -2.652  35.230 29.686  1.00 16.69 ? 306 ILE C O   1 
ATOM   2242 C CB  . ILE C 1 83 ? -0.895  33.231 28.277  1.00 15.48 ? 306 ILE C CB  1 
ATOM   2243 C CG1 . ILE C 1 83 ? -0.501  32.337 27.086  1.00 15.44 ? 306 ILE C CG1 1 
ATOM   2244 C CG2 . ILE C 1 83 ? -0.022  32.933 29.501  1.00 18.13 ? 306 ILE C CG2 1 
ATOM   2245 C CD1 . ILE C 1 83 ? -0.864  30.882 27.227  1.00 17.68 ? 306 ILE C CD1 1 
ATOM   2246 N N   . ILE C 1 84 ? -3.237  33.355 30.832  1.00 15.01 ? 307 ILE C N   1 
ATOM   2247 C CA  . ILE C 1 84 ? -3.630  34.065 32.044  1.00 17.09 ? 307 ILE C CA  1 
ATOM   2248 C C   . ILE C 1 84 ? -2.551  33.743 33.096  1.00 17.03 ? 307 ILE C C   1 
ATOM   2249 O O   . ILE C 1 84 ? -2.146  32.597 33.235  1.00 17.41 ? 307 ILE C O   1 
ATOM   2250 C CB  . ILE C 1 84 ? -5.012  33.590 32.534  1.00 18.08 ? 307 ILE C CB  1 
ATOM   2251 C CG1 . ILE C 1 84 ? -6.073  33.960 31.494  1.00 20.55 ? 307 ILE C CG1 1 
ATOM   2252 C CG2 . ILE C 1 84 ? -5.360  34.210 33.895  1.00 19.83 ? 307 ILE C CG2 1 
ATOM   2253 C CD1 . ILE C 1 84 ? -7.413  33.377 31.814  1.00 22.14 ? 307 ILE C CD1 1 
ATOM   2254 N N   . ILE C 1 85 ? -2.081  34.758 33.813  1.00 18.98 ? 308 ILE C N   1 
ATOM   2255 C CA  . ILE C 1 85 ? -1.112  34.556 34.845  1.00 21.07 ? 308 ILE C CA  1 
ATOM   2256 C C   . ILE C 1 85 ? -1.799  34.787 36.190  1.00 22.78 ? 308 ILE C C   1 
ATOM   2257 O O   . ILE C 1 85 ? -2.342  35.856 36.406  1.00 24.30 ? 308 ILE C O   1 
ATOM   2258 C CB  . ILE C 1 85 ? 0.117   35.518 34.660  1.00 21.95 ? 308 ILE C CB  1 
ATOM   2259 C CG1 . ILE C 1 85 ? 0.712   35.418 33.259  1.00 24.19 ? 308 ILE C CG1 1 
ATOM   2260 C CG2 . ILE C 1 85 ? 1.166   35.296 35.737  1.00 25.72 ? 308 ILE C CG2 1 
ATOM   2261 C CD1 . ILE C 1 85 ? 1.396   34.117 33.005  1.00 24.63 ? 308 ILE C CD1 1 
ATOM   2262 N N   . ASP C 1 86 ? -1.848  33.812 37.079  1.00 24.49 ? 309 ASP C N   1 
ATOM   2263 C CA  . ASP C 1 86 ? -2.438  33.986 38.418  1.00 28.16 ? 309 ASP C CA  1 
ATOM   2264 C C   . ASP C 1 86 ? -1.345  34.052 39.488  1.00 30.11 ? 309 ASP C C   1 
ATOM   2265 O O   . ASP C 1 86 ? -0.721  35.111 39.703  1.00 34.20 ? 309 ASP C O   1 
ATOM   2266 C CB  . ASP C 1 86 ? -3.309  32.794 38.709  1.00 29.70 ? 309 ASP C CB  1 
ATOM   2267 N N   . SER D 1 2  ? 22.636  57.978 29.663  1.00 29.44 ? 225 SER D N   1 
ATOM   2268 C CA  . SER D 1 2  ? 21.511  58.540 28.883  1.00 29.15 ? 225 SER D CA  1 
ATOM   2269 C C   . SER D 1 2  ? 20.913  57.451 27.977  1.00 26.40 ? 225 SER D C   1 
ATOM   2270 O O   . SER D 1 2  ? 21.640  56.541 27.486  1.00 24.60 ? 225 SER D O   1 
ATOM   2271 C CB  . SER D 1 2  ? 22.016  59.725 28.076  1.00 30.58 ? 225 SER D CB  1 
ATOM   2272 O OG  . SER D 1 2  ? 20.972  60.571 27.664  1.00 35.90 ? 225 SER D OG  1 
ATOM   2273 N N   . LYS D 1 3  ? 19.590  57.500 27.793  1.00 25.33 ? 226 LYS D N   1 
ATOM   2274 C CA  . LYS D 1 3  ? 18.838  56.394 27.181  1.00 25.20 ? 226 LYS D CA  1 
ATOM   2275 C C   . LYS D 1 3  ? 19.256  56.186 25.754  1.00 22.09 ? 226 LYS D C   1 
ATOM   2276 O O   . LYS D 1 3  ? 19.350  57.108 24.954  1.00 23.65 ? 226 LYS D O   1 
ATOM   2277 C CB  . LYS D 1 3  ? 17.325  56.645 27.164  1.00 26.48 ? 226 LYS D CB  1 
ATOM   2278 C CG  . LYS D 1 3  ? 16.636  56.876 28.497  1.00 30.34 ? 226 LYS D CG  1 
ATOM   2279 C CD  . LYS D 1 3  ? 15.124  57.107 28.317  1.00 29.95 ? 226 LYS D CD  1 
ATOM   2280 C CE  . LYS D 1 3  ? 14.333  56.698 29.577  1.00 33.89 ? 226 LYS D CE  1 
ATOM   2281 N NZ  . LYS D 1 3  ? 12.877  57.134 29.566  1.00 33.81 ? 226 LYS D NZ  1 
ATOM   2282 N N   . LEU D 1 4  ? 19.459  54.942 25.405  1.00 20.54 ? 227 LEU D N   1 
ATOM   2283 C CA  . LEU D 1 4  ? 19.823  54.580 24.041  1.00 17.89 ? 227 LEU D CA  1 
ATOM   2284 C C   . LEU D 1 4  ? 18.599  54.795 23.150  1.00 17.98 ? 227 LEU D C   1 
ATOM   2285 O O   . LEU D 1 4  ? 17.477  54.424 23.475  1.00 19.77 ? 227 LEU D O   1 
ATOM   2286 C CB  . LEU D 1 4  ? 20.283  53.130 24.064  1.00 18.42 ? 227 LEU D CB  1 
ATOM   2287 C CG  . LEU D 1 4  ? 20.690  52.567 22.693  1.00 17.35 ? 227 LEU D CG  1 
ATOM   2288 C CD1 . LEU D 1 4  ? 21.795  51.535 22.853  1.00 19.34 ? 227 LEU D CD1 1 
ATOM   2289 C CD2 . LEU D 1 4  ? 19.494  51.965 21.932  1.00 21.56 ? 227 LEU D CD2 1 
ATOM   2290 N N   . GLN D 1 5  ? 18.820  55.467 22.034  1.00 15.61 ? 228 GLN D N   1 
ATOM   2291 C CA  . GLN D 1 5  ? 17.716  55.753 21.125  1.00 16.01 ? 228 GLN D CA  1 
ATOM   2292 C C   . GLN D 1 5  ? 18.254  55.854 19.696  1.00 14.56 ? 228 GLN D C   1 
ATOM   2293 O O   . GLN D 1 5  ? 19.165  56.644 19.434  1.00 15.60 ? 228 GLN D O   1 
ATOM   2294 C CB  . GLN D 1 5  ? 17.008  57.081 21.490  1.00 17.33 ? 228 GLN D CB  1 
ATOM   2295 C CG  . GLN D 1 5  ? 15.927  57.431 20.477  1.00 19.40 ? 228 GLN D CG  1 
ATOM   2296 C CD  . GLN D 1 5  ? 14.827  56.370 20.388  1.00 21.10 ? 228 GLN D CD  1 
ATOM   2297 O OE1 . GLN D 1 5  ? 14.315  55.907 21.409  1.00 22.25 ? 228 GLN D OE1 1 
ATOM   2298 N NE2 . GLN D 1 5  ? 14.449  56.015 19.181  1.00 21.84 ? 228 GLN D NE2 1 
ATOM   2299 N N   . ILE D 1 6  ? 17.632  55.120 18.784  1.00 14.47 ? 229 ILE D N   1 
ATOM   2300 C CA  . ILE D 1 6  ? 17.963  55.258 17.353  1.00 14.72 ? 229 ILE D CA  1 
ATOM   2301 C C   . ILE D 1 6  ? 17.368  56.555 16.852  1.00 15.13 ? 229 ILE D C   1 
ATOM   2302 O O   . ILE D 1 6  ? 16.159  56.781 17.011  1.00 16.82 ? 229 ILE D O   1 
ATOM   2303 C CB  . ILE D 1 6  ? 17.450  54.068 16.556  1.00 14.52 ? 229 ILE D CB  1 
ATOM   2304 C CG1 . ILE D 1 6  ? 18.185  52.797 17.025  1.00 13.68 ? 229 ILE D CG1 1 
ATOM   2305 C CG2 . ILE D 1 6  ? 17.563  54.312 15.052  1.00 14.85 ? 229 ILE D CG2 1 
ATOM   2306 C CD1 . ILE D 1 6  ? 17.639  51.599 16.351  1.00 14.36 ? 229 ILE D CD1 1 
ATOM   2307 N N   A CYS D 1 7  ? 18.191  57.376 16.233  0.50 13.21 ? 230 CYS D N   1 
ATOM   2308 N N   B CYS D 1 7  ? 18.187  57.387 16.248  0.50 14.60 ? 230 CYS D N   1 
ATOM   2309 C CA  A CYS D 1 7  ? 17.824  58.689 15.694  0.50 15.21 ? 230 CYS D CA  1 
ATOM   2310 C CA  B CYS D 1 7  ? 17.677  58.616 15.650  0.50 17.54 ? 230 CYS D CA  1 
ATOM   2311 C C   A CYS D 1 7  ? 17.900  58.838 14.178  0.50 15.17 ? 230 CYS D C   1 
ATOM   2312 C C   B CYS D 1 7  ? 17.649  58.591 14.137  0.50 17.16 ? 230 CYS D C   1 
ATOM   2313 O O   A CYS D 1 7  ? 17.277  59.755 13.630  0.50 14.99 ? 230 CYS D O   1 
ATOM   2314 O O   B CYS D 1 7  ? 16.712  59.169 13.548  0.50 18.12 ? 230 CYS D O   1 
ATOM   2315 C CB  A CYS D 1 7  ? 18.746  59.725 16.278  0.50 16.00 ? 230 CYS D CB  1 
ATOM   2316 C CB  B CYS D 1 7  ? 18.440  59.845 16.132  0.50 19.01 ? 230 CYS D CB  1 
ATOM   2317 S SG  A CYS D 1 7  ? 18.440  59.958 18.009  0.50 17.85 ? 230 CYS D SG  1 
ATOM   2318 S SG  B CYS D 1 7  ? 20.205  59.643 16.354  0.50 26.97 ? 230 CYS D SG  1 
ATOM   2319 N N   . VAL D 1 8  ? 18.669  57.979 13.507  1.00 15.13 ? 231 VAL D N   1 
ATOM   2320 C CA  . VAL D 1 8  ? 18.695  57.891 12.047  1.00 14.88 ? 231 VAL D CA  1 
ATOM   2321 C C   . VAL D 1 8  ? 18.471  56.408 11.722  1.00 13.89 ? 231 VAL D C   1 
ATOM   2322 O O   . VAL D 1 8  ? 19.177  55.521 12.204  1.00 12.87 ? 231 VAL D O   1 
ATOM   2323 C CB  . VAL D 1 8  ? 20.051  58.330 11.425  1.00 15.78 ? 231 VAL D CB  1 
ATOM   2324 C CG1 . VAL D 1 8  ? 20.037  58.158 9.889   1.00 17.41 ? 231 VAL D CG1 1 
ATOM   2325 C CG2 . VAL D 1 8  ? 20.398  59.786 11.809  1.00 17.58 ? 231 VAL D CG2 1 
ATOM   2326 N N   . GLU D 1 9  ? 17.448  56.172 10.917  1.00 15.11 ? 232 GLU D N   1 
ATOM   2327 C CA  . GLU D 1 9  ? 17.072  54.866 10.465  1.00 14.62 ? 232 GLU D CA  1 
ATOM   2328 C C   . GLU D 1 9  ? 17.553  54.641 9.049   1.00 14.66 ? 232 GLU D C   1 
ATOM   2329 O O   . GLU D 1 9  ? 17.635  55.572 8.253   1.00 16.00 ? 232 GLU D O   1 
ATOM   2330 C CB  . GLU D 1 9  ? 15.534  54.754 10.460  1.00 16.63 ? 232 GLU D CB  1 
ATOM   2331 C CG  . GLU D 1 9  ? 14.919  54.823 11.855  1.00 17.62 ? 232 GLU D CG  1 
ATOM   2332 C CD  . GLU D 1 9  ? 14.967  53.494 12.612  1.00 16.46 ? 232 GLU D CD  1 
ATOM   2333 O OE1 . GLU D 1 9  ? 15.561  52.521 12.121  1.00 17.34 ? 232 GLU D OE1 1 
ATOM   2334 O OE2 . GLU D 1 9  ? 14.372  53.438 13.726  1.00 20.77 ? 232 GLU D OE2 1 
ATOM   2335 N N   . PRO D 1 10 ? 17.812  53.376 8.680   1.00 14.94 ? 233 PRO D N   1 
ATOM   2336 C CA  . PRO D 1 10 ? 18.228  53.070 7.323   1.00 14.21 ? 233 PRO D CA  1 
ATOM   2337 C C   . PRO D 1 10 ? 17.040  53.210 6.343   1.00 13.98 ? 233 PRO D C   1 
ATOM   2338 O O   . PRO D 1 10 ? 15.867  53.304 6.773   1.00 15.31 ? 233 PRO D O   1 
ATOM   2339 C CB  . PRO D 1 10 ? 18.655  51.594 7.418   1.00 14.63 ? 233 PRO D CB  1 
ATOM   2340 C CG  . PRO D 1 10 ? 17.891  51.049 8.584   1.00 14.92 ? 233 PRO D CG  1 
ATOM   2341 C CD  . PRO D 1 10 ? 17.854  52.204 9.577   1.00 14.65 ? 233 PRO D CD  1 
ATOM   2342 N N   . THR D 1 11 ? 17.388  53.280 5.049   1.00 15.08 ? 234 THR D N   1 
ATOM   2343 C CA  . THR D 1 11 ? 16.393  53.417 3.981   1.00 15.81 ? 234 THR D CA  1 
ATOM   2344 C C   . THR D 1 11 ? 16.444  52.301 2.982   1.00 13.97 ? 234 THR D C   1 
ATOM   2345 O O   . THR D 1 11 ? 17.483  51.856 2.571   1.00 14.62 ? 234 THR D O   1 
ATOM   2346 C CB  . THR D 1 11 ? 16.648  54.778 3.231   1.00 16.81 ? 234 THR D CB  1 
ATOM   2347 O OG1 . THR D 1 11 ? 18.012  54.957 2.774   1.00 22.61 ? 234 THR D OG1 1 
ATOM   2348 C CG2 . THR D 1 11 ? 16.367  55.874 4.191   1.00 18.79 ? 234 THR D CG2 1 
ATOM   2349 N N   . SER D 1 12 ? 15.257  51.856 2.538   1.00 14.30 ? 235 SER D N   1 
ATOM   2350 C CA  . SER D 1 12 ? 15.135  50.907 1.430   1.00 13.91 ? 235 SER D CA  1 
ATOM   2351 C C   . SER D 1 12 ? 15.591  51.548 0.128   1.00 15.48 ? 235 SER D C   1 
ATOM   2352 O O   . SER D 1 12 ? 15.410  52.763 -0.053  1.00 17.14 ? 235 SER D O   1 
ATOM   2353 C CB  . SER D 1 12 ? 13.688  50.470 1.277   1.00 16.12 ? 235 SER D CB  1 
ATOM   2354 O OG  . SER D 1 12 ? 13.299  49.659 2.369   1.00 16.28 ? 235 SER D OG  1 
ATOM   2355 N N   A GLN D 1 13 ? 16.171  50.745 -0.767  0.50 13.66 ? 236 GLN D N   1 
ATOM   2356 N N   B GLN D 1 13 ? 16.194  50.748 -0.756  0.50 14.34 ? 236 GLN D N   1 
ATOM   2357 C CA  A GLN D 1 13 ? 16.688  51.250 -2.016  0.50 14.40 ? 236 GLN D CA  1 
ATOM   2358 C CA  B GLN D 1 13 ? 16.821  51.228 -1.972  0.50 15.77 ? 236 GLN D CA  1 
ATOM   2359 C C   A GLN D 1 13 ? 16.620  50.214 -3.093  0.50 14.68 ? 236 GLN D C   1 
ATOM   2360 C C   B GLN D 1 13 ? 16.505  50.225 -3.070  0.50 15.45 ? 236 GLN D C   1 
ATOM   2361 O O   A GLN D 1 13 ? 16.817  49.000 -2.859  0.50 14.52 ? 236 GLN D O   1 
ATOM   2362 O O   B GLN D 1 13 ? 16.349  49.028 -2.809  0.50 15.96 ? 236 GLN D O   1 
ATOM   2363 C CB  A GLN D 1 13 ? 18.141  51.638 -1.869  0.50 13.61 ? 236 GLN D CB  1 
ATOM   2364 C CB  B GLN D 1 13 ? 18.344  51.303 -1.784  0.50 15.65 ? 236 GLN D CB  1 
ATOM   2365 C CG  A GLN D 1 13 ? 18.385  52.646 -0.764  0.50 13.87 ? 236 GLN D CG  1 
ATOM   2366 C CG  B GLN D 1 13 ? 18.800  52.164 -0.580  0.50 19.60 ? 236 GLN D CG  1 
ATOM   2367 C CD  A GLN D 1 13 ? 19.825  52.713 -0.397  0.50 11.62 ? 236 GLN D CD  1 
ATOM   2368 C CD  B GLN D 1 13 ? 19.448  53.477 -0.940  0.50 23.52 ? 236 GLN D CD  1 
ATOM   2369 O OE1 A GLN D 1 13 ? 20.679  52.950 -1.255  0.50 14.73 ? 236 GLN D OE1 1 
ATOM   2370 O OE1 B GLN D 1 13 ? 20.380  53.519 -1.737  0.50 27.87 ? 236 GLN D OE1 1 
ATOM   2371 N NE2 A GLN D 1 13 ? 20.120  52.600 0.886   0.50 11.08 ? 236 GLN D NE2 1 
ATOM   2372 N NE2 B GLN D 1 13 ? 18.995  54.564 -0.298  0.50 22.38 ? 236 GLN D NE2 1 
ATOM   2373 N N   . LYS D 1 14 ? 16.399  50.729 -4.299  1.00 15.98 ? 237 LYS D N   1 
ATOM   2374 C CA  . LYS D 1 14 ? 16.428  49.904 -5.513  1.00 17.13 ? 237 LYS D CA  1 
ATOM   2375 C C   . LYS D 1 14 ? 17.633  50.367 -6.313  1.00 17.05 ? 237 LYS D C   1 
ATOM   2376 O O   . LYS D 1 14 ? 17.728  51.533 -6.736  1.00 18.22 ? 237 LYS D O   1 
ATOM   2377 C CB  . LYS D 1 14 ? 15.148  50.052 -6.321  1.00 19.66 ? 237 LYS D CB  1 
ATOM   2378 C CG  . LYS D 1 14 ? 15.059  49.116 -7.541  1.00 23.13 ? 237 LYS D CG  1 
ATOM   2379 C CD  . LYS D 1 14 ? 13.695  49.190 -8.287  1.00 24.23 ? 237 LYS D CD  1 
ATOM   2380 C CE  . LYS D 1 14 ? 13.720  48.387 -9.559  1.00 28.55 ? 237 LYS D CE  1 
ATOM   2381 N NZ  . LYS D 1 14 ? 14.267  49.106 -10.738 1.00 35.77 ? 237 LYS D NZ  1 
ATOM   2382 N N   . LEU D 1 15 ? 18.555  49.462 -6.490  1.00 16.45 ? 238 LEU D N   1 
ATOM   2383 C CA  . LEU D 1 15 ? 19.862  49.772 -7.072  1.00 16.73 ? 238 LEU D CA  1 
ATOM   2384 C C   . LEU D 1 15 ? 20.138  48.957 -8.314  1.00 19.41 ? 238 LEU D C   1 
ATOM   2385 O O   . LEU D 1 15 ? 19.565  47.900 -8.507  1.00 20.10 ? 238 LEU D O   1 
ATOM   2386 C CB  . LEU D 1 15 ? 20.949  49.450 -6.046  1.00 16.61 ? 238 LEU D CB  1 
ATOM   2387 C CG  . LEU D 1 15 ? 20.836  50.233 -4.733  1.00 15.13 ? 238 LEU D CG  1 
ATOM   2388 C CD1 . LEU D 1 15 ? 21.890  49.749 -3.767  1.00 16.72 ? 238 LEU D CD1 1 
ATOM   2389 C CD2 . LEU D 1 15 ? 20.989  51.730 -4.991  1.00 16.33 ? 238 LEU D CD2 1 
ATOM   2390 N N   A MET D 1 16 ? 21.035  49.474 -9.157  0.50 21.08 ? 239 MET D N   1 
ATOM   2391 N N   B MET D 1 16 ? 21.009  49.451 -9.174  0.50 21.20 ? 239 MET D N   1 
ATOM   2392 C CA  A MET D 1 16 ? 21.535  48.759 -10.343 0.50 23.63 ? 239 MET D CA  1 
ATOM   2393 C CA  B MET D 1 16 ? 21.427  48.661 -10.320 0.50 23.85 ? 239 MET D CA  1 
ATOM   2394 C C   A MET D 1 16 ? 22.789  47.994 -9.972  0.50 22.41 ? 239 MET D C   1 
ATOM   2395 C C   B MET D 1 16 ? 22.749  47.995 -9.997  0.50 22.50 ? 239 MET D C   1 
ATOM   2396 O O   A MET D 1 16 ? 23.587  48.471 -9.159  0.50 21.34 ? 239 MET D O   1 
ATOM   2397 O O   B MET D 1 16 ? 23.549  48.538 -9.232  0.50 21.75 ? 239 MET D O   1 
ATOM   2398 C CB  A MET D 1 16 ? 21.899  49.719 -11.502 0.50 24.21 ? 239 MET D CB  1 
ATOM   2399 C CB  B MET D 1 16 ? 21.597  49.537 -11.557 0.50 24.25 ? 239 MET D CB  1 
ATOM   2400 C CG  A MET D 1 16 ? 21.070  50.957 -11.615 0.50 26.96 ? 239 MET D CG  1 
ATOM   2401 C CG  B MET D 1 16 ? 20.355  50.101 -12.146 0.50 26.92 ? 239 MET D CG  1 
ATOM   2402 S SD  A MET D 1 16 ? 20.549  51.196 -13.291 0.50 30.80 ? 239 MET D SD  1 
ATOM   2403 S SD  B MET D 1 16 ? 20.661  50.327 -13.894 0.50 30.44 ? 239 MET D SD  1 
ATOM   2404 C CE  A MET D 1 16 ? 19.389  49.840 -13.313 0.50 24.46 ? 239 MET D CE  1 
ATOM   2405 C CE  B MET D 1 16 ? 22.259  51.153 -13.819 0.50 29.84 ? 239 MET D CE  1 
ATOM   2406 N N   . PRO D 1 17 ? 23.029  46.834 -10.617 1.00 22.50 ? 240 PRO D N   1 
ATOM   2407 C CA  . PRO D 1 17 ? 24.344  46.270 -10.394 1.00 22.39 ? 240 PRO D CA  1 
ATOM   2408 C C   . PRO D 1 17 ? 25.457  47.317 -10.683 1.00 21.53 ? 240 PRO D C   1 
ATOM   2409 O O   . PRO D 1 17 ? 25.374  48.109 -11.625 1.00 22.48 ? 240 PRO D O   1 
ATOM   2410 C CB  . PRO D 1 17 ? 24.378  45.051 -11.366 1.00 23.45 ? 240 PRO D CB  1 
ATOM   2411 C CG  . PRO D 1 17 ? 22.936  44.654 -11.462 1.00 25.93 ? 240 PRO D CG  1 
ATOM   2412 C CD  . PRO D 1 17 ? 22.210  45.975 -11.503 1.00 24.89 ? 240 PRO D CD  1 
ATOM   2413 N N   . GLY D 1 18 ? 26.449  47.368 -9.818  1.00 20.52 ? 241 GLY D N   1 
ATOM   2414 C CA  . GLY D 1 18 ? 27.568  48.293 -9.953  1.00 21.14 ? 241 GLY D CA  1 
ATOM   2415 C C   . GLY D 1 18 ? 27.356  49.612 -9.197  1.00 19.83 ? 241 GLY D C   1 
ATOM   2416 O O   . GLY D 1 18 ? 28.275  50.398 -9.042  1.00 22.14 ? 241 GLY D O   1 
ATOM   2417 N N   A SER D 1 19 ? 26.129  49.847 -8.730  0.50 17.72 ? 242 SER D N   1 
ATOM   2418 N N   B SER D 1 19 ? 26.139  49.879 -8.745  0.50 18.38 ? 242 SER D N   1 
ATOM   2419 C CA  A SER D 1 19 ? 25.816  51.014 -7.875  0.50 16.56 ? 242 SER D CA  1 
ATOM   2420 C CA  B SER D 1 19 ? 25.921  51.097 -7.950  0.50 17.59 ? 242 SER D CA  1 
ATOM   2421 C C   A SER D 1 19 ? 26.453  50.840 -6.507  0.50 17.46 ? 242 SER D C   1 
ATOM   2422 C C   B SER D 1 19 ? 26.297  50.815 -6.493  0.50 18.29 ? 242 SER D C   1 
ATOM   2423 O O   A SER D 1 19 ? 26.937  49.768 -6.151  0.50 15.05 ? 242 SER D O   1 
ATOM   2424 O O   B SER D 1 19 ? 26.552  49.643 -6.119  0.50 16.29 ? 242 SER D O   1 
ATOM   2425 C CB  A SER D 1 19 ? 24.314  51.136 -7.656  0.50 16.74 ? 242 SER D CB  1 
ATOM   2426 C CB  B SER D 1 19 ? 24.502  51.612 -8.104  0.50 18.30 ? 242 SER D CB  1 
ATOM   2427 O OG  A SER D 1 19 ? 23.631  51.499 -8.851  0.50 18.00 ? 242 SER D OG  1 
ATOM   2428 O OG  B SER D 1 19 ? 23.560  50.665 -7.617  0.50 19.86 ? 242 SER D OG  1 
ATOM   2429 N N   . THR D 1 20 ? 26.397  51.882 -5.697  1.00 16.33 ? 243 THR D N   1 
ATOM   2430 C CA  . THR D 1 20 ? 26.905  51.798 -4.336  1.00 16.17 ? 243 THR D CA  1 
ATOM   2431 C C   . THR D 1 20 ? 25.758  51.589 -3.374  1.00 14.56 ? 243 THR D C   1 
ATOM   2432 O O   . THR D 1 20 ? 24.712  52.250 -3.467  1.00 15.27 ? 243 THR D O   1 
ATOM   2433 C CB  . THR D 1 20 ? 27.672  53.071 -3.981  1.00 17.77 ? 243 THR D CB  1 
ATOM   2434 O OG1 . THR D 1 20 ? 28.827  53.122 -4.819  1.00 22.83 ? 243 THR D OG1 1 
ATOM   2435 C CG2 . THR D 1 20 ? 28.136  53.039 -2.545  1.00 17.75 ? 243 THR D CG2 1 
ATOM   2436 N N   . LEU D 1 21 ? 25.952  50.675 -2.417  1.00 14.19 ? 244 LEU D N   1 
ATOM   2437 C CA  . LEU D 1 21 ? 25.000  50.506 -1.330  1.00 13.98 ? 244 LEU D CA  1 
ATOM   2438 C C   . LEU D 1 21 ? 25.533  51.168 -0.087  1.00 12.95 ? 244 LEU D C   1 
ATOM   2439 O O   . LEU D 1 21 ? 26.607  50.837 0.347   1.00 14.43 ? 244 LEU D O   1 
ATOM   2440 C CB  . LEU D 1 21 ? 24.747  48.999 -1.072  1.00 14.16 ? 244 LEU D CB  1 
ATOM   2441 C CG  . LEU D 1 21 ? 23.923  48.696 0.194   1.00 15.79 ? 244 LEU D CG  1 
ATOM   2442 C CD1 . LEU D 1 21 ? 22.561  49.316 0.122   1.00 15.91 ? 244 LEU D CD1 1 
ATOM   2443 C CD2 . LEU D 1 21 ? 23.835  47.150 0.357   1.00 16.78 ? 244 LEU D CD2 1 
ATOM   2444 N N   . VAL D 1 22 ? 24.786  52.128 0.463   1.00 13.56 ? 245 VAL D N   1 
ATOM   2445 C CA  . VAL D 1 22 ? 25.086  52.660 1.799   1.00 14.13 ? 245 VAL D CA  1 
ATOM   2446 C C   . VAL D 1 22 ? 23.820  52.515 2.642   1.00 13.47 ? 245 VAL D C   1 
ATOM   2447 O O   . VAL D 1 22 ? 22.754  52.999 2.249   1.00 14.41 ? 245 VAL D O   1 
ATOM   2448 C CB  . VAL D 1 22 ? 25.539  54.167 1.800   1.00 17.00 ? 245 VAL D CB  1 
ATOM   2449 C CG1 . VAL D 1 22 ? 25.872  54.611 3.253   1.00 18.97 ? 245 VAL D CG1 1 
ATOM   2450 C CG2 . VAL D 1 22 ? 26.723  54.324 0.880   1.00 18.43 ? 245 VAL D CG2 1 
ATOM   2451 N N   . LEU D 1 23 ? 23.948  51.868 3.790   1.00 12.18 ? 246 LEU D N   1 
ATOM   2452 C CA  . LEU D 1 23 ? 22.916  51.845 4.808   1.00 11.91 ? 246 LEU D CA  1 
ATOM   2453 C C   . LEU D 1 23 ? 23.459  52.505 6.065   1.00 11.81 ? 246 LEU D C   1 
ATOM   2454 O O   . LEU D 1 23 ? 24.609  52.322 6.394   1.00 12.27 ? 246 LEU D O   1 
ATOM   2455 C CB  . LEU D 1 23 ? 22.497  50.387 5.102   1.00 12.41 ? 246 LEU D CB  1 
ATOM   2456 C CG  . LEU D 1 23 ? 21.714  49.740 3.998   1.00 12.91 ? 246 LEU D CG  1 
ATOM   2457 C CD1 . LEU D 1 23 ? 21.546  48.230 4.264   1.00 16.12 ? 246 LEU D CD1 1 
ATOM   2458 C CD2 . LEU D 1 23 ? 20.315  50.368 3.915   1.00 18.35 ? 246 LEU D CD2 1 
ATOM   2459 N N   . GLN D 1 24 ? 22.608  53.273 6.738   1.00 10.29 ? 247 GLN D N   1 
ATOM   2460 C CA  . GLN D 1 24 ? 23.037  54.012 7.897   1.00 11.27 ? 247 GLN D CA  1 
ATOM   2461 C C   . GLN D 1 24 ? 22.047  53.836 9.043   1.00 10.48 ? 247 GLN D C   1 
ATOM   2462 O O   . GLN D 1 24 ? 20.845  53.877 8.845   1.00 12.02 ? 247 GLN D O   1 
ATOM   2463 C CB  . GLN D 1 24 ? 23.168  55.507 7.553   1.00 11.88 ? 247 GLN D CB  1 
ATOM   2464 C CG  . GLN D 1 24 ? 23.711  56.363 8.717   1.00 13.49 ? 247 GLN D CG  1 
ATOM   2465 C CD  . GLN D 1 24 ? 24.038  57.798 8.278   1.00 13.19 ? 247 GLN D CD  1 
ATOM   2466 O OE1 . GLN D 1 24 ? 23.569  58.275 7.200   1.00 17.41 ? 247 GLN D OE1 1 
ATOM   2467 N NE2 . GLN D 1 24 ? 24.872  58.423 9.004   1.00 12.06 ? 247 GLN D NE2 1 
ATOM   2468 N N   . CYS D 1 25 ? 22.587  53.692 10.254  1.00 10.65 ? 248 CYS D N   1 
ATOM   2469 C CA  . CYS D 1 25 ? 21.784  53.708 11.478  1.00 11.30 ? 248 CYS D CA  1 
ATOM   2470 C C   . CYS D 1 25 ? 22.618  54.447 12.501  1.00 11.13 ? 248 CYS D C   1 
ATOM   2471 O O   . CYS D 1 25 ? 23.797  54.122 12.692  1.00 12.43 ? 248 CYS D O   1 
ATOM   2472 C CB  . CYS D 1 25 ? 21.506  52.266 11.929  1.00 11.49 ? 248 CYS D CB  1 
ATOM   2473 S SG  . CYS D 1 25 ? 20.466  52.221 13.407  1.00 13.15 ? 248 CYS D SG  1 
ATOM   2474 N N   . VAL D 1 26 ? 22.015  55.461 13.140  1.00 12.16 ? 249 VAL D N   1 
ATOM   2475 C CA  . VAL D 1 26 ? 22.738  56.252 14.131  1.00 13.08 ? 249 VAL D CA  1 
ATOM   2476 C C   . VAL D 1 26 ? 21.880  56.307 15.382  1.00 12.71 ? 249 VAL D C   1 
ATOM   2477 O O   . VAL D 1 26 ? 20.694  56.616 15.316  1.00 13.96 ? 249 VAL D O   1 
ATOM   2478 C CB  . VAL D 1 26 ? 23.021  57.693 13.684  1.00 14.91 ? 249 VAL D CB  1 
ATOM   2479 C CG1 . VAL D 1 26 ? 23.873  58.443 14.740  1.00 16.94 ? 249 VAL D CG1 1 
ATOM   2480 C CG2 . VAL D 1 26 ? 23.754  57.699 12.335  1.00 15.84 ? 249 VAL D CG2 1 
ATOM   2481 N N   . ALA D 1 27 ? 22.498  56.063 16.537  1.00 12.88 ? 250 ALA D N   1 
ATOM   2482 C CA  . ALA D 1 27 ? 21.836  56.183 17.810  1.00 13.05 ? 250 ALA D CA  1 
ATOM   2483 C C   . ALA D 1 27 ? 22.626  57.099 18.740  1.00 13.13 ? 250 ALA D C   1 
ATOM   2484 O O   . ALA D 1 27 ? 23.825  57.288 18.551  1.00 15.73 ? 250 ALA D O   1 
ATOM   2485 C CB  . ALA D 1 27 ? 21.682  54.754 18.430  1.00 13.84 ? 250 ALA D CB  1 
ATOM   2486 N N   . VAL D 1 28 ? 21.925  57.560 19.775  1.00 15.11 ? 251 VAL D N   1 
ATOM   2487 C CA  . VAL D 1 28 ? 22.558  58.259 20.885  1.00 16.60 ? 251 VAL D CA  1 
ATOM   2488 C C   . VAL D 1 28 ? 22.436  57.387 22.118  1.00 16.17 ? 251 VAL D C   1 
ATOM   2489 O O   . VAL D 1 28 ? 21.595  56.502 22.141  1.00 17.18 ? 251 VAL D O   1 
ATOM   2490 C CB  . VAL D 1 28 ? 21.868  59.632 21.137  1.00 18.47 ? 251 VAL D CB  1 
ATOM   2491 C CG1 . VAL D 1 28 ? 22.123  60.569 19.945  1.00 22.62 ? 251 VAL D CG1 1 
ATOM   2492 C CG2 . VAL D 1 28 ? 20.395  59.490 21.433  1.00 20.14 ? 251 VAL D CG2 1 
ATOM   2493 N N   . GLY D 1 29 ? 23.218  57.677 23.161  1.00 18.08 ? 252 GLY D N   1 
ATOM   2494 C CA  . GLY D 1 29 ? 23.119  56.987 24.418  1.00 19.76 ? 252 GLY D CA  1 
ATOM   2495 C C   . GLY D 1 29 ? 24.439  57.050 25.136  1.00 19.32 ? 252 GLY D C   1 
ATOM   2496 O O   . GLY D 1 29 ? 25.481  57.239 24.508  1.00 18.75 ? 252 GLY D O   1 
ATOM   2497 N N   . SER D 1 30 ? 24.406  56.777 26.433  1.00 20.10 ? 253 SER D N   1 
ATOM   2498 C CA  . SER D 1 30 ? 25.617  56.588 27.220  1.00 20.42 ? 253 SER D CA  1 
ATOM   2499 C C   . SER D 1 30 ? 25.281  55.504 28.206  1.00 20.35 ? 253 SER D C   1 
ATOM   2500 O O   . SER D 1 30 ? 24.329  55.678 28.948  1.00 22.32 ? 253 SER D O   1 
ATOM   2501 C CB  . SER D 1 30 ? 26.026  57.881 27.945  1.00 22.26 ? 253 SER D CB  1 
ATOM   2502 O OG  . SER D 1 30 ? 27.243  57.705 28.645  1.00 26.66 ? 253 SER D OG  1 
ATOM   2503 N N   . PRO D 1 31 ? 26.062  54.409 28.229  1.00 19.02 ? 254 PRO D N   1 
ATOM   2504 C CA  . PRO D 1 31 ? 27.229  54.190 27.398  1.00 17.91 ? 254 PRO D CA  1 
ATOM   2505 C C   . PRO D 1 31 ? 26.912  54.242 25.902  1.00 15.61 ? 254 PRO D C   1 
ATOM   2506 O O   . PRO D 1 31 ? 25.766  53.998 25.471  1.00 15.90 ? 254 PRO D O   1 
ATOM   2507 C CB  . PRO D 1 31 ? 27.713  52.794 27.826  1.00 18.47 ? 254 PRO D CB  1 
ATOM   2508 C CG  . PRO D 1 31 ? 27.221  52.657 29.230  1.00 20.37 ? 254 PRO D CG  1 
ATOM   2509 C CD  . PRO D 1 31 ? 25.905  53.358 29.257  1.00 20.11 ? 254 PRO D CD  1 
ATOM   2510 N N   A ILE D 1 32 ? 27.937  54.549 25.124  0.50 15.29 ? 255 ILE D N   1 
ATOM   2511 N N   B ILE D 1 32 ? 27.941  54.565 25.127  0.50 16.10 ? 255 ILE D N   1 
ATOM   2512 C CA  A ILE D 1 32 ? 27.768  54.813 23.710  0.50 14.79 ? 255 ILE D CA  1 
ATOM   2513 C CA  B ILE D 1 32 ? 27.778  54.782 23.703  0.50 16.22 ? 255 ILE D CA  1 
ATOM   2514 C C   A ILE D 1 32 ? 27.267  53.552 22.968  0.50 14.51 ? 255 ILE D C   1 
ATOM   2515 C C   B ILE D 1 32 ? 27.183  53.521 23.041  0.50 15.04 ? 255 ILE D C   1 
ATOM   2516 O O   A ILE D 1 32 ? 27.791  52.462 23.163  0.50 14.79 ? 255 ILE D O   1 
ATOM   2517 O O   B ILE D 1 32 ? 27.474  52.395 23.437  0.50 15.28 ? 255 ILE D O   1 
ATOM   2518 C CB  A ILE D 1 32 ? 29.082  55.296 23.112  0.50 16.39 ? 255 ILE D CB  1 
ATOM   2519 C CB  B ILE D 1 32 ? 29.100  55.231 23.034  0.50 17.88 ? 255 ILE D CB  1 
ATOM   2520 C CG1 A ILE D 1 32 ? 29.428  56.661 23.721  0.50 16.02 ? 255 ILE D CG1 1 
ATOM   2521 C CG1 B ILE D 1 32 ? 28.812  55.904 21.682  0.50 20.68 ? 255 ILE D CG1 1 
ATOM   2522 C CG2 A ILE D 1 32 ? 28.957  55.428 21.623  0.50 17.96 ? 255 ILE D CG2 1 
ATOM   2523 C CG2 B ILE D 1 32 ? 30.142  54.102 22.997  0.50 16.79 ? 255 ILE D CG2 1 
ATOM   2524 C CD1 A ILE D 1 32 ? 30.872  56.979 23.792  0.50 22.23 ? 255 ILE D CD1 1 
ATOM   2525 C CD1 B ILE D 1 32 ? 29.707  57.108 21.394  0.50 27.11 ? 255 ILE D CD1 1 
ATOM   2526 N N   . PRO D 1 33 ? 26.260  53.711 22.085  1.00 14.24 ? 256 PRO D N   1 
ATOM   2527 C CA  . PRO D 1 33 ? 25.736  52.546 21.384  1.00 13.68 ? 256 PRO D CA  1 
ATOM   2528 C C   . PRO D 1 33 ? 26.748  51.815 20.528  1.00 13.77 ? 256 PRO D C   1 
ATOM   2529 O O   . PRO D 1 33 ? 27.633  52.429 19.917  1.00 14.84 ? 256 PRO D O   1 
ATOM   2530 C CB  . PRO D 1 33 ? 24.594  53.137 20.520  1.00 15.62 ? 256 PRO D CB  1 
ATOM   2531 C CG  . PRO D 1 33 ? 24.196  54.378 21.279  1.00 18.29 ? 256 PRO D CG  1 
ATOM   2532 C CD  . PRO D 1 33 ? 25.471  54.934 21.803  1.00 17.20 ? 256 PRO D CD  1 
ATOM   2533 N N   . HIS D 1 34 ? 26.577  50.504 20.462  1.00 13.07 ? 257 HIS D N   1 
ATOM   2534 C CA  . HIS D 1 34 ? 27.265  49.637 19.532  1.00 12.09 ? 257 HIS D CA  1 
ATOM   2535 C C   . HIS D 1 34 ? 26.231  49.177 18.496  1.00 11.79 ? 257 HIS D C   1 
ATOM   2536 O O   . HIS D 1 34 ? 25.017  49.213 18.715  1.00 11.78 ? 257 HIS D O   1 
ATOM   2537 C CB  . HIS D 1 34 ? 27.843  48.429 20.248  1.00 14.53 ? 257 HIS D CB  1 
ATOM   2538 C CG  . HIS D 1 34 ? 28.842  48.798 21.271  1.00 17.88 ? 257 HIS D CG  1 
ATOM   2539 N ND1 . HIS D 1 34 ? 30.182  48.601 21.075  1.00 22.78 ? 257 HIS D ND1 1 
ATOM   2540 C CD2 . HIS D 1 34 ? 28.719  49.474 22.435  1.00 20.62 ? 257 HIS D CD2 1 
ATOM   2541 C CE1 . HIS D 1 34 ? 30.848  49.067 22.126  1.00 23.83 ? 257 HIS D CE1 1 
ATOM   2542 N NE2 . HIS D 1 34 ? 29.980  49.614 22.961  1.00 22.98 ? 257 HIS D NE2 1 
ATOM   2543 N N   . TYR D 1 35 ? 26.769  48.656 17.390  1.00 11.77 ? 258 TYR D N   1 
ATOM   2544 C CA  . TYR D 1 35 ? 25.956  48.343 16.207  1.00 11.25 ? 258 TYR D CA  1 
ATOM   2545 C C   . TYR D 1 35 ? 26.326  46.973 15.700  1.00 12.10 ? 258 TYR D C   1 
ATOM   2546 O O   . TYR D 1 35 ? 27.488  46.553 15.752  1.00 12.21 ? 258 TYR D O   1 
ATOM   2547 C CB  . TYR D 1 35 ? 26.260  49.350 15.055  1.00 11.93 ? 258 TYR D CB  1 
ATOM   2548 C CG  . TYR D 1 35 ? 25.966  50.761 15.465  1.00 11.61 ? 258 TYR D CG  1 
ATOM   2549 C CD1 . TYR D 1 35 ? 24.710  51.322 15.263  1.00 12.12 ? 258 TYR D CD1 1 
ATOM   2550 C CD2 . TYR D 1 35 ? 26.915  51.534 16.119  1.00 12.79 ? 258 TYR D CD2 1 
ATOM   2551 C CE1 . TYR D 1 35 ? 24.386  52.614 15.688  1.00 12.54 ? 258 TYR D CE1 1 
ATOM   2552 C CE2 . TYR D 1 35 ? 26.629  52.827 16.565  1.00 13.16 ? 258 TYR D CE2 1 
ATOM   2553 C CZ  . TYR D 1 35 ? 25.358  53.349 16.379  1.00 11.54 ? 258 TYR D CZ  1 
ATOM   2554 O OH  . TYR D 1 35 ? 25.064  54.631 16.818  1.00 13.67 ? 258 TYR D OH  1 
ATOM   2555 N N   . GLN D 1 36 ? 25.364  46.259 15.101  1.00 11.29 ? 259 GLN D N   1 
ATOM   2556 C CA  . GLN D 1 36 ? 25.655  45.049 14.324  1.00 10.57 ? 259 GLN D CA  1 
ATOM   2557 C C   . GLN D 1 36 ? 24.593  44.947 13.219  1.00 10.95 ? 259 GLN D C   1 
ATOM   2558 O O   . GLN D 1 36 ? 23.412  44.899 13.518  1.00 11.27 ? 259 GLN D O   1 
ATOM   2559 C CB  . GLN D 1 36 ? 25.639  43.811 15.186  1.00 11.99 ? 259 GLN D CB  1 
ATOM   2560 C CG  . GLN D 1 36 ? 25.783  42.507 14.432  1.00 11.95 ? 259 GLN D CG  1 
ATOM   2561 C CD  . GLN D 1 36 ? 27.096  42.374 13.641  1.00 12.74 ? 259 GLN D CD  1 
ATOM   2562 O OE1 . GLN D 1 36 ? 28.189  42.441 14.205  1.00 13.55 ? 259 GLN D OE1 1 
ATOM   2563 N NE2 . GLN D 1 36 ? 26.970  42.199 12.344  1.00 13.35 ? 259 GLN D NE2 1 
ATOM   2564 N N   . TRP D 1 37 ? 25.042  44.890 11.966  1.00 10.87 ? 260 TRP D N   1 
ATOM   2565 C CA  . TRP D 1 37 ? 24.153  44.782 10.844  1.00 10.67 ? 260 TRP D CA  1 
ATOM   2566 C C   . TRP D 1 37 ? 23.819  43.325 10.521  1.00 10.86 ? 260 TRP D C   1 
ATOM   2567 O O   . TRP D 1 37 ? 24.657  42.399 10.671  1.00 12.36 ? 260 TRP D O   1 
ATOM   2568 C CB  . TRP D 1 37 ? 24.793  45.423 9.598   1.00 10.75 ? 260 TRP D CB  1 
ATOM   2569 C CG  . TRP D 1 37 ? 24.795  46.895 9.684   1.00 10.60 ? 260 TRP D CG  1 
ATOM   2570 C CD1 . TRP D 1 37 ? 25.844  47.700 10.144  1.00 11.04 ? 260 TRP D CD1 1 
ATOM   2571 C CD2 . TRP D 1 37 ? 23.747  47.773 9.291   1.00 10.60 ? 260 TRP D CD2 1 
ATOM   2572 N NE1 . TRP D 1 37 ? 25.448  49.028 10.104  1.00 11.03 ? 260 TRP D NE1 1 
ATOM   2573 C CE2 . TRP D 1 37 ? 24.173  49.090 9.593   1.00 10.90 ? 260 TRP D CE2 1 
ATOM   2574 C CE3 . TRP D 1 37 ? 22.470  47.592 8.762   1.00 11.41 ? 260 TRP D CE3 1 
ATOM   2575 C CZ2 . TRP D 1 37 ? 23.372  50.218 9.323   1.00 11.90 ? 260 TRP D CZ2 1 
ATOM   2576 C CZ3 . TRP D 1 37 ? 21.689  48.687 8.504   1.00 11.52 ? 260 TRP D CZ3 1 
ATOM   2577 C CH2 . TRP D 1 37 ? 22.119  49.997 8.827   1.00 11.90 ? 260 TRP D CH2 1 
ATOM   2578 N N   . PHE D 1 38 ? 22.594  43.113 10.053  1.00 11.31 ? 261 PHE D N   1 
ATOM   2579 C CA  . PHE D 1 38 ? 22.057  41.810 9.689   1.00 12.51 ? 261 PHE D CA  1 
ATOM   2580 C C   . PHE D 1 38 ? 21.472  41.906 8.301   1.00 13.17 ? 261 PHE D C   1 
ATOM   2581 O O   . PHE D 1 38 ? 20.904  42.920 7.918   1.00 13.47 ? 261 PHE D O   1 
ATOM   2582 C CB  . PHE D 1 38 ? 20.938  41.402 10.661  1.00 13.51 ? 261 PHE D CB  1 
ATOM   2583 C CG  . PHE D 1 38 ? 21.455  41.122 12.047  1.00 13.39 ? 261 PHE D CG  1 
ATOM   2584 C CD1 . PHE D 1 38 ? 21.702  39.802 12.435  1.00 15.29 ? 261 PHE D CD1 1 
ATOM   2585 C CD2 . PHE D 1 38 ? 21.716  42.153 12.961  1.00 12.75 ? 261 PHE D CD2 1 
ATOM   2586 C CE1 . PHE D 1 38 ? 22.247  39.512 13.696  1.00 16.34 ? 261 PHE D CE1 1 
ATOM   2587 C CE2 . PHE D 1 38 ? 22.236  41.875 14.201  1.00 14.37 ? 261 PHE D CE2 1 
ATOM   2588 C CZ  . PHE D 1 38 ? 22.537  40.571 14.556  1.00 15.25 ? 261 PHE D CZ  1 
ATOM   2589 N N   . LYS D 1 39 ? 21.629  40.806 7.553   1.00 13.82 ? 262 LYS D N   1 
ATOM   2590 C CA  . LYS D 1 39 ? 20.949  40.642 6.268   1.00 14.81 ? 262 LYS D CA  1 
ATOM   2591 C C   . LYS D 1 39 ? 20.206  39.325 6.297   1.00 16.77 ? 262 LYS D C   1 
ATOM   2592 O O   . LYS D 1 39 ? 20.808  38.307 6.628   1.00 17.49 ? 262 LYS D O   1 
ATOM   2593 C CB  . LYS D 1 39 ? 21.935  40.647 5.110   1.00 16.32 ? 262 LYS D CB  1 
ATOM   2594 C CG  . LYS D 1 39 ? 21.190  40.597 3.781   1.00 20.21 ? 262 LYS D CG  1 
ATOM   2595 C CD  . LYS D 1 39 ? 22.178  40.582 2.650   1.00 25.71 ? 262 LYS D CD  1 
ATOM   2596 C CE  . LYS D 1 39 ? 22.765  39.214 2.520   1.00 30.30 ? 262 LYS D CE  1 
ATOM   2597 N NZ  . LYS D 1 39 ? 22.900  38.969 1.061   1.00 33.35 ? 262 LYS D NZ  1 
ATOM   2598 N N   . ASN D 1 40 ? 18.906  39.339 5.989   1.00 17.38 ? 263 ASN D N   1 
ATOM   2599 C CA  . ASN D 1 40 ? 18.103  38.079 6.001   1.00 19.34 ? 263 ASN D CA  1 
ATOM   2600 C C   . ASN D 1 40 ? 18.358  37.297 7.299   1.00 20.42 ? 263 ASN D C   1 
ATOM   2601 O O   . ASN D 1 40 ? 18.554  36.068 7.311   1.00 21.56 ? 263 ASN D O   1 
ATOM   2602 C CB  . ASN D 1 40 ? 18.472  37.285 4.772   1.00 20.55 ? 263 ASN D CB  1 
ATOM   2603 C CG  . ASN D 1 40 ? 18.037  37.998 3.467   1.00 22.27 ? 263 ASN D CG  1 
ATOM   2604 O OD1 . ASN D 1 40 ? 17.198  38.933 3.485   1.00 22.61 ? 263 ASN D OD1 1 
ATOM   2605 N ND2 . ASN D 1 40 ? 18.585  37.569 2.347   1.00 25.46 ? 263 ASN D ND2 1 
ATOM   2606 N N   . GLU D 1 41 ? 18.295  38.055 8.391   1.00 20.16 ? 264 GLU D N   1 
ATOM   2607 C CA  . GLU D 1 41 ? 18.410  37.553 9.781   1.00 21.23 ? 264 GLU D CA  1 
ATOM   2608 C C   . GLU D 1 41 ? 19.775  37.021 10.198  1.00 21.05 ? 264 GLU D C   1 
ATOM   2609 O O   . GLU D 1 41 ? 19.924  36.592 11.346  1.00 24.01 ? 264 GLU D O   1 
ATOM   2610 C CB  . GLU D 1 41 ? 17.298  36.551 10.136  1.00 23.50 ? 264 GLU D CB  1 
ATOM   2611 C CG  . GLU D 1 41 ? 15.898  37.009 9.796   1.00 25.53 ? 264 GLU D CG  1 
ATOM   2612 C CD  . GLU D 1 41 ? 15.445  38.307 10.447  1.00 32.25 ? 264 GLU D CD  1 
ATOM   2613 O OE1 . GLU D 1 41 ? 16.090  38.848 11.385  1.00 29.89 ? 264 GLU D OE1 1 
ATOM   2614 O OE2 . GLU D 1 41 ? 14.385  38.802 10.005  1.00 37.64 ? 264 GLU D OE2 1 
ATOM   2615 N N   . LEU D 1 42 ? 20.791  37.106 9.322   1.00 18.68 ? 265 LEU D N   1 
ATOM   2616 C CA  . LEU D 1 42 ? 22.145  36.718 9.680   1.00 19.03 ? 265 LEU D CA  1 
ATOM   2617 C C   . LEU D 1 42 ? 23.130  37.870 9.826   1.00 17.25 ? 265 LEU D C   1 
ATOM   2618 O O   . LEU D 1 42 ? 23.075  38.809 9.062   1.00 15.58 ? 265 LEU D O   1 
ATOM   2619 C CB  . LEU D 1 42 ? 22.654  35.736 8.672   1.00 20.29 ? 265 LEU D CB  1 
ATOM   2620 C CG  . LEU D 1 42 ? 21.674  34.526 8.542   1.00 22.86 ? 265 LEU D CG  1 
ATOM   2621 C CD1 . LEU D 1 42 ? 22.188  33.580 7.524   1.00 30.20 ? 265 LEU D CD1 1 
ATOM   2622 C CD2 . LEU D 1 42 ? 21.443  33.802 9.888   1.00 28.32 ? 265 LEU D CD2 1 
ATOM   2623 N N   . PRO D 1 43 ? 24.033  37.797 10.806  1.00 16.39 ? 266 PRO D N   1 
ATOM   2624 C CA  . PRO D 1 43 ? 24.908  38.953 11.029  1.00 15.08 ? 266 PRO D CA  1 
ATOM   2625 C C   . PRO D 1 43 ? 25.952  39.059 9.907   1.00 15.95 ? 266 PRO D C   1 
ATOM   2626 O O   . PRO D 1 43 ? 26.509  38.058 9.448   1.00 17.51 ? 266 PRO D O   1 
ATOM   2627 C CB  . PRO D 1 43 ? 25.607  38.615 12.349  1.00 17.15 ? 266 PRO D CB  1 
ATOM   2628 C CG  . PRO D 1 43 ? 25.534  37.090 12.433  1.00 18.61 ? 266 PRO D CG  1 
ATOM   2629 C CD  . PRO D 1 43 ? 24.263  36.706 11.784  1.00 18.37 ? 266 PRO D CD  1 
ATOM   2630 N N   . LEU D 1 44 ? 26.263  40.287 9.498   1.00 14.51 ? 267 LEU D N   1 
ATOM   2631 C CA  . LEU D 1 44 ? 27.315  40.564 8.535   1.00 14.30 ? 267 LEU D CA  1 
ATOM   2632 C C   . LEU D 1 44 ? 28.625  40.776 9.328   1.00 14.65 ? 267 LEU D C   1 
ATOM   2633 O O   . LEU D 1 44 ? 28.775  41.721 10.091  1.00 14.89 ? 267 LEU D O   1 
ATOM   2634 C CB  . LEU D 1 44 ? 26.935  41.834 7.765   1.00 14.48 ? 267 LEU D CB  1 
ATOM   2635 C CG  . LEU D 1 44 ? 25.705  41.676 6.850   1.00 15.39 ? 267 LEU D CG  1 
ATOM   2636 C CD1 . LEU D 1 44 ? 25.198  43.030 6.411   1.00 16.33 ? 267 LEU D CD1 1 
ATOM   2637 C CD2 . LEU D 1 44 ? 25.976  40.797 5.627   1.00 22.00 ? 267 LEU D CD2 1 
ATOM   2638 N N   A THR D 1 45 ? 29.573  39.892 9.068   0.50 17.90 ? 268 THR D N   1 
ATOM   2639 N N   B THR D 1 45 ? 29.563  39.862 9.136   0.50 16.13 ? 268 THR D N   1 
ATOM   2640 C CA  A THR D 1 45 ? 30.785  39.864 9.859   0.50 17.96 ? 268 THR D CA  1 
ATOM   2641 C CA  B THR D 1 45 ? 30.729  39.849 10.007  0.50 14.34 ? 268 THR D CA  1 
ATOM   2642 C C   A THR D 1 45 ? 31.501  41.222 9.850   0.50 15.56 ? 268 THR D C   1 
ATOM   2643 C C   B THR D 1 45 ? 31.556  41.119 9.871   0.50 13.85 ? 268 THR D C   1 
ATOM   2644 O O   A THR D 1 45 ? 31.631  41.876 8.798   0.50 17.52 ? 268 THR D O   1 
ATOM   2645 O O   B THR D 1 45 ? 31.912  41.529 8.740   0.50 15.29 ? 268 THR D O   1 
ATOM   2646 C CB  A THR D 1 45 ? 31.721  38.715 9.383   0.50 18.97 ? 268 THR D CB  1 
ATOM   2647 C CB  B THR D 1 45 ? 31.664  38.659 9.735   0.50 14.48 ? 268 THR D CB  1 
ATOM   2648 O OG1 A THR D 1 45 ? 32.755  38.474 10.352  0.50 23.79 ? 268 THR D OG1 1 
ATOM   2649 O OG1 B THR D 1 45 ? 30.872  37.496 9.467   0.50 15.34 ? 268 THR D OG1 1 
ATOM   2650 C CG2 A THR D 1 45 ? 32.333  39.007 8.033   0.50 24.12 ? 268 THR D CG2 1 
ATOM   2651 C CG2 B THR D 1 45 ? 32.617  38.435 10.936  0.50 17.87 ? 268 THR D CG2 1 
ATOM   2652 N N   . HIS D 1 46 ? 31.902  41.666 11.041  1.00 16.80 ? 269 HIS D N   1 
ATOM   2653 C CA  . HIS D 1 46 ? 32.673  42.934 11.224  1.00 16.99 ? 269 HIS D CA  1 
ATOM   2654 C C   . HIS D 1 46 ? 31.891  44.178 10.874  1.00 16.53 ? 269 HIS D C   1 
ATOM   2655 O O   . HIS D 1 46 ? 32.445  45.269 11.028  1.00 17.60 ? 269 HIS D O   1 
ATOM   2656 C CB  . HIS D 1 46 ? 34.009  42.959 10.516  1.00 18.75 ? 269 HIS D CB  1 
ATOM   2657 C CG  . HIS D 1 46 ? 34.803  41.745 10.820  1.00 20.91 ? 269 HIS D CG  1 
ATOM   2658 N ND1 . HIS D 1 46 ? 35.062  41.375 12.120  1.00 27.19 ? 269 HIS D ND1 1 
ATOM   2659 C CD2 . HIS D 1 46 ? 35.371  40.802 10.029  1.00 24.52 ? 269 HIS D CD2 1 
ATOM   2660 C CE1 . HIS D 1 46 ? 35.782  40.263 12.114  1.00 24.74 ? 269 HIS D CE1 1 
ATOM   2661 N NE2 . HIS D 1 46 ? 35.957  39.882 10.861  1.00 23.10 ? 269 HIS D NE2 1 
ATOM   2662 N N   . GLU D 1 47 ? 30.611  44.046 10.545  1.00 14.38 ? 270 GLU D N   1 
ATOM   2663 C CA  . GLU D 1 47 ? 29.809  45.233 10.212  1.00 12.23 ? 270 GLU D CA  1 
ATOM   2664 C C   . GLU D 1 47 ? 29.147  45.787 11.460  1.00 12.36 ? 270 GLU D C   1 
ATOM   2665 O O   . GLU D 1 47 ? 27.975  45.557 11.753  1.00 13.30 ? 270 GLU D O   1 
ATOM   2666 C CB  . GLU D 1 47 ? 28.801  44.907 9.105   1.00 13.45 ? 270 GLU D CB  1 
ATOM   2667 C CG  . GLU D 1 47 ? 29.479  44.465 7.818   1.00 14.19 ? 270 GLU D CG  1 
ATOM   2668 C CD  . GLU D 1 47 ? 30.404  45.511 7.118   1.00 16.82 ? 270 GLU D CD  1 
ATOM   2669 O OE1 . GLU D 1 47 ? 30.339  46.700 7.539   1.00 15.82 ? 270 GLU D OE1 1 
ATOM   2670 O OE2 . GLU D 1 47 ? 31.054  45.125 6.132   1.00 21.87 ? 270 GLU D OE2 1 
ATOM   2671 N N   . THR D 1 48 ? 29.990  46.498 12.191  1.00 13.01 ? 271 THR D N   1 
ATOM   2672 C CA  . THR D 1 48 ? 29.658  47.000 13.524  1.00 13.44 ? 271 THR D CA  1 
ATOM   2673 C C   . THR D 1 48 ? 29.720  48.516 13.582  1.00 13.45 ? 271 THR D C   1 
ATOM   2674 O O   . THR D 1 48 ? 29.869  49.124 14.651  1.00 14.17 ? 271 THR D O   1 
ATOM   2675 C CB  . THR D 1 48 ? 30.592  46.442 14.573  1.00 13.88 ? 271 THR D CB  1 
ATOM   2676 O OG1 . THR D 1 48 ? 31.924  46.838 14.261  1.00 16.42 ? 271 THR D OG1 1 
ATOM   2677 C CG2 . THR D 1 48 ? 30.497  44.936 14.622  1.00 16.24 ? 271 THR D CG2 1 
ATOM   2678 N N   . LYS D 1 49 ? 29.577  49.138 12.407  1.00 13.77 ? 272 LYS D N   1 
ATOM   2679 C CA  . LYS D 1 49 ? 29.626  50.623 12.325  1.00 14.14 ? 272 LYS D CA  1 
ATOM   2680 C C   . LYS D 1 49 ? 28.273  51.165 11.947  1.00 12.96 ? 272 LYS D C   1 
ATOM   2681 O O   . LYS D 1 49 ? 27.373  50.448 11.509  1.00 12.48 ? 272 LYS D O   1 
ATOM   2682 C CB  . LYS D 1 49 ? 30.647  51.030 11.264  1.00 15.19 ? 272 LYS D CB  1 
ATOM   2683 C CG  . LYS D 1 49 ? 32.041  50.390 11.469  1.00 20.17 ? 272 LYS D CG  1 
ATOM   2684 C CD  . LYS D 1 49 ? 33.058  51.135 10.657  1.00 25.10 ? 272 LYS D CD  1 
ATOM   2685 C CE  . LYS D 1 49 ? 34.491  50.651 10.873  1.00 32.14 ? 272 LYS D CE  1 
ATOM   2686 N NZ  . LYS D 1 49 ? 35.100  51.215 12.111  1.00 35.88 ? 272 LYS D NZ  1 
ATOM   2687 N N   A LYS D 1 50 ? 28.077  52.458 12.193  0.50 12.73 ? 273 LYS D N   1 
ATOM   2688 N N   B LYS D 1 50 ? 28.138  52.472 12.136  0.50 13.04 ? 273 LYS D N   1 
ATOM   2689 C CA  A LYS D 1 50 ? 26.829  53.138 11.800  0.50 12.82 ? 273 LYS D CA  1 
ATOM   2690 C CA  B LYS D 1 50 ? 26.923  53.216 11.799  0.50 12.87 ? 273 LYS D CA  1 
ATOM   2691 C C   A LYS D 1 50 ? 26.540  52.964 10.302  0.50 11.91 ? 273 LYS D C   1 
ATOM   2692 C C   B LYS D 1 50 ? 26.581  53.121 10.309  0.50 12.06 ? 273 LYS D C   1 
ATOM   2693 O O   A LYS D 1 50 ? 25.359  52.846 9.921   0.50 11.63 ? 273 LYS D O   1 
ATOM   2694 O O   B LYS D 1 50 ? 25.425  53.245 9.926   0.50 11.44 ? 273 LYS D O   1 
ATOM   2695 C CB  A LYS D 1 50 ? 26.860  54.630 12.168  0.50 13.47 ? 273 LYS D CB  1 
ATOM   2696 C CB  B LYS D 1 50 ? 27.107  54.678 12.184  0.50 13.64 ? 273 LYS D CB  1 
ATOM   2697 C CG  A LYS D 1 50 ? 26.759  54.907 13.682  0.50 12.29 ? 273 LYS D CG  1 
ATOM   2698 C CG  B LYS D 1 50 ? 27.184  54.921 13.684  0.50 14.38 ? 273 LYS D CG  1 
ATOM   2699 C CD  A LYS D 1 50 ? 27.006  56.390 14.020  0.50 16.33 ? 273 LYS D CD  1 
ATOM   2700 C CD  B LYS D 1 50 ? 27.582  56.393 13.928  0.50 15.74 ? 273 LYS D CD  1 
ATOM   2701 C CE  A LYS D 1 50 ? 28.421  56.802 13.722  0.50 19.47 ? 273 LYS D CE  1 
ATOM   2702 C CE  B LYS D 1 50 ? 27.287  56.836 15.360  0.50 18.28 ? 273 LYS D CE  1 
ATOM   2703 N NZ  A LYS D 1 50 ? 29.382  56.179 14.677  0.50 22.90 ? 273 LYS D NZ  1 
ATOM   2704 N NZ  B LYS D 1 50 ? 27.957  58.152 15.567  0.50 20.80 ? 273 LYS D NZ  1 
ATOM   2705 N N   . LEU D 1 51 ? 27.597  52.973 9.477   1.00 12.33 ? 274 LEU D N   1 
ATOM   2706 C CA  . LEU D 1 51 ? 27.407  52.755 8.023   1.00 13.27 ? 274 LEU D CA  1 
ATOM   2707 C C   . LEU D 1 51 ? 27.768  51.334 7.649   1.00 12.79 ? 274 LEU D C   1 
ATOM   2708 O O   . LEU D 1 51 ? 28.758  50.799 8.124   1.00 13.60 ? 274 LEU D O   1 
ATOM   2709 C CB  . LEU D 1 51 ? 28.338  53.680 7.214   1.00 14.21 ? 274 LEU D CB  1 
ATOM   2710 C CG  . LEU D 1 51 ? 28.058  55.160 7.442   1.00 14.64 ? 274 LEU D CG  1 
ATOM   2711 C CD1 . LEU D 1 51 ? 29.125  56.004 6.732   1.00 18.36 ? 274 LEU D CD1 1 
ATOM   2712 C CD2 . LEU D 1 51 ? 26.742  55.518 6.855   1.00 18.22 ? 274 LEU D CD2 1 
ATOM   2713 N N   . TYR D 1 52 ? 26.948  50.770 6.777   1.00 12.93 ? 275 TYR D N   1 
ATOM   2714 C CA  . TYR D 1 52 ? 27.281  49.543 6.081   1.00 12.66 ? 275 TYR D CA  1 
ATOM   2715 C C   . TYR D 1 52 ? 27.394  49.914 4.595   1.00 14.05 ? 275 TYR D C   1 
ATOM   2716 O O   . TYR D 1 52 ? 26.435  50.479 4.044   1.00 14.04 ? 275 TYR D O   1 
ATOM   2717 C CB  . TYR D 1 52 ? 26.185  48.504 6.288   1.00 13.12 ? 275 TYR D CB  1 
ATOM   2718 C CG  . TYR D 1 52 ? 26.411  47.301 5.377   1.00 12.83 ? 275 TYR D CG  1 
ATOM   2719 C CD1 . TYR D 1 52 ? 27.557  46.505 5.496   1.00 14.87 ? 275 TYR D CD1 1 
ATOM   2720 C CD2 . TYR D 1 52 ? 25.497  46.976 4.385   1.00 14.51 ? 275 TYR D CD2 1 
ATOM   2721 C CE1 . TYR D 1 52 ? 27.801  45.443 4.628   1.00 15.37 ? 275 TYR D CE1 1 
ATOM   2722 C CE2 . TYR D 1 52 ? 25.729  45.891 3.529   1.00 15.17 ? 275 TYR D CE2 1 
ATOM   2723 C CZ  . TYR D 1 52 ? 26.876  45.143 3.671   1.00 14.30 ? 275 TYR D CZ  1 
ATOM   2724 O OH  . TYR D 1 52 ? 27.116  44.044 2.857   1.00 16.44 ? 275 TYR D OH  1 
ATOM   2725 N N   . MET D 1 53 ? 28.542  49.637 3.970   1.00 16.57 ? 276 MET D N   1 
ATOM   2726 C CA  . MET D 1 53 ? 28.698  50.137 2.625   1.00 19.19 ? 276 MET D CA  1 
ATOM   2727 C C   . MET D 1 53 ? 29.325  49.066 1.729   1.00 15.65 ? 276 MET D C   1 
ATOM   2728 O O   . MET D 1 53 ? 30.203  48.295 2.128   1.00 24.71 ? 276 MET D O   1 
ATOM   2729 C CB  . MET D 1 53 ? 29.616  51.343 2.632   1.00 20.63 ? 276 MET D CB  1 
ATOM   2730 C CG  . MET D 1 53 ? 29.011  52.493 3.296   1.00 27.12 ? 276 MET D CG  1 
ATOM   2731 S SD  . MET D 1 53 ? 30.080  53.911 3.242   1.00 33.55 ? 276 MET D SD  1 
ATOM   2732 C CE  . MET D 1 53 ? 31.371  53.334 4.317   1.00 31.10 ? 276 MET D CE  1 
ATOM   2733 N N   . VAL D 1 54 ? 28.781  49.010 0.523   1.00 17.20 ? 277 VAL D N   1 
ATOM   2734 C CA  . VAL D 1 54 ? 29.222  48.048 -0.482  1.00 17.54 ? 277 VAL D CA  1 
ATOM   2735 C C   . VAL D 1 54 ? 29.440  48.908 -1.729  1.00 18.31 ? 277 VAL D C   1 
ATOM   2736 O O   . VAL D 1 54 ? 28.497  49.458 -2.285  1.00 17.93 ? 277 VAL D O   1 
ATOM   2737 C CB  . VAL D 1 54 ? 28.150  46.961 -0.783  1.00 17.20 ? 277 VAL D CB  1 
ATOM   2738 C CG1 . VAL D 1 54 ? 28.583  46.054 -1.943  1.00 20.27 ? 277 VAL D CG1 1 
ATOM   2739 C CG2 . VAL D 1 54 ? 27.891  46.136 0.431   1.00 18.90 ? 277 VAL D CG2 1 
ATOM   2740 N N   . PRO D 1 55 ? 30.702  49.081 -2.200  1.00 18.30 ? 278 PRO D N   1 
ATOM   2741 C CA  . PRO D 1 55 ? 30.979  49.963 -3.330  1.00 20.30 ? 278 PRO D CA  1 
ATOM   2742 C C   . PRO D 1 55 ? 30.382  49.582 -4.659  1.00 19.85 ? 278 PRO D C   1 
ATOM   2743 O O   . PRO D 1 55 ? 30.011  50.466 -5.416  1.00 22.12 ? 278 PRO D O   1 
ATOM   2744 C CB  . PRO D 1 55 ? 32.501  50.046 -3.390  1.00 23.11 ? 278 PRO D CB  1 
ATOM   2745 C CG  . PRO D 1 55 ? 32.987  48.979 -2.642  1.00 24.08 ? 278 PRO D CG  1 
ATOM   2746 C CD  . PRO D 1 55 ? 31.953  48.554 -1.634  1.00 20.55 ? 278 PRO D CD  1 
ATOM   2747 N N   A TYR D 1 56 ? 30.348  48.286 -5.005  0.50 19.82 ? 279 TYR D N   1 
ATOM   2748 N N   B TYR D 1 56 ? 30.309  48.281 -4.899  0.50 19.21 ? 279 TYR D N   1 
ATOM   2749 C CA  A TYR D 1 56 ? 29.725  47.830 -6.271  0.50 20.11 ? 279 TYR D CA  1 
ATOM   2750 C CA  B TYR D 1 56 ? 29.857  47.737 -6.146  0.50 19.31 ? 279 TYR D CA  1 
ATOM   2751 C C   A TYR D 1 56 ? 28.769  46.677 -6.051  0.50 19.91 ? 279 TYR D C   1 
ATOM   2752 C C   B TYR D 1 56 ? 28.816  46.689 -5.773  0.50 19.45 ? 279 TYR D C   1 
ATOM   2753 O O   A TYR D 1 56 ? 29.162  45.516 -6.022  0.50 18.39 ? 279 TYR D O   1 
ATOM   2754 O O   B TYR D 1 56 ? 29.224  45.603 -5.316  0.50 17.60 ? 279 TYR D O   1 
ATOM   2755 C CB  A TYR D 1 56 ? 30.767  47.318 -7.280  0.50 21.73 ? 279 TYR D CB  1 
ATOM   2756 C CB  B TYR D 1 56 ? 31.096  47.073 -6.828  0.50 20.11 ? 279 TYR D CB  1 
ATOM   2757 C CG  A TYR D 1 56 ? 31.880  48.236 -7.627  0.50 24.74 ? 279 TYR D CG  1 
ATOM   2758 C CG  B TYR D 1 56 ? 30.888  46.682 -8.257  0.50 21.21 ? 279 TYR D CG  1 
ATOM   2759 C CD1 A TYR D 1 56 ? 31.783  49.077 -8.724  0.50 26.22 ? 279 TYR D CD1 1 
ATOM   2760 C CD1 B TYR D 1 56 ? 31.598  47.323 -9.270  0.50 21.33 ? 279 TYR D CD1 1 
ATOM   2761 C CD2 A TYR D 1 56 ? 33.053  48.216 -6.895  0.50 24.50 ? 279 TYR D CD2 1 
ATOM   2762 C CD2 B TYR D 1 56 ? 29.985  45.682 -8.608  0.50 21.99 ? 279 TYR D CD2 1 
ATOM   2763 C CE1 A TYR D 1 56 ? 32.818  49.902 -9.053  0.50 24.45 ? 279 TYR D CE1 1 
ATOM   2764 C CE1 B TYR D 1 56 ? 31.401  46.976 -10.605 0.50 24.72 ? 279 TYR D CE1 1 
ATOM   2765 C CE2 A TYR D 1 56 ? 34.093  49.040 -7.202  0.50 23.41 ? 279 TYR D CE2 1 
ATOM   2766 C CE2 B TYR D 1 56 ? 29.782  45.321 -9.922  0.50 24.20 ? 279 TYR D CE2 1 
ATOM   2767 C CZ  A TYR D 1 56 ? 33.964  49.885 -8.298  0.50 22.91 ? 279 TYR D CZ  1 
ATOM   2768 C CZ  B TYR D 1 56 ? 30.475  45.975 -10.921 0.50 23.10 ? 279 TYR D CZ  1 
ATOM   2769 O OH  A TYR D 1 56 ? 34.979  50.724 -8.670  0.50 25.69 ? 279 TYR D OH  1 
ATOM   2770 O OH  B TYR D 1 56 ? 30.248  45.596 -12.236 0.50 25.66 ? 279 TYR D OH  1 
ATOM   2771 N N   . VAL D 1 57 ? 27.502  46.992 -5.911  1.00 19.22 ? 280 VAL D N   1 
ATOM   2772 C CA  . VAL D 1 57 ? 26.478  45.939 -5.650  1.00 21.16 ? 280 VAL D CA  1 
ATOM   2773 C C   . VAL D 1 57 ? 26.156  45.000 -6.773  1.00 22.83 ? 280 VAL D C   1 
ATOM   2774 O O   . VAL D 1 57 ? 26.292  45.307 -7.941  1.00 23.35 ? 280 VAL D O   1 
ATOM   2775 C CB  . VAL D 1 57 ? 25.116  46.433 -5.209  1.00 21.16 ? 280 VAL D CB  1 
ATOM   2776 C CG1 . VAL D 1 57 ? 25.276  47.129 -4.007  1.00 21.27 ? 280 VAL D CG1 1 
ATOM   2777 C CG2 . VAL D 1 57 ? 24.363  47.294 -6.283  1.00 20.20 ? 280 VAL D CG2 1 
ATOM   2778 N N   . ASP D 1 58 ? 25.723  43.816 -6.382  1.00 24.36 ? 281 ASP D N   1 
ATOM   2779 C CA  . ASP D 1 58 ? 25.267  42.844 -7.307  1.00 26.14 ? 281 ASP D CA  1 
ATOM   2780 C C   . ASP D 1 58 ? 24.147  42.135 -6.629  1.00 24.90 ? 281 ASP D C   1 
ATOM   2781 O O   . ASP D 1 58 ? 23.737  42.478 -5.494  1.00 21.60 ? 281 ASP D O   1 
ATOM   2782 C CB  . ASP D 1 58 ? 26.378  41.840 -7.609  1.00 28.80 ? 281 ASP D CB  1 
ATOM   2783 C CG  . ASP D 1 58 ? 26.827  41.897 -9.029  1.00 32.15 ? 281 ASP D CG  1 
ATOM   2784 O OD1 . ASP D 1 58 ? 25.968  42.144 -9.888  1.00 37.08 ? 281 ASP D OD1 1 
ATOM   2785 O OD2 . ASP D 1 58 ? 28.043  41.692 -9.296  1.00 39.04 ? 281 ASP D OD2 1 
ATOM   2786 N N   . LEU D 1 59 ? 23.666  41.118 -7.322  1.00 25.64 ? 282 LEU D N   1 
ATOM   2787 C CA  . LEU D 1 59 ? 22.472  40.441 -6.907  1.00 24.16 ? 282 LEU D CA  1 
ATOM   2788 C C   . LEU D 1 59 ? 22.680  39.840 -5.525  1.00 22.95 ? 282 LEU D C   1 
ATOM   2789 O O   . LEU D 1 59 ? 21.728  39.722 -4.776  1.00 22.49 ? 282 LEU D O   1 
ATOM   2790 C CB  . LEU D 1 59 ? 22.119  39.370 -7.948  1.00 25.26 ? 282 LEU D CB  1 
ATOM   2791 C CG  . LEU D 1 59 ? 21.947  39.963 -9.365  1.00 29.40 ? 282 LEU D CG  1 
ATOM   2792 C CD1 . LEU D 1 59 ? 21.999  38.886 -10.472 1.00 32.42 ? 282 LEU D CD1 1 
ATOM   2793 C CD2 . LEU D 1 59 ? 20.662  40.762 -9.460  1.00 32.89 ? 282 LEU D CD2 1 
ATOM   2794 N N   . GLU D 1 60 ? 23.922  39.489 -5.159  1.00 22.19 ? 283 GLU D N   1 
ATOM   2795 C CA  . GLU D 1 60 ? 24.122  38.844 -3.859  1.00 25.24 ? 283 GLU D CA  1 
ATOM   2796 C C   . GLU D 1 60 ? 23.768  39.791 -2.713  1.00 21.04 ? 283 GLU D C   1 
ATOM   2797 O O   . GLU D 1 60 ? 23.505  39.349 -1.600  1.00 21.38 ? 283 GLU D O   1 
ATOM   2798 C CB  . GLU D 1 60 ? 25.541  38.320 -3.680  1.00 24.78 ? 283 GLU D CB  1 
ATOM   2799 C CG  . GLU D 1 60 ? 26.616  39.385 -3.652  1.00 30.00 ? 283 GLU D CG  1 
ATOM   2800 C CD  . GLU D 1 60 ? 28.008  38.785 -3.572  1.00 28.20 ? 283 GLU D CD  1 
ATOM   2801 O OE1 . GLU D 1 60 ? 28.482  38.226 -4.582  1.00 41.80 ? 283 GLU D OE1 1 
ATOM   2802 O OE2 . GLU D 1 60 ? 28.631  38.869 -2.497  1.00 38.39 ? 283 GLU D OE2 1 
ATOM   2803 N N   . HIS D 1 61 ? 23.742  41.110 -2.975  1.00 18.44 ? 284 HIS D N   1 
ATOM   2804 C CA  . HIS D 1 61 ? 23.435  42.074 -1.905  1.00 16.26 ? 284 HIS D CA  1 
ATOM   2805 C C   . HIS D 1 61 ? 21.956  42.308 -1.727  1.00 16.07 ? 284 HIS D C   1 
ATOM   2806 O O   . HIS D 1 61 ? 21.549  43.055 -0.831  1.00 17.16 ? 284 HIS D O   1 
ATOM   2807 C CB  . HIS D 1 61 ? 24.180  43.360 -2.141  1.00 17.91 ? 284 HIS D CB  1 
ATOM   2808 C CG  . HIS D 1 61 ? 25.621  43.136 -2.415  1.00 18.48 ? 284 HIS D CG  1 
ATOM   2809 N ND1 . HIS D 1 61 ? 26.553  42.778 -1.463  1.00 22.65 ? 284 HIS D ND1 1 
ATOM   2810 C CD2 . HIS D 1 61 ? 26.274  43.197 -3.587  1.00 17.72 ? 284 HIS D CD2 1 
ATOM   2811 C CE1 . HIS D 1 61 ? 27.737  42.655 -2.050  1.00 20.76 ? 284 HIS D CE1 1 
ATOM   2812 N NE2 . HIS D 1 61 ? 27.583  42.890 -3.341  1.00 24.39 ? 284 HIS D NE2 1 
ATOM   2813 N N   . GLN D 1 62 ? 21.130  41.743 -2.603  1.00 17.01 ? 285 GLN D N   1 
ATOM   2814 C CA  . GLN D 1 62 ? 19.713  41.897 -2.406  1.00 16.99 ? 285 GLN D CA  1 
ATOM   2815 C C   . GLN D 1 62 ? 19.247  41.262 -1.086  1.00 17.83 ? 285 GLN D C   1 
ATOM   2816 O O   . GLN D 1 62 ? 19.730  40.176 -0.710  1.00 20.49 ? 285 GLN D O   1 
ATOM   2817 C CB  . GLN D 1 62 ? 18.951  41.292 -3.583  1.00 19.32 ? 285 GLN D CB  1 
ATOM   2818 C CG  . GLN D 1 62 ? 17.473  41.502 -3.648  1.00 23.55 ? 285 GLN D CG  1 
ATOM   2819 C CD  . GLN D 1 62 ? 16.913  41.163 -5.020  1.00 23.98 ? 285 GLN D CD  1 
ATOM   2820 O OE1 . GLN D 1 62 ? 16.866  42.020 -5.926  1.00 26.95 ? 285 GLN D OE1 1 
ATOM   2821 N NE2 . GLN D 1 62 ? 16.502  39.912 -5.198  1.00 27.31 ? 285 GLN D NE2 1 
ATOM   2822 N N   . GLY D 1 63 ? 18.309  41.875 -0.402  1.00 16.57 ? 286 GLY D N   1 
ATOM   2823 C CA  . GLY D 1 63 ? 17.773  41.268 0.798   1.00 16.35 ? 286 GLY D CA  1 
ATOM   2824 C C   . GLY D 1 63 ? 17.228  42.283 1.760   1.00 15.60 ? 286 GLY D C   1 
ATOM   2825 O O   . GLY D 1 63 ? 17.098  43.465 1.453   1.00 16.04 ? 286 GLY D O   1 
ATOM   2826 N N   . THR D 1 64 ? 16.906  41.781 2.943   1.00 15.15 ? 287 THR D N   1 
ATOM   2827 C CA  . THR D 1 64 ? 16.309  42.583 4.007   1.00 16.56 ? 287 THR D CA  1 
ATOM   2828 C C   . THR D 1 64 ? 17.369  42.808 5.052   1.00 15.17 ? 287 THR D C   1 
ATOM   2829 O O   . THR D 1 64 ? 17.948  41.861 5.573   1.00 17.03 ? 287 THR D O   1 
ATOM   2830 C CB  . THR D 1 64 ? 15.153  41.863 4.656   1.00 17.56 ? 287 THR D CB  1 
ATOM   2831 O OG1 . THR D 1 64 ? 14.197  41.591 3.629   1.00 20.40 ? 287 THR D OG1 1 
ATOM   2832 C CG2 . THR D 1 64 ? 14.490  42.711 5.704   1.00 18.86 ? 287 THR D CG2 1 
ATOM   2833 N N   . TYR D 1 65 ? 17.602  44.088 5.405   1.00 13.93 ? 288 TYR D N   1 
ATOM   2834 C CA  . TYR D 1 65 ? 18.668  44.466 6.337   1.00 12.82 ? 288 TYR D CA  1 
ATOM   2835 C C   . TYR D 1 65 ? 18.099  45.197 7.545   1.00 12.62 ? 288 TYR D C   1 
ATOM   2836 O O   . TYR D 1 65 ? 17.065  45.908 7.465   1.00 14.06 ? 288 TYR D O   1 
ATOM   2837 C CB  . TYR D 1 65 ? 19.608  45.452 5.642   1.00 13.70 ? 288 TYR D CB  1 
ATOM   2838 C CG  . TYR D 1 65 ? 20.409  44.874 4.505   1.00 12.50 ? 288 TYR D CG  1 
ATOM   2839 C CD1 . TYR D 1 65 ? 21.760  44.605 4.696   1.00 13.77 ? 288 TYR D CD1 1 
ATOM   2840 C CD2 . TYR D 1 65 ? 19.845  44.645 3.252   1.00 13.39 ? 288 TYR D CD2 1 
ATOM   2841 C CE1 . TYR D 1 65 ? 22.577  44.152 3.660   1.00 14.90 ? 288 TYR D CE1 1 
ATOM   2842 C CE2 . TYR D 1 65 ? 20.660  44.179 2.203   1.00 13.94 ? 288 TYR D CE2 1 
ATOM   2843 C CZ  . TYR D 1 65 ? 22.013  43.957 2.418   1.00 13.82 ? 288 TYR D CZ  1 
ATOM   2844 O OH  . TYR D 1 65 ? 22.869  43.566 1.429   1.00 17.31 ? 288 TYR D OH  1 
ATOM   2845 N N   . TRP D 1 66 ? 18.808  45.068 8.671   1.00 12.91 ? 289 TRP D N   1 
ATOM   2846 C CA  . TRP D 1 66 ? 18.483  45.899 9.840   1.00 13.11 ? 289 TRP D CA  1 
ATOM   2847 C C   . TRP D 1 66 ? 19.740  45.887 10.709  1.00 11.59 ? 289 TRP D C   1 
ATOM   2848 O O   . TRP D 1 66 ? 20.672  45.111 10.452  1.00 12.18 ? 289 TRP D O   1 
ATOM   2849 C CB  . TRP D 1 66 ? 17.255  45.379 10.617  1.00 14.34 ? 289 TRP D CB  1 
ATOM   2850 C CG  . TRP D 1 66 ? 17.406  43.962 10.995  1.00 17.07 ? 289 TRP D CG  1 
ATOM   2851 C CD1 . TRP D 1 66 ? 17.206  42.865 10.160  1.00 19.62 ? 289 TRP D CD1 1 
ATOM   2852 C CD2 . TRP D 1 66 ? 17.768  43.437 12.242  1.00 18.91 ? 289 TRP D CD2 1 
ATOM   2853 N NE1 . TRP D 1 66 ? 17.350  41.705 10.844  1.00 23.95 ? 289 TRP D NE1 1 
ATOM   2854 C CE2 . TRP D 1 66 ? 17.753  42.004 12.127  1.00 22.16 ? 289 TRP D CE2 1 
ATOM   2855 C CE3 . TRP D 1 66 ? 18.044  44.013 13.472  1.00 21.01 ? 289 TRP D CE3 1 
ATOM   2856 C CZ2 . TRP D 1 66 ? 18.018  41.140 13.195  1.00 23.78 ? 289 TRP D CZ2 1 
ATOM   2857 C CZ3 . TRP D 1 66 ? 18.349  43.140 14.556  1.00 21.66 ? 289 TRP D CZ3 1 
ATOM   2858 C CH2 . TRP D 1 66 ? 18.299  41.717 14.405  1.00 21.46 ? 289 TRP D CH2 1 
ATOM   2859 N N   . CYS D 1 67 ? 19.740  46.782 11.674  1.00 11.38 ? 290 CYS D N   1 
ATOM   2860 C CA  . CYS D 1 67 ? 20.887  46.962 12.552  1.00 11.59 ? 290 CYS D CA  1 
ATOM   2861 C C   . CYS D 1 67 ? 20.392  46.842 13.997  1.00 10.68 ? 290 CYS D C   1 
ATOM   2862 O O   . CYS D 1 67 ? 19.400  47.458 14.398  1.00 11.95 ? 290 CYS D O   1 
ATOM   2863 C CB  . CYS D 1 67 ? 21.460  48.369 12.314  1.00 11.85 ? 290 CYS D CB  1 
ATOM   2864 S SG  . CYS D 1 67 ? 23.033  48.624 13.161  1.00 11.93 ? 290 CYS D SG  1 
ATOM   2865 N N   . HIS D 1 68 ? 21.105  46.016 14.781  1.00 11.25 ? 291 HIS D N   1 
ATOM   2866 C CA  . HIS D 1 68 ? 20.875  45.920 16.208  1.00 11.32 ? 291 HIS D CA  1 
ATOM   2867 C C   . HIS D 1 68 ? 21.759  46.953 16.903  1.00 10.64 ? 291 HIS D C   1 
ATOM   2868 O O   . HIS D 1 68 ? 22.948  46.991 16.636  1.00 12.33 ? 291 HIS D O   1 
ATOM   2869 C CB  . HIS D 1 68 ? 21.196  44.534 16.762  1.00 11.93 ? 291 HIS D CB  1 
ATOM   2870 C CG  . HIS D 1 68 ? 20.809  44.394 18.205  1.00 12.06 ? 291 HIS D CG  1 
ATOM   2871 N ND1 . HIS D 1 68 ? 19.493  44.485 18.625  1.00 14.28 ? 291 HIS D ND1 1 
ATOM   2872 C CD2 . HIS D 1 68 ? 21.543  44.207 19.331  1.00 12.99 ? 291 HIS D CD2 1 
ATOM   2873 C CE1 . HIS D 1 68 ? 19.439  44.302 19.942  1.00 14.64 ? 291 HIS D CE1 1 
ATOM   2874 N NE2 . HIS D 1 68 ? 20.666  44.142 20.401  1.00 13.45 ? 291 HIS D NE2 1 
ATOM   2875 N N   . VAL D 1 69 ? 21.153  47.782 17.744  1.00 11.04 ? 292 VAL D N   1 
ATOM   2876 C CA  . VAL D 1 69 ? 21.859  48.870 18.405  1.00 11.06 ? 292 VAL D CA  1 
ATOM   2877 C C   . VAL D 1 69 ? 21.801  48.615 19.887  1.00 11.52 ? 292 VAL D C   1 
ATOM   2878 O O   . VAL D 1 69 ? 20.711  48.379 20.415  1.00 12.30 ? 292 VAL D O   1 
ATOM   2879 C CB  . VAL D 1 69 ? 21.216  50.197 18.026  1.00 12.34 ? 292 VAL D CB  1 
ATOM   2880 C CG1 . VAL D 1 69 ? 21.936  51.294 18.645  1.00 15.70 ? 292 VAL D CG1 1 
ATOM   2881 C CG2 . VAL D 1 69 ? 21.168  50.373 16.483  1.00 13.50 ? 292 VAL D CG2 1 
ATOM   2882 N N   . TYR D 1 70 ? 22.926  48.710 20.593  1.00 11.23 ? 293 TYR D N   1 
ATOM   2883 C CA  . TYR D 1 70 ? 22.902  48.228 21.979  1.00 11.59 ? 293 TYR D CA  1 
ATOM   2884 C C   . TYR D 1 70 ? 24.022  48.766 22.791  1.00 11.62 ? 293 TYR D C   1 
ATOM   2885 O O   . TYR D 1 70 ? 25.071  49.100 22.292  1.00 13.22 ? 293 TYR D O   1 
ATOM   2886 C CB  . TYR D 1 70 ? 22.913  46.669 22.012  1.00 12.86 ? 293 TYR D CB  1 
ATOM   2887 C CG  . TYR D 1 70 ? 24.223  46.073 21.532  1.00 12.45 ? 293 TYR D CG  1 
ATOM   2888 C CD1 . TYR D 1 70 ? 25.179  45.620 22.425  1.00 13.41 ? 293 TYR D CD1 1 
ATOM   2889 C CD2 . TYR D 1 70 ? 24.500  46.001 20.179  1.00 12.62 ? 293 TYR D CD2 1 
ATOM   2890 C CE1 . TYR D 1 70 ? 26.329  45.089 22.009  1.00 14.97 ? 293 TYR D CE1 1 
ATOM   2891 C CE2 . TYR D 1 70 ? 25.724  45.502 19.710  1.00 13.33 ? 293 TYR D CE2 1 
ATOM   2892 C CZ  . TYR D 1 70 ? 26.652  45.055 20.639  1.00 13.84 ? 293 TYR D CZ  1 
ATOM   2893 O OH  . TYR D 1 70 ? 27.860  44.548 20.239  1.00 15.00 ? 293 TYR D OH  1 
ATOM   2894 N N   . ASN D 1 71 ? 23.809  48.763 24.091  1.00 13.08 ? 294 ASN D N   1 
ATOM   2895 C CA  . ASN D 1 71 ? 24.892  48.940 25.064  1.00 13.50 ? 294 ASN D CA  1 
ATOM   2896 C C   . ASN D 1 71 ? 24.667  47.948 26.195  1.00 13.59 ? 294 ASN D C   1 
ATOM   2897 O O   . ASN D 1 71 ? 23.948  46.962 26.020  1.00 14.59 ? 294 ASN D O   1 
ATOM   2898 C CB  . ASN D 1 71 ? 25.041  50.410 25.499  1.00 13.33 ? 294 ASN D CB  1 
ATOM   2899 C CG  . ASN D 1 71 ? 23.798  50.941 26.175  1.00 14.20 ? 294 ASN D CG  1 
ATOM   2900 O OD1 . ASN D 1 71 ? 22.967  50.165 26.648  1.00 14.52 ? 294 ASN D OD1 1 
ATOM   2901 N ND2 . ASN D 1 71 ? 23.673  52.268 26.320  1.00 15.40 ? 294 ASN D ND2 1 
ATOM   2902 N N   . ASP D 1 72 ? 25.301  48.149 27.338  1.00 14.17 ? 295 ASP D N   1 
ATOM   2903 C CA  . ASP D 1 72 ? 25.169  47.206 28.460  1.00 14.40 ? 295 ASP D CA  1 
ATOM   2904 C C   . ASP D 1 72 ? 23.937  47.407 29.307  1.00 14.92 ? 295 ASP D C   1 
ATOM   2905 O O   . ASP D 1 72 ? 23.815  46.755 30.346  1.00 16.34 ? 295 ASP D O   1 
ATOM   2906 C CB  . ASP D 1 72 ? 26.453  47.211 29.317  1.00 16.81 ? 295 ASP D CB  1 
ATOM   2907 C CG  . ASP D 1 72 ? 26.725  48.531 29.993  1.00 17.04 ? 295 ASP D CG  1 
ATOM   2908 O OD1 . ASP D 1 72 ? 25.889  49.464 29.902  1.00 20.22 ? 295 ASP D OD1 1 
ATOM   2909 O OD2 . ASP D 1 72 ? 27.818  48.664 30.649  1.00 20.37 ? 295 ASP D OD2 1 
ATOM   2910 N N   A ARG D 1 73 ? 23.001  48.256 28.874  0.50 15.91 ? 296 ARG D N   1 
ATOM   2911 N N   B ARG D 1 73 ? 23.041  48.273 28.829  0.50 15.26 ? 296 ARG D N   1 
ATOM   2912 C CA  A ARG D 1 73 ? 21.724  48.403 29.579  0.50 16.00 ? 296 ARG D CA  1 
ATOM   2913 C CA  B ARG D 1 73 ? 21.837  48.630 29.542  0.50 14.80 ? 296 ARG D CA  1 
ATOM   2914 C C   A ARG D 1 73 ? 20.513  48.215 28.674  0.50 15.33 ? 296 ARG D C   1 
ATOM   2915 C C   B ARG D 1 73 ? 20.551  48.440 28.750  0.50 14.47 ? 296 ARG D C   1 
ATOM   2916 O O   A ARG D 1 73 ? 19.490  47.646 29.082  0.50 16.83 ? 296 ARG D O   1 
ATOM   2917 O O   B ARG D 1 73 ? 19.500  48.124 29.341  0.50 16.21 ? 296 ARG D O   1 
ATOM   2918 C CB  A ARG D 1 73 ? 21.646  49.759 30.285  0.50 16.89 ? 296 ARG D CB  1 
ATOM   2919 C CB  B ARG D 1 73 ? 21.929  50.087 30.026  0.50 15.38 ? 296 ARG D CB  1 
ATOM   2920 C CG  A ARG D 1 73 ? 20.347  49.949 31.076  0.50 19.23 ? 296 ARG D CG  1 
ATOM   2921 C CG  B ARG D 1 73 ? 20.837  50.336 31.072  0.50 16.78 ? 296 ARG D CG  1 
ATOM   2922 C CD  A ARG D 1 73 ? 20.270  51.220 31.857  0.50 23.58 ? 296 ARG D CD  1 
ATOM   2923 C CD  B ARG D 1 73 ? 20.749  51.752 31.554  0.50 17.98 ? 296 ARG D CD  1 
ATOM   2924 N NE  A ARG D 1 73 ? 19.058  51.178 32.672  0.50 27.05 ? 296 ARG D NE  1 
ATOM   2925 N NE  B ARG D 1 73 ? 19.701  51.866 32.571  0.50 19.64 ? 296 ARG D NE  1 
ATOM   2926 C CZ  A ARG D 1 73 ? 17.876  51.682 32.318  0.50 29.37 ? 296 ARG D CZ  1 
ATOM   2927 C CZ  B ARG D 1 73 ? 19.899  52.297 33.814  0.50 17.95 ? 296 ARG D CZ  1 
ATOM   2928 N NH1 A ARG D 1 73 ? 17.734  52.302 31.147  0.50 30.16 ? 296 ARG D NH1 1 
ATOM   2929 N NH1 B ARG D 1 73 ? 21.082  52.721 34.201  0.50 18.26 ? 296 ARG D NH1 1 
ATOM   2930 N NH2 A ARG D 1 73 ? 16.834  51.578 33.146  0.50 29.47 ? 296 ARG D NH2 1 
ATOM   2931 N NH2 B ARG D 1 73 ? 18.885  52.348 34.678  0.50 21.62 ? 296 ARG D NH2 1 
ATOM   2932 N N   . ASP D 1 74 ? 20.613  48.678 27.426  1.00 15.17 ? 297 ASP D N   1 
ATOM   2933 C CA  . ASP D 1 74 ? 19.415  48.785 26.597  1.00 17.81 ? 297 ASP D CA  1 
ATOM   2934 C C   . ASP D 1 74 ? 19.752  48.393 25.170  1.00 14.65 ? 297 ASP D C   1 
ATOM   2935 O O   . ASP D 1 74 ? 20.901  48.418 24.777  1.00 14.93 ? 297 ASP D O   1 
ATOM   2936 C CB  . ASP D 1 74 ? 18.978  50.279 26.544  1.00 20.14 ? 297 ASP D CB  1 
ATOM   2937 C CG  . ASP D 1 74 ? 18.403  50.827 27.864  1.00 24.31 ? 297 ASP D CG  1 
ATOM   2938 O OD1 . ASP D 1 74 ? 17.294  50.442 28.220  1.00 26.07 ? 297 ASP D OD1 1 
ATOM   2939 O OD2 . ASP D 1 74 ? 19.048  51.658 28.500  1.00 29.86 ? 297 ASP D OD2 1 
ATOM   2940 N N   . SER D 1 75 ? 18.726  48.077 24.379  1.00 15.28 ? 298 SER D N   1 
ATOM   2941 C CA  . SER D 1 75 ? 18.923  47.847 22.962  1.00 14.23 ? 298 SER D CA  1 
ATOM   2942 C C   . SER D 1 75 ? 17.660  48.201 22.190  1.00 13.48 ? 298 SER D C   1 
ATOM   2943 O O   . SER D 1 75 ? 16.556  48.235 22.735  1.00 15.36 ? 298 SER D O   1 
ATOM   2944 C CB  . SER D 1 75 ? 19.358  46.382 22.716  1.00 15.14 ? 298 SER D CB  1 
ATOM   2945 O OG  . SER D 1 75 ? 18.266  45.492 23.031  1.00 18.32 ? 298 SER D OG  1 
ATOM   2946 N N   . GLN D 1 76 ? 17.867  48.423 20.906  1.00 13.60 ? 299 GLN D N   1 
ATOM   2947 C CA  . GLN D 1 76 ? 16.795  48.654 19.972  1.00 13.63 ? 299 GLN D CA  1 
ATOM   2948 C C   . GLN D 1 76 ? 17.206  48.061 18.656  1.00 13.32 ? 299 GLN D C   1 
ATOM   2949 O O   . GLN D 1 76 ? 18.364  48.069 18.298  1.00 14.32 ? 299 GLN D O   1 
ATOM   2950 C CB  . GLN D 1 76 ? 16.558  50.158 19.775  1.00 15.08 ? 299 GLN D CB  1 
ATOM   2951 C CG  . GLN D 1 76 ? 15.968  50.859 20.966  1.00 17.59 ? 299 GLN D CG  1 
ATOM   2952 C CD  . GLN D 1 76 ? 15.613  52.309 20.686  1.00 17.61 ? 299 GLN D CD  1 
ATOM   2953 O OE1 . GLN D 1 76 ? 16.005  52.893 19.669  1.00 17.83 ? 299 GLN D OE1 1 
ATOM   2954 N NE2 . GLN D 1 76 ? 14.819  52.896 21.572  1.00 22.72 ? 299 GLN D NE2 1 
ATOM   2955 N N   . ASP D 1 77 ? 16.208  47.659 17.868  1.00 14.54 ? 300 ASP D N   1 
ATOM   2956 C CA  . ASP D 1 77 ? 16.447  47.271 16.484  1.00 14.73 ? 300 ASP D CA  1 
ATOM   2957 C C   . ASP D 1 77 ? 16.023  48.380 15.561  1.00 14.86 ? 300 ASP D C   1 
ATOM   2958 O O   . ASP D 1 77 ? 14.987  48.992 15.735  1.00 14.86 ? 300 ASP D O   1 
ATOM   2959 C CB  . ASP D 1 77 ? 15.647  46.038 16.121  1.00 16.41 ? 300 ASP D CB  1 
ATOM   2960 C CG  . ASP D 1 77 ? 16.152  44.799 16.778  1.00 20.06 ? 300 ASP D CG  1 
ATOM   2961 O OD1 . ASP D 1 77 ? 17.365  44.672 16.964  1.00 25.26 ? 300 ASP D OD1 1 
ATOM   2962 O OD2 . ASP D 1 77 ? 15.344  43.850 17.005  1.00 23.33 ? 300 ASP D OD2 1 
ATOM   2963 N N   . SER D 1 78 ? 16.856  48.644 14.555  1.00 13.30 ? 301 SER D N   1 
ATOM   2964 C CA  . SER D 1 78 ? 16.424  49.557 13.510  1.00 13.62 ? 301 SER D CA  1 
ATOM   2965 C C   . SER D 1 78 ? 15.218  49.035 12.801  1.00 14.68 ? 301 SER D C   1 
ATOM   2966 O O   . SER D 1 78 ? 14.941  47.841 12.814  1.00 14.90 ? 301 SER D O   1 
ATOM   2967 C CB  . SER D 1 78 ? 17.512  49.820 12.471  1.00 13.15 ? 301 SER D CB  1 
ATOM   2968 O OG  . SER D 1 78 ? 17.647  48.724 11.553  1.00 13.12 ? 301 SER D OG  1 
ATOM   2969 N N   . LYS D 1 79 ? 14.556  49.901 12.053  1.00 14.89 ? 302 LYS D N   1 
ATOM   2970 C CA  . LYS D 1 79 ? 13.645  49.423 11.040  1.00 16.55 ? 302 LYS D CA  1 
ATOM   2971 C C   . LYS D 1 79 ? 14.320  48.454 10.064  1.00 15.12 ? 302 LYS D C   1 
ATOM   2972 O O   . LYS D 1 79 ? 15.500  48.570 9.800   1.00 14.06 ? 302 LYS D O   1 
ATOM   2973 C CB  . LYS D 1 79 ? 13.066  50.637 10.281  1.00 19.16 ? 302 LYS D CB  1 
ATOM   2974 C CG  . LYS D 1 79 ? 12.163  51.445 11.212  1.00 23.94 ? 302 LYS D CG  1 
ATOM   2975 C CD  . LYS D 1 79 ? 11.643  52.753 10.618  1.00 25.83 ? 302 LYS D CD  1 
ATOM   2976 C CE  . LYS D 1 79 ? 11.016  53.655 11.738  1.00 26.97 ? 302 LYS D CE  1 
ATOM   2977 N NZ  . LYS D 1 79 ? 10.855  55.077 11.373  1.00 32.77 ? 302 LYS D NZ  1 
ATOM   2978 N N   A LYS D 1 80 ? 13.521  47.534 9.485   0.50 16.77 ? 303 LYS D N   1 
ATOM   2979 N N   B LYS D 1 80 ? 13.519  47.533 9.529   0.50 16.63 ? 303 LYS D N   1 
ATOM   2980 C CA  A LYS D 1 80 ? 13.966  46.487 8.531   0.50 15.93 ? 303 LYS D CA  1 
ATOM   2981 C CA  B LYS D 1 80 ? 13.970  46.693 8.450   0.50 15.24 ? 303 LYS D CA  1 
ATOM   2982 C C   A LYS D 1 80 ? 13.696  46.956 7.092   0.50 14.56 ? 303 LYS D C   1 
ATOM   2983 C C   B LYS D 1 80 ? 13.800  47.434 7.164   0.50 15.54 ? 303 LYS D C   1 
ATOM   2984 O O   A LYS D 1 80 ? 12.525  47.173 6.748   0.50 15.58 ? 303 LYS D O   1 
ATOM   2985 O O   B LYS D 1 80 ? 12.860  48.256 6.971   0.50 15.15 ? 303 LYS D O   1 
ATOM   2986 C CB  A LYS D 1 80 ? 13.224  45.155 8.801   0.50 16.96 ? 303 LYS D CB  1 
ATOM   2987 C CB  B LYS D 1 80 ? 13.214  45.387 8.375   0.50 16.87 ? 303 LYS D CB  1 
ATOM   2988 C CG  A LYS D 1 80 ? 13.579  44.427 10.097  0.50 18.11 ? 303 LYS D CG  1 
ATOM   2989 C CG  B LYS D 1 80 ? 13.722  44.420 9.392   0.50 17.79 ? 303 LYS D CG  1 
ATOM   2990 C CD  A LYS D 1 80 ? 12.959  43.021 10.196  0.50 20.37 ? 303 LYS D CD  1 
ATOM   2991 C CD  B LYS D 1 80 ? 12.908  43.154 9.426   0.50 19.23 ? 303 LYS D CD  1 
ATOM   2992 C CE  A LYS D 1 80 ? 13.415  42.088 9.085   0.50 23.73 ? 303 LYS D CE  1 
ATOM   2993 C CE  B LYS D 1 80 ? 13.609  42.128 10.315  0.50 21.07 ? 303 LYS D CE  1 
ATOM   2994 N NZ  A LYS D 1 80 ? 12.947  40.687 9.312   0.50 25.90 ? 303 LYS D NZ  1 
ATOM   2995 N NZ  B LYS D 1 80 ? 12.675  41.029 10.707  0.50 24.81 ? 303 LYS D NZ  1 
ATOM   2996 N N   . VAL D 1 81 ? 14.780  47.194 6.301   1.00 13.95 ? 304 VAL D N   1 
ATOM   2997 C CA  . VAL D 1 81 ? 14.662  47.805 4.962   1.00 15.74 ? 304 VAL D CA  1 
ATOM   2998 C C   . VAL D 1 81 ? 15.016  46.775 3.912   1.00 14.43 ? 304 VAL D C   1 
ATOM   2999 O O   . VAL D 1 81 ? 15.662  45.789 4.156   1.00 15.65 ? 304 VAL D O   1 
ATOM   3000 C CB  . VAL D 1 81 ? 15.591  49.020 4.858   1.00 16.16 ? 304 VAL D CB  1 
ATOM   3001 C CG1 . VAL D 1 81 ? 15.183  50.154 5.806   1.00 19.05 ? 304 VAL D CG1 1 
ATOM   3002 C CG2 . VAL D 1 81 ? 17.058  48.616 4.974   1.00 16.54 ? 304 VAL D CG2 1 
ATOM   3003 N N   . GLU D 1 82 ? 14.575  47.058 2.702   1.00 15.01 ? 305 GLU D N   1 
ATOM   3004 C CA  . GLU D 1 82 ? 14.837  46.126 1.624   1.00 15.73 ? 305 GLU D CA  1 
ATOM   3005 C C   . GLU D 1 82 ? 15.743  46.762 0.600   1.00 14.19 ? 305 GLU D C   1 
ATOM   3006 O O   . GLU D 1 82 ? 15.496  47.907 0.159   1.00 15.24 ? 305 GLU D O   1 
ATOM   3007 C CB  . GLU D 1 82 ? 13.578  45.690 0.914   1.00 17.10 ? 305 GLU D CB  1 
ATOM   3008 C CG  . GLU D 1 82 ? 13.896  44.518 -0.002  1.00 20.98 ? 305 GLU D CG  1 
ATOM   3009 C CD  . GLU D 1 82 ? 12.674  43.907 -0.671  1.00 25.36 ? 305 GLU D CD  1 
ATOM   3010 O OE1 . GLU D 1 82 ? 11.652  44.615 -0.779  1.00 22.79 ? 305 GLU D OE1 1 
ATOM   3011 O OE2 . GLU D 1 82 ? 12.780  42.729 -1.125  1.00 26.90 ? 305 GLU D OE2 1 
ATOM   3012 N N   . ILE D 1 83 ? 16.708  46.000 0.126   1.00 14.74 ? 306 ILE D N   1 
ATOM   3013 C CA  . ILE D 1 83 ? 17.567  46.400 -0.997  1.00 14.02 ? 306 ILE D CA  1 
ATOM   3014 C C   . ILE D 1 83 ? 17.196  45.501 -2.124  1.00 14.98 ? 306 ILE D C   1 
ATOM   3015 O O   . ILE D 1 83 ? 17.310  44.262 -2.025  1.00 16.91 ? 306 ILE D O   1 
ATOM   3016 C CB  . ILE D 1 83 ? 19.046  46.225 -0.653  1.00 16.09 ? 306 ILE D CB  1 
ATOM   3017 C CG1 . ILE D 1 83 ? 19.448  47.104 0.560   1.00 15.89 ? 306 ILE D CG1 1 
ATOM   3018 C CG2 . ILE D 1 83 ? 19.942  46.520 -1.882  1.00 18.01 ? 306 ILE D CG2 1 
ATOM   3019 C CD1 . ILE D 1 83 ? 19.046  48.589 0.435   1.00 17.90 ? 306 ILE D CD1 1 
ATOM   3020 N N   . ILE D 1 84 ? 16.712  46.129 -3.192  1.00 14.88 ? 307 ILE D N   1 
ATOM   3021 C CA  . ILE D 1 84 ? 16.336  45.405 -4.425  1.00 16.44 ? 307 ILE D CA  1 
ATOM   3022 C C   . ILE D 1 84 ? 17.414  45.739 -5.474  1.00 16.81 ? 307 ILE D C   1 
ATOM   3023 O O   . ILE D 1 84 ? 17.804  46.888 -5.609  1.00 17.02 ? 307 ILE D O   1 
ATOM   3024 C CB  . ILE D 1 84 ? 14.950  45.853 -4.903  1.00 17.73 ? 307 ILE D CB  1 
ATOM   3025 C CG1 . ILE D 1 84 ? 13.914  45.552 -3.831  1.00 20.76 ? 307 ILE D CG1 1 
ATOM   3026 C CG2 . ILE D 1 84 ? 14.599  45.246 -6.259  1.00 20.30 ? 307 ILE D CG2 1 
ATOM   3027 C CD1 . ILE D 1 84 ? 12.563  46.098 -4.171  1.00 22.25 ? 307 ILE D CD1 1 
ATOM   3028 N N   . ILE D 1 85 ? 17.867  44.725 -6.196  1.00 18.59 ? 308 ILE D N   1 
ATOM   3029 C CA  . ILE D 1 85 ? 18.866  44.918 -7.218  1.00 20.57 ? 308 ILE D CA  1 
ATOM   3030 C C   . ILE D 1 85 ? 18.162  44.624 -8.561  1.00 22.15 ? 308 ILE D C   1 
ATOM   3031 O O   . ILE D 1 85 ? 17.637  43.523 -8.761  1.00 25.49 ? 308 ILE D O   1 
ATOM   3032 C CB  . ILE D 1 85 ? 20.084  43.954 -6.995  1.00 21.79 ? 308 ILE D CB  1 
ATOM   3033 C CG1 . ILE D 1 85 ? 20.676  44.088 -5.591  1.00 23.42 ? 308 ILE D CG1 1 
ATOM   3034 C CG2 . ILE D 1 85 ? 21.133  44.178 -8.087  1.00 25.70 ? 308 ILE D CG2 1 
ATOM   3035 C CD1 . ILE D 1 85 ? 21.277  45.418 -5.351  1.00 22.63 ? 308 ILE D CD1 1 
ATOM   3036 N N   . ASP D 1 86 ? 18.069  45.621 -9.439  1.00 24.71 ? 309 ASP D N   1 
ATOM   3037 C CA  . ASP D 1 86 ? 17.364  45.496 -10.723 1.00 28.40 ? 309 ASP D CA  1 
ATOM   3038 C C   . ASP D 1 86 ? 18.355  45.308 -11.840 1.00 29.93 ? 309 ASP D C   1 
ATOM   3039 O O   . ASP D 1 86 ? 19.058  46.253 -12.185 1.00 32.59 ? 309 ASP D O   1 
ATOM   3040 C CB  . ASP D 1 86 ? 16.581  46.768 -10.979 1.00 29.87 ? 309 ASP D CB  1 
HETATM 3041 O O   . HOH E 2 .  ? 21.697  43.675 22.927  1.00 13.35 ? 315 HOH A O   1 
HETATM 3042 O O   . HOH E 2 .  ? 29.614  39.873 30.741  1.00 17.67 ? 316 HOH A O   1 
HETATM 3043 O O   . HOH E 2 .  ? 29.180  40.467 38.480  1.00 15.52 ? 317 HOH A O   1 
HETATM 3044 O O   . HOH E 2 .  ? 28.705  43.891 30.266  1.00 18.55 ? 318 HOH A O   1 
HETATM 3045 O O   . HOH E 2 .  ? 20.840  35.644 20.377  1.00 18.38 ? 319 HOH A O   1 
HETATM 3046 O O   . HOH E 2 .  ? 29.125  46.442 31.238  1.00 17.05 ? 320 HOH A O   1 
HETATM 3047 O O   . HOH E 2 .  ? 19.470  32.570 51.705  1.00 20.03 ? 321 HOH A O   1 
HETATM 3048 O O   . HOH E 2 .  ? 27.614  39.522 20.880  1.00 18.29 ? 322 HOH A O   1 
HETATM 3049 O O   . HOH E 2 .  ? 30.684  40.115 42.592  1.00 23.07 ? 323 HOH A O   1 
HETATM 3050 O O   . HOH E 2 .  ? 20.115  34.926 43.028  1.00 19.19 ? 324 HOH A O   1 
HETATM 3051 O O   . HOH E 2 .  ? 30.045  34.026 20.860  1.00 26.45 ? 325 HOH A O   1 
HETATM 3052 O O   . HOH E 2 .  ? 24.915  37.935 15.887  1.00 23.71 ? 326 HOH A O   1 
HETATM 3053 O O   . HOH E 2 .  ? 28.741  37.982 22.764  1.00 18.22 ? 327 HOH A O   1 
HETATM 3054 O O   . HOH E 2 .  ? 16.421  35.138 52.197  1.00 24.76 ? 328 HOH A O   1 
HETATM 3055 O O   . HOH E 2 .  ? 13.711  37.675 32.713  1.00 21.58 ? 329 HOH A O   1 
HETATM 3056 O O   . HOH E 2 .  ? 25.483  46.299 46.489  1.00 21.00 ? 330 HOH A O   1 
HETATM 3057 O O   . HOH E 2 .  ? 30.675  47.766 34.665  1.00 28.84 ? 331 HOH A O   1 
HETATM 3058 O O   . HOH E 2 .  ? 27.469  38.465 15.255  1.00 27.80 ? 332 HOH A O   1 
HETATM 3059 O O   . HOH E 2 .  ? 26.770  33.563 29.222  1.00 22.39 ? 333 HOH A O   1 
HETATM 3060 O O   . HOH E 2 .  ? 22.488  32.087 43.620  1.00 26.07 ? 334 HOH A O   1 
HETATM 3061 O O   . HOH E 2 .  ? 29.654  45.647 45.339  1.00 25.43 ? 335 HOH A O   1 
HETATM 3062 O O   . HOH E 2 .  ? 30.503  51.837 52.210  1.00 42.55 ? 336 HOH A O   1 
HETATM 3063 O O   . HOH E 2 .  ? 21.574  33.246 45.751  1.00 26.57 ? 337 HOH A O   1 
HETATM 3064 O O   . HOH E 2 .  ? 18.912  32.858 41.944  1.00 30.18 ? 338 HOH A O   1 
HETATM 3065 O O   . HOH E 2 .  ? 19.742  35.430 45.627  1.00 21.70 ? 339 HOH A O   1 
HETATM 3066 O O   . HOH E 2 .  ? 31.079  45.915 43.145  1.00 30.56 ? 340 HOH A O   1 
HETATM 3067 O O   . HOH E 2 .  ? 26.858  33.073 17.076  1.00 26.98 ? 341 HOH A O   1 
HETATM 3068 O O   . HOH E 2 .  ? 13.575  41.700 29.150  1.00 29.00 ? 342 HOH A O   1 
HETATM 3069 O O   . HOH E 2 .  ? 29.089  50.748 41.479  1.00 32.72 ? 343 HOH A O   1 
HETATM 3070 O O   . HOH E 2 .  ? 21.769  35.116 17.773  1.00 26.04 ? 344 HOH A O   1 
HETATM 3071 O O   . HOH E 2 .  ? 29.232  33.311 30.418  1.00 26.46 ? 345 HOH A O   1 
HETATM 3072 O O   . HOH E 2 .  ? 25.631  30.152 25.657  1.00 27.14 ? 346 HOH A O   1 
HETATM 3073 O O   . HOH E 2 .  ? 16.260  34.830 55.257  1.00 22.69 ? 347 HOH A O   1 
HETATM 3074 O O   . HOH E 2 .  ? 32.717  41.511 37.022  1.00 25.31 ? 348 HOH A O   1 
HETATM 3075 O O   . HOH E 2 .  ? 10.654  41.616 37.703  1.00 34.37 ? 349 HOH A O   1 
HETATM 3076 O O   . HOH E 2 .  ? 30.156  34.273 38.097  1.00 28.20 ? 350 HOH A O   1 
HETATM 3077 O O   . HOH E 2 .  ? 31.387  37.843 40.527  1.00 27.87 ? 351 HOH A O   1 
HETATM 3078 O O   . HOH E 2 .  ? 33.735  44.152 34.098  1.00 29.18 ? 352 HOH A O   1 
HETATM 3079 O O   . HOH E 2 .  ? 11.601  47.479 44.290  1.00 27.33 ? 353 HOH A O   1 
HETATM 3080 O O   . HOH E 2 .  ? 29.305  34.105 18.139  1.00 26.62 ? 354 HOH A O   1 
HETATM 3081 O O   . HOH E 2 .  ? 22.846  36.222 15.527  1.00 26.68 ? 355 HOH A O   1 
HETATM 3082 O O   . HOH E 2 .  ? 26.882  35.975 58.853  1.00 25.41 ? 356 HOH A O   1 
HETATM 3083 O O   . HOH E 2 .  ? 29.362  38.519 13.409  1.00 22.67 ? 357 HOH A O   1 
HETATM 3084 O O   . HOH E 2 .  ? 26.806  31.041 27.923  1.00 29.39 ? 358 HOH A O   1 
HETATM 3085 O O   . HOH E 2 .  ? 26.924  29.111 34.601  1.00 27.21 ? 359 HOH A O   1 
HETATM 3086 O O   . HOH E 2 .  ? 29.776  30.267 27.596  1.00 30.60 ? 360 HOH A O   1 
HETATM 3087 O O   . HOH E 2 .  ? 16.714  42.062 18.899  1.00 28.10 ? 361 HOH A O   1 
HETATM 3088 O O   . HOH E 2 .  ? 14.009  36.902 30.119  1.00 26.84 ? 362 HOH A O   1 
HETATM 3089 O O   A HOH E 2 .  ? 16.176  42.150 22.350  0.70 22.76 ? 363 HOH A O   1 
HETATM 3090 O O   B HOH E 2 .  ? 16.410  40.448 21.861  0.30 18.03 ? 363 HOH A O   1 
HETATM 3091 O O   . HOH E 2 .  ? 26.867  30.661 37.403  1.00 30.38 ? 364 HOH A O   1 
HETATM 3092 O O   . HOH E 2 .  ? 33.289  40.106 32.491  1.00 31.75 ? 365 HOH A O   1 
HETATM 3093 O O   . HOH E 2 .  ? 24.929  38.122 59.765  1.00 30.90 ? 366 HOH A O   1 
HETATM 3094 O O   . HOH E 2 .  ? 32.557  40.249 39.587  1.00 29.20 ? 367 HOH A O   1 
HETATM 3095 O O   . HOH E 2 .  ? 11.792  35.379 29.361  1.00 32.77 ? 368 HOH A O   1 
HETATM 3096 O O   . HOH E 2 .  ? 13.074  52.665 39.763  1.00 33.94 ? 369 HOH A O   1 
HETATM 3097 O O   . HOH E 2 .  ? 35.109  49.159 37.852  1.00 58.99 ? 370 HOH A O   1 
HETATM 3098 O O   . HOH E 2 .  ? 28.787  46.771 26.571  1.00 34.85 ? 371 HOH A O   1 
HETATM 3099 O O   . HOH E 2 .  ? 16.365  44.356 27.273  1.00 33.46 ? 372 HOH A O   1 
HETATM 3100 O O   . HOH E 2 .  ? 31.802  47.078 31.558  1.00 34.17 ? 373 HOH A O   1 
HETATM 3101 O O   . HOH E 2 .  ? 12.707  35.873 44.393  1.00 29.56 ? 374 HOH A O   1 
HETATM 3102 O O   . HOH E 2 .  ? 30.719  42.243 29.445  1.00 28.35 ? 375 HOH A O   1 
HETATM 3103 O O   . HOH E 2 .  ? 25.389  34.404 15.224  1.00 39.45 ? 376 HOH A O   1 
HETATM 3104 O O   . HOH E 2 .  ? 13.852  33.569 32.615  1.00 28.75 ? 377 HOH A O   1 
HETATM 3105 O O   . HOH E 2 .  ? 24.352  41.484 62.271  1.00 34.77 ? 378 HOH A O   1 
HETATM 3106 O O   . HOH E 2 .  ? 13.459  34.292 48.351  1.00 39.45 ? 379 HOH A O   1 
HETATM 3107 O O   . HOH E 2 .  ? 13.501  35.787 51.163  1.00 53.47 ? 380 HOH A O   1 
HETATM 3108 O O   . HOH E 2 .  ? 15.094  27.801 33.391  1.00 36.66 ? 381 HOH A O   1 
HETATM 3109 O O   . HOH E 2 .  ? 12.992  43.468 34.952  1.00 33.77 ? 382 HOH A O   1 
HETATM 3110 O O   . HOH E 2 .  ? 14.361  47.215 55.190  1.00 38.11 ? 383 HOH A O   1 
HETATM 3111 O O   . HOH E 2 .  ? 25.340  29.700 29.929  1.00 35.66 ? 384 HOH A O   1 
HETATM 3112 O O   . HOH E 2 .  ? 15.218  30.809 43.768  1.00 36.33 ? 385 HOH A O   1 
HETATM 3113 O O   . HOH E 2 .  ? 17.203  26.813 35.165  1.00 39.48 ? 386 HOH A O   1 
HETATM 3114 O O   . HOH E 2 .  ? 29.376  51.932 36.566  1.00 47.38 ? 387 HOH A O   1 
HETATM 3115 O O   . HOH E 2 .  ? 27.377  35.726 15.459  1.00 36.26 ? 388 HOH A O   1 
HETATM 3116 O O   . HOH E 2 .  ? 23.947  47.641 60.523  1.00 45.90 ? 389 HOH A O   1 
HETATM 3117 O O   . HOH E 2 .  ? 34.596  40.847 34.968  1.00 44.21 ? 390 HOH A O   1 
HETATM 3118 O O   . HOH E 2 .  ? 11.798  52.274 41.614  1.00 33.11 ? 391 HOH A O   1 
HETATM 3119 O O   . HOH E 2 .  ? 18.665  29.292 23.453  1.00 37.56 ? 392 HOH A O   1 
HETATM 3120 O O   . HOH E 2 .  ? 22.907  52.481 48.999  1.00 39.62 ? 393 HOH A O   1 
HETATM 3121 O O   . HOH E 2 .  ? 33.445  37.670 31.956  1.00 31.48 ? 394 HOH A O   1 
HETATM 3122 O O   . HOH E 2 .  ? 30.377  36.969 26.260  1.00 30.59 ? 395 HOH A O   1 
HETATM 3123 O O   . HOH E 2 .  ? 30.686  37.128 32.316  1.00 26.66 ? 396 HOH A O   1 
HETATM 3124 O O   . HOH E 2 .  ? 23.384  51.715 42.865  1.00 42.84 ? 397 HOH A O   1 
HETATM 3125 O O   . HOH E 2 .  ? 20.601  50.885 50.719  1.00 41.94 ? 398 HOH A O   1 
HETATM 3126 O O   . HOH E 2 .  ? 14.156  43.153 26.938  1.00 39.40 ? 399 HOH A O   1 
HETATM 3127 O O   . HOH E 2 .  ? 25.774  50.504 55.486  1.00 38.55 ? 400 HOH A O   1 
HETATM 3128 O O   . HOH E 2 .  ? 30.139  45.592 54.644  1.00 36.99 ? 401 HOH A O   1 
HETATM 3129 O O   . HOH E 2 .  ? 27.017  29.735 23.174  1.00 35.53 ? 402 HOH A O   1 
HETATM 3130 O O   . HOH E 2 .  ? 29.506  32.703 33.008  1.00 33.62 ? 403 HOH A O   1 
HETATM 3131 O O   . HOH E 2 .  ? 20.309  27.314 23.871  1.00 41.98 ? 404 HOH A O   1 
HETATM 3132 O O   . HOH E 2 .  ? 16.070  36.706 23.230  1.00 30.93 ? 405 HOH A O   1 
HETATM 3133 O O   . HOH E 2 .  ? 21.897  47.019 61.832  1.00 40.79 ? 406 HOH A O   1 
HETATM 3134 O O   . HOH E 2 .  ? 30.723  44.873 57.096  1.00 41.98 ? 407 HOH A O   1 
HETATM 3135 O O   . HOH E 2 .  ? 11.530  33.923 26.077  1.00 42.22 ? 408 HOH A O   1 
HETATM 3136 O O   . HOH E 2 .  ? 22.344  36.121 49.598  1.00 17.87 ? 409 HOH A O   1 
HETATM 3137 O O   . HOH E 2 .  ? 28.288  30.700 20.926  1.00 38.36 ? 410 HOH A O   1 
HETATM 3138 O O   . HOH F 2 .  ? 9.219   58.791 34.620  1.00 15.42 ? 315 HOH B O   1 
HETATM 3139 O O   . HOH F 2 .  ? 1.720   55.579 50.197  1.00 13.76 ? 316 HOH B O   1 
HETATM 3140 O O   . HOH F 2 .  ? 1.853   53.851 47.932  1.00 15.01 ? 317 HOH B O   1 
HETATM 3141 O O   . HOH F 2 .  ? 9.636   59.419 42.368  1.00 17.60 ? 318 HOH B O   1 
HETATM 3142 O O   . HOH F 2 .  ? -0.538  66.705 21.409  1.00 20.29 ? 319 HOH B O   1 
HETATM 3143 O O   . HOH F 2 .  ? 7.666   59.702 52.264  1.00 18.00 ? 320 HOH B O   1 
HETATM 3144 O O   . HOH F 2 .  ? 0.897   63.614 52.727  1.00 19.05 ? 321 HOH B O   1 
HETATM 3145 O O   . HOH F 2 .  ? 0.150   64.321 30.098  1.00 20.12 ? 322 HOH B O   1 
HETATM 3146 O O   . HOH F 2 .  ? 8.691   55.364 42.874  1.00 17.81 ? 323 HOH B O   1 
HETATM 3147 O O   . HOH F 2 .  ? 10.747  59.078 30.517  1.00 22.04 ? 324 HOH B O   1 
HETATM 3148 O O   . HOH F 2 .  ? 4.910   61.309 57.203  1.00 23.39 ? 325 HOH B O   1 
HETATM 3149 O O   . HOH F 2 .  ? 8.782   61.288 50.349  1.00 17.94 ? 326 HOH B O   1 
HETATM 3150 O O   . HOH F 2 .  ? 5.464   52.904 26.701  1.00 21.79 ? 327 HOH B O   1 
HETATM 3151 O O   . HOH F 2 .  ? -3.508  64.087 20.928  1.00 25.75 ? 328 HOH B O   1 
HETATM 3152 O O   . HOH F 2 .  ? 10.028  65.249 52.273  1.00 24.51 ? 329 HOH B O   1 
HETATM 3153 O O   . HOH F 2 .  ? 6.757   65.727 43.907  1.00 22.38 ? 330 HOH B O   1 
HETATM 3154 O O   . HOH F 2 .  ? 10.229  64.030 38.942  1.00 22.35 ? 331 HOH B O   1 
HETATM 3155 O O   . HOH F 2 .  ? 7.483   60.790 57.829  1.00 28.76 ? 332 HOH B O   1 
HETATM 3156 O O   . HOH F 2 .  ? -6.220  61.564 40.387  1.00 24.61 ? 333 HOH B O   1 
HETATM 3157 O O   . HOH F 2 .  ? -3.731  64.409 17.847  1.00 22.27 ? 334 HOH B O   1 
HETATM 3158 O O   . HOH F 2 .  ? 8.638   55.116 15.298  1.00 43.28 ? 335 HOH B O   1 
HETATM 3159 O O   . HOH F 2 .  ? 10.701  51.531 38.441  1.00 27.77 ? 336 HOH B O   1 
HETATM 3160 O O   . HOH F 2 .  ? 2.418   67.301 29.621  1.00 28.41 ? 337 HOH B O   1 
HETATM 3161 O O   . HOH F 2 .  ? 12.740  57.744 36.131  1.00 24.88 ? 338 HOH B O   1 
HETATM 3162 O O   . HOH F 2 .  ? 11.138  53.380 30.026  1.00 28.94 ? 339 HOH B O   1 
HETATM 3163 O O   . HOH F 2 .  ? 6.958   66.270 56.060  1.00 28.40 ? 340 HOH B O   1 
HETATM 3164 O O   . HOH F 2 .  ? 9.086   48.452 31.732  1.00 32.67 ? 341 HOH B O   1 
HETATM 3165 O O   . HOH F 2 .  ? -0.232  63.820 27.478  1.00 21.59 ? 342 HOH B O   1 
HETATM 3166 O O   . HOH F 2 .  ? -9.447  57.577 35.346  1.00 33.90 ? 343 HOH B O   1 
HETATM 3167 O O   . HOH F 2 .  ? 1.797   64.119 55.325  1.00 24.89 ? 344 HOH B O   1 
HETATM 3168 O O   . HOH F 2 .  ? 9.679   53.557 27.771  1.00 30.07 ? 345 HOH B O   1 
HETATM 3169 O O   . HOH F 2 .  ? -3.290  57.209 54.124  1.00 25.89 ? 346 HOH B O   1 
HETATM 3170 O O   . HOH F 2 .  ? 13.717  55.134 38.953  1.00 29.15 ? 347 HOH B O   1 
HETATM 3171 O O   . HOH F 2 .  ? 10.518  47.505 20.691  1.00 42.12 ? 348 HOH B O   1 
HETATM 3172 O O   . HOH F 2 .  ? 10.164  64.995 35.080  1.00 28.97 ? 349 HOH B O   1 
HETATM 3173 O O   . HOH F 2 .  ? -5.971  62.420 43.002  1.00 26.54 ? 350 HOH B O   1 
HETATM 3174 O O   . HOH F 2 .  ? 11.375  56.082 21.228  1.00 28.27 ? 351 HOH B O   1 
HETATM 3175 O O   . HOH F 2 .  ? 2.878   62.965 57.576  1.00 26.61 ? 352 HOH B O   1 
HETATM 3176 O O   . HOH F 2 .  ? 6.931   70.168 38.554  1.00 27.22 ? 353 HOH B O   1 
HETATM 3177 O O   . HOH F 2 .  ? 6.940   68.157 45.229  1.00 27.99 ? 354 HOH B O   1 
HETATM 3178 O O   . HOH F 2 .  ? -1.129  66.352 31.170  1.00 29.26 ? 355 HOH B O   1 
HETATM 3179 O O   . HOH F 2 .  ? 5.612   69.102 47.436  1.00 26.83 ? 356 HOH B O   1 
HETATM 3180 O O   . HOH F 2 .  ? 11.392  61.411 32.611  1.00 30.93 ? 357 HOH B O   1 
HETATM 3181 O O   . HOH F 2 .  ? -6.487  57.403 43.974  1.00 29.21 ? 358 HOH B O   1 
HETATM 3182 O O   . HOH F 2 .  ? 1.579   66.029 27.398  1.00 27.34 ? 359 HOH B O   1 
HETATM 3183 O O   . HOH F 2 .  ? 9.706   48.967 38.480  1.00 30.96 ? 360 HOH B O   1 
HETATM 3184 O O   . HOH F 2 .  ? 6.867   68.614 35.817  1.00 29.83 ? 361 HOH B O   1 
HETATM 3185 O O   . HOH F 2 .  ? 9.785   69.020 45.558  1.00 30.90 ? 362 HOH B O   1 
HETATM 3186 O O   . HOH F 2 .  ? 9.445   60.550 54.500  1.00 29.41 ? 363 HOH B O   1 
HETATM 3187 O O   . HOH F 2 .  ? 4.982   61.155 13.314  1.00 30.33 ? 364 HOH B O   1 
HETATM 3188 O O   . HOH F 2 .  ? -8.417  51.724 28.882  1.00 30.28 ? 365 HOH B O   1 
HETATM 3189 O O   . HOH F 2 .  ? 9.318   65.945 42.841  1.00 28.29 ? 366 HOH B O   1 
HETATM 3190 O O   . HOH F 2 .  ? -7.278  63.346 28.761  1.00 32.27 ? 367 HOH B O   1 
HETATM 3191 O O   . HOH F 2 .  ? -8.041  64.000 43.770  1.00 31.00 ? 368 HOH B O   1 
HETATM 3192 O O   . HOH F 2 .  ? 9.574   47.598 36.236  1.00 44.58 ? 369 HOH B O   1 
HETATM 3193 O O   . HOH F 2 .  ? 10.384  62.326 46.856  1.00 28.23 ? 370 HOH B O   1 
HETATM 3194 O O   . HOH F 2 .  ? 11.117  68.609 39.667  1.00 45.53 ? 371 HOH B O   1 
HETATM 3195 O O   . HOH F 2 .  ? 10.725  57.138 43.661  1.00 31.08 ? 372 HOH B O   1 
HETATM 3196 O O   . HOH F 2 .  ? 4.424   57.782 10.843  1.00 35.09 ? 373 HOH B O   1 
HETATM 3197 O O   . HOH F 2 .  ? -3.581  54.890 45.738  1.00 34.55 ? 374 HOH B O   1 
HETATM 3198 O O   . HOH F 2 .  ? -3.886  62.428 49.861  1.00 31.23 ? 375 HOH B O   1 
HETATM 3199 O O   . HOH F 2 .  ? 12.590  59.027 33.543  1.00 28.74 ? 376 HOH B O   1 
HETATM 3200 O O   . HOH F 2 .  ? 14.847  49.375 35.145  1.00 43.50 ? 377 HOH B O   1 
HETATM 3201 O O   . HOH F 2 .  ? -7.042  46.573 33.449  1.00 30.95 ? 378 HOH B O   1 
HETATM 3202 O O   . HOH F 2 .  ? -4.946  71.469 39.680  1.00 38.84 ? 379 HOH B O   1 
HETATM 3203 O O   . HOH F 2 .  ? -1.457  52.047 41.495  1.00 32.24 ? 380 HOH B O   1 
HETATM 3204 O O   . HOH F 2 .  ? -6.072  65.516 40.541  1.00 37.83 ? 381 HOH B O   1 
HETATM 3205 O O   . HOH F 2 .  ? -5.613  49.044 28.243  1.00 46.94 ? 382 HOH B O   1 
HETATM 3206 O O   . HOH F 2 .  ? -3.855  57.012 50.781  1.00 27.95 ? 383 HOH B O   1 
HETATM 3207 O O   . HOH F 2 .  ? 13.281  59.190 40.591  1.00 29.98 ? 384 HOH B O   1 
HETATM 3208 O O   . HOH F 2 .  ? -6.966  55.731 38.164  1.00 32.52 ? 385 HOH B O   1 
HETATM 3209 O O   . HOH F 2 .  ? 11.468  65.470 37.251  1.00 33.90 ? 386 HOH B O   1 
HETATM 3210 O O   . HOH F 2 .  ? 2.637   46.954 24.169  1.00 35.05 ? 387 HOH B O   1 
HETATM 3211 O O   . HOH F 2 .  ? 13.335  61.652 41.119  1.00 30.66 ? 388 HOH B O   1 
HETATM 3212 O O   . HOH F 2 .  ? -5.133  49.190 31.718  1.00 36.74 ? 389 HOH B O   1 
HETATM 3213 O O   . HOH F 2 .  ? 5.771   48.798 17.580  1.00 39.97 ? 390 HOH B O   1 
HETATM 3214 O O   . HOH F 2 .  ? -2.891  72.309 37.786  1.00 45.95 ? 391 HOH B O   1 
HETATM 3215 O O   . HOH F 2 .  ? 10.198  53.681 18.477  1.00 37.35 ? 392 HOH B O   1 
HETATM 3216 O O   . HOH F 2 .  ? 10.661  62.215 40.889  1.00 27.15 ? 393 HOH B O   1 
HETATM 3217 O O   . HOH F 2 .  ? 14.584  58.503 37.974  1.00 40.34 ? 394 HOH B O   1 
HETATM 3218 O O   . HOH F 2 .  ? -7.016  68.668 47.601  1.00 42.01 ? 395 HOH B O   1 
HETATM 3219 O O   . HOH F 2 .  ? 8.983   52.518 46.430  1.00 34.53 ? 396 HOH B O   1 
HETATM 3220 O O   . HOH F 2 .  ? -10.315 50.404 34.615  1.00 31.34 ? 397 HOH B O   1 
HETATM 3221 O O   . HOH F 2 .  ? -9.107  56.358 30.526  1.00 37.73 ? 398 HOH B O   1 
HETATM 3222 O O   . HOH F 2 .  ? -10.426 54.572 35.033  1.00 36.00 ? 399 HOH B O   1 
HETATM 3223 O O   . HOH F 2 .  ? 5.261   46.199 16.312  1.00 39.03 ? 400 HOH B O   1 
HETATM 3224 O O   . HOH F 2 .  ? 7.087   69.468 49.989  1.00 32.23 ? 401 HOH B O   1 
HETATM 3225 O O   . HOH F 2 .  ? -1.057  43.149 39.055  1.00 69.11 ? 402 HOH B O   1 
HETATM 3226 O O   . HOH F 2 .  ? -4.707  68.450 29.409  1.00 36.56 ? 403 HOH B O   1 
HETATM 3227 O O   . HOH F 2 .  ? -6.437  57.532 46.856  1.00 41.30 ? 404 HOH B O   1 
HETATM 3228 O O   . HOH F 2 .  ? 0.669   48.505 22.293  1.00 42.08 ? 405 HOH B O   1 
HETATM 3229 O O   . HOH F 2 .  ? -7.022  61.740 48.518  1.00 34.71 ? 406 HOH B O   1 
HETATM 3230 O O   . HOH F 2 .  ? 5.150   48.995 13.982  1.00 54.52 ? 407 HOH B O   1 
HETATM 3231 O O   . HOH F 2 .  ? -5.012  60.022 49.263  1.00 42.47 ? 408 HOH B O   1 
HETATM 3232 O O   . HOH F 2 .  ? -5.009  52.786 38.480  1.00 39.26 ? 409 HOH B O   1 
HETATM 3233 O O   . HOH F 2 .  ? -6.596  65.058 24.986  1.00 46.66 ? 410 HOH B O   1 
HETATM 3234 O O   . HOH F 2 .  ? -6.123  63.803 52.362  1.00 46.79 ? 411 HOH B O   1 
HETATM 3235 O O   . HOH F 2 .  ? -11.073 53.173 32.802  1.00 43.13 ? 412 HOH B O   1 
HETATM 3236 O O   . HOH F 2 .  ? 9.725   52.515 24.961  1.00 39.26 ? 413 HOH B O   1 
HETATM 3237 O O   . HOH F 2 .  ? 2.420   63.156 23.551  1.00 18.32 ? 414 HOH B O   1 
HETATM 3238 O O   . HOH G 2 .  ? 0.343   25.366 22.705  1.00 13.73 ? 315 HOH C O   1 
HETATM 3239 O O   . HOH G 2 .  ? 8.969   37.091 10.894  1.00 15.99 ? 316 HOH C O   1 
HETATM 3240 O O   . HOH G 2 .  ? 9.239   31.150 18.074  1.00 13.95 ? 317 HOH C O   1 
HETATM 3241 O O   . HOH G 2 .  ? 8.640   34.538 9.884   1.00 15.42 ? 318 HOH C O   1 
HETATM 3242 O O   . HOH G 2 .  ? 1.964   22.131 22.772  1.00 17.32 ? 319 HOH C O   1 
HETATM 3243 O O   . HOH G 2 .  ? 9.754   30.483 10.320  1.00 18.59 ? 320 HOH C O   1 
HETATM 3244 O O   . HOH G 2 .  ? 9.164   33.079 -3.607  1.00 17.44 ? 321 HOH C O   1 
HETATM 3245 O O   . HOH G 2 .  ? 1.733   23.935 24.898  1.00 19.85 ? 322 HOH C O   1 
HETATM 3246 O O   . HOH G 2 .  ? -3.713  34.366 6.533   1.00 20.00 ? 323 HOH C O   1 
HETATM 3247 O O   . HOH G 2 .  ? -6.126  27.998 12.262  1.00 19.26 ? 324 HOH C O   1 
HETATM 3248 O O   . HOH G 2 .  ? 10.750  30.874 22.103  1.00 20.72 ? 325 HOH C O   1 
HETATM 3249 O O   . HOH G 2 .  ? 8.058   30.034 0.773   1.00 20.17 ? 326 HOH C O   1 
HETATM 3250 O O   . HOH G 2 .  ? 10.480  38.463 14.218  1.00 23.24 ? 327 HOH C O   1 
HETATM 3251 O O   . HOH G 2 .  ? 9.231   28.169 2.470   1.00 21.13 ? 328 HOH C O   1 
HETATM 3252 O O   . HOH G 2 .  ? 1.348   26.050 -0.057  1.00 22.62 ? 329 HOH C O   1 
HETATM 3253 O O   . HOH G 2 .  ? 11.514  33.658 31.561  1.00 24.73 ? 330 HOH C O   1 
HETATM 3254 O O   . HOH G 2 .  ? 3.114   26.171 29.018  1.00 20.31 ? 331 HOH C O   1 
HETATM 3255 O O   . HOH G 2 .  ? 10.492  25.738 13.974  1.00 26.74 ? 332 HOH C O   1 
HETATM 3256 O O   . HOH G 2 .  ? 5.313   37.084 25.841  1.00 21.24 ? 333 HOH C O   1 
HETATM 3257 O O   . HOH G 2 .  ? 5.328   28.524 -4.389  1.00 23.93 ? 334 HOH C O   1 
HETATM 3258 O O   . HOH G 2 .  ? 7.008   24.234 8.955   1.00 23.42 ? 335 HOH C O   1 
HETATM 3259 O O   . HOH G 2 .  ? -9.004  36.447 21.781  1.00 22.59 ? 336 HOH C O   1 
HETATM 3260 O O   . HOH G 2 .  ? -9.152  31.964 17.004  1.00 26.57 ? 337 HOH C O   1 
HETATM 3261 O O   . HOH G 2 .  ? 9.047   41.337 21.024  1.00 29.05 ? 338 HOH C O   1 
HETATM 3262 O O   . HOH G 2 .  ? 6.953   21.073 16.975  1.00 23.63 ? 339 HOH C O   1 
HETATM 3263 O O   . HOH G 2 .  ? -7.086  26.184 24.052  1.00 22.72 ? 340 HOH C O   1 
HETATM 3264 O O   . HOH G 2 .  ? 10.414  25.105 17.536  1.00 24.34 ? 341 HOH C O   1 
HETATM 3265 O O   . HOH G 2 .  ? 8.023   28.964 -4.997  1.00 29.20 ? 342 HOH C O   1 
HETATM 3266 O O   . HOH G 2 .  ? 8.698   37.470 6.248   1.00 25.73 ? 343 HOH C O   1 
HETATM 3267 O O   . HOH G 2 .  ? -3.074  25.783 32.019  1.00 24.12 ? 344 HOH C O   1 
HETATM 3268 O O   . HOH G 2 .  ? -3.024  38.906 19.599  1.00 24.72 ? 345 HOH C O   1 
HETATM 3269 O O   . HOH G 2 .  ? -8.742  32.147 28.757  1.00 27.66 ? 346 HOH C O   1 
HETATM 3270 O O   . HOH G 2 .  ? -6.495  31.607 8.669   1.00 28.47 ? 347 HOH C O   1 
HETATM 3271 O O   . HOH G 2 .  ? 5.100   28.555 39.195  1.00 30.64 ? 348 HOH C O   1 
HETATM 3272 O O   . HOH G 2 .  ? -8.395  23.320 6.359   1.00 27.71 ? 349 HOH C O   1 
HETATM 3273 O O   . HOH G 2 .  ? -6.993  41.881 14.741  1.00 34.22 ? 350 HOH C O   1 
HETATM 3274 O O   . HOH G 2 .  ? 13.005  30.403 12.199  1.00 32.24 ? 351 HOH C O   1 
HETATM 3275 O O   . HOH G 2 .  ? -7.677  31.515 12.224  1.00 34.28 ? 352 HOH C O   1 
HETATM 3276 O O   . HOH G 2 .  ? 8.873   42.437 16.593  1.00 27.63 ? 353 HOH C O   1 
HETATM 3277 O O   . HOH G 2 .  ? -0.871  23.524 27.223  1.00 34.64 ? 354 HOH C O   1 
HETATM 3278 O O   . HOH G 2 .  ? 9.334   40.927 14.240  1.00 22.50 ? 355 HOH C O   1 
HETATM 3279 O O   . HOH G 2 .  ? 6.915   19.617 14.222  1.00 24.60 ? 356 HOH C O   1 
HETATM 3280 O O   . HOH G 2 .  ? -7.926  36.327 24.448  1.00 25.22 ? 357 HOH C O   1 
HETATM 3281 O O   . HOH G 2 .  ? 10.701  32.949 8.968   1.00 24.59 ? 358 HOH C O   1 
HETATM 3282 O O   . HOH G 2 .  ? 3.672   26.507 -4.974  1.00 29.21 ? 359 HOH C O   1 
HETATM 3283 O O   . HOH G 2 .  ? 9.713   36.075 25.137  1.00 29.97 ? 360 HOH C O   1 
HETATM 3284 O O   . HOH G 2 .  ? -6.546  31.002 29.630  1.00 28.38 ? 361 HOH C O   1 
HETATM 3285 O O   . HOH G 2 .  ? -5.955  27.156 9.801   1.00 23.84 ? 362 HOH C O   1 
HETATM 3286 O O   . HOH G 2 .  ? 5.700   39.712 26.124  1.00 36.51 ? 363 HOH C O   1 
HETATM 3287 O O   . HOH G 2 .  ? 11.095  36.586 22.822  1.00 28.50 ? 364 HOH C O   1 
HETATM 3288 O O   . HOH G 2 .  ? -6.548  24.005 12.506  1.00 33.46 ? 365 HOH C O   1 
HETATM 3289 O O   . HOH G 2 .  ? -5.121  23.615 3.566   1.00 31.26 ? 366 HOH C O   1 
HETATM 3290 O O   . HOH G 2 .  ? 2.430   25.340 -2.616  1.00 31.69 ? 367 HOH C O   1 
HETATM 3291 O O   . HOH G 2 .  ? -10.547 38.743 18.640  1.00 28.85 ? 368 HOH C O   1 
HETATM 3292 O O   . HOH G 2 .  ? 10.020  27.759 9.126   1.00 28.14 ? 369 HOH C O   1 
HETATM 3293 O O   . HOH G 2 .  ? 9.580   22.259 17.117  1.00 32.23 ? 370 HOH C O   1 
HETATM 3294 O O   . HOH G 2 .  ? 12.999  37.483 13.032  1.00 33.13 ? 371 HOH C O   1 
HETATM 3295 O O   . HOH G 2 .  ? 16.317  30.189 38.328  1.00 27.46 ? 372 HOH C O   1 
HETATM 3296 O O   . HOH G 2 .  ? -7.063  33.232 14.450  1.00 29.21 ? 373 HOH C O   1 
HETATM 3297 O O   . HOH G 2 .  ? 11.389  28.388 20.260  1.00 28.64 ? 374 HOH C O   1 
HETATM 3298 O O   . HOH G 2 .  ? 5.817   20.576 9.778   1.00 35.22 ? 375 HOH C O   1 
HETATM 3299 O O   . HOH G 2 .  ? 9.883   29.732 -1.427  1.00 29.58 ? 376 HOH C O   1 
HETATM 3300 O O   . HOH G 2 .  ? 2.768   42.434 22.578  1.00 33.47 ? 377 HOH C O   1 
HETATM 3301 O O   . HOH G 2 .  ? -10.309 36.378 16.842  1.00 30.75 ? 378 HOH C O   1 
HETATM 3302 O O   . HOH G 2 .  ? -8.282  42.185 17.236  1.00 34.09 ? 379 HOH C O   1 
HETATM 3303 O O   . HOH G 2 .  ? -1.997  26.047 -2.576  1.00 36.12 ? 380 HOH C O   1 
HETATM 3304 O O   . HOH G 2 .  ? 0.762   43.362 13.814  1.00 30.57 ? 381 HOH C O   1 
HETATM 3305 O O   . HOH G 2 .  ? -5.056  36.920 13.326  1.00 30.16 ? 382 HOH C O   1 
HETATM 3306 O O   . HOH G 2 .  ? -1.277  19.866 2.963   1.00 37.96 ? 383 HOH C O   1 
HETATM 3307 O O   A HOH G 2 .  ? -8.606  33.671 35.845  0.70 25.46 ? 384 HOH C O   1 
HETATM 3308 O O   B HOH G 2 .  ? -9.728  35.199 34.231  0.30 10.96 ? 384 HOH C O   1 
HETATM 3309 O O   . HOH G 2 .  ? 11.601  25.313 31.701  1.00 38.06 ? 385 HOH C O   1 
HETATM 3310 O O   . HOH G 2 .  ? 12.977  30.730 25.173  1.00 40.78 ? 386 HOH C O   1 
HETATM 3311 O O   . HOH G 2 .  ? -4.677  33.219 3.203   1.00 31.10 ? 387 HOH C O   1 
HETATM 3312 O O   . HOH G 2 .  ? 0.594   46.252 13.431  1.00 39.58 ? 388 HOH C O   1 
HETATM 3313 O O   . HOH G 2 .  ? -10.239 36.135 29.711  1.00 27.74 ? 389 HOH C O   1 
HETATM 3314 O O   . HOH G 2 .  ? 6.609   21.881 7.771   1.00 33.98 ? 390 HOH C O   1 
HETATM 3315 O O   . HOH G 2 .  ? -4.725  37.296 29.952  1.00 31.14 ? 391 HOH C O   1 
HETATM 3316 O O   . HOH G 2 .  ? 5.112   44.348 39.520  1.00 40.94 ? 392 HOH C O   1 
HETATM 3317 O O   . HOH G 2 .  ? -3.130  32.556 -1.189  1.00 32.94 ? 393 HOH C O   1 
HETATM 3318 O O   . HOH G 2 .  ? -6.074  26.863 31.714  1.00 39.90 ? 394 HOH C O   1 
HETATM 3319 O O   . HOH G 2 .  ? -6.869  45.212 18.267  1.00 45.60 ? 395 HOH C O   1 
HETATM 3320 O O   . HOH G 2 .  ? -4.559  26.498 -3.746  1.00 37.43 ? 396 HOH C O   1 
HETATM 3321 O O   . HOH G 2 .  ? 5.979   41.594 24.455  1.00 51.80 ? 397 HOH C O   1 
HETATM 3322 O O   . HOH G 2 .  ? -8.579  38.923 28.894  1.00 31.03 ? 398 HOH C O   1 
HETATM 3323 O O   . HOH G 2 .  ? -5.503  39.981 25.828  1.00 35.53 ? 399 HOH C O   1 
HETATM 3324 O O   . HOH G 2 .  ? -2.057  41.519 27.992  1.00 38.76 ? 400 HOH C O   1 
HETATM 3325 O O   . HOH G 2 .  ? -3.546  27.013 2.540   1.00 32.56 ? 401 HOH C O   1 
HETATM 3326 O O   . HOH G 2 .  ? 12.550  33.590 42.459  1.00 47.91 ? 402 HOH C O   1 
HETATM 3327 O O   . HOH G 2 .  ? -7.449  29.090 8.574   1.00 33.85 ? 403 HOH C O   1 
HETATM 3328 O O   . HOH G 2 .  ? 13.747  34.552 12.966  1.00 34.75 ? 404 HOH C O   1 
HETATM 3329 O O   . HOH G 2 .  ? 6.189   40.607 34.712  1.00 35.57 ? 405 HOH C O   1 
HETATM 3330 O O   . HOH G 2 .  ? -2.191  42.046 14.079  1.00 42.43 ? 406 HOH C O   1 
HETATM 3331 O O   . HOH G 2 .  ? 7.826   43.040 42.065  1.00 42.79 ? 407 HOH C O   1 
HETATM 3332 O O   . HOH G 2 .  ? 4.972   43.252 37.163  1.00 53.28 ? 408 HOH C O   1 
HETATM 3333 O O   . HOH G 2 .  ? -7.095  40.429 23.128  1.00 42.97 ? 409 HOH C O   1 
HETATM 3334 O O   . HOH G 2 .  ? 12.424  22.848 27.039  1.00 91.29 ? 410 HOH C O   1 
HETATM 3335 O O   . HOH G 2 .  ? -5.528  39.351 14.610  1.00 37.33 ? 411 HOH C O   1 
HETATM 3336 O O   . HOH G 2 .  ? -8.508  28.350 23.746  1.00 30.87 ? 412 HOH C O   1 
HETATM 3337 O O   . HOH G 2 .  ? -7.479  28.861 30.749  1.00 42.37 ? 413 HOH C O   1 
HETATM 3338 O O   . HOH G 2 .  ? 6.231   43.797 34.874  1.00 38.96 ? 414 HOH C O   1 
HETATM 3339 O O   . HOH G 2 .  ? -6.058  33.326 6.449   1.00 40.54 ? 415 HOH C O   1 
HETATM 3340 O O   . HOH G 2 .  ? -4.250  29.649 -2.599  1.00 45.90 ? 416 HOH C O   1 
HETATM 3341 O O   . HOH G 2 .  ? -4.490  22.307 19.863  1.00 30.30 ? 417 HOH C O   1 
HETATM 3342 O O   . HOH G 2 .  ? -8.311  38.665 20.418  1.00 29.64 ? 418 HOH C O   1 
HETATM 3343 O O   . HOH H 2 .  ? 21.835  45.404 25.183  1.00 14.48 ? 315 HOH D O   1 
HETATM 3344 O O   . HOH H 2 .  ? 28.949  42.414 16.773  1.00 15.74 ? 316 HOH D O   1 
HETATM 3345 O O   . HOH H 2 .  ? 20.303  54.114 4.958   1.00 14.16 ? 317 HOH D O   1 
HETATM 3346 O O   . HOH H 2 .  ? 29.697  48.970 17.336  1.00 17.13 ? 318 HOH D O   1 
HETATM 3347 O O   . HOH H 2 .  ? 29.184  48.336 9.560   1.00 14.02 ? 319 HOH D O   1 
HETATM 3348 O O   . HOH H 2 .  ? 28.596  44.921 17.762  1.00 15.34 ? 320 HOH D O   1 
HETATM 3349 O O   . HOH H 2 .  ? 21.904  57.359 4.860   1.00 16.93 ? 321 HOH D O   1 
HETATM 3350 O O   . HOH H 2 .  ? 30.467  41.063 13.434  1.00 19.89 ? 322 HOH D O   1 
HETATM 3351 O O   . HOH H 2 .  ? 30.431  53.704 13.679  1.00 21.04 ? 323 HOH D O   1 
HETATM 3352 O O   . HOH H 2 .  ? 21.769  55.561 2.758   1.00 20.02 ? 324 HOH D O   1 
HETATM 3353 O O   . HOH H 2 .  ? 23.094  53.347 -1.362  1.00 19.42 ? 325 HOH D O   1 
HETATM 3354 O O   . HOH H 2 .  ? 13.831  51.473 15.365  1.00 21.12 ? 326 HOH D O   1 
HETATM 3355 O O   . HOH H 2 .  ? 30.756  48.595 5.553   1.00 21.18 ? 327 HOH D O   1 
HETATM 3356 O O   . HOH H 2 .  ? 21.297  53.416 27.700  1.00 22.95 ? 328 HOH D O   1 
HETATM 3357 O O   . HOH H 2 .  ? 28.052  49.435 26.834  1.00 20.85 ? 329 HOH D O   1 
HETATM 3358 O O   . HOH H 2 .  ? 10.787  47.548 10.571  1.00 31.03 ? 330 HOH D O   1 
HETATM 3359 O O   . HOH H 2 .  ? 26.932  55.237 18.689  1.00 23.18 ? 331 HOH D O   1 
HETATM 3360 O O   . HOH H 2 .  ? 25.301  42.408 1.791   1.00 22.90 ? 332 HOH D O   1 
HETATM 3361 O O   . HOH H 2 .  ? 10.960  43.088 5.879   1.00 23.77 ? 333 HOH D O   1 
HETATM 3362 O O   . HOH H 2 .  ? 16.307  45.105 21.091  1.00 20.60 ? 334 HOH D O   1 
HETATM 3363 O O   . HOH H 2 .  ? 27.935  50.535 32.612  1.00 28.99 ? 335 HOH D O   1 
HETATM 3364 O O   . HOH H 2 .  ? 25.274  50.959 32.029  1.00 23.55 ? 336 HOH D O   1 
HETATM 3365 O O   . HOH H 2 .  ? 26.855  58.419 10.776  1.00 25.31 ? 337 HOH D O   1 
HETATM 3366 O O   . HOH H 2 .  ? 31.412  45.814 -3.912  1.00 26.88 ? 338 HOH D O   1 
HETATM 3367 O O   . HOH H 2 .  ? 29.215  51.290 25.150  1.00 20.98 ? 339 HOH D O   1 
HETATM 3368 O O   . HOH H 2 .  ? 13.283  47.805 18.921  1.00 30.89 ? 340 HOH D O   1 
HETATM 3369 O O   . HOH H 2 .  ? 12.841  53.266 3.626   1.00 28.36 ? 341 HOH D O   1 
HETATM 3370 O O   . HOH H 2 .  ? 29.071  38.066 6.708   1.00 28.09 ? 342 HOH D O   1 
HETATM 3371 O O   . HOH H 2 .  ? 30.361  54.398 10.090  1.00 25.25 ? 343 HOH D O   1 
HETATM 3372 O O   . HOH H 2 .  ? 16.896  53.709 -4.345  1.00 24.36 ? 344 HOH D O   1 
HETATM 3373 O O   . HOH H 2 .  ? 14.890  42.517 14.280  1.00 27.68 ? 345 HOH D O   1 
HETATM 3374 O O   . HOH H 2 .  ? 29.862  49.651 28.953  1.00 28.63 ? 346 HOH D O   1 
HETATM 3375 O O   . HOH H 2 .  ? 11.204  47.391 -1.099  1.00 27.97 ? 347 HOH D O   1 
HETATM 3376 O O   . HOH H 2 .  ? 16.456  48.599 26.179  1.00 34.33 ? 348 HOH D O   1 
HETATM 3377 O O   . HOH H 2 .  ? 14.017  52.273 17.852  1.00 23.90 ? 349 HOH D O   1 
HETATM 3378 O O   . HOH H 2 .  ? 16.904  40.628 8.060   1.00 24.92 ? 350 HOH D O   1 
HETATM 3379 O O   . HOH H 2 .  ? 31.399  51.150 7.418   1.00 32.95 ? 351 HOH D O   1 
HETATM 3380 O O   . HOH H 2 .  ? 22.652  37.008 4.994   1.00 33.84 ? 352 HOH D O   1 
HETATM 3381 O O   . HOH H 2 .  ? 18.592  59.549 24.621  1.00 38.14 ? 353 HOH D O   1 
HETATM 3382 O O   . HOH H 2 .  ? 28.858  37.074 11.000  1.00 28.27 ? 354 HOH D O   1 
HETATM 3383 O O   . HOH H 2 .  ? 9.285   45.397 9.529   1.00 24.11 ? 355 HOH D O   1 
HETATM 3384 O O   . HOH H 2 .  ? 29.971  51.953 18.501  1.00 28.04 ? 356 HOH D O   1 
HETATM 3385 O O   . HOH H 2 .  ? 22.436  54.140 30.295  1.00 30.89 ? 357 HOH D O   1 
HETATM 3386 O O   . HOH H 2 .  ? 25.471  39.736 1.401   1.00 32.30 ? 358 HOH D O   1 
HETATM 3387 O O   . HOH H 2 .  ? 23.664  52.978 32.610  1.00 28.21 ? 359 HOH D O   1 
HETATM 3388 O O   . HOH H 2 .  ? 9.708   43.381 -2.120  1.00 26.48 ? 360 HOH D O   1 
HETATM 3389 O O   . HOH H 2 .  ? 13.453  48.465 -1.921  1.00 27.51 ? 361 HOH D O   1 
HETATM 3390 O O   . HOH H 2 .  ? 12.592  50.389 19.157  1.00 31.87 ? 362 HOH D O   1 
HETATM 3391 O O   . HOH H 2 .  ? 29.644  57.173 10.493  1.00 34.89 ? 363 HOH D O   1 
HETATM 3392 O O   . HOH H 2 .  ? 28.688  42.019 21.387  1.00 27.06 ? 364 HOH D O   1 
HETATM 3393 O O   . HOH H 2 .  ? 11.578  37.288 10.374  1.00 32.78 ? 365 HOH D O   1 
HETATM 3394 O O   . HOH H 2 .  ? 33.067  49.143 15.429  1.00 27.67 ? 366 HOH D O   1 
HETATM 3395 O O   . HOH H 2 .  ? 12.019  43.140 3.238   1.00 25.66 ? 367 HOH D O   1 
HETATM 3396 O O   . HOH H 2 .  ? 36.266  49.269 -10.759 1.00 25.78 ? 368 HOH D O   1 
HETATM 3397 O O   . HOH H 2 .  ? 31.066  42.902 4.798   1.00 29.34 ? 369 HOH D O   1 
HETATM 3398 O O   . HOH H 2 .  ? 13.075  55.329 14.997  1.00 33.11 ? 370 HOH D O   1 
HETATM 3399 O O   . HOH H 2 .  ? 29.677  43.321 2.509   1.00 30.54 ? 371 HOH D O   1 
HETATM 3400 O O   . HOH H 2 .  ? 11.326  40.586 -1.243  1.00 32.40 ? 372 HOH D O   1 
HETATM 3401 O O   . HOH H 2 .  ? 14.300  39.885 1.477   1.00 32.95 ? 373 HOH D O   1 
HETATM 3402 O O   . HOH H 2 .  ? 30.618  46.570 18.658  1.00 25.40 ? 374 HOH D O   1 
HETATM 3403 O O   . HOH H 2 .  ? 12.890  46.181 13.174  1.00 29.45 ? 375 HOH D O   1 
HETATM 3404 O O   . HOH H 2 .  ? 30.862  59.233 13.348  1.00 55.49 ? 376 HOH D O   1 
HETATM 3405 O O   . HOH H 2 .  ? 9.671   43.218 10.809  1.00 34.01 ? 377 HOH D O   1 
HETATM 3406 O O   . HOH H 2 .  ? 17.735  37.943 -0.297  1.00 33.53 ? 378 HOH D O   1 
HETATM 3407 O O   . HOH H 2 .  ? 5.286   45.086 12.375  1.00 36.37 ? 379 HOH D O   1 
HETATM 3408 O O   . HOH H 2 .  ? 14.865  55.800 24.040  1.00 32.82 ? 380 HOH D O   1 
HETATM 3409 O O   . HOH H 2 .  ? 16.424  52.381 25.071  1.00 32.64 ? 381 HOH D O   1 
HETATM 3410 O O   . HOH H 2 .  ? 25.068  50.923 -11.577 1.00 30.21 ? 382 HOH D O   1 
HETATM 3411 O O   . HOH H 2 .  ? 14.451  39.486 7.405   1.00 34.62 ? 383 HOH D O   1 
HETATM 3412 O O   . HOH H 2 .  ? 31.083  51.443 0.260   1.00 29.74 ? 384 HOH D O   1 
HETATM 3413 O O   . HOH H 2 .  ? 15.190  42.179 -2.369  1.00 31.23 ? 385 HOH D O   1 
HETATM 3414 O O   . HOH H 2 .  ? 33.959  44.959 14.559  1.00 40.56 ? 386 HOH D O   1 
HETATM 3415 O O   . HOH H 2 .  ? 14.646  57.147 14.584  1.00 40.99 ? 387 HOH D O   1 
HETATM 3416 O O   . HOH H 2 .  ? 13.500  52.809 7.781   1.00 36.36 ? 388 HOH D O   1 
HETATM 3417 O O   . HOH H 2 .  ? 25.677  59.148 17.873  1.00 35.44 ? 389 HOH D O   1 
HETATM 3418 O O   . HOH H 2 .  ? 16.805  46.891 28.763  1.00 33.27 ? 390 HOH D O   1 
HETATM 3419 O O   . HOH H 2 .  ? 20.703  37.841 -2.141  1.00 37.42 ? 391 HOH D O   1 
HETATM 3420 O O   . HOH H 2 .  ? 12.783  39.112 4.561   1.00 40.29 ? 392 HOH D O   1 
HETATM 3421 O O   . HOH H 2 .  ? 11.386  51.109 3.910   1.00 30.51 ? 393 HOH D O   1 
HETATM 3422 O O   . HOH H 2 .  ? 15.338  46.163 24.478  1.00 32.88 ? 394 HOH D O   1 
HETATM 3423 O O   . HOH H 2 .  ? 25.351  55.029 33.368  1.00 43.61 ? 395 HOH D O   1 
HETATM 3424 O O   . HOH H 2 .  ? 7.303   43.786 12.076  1.00 39.15 ? 396 HOH D O   1 
HETATM 3425 O O   . HOH H 2 .  ? 18.564  47.163 31.645  1.00 31.86 ? 397 HOH D O   1 
HETATM 3426 O O   . HOH H 2 .  ? 26.098  37.912 3.139   1.00 47.18 ? 398 HOH D O   1 
HETATM 3427 O O   . HOH H 2 .  ? 26.544  57.687 19.834  1.00 35.31 ? 399 HOH D O   1 
HETATM 3428 O O   . HOH H 2 .  ? 13.943  46.175 21.279  1.00 34.69 ? 400 HOH D O   1 
HETATM 3429 O O   . HOH H 2 .  ? 34.472  48.656 13.212  1.00 37.82 ? 401 HOH D O   1 
HETATM 3430 O O   . HOH H 2 .  ? 16.054  39.245 -1.796  1.00 46.63 ? 402 HOH D O   1 
HETATM 3431 O O   . HOH H 2 .  ? 32.465  53.612 8.785   1.00 42.49 ? 403 HOH D O   1 
HETATM 3432 O O   . HOH H 2 .  ? 12.512  44.759 17.688  1.00 45.26 ? 404 HOH D O   1 
HETATM 3433 O O   . HOH H 2 .  ? 20.929  55.062 -3.255  1.00 28.19 ? 405 HOH D O   1 
HETATM 3434 O O   A HOH H 2 .  ? 25.882  58.729 22.217  0.70 25.86 ? 406 HOH D O   1 
HETATM 3435 O O   B HOH H 2 .  ? 24.954  59.984 22.669  0.30 21.84 ? 406 HOH D O   1 
HETATM 3436 O O   . HOH H 2 .  ? 12.378  47.985 15.560  1.00 36.71 ? 407 HOH D O   1 
HETATM 3437 O O   . HOH H 2 .  ? 31.540  54.260 -3.954  1.00 34.88 ? 408 HOH D O   1 
HETATM 3438 O O   . HOH H 2 .  ? 12.676  55.596 25.099  1.00 41.51 ? 409 HOH D O   1 
HETATM 3439 O O   . HOH H 2 .  ? 15.139  50.101 24.415  1.00 47.73 ? 410 HOH D O   1 
HETATM 3440 O O   . HOH H 2 .  ? 25.260  55.807 35.956  1.00 45.08 ? 411 HOH D O   1 
HETATM 3441 O O   . HOH H 2 .  ? 8.634   55.988 12.721  1.00 37.34 ? 412 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 2  ? 0.3340 0.3641 0.3336 -0.0217 0.0179  -0.0090 225 SER A N   
2    C CA  . SER A 2  ? 0.3197 0.3418 0.3166 -0.0185 0.0074  -0.0072 225 SER A CA  
3    C C   . SER A 2  ? 0.2814 0.3092 0.2684 -0.0343 -0.0048 -0.0192 225 SER A C   
4    O O   . SER A 2  ? 0.2698 0.2908 0.2498 -0.0343 -0.0162 -0.0234 225 SER A O   
5    C CB  . SER A 2  ? 0.3540 0.3689 0.3530 -0.0117 0.0116  0.0024  225 SER A CB  
6    O OG  . SER A 2  ? 0.4309 0.4410 0.4372 -0.0140 0.0298  0.0049  225 SER A OG  
7    N N   A LYS A 3  ? 0.2615 0.2919 0.2577 -0.0233 -0.0113 -0.0185 226 LYS A N   
8    N N   B LYS A 3  ? 0.2660 0.2923 0.2579 -0.0213 -0.0107 -0.0196 226 LYS A N   
9    C CA  A LYS A 3  ? 0.2519 0.2713 0.2576 -0.0269 -0.0169 -0.0127 226 LYS A CA  
10   C CA  B LYS A 3  ? 0.2678 0.2778 0.2496 -0.0214 -0.0166 -0.0156 226 LYS A CA  
11   C C   A LYS A 3  ? 0.2421 0.2608 0.2339 -0.0262 -0.0183 -0.0073 226 LYS A C   
12   C C   B LYS A 3  ? 0.2437 0.2674 0.2323 -0.0234 -0.0162 -0.0064 226 LYS A C   
13   O O   A LYS A 3  ? 0.2477 0.2355 0.2401 -0.0453 -0.0294 -0.0235 226 LYS A O   
14   O O   B LYS A 3  ? 0.2351 0.2579 0.2477 -0.0431 -0.0171 -0.0094 226 LYS A O   
15   C CB  A LYS A 3  ? 0.2459 0.2742 0.2438 -0.0223 -0.0131 -0.0060 226 LYS A CB  
16   C CB  B LYS A 3  ? 0.2610 0.2813 0.2577 -0.0174 -0.0139 -0.0180 226 LYS A CB  
17   C CG  A LYS A 3  ? 0.2315 0.2762 0.2752 -0.0222 -0.0044 0.0077  226 LYS A CG  
18   C CG  B LYS A 3  ? 0.2673 0.2932 0.2909 -0.0176 -0.0166 -0.0123 226 LYS A CG  
19   C CD  A LYS A 3  ? 0.2305 0.2955 0.2842 -0.0334 -0.0115 -0.0078 226 LYS A CD  
20   C CD  B LYS A 3  ? 0.2861 0.3121 0.3322 0.0002  -0.0095 -0.0007 226 LYS A CD  
21   C CE  A LYS A 3  ? 0.2295 0.3056 0.2658 -0.0252 -0.0127 -0.0116 226 LYS A CE  
22   C CE  B LYS A 3  ? 0.2850 0.3106 0.3551 -0.0247 0.0000  -0.0003 226 LYS A CE  
23   N NZ  A LYS A 3  ? 0.2256 0.3250 0.2759 -0.0358 -0.0399 -0.0078 226 LYS A NZ  
24   N NZ  B LYS A 3  ? 0.2950 0.3457 0.3782 -0.0263 -0.0055 0.0014  226 LYS A NZ  
25   N N   . LEU A 4  ? 0.2382 0.2532 0.2308 -0.0241 -0.0206 -0.0142 227 LEU A N   
26   C CA  . LEU A 4  ? 0.1967 0.2304 0.2225 -0.0356 -0.0222 -0.0179 227 LEU A CA  
27   C C   . LEU A 4  ? 0.1775 0.2387 0.2094 -0.0228 -0.0205 -0.0125 227 LEU A C   
28   O O   . LEU A 4  ? 0.1869 0.2714 0.2598 -0.0313 -0.0435 0.0081  227 LEU A O   
29   C CB  . LEU A 4  ? 0.2145 0.2306 0.2540 -0.0230 -0.0238 -0.0053 227 LEU A CB  
30   C CG  . LEU A 4  ? 0.1660 0.2312 0.2354 -0.0406 0.0125  -0.0183 227 LEU A CG  
31   C CD1 . LEU A 4  ? 0.1971 0.2280 0.2733 -0.0430 0.0333  0.0267  227 LEU A CD1 
32   C CD2 . LEU A 4  ? 0.2001 0.2922 0.3282 0.0067  0.0300  0.0134  227 LEU A CD2 
33   N N   . GLN A 5  ? 0.1922 0.2404 0.1964 -0.0383 -0.0254 -0.0127 228 GLN A N   
34   C CA  . GLN A 5  ? 0.1977 0.2714 0.2029 -0.0553 -0.0232 -0.0161 228 GLN A CA  
35   C C   . GLN A 5  ? 0.1814 0.2499 0.2176 -0.0469 -0.0268 -0.0070 228 GLN A C   
36   O O   . GLN A 5  ? 0.2053 0.2538 0.2088 -0.0355 -0.0065 -0.0008 228 GLN A O   
37   C CB  . GLN A 5  ? 0.2253 0.2826 0.2385 -0.0507 -0.0112 -0.0172 228 GLN A CB  
38   C CG  . GLN A 5  ? 0.2480 0.3177 0.2517 -0.0398 -0.0046 -0.0126 228 GLN A CG  
39   C CD  . GLN A 5  ? 0.2782 0.2952 0.3107 -0.0343 -0.0302 0.0082  228 GLN A CD  
40   O OE1 . GLN A 5  ? 0.2526 0.3797 0.3147 -0.0690 -0.0246 0.0158  228 GLN A OE1 
41   N NE2 . GLN A 5  ? 0.2336 0.3688 0.3132 -0.0293 0.0005  0.0185  228 GLN A NE2 
42   N N   . ILE A 6  ? 0.1700 0.2722 0.2009 -0.0531 -0.0065 0.0066  229 ILE A N   
43   C CA  . ILE A 6  ? 0.1764 0.2230 0.2194 -0.0648 -0.0194 0.0132  229 ILE A CA  
44   C C   . ILE A 6  ? 0.1667 0.2283 0.2355 -0.0885 -0.0197 0.0033  229 ILE A C   
45   O O   . ILE A 6  ? 0.2083 0.2988 0.2838 -0.0606 -0.0129 0.0074  229 ILE A O   
46   C CB  . ILE A 6  ? 0.1594 0.2646 0.2139 -0.0495 -0.0092 0.0102  229 ILE A CB  
47   C CG1 . ILE A 6  ? 0.1619 0.2632 0.2296 -0.0459 -0.0093 0.0092  229 ILE A CG1 
48   C CG2 . ILE A 6  ? 0.1636 0.2766 0.2273 -0.0762 -0.0070 0.0294  229 ILE A CG2 
49   C CD1 . ILE A 6  ? 0.1456 0.2652 0.1894 -0.0003 0.0020  0.0143  229 ILE A CD1 
50   N N   A CYS A 7  ? 0.2199 0.2094 0.2175 -0.0736 -0.0049 0.0137  230 CYS A N   
51   N N   B CYS A 7  ? 0.2292 0.2213 0.2314 -0.0651 -0.0019 0.0113  230 CYS A N   
52   C CA  A CYS A 7  ? 0.2564 0.2154 0.2255 -0.0672 -0.0064 0.0068  230 CYS A CA  
53   C CA  B CYS A 7  ? 0.2655 0.2348 0.2459 -0.0531 -0.0015 0.0055  230 CYS A CA  
54   C C   A CYS A 7  ? 0.2655 0.2288 0.2305 -0.0558 -0.0035 0.0081  230 CYS A C   
55   C C   B CYS A 7  ? 0.2729 0.2241 0.2390 -0.0473 0.0039  0.0043  230 CYS A C   
56   O O   A CYS A 7  ? 0.2219 0.1979 0.2303 -0.0980 -0.0190 0.0066  230 CYS A O   
57   O O   B CYS A 7  ? 0.2198 0.1650 0.2179 -0.0759 0.0017  0.0010  230 CYS A O   
58   C CB  A CYS A 7  ? 0.2803 0.2265 0.2215 -0.0491 -0.0009 0.0110  230 CYS A CB  
59   C CB  B CYS A 7  ? 0.3072 0.2521 0.2565 -0.0377 0.0008  0.0068  230 CYS A CB  
60   S SG  A CYS A 7  ? 0.4019 0.1828 0.2178 -0.0955 0.0030  -0.0018 230 CYS A SG  
61   S SG  B CYS A 7  ? 0.3924 0.3712 0.3615 -0.0304 0.0189  0.0011  230 CYS A SG  
62   N N   . VAL A 8  ? 0.2565 0.2260 0.2066 -0.0710 -0.0119 0.0096  231 VAL A N   
63   C CA  . VAL A 8  ? 0.2532 0.2228 0.2020 -0.0679 -0.0046 0.0143  231 VAL A CA  
64   C C   . VAL A 8  ? 0.2192 0.2334 0.1853 -0.0509 -0.0109 0.0035  231 VAL A C   
65   O O   . VAL A 8  ? 0.1920 0.2256 0.2014 -0.0520 0.0030  0.0192  231 VAL A O   
66   C CB  . VAL A 8  ? 0.2872 0.2155 0.2003 -0.0447 -0.0110 0.0217  231 VAL A CB  
67   C CG1 . VAL A 8  ? 0.3109 0.2612 0.1967 -0.0514 -0.0194 0.0084  231 VAL A CG1 
68   C CG2 . VAL A 8  ? 0.3259 0.2068 0.2362 -0.0620 -0.0024 0.0107  231 VAL A CG2 
69   N N   . GLU A 9  ? 0.1910 0.2644 0.2181 -0.0920 0.0025  0.0066  232 GLU A N   
70   C CA  . GLU A 9  ? 0.2014 0.3037 0.2177 -0.0457 0.0087  0.0049  232 GLU A CA  
71   C C   . GLU A 9  ? 0.2091 0.2851 0.2121 -0.0650 0.0107  0.0023  232 GLU A C   
72   O O   . GLU A 9  ? 0.2768 0.2994 0.2389 -0.0736 0.0055  0.0208  232 GLU A O   
73   C CB  . GLU A 9  ? 0.1928 0.3225 0.2563 -0.0568 -0.0021 0.0021  232 GLU A CB  
74   C CG  . GLU A 9  ? 0.1993 0.3370 0.2358 -0.0566 0.0138  0.0069  232 GLU A CG  
75   C CD  . GLU A 9  ? 0.1831 0.3334 0.2478 -0.0446 -0.0137 -0.0005 232 GLU A CD  
76   O OE1 . GLU A 9  ? 0.2514 0.3760 0.2966 -0.0577 -0.0042 0.0265  232 GLU A OE1 
77   O OE2 . GLU A 9  ? 0.2576 0.3671 0.2547 -0.0465 -0.0287 0.0109  232 GLU A OE2 
78   N N   . PRO A 10 ? 0.1952 0.2917 0.2069 -0.0587 0.0138  0.0097  233 PRO A N   
79   C CA  . PRO A 10 ? 0.1925 0.2994 0.2223 -0.0561 0.0139  -0.0050 233 PRO A CA  
80   C C   . PRO A 10 ? 0.1844 0.3178 0.2289 -0.0572 0.0085  0.0036  233 PRO A C   
81   O O   . PRO A 10 ? 0.1721 0.3552 0.2317 -0.0497 0.0202  -0.0123 233 PRO A O   
82   C CB  . PRO A 10 ? 0.1747 0.2945 0.2129 -0.0654 0.0200  0.0063  233 PRO A CB  
83   C CG  . PRO A 10 ? 0.1916 0.2944 0.2238 -0.0196 0.0156  -0.0131 233 PRO A CG  
84   C CD  . PRO A 10 ? 0.1733 0.2830 0.2200 -0.0534 0.0250  0.0031  233 PRO A CD  
85   N N   . THR A 11 ? 0.2196 0.3182 0.2345 -0.0617 0.0241  0.0090  234 THR A N   
86   C CA  . THR A 11 ? 0.2563 0.3183 0.2423 -0.0453 0.0405  -0.0021 234 THR A CA  
87   C C   . THR A 11 ? 0.1768 0.3067 0.2419 -0.0670 0.0521  0.0017  234 THR A C   
88   O O   . THR A 11 ? 0.2274 0.3011 0.2800 -0.0463 0.0258  -0.0144 234 THR A O   
89   C CB  . THR A 11 ? 0.2839 0.3003 0.2693 -0.0465 0.0417  -0.0003 234 THR A CB  
90   O OG1 . THR A 11 ? 0.3631 0.3355 0.3415 -0.0187 0.0546  -0.0419 234 THR A OG1 
91   C CG2 . THR A 11 ? 0.3405 0.3938 0.3217 -0.0215 0.0335  0.0149  234 THR A CG2 
92   N N   . SER A 12 ? 0.1880 0.3472 0.2560 -0.0390 0.0366  -0.0090 235 SER A N   
93   C CA  . SER A 12 ? 0.1640 0.3235 0.2423 -0.0347 0.0331  0.0031  235 SER A CA  
94   C C   . SER A 12 ? 0.2140 0.2877 0.2274 -0.0235 0.0234  0.0027  235 SER A C   
95   O O   . SER A 12 ? 0.2378 0.3200 0.2444 -0.0314 0.0035  0.0040  235 SER A O   
96   C CB  . SER A 12 ? 0.1798 0.3475 0.2600 -0.0135 0.0162  0.0124  235 SER A CB  
97   O OG  . SER A 12 ? 0.2130 0.4344 0.3267 -0.0100 0.0175  0.0274  235 SER A OG  
98   N N   . GLN A 13 ? 0.1834 0.2881 0.2215 -0.0260 0.0165  0.0092  236 GLN A N   
99   C CA  . GLN A 13 ? 0.2048 0.2620 0.2265 0.0091  0.0229  0.0089  236 GLN A CA  
100  C C   . GLN A 13 ? 0.2090 0.2633 0.2497 -0.0094 0.0233  0.0011  236 GLN A C   
101  O O   . GLN A 13 ? 0.2222 0.2809 0.2229 0.0058  0.0221  0.0022  236 GLN A O   
102  C CB  . GLN A 13 ? 0.1934 0.2377 0.2544 -0.0180 0.0269  -0.0051 236 GLN A CB  
103  C CG  . GLN A 13 ? 0.2350 0.2416 0.2481 -0.0023 0.0171  -0.0064 236 GLN A CG  
104  C CD  . GLN A 13 ? 0.2737 0.2298 0.2567 -0.0060 0.0160  -0.0228 236 GLN A CD  
105  O OE1 . GLN A 13 ? 0.3198 0.2053 0.2642 -0.0206 0.0478  -0.0278 236 GLN A OE1 
106  N NE2 . GLN A 13 ? 0.2860 0.2277 0.2801 0.0046  -0.0082 -0.0402 236 GLN A NE2 
107  N N   . LYS A 14 ? 0.1967 0.2688 0.2245 -0.0013 0.0356  -0.0009 237 LYS A N   
108  C CA  . LYS A 14 ? 0.1958 0.2897 0.2456 0.0028  0.0412  -0.0035 237 LYS A CA  
109  C C   . LYS A 14 ? 0.1866 0.2451 0.2163 -0.0016 0.0366  -0.0054 237 LYS A C   
110  O O   . LYS A 14 ? 0.2029 0.2376 0.2564 -0.0390 0.0174  -0.0089 237 LYS A O   
111  C CB  . LYS A 14 ? 0.1922 0.3278 0.2577 -0.0026 0.0470  0.0058  237 LYS A CB  
112  C CG  . LYS A 14 ? 0.3076 0.3786 0.3283 0.0089  0.0465  -0.0077 237 LYS A CG  
113  C CD  . LYS A 14 ? 0.2987 0.3852 0.3321 0.0030  0.0476  -0.0072 237 LYS A CD  
114  N N   . LEU A 15 ? 0.1782 0.2429 0.2105 -0.0144 0.0336  0.0070  238 LEU A N   
115  C CA  . LEU A 15 ? 0.1886 0.2011 0.2025 -0.0069 0.0240  -0.0119 238 LEU A CA  
116  C C   . LEU A 15 ? 0.2312 0.2176 0.2246 0.0151  0.0273  -0.0165 238 LEU A C   
117  O O   . LEU A 15 ? 0.3043 0.2409 0.2550 0.0489  0.0123  -0.0294 238 LEU A O   
118  C CB  . LEU A 15 ? 0.2041 0.2084 0.1937 -0.0114 0.0389  -0.0018 238 LEU A CB  
119  C CG  . LEU A 15 ? 0.2120 0.1685 0.2118 0.0087  0.0437  -0.0086 238 LEU A CG  
120  C CD1 . LEU A 15 ? 0.1961 0.2109 0.1986 -0.0174 0.0318  -0.0079 238 LEU A CD1 
121  C CD2 . LEU A 15 ? 0.2031 0.1626 0.2308 0.0109  0.0231  -0.0174 238 LEU A CD2 
122  N N   A MET A 16 ? 0.2356 0.2043 0.2140 -0.0028 0.0106  -0.0307 239 MET A N   
123  N N   B MET A 16 ? 0.2524 0.2254 0.2357 0.0021  0.0066  -0.0253 239 MET A N   
124  C CA  A MET A 16 ? 0.2560 0.2317 0.2318 -0.0011 0.0135  -0.0383 239 MET A CA  
125  C CA  B MET A 16 ? 0.2799 0.2626 0.2643 0.0038  0.0065  -0.0337 239 MET A CA  
126  C C   A MET A 16 ? 0.2424 0.2019 0.2205 -0.0017 0.0106  -0.0399 239 MET A C   
127  C C   B MET A 16 ? 0.2601 0.2217 0.2376 0.0031  0.0078  -0.0393 239 MET A C   
128  O O   A MET A 16 ? 0.2089 0.1721 0.2058 -0.0013 0.0199  -0.0434 239 MET A O   
129  O O   B MET A 16 ? 0.2330 0.1951 0.2158 0.0149  0.0130  -0.0447 239 MET A O   
130  C CB  A MET A 16 ? 0.2472 0.2315 0.2364 -0.0023 0.0238  -0.0243 239 MET A CB  
131  C CB  B MET A 16 ? 0.3095 0.2851 0.2883 0.0066  0.0013  -0.0190 239 MET A CB  
132  C CG  A MET A 16 ? 0.2756 0.2510 0.2717 0.0000  0.0236  -0.0203 239 MET A CG  
133  C CG  B MET A 16 ? 0.3430 0.3018 0.3270 0.0113  -0.0033 -0.0208 239 MET A CG  
134  S SD  A MET A 16 ? 0.3747 0.3247 0.3296 0.0003  0.0149  -0.0098 239 MET A SD  
135  S SD  B MET A 16 ? 0.3870 0.3743 0.3530 0.0005  0.0072  0.0069  239 MET A SD  
136  C CE  A MET A 16 ? 0.3364 0.3040 0.3224 0.0031  -0.0123 0.0058  239 MET A CE  
137  C CE  B MET A 16 ? 0.3946 0.3652 0.3569 0.0017  -0.0049 -0.0066 239 MET A CE  
138  N N   . PRO A 17 ? 0.2570 0.2085 0.2536 0.0022  0.0102  -0.0485 240 PRO A N   
139  C CA  . PRO A 17 ? 0.2519 0.1877 0.2537 -0.0095 0.0060  -0.0461 240 PRO A CA  
140  C C   . PRO A 17 ? 0.2391 0.1831 0.2399 -0.0258 -0.0034 -0.0465 240 PRO A C   
141  O O   . PRO A 17 ? 0.2795 0.2135 0.2462 -0.0199 -0.0253 -0.0367 240 PRO A O   
142  C CB  . PRO A 17 ? 0.2894 0.2273 0.2800 -0.0056 -0.0056 -0.0599 240 PRO A CB  
143  C CG  . PRO A 17 ? 0.2921 0.2380 0.3070 -0.0187 0.0001  -0.0559 240 PRO A CG  
144  C CD  . PRO A 17 ? 0.2834 0.2321 0.2801 0.0044  0.0102  -0.0631 240 PRO A CD  
145  N N   . GLY A 18 ? 0.2259 0.1925 0.2517 -0.0251 -0.0118 -0.0509 241 GLY A N   
146  C CA  . GLY A 18 ? 0.2125 0.1968 0.2489 -0.0336 -0.0155 -0.0318 241 GLY A CA  
147  C C   . GLY A 18 ? 0.1966 0.1899 0.2442 -0.0199 -0.0161 -0.0315 241 GLY A C   
148  O O   . GLY A 18 ? 0.2220 0.2032 0.2970 -0.0130 -0.0169 -0.0394 241 GLY A O   
149  N N   A SER A 19 ? 0.1781 0.1625 0.2097 -0.0168 -0.0024 -0.0265 242 SER A N   
150  N N   B SER A 19 ? 0.1759 0.1630 0.2062 -0.0190 -0.0025 -0.0267 242 SER A N   
151  C CA  A SER A 19 ? 0.1766 0.1593 0.2013 -0.0174 -0.0113 -0.0234 242 SER A CA  
152  C CA  B SER A 19 ? 0.1697 0.1601 0.1914 -0.0183 -0.0131 -0.0234 242 SER A CA  
153  C C   A SER A 19 ? 0.1714 0.1530 0.2039 -0.0186 -0.0095 -0.0016 242 SER A C   
154  C C   B SER A 19 ? 0.1680 0.1469 0.2032 -0.0263 -0.0060 -0.0035 242 SER A C   
155  O O   A SER A 19 ? 0.1465 0.1434 0.2211 -0.0149 -0.0109 -0.0049 242 SER A O   
156  O O   B SER A 19 ? 0.1681 0.1512 0.2265 -0.0287 0.0008  -0.0025 242 SER A O   
157  C CB  A SER A 19 ? 0.1867 0.1475 0.2177 -0.0127 -0.0023 -0.0116 242 SER A CB  
158  C CB  B SER A 19 ? 0.1892 0.1572 0.2116 -0.0206 -0.0035 -0.0160 242 SER A CB  
159  O OG  A SER A 19 ? 0.2211 0.1754 0.2236 -0.0311 0.0282  -0.0089 242 SER A OG  
160  O OG  B SER A 19 ? 0.1803 0.1761 0.2075 -0.0063 0.0062  -0.0006 242 SER A OG  
161  N N   . THR A 20 ? 0.1891 0.1527 0.1958 -0.0239 -0.0108 -0.0061 243 THR A N   
162  C CA  . THR A 20 ? 0.1911 0.1550 0.1923 -0.0311 -0.0070 -0.0035 243 THR A CA  
163  C C   . THR A 20 ? 0.1740 0.1535 0.1908 -0.0243 -0.0121 0.0102  243 THR A C   
164  O O   . THR A 20 ? 0.1675 0.1640 0.1939 -0.0393 -0.0002 0.0081  243 THR A O   
165  C CB  . THR A 20 ? 0.2209 0.1696 0.1817 0.0000  -0.0261 -0.0091 243 THR A CB  
166  O OG1 . THR A 20 ? 0.2586 0.1972 0.2495 0.0295  -0.0474 -0.0134 243 THR A OG1 
167  C CG2 . THR A 20 ? 0.2104 0.2166 0.2181 0.0115  0.0186  -0.0099 243 THR A CG2 
168  N N   . LEU A 21 ? 0.1663 0.1458 0.1891 -0.0503 -0.0211 0.0100  244 LEU A N   
169  C CA  . LEU A 21 ? 0.1606 0.1757 0.2021 -0.0360 -0.0069 0.0193  244 LEU A CA  
170  C C   . LEU A 21 ? 0.1664 0.1438 0.2108 -0.0362 -0.0149 0.0039  244 LEU A C   
171  O O   . LEU A 21 ? 0.1660 0.1663 0.1990 -0.0206 -0.0218 -0.0155 244 LEU A O   
172  C CB  . LEU A 21 ? 0.1773 0.1575 0.2088 -0.0242 -0.0066 0.0047  244 LEU A CB  
173  C CG  . LEU A 21 ? 0.1566 0.1971 0.2603 -0.0290 0.0003  0.0321  244 LEU A CG  
174  C CD1 . LEU A 21 ? 0.1873 0.2190 0.2407 -0.0167 -0.0212 0.0142  244 LEU A CD1 
175  C CD2 . LEU A 21 ? 0.2039 0.2099 0.2661 -0.0199 -0.0041 0.0175  244 LEU A CD2 
176  N N   A VAL A 22 ? 0.2166 0.1670 0.2008 -0.0240 -0.0194 0.0105  245 VAL A N   
177  N N   B VAL A 22 ? 0.2103 0.1777 0.1994 -0.0324 -0.0194 0.0092  245 VAL A N   
178  C CA  A VAL A 22 ? 0.2252 0.1472 0.2231 -0.0015 -0.0288 -0.0015 245 VAL A CA  
179  C CA  B VAL A 22 ? 0.2122 0.1781 0.2179 -0.0195 -0.0246 -0.0018 245 VAL A CA  
180  C C   A VAL A 22 ? 0.2091 0.1596 0.2028 -0.0162 -0.0215 -0.0098 245 VAL A C   
181  C C   B VAL A 22 ? 0.1945 0.1822 0.1986 -0.0345 -0.0218 -0.0134 245 VAL A C   
182  O O   A VAL A 22 ? 0.2102 0.1287 0.1975 -0.0266 -0.0135 -0.0074 245 VAL A O   
183  O O   B VAL A 22 ? 0.2011 0.1665 0.1870 -0.0557 -0.0261 -0.0105 245 VAL A O   
184  C CB  A VAL A 22 ? 0.2401 0.1671 0.2396 0.0000  -0.0234 0.0128  245 VAL A CB  
185  C CB  B VAL A 22 ? 0.2160 0.1882 0.2369 -0.0197 -0.0149 0.0038  245 VAL A CB  
186  C CG1 A VAL A 22 ? 0.2586 0.1696 0.2675 -0.0023 -0.0157 0.0024  245 VAL A CG1 
187  C CG1 B VAL A 22 ? 0.2486 0.2325 0.2929 -0.0413 -0.0136 0.0147  245 VAL A CG1 
188  C CG2 A VAL A 22 ? 0.2629 0.1593 0.2558 0.0155  -0.0550 -0.0061 245 VAL A CG2 
189  C CG2 B VAL A 22 ? 0.2354 0.1966 0.2631 -0.0061 -0.0004 0.0112  245 VAL A CG2 
190  N N   . LEU A 23 ? 0.1842 0.1678 0.1746 -0.0182 -0.0207 -0.0054 246 LEU A N   
191  C CA  . LEU A 23 ? 0.1580 0.1836 0.1942 -0.0123 -0.0065 -0.0005 246 LEU A CA  
192  C C   . LEU A 23 ? 0.1627 0.1826 0.1869 -0.0198 -0.0164 0.0156  246 LEU A C   
193  O O   . LEU A 23 ? 0.1634 0.2020 0.1964 -0.0362 -0.0126 -0.0089 246 LEU A O   
194  C CB  . LEU A 23 ? 0.1829 0.2028 0.2027 -0.0025 -0.0068 -0.0038 246 LEU A CB  
195  C CG  . LEU A 23 ? 0.1552 0.2156 0.2262 0.0203  -0.0216 -0.0080 246 LEU A CG  
196  C CD1 . LEU A 23 ? 0.2104 0.2212 0.2978 -0.0064 0.0012  -0.0178 246 LEU A CD1 
197  C CD2 . LEU A 23 ? 0.1363 0.2559 0.3223 0.0012  0.0235  -0.0101 246 LEU A CD2 
198  N N   . GLN A 24 ? 0.1647 0.1649 0.1912 -0.0406 -0.0137 0.0118  247 GLN A N   
199  C CA  . GLN A 24 ? 0.1654 0.1711 0.1680 -0.0047 -0.0202 0.0085  247 GLN A CA  
200  C C   . GLN A 24 ? 0.1576 0.1592 0.1788 -0.0494 -0.0149 0.0045  247 GLN A C   
201  O O   . GLN A 24 ? 0.1748 0.1980 0.1793 -0.0463 -0.0205 0.0182  247 GLN A O   
202  C CB  . GLN A 24 ? 0.1873 0.1688 0.1914 -0.0098 -0.0177 0.0112  247 GLN A CB  
203  C CG  . GLN A 24 ? 0.2424 0.1748 0.2031 0.0038  -0.0121 0.0101  247 GLN A CG  
204  C CD  . GLN A 24 ? 0.2012 0.2105 0.1898 0.0072  -0.0120 -0.0018 247 GLN A CD  
205  O OE1 . GLN A 24 ? 0.3041 0.2443 0.2764 -0.0299 0.0282  0.0149  247 GLN A OE1 
206  N NE2 . GLN A 24 ? 0.2481 0.1838 0.1917 0.0324  0.0031  -0.0052 247 GLN A NE2 
207  N N   . CYS A 25 ? 0.1618 0.1657 0.1599 -0.0380 -0.0201 0.0066  248 CYS A N   
208  C CA  . CYS A 25 ? 0.1487 0.1623 0.1750 -0.0364 -0.0195 0.0067  248 CYS A CA  
209  C C   . CYS A 25 ? 0.1598 0.1558 0.1783 -0.0371 -0.0261 0.0092  248 CYS A C   
210  O O   . CYS A 25 ? 0.1742 0.1680 0.1903 -0.0456 -0.0187 0.0025  248 CYS A O   
211  C CB  . CYS A 25 ? 0.1875 0.1865 0.1647 -0.0121 -0.0335 0.0286  248 CYS A CB  
212  S SG  . CYS A 25 ? 0.1773 0.2181 0.1783 -0.0270 -0.0255 0.0227  248 CYS A SG  
213  N N   . VAL A 26 ? 0.1983 0.1672 0.1740 -0.0350 -0.0158 0.0067  249 VAL A N   
214  C CA  . VAL A 26 ? 0.2114 0.1606 0.1956 -0.0389 -0.0103 -0.0079 249 VAL A CA  
215  C C   . VAL A 26 ? 0.2010 0.1690 0.1943 -0.0544 0.0032  -0.0021 249 VAL A C   
216  O O   . VAL A 26 ? 0.1861 0.2252 0.1945 -0.0601 -0.0015 0.0062  249 VAL A O   
217  C CB  . VAL A 26 ? 0.2443 0.1675 0.2268 -0.0272 -0.0213 0.0078  249 VAL A CB  
218  C CG1 . VAL A 26 ? 0.2838 0.1837 0.2581 -0.0076 -0.0340 -0.0243 249 VAL A CG1 
219  C CG2 . VAL A 26 ? 0.2700 0.1995 0.2408 -0.0174 -0.0353 0.0175  249 VAL A CG2 
220  N N   . ALA A 27 ? 0.2073 0.1676 0.2007 -0.0332 -0.0053 0.0074  250 ALA A N   
221  C CA  . ALA A 27 ? 0.2103 0.1899 0.1931 -0.0054 0.0097  0.0019  250 ALA A CA  
222  C C   . ALA A 27 ? 0.2098 0.1807 0.1909 -0.0229 0.0088  -0.0032 250 ALA A C   
223  O O   . ALA A 27 ? 0.2103 0.2046 0.2194 0.0134  0.0039  -0.0075 250 ALA A O   
224  C CB  . ALA A 27 ? 0.1993 0.1787 0.2169 -0.0331 0.0118  0.0144  250 ALA A CB  
225  N N   . VAL A 28 ? 0.2542 0.2088 0.1925 -0.0114 -0.0018 -0.0061 251 VAL A N   
226  C CA  . VAL A 28 ? 0.2693 0.2085 0.2211 -0.0019 0.0012  -0.0057 251 VAL A CA  
227  C C   . VAL A 28 ? 0.2410 0.2159 0.1975 0.0000  0.0159  -0.0041 251 VAL A C   
228  O O   . VAL A 28 ? 0.2106 0.2288 0.2138 -0.0202 -0.0004 0.0052  251 VAL A O   
229  C CB  . VAL A 28 ? 0.3035 0.2345 0.2451 -0.0113 0.0084  -0.0066 251 VAL A CB  
230  C CG1 . VAL A 28 ? 0.3802 0.2965 0.2909 0.0049  0.0014  0.0149  251 VAL A CG1 
231  C CG2 . VAL A 28 ? 0.3245 0.2476 0.2812 -0.0339 -0.0004 0.0017  251 VAL A CG2 
232  N N   . GLY A 29 ? 0.2621 0.2499 0.2223 0.0117  0.0051  0.0109  252 GLY A N   
233  C CA  . GLY A 29 ? 0.2404 0.2504 0.2151 -0.0019 0.0017  0.0091  252 GLY A CA  
234  C C   . GLY A 29 ? 0.2298 0.2061 0.2133 0.0052  -0.0144 -0.0086 252 GLY A C   
235  O O   . GLY A 29 ? 0.2592 0.1923 0.2093 0.0154  -0.0269 -0.0105 252 GLY A O   
236  N N   . SER A 30 ? 0.2091 0.2147 0.2031 -0.0049 -0.0103 -0.0045 253 SER A N   
237  C CA  . SER A 30 ? 0.2215 0.2073 0.2306 -0.0237 -0.0106 -0.0231 253 SER A CA  
238  C C   . SER A 30 ? 0.1782 0.2419 0.2150 -0.0144 -0.0134 -0.0044 253 SER A C   
239  O O   . SER A 30 ? 0.2285 0.2608 0.2245 -0.0266 -0.0374 -0.0031 253 SER A O   
240  C CB  . SER A 30 ? 0.2233 0.2247 0.2521 -0.0100 0.0320  -0.0167 253 SER A CB  
241  O OG  . SER A 30 ? 0.2910 0.2846 0.2832 -0.0098 0.0478  -0.0334 253 SER A OG  
242  N N   . PRO A 31 ? 0.2268 0.2220 0.1889 0.0040  -0.0159 -0.0070 254 PRO A N   
243  C CA  . PRO A 31 ? 0.2130 0.2221 0.1855 -0.0084 -0.0033 -0.0135 254 PRO A CA  
244  C C   . PRO A 31 ? 0.1685 0.1982 0.1719 0.0192  -0.0027 -0.0297 254 PRO A C   
245  O O   . PRO A 31 ? 0.1523 0.1999 0.1712 0.0124  -0.0015 -0.0170 254 PRO A O   
246  C CB  . PRO A 31 ? 0.2411 0.2340 0.2006 -0.0057 -0.0035 0.0055  254 PRO A CB  
247  C CG  . PRO A 31 ? 0.2444 0.2332 0.2090 -0.0086 -0.0009 -0.0018 254 PRO A CG  
248  C CD  . PRO A 31 ? 0.2446 0.2232 0.2001 -0.0038 -0.0137 0.0054  254 PRO A CD  
249  N N   . ILE A 32 ? 0.1616 0.2254 0.1807 0.0052  0.0019  -0.0186 255 ILE A N   
250  C CA  . ILE A 32 ? 0.1622 0.2130 0.1888 0.0184  -0.0026 -0.0226 255 ILE A CA  
251  C C   . ILE A 32 ? 0.1443 0.1838 0.1898 -0.0098 -0.0069 -0.0135 255 ILE A C   
252  O O   . ILE A 32 ? 0.1964 0.2042 0.2021 -0.0337 0.0145  -0.0256 255 ILE A O   
253  C CB  . ILE A 32 ? 0.1669 0.2371 0.1867 0.0446  0.0121  -0.0255 255 ILE A CB  
254  C CG1 . ILE A 32 ? 0.1777 0.2842 0.2623 0.0728  -0.0007 -0.0134 255 ILE A CG1 
255  C CG2 . ILE A 32 ? 0.1838 0.2965 0.1972 0.0317  0.0000  -0.0190 255 ILE A CG2 
256  C CD1 . ILE A 32 ? 0.1785 0.3075 0.2854 0.0548  0.0436  -0.0304 255 ILE A CD1 
257  N N   . PRO A 33 ? 0.1511 0.1711 0.1943 0.0046  0.0026  -0.0074 256 PRO A N   
258  C CA  . PRO A 33 ? 0.1414 0.1931 0.1798 -0.0026 0.0021  -0.0332 256 PRO A CA  
259  C C   . PRO A 33 ? 0.1172 0.1774 0.1695 0.0041  0.0115  -0.0172 256 PRO A C   
260  O O   . PRO A 33 ? 0.1612 0.1971 0.1987 0.0377  -0.0255 -0.0172 256 PRO A O   
261  C CB  . PRO A 33 ? 0.1557 0.2040 0.2307 -0.0193 0.0252  -0.0306 256 PRO A CB  
262  C CG  . PRO A 33 ? 0.2210 0.2507 0.2496 0.0070  0.0454  -0.0435 256 PRO A CG  
263  C CD  . PRO A 33 ? 0.1737 0.2198 0.2242 -0.0192 0.0297  -0.0106 256 PRO A CD  
264  N N   . HIS A 34 ? 0.1288 0.1603 0.1699 -0.0015 -0.0015 -0.0248 257 HIS A N   
265  C CA  . HIS A 34 ? 0.1236 0.1872 0.1755 -0.0244 0.0151  -0.0141 257 HIS A CA  
266  C C   . HIS A 34 ? 0.1037 0.1566 0.1717 -0.0113 0.0116  -0.0054 257 HIS A C   
267  O O   . HIS A 34 ? 0.1285 0.1756 0.1634 -0.0036 0.0019  -0.0098 257 HIS A O   
268  C CB  . HIS A 34 ? 0.1928 0.2180 0.1822 -0.0428 0.0429  -0.0283 257 HIS A CB  
269  C CG  . HIS A 34 ? 0.2305 0.2889 0.2405 -0.0450 0.0553  -0.0227 257 HIS A CG  
270  N ND1 . HIS A 34 ? 0.2847 0.3692 0.2784 -0.0148 0.0402  -0.0158 257 HIS A ND1 
271  C CD2 . HIS A 34 ? 0.1762 0.3394 0.2726 0.0077  0.0609  -0.0409 257 HIS A CD2 
272  C CE1 . HIS A 34 ? 0.2505 0.3877 0.2853 -0.0059 0.0331  -0.0282 257 HIS A CE1 
273  N NE2 . HIS A 34 ? 0.2787 0.4444 0.3178 -0.0247 0.0442  -0.0217 257 HIS A NE2 
274  N N   . TYR A 35 ? 0.1238 0.1763 0.1659 -0.0160 0.0113  -0.0212 258 TYR A N   
275  C CA  . TYR A 35 ? 0.1062 0.1604 0.1683 -0.0167 0.0096  -0.0095 258 TYR A CA  
276  C C   . TYR A 35 ? 0.1299 0.1680 0.1810 -0.0198 0.0032  -0.0152 258 TYR A C   
277  O O   . TYR A 35 ? 0.1292 0.1826 0.1900 -0.0357 0.0077  -0.0272 258 TYR A O   
278  C CB  . TYR A 35 ? 0.1110 0.1631 0.1924 -0.0253 -0.0084 0.0097  258 TYR A CB  
279  C CG  . TYR A 35 ? 0.1340 0.1475 0.1684 0.0122  -0.0047 -0.0093 258 TYR A CG  
280  C CD1 . TYR A 35 ? 0.1269 0.1700 0.1752 -0.0153 -0.0061 0.0020  258 TYR A CD1 
281  C CD2 . TYR A 35 ? 0.1249 0.1739 0.1885 -0.0082 -0.0117 0.0137  258 TYR A CD2 
282  C CE1 . TYR A 35 ? 0.1570 0.1539 0.1826 -0.0013 0.0015  -0.0095 258 TYR A CE1 
283  C CE2 . TYR A 35 ? 0.1780 0.1588 0.2095 -0.0015 0.0118  0.0087  258 TYR A CE2 
284  C CZ  . TYR A 35 ? 0.1283 0.1530 0.1927 -0.0262 -0.0069 0.0035  258 TYR A CZ  
285  O OH  . TYR A 35 ? 0.1867 0.1631 0.2112 -0.0174 0.0085  -0.0124 258 TYR A OH  
286  N N   . GLN A 36 ? 0.1256 0.1515 0.1722 -0.0132 0.0154  -0.0170 259 GLN A N   
287  C CA  . GLN A 36 ? 0.1292 0.1507 0.1634 -0.0252 0.0252  -0.0134 259 GLN A CA  
288  C C   . GLN A 36 ? 0.1320 0.1529 0.1797 -0.0036 0.0012  -0.0143 259 GLN A C   
289  O O   . GLN A 36 ? 0.1306 0.1621 0.1678 -0.0117 0.0097  -0.0105 259 GLN A O   
290  C CB  . GLN A 36 ? 0.1627 0.1665 0.1955 -0.0274 0.0155  0.0015  259 GLN A CB  
291  C CG  . GLN A 36 ? 0.1941 0.1685 0.2015 -0.0196 0.0387  -0.0036 259 GLN A CG  
292  C CD  . GLN A 36 ? 0.1522 0.1583 0.2311 -0.0427 0.0245  -0.0236 259 GLN A CD  
293  O OE1 . GLN A 36 ? 0.1994 0.2236 0.2546 -0.0541 0.0403  -0.0325 259 GLN A OE1 
294  N NE2 . GLN A 36 ? 0.2328 0.1793 0.2214 -0.0392 0.0262  -0.0039 259 GLN A NE2 
295  N N   . TRP A 37 ? 0.1195 0.1475 0.1607 -0.0098 0.0170  -0.0223 260 TRP A N   
296  C CA  . TRP A 37 ? 0.1301 0.1554 0.1755 0.0034  0.0166  -0.0054 260 TRP A CA  
297  C C   . TRP A 37 ? 0.1762 0.1696 0.1698 0.0023  0.0215  -0.0109 260 TRP A C   
298  O O   . TRP A 37 ? 0.1965 0.1594 0.1901 -0.0047 0.0366  -0.0127 260 TRP A O   
299  C CB  . TRP A 37 ? 0.1358 0.1759 0.1827 -0.0131 0.0134  0.0019  260 TRP A CB  
300  C CG  . TRP A 37 ? 0.1195 0.1631 0.1632 -0.0089 0.0036  -0.0092 260 TRP A CG  
301  C CD1 . TRP A 37 ? 0.1248 0.1724 0.1629 -0.0197 -0.0066 -0.0044 260 TRP A CD1 
302  C CD2 . TRP A 37 ? 0.1258 0.1663 0.1708 -0.0032 -0.0116 -0.0044 260 TRP A CD2 
303  N NE1 . TRP A 37 ? 0.1133 0.1789 0.1684 -0.0025 -0.0159 -0.0063 260 TRP A NE1 
304  C CE2 . TRP A 37 ? 0.0976 0.1737 0.1564 -0.0114 0.0085  0.0103  260 TRP A CE2 
305  C CE3 . TRP A 37 ? 0.1385 0.1780 0.1576 -0.0272 0.0133  0.0116  260 TRP A CE3 
306  C CZ2 . TRP A 37 ? 0.1301 0.1930 0.1766 -0.0225 -0.0166 0.0200  260 TRP A CZ2 
307  C CZ3 . TRP A 37 ? 0.1385 0.2034 0.1681 -0.0089 0.0090  -0.0052 260 TRP A CZ3 
308  C CH2 . TRP A 37 ? 0.1453 0.1759 0.1756 -0.0275 -0.0028 0.0014  260 TRP A CH2 
309  N N   . PHE A 38 ? 0.1838 0.1812 0.1770 0.0289  0.0238  -0.0041 261 PHE A N   
310  C CA  . PHE A 38 ? 0.2007 0.1946 0.1805 0.0276  0.0256  -0.0153 261 PHE A CA  
311  C C   . PHE A 38 ? 0.2166 0.1973 0.1875 0.0427  0.0263  -0.0047 261 PHE A C   
312  O O   . PHE A 38 ? 0.2089 0.2183 0.1799 0.0241  0.0395  -0.0121 261 PHE A O   
313  C CB  . PHE A 38 ? 0.2265 0.2119 0.1836 0.0377  0.0071  -0.0025 261 PHE A CB  
314  C CG  . PHE A 38 ? 0.2224 0.2027 0.1948 0.0151  0.0008  -0.0096 261 PHE A CG  
315  C CD1 . PHE A 38 ? 0.2886 0.1898 0.2103 0.0297  0.0049  -0.0049 261 PHE A CD1 
316  C CD2 . PHE A 38 ? 0.1923 0.1650 0.2229 0.0163  0.0129  -0.0274 261 PHE A CD2 
317  C CE1 . PHE A 38 ? 0.3060 0.1977 0.2244 0.0266  -0.0009 -0.0051 261 PHE A CE1 
318  C CE2 . PHE A 38 ? 0.2320 0.2029 0.2163 0.0002  -0.0019 0.0103  261 PHE A CE2 
319  C CZ  . PHE A 38 ? 0.2508 0.2000 0.2081 -0.0090 0.0192  0.0089  261 PHE A CZ  
320  N N   A LYS A 39 ? 0.2411 0.2300 0.2192 0.0365  0.0193  -0.0132 262 LYS A N   
321  N N   B LYS A 39 ? 0.2313 0.2160 0.2021 0.0404  0.0214  -0.0158 262 LYS A N   
322  C CA  A LYS A 39 ? 0.2640 0.2442 0.2352 0.0522  0.0250  -0.0081 262 LYS A CA  
323  C CA  B LYS A 39 ? 0.2503 0.2224 0.2077 0.0536  0.0238  -0.0118 262 LYS A CA  
324  C C   A LYS A 39 ? 0.2794 0.2589 0.2447 0.0501  0.0300  -0.0050 262 LYS A C   
325  C C   B LYS A 39 ? 0.2682 0.2373 0.2321 0.0544  0.0333  -0.0084 262 LYS A C   
326  O O   A LYS A 39 ? 0.3174 0.2405 0.2455 0.0578  0.0181  -0.0026 262 LYS A O   
327  O O   B LYS A 39 ? 0.2927 0.1987 0.2187 0.0798  0.0302  -0.0084 262 LYS A O   
328  C CB  A LYS A 39 ? 0.2666 0.2354 0.2338 0.0390  0.0153  -0.0063 262 LYS A CB  
329  C CB  B LYS A 39 ? 0.2500 0.2013 0.1899 0.0429  0.0210  -0.0101 262 LYS A CB  
330  C CG  A LYS A 39 ? 0.2711 0.2693 0.2597 0.0330  0.0095  -0.0121 262 LYS A CG  
331  C CG  B LYS A 39 ? 0.2502 0.2057 0.2200 0.0356  0.0241  -0.0131 262 LYS A CG  
332  C CD  A LYS A 39 ? 0.3319 0.3152 0.2745 0.0121  -0.0132 -0.0037 262 LYS A CD  
333  C CD  B LYS A 39 ? 0.2771 0.2527 0.2087 0.0297  0.0147  -0.0137 262 LYS A CD  
334  C CE  A LYS A 39 ? 0.3512 0.3332 0.3055 0.0022  -0.0061 -0.0029 262 LYS A CE  
335  C CE  B LYS A 39 ? 0.2840 0.2616 0.2157 0.0016  -0.0033 -0.0096 262 LYS A CE  
336  N NZ  A LYS A 39 ? 0.3525 0.3352 0.3295 0.0130  0.0026  0.0113  262 LYS A NZ  
337  N NZ  B LYS A 39 ? 0.3229 0.3253 0.2822 0.0103  0.0064  -0.0195 262 LYS A NZ  
338  N N   . ASN A 40 ? 0.2907 0.2816 0.2801 0.0700  0.0265  0.0053  263 ASN A N   
339  C CA  . ASN A 40 ? 0.3184 0.2761 0.2932 0.0626  0.0293  0.0034  263 ASN A CA  
340  C C   . ASN A 40 ? 0.3392 0.2841 0.3062 0.0531  0.0247  0.0115  263 ASN A C   
341  O O   . ASN A 40 ? 0.3444 0.3047 0.3129 0.0652  0.0597  0.0123  263 ASN A O   
342  C CB  . ASN A 40 ? 0.3331 0.2897 0.3233 0.0559  0.0288  -0.0050 263 ASN A CB  
343  C CG  . ASN A 40 ? 0.3496 0.2979 0.3271 0.0404  0.0366  -0.0153 263 ASN A CG  
344  O OD1 . ASN A 40 ? 0.3293 0.3588 0.3398 0.0654  0.0519  -0.0045 263 ASN A OD1 
345  N ND2 . ASN A 40 ? 0.4192 0.3853 0.3910 0.0232  0.0224  -0.0252 263 ASN A ND2 
346  N N   . GLU A 41 ? 0.3446 0.3206 0.3003 0.0516  0.0277  0.0221  264 GLU A N   
347  C CA  . GLU A 41 ? 0.3584 0.3024 0.3100 0.0406  0.0244  0.0196  264 GLU A CA  
348  C C   . GLU A 41 ? 0.3653 0.3084 0.3003 0.0333  0.0242  0.0136  264 GLU A C   
349  O O   . GLU A 41 ? 0.3948 0.3418 0.3120 0.0271  0.0247  0.0542  264 GLU A O   
350  C CB  . GLU A 41 ? 0.3659 0.3358 0.3304 0.0310  0.0219  0.0163  264 GLU A CB  
351  C CG  . GLU A 41 ? 0.3631 0.3763 0.3705 0.0282  0.0190  0.0196  264 GLU A CG  
352  C CD  . GLU A 41 ? 0.4042 0.3660 0.4073 0.0353  0.0249  0.0007  264 GLU A CD  
353  O OE1 . GLU A 41 ? 0.4600 0.4695 0.4236 0.0343  0.0251  -0.0138 264 GLU A OE1 
354  O OE2 . GLU A 41 ? 0.4248 0.4229 0.4699 0.0191  0.0167  0.0006  264 GLU A OE2 
355  N N   . LEU A 42 ? 0.3358 0.2079 0.2731 0.0559  0.0390  -0.0224 265 LEU A N   
356  C CA  . LEU A 42 ? 0.3525 0.2077 0.2485 0.0225  0.0392  -0.0157 265 LEU A CA  
357  C C   . LEU A 42 ? 0.3099 0.2009 0.2452 0.0252  0.0375  -0.0077 265 LEU A C   
358  O O   . LEU A 42 ? 0.3302 0.1559 0.2226 0.0410  0.0505  -0.0081 265 LEU A O   
359  C CB  . LEU A 42 ? 0.3650 0.2058 0.2939 0.0153  0.0369  -0.0316 265 LEU A CB  
360  C CG  . LEU A 42 ? 0.4192 0.2518 0.3244 0.0178  0.0347  -0.0497 265 LEU A CG  
361  C CD1 . LEU A 42 ? 0.4564 0.2738 0.3544 0.0083  0.0170  -0.0422 265 LEU A CD1 
362  C CD2 . LEU A 42 ? 0.4472 0.3210 0.3888 0.0165  0.0087  0.0009  265 LEU A CD2 
363  N N   . PRO A 43 ? 0.3260 0.1957 0.2293 0.0097  0.0219  -0.0020 266 PRO A N   
364  C CA  . PRO A 43 ? 0.3076 0.2091 0.2308 -0.0049 0.0117  -0.0110 266 PRO A CA  
365  C C   . PRO A 43 ? 0.2946 0.1911 0.2459 -0.0195 0.0014  -0.0204 266 PRO A C   
366  O O   . PRO A 43 ? 0.3612 0.1580 0.2832 -0.0492 -0.0171 -0.0387 266 PRO A O   
367  C CB  . PRO A 43 ? 0.3269 0.2340 0.2340 -0.0047 0.0162  0.0089  266 PRO A CB  
368  C CG  . PRO A 43 ? 0.3345 0.2438 0.2669 -0.0069 0.0378  0.0009  266 PRO A CG  
369  C CD  . PRO A 43 ? 0.3114 0.2169 0.2419 0.0068  0.0264  0.0165  266 PRO A CD  
370  N N   . LEU A 44 ? 0.2814 0.1723 0.2153 -0.0247 0.0177  -0.0242 267 LEU A N   
371  C CA  . LEU A 44 ? 0.2597 0.1883 0.2405 -0.0266 0.0108  -0.0253 267 LEU A CA  
372  C C   . LEU A 44 ? 0.2659 0.2138 0.2682 -0.0549 0.0079  -0.0255 267 LEU A C   
373  O O   . LEU A 44 ? 0.2517 0.2181 0.2493 -0.0415 0.0271  -0.0080 267 LEU A O   
374  C CB  . LEU A 44 ? 0.2435 0.2052 0.2250 -0.0249 0.0218  -0.0342 267 LEU A CB  
375  C CG  . LEU A 44 ? 0.2296 0.2032 0.2215 0.0018  0.0183  -0.0485 267 LEU A CG  
376  C CD1 . LEU A 44 ? 0.2552 0.2083 0.2290 -0.0007 0.0267  -0.0068 267 LEU A CD1 
377  C CD2 . LEU A 44 ? 0.2791 0.2638 0.2436 -0.0437 0.0025  -0.0596 267 LEU A CD2 
378  N N   A THR A 45 ? 0.2572 0.2323 0.2882 -0.0609 0.0083  -0.0276 268 THR A N   
379  N N   B THR A 45 ? 0.2753 0.2518 0.2978 -0.0501 0.0101  -0.0235 268 THR A N   
380  C CA  A THR A 45 ? 0.2524 0.2584 0.3130 -0.0698 0.0041  -0.0202 268 THR A CA  
381  C CA  B THR A 45 ? 0.2931 0.2967 0.3338 -0.0437 0.0117  -0.0119 268 THR A CA  
382  C C   A THR A 45 ? 0.2543 0.2578 0.3196 -0.0752 0.0143  -0.0045 268 THR A C   
383  C C   B THR A 45 ? 0.2936 0.2906 0.3395 -0.0515 0.0212  -0.0003 268 THR A C   
384  O O   A THR A 45 ? 0.3416 0.3877 0.3564 0.0391  -0.0098 -0.0165 268 THR A O   
385  O O   B THR A 45 ? 0.3280 0.3468 0.3748 -0.0260 -0.0011 -0.0086 268 THR A O   
386  C CB  A THR A 45 ? 0.2802 0.2774 0.3235 -0.0623 -0.0018 -0.0189 268 THR A CB  
387  C CB  B THR A 45 ? 0.3037 0.3118 0.3421 -0.0432 0.0011  -0.0121 268 THR A CB  
388  O OG1 A THR A 45 ? 0.3327 0.2985 0.3552 -0.0583 -0.0036 -0.0084 268 THR A OG1 
389  O OG1 B THR A 45 ? 0.3344 0.3338 0.3551 -0.0376 0.0001  -0.0122 268 THR A OG1 
390  C CG2 A THR A 45 ? 0.2695 0.2387 0.2850 -0.0640 -0.0056 -0.0247 268 THR A CG2 
391  C CG2 B THR A 45 ? 0.3238 0.3348 0.3562 -0.0229 0.0100  -0.0045 268 THR A CG2 
392  N N   . HIS A 46 ? 0.2421 0.2863 0.3535 -0.0776 0.0200  -0.0157 269 HIS A N   
393  C CA  . HIS A 46 ? 0.2019 0.2733 0.3602 -0.0830 0.0268  0.0042  269 HIS A CA  
394  C C   . HIS A 46 ? 0.1698 0.2576 0.3376 -0.0626 0.0192  -0.0027 269 HIS A C   
395  O O   . HIS A 46 ? 0.3818 0.3627 0.4454 -0.0161 0.0133  0.0234  269 HIS A O   
396  C CB  . HIS A 46 ? 0.2292 0.3101 0.3879 -0.0688 0.0216  -0.0034 269 HIS A CB  
397  N N   . GLU A 47 ? 0.2371 0.2906 0.2587 0.0119  -0.0050 -0.0104 270 GLU A N   
398  C CA  . GLU A 47 ? 0.1813 0.2157 0.2244 -0.0039 0.0001  -0.0228 270 GLU A CA  
399  C C   . GLU A 47 ? 0.0897 0.1994 0.1950 -0.0426 0.0059  -0.0114 270 GLU A C   
400  O O   . GLU A 47 ? 0.1308 0.2112 0.2180 -0.0192 0.0054  -0.0130 270 GLU A O   
401  C CB  . GLU A 47 ? 0.1360 0.2011 0.2018 -0.0395 0.0014  -0.0197 270 GLU A CB  
402  C CG  . GLU A 47 ? 0.1424 0.2335 0.2312 -0.0286 -0.0144 -0.0319 270 GLU A CG  
403  C CD  . GLU A 47 ? 0.1955 0.2250 0.2011 -0.0376 -0.0137 -0.0310 270 GLU A CD  
404  O OE1 . GLU A 47 ? 0.1576 0.2326 0.2335 -0.0102 -0.0060 -0.0109 270 GLU A OE1 
405  O OE2 . GLU A 47 ? 0.2300 0.3289 0.2405 -0.0298 -0.0513 -0.0403 270 GLU A OE2 
406  N N   . THR A 48 ? 0.1222 0.2054 0.2159 -0.0414 0.0059  -0.0190 271 THR A N   
407  C CA  . THR A 48 ? 0.1307 0.2262 0.2146 -0.0253 0.0135  -0.0247 271 THR A CA  
408  C C   . THR A 48 ? 0.1028 0.2065 0.2119 -0.0272 0.0141  -0.0190 271 THR A C   
409  O O   . THR A 48 ? 0.1486 0.2343 0.2143 -0.0165 0.0238  -0.0284 271 THR A O   
410  C CB  . THR A 48 ? 0.1751 0.2411 0.2344 -0.0305 0.0080  -0.0003 271 THR A CB  
411  O OG1 . THR A 48 ? 0.1289 0.2980 0.2422 -0.0521 0.0249  -0.0114 271 THR A OG1 
412  C CG2 . THR A 48 ? 0.2229 0.2327 0.2333 -0.0593 0.0088  -0.0112 271 THR A CG2 
413  N N   A LYS A 49 ? 0.1168 0.2060 0.2257 0.0030  0.0106  -0.0278 272 LYS A N   
414  N N   B LYS A 49 ? 0.1463 0.2110 0.2176 -0.0061 0.0061  -0.0221 272 LYS A N   
415  C CA  A LYS A 49 ? 0.1451 0.2040 0.2122 -0.0002 0.0198  -0.0170 272 LYS A CA  
416  C CA  B LYS A 49 ? 0.1673 0.2069 0.2226 -0.0058 0.0083  -0.0129 272 LYS A CA  
417  C C   A LYS A 49 ? 0.1202 0.1826 0.2125 0.0080  0.0117  -0.0148 272 LYS A C   
418  C C   B LYS A 49 ? 0.1543 0.1882 0.2105 -0.0028 0.0077  -0.0101 272 LYS A C   
419  O O   A LYS A 49 ? 0.1027 0.1773 0.2144 0.0171  0.0029  -0.0070 272 LYS A O   
420  O O   B LYS A 49 ? 0.1598 0.1876 0.2210 -0.0004 -0.0018 -0.0062 272 LYS A O   
421  C CB  A LYS A 49 ? 0.1363 0.2346 0.2402 0.0016  0.0113  -0.0199 272 LYS A CB  
422  C CB  B LYS A 49 ? 0.1816 0.2186 0.2157 0.0035  0.0098  -0.0136 272 LYS A CB  
423  C CG  A LYS A 49 ? 0.2262 0.2999 0.2771 -0.0005 -0.0065 -0.0038 272 LYS A CG  
424  C CG  B LYS A 49 ? 0.2195 0.2321 0.2490 0.0115  0.0077  -0.0222 272 LYS A CG  
425  C CD  A LYS A 49 ? 0.2725 0.3267 0.3076 -0.0150 0.0367  -0.0062 272 LYS A CD  
426  C CD  B LYS A 49 ? 0.1794 0.2258 0.2538 -0.0023 -0.0034 -0.0224 272 LYS A CD  
427  C CE  A LYS A 49 ? 0.2726 0.3322 0.3523 0.0054  0.0268  -0.0020 272 LYS A CE  
428  C CE  B LYS A 49 ? 0.2364 0.2727 0.3081 -0.0091 0.0075  -0.0078 272 LYS A CE  
429  N NZ  A LYS A 49 ? 0.3660 0.3420 0.3640 0.0270  0.0104  0.0025  272 LYS A NZ  
430  N NZ  B LYS A 49 ? 0.2681 0.2729 0.3005 0.0000  0.0037  -0.0014 272 LYS A NZ  
431  N N   . LYS A 50 ? 0.1529 0.1796 0.2121 0.0069  0.0101  -0.0081 273 LYS A N   
432  C CA  . LYS A 50 ? 0.1798 0.1744 0.1938 -0.0064 0.0082  -0.0127 273 LYS A CA  
433  C C   . LYS A 50 ? 0.1625 0.1610 0.1904 -0.0083 -0.0019 -0.0047 273 LYS A C   
434  O O   . LYS A 50 ? 0.1736 0.2143 0.1880 -0.0390 -0.0105 0.0112  273 LYS A O   
435  C CB  . LYS A 50 ? 0.2237 0.1615 0.2154 0.0026  -0.0050 -0.0316 273 LYS A CB  
436  C CG  . LYS A 50 ? 0.2301 0.1950 0.2207 0.0065  0.0021  -0.0393 273 LYS A CG  
437  C CD  . LYS A 50 ? 0.2904 0.2289 0.2821 0.0009  0.0061  -0.0352 273 LYS A CD  
438  C CE  . LYS A 50 ? 0.3817 0.2610 0.3057 0.0150  0.0221  -0.0103 273 LYS A CE  
439  N NZ  . LYS A 50 ? 0.4084 0.3473 0.3782 0.0350  0.0227  -0.0066 273 LYS A NZ  
440  N N   . LEU A 51 ? 0.1579 0.2011 0.2005 0.0195  -0.0070 -0.0062 274 LEU A N   
441  C CA  . LEU A 51 ? 0.1740 0.2004 0.1945 -0.0076 -0.0264 0.0050  274 LEU A CA  
442  C C   . LEU A 51 ? 0.1638 0.2092 0.1924 -0.0165 -0.0227 -0.0144 274 LEU A C   
443  O O   . LEU A 51 ? 0.1548 0.2233 0.2244 -0.0184 0.0022  -0.0112 274 LEU A O   
444  C CB  . LEU A 51 ? 0.2271 0.2274 0.2230 -0.0008 -0.0200 0.0180  274 LEU A CB  
445  C CG  . LEU A 51 ? 0.2318 0.2088 0.2606 0.0101  -0.0260 0.0027  274 LEU A CG  
446  C CD1 . LEU A 51 ? 0.2410 0.2391 0.3645 0.0111  -0.0045 0.0205  274 LEU A CD1 
447  C CD2 . LEU A 51 ? 0.2605 0.2248 0.3592 -0.0204 0.0137  0.0153  274 LEU A CD2 
448  N N   . TYR A 52 ? 0.1654 0.2231 0.1811 -0.0250 -0.0079 -0.0160 275 TYR A N   
449  C CA  . TYR A 52 ? 0.1761 0.2224 0.1885 -0.0312 0.0043  -0.0175 275 TYR A CA  
450  C C   . TYR A 52 ? 0.1658 0.2347 0.1962 -0.0196 -0.0045 -0.0184 275 TYR A C   
451  O O   . TYR A 52 ? 0.1828 0.2117 0.1829 -0.0181 -0.0086 -0.0083 275 TYR A O   
452  C CB  . TYR A 52 ? 0.1993 0.2197 0.2056 -0.0232 0.0112  0.0043  275 TYR A CB  
453  C CG  . TYR A 52 ? 0.2142 0.2162 0.2141 -0.0290 0.0170  0.0075  275 TYR A CG  
454  C CD1 . TYR A 52 ? 0.2198 0.2304 0.2434 -0.0220 0.0338  -0.0314 275 TYR A CD1 
455  C CD2 . TYR A 52 ? 0.1822 0.2012 0.2355 -0.0134 0.0145  -0.0085 275 TYR A CD2 
456  C CE1 . TYR A 52 ? 0.2275 0.2240 0.2111 -0.0230 0.0283  -0.0327 275 TYR A CE1 
457  C CE2 . TYR A 52 ? 0.2118 0.1947 0.2435 -0.0037 0.0221  -0.0072 275 TYR A CE2 
458  C CZ  . TYR A 52 ? 0.2014 0.1941 0.2077 -0.0170 0.0204  0.0035  275 TYR A CZ  
459  O OH  . TYR A 52 ? 0.2577 0.1804 0.2404 -0.0091 0.0046  -0.0263 275 TYR A OH  
460  N N   A MET A 53 ? 0.1821 0.2323 0.2002 -0.0283 -0.0039 -0.0146 276 MET A N   
461  N N   B MET A 53 ? 0.1735 0.2232 0.1904 -0.0273 -0.0025 -0.0159 276 MET A N   
462  N N   C MET A 53 ? 0.1732 0.2486 0.2083 -0.0427 0.0004  -0.0203 276 MET A N   
463  C CA  A MET A 53 ? 0.1980 0.2479 0.2300 -0.0194 -0.0132 -0.0090 276 MET A CA  
464  C CA  B MET A 53 ? 0.1746 0.2206 0.2064 -0.0157 -0.0109 -0.0118 276 MET A CA  
465  C CA  C MET A 53 ? 0.1934 0.2707 0.2511 -0.0263 -0.0056 -0.0114 276 MET A CA  
466  C C   A MET A 53 ? 0.1769 0.2318 0.2140 -0.0302 -0.0108 -0.0085 276 MET A C   
467  C C   B MET A 53 ? 0.1665 0.2210 0.2051 -0.0290 -0.0101 -0.0097 276 MET A C   
468  C C   C MET A 53 ? 0.1643 0.2544 0.2316 -0.0346 -0.0043 -0.0120 276 MET A C   
469  O O   A MET A 53 ? 0.1962 0.2433 0.2192 -0.0142 -0.0153 -0.0041 276 MET A O   
470  O O   B MET A 53 ? 0.1830 0.2338 0.2092 -0.0132 -0.0150 -0.0036 276 MET A O   
471  O O   C MET A 53 ? 0.1735 0.2817 0.2435 -0.0145 0.0110  -0.0105 276 MET A O   
472  C CB  A MET A 53 ? 0.2070 0.2454 0.2223 -0.0096 -0.0034 -0.0114 276 MET A CB  
473  C CB  B MET A 53 ? 0.1941 0.2261 0.2092 -0.0051 -0.0024 -0.0153 276 MET A CB  
474  C CB  C MET A 53 ? 0.2110 0.2743 0.2648 -0.0276 -0.0026 -0.0093 276 MET A CB  
475  C CG  A MET A 53 ? 0.2206 0.2593 0.2495 -0.0173 -0.0058 -0.0027 276 MET A CG  
476  C CG  B MET A 53 ? 0.1903 0.1942 0.2216 0.0180  0.0018  -0.0147 276 MET A CG  
477  C CG  C MET A 53 ? 0.2278 0.2823 0.3191 -0.0271 -0.0111 -0.0113 276 MET A CG  
478  S SD  A MET A 53 ? 0.2552 0.3014 0.3014 -0.0010 -0.0176 -0.0103 276 MET A SD  
479  S SD  B MET A 53 ? 0.2108 0.2605 0.2387 0.0180  -0.0170 -0.0129 276 MET A SD  
480  S SD  C MET A 53 ? 0.3291 0.3494 0.3891 0.0128  -0.0014 -0.0098 276 MET A SD  
481  C CE  A MET A 53 ? 0.2640 0.3268 0.3073 -0.0142 -0.0146 -0.0046 276 MET A CE  
482  C CE  B MET A 53 ? 0.2386 0.2191 0.2657 0.0167  0.0033  -0.0038 276 MET A CE  
483  C CE  C MET A 53 ? 0.2516 0.2133 0.3723 0.0414  -0.0154 0.0217  276 MET A CE  
484  N N   . VAL A 54 ? 0.1664 0.2248 0.2083 -0.0369 -0.0216 -0.0297 277 VAL A N   
485  C CA  . VAL A 54 ? 0.1581 0.2069 0.2057 -0.0470 -0.0207 -0.0241 277 VAL A CA  
486  C C   . VAL A 54 ? 0.1668 0.2215 0.2148 -0.0409 -0.0320 -0.0203 277 VAL A C   
487  O O   . VAL A 54 ? 0.1783 0.2192 0.2145 -0.0606 -0.0324 -0.0056 277 VAL A O   
488  C CB  . VAL A 54 ? 0.1961 0.1950 0.2342 -0.0340 -0.0124 0.0026  277 VAL A CB  
489  C CG1 . VAL A 54 ? 0.2258 0.2172 0.2724 -0.0481 -0.0238 -0.0154 277 VAL A CG1 
490  C CG2 . VAL A 54 ? 0.2557 0.2396 0.2431 -0.0483 -0.0078 0.0156  277 VAL A CG2 
491  N N   . PRO A 55 ? 0.1955 0.2366 0.2490 -0.0300 -0.0272 -0.0098 278 PRO A N   
492  C CA  . PRO A 55 ? 0.2307 0.2712 0.2935 -0.0249 -0.0341 -0.0046 278 PRO A CA  
493  C C   . PRO A 55 ? 0.2566 0.2581 0.3110 -0.0140 -0.0263 -0.0311 278 PRO A C   
494  O O   . PRO A 55 ? 0.2876 0.2670 0.3111 -0.0128 -0.0195 -0.0154 278 PRO A O   
495  C CB  . PRO A 55 ? 0.2406 0.3065 0.3096 -0.0111 -0.0285 0.0017  278 PRO A CB  
496  C CG  . PRO A 55 ? 0.2008 0.3034 0.3235 -0.0378 -0.0242 -0.0135 278 PRO A CG  
497  C CD  . PRO A 55 ? 0.1817 0.2602 0.2770 -0.0391 -0.0213 -0.0095 278 PRO A CD  
498  N N   . TYR A 56 ? 0.2324 0.2112 0.3230 -0.0269 -0.0361 -0.0335 279 TYR A N   
499  C CA  . TYR A 56 ? 0.2443 0.2650 0.3334 -0.0256 0.0017  0.0081  279 TYR A CA  
500  C C   . TYR A 56 ? 0.2495 0.2245 0.3400 -0.0250 -0.0082 0.0014  279 TYR A C   
501  O O   . TYR A 56 ? 0.2892 0.2066 0.3829 -0.0532 -0.0160 0.0119  279 TYR A O   
502  C CB  . TYR A 56 ? 0.3039 0.3183 0.3445 -0.0065 -0.0109 -0.0070 279 TYR A CB  
503  C CG  . TYR A 56 ? 0.3301 0.3542 0.3653 0.0019  0.0022  0.0004  279 TYR A CG  
504  C CD1 . TYR A 56 ? 0.3813 0.4056 0.4095 0.0118  -0.0108 0.0128  279 TYR A CD1 
505  C CD2 . TYR A 56 ? 0.3294 0.3527 0.3743 -0.0108 -0.0121 -0.0065 279 TYR A CD2 
506  C CE1 . TYR A 56 ? 0.3897 0.4225 0.4425 0.0220  -0.0037 0.0099  279 TYR A CE1 
507  C CE2 . TYR A 56 ? 0.3581 0.3945 0.3964 0.0138  -0.0136 -0.0106 279 TYR A CE2 
508  C CZ  . TYR A 56 ? 0.3589 0.4055 0.4386 0.0176  -0.0073 0.0166  279 TYR A CZ  
509  O OH  . TYR A 56 ? 0.3956 0.4319 0.4631 0.0365  -0.0228 0.0138  279 TYR A OH  
510  N N   . VAL A 57 ? 0.2205 0.1680 0.2913 -0.0080 0.0087  -0.0009 280 VAL A N   
511  C CA  . VAL A 57 ? 0.2526 0.2016 0.2723 0.0052  0.0076  -0.0160 280 VAL A CA  
512  C C   . VAL A 57 ? 0.2754 0.1898 0.2805 0.0165  0.0161  -0.0131 280 VAL A C   
513  O O   . VAL A 57 ? 0.2784 0.1587 0.2899 -0.0030 -0.0058 -0.0308 280 VAL A O   
514  C CB  . VAL A 57 ? 0.2506 0.2230 0.2399 -0.0010 0.0060  -0.0098 280 VAL A CB  
515  C CG1 . VAL A 57 ? 0.2864 0.2082 0.2600 -0.0171 -0.0020 -0.0331 280 VAL A CG1 
516  C CG2 . VAL A 57 ? 0.2658 0.2303 0.2272 0.0046  0.0138  -0.0024 280 VAL A CG2 
517  N N   . ASP A 58 ? 0.3145 0.1829 0.3008 0.0269  0.0179  -0.0137 281 ASP A N   
518  C CA  . ASP A 58 ? 0.3248 0.2294 0.3181 0.0169  0.0107  -0.0260 281 ASP A CA  
519  C C   . ASP A 58 ? 0.3164 0.1985 0.3045 0.0158  0.0233  -0.0186 281 ASP A C   
520  O O   . ASP A 58 ? 0.3200 0.1505 0.3219 0.0131  0.0249  -0.0135 281 ASP A O   
521  C CB  . ASP A 58 ? 0.3266 0.2796 0.3430 0.0157  -0.0047 -0.0158 281 ASP A CB  
522  C CG  . ASP A 58 ? 0.3759 0.3906 0.3676 0.0032  0.0072  -0.0136 281 ASP A CG  
523  O OD1 . ASP A 58 ? 0.4051 0.4488 0.4361 0.0230  -0.0088 -0.0286 281 ASP A OD1 
524  O OD2 . ASP A 58 ? 0.3787 0.4757 0.4484 -0.0215 -0.0205 -0.0381 281 ASP A OD2 
525  N N   . LEU A 59 ? 0.3302 0.1832 0.3120 0.0222  0.0166  -0.0399 282 LEU A N   
526  C CA  . LEU A 59 ? 0.3156 0.1906 0.2997 0.0235  0.0188  -0.0389 282 LEU A CA  
527  C C   . LEU A 59 ? 0.3153 0.1811 0.3065 0.0192  0.0099  -0.0385 282 LEU A C   
528  O O   . LEU A 59 ? 0.2902 0.2063 0.3340 0.0357  0.0108  -0.0525 282 LEU A O   
529  C CB  . LEU A 59 ? 0.3343 0.2060 0.3246 0.0242  0.0178  -0.0418 282 LEU A CB  
530  C CG  . LEU A 59 ? 0.3534 0.2800 0.3467 0.0092  0.0100  -0.0353 282 LEU A CG  
531  C CD1 . LEU A 59 ? 0.3869 0.3295 0.3870 0.0323  0.0213  -0.0499 282 LEU A CD1 
532  C CD2 . LEU A 59 ? 0.3541 0.3460 0.3844 -0.0251 0.0006  -0.0161 282 LEU A CD2 
533  N N   . GLU A 60 ? 0.3177 0.1502 0.3180 0.0092  0.0116  -0.0428 283 GLU A N   
534  C CA  . GLU A 60 ? 0.3281 0.1999 0.3194 -0.0027 0.0128  -0.0281 283 GLU A CA  
535  C C   . GLU A 60 ? 0.3158 0.1894 0.3061 0.0060  0.0119  -0.0206 283 GLU A C   
536  O O   . GLU A 60 ? 0.3534 0.1880 0.3256 -0.0017 0.0195  -0.0043 283 GLU A O   
537  C CB  . GLU A 60 ? 0.3275 0.2481 0.3395 -0.0019 0.0061  -0.0178 283 GLU A CB  
538  C CG  . GLU A 60 ? 0.3737 0.3145 0.3967 0.0087  0.0060  -0.0109 283 GLU A CG  
539  C CD  . GLU A 60 ? 0.4347 0.4406 0.4703 -0.0136 0.0006  0.0033  283 GLU A CD  
540  O OE1 . GLU A 60 ? 0.4963 0.4936 0.4872 -0.0283 0.0061  0.0049  283 GLU A OE1 
541  O OE2 . GLU A 60 ? 0.4712 0.4945 0.5077 -0.0017 -0.0191 0.0092  283 GLU A OE2 
542  N N   . HIS A 61 ? 0.2815 0.1535 0.2766 0.0034  0.0183  -0.0225 284 HIS A N   
543  C CA  . HIS A 61 ? 0.2652 0.1611 0.2587 0.0073  0.0267  -0.0165 284 HIS A CA  
544  C C   . HIS A 61 ? 0.2629 0.1968 0.2629 0.0166  0.0301  -0.0120 284 HIS A C   
545  O O   . HIS A 61 ? 0.2753 0.2321 0.2418 0.0044  0.0389  -0.0247 284 HIS A O   
546  C CB  . HIS A 61 ? 0.2320 0.1806 0.2687 0.0146  0.0368  0.0013  284 HIS A CB  
547  C CG  . HIS A 61 ? 0.2573 0.1349 0.3096 -0.0011 0.0260  -0.0127 284 HIS A CG  
548  N ND1 . HIS A 61 ? 0.3019 0.2037 0.3354 0.0063  0.0249  -0.0112 284 HIS A ND1 
549  C CD2 . HIS A 61 ? 0.2420 0.1221 0.2954 0.0073  0.0033  -0.0161 284 HIS A CD2 
550  C CE1 . HIS A 61 ? 0.2964 0.1991 0.3131 -0.0084 0.0138  0.0148  284 HIS A CE1 
551  N NE2 . HIS A 61 ? 0.2987 0.2159 0.3488 -0.0093 0.0114  -0.0123 284 HIS A NE2 
552  N N   . GLN A 62 ? 0.2705 0.2244 0.2463 0.0226  0.0297  -0.0158 285 GLN A N   
553  C CA  . GLN A 62 ? 0.2843 0.2402 0.2479 0.0371  0.0412  -0.0181 285 GLN A CA  
554  C C   . GLN A 62 ? 0.2767 0.2663 0.2623 0.0333  0.0374  0.0005  285 GLN A C   
555  O O   . GLN A 62 ? 0.3385 0.2728 0.3073 0.0304  0.0178  0.0117  285 GLN A O   
556  C CB  . GLN A 62 ? 0.2847 0.2746 0.2625 0.0395  0.0437  -0.0169 285 GLN A CB  
557  C CG  . GLN A 62 ? 0.3237 0.3248 0.3358 0.0377  0.0209  -0.0103 285 GLN A CG  
558  C CD  . GLN A 62 ? 0.3611 0.3203 0.3721 0.0428  0.0432  0.0026  285 GLN A CD  
559  O OE1 . GLN A 62 ? 0.3593 0.2877 0.3744 0.0600  0.0311  0.0066  285 GLN A OE1 
560  N NE2 . GLN A 62 ? 0.4494 0.3537 0.4106 0.0264  0.0230  -0.0199 285 GLN A NE2 
561  N N   . GLY A 63 ? 0.2704 0.2489 0.2298 0.0523  0.0341  0.0046  286 GLY A N   
562  C CA  . GLY A 63 ? 0.2674 0.2734 0.2473 0.0648  0.0264  0.0030  286 GLY A CA  
563  C C   . GLY A 63 ? 0.2472 0.2889 0.2468 0.0680  0.0256  0.0099  286 GLY A C   
564  O O   . GLY A 63 ? 0.2455 0.3192 0.2492 0.0552  0.0314  0.0155  286 GLY A O   
565  N N   . THR A 64 ? 0.2204 0.3020 0.2368 0.0853  0.0355  0.0040  287 THR A N   
566  C CA  . THR A 64 ? 0.1836 0.3027 0.2104 0.0821  0.0707  -0.0095 287 THR A CA  
567  C C   . THR A 64 ? 0.1789 0.2898 0.2062 0.0671  0.0701  -0.0101 287 THR A C   
568  O O   . THR A 64 ? 0.2815 0.3037 0.2856 0.0779  0.0329  0.0014  287 THR A O   
569  C CB  . THR A 64 ? 0.3573 0.3669 0.3306 0.0016  -0.0639 0.0437  287 THR A CB  
570  O OG1 . THR A 64 ? 0.4382 0.4138 0.3912 -0.0127 -0.0936 0.0708  287 THR A OG1 
571  C CG2 . THR A 64 ? 0.3050 0.3993 0.3046 0.0269  0.0015  0.0019  287 THR A CG2 
572  N N   . TYR A 65 ? 0.2052 0.2986 0.2117 0.0428  0.0221  -0.0074 288 TYR A N   
573  C CA  . TYR A 65 ? 0.1780 0.2954 0.2103 0.0456  0.0270  -0.0125 288 TYR A CA  
574  C C   . TYR A 65 ? 0.1707 0.3108 0.2114 0.0409  0.0182  -0.0081 288 TYR A C   
575  O O   . TYR A 65 ? 0.1678 0.3230 0.2173 0.0361  0.0242  -0.0149 288 TYR A O   
576  C CB  . TYR A 65 ? 0.1568 0.2797 0.1936 0.0330  0.0358  -0.0179 288 TYR A CB  
577  C CG  . TYR A 65 ? 0.1465 0.2304 0.2078 0.0505  0.0387  -0.0051 288 TYR A CG  
578  C CD1 . TYR A 65 ? 0.1640 0.1969 0.2092 0.0147  0.0314  0.0141  288 TYR A CD1 
579  C CD2 . TYR A 65 ? 0.1542 0.2571 0.1966 0.0337  0.0400  -0.0094 288 TYR A CD2 
580  C CE1 . TYR A 65 ? 0.1975 0.2305 0.2203 0.0044  0.0193  0.0181  288 TYR A CE1 
581  C CE2 . TYR A 65 ? 0.1796 0.1947 0.2056 0.0225  0.0466  0.0059  288 TYR A CE2 
582  C CZ  . TYR A 65 ? 0.2011 0.2206 0.2128 -0.0010 0.0148  0.0100  288 TYR A CZ  
583  O OH  . TYR A 65 ? 0.2162 0.2703 0.2137 -0.0148 -0.0115 0.0168  288 TYR A OH  
584  N N   . TRP A 66 ? 0.1551 0.3055 0.1957 0.0412  0.0244  -0.0133 289 TRP A N   
585  C CA  . TRP A 66 ? 0.1461 0.2835 0.1786 0.0336  0.0153  -0.0106 289 TRP A CA  
586  C C   . TRP A 66 ? 0.1387 0.2120 0.1670 0.0194  0.0271  -0.0027 289 TRP A C   
587  O O   . TRP A 66 ? 0.1663 0.2070 0.1749 0.0121  0.0213  -0.0163 289 TRP A O   
588  C CB  . TRP A 66 ? 0.1754 0.3067 0.2481 0.0422  0.0276  -0.0186 289 TRP A CB  
589  C CG  . TRP A 66 ? 0.2166 0.3235 0.3022 0.0427  0.0252  -0.0216 289 TRP A CG  
590  C CD1 . TRP A 66 ? 0.2706 0.3463 0.3144 0.0311  0.0318  -0.0136 289 TRP A CD1 
591  C CD2 . TRP A 66 ? 0.2401 0.3543 0.2952 0.0107  0.0317  -0.0089 289 TRP A CD2 
592  N NE1 . TRP A 66 ? 0.2538 0.3289 0.3323 0.0538  0.0294  -0.0078 289 TRP A NE1 
593  C CE2 . TRP A 66 ? 0.2887 0.3337 0.3277 0.0374  0.0244  0.0005  289 TRP A CE2 
594  C CE3 . TRP A 66 ? 0.2016 0.3546 0.2633 0.0584  0.0521  -0.0309 289 TRP A CE3 
595  C CZ2 . TRP A 66 ? 0.2411 0.3809 0.2599 0.0548  0.0546  -0.0037 289 TRP A CZ2 
596  C CZ3 . TRP A 66 ? 0.2439 0.3158 0.3213 0.0452  0.0244  -0.0022 289 TRP A CZ3 
597  C CH2 . TRP A 66 ? 0.2876 0.3616 0.3253 0.0353  0.0160  -0.0031 289 TRP A CH2 
598  N N   . CYS A 67 ? 0.1291 0.2036 0.1664 0.0039  0.0141  -0.0064 290 CYS A N   
599  C CA  . CYS A 67 ? 0.1054 0.1966 0.1755 0.0161  0.0129  -0.0047 290 CYS A CA  
600  C C   . CYS A 67 ? 0.0954 0.1837 0.1810 0.0007  0.0114  -0.0050 290 CYS A C   
601  O O   . CYS A 67 ? 0.1219 0.2168 0.1809 -0.0207 0.0008  0.0218  290 CYS A O   
602  C CB  . CYS A 67 ? 0.1066 0.2039 0.1736 0.0034  0.0086  -0.0037 290 CYS A CB  
603  S SG  . CYS A 67 ? 0.1107 0.1721 0.1947 -0.0019 0.0144  -0.0028 290 CYS A SG  
604  N N   . HIS A 68 ? 0.1170 0.1745 0.1698 0.0024  0.0167  0.0020  291 HIS A N   
605  C CA  . HIS A 68 ? 0.1356 0.1684 0.1648 -0.0011 0.0032  -0.0020 291 HIS A CA  
606  C C   . HIS A 68 ? 0.1175 0.1616 0.1677 -0.0221 -0.0015 0.0038  291 HIS A C   
607  O O   . HIS A 68 ? 0.1059 0.1887 0.2073 -0.0057 0.0007  -0.0306 291 HIS A O   
608  C CB  . HIS A 68 ? 0.1555 0.1564 0.1890 0.0006  -0.0014 0.0002  291 HIS A CB  
609  C CG  . HIS A 68 ? 0.1877 0.1671 0.1705 0.0162  -0.0207 0.0034  291 HIS A CG  
610  N ND1 . HIS A 68 ? 0.1754 0.2079 0.1956 0.0032  -0.0265 -0.0030 291 HIS A ND1 
611  C CD2 . HIS A 68 ? 0.2070 0.1544 0.1966 0.0062  0.0071  0.0198  291 HIS A CD2 
612  C CE1 . HIS A 68 ? 0.1987 0.2056 0.2157 0.0046  -0.0200 0.0164  291 HIS A CE1 
613  N NE2 . HIS A 68 ? 0.1869 0.1804 0.1845 0.0222  0.0070  0.0222  291 HIS A NE2 
614  N N   . VAL A 69 ? 0.1191 0.1584 0.1643 -0.0112 0.0034  0.0023  292 VAL A N   
615  C CA  . VAL A 69 ? 0.1278 0.1602 0.1726 -0.0085 0.0091  0.0138  292 VAL A CA  
616  C C   . VAL A 69 ? 0.1271 0.1743 0.1518 -0.0081 -0.0081 0.0140  292 VAL A C   
617  O O   . VAL A 69 ? 0.1366 0.2155 0.1690 -0.0063 0.0086  0.0216  292 VAL A O   
618  C CB  . VAL A 69 ? 0.1506 0.1552 0.1781 -0.0185 0.0038  0.0098  292 VAL A CB  
619  C CG1 . VAL A 69 ? 0.1995 0.1699 0.2321 0.0017  0.0254  0.0164  292 VAL A CG1 
620  C CG2 . VAL A 69 ? 0.1479 0.2050 0.1760 -0.0125 -0.0076 0.0245  292 VAL A CG2 
621  N N   . TYR A 70 ? 0.1269 0.1640 0.1532 -0.0110 -0.0014 0.0023  293 TYR A N   
622  C CA  . TYR A 70 ? 0.1381 0.1594 0.1415 0.0027  -0.0089 0.0009  293 TYR A CA  
623  C C   . TYR A 70 ? 0.1309 0.1609 0.1556 -0.0151 -0.0088 0.0080  293 TYR A C   
624  O O   . TYR A 70 ? 0.1431 0.1635 0.1660 -0.0093 -0.0042 -0.0033 293 TYR A O   
625  C CB  . TYR A 70 ? 0.1512 0.1639 0.1797 -0.0026 0.0037  -0.0037 293 TYR A CB  
626  C CG  . TYR A 70 ? 0.1567 0.1681 0.1630 -0.0030 0.0046  0.0060  293 TYR A CG  
627  C CD1 . TYR A 70 ? 0.1779 0.1672 0.1750 -0.0219 0.0132  -0.0040 293 TYR A CD1 
628  C CD2 . TYR A 70 ? 0.1738 0.1510 0.1891 -0.0191 0.0002  0.0067  293 TYR A CD2 
629  C CE1 . TYR A 70 ? 0.1719 0.2086 0.2011 -0.0305 0.0017  -0.0291 293 TYR A CE1 
630  C CE2 . TYR A 70 ? 0.1449 0.1692 0.1836 -0.0189 0.0056  -0.0254 293 TYR A CE2 
631  C CZ  . TYR A 70 ? 0.1723 0.1727 0.2084 -0.0422 -0.0051 -0.0187 293 TYR A CZ  
632  O OH  . TYR A 70 ? 0.1783 0.2215 0.2100 -0.0609 0.0144  -0.0202 293 TYR A OH  
633  N N   . ASN A 71 ? 0.1450 0.1770 0.1512 -0.0223 0.0060  0.0065  294 ASN A N   
634  C CA  . ASN A 71 ? 0.1388 0.1846 0.1481 0.0017  0.0128  -0.0013 294 ASN A CA  
635  C C   . ASN A 71 ? 0.1221 0.1778 0.1717 -0.0089 0.0198  -0.0008 294 ASN A C   
636  O O   . ASN A 71 ? 0.1643 0.1796 0.1713 -0.0006 0.0106  0.0114  294 ASN A O   
637  C CB  . ASN A 71 ? 0.1311 0.1849 0.1651 -0.0017 0.0018  0.0046  294 ASN A CB  
638  C CG  . ASN A 71 ? 0.1385 0.1779 0.1625 -0.0009 0.0071  -0.0104 294 ASN A CG  
639  O OD1 . ASN A 71 ? 0.1394 0.1883 0.1771 -0.0163 -0.0058 0.0206  294 ASN A OD1 
640  N ND2 . ASN A 71 ? 0.1719 0.1674 0.1874 -0.0070 -0.0078 -0.0059 294 ASN A ND2 
641  N N   . ASP A 72 ? 0.1314 0.1742 0.1647 -0.0057 0.0149  0.0050  295 ASP A N   
642  C CA  . ASP A 72 ? 0.1608 0.1771 0.1568 -0.0031 0.0188  0.0004  295 ASP A CA  
643  C C   . ASP A 72 ? 0.1751 0.1779 0.1643 0.0028  0.0013  0.0047  295 ASP A C   
644  O O   . ASP A 72 ? 0.1973 0.1803 0.1723 0.0053  0.0075  0.0175  295 ASP A O   
645  C CB  . ASP A 72 ? 0.1670 0.1923 0.1817 0.0206  0.0349  -0.0012 295 ASP A CB  
646  C CG  . ASP A 72 ? 0.1867 0.2123 0.1910 0.0097  0.0336  0.0061  295 ASP A CG  
647  O OD1 . ASP A 72 ? 0.2290 0.2028 0.2374 0.0030  0.0188  -0.0094 295 ASP A OD1 
648  O OD2 . ASP A 72 ? 0.2155 0.2155 0.2543 0.0111  0.0731  0.0094  295 ASP A OD2 
649  N N   A ARG A 73 ? 0.1662 0.1722 0.1694 -0.0067 -0.0099 0.0167  296 ARG A N   
650  N N   B ARG A 73 ? 0.1795 0.1768 0.1804 -0.0030 -0.0079 0.0106  296 ARG A N   
651  C CA  A ARG A 73 ? 0.1702 0.1733 0.1803 -0.0116 -0.0216 0.0156  296 ARG A CA  
652  C CA  B ARG A 73 ? 0.1963 0.1845 0.1895 -0.0017 -0.0168 0.0138  296 ARG A CA  
653  C C   A ARG A 73 ? 0.1616 0.1949 0.1989 -0.0104 -0.0268 0.0111  296 ARG A C   
654  C C   B ARG A 73 ? 0.1860 0.2060 0.2033 -0.0050 -0.0188 0.0103  296 ARG A C   
655  O O   A ARG A 73 ? 0.1391 0.1749 0.2172 -0.0142 -0.0338 -0.0036 296 ARG A O   
656  O O   B ARG A 73 ? 0.1999 0.2178 0.2113 0.0022  -0.0302 0.0207  296 ARG A O   
657  C CB  A ARG A 73 ? 0.1765 0.1754 0.1748 -0.0218 -0.0106 0.0284  296 ARG A CB  
658  C CB  B ARG A 73 ? 0.1920 0.1757 0.1950 -0.0084 -0.0172 0.0092  296 ARG A CB  
659  C CG  A ARG A 73 ? 0.1719 0.1819 0.1970 -0.0259 -0.0235 0.0073  296 ARG A CG  
660  C CG  B ARG A 73 ? 0.2155 0.1825 0.2002 0.0051  -0.0213 -0.0123 296 ARG A CG  
661  C CD  A ARG A 73 ? 0.2056 0.1976 0.2215 -0.0229 -0.0120 -0.0119 296 ARG A CD  
662  C CD  B ARG A 73 ? 0.2294 0.2077 0.2392 -0.0074 -0.0222 -0.0001 296 ARG A CD  
663  N NE  A ARG A 73 ? 0.2149 0.2013 0.1871 -0.0381 -0.0210 -0.0165 296 ARG A NE  
664  N NE  B ARG A 73 ? 0.2978 0.2877 0.3150 -0.0257 -0.0282 -0.0152 296 ARG A NE  
665  C CZ  A ARG A 73 ? 0.2066 0.2087 0.2046 -0.0213 -0.0124 -0.0267 296 ARG A CZ  
666  C CZ  B ARG A 73 ? 0.3252 0.2953 0.3015 -0.0174 -0.0258 0.0026  296 ARG A CZ  
667  N NH1 A ARG A 73 ? 0.2244 0.2489 0.2263 -0.0431 -0.0162 -0.0338 296 ARG A NH1 
668  N NH1 B ARG A 73 ? 0.2853 0.2425 0.2098 -0.0586 -0.0297 0.0205  296 ARG A NH1 
669  N NH2 A ARG A 73 ? 0.1672 0.2497 0.2292 -0.0136 0.0088  0.0112  296 ARG A NH2 
670  N NH2 B ARG A 73 ? 0.3577 0.3617 0.3139 -0.0256 -0.0389 0.0164  296 ARG A NH2 
671  N N   . ASP A 74 ? 0.1491 0.2241 0.1784 -0.0131 -0.0224 0.0036  297 ASP A N   
672  C CA  . ASP A 74 ? 0.1566 0.2704 0.1937 -0.0031 -0.0059 0.0057  297 ASP A CA  
673  C C   . ASP A 74 ? 0.1453 0.2401 0.1798 -0.0034 -0.0172 0.0095  297 ASP A C   
674  O O   . ASP A 74 ? 0.1487 0.2157 0.1935 -0.0004 -0.0194 0.0127  297 ASP A O   
675  C CB  . ASP A 74 ? 0.1874 0.2840 0.2622 -0.0173 0.0020  -0.0185 297 ASP A CB  
676  C CG  . ASP A 74 ? 0.2114 0.3302 0.2822 -0.0178 0.0074  0.0155  297 ASP A CG  
677  O OD1 . ASP A 74 ? 0.2995 0.3896 0.2466 0.0014  -0.0484 -0.0278 297 ASP A OD1 
678  O OD2 . ASP A 74 ? 0.3060 0.3761 0.3005 -0.0045 -0.0104 -0.0156 297 ASP A OD2 
679  N N   A SER A 75 ? 0.1322 0.2360 0.1576 0.0005  -0.0151 0.0102  298 SER A N   
680  N N   B SER A 75 ? 0.1547 0.2440 0.1778 -0.0037 -0.0121 0.0071  298 SER A N   
681  C CA  A SER A 75 ? 0.1244 0.2223 0.1551 0.0082  -0.0012 0.0185  298 SER A CA  
682  C CA  B SER A 75 ? 0.1677 0.2417 0.1880 -0.0021 -0.0016 0.0096  298 SER A CA  
683  C C   A SER A 75 ? 0.1142 0.2281 0.1541 -0.0028 -0.0017 0.0175  298 SER A C   
684  C C   B SER A 75 ? 0.1471 0.2366 0.1800 -0.0054 -0.0041 0.0119  298 SER A C   
685  O O   A SER A 75 ? 0.1013 0.2245 0.1832 -0.0134 -0.0135 0.0179  298 SER A O   
686  O O   B SER A 75 ? 0.1329 0.2226 0.1949 0.0040  -0.0136 0.0055  298 SER A O   
687  C CB  A SER A 75 ? 0.1255 0.2116 0.1674 0.0154  -0.0032 0.0178  298 SER A CB  
688  C CB  B SER A 75 ? 0.1721 0.2409 0.2142 -0.0098 0.0127  0.0094  298 SER A CB  
689  O OG  A SER A 75 ? 0.1287 0.2037 0.1877 0.0314  0.0255  0.0323  298 SER A OG  
690  O OG  B SER A 75 ? 0.2292 0.2723 0.2302 -0.0122 0.0084  0.0137  298 SER A OG  
691  N N   . GLN A 76 ? 0.1368 0.2408 0.1740 -0.0079 -0.0066 0.0248  299 GLN A N   
692  C CA  . GLN A 76 ? 0.1370 0.2723 0.1950 -0.0255 0.0062  0.0236  299 GLN A CA  
693  C C   . GLN A 76 ? 0.0809 0.2630 0.1836 -0.0387 0.0121  0.0212  299 GLN A C   
694  O O   . GLN A 76 ? 0.1504 0.3175 0.2185 -0.0113 -0.0075 -0.0091 299 GLN A O   
695  C CB  . GLN A 76 ? 0.1669 0.2672 0.2033 -0.0130 0.0058  0.0239  299 GLN A CB  
696  C CG  . GLN A 76 ? 0.2297 0.2994 0.2542 -0.0268 0.0082  0.0103  299 GLN A CG  
697  C CD  . GLN A 76 ? 0.2419 0.2890 0.2757 -0.0209 -0.0193 0.0152  299 GLN A CD  
698  O OE1 . GLN A 76 ? 0.2176 0.3181 0.2833 -0.0512 -0.0300 0.0349  299 GLN A OE1 
699  N NE2 . GLN A 76 ? 0.2122 0.3628 0.3269 -0.0223 -0.0300 0.0116  299 GLN A NE2 
700  N N   . ASP A 77 ? 0.1402 0.3029 0.1845 -0.0090 0.0110  0.0104  300 ASP A N   
701  C CA  . ASP A 77 ? 0.1463 0.3007 0.1890 -0.0111 0.0289  0.0066  300 ASP A CA  
702  C C   . ASP A 77 ? 0.1177 0.2982 0.1819 -0.0317 0.0192  0.0191  300 ASP A C   
703  O O   . ASP A 77 ? 0.1652 0.3434 0.2205 -0.0164 -0.0115 0.0037  300 ASP A O   
704  C CB  . ASP A 77 ? 0.1563 0.3005 0.2260 0.0046  0.0115  0.0065  300 ASP A CB  
705  C CG  . ASP A 77 ? 0.1723 0.3242 0.2678 0.0116  0.0499  0.0106  300 ASP A CG  
706  O OD1 . ASP A 77 ? 0.2320 0.3237 0.3117 0.0078  0.0405  0.0376  300 ASP A OD1 
707  O OD2 . ASP A 77 ? 0.3262 0.3483 0.4104 0.0238  0.0058  0.0389  300 ASP A OD2 
708  N N   . SER A 78 ? 0.1472 0.2913 0.1968 -0.0287 0.0133  0.0101  301 SER A N   
709  C CA  . SER A 78 ? 0.1499 0.3223 0.2006 -0.0196 0.0192  0.0203  301 SER A CA  
710  C C   . SER A 78 ? 0.2034 0.3371 0.2091 -0.0121 0.0033  0.0053  301 SER A C   
711  O O   . SER A 78 ? 0.2042 0.3695 0.2507 -0.0098 -0.0100 0.0069  301 SER A O   
712  C CB  . SER A 78 ? 0.1424 0.2985 0.2094 -0.0232 -0.0061 0.0124  301 SER A CB  
713  O OG  . SER A 78 ? 0.1328 0.3060 0.2042 -0.0110 0.0003  0.0246  301 SER A OG  
714  N N   . LYS A 79 ? 0.0945 0.3574 0.2123 -0.0489 0.0316  0.0083  302 LYS A N   
715  C CA  . LYS A 79 ? 0.1879 0.3845 0.2200 -0.0174 0.0353  -0.0010 302 LYS A CA  
716  C C   . LYS A 79 ? 0.1462 0.3741 0.2255 -0.0159 0.0290  -0.0006 302 LYS A C   
717  O O   . LYS A 79 ? 0.1818 0.3819 0.2272 -0.0011 -0.0050 0.0053  302 LYS A O   
718  C CB  . LYS A 79 ? 0.2729 0.3946 0.2966 -0.0302 0.0221  0.0127  302 LYS A CB  
719  C CG  . LYS A 79 ? 0.3438 0.4471 0.3894 -0.0162 -0.0097 -0.0126 302 LYS A CG  
720  C CD  . LYS A 79 ? 0.4219 0.4893 0.4349 -0.0046 0.0198  -0.0144 302 LYS A CD  
721  C CE  . LYS A 79 ? 0.4497 0.4826 0.4350 -0.0090 -0.0092 -0.0039 302 LYS A CE  
722  N NZ  . LYS A 79 ? 0.5022 0.4922 0.5065 -0.0197 0.0066  -0.0173 302 LYS A NZ  
723  N N   . LYS A 80 ? 0.1792 0.3871 0.2431 0.0133  0.0009  -0.0146 303 LYS A N   
724  C CA  . LYS A 80 ? 0.2129 0.3663 0.2608 0.0080  0.0269  -0.0065 303 LYS A CA  
725  C C   . LYS A 80 ? 0.1408 0.3760 0.2244 0.0158  0.0582  -0.0144 303 LYS A C   
726  O O   . LYS A 80 ? 0.2688 0.4288 0.3030 0.0024  -0.0189 0.0021  303 LYS A O   
727  C CB  . LYS A 80 ? 0.2328 0.3770 0.2840 0.0142  0.0252  0.0017  303 LYS A CB  
728  C CG  . LYS A 80 ? 0.2742 0.3765 0.3449 0.0299  0.0194  0.0044  303 LYS A CG  
729  C CD  . LYS A 80 ? 0.2697 0.3543 0.3339 0.0150  0.0000  0.0063  303 LYS A CD  
730  C CE  . LYS A 80 ? 0.3076 0.3856 0.3992 0.0060  0.0013  0.0011  303 LYS A CE  
731  N N   . VAL A 81 ? 0.1863 0.3693 0.2184 0.0286  0.0269  -0.0063 304 VAL A N   
732  C CA  . VAL A 81 ? 0.1826 0.3485 0.2329 0.0221  0.0464  0.0018  304 VAL A CA  
733  C C   . VAL A 81 ? 0.2378 0.3621 0.2623 0.0192  -0.0077 -0.0033 304 VAL A C   
734  O O   . VAL A 81 ? 0.1964 0.3809 0.1889 0.0415  0.0763  -0.0052 304 VAL A O   
735  C CB  . VAL A 81 ? 0.2465 0.3577 0.2577 0.0218  0.0169  -0.0003 304 VAL A CB  
736  C CG1 . VAL A 81 ? 0.2594 0.3817 0.2500 0.0129  0.0208  -0.0039 304 VAL A CG1 
737  C CG2 . VAL A 81 ? 0.2516 0.3715 0.2914 0.0366  -0.0093 0.0225  304 VAL A CG2 
738  N N   . GLU A 82 ? 0.1482 0.3455 0.2069 0.0361  0.0510  -0.0137 305 GLU A N   
739  C CA  . GLU A 82 ? 0.2454 0.3575 0.2447 0.0063  0.0100  0.0013  305 GLU A CA  
740  C C   . GLU A 82 ? 0.2129 0.3244 0.2429 0.0229  0.0304  0.0104  305 GLU A C   
741  O O   . GLU A 82 ? 0.1970 0.3574 0.2403 0.0084  0.0334  0.0095  305 GLU A O   
742  C CB  . GLU A 82 ? 0.2949 0.3906 0.2729 0.0031  0.0166  -0.0037 305 GLU A CB  
743  C CG  . GLU A 82 ? 0.2411 0.3741 0.2886 0.0384  0.0298  0.0024  305 GLU A CG  
744  C CD  . GLU A 82 ? 0.2368 0.2797 0.2919 0.0337  0.0479  -0.0294 305 GLU A CD  
745  O OE1 . GLU A 82 ? 0.3258 0.3225 0.3610 0.0405  0.0299  -0.0500 305 GLU A OE1 
746  O OE2 . GLU A 82 ? 0.3641 0.4053 0.3927 -0.0383 0.0339  0.0221  305 GLU A OE2 
747  N N   . ILE A 83 ? 0.2174 0.3152 0.2284 0.0178  0.0229  0.0196  306 ILE A N   
748  C CA  . ILE A 83 ? 0.2133 0.2945 0.2538 0.0203  0.0119  0.0181  306 ILE A CA  
749  C C   . ILE A 83 ? 0.2236 0.2916 0.2442 0.0271  0.0203  0.0254  306 ILE A C   
750  O O   . ILE A 83 ? 0.2410 0.3092 0.2448 0.0353  0.0173  0.0163  306 ILE A O   
751  C CB  . ILE A 83 ? 0.2162 0.2744 0.2609 0.0149  0.0173  0.0247  306 ILE A CB  
752  C CG1 . ILE A 83 ? 0.2443 0.2752 0.2701 0.0124  0.0241  0.0098  306 ILE A CG1 
753  C CG2 . ILE A 83 ? 0.2341 0.2965 0.2766 -0.0008 -0.0065 0.0201  306 ILE A CG2 
754  C CD1 . ILE A 83 ? 0.2503 0.2981 0.3185 -0.0110 0.0385  0.0039  306 ILE A CD1 
755  N N   . ILE A 84 ? 0.2074 0.2898 0.2328 0.0360  0.0317  0.0215  307 ILE A N   
756  C CA  . ILE A 84 ? 0.2389 0.2907 0.2650 0.0414  0.0366  0.0124  307 ILE A CA  
757  C C   . ILE A 84 ? 0.2572 0.2850 0.2597 0.0327  0.0299  0.0022  307 ILE A C   
758  O O   . ILE A 84 ? 0.2733 0.2501 0.2587 0.0241  0.0190  0.0064  307 ILE A O   
759  C CB  . ILE A 84 ? 0.2518 0.3441 0.2987 0.0316  0.0343  0.0105  307 ILE A CB  
760  C CG1 . ILE A 84 ? 0.3045 0.3751 0.3472 0.0119  0.0079  0.0150  307 ILE A CG1 
761  C CG2 . ILE A 84 ? 0.2859 0.3519 0.3251 0.0114  0.0466  -0.0031 307 ILE A CG2 
762  C CD1 . ILE A 84 ? 0.4019 0.4191 0.3951 0.0142  0.0051  -0.0116 307 ILE A CD1 
763  N N   . ILE A 85 ? 0.2929 0.2662 0.2978 0.0400  0.0250  -0.0036 308 ILE A N   
764  C CA  . ILE A 85 ? 0.3381 0.3229 0.3202 0.0327  0.0100  -0.0204 308 ILE A CA  
765  C C   . ILE A 85 ? 0.3643 0.3404 0.3407 0.0365  0.0162  -0.0219 308 ILE A C   
766  O O   . ILE A 85 ? 0.3959 0.3540 0.3629 0.0629  0.0065  -0.0263 308 ILE A O   
767  C CB  . ILE A 85 ? 0.3374 0.3092 0.3344 0.0223  0.0050  -0.0224 308 ILE A CB  
768  C CG1 . ILE A 85 ? 0.3679 0.3689 0.3179 0.0177  0.0187  -0.0091 308 ILE A CG1 
769  C CG2 . ILE A 85 ? 0.3778 0.3677 0.3596 0.0018  -0.0001 -0.0044 308 ILE A CG2 
770  C CD1 . ILE A 85 ? 0.3354 0.3604 0.3490 0.0279  0.0044  -0.0187 308 ILE A CD1 
771  N N   . ASP A 86 ? 0.3888 0.3731 0.3494 0.0455  0.0318  -0.0235 309 ASP A N   
772  C CA  . ASP A 86 ? 0.4018 0.4125 0.3725 0.0317  0.0278  -0.0160 309 ASP A CA  
773  C C   . ASP A 86 ? 0.4122 0.4058 0.3876 0.0349  0.0169  -0.0115 309 ASP A C   
774  O O   . ASP A 86 ? 0.4233 0.4134 0.3970 0.0367  0.0131  -0.0154 309 ASP A O   
775  C CB  . ASP A 86 ? 0.4333 0.4302 0.3967 0.0231  0.0233  -0.0175 309 ASP A CB  
776  N N   . SER B 2  ? 0.3361 0.3775 0.3518 0.0263  0.0181  -0.0146 225 SER B N   
777  C CA  . SER B 2  ? 0.3423 0.3707 0.3305 0.0137  0.0123  -0.0156 225 SER B CA  
778  C C   . SER B 2  ? 0.3040 0.3327 0.2833 0.0298  0.0267  -0.0283 225 SER B C   
779  O O   . SER B 2  ? 0.3039 0.2910 0.2572 0.0289  0.0309  -0.0303 225 SER B O   
780  C CB  . SER B 2  ? 0.3763 0.3938 0.3600 0.0085  0.0038  -0.0048 225 SER B CB  
781  O OG  . SER B 2  ? 0.4567 0.4723 0.4248 0.0052  -0.0119 -0.0016 225 SER B OG  
782  N N   . LYS B 3  ? 0.2850 0.3094 0.2704 0.0243  0.0300  -0.0354 226 LYS B N   
783  C CA  . LYS B 3  ? 0.2735 0.3014 0.2682 0.0229  0.0416  -0.0322 226 LYS B CA  
784  C C   . LYS B 3  ? 0.2291 0.2705 0.2418 0.0279  0.0460  -0.0141 226 LYS B C   
785  O O   . LYS B 3  ? 0.2735 0.2533 0.2650 0.0480  0.0432  -0.0199 226 LYS B O   
786  C CB  . LYS B 3  ? 0.2803 0.3401 0.3034 0.0121  0.0388  -0.0392 226 LYS B CB  
787  C CG  . LYS B 3  ? 0.2854 0.3619 0.3231 0.0129  0.0303  -0.0215 226 LYS B CG  
788  C CD  . LYS B 3  ? 0.3019 0.3931 0.3537 0.0144  0.0318  -0.0188 226 LYS B CD  
789  C CE  . LYS B 3  ? 0.3788 0.4306 0.3738 0.0107  0.0126  -0.0269 226 LYS B CE  
790  N NZ  . LYS B 3  ? 0.4453 0.4611 0.4473 0.0224  0.0169  -0.0187 226 LYS B NZ  
791  N N   . LEU B 4  ? 0.2244 0.2629 0.2151 0.0202  0.0351  -0.0230 227 LEU B N   
792  C CA  . LEU B 4  ? 0.2007 0.2377 0.2097 0.0249  0.0404  -0.0278 227 LEU B CA  
793  C C   . LEU B 4  ? 0.1804 0.2488 0.2104 0.0189  0.0451  -0.0080 227 LEU B C   
794  O O   . LEU B 4  ? 0.1655 0.2752 0.2653 0.0269  0.0574  0.0126  227 LEU B O   
795  C CB  . LEU B 4  ? 0.2179 0.2318 0.2434 0.0142  0.0184  -0.0148 227 LEU B CB  
796  C CG  . LEU B 4  ? 0.2098 0.2324 0.2273 0.0449  0.0137  -0.0280 227 LEU B CG  
797  C CD1 . LEU B 4  ? 0.2229 0.2399 0.2841 0.0472  -0.0103 0.0017  227 LEU B CD1 
798  C CD2 . LEU B 4  ? 0.2226 0.2946 0.2949 0.0181  -0.0032 -0.0084 227 LEU B CD2 
799  N N   . GLN B 5  ? 0.1851 0.2490 0.2077 0.0349  0.0388  -0.0140 228 GLN B N   
800  C CA  . GLN B 5  ? 0.1763 0.2796 0.2068 0.0500  0.0444  -0.0122 228 GLN B CA  
801  C C   . GLN B 5  ? 0.1721 0.2445 0.2163 0.0413  0.0576  -0.0029 228 GLN B C   
802  O O   . GLN B 5  ? 0.2093 0.2481 0.2179 0.0182  0.0345  -0.0048 228 GLN B O   
803  C CB  . GLN B 5  ? 0.2281 0.2940 0.2565 0.0555  0.0148  -0.0112 228 GLN B CB  
804  C CG  . GLN B 5  ? 0.2397 0.3316 0.2619 0.0513  0.0134  -0.0181 228 GLN B CG  
805  C CD  . GLN B 5  ? 0.2584 0.3030 0.2728 0.0384  0.0423  -0.0020 228 GLN B CD  
806  O OE1 . GLN B 5  ? 0.2956 0.3773 0.3023 0.0689  0.0345  0.0161  228 GLN B OE1 
807  N NE2 . GLN B 5  ? 0.2347 0.3520 0.2939 0.0384  0.0058  0.0053  228 GLN B NE2 
808  N N   . ILE B 6  ? 0.1963 0.2742 0.1885 0.0527  0.0396  0.0105  229 ILE B N   
809  C CA  . ILE B 6  ? 0.1880 0.2362 0.2214 0.0484  0.0401  0.0116  229 ILE B CA  
810  C C   . ILE B 6  ? 0.2033 0.2454 0.2316 0.0659  0.0290  0.0011  229 ILE B C   
811  O O   . ILE B 6  ? 0.1720 0.2914 0.2700 0.0768  0.0338  0.0031  229 ILE B O   
812  C CB  . ILE B 6  ? 0.1890 0.2587 0.1962 0.0512  0.0376  0.0063  229 ILE B CB  
813  C CG1 . ILE B 6  ? 0.1522 0.2470 0.2367 0.0468  0.0456  0.0201  229 ILE B CG1 
814  C CG2 . ILE B 6  ? 0.1825 0.2619 0.2020 0.0595  0.0479  0.0169  229 ILE B CG2 
815  C CD1 . ILE B 6  ? 0.1804 0.2540 0.2081 0.0140  0.0291  0.0205  229 ILE B CD1 
816  N N   A CYS B 7  ? 0.2292 0.2225 0.2178 0.0748  0.0249  0.0061  230 CYS B N   
817  N N   B CYS B 7  ? 0.2260 0.2411 0.2303 0.0555  0.0194  0.0026  230 CYS B N   
818  C CA  A CYS B 7  ? 0.2728 0.2292 0.2328 0.0664  0.0132  0.0048  230 CYS B CA  
819  C CA  B CYS B 7  ? 0.2535 0.2437 0.2361 0.0449  0.0114  0.0043  230 CYS B CA  
820  C C   A CYS B 7  ? 0.2642 0.2164 0.2324 0.0646  0.0065  0.0071  230 CYS B C   
821  C C   B CYS B 7  ? 0.2549 0.2367 0.2317 0.0474  0.0127  0.0085  230 CYS B C   
822  O O   A CYS B 7  ? 0.2367 0.1938 0.2385 0.0926  0.0158  -0.0020 230 CYS B O   
823  O O   B CYS B 7  ? 0.2296 0.2161 0.2332 0.0572  0.0219  0.0132  230 CYS B O   
824  C CB  A CYS B 7  ? 0.2868 0.2249 0.2396 0.0451  0.0072  0.0143  230 CYS B CB  
825  C CB  B CYS B 7  ? 0.2727 0.2513 0.2343 0.0304  0.0075  0.0046  230 CYS B CB  
826  S SG  A CYS B 7  ? 0.4357 0.2349 0.2506 0.1177  0.0017  0.0001  230 CYS B SG  
827  S SG  B CYS B 7  ? 0.3171 0.2811 0.2836 0.0234  -0.0145 -0.0057 230 CYS B SG  
828  N N   . VAL B 8  ? 0.2617 0.2159 0.2129 0.0790  0.0175  0.0105  231 VAL B N   
829  C CA  . VAL B 8  ? 0.2486 0.2235 0.2026 0.0641  0.0228  0.0082  231 VAL B CA  
830  C C   . VAL B 8  ? 0.2274 0.2165 0.1862 0.0516  0.0207  0.0085  231 VAL B C   
831  O O   . VAL B 8  ? 0.1880 0.2177 0.2000 0.0472  0.0130  0.0121  231 VAL B O   
832  C CB  . VAL B 8  ? 0.2752 0.2145 0.1946 0.0323  0.0184  0.0278  231 VAL B CB  
833  C CG1 . VAL B 8  ? 0.3125 0.2635 0.1841 0.0603  0.0348  0.0214  231 VAL B CG1 
834  C CG2 . VAL B 8  ? 0.2896 0.2053 0.2396 0.0558  0.0103  -0.0030 231 VAL B CG2 
835  N N   . GLU B 9  ? 0.2201 0.2615 0.2071 0.0809  0.0134  0.0016  232 GLU B N   
836  C CA  . GLU B 9  ? 0.2103 0.2885 0.2003 0.0474  0.0093  0.0106  232 GLU B CA  
837  C C   . GLU B 9  ? 0.1948 0.2770 0.1863 0.0603  0.0010  0.0027  232 GLU B C   
838  O O   . GLU B 9  ? 0.2815 0.2934 0.2251 0.0718  0.0017  0.0198  232 GLU B O   
839  C CB  . GLU B 9  ? 0.2174 0.3183 0.2353 0.0608  0.0079  -0.0013 232 GLU B CB  
840  C CG  . GLU B 9  ? 0.2032 0.3329 0.2421 0.0661  0.0101  0.0074  232 GLU B CG  
841  C CD  . GLU B 9  ? 0.1918 0.3282 0.2299 0.0611  0.0520  -0.0055 232 GLU B CD  
842  O OE1 . GLU B 9  ? 0.2572 0.3743 0.2903 0.0474  -0.0068 0.0185  232 GLU B OE1 
843  O OE2 . GLU B 9  ? 0.2969 0.4024 0.2998 0.0443  0.0159  0.0170  232 GLU B OE2 
844  N N   . PRO B 10 ? 0.2169 0.2823 0.2043 0.0437  -0.0077 0.0057  233 PRO B N   
845  C CA  . PRO B 10 ? 0.2124 0.2851 0.2157 0.0462  -0.0114 -0.0133 233 PRO B CA  
846  C C   . PRO B 10 ? 0.2024 0.3207 0.2317 0.0557  -0.0136 -0.0053 233 PRO B C   
847  O O   . PRO B 10 ? 0.1877 0.3673 0.2384 0.0524  -0.0189 -0.0078 233 PRO B O   
848  C CB  . PRO B 10 ? 0.1978 0.2781 0.2177 0.0584  -0.0067 -0.0037 233 PRO B CB  
849  C CG  . PRO B 10 ? 0.2218 0.2750 0.2136 0.0187  0.0097  -0.0127 233 PRO B CG  
850  C CD  . PRO B 10 ? 0.1994 0.2722 0.2137 0.0335  0.0046  -0.0030 233 PRO B CD  
851  N N   . THR B 11 ? 0.2287 0.3214 0.2432 0.0439  -0.0263 0.0016  234 THR B N   
852  C CA  . THR B 11 ? 0.2459 0.3185 0.2410 0.0378  -0.0259 -0.0084 234 THR B CA  
853  C C   . THR B 11 ? 0.2229 0.3173 0.2494 0.0354  -0.0196 -0.0121 234 THR B C   
854  O O   . THR B 11 ? 0.2027 0.2941 0.2570 0.0558  -0.0189 -0.0047 234 THR B O   
855  C CB  . THR B 11 ? 0.2792 0.3062 0.2817 0.0328  -0.0247 -0.0072 234 THR B CB  
856  O OG1 . THR B 11 ? 0.3290 0.3294 0.3254 0.0381  -0.0268 -0.0402 234 THR B OG1 
857  C CG2 . THR B 11 ? 0.3458 0.3856 0.3175 0.0173  -0.0271 0.0015  234 THR B CG2 
858  N N   . SER B 12 ? 0.2016 0.3428 0.2559 0.0253  -0.0069 -0.0153 235 SER B N   
859  C CA  . SER B 12 ? 0.1987 0.3081 0.2424 0.0036  -0.0040 -0.0141 235 SER B CA  
860  C C   . SER B 12 ? 0.2330 0.2862 0.2299 0.0006  -0.0015 -0.0107 235 SER B C   
861  O O   . SER B 12 ? 0.2438 0.3160 0.2425 0.0230  0.0177  -0.0004 235 SER B O   
862  C CB  . SER B 12 ? 0.1992 0.3371 0.2450 -0.0206 0.0107  -0.0095 235 SER B CB  
863  O OG  . SER B 12 ? 0.2413 0.4130 0.2953 -0.0072 0.0066  0.0103  235 SER B OG  
864  N N   . GLN B 13 ? 0.1880 0.2850 0.2231 0.0031  0.0028  0.0053  236 GLN B N   
865  C CA  . GLN B 13 ? 0.2011 0.2616 0.2086 -0.0230 -0.0006 0.0017  236 GLN B CA  
866  C C   . GLN B 13 ? 0.2191 0.2821 0.2450 -0.0028 -0.0034 0.0001  236 GLN B C   
867  O O   . GLN B 13 ? 0.2170 0.2802 0.2261 -0.0189 -0.0121 0.0047  236 GLN B O   
868  C CB  . GLN B 13 ? 0.1999 0.2481 0.2432 -0.0057 -0.0105 -0.0127 236 GLN B CB  
869  C CG  . GLN B 13 ? 0.2364 0.2366 0.2452 -0.0129 0.0016  -0.0072 236 GLN B CG  
870  C CD  . GLN B 13 ? 0.2796 0.2436 0.2705 0.0060  0.0067  -0.0121 236 GLN B CD  
871  O OE1 . GLN B 13 ? 0.2900 0.2298 0.2793 0.0196  -0.0269 -0.0047 236 GLN B OE1 
872  N NE2 . GLN B 13 ? 0.3277 0.2613 0.2666 -0.0244 0.0162  -0.0289 236 GLN B NE2 
873  N N   . LYS B 14 ? 0.2211 0.2732 0.2390 -0.0040 -0.0135 0.0104  237 LYS B N   
874  C CA  . LYS B 14 ? 0.2025 0.2911 0.2404 -0.0142 -0.0207 0.0067  237 LYS B CA  
875  C C   . LYS B 14 ? 0.1987 0.2453 0.2182 -0.0153 -0.0151 -0.0002 237 LYS B C   
876  O O   . LYS B 14 ? 0.2207 0.2359 0.2434 0.0118  -0.0069 -0.0017 237 LYS B O   
877  C CB  . LYS B 14 ? 0.2133 0.3318 0.2559 -0.0168 -0.0286 0.0184  237 LYS B CB  
878  C CG  . LYS B 14 ? 0.2888 0.3974 0.3327 -0.0215 -0.0388 -0.0029 237 LYS B CG  
879  C CD  . LYS B 14 ? 0.3449 0.4632 0.4373 -0.0090 -0.0343 0.0077  237 LYS B CD  
880  C CE  . LYS B 14 ? 0.4121 0.4565 0.3893 -0.0054 -0.0040 -0.0097 237 LYS B CE  
881  N NZ  . LYS B 14 ? 0.4033 0.5200 0.4961 -0.0253 -0.0011 0.0204  237 LYS B NZ  
882  N N   . LEU B 15 ? 0.2027 0.2308 0.2208 -0.0036 -0.0144 0.0098  238 LEU B N   
883  C CA  . LEU B 15 ? 0.1935 0.1984 0.2042 -0.0042 -0.0112 -0.0025 238 LEU B CA  
884  C C   . LEU B 15 ? 0.2409 0.2116 0.2260 -0.0305 -0.0125 -0.0123 238 LEU B C   
885  O O   . LEU B 15 ? 0.2934 0.2473 0.2595 -0.0583 -0.0041 -0.0257 238 LEU B O   
886  C CB  . LEU B 15 ? 0.2274 0.2068 0.2146 0.0085  -0.0223 0.0043  238 LEU B CB  
887  C CG  . LEU B 15 ? 0.1955 0.1701 0.1993 -0.0067 -0.0296 -0.0002 238 LEU B CG  
888  C CD1 . LEU B 15 ? 0.2026 0.1966 0.1906 0.0094  -0.0151 0.0033  238 LEU B CD1 
889  C CD2 . LEU B 15 ? 0.1757 0.1750 0.2218 -0.0189 -0.0022 -0.0130 238 LEU B CD2 
890  N N   A MET B 16 ? 0.2444 0.2053 0.2132 -0.0180 0.0100  -0.0323 239 MET B N   
891  N N   B MET B 16 ? 0.2531 0.2240 0.2309 -0.0163 0.0111  -0.0277 239 MET B N   
892  C CA  A MET B 16 ? 0.2627 0.2404 0.2455 -0.0134 -0.0028 -0.0351 239 MET B CA  
893  C CA  B MET B 16 ? 0.2837 0.2706 0.2744 -0.0068 0.0024  -0.0303 239 MET B CA  
894  C C   A MET B 16 ? 0.2490 0.2130 0.2312 -0.0076 0.0097  -0.0357 239 MET B C   
895  C C   B MET B 16 ? 0.2608 0.2295 0.2458 -0.0056 0.0106  -0.0350 239 MET B C   
896  O O   A MET B 16 ? 0.2485 0.1973 0.2312 -0.0071 -0.0021 -0.0288 239 MET B O   
897  O O   B MET B 16 ? 0.2625 0.2206 0.2446 -0.0065 0.0003  -0.0296 239 MET B O   
898  C CB  A MET B 16 ? 0.2761 0.2370 0.2545 -0.0106 0.0018  -0.0273 239 MET B CB  
899  C CB  B MET B 16 ? 0.3003 0.2843 0.2857 0.0005  0.0102  -0.0214 239 MET B CB  
900  C CG  A MET B 16 ? 0.2786 0.2572 0.2726 0.0027  -0.0096 -0.0249 239 MET B CG  
901  C CG  B MET B 16 ? 0.3289 0.2992 0.3345 -0.0033 0.0120  -0.0189 239 MET B CG  
902  S SD  A MET B 16 ? 0.3551 0.3089 0.3434 -0.0224 -0.0155 -0.0127 239 MET B SD  
903  S SD  B MET B 16 ? 0.3826 0.3719 0.3723 0.0055  0.0040  0.0091  239 MET B SD  
904  C CE  A MET B 16 ? 0.3529 0.2829 0.2643 -0.0062 -0.0161 -0.0026 239 MET B CE  
905  C CE  B MET B 16 ? 0.3861 0.3704 0.3658 0.0145  0.0082  0.0043  239 MET B CE  
906  N N   . PRO B 17 ? 0.2602 0.2218 0.2576 -0.0092 -0.0043 -0.0499 240 PRO B N   
907  C CA  . PRO B 17 ? 0.2588 0.2121 0.2569 0.0015  0.0050  -0.0488 240 PRO B CA  
908  C C   . PRO B 17 ? 0.2577 0.1964 0.2479 0.0161  0.0114  -0.0446 240 PRO B C   
909  O O   . PRO B 17 ? 0.2783 0.1978 0.2373 0.0177  0.0294  -0.0453 240 PRO B O   
910  C CB  . PRO B 17 ? 0.2747 0.2305 0.2989 0.0061  0.0021  -0.0560 240 PRO B CB  
911  C CG  . PRO B 17 ? 0.2883 0.2443 0.2922 0.0147  0.0030  -0.0766 240 PRO B CG  
912  C CD  . PRO B 17 ? 0.2753 0.2504 0.2722 -0.0084 -0.0082 -0.0624 240 PRO B CD  
913  N N   . GLY B 18 ? 0.2263 0.1915 0.2358 0.0105  0.0293  -0.0507 241 GLY B N   
914  C CA  . GLY B 18 ? 0.2369 0.2038 0.2456 0.0131  0.0342  -0.0342 241 GLY B CA  
915  C C   . GLY B 18 ? 0.2140 0.1967 0.2379 0.0102  0.0254  -0.0265 241 GLY B C   
916  O O   . GLY B 18 ? 0.2233 0.2069 0.2949 -0.0033 0.0195  -0.0312 241 GLY B O   
917  N N   A SER B 19 ? 0.1967 0.1497 0.2049 0.0159  0.0315  -0.0339 242 SER B N   
918  N N   B SER B 19 ? 0.2006 0.1516 0.2104 0.0128  0.0301  -0.0295 242 SER B N   
919  C CA  A SER B 19 ? 0.1776 0.1454 0.1918 0.0170  0.0266  -0.0315 242 SER B CA  
920  C CA  B SER B 19 ? 0.1863 0.1469 0.2026 0.0131  0.0242  -0.0220 242 SER B CA  
921  C C   A SER B 19 ? 0.1855 0.1546 0.2137 0.0080  0.0185  0.0035  242 SER B C   
922  C C   B SER B 19 ? 0.1910 0.1636 0.2183 0.0024  0.0207  0.0108  242 SER B C   
923  O O   A SER B 19 ? 0.1725 0.1058 0.2073 0.0155  0.0176  -0.0309 242 SER B O   
924  O O   B SER B 19 ? 0.1698 0.1251 0.2255 0.0056  0.0302  -0.0173 242 SER B O   
925  C CB  A SER B 19 ? 0.1974 0.1529 0.2012 0.0199  0.0221  -0.0259 242 SER B CB  
926  C CB  B SER B 19 ? 0.2079 0.1464 0.2119 0.0155  0.0169  -0.0139 242 SER B CB  
927  O OG  A SER B 19 ? 0.1758 0.1709 0.1927 -0.0011 0.0239  -0.0158 242 SER B OG  
928  O OG  B SER B 19 ? 0.2282 0.1942 0.2361 0.0201  -0.0092 -0.0088 242 SER B OG  
929  N N   . THR B 20 ? 0.1968 0.1462 0.2073 0.0115  0.0271  -0.0063 243 THR B N   
930  C CA  . THR B 20 ? 0.1871 0.1529 0.1897 0.0180  0.0301  -0.0076 243 THR B CA  
931  C C   . THR B 20 ? 0.1858 0.1427 0.1991 0.0281  0.0354  -0.0017 243 THR B C   
932  O O   . THR B 20 ? 0.1723 0.1520 0.1990 0.0289  0.0332  0.0022  243 THR B O   
933  C CB  . THR B 20 ? 0.2012 0.1709 0.1811 -0.0033 0.0363  -0.0054 243 THR B CB  
934  O OG1 . THR B 20 ? 0.2253 0.2142 0.2366 -0.0365 0.0571  -0.0135 243 THR B OG1 
935  C CG2 . THR B 20 ? 0.2231 0.2187 0.2150 0.0113  0.0013  -0.0149 243 THR B CG2 
936  N N   . LEU B 21 ? 0.1640 0.1500 0.1905 0.0254  0.0386  0.0161  244 LEU B N   
937  C CA  . LEU B 21 ? 0.1901 0.1633 0.1817 0.0255  0.0372  0.0180  244 LEU B CA  
938  C C   . LEU B 21 ? 0.1739 0.1457 0.1992 0.0217  0.0347  0.0053  244 LEU B C   
939  O O   . LEU B 21 ? 0.1697 0.1634 0.1918 0.0148  0.0385  -0.0222 244 LEU B O   
940  C CB  . LEU B 21 ? 0.1825 0.1615 0.2063 0.0039  0.0232  -0.0048 244 LEU B CB  
941  C CG  . LEU B 21 ? 0.2028 0.1922 0.2453 0.0141  0.0158  0.0231  244 LEU B CG  
942  C CD1 . LEU B 21 ? 0.1957 0.2186 0.2583 0.0108  0.0173  -0.0019 244 LEU B CD1 
943  C CD2 . LEU B 21 ? 0.2320 0.2063 0.2745 0.0167  0.0097  0.0224  244 LEU B CD2 
944  N N   A VAL B 22 ? 0.2195 0.1637 0.1924 0.0241  0.0286  0.0040  245 VAL B N   
945  N N   B VAL B 22 ? 0.2195 0.1759 0.1917 0.0247  0.0274  0.0029  245 VAL B N   
946  C CA  A VAL B 22 ? 0.2108 0.1502 0.2139 0.0073  0.0424  -0.0062 245 VAL B CA  
947  C CA  B VAL B 22 ? 0.2148 0.1873 0.2077 0.0110  0.0345  -0.0021 245 VAL B CA  
948  C C   A VAL B 22 ? 0.2029 0.1725 0.2001 0.0135  0.0370  -0.0121 245 VAL B C   
949  C C   B VAL B 22 ? 0.2098 0.1986 0.1949 0.0193  0.0341  -0.0162 245 VAL B C   
950  O O   A VAL B 22 ? 0.2038 0.1316 0.2056 0.0377  0.0330  -0.0051 245 VAL B O   
951  O O   B VAL B 22 ? 0.2349 0.1895 0.1744 0.0299  0.0189  -0.0140 245 VAL B O   
952  C CB  A VAL B 22 ? 0.2355 0.1709 0.2363 -0.0039 0.0345  0.0056  245 VAL B CB  
953  C CB  B VAL B 22 ? 0.2190 0.1993 0.2413 0.0059  0.0289  -0.0017 245 VAL B CB  
954  C CG1 A VAL B 22 ? 0.2343 0.2005 0.2523 -0.0171 0.0447  -0.0200 245 VAL B CG1 
955  C CG1 B VAL B 22 ? 0.2218 0.1989 0.2429 -0.0178 0.0229  0.0135  245 VAL B CG1 
956  C CG2 A VAL B 22 ? 0.2406 0.1834 0.2496 -0.0244 0.0351  0.0066  245 VAL B CG2 
957  C CG2 B VAL B 22 ? 0.2471 0.2645 0.2591 0.0194  0.0135  0.0122  245 VAL B CG2 
958  N N   . LEU B 23 ? 0.1833 0.1806 0.1825 0.0124  0.0315  -0.0009 246 LEU B N   
959  C CA  . LEU B 23 ? 0.1668 0.1799 0.1829 0.0017  0.0203  -0.0099 246 LEU B CA  
960  C C   . LEU B 23 ? 0.1583 0.1773 0.1863 0.0056  0.0256  0.0037  246 LEU B C   
961  O O   . LEU B 23 ? 0.1522 0.1958 0.1944 0.0252  0.0336  -0.0250 246 LEU B O   
962  C CB  . LEU B 23 ? 0.1872 0.1944 0.2048 -0.0043 0.0196  -0.0034 246 LEU B CB  
963  C CG  . LEU B 23 ? 0.1805 0.2159 0.2197 -0.0102 0.0390  -0.0109 246 LEU B CG  
964  C CD1 . LEU B 23 ? 0.2073 0.2200 0.2934 -0.0042 0.0018  0.0008  246 LEU B CD1 
965  C CD2 . LEU B 23 ? 0.1986 0.2676 0.3096 0.0058  0.0076  -0.0088 246 LEU B CD2 
966  N N   . GLN B 24 ? 0.1666 0.1767 0.1789 0.0252  0.0341  0.0047  247 GLN B N   
967  C CA  . GLN B 24 ? 0.1714 0.1684 0.1632 0.0077  0.0440  0.0086  247 GLN B CA  
968  C C   . GLN B 24 ? 0.1495 0.1630 0.1843 0.0335  0.0273  -0.0011 247 GLN B C   
969  O O   . GLN B 24 ? 0.1763 0.2090 0.1723 0.0308  0.0308  0.0121  247 GLN B O   
970  C CB  . GLN B 24 ? 0.1875 0.1688 0.1901 0.0094  0.0248  0.0153  247 GLN B CB  
971  C CG  . GLN B 24 ? 0.2454 0.1689 0.1889 0.0100  0.0500  -0.0014 247 GLN B CG  
972  C CD  . GLN B 24 ? 0.2266 0.2087 0.1850 -0.0077 0.0344  -0.0020 247 GLN B CD  
973  O OE1 . GLN B 24 ? 0.3269 0.2503 0.2708 0.0265  -0.0127 0.0271  247 GLN B OE1 
974  N NE2 . GLN B 24 ? 0.2313 0.1817 0.2055 -0.0264 -0.0016 0.0051  247 GLN B NE2 
975  N N   . CYS B 25 ? 0.1669 0.1643 0.1618 0.0335  0.0331  0.0100  248 CYS B N   
976  C CA  . CYS B 25 ? 0.1747 0.1713 0.1623 0.0180  0.0344  0.0123  248 CYS B CA  
977  C C   . CYS B 25 ? 0.1668 0.1640 0.1957 0.0225  0.0347  0.0157  248 CYS B C   
978  O O   . CYS B 25 ? 0.1735 0.1724 0.1951 0.0352  0.0462  -0.0055 248 CYS B O   
979  C CB  . CYS B 25 ? 0.1770 0.1758 0.1772 0.0175  0.0560  0.0197  248 CYS B CB  
980  S SG  . CYS B 25 ? 0.1907 0.2155 0.1789 0.0231  0.0449  0.0236  248 CYS B SG  
981  N N   . VAL B 26 ? 0.2130 0.1681 0.1775 0.0357  0.0255  0.0037  249 VAL B N   
982  C CA  . VAL B 26 ? 0.2117 0.1760 0.1950 0.0311  0.0299  -0.0041 249 VAL B CA  
983  C C   . VAL B 26 ? 0.2084 0.1666 0.1891 0.0528  0.0190  -0.0093 249 VAL B C   
984  O O   . VAL B 26 ? 0.2052 0.2245 0.1920 0.0611  0.0216  0.0060  249 VAL B O   
985  C CB  . VAL B 26 ? 0.2358 0.1733 0.2183 0.0312  0.0432  0.0028  249 VAL B CB  
986  C CG1 . VAL B 26 ? 0.2949 0.1864 0.2462 0.0013  0.0393  -0.0221 249 VAL B CG1 
987  C CG2 . VAL B 26 ? 0.2676 0.1910 0.2345 0.0135  0.0583  0.0054  249 VAL B CG2 
988  N N   . ALA B 27 ? 0.2069 0.1731 0.1859 0.0306  0.0190  0.0005  250 ALA B N   
989  C CA  . ALA B 27 ? 0.2180 0.1913 0.1941 0.0094  0.0080  0.0072  250 ALA B CA  
990  C C   . ALA B 27 ? 0.2126 0.1823 0.1959 0.0144  0.0201  -0.0044 250 ALA B C   
991  O O   . ALA B 27 ? 0.2138 0.2177 0.2138 -0.0234 0.0082  -0.0027 250 ALA B O   
992  C CB  . ALA B 27 ? 0.2052 0.1909 0.2121 0.0283  0.0018  0.0123  250 ALA B CB  
993  N N   . VAL B 28 ? 0.2552 0.2203 0.1939 0.0094  0.0279  -0.0022 251 VAL B N   
994  C CA  . VAL B 28 ? 0.2966 0.2127 0.2236 -0.0015 0.0134  -0.0120 251 VAL B CA  
995  C C   . VAL B 28 ? 0.2527 0.2224 0.1933 -0.0044 0.0043  -0.0157 251 VAL B C   
996  O O   . VAL B 28 ? 0.2239 0.2422 0.2091 -0.0001 0.0252  -0.0004 251 VAL B O   
997  C CB  . VAL B 28 ? 0.3114 0.2320 0.2449 -0.0002 0.0025  -0.0062 251 VAL B CB  
998  C CG1 . VAL B 28 ? 0.3938 0.2667 0.3030 -0.0016 0.0078  0.0063  251 VAL B CG1 
999  C CG2 . VAL B 28 ? 0.3297 0.2283 0.2849 0.0360  0.0069  -0.0120 251 VAL B CG2 
1000 N N   . GLY B 29 ? 0.2705 0.2495 0.2061 -0.0259 0.0206  -0.0068 252 GLY B N   
1001 C CA  . GLY B 29 ? 0.2507 0.2404 0.2101 -0.0070 0.0179  0.0036  252 GLY B CA  
1002 C C   . GLY B 29 ? 0.2455 0.2154 0.2145 -0.0037 0.0300  -0.0232 252 GLY B C   
1003 O O   . GLY B 29 ? 0.2652 0.1995 0.2041 -0.0195 0.0366  -0.0163 252 GLY B O   
1004 N N   . SER B 30 ? 0.2237 0.2013 0.2131 -0.0015 0.0296  -0.0193 253 SER B N   
1005 C CA  . SER B 30 ? 0.2352 0.2229 0.2190 0.0092  0.0278  -0.0252 253 SER B CA  
1006 C C   . SER B 30 ? 0.2046 0.2412 0.1983 0.0007  0.0362  -0.0109 253 SER B C   
1007 O O   . SER B 30 ? 0.2313 0.2745 0.2266 0.0126  0.0553  0.0011  253 SER B O   
1008 C CB  . SER B 30 ? 0.2350 0.2321 0.2329 -0.0097 0.0010  -0.0142 253 SER B CB  
1009 O OG  . SER B 30 ? 0.2925 0.3060 0.2916 0.0065  -0.0296 -0.0389 253 SER B OG  
1010 N N   . PRO B 31 ? 0.2121 0.2209 0.1900 -0.0303 0.0227  -0.0067 254 PRO B N   
1011 C CA  . PRO B 31 ? 0.1874 0.2159 0.1827 -0.0172 0.0207  -0.0065 254 PRO B CA  
1012 C C   . PRO B 31 ? 0.1556 0.1729 0.1916 -0.0373 0.0168  -0.0158 254 PRO B C   
1013 O O   . PRO B 31 ? 0.1606 0.1911 0.1791 -0.0195 0.0328  -0.0129 254 PRO B O   
1014 C CB  . PRO B 31 ? 0.2336 0.2286 0.2115 -0.0180 0.0249  0.0080  254 PRO B CB  
1015 C CG  . PRO B 31 ? 0.2519 0.2495 0.2143 -0.0122 0.0131  0.0042  254 PRO B CG  
1016 C CD  . PRO B 31 ? 0.2392 0.2288 0.1941 -0.0168 0.0311  0.0092  254 PRO B CD  
1017 N N   . ILE B 32 ? 0.1524 0.2119 0.1851 -0.0266 0.0136  -0.0191 255 ILE B N   
1018 C CA  . ILE B 32 ? 0.1820 0.2133 0.1835 -0.0330 0.0016  -0.0194 255 ILE B CA  
1019 C C   . ILE B 32 ? 0.1396 0.1849 0.1992 -0.0194 0.0181  -0.0064 255 ILE B C   
1020 O O   . ILE B 32 ? 0.1833 0.2059 0.2012 0.0056  0.0036  -0.0112 255 ILE B O   
1021 C CB  . ILE B 32 ? 0.1567 0.2435 0.1976 -0.0509 0.0097  -0.0266 255 ILE B CB  
1022 C CG1 . ILE B 32 ? 0.1646 0.2799 0.2342 -0.0783 0.0127  -0.0188 255 ILE B CG1 
1023 C CG2 . ILE B 32 ? 0.2027 0.2849 0.2052 -0.0799 0.0269  -0.0213 255 ILE B CG2 
1024 C CD1 . ILE B 32 ? 0.1646 0.3407 0.2684 -0.0736 -0.0272 -0.0216 255 ILE B CD1 
1025 N N   . PRO B 33 ? 0.1540 0.1703 0.1846 -0.0141 0.0087  -0.0151 256 PRO B N   
1026 C CA  . PRO B 33 ? 0.1415 0.1958 0.1876 -0.0062 0.0066  -0.0274 256 PRO B CA  
1027 C C   . PRO B 33 ? 0.1284 0.1912 0.1614 -0.0085 0.0185  -0.0205 256 PRO B C   
1028 O O   . PRO B 33 ? 0.1571 0.2011 0.1853 -0.0500 0.0419  -0.0230 256 PRO B O   
1029 C CB  . PRO B 33 ? 0.1829 0.2007 0.2238 0.0052  -0.0200 -0.0398 256 PRO B CB  
1030 C CG  . PRO B 33 ? 0.2072 0.2460 0.2597 0.0067  -0.0402 -0.0514 256 PRO B CG  
1031 C CD  . PRO B 33 ? 0.1751 0.1999 0.2224 -0.0024 -0.0305 -0.0217 256 PRO B CD  
1032 N N   . HIS B 34 ? 0.1346 0.1497 0.1743 -0.0012 0.0313  -0.0192 257 HIS B N   
1033 C CA  . HIS B 34 ? 0.1290 0.1685 0.1749 0.0118  0.0034  -0.0244 257 HIS B CA  
1034 C C   . HIS B 34 ? 0.1026 0.1479 0.1767 0.0011  0.0143  -0.0032 257 HIS B C   
1035 O O   . HIS B 34 ? 0.1173 0.1716 0.1753 -0.0075 0.0116  -0.0035 257 HIS B O   
1036 C CB  . HIS B 34 ? 0.1989 0.1990 0.2001 0.0278  -0.0257 -0.0425 257 HIS B CB  
1037 C CG  . HIS B 34 ? 0.2054 0.2639 0.2636 0.0437  -0.0351 -0.0214 257 HIS B CG  
1038 N ND1 . HIS B 34 ? 0.1963 0.3818 0.2842 -0.0034 -0.0590 -0.0373 257 HIS B ND1 
1039 C CD2 . HIS B 34 ? 0.2517 0.3407 0.2808 -0.0092 -0.0336 -0.0237 257 HIS B CD2 
1040 C CE1 . HIS B 34 ? 0.2734 0.4090 0.2863 0.0218  -0.0385 -0.0347 257 HIS B CE1 
1041 N NE2 . HIS B 34 ? 0.2654 0.3938 0.3060 -0.0149 -0.0416 -0.0393 257 HIS B NE2 
1042 N N   . TYR B 35 ? 0.1093 0.1689 0.1772 -0.0101 0.0177  -0.0179 258 TYR B N   
1043 C CA  . TYR B 35 ? 0.1156 0.1525 0.1673 0.0100  0.0078  -0.0205 258 TYR B CA  
1044 C C   . TYR B 35 ? 0.1241 0.1867 0.1818 0.0156  0.0162  -0.0167 258 TYR B C   
1045 O O   . TYR B 35 ? 0.1180 0.1920 0.1880 0.0264  0.0138  -0.0251 258 TYR B O   
1046 C CB  . TYR B 35 ? 0.1245 0.1620 0.1825 0.0139  0.0313  -0.0111 258 TYR B CB  
1047 C CG  . TYR B 35 ? 0.1117 0.1618 0.1615 -0.0096 0.0201  -0.0137 258 TYR B CG  
1048 C CD1 . TYR B 35 ? 0.1165 0.1741 0.1788 0.0035  0.0358  0.0122  258 TYR B CD1 
1049 C CD2 . TYR B 35 ? 0.1375 0.1743 0.1853 -0.0069 0.0183  0.0039  258 TYR B CD2 
1050 C CE1 . TYR B 35 ? 0.1404 0.1654 0.1898 -0.0044 0.0242  -0.0054 258 TYR B CE1 
1051 C CE2 . TYR B 35 ? 0.1464 0.1633 0.2122 0.0072  0.0210  -0.0037 258 TYR B CE2 
1052 C CZ  . TYR B 35 ? 0.1292 0.1607 0.1914 0.0106  0.0196  0.0100  258 TYR B CZ  
1053 O OH  . TYR B 35 ? 0.1968 0.1567 0.2168 0.0208  0.0140  -0.0113 258 TYR B OH  
1054 N N   . GLN B 36 ? 0.1223 0.1611 0.1701 0.0067  0.0001  -0.0089 259 GLN B N   
1055 C CA  . GLN B 36 ? 0.1330 0.1455 0.1719 0.0152  -0.0021 -0.0109 259 GLN B CA  
1056 C C   . GLN B 36 ? 0.1242 0.1582 0.1840 0.0076  0.0110  -0.0096 259 GLN B C   
1057 O O   . GLN B 36 ? 0.1344 0.1571 0.1726 0.0050  0.0024  -0.0100 259 GLN B O   
1058 C CB  . GLN B 36 ? 0.1826 0.1717 0.1894 0.0234  0.0015  0.0038  259 GLN B CB  
1059 C CG  . GLN B 36 ? 0.2117 0.1703 0.1943 0.0277  -0.0106 0.0000  259 GLN B CG  
1060 C CD  . GLN B 36 ? 0.1650 0.1684 0.2433 0.0289  -0.0286 -0.0245 259 GLN B CD  
1061 O OE1 . GLN B 36 ? 0.1720 0.2043 0.2571 0.0659  -0.0285 -0.0455 259 GLN B OE1 
1062 N NE2 . GLN B 36 ? 0.2492 0.1900 0.2298 0.0464  -0.0007 0.0017  259 GLN B NE2 
1063 N N   . TRP B 37 ? 0.1271 0.1454 0.1673 0.0032  0.0048  -0.0118 260 TRP B N   
1064 C CA  . TRP B 37 ? 0.1510 0.1591 0.1805 -0.0019 0.0011  -0.0004 260 TRP B CA  
1065 C C   . TRP B 37 ? 0.1773 0.1583 0.1771 0.0043  -0.0055 -0.0066 260 TRP B C   
1066 O O   . TRP B 37 ? 0.2021 0.1639 0.1962 0.0032  -0.0248 -0.0080 260 TRP B O   
1067 C CB  . TRP B 37 ? 0.1305 0.1733 0.1806 0.0051  0.0049  0.0008  260 TRP B CB  
1068 C CG  . TRP B 37 ? 0.1239 0.1535 0.1693 0.0017  0.0213  -0.0086 260 TRP B CG  
1069 C CD1 . TRP B 37 ? 0.1237 0.1517 0.1655 0.0138  0.0254  -0.0032 260 TRP B CD1 
1070 C CD2 . TRP B 37 ? 0.1205 0.1677 0.1768 0.0086  0.0331  0.0088  260 TRP B CD2 
1071 N NE1 . TRP B 37 ? 0.1107 0.1710 0.1741 -0.0045 0.0268  -0.0021 260 TRP B NE1 
1072 C CE2 . TRP B 37 ? 0.1295 0.1485 0.1748 0.0091  0.0176  0.0134  260 TRP B CE2 
1073 C CE3 . TRP B 37 ? 0.1391 0.1889 0.1612 0.0149  -0.0063 0.0109  260 TRP B CE3 
1074 C CZ2 . TRP B 37 ? 0.1442 0.1811 0.1846 -0.0022 0.0341  0.0199  260 TRP B CZ2 
1075 C CZ3 . TRP B 37 ? 0.1269 0.1935 0.1720 0.0073  0.0172  -0.0008 260 TRP B CZ3 
1076 C CH2 . TRP B 37 ? 0.1521 0.1725 0.1836 0.0183  0.0166  0.0034  260 TRP B CH2 
1077 N N   . PHE B 38 ? 0.1798 0.1733 0.1906 -0.0408 -0.0109 0.0069  261 PHE B N   
1078 C CA  . PHE B 38 ? 0.2004 0.1955 0.2030 -0.0264 -0.0039 -0.0120 261 PHE B CA  
1079 C C   . PHE B 38 ? 0.2111 0.1916 0.2076 -0.0430 -0.0101 0.0036  261 PHE B C   
1080 O O   . PHE B 38 ? 0.1993 0.2031 0.2037 -0.0302 -0.0226 -0.0108 261 PHE B O   
1081 C CB  . PHE B 38 ? 0.2190 0.2165 0.1974 -0.0359 0.0001  -0.0050 261 PHE B CB  
1082 C CG  . PHE B 38 ? 0.2190 0.1962 0.2152 -0.0472 0.0037  -0.0037 261 PHE B CG  
1083 C CD1 . PHE B 38 ? 0.2975 0.1957 0.2149 -0.0417 0.0027  0.0019  261 PHE B CD1 
1084 C CD2 . PHE B 38 ? 0.1858 0.1721 0.2272 -0.0444 -0.0016 -0.0230 261 PHE B CD2 
1085 C CE1 . PHE B 38 ? 0.3090 0.2126 0.2207 -0.0328 0.0035  0.0011  261 PHE B CE1 
1086 C CE2 . PHE B 38 ? 0.2160 0.2067 0.2073 -0.0212 0.0163  0.0053  261 PHE B CE2 
1087 C CZ  . PHE B 38 ? 0.2600 0.2044 0.2040 -0.0168 -0.0062 0.0099  261 PHE B CZ  
1088 N N   . LYS B 39 ? 0.2465 0.1946 0.2151 -0.0634 -0.0164 -0.0183 262 LYS B N   
1089 C CA  . LYS B 39 ? 0.2771 0.2346 0.2293 -0.0724 -0.0201 -0.0080 262 LYS B CA  
1090 C C   . LYS B 39 ? 0.3014 0.2727 0.2551 -0.0695 -0.0417 -0.0012 262 LYS B C   
1091 O O   . LYS B 39 ? 0.3346 0.2016 0.2515 -0.1024 -0.0483 0.0020  262 LYS B O   
1092 C CB  . LYS B 39 ? 0.3048 0.2182 0.2137 -0.0596 -0.0028 -0.0119 262 LYS B CB  
1093 C CG  . LYS B 39 ? 0.3498 0.2639 0.2639 -0.0536 -0.0082 -0.0214 262 LYS B CG  
1094 C CD  . LYS B 39 ? 0.4027 0.3525 0.3110 -0.0335 0.0192  0.0007  262 LYS B CD  
1095 C CE  . LYS B 39 ? 0.4617 0.4270 0.4258 -0.0049 -0.0040 -0.0281 262 LYS B CE  
1096 N NZ  . LYS B 39 ? 0.5023 0.4629 0.4145 0.0002  0.0024  -0.0006 262 LYS B NZ  
1097 N N   . ASN B 40 ? 0.2860 0.2727 0.2860 -0.1028 -0.0325 0.0093  263 ASN B N   
1098 C CA  . ASN B 40 ? 0.3180 0.2708 0.3050 -0.0783 -0.0290 0.0047  263 ASN B CA  
1099 C C   . ASN B 40 ? 0.3388 0.2955 0.3253 -0.0558 -0.0132 0.0171  263 ASN B C   
1100 O O   . ASN B 40 ? 0.3636 0.3063 0.3301 -0.0526 -0.0301 0.0276  263 ASN B O   
1101 C CB  . ASN B 40 ? 0.3396 0.3029 0.3412 -0.0598 -0.0184 0.0036  263 ASN B CB  
1102 C CG  . ASN B 40 ? 0.3394 0.2937 0.3287 -0.0616 -0.0307 -0.0192 263 ASN B CG  
1103 O OD1 . ASN B 40 ? 0.3203 0.3421 0.3524 -0.0705 -0.0639 -0.0064 263 ASN B OD1 
1104 N ND2 . ASN B 40 ? 0.4281 0.4054 0.3862 -0.0251 -0.0186 -0.0129 263 ASN B ND2 
1105 N N   . GLU B 41 ? 0.3380 0.3132 0.3123 -0.0655 -0.0222 0.0246  264 GLU B N   
1106 C CA  . GLU B 41 ? 0.3497 0.3017 0.3149 -0.0499 -0.0182 0.0226  264 GLU B CA  
1107 C C   . GLU B 41 ? 0.3585 0.3052 0.2952 -0.0397 -0.0151 0.0167  264 GLU B C   
1108 O O   . GLU B 41 ? 0.3883 0.3383 0.3104 -0.0321 -0.0148 0.0532  264 GLU B O   
1109 C CB  . GLU B 41 ? 0.3624 0.3351 0.3373 -0.0388 -0.0108 0.0267  264 GLU B CB  
1110 C CG  . GLU B 41 ? 0.3566 0.3859 0.3588 -0.0401 -0.0097 0.0280  264 GLU B CG  
1111 C CD  . GLU B 41 ? 0.4339 0.4086 0.4284 -0.0248 -0.0246 -0.0002 264 GLU B CD  
1112 O OE1 . GLU B 41 ? 0.4773 0.5083 0.4482 -0.0192 -0.0273 -0.0027 264 GLU B OE1 
1113 O OE2 . GLU B 41 ? 0.4393 0.4549 0.4620 -0.0153 -0.0175 0.0065  264 GLU B OE2 
1114 N N   . LEU B 42 ? 0.3325 0.2048 0.2635 -0.0566 -0.0168 -0.0133 265 LEU B N   
1115 C CA  . LEU B 42 ? 0.3521 0.2103 0.2644 -0.0226 -0.0204 -0.0113 265 LEU B CA  
1116 C C   . LEU B 42 ? 0.3337 0.1940 0.2430 -0.0245 -0.0208 -0.0063 265 LEU B C   
1117 O O   . LEU B 42 ? 0.3329 0.1739 0.2060 -0.0389 -0.0254 -0.0061 265 LEU B O   
1118 C CB  . LEU B 42 ? 0.3569 0.2144 0.2978 -0.0185 -0.0274 -0.0271 265 LEU B CB  
1119 C CG  . LEU B 42 ? 0.3926 0.2632 0.3177 -0.0171 -0.0168 -0.0329 265 LEU B CG  
1120 C CD1 . LEU B 42 ? 0.4342 0.3007 0.3600 -0.0010 -0.0135 -0.0199 265 LEU B CD1 
1121 C CD2 . LEU B 42 ? 0.4019 0.2990 0.3921 -0.0171 -0.0081 0.0170  265 LEU B CD2 
1122 N N   . PRO B 43 ? 0.3320 0.2059 0.2326 -0.0064 -0.0092 0.0089  266 PRO B N   
1123 C CA  . PRO B 43 ? 0.3240 0.2037 0.2270 0.0074  -0.0071 -0.0054 266 PRO B CA  
1124 C C   . PRO B 43 ? 0.3172 0.1868 0.2415 0.0273  0.0082  -0.0162 266 PRO B C   
1125 O O   . PRO B 43 ? 0.3512 0.1745 0.2762 0.0433  0.0205  -0.0198 266 PRO B O   
1126 C CB  . PRO B 43 ? 0.3213 0.2291 0.2283 0.0187  -0.0167 0.0037  266 PRO B CB  
1127 C CG  . PRO B 43 ? 0.3486 0.2492 0.2522 0.0137  -0.0371 0.0050  266 PRO B CG  
1128 C CD  . PRO B 43 ? 0.3297 0.2041 0.2639 -0.0053 -0.0224 0.0180  266 PRO B CD  
1129 N N   . LEU B 44 ? 0.2916 0.1597 0.2223 0.0264  0.0059  -0.0268 267 LEU B N   
1130 C CA  . LEU B 44 ? 0.2568 0.1895 0.2336 0.0221  0.0034  -0.0175 267 LEU B CA  
1131 C C   . LEU B 44 ? 0.2657 0.2137 0.2725 0.0532  -0.0007 -0.0159 267 LEU B C   
1132 O O   . LEU B 44 ? 0.2628 0.2238 0.2443 0.0435  -0.0061 -0.0165 267 LEU B O   
1133 C CB  . LEU B 44 ? 0.2402 0.2025 0.2215 0.0252  -0.0046 -0.0232 267 LEU B CB  
1134 C CG  . LEU B 44 ? 0.2184 0.2046 0.2328 -0.0037 -0.0067 -0.0207 267 LEU B CG  
1135 C CD1 . LEU B 44 ? 0.2568 0.1934 0.2419 0.0011  -0.0073 -0.0057 267 LEU B CD1 
1136 C CD2 . LEU B 44 ? 0.3059 0.2464 0.2472 0.0294  0.0024  -0.0556 267 LEU B CD2 
1137 N N   . THR B 45 ? 0.2879 0.2407 0.3023 0.0658  -0.0073 -0.0332 268 THR B N   
1138 C CA  . THR B 45 ? 0.2810 0.2762 0.3397 0.0711  0.0040  -0.0267 268 THR B CA  
1139 C C   . THR B 45 ? 0.2545 0.2676 0.3344 0.0813  -0.0058 -0.0082 268 THR B C   
1140 O O   . THR B 45 ? 0.2748 0.3348 0.3633 0.0457  0.0227  -0.0241 268 THR B O   
1141 C CB  . THR B 45 ? 0.2877 0.2951 0.3335 0.0792  0.0115  -0.0279 268 THR B CB  
1142 O OG1 . THR B 45 ? 0.3724 0.3308 0.4021 0.0675  -0.0079 -0.0314 268 THR B OG1 
1143 C CG2 . THR B 45 ? 0.3528 0.3496 0.3765 0.0526  0.0121  -0.0184 268 THR B CG2 
1144 N N   . HIS B 46 ? 0.2435 0.2567 0.3598 0.0886  -0.0055 -0.0252 269 HIS B N   
1145 C CA  . HIS B 46 ? 0.2300 0.2879 0.3717 0.0599  -0.0116 0.0073  269 HIS B CA  
1146 C C   . HIS B 46 ? 0.2092 0.2607 0.3483 0.0632  -0.0046 0.0040  269 HIS B C   
1147 O O   . HIS B 46 ? 0.2208 0.3402 0.4237 0.0424  -0.0164 0.0263  269 HIS B O   
1148 C CB  . HIS B 46 ? 0.2654 0.3207 0.4033 0.0557  -0.0085 0.0069  269 HIS B CB  
1149 N N   . GLU B 47 ? 0.1742 0.2374 0.2393 0.0557  0.0236  -0.0029 270 GLU B N   
1150 C CA  . GLU B 47 ? 0.1633 0.1847 0.2071 0.0393  0.0105  -0.0200 270 GLU B CA  
1151 C C   . GLU B 47 ? 0.1370 0.1966 0.1965 0.0237  0.0229  0.0009  270 GLU B C   
1152 O O   . GLU B 47 ? 0.1457 0.1968 0.2132 0.0225  0.0220  -0.0032 270 GLU B O   
1153 C CB  . GLU B 47 ? 0.1581 0.1941 0.2079 0.0286  0.0211  -0.0259 270 GLU B CB  
1154 C CG  . GLU B 47 ? 0.1601 0.2266 0.2237 0.0066  0.0264  -0.0345 270 GLU B CG  
1155 C CD  . GLU B 47 ? 0.1911 0.2234 0.1963 0.0415  0.0272  -0.0241 270 GLU B CD  
1156 O OE1 . GLU B 47 ? 0.1730 0.2451 0.2470 0.0168  0.0209  -0.0098 270 GLU B OE1 
1157 O OE2 . GLU B 47 ? 0.3403 0.3689 0.3492 -0.0257 -0.0526 0.0177  270 GLU B OE2 
1158 N N   . THR B 48 ? 0.1380 0.2143 0.2038 0.0256  0.0085  -0.0174 271 THR B N   
1159 C CA  . THR B 48 ? 0.1258 0.2218 0.2135 0.0216  0.0025  -0.0194 271 THR B CA  
1160 C C   . THR B 48 ? 0.1188 0.2240 0.2098 0.0089  0.0169  -0.0104 271 THR B C   
1161 O O   . THR B 48 ? 0.1549 0.2400 0.2142 -0.0022 -0.0055 -0.0204 271 THR B O   
1162 C CB  . THR B 48 ? 0.1684 0.2361 0.2151 0.0351  0.0064  -0.0043 271 THR B CB  
1163 O OG1 . THR B 48 ? 0.1375 0.3053 0.2640 0.0320  0.0015  -0.0125 271 THR B OG1 
1164 C CG2 . THR B 48 ? 0.1928 0.2405 0.2312 0.0494  -0.0014 -0.0186 271 THR B CG2 
1165 N N   A LYS B 49 ? 0.1421 0.2175 0.2231 -0.0045 0.0093  -0.0114 272 LYS B N   
1166 N N   B LYS B 49 ? 0.1305 0.2071 0.2147 -0.0074 0.0144  -0.0107 272 LYS B N   
1167 C CA  A LYS B 49 ? 0.1649 0.2217 0.2353 -0.0039 -0.0007 -0.0121 272 LYS B CA  
1168 C CA  B LYS B 49 ? 0.1441 0.2045 0.2079 -0.0107 0.0017  -0.0107 272 LYS B CA  
1169 C C   A LYS B 49 ? 0.1502 0.1841 0.2074 -0.0047 0.0036  -0.0120 272 LYS B C   
1170 C C   B LYS B 49 ? 0.1425 0.1749 0.1934 -0.0050 0.0087  -0.0128 272 LYS B C   
1171 O O   A LYS B 49 ? 0.0996 0.1823 0.2081 -0.0256 0.0004  -0.0088 272 LYS B O   
1172 O O   B LYS B 49 ? 0.0992 0.1627 0.1798 -0.0200 0.0148  -0.0168 272 LYS B O   
1173 C CB  A LYS B 49 ? 0.1801 0.2338 0.2325 0.0018  0.0015  -0.0161 272 LYS B CB  
1174 C CB  B LYS B 49 ? 0.1438 0.2151 0.2267 -0.0126 0.0061  -0.0077 272 LYS B CB  
1175 C CG  A LYS B 49 ? 0.1944 0.2606 0.2573 -0.0044 0.0025  0.0007  272 LYS B CG  
1176 C CG  B LYS B 49 ? 0.1633 0.2638 0.2140 -0.0156 0.0285  0.0050  272 LYS B CG  
1177 C CD  A LYS B 49 ? 0.1695 0.2693 0.2871 -0.0129 0.0112  -0.0152 272 LYS B CD  
1178 C CD  B LYS B 49 ? 0.2565 0.2848 0.2624 0.0077  -0.0141 -0.0195 272 LYS B CD  
1179 C CE  A LYS B 49 ? 0.2131 0.2935 0.3085 -0.0092 -0.0082 -0.0063 272 LYS B CE  
1180 C CE  B LYS B 49 ? 0.2923 0.3241 0.3177 -0.0033 -0.0153 0.0012  272 LYS B CE  
1181 N NZ  A LYS B 49 ? 0.3410 0.3379 0.3575 -0.0108 -0.0157 -0.0128 272 LYS B NZ  
1182 N NZ  B LYS B 49 ? 0.3348 0.3183 0.3389 -0.0298 -0.0090 0.0040  272 LYS B NZ  
1183 N N   . LYS B 50 ? 0.1666 0.1773 0.2161 -0.0107 0.0108  -0.0078 273 LYS B N   
1184 C CA  . LYS B 50 ? 0.1876 0.1814 0.2061 -0.0049 0.0111  -0.0124 273 LYS B CA  
1185 C C   . LYS B 50 ? 0.1633 0.1727 0.1970 0.0009  0.0204  0.0109  273 LYS B C   
1186 O O   . LYS B 50 ? 0.1859 0.2136 0.1786 0.0408  0.0299  0.0051  273 LYS B O   
1187 C CB  . LYS B 50 ? 0.2042 0.1696 0.2241 -0.0049 0.0222  -0.0262 273 LYS B CB  
1188 C CG  . LYS B 50 ? 0.2151 0.1924 0.2226 -0.0089 0.0229  -0.0247 273 LYS B CG  
1189 C CD  . LYS B 50 ? 0.2349 0.2054 0.2627 -0.0123 0.0007  -0.0393 273 LYS B CD  
1190 C CE  . LYS B 50 ? 0.2967 0.2722 0.3232 -0.0028 -0.0074 -0.0113 273 LYS B CE  
1191 N NZ  . LYS B 50 ? 0.3026 0.3490 0.3527 -0.0023 -0.0353 -0.0114 273 LYS B NZ  
1192 N N   . LEU B 51 ? 0.1555 0.1939 0.2009 -0.0276 0.0342  -0.0013 274 LEU B N   
1193 C CA  . LEU B 51 ? 0.1741 0.2055 0.1936 -0.0148 0.0352  0.0047  274 LEU B CA  
1194 C C   . LEU B 51 ? 0.1613 0.2095 0.1858 0.0083  0.0230  -0.0044 274 LEU B C   
1195 O O   . LEU B 51 ? 0.1695 0.2233 0.2024 0.0086  0.0081  -0.0070 274 LEU B O   
1196 C CB  . LEU B 51 ? 0.2064 0.2157 0.2145 -0.0189 0.0401  0.0197  274 LEU B CB  
1197 C CG  . LEU B 51 ? 0.1943 0.2354 0.2736 -0.0264 0.0424  -0.0003 274 LEU B CG  
1198 C CD1 . LEU B 51 ? 0.2161 0.2524 0.3843 -0.0204 0.0357  0.0204  274 LEU B CD1 
1199 C CD2 . LEU B 51 ? 0.2246 0.2195 0.3660 0.0004  -0.0024 0.0083  274 LEU B CD2 
1200 N N   . TYR B 52 ? 0.1707 0.2065 0.1840 0.0157  0.0184  -0.0141 275 TYR B N   
1201 C CA  . TYR B 52 ? 0.1781 0.2046 0.1953 0.0249  0.0063  -0.0261 275 TYR B CA  
1202 C C   . TYR B 52 ? 0.1824 0.2251 0.1984 0.0183  0.0153  -0.0120 275 TYR B C   
1203 O O   . TYR B 52 ? 0.1848 0.2057 0.1829 0.0268  0.0274  -0.0044 275 TYR B O   
1204 C CB  . TYR B 52 ? 0.2067 0.2096 0.2099 0.0138  0.0141  0.0030  275 TYR B CB  
1205 C CG  . TYR B 52 ? 0.1833 0.2011 0.2008 0.0212  0.0001  0.0144  275 TYR B CG  
1206 C CD1 . TYR B 52 ? 0.2133 0.2205 0.2465 0.0509  -0.0145 -0.0420 275 TYR B CD1 
1207 C CD2 . TYR B 52 ? 0.1940 0.2040 0.2494 0.0041  -0.0129 -0.0093 275 TYR B CD2 
1208 C CE1 . TYR B 52 ? 0.2361 0.2247 0.2237 0.0332  -0.0070 -0.0426 275 TYR B CE1 
1209 C CE2 . TYR B 52 ? 0.2110 0.1957 0.2726 0.0101  -0.0024 0.0037  275 TYR B CE2 
1210 C CZ  . TYR B 52 ? 0.2149 0.1782 0.2258 0.0187  0.0050  -0.0116 275 TYR B CZ  
1211 O OH  . TYR B 52 ? 0.2801 0.1767 0.2322 0.0151  0.0088  -0.0326 275 TYR B OH  
1212 N N   A MET B 53 ? 0.2107 0.2440 0.2206 0.0163  0.0094  -0.0096 276 MET B N   
1213 N N   B MET B 53 ? 0.2003 0.2514 0.2200 0.0144  0.0112  -0.0073 276 MET B N   
1214 N N   C MET B 53 ? 0.2007 0.2356 0.2054 0.0117  0.0108  -0.0090 276 MET B N   
1215 C CA  A MET B 53 ? 0.2172 0.2562 0.2424 0.0182  0.0265  -0.0130 276 MET B CA  
1216 C CA  B MET B 53 ? 0.1877 0.2645 0.2301 0.0215  0.0327  -0.0136 276 MET B CA  
1217 C CA  C MET B 53 ? 0.1857 0.2265 0.2013 0.0124  0.0314  -0.0178 276 MET B CA  
1218 C C   A MET B 53 ? 0.1777 0.2344 0.2132 0.0342  0.0321  -0.0146 276 MET B C   
1219 C C   B MET B 53 ? 0.1569 0.2394 0.2087 0.0278  0.0327  -0.0182 276 MET B C   
1220 C C   C MET B 53 ? 0.1629 0.2230 0.1961 0.0301  0.0353  -0.0165 276 MET B C   
1221 O O   A MET B 53 ? 0.2448 0.2674 0.2550 0.0006  0.0109  0.0037  276 MET B O   
1222 O O   B MET B 53 ? 0.1784 0.2591 0.2360 -0.0191 0.0037  -0.0024 276 MET B O   
1223 O O   C MET B 53 ? 0.2248 0.2643 0.2350 -0.0043 0.0078  0.0061  276 MET B O   
1224 C CB  A MET B 53 ? 0.2348 0.2530 0.2428 0.0101  0.0120  -0.0092 276 MET B CB  
1225 C CB  B MET B 53 ? 0.1971 0.2698 0.2502 0.0158  0.0218  -0.0021 276 MET B CB  
1226 C CB  C MET B 53 ? 0.2184 0.2364 0.2174 -0.0001 0.0154  -0.0114 276 MET B CB  
1227 C CG  A MET B 53 ? 0.2386 0.2674 0.2785 0.0218  0.0084  -0.0052 276 MET B CG  
1228 C CG  B MET B 53 ? 0.2461 0.2913 0.2748 0.0259  0.0187  -0.0065 276 MET B CG  
1229 C CG  C MET B 53 ? 0.2119 0.2228 0.2200 -0.0090 0.0137  -0.0138 276 MET B CG  
1230 S SD  A MET B 53 ? 0.2867 0.3211 0.3643 0.0127  0.0176  -0.0034 276 MET B SD  
1231 S SD  B MET B 53 ? 0.2589 0.3385 0.3336 0.0143  0.0348  -0.0008 276 MET B SD  
1232 S SD  C MET B 53 ? 0.2152 0.2899 0.2567 -0.0022 0.0209  -0.0226 276 MET B SD  
1233 C CE  A MET B 53 ? 0.2128 0.1740 0.2770 -0.0755 0.0278  0.0269  276 MET B CE  
1234 C CE  B MET B 53 ? 0.2821 0.3261 0.2964 0.0031  0.0133  -0.0063 276 MET B CE  
1235 C CE  C MET B 53 ? 0.2095 0.2211 0.2701 0.0025  0.0073  -0.0088 276 MET B CE  
1236 N N   . VAL B 54 ? 0.1766 0.2238 0.2044 0.0230  0.0432  -0.0304 277 VAL B N   
1237 C CA  . VAL B 54 ? 0.1871 0.2113 0.2017 0.0276  0.0403  -0.0264 277 VAL B CA  
1238 C C   . VAL B 54 ? 0.1870 0.2190 0.2232 0.0245  0.0308  -0.0106 277 VAL B C   
1239 O O   . VAL B 54 ? 0.2088 0.2017 0.2110 0.0500  0.0619  0.0003  277 VAL B O   
1240 C CB  . VAL B 54 ? 0.1967 0.2065 0.2293 0.0217  0.0326  -0.0004 277 VAL B CB  
1241 C CG1 . VAL B 54 ? 0.2641 0.2030 0.2664 0.0209  0.0273  -0.0172 277 VAL B CG1 
1242 C CG2 . VAL B 54 ? 0.2538 0.2484 0.2260 0.0254  0.0227  0.0053  277 VAL B CG2 
1243 N N   . PRO B 55 ? 0.1890 0.2165 0.2512 0.0248  0.0367  -0.0094 278 PRO B N   
1244 C CA  . PRO B 55 ? 0.2184 0.2516 0.2824 0.0244  0.0460  -0.0017 278 PRO B CA  
1245 C C   . PRO B 55 ? 0.2380 0.2539 0.3083 0.0088  0.0331  -0.0166 278 PRO B C   
1246 O O   . PRO B 55 ? 0.2725 0.2460 0.3163 0.0178  0.0276  -0.0036 278 PRO B O   
1247 C CB  . PRO B 55 ? 0.2274 0.2955 0.3070 0.0012  0.0486  0.0015  278 PRO B CB  
1248 C CG  . PRO B 55 ? 0.2217 0.2836 0.3156 0.0239  0.0367  -0.0178 278 PRO B CG  
1249 C CD  . PRO B 55 ? 0.1818 0.2693 0.2857 0.0208  0.0263  -0.0042 278 PRO B CD  
1250 N N   . TYR B 56 ? 0.2032 0.2172 0.3137 0.0111  0.0516  -0.0311 279 TYR B N   
1251 C CA  . TYR B 56 ? 0.2341 0.2709 0.3156 0.0112  0.0159  0.0106  279 TYR B CA  
1252 C C   . TYR B 56 ? 0.2539 0.2036 0.3225 0.0216  0.0223  0.0018  279 TYR B C   
1253 O O   . TYR B 56 ? 0.2959 0.2040 0.3770 0.0360  0.0131  0.0216  279 TYR B O   
1254 C CB  . TYR B 56 ? 0.2934 0.3096 0.3256 0.0001  0.0210  -0.0059 279 TYR B CB  
1255 C CG  . TYR B 56 ? 0.3253 0.3537 0.3728 -0.0085 0.0040  0.0064  279 TYR B CG  
1256 C CD1 . TYR B 56 ? 0.3619 0.4013 0.3973 -0.0160 0.0093  0.0151  279 TYR B CD1 
1257 C CD2 . TYR B 56 ? 0.3050 0.3605 0.3503 -0.0014 0.0399  -0.0028 279 TYR B CD2 
1258 C CE1 . TYR B 56 ? 0.3968 0.4288 0.4520 -0.0233 0.0007  0.0162  279 TYR B CE1 
1259 C CE2 . TYR B 56 ? 0.3411 0.4093 0.3906 -0.0209 0.0253  -0.0010 279 TYR B CE2 
1260 C CZ  . TYR B 56 ? 0.3500 0.4035 0.4302 -0.0195 0.0134  0.0197  279 TYR B CZ  
1261 O OH  . TYR B 56 ? 0.3652 0.4477 0.4538 -0.0439 0.0242  0.0197  279 TYR B OH  
1262 N N   . VAL B 57 ? 0.2290 0.1653 0.2928 -0.0057 0.0098  0.0022  280 VAL B N   
1263 C CA  . VAL B 57 ? 0.2583 0.2005 0.2815 -0.0048 0.0066  -0.0039 280 VAL B CA  
1264 C C   . VAL B 57 ? 0.2743 0.2017 0.2886 -0.0143 -0.0025 -0.0092 280 VAL B C   
1265 O O   . VAL B 57 ? 0.2850 0.1721 0.2803 -0.0017 0.0175  -0.0292 280 VAL B O   
1266 C CB  . VAL B 57 ? 0.2366 0.2265 0.2593 0.0071  -0.0029 -0.0109 280 VAL B CB  
1267 C CG1 . VAL B 57 ? 0.2818 0.2079 0.2823 -0.0076 0.0045  -0.0264 280 VAL B CG1 
1268 C CG2 . VAL B 57 ? 0.2678 0.2280 0.2346 -0.0001 0.0041  -0.0048 280 VAL B CG2 
1269 N N   . ASP B 58 ? 0.3124 0.1854 0.3135 -0.0251 -0.0042 -0.0173 281 ASP B N   
1270 C CA  . ASP B 58 ? 0.3177 0.2277 0.3158 -0.0149 0.0015  -0.0299 281 ASP B CA  
1271 C C   . ASP B 58 ? 0.3151 0.2100 0.3164 -0.0153 -0.0053 -0.0185 281 ASP B C   
1272 O O   . ASP B 58 ? 0.3070 0.1430 0.3352 -0.0124 -0.0058 -0.0213 281 ASP B O   
1273 C CB  . ASP B 58 ? 0.3277 0.2779 0.3529 -0.0193 0.0115  -0.0251 281 ASP B CB  
1274 C CG  . ASP B 58 ? 0.3908 0.4111 0.3787 -0.0085 0.0001  -0.0118 281 ASP B CG  
1275 O OD1 . ASP B 58 ? 0.4120 0.4526 0.4399 -0.0161 0.0070  -0.0230 281 ASP B OD1 
1276 O OD2 . ASP B 58 ? 0.4095 0.4975 0.4685 0.0112  0.0180  -0.0270 281 ASP B OD2 
1277 N N   . LEU B 59 ? 0.3221 0.1980 0.3114 -0.0180 -0.0103 -0.0408 282 LEU B N   
1278 C CA  . LEU B 59 ? 0.3187 0.2038 0.3099 -0.0233 -0.0128 -0.0368 282 LEU B CA  
1279 C C   . LEU B 59 ? 0.3151 0.1779 0.3016 -0.0213 -0.0043 -0.0413 282 LEU B C   
1280 O O   . LEU B 59 ? 0.3131 0.2240 0.3377 -0.0426 -0.0076 -0.0378 282 LEU B O   
1281 C CB  . LEU B 59 ? 0.3506 0.1918 0.3144 -0.0279 -0.0209 -0.0488 282 LEU B CB  
1282 C CG  . LEU B 59 ? 0.3754 0.2687 0.3302 -0.0168 -0.0105 -0.0368 282 LEU B CG  
1283 C CD1 . LEU B 59 ? 0.3844 0.3079 0.3653 -0.0312 -0.0321 -0.0442 282 LEU B CD1 
1284 C CD2 . LEU B 59 ? 0.3755 0.3524 0.3888 0.0163  -0.0107 -0.0116 282 LEU B CD2 
1285 N N   . GLU B 60 ? 0.3282 0.1630 0.3154 -0.0105 0.0003  -0.0461 283 GLU B N   
1286 C CA  . GLU B 60 ? 0.3411 0.2246 0.3260 0.0006  -0.0032 -0.0213 283 GLU B CA  
1287 C C   . GLU B 60 ? 0.3219 0.1948 0.3015 -0.0145 0.0000  -0.0163 283 GLU B C   
1288 O O   . GLU B 60 ? 0.3618 0.1986 0.3172 -0.0061 0.0007  -0.0012 283 GLU B O   
1289 C CB  . GLU B 60 ? 0.3438 0.2598 0.3404 0.0148  0.0059  -0.0177 283 GLU B CB  
1290 C CG  . GLU B 60 ? 0.3655 0.3232 0.3921 0.0050  -0.0004 -0.0047 283 GLU B CG  
1291 C CD  . GLU B 60 ? 0.3891 0.3542 0.3978 0.0096  -0.0019 -0.0070 283 GLU B CD  
1292 O OE1 . GLU B 60 ? 0.4849 0.4839 0.4414 0.0188  -0.0086 0.0103  283 GLU B OE1 
1293 O OE2 . GLU B 60 ? 0.4610 0.4930 0.4795 0.0088  0.0295  0.0135  283 GLU B OE2 
1294 N N   . HIS B 61 ? 0.3007 0.1705 0.2678 -0.0135 -0.0038 -0.0103 284 HIS B N   
1295 C CA  . HIS B 61 ? 0.2614 0.1729 0.2687 -0.0186 -0.0044 -0.0200 284 HIS B CA  
1296 C C   . HIS B 61 ? 0.2748 0.2025 0.2678 -0.0154 -0.0099 -0.0123 284 HIS B C   
1297 O O   . HIS B 61 ? 0.2737 0.2240 0.2517 -0.0157 -0.0208 -0.0198 284 HIS B O   
1298 C CB  . HIS B 61 ? 0.2324 0.1814 0.2729 -0.0229 -0.0084 -0.0143 284 HIS B CB  
1299 C CG  . HIS B 61 ? 0.2528 0.1544 0.3074 0.0100  0.0002  -0.0218 284 HIS B CG  
1300 N ND1 . HIS B 61 ? 0.2619 0.1674 0.3140 0.0043  0.0057  -0.0195 284 HIS B ND1 
1301 C CD2 . HIS B 61 ? 0.2619 0.1954 0.3045 -0.0057 -0.0181 -0.0039 284 HIS B CD2 
1302 C CE1 . HIS B 61 ? 0.2692 0.2050 0.3211 -0.0013 -0.0253 -0.0075 284 HIS B CE1 
1303 N NE2 . HIS B 61 ? 0.2992 0.2149 0.3380 0.0020  -0.0114 0.0003  284 HIS B NE2 
1304 N N   . GLN B 62 ? 0.2829 0.2206 0.2576 -0.0336 -0.0185 -0.0162 285 GLN B N   
1305 C CA  . GLN B 62 ? 0.2849 0.2288 0.2572 -0.0452 -0.0216 -0.0190 285 GLN B CA  
1306 C C   . GLN B 62 ? 0.2830 0.2454 0.2653 -0.0400 -0.0214 -0.0101 285 GLN B C   
1307 O O   . GLN B 62 ? 0.3327 0.2583 0.3083 -0.0299 -0.0214 0.0072  285 GLN B O   
1308 C CB  . GLN B 62 ? 0.2953 0.2659 0.2785 -0.0455 -0.0278 -0.0231 285 GLN B CB  
1309 C CG  . GLN B 62 ? 0.3365 0.3260 0.3389 -0.0435 -0.0135 -0.0101 285 GLN B CG  
1310 C CD  . GLN B 62 ? 0.3752 0.3395 0.3728 -0.0455 -0.0321 0.0028  285 GLN B CD  
1311 O OE1 . GLN B 62 ? 0.3408 0.2804 0.3526 -0.0748 -0.0434 0.0052  285 GLN B OE1 
1312 N NE2 . GLN B 62 ? 0.4410 0.3543 0.3958 -0.0326 -0.0128 -0.0170 285 GLN B NE2 
1313 N N   . GLY B 63 ? 0.2617 0.2441 0.2427 -0.0575 -0.0189 0.0031  286 GLY B N   
1314 C CA  . GLY B 63 ? 0.2583 0.2523 0.2443 -0.0664 -0.0126 0.0075  286 GLY B CA  
1315 C C   . GLY B 63 ? 0.2210 0.2651 0.2461 -0.0857 -0.0159 0.0074  286 GLY B C   
1316 O O   . GLY B 63 ? 0.2487 0.3150 0.2417 -0.0568 -0.0249 0.0133  286 GLY B O   
1317 N N   . THR B 64 ? 0.2230 0.2721 0.2253 -0.0954 -0.0216 0.0071  287 THR B N   
1318 C CA  . THR B 64 ? 0.2337 0.3294 0.2455 -0.0529 -0.0210 0.0093  287 THR B CA  
1319 C C   . THR B 64 ? 0.2495 0.3208 0.2537 -0.0308 -0.0146 0.0130  287 THR B C   
1320 O O   . THR B 64 ? 0.2504 0.3243 0.2858 -0.0589 -0.0439 0.0076  287 THR B O   
1321 C CB  . THR B 64 ? 0.2619 0.3651 0.2849 -0.0395 -0.0033 0.0057  287 THR B CB  
1322 O OG1 . THR B 64 ? 0.2345 0.3617 0.2979 -0.0962 -0.0467 0.0119  287 THR B OG1 
1323 C CG2 . THR B 64 ? 0.2286 0.3782 0.2833 -0.0549 -0.0094 -0.0070 287 THR B CG2 
1324 N N   . TYR B 65 ? 0.1657 0.3008 0.1866 -0.0696 -0.0470 -0.0207 288 TYR B N   
1325 C CA  . TYR B 65 ? 0.1401 0.2948 0.2027 -0.0555 -0.0385 -0.0191 288 TYR B CA  
1326 C C   . TYR B 65 ? 0.1312 0.3131 0.2101 -0.0456 -0.0155 0.0006  288 TYR B C   
1327 O O   . TYR B 65 ? 0.1980 0.3433 0.2180 -0.0191 -0.0136 -0.0034 288 TYR B O   
1328 C CB  . TYR B 65 ? 0.1741 0.2900 0.2182 -0.0342 -0.0100 -0.0132 288 TYR B CB  
1329 C CG  . TYR B 65 ? 0.1397 0.2451 0.1963 -0.0631 -0.0230 -0.0160 288 TYR B CG  
1330 C CD1 . TYR B 65 ? 0.1767 0.2216 0.2059 -0.0320 0.0035  0.0197  288 TYR B CD1 
1331 C CD2 . TYR B 65 ? 0.1787 0.2503 0.1894 -0.0362 -0.0096 0.0023  288 TYR B CD2 
1332 C CE1 . TYR B 65 ? 0.2012 0.2475 0.1927 -0.0147 -0.0085 0.0221  288 TYR B CE1 
1333 C CE2 . TYR B 65 ? 0.1998 0.2136 0.2010 -0.0355 -0.0225 0.0179  288 TYR B CE2 
1334 C CZ  . TYR B 65 ? 0.1820 0.2179 0.2121 -0.0168 0.0037  -0.0022 288 TYR B CZ  
1335 O OH  . TYR B 65 ? 0.2065 0.2827 0.2003 0.0026  0.0156  0.0245  288 TYR B OH  
1336 N N   . TRP B 66 ? 0.1594 0.3045 0.2056 -0.0302 -0.0194 -0.0124 289 TRP B N   
1337 C CA  . TRP B 66 ? 0.1378 0.2843 0.2060 -0.0288 0.0099  -0.0104 289 TRP B CA  
1338 C C   . TRP B 66 ? 0.1209 0.2201 0.1806 -0.0284 0.0000  0.0069  289 TRP B C   
1339 O O   . TRP B 66 ? 0.1391 0.2221 0.1808 -0.0157 -0.0124 -0.0057 289 TRP B O   
1340 C CB  . TRP B 66 ? 0.1181 0.3023 0.2441 -0.0404 0.0040  -0.0200 289 TRP B CB  
1341 C CG  . TRP B 66 ? 0.2249 0.3299 0.3117 -0.0418 0.0125  -0.0086 289 TRP B CG  
1342 C CD1 . TRP B 66 ? 0.2721 0.3404 0.3117 -0.0346 -0.0151 -0.0145 289 TRP B CD1 
1343 C CD2 . TRP B 66 ? 0.1321 0.3599 0.2725 -0.0446 -0.0198 -0.0254 289 TRP B CD2 
1344 N NE1 . TRP B 66 ? 0.2225 0.3332 0.3132 -0.0539 -0.0159 -0.0062 289 TRP B NE1 
1345 C CE2 . TRP B 66 ? 0.2513 0.3382 0.3274 -0.0328 0.0013  0.0004  289 TRP B CE2 
1346 C CE3 . TRP B 66 ? 0.2812 0.3890 0.2696 -0.0033 0.0129  -0.0089 289 TRP B CE3 
1347 C CZ2 . TRP B 66 ? 0.2019 0.3739 0.2617 -0.0488 -0.0323 -0.0085 289 TRP B CZ2 
1348 C CZ3 . TRP B 66 ? 0.2521 0.3248 0.3171 -0.0331 -0.0303 -0.0036 289 TRP B CZ3 
1349 C CH2 . TRP B 66 ? 0.2819 0.3586 0.3048 -0.0176 0.0114  -0.0067 289 TRP B CH2 
1350 N N   . CYS B 67 ? 0.1256 0.2111 0.1640 -0.0213 -0.0077 -0.0030 290 CYS B N   
1351 C CA  . CYS B 67 ? 0.0988 0.2057 0.1765 -0.0237 0.0089  -0.0013 290 CYS B CA  
1352 C C   . CYS B 67 ? 0.1013 0.1886 0.1808 -0.0212 0.0079  0.0093  290 CYS B C   
1353 O O   . CYS B 67 ? 0.1266 0.2158 0.1910 0.0044  0.0121  0.0176  290 CYS B O   
1354 C CB  . CYS B 67 ? 0.1172 0.1947 0.1805 -0.0247 0.0058  0.0136  290 CYS B CB  
1355 S SG  . CYS B 67 ? 0.1164 0.1759 0.1899 -0.0070 0.0041  -0.0021 290 CYS B SG  
1356 N N   . HIS B 68 ? 0.1345 0.1748 0.1747 -0.0134 0.0034  0.0032  291 HIS B N   
1357 C CA  . HIS B 68 ? 0.1446 0.1740 0.1625 -0.0141 0.0012  0.0064  291 HIS B CA  
1358 C C   . HIS B 68 ? 0.1285 0.1681 0.1691 0.0075  0.0036  0.0119  291 HIS B C   
1359 O O   . HIS B 68 ? 0.1146 0.1897 0.2017 -0.0096 0.0216  -0.0280 291 HIS B O   
1360 C CB  . HIS B 68 ? 0.1459 0.1616 0.2011 -0.0097 0.0070  0.0019  291 HIS B CB  
1361 C CG  . HIS B 68 ? 0.1673 0.1650 0.1776 -0.0132 0.0161  -0.0030 291 HIS B CG  
1362 N ND1 . HIS B 68 ? 0.1563 0.2151 0.2109 -0.0102 0.0307  0.0049  291 HIS B ND1 
1363 C CD2 . HIS B 68 ? 0.1708 0.1694 0.2009 -0.0114 0.0163  0.0172  291 HIS B CD2 
1364 C CE1 . HIS B 68 ? 0.1757 0.2024 0.2243 -0.0051 0.0293  0.0268  291 HIS B CE1 
1365 N NE2 . HIS B 68 ? 0.1887 0.1944 0.1913 -0.0287 0.0105  0.0190  291 HIS B NE2 
1366 N N   . VAL B 69 ? 0.1205 0.1549 0.1756 -0.0083 0.0105  0.0047  292 VAL B N   
1367 C CA  . VAL B 69 ? 0.1242 0.1412 0.1664 -0.0014 0.0001  0.0130  292 VAL B CA  
1368 C C   . VAL B 69 ? 0.1035 0.1511 0.1597 -0.0088 0.0029  -0.0004 292 VAL B C   
1369 O O   . VAL B 69 ? 0.0942 0.2214 0.1847 -0.0123 0.0195  0.0264  292 VAL B O   
1370 C CB  . VAL B 69 ? 0.1292 0.1574 0.1725 0.0129  0.0028  0.0039  292 VAL B CB  
1371 C CG1 . VAL B 69 ? 0.2441 0.1687 0.2201 -0.0145 -0.0243 0.0204  292 VAL B CG1 
1372 C CG2 . VAL B 69 ? 0.1703 0.1949 0.1839 0.0256  0.0210  0.0294  292 VAL B CG2 
1373 N N   . TYR B 70 ? 0.1081 0.1520 0.1637 -0.0002 0.0200  -0.0055 293 TYR B N   
1374 C CA  . TYR B 70 ? 0.1393 0.1571 0.1449 0.0006  0.0214  0.0029  293 TYR B CA  
1375 C C   . TYR B 70 ? 0.1232 0.1569 0.1622 -0.0032 0.0357  0.0073  293 TYR B C   
1376 O O   . TYR B 70 ? 0.1364 0.1620 0.1663 -0.0111 0.0195  0.0008  293 TYR B O   
1377 C CB  . TYR B 70 ? 0.1494 0.1644 0.1849 0.0042  0.0170  -0.0051 293 TYR B CB  
1378 C CG  . TYR B 70 ? 0.1622 0.1621 0.1458 0.0006  0.0127  0.0080  293 TYR B CG  
1379 C CD1 . TYR B 70 ? 0.1600 0.1730 0.1998 0.0305  -0.0038 -0.0017 293 TYR B CD1 
1380 C CD2 . TYR B 70 ? 0.1513 0.1638 0.1964 0.0014  0.0258  0.0016  293 TYR B CD2 
1381 C CE1 . TYR B 70 ? 0.1518 0.2221 0.1984 0.0184  -0.0048 -0.0314 293 TYR B CE1 
1382 C CE2 . TYR B 70 ? 0.1543 0.1904 0.1796 0.0132  0.0102  -0.0205 293 TYR B CE2 
1383 C CZ  . TYR B 70 ? 0.1708 0.1787 0.2025 0.0237  0.0188  -0.0157 293 TYR B CZ  
1384 O OH  . TYR B 70 ? 0.1855 0.2369 0.2098 0.0534  0.0098  -0.0234 293 TYR B OH  
1385 N N   . ASN B 71 ? 0.1457 0.1771 0.1589 0.0083  0.0205  0.0072  294 ASN B N   
1386 C CA  . ASN B 71 ? 0.1358 0.1731 0.1607 0.0107  0.0104  -0.0083 294 ASN B CA  
1387 C C   . ASN B 71 ? 0.1103 0.1770 0.1633 0.0060  0.0055  -0.0063 294 ASN B C   
1388 O O   . ASN B 71 ? 0.1627 0.1757 0.1755 -0.0103 0.0002  0.0071  294 ASN B O   
1389 C CB  . ASN B 71 ? 0.1158 0.1864 0.1727 -0.0046 0.0098  0.0100  294 ASN B CB  
1390 C CG  . ASN B 71 ? 0.1126 0.1719 0.1674 -0.0072 0.0172  -0.0230 294 ASN B CG  
1391 O OD1 . ASN B 71 ? 0.1118 0.1781 0.1878 -0.0044 0.0360  0.0091  294 ASN B OD1 
1392 N ND2 . ASN B 71 ? 0.1453 0.1631 0.2036 -0.0060 0.0291  -0.0149 294 ASN B ND2 
1393 N N   . ASP B 72 ? 0.1381 0.1809 0.1646 0.0036  0.0093  0.0021  295 ASP B N   
1394 C CA  . ASP B 72 ? 0.1586 0.1801 0.1620 -0.0013 -0.0055 0.0037  295 ASP B CA  
1395 C C   . ASP B 72 ? 0.1694 0.1714 0.1752 -0.0010 0.0127  0.0024  295 ASP B C   
1396 O O   . ASP B 72 ? 0.1637 0.1878 0.1782 -0.0197 0.0099  0.0219  295 ASP B O   
1397 C CB  . ASP B 72 ? 0.1590 0.1945 0.1860 -0.0122 -0.0029 0.0024  295 ASP B CB  
1398 C CG  . ASP B 72 ? 0.2008 0.1908 0.2046 -0.0076 -0.0081 -0.0005 295 ASP B CG  
1399 O OD1 . ASP B 72 ? 0.2128 0.2020 0.2378 -0.0180 -0.0174 -0.0088 295 ASP B OD1 
1400 O OD2 . ASP B 72 ? 0.2218 0.2279 0.2647 -0.0155 -0.0702 0.0038  295 ASP B OD2 
1401 N N   . ARG B 73 ? 0.1615 0.1667 0.1773 0.0100  0.0318  0.0104  296 ARG B N   
1402 C CA  . ARG B 73 ? 0.1803 0.1838 0.1860 0.0119  0.0425  0.0149  296 ARG B CA  
1403 C C   . ARG B 73 ? 0.1769 0.2081 0.2172 -0.0034 0.0437  0.0203  296 ARG B C   
1404 O O   . ARG B 73 ? 0.1792 0.2507 0.2497 -0.0185 0.0555  0.0468  296 ARG B O   
1405 C CB  . ARG B 73 ? 0.2136 0.1962 0.1817 0.0345  0.0338  0.0149  296 ARG B CB  
1406 C CG  . ARG B 73 ? 0.2318 0.2634 0.2148 0.0676  0.0417  -0.0096 296 ARG B CG  
1407 C CD  . ARG B 73 ? 0.3250 0.3040 0.2614 0.0581  0.0137  -0.0102 296 ARG B CD  
1408 N NE  . ARG B 73 ? 0.2715 0.2903 0.2715 0.0354  0.0272  -0.0008 296 ARG B NE  
1409 C CZ  . ARG B 73 ? 0.2553 0.2731 0.2790 0.0374  0.0275  -0.0187 296 ARG B CZ  
1410 N NH1 . ARG B 73 ? 0.3563 0.3675 0.3185 0.0505  -0.0026 -0.0183 296 ARG B NH1 
1411 N NH2 . ARG B 73 ? 0.2886 0.3387 0.3196 0.0222  0.0093  0.0346  296 ARG B NH2 
1412 N N   . ASP B 74 ? 0.1428 0.2249 0.1765 0.0008  0.0517  0.0110  297 ASP B N   
1413 C CA  . ASP B 74 ? 0.1733 0.2749 0.2049 -0.0082 0.0186  -0.0021 297 ASP B CA  
1414 C C   . ASP B 74 ? 0.1292 0.2296 0.1908 -0.0073 0.0163  0.0035  297 ASP B C   
1415 O O   . ASP B 74 ? 0.1152 0.2239 0.1972 -0.0222 0.0296  0.0252  297 ASP B O   
1416 C CB  . ASP B 74 ? 0.1918 0.2794 0.2527 0.0084  0.0132  -0.0202 297 ASP B CB  
1417 C CG  . ASP B 74 ? 0.2393 0.3213 0.2936 0.0080  0.0167  -0.0003 297 ASP B CG  
1418 O OD1 . ASP B 74 ? 0.3216 0.3732 0.2240 -0.0014 0.0850  -0.0305 297 ASP B OD1 
1419 O OD2 . ASP B 74 ? 0.2345 0.3854 0.3158 -0.0129 0.0270  0.0057  297 ASP B OD2 
1420 N N   . SER B 75 ? 0.1338 0.2450 0.1828 -0.0192 0.0315  0.0076  298 SER B N   
1421 C CA  . SER B 75 ? 0.1360 0.2323 0.1738 -0.0228 0.0051  0.0095  298 SER B CA  
1422 C C   . SER B 75 ? 0.1326 0.2385 0.1830 -0.0180 0.0205  0.0200  298 SER B C   
1423 O O   . SER B 75 ? 0.1486 0.2949 0.2141 -0.0004 0.0124  0.0287  298 SER B O   
1424 C CB  . SER B 75 ? 0.1641 0.2515 0.2145 -0.0210 0.0194  -0.0074 298 SER B CB  
1425 O OG  . SER B 75 ? 0.2018 0.2999 0.2750 -0.0417 0.0080  0.0350  298 SER B OG  
1426 N N   . GLN B 76 ? 0.1174 0.2487 0.1785 -0.0056 0.0287  0.0339  299 GLN B N   
1427 C CA  . GLN B 76 ? 0.1396 0.2567 0.1945 -0.0040 0.0183  0.0192  299 GLN B CA  
1428 C C   . GLN B 76 ? 0.1528 0.2632 0.1910 0.0091  0.0070  0.0214  299 GLN B C   
1429 O O   . GLN B 76 ? 0.1424 0.3272 0.2182 -0.0014 -0.0006 -0.0007 299 GLN B O   
1430 C CB  . GLN B 76 ? 0.1661 0.2619 0.2106 0.0106  0.0226  0.0266  299 GLN B CB  
1431 C CG  . GLN B 76 ? 0.2451 0.2896 0.2643 0.0174  0.0186  0.0054  299 GLN B CG  
1432 C CD  . GLN B 76 ? 0.2308 0.2741 0.2565 0.0172  0.0350  0.0112  299 GLN B CD  
1433 O OE1 . GLN B 76 ? 0.2371 0.3188 0.2807 0.0598  0.0335  0.0388  299 GLN B OE1 
1434 N NE2 . GLN B 76 ? 0.2517 0.3657 0.3089 0.0216  0.0727  -0.0032 299 GLN B NE2 
1435 N N   . ASP B 77 ? 0.1374 0.2931 0.1856 -0.0210 0.0134  0.0189  300 ASP B N   
1436 C CA  . ASP B 77 ? 0.1462 0.2962 0.1891 -0.0157 0.0072  0.0195  300 ASP B CA  
1437 C C   . ASP B 77 ? 0.1178 0.3111 0.1988 0.0012  0.0057  0.0151  300 ASP B C   
1438 O O   . ASP B 77 ? 0.1481 0.3480 0.2137 0.0104  0.0180  0.0142  300 ASP B O   
1439 C CB  . ASP B 77 ? 0.1573 0.2906 0.2398 -0.0305 0.0054  0.0143  300 ASP B CB  
1440 C CG  . ASP B 77 ? 0.2279 0.3250 0.2842 -0.0277 -0.0125 0.0205  300 ASP B CG  
1441 O OD1 . ASP B 77 ? 0.2709 0.3123 0.2853 -0.0236 -0.0255 0.0179  300 ASP B OD1 
1442 O OD2 . ASP B 77 ? 0.3085 0.3571 0.3854 -0.0513 0.0199  0.0575  300 ASP B OD2 
1443 N N   . SER B 78 ? 0.1320 0.2962 0.1909 0.0164  0.0177  0.0163  301 SER B N   
1444 C CA  . SER B 78 ? 0.1004 0.2996 0.1911 0.0168  0.0210  0.0160  301 SER B CA  
1445 C C   . SER B 78 ? 0.1851 0.3224 0.2116 -0.0053 -0.0066 0.0168  301 SER B C   
1446 O O   . SER B 78 ? 0.2252 0.3853 0.2550 0.0082  -0.0348 0.0083  301 SER B O   
1447 C CB  . SER B 78 ? 0.0950 0.2865 0.1985 0.0379  0.0521  0.0116  301 SER B CB  
1448 O OG  . SER B 78 ? 0.1461 0.2996 0.2103 0.0085  -0.0079 0.0143  301 SER B OG  
1449 N N   . LYS B 79 ? 0.1554 0.3634 0.2135 0.0315  0.0069  0.0059  302 LYS B N   
1450 C CA  . LYS B 79 ? 0.1909 0.3757 0.2210 0.0068  -0.0035 -0.0015 302 LYS B CA  
1451 C C   . LYS B 79 ? 0.1910 0.3655 0.2238 0.0037  -0.0053 -0.0013 302 LYS B C   
1452 O O   . LYS B 79 ? 0.1550 0.3677 0.2239 -0.0046 0.0006  0.0041  302 LYS B O   
1453 C CB  . LYS B 79 ? 0.2536 0.3858 0.2855 0.0174  -0.0172 0.0108  302 LYS B CB  
1454 C CG  . LYS B 79 ? 0.3196 0.3978 0.3347 0.0107  -0.0150 -0.0140 302 LYS B CG  
1455 C CD  . LYS B 79 ? 0.3634 0.4380 0.3717 0.0046  0.0039  -0.0054 302 LYS B CD  
1456 C CE  . LYS B 79 ? 0.3389 0.4487 0.3708 0.0064  0.0124  -0.0044 302 LYS B CE  
1457 N NZ  . LYS B 79 ? 0.3318 0.4462 0.4086 0.0130  0.0122  -0.0198 302 LYS B NZ  
1458 N N   A LYS B 80 ? 0.1774 0.3805 0.2448 -0.0101 0.0068  -0.0086 303 LYS B N   
1459 N N   B LYS B 80 ? 0.1800 0.3427 0.2304 -0.0063 0.0050  -0.0056 303 LYS B N   
1460 C CA  A LYS B 80 ? 0.2143 0.3744 0.2664 -0.0148 -0.0112 -0.0060 303 LYS B CA  
1461 C CA  B LYS B 80 ? 0.1796 0.3123 0.2327 -0.0189 0.0002  -0.0075 303 LYS B CA  
1462 C C   A LYS B 80 ? 0.1581 0.3735 0.2417 -0.0231 -0.0255 -0.0063 303 LYS B C   
1463 C C   B LYS B 80 ? 0.1766 0.3234 0.2274 -0.0210 -0.0132 -0.0066 303 LYS B C   
1464 O O   A LYS B 80 ? 0.1981 0.4073 0.2588 -0.0039 -0.0232 -0.0017 303 LYS B O   
1465 O O   B LYS B 80 ? 0.2233 0.3056 0.2293 -0.0214 -0.0024 -0.0096 303 LYS B O   
1466 C CB  A LYS B 80 ? 0.2568 0.3857 0.2991 -0.0159 -0.0133 0.0053  303 LYS B CB  
1467 C CB  B LYS B 80 ? 0.2003 0.3102 0.2441 -0.0227 -0.0033 0.0039  303 LYS B CB  
1468 C CG  A LYS B 80 ? 0.2598 0.3850 0.3053 -0.0255 -0.0156 0.0066  303 LYS B CG  
1469 C CG  B LYS B 80 ? 0.1283 0.2769 0.2331 -0.0275 0.0245  -0.0069 303 LYS B CG  
1470 C CD  A LYS B 80 ? 0.3207 0.3828 0.3438 -0.0209 -0.0048 0.0015  303 LYS B CD  
1471 C CD  B LYS B 80 ? 0.1933 0.2833 0.2291 -0.0237 0.0092  -0.0157 303 LYS B CD  
1472 C CE  A LYS B 80 ? 0.3823 0.4049 0.3782 -0.0131 -0.0043 -0.0082 303 LYS B CE  
1473 C CE  B LYS B 80 ? 0.0700 0.2790 0.2472 -0.0608 0.0070  -0.0010 303 LYS B CE  
1474 N NZ  A LYS B 80 ? 0.3775 0.4030 0.4202 -0.0406 0.0102  -0.0038 303 LYS B NZ  
1475 N NZ  B LYS B 80 ? 0.2012 0.3183 0.2897 -0.0005 0.0059  0.0009  303 LYS B NZ  
1476 N N   . VAL B 81 ? 0.1743 0.3567 0.2273 -0.0335 -0.0094 -0.0006 304 VAL B N   
1477 C CA  . VAL B 81 ? 0.2059 0.3542 0.2474 -0.0324 -0.0205 0.0001  304 VAL B CA  
1478 C C   . VAL B 81 ? 0.1768 0.3507 0.2354 -0.0389 -0.0268 -0.0037 304 VAL B C   
1479 O O   . VAL B 81 ? 0.2227 0.3714 0.2239 -0.0349 -0.0300 -0.0065 304 VAL B O   
1480 C CB  . VAL B 81 ? 0.2141 0.3521 0.2428 -0.0412 -0.0335 -0.0056 304 VAL B CB  
1481 C CG1 . VAL B 81 ? 0.2831 0.3661 0.2500 -0.0173 -0.0449 -0.0036 304 VAL B CG1 
1482 C CG2 . VAL B 81 ? 0.2046 0.3840 0.2733 -0.0443 -0.0187 0.0125  304 VAL B CG2 
1483 N N   . GLU B 82 ? 0.1665 0.3522 0.2221 -0.0417 -0.0336 -0.0085 305 GLU B N   
1484 C CA  . GLU B 82 ? 0.1962 0.3350 0.2428 -0.0373 -0.0114 -0.0106 305 GLU B CA  
1485 C C   . GLU B 82 ? 0.1905 0.3214 0.2416 -0.0393 -0.0173 0.0018  305 GLU B C   
1486 O O   . GLU B 82 ? 0.2064 0.3536 0.2285 -0.0093 -0.0034 0.0113  305 GLU B O   
1487 C CB  . GLU B 82 ? 0.2114 0.3672 0.2544 -0.0304 -0.0227 -0.0051 305 GLU B CB  
1488 C CG  . GLU B 82 ? 0.1586 0.3538 0.2678 -0.0886 -0.0450 -0.0207 305 GLU B CG  
1489 C CD  . GLU B 82 ? 0.1965 0.2938 0.2825 -0.0731 -0.0614 -0.0371 305 GLU B CD  
1490 O OE1 . GLU B 82 ? 0.2935 0.3390 0.3613 -0.0326 -0.0334 -0.0256 305 GLU B OE1 
1491 O OE2 . GLU B 82 ? 0.3255 0.3646 0.3586 -0.0210 -0.0446 -0.0080 305 GLU B OE2 
1492 N N   . ILE B 83 ? 0.2017 0.3212 0.2192 -0.0255 -0.0067 0.0110  306 ILE B N   
1493 C CA  . ILE B 83 ? 0.2005 0.2977 0.2463 -0.0227 0.0043  0.0151  306 ILE B CA  
1494 C C   . ILE B 83 ? 0.2170 0.2943 0.2475 -0.0330 0.0028  0.0180  306 ILE B C   
1495 O O   . ILE B 83 ? 0.2432 0.2990 0.2466 -0.0308 -0.0055 0.0103  306 ILE B O   
1496 C CB  . ILE B 83 ? 0.2091 0.2837 0.2621 -0.0289 -0.0033 0.0152  306 ILE B CB  
1497 C CG1 . ILE B 83 ? 0.2565 0.2731 0.2629 -0.0303 -0.0123 0.0066  306 ILE B CG1 
1498 C CG2 . ILE B 83 ? 0.1912 0.2799 0.2710 -0.0323 0.0255  0.0362  306 ILE B CG2 
1499 C CD1 . ILE B 83 ? 0.2816 0.2969 0.2942 0.0024  -0.0202 0.0162  306 ILE B CD1 
1500 N N   . ILE B 84 ? 0.2016 0.2965 0.2414 -0.0415 -0.0113 0.0131  307 ILE B N   
1501 C CA  . ILE B 84 ? 0.2439 0.2973 0.2702 -0.0407 -0.0176 0.0093  307 ILE B CA  
1502 C C   . ILE B 84 ? 0.2643 0.2920 0.2640 -0.0297 -0.0136 0.0076  307 ILE B C   
1503 O O   . ILE B 84 ? 0.2896 0.2560 0.2700 -0.0282 -0.0007 0.0072  307 ILE B O   
1504 C CB  . ILE B 84 ? 0.2731 0.3484 0.3055 -0.0169 -0.0125 0.0108  307 ILE B CB  
1505 C CG1 . ILE B 84 ? 0.3116 0.3823 0.3392 -0.0082 -0.0028 0.0000  307 ILE B CG1 
1506 C CG2 . ILE B 84 ? 0.3201 0.3751 0.3426 -0.0094 -0.0250 -0.0079 307 ILE B CG2 
1507 C CD1 . ILE B 84 ? 0.4085 0.4092 0.4279 0.0111  -0.0053 -0.0053 307 ILE B CD1 
1508 N N   . ILE B 85 ? 0.2793 0.2862 0.2923 -0.0289 -0.0142 0.0029  308 ILE B N   
1509 C CA  . ILE B 85 ? 0.3397 0.3237 0.3202 -0.0251 -0.0042 -0.0093 308 ILE B CA  
1510 C C   . ILE B 85 ? 0.3697 0.3506 0.3451 -0.0324 -0.0131 -0.0137 308 ILE B C   
1511 O O   . ILE B 85 ? 0.4078 0.3628 0.3638 -0.0479 -0.0033 -0.0175 308 ILE B O   
1512 C CB  . ILE B 85 ? 0.3423 0.3372 0.3401 -0.0205 -0.0068 0.0023  308 ILE B CB  
1513 C CG1 . ILE B 85 ? 0.3671 0.3288 0.3575 -0.0129 0.0077  -0.0194 308 ILE B CG1 
1514 C CG2 . ILE B 85 ? 0.3641 0.3782 0.3583 -0.0004 0.0017  -0.0002 308 ILE B CG2 
1515 C CD1 . ILE B 85 ? 0.3572 0.3059 0.3356 -0.0466 0.0137  -0.0205 308 ILE B CD1 
1516 N N   . ASP B 86 ? 0.4015 0.3920 0.3633 -0.0393 -0.0246 -0.0157 309 ASP B N   
1517 C CA  . ASP B 86 ? 0.4291 0.4359 0.3954 -0.0244 -0.0236 -0.0099 309 ASP B CA  
1518 C C   . ASP B 86 ? 0.4209 0.4273 0.4078 -0.0319 -0.0166 -0.0088 309 ASP B C   
1519 O O   . ASP B 86 ? 0.4303 0.4386 0.4083 -0.0336 -0.0160 -0.0073 309 ASP B O   
1520 C CB  . ASP B 86 ? 0.4429 0.4633 0.4237 -0.0187 -0.0153 -0.0102 309 ASP B CB  
1521 C CG  . ASP B 86 ? 0.4829 0.4867 0.4689 -0.0078 -0.0158 -0.0042 309 ASP B CG  
1522 O OD1 . ASP B 86 ? 0.5365 0.5560 0.5196 -0.0033 0.0065  0.0073  309 ASP B OD1 
1523 O OD2 . ASP B 86 ? 0.5065 0.5505 0.5106 0.0073  0.0100  -0.0180 309 ASP B OD2 
1524 N N   . SER C 2  ? 0.4237 0.3827 0.3868 -0.0254 0.0001  -0.0240 225 SER C N   
1525 C CA  . SER C 2  ? 0.4085 0.3876 0.3781 -0.0232 0.0020  -0.0171 225 SER C CA  
1526 C C   . SER C 2  ? 0.3788 0.3536 0.3261 -0.0297 0.0048  -0.0258 225 SER C C   
1527 O O   . SER C 2  ? 0.3636 0.3332 0.2915 -0.0412 -0.0040 -0.0340 225 SER C O   
1528 C CB  . SER C 2  ? 0.4196 0.4031 0.3919 -0.0121 0.0042  -0.0129 225 SER C CB  
1529 O OG  . SER C 2  ? 0.4462 0.4401 0.4587 -0.0243 -0.0086 -0.0219 225 SER C OG  
1530 N N   . LYS C 3  ? 0.3581 0.3253 0.2879 -0.0309 -0.0109 -0.0291 226 LYS C N   
1531 C CA  . LYS C 3  ? 0.3443 0.3227 0.2772 -0.0305 -0.0122 -0.0185 226 LYS C CA  
1532 C C   . LYS C 3  ? 0.3205 0.2864 0.2491 -0.0392 -0.0144 -0.0079 226 LYS C C   
1533 O O   . LYS C 3  ? 0.3608 0.2551 0.2798 -0.0455 -0.0211 -0.0226 226 LYS C O   
1534 C CB  . LYS C 3  ? 0.3470 0.3517 0.3073 -0.0351 -0.0231 -0.0182 226 LYS C CB  
1535 C CG  . LYS C 3  ? 0.3717 0.3976 0.3732 -0.0117 -0.0129 -0.0119 226 LYS C CG  
1536 C CD  . LYS C 3  ? 0.4209 0.4995 0.4250 -0.0171 -0.0257 0.0056  226 LYS C CD  
1537 C CE  . LYS C 3  ? 0.4624 0.4670 0.4572 0.0073  0.0068  -0.0076 226 LYS C CE  
1538 N NZ  . LYS C 3  ? 0.4905 0.5482 0.5062 -0.0106 -0.0143 0.0060  226 LYS C NZ  
1539 N N   . LEU C 4  ? 0.2977 0.2592 0.2274 -0.0342 -0.0030 -0.0076 227 LEU C N   
1540 C CA  . LEU C 4  ? 0.2394 0.2223 0.2130 -0.0512 -0.0037 -0.0202 227 LEU C CA  
1541 C C   . LEU C 4  ? 0.2169 0.2318 0.2104 -0.0354 -0.0054 -0.0113 227 LEU C C   
1542 O O   . LEU C 4  ? 0.2144 0.2859 0.2202 -0.0476 -0.0138 0.0066  227 LEU C O   
1543 C CB  . LEU C 4  ? 0.2354 0.2107 0.2424 -0.0390 -0.0039 -0.0143 227 LEU C CB  
1544 C CG  . LEU C 4  ? 0.2180 0.2191 0.2239 -0.0457 0.0118  -0.0226 227 LEU C CG  
1545 C CD1 . LEU C 4  ? 0.2543 0.2343 0.2547 -0.0538 0.0218  0.0161  227 LEU C CD1 
1546 C CD2 . LEU C 4  ? 0.2683 0.2914 0.3143 0.0164  0.0017  0.0004  227 LEU C CD2 
1547 N N   . GLN C 5  ? 0.1820 0.2166 0.1895 -0.0284 -0.0127 -0.0147 228 GLN C N   
1548 C CA  . GLN C 5  ? 0.1566 0.2246 0.2111 -0.0568 -0.0209 -0.0004 228 GLN C CA  
1549 C C   . GLN C 5  ? 0.1491 0.2025 0.2195 -0.0281 -0.0167 -0.0074 228 GLN C C   
1550 O O   . GLN C 5  ? 0.1571 0.2125 0.1979 -0.0301 -0.0195 -0.0094 228 GLN C O   
1551 C CB  . GLN C 5  ? 0.1812 0.2173 0.2251 -0.0682 -0.0201 -0.0128 228 GLN C CB  
1552 C CG  . GLN C 5  ? 0.2303 0.2660 0.2601 -0.0485 -0.0114 0.0037  228 GLN C CG  
1553 C CD  . GLN C 5  ? 0.2155 0.2966 0.2845 -0.0451 -0.0112 -0.0025 228 GLN C CD  
1554 O OE1 . GLN C 5  ? 0.2029 0.2949 0.3199 -0.0422 -0.0364 0.0181  228 GLN C OE1 
1555 N NE2 . GLN C 5  ? 0.2035 0.2863 0.3330 -0.0717 0.0339  0.0045  228 GLN C NE2 
1556 N N   . ILE C 6  ? 0.1319 0.2112 0.1995 -0.0349 -0.0135 0.0000  229 ILE C N   
1557 C CA  . ILE C 6  ? 0.1522 0.1882 0.2108 -0.0338 -0.0127 -0.0002 229 ILE C CA  
1558 C C   . ILE C 6  ? 0.1462 0.2049 0.2153 -0.0641 -0.0051 0.0035  229 ILE C C   
1559 O O   . ILE C 6  ? 0.1918 0.2532 0.2715 -0.0536 -0.0198 0.0185  229 ILE C O   
1560 C CB  . ILE C 6  ? 0.1406 0.2114 0.1937 -0.0266 -0.0118 0.0023  229 ILE C CB  
1561 C CG1 . ILE C 6  ? 0.1339 0.1604 0.2353 -0.0368 0.0083  -0.0004 229 ILE C CG1 
1562 C CG2 . ILE C 6  ? 0.1728 0.1998 0.2052 -0.0363 -0.0106 0.0147  229 ILE C CG2 
1563 C CD1 . ILE C 6  ? 0.1464 0.1876 0.2099 0.0093  0.0057  0.0208  229 ILE C CD1 
1564 N N   A CYS C 7  ? 0.1565 0.1580 0.1777 -0.0670 -0.0063 0.0037  230 CYS C N   
1565 N N   B CYS C 7  ? 0.1716 0.1821 0.2039 -0.0610 -0.0054 0.0071  230 CYS C N   
1566 C CA  A CYS C 7  ? 0.2031 0.1576 0.1981 -0.0600 -0.0074 -0.0037 230 CYS C CA  
1567 C CA  B CYS C 7  ? 0.2240 0.1994 0.2369 -0.0502 -0.0047 0.0081  230 CYS C CA  
1568 C C   A CYS C 7  ? 0.2024 0.1813 0.2081 -0.0431 0.0049  0.0039  230 CYS C C   
1569 C C   B CYS C 7  ? 0.2221 0.2104 0.2375 -0.0365 0.0075  0.0089  230 CYS C C   
1570 O O   A CYS C 7  ? 0.1945 0.1426 0.2061 -0.0550 -0.0006 0.0077  230 CYS C O   
1571 O O   B CYS C 7  ? 0.1770 0.1980 0.2553 -0.0703 0.0024  -0.0065 230 CYS C O   
1572 C CB  A CYS C 7  ? 0.2085 0.1932 0.2080 -0.0427 0.0044  0.0013  230 CYS C CB  
1573 C CB  B CYS C 7  ? 0.2570 0.2249 0.2280 -0.0328 0.0019  0.0103  230 CYS C CB  
1574 S SG  A CYS C 7  ? 0.2866 0.1784 0.1908 -0.0651 0.0059  -0.0465 230 CYS C SG  
1575 S SG  B CYS C 7  ? 0.3591 0.3048 0.3972 -0.0028 0.0035  0.0178  230 CYS C SG  
1576 N N   . VAL C 8  ? 0.1914 0.1663 0.2094 -0.0347 0.0034  -0.0022 231 VAL C N   
1577 C CA  . VAL C 8  ? 0.1996 0.1553 0.2057 -0.0351 -0.0024 -0.0023 231 VAL C CA  
1578 C C   . VAL C 8  ? 0.1811 0.1873 0.1904 -0.0278 0.0037  -0.0053 231 VAL C C   
1579 O O   . VAL C 8  ? 0.1329 0.1686 0.2063 -0.0166 0.0071  -0.0002 231 VAL C O   
1580 C CB  . VAL C 8  ? 0.2080 0.1799 0.2120 -0.0296 -0.0072 -0.0065 231 VAL C CB  
1581 C CG1 . VAL C 8  ? 0.2357 0.1910 0.2088 -0.0269 -0.0074 0.0032  231 VAL C CG1 
1582 C CG2 . VAL C 8  ? 0.2510 0.1440 0.2358 -0.0099 -0.0074 -0.0134 231 VAL C CG2 
1583 N N   . GLU C 9  ? 0.1848 0.1750 0.2077 -0.0439 0.0257  -0.0160 232 GLU C N   
1584 C CA  . GLU C 9  ? 0.1601 0.2018 0.2052 -0.0148 0.0312  -0.0132 232 GLU C CA  
1585 C C   . GLU C 9  ? 0.1496 0.2002 0.2025 -0.0282 0.0339  -0.0007 232 GLU C C   
1586 O O   . GLU C 9  ? 0.1772 0.2091 0.2155 -0.0416 0.0356  0.0006  232 GLU C O   
1587 C CB  . GLU C 9  ? 0.1571 0.2441 0.2256 -0.0353 0.0236  -0.0146 232 GLU C CB  
1588 C CG  . GLU C 9  ? 0.1858 0.2532 0.2196 -0.0535 0.0107  0.0108  232 GLU C CG  
1589 C CD  . GLU C 9  ? 0.1520 0.2578 0.2193 -0.0569 0.0025  0.0065  232 GLU C CD  
1590 O OE1 . GLU C 9  ? 0.1858 0.2292 0.2624 -0.0624 0.0205  -0.0078 232 GLU C OE1 
1591 O OE2 . GLU C 9  ? 0.2014 0.2803 0.2587 -0.0619 -0.0028 0.0112  232 GLU C OE2 
1592 N N   . PRO C 10 ? 0.1411 0.2031 0.2083 -0.0338 0.0348  -0.0070 233 PRO C N   
1593 C CA  . PRO C 10 ? 0.1426 0.1939 0.2050 -0.0261 0.0328  -0.0248 233 PRO C CA  
1594 C C   . PRO C 10 ? 0.1262 0.2106 0.2081 -0.0251 0.0229  -0.0131 233 PRO C C   
1595 O O   . PRO C 10 ? 0.1367 0.2310 0.2059 -0.0351 0.0378  -0.0124 233 PRO C O   
1596 C CB  . PRO C 10 ? 0.1266 0.2009 0.2082 -0.0424 0.0221  -0.0116 233 PRO C CB  
1597 C CG  . PRO C 10 ? 0.1342 0.1748 0.2109 -0.0320 0.0318  -0.0225 233 PRO C CG  
1598 C CD  . PRO C 10 ? 0.1484 0.1847 0.2081 -0.0111 0.0296  -0.0100 233 PRO C CD  
1599 N N   . THR C 11 ? 0.1477 0.2165 0.2056 -0.0206 0.0318  -0.0176 234 THR C N   
1600 C CA  . THR C 11 ? 0.1697 0.2093 0.2260 -0.0128 0.0558  -0.0077 234 THR C CA  
1601 C C   . THR C 11 ? 0.1183 0.1977 0.2108 -0.0201 0.0416  -0.0019 234 THR C C   
1602 O O   . THR C 11 ? 0.1255 0.1974 0.2229 -0.0180 0.0333  -0.0095 234 THR C O   
1603 C CB  . THR C 11 ? 0.1953 0.1973 0.2404 -0.0210 0.0516  -0.0021 234 THR C CB  
1604 O OG1 . THR C 11 ? 0.3345 0.2761 0.3100 0.0037  0.0046  0.0015  234 THR C OG1 
1605 C CG2 . THR C 11 ? 0.2608 0.2115 0.2571 0.0168  0.0302  -0.0187 234 THR C CG2 
1606 N N   . SER C 12 ? 0.1275 0.2171 0.2037 -0.0144 0.0396  0.0030  235 SER C N   
1607 C CA  . SER C 12 ? 0.1287 0.2175 0.1895 -0.0127 0.0418  -0.0014 235 SER C CA  
1608 C C   . SER C 12 ? 0.1929 0.2026 0.2051 -0.0151 0.0284  0.0058  235 SER C C   
1609 O O   . SER C 12 ? 0.2461 0.2187 0.2129 -0.0379 0.0075  0.0065  235 SER C O   
1610 C CB  . SER C 12 ? 0.1249 0.2465 0.2080 -0.0198 0.0561  0.0077  235 SER C CB  
1611 O OG  . SER C 12 ? 0.1302 0.2467 0.2317 0.0052  0.0442  -0.0193 235 SER C OG  
1612 N N   . GLN C 13 ? 0.1681 0.1946 0.1803 -0.0051 0.0311  0.0050  236 GLN C N   
1613 C CA  . GLN C 13 ? 0.1804 0.1955 0.1881 0.0082  0.0254  0.0008  236 GLN C CA  
1614 C C   . GLN C 13 ? 0.1973 0.1945 0.1913 0.0038  0.0261  -0.0019 236 GLN C C   
1615 O O   . GLN C 13 ? 0.2582 0.2119 0.1909 0.0203  0.0276  0.0028  236 GLN C O   
1616 C CB  . GLN C 13 ? 0.1675 0.1950 0.1915 0.0186  0.0332  -0.0175 236 GLN C CB  
1617 C CG  . GLN C 13 ? 0.2243 0.2418 0.2410 0.0139  0.0315  -0.0104 236 GLN C CG  
1618 C CD  . GLN C 13 ? 0.1937 0.2304 0.2228 -0.0126 -0.0024 -0.0164 236 GLN C CD  
1619 O OE1 . GLN C 13 ? 0.2718 0.3105 0.2518 0.0181  -0.0010 0.0017  236 GLN C OE1 
1620 N NE2 . GLN C 13 ? 0.2076 0.2207 0.2170 -0.0229 0.0279  -0.0197 236 GLN C NE2 
1621 N N   . LYS C 14 ? 0.2215 0.2090 0.1977 -0.0040 0.0351  0.0041  237 LYS C N   
1622 C CA  . LYS C 14 ? 0.2113 0.2467 0.2147 0.0000  0.0341  -0.0024 237 LYS C CA  
1623 C C   . LYS C 14 ? 0.2156 0.2317 0.1972 -0.0008 0.0341  0.0070  237 LYS C C   
1624 O O   . LYS C 14 ? 0.2482 0.2155 0.2517 -0.0134 0.0165  0.0127  237 LYS C O   
1625 C CB  . LYS C 14 ? 0.2585 0.3138 0.2160 0.0027  0.0357  -0.0077 237 LYS C CB  
1626 C CG  . LYS C 14 ? 0.2646 0.3110 0.2542 0.0211  0.0408  -0.0200 237 LYS C CG  
1627 C CD  . LYS C 14 ? 0.2524 0.3364 0.2943 0.0358  0.0326  -0.0188 237 LYS C CD  
1628 C CE  . LYS C 14 ? 0.3756 0.4070 0.3451 0.0179  0.0320  -0.0161 237 LYS C CE  
1629 N NZ  . LYS C 14 ? 0.4313 0.4645 0.4418 0.0326  -0.0063 0.0223  237 LYS C NZ  
1630 N N   . LEU C 15 ? 0.2207 0.2000 0.1949 0.0047  0.0181  -0.0027 238 LEU C N   
1631 C CA  . LEU C 15 ? 0.2457 0.2102 0.1848 0.0173  0.0009  -0.0211 238 LEU C CA  
1632 C C   . LEU C 15 ? 0.2843 0.2283 0.2088 0.0143  -0.0008 -0.0323 238 LEU C C   
1633 O O   . LEU C 15 ? 0.3208 0.2249 0.2112 0.0418  0.0071  -0.0470 238 LEU C O   
1634 C CB  . LEU C 15 ? 0.2292 0.2105 0.1724 -0.0009 0.0091  -0.0156 238 LEU C CB  
1635 C CG  . LEU C 15 ? 0.2304 0.1907 0.1909 -0.0015 0.0126  -0.0157 238 LEU C CG  
1636 C CD1 . LEU C 15 ? 0.2008 0.2332 0.1959 0.0050  0.0281  0.0048  238 LEU C CD1 
1637 C CD2 . LEU C 15 ? 0.2498 0.1826 0.2165 0.0072  0.0074  -0.0142 238 LEU C CD2 
1638 N N   A MET C 16 ? 0.3197 0.2688 0.2317 0.0162  -0.0131 -0.0290 239 MET C N   
1639 N N   B MET C 16 ? 0.3176 0.2585 0.2039 0.0147  -0.0156 -0.0334 239 MET C N   
1640 C CA  A MET C 16 ? 0.3510 0.3178 0.2738 0.0048  -0.0104 -0.0319 239 MET C CA  
1641 C CA  B MET C 16 ? 0.3362 0.2869 0.2161 0.0042  -0.0126 -0.0356 239 MET C CA  
1642 C C   A MET C 16 ? 0.3453 0.2842 0.2533 0.0013  -0.0232 -0.0289 239 MET C C   
1643 C C   B MET C 16 ? 0.3386 0.2722 0.2251 -0.0008 -0.0250 -0.0290 239 MET C C   
1644 O O   A MET C 16 ? 0.3288 0.2559 0.2299 -0.0077 -0.0167 -0.0338 239 MET C O   
1645 O O   B MET C 16 ? 0.3114 0.2365 0.1714 -0.0160 -0.0314 -0.0344 239 MET C O   
1646 C CB  A MET C 16 ? 0.3608 0.3342 0.2702 0.0010  -0.0142 -0.0242 239 MET C CB  
1647 C CB  B MET C 16 ? 0.3661 0.3159 0.2264 -0.0057 -0.0111 -0.0217 239 MET C CB  
1648 C CG  A MET C 16 ? 0.3728 0.3732 0.3449 -0.0061 -0.0038 -0.0187 239 MET C CG  
1649 C CG  B MET C 16 ? 0.3759 0.3515 0.2777 -0.0048 -0.0080 -0.0167 239 MET C CG  
1650 S SD  A MET C 16 ? 0.4225 0.4118 0.3712 0.0029  -0.0017 0.0003  239 MET C SD  
1651 S SD  B MET C 16 ? 0.4375 0.3956 0.3425 -0.0129 0.0271  -0.0233 239 MET C SD  
1652 C CE  A MET C 16 ? 0.4117 0.3816 0.3538 -0.0043 0.0057  0.0042  239 MET C CE  
1653 C CE  B MET C 16 ? 0.4099 0.3683 0.3396 -0.0050 0.0064  -0.0099 239 MET C CE  
1654 N N   . PRO C 17 ? 0.3373 0.2805 0.2464 0.0045  -0.0227 -0.0456 240 PRO C N   
1655 C CA  . PRO C 17 ? 0.3391 0.2569 0.2550 -0.0100 -0.0319 -0.0432 240 PRO C CA  
1656 C C   . PRO C 17 ? 0.3315 0.2491 0.2535 -0.0189 -0.0427 -0.0377 240 PRO C C   
1657 O O   . PRO C 17 ? 0.3587 0.2582 0.2512 -0.0061 -0.0602 -0.0252 240 PRO C O   
1658 C CB  . PRO C 17 ? 0.3325 0.2641 0.2880 -0.0216 -0.0297 -0.0597 240 PRO C CB  
1659 C CG  . PRO C 17 ? 0.3667 0.3152 0.2994 -0.0081 -0.0202 -0.0415 240 PRO C CG  
1660 C CD  . PRO C 17 ? 0.3576 0.2989 0.2798 0.0101  -0.0131 -0.0475 240 PRO C CD  
1661 N N   . GLY C 18 ? 0.3080 0.2327 0.2448 -0.0365 -0.0563 -0.0318 241 GLY C N   
1662 C CA  . GLY C 18 ? 0.3027 0.2519 0.2681 -0.0298 -0.0576 -0.0240 241 GLY C CA  
1663 C C   . GLY C 18 ? 0.2952 0.2523 0.2504 -0.0239 -0.0505 -0.0057 241 GLY C C   
1664 O O   . GLY C 18 ? 0.2906 0.2904 0.2859 -0.0295 -0.0552 -0.0244 241 GLY C O   
1665 N N   A SER C 19 ? 0.2809 0.2241 0.2236 -0.0281 -0.0416 -0.0161 242 SER C N   
1666 N N   B SER C 19 ? 0.2843 0.2369 0.2299 -0.0281 -0.0414 -0.0168 242 SER C N   
1667 C CA  A SER C 19 ? 0.2711 0.1951 0.2072 -0.0220 -0.0324 -0.0041 242 SER C CA  
1668 C CA  B SER C 19 ? 0.2748 0.2189 0.2150 -0.0207 -0.0323 -0.0079 242 SER C CA  
1669 C C   A SER C 19 ? 0.2496 0.1863 0.2004 -0.0359 -0.0354 0.0000  242 SER C C   
1670 C C   B SER C 19 ? 0.2506 0.1966 0.2071 -0.0370 -0.0294 -0.0019 242 SER C C   
1671 O O   A SER C 19 ? 0.2441 0.1823 0.2235 -0.0393 -0.0299 0.0067  242 SER C O   
1672 O O   B SER C 19 ? 0.2592 0.1940 0.2295 -0.0440 -0.0237 -0.0058 242 SER C O   
1673 C CB  A SER C 19 ? 0.2679 0.1893 0.2188 -0.0206 -0.0257 -0.0007 242 SER C CB  
1674 C CB  B SER C 19 ? 0.2790 0.2304 0.2368 -0.0225 -0.0254 -0.0088 242 SER C CB  
1675 O OG  A SER C 19 ? 0.3066 0.1618 0.2154 -0.0162 -0.0056 0.0026  242 SER C OG  
1676 O OG  B SER C 19 ? 0.3004 0.2775 0.2198 -0.0043 -0.0361 -0.0045 242 SER C OG  
1677 N N   . THR C 20 ? 0.2702 0.1902 0.1886 -0.0398 -0.0338 0.0103  243 THR C N   
1678 C CA  . THR C 20 ? 0.2267 0.2002 0.1974 -0.0170 -0.0245 0.0089  243 THR C CA  
1679 C C   . THR C 20 ? 0.2222 0.1577 0.2001 -0.0256 -0.0210 -0.0045 243 THR C C   
1680 O O   . THR C 20 ? 0.2312 0.1620 0.1975 -0.0524 -0.0145 0.0014  243 THR C O   
1681 C CB  . THR C 20 ? 0.2287 0.2249 0.2007 0.0010  -0.0349 0.0036  243 THR C CB  
1682 O OG1 . THR C 20 ? 0.2660 0.2902 0.2736 0.0066  -0.0801 0.0284  243 THR C OG1 
1683 C CG2 . THR C 20 ? 0.2350 0.2247 0.2152 0.0031  -0.0112 -0.0057 243 THR C CG2 
1684 N N   . LEU C 21 ? 0.2114 0.1613 0.1857 -0.0167 -0.0167 0.0014  244 LEU C N   
1685 C CA  . LEU C 21 ? 0.1746 0.1603 0.2090 -0.0141 -0.0020 0.0040  244 LEU C CA  
1686 C C   . LEU C 21 ? 0.1574 0.1639 0.1902 -0.0183 -0.0145 0.0040  244 LEU C C   
1687 O O   . LEU C 21 ? 0.1552 0.1779 0.2049 -0.0146 -0.0261 0.0040  244 LEU C O   
1688 C CB  . LEU C 21 ? 0.1986 0.1603 0.2111 -0.0096 0.0027  -0.0023 244 LEU C CB  
1689 C CG  . LEU C 21 ? 0.1814 0.1798 0.2381 0.0105  0.0130  0.0077  244 LEU C CG  
1690 C CD1 . LEU C 21 ? 0.1819 0.2088 0.2242 0.0105  0.0247  -0.0303 244 LEU C CD1 
1691 C CD2 . LEU C 21 ? 0.1974 0.2028 0.2659 0.0015  0.0140  0.0203  244 LEU C CD2 
1692 N N   . VAL C 22 ? 0.1675 0.1548 0.1916 -0.0103 -0.0271 -0.0075 245 VAL C N   
1693 C CA  . VAL C 22 ? 0.1823 0.1418 0.2069 0.0083  -0.0265 -0.0078 245 VAL C CA  
1694 C C   . VAL C 22 ? 0.1457 0.1436 0.1919 -0.0011 -0.0177 -0.0156 245 VAL C C   
1695 O O   . VAL C 22 ? 0.1702 0.1664 0.1915 -0.0248 0.0022  0.0003  245 VAL C O   
1696 C CB  . VAL C 22 ? 0.2052 0.1569 0.2355 0.0221  -0.0275 -0.0220 245 VAL C CB  
1697 C CG1 . VAL C 22 ? 0.2489 0.2049 0.2830 0.0507  -0.0056 -0.0331 245 VAL C CG1 
1698 C CG2 . VAL C 22 ? 0.2436 0.1930 0.2802 0.0425  -0.0542 0.0006  245 VAL C CG2 
1699 N N   . LEU C 23 ? 0.1320 0.1352 0.1785 0.0051  -0.0128 -0.0121 246 LEU C N   
1700 C CA  . LEU C 23 ? 0.1344 0.1411 0.1896 0.0138  -0.0069 -0.0181 246 LEU C CA  
1701 C C   . LEU C 23 ? 0.1138 0.1255 0.1863 0.0011  -0.0101 -0.0092 246 LEU C C   
1702 O O   . LEU C 23 ? 0.1056 0.1814 0.2002 -0.0143 -0.0062 -0.0212 246 LEU C O   
1703 C CB  . LEU C 23 ? 0.1394 0.1247 0.2179 0.0033  -0.0046 -0.0096 246 LEU C CB  
1704 C CG  . LEU C 23 ? 0.1391 0.1685 0.1985 0.0106  -0.0057 -0.0389 246 LEU C CG  
1705 C CD1 . LEU C 23 ? 0.1760 0.1687 0.2593 0.0140  0.0314  -0.0230 246 LEU C CD1 
1706 C CD2 . LEU C 23 ? 0.1859 0.2208 0.2900 0.0265  0.0633  -0.0432 246 LEU C CD2 
1707 N N   . GLN C 24 ? 0.0958 0.1284 0.1762 -0.0021 -0.0074 -0.0056 247 GLN C N   
1708 C CA  . GLN C 24 ? 0.1204 0.1204 0.1805 0.0030  -0.0012 -0.0102 247 GLN C CA  
1709 C C   . GLN C 24 ? 0.1182 0.1198 0.1700 -0.0204 -0.0069 -0.0105 247 GLN C C   
1710 O O   . GLN C 24 ? 0.1204 0.1598 0.1839 -0.0124 -0.0106 0.0024  247 GLN C O   
1711 C CB  . GLN C 24 ? 0.1455 0.1225 0.1890 0.0074  0.0027  -0.0058 247 GLN C CB  
1712 C CG  . GLN C 24 ? 0.1739 0.1209 0.1965 0.0158  -0.0077 -0.0173 247 GLN C CG  
1713 C CD  . GLN C 24 ? 0.1686 0.1406 0.1782 0.0131  0.0001  -0.0066 247 GLN C CD  
1714 O OE1 . GLN C 24 ? 0.2250 0.2009 0.2496 -0.0007 0.0344  0.0225  247 GLN C OE1 
1715 N NE2 . GLN C 24 ? 0.1571 0.1307 0.1581 0.0198  0.0040  -0.0113 247 GLN C NE2 
1716 N N   . CYS C 25 ? 0.1315 0.1189 0.1649 -0.0168 -0.0106 0.0025  248 CYS C N   
1717 C CA  . CYS C 25 ? 0.1320 0.1282 0.1680 -0.0067 -0.0137 0.0002  248 CYS C CA  
1718 C C   . CYS C 25 ? 0.1212 0.1596 0.1600 0.0029  -0.0078 0.0088  248 CYS C C   
1719 O O   . CYS C 25 ? 0.1447 0.1412 0.1847 -0.0125 0.0113  -0.0123 248 CYS C O   
1720 C CB  . CYS C 25 ? 0.1297 0.1540 0.1486 0.0085  -0.0045 0.0042  248 CYS C CB  
1721 S SG  . CYS C 25 ? 0.1349 0.1683 0.1904 0.0014  -0.0124 0.0075  248 CYS C SG  
1722 N N   . VAL C 26 ? 0.1361 0.1545 0.1768 -0.0056 -0.0069 -0.0092 249 VAL C N   
1723 C CA  . VAL C 26 ? 0.1519 0.1603 0.1821 0.0105  -0.0031 -0.0054 249 VAL C CA  
1724 C C   . VAL C 26 ? 0.1411 0.1563 0.1921 -0.0243 0.0001  -0.0242 249 VAL C C   
1725 O O   . VAL C 26 ? 0.1553 0.1904 0.1964 -0.0294 -0.0070 -0.0035 249 VAL C O   
1726 C CB  . VAL C 26 ? 0.1997 0.1477 0.2127 0.0103  -0.0213 -0.0131 249 VAL C CB  
1727 C CG1 . VAL C 26 ? 0.2052 0.1751 0.2407 0.0540  -0.0103 -0.0286 249 VAL C CG1 
1728 C CG2 . VAL C 26 ? 0.1963 0.1989 0.2145 0.0376  -0.0188 -0.0077 249 VAL C CG2 
1729 N N   . ALA C 27 ? 0.1560 0.1582 0.1763 -0.0103 0.0012  -0.0140 250 ALA C N   
1730 C CA  . ALA C 27 ? 0.1479 0.1632 0.1756 -0.0021 0.0117  -0.0099 250 ALA C CA  
1731 C C   . ALA C 27 ? 0.1574 0.1717 0.1994 -0.0196 0.0155  -0.0053 250 ALA C C   
1732 O O   . ALA C 27 ? 0.1935 0.1967 0.2236 0.0108  0.0086  -0.0319 250 ALA C O   
1733 C CB  . ALA C 27 ? 0.1619 0.1750 0.2132 -0.0198 -0.0007 0.0050  250 ALA C CB  
1734 N N   . VAL C 28 ? 0.2074 0.1864 0.1982 -0.0041 -0.0060 -0.0305 251 VAL C N   
1735 C CA  . VAL C 28 ? 0.2248 0.1884 0.2175 -0.0150 -0.0008 -0.0294 251 VAL C CA  
1736 C C   . VAL C 28 ? 0.2277 0.2106 0.2138 -0.0190 0.0036  -0.0299 251 VAL C C   
1737 O O   . VAL C 28 ? 0.2338 0.2248 0.2097 -0.0168 0.0234  -0.0114 251 VAL C O   
1738 C CB  . VAL C 28 ? 0.2656 0.2001 0.2435 -0.0148 -0.0047 -0.0310 251 VAL C CB  
1739 C CG1 . VAL C 28 ? 0.3470 0.2505 0.2727 0.0016  -0.0097 -0.0190 251 VAL C CG1 
1740 C CG2 . VAL C 28 ? 0.2855 0.2167 0.2568 -0.0399 0.0102  -0.0501 251 VAL C CG2 
1741 N N   . GLY C 29 ? 0.2547 0.2186 0.2162 -0.0253 0.0194  -0.0182 252 GLY C N   
1742 C CA  . GLY C 29 ? 0.2634 0.2603 0.2323 -0.0134 0.0250  -0.0181 252 GLY C CA  
1743 C C   . GLY C 29 ? 0.2596 0.2276 0.2397 -0.0103 0.0260  -0.0313 252 GLY C C   
1744 O O   . GLY C 29 ? 0.2635 0.2066 0.2486 0.0081  0.0356  -0.0437 252 GLY C O   
1745 N N   . SER C 30 ? 0.2547 0.2430 0.2422 -0.0162 0.0391  -0.0358 253 SER C N   
1746 C CA  . SER C 30 ? 0.2643 0.2463 0.2403 -0.0152 0.0368  -0.0334 253 SER C CA  
1747 C C   . SER C 30 ? 0.2595 0.2644 0.2349 -0.0177 0.0278  -0.0231 253 SER C C   
1748 O O   . SER C 30 ? 0.2730 0.3102 0.2558 -0.0308 0.0071  -0.0099 253 SER C O   
1749 C CB  . SER C 30 ? 0.2773 0.2606 0.2554 -0.0084 0.0483  -0.0462 253 SER C CB  
1750 O OG  . SER C 30 ? 0.3478 0.3217 0.3303 0.0026  0.0697  -0.0448 253 SER C OG  
1751 N N   . PRO C 31 ? 0.2438 0.2572 0.2233 -0.0081 0.0319  -0.0158 254 PRO C N   
1752 C CA  . PRO C 31 ? 0.2281 0.2247 0.2085 0.0028  0.0454  -0.0232 254 PRO C CA  
1753 C C   . PRO C 31 ? 0.2070 0.2072 0.2007 0.0087  0.0350  -0.0293 254 PRO C C   
1754 O O   . PRO C 31 ? 0.1996 0.2162 0.2048 0.0099  0.0241  -0.0216 254 PRO C O   
1755 C CB  . PRO C 31 ? 0.2352 0.2408 0.2375 0.0009  0.0309  -0.0015 254 PRO C CB  
1756 C CG  . PRO C 31 ? 0.2527 0.2652 0.2344 -0.0080 0.0198  0.0100  254 PRO C CG  
1757 C CD  . PRO C 31 ? 0.2552 0.2747 0.2316 -0.0139 0.0179  -0.0047 254 PRO C CD  
1758 N N   A ILE C 32 ? 0.1841 0.1898 0.1888 0.0202  0.0360  -0.0338 255 ILE C N   
1759 N N   B ILE C 32 ? 0.2040 0.2019 0.2017 0.0154  0.0304  -0.0309 255 ILE C N   
1760 C CA  A ILE C 32 ? 0.1672 0.1915 0.2036 0.0236  0.0199  -0.0201 255 ILE C CA  
1761 C CA  B ILE C 32 ? 0.2039 0.2187 0.2283 0.0139  0.0184  -0.0211 255 ILE C CA  
1762 C C   A ILE C 32 ? 0.1701 0.1804 0.1981 0.0147  0.0206  -0.0285 255 ILE C C   
1763 C C   B ILE C 32 ? 0.1957 0.1971 0.2140 0.0069  0.0169  -0.0258 255 ILE C C   
1764 O O   A ILE C 32 ? 0.1505 0.1989 0.1787 0.0054  0.0402  -0.0244 255 ILE C O   
1765 O O   B ILE C 32 ? 0.2070 0.1981 0.2076 0.0050  0.0197  -0.0261 255 ILE C O   
1766 C CB  A ILE C 32 ? 0.1511 0.2089 0.2222 0.0262  0.0234  -0.0180 255 ILE C CB  
1767 C CB  B ILE C 32 ? 0.1985 0.2327 0.2423 0.0148  0.0159  -0.0173 255 ILE C CB  
1768 C CG1 A ILE C 32 ? 0.1641 0.2041 0.2297 0.0513  0.0225  0.0019  255 ILE C CG1 
1769 C CG1 B ILE C 32 ? 0.2311 0.2502 0.2521 0.0169  0.0287  -0.0209 255 ILE C CG1 
1770 C CG2 A ILE C 32 ? 0.2043 0.2173 0.2343 0.0189  0.0194  -0.0180 255 ILE C CG2 
1771 C CG2 B ILE C 32 ? 0.2045 0.2378 0.2410 0.0151  0.0184  -0.0065 255 ILE C CG2 
1772 C CD1 A ILE C 32 ? 0.1945 0.3148 0.2810 0.0051  -0.0077 -0.0238 255 ILE C CD1 
1773 C CD1 B ILE C 32 ? 0.2412 0.2590 0.2747 0.0171  0.0000  -0.0149 255 ILE C CD1 
1774 N N   . PRO C 33 ? 0.1701 0.1747 0.2080 -0.0033 0.0272  -0.0303 256 PRO C N   
1775 C CA  . PRO C 33 ? 0.1580 0.1878 0.1998 0.0002  0.0326  -0.0346 256 PRO C CA  
1776 C C   . PRO C 33 ? 0.1348 0.1953 0.2005 0.0048  0.0198  -0.0117 256 PRO C C   
1777 O O   . PRO C 33 ? 0.1796 0.1899 0.2064 0.0241  -0.0094 -0.0205 256 PRO C O   
1778 C CB  . PRO C 33 ? 0.1516 0.1960 0.2229 -0.0141 0.0518  -0.0378 256 PRO C CB  
1779 C CG  . PRO C 33 ? 0.2068 0.2109 0.2495 -0.0071 0.0634  -0.0430 256 PRO C CG  
1780 C CD  . PRO C 33 ? 0.2023 0.2129 0.2392 -0.0080 0.0450  -0.0339 256 PRO C CD  
1781 N N   . HIS C 34 ? 0.1410 0.1776 0.1773 -0.0028 0.0149  -0.0156 257 HIS C N   
1782 C CA  . HIS C 34 ? 0.1262 0.1688 0.1839 -0.0197 0.0214  -0.0261 257 HIS C CA  
1783 C C   . HIS C 34 ? 0.1022 0.1639 0.1798 -0.0086 0.0143  -0.0176 257 HIS C C   
1784 O O   . HIS C 34 ? 0.1235 0.1684 0.1851 -0.0091 0.0057  -0.0030 257 HIS C O   
1785 C CB  . HIS C 34 ? 0.1628 0.2101 0.1768 -0.0340 0.0336  -0.0184 257 HIS C CB  
1786 C CG  . HIS C 34 ? 0.2090 0.2492 0.2332 -0.0353 0.0234  -0.0116 257 HIS C CG  
1787 N ND1 . HIS C 34 ? 0.2200 0.4139 0.2751 -0.0004 0.0690  -0.0277 257 HIS C ND1 
1788 C CD2 . HIS C 34 ? 0.2392 0.2751 0.2276 -0.0190 0.0701  -0.0406 257 HIS C CD2 
1789 C CE1 . HIS C 34 ? 0.1507 0.4117 0.2661 -0.0471 0.0841  -0.0205 257 HIS C CE1 
1790 N NE2 . HIS C 34 ? 0.3890 0.4363 0.3678 -0.0098 -0.0347 -0.0001 257 HIS C NE2 
1791 N N   . TYR C 35 ? 0.1323 0.1696 0.1681 -0.0046 0.0160  -0.0117 258 TYR C N   
1792 C CA  . TYR C 35 ? 0.1161 0.1624 0.1634 -0.0154 0.0188  -0.0027 258 TYR C CA  
1793 C C   . TYR C 35 ? 0.1125 0.1715 0.1732 -0.0169 0.0145  0.0059  258 TYR C C   
1794 O O   . TYR C 35 ? 0.1118 0.1672 0.1803 -0.0263 0.0259  -0.0112 258 TYR C O   
1795 C CB  . TYR C 35 ? 0.1159 0.1517 0.1815 -0.0236 -0.0099 -0.0076 258 TYR C CB  
1796 C CG  . TYR C 35 ? 0.1104 0.1671 0.1724 0.0053  -0.0019 -0.0065 258 TYR C CG  
1797 C CD1 . TYR C 35 ? 0.1094 0.1535 0.1977 -0.0096 -0.0029 0.0026  258 TYR C CD1 
1798 C CD2 . TYR C 35 ? 0.1159 0.1665 0.1955 -0.0071 -0.0064 0.0024  258 TYR C CD2 
1799 C CE1 . TYR C 35 ? 0.1048 0.1631 0.1899 0.0067  0.0225  -0.0096 258 TYR C CE1 
1800 C CE2 . TYR C 35 ? 0.1159 0.1571 0.2043 0.0000  0.0117  0.0013  258 TYR C CE2 
1801 C CZ  . TYR C 35 ? 0.1336 0.1509 0.1826 -0.0141 -0.0061 0.0002  258 TYR C CZ  
1802 O OH  . TYR C 35 ? 0.1463 0.1452 0.2237 -0.0197 0.0012  -0.0146 258 TYR C OH  
1803 N N   . GLN C 36 ? 0.1048 0.1533 0.1725 -0.0104 0.0211  -0.0075 259 GLN C N   
1804 C CA  . GLN C 36 ? 0.1195 0.1341 0.1732 -0.0140 0.0336  -0.0042 259 GLN C CA  
1805 C C   . GLN C 36 ? 0.1065 0.1336 0.1796 -0.0003 0.0152  0.0069  259 GLN C C   
1806 O O   . GLN C 36 ? 0.1016 0.1436 0.1824 -0.0087 0.0132  -0.0046 259 GLN C O   
1807 C CB  . GLN C 36 ? 0.1466 0.1453 0.1662 -0.0180 0.0340  0.0017  259 GLN C CB  
1808 C CG  . GLN C 36 ? 0.1380 0.1495 0.1900 -0.0349 -0.0013 -0.0100 259 GLN C CG  
1809 C CD  . GLN C 36 ? 0.1251 0.1438 0.1951 -0.0733 0.0119  0.0128  259 GLN C CD  
1810 O OE1 . GLN C 36 ? 0.1425 0.1830 0.2000 -0.0399 0.0136  -0.0077 259 GLN C OE1 
1811 N NE2 . GLN C 36 ? 0.1558 0.1783 0.1877 -0.0365 0.0136  0.0127  259 GLN C NE2 
1812 N N   . TRP C 37 ? 0.1232 0.1345 0.1663 -0.0055 0.0143  -0.0082 260 TRP C N   
1813 C CA  . TRP C 37 ? 0.1222 0.1295 0.1556 -0.0009 0.0165  -0.0052 260 TRP C CA  
1814 C C   . TRP C 37 ? 0.1153 0.1610 0.1525 -0.0122 0.0263  -0.0070 260 TRP C C   
1815 O O   . TRP C 37 ? 0.1403 0.1330 0.1910 -0.0197 0.0180  0.0017  260 TRP C O   
1816 C CB  . TRP C 37 ? 0.1205 0.1386 0.1796 -0.0138 0.0056  0.0021  260 TRP C CB  
1817 C CG  . TRP C 37 ? 0.1032 0.1256 0.1727 0.0029  0.0097  -0.0036 260 TRP C CG  
1818 C CD1 . TRP C 37 ? 0.0882 0.1434 0.1866 -0.0228 -0.0082 0.0043  260 TRP C CD1 
1819 C CD2 . TRP C 37 ? 0.0937 0.1497 0.1583 -0.0060 0.0044  -0.0024 260 TRP C CD2 
1820 N NE1 . TRP C 37 ? 0.0892 0.1465 0.1849 -0.0042 0.0023  0.0004  260 TRP C NE1 
1821 C CE2 . TRP C 37 ? 0.0895 0.1437 0.1626 -0.0077 0.0143  -0.0046 260 TRP C CE2 
1822 C CE3 . TRP C 37 ? 0.1171 0.1468 0.1608 -0.0180 0.0046  0.0077  260 TRP C CE3 
1823 C CZ2 . TRP C 37 ? 0.1031 0.1508 0.1748 -0.0061 0.0068  0.0164  260 TRP C CZ2 
1824 C CZ3 . TRP C 37 ? 0.1075 0.1654 0.1627 -0.0123 0.0200  -0.0098 260 TRP C CZ3 
1825 C CH2 . TRP C 37 ? 0.1090 0.1648 0.1590 -0.0140 0.0105  0.0058  260 TRP C CH2 
1826 N N   . PHE C 38 ? 0.1222 0.1419 0.1579 0.0030  0.0145  -0.0042 261 PHE C N   
1827 C CA  . PHE C 38 ? 0.1533 0.1504 0.1836 0.0157  0.0193  -0.0034 261 PHE C CA  
1828 C C   . PHE C 38 ? 0.1628 0.1617 0.1961 0.0108  0.0280  -0.0013 261 PHE C C   
1829 O O   . PHE C 38 ? 0.1542 0.1606 0.1962 0.0103  0.0251  -0.0021 261 PHE C O   
1830 C CB  . PHE C 38 ? 0.1471 0.1755 0.1905 0.0181  0.0172  0.0019  261 PHE C CB  
1831 C CG  . PHE C 38 ? 0.1513 0.1499 0.1949 0.0157  0.0171  0.0117  261 PHE C CG  
1832 C CD1 . PHE C 38 ? 0.2276 0.1644 0.1926 0.0174  -0.0057 -0.0117 261 PHE C CD1 
1833 C CD2 . PHE C 38 ? 0.1169 0.1611 0.2054 0.0090  0.0162  0.0011  261 PHE C CD2 
1834 C CE1 . PHE C 38 ? 0.2577 0.1610 0.1898 -0.0096 -0.0116 0.0229  261 PHE C CE1 
1835 C CE2 . PHE C 38 ? 0.1547 0.1739 0.2083 0.0075  -0.0093 0.0075  261 PHE C CE2 
1836 C CZ  . PHE C 38 ? 0.1632 0.1953 0.2071 -0.0003 -0.0150 0.0049  261 PHE C CZ  
1837 N N   . LYS C 39 ? 0.1725 0.1642 0.1948 0.0175  0.0427  -0.0087 262 LYS C N   
1838 C CA  . LYS C 39 ? 0.1921 0.1826 0.1880 0.0403  0.0469  -0.0070 262 LYS C CA  
1839 C C   . LYS C 39 ? 0.2418 0.1978 0.2235 0.0289  0.0337  0.0115  262 LYS C C   
1840 O O   . LYS C 39 ? 0.2940 0.1701 0.2216 0.0403  0.0440  -0.0032 262 LYS C O   
1841 C CB  . LYS C 39 ? 0.2226 0.1960 0.1910 0.0360  0.0346  -0.0026 262 LYS C CB  
1842 C CG  . LYS C 39 ? 0.2958 0.2607 0.2122 0.0587  -0.0006 -0.0198 262 LYS C CG  
1843 C CD  . LYS C 39 ? 0.3900 0.3238 0.2880 0.0381  -0.0310 -0.0140 262 LYS C CD  
1844 C CE  . LYS C 39 ? 0.4264 0.3970 0.3725 -0.0091 -0.0314 -0.0051 262 LYS C CE  
1845 N NZ  . LYS C 39 ? 0.4582 0.3885 0.3818 0.0038  0.0083  -0.0009 262 LYS C NZ  
1846 N N   . ASN C 40 ? 0.2381 0.2019 0.2371 0.0677  0.0391  0.0077  263 ASN C N   
1847 C CA  . ASN C 40 ? 0.2731 0.2024 0.2461 0.0558  0.0395  0.0203  263 ASN C CA  
1848 C C   . ASN C 40 ? 0.2846 0.2081 0.2686 0.0538  0.0276  0.0092  263 ASN C C   
1849 O O   . ASN C 40 ? 0.3207 0.2297 0.2874 0.0501  0.0509  0.0113  263 ASN C O   
1850 C CB  . ASN C 40 ? 0.2967 0.2254 0.2779 0.0543  0.0215  0.0016  263 ASN C CB  
1851 C CG  . ASN C 40 ? 0.2804 0.2375 0.2947 0.0415  0.0433  -0.0145 263 ASN C CG  
1852 O OD1 . ASN C 40 ? 0.2986 0.2098 0.3129 0.0643  0.0926  -0.0003 263 ASN C OD1 
1853 N ND2 . ASN C 40 ? 0.3589 0.2869 0.3273 0.0159  0.0151  -0.0288 263 ASN C ND2 
1854 N N   . GLU C 41 ? 0.2747 0.2575 0.2441 0.0573  0.0269  0.0119  264 GLU C N   
1855 C CA  . GLU C 41 ? 0.3059 0.2566 0.2652 0.0523  0.0079  0.0347  264 GLU C CA  
1856 C C   . GLU C 41 ? 0.3145 0.2273 0.2563 0.0433  0.0284  0.0370  264 GLU C C   
1857 O O   . GLU C 41 ? 0.3746 0.3013 0.2644 0.0511  0.0190  0.0555  264 GLU C O   
1858 C CB  . GLU C 41 ? 0.3183 0.2800 0.2919 0.0542  0.0129  0.0319  264 GLU C CB  
1859 C CG  . GLU C 41 ? 0.3321 0.3368 0.3264 0.0393  0.0155  0.0260  264 GLU C CG  
1860 C CD  . GLU C 41 ? 0.4198 0.4369 0.4158 0.0040  -0.0064 0.0138  264 GLU C CD  
1861 O OE1 . GLU C 41 ? 0.4272 0.4213 0.3933 0.0403  0.0013  0.0069  264 GLU C OE1 
1862 O OE2 . GLU C 41 ? 0.4283 0.4967 0.4612 -0.0102 0.0144  0.0199  264 GLU C OE2 
1863 N N   . LEU C 42 ? 0.2746 0.1806 0.2404 0.0572  0.0485  0.0110  265 LEU C N   
1864 C CA  . LEU C 42 ? 0.2988 0.1611 0.2478 0.0290  0.0414  -0.0038 265 LEU C CA  
1865 C C   . LEU C 42 ? 0.2680 0.1504 0.2195 0.0156  0.0502  -0.0065 265 LEU C C   
1866 O O   . LEU C 42 ? 0.2434 0.1372 0.2113 0.0091  0.0394  0.0063  265 LEU C O   
1867 C CB  . LEU C 42 ? 0.3330 0.1627 0.3060 0.0070  0.0335  -0.0288 265 LEU C CB  
1868 C CG  . LEU C 42 ? 0.3704 0.1922 0.3454 0.0020  0.0474  -0.0314 265 LEU C CG  
1869 C CD1 . LEU C 42 ? 0.3938 0.3188 0.4184 -0.0290 -0.0163 -0.0502 265 LEU C CD1 
1870 C CD2 . LEU C 42 ? 0.3908 0.2764 0.3765 0.0196  0.0115  -0.0246 265 LEU C CD2 
1871 N N   . PRO C 43 ? 0.2568 0.1533 0.2059 0.0031  0.0434  0.0152  266 PRO C N   
1872 C CA  . PRO C 43 ? 0.2385 0.1552 0.2076 0.0003  0.0239  -0.0031 266 PRO C CA  
1873 C C   . PRO C 43 ? 0.2179 0.1529 0.2134 -0.0234 0.0252  -0.0115 266 PRO C C   
1874 O O   . PRO C 43 ? 0.2530 0.1656 0.2553 -0.0443 0.0004  -0.0166 266 PRO C O   
1875 C CB  . PRO C 43 ? 0.2718 0.1732 0.2140 0.0002  0.0286  0.0120  266 PRO C CB  
1876 C CG  . PRO C 43 ? 0.2749 0.1909 0.2393 -0.0052 0.0341  0.0241  266 PRO C CG  
1877 C CD  . PRO C 43 ? 0.2682 0.1823 0.2316 0.0117  0.0460  0.0326  266 PRO C CD  
1878 N N   . LEU C 44 ? 0.1844 0.1480 0.2102 -0.0260 0.0135  0.0022  267 LEU C N   
1879 C CA  . LEU C 44 ? 0.1677 0.1771 0.2044 -0.0290 0.0226  0.0006  267 LEU C CA  
1880 C C   . LEU C 44 ? 0.1253 0.1571 0.2129 -0.0803 0.0029  -0.0138 267 LEU C C   
1881 O O   . LEU C 44 ? 0.1531 0.2094 0.2150 -0.0247 0.0128  -0.0054 267 LEU C O   
1882 C CB  . LEU C 44 ? 0.1703 0.1784 0.2035 -0.0253 0.0247  -0.0017 267 LEU C CB  
1883 C CG  . LEU C 44 ? 0.1802 0.1812 0.2048 -0.0182 0.0424  -0.0069 267 LEU C CG  
1884 C CD1 . LEU C 44 ? 0.2325 0.1912 0.1973 -0.0380 0.0394  0.0273  267 LEU C CD1 
1885 C CD2 . LEU C 44 ? 0.2860 0.2338 0.2678 -0.0752 0.0471  -0.0521 267 LEU C CD2 
1886 N N   . THR C 45 ? 0.1709 0.1931 0.2656 -0.0711 -0.0016 0.0053  268 THR C N   
1887 C CA  . THR C 45 ? 0.2687 0.2718 0.2996 0.0197  0.0071  -0.0046 268 THR C CA  
1888 C C   . THR C 45 ? 0.2219 0.2276 0.2723 -0.0086 0.0064  -0.0065 268 THR C C   
1889 O O   . THR C 45 ? 0.1970 0.2348 0.2838 -0.0352 -0.0223 -0.0097 268 THR C O   
1890 C CB  . THR C 45 ? 0.2608 0.2925 0.3344 0.0329  0.0107  -0.0090 268 THR C CB  
1891 O OG1 . THR C 45 ? 0.2236 0.2265 0.3790 -0.0315 0.0295  -0.0213 268 THR C OG1 
1892 C CG2 . THR C 45 ? 0.1916 0.2202 0.3088 -0.0653 0.0064  0.0052  268 THR C CG2 
1893 N N   . HIS C 46 ? 0.2113 0.2668 0.2918 -0.0112 0.0142  -0.0036 269 HIS C N   
1894 C CA  . HIS C 46 ? 0.1436 0.2446 0.2876 -0.0367 0.0170  0.0015  269 HIS C CA  
1895 C C   . HIS C 46 ? 0.1681 0.2071 0.2771 -0.0430 0.0159  -0.0027 269 HIS C C   
1896 O O   . HIS C 46 ? 0.1650 0.2279 0.2922 -0.0204 0.0216  -0.0025 269 HIS C O   
1897 C CB  . HIS C 46 ? 0.1247 0.2464 0.3176 -0.0774 0.0090  0.0042  269 HIS C CB  
1898 C CG  . HIS C 46 ? 0.1949 0.2796 0.3570 -0.0470 -0.0137 0.0026  269 HIS C CG  
1899 N ND1 . HIS C 46 ? 0.2911 0.2948 0.3927 -0.0233 -0.0285 -0.0072 269 HIS C ND1 
1900 C CD2 . HIS C 46 ? 0.2724 0.3370 0.3917 -0.0345 -0.0013 0.0171  269 HIS C CD2 
1901 C CE1 . HIS C 46 ? 0.1951 0.2971 0.4168 -0.0631 -0.0385 -0.0089 269 HIS C CE1 
1902 N NE2 . HIS C 46 ? 0.1865 0.3159 0.4353 -0.0811 0.0272  0.0219  269 HIS C NE2 
1903 N N   . GLU C 47 ? 0.1631 0.2245 0.2300 -0.0151 -0.0005 -0.0018 270 GLU C N   
1904 C CA  . GLU C 47 ? 0.1260 0.1891 0.2089 -0.0099 0.0091  -0.0187 270 GLU C CA  
1905 C C   . GLU C 47 ? 0.0897 0.1583 0.2005 -0.0275 0.0139  -0.0095 270 GLU C C   
1906 O O   . GLU C 47 ? 0.1190 0.1930 0.2080 -0.0211 0.0074  -0.0010 270 GLU C O   
1907 C CB  . GLU C 47 ? 0.1143 0.1804 0.1988 -0.0369 0.0130  0.0006  270 GLU C CB  
1908 C CG  . GLU C 47 ? 0.1119 0.1990 0.2021 -0.0546 0.0033  0.0020  270 GLU C CG  
1909 C CD  . GLU C 47 ? 0.1460 0.2577 0.1999 -0.0434 0.0194  -0.0130 270 GLU C CD  
1910 O OE1 . GLU C 47 ? 0.1711 0.2330 0.2125 -0.0172 -0.0227 0.0000  270 GLU C OE1 
1911 O OE2 . GLU C 47 ? 0.1856 0.2888 0.2532 -0.0557 -0.0354 -0.0136 270 GLU C OE2 
1912 N N   . THR C 48 ? 0.1067 0.1747 0.2075 -0.0232 0.0102  -0.0117 271 THR C N   
1913 C CA  . THR C 48 ? 0.1254 0.1939 0.2016 -0.0119 0.0172  -0.0188 271 THR C CA  
1914 C C   . THR C 48 ? 0.0989 0.1896 0.2164 -0.0116 0.0304  -0.0187 271 THR C C   
1915 O O   . THR C 48 ? 0.1243 0.2030 0.2058 -0.0131 0.0280  -0.0222 271 THR C O   
1916 C CB  . THR C 48 ? 0.1330 0.2145 0.2159 0.0068  0.0289  -0.0156 271 THR C CB  
1917 O OG1 . THR C 48 ? 0.1032 0.2156 0.2707 -0.0202 0.0343  0.0151  271 THR C OG1 
1918 C CG2 . THR C 48 ? 0.1878 0.1861 0.2266 -0.0266 0.0282  0.0027  271 THR C CG2 
1919 N N   . LYS C 49 ? 0.1035 0.1918 0.2208 -0.0003 0.0197  -0.0085 272 LYS C N   
1920 C CA  . LYS C 49 ? 0.1026 0.1718 0.2174 -0.0089 0.0370  0.0085  272 LYS C CA  
1921 C C   . LYS C 49 ? 0.1071 0.1682 0.2062 -0.0025 0.0425  -0.0083 272 LYS C C   
1922 O O   . LYS C 49 ? 0.1059 0.1486 0.2239 0.0019  0.0227  -0.0098 272 LYS C O   
1923 C CB  . LYS C 49 ? 0.1299 0.2077 0.2526 0.0057  0.0101  0.0111  272 LYS C CB  
1924 C CG  . LYS C 49 ? 0.2281 0.2739 0.3259 0.0082  0.0011  0.0255  272 LYS C CG  
1925 C CD  . LYS C 49 ? 0.3122 0.3468 0.3602 -0.0183 0.0065  0.0080  272 LYS C CD  
1926 C CE  . LYS C 49 ? 0.3355 0.4117 0.4513 -0.0113 0.0081  0.0071  272 LYS C CE  
1927 N NZ  . LYS C 49 ? 0.4009 0.4294 0.4804 -0.0179 -0.0120 0.0111  272 LYS C NZ  
1928 N N   . LYS C 50 ? 0.1353 0.1615 0.2144 0.0012  0.0206  -0.0146 273 LYS C N   
1929 C CA  . LYS C 50 ? 0.1195 0.1663 0.2022 -0.0210 0.0285  -0.0213 273 LYS C CA  
1930 C C   . LYS C 50 ? 0.1229 0.1465 0.1940 -0.0233 0.0207  -0.0062 273 LYS C C   
1931 O O   . LYS C 50 ? 0.1105 0.1976 0.1863 -0.0174 0.0069  0.0012  273 LYS C O   
1932 C CB  . LYS C 50 ? 0.1671 0.1588 0.2232 -0.0061 0.0326  -0.0323 273 LYS C CB  
1933 C CG  . LYS C 50 ? 0.2100 0.1723 0.2099 -0.0055 0.0386  -0.0206 273 LYS C CG  
1934 C CD  . LYS C 50 ? 0.2777 0.1848 0.2653 -0.0171 0.0442  -0.0450 273 LYS C CD  
1935 C CE  . LYS C 50 ? 0.3202 0.2593 0.2953 0.0249  0.0116  -0.0313 273 LYS C CE  
1936 N NZ  . LYS C 50 ? 0.3634 0.3330 0.4006 0.0319  0.0115  -0.0209 273 LYS C NZ  
1937 N N   . LEU C 51 ? 0.1115 0.1768 0.2028 -0.0033 0.0075  -0.0092 274 LEU C N   
1938 C CA  . LEU C 51 ? 0.1409 0.1612 0.2001 -0.0186 0.0045  -0.0037 274 LEU C CA  
1939 C C   . LEU C 51 ? 0.1336 0.1700 0.1927 -0.0116 -0.0081 -0.0073 274 LEU C C   
1940 O O   . LEU C 51 ? 0.1358 0.1822 0.2044 -0.0251 0.0097  0.0001  274 LEU C O   
1941 C CB  . LEU C 51 ? 0.1542 0.1881 0.2275 -0.0174 -0.0179 0.0148  274 LEU C CB  
1942 C CG  . LEU C 51 ? 0.1616 0.1817 0.2332 0.0077  -0.0015 0.0099  274 LEU C CG  
1943 C CD1 . LEU C 51 ? 0.2163 0.2194 0.3403 0.0107  -0.0264 0.0329  274 LEU C CD1 
1944 C CD2 . LEU C 51 ? 0.2121 0.1736 0.2802 0.0062  0.0157  -0.0098 274 LEU C CD2 
1945 N N   . TYR C 52 ? 0.1358 0.1558 0.1936 -0.0170 -0.0061 -0.0138 275 TYR C N   
1946 C CA  . TYR C 52 ? 0.1370 0.1578 0.1797 -0.0220 0.0047  -0.0126 275 TYR C CA  
1947 C C   . TYR C 52 ? 0.1484 0.1760 0.2026 -0.0319 -0.0148 -0.0002 275 TYR C C   
1948 O O   . TYR C 52 ? 0.1570 0.1637 0.1966 -0.0433 -0.0213 0.0080  275 TYR C O   
1949 C CB  . TYR C 52 ? 0.1463 0.1713 0.2192 -0.0220 -0.0003 -0.0014 275 TYR C CB  
1950 C CG  . TYR C 52 ? 0.1371 0.1613 0.2072 -0.0138 0.0062  0.0111  275 TYR C CG  
1951 C CD1 . TYR C 52 ? 0.1755 0.1792 0.2335 -0.0216 0.0019  -0.0108 275 TYR C CD1 
1952 C CD2 . TYR C 52 ? 0.1226 0.1892 0.2266 0.0038  0.0149  -0.0025 275 TYR C CD2 
1953 C CE1 . TYR C 52 ? 0.1502 0.1944 0.2036 -0.0448 -0.0053 -0.0183 275 TYR C CE1 
1954 C CE2 . TYR C 52 ? 0.1797 0.1599 0.2405 -0.0095 0.0089  -0.0008 275 TYR C CE2 
1955 C CZ  . TYR C 52 ? 0.1979 0.1691 0.2050 -0.0152 0.0047  0.0075  275 TYR C CZ  
1956 O OH  . TYR C 52 ? 0.2319 0.1742 0.2181 0.0027  0.0008  -0.0187 275 TYR C OH  
1957 N N   A MET C 53 ? 0.1909 0.2162 0.1995 -0.0240 -0.0293 0.0103  276 MET C N   
1958 N N   B MET C 53 ? 0.1668 0.1964 0.1973 -0.0263 -0.0175 0.0060  276 MET C N   
1959 C CA  A MET C 53 ? 0.2333 0.2453 0.2381 -0.0255 -0.0459 0.0098  276 MET C CA  
1960 C CA  B MET C 53 ? 0.1602 0.1968 0.2026 -0.0387 -0.0350 0.0074  276 MET C CA  
1961 C C   A MET C 53 ? 0.1598 0.2334 0.2126 -0.0664 -0.0568 0.0062  276 MET C C   
1962 C C   B MET C 53 ? 0.1434 0.2047 0.2062 -0.0545 -0.0479 0.0065  276 MET C C   
1963 O O   A MET C 53 ? 0.2442 0.2764 0.2554 -0.0283 -0.0343 0.0336  276 MET C O   
1964 O O   B MET C 53 ? 0.2179 0.2423 0.2449 0.0055  -0.0174 0.0319  276 MET C O   
1965 C CB  A MET C 53 ? 0.2722 0.2766 0.2678 -0.0093 -0.0302 0.0116  276 MET C CB  
1966 C CB  B MET C 53 ? 0.1993 0.2229 0.2414 -0.0293 -0.0142 0.0100  276 MET C CB  
1967 C CG  A MET C 53 ? 0.3208 0.2787 0.3186 0.0129  -0.0329 0.0004  276 MET C CG  
1968 C CG  B MET C 53 ? 0.2377 0.2545 0.2542 -0.0133 -0.0132 0.0096  276 MET C CG  
1969 S SD  A MET C 53 ? 0.4078 0.3380 0.3851 0.0465  -0.0290 0.0110  276 MET C SD  
1970 S SD  B MET C 53 ? 0.2657 0.3253 0.3211 -0.0118 -0.0399 0.0216  276 MET C SD  
1971 C CE  A MET C 53 ? 0.3845 0.3652 0.3890 0.0182  -0.0231 0.0100  276 MET C CE  
1972 C CE  B MET C 53 ? 0.2553 0.2880 0.2579 -0.0171 -0.0172 -0.0021 276 MET C CE  
1973 N N   . VAL C 54 ? 0.1923 0.2234 0.2151 -0.0549 -0.0577 0.0106  277 VAL C N   
1974 C CA  . VAL C 54 ? 0.2081 0.2255 0.2109 -0.0624 -0.0643 0.0036  277 VAL C CA  
1975 C C   . VAL C 54 ? 0.2175 0.2396 0.2125 -0.0590 -0.0631 0.0245  277 VAL C C   
1976 O O   . VAL C 54 ? 0.2639 0.2305 0.2188 -0.0887 -0.0581 0.0289  277 VAL C O   
1977 C CB  . VAL C 54 ? 0.2212 0.2073 0.2505 -0.0672 -0.0644 0.0239  277 VAL C CB  
1978 C CG1 . VAL C 54 ? 0.2844 0.2178 0.2614 -0.0435 -0.0517 -0.0084 277 VAL C CG1 
1979 C CG2 . VAL C 54 ? 0.2469 0.2405 0.2526 -0.0464 -0.0619 0.0228  277 VAL C CG2 
1980 N N   . PRO C 55 ? 0.2529 0.2414 0.2466 -0.0618 -0.0553 0.0279  278 PRO C N   
1981 C CA  . PRO C 55 ? 0.2711 0.2552 0.2628 -0.0242 -0.0498 0.0267  278 PRO C CA  
1982 C C   . PRO C 55 ? 0.2529 0.2503 0.2626 -0.0130 -0.0499 0.0147  278 PRO C C   
1983 O O   . PRO C 55 ? 0.3186 0.2554 0.2716 -0.0092 -0.0365 0.0192  278 PRO C O   
1984 C CB  . PRO C 55 ? 0.2936 0.2801 0.3021 -0.0253 -0.0461 0.0194  278 PRO C CB  
1985 C CG  . PRO C 55 ? 0.2848 0.2879 0.3190 -0.0465 -0.0644 0.0227  278 PRO C CG  
1986 C CD  . PRO C 55 ? 0.2421 0.2731 0.2645 -0.0479 -0.0405 0.0349  278 PRO C CD  
1987 N N   A TYR C 56 ? 0.2420 0.2471 0.2673 -0.0147 -0.0611 0.0181  279 TYR C N   
1988 N N   B TYR C 56 ? 0.2407 0.2383 0.2499 -0.0169 -0.0458 0.0090  279 TYR C N   
1989 C CA  A TYR C 56 ? 0.2604 0.2708 0.2834 -0.0083 -0.0528 0.0123  279 TYR C CA  
1990 C CA  B TYR C 56 ? 0.2301 0.2357 0.2541 -0.0207 -0.0411 0.0030  279 TYR C CA  
1991 C C   A TYR C 56 ? 0.2580 0.2473 0.2886 -0.0147 -0.0489 0.0241  279 TYR C C   
1992 C C   B TYR C 56 ? 0.2376 0.2283 0.2592 -0.0201 -0.0386 0.0083  279 TYR C C   
1993 O O   A TYR C 56 ? 0.2686 0.2261 0.3067 -0.0401 -0.0648 0.0011  279 TYR C O   
1994 O O   B TYR C 56 ? 0.2457 0.2159 0.2601 -0.0231 -0.0301 -0.0046 279 TYR C O   
1995 C CB  A TYR C 56 ? 0.3102 0.3158 0.2957 -0.0141 -0.0444 0.0078  279 TYR C CB  
1996 C CB  B TYR C 56 ? 0.2307 0.2355 0.2504 -0.0276 -0.0365 0.0009  279 TYR C CB  
1997 C CG  A TYR C 56 ? 0.3430 0.3498 0.3570 0.0030  -0.0179 0.0090  279 TYR C CG  
1998 C CG  B TYR C 56 ? 0.1965 0.2076 0.2529 -0.0489 -0.0206 -0.0051 279 TYR C CG  
1999 C CD1 A TYR C 56 ? 0.3845 0.3869 0.3902 0.0079  -0.0188 0.0194  279 TYR C CD1 
2000 C CD1 B TYR C 56 ? 0.2040 0.2153 0.2492 -0.0223 -0.0188 -0.0054 279 TYR C CD1 
2001 C CD2 A TYR C 56 ? 0.3494 0.3604 0.3456 0.0017  -0.0114 0.0112  279 TYR C CD2 
2002 C CD2 B TYR C 56 ? 0.2140 0.2201 0.2431 -0.0338 -0.0236 0.0063  279 TYR C CD2 
2003 C CE1 A TYR C 56 ? 0.3527 0.3748 0.3726 0.0122  -0.0063 0.0057  279 TYR C CE1 
2004 C CE1 B TYR C 56 ? 0.2395 0.2528 0.2562 -0.0193 -0.0149 -0.0186 279 TYR C CE1 
2005 C CE2 A TYR C 56 ? 0.3603 0.3582 0.3642 0.0190  -0.0071 0.0067  279 TYR C CE2 
2006 C CE2 B TYR C 56 ? 0.2447 0.2301 0.2602 -0.0323 -0.0172 -0.0273 279 TYR C CE2 
2007 C CZ  A TYR C 56 ? 0.3543 0.3541 0.3646 0.0028  -0.0147 0.0123  279 TYR C CZ  
2008 C CZ  B TYR C 56 ? 0.2460 0.2480 0.2583 -0.0206 -0.0070 -0.0040 279 TYR C CZ  
2009 O OH  A TYR C 56 ? 0.3476 0.3635 0.4212 0.0054  -0.0079 0.0127  279 TYR C OH  
2010 O OH  B TYR C 56 ? 0.3064 0.2833 0.2715 -0.0239 -0.0075 -0.0050 279 TYR C OH  
2011 N N   . VAL C 57 ? 0.2478 0.2241 0.2737 -0.0306 -0.0515 0.0082  280 VAL C N   
2012 C CA  . VAL C 57 ? 0.2602 0.2688 0.2828 -0.0189 -0.0407 0.0168  280 VAL C CA  
2013 C C   . VAL C 57 ? 0.3065 0.2784 0.3101 -0.0173 -0.0314 0.0141  280 VAL C C   
2014 O O   . VAL C 57 ? 0.3186 0.2866 0.3068 -0.0211 -0.0247 0.0282  280 VAL C O   
2015 C CB  . VAL C 57 ? 0.2511 0.3038 0.2781 -0.0365 -0.0407 0.0141  280 VAL C CB  
2016 C CG1 . VAL C 57 ? 0.2711 0.3002 0.2706 -0.0579 0.0031  -0.0471 280 VAL C CG1 
2017 C CG2 . VAL C 57 ? 0.2521 0.2991 0.2353 -0.0296 -0.0366 0.0176  280 VAL C CG2 
2018 N N   . ASP C 58 ? 0.3264 0.2856 0.3284 -0.0019 -0.0294 0.0223  281 ASP C N   
2019 C CA  . ASP C 58 ? 0.3528 0.3031 0.3466 -0.0068 -0.0183 0.0015  281 ASP C CA  
2020 C C   . ASP C 58 ? 0.3614 0.2748 0.3336 -0.0061 -0.0164 -0.0047 281 ASP C C   
2021 O O   . ASP C 58 ? 0.3342 0.1977 0.2949 -0.0372 -0.0104 0.0007  281 ASP C O   
2022 C CB  . ASP C 58 ? 0.3797 0.3397 0.3849 -0.0070 -0.0148 -0.0046 281 ASP C CB  
2023 C CG  . ASP C 58 ? 0.4302 0.4003 0.4046 -0.0083 -0.0100 0.0042  281 ASP C CG  
2024 O OD1 . ASP C 58 ? 0.5161 0.4755 0.4862 -0.0132 0.0166  -0.0103 281 ASP C OD1 
2025 O OD2 . ASP C 58 ? 0.4901 0.5110 0.5099 -0.0262 -0.0181 -0.0052 281 ASP C OD2 
2026 N N   . LEU C 59 ? 0.3739 0.2548 0.3360 -0.0249 -0.0147 -0.0311 282 LEU C N   
2027 C CA  . LEU C 59 ? 0.3841 0.2536 0.3333 -0.0058 -0.0056 -0.0310 282 LEU C CA  
2028 C C   . LEU C 59 ? 0.3580 0.2062 0.3116 -0.0064 -0.0076 -0.0413 282 LEU C C   
2029 O O   . LEU C 59 ? 0.3477 0.2031 0.3223 0.0128  -0.0010 -0.0523 282 LEU C O   
2030 C CB  . LEU C 59 ? 0.4002 0.2628 0.3129 -0.0105 -0.0023 -0.0457 282 LEU C CB  
2031 C CG  . LEU C 59 ? 0.4235 0.3502 0.3953 -0.0085 0.0036  -0.0260 282 LEU C CG  
2032 C CD1 . LEU C 59 ? 0.4697 0.3795 0.4003 0.0096  -0.0073 -0.0163 282 LEU C CD1 
2033 C CD2 . LEU C 59 ? 0.4275 0.3377 0.3927 -0.0030 -0.0024 -0.0314 282 LEU C CD2 
2034 N N   . GLU C 60 ? 0.3590 0.1792 0.3102 -0.0183 -0.0120 -0.0312 283 GLU C N   
2035 C CA  . GLU C 60 ? 0.3333 0.2297 0.3276 -0.0272 -0.0062 -0.0189 283 GLU C CA  
2036 C C   . GLU C 60 ? 0.3195 0.1854 0.2923 -0.0147 -0.0117 -0.0176 283 GLU C C   
2037 O O   . GLU C 60 ? 0.3316 0.1653 0.3189 -0.0101 0.0057  -0.0010 283 GLU C O   
2038 C CB  . GLU C 60 ? 0.3361 0.2579 0.3245 -0.0406 -0.0178 -0.0191 283 GLU C CB  
2039 C CG  . GLU C 60 ? 0.3585 0.3026 0.3641 -0.0381 -0.0004 0.0028  283 GLU C CG  
2040 C CD  . GLU C 60 ? 0.3742 0.3488 0.4073 -0.0261 -0.0105 -0.0074 283 GLU C CD  
2041 O OE1 . GLU C 60 ? 0.4799 0.4598 0.4480 -0.0211 0.0016  0.0223  283 GLU C OE1 
2042 O OE2 . GLU C 60 ? 0.4544 0.4837 0.4912 0.0042  -0.0350 0.0054  283 GLU C OE2 
2043 N N   . HIS C 61 ? 0.2730 0.1496 0.2920 -0.0229 -0.0056 -0.0125 284 HIS C N   
2044 C CA  . HIS C 61 ? 0.2527 0.1640 0.2595 -0.0156 -0.0158 -0.0060 284 HIS C CA  
2045 C C   . HIS C 61 ? 0.2226 0.1764 0.2525 -0.0075 -0.0081 -0.0080 284 HIS C C   
2046 O O   . HIS C 61 ? 0.2309 0.1924 0.2344 0.0031  0.0033  -0.0259 284 HIS C O   
2047 C CB  . HIS C 61 ? 0.2494 0.1739 0.2851 -0.0118 -0.0140 -0.0104 284 HIS C CB  
2048 C CG  . HIS C 61 ? 0.2729 0.1705 0.2851 -0.0354 -0.0082 0.0220  284 HIS C CG  
2049 N ND1 . HIS C 61 ? 0.2524 0.1894 0.3077 -0.0436 -0.0282 0.0110  284 HIS C ND1 
2050 C CD2 . HIS C 61 ? 0.2887 0.2206 0.3189 -0.0134 0.0023  0.0142  284 HIS C CD2 
2051 C CE1 . HIS C 61 ? 0.2769 0.2386 0.3424 -0.0476 -0.0144 -0.0120 284 HIS C CE1 
2052 N NE2 . HIS C 61 ? 0.2926 0.2687 0.3557 -0.0436 -0.0093 0.0151  284 HIS C NE2 
2053 N N   . GLN C 62 ? 0.2553 0.1672 0.2416 0.0048  0.0017  -0.0055 285 GLN C N   
2054 C CA  . GLN C 62 ? 0.2461 0.1797 0.2388 0.0101  0.0129  -0.0083 285 GLN C CA  
2055 C C   . GLN C 62 ? 0.2459 0.1793 0.2548 0.0126  0.0119  -0.0016 285 GLN C C   
2056 O O   . GLN C 62 ? 0.2973 0.1992 0.3108 -0.0178 -0.0087 0.0251  285 GLN C O   
2057 C CB  . GLN C 62 ? 0.2590 0.2138 0.2600 0.0079  0.0225  -0.0163 285 GLN C CB  
2058 C CG  . GLN C 62 ? 0.3048 0.2469 0.3105 0.0044  0.0026  -0.0149 285 GLN C CG  
2059 C CD  . GLN C 62 ? 0.3436 0.2278 0.3290 0.0411  0.0363  -0.0227 285 GLN C CD  
2060 O OE1 . GLN C 62 ? 0.3430 0.2719 0.3830 0.0129  0.0660  -0.0002 285 GLN C OE1 
2061 N NE2 . GLN C 62 ? 0.4198 0.2740 0.3910 0.0282  0.0246  -0.0305 285 GLN C NE2 
2062 N N   . GLY C 63 ? 0.2255 0.1716 0.2130 0.0296  0.0155  -0.0041 286 GLY C N   
2063 C CA  . GLY C 63 ? 0.2186 0.1799 0.2322 0.0233  0.0190  0.0075  286 GLY C CA  
2064 C C   . GLY C 63 ? 0.2064 0.1751 0.2260 0.0379  0.0397  -0.0104 286 GLY C C   
2065 O O   . GLY C 63 ? 0.2002 0.1817 0.2303 0.0322  0.0301  0.0188  286 GLY C O   
2066 N N   . THR C 64 ? 0.1929 0.1866 0.2152 0.0448  0.0334  0.0033  287 THR C N   
2067 C CA  . THR C 64 ? 0.1530 0.1929 0.2075 0.0533  0.0607  -0.0202 287 THR C CA  
2068 C C   . THR C 64 ? 0.1299 0.1791 0.1995 0.0440  0.0597  -0.0037 287 THR C C   
2069 O O   . THR C 64 ? 0.2128 0.2019 0.2644 0.0454  0.0502  0.0116  287 THR C O   
2070 C CB  . THR C 64 ? 0.2745 0.2744 0.2836 0.0041  -0.0371 0.0300  287 THR C CB  
2071 O OG1 . THR C 64 ? 0.3128 0.3337 0.3258 0.0059  -0.0366 0.0377  287 THR C OG1 
2072 C CG2 . THR C 64 ? 0.2343 0.2577 0.2691 0.0287  0.0288  -0.0196 287 THR C CG2 
2073 N N   . TYR C 65 ? 0.1637 0.1957 0.2033 0.0273  0.0211  0.0043  288 TYR C N   
2074 C CA  . TYR C 65 ? 0.1302 0.2079 0.2091 0.0227  0.0187  -0.0048 288 TYR C CA  
2075 C C   . TYR C 65 ? 0.1043 0.2067 0.1966 0.0109  0.0207  -0.0023 288 TYR C C   
2076 O O   . TYR C 65 ? 0.1176 0.2173 0.1821 -0.0005 0.0410  0.0022  288 TYR C O   
2077 C CB  . TYR C 65 ? 0.1105 0.1956 0.1885 0.0120  0.0200  -0.0036 288 TYR C CB  
2078 C CG  . TYR C 65 ? 0.1396 0.1675 0.1945 0.0035  0.0145  0.0025  288 TYR C CG  
2079 C CD1 . TYR C 65 ? 0.1595 0.1758 0.1885 -0.0035 0.0144  0.0224  288 TYR C CD1 
2080 C CD2 . TYR C 65 ? 0.1534 0.1675 0.1810 0.0255  -0.0024 -0.0005 288 TYR C CD2 
2081 C CE1 . TYR C 65 ? 0.1604 0.2058 0.2153 0.0002  0.0079  0.0161  288 TYR C CE1 
2082 C CE2 . TYR C 65 ? 0.1649 0.1703 0.1994 0.0020  0.0212  0.0161  288 TYR C CE2 
2083 C CZ  . TYR C 65 ? 0.1627 0.1806 0.1900 -0.0354 -0.0035 0.0101  288 TYR C CZ  
2084 O OH  . TYR C 65 ? 0.1891 0.2426 0.2161 -0.0424 -0.0060 0.0255  288 TYR C OH  
2085 N N   . TRP C 66 ? 0.1201 0.2011 0.1840 0.0106  0.0274  -0.0088 289 TRP C N   
2086 C CA  . TRP C 66 ? 0.0729 0.1971 0.1793 0.0132  0.0266  -0.0091 289 TRP C CA  
2087 C C   . TRP C 66 ? 0.0902 0.1601 0.1894 -0.0004 0.0242  0.0117  289 TRP C C   
2088 O O   . TRP C 66 ? 0.1098 0.1661 0.1741 0.0061  0.0194  0.0003  289 TRP C O   
2089 C CB  . TRP C 66 ? 0.1319 0.2102 0.2297 0.0282  0.0193  0.0060  289 TRP C CB  
2090 C CG  . TRP C 66 ? 0.1690 0.2279 0.2882 0.0317  0.0072  -0.0102 289 TRP C CG  
2091 C CD1 . TRP C 66 ? 0.2203 0.2649 0.2962 0.0218  0.0035  -0.0007 289 TRP C CD1 
2092 C CD2 . TRP C 66 ? 0.1706 0.2334 0.3224 0.0234  -0.0024 0.0129  289 TRP C CD2 
2093 N NE1 . TRP C 66 ? 0.2139 0.3100 0.3619 0.0237  0.0007  0.0065  289 TRP C NE1 
2094 C CE2 . TRP C 66 ? 0.1862 0.2330 0.3274 0.0291  -0.0108 0.0513  289 TRP C CE2 
2095 C CE3 . TRP C 66 ? 0.1687 0.2701 0.2523 0.0151  0.0340  0.0299  289 TRP C CE3 
2096 C CZ2 . TRP C 66 ? 0.2675 0.3227 0.3310 0.0230  -0.0121 0.0452  289 TRP C CZ2 
2097 C CZ3 . TRP C 66 ? 0.2145 0.3022 0.3016 0.0148  0.0039  0.0358  289 TRP C CZ3 
2098 C CH2 . TRP C 66 ? 0.1905 0.2878 0.3007 0.0101  0.0123  0.0526  289 TRP C CH2 
2099 N N   . CYS C 67 ? 0.1022 0.1728 0.1695 -0.0013 0.0185  0.0019  290 CYS C N   
2100 C CA  . CYS C 67 ? 0.0985 0.1736 0.1602 -0.0042 0.0172  -0.0053 290 CYS C CA  
2101 C C   . CYS C 67 ? 0.0930 0.1506 0.1720 -0.0089 0.0102  0.0003  290 CYS C C   
2102 O O   . CYS C 67 ? 0.1030 0.1709 0.1796 -0.0233 0.0049  0.0023  290 CYS C O   
2103 C CB  . CYS C 67 ? 0.1007 0.1471 0.1816 -0.0074 0.0056  -0.0044 290 CYS C CB  
2104 S SG  . CYS C 67 ? 0.1098 0.1566 0.1914 -0.0007 0.0239  -0.0038 290 CYS C SG  
2105 N N   . HIS C 68 ? 0.1035 0.1480 0.1668 0.0009  0.0247  0.0028  291 HIS C N   
2106 C CA  . HIS C 68 ? 0.1096 0.1606 0.1592 0.0000  0.0090  0.0041  291 HIS C CA  
2107 C C   . HIS C 68 ? 0.0922 0.1602 0.1654 -0.0150 0.0020  0.0015  291 HIS C C   
2108 O O   . HIS C 68 ? 0.1041 0.1870 0.1966 -0.0081 0.0114  -0.0262 291 HIS C O   
2109 C CB  . HIS C 68 ? 0.1104 0.1534 0.1847 -0.0048 0.0081  0.0045  291 HIS C CB  
2110 C CG  . HIS C 68 ? 0.1282 0.1534 0.1840 -0.0089 0.0051  0.0038  291 HIS C CG  
2111 N ND1 . HIS C 68 ? 0.1522 0.1965 0.2035 -0.0088 -0.0109 0.0134  291 HIS C ND1 
2112 C CD2 . HIS C 68 ? 0.1503 0.1538 0.1847 -0.0009 0.0098  0.0149  291 HIS C CD2 
2113 C CE1 . HIS C 68 ? 0.1636 0.1881 0.1952 -0.0261 -0.0244 0.0062  291 HIS C CE1 
2114 N NE2 . HIS C 68 ? 0.1581 0.1741 0.1784 -0.0031 -0.0182 0.0161  291 HIS C NE2 
2115 N N   . VAL C 69 ? 0.1188 0.1414 0.1638 -0.0202 -0.0010 0.0058  292 VAL C N   
2116 C CA  . VAL C 69 ? 0.1244 0.1433 0.1772 -0.0226 0.0065  0.0087  292 VAL C CA  
2117 C C   . VAL C 69 ? 0.1250 0.1473 0.1686 -0.0051 -0.0033 -0.0020 292 VAL C C   
2118 O O   . VAL C 69 ? 0.1185 0.1909 0.1764 -0.0147 0.0089  0.0019  292 VAL C O   
2119 C CB  . VAL C 69 ? 0.1527 0.1601 0.1920 -0.0192 0.0109  0.0037  292 VAL C CB  
2120 C CG1 . VAL C 69 ? 0.1839 0.1712 0.2261 0.0005  0.0324  0.0190  292 VAL C CG1 
2121 C CG2 . VAL C 69 ? 0.1816 0.1677 0.1794 -0.0146 -0.0112 0.0349  292 VAL C CG2 
2122 N N   . TYR C 70 ? 0.1205 0.1496 0.1612 -0.0181 0.0131  -0.0009 293 TYR C N   
2123 C CA  . TYR C 70 ? 0.1297 0.1509 0.1633 0.0001  0.0033  0.0108  293 TYR C CA  
2124 C C   . TYR C 70 ? 0.1229 0.1615 0.1704 -0.0068 0.0016  0.0038  293 TYR C C   
2125 O O   . TYR C 70 ? 0.1494 0.1819 0.1717 -0.0074 0.0083  -0.0061 293 TYR C O   
2126 C CB  . TYR C 70 ? 0.1461 0.1628 0.1886 -0.0077 0.0163  0.0043  293 TYR C CB  
2127 C CG  . TYR C 70 ? 0.1566 0.1426 0.1816 -0.0076 0.0172  0.0217  293 TYR C CG  
2128 C CD1 . TYR C 70 ? 0.1664 0.1693 0.2015 -0.0197 0.0205  0.0178  293 TYR C CD1 
2129 C CD2 . TYR C 70 ? 0.1369 0.1509 0.1996 -0.0020 0.0043  0.0169  293 TYR C CD2 
2130 C CE1 . TYR C 70 ? 0.1738 0.2034 0.1948 -0.0391 0.0235  0.0006  293 TYR C CE1 
2131 C CE2 . TYR C 70 ? 0.1311 0.1762 0.1833 -0.0192 0.0066  -0.0282 293 TYR C CE2 
2132 C CZ  . TYR C 70 ? 0.1482 0.1762 0.1960 -0.0233 0.0207  -0.0055 293 TYR C CZ  
2133 O OH  . TYR C 70 ? 0.1660 0.2096 0.1968 -0.0502 0.0252  -0.0084 293 TYR C OH  
2134 N N   . ASN C 71 ? 0.1527 0.1790 0.1704 -0.0044 0.0140  -0.0041 294 ASN C N   
2135 C CA  . ASN C 71 ? 0.1552 0.1818 0.1713 -0.0065 0.0287  -0.0143 294 ASN C CA  
2136 C C   . ASN C 71 ? 0.1736 0.1849 0.1639 -0.0054 0.0276  -0.0176 294 ASN C C   
2137 O O   . ASN C 71 ? 0.1930 0.1789 0.1809 -0.0081 0.0311  -0.0048 294 ASN C O   
2138 C CB  . ASN C 71 ? 0.1531 0.1769 0.1862 -0.0070 0.0093  -0.0199 294 ASN C CB  
2139 C CG  . ASN C 71 ? 0.2024 0.1835 0.1692 -0.0227 0.0236  -0.0037 294 ASN C CG  
2140 O OD1 . ASN C 71 ? 0.2064 0.2101 0.1939 -0.0221 0.0155  -0.0034 294 ASN C OD1 
2141 N ND2 . ASN C 71 ? 0.1958 0.1807 0.1962 -0.0242 0.0218  -0.0252 294 ASN C ND2 
2142 N N   . ASP C 72 ? 0.1897 0.1892 0.1646 -0.0058 0.0318  0.0029  295 ASP C N   
2143 C CA  . ASP C 72 ? 0.1754 0.2039 0.1765 -0.0079 0.0272  -0.0062 295 ASP C CA  
2144 C C   . ASP C 72 ? 0.1893 0.1936 0.1640 -0.0019 0.0121  -0.0090 295 ASP C C   
2145 O O   . ASP C 72 ? 0.2187 0.2058 0.1917 -0.0032 0.0196  0.0059  295 ASP C O   
2146 C CB  . ASP C 72 ? 0.1998 0.2294 0.1797 0.0153  0.0371  -0.0083 295 ASP C CB  
2147 C CG  . ASP C 72 ? 0.2014 0.2105 0.2250 0.0226  0.0377  -0.0128 295 ASP C CG  
2148 O OD1 . ASP C 72 ? 0.2956 0.2358 0.2387 -0.0057 0.0500  -0.0325 295 ASP C OD1 
2149 O OD2 . ASP C 72 ? 0.2494 0.2702 0.2769 0.0200  0.0455  -0.0073 295 ASP C OD2 
2150 N N   . ARG C 73 ? 0.1988 0.2138 0.1870 -0.0187 0.0034  -0.0083 296 ARG C N   
2151 C CA  . ARG C 73 ? 0.2022 0.2188 0.1916 -0.0176 -0.0007 -0.0081 296 ARG C CA  
2152 C C   . ARG C 73 ? 0.1975 0.2389 0.1944 -0.0196 -0.0171 -0.0043 296 ARG C C   
2153 O O   . ARG C 73 ? 0.2165 0.2741 0.2095 -0.0221 -0.0267 0.0250  296 ARG C O   
2154 C CB  . ARG C 73 ? 0.2172 0.2264 0.2257 -0.0274 0.0113  -0.0252 296 ARG C CB  
2155 C CG  . ARG C 73 ? 0.2487 0.2811 0.2549 -0.0099 -0.0066 -0.0272 296 ARG C CG  
2156 C CD  . ARG C 73 ? 0.2723 0.2818 0.2877 -0.0098 -0.0167 -0.0116 296 ARG C CD  
2157 N NE  . ARG C 73 ? 0.3510 0.3705 0.3308 -0.0388 -0.0325 -0.0126 296 ARG C NE  
2158 C CZ  . ARG C 73 ? 0.3019 0.3223 0.2854 -0.0529 -0.0277 0.0029  296 ARG C CZ  
2159 N NH1 . ARG C 73 ? 0.3688 0.3114 0.3008 -0.0429 -0.0195 -0.0144 296 ARG C NH1 
2160 N NH2 . ARG C 73 ? 0.3732 0.3716 0.3652 -0.0714 -0.0502 0.0127  296 ARG C NH2 
2161 N N   . ASP C 74 ? 0.1982 0.2502 0.1739 -0.0119 -0.0014 0.0025  297 ASP C N   
2162 C CA  . ASP C 74 ? 0.1853 0.2781 0.2021 -0.0107 -0.0078 -0.0065 297 ASP C CA  
2163 C C   . ASP C 74 ? 0.1558 0.2378 0.1709 -0.0125 -0.0043 0.0044  297 ASP C C   
2164 O O   . ASP C 74 ? 0.1552 0.2417 0.1794 -0.0167 -0.0014 0.0069  297 ASP C O   
2165 C CB  . ASP C 74 ? 0.2102 0.2945 0.2527 -0.0330 0.0039  -0.0367 297 ASP C CB  
2166 C CG  . ASP C 74 ? 0.2641 0.3357 0.3015 -0.0157 -0.0042 -0.0136 297 ASP C CG  
2167 O OD1 . ASP C 74 ? 0.2940 0.3826 0.3205 -0.0391 -0.0464 -0.0426 297 ASP C OD1 
2168 O OD2 . ASP C 74 ? 0.3380 0.3710 0.3713 -0.0359 -0.0036 -0.0672 297 ASP C OD2 
2169 N N   A SER C 75 ? 0.1276 0.2339 0.1578 -0.0140 -0.0076 0.0053  298 SER C N   
2170 N N   B SER C 75 ? 0.1536 0.2471 0.1774 -0.0125 -0.0019 0.0063  298 SER C N   
2171 C CA  A SER C 75 ? 0.1099 0.2017 0.1574 -0.0281 0.0009  0.0098  298 SER C CA  
2172 C CA  B SER C 75 ? 0.1588 0.2314 0.1855 -0.0212 0.0077  0.0029  298 SER C CA  
2173 C C   A SER C 75 ? 0.1067 0.2100 0.1633 -0.0268 -0.0055 0.0119  298 SER C C   
2174 C C   B SER C 75 ? 0.1466 0.2158 0.1850 -0.0174 0.0039  0.0086  298 SER C C   
2175 O O   A SER C 75 ? 0.1133 0.2085 0.1819 -0.0212 -0.0356 0.0144  298 SER C O   
2176 O O   B SER C 75 ? 0.1605 0.1899 0.1919 -0.0060 -0.0118 0.0005  298 SER C O   
2177 C CB  A SER C 75 ? 0.1383 0.1912 0.1871 -0.0186 -0.0021 0.0170  298 SER C CB  
2178 C CB  B SER C 75 ? 0.2086 0.2431 0.2264 -0.0040 -0.0008 -0.0014 298 SER C CB  
2179 O OG  A SER C 75 ? 0.0986 0.1913 0.1780 -0.0117 0.0156  0.0301  298 SER C OG  
2180 O OG  B SER C 75 ? 0.2742 0.3508 0.2835 -0.0077 0.0198  0.0062  298 SER C OG  
2181 N N   . GLN C 76 ? 0.1321 0.2007 0.1709 -0.0094 -0.0069 0.0113  299 GLN C N   
2182 C CA  . GLN C 76 ? 0.1143 0.2041 0.1876 -0.0213 0.0148  0.0000  299 GLN C CA  
2183 C C   . GLN C 76 ? 0.0963 0.2029 0.1846 -0.0230 0.0005  0.0112  299 GLN C C   
2184 O O   . GLN C 76 ? 0.1152 0.2428 0.1897 -0.0209 0.0098  -0.0070 299 GLN C O   
2185 C CB  . GLN C 76 ? 0.1251 0.1852 0.2192 -0.0256 -0.0069 -0.0123 299 GLN C CB  
2186 C CG  . GLN C 76 ? 0.2165 0.2539 0.2220 -0.0318 0.0055  -0.0135 299 GLN C CG  
2187 C CD  . GLN C 76 ? 0.1763 0.2235 0.2565 -0.0389 -0.0112 -0.0122 299 GLN C CD  
2188 O OE1 . GLN C 76 ? 0.1703 0.2314 0.2637 -0.0356 -0.0021 0.0163  299 GLN C OE1 
2189 N NE2 . GLN C 76 ? 0.1963 0.2896 0.3159 -0.0259 -0.0586 -0.0125 299 GLN C NE2 
2190 N N   . ASP C 77 ? 0.1184 0.2305 0.1886 -0.0118 0.0131  0.0079  300 ASP C N   
2191 C CA  . ASP C 77 ? 0.1394 0.2316 0.1853 0.0053  0.0245  0.0053  300 ASP C CA  
2192 C C   . ASP C 77 ? 0.1177 0.2213 0.1786 -0.0015 0.0314  -0.0141 300 ASP C C   
2193 O O   . ASP C 77 ? 0.1309 0.2503 0.2013 -0.0090 0.0012  0.0018  300 ASP C O   
2194 C CB  . ASP C 77 ? 0.1397 0.2298 0.2223 -0.0115 0.0318  0.0056  300 ASP C CB  
2195 C CG  . ASP C 77 ? 0.1737 0.2264 0.2836 0.0150  0.0651  -0.0004 300 ASP C CG  
2196 O OD1 . ASP C 77 ? 0.3959 0.3682 0.4573 0.0248  -0.0158 0.0116  300 ASP C OD1 
2197 O OD2 . ASP C 77 ? 0.2963 0.2312 0.3602 0.0807  0.0285  0.0127  300 ASP C OD2 
2198 N N   . SER C 78 ? 0.1273 0.2101 0.1859 -0.0191 0.0207  -0.0059 301 SER C N   
2199 C CA  . SER C 78 ? 0.1261 0.2186 0.1936 -0.0020 0.0168  0.0023  301 SER C CA  
2200 C C   . SER C 78 ? 0.1325 0.2386 0.2030 -0.0007 0.0076  -0.0018 301 SER C C   
2201 O O   . SER C 78 ? 0.1125 0.2471 0.2070 0.0005  0.0153  -0.0056 301 SER C O   
2202 C CB  . SER C 78 ? 0.1220 0.1941 0.1920 -0.0120 0.0082  -0.0022 301 SER C CB  
2203 O OG  . SER C 78 ? 0.1071 0.1988 0.1942 -0.0122 0.0180  0.0096  301 SER C OG  
2204 N N   . LYS C 79 ? 0.0813 0.2337 0.1959 -0.0321 0.0359  -0.0147 302 LYS C N   
2205 C CA  . LYS C 79 ? 0.1410 0.2652 0.2195 -0.0215 0.0358  -0.0191 302 LYS C CA  
2206 C C   . LYS C 79 ? 0.1244 0.2587 0.1967 -0.0263 0.0278  -0.0047 302 LYS C C   
2207 O O   . LYS C 79 ? 0.1231 0.2357 0.1918 -0.0017 0.0159  -0.0097 302 LYS C O   
2208 C CB  . LYS C 79 ? 0.2234 0.2913 0.2579 -0.0346 0.0358  -0.0088 302 LYS C CB  
2209 C CG  . LYS C 79 ? 0.2149 0.3211 0.3233 -0.0517 0.0400  -0.0197 302 LYS C CG  
2210 C CD  . LYS C 79 ? 0.2461 0.3301 0.3135 -0.0494 0.0144  -0.0207 302 LYS C CD  
2211 C CE  . LYS C 79 ? 0.3226 0.3731 0.3447 -0.0327 -0.0130 -0.0421 302 LYS C CE  
2212 N NZ  . LYS C 79 ? 0.4108 0.4266 0.4164 0.0010  -0.0016 0.0021  302 LYS C NZ  
2213 N N   . LYS C 80 ? 0.1321 0.2846 0.1814 -0.0008 0.0187  -0.0179 303 LYS C N   
2214 C CA  . LYS C 80 ? 0.1380 0.2744 0.1799 0.0029  0.0435  -0.0080 303 LYS C CA  
2215 C C   . LYS C 80 ? 0.1615 0.3190 0.1909 -0.0028 0.0285  0.0074  303 LYS C C   
2216 O O   . LYS C 80 ? 0.2091 0.4339 0.2361 -0.0412 -0.0006 0.0261  303 LYS C O   
2217 C CB  . LYS C 80 ? 0.1749 0.2986 0.2574 0.0184  0.0315  -0.0165 303 LYS C CB  
2218 C CG  . LYS C 80 ? 0.2127 0.2815 0.2861 0.0548  0.0389  -0.0132 303 LYS C CG  
2219 C CD  . LYS C 80 ? 0.2715 0.3202 0.3692 0.0790  0.0186  0.0018  303 LYS C CD  
2220 C CE  . LYS C 80 ? 0.3514 0.3718 0.4320 0.0446  0.0177  0.0240  303 LYS C CE  
2221 N NZ  . LYS C 80 ? 0.4058 0.4091 0.4809 0.0547  0.0095  0.0294  303 LYS C NZ  
2222 N N   . VAL C 81 ? 0.1440 0.2504 0.1878 0.0055  0.0250  0.0025  304 VAL C N   
2223 C CA  . VAL C 81 ? 0.1557 0.2217 0.1985 0.0047  0.0392  -0.0066 304 VAL C CA  
2224 C C   . VAL C 81 ? 0.1557 0.2031 0.1914 0.0084  0.0339  -0.0052 304 VAL C C   
2225 O O   . VAL C 81 ? 0.1729 0.2245 0.2038 0.0162  0.0416  -0.0005 304 VAL C O   
2226 C CB  . VAL C 81 ? 0.1947 0.1986 0.2028 0.0144  0.0362  -0.0060 304 VAL C CB  
2227 C CG1 . VAL C 81 ? 0.2465 0.2655 0.2220 -0.0156 0.0387  -0.0049 304 VAL C CG1 
2228 C CG2 . VAL C 81 ? 0.1605 0.2255 0.2490 0.0245  0.0222  0.0060  304 VAL C CG2 
2229 N N   . GLU C 82 ? 0.1590 0.2145 0.1878 0.0268  0.0233  -0.0121 305 GLU C N   
2230 C CA  . GLU C 82 ? 0.1697 0.2252 0.1929 0.0394  0.0299  -0.0225 305 GLU C CA  
2231 C C   . GLU C 82 ? 0.1440 0.2022 0.2169 0.0407  0.0274  -0.0055 305 GLU C C   
2232 O O   . GLU C 82 ? 0.1591 0.2108 0.2168 0.0347  0.0243  -0.0006 305 GLU C O   
2233 C CB  . GLU C 82 ? 0.1813 0.2669 0.2225 0.0549  0.0163  -0.0252 305 GLU C CB  
2234 C CG  . GLU C 82 ? 0.2403 0.2867 0.2325 0.0541  0.0146  -0.0460 305 GLU C CG  
2235 C CD  . GLU C 82 ? 0.2936 0.3341 0.2748 0.0404  0.0085  -0.0319 305 GLU C CD  
2236 O OE1 . GLU C 82 ? 0.2036 0.3890 0.2929 0.0800  0.0584  -0.0472 305 GLU C OE1 
2237 O OE2 . GLU C 82 ? 0.3053 0.3669 0.3651 0.0522  0.0216  -0.0545 305 GLU C OE2 
2238 N N   . ILE C 83 ? 0.1510 0.2107 0.1982 0.0215  0.0275  0.0093  306 ILE C N   
2239 C CA  . ILE C 83 ? 0.1582 0.1951 0.2100 0.0259  0.0345  0.0126  306 ILE C CA  
2240 C C   . ILE C 83 ? 0.1583 0.1887 0.2182 0.0270  0.0183  0.0080  306 ILE C C   
2241 O O   . ILE C 83 ? 0.2139 0.1937 0.2265 0.0154  0.0177  -0.0023 306 ILE C O   
2242 C CB  . ILE C 83 ? 0.1631 0.1985 0.2266 0.0209  0.0292  0.0172  306 ILE C CB  
2243 C CG1 . ILE C 83 ? 0.1551 0.1838 0.2475 0.0353  0.0563  0.0051  306 ILE C CG1 
2244 C CG2 . ILE C 83 ? 0.1736 0.2601 0.2549 0.0279  0.0218  0.0040  306 ILE C CG2 
2245 C CD1 . ILE C 83 ? 0.2132 0.1795 0.2787 0.0001  0.0618  -0.0038 306 ILE C CD1 
2246 N N   . ILE C 84 ? 0.1753 0.1804 0.2146 0.0322  0.0391  0.0004  307 ILE C N   
2247 C CA  . ILE C 84 ? 0.1955 0.2138 0.2398 0.0396  0.0277  -0.0050 307 ILE C CA  
2248 C C   . ILE C 84 ? 0.2155 0.1961 0.2353 0.0220  0.0312  -0.0082 307 ILE C C   
2249 O O   . ILE C 84 ? 0.2508 0.1797 0.2310 0.0287  -0.0001 -0.0006 307 ILE C O   
2250 C CB  . ILE C 84 ? 0.2115 0.2365 0.2389 0.0421  0.0343  -0.0113 307 ILE C CB  
2251 C CG1 . ILE C 84 ? 0.2265 0.2942 0.2600 0.0413  0.0307  0.0049  307 ILE C CG1 
2252 C CG2 . ILE C 84 ? 0.2169 0.2822 0.2542 0.0312  0.0481  -0.0153 307 ILE C CG2 
2253 C CD1 . ILE C 84 ? 0.2334 0.3188 0.2890 0.0460  0.0540  -0.0175 307 ILE C CD1 
2254 N N   . ILE C 85 ? 0.2535 0.2039 0.2636 0.0268  0.0185  -0.0281 308 ILE C N   
2255 C CA  . ILE C 85 ? 0.2858 0.2506 0.2639 0.0262  0.0159  -0.0309 308 ILE C CA  
2256 C C   . ILE C 85 ? 0.3095 0.2732 0.2828 0.0426  0.0246  -0.0489 308 ILE C C   
2257 O O   . ILE C 85 ? 0.3498 0.2642 0.3094 0.0803  0.0206  -0.0906 308 ILE C O   
2258 C CB  . ILE C 85 ? 0.2962 0.2465 0.2909 0.0094  0.0021  -0.0157 308 ILE C CB  
2259 C CG1 . ILE C 85 ? 0.3269 0.2651 0.3272 -0.0051 -0.0029 -0.0166 308 ILE C CG1 
2260 C CG2 . ILE C 85 ? 0.3317 0.3304 0.3151 0.0016  -0.0091 -0.0076 308 ILE C CG2 
2261 C CD1 . ILE C 85 ? 0.3358 0.2848 0.3149 0.0139  0.0041  -0.0299 308 ILE C CD1 
2262 N N   . ASP C 86 ? 0.3409 0.3032 0.2862 0.0508  0.0358  -0.0587 309 ASP C N   
2263 C CA  . ASP C 86 ? 0.3802 0.3669 0.3228 0.0257  0.0296  -0.0335 309 ASP C CA  
2264 C C   . ASP C 86 ? 0.4027 0.3890 0.3520 0.0055  0.0160  -0.0329 309 ASP C C   
2265 O O   . ASP C 86 ? 0.4531 0.4251 0.4211 0.0016  0.0088  -0.0208 309 ASP C O   
2266 C CB  . ASP C 86 ? 0.3938 0.3908 0.3436 0.0146  0.0284  -0.0258 309 ASP C CB  
2267 N N   . SER D 2  ? 0.3852 0.3939 0.3392 0.0162  0.0068  -0.0291 225 SER D N   
2268 C CA  . SER D 2  ? 0.3893 0.3801 0.3379 0.0184  0.0040  -0.0310 225 SER D CA  
2269 C C   . SER D 2  ? 0.3610 0.3451 0.2968 0.0353  0.0104  -0.0417 225 SER D C   
2270 O O   . SER D 2  ? 0.3430 0.3361 0.2555 0.0433  0.0203  -0.0408 225 SER D O   
2271 C CB  . SER D 2  ? 0.4043 0.3994 0.3582 0.0139  0.0035  -0.0187 225 SER D CB  
2272 O OG  . SER D 2  ? 0.4589 0.4751 0.4297 0.0188  -0.0120 -0.0147 225 SER D OG  
2273 N N   . LYS D 3  ? 0.3519 0.3311 0.2794 0.0328  0.0198  -0.0326 226 LYS D N   
2274 C CA  . LYS D 3  ? 0.3397 0.3337 0.2840 0.0330  0.0274  -0.0197 226 LYS D CA  
2275 C C   . LYS D 3  ? 0.3093 0.2866 0.2434 0.0412  0.0297  -0.0066 226 LYS D C   
2276 O O   . LYS D 3  ? 0.3599 0.2592 0.2792 0.0488  0.0367  -0.0238 226 LYS D O   
2277 C CB  . LYS D 3  ? 0.3334 0.3590 0.3136 0.0397  0.0317  -0.0166 226 LYS D CB  
2278 C CG  . LYS D 3  ? 0.3754 0.4226 0.3547 0.0236  0.0274  -0.0110 226 LYS D CG  
2279 C CD  . LYS D 3  ? 0.3735 0.4072 0.3572 0.0253  0.0258  -0.0108 226 LYS D CD  
2280 C CE  . LYS D 3  ? 0.4003 0.4798 0.4073 0.0228  0.0328  -0.0042 226 LYS D CE  
2281 N NZ  . LYS D 3  ? 0.4004 0.4831 0.4010 0.0076  0.0136  0.0072  226 LYS D NZ  
2282 N N   . LEU D 4  ? 0.2927 0.2616 0.2258 0.0347  0.0403  -0.0039 227 LEU D N   
2283 C CA  . LEU D 4  ? 0.2377 0.2296 0.2122 0.0355  0.0277  -0.0185 227 LEU D CA  
2284 C C   . LEU D 4  ? 0.2226 0.2344 0.2262 0.0269  0.0210  -0.0080 227 LEU D C   
2285 O O   . LEU D 4  ? 0.2336 0.2853 0.2322 0.0303  0.0349  0.0108  227 LEU D O   
2286 C CB  . LEU D 4  ? 0.2390 0.2201 0.2405 0.0221  0.0354  -0.0054 227 LEU D CB  
2287 C CG  . LEU D 4  ? 0.2009 0.2226 0.2356 0.0382  0.0094  -0.0265 227 LEU D CG  
2288 C CD1 . LEU D 4  ? 0.2499 0.2402 0.2447 0.0564  0.0230  -0.0010 227 LEU D CD1 
2289 C CD2 . LEU D 4  ? 0.2079 0.2953 0.3158 -0.0218 0.0034  -0.0088 227 LEU D CD2 
2290 N N   . GLN D 5  ? 0.1829 0.2084 0.2017 0.0230  0.0332  -0.0191 228 GLN D N   
2291 C CA  . GLN D 5  ? 0.1807 0.2248 0.2028 0.0502  0.0410  0.0034  228 GLN D CA  
2292 C C   . GLN D 5  ? 0.1640 0.1953 0.1936 0.0428  0.0538  -0.0012 228 GLN D C   
2293 O O   . GLN D 5  ? 0.1860 0.2072 0.1992 0.0348  0.0382  -0.0053 228 GLN D O   
2294 C CB  . GLN D 5  ? 0.1982 0.2456 0.2145 0.0460  0.0350  -0.0108 228 GLN D CB  
2295 C CG  . GLN D 5  ? 0.2202 0.2438 0.2729 0.0500  0.0374  0.0116  228 GLN D CG  
2296 C CD  . GLN D 5  ? 0.2456 0.2748 0.2810 0.0317  0.0424  -0.0088 228 GLN D CD  
2297 O OE1 . GLN D 5  ? 0.2135 0.2915 0.3403 0.0183  0.0801  0.0103  228 GLN D OE1 
2298 N NE2 . GLN D 5  ? 0.2038 0.3107 0.3152 0.0523  0.0148  0.0188  228 GLN D NE2 
2299 N N   . ILE D 6  ? 0.1540 0.2040 0.1917 0.0480  0.0387  0.0012  229 ILE D N   
2300 C CA  . ILE D 6  ? 0.1640 0.1896 0.2055 0.0279  0.0430  -0.0014 229 ILE D CA  
2301 C C   . ILE D 6  ? 0.1483 0.2142 0.2124 0.0501  0.0334  -0.0003 229 ILE D C   
2302 O O   . ILE D 6  ? 0.1611 0.2233 0.2547 0.0697  0.0523  0.0200  229 ILE D O   
2303 C CB  . ILE D 6  ? 0.1508 0.2021 0.1985 0.0191  0.0343  0.0121  229 ILE D CB  
2304 C CG1 . ILE D 6  ? 0.1332 0.1691 0.2172 0.0055  0.0187  -0.0053 229 ILE D CG1 
2305 C CG2 . ILE D 6  ? 0.1562 0.2147 0.1933 0.0254  0.0278  0.0156  229 ILE D CG2 
2306 C CD1 . ILE D 6  ? 0.1527 0.1886 0.2043 -0.0055 0.0199  0.0136  229 ILE D CD1 
2307 N N   A CYS D 7  ? 0.1666 0.1591 0.1761 0.0566  0.0378  0.0054  230 CYS D N   
2308 N N   B CYS D 7  ? 0.1778 0.1844 0.1922 0.0498  0.0333  0.0009  230 CYS D N   
2309 C CA  A CYS D 7  ? 0.2009 0.1776 0.1995 0.0520  0.0284  0.0064  230 CYS D CA  
2310 C CA  B CYS D 7  ? 0.2224 0.2125 0.2314 0.0413  0.0187  0.0061  230 CYS D CA  
2311 C C   A CYS D 7  ? 0.2091 0.1653 0.2018 0.0504  0.0189  0.0049  230 CYS D C   
2312 C C   B CYS D 7  ? 0.2288 0.1958 0.2272 0.0407  0.0099  -0.0035 230 CYS D C   
2313 O O   A CYS D 7  ? 0.2171 0.1475 0.2049 0.0449  0.0170  0.0122  230 CYS D O   
2314 O O   B CYS D 7  ? 0.2308 0.2071 0.2506 0.0426  0.0052  -0.0177 230 CYS D O   
2315 C CB  A CYS D 7  ? 0.2022 0.1992 0.2064 0.0480  0.0199  0.0051  230 CYS D CB  
2316 C CB  B CYS D 7  ? 0.2572 0.2383 0.2265 0.0333  0.0035  -0.0009 230 CYS D CB  
2317 S SG  A CYS D 7  ? 0.3169 0.1789 0.1824 0.0676  0.0114  -0.0415 230 CYS D SG  
2318 S SG  B CYS D 7  ? 0.3345 0.3177 0.3724 0.0071  -0.0054 0.0051  230 CYS D SG  
2319 N N   . VAL D 8  ? 0.2108 0.1610 0.2029 0.0390  0.0190  -0.0061 231 VAL D N   
2320 C CA  . VAL D 8  ? 0.2042 0.1621 0.1988 0.0251  0.0189  -0.0040 231 VAL D CA  
2321 C C   . VAL D 8  ? 0.1716 0.1693 0.1870 0.0193  0.0234  -0.0064 231 VAL D C   
2322 O O   . VAL D 8  ? 0.1256 0.1625 0.2008 0.0071  0.0258  0.0081  231 VAL D O   
2323 C CB  . VAL D 8  ? 0.2207 0.1796 0.1992 0.0123  0.0238  0.0058  231 VAL D CB  
2324 C CG1 . VAL D 8  ? 0.2570 0.2063 0.1982 0.0114  0.0177  0.0147  231 VAL D CG1 
2325 C CG2 . VAL D 8  ? 0.2719 0.1789 0.2169 0.0133  0.0141  -0.0161 231 VAL D CG2 
2326 N N   . GLU D 9  ? 0.1805 0.1748 0.2187 0.0373  -0.0021 -0.0214 232 GLU D N   
2327 C CA  . GLU D 9  ? 0.1692 0.1863 0.1999 0.0084  -0.0134 -0.0141 232 GLU D CA  
2328 C C   . GLU D 9  ? 0.1588 0.2022 0.1960 0.0137  -0.0085 -0.0081 232 GLU D C   
2329 O O   . GLU D 9  ? 0.1924 0.2047 0.2105 0.0214  -0.0154 0.0047  232 GLU D O   
2330 C CB  . GLU D 9  ? 0.1818 0.2391 0.2108 0.0279  -0.0100 -0.0149 232 GLU D CB  
2331 C CG  . GLU D 9  ? 0.2055 0.2541 0.2099 0.0539  0.0092  0.0033  232 GLU D CG  
2332 C CD  . GLU D 9  ? 0.1756 0.2279 0.2217 0.0537  0.0075  -0.0188 232 GLU D CD  
2333 O OE1 . GLU D 9  ? 0.1718 0.2191 0.2679 0.0380  -0.0047 -0.0150 232 GLU D OE1 
2334 O OE2 . GLU D 9  ? 0.2492 0.2836 0.2560 0.0396  0.0148  -0.0074 232 GLU D OE2 
2335 N N   . PRO D 10 ? 0.1594 0.2009 0.2072 0.0257  -0.0143 -0.0048 233 PRO D N   
2336 C CA  . PRO D 10 ? 0.1377 0.2010 0.2009 0.0082  -0.0115 -0.0192 233 PRO D CA  
2337 C C   . PRO D 10 ? 0.1240 0.2084 0.1986 0.0066  -0.0095 -0.0163 233 PRO D C   
2338 O O   . PRO D 10 ? 0.1361 0.2372 0.2084 0.0179  -0.0177 -0.0152 233 PRO D O   
2339 C CB  . PRO D 10 ? 0.1571 0.1979 0.2008 0.0281  -0.0001 -0.0102 233 PRO D CB  
2340 C CG  . PRO D 10 ? 0.1596 0.1907 0.2165 0.0150  0.0018  -0.0195 233 PRO D CG  
2341 C CD  . PRO D 10 ? 0.1602 0.1872 0.2090 -0.0120 -0.0101 -0.0209 233 PRO D CD  
2342 N N   . THR D 11 ? 0.1531 0.2226 0.1972 0.0066  -0.0220 -0.0131 234 THR D N   
2343 C CA  . THR D 11 ? 0.1732 0.2080 0.2193 -0.0027 -0.0273 -0.0104 234 THR D CA  
2344 C C   . THR D 11 ? 0.1265 0.2076 0.1966 0.0090  -0.0123 -0.0072 234 THR D C   
2345 O O   . THR D 11 ? 0.1209 0.2030 0.2316 0.0018  -0.0123 -0.0072 234 THR D O   
2346 C CB  . THR D 11 ? 0.1879 0.2077 0.2431 -0.0022 -0.0235 -0.0088 234 THR D CB  
2347 O OG1 . THR D 11 ? 0.2952 0.2529 0.3107 -0.0099 -0.0052 0.0106  234 THR D OG1 
2348 C CG2 . THR D 11 ? 0.2215 0.2278 0.2644 -0.0042 -0.0278 -0.0371 234 THR D CG2 
2349 N N   . SER D 12 ? 0.1244 0.2147 0.2040 -0.0031 -0.0221 -0.0067 235 SER D N   
2350 C CA  . SER D 12 ? 0.1353 0.2089 0.1841 -0.0031 -0.0125 -0.0084 235 SER D CA  
2351 C C   . SER D 12 ? 0.1714 0.2111 0.2056 0.0049  -0.0010 -0.0009 235 SER D C   
2352 O O   . SER D 12 ? 0.2154 0.2237 0.2120 0.0328  0.0083  0.0046  235 SER D O   
2353 C CB  . SER D 12 ? 0.1356 0.2609 0.2160 -0.0033 -0.0133 0.0084  235 SER D CB  
2354 O OG  . SER D 12 ? 0.1184 0.2563 0.2438 -0.0195 -0.0184 -0.0024 235 SER D OG  
2355 N N   A GLN D 13 ? 0.1530 0.1914 0.1745 -0.0014 -0.0082 -0.0027 236 GLN D N   
2356 N N   B GLN D 13 ? 0.1599 0.1999 0.1849 -0.0024 -0.0020 -0.0047 236 GLN D N   
2357 C CA  A GLN D 13 ? 0.1739 0.1909 0.1821 -0.0039 -0.0050 0.0019  236 GLN D CA  
2358 C CA  B GLN D 13 ? 0.1922 0.2074 0.1996 -0.0026 0.0018  -0.0012 236 GLN D CA  
2359 C C   A GLN D 13 ? 0.1842 0.1905 0.1831 -0.0050 -0.0090 0.0005  236 GLN D C   
2360 C C   B GLN D 13 ? 0.1893 0.2017 0.1957 -0.0075 -0.0013 0.0012  236 GLN D C   
2361 O O   A GLN D 13 ? 0.1922 0.1878 0.1714 -0.0184 -0.0090 -0.0086 236 GLN D O   
2362 O O   B GLN D 13 ? 0.2060 0.2012 0.1991 -0.0217 -0.0052 -0.0025 236 GLN D O   
2363 C CB  A GLN D 13 ? 0.1593 0.1776 0.1798 -0.0029 -0.0144 -0.0008 236 GLN D CB  
2364 C CB  B GLN D 13 ? 0.1840 0.2056 0.2048 -0.0171 0.0076  -0.0154 236 GLN D CB  
2365 C CG  A GLN D 13 ? 0.1730 0.1721 0.1817 -0.0220 -0.0235 0.0027  236 GLN D CG  
2366 C CG  B GLN D 13 ? 0.2511 0.2504 0.2432 -0.0038 -0.0181 -0.0106 236 GLN D CG  
2367 C CD  A GLN D 13 ? 0.1400 0.1320 0.1694 -0.0341 -0.0055 -0.0218 236 GLN D CD  
2368 C CD  B GLN D 13 ? 0.3178 0.2889 0.2869 -0.0026 0.0003  -0.0098 236 GLN D CD  
2369 O OE1 A GLN D 13 ? 0.2015 0.1809 0.1772 -0.0207 0.0053  0.0177  236 GLN D OE1 
2370 O OE1 B GLN D 13 ? 0.3555 0.3502 0.3530 0.0069  0.0026  -0.0031 236 GLN D OE1 
2371 N NE2 A GLN D 13 ? 0.1393 0.1304 0.1511 0.0036  0.0023  -0.0397 236 GLN D NE2 
2372 N NE2 B GLN D 13 ? 0.3098 0.2731 0.2673 -0.0044 -0.0119 -0.0118 236 GLN D NE2 
2373 N N   . LYS D 14 ? 0.2090 0.2096 0.1886 -0.0024 -0.0186 -0.0074 237 LYS D N   
2374 C CA  . LYS D 14 ? 0.2086 0.2394 0.2026 -0.0044 -0.0110 -0.0056 237 LYS D CA  
2375 C C   . LYS D 14 ? 0.2203 0.2207 0.2065 -0.0058 -0.0073 0.0085  237 LYS D C   
2376 O O   . LYS D 14 ? 0.2499 0.1977 0.2446 0.0013  0.0043  0.0106  237 LYS D O   
2377 C CB  . LYS D 14 ? 0.2240 0.3113 0.2115 -0.0042 -0.0238 -0.0148 237 LYS D CB  
2378 C CG  . LYS D 14 ? 0.2793 0.3377 0.2618 -0.0258 -0.0132 -0.0185 237 LYS D CG  
2379 C CD  . LYS D 14 ? 0.2609 0.3514 0.3082 -0.0314 -0.0153 -0.0228 237 LYS D CD  
2380 C CE  . LYS D 14 ? 0.3383 0.4094 0.3369 -0.0278 -0.0282 -0.0213 237 LYS D CE  
2381 N NZ  . LYS D 14 ? 0.4419 0.4839 0.4333 -0.0177 0.0072  0.0153  237 LYS D NZ  
2382 N N   . LEU D 15 ? 0.2289 0.2072 0.1888 -0.0113 0.0035  -0.0063 238 LEU D N   
2383 C CA  . LEU D 15 ? 0.2385 0.2047 0.1922 -0.0221 0.0102  -0.0179 238 LEU D CA  
2384 C C   . LEU D 15 ? 0.2820 0.2279 0.2274 -0.0230 0.0127  -0.0287 238 LEU D C   
2385 O O   . LEU D 15 ? 0.3082 0.2258 0.2297 -0.0508 0.0111  -0.0438 238 LEU D O   
2386 C CB  . LEU D 15 ? 0.2184 0.2104 0.2023 -0.0070 0.0049  -0.0158 238 LEU D CB  
2387 C CG  . LEU D 15 ? 0.1941 0.1725 0.2081 0.0045  0.0031  -0.0147 238 LEU D CG  
2388 C CD1 . LEU D 15 ? 0.2068 0.2204 0.2079 -0.0038 -0.0240 -0.0107 238 LEU D CD1 
2389 C CD2 . LEU D 15 ? 0.2389 0.1706 0.2106 -0.0218 0.0207  -0.0258 238 LEU D CD2 
2390 N N   A MET D 16 ? 0.3169 0.2673 0.2166 -0.0089 0.0293  -0.0313 239 MET D N   
2391 N N   B MET D 16 ? 0.3134 0.2680 0.2239 -0.0095 0.0256  -0.0321 239 MET D N   
2392 C CA  A MET D 16 ? 0.3451 0.2996 0.2531 -0.0042 0.0274  -0.0356 239 MET D CA  
2393 C CA  B MET D 16 ? 0.3390 0.3014 0.2658 -0.0037 0.0188  -0.0399 239 MET D CA  
2394 C C   A MET D 16 ? 0.3342 0.2758 0.2414 -0.0049 0.0344  -0.0320 239 MET D C   
2395 C C   B MET D 16 ? 0.3310 0.2769 0.2470 -0.0053 0.0299  -0.0333 239 MET D C   
2396 O O   A MET D 16 ? 0.3262 0.2592 0.2252 0.0135  0.0410  -0.0222 239 MET D O   
2397 O O   B MET D 16 ? 0.3294 0.2646 0.2320 0.0100  0.0324  -0.0241 239 MET D O   
2398 C CB  A MET D 16 ? 0.3566 0.3145 0.2484 -0.0013 0.0223  -0.0282 239 MET D CB  
2399 C CB  B MET D 16 ? 0.3478 0.3164 0.2573 -0.0007 0.0139  -0.0302 239 MET D CB  
2400 C CG  A MET D 16 ? 0.3785 0.3340 0.3117 -0.0046 0.0244  -0.0129 239 MET D CG  
2401 C CG  B MET D 16 ? 0.3473 0.3423 0.3329 0.0000  0.0121  -0.0206 239 MET D CG  
2402 S SD  A MET D 16 ? 0.4391 0.3780 0.3529 0.0122  0.0231  -0.0213 239 MET D SD  
2403 S SD  B MET D 16 ? 0.4120 0.3835 0.3609 -0.0003 -0.0004 -0.0353 239 MET D SD  
2404 C CE  A MET D 16 ? 0.3562 0.3259 0.2474 0.0110  0.0194  -0.0189 239 MET D CE  
2405 C CE  B MET D 16 ? 0.4051 0.3642 0.3641 0.0020  -0.0140 0.0043  239 MET D CE  
2406 N N   . PRO D 17 ? 0.3320 0.2729 0.2498 -0.0100 0.0276  -0.0484 240 PRO D N   
2407 C CA  . PRO D 17 ? 0.3439 0.2577 0.2488 0.0099  0.0343  -0.0484 240 PRO D CA  
2408 C C   . PRO D 17 ? 0.3288 0.2466 0.2427 0.0248  0.0559  -0.0319 240 PRO D C   
2409 O O   . PRO D 17 ? 0.3526 0.2584 0.2430 0.0116  0.0674  -0.0276 240 PRO D O   
2410 C CB  . PRO D 17 ? 0.3558 0.2631 0.2720 0.0205  0.0360  -0.0652 240 PRO D CB  
2411 C CG  . PRO D 17 ? 0.3728 0.3115 0.3008 0.0199  0.0227  -0.0388 240 PRO D CG  
2412 C CD  . PRO D 17 ? 0.3572 0.2966 0.2919 -0.0121 0.0220  -0.0458 240 PRO D CD  
2413 N N   . GLY D 18 ? 0.3012 0.2349 0.2434 0.0335  0.0742  -0.0289 241 GLY D N   
2414 C CA  . GLY D 18 ? 0.2915 0.2475 0.2639 0.0307  0.0661  -0.0245 241 GLY D CA  
2415 C C   . GLY D 18 ? 0.2641 0.2426 0.2467 0.0243  0.0628  -0.0113 241 GLY D C   
2416 O O   . GLY D 18 ? 0.2721 0.2804 0.2884 0.0259  0.0706  -0.0288 241 GLY D O   
2417 N N   A SER D 19 ? 0.2549 0.2061 0.2121 0.0410  0.0595  -0.0205 242 SER D N   
2418 N N   B SER D 19 ? 0.2597 0.2175 0.2210 0.0352  0.0581  -0.0216 242 SER D N   
2419 C CA  A SER D 19 ? 0.2408 0.1854 0.2028 0.0309  0.0415  -0.0102 242 SER D CA  
2420 C CA  B SER D 19 ? 0.2461 0.2078 0.2142 0.0218  0.0425  -0.0146 242 SER D CA  
2421 C C   A SER D 19 ? 0.2492 0.2063 0.2078 0.0279  0.0379  0.0105  242 SER D C   
2422 C C   B SER D 19 ? 0.2557 0.2175 0.2214 0.0210  0.0292  0.0084  242 SER D C   
2423 O O   A SER D 19 ? 0.2128 0.1607 0.1982 0.0507  0.0521  -0.0096 242 SER D O   
2424 O O   B SER D 19 ? 0.2284 0.1742 0.2162 0.0406  0.0369  -0.0168 242 SER D O   
2425 C CB  A SER D 19 ? 0.2456 0.1790 0.2113 0.0384  0.0342  -0.0074 242 SER D CB  
2426 C CB  B SER D 19 ? 0.2482 0.2135 0.2333 0.0189  0.0399  -0.0129 242 SER D CB  
2427 O OG  A SER D 19 ? 0.3026 0.1784 0.2027 0.0217  0.0015  0.0077  242 SER D OG  
2428 O OG  B SER D 19 ? 0.2787 0.2613 0.2144 -0.0028 0.0406  -0.0035 242 SER D OG  
2429 N N   . THR D 20 ? 0.2385 0.1992 0.1826 0.0299  0.0505  0.0068  243 THR D N   
2430 C CA  . THR D 20 ? 0.2144 0.2012 0.1984 0.0189  0.0474  0.0025  243 THR D CA  
2431 C C   . THR D 20 ? 0.1935 0.1624 0.1972 0.0175  0.0307  -0.0159 243 THR D C   
2432 O O   . THR D 20 ? 0.2096 0.1719 0.1985 0.0436  0.0275  0.0037  243 THR D O   
2433 C CB  . THR D 20 ? 0.2399 0.2359 0.1994 -0.0028 0.0349  -0.0024 243 THR D CB  
2434 O OG1 . THR D 20 ? 0.2930 0.3012 0.2729 -0.0181 0.0604  0.0141  243 THR D OG1 
2435 C CG2 . THR D 20 ? 0.2453 0.2273 0.2015 -0.0009 0.0323  -0.0121 243 THR D CG2 
2436 N N   . LEU D 21 ? 0.1965 0.1652 0.1773 0.0209  0.0382  -0.0096 244 LEU D N   
2437 C CA  . LEU D 21 ? 0.1817 0.1532 0.1960 0.0150  0.0254  -0.0033 244 LEU D CA  
2438 C C   . LEU D 21 ? 0.1554 0.1553 0.1811 0.0120  0.0403  0.0028  244 LEU D C   
2439 O O   . LEU D 21 ? 0.1595 0.1889 0.1998 0.0123  0.0359  -0.0009 244 LEU D O   
2440 C CB  . LEU D 21 ? 0.1540 0.1632 0.2207 -0.0041 0.0188  -0.0084 244 LEU D CB  
2441 C CG  . LEU D 21 ? 0.2046 0.1677 0.2275 -0.0005 0.0176  -0.0130 244 LEU D CG  
2442 C CD1 . LEU D 21 ? 0.1637 0.2165 0.2243 -0.0165 0.0243  -0.0329 244 LEU D CD1 
2443 C CD2 . LEU D 21 ? 0.2036 0.1883 0.2457 -0.0025 0.0148  0.0142  244 LEU D CD2 
2444 N N   . VAL D 22 ? 0.1727 0.1503 0.1920 0.0029  0.0374  -0.0062 245 VAL D N   
2445 C CA  . VAL D 22 ? 0.1877 0.1464 0.2024 -0.0302 0.0489  -0.0062 245 VAL D CA  
2446 C C   . VAL D 22 ? 0.1586 0.1574 0.1956 -0.0088 0.0266  -0.0198 245 VAL D C   
2447 O O   . VAL D 22 ? 0.1819 0.1697 0.1955 0.0191  0.0331  0.0025  245 VAL D O   
2448 C CB  . VAL D 22 ? 0.2248 0.1767 0.2443 -0.0326 0.0356  -0.0189 245 VAL D CB  
2449 C CG1 . VAL D 22 ? 0.2258 0.2086 0.2862 -0.0678 0.0374  -0.0256 245 VAL D CG1 
2450 C CG2 . VAL D 22 ? 0.2125 0.1972 0.2902 -0.0299 0.0679  -0.0034 245 VAL D CG2 
2451 N N   . LEU D 23 ? 0.1473 0.1356 0.1796 -0.0150 0.0322  -0.0153 246 LEU D N   
2452 C CA  . LEU D 23 ? 0.1236 0.1468 0.1818 -0.0226 0.0214  -0.0126 246 LEU D CA  
2453 C C   . LEU D 23 ? 0.1102 0.1493 0.1889 -0.0102 0.0238  0.0001  246 LEU D C   
2454 O O   . LEU D 23 ? 0.1037 0.1644 0.1977 0.0016  0.0248  -0.0330 246 LEU D O   
2455 C CB  . LEU D 23 ? 0.1243 0.1450 0.2018 -0.0193 0.0222  -0.0170 246 LEU D CB  
2456 C CG  . LEU D 23 ? 0.1280 0.1592 0.2032 -0.0151 0.0224  -0.0316 246 LEU D CG  
2457 C CD1 . LEU D 23 ? 0.1756 0.1481 0.2886 -0.0158 0.0136  -0.0191 246 LEU D CD1 
2458 C CD2 . LEU D 23 ? 0.1860 0.2261 0.2850 0.0093  -0.0346 -0.0587 246 LEU D CD2 
2459 N N   . GLN D 24 ? 0.0927 0.1325 0.1655 -0.0072 0.0267  -0.0156 247 GLN D N   
2460 C CA  . GLN D 24 ? 0.1269 0.1262 0.1749 -0.0123 0.0263  -0.0100 247 GLN D CA  
2461 C C   . GLN D 24 ? 0.1052 0.1245 0.1684 0.0032  0.0166  -0.0089 247 GLN D C   
2462 O O   . GLN D 24 ? 0.1067 0.1685 0.1816 0.0049  0.0213  0.0042  247 GLN D O   
2463 C CB  . GLN D 24 ? 0.1339 0.1317 0.1856 -0.0180 0.0174  0.0084  247 GLN D CB  
2464 C CG  . GLN D 24 ? 0.1948 0.1431 0.1743 -0.0337 0.0149  -0.0108 247 GLN D CG  
2465 C CD  . GLN D 24 ? 0.1719 0.1532 0.1759 -0.0180 0.0268  -0.0003 247 GLN D CD  
2466 O OE1 . GLN D 24 ? 0.2254 0.2042 0.2319 -0.0055 -0.0061 0.0203  247 GLN D OE1 
2467 N NE2 . GLN D 24 ? 0.1645 0.1290 0.1647 -0.0284 0.0166  -0.0116 247 GLN D NE2 
2468 N N   . CYS D 25 ? 0.1155 0.1261 0.1629 -0.0036 0.0318  0.0037  248 CYS D N   
2469 C CA  . CYS D 25 ? 0.1363 0.1336 0.1594 -0.0060 0.0314  -0.0015 248 CYS D CA  
2470 C C   . CYS D 25 ? 0.1153 0.1446 0.1629 -0.0015 0.0314  0.0029  248 CYS D C   
2471 O O   . CYS D 25 ? 0.1362 0.1491 0.1868 0.0003  0.0113  -0.0156 248 CYS D O   
2472 C CB  . CYS D 25 ? 0.1341 0.1513 0.1509 -0.0040 0.0320  -0.0021 248 CYS D CB  
2473 S SG  . CYS D 25 ? 0.1441 0.1690 0.1863 -0.0115 0.0335  0.0043  248 CYS D SG  
2474 N N   . VAL D 26 ? 0.1324 0.1508 0.1789 0.0011  0.0304  -0.0150 249 VAL D N   
2475 C CA  . VAL D 26 ? 0.1497 0.1583 0.1889 -0.0166 0.0230  -0.0012 249 VAL D CA  
2476 C C   . VAL D 26 ? 0.1283 0.1622 0.1922 0.0084  0.0201  -0.0226 249 VAL D C   
2477 O O   . VAL D 26 ? 0.1452 0.1851 0.1998 0.0114  0.0205  -0.0079 249 VAL D O   
2478 C CB  . VAL D 26 ? 0.1840 0.1688 0.2135 -0.0208 0.0255  -0.0056 249 VAL D CB  
2479 C CG1 . VAL D 26 ? 0.2399 0.1598 0.2440 -0.0492 0.0251  -0.0104 249 VAL D CG1 
2480 C CG2 . VAL D 26 ? 0.1908 0.1988 0.2123 -0.0630 0.0252  0.0067  249 VAL D CG2 
2481 N N   . ALA D 27 ? 0.1442 0.1579 0.1872 0.0043  0.0280  -0.0145 250 ALA D N   
2482 C CA  . ALA D 27 ? 0.1427 0.1750 0.1781 -0.0061 0.0215  -0.0052 250 ALA D CA  
2483 C C   . ALA D 27 ? 0.1479 0.1550 0.1958 0.0078  0.0228  -0.0129 250 ALA D C   
2484 O O   . ALA D 27 ? 0.1869 0.1895 0.2213 -0.0102 0.0291  -0.0246 250 ALA D O   
2485 C CB  . ALA D 27 ? 0.1595 0.1700 0.1963 0.0053  0.0139  -0.0008 250 ALA D CB  
2486 N N   . VAL D 28 ? 0.1826 0.1919 0.1995 -0.0020 0.0235  -0.0278 251 VAL D N   
2487 C CA  . VAL D 28 ? 0.2374 0.1813 0.2119 0.0003  0.0162  -0.0394 251 VAL D CA  
2488 C C   . VAL D 28 ? 0.2033 0.2090 0.2018 -0.0009 0.0170  -0.0359 251 VAL D C   
2489 O O   . VAL D 28 ? 0.2211 0.2168 0.2146 -0.0041 -0.0137 -0.0138 251 VAL D O   
2490 C CB  . VAL D 28 ? 0.2696 0.1963 0.2355 -0.0001 0.0090  -0.0391 251 VAL D CB  
2491 C CG1 . VAL D 28 ? 0.3320 0.2392 0.2882 -0.0033 0.0118  -0.0166 251 VAL D CG1 
2492 C CG2 . VAL D 28 ? 0.2834 0.2157 0.2661 0.0481  0.0048  -0.0544 251 VAL D CG2 
2493 N N   . GLY D 29 ? 0.2432 0.2224 0.2212 0.0015  -0.0069 -0.0220 252 GLY D N   
2494 C CA  . GLY D 29 ? 0.2599 0.2550 0.2358 0.0109  -0.0097 -0.0213 252 GLY D CA  
2495 C C   . GLY D 29 ? 0.2757 0.2177 0.2403 0.0107  -0.0143 -0.0363 252 GLY D C   
2496 O O   . GLY D 29 ? 0.2716 0.2018 0.2387 -0.0059 -0.0312 -0.0446 252 GLY D O   
2497 N N   . SER D 30 ? 0.2863 0.2362 0.2409 0.0193  -0.0216 -0.0443 253 SER D N   
2498 C CA  . SER D 30 ? 0.2871 0.2371 0.2517 0.0043  -0.0219 -0.0308 253 SER D CA  
2499 C C   . SER D 30 ? 0.2767 0.2594 0.2370 0.0111  -0.0075 -0.0265 253 SER D C   
2500 O O   . SER D 30 ? 0.2964 0.3019 0.2496 0.0216  0.0105  -0.0114 253 SER D O   
2501 C CB  . SER D 30 ? 0.3099 0.2615 0.2744 0.0014  -0.0269 -0.0448 253 SER D CB  
2502 O OG  . SER D 30 ? 0.3587 0.3053 0.3489 -0.0049 -0.0536 -0.0432 253 SER D OG  
2503 N N   . PRO D 31 ? 0.2562 0.2501 0.2161 0.0071  -0.0140 -0.0162 254 PRO D N   
2504 C CA  . PRO D 31 ? 0.2342 0.2264 0.2198 -0.0110 -0.0164 -0.0147 254 PRO D CA  
2505 C C   . PRO D 31 ? 0.1930 0.1914 0.2087 -0.0175 -0.0075 -0.0225 254 PRO D C   
2506 O O   . PRO D 31 ? 0.1910 0.2041 0.2090 -0.0111 -0.0033 -0.0240 254 PRO D O   
2507 C CB  . PRO D 31 ? 0.2419 0.2259 0.2338 -0.0120 -0.0159 -0.0046 254 PRO D CB  
2508 C CG  . PRO D 31 ? 0.2622 0.2710 0.2405 0.0124  -0.0158 -0.0012 254 PRO D CG  
2509 C CD  . PRO D 31 ? 0.2581 0.2711 0.2349 0.0101  -0.0050 -0.0077 254 PRO D CD  
2510 N N   A ILE D 32 ? 0.1956 0.1908 0.1944 -0.0199 -0.0129 -0.0206 255 ILE D N   
2511 N N   B ILE D 32 ? 0.2031 0.2031 0.2053 -0.0162 -0.0084 -0.0197 255 ILE D N   
2512 C CA  A ILE D 32 ? 0.1909 0.1723 0.1988 -0.0227 -0.0148 -0.0158 255 ILE D CA  
2513 C CA  B ILE D 32 ? 0.2003 0.1998 0.2161 -0.0126 -0.0090 -0.0134 255 ILE D CA  
2514 C C   A ILE D 32 ? 0.1733 0.1718 0.2061 -0.0138 -0.0123 -0.0201 255 ILE D C   
2515 C C   B ILE D 32 ? 0.1754 0.1863 0.2097 -0.0091 -0.0058 -0.0194 255 ILE D C   
2516 O O   A ILE D 32 ? 0.1860 0.1797 0.1961 -0.0144 -0.0289 -0.0107 255 ILE D O   
2517 O O   B ILE D 32 ? 0.1828 0.2040 0.1934 0.0012  -0.0040 -0.0219 255 ILE D O   
2518 C CB  A ILE D 32 ? 0.2023 0.2046 0.2157 -0.0275 -0.0101 -0.0163 255 ILE D CB  
2519 C CB  B ILE D 32 ? 0.2158 0.2227 0.2407 -0.0154 -0.0008 -0.0161 255 ILE D CB  
2520 C CG1 A ILE D 32 ? 0.1972 0.1918 0.2195 -0.0503 -0.0160 -0.0108 255 ILE D CG1 
2521 C CG1 B ILE D 32 ? 0.2553 0.2658 0.2643 -0.0147 -0.0140 -0.0172 255 ILE D CG1 
2522 C CG2 A ILE D 32 ? 0.2223 0.2375 0.2225 -0.0201 -0.0121 -0.0229 255 ILE D CG2 
2523 C CG2 B ILE D 32 ? 0.1602 0.2351 0.2427 -0.0161 -0.0051 -0.0054 255 ILE D CG2 
2524 C CD1 A ILE D 32 ? 0.2367 0.3273 0.2805 0.0043  -0.0022 -0.0298 255 ILE D CD1 
2525 C CD1 B ILE D 32 ? 0.3423 0.3259 0.3615 -0.0238 -0.0012 0.0049  255 ILE D CD1 
2526 N N   . PRO D 33 ? 0.1671 0.1731 0.2006 -0.0042 -0.0105 -0.0214 256 PRO D N   
2527 C CA  . PRO D 33 ? 0.1505 0.1779 0.1910 -0.0056 -0.0222 -0.0354 256 PRO D CA  
2528 C C   . PRO D 33 ? 0.1244 0.2064 0.1923 -0.0172 -0.0014 -0.0222 256 PRO D C   
2529 O O   . PRO D 33 ? 0.1524 0.1967 0.2145 -0.0271 0.0103  -0.0212 256 PRO D O   
2530 C CB  . PRO D 33 ? 0.1773 0.1856 0.2303 0.0099  -0.0285 -0.0308 256 PRO D CB  
2531 C CG  . PRO D 33 ? 0.2206 0.2104 0.2640 -0.0003 -0.0472 -0.0479 256 PRO D CG  
2532 C CD  . PRO D 33 ? 0.2096 0.2080 0.2358 -0.0079 -0.0405 -0.0258 256 PRO D CD  
2533 N N   . HIS D 34 ? 0.1476 0.1714 0.1776 0.0087  0.0034  -0.0213 257 HIS D N   
2534 C CA  . HIS D 34 ? 0.1149 0.1571 0.1874 -0.0014 -0.0052 -0.0209 257 HIS D CA  
2535 C C   . HIS D 34 ? 0.0995 0.1618 0.1863 -0.0041 0.0093  -0.0161 257 HIS D C   
2536 O O   . HIS D 34 ? 0.1101 0.1668 0.1705 -0.0094 0.0076  -0.0057 257 HIS D O   
2537 C CB  . HIS D 34 ? 0.1630 0.2036 0.1852 0.0122  -0.0274 -0.0185 257 HIS D CB  
2538 C CG  . HIS D 34 ? 0.1955 0.2525 0.2313 0.0185  -0.0157 -0.0133 257 HIS D CG  
2539 N ND1 . HIS D 34 ? 0.1977 0.4007 0.2670 0.0239  -0.0530 -0.0354 257 HIS D ND1 
2540 C CD2 . HIS D 34 ? 0.2356 0.2964 0.2513 0.0097  -0.0567 -0.0389 257 HIS D CD2 
2541 C CE1 . HIS D 34 ? 0.2402 0.4162 0.2491 0.0238  -0.0611 -0.0190 257 HIS D CE1 
2542 N NE2 . HIS D 34 ? 0.2270 0.3859 0.2601 0.0103  -0.0683 -0.0008 257 HIS D NE2 
2543 N N   . TYR D 35 ? 0.1061 0.1674 0.1733 0.0053  0.0128  -0.0150 258 TYR D N   
2544 C CA  . TYR D 35 ? 0.1060 0.1620 0.1595 0.0202  0.0103  -0.0091 258 TYR D CA  
2545 C C   . TYR D 35 ? 0.1123 0.1623 0.1849 0.0242  0.0159  -0.0043 258 TYR D C   
2546 O O   . TYR D 35 ? 0.1190 0.1578 0.1869 0.0336  0.0063  -0.0102 258 TYR D O   
2547 C CB  . TYR D 35 ? 0.1117 0.1507 0.1908 0.0129  0.0285  -0.0024 258 TYR D CB  
2548 C CG  . TYR D 35 ? 0.1075 0.1560 0.1775 0.0071  0.0125  -0.0022 258 TYR D CG  
2549 C CD1 . TYR D 35 ? 0.1252 0.1517 0.1837 0.0119  0.0110  0.0019  258 TYR D CD1 
2550 C CD2 . TYR D 35 ? 0.1304 0.1652 0.1901 -0.0047 0.0235  -0.0056 258 TYR D CD2 
2551 C CE1 . TYR D 35 ? 0.1243 0.1496 0.2023 -0.0112 0.0097  -0.0074 258 TYR D CE1 
2552 C CE2 . TYR D 35 ? 0.1503 0.1406 0.2088 -0.0073 0.0054  -0.0010 258 TYR D CE2 
2553 C CZ  . TYR D 35 ? 0.1231 0.1351 0.1800 0.0207  0.0336  0.0086  258 TYR D CZ  
2554 O OH  . TYR D 35 ? 0.1356 0.1482 0.2353 0.0156  0.0099  -0.0065 258 TYR D OH  
2555 N N   . GLN D 36 ? 0.1153 0.1422 0.1715 -0.0003 0.0072  -0.0077 259 GLN D N   
2556 C CA  . GLN D 36 ? 0.0921 0.1335 0.1761 0.0099  0.0029  0.0067  259 GLN D CA  
2557 C C   . GLN D 36 ? 0.1052 0.1400 0.1708 -0.0045 -0.0037 0.0117  259 GLN D C   
2558 O O   . GLN D 36 ? 0.1013 0.1386 0.1881 -0.0032 0.0125  -0.0052 259 GLN D O   
2559 C CB  . GLN D 36 ? 0.1331 0.1532 0.1691 0.0145  -0.0140 -0.0021 259 GLN D CB  
2560 C CG  . GLN D 36 ? 0.1310 0.1467 0.1762 0.0142  0.0079  -0.0008 259 GLN D CG  
2561 C CD  . GLN D 36 ? 0.1300 0.1527 0.2014 0.0308  -0.0066 0.0044  259 GLN D CD  
2562 O OE1 . GLN D 36 ? 0.1311 0.1831 0.2006 0.0277  -0.0018 -0.0073 259 GLN D OE1 
2563 N NE2 . GLN D 36 ? 0.1488 0.1663 0.1919 0.0232  0.0115  -0.0045 259 GLN D NE2 
2564 N N   . TRP D 37 ? 0.1103 0.1297 0.1730 -0.0077 -0.0039 -0.0043 260 TRP D N   
2565 C CA  . TRP D 37 ? 0.1157 0.1297 0.1601 -0.0081 0.0028  -0.0004 260 TRP D CA  
2566 C C   . TRP D 37 ? 0.1188 0.1412 0.1523 0.0012  -0.0026 -0.0079 260 TRP D C   
2567 O O   . TRP D 37 ? 0.1277 0.1373 0.2044 0.0028  0.0020  -0.0038 260 TRP D O   
2568 C CB  . TRP D 37 ? 0.1068 0.1363 0.1650 0.0110  0.0109  0.0010  260 TRP D CB  
2569 C CG  . TRP D 37 ? 0.1092 0.1306 0.1629 -0.0007 0.0129  -0.0003 260 TRP D CG  
2570 C CD1 . TRP D 37 ? 0.1193 0.1397 0.1605 -0.0044 0.0181  -0.0015 260 TRP D CD1 
2571 C CD2 . TRP D 37 ? 0.0921 0.1534 0.1570 0.0009  0.0070  0.0016  260 TRP D CD2 
2572 N NE1 . TRP D 37 ? 0.0924 0.1398 0.1869 -0.0048 0.0205  -0.0002 260 TRP D NE1 
2573 C CE2 . TRP D 37 ? 0.1131 0.1378 0.1632 -0.0042 0.0178  -0.0001 260 TRP D CE2 
2574 C CE3 . TRP D 37 ? 0.1088 0.1516 0.1731 0.0041  0.0112  0.0055  260 TRP D CE3 
2575 C CZ2 . TRP D 37 ? 0.1330 0.1399 0.1793 -0.0101 0.0215  0.0004  260 TRP D CZ2 
2576 C CZ3 . TRP D 37 ? 0.1058 0.1612 0.1705 0.0013  0.0080  0.0004  260 TRP D CZ3 
2577 C CH2 . TRP D 37 ? 0.1255 0.1610 0.1654 0.0048  0.0133  0.0062  260 TRP D CH2 
2578 N N   . PHE D 38 ? 0.1174 0.1402 0.1722 -0.0183 -0.0063 -0.0053 261 PHE D N   
2579 C CA  . PHE D 38 ? 0.1399 0.1449 0.1902 -0.0327 0.0018  -0.0031 261 PHE D CA  
2580 C C   . PHE D 38 ? 0.1486 0.1450 0.2066 -0.0283 -0.0049 0.0131  261 PHE D C   
2581 O O   . PHE D 38 ? 0.1538 0.1545 0.2034 -0.0163 -0.0070 0.0093  261 PHE D O   
2582 C CB  . PHE D 38 ? 0.1545 0.1673 0.1913 -0.0271 0.0040  0.0005  261 PHE D CB  
2583 C CG  . PHE D 38 ? 0.1580 0.1598 0.1908 -0.0246 0.0101  0.0199  261 PHE D CG  
2584 C CD1 . PHE D 38 ? 0.2052 0.1689 0.2067 -0.0167 0.0239  0.0130  261 PHE D CD1 
2585 C CD2 . PHE D 38 ? 0.1368 0.1539 0.1935 -0.0317 0.0099  -0.0121 261 PHE D CD2 
2586 C CE1 . PHE D 38 ? 0.2485 0.1747 0.1974 -0.0032 0.0147  0.0199  261 PHE D CE1 
2587 C CE2 . PHE D 38 ? 0.1440 0.1946 0.2074 -0.0207 0.0309  0.0192  261 PHE D CE2 
2588 C CZ  . PHE D 38 ? 0.1901 0.1925 0.1969 -0.0058 0.0214  0.0202  261 PHE D CZ  
2589 N N   . LYS D 39 ? 0.1794 0.1503 0.1953 -0.0357 -0.0219 -0.0097 262 LYS D N   
2590 C CA  . LYS D 39 ? 0.1949 0.1804 0.1874 -0.0474 -0.0130 -0.0061 262 LYS D CA  
2591 C C   . LYS D 39 ? 0.2310 0.1932 0.2127 -0.0435 -0.0242 0.0120  262 LYS D C   
2592 O O   . LYS D 39 ? 0.2814 0.1694 0.2137 -0.0448 -0.0413 -0.0007 262 LYS D O   
2593 C CB  . LYS D 39 ? 0.2339 0.1823 0.2036 -0.0438 -0.0126 -0.0147 262 LYS D CB  
2594 C CG  . LYS D 39 ? 0.2926 0.2585 0.2164 -0.0708 0.0034  -0.0126 262 LYS D CG  
2595 C CD  . LYS D 39 ? 0.3886 0.3148 0.2734 -0.0455 0.0353  -0.0124 262 LYS D CD  
2596 C CE  . LYS D 39 ? 0.4177 0.3781 0.3554 0.0062  0.0405  0.0051  262 LYS D CE  
2597 N NZ  . LYS D 39 ? 0.5000 0.4243 0.3428 -0.0153 -0.0037 0.0081  262 LYS D NZ  
2598 N N   . ASN D 40 ? 0.2223 0.1951 0.2429 -0.0774 -0.0250 0.0074  263 ASN D N   
2599 C CA  . ASN D 40 ? 0.2712 0.2123 0.2511 -0.0729 -0.0244 0.0188  263 ASN D CA  
2600 C C   . ASN D 40 ? 0.2954 0.2133 0.2669 -0.0649 -0.0118 0.0105  263 ASN D C   
2601 O O   . ASN D 40 ? 0.3159 0.2298 0.2734 -0.0577 -0.0318 0.0111  263 ASN D O   
2602 C CB  . ASN D 40 ? 0.2812 0.2218 0.2778 -0.0677 -0.0053 0.0147  263 ASN D CB  
2603 C CG  . ASN D 40 ? 0.3067 0.2407 0.2988 -0.0371 -0.0302 -0.0121 263 ASN D CG  
2604 O OD1 . ASN D 40 ? 0.3155 0.2190 0.3244 -0.0488 -0.0849 0.0044  263 ASN D OD1 
2605 N ND2 . ASN D 40 ? 0.3476 0.2776 0.3419 -0.0233 -0.0178 -0.0240 263 ASN D ND2 
2606 N N   . GLU D 41 ? 0.2786 0.2499 0.2372 -0.0722 -0.0067 0.0132  264 GLU D N   
2607 C CA  . GLU D 41 ? 0.3021 0.2453 0.2590 -0.0665 -0.0077 0.0278  264 GLU D CA  
2608 C C   . GLU D 41 ? 0.3132 0.2246 0.2618 -0.0518 -0.0151 0.0339  264 GLU D C   
2609 O O   . GLU D 41 ? 0.3541 0.2960 0.2621 -0.0518 -0.0247 0.0415  264 GLU D O   
2610 C CB  . GLU D 41 ? 0.3263 0.2756 0.2908 -0.0674 0.0002  0.0339  264 GLU D CB  
2611 C CG  . GLU D 41 ? 0.3321 0.3264 0.3113 -0.0494 -0.0121 0.0112  264 GLU D CG  
2612 C CD  . GLU D 41 ? 0.4051 0.4237 0.3964 -0.0086 0.0141  -0.0020 264 GLU D CD  
2613 O OE1 . GLU D 41 ? 0.3759 0.3708 0.3887 -0.0476 0.0212  -0.0056 264 GLU D OE1 
2614 O OE2 . GLU D 41 ? 0.4403 0.5106 0.4791 0.0149  -0.0197 0.0118  264 GLU D OE2 
2615 N N   . LEU D 42 ? 0.2793 0.1882 0.2422 -0.0534 -0.0327 0.0168  265 LEU D N   
2616 C CA  . LEU D 42 ? 0.2997 0.1585 0.2647 -0.0306 -0.0277 -0.0041 265 LEU D CA  
2617 C C   . LEU D 42 ? 0.2688 0.1528 0.2338 -0.0239 -0.0320 0.0053  265 LEU D C   
2618 O O   . LEU D 42 ? 0.2456 0.1340 0.2122 -0.0165 -0.0246 0.0115  265 LEU D O   
2619 C CB  . LEU D 42 ? 0.3231 0.1380 0.3098 -0.0033 -0.0220 -0.0311 265 LEU D CB  
2620 C CG  . LEU D 42 ? 0.3736 0.1546 0.3401 -0.0250 -0.0397 -0.0561 265 LEU D CG  
2621 C CD1 . LEU D 42 ? 0.3855 0.3349 0.4270 0.0351  0.0207  -0.0494 265 LEU D CD1 
2622 C CD2 . LEU D 42 ? 0.3985 0.2915 0.3856 -0.0236 -0.0191 -0.0157 265 LEU D CD2 
2623 N N   . PRO D 43 ? 0.2536 0.1545 0.2146 -0.0132 -0.0239 0.0155  266 PRO D N   
2624 C CA  . PRO D 43 ? 0.2225 0.1478 0.2026 -0.0010 -0.0117 0.0034  266 PRO D CA  
2625 C C   . PRO D 43 ? 0.2414 0.1579 0.2065 0.0134  -0.0005 -0.0157 266 PRO D C   
2626 O O   . PRO D 43 ? 0.2545 0.1675 0.2433 0.0436  0.0066  -0.0120 266 PRO D O   
2627 C CB  . PRO D 43 ? 0.2636 0.1859 0.2020 -0.0004 -0.0167 0.0065  266 PRO D CB  
2628 C CG  . PRO D 43 ? 0.2773 0.1984 0.2311 0.0157  -0.0212 0.0263  266 PRO D CG  
2629 C CD  . PRO D 43 ? 0.2870 0.1750 0.2357 -0.0139 -0.0299 0.0414  266 PRO D CD  
2630 N N   . LEU D 44 ? 0.1992 0.1578 0.1943 0.0195  0.0075  0.0047  267 LEU D N   
2631 C CA  . LEU D 44 ? 0.1708 0.1721 0.2001 0.0144  0.0081  -0.0109 267 LEU D CA  
2632 C C   . LEU D 44 ? 0.1604 0.1827 0.2135 0.0198  0.0229  -0.0133 267 LEU D C   
2633 O O   . LEU D 44 ? 0.1429 0.2092 0.2135 0.0262  0.0045  -0.0075 267 LEU D O   
2634 C CB  . LEU D 44 ? 0.1753 0.1681 0.2065 0.0116  0.0040  0.0035  267 LEU D CB  
2635 C CG  . LEU D 44 ? 0.1906 0.1815 0.2127 0.0054  -0.0067 -0.0110 267 LEU D CG  
2636 C CD1 . LEU D 44 ? 0.2288 0.1885 0.2031 0.0134  -0.0002 0.0084  267 LEU D CD1 
2637 C CD2 . LEU D 44 ? 0.3178 0.2370 0.2808 0.0687  -0.0247 -0.0535 267 LEU D CD2 
2638 N N   A THR D 45 ? 0.2085 0.2116 0.2600 0.0212  0.0116  -0.0070 268 THR D N   
2639 N N   B THR D 45 ? 0.1834 0.1866 0.2426 0.0208  0.0124  -0.0094 268 THR D N   
2640 C CA  A THR D 45 ? 0.1995 0.2145 0.2684 0.0424  0.0109  -0.0109 268 THR D CA  
2641 C CA  B THR D 45 ? 0.1483 0.1602 0.2361 0.0536  0.0128  -0.0120 268 THR D CA  
2642 C C   A THR D 45 ? 0.1425 0.1956 0.2529 0.0446  0.0235  -0.0083 268 THR D C   
2643 C C   B THR D 45 ? 0.1196 0.1677 0.2389 0.0465  0.0241  -0.0130 268 THR D C   
2644 O O   A THR D 45 ? 0.1963 0.2041 0.2650 0.0603  0.0279  -0.0251 268 THR D O   
2645 O O   B THR D 45 ? 0.1610 0.1757 0.2442 0.0346  0.0230  -0.0128 268 THR D O   
2646 C CB  A THR D 45 ? 0.2039 0.2257 0.2910 0.0395  0.0139  -0.0187 268 THR D CB  
2647 C CB  B THR D 45 ? 0.1383 0.1602 0.2514 0.0484  0.0079  -0.0250 268 THR D CB  
2648 O OG1 A THR D 45 ? 0.2896 0.3094 0.3047 0.0151  0.0087  0.0058  268 THR D OG1 
2649 O OG1 B THR D 45 ? 0.1563 0.1474 0.2791 0.0240  -0.0112 -0.0239 268 THR D OG1 
2650 C CG2 A THR D 45 ? 0.3100 0.2910 0.3155 0.0029  0.0015  -0.0072 268 THR D CG2 
2651 C CG2 B THR D 45 ? 0.2159 0.2106 0.2524 0.0262  0.0106  0.0197  268 THR D CG2 
2652 N N   . HIS D 46 ? 0.1466 0.2126 0.2792 0.0542  0.0012  -0.0041 269 HIS D N   
2653 C CA  . HIS D 46 ? 0.1383 0.2305 0.2766 0.0388  0.0059  -0.0030 269 HIS D CA  
2654 C C   . HIS D 46 ? 0.1531 0.2024 0.2726 0.0176  -0.0130 -0.0098 269 HIS D C   
2655 O O   . HIS D 46 ? 0.1626 0.2195 0.2865 0.0088  -0.0009 -0.0136 269 HIS D O   
2656 C CB  . HIS D 46 ? 0.1573 0.2496 0.3052 0.0481  0.0181  -0.0086 269 HIS D CB  
2657 C CG  . HIS D 46 ? 0.1893 0.2706 0.3344 0.0499  0.0388  0.0042  269 HIS D CG  
2658 N ND1 . HIS D 46 ? 0.2657 0.3602 0.4070 0.0462  -0.0070 0.0248  269 HIS D ND1 
2659 C CD2 . HIS D 46 ? 0.2792 0.2909 0.3613 0.0115  0.0241  -0.0089 269 HIS D CD2 
2660 C CE1 . HIS D 46 ? 0.2465 0.3082 0.3851 0.0560  0.0030  -0.0052 269 HIS D CE1 
2661 N NE2 . HIS D 46 ? 0.1883 0.3021 0.3871 0.0293  0.0126  -0.0236 269 HIS D NE2 
2662 N N   . GLU D 47 ? 0.1129 0.2061 0.2272 0.0333  0.0065  0.0051  270 GLU D N   
2663 C CA  . GLU D 47 ? 0.0953 0.1541 0.2151 0.0248  0.0058  -0.0086 270 GLU D CA  
2664 C C   . GLU D 47 ? 0.1111 0.1637 0.1947 0.0046  0.0061  -0.0007 270 GLU D C   
2665 O O   . GLU D 47 ? 0.1217 0.1739 0.2096 0.0073  0.0108  0.0065  270 GLU D O   
2666 C CB  . GLU D 47 ? 0.1276 0.1825 0.2006 0.0191  0.0111  -0.0090 270 GLU D CB  
2667 C CG  . GLU D 47 ? 0.1332 0.1967 0.2091 0.0335  0.0313  -0.0109 270 GLU D CG  
2668 C CD  . GLU D 47 ? 0.1810 0.2424 0.2157 0.0248  0.0139  -0.0163 270 GLU D CD  
2669 O OE1 . GLU D 47 ? 0.1560 0.2366 0.2084 0.0020  0.0299  0.0018  270 GLU D OE1 
2670 O OE2 . GLU D 47 ? 0.2276 0.3037 0.2997 0.0072  0.0117  -0.0029 270 GLU D OE2 
2671 N N   . THR D 48 ? 0.1096 0.1751 0.2093 0.0199  0.0126  -0.0128 271 THR D N   
2672 C CA  . THR D 48 ? 0.1233 0.1745 0.2128 0.0159  0.0036  -0.0143 271 THR D CA  
2673 C C   . THR D 48 ? 0.1016 0.1931 0.2163 -0.0016 0.0102  -0.0213 271 THR D C   
2674 O O   . THR D 48 ? 0.1337 0.1935 0.2111 -0.0032 0.0009  -0.0230 271 THR D O   
2675 C CB  . THR D 48 ? 0.1285 0.1899 0.2087 -0.0075 0.0035  -0.0034 271 THR D CB  
2676 O OG1 . THR D 48 ? 0.1174 0.2297 0.2765 0.0050  -0.0068 0.0141  271 THR D OG1 
2677 C CG2 . THR D 48 ? 0.1817 0.1974 0.2377 0.0319  -0.0041 0.0003  271 THR D CG2 
2678 N N   . LYS D 49 ? 0.1108 0.1871 0.2251 -0.0013 0.0050  -0.0024 272 LYS D N   
2679 C CA  . LYS D 49 ? 0.1173 0.1890 0.2310 -0.0016 0.0114  0.0022  272 LYS D CA  
2680 C C   . LYS D 49 ? 0.1038 0.1737 0.2149 0.0023  0.0042  -0.0009 272 LYS D C   
2681 O O   . LYS D 49 ? 0.0912 0.1597 0.2230 -0.0136 -0.0049 0.0033  272 LYS D O   
2682 C CB  . LYS D 49 ? 0.1383 0.1993 0.2396 0.0072  0.0164  0.0002  272 LYS D CB  
2683 C CG  . LYS D 49 ? 0.1569 0.2774 0.3320 -0.0099 0.0251  0.0264  272 LYS D CG  
2684 C CD  . LYS D 49 ? 0.1990 0.3819 0.3727 -0.0052 0.0609  0.0124  272 LYS D CD  
2685 C CE  . LYS D 49 ? 0.3409 0.4268 0.4533 0.0218  -0.0015 0.0083  272 LYS D CE  
2686 N NZ  . LYS D 49 ? 0.4201 0.4865 0.4567 0.0041  0.0050  -0.0102 272 LYS D NZ  
2687 N N   A LYS D 50 ? 0.1216 0.1535 0.2086 -0.0215 -0.0038 -0.0128 273 LYS D N   
2688 N N   B LYS D 50 ? 0.1242 0.1653 0.2056 -0.0085 0.0023  -0.0056 273 LYS D N   
2689 C CA  A LYS D 50 ? 0.1362 0.1483 0.2024 -0.0073 0.0000  -0.0152 273 LYS D CA  
2690 C CA  B LYS D 50 ? 0.1295 0.1615 0.1977 0.0014  0.0063  -0.0047 273 LYS D CA  
2691 C C   A LYS D 50 ? 0.1217 0.1413 0.1893 -0.0049 0.0073  0.0036  273 LYS D C   
2692 C C   B LYS D 50 ? 0.1216 0.1465 0.1901 0.0023  0.0027  0.0072  273 LYS D C   
2693 O O   A LYS D 50 ? 0.1123 0.1412 0.1882 0.0072  0.0299  -0.0002 273 LYS D O   
2694 O O   B LYS D 50 ? 0.0906 0.1555 0.1883 0.0183  0.0051  -0.0092 273 LYS D O   
2695 C CB  A LYS D 50 ? 0.1504 0.1494 0.2117 -0.0218 0.0030  -0.0227 273 LYS D CB  
2696 C CB  B LYS D 50 ? 0.1467 0.1595 0.2119 -0.0028 0.0074  -0.0082 273 LYS D CB  
2697 C CG  A LYS D 50 ? 0.1371 0.1295 0.2002 -0.0286 -0.0161 -0.0373 273 LYS D CG  
2698 C CG  B LYS D 50 ? 0.1656 0.1797 0.2010 -0.0238 0.0083  0.0055  273 LYS D CG  
2699 C CD  A LYS D 50 ? 0.1904 0.1876 0.2424 -0.0098 -0.0170 -0.0498 273 LYS D CD  
2700 C CD  B LYS D 50 ? 0.1695 0.1896 0.2387 -0.0352 0.0146  -0.0095 273 LYS D CD  
2701 C CE  A LYS D 50 ? 0.2433 0.1991 0.2974 0.0127  -0.0022 -0.0427 273 LYS D CE  
2702 C CE  B LYS D 50 ? 0.2344 0.2014 0.2585 -0.0370 -0.0076 0.0010  273 LYS D CE  
2703 N NZ  A LYS D 50 ? 0.2727 0.2593 0.3378 -0.0063 -0.0073 -0.0131 273 LYS D NZ  
2704 N NZ  B LYS D 50 ? 0.2352 0.2547 0.3004 -0.0557 -0.0381 -0.0041 273 LYS D NZ  
2705 N N   . LEU D 51 ? 0.1081 0.1632 0.1971 -0.0174 0.0197  -0.0042 274 LEU D N   
2706 C CA  . LEU D 51 ? 0.1359 0.1744 0.1939 -0.0054 0.0266  0.0040  274 LEU D CA  
2707 C C   . LEU D 51 ? 0.1158 0.1743 0.1957 0.0080  0.0224  -0.0032 274 LEU D C   
2708 O O   . LEU D 51 ? 0.1318 0.1844 0.2003 0.0105  0.0106  0.0108  274 LEU D O   
2709 C CB  . LEU D 51 ? 0.1420 0.1824 0.2154 0.0031  0.0412  0.0157  274 LEU D CB  
2710 C CG  . LEU D 51 ? 0.1363 0.1716 0.2484 -0.0408 0.0292  0.0046  274 LEU D CG  
2711 C CD1 . LEU D 51 ? 0.1820 0.1770 0.3386 -0.0503 0.0417  0.0364  274 LEU D CD1 
2712 C CD2 . LEU D 51 ? 0.2059 0.1908 0.2953 -0.0077 -0.0095 -0.0033 274 LEU D CD2 
2713 N N   . TYR D 52 ? 0.1361 0.1632 0.1919 0.0154  0.0189  -0.0073 275 TYR D N   
2714 C CA  . TYR D 52 ? 0.1326 0.1652 0.1831 0.0106  0.0126  -0.0114 275 TYR D CA  
2715 C C   . TYR D 52 ? 0.1664 0.1648 0.2025 0.0216  0.0268  0.0019  275 TYR D C   
2716 O O   . TYR D 52 ? 0.1606 0.1799 0.1930 0.0305  0.0432  0.0059  275 TYR D O   
2717 C CB  . TYR D 52 ? 0.1449 0.1602 0.1932 0.0186  0.0319  0.0008  275 TYR D CB  
2718 C CG  . TYR D 52 ? 0.1247 0.1552 0.2073 0.0068  0.0277  0.0001  275 TYR D CG  
2719 C CD1 . TYR D 52 ? 0.1658 0.1803 0.2188 0.0362  0.0086  -0.0097 275 TYR D CD1 
2720 C CD2 . TYR D 52 ? 0.1403 0.1837 0.2271 -0.0063 0.0079  -0.0115 275 TYR D CD2 
2721 C CE1 . TYR D 52 ? 0.1849 0.1994 0.1995 0.0265  0.0125  -0.0168 275 TYR D CE1 
2722 C CE2 . TYR D 52 ? 0.1816 0.1765 0.2182 0.0000  0.0101  0.0112  275 TYR D CE2 
2723 C CZ  . TYR D 52 ? 0.1815 0.1598 0.2019 0.0107  0.0155  -0.0047 275 TYR D CZ  
2724 O OH  . TYR D 52 ? 0.2306 0.1794 0.2143 -0.0030 0.0132  -0.0281 275 TYR D OH  
2725 N N   . MET D 53 ? 0.1938 0.2351 0.2004 0.0257  0.0376  0.0134  276 MET D N   
2726 C CA  . MET D 53 ? 0.2360 0.2488 0.2442 0.0246  0.0641  0.0153  276 MET D CA  
2727 C C   . MET D 53 ? 0.1511 0.2403 0.2031 0.0726  0.0911  0.0096  276 MET D C   
2728 O O   . MET D 53 ? 0.3172 0.3279 0.2934 0.0205  -0.0070 0.0599  276 MET D O   
2729 C CB  . MET D 53 ? 0.2426 0.2913 0.2496 -0.0126 0.0557  0.0220  276 MET D CB  
2730 C CG  . MET D 53 ? 0.3500 0.3275 0.3529 -0.0177 0.0398  0.0070  276 MET D CG  
2731 S SD  . MET D 53 ? 0.4305 0.3966 0.4476 -0.0347 0.0280  0.0163  276 MET D SD  
2732 C CE  . MET D 53 ? 0.3573 0.3804 0.4439 -0.0235 0.0217  -0.0103 276 MET D CE  
2733 N N   . VAL D 54 ? 0.2087 0.2232 0.2214 0.0575  0.0747  0.0184  277 VAL D N   
2734 C CA  . VAL D 54 ? 0.2246 0.2296 0.2121 0.0649  0.0689  0.0024  277 VAL D CA  
2735 C C   . VAL D 54 ? 0.2135 0.2566 0.2255 0.0468  0.0591  0.0327  277 VAL D C   
2736 O O   . VAL D 54 ? 0.2142 0.2328 0.2342 0.0803  0.0814  0.0251  277 VAL D O   
2737 C CB  . VAL D 54 ? 0.2095 0.2159 0.2281 0.0684  0.0767  0.0234  277 VAL D CB  
2738 C CG1 . VAL D 54 ? 0.2801 0.2335 0.2566 0.0461  0.0415  -0.0023 277 VAL D CG1 
2739 C CG2 . VAL D 54 ? 0.2269 0.2468 0.2443 0.0419  0.0734  0.0261  277 VAL D CG2 
2740 N N   . PRO D 55 ? 0.2251 0.2315 0.2384 0.0513  0.0885  0.0278  278 PRO D N   
2741 C CA  . PRO D 55 ? 0.2538 0.2519 0.2655 0.0243  0.0627  0.0316  278 PRO D CA  
2742 C C   . PRO D 55 ? 0.2482 0.2431 0.2627 0.0163  0.0699  0.0081  278 PRO D C   
2743 O O   . PRO D 55 ? 0.3085 0.2552 0.2766 0.0106  0.0550  0.0281  278 PRO D O   
2744 C CB  . PRO D 55 ? 0.2824 0.2998 0.2956 0.0131  0.0640  0.0266  278 PRO D CB  
2745 C CG  . PRO D 55 ? 0.2915 0.2934 0.3300 0.0319  0.0608  0.0273  278 PRO D CG  
2746 C CD  . PRO D 55 ? 0.2270 0.2723 0.2815 0.0292  0.0476  0.0448  278 PRO D CD  
2747 N N   A TYR D 56 ? 0.2506 0.2349 0.2675 0.0113  0.0634  0.0144  279 TYR D N   
2748 N N   B TYR D 56 ? 0.2420 0.2306 0.2571 0.0166  0.0738  0.0128  279 TYR D N   
2749 C CA  A TYR D 56 ? 0.2425 0.2589 0.2627 0.0060  0.0589  0.0156  279 TYR D CA  
2750 C CA  B TYR D 56 ? 0.2337 0.2489 0.2508 0.0113  0.0717  0.0142  279 TYR D CA  
2751 C C   A TYR D 56 ? 0.2484 0.2364 0.2717 0.0100  0.0576  0.0203  279 TYR D C   
2752 C C   B TYR D 56 ? 0.2449 0.2334 0.2607 0.0071  0.0677  0.0227  279 TYR D C   
2753 O O   A TYR D 56 ? 0.2283 0.2079 0.2626 0.0288  0.0542  0.0094  279 TYR D O   
2754 O O   B TYR D 56 ? 0.2239 0.1955 0.2493 0.0268  0.0874  0.0121  279 TYR D O   
2755 C CB  A TYR D 56 ? 0.2705 0.2868 0.2681 0.0042  0.0499  0.0107  279 TYR D CB  
2756 C CB  B TYR D 56 ? 0.2351 0.2635 0.2655 0.0183  0.0575  0.0120  279 TYR D CB  
2757 C CG  A TYR D 56 ? 0.3008 0.3193 0.3199 -0.0068 0.0227  0.0125  279 TYR D CG  
2758 C CG  B TYR D 56 ? 0.2511 0.2741 0.2807 0.0203  0.0444  -0.0012 279 TYR D CG  
2759 C CD1 A TYR D 56 ? 0.3227 0.3313 0.3422 -0.0092 0.0176  0.0186  279 TYR D CD1 
2760 C CD1 B TYR D 56 ? 0.2514 0.2782 0.2807 0.0083  0.0236  0.0022  279 TYR D CD1 
2761 C CD2 A TYR D 56 ? 0.3041 0.3181 0.3087 0.0002  0.0158  0.0119  279 TYR D CD2 
2762 C CD2 B TYR D 56 ? 0.2830 0.2836 0.2687 0.0137  0.0216  -0.0066 279 TYR D CD2 
2763 C CE1 A TYR D 56 ? 0.2987 0.3213 0.3089 -0.0036 0.0130  0.0008  279 TYR D CE1 
2764 C CE1 B TYR D 56 ? 0.3265 0.3153 0.2972 0.0153  0.0184  -0.0217 279 TYR D CE1 
2765 C CE2 A TYR D 56 ? 0.2640 0.3074 0.3181 -0.0071 0.0101  -0.0047 279 TYR D CE2 
2766 C CE2 B TYR D 56 ? 0.3126 0.3051 0.3015 0.0222  0.0185  -0.0301 279 TYR D CE2 
2767 C CZ  A TYR D 56 ? 0.2679 0.2982 0.3043 0.0065  0.0161  0.0037  279 TYR D CZ  
2768 C CZ  B TYR D 56 ? 0.2844 0.2972 0.2961 0.0139  0.0149  -0.0023 279 TYR D CZ  
2769 O OH  A TYR D 56 ? 0.3114 0.3058 0.3590 -0.0108 0.0012  0.0097  279 TYR D OH  
2770 O OH  B TYR D 56 ? 0.3238 0.3411 0.3098 0.0145  0.0126  -0.0110 279 TYR D OH  
2771 N N   . VAL D 57 ? 0.2464 0.2188 0.2651 0.0204  0.0640  0.0152  280 VAL D N   
2772 C CA  . VAL D 57 ? 0.2626 0.2590 0.2824 0.0134  0.0473  0.0254  280 VAL D CA  
2773 C C   . VAL D 57 ? 0.2914 0.2668 0.3091 -0.0024 0.0334  0.0192  280 VAL D C   
2774 O O   . VAL D 57 ? 0.3166 0.2675 0.3028 -0.0031 0.0356  0.0348  280 VAL D O   
2775 C CB  . VAL D 57 ? 0.2595 0.2834 0.2607 0.0365  0.0420  0.0157  280 VAL D CB  
2776 C CG1 . VAL D 57 ? 0.2422 0.2712 0.2945 0.0577  0.0063  -0.0464 280 VAL D CG1 
2777 C CG2 . VAL D 57 ? 0.2585 0.2692 0.2398 0.0348  0.0224  0.0097  280 VAL D CG2 
2778 N N   . ASP D 58 ? 0.3238 0.2729 0.3288 -0.0088 0.0231  0.0251  281 ASP D N   
2779 C CA  . ASP D 58 ? 0.3537 0.2935 0.3459 -0.0065 0.0190  0.0050  281 ASP D CA  
2780 C C   . ASP D 58 ? 0.3564 0.2633 0.3262 -0.0031 0.0211  0.0000  281 ASP D C   
2781 O O   . ASP D 58 ? 0.3306 0.1876 0.3025 0.0262  0.0329  0.0024  281 ASP D O   
2782 C CB  . ASP D 58 ? 0.3761 0.3379 0.3800 -0.0042 0.0147  0.0045  281 ASP D CB  
2783 C CG  . ASP D 58 ? 0.4302 0.3859 0.4054 0.0035  0.0078  0.0141  281 ASP D CG  
2784 O OD1 . ASP D 58 ? 0.4698 0.4505 0.4883 0.0078  -0.0303 -0.0221 281 ASP D OD1 
2785 O OD2 . ASP D 58 ? 0.4752 0.4999 0.5083 0.0162  0.0146  0.0015  281 ASP D OD2 
2786 N N   . LEU D 59 ? 0.3835 0.2542 0.3363 0.0146  0.0170  -0.0284 282 LEU D N   
2787 C CA  . LEU D 59 ? 0.3799 0.2178 0.3202 0.0018  0.0100  -0.0394 282 LEU D CA  
2788 C C   . LEU D 59 ? 0.3634 0.1946 0.3138 0.0029  0.0094  -0.0385 282 LEU D C   
2789 O O   . LEU D 59 ? 0.3651 0.1664 0.3230 -0.0113 0.0068  -0.0589 282 LEU D O   
2790 C CB  . LEU D 59 ? 0.4047 0.2429 0.3118 0.0062  0.0073  -0.0511 282 LEU D CB  
2791 C CG  . LEU D 59 ? 0.4265 0.3353 0.3549 0.0102  -0.0086 -0.0219 282 LEU D CG  
2792 C CD1 . LEU D 59 ? 0.4383 0.3847 0.4085 0.0056  -0.0006 -0.0348 282 LEU D CD1 
2793 C CD2 . LEU D 59 ? 0.4438 0.3896 0.4162 0.0249  -0.0032 -0.0339 282 LEU D CD2 
2794 N N   . GLU D 60 ? 0.3482 0.1888 0.3060 0.0139  0.0180  -0.0260 283 GLU D N   
2795 C CA  . GLU D 60 ? 0.3613 0.2566 0.3409 0.0275  0.0150  -0.0167 283 GLU D CA  
2796 C C   . GLU D 60 ? 0.3179 0.1840 0.2973 0.0087  0.0223  -0.0154 283 GLU D C   
2797 O O   . GLU D 60 ? 0.3268 0.1679 0.3173 0.0223  0.0099  0.0020  283 GLU D O   
2798 C CB  . GLU D 60 ? 0.3545 0.2593 0.3275 0.0422  0.0190  -0.0118 283 GLU D CB  
2799 C CG  . GLU D 60 ? 0.4048 0.3461 0.3889 0.0204  0.0092  -0.0059 283 GLU D CG  
2800 C CD  . GLU D 60 ? 0.3765 0.3439 0.3510 0.0385  0.0023  -0.0297 283 GLU D CD  
2801 O OE1 . GLU D 60 ? 0.5266 0.5339 0.5277 -0.0008 -0.0025 0.0012  283 GLU D OE1 
2802 O OE2 . GLU D 60 ? 0.4839 0.4805 0.4941 0.0402  0.0040  -0.0062 283 GLU D OE2 
2803 N N   . HIS D 61 ? 0.2612 0.1473 0.2919 0.0190  0.0240  -0.0131 284 HIS D N   
2804 C CA  . HIS D 61 ? 0.2126 0.1436 0.2615 -0.0007 0.0346  -0.0137 284 HIS D CA  
2805 C C   . HIS D 61 ? 0.1942 0.1715 0.2445 -0.0078 0.0295  -0.0140 284 HIS D C   
2806 O O   . HIS D 61 ? 0.2200 0.1922 0.2395 0.0020  0.0245  -0.0203 284 HIS D O   
2807 C CB  . HIS D 61 ? 0.2083 0.1855 0.2865 0.0007  0.0300  -0.0034 284 HIS D CB  
2808 C CG  . HIS D 61 ? 0.2286 0.1693 0.3041 0.0277  0.0245  0.0138  284 HIS D CG  
2809 N ND1 . HIS D 61 ? 0.2638 0.2605 0.3362 0.0021  0.0276  0.0118  284 HIS D ND1 
2810 C CD2 . HIS D 61 ? 0.2017 0.1740 0.2974 0.0184  0.0641  0.0031  284 HIS D CD2 
2811 C CE1 . HIS D 61 ? 0.2119 0.2549 0.3218 0.0164  0.0260  0.0232  284 HIS D CE1 
2812 N NE2 . HIS D 61 ? 0.2801 0.2715 0.3748 0.0192  0.0225  -0.0161 284 HIS D NE2 
2813 N N   . GLN D 62 ? 0.2362 0.1700 0.2401 -0.0121 0.0258  -0.0114 285 GLN D N   
2814 C CA  . GLN D 62 ? 0.2276 0.1805 0.2373 -0.0226 0.0134  -0.0108 285 GLN D CA  
2815 C C   . GLN D 62 ? 0.2387 0.1863 0.2524 -0.0242 0.0109  -0.0095 285 GLN D C   
2816 O O   . GLN D 62 ? 0.2837 0.1849 0.3098 -0.0032 0.0159  0.0121  285 GLN D O   
2817 C CB  . GLN D 62 ? 0.2662 0.2088 0.2591 -0.0098 -0.0043 -0.0215 285 GLN D CB  
2818 C CG  . GLN D 62 ? 0.3194 0.2648 0.3103 -0.0204 -0.0026 -0.0052 285 GLN D CG  
2819 C CD  . GLN D 62 ? 0.3528 0.2303 0.3279 -0.0372 -0.0163 -0.0222 285 GLN D CD  
2820 O OE1 . GLN D 62 ? 0.3470 0.2928 0.3842 -0.0329 -0.0407 -0.0035 285 GLN D OE1 
2821 N NE2 . GLN D 62 ? 0.3903 0.2602 0.3870 -0.0295 -0.0056 -0.0183 285 GLN D NE2 
2822 N N   . GLY D 63 ? 0.2376 0.1790 0.2127 -0.0337 0.0061  -0.0060 286 GLY D N   
2823 C CA  . GLY D 63 ? 0.2187 0.1786 0.2240 -0.0284 0.0122  0.0044  286 GLY D CA  
2824 C C   . GLY D 63 ? 0.1924 0.1749 0.2252 -0.0417 -0.0102 -0.0076 286 GLY D C   
2825 O O   . GLY D 63 ? 0.2102 0.1762 0.2229 -0.0444 -0.0098 0.0153  286 GLY D O   
2826 N N   . THR D 64 ? 0.1931 0.1726 0.2099 -0.0512 -0.0292 -0.0042 287 THR D N   
2827 C CA  . THR D 64 ? 0.1886 0.2253 0.2150 -0.0363 -0.0181 -0.0036 287 THR D CA  
2828 C C   . THR D 64 ? 0.1630 0.2070 0.2062 -0.0294 -0.0230 0.0008  287 THR D C   
2829 O O   . THR D 64 ? 0.1881 0.2069 0.2520 -0.0578 -0.0520 0.0080  287 THR D O   
2830 C CB  . THR D 64 ? 0.1835 0.2585 0.2250 -0.0406 -0.0270 0.0005  287 THR D CB  
2831 O OG1 . THR D 64 ? 0.1996 0.3145 0.2609 -0.0718 -0.0464 0.0023  287 THR D OG1 
2832 C CG2 . THR D 64 ? 0.2114 0.2511 0.2541 -0.0438 -0.0235 -0.0261 287 THR D CG2 
2833 N N   . TYR D 65 ? 0.1407 0.2040 0.1843 -0.0455 -0.0119 -0.0039 288 TYR D N   
2834 C CA  . TYR D 65 ? 0.0967 0.1992 0.1909 -0.0417 -0.0055 -0.0103 288 TYR D CA  
2835 C C   . TYR D 65 ? 0.0964 0.1923 0.1907 -0.0303 -0.0049 -0.0033 288 TYR D C   
2836 O O   . TYR D 65 ? 0.1261 0.2226 0.1854 -0.0163 -0.0106 -0.0055 288 TYR D O   
2837 C CB  . TYR D 65 ? 0.1216 0.1993 0.1996 -0.0178 0.0097  -0.0047 288 TYR D CB  
2838 C CG  . TYR D 65 ? 0.1243 0.1599 0.1907 -0.0184 0.0038  0.0000  288 TYR D CG  
2839 C CD1 . TYR D 65 ? 0.1467 0.1881 0.1883 -0.0095 0.0015  0.0296  288 TYR D CD1 
2840 C CD2 . TYR D 65 ? 0.1516 0.1810 0.1761 -0.0292 0.0157  0.0095  288 TYR D CD2 
2841 C CE1 . TYR D 65 ? 0.1470 0.2168 0.2023 -0.0043 0.0015  0.0114  288 TYR D CE1 
2842 C CE2 . TYR D 65 ? 0.1478 0.1907 0.1911 -0.0246 0.0134  0.0157  288 TYR D CE2 
2843 C CZ  . TYR D 65 ? 0.1430 0.1846 0.1973 0.0181  0.0365  0.0017  288 TYR D CZ  
2844 O OH  . TYR D 65 ? 0.1856 0.2555 0.2166 0.0461  0.0291  0.0275  288 TYR D OH  
2845 N N   . TRP D 66 ? 0.1190 0.1907 0.1807 -0.0300 -0.0134 -0.0029 289 TRP D N   
2846 C CA  . TRP D 66 ? 0.1096 0.1994 0.1890 -0.0228 0.0105  -0.0048 289 TRP D CA  
2847 C C   . TRP D 66 ? 0.1023 0.1515 0.1864 -0.0159 0.0047  0.0109  289 TRP D C   
2848 O O   . TRP D 66 ? 0.1189 0.1560 0.1878 -0.0038 -0.0076 -0.0026 289 TRP D O   
2849 C CB  . TRP D 66 ? 0.1278 0.2014 0.2155 -0.0327 0.0012  0.0128  289 TRP D CB  
2850 C CG  . TRP D 66 ? 0.1356 0.2355 0.2772 -0.0394 0.0175  -0.0135 289 TRP D CG  
2851 C CD1 . TRP D 66 ? 0.2107 0.2331 0.3014 -0.0363 0.0396  0.0021  289 TRP D CD1 
2852 C CD2 . TRP D 66 ? 0.1475 0.2495 0.3215 -0.0355 0.0092  0.0119  289 TRP D CD2 
2853 N NE1 . TRP D 66 ? 0.2195 0.3141 0.3762 -0.0239 0.0131  0.0030  289 TRP D NE1 
2854 C CE2 . TRP D 66 ? 0.2329 0.2770 0.3321 0.0181  0.0186  0.0416  289 TRP D CE2 
2855 C CE3 . TRP D 66 ? 0.2022 0.3043 0.2916 -0.0033 -0.0057 0.0249  289 TRP D CE3 
2856 C CZ2 . TRP D 66 ? 0.2264 0.3403 0.3369 -0.0425 0.0284  0.0456  289 TRP D CZ2 
2857 C CZ3 . TRP D 66 ? 0.2220 0.3031 0.2978 -0.0338 0.0037  0.0353  289 TRP D CZ3 
2858 C CH2 . TRP D 66 ? 0.2047 0.3015 0.3089 -0.0204 -0.0007 0.0552  289 TRP D CH2 
2859 N N   . CYS D 67 ? 0.0993 0.1533 0.1795 -0.0138 0.0211  -0.0006 290 CYS D N   
2860 C CA  . CYS D 67 ? 0.0957 0.1780 0.1665 -0.0121 0.0034  -0.0158 290 CYS D CA  
2861 C C   . CYS D 67 ? 0.0782 0.1625 0.1650 -0.0106 0.0216  0.0033  290 CYS D C   
2862 O O   . CYS D 67 ? 0.1100 0.1787 0.1653 0.0159  0.0152  0.0014  290 CYS D O   
2863 C CB  . CYS D 67 ? 0.1088 0.1431 0.1981 -0.0139 0.0199  -0.0007 290 CYS D CB  
2864 S SG  . CYS D 67 ? 0.1076 0.1588 0.1866 -0.0106 -0.0016 -0.0027 290 CYS D SG  
2865 N N   . HIS D 68 ? 0.0995 0.1566 0.1711 -0.0192 0.0019  0.0083  291 HIS D N   
2866 C CA  . HIS D 68 ? 0.1093 0.1602 0.1603 -0.0081 0.0149  0.0111  291 HIS D CA  
2867 C C   . HIS D 68 ? 0.0835 0.1526 0.1678 0.0002  0.0110  0.0045  291 HIS D C   
2868 O O   . HIS D 68 ? 0.0901 0.1854 0.1929 -0.0077 0.0163  -0.0367 291 HIS D O   
2869 C CB  . HIS D 68 ? 0.1181 0.1521 0.1828 -0.0012 0.0091  0.0164  291 HIS D CB  
2870 C CG  . HIS D 68 ? 0.1211 0.1627 0.1744 -0.0140 0.0162  0.0020  291 HIS D CG  
2871 N ND1 . HIS D 68 ? 0.1458 0.2002 0.1964 -0.0142 0.0245  0.0143  291 HIS D ND1 
2872 C CD2 . HIS D 68 ? 0.1603 0.1574 0.1759 -0.0075 0.0034  0.0098  291 HIS D CD2 
2873 C CE1 . HIS D 68 ? 0.1832 0.1985 0.1744 -0.0036 0.0280  -0.0002 291 HIS D CE1 
2874 N NE2 . HIS D 68 ? 0.1669 0.1737 0.1704 -0.0216 0.0265  0.0099  291 HIS D NE2 
2875 N N   . VAL D 69 ? 0.1104 0.1455 0.1636 -0.0020 0.0132  0.0011  292 VAL D N   
2876 C CA  . VAL D 69 ? 0.1097 0.1421 0.1682 0.0008  0.0132  0.0097  292 VAL D CA  
2877 C C   . VAL D 69 ? 0.1273 0.1454 0.1650 -0.0050 0.0107  0.0054  292 VAL D C   
2878 O O   . VAL D 69 ? 0.1053 0.1830 0.1789 -0.0058 0.0040  0.0068  292 VAL D O   
2879 C CB  . VAL D 69 ? 0.1284 0.1583 0.1822 0.0021  0.0039  0.0054  292 VAL D CB  
2880 C CG1 . VAL D 69 ? 0.1841 0.1841 0.2281 -0.0186 -0.0126 0.0165  292 VAL D CG1 
2881 C CG2 . VAL D 69 ? 0.1482 0.1701 0.1946 0.0013  0.0197  0.0282  292 VAL D CG2 
2882 N N   . TYR D 70 ? 0.1189 0.1465 0.1613 0.0077  0.0067  -0.0031 293 TYR D N   
2883 C CA  . TYR D 70 ? 0.1376 0.1540 0.1485 -0.0081 0.0158  0.0068  293 TYR D CA  
2884 C C   . TYR D 70 ? 0.1225 0.1623 0.1567 0.0011  0.0157  -0.0028 293 TYR D C   
2885 O O   . TYR D 70 ? 0.1365 0.1875 0.1780 -0.0073 0.0162  -0.0063 293 TYR D O   
2886 C CB  . TYR D 70 ? 0.1370 0.1684 0.1831 -0.0010 0.0105  -0.0019 293 TYR D CB  
2887 C CG  . TYR D 70 ? 0.1435 0.1547 0.1746 -0.0050 -0.0086 0.0197  293 TYR D CG  
2888 C CD1 . TYR D 70 ? 0.1403 0.1757 0.1934 0.0171  -0.0037 0.0145  293 TYR D CD1 
2889 C CD2 . TYR D 70 ? 0.1262 0.1667 0.1866 0.0057  0.0109  0.0165  293 TYR D CD2 
2890 C CE1 . TYR D 70 ? 0.1558 0.2037 0.2092 0.0417  -0.0037 0.0058  293 TYR D CE1 
2891 C CE2 . TYR D 70 ? 0.1442 0.1631 0.1990 -0.0059 -0.0088 -0.0051 293 TYR D CE2 
2892 C CZ  . TYR D 70 ? 0.1597 0.1739 0.1919 0.0054  0.0141  0.0061  293 TYR D CZ  
2893 O OH  . TYR D 70 ? 0.1572 0.2119 0.2007 0.0445  -0.0065 -0.0124 293 TYR D OH  
2894 N N   . ASN D 71 ? 0.1619 0.1755 0.1592 -0.0022 0.0064  -0.0021 294 ASN D N   
2895 C CA  . ASN D 71 ? 0.1627 0.1825 0.1675 -0.0006 0.0002  -0.0099 294 ASN D CA  
2896 C C   . ASN D 71 ? 0.1649 0.1904 0.1608 0.0039  -0.0106 -0.0071 294 ASN D C   
2897 O O   . ASN D 71 ? 0.1948 0.1806 0.1788 -0.0037 -0.0048 0.0002  294 ASN D O   
2898 C CB  . ASN D 71 ? 0.1390 0.1860 0.1814 0.0049  0.0231  -0.0156 294 ASN D CB  
2899 C CG  . ASN D 71 ? 0.1882 0.1923 0.1590 0.0037  0.0028  0.0113  294 ASN D CG  
2900 O OD1 . ASN D 71 ? 0.1511 0.2049 0.1955 0.0066  0.0096  0.0011  294 ASN D OD1 
2901 N ND2 . ASN D 71 ? 0.2066 0.1787 0.1995 0.0129  -0.0114 -0.0181 294 ASN D ND2 
2902 N N   . ASP D 72 ? 0.1891 0.1891 0.1599 0.0075  -0.0117 0.0048  295 ASP D N   
2903 C CA  . ASP D 72 ? 0.1821 0.2035 0.1613 0.0010  -0.0099 -0.0105 295 ASP D CA  
2904 C C   . ASP D 72 ? 0.1988 0.1988 0.1691 0.0137  0.0000  -0.0040 295 ASP D C   
2905 O O   . ASP D 72 ? 0.2207 0.2142 0.1857 0.0027  -0.0073 0.0036  295 ASP D O   
2906 C CB  . ASP D 72 ? 0.2266 0.2285 0.1836 -0.0081 -0.0146 -0.0057 295 ASP D CB  
2907 C CG  . ASP D 72 ? 0.2172 0.2124 0.2176 -0.0180 -0.0307 -0.0195 295 ASP D CG  
2908 O OD1 . ASP D 72 ? 0.2857 0.2362 0.2461 -0.0060 -0.0371 -0.0309 295 ASP D OD1 
2909 O OD2 . ASP D 72 ? 0.2433 0.2780 0.2525 -0.0122 -0.0560 -0.0175 295 ASP D OD2 
2910 N N   A ARG D 73 ? 0.2079 0.2017 0.1948 0.0189  0.0115  -0.0022 296 ARG D N   
2911 N N   B ARG D 73 ? 0.1875 0.2086 0.1836 0.0159  0.0150  -0.0085 296 ARG D N   
2912 C CA  A ARG D 73 ? 0.2123 0.1939 0.2016 0.0121  0.0143  -0.0047 296 ARG D CA  
2913 C CA  B ARG D 73 ? 0.1827 0.2099 0.1696 0.0040  0.0147  -0.0107 296 ARG D CA  
2914 C C   A ARG D 73 ? 0.1969 0.2017 0.1838 0.0171  0.0307  -0.0003 296 ARG D C   
2915 C C   B ARG D 73 ? 0.1626 0.2225 0.1646 0.0044  0.0371  -0.0065 296 ARG D C   
2916 O O   A ARG D 73 ? 0.2113 0.2061 0.2219 0.0214  0.0263  0.0020  296 ARG D O   
2917 O O   B ARG D 73 ? 0.1930 0.2410 0.1817 -0.0098 0.0320  0.0038  296 ARG D O   
2918 C CB  A ARG D 73 ? 0.2369 0.1894 0.2154 0.0294  0.0110  0.0007  296 ARG D CB  
2919 C CB  B ARG D 73 ? 0.1766 0.2153 0.1924 0.0038  0.0315  -0.0201 296 ARG D CB  
2920 C CG  A ARG D 73 ? 0.2448 0.2220 0.2638 -0.0017 0.0108  -0.0117 296 ARG D CG  
2921 C CG  B ARG D 73 ? 0.2034 0.2138 0.2204 -0.0073 0.0369  -0.0266 296 ARG D CG  
2922 C CD  A ARG D 73 ? 0.3160 0.2815 0.2983 0.0138  -0.0019 -0.0131 296 ARG D CD  
2923 C CD  B ARG D 73 ? 0.2212 0.2052 0.2564 -0.0147 0.0429  -0.0058 296 ARG D CD  
2924 N NE  A ARG D 73 ? 0.3328 0.3394 0.3552 0.0021  0.0165  0.0046  296 ARG D NE  
2925 N NE  B ARG D 73 ? 0.2405 0.2454 0.2601 0.0214  0.0444  -0.0249 296 ARG D NE  
2926 C CZ  A ARG D 73 ? 0.3563 0.3904 0.3689 0.0128  -0.0040 -0.0007 296 ARG D CZ  
2927 C CZ  B ARG D 73 ? 0.2485 0.2240 0.2092 0.0509  0.0323  0.0066  296 ARG D CZ  
2928 N NH1 A ARG D 73 ? 0.3572 0.3917 0.3968 0.0122  -0.0114 0.0111  296 ARG D NH1 
2929 N NH1 B ARG D 73 ? 0.2731 0.2382 0.1824 0.0448  0.0322  -0.0052 296 ARG D NH1 
2930 N NH2 A ARG D 73 ? 0.3736 0.3730 0.3731 0.0236  0.0083  0.0060  296 ARG D NH2 
2931 N NH2 B ARG D 73 ? 0.2697 0.2698 0.2819 0.0700  0.0403  0.0135  296 ARG D NH2 
2932 N N   . ASP D 74 ? 0.1735 0.2399 0.1628 0.0086  0.0267  0.0008  297 ASP D N   
2933 C CA  . ASP D 74 ? 0.1991 0.2812 0.1961 0.0137  0.0203  -0.0138 297 ASP D CA  
2934 C C   . ASP D 74 ? 0.1569 0.2347 0.1650 0.0197  0.0244  0.0127  297 ASP D C   
2935 O O   . ASP D 74 ? 0.1369 0.2494 0.1810 0.0123  0.0293  0.0001  297 ASP D O   
2936 C CB  . ASP D 74 ? 0.2114 0.2977 0.2558 0.0287  0.0015  -0.0335 297 ASP D CB  
2937 C CG  . ASP D 74 ? 0.2743 0.3382 0.3111 0.0116  0.0095  -0.0133 297 ASP D CG  
2938 O OD1 . ASP D 74 ? 0.2868 0.3863 0.3174 0.0461  0.0499  -0.0360 297 ASP D OD1 
2939 O OD2 . ASP D 74 ? 0.3503 0.3968 0.3873 0.0222  0.0114  -0.0446 297 ASP D OD2 
2940 N N   . SER D 75 ? 0.1548 0.2528 0.1729 0.0113  0.0212  0.0015  298 SER D N   
2941 C CA  . SER D 75 ? 0.1410 0.2230 0.1765 0.0234  0.0159  0.0054  298 SER D CA  
2942 C C   . SER D 75 ? 0.1322 0.2163 0.1637 0.0179  0.0377  0.0090  298 SER D C   
2943 O O   . SER D 75 ? 0.1468 0.2456 0.1911 0.0153  0.0375  0.0089  298 SER D O   
2944 C CB  . SER D 75 ? 0.1563 0.2106 0.2081 0.0099  0.0283  0.0052  298 SER D CB  
2945 O OG  . SER D 75 ? 0.1665 0.2654 0.2640 -0.0110 0.0029  0.0297  298 SER D OG  
2946 N N   . GLN D 76 ? 0.1379 0.2127 0.1660 -0.0008 0.0264  0.0183  299 GLN D N   
2947 C CA  . GLN D 76 ? 0.1210 0.2120 0.1848 0.0068  0.0233  0.0010  299 GLN D CA  
2948 C C   . GLN D 76 ? 0.1135 0.2144 0.1782 -0.0010 0.0049  0.0147  299 GLN D C   
2949 O O   . GLN D 76 ? 0.1034 0.2540 0.1867 0.0000  0.0144  -0.0019 299 GLN D O   
2950 C CB  . GLN D 76 ? 0.1492 0.2022 0.2213 0.0247  0.0106  -0.0031 299 GLN D CB  
2951 C CG  . GLN D 76 ? 0.2048 0.2532 0.2102 0.0255  0.0153  -0.0020 299 GLN D CG  
2952 C CD  . GLN D 76 ? 0.1899 0.2416 0.2373 0.0268  0.0257  0.0000  299 GLN D CD  
2953 O OE1 . GLN D 76 ? 0.2131 0.2281 0.2360 0.0279  0.0288  0.0176  299 GLN D OE1 
2954 N NE2 . GLN D 76 ? 0.2432 0.2853 0.3345 0.0113  0.0689  0.0071  299 GLN D NE2 
2955 N N   . ASP D 77 ? 0.1231 0.2351 0.1939 -0.0084 0.0174  0.0055  300 ASP D N   
2956 C CA  . ASP D 77 ? 0.1181 0.2371 0.2045 -0.0104 -0.0049 0.0016  300 ASP D CA  
2957 C C   . ASP D 77 ? 0.1183 0.2412 0.2049 -0.0108 -0.0076 -0.0079 300 ASP D C   
2958 O O   . ASP D 77 ? 0.1102 0.2478 0.2064 0.0023  0.0081  0.0006  300 ASP D O   
2959 C CB  . ASP D 77 ? 0.1604 0.2379 0.2250 -0.0182 -0.0067 0.0037  300 ASP D CB  
2960 C CG  . ASP D 77 ? 0.2203 0.2347 0.3072 -0.0406 -0.0238 0.0018  300 ASP D CG  
2961 O OD1 . ASP D 77 ? 0.2850 0.3071 0.3674 -0.0014 -0.0872 0.0262  300 ASP D OD1 
2962 O OD2 . ASP D 77 ? 0.2906 0.2449 0.3509 -0.0875 -0.0129 0.0141  300 ASP D OD2 
2963 N N   . SER D 78 ? 0.1056 0.2157 0.1839 0.0091  0.0042  -0.0079 301 SER D N   
2964 C CA  . SER D 78 ? 0.1074 0.2177 0.1924 0.0008  0.0065  -0.0048 301 SER D CA  
2965 C C   . SER D 78 ? 0.1316 0.2322 0.1937 -0.0030 0.0118  -0.0011 301 SER D C   
2966 O O   . SER D 78 ? 0.1016 0.2577 0.2068 -0.0219 0.0096  -0.0010 301 SER D O   
2967 C CB  . SER D 78 ? 0.1082 0.1862 0.2049 0.0136  0.0463  0.0047  301 SER D CB  
2968 O OG  . SER D 78 ? 0.1185 0.1839 0.1958 0.0052  0.0122  0.0025  301 SER D OG  
2969 N N   . LYS D 79 ? 0.1352 0.2361 0.1943 0.0156  0.0007  -0.0126 302 LYS D N   
2970 C CA  . LYS D 79 ? 0.1530 0.2691 0.2067 0.0092  -0.0115 -0.0150 302 LYS D CA  
2971 C C   . LYS D 79 ? 0.1245 0.2589 0.1908 -0.0008 -0.0140 0.0049  302 LYS D C   
2972 O O   . LYS D 79 ? 0.1038 0.2437 0.1866 -0.0050 0.0042  -0.0080 302 LYS D O   
2973 C CB  . LYS D 79 ? 0.1996 0.2823 0.2460 0.0264  -0.0226 0.0026  302 LYS D CB  
2974 C CG  . LYS D 79 ? 0.2641 0.3272 0.3180 0.0261  -0.0132 -0.0108 302 LYS D CG  
2975 C CD  . LYS D 79 ? 0.2860 0.3513 0.3439 0.0442  0.0043  -0.0188 302 LYS D CD  
2976 C CE  . LYS D 79 ? 0.3040 0.3606 0.3599 0.0423  0.0193  -0.0288 302 LYS D CE  
2977 N NZ  . LYS D 79 ? 0.4027 0.4157 0.4266 0.0254  0.0238  0.0138  302 LYS D NZ  
2978 N N   A LYS D 80 ? 0.1566 0.2725 0.2080 -0.0109 -0.0057 -0.0039 303 LYS D N   
2979 N N   B LYS D 80 ? 0.1587 0.2714 0.2015 -0.0052 -0.0001 -0.0057 303 LYS D N   
2980 C CA  A LYS D 80 ? 0.1475 0.2540 0.2038 -0.0232 -0.0186 -0.0003 303 LYS D CA  
2981 C CA  B LYS D 80 ? 0.1442 0.2516 0.1831 -0.0105 -0.0069 -0.0010 303 LYS D CA  
2982 C C   A LYS D 80 ? 0.1097 0.2459 0.1973 -0.0388 -0.0076 0.0057  303 LYS D C   
2983 C C   B LYS D 80 ? 0.1399 0.2585 0.1919 0.0001  0.0012  -0.0077 303 LYS D C   
2984 O O   A LYS D 80 ? 0.1244 0.2665 0.2008 -0.0346 -0.0143 -0.0002 303 LYS D O   
2985 O O   B LYS D 80 ? 0.1358 0.2629 0.1768 0.0011  0.0082  0.0016  303 LYS D O   
2986 C CB  A LYS D 80 ? 0.1574 0.2548 0.2321 -0.0282 -0.0255 -0.0073 303 LYS D CB  
2987 C CB  B LYS D 80 ? 0.1646 0.2614 0.2149 -0.0177 -0.0062 0.0036  303 LYS D CB  
2988 C CG  A LYS D 80 ? 0.1827 0.2642 0.2408 -0.0184 -0.0175 -0.0072 303 LYS D CG  
2989 C CG  B LYS D 80 ? 0.2004 0.2507 0.2247 -0.0323 -0.0174 0.0055  303 LYS D CG  
2990 C CD  A LYS D 80 ? 0.2207 0.2739 0.2792 -0.0148 -0.0104 -0.0003 303 LYS D CD  
2991 C CD  B LYS D 80 ? 0.2341 0.2576 0.2387 -0.0384 -0.0026 0.0021  303 LYS D CD  
2992 C CE  A LYS D 80 ? 0.2561 0.3283 0.3170 -0.0049 -0.0001 -0.0024 303 LYS D CE  
2993 C CE  B LYS D 80 ? 0.2497 0.2669 0.2840 -0.0324 0.0000  0.0152  303 LYS D CE  
2994 N NZ  A LYS D 80 ? 0.2818 0.3332 0.3691 -0.0113 0.0236  -0.0021 303 LYS D NZ  
2995 N NZ  B LYS D 80 ? 0.2977 0.3131 0.3317 -0.0550 -0.0054 0.0086  303 LYS D NZ  
2996 N N   . VAL D 81 ? 0.1010 0.2437 0.1850 -0.0316 -0.0007 0.0014  304 VAL D N   
2997 C CA  . VAL D 81 ? 0.1635 0.2261 0.2081 -0.0246 -0.0103 -0.0058 304 VAL D CA  
2998 C C   . VAL D 81 ? 0.1315 0.2154 0.2014 -0.0354 -0.0177 -0.0020 304 VAL D C   
2999 O O   . VAL D 81 ? 0.1784 0.2178 0.1984 -0.0344 -0.0166 0.0032  304 VAL D O   
3000 C CB  . VAL D 81 ? 0.1833 0.2268 0.2040 -0.0259 -0.0269 -0.0056 304 VAL D CB  
3001 C CG1 . VAL D 81 ? 0.2333 0.2631 0.2274 0.0028  -0.0185 -0.0101 304 VAL D CG1 
3002 C CG2 . VAL D 81 ? 0.1522 0.2217 0.2545 -0.0575 -0.0226 0.0115  304 VAL D CG2 
3003 N N   . GLU D 82 ? 0.1613 0.2167 0.1922 -0.0426 -0.0025 -0.0013 305 GLU D N   
3004 C CA  . GLU D 82 ? 0.1460 0.2360 0.2156 -0.0535 -0.0014 -0.0116 305 GLU D CA  
3005 C C   . GLU D 82 ? 0.1386 0.1961 0.2041 -0.0483 0.0143  -0.0100 305 GLU D C   
3006 O O   . GLU D 82 ? 0.1365 0.2212 0.2210 -0.0379 0.0008  0.0088  305 GLU D O   
3007 C CB  . GLU D 82 ? 0.1432 0.2700 0.2362 -0.0689 0.0002  -0.0213 305 GLU D CB  
3008 C CG  . GLU D 82 ? 0.2374 0.3067 0.2531 -0.0710 0.0064  -0.0121 305 GLU D CG  
3009 C CD  . GLU D 82 ? 0.2954 0.3600 0.3079 -0.0222 0.0049  -0.0211 305 GLU D CD  
3010 O OE1 . GLU D 82 ? 0.2069 0.3790 0.2801 -0.0781 -0.0175 -0.0374 305 GLU D OE1 
3011 O OE2 . GLU D 82 ? 0.2966 0.3676 0.3578 -0.0959 -0.0266 -0.0599 305 GLU D OE2 
3012 N N   . ILE D 83 ? 0.1480 0.2197 0.1922 -0.0354 0.0114  0.0005  306 ILE D N   
3013 C CA  . ILE D 83 ? 0.1405 0.1901 0.2018 -0.0268 0.0006  0.0009  306 ILE D CA  
3014 C C   . ILE D 83 ? 0.1812 0.1925 0.1953 -0.0362 -0.0004 -0.0020 306 ILE D C   
3015 O O   . ILE D 83 ? 0.2303 0.1921 0.2201 -0.0189 -0.0035 -0.0061 306 ILE D O   
3016 C CB  . ILE D 83 ? 0.1738 0.1992 0.2382 -0.0337 -0.0128 0.0072  306 ILE D CB  
3017 C CG1 . ILE D 83 ? 0.1777 0.1667 0.2590 -0.0373 -0.0332 0.0053  306 ILE D CG1 
3018 C CG2 . ILE D 83 ? 0.1656 0.2550 0.2634 -0.0436 0.0046  0.0110  306 ILE D CG2 
3019 C CD1 . ILE D 83 ? 0.2243 0.1792 0.2764 -0.0085 -0.0635 -0.0112 306 ILE D CD1 
3020 N N   . ILE D 84 ? 0.1745 0.1905 0.2001 -0.0369 -0.0216 -0.0045 307 ILE D N   
3021 C CA  . ILE D 84 ? 0.1832 0.2110 0.2301 -0.0485 -0.0086 -0.0077 307 ILE D CA  
3022 C C   . ILE D 84 ? 0.2086 0.1865 0.2435 -0.0306 -0.0016 -0.0085 307 ILE D C   
3023 O O   . ILE D 84 ? 0.2388 0.1755 0.2321 -0.0313 0.0219  -0.0136 307 ILE D O   
3024 C CB  . ILE D 84 ? 0.2118 0.2306 0.2312 -0.0328 -0.0212 -0.0075 307 ILE D CB  
3025 C CG1 . ILE D 84 ? 0.2235 0.2925 0.2724 -0.0455 -0.0069 0.0086  307 ILE D CG1 
3026 C CG2 . ILE D 84 ? 0.2402 0.2854 0.2457 -0.0375 -0.0336 -0.0234 307 ILE D CG2 
3027 C CD1 . ILE D 84 ? 0.2514 0.3070 0.2868 -0.0460 -0.0327 -0.0172 307 ILE D CD1 
3028 N N   . ILE D 85 ? 0.2277 0.2100 0.2684 -0.0386 -0.0027 -0.0321 308 ILE D N   
3029 C CA  . ILE D 85 ? 0.2736 0.2416 0.2661 -0.0332 -0.0001 -0.0422 308 ILE D CA  
3030 C C   . ILE D 85 ? 0.3005 0.2567 0.2843 -0.0531 -0.0165 -0.0546 308 ILE D C   
3031 O O   . ILE D 85 ? 0.3479 0.2857 0.3350 -0.0737 -0.0009 -0.0611 308 ILE D O   
3032 C CB  . ILE D 85 ? 0.2830 0.2562 0.2885 -0.0215 0.0056  -0.0249 308 ILE D CB  
3033 C CG1 . ILE D 85 ? 0.3166 0.2599 0.3134 0.0063  0.0078  -0.0265 308 ILE D CG1 
3034 C CG2 . ILE D 85 ? 0.3286 0.3304 0.3172 -0.0005 0.0195  -0.0119 308 ILE D CG2 
3035 C CD1 . ILE D 85 ? 0.2833 0.2927 0.2836 -0.0400 -0.0114 -0.0407 308 ILE D CD1 
3036 N N   . ASP D 86 ? 0.3377 0.3074 0.2935 -0.0569 -0.0212 -0.0472 309 ASP D N   
3037 C CA  . ASP D 86 ? 0.3825 0.3631 0.3334 -0.0339 -0.0179 -0.0188 309 ASP D CA  
3038 C C   . ASP D 86 ? 0.4001 0.3794 0.3575 -0.0337 -0.0158 -0.0193 309 ASP D C   
3039 O O   . ASP D 86 ? 0.4335 0.4015 0.4033 -0.0369 -0.0050 0.0033  309 ASP D O   
3040 C CB  . ASP D 86 ? 0.4005 0.3871 0.3473 -0.0220 -0.0226 -0.0123 309 ASP D CB  
3041 O O   . HOH E .  ? 0.1606 0.1726 0.1738 -0.0051 0.0253  0.0251  315 HOH A O   
3042 O O   . HOH E .  ? 0.1354 0.2986 0.2372 -0.0017 0.0068  -0.0457 316 HOH A O   
3043 O O   . HOH E .  ? 0.1323 0.2352 0.2221 -0.0306 0.0027  -0.0240 317 HOH A O   
3044 O O   . HOH E .  ? 0.1959 0.2824 0.2264 -0.0503 0.0372  -0.0122 318 HOH A O   
3045 O O   . HOH E .  ? 0.2336 0.2486 0.2162 -0.0585 -0.0291 0.0215  319 HOH A O   
3046 O O   . HOH E .  ? 0.1806 0.2397 0.2272 -0.0488 -0.0031 -0.0204 320 HOH A O   
3047 O O   . HOH E .  ? 0.2336 0.2132 0.3142 0.0312  0.0207  -0.0396 321 HOH A O   
3048 O O   . HOH E .  ? 0.1906 0.2277 0.2766 0.0032  0.0283  0.0067  322 HOH A O   
3049 O O   . HOH E .  ? 0.2080 0.3780 0.2902 -0.0361 0.0161  0.0176  323 HOH A O   
3050 O O   . HOH E .  ? 0.2072 0.3231 0.1986 -0.1053 -0.0060 0.0148  324 HOH A O   
3051 O O   . HOH E .  ? 0.2947 0.3668 0.3433 0.0078  0.0226  0.0020  325 HOH A O   
3052 O O   . HOH E .  ? 0.3426 0.3245 0.2338 -0.0357 -0.0124 -0.0127 326 HOH A O   
3053 O O   . HOH E .  ? 0.2025 0.2615 0.2280 -0.0187 -0.0050 0.0073  327 HOH A O   
3054 O O   . HOH E .  ? 0.3264 0.3072 0.3069 0.0327  0.0454  -0.0023 328 HOH A O   
3055 O O   . HOH E .  ? 0.1624 0.3792 0.2782 -0.0800 -0.0134 -0.0011 329 HOH A O   
3056 O O   . HOH E .  ? 0.2301 0.2462 0.3213 -0.0602 0.0384  -0.0592 330 HOH A O   
3057 O O   . HOH E .  ? 0.3384 0.4020 0.3554 -0.0479 0.0249  -0.0415 331 HOH A O   
3058 O O   . HOH E .  ? 0.3040 0.4231 0.3292 0.0015  0.0048  -0.0649 332 HOH A O   
3059 O O   . HOH E .  ? 0.2524 0.3106 0.2876 0.0418  0.0048  -0.0826 333 HOH A O   
3060 O O   . HOH E .  ? 0.3497 0.2944 0.3463 0.0802  0.0969  0.0812  334 HOH A O   
3061 O O   . HOH E .  ? 0.2472 0.3336 0.3854 -0.0975 0.0480  -0.0867 335 HOH A O   
3062 O O   . HOH E .  ? 0.5125 0.5273 0.5768 0.0035  0.0042  -0.0028 336 HOH A O   
3063 O O   . HOH E .  ? 0.3357 0.2699 0.4037 -0.0195 -0.0184 -0.0918 337 HOH A O   
3064 O O   . HOH E .  ? 0.4433 0.3395 0.3640 -0.0815 -0.0494 -0.0135 338 HOH A O   
3065 O O   . HOH E .  ? 0.2016 0.3109 0.3120 -0.0350 -0.0073 0.0080  339 HOH A O   
3066 O O   . HOH E .  ? 0.3510 0.3628 0.4472 -0.0550 -0.0314 -0.0500 340 HOH A O   
3067 O O   . HOH E .  ? 0.3599 0.3350 0.3302 0.0121  0.0034  -0.0328 341 HOH A O   
3068 O O   . HOH E .  ? 0.2623 0.4712 0.3681 0.0105  -0.0034 -0.0142 342 HOH A O   
3069 O O   . HOH E .  ? 0.4328 0.3740 0.4362 -0.0428 -0.0159 -0.0674 343 HOH A O   
3070 O O   . HOH E .  ? 0.3927 0.3260 0.2707 0.0275  -0.0418 0.0104  344 HOH A O   
3071 O O   . HOH E .  ? 0.2781 0.3288 0.3984 0.0343  -0.0047 -0.0299 345 HOH A O   
3072 O O   . HOH E .  ? 0.3261 0.4035 0.3014 0.0538  -0.0555 0.0019  346 HOH A O   
3073 O O   . HOH E .  ? 0.2604 0.2361 0.3657 0.0051  -0.0552 0.0388  347 HOH A O   
3074 O O   . HOH E .  ? 0.2507 0.3793 0.3317 -0.0396 0.0055  -0.0109 348 HOH A O   
3075 O O   . HOH E .  ? 0.3116 0.5528 0.4413 0.0143  -0.0366 -0.0211 349 HOH A O   
3076 O O   . HOH E .  ? 0.3113 0.4294 0.3306 0.0853  0.0303  0.0364  350 HOH A O   
3077 O O   . HOH E .  ? 0.2439 0.4255 0.3892 -0.0146 -0.0347 0.0060  351 HOH A O   
3078 O O   . HOH E .  ? 0.2583 0.3637 0.4867 -0.0715 -0.0370 -0.0120 352 HOH A O   
3079 O O   . HOH E .  ? 0.2463 0.3974 0.3947 0.0426  0.0910  0.0104  353 HOH A O   
3080 O O   . HOH E .  ? 0.3013 0.3649 0.3452 0.0419  0.0239  -0.0626 354 HOH A O   
3081 O O   . HOH E .  ? 0.4114 0.2960 0.3061 -0.0238 -0.0189 0.0227  355 HOH A O   
3082 O O   . HOH E .  ? 0.3398 0.2550 0.3706 -0.0228 -0.0127 0.0342  356 HOH A O   
3083 O O   . HOH E .  ? 0.2867 0.2965 0.2781 0.0611  0.0359  -0.0073 357 HOH A O   
3084 O O   . HOH E .  ? 0.4230 0.3743 0.3191 -0.0012 -0.0401 0.0059  358 HOH A O   
3085 O O   . HOH E .  ? 0.3901 0.2719 0.3716 -0.0064 0.0087  0.0278  359 HOH A O   
3086 O O   . HOH E .  ? 0.4095 0.3895 0.3636 0.0047  0.0001  -0.0156 360 HOH A O   
3087 O O   . HOH E .  ? 0.2764 0.3123 0.4789 -0.0311 -0.0056 0.0465  361 HOH A O   
3088 O O   . HOH E .  ? 0.2445 0.4101 0.3649 -0.0912 -0.0283 0.0078  362 HOH A O   
3089 O O   A HOH E .  ? 0.1938 0.3823 0.2884 0.0467  -0.0247 0.0071  363 HOH A O   
3090 O O   B HOH E .  ? 0.2140 0.3212 0.1498 -0.0056 -0.0025 -0.0295 363 HOH A O   
3091 O O   . HOH E .  ? 0.3944 0.2440 0.5158 0.0454  0.0035  0.0082  364 HOH A O   
3092 O O   . HOH E .  ? 0.3248 0.4406 0.4409 0.0630  0.0526  -0.0554 365 HOH A O   
3093 O O   . HOH E .  ? 0.4273 0.3128 0.4340 -0.0038 0.0548  -0.0075 366 HOH A O   
3094 O O   . HOH E .  ? 0.3001 0.4420 0.3672 0.0087  0.0011  0.0150  367 HOH A O   
3095 O O   . HOH E .  ? 0.4072 0.4330 0.4048 -0.0508 0.0141  0.0240  368 HOH A O   
3096 O O   . HOH E .  ? 0.3740 0.4673 0.4481 0.0683  0.0194  -0.0237 369 HOH A O   
3097 O O   . HOH E .  ? 0.7487 0.7407 0.7517 -0.0023 -0.0087 0.0049  370 HOH A O   
3098 O O   . HOH E .  ? 0.4428 0.4089 0.4725 -0.0314 0.0636  0.0103  371 HOH A O   
3099 O O   . HOH E .  ? 0.3017 0.5100 0.4593 0.0087  0.0211  -0.0083 372 HOH A O   
3100 O O   . HOH E .  ? 0.3402 0.4462 0.5118 -0.0652 0.0244  0.0374  373 HOH A O   
3101 O O   . HOH E .  ? 0.2306 0.4996 0.3927 -0.0744 -0.0243 -0.0282 374 HOH A O   
3102 O O   . HOH E .  ? 0.2906 0.3743 0.4121 -0.0187 0.0460  -0.0327 375 HOH A O   
3103 O O   . HOH E .  ? 0.5506 0.4820 0.4662 0.0179  0.0061  0.0057  376 HOH A O   
3104 O O   . HOH E .  ? 0.2653 0.4627 0.3641 -0.0610 -0.0388 -0.0569 377 HOH A O   
3105 O O   . HOH E .  ? 0.5165 0.4184 0.3862 -0.0222 0.0172  -0.0106 378 HOH A O   
3106 O O   . HOH E .  ? 0.4397 0.5074 0.5517 0.0076  0.0266  0.0178  379 HOH A O   
3107 O O   . HOH E .  ? 0.6567 0.6840 0.6908 -0.0050 0.0029  0.0070  380 HOH A O   
3108 O O   . HOH E .  ? 0.4509 0.4529 0.4891 -0.0158 0.0049  0.0039  381 HOH A O   
3109 O O   . HOH E .  ? 0.3659 0.5224 0.3948 0.0452  0.0386  0.0268  382 HOH A O   
3110 O O   . HOH E .  ? 0.4511 0.5091 0.4876 0.0268  0.0298  -0.0251 383 HOH A O   
3111 O O   . HOH E .  ? 0.4753 0.4445 0.4350 0.0546  0.0298  0.0113  384 HOH A O   
3112 O O   . HOH E .  ? 0.4776 0.3823 0.5205 0.0181  -0.0203 0.0170  385 HOH A O   
3113 O O   . HOH E .  ? 0.5030 0.5267 0.4701 0.0135  0.0143  0.0252  386 HOH A O   
3114 O O   . HOH E .  ? 0.6159 0.5760 0.6082 -0.0031 -0.0053 -0.0233 387 HOH A O   
3115 O O   . HOH E .  ? 0.4547 0.4356 0.4875 0.0557  -0.0116 -0.0091 388 HOH A O   
3116 O O   . HOH E .  ? 0.6005 0.5729 0.5706 -0.0044 0.0050  -0.0055 389 HOH A O   
3117 O O   . HOH E .  ? 0.5417 0.5504 0.5875 0.0115  0.0132  -0.0062 390 HOH A O   
3118 O O   . HOH E .  ? 0.3076 0.4548 0.4954 0.0706  -0.0058 0.0282  391 HOH A O   
3119 O O   . HOH E .  ? 0.5159 0.4201 0.4912 -0.0276 0.0042  -0.0110 392 HOH A O   
3120 O O   . HOH E .  ? 0.5220 0.4828 0.5003 0.0315  -0.0020 -0.0197 393 HOH A O   
3121 O O   . HOH E .  ? 0.3299 0.3633 0.5025 0.0487  0.0620  -0.0285 394 HOH A O   
3122 O O   . HOH E .  ? 0.3189 0.4556 0.3875 0.0153  0.0031  0.0062  395 HOH A O   
3123 O O   . HOH E .  ? 0.3584 0.3573 0.2970 0.0253  0.1124  -0.0321 396 HOH A O   
3124 O O   . HOH E .  ? 0.5828 0.4905 0.5545 0.0010  -0.0124 0.0176  397 HOH A O   
3125 O O   . HOH E .  ? 0.5319 0.5135 0.5480 0.0056  0.0048  -0.0102 398 HOH A O   
3126 O O   . HOH E .  ? 0.4650 0.5242 0.5076 0.0008  -0.0033 0.0131  399 HOH A O   
3127 O O   . HOH E .  ? 0.4631 0.4828 0.5188 -0.0086 -0.0113 -0.0061 400 HOH A O   
3128 O O   . HOH E .  ? 0.4081 0.4527 0.5445 -0.0645 -0.0217 -0.0083 401 HOH A O   
3129 O O   . HOH E .  ? 0.4481 0.4373 0.4644 0.0092  0.0087  0.0102  402 HOH A O   
3130 O O   . HOH E .  ? 0.4382 0.3909 0.4480 -0.0085 0.0145  -0.0196 403 HOH A O   
3131 O O   . HOH E .  ? 0.5687 0.5156 0.5105 -0.0065 -0.0081 -0.0414 404 HOH A O   
3132 O O   . HOH E .  ? 0.3952 0.3803 0.3998 0.0173  -0.0251 0.0522  405 HOH A O   
3133 O O   . HOH E .  ? 0.5693 0.4882 0.4922 -0.0008 0.0146  -0.0427 406 HOH A O   
3134 O O   . HOH E .  ? 0.5051 0.5365 0.5534 -0.0285 -0.0179 -0.0191 407 HOH A O   
3135 O O   . HOH E .  ? 0.5813 0.5414 0.4814 0.0118  -0.0122 0.0137  408 HOH A O   
3136 O O   . HOH E .  ? 0.2283 0.2190 0.2315 -0.0766 -0.0283 0.0275  409 HOH A O   
3137 O O   . HOH E .  ? 0.4347 0.5357 0.4871 -0.0100 0.0094  -0.0092 410 HOH A O   
3138 O O   . HOH F .  ? 0.1398 0.2255 0.2204 0.0066  0.0194  -0.0202 315 HOH B O   
3139 O O   . HOH F .  ? 0.1669 0.1761 0.1796 -0.0131 0.0049  0.0318  316 HOH B O   
3140 O O   . HOH F .  ? 0.1907 0.1916 0.1880 -0.0235 0.0141  0.0178  317 HOH B O   
3141 O O   . HOH F .  ? 0.1289 0.3096 0.2301 -0.0164 0.0012  -0.0490 318 HOH B O   
3142 O O   . HOH F .  ? 0.2604 0.2078 0.3024 -0.0384 -0.0218 -0.0387 319 HOH B O   
3143 O O   . HOH F .  ? 0.1617 0.2434 0.2785 -0.0210 0.0021  0.0214  320 HOH B O   
3144 O O   . HOH F .  ? 0.2564 0.2484 0.2190 0.0556  0.0652  0.0215  321 HOH B O   
3145 O O   . HOH F .  ? 0.2258 0.3211 0.2173 0.0902  0.0159  0.0187  322 HOH B O   
3146 O O   . HOH F .  ? 0.1906 0.2848 0.2011 0.0569  -0.0138 -0.0114 323 HOH B O   
3147 O O   . HOH F .  ? 0.1956 0.3642 0.2774 0.0172  0.0444  0.0329  324 HOH B O   
3148 O O   . HOH F .  ? 0.3469 0.3175 0.2243 0.0177  0.0171  -0.0064 325 HOH B O   
3149 O O   . HOH F .  ? 0.1844 0.2617 0.2352 0.0130  -0.0137 -0.0109 326 HOH B O   
3150 O O   . HOH F .  ? 0.2535 0.2397 0.3346 0.0466  -0.0348 -0.0392 327 HOH B O   
3151 O O   . HOH F .  ? 0.3727 0.2971 0.3084 -0.0521 -0.0401 0.0001  328 HOH B O   
3152 O O   . HOH F .  ? 0.2908 0.3407 0.2998 -0.0301 -0.0661 -0.0213 329 HOH B O   
3153 O O   . HOH F .  ? 0.2360 0.3072 0.3072 -0.0646 0.0234  -0.0858 330 HOH B O   
3154 O O   . HOH F .  ? 0.2870 0.2619 0.2999 -0.0239 -0.0968 -0.0711 331 HOH B O   
3155 O O   . HOH F .  ? 0.3169 0.4236 0.3521 0.0162  0.0009  -0.0759 332 HOH B O   
3156 O O   . HOH F .  ? 0.2148 0.4195 0.3008 0.0826  0.0230  0.0017  333 HOH B O   
3157 O O   . HOH F .  ? 0.2574 0.2465 0.3421 -0.0268 0.0721  0.0374  334 HOH B O   
3158 O O   . HOH F .  ? 0.5409 0.5533 0.5501 0.0360  0.0117  0.0077  335 HOH B O   
3159 O O   . HOH F .  ? 0.3462 0.3450 0.3637 0.1036  -0.0340 -0.0407 336 HOH B O   
3160 O O   . HOH F .  ? 0.3721 0.3400 0.3671 -0.0894 -0.1048 0.0643  337 HOH B O   
3161 O O   . HOH F .  ? 0.2444 0.3713 0.3295 0.0228  0.0152  -0.0196 338 HOH B O   
3162 O O   . HOH F .  ? 0.3112 0.3493 0.4390 0.0600  0.0135  -0.0721 339 HOH B O   
3163 O O   . HOH F .  ? 0.3940 0.3448 0.3402 0.0003  0.0032  -0.0268 340 HOH B O   
3164 O O   . HOH F .  ? 0.4418 0.3621 0.4371 0.0579  0.0099  -0.0764 341 HOH B O   
3165 O O   . HOH F .  ? 0.2401 0.2936 0.2864 0.0345  0.0157  -0.0098 342 HOH B O   
3166 O O   . HOH F .  ? 0.2567 0.5590 0.4723 -0.0113 0.0355  -0.0166 343 HOH B O   
3167 O O   . HOH F .  ? 0.3662 0.3178 0.2616 -0.0091 0.0885  0.0140  344 HOH B O   
3168 O O   . HOH F .  ? 0.3580 0.3512 0.4331 0.0715  -0.0090 -0.0806 345 HOH B O   
3169 O O   . HOH F .  ? 0.2316 0.2800 0.4721 0.0121  0.0267  0.0496  346 HOH B O   
3170 O O   . HOH F .  ? 0.2826 0.3492 0.4756 0.0921  0.0541  -0.0158 347 HOH B O   
3171 O O   . HOH F .  ? 0.5085 0.5106 0.5812 -0.0127 0.0056  -0.0029 348 HOH B O   
3172 O O   . HOH F .  ? 0.3182 0.4257 0.3568 -0.0781 -0.0010 0.0142  349 HOH B O   
3173 O O   . HOH F .  ? 0.2746 0.3913 0.3424 0.0924  0.0366  0.0092  350 HOH B O   
3174 O O   . HOH F .  ? 0.2949 0.4093 0.3698 0.0485  0.0750  -0.0067 351 HOH B O   
3175 O O   . HOH F .  ? 0.3838 0.3197 0.3075 0.0260  0.0097  0.0302  352 HOH B O   
3176 O O   . HOH F .  ? 0.3773 0.2904 0.3666 0.0101  -0.0242 0.0335  353 HOH B O   
3177 O O   . HOH F .  ? 0.4070 0.3571 0.2992 -0.0128 0.0399  -0.0056 354 HOH B O   
3178 O O   . HOH F .  ? 0.4265 0.3315 0.3538 0.1046  0.0491  -0.0055 355 HOH B O   
3179 O O   . HOH F .  ? 0.3350 0.3789 0.3054 -0.0649 0.0537  -0.0006 356 HOH B O   
3180 O O   . HOH F .  ? 0.3414 0.4253 0.4082 0.0015  -0.0122 0.0095  357 HOH B O   
3181 O O   . HOH F .  ? 0.2740 0.4577 0.3780 -0.0425 0.0278  -0.0132 358 HOH B O   
3182 O O   . HOH F .  ? 0.3579 0.2629 0.4178 0.0135  0.0274  -0.0930 359 HOH B O   
3183 O O   . HOH F .  ? 0.3784 0.3873 0.4105 0.0551  0.0122  -0.0373 360 HOH B O   
3184 O O   . HOH F .  ? 0.3592 0.2601 0.5138 -0.0393 -0.0179 -0.0014 361 HOH B O   
3185 O O   . HOH F .  ? 0.3865 0.3937 0.3936 -0.0079 0.0194  -0.0024 362 HOH B O   
3186 O O   . HOH F .  ? 0.3876 0.3523 0.3775 -0.0348 -0.0066 0.0461  363 HOH B O   
3187 O O   . HOH F .  ? 0.4452 0.2751 0.4322 -0.0141 -0.0586 -0.0259 364 HOH B O   
3188 O O   . HOH F .  ? 0.2831 0.4392 0.4279 -0.0255 -0.0356 0.0009  365 HOH B O   
3189 O O   . HOH F .  ? 0.3052 0.3537 0.4160 -0.0420 0.0644  0.0259  366 HOH B O   
3190 O O   . HOH F .  ? 0.3242 0.5039 0.3979 0.0627  0.0212  -0.0122 367 HOH B O   
3191 O O   . HOH F .  ? 0.3207 0.4155 0.4417 0.0367  0.0130  0.0314  368 HOH B O   
3192 O O   . HOH F .  ? 0.5576 0.5533 0.5827 0.0130  0.0048  -0.0176 369 HOH B O   
3193 O O   . HOH F .  ? 0.2388 0.4548 0.3790 -0.0407 -0.0075 0.0076  370 HOH B O   
3194 O O   . HOH F .  ? 0.5630 0.5565 0.6105 0.0046  0.0226  0.0042  371 HOH B O   
3195 O O   . HOH F .  ? 0.3399 0.4207 0.4200 0.0411  -0.0153 -0.0137 372 HOH B O   
3196 O O   . HOH F .  ? 0.5302 0.4133 0.3897 0.0059  -0.0235 0.0055  373 HOH B O   
3197 O O   . HOH F .  ? 0.3028 0.5295 0.4805 -0.0193 -0.0463 -0.0003 374 HOH B O   
3198 O O   . HOH F .  ? 0.4109 0.3762 0.3992 -0.0310 0.0368  0.0560  375 HOH B O   
3199 O O   . HOH F .  ? 0.3188 0.4186 0.3546 -0.0040 -0.0185 0.0056  376 HOH B O   
3200 O O   . HOH F .  ? 0.5150 0.5762 0.5615 0.0106  0.0188  0.0154  377 HOH B O   
3201 O O   . HOH F .  ? 0.3099 0.4310 0.4348 -0.0607 0.0108  -0.0305 378 HOH B O   
3202 O O   . HOH F .  ? 0.5150 0.4766 0.4842 0.0114  -0.0013 0.0104  379 HOH B O   
3203 O O   . HOH F .  ? 0.3756 0.4254 0.4236 -0.0046 0.0143  0.0095  380 HOH B O   
3204 O O   . HOH F .  ? 0.4116 0.5031 0.5227 -0.0098 -0.0195 -0.0261 381 HOH B O   
3205 O O   . HOH F .  ? 0.6002 0.6023 0.5809 -0.0210 -0.0213 -0.0020 382 HOH B O   
3206 O O   . HOH F .  ? 0.2313 0.4644 0.3661 -0.0505 0.0674  0.0348  383 HOH B O   
3207 O O   . HOH F .  ? 0.2915 0.4357 0.4116 -0.0619 -0.0577 -0.0637 384 HOH B O   
3208 O O   . HOH F .  ? 0.3587 0.4825 0.3943 -0.0474 -0.0352 0.0163  385 HOH B O   
3209 O O   . HOH F .  ? 0.3867 0.4485 0.4528 -0.0068 -0.0503 0.0188  386 HOH B O   
3210 O O   . HOH F .  ? 0.4747 0.3777 0.4791 -0.0519 0.0120  -0.0062 387 HOH B O   
3211 O O   . HOH F .  ? 0.3399 0.3497 0.4753 -0.0595 -0.0498 -0.0217 388 HOH B O   
3212 O O   . HOH F .  ? 0.4772 0.4539 0.4646 -0.0273 0.0105  0.0279  389 HOH B O   
3213 O O   . HOH F .  ? 0.4681 0.5129 0.5375 0.0155  0.0180  -0.0097 390 HOH B O   
3214 O O   . HOH F .  ? 0.5967 0.5793 0.5699 -0.0048 -0.0115 0.0211  391 HOH B O   
3215 O O   . HOH F .  ? 0.4462 0.4376 0.5352 0.0600  0.0296  -0.0029 392 HOH B O   
3216 O O   . HOH F .  ? 0.3611 0.3342 0.3362 -0.0558 -0.0264 -0.0040 393 HOH B O   
3217 O O   . HOH F .  ? 0.4937 0.5014 0.5376 -0.0219 -0.0099 -0.0046 394 HOH B O   
3218 O O   . HOH F .  ? 0.4756 0.5463 0.5743 0.0129  0.0142  -0.0093 395 HOH B O   
3219 O O   . HOH F .  ? 0.4220 0.4194 0.4703 0.0343  -0.0507 -0.0119 396 HOH B O   
3220 O O   . HOH F .  ? 0.3843 0.3804 0.4260 -0.0262 0.0017  -0.0330 397 HOH B O   
3221 O O   . HOH F .  ? 0.4513 0.5170 0.4650 -0.0093 -0.0171 0.0019  398 HOH B O   
3222 O O   . HOH F .  ? 0.4181 0.4792 0.4704 -0.0360 -0.0382 -0.0338 399 HOH B O   
3223 O O   . HOH F .  ? 0.4724 0.4543 0.5563 -0.0071 0.0049  -0.0047 400 HOH B O   
3224 O O   . HOH F .  ? 0.3492 0.4366 0.4387 -0.0094 -0.0050 0.0097  401 HOH B O   
3225 O O   . HOH F .  ? 0.8870 0.8728 0.8659 -0.0075 0.0045  -0.0005 402 HOH B O   
3226 O O   . HOH F .  ? 0.4623 0.4020 0.5246 -0.0078 0.0186  0.0178  403 HOH B O   
3227 O O   . HOH F .  ? 0.5063 0.5509 0.5119 -0.0299 0.0013  0.0223  404 HOH B O   
3228 O O   . HOH F .  ? 0.5035 0.5485 0.5466 -0.0136 0.0076  -0.0130 405 HOH B O   
3229 O O   . HOH F .  ? 0.4349 0.4659 0.4179 -0.0026 0.0411  0.0464  406 HOH B O   
3230 O O   . HOH F .  ? 0.7021 0.6641 0.7053 0.0080  0.0029  0.0005  407 HOH B O   
3231 O O   . HOH F .  ? 0.5245 0.5397 0.5493 0.0268  0.0119  0.0147  408 HOH B O   
3232 O O   . HOH F .  ? 0.4261 0.5152 0.5503 -0.0403 0.0105  -0.0263 409 HOH B O   
3233 O O   . HOH F .  ? 0.5898 0.5460 0.6367 -0.0099 -0.0024 0.0110  410 HOH B O   
3234 O O   . HOH F .  ? 0.5885 0.5865 0.6028 0.0223  0.0073  0.0060  411 HOH B O   
3235 O O   . HOH F .  ? 0.5778 0.5506 0.5101 -0.0047 0.0027  -0.0201 412 HOH B O   
3236 O O   . HOH F .  ? 0.4668 0.4989 0.5256 -0.0122 -0.0023 -0.0178 413 HOH B O   
3237 O O   . HOH F .  ? 0.2453 0.2263 0.2244 0.0940  0.0636  0.0369  414 HOH B O   
3238 O O   . HOH G .  ? 0.1404 0.1888 0.1924 -0.0245 0.0240  -0.0125 315 HOH C O   
3239 O O   . HOH G .  ? 0.1808 0.2127 0.2137 -0.0189 0.0095  -0.0085 316 HOH C O   
3240 O O   . HOH G .  ? 0.1224 0.1933 0.2140 -0.0174 0.0139  -0.0033 317 HOH C O   
3241 O O   . HOH G .  ? 0.1573 0.2243 0.2042 -0.0318 0.0250  -0.0024 318 HOH C O   
3242 O O   . HOH G .  ? 0.2177 0.2042 0.2360 0.0441  0.0470  0.0034  319 HOH C O   
3243 O O   . HOH G .  ? 0.1670 0.2887 0.2506 -0.0003 0.0047  -0.0282 320 HOH C O   
3244 O O   . HOH G .  ? 0.1806 0.2449 0.2370 0.0332  0.0128  -0.0166 321 HOH C O   
3245 O O   . HOH G .  ? 0.2952 0.1760 0.2828 -0.0685 0.0130  -0.0611 322 HOH C O   
3246 O O   . HOH G .  ? 0.1688 0.3087 0.2821 0.0345  0.0387  -0.0145 323 HOH C O   
3247 O O   . HOH G .  ? 0.1663 0.2893 0.2759 -0.0842 -0.0098 0.0090  324 HOH C O   
3248 O O   . HOH G .  ? 0.1492 0.3289 0.3090 -0.0185 -0.0208 0.0460  325 HOH C O   
3249 O O   . HOH G .  ? 0.2006 0.2411 0.3243 0.0094  0.0877  -0.0013 326 HOH C O   
3250 O O   . HOH G .  ? 0.2868 0.3238 0.2723 -0.0468 -0.0014 -0.0103 327 HOH C O   
3251 O O   . HOH G .  ? 0.2475 0.3138 0.2414 -0.0519 0.0423  -0.0114 328 HOH C O   
3252 O O   . HOH G .  ? 0.3293 0.2880 0.2418 -0.0912 -0.0550 -0.0184 329 HOH C O   
3253 O O   . HOH G .  ? 0.2232 0.3607 0.3557 -0.0504 -0.0818 -0.0126 330 HOH C O   
3254 O O   . HOH G .  ? 0.3112 0.2511 0.2091 -0.1035 -0.0366 0.0232  331 HOH C O   
3255 O O   . HOH G .  ? 0.3019 0.2981 0.4157 -0.0488 0.0147  -0.0321 332 HOH C O   
3256 O O   . HOH G .  ? 0.2154 0.2294 0.3623 -0.0477 0.0293  -0.0347 333 HOH C O   
3257 O O   . HOH G .  ? 0.3553 0.2947 0.2589 0.0251  -0.0254 -0.0227 334 HOH C O   
3258 O O   . HOH G .  ? 0.2614 0.3225 0.3058 0.0354  0.0547  -0.0719 335 HOH C O   
3259 O O   . HOH G .  ? 0.1703 0.4002 0.2877 0.0169  0.0432  0.0006  336 HOH C O   
3260 O O   . HOH G .  ? 0.2375 0.4020 0.3698 0.0371  -0.0429 -0.0979 337 HOH C O   
3261 O O   . HOH G .  ? 0.3531 0.3438 0.4066 -0.0136 -0.0109 -0.0636 338 HOH C O   
3262 O O   . HOH G .  ? 0.2373 0.1908 0.4696 -0.0048 0.1104  -0.0006 339 HOH C O   
3263 O O   . HOH G .  ? 0.1109 0.4269 0.3252 -0.0586 -0.0048 -0.0709 340 HOH C O   
3264 O O   . HOH G .  ? 0.2410 0.3600 0.3235 0.0385  0.0083  0.0540  341 HOH C O   
3265 O O   . HOH G .  ? 0.3799 0.3795 0.3500 -0.0083 0.0134  -0.0679 342 HOH C O   
3266 O O   . HOH G .  ? 0.3109 0.2685 0.3982 -0.0280 0.1017  0.0326  343 HOH C O   
3267 O O   . HOH G .  ? 0.3919 0.2585 0.2660 0.0540  0.0384  0.0192  344 HOH C O   
3268 O O   . HOH G .  ? 0.3264 0.2911 0.3215 0.0228  0.0343  0.0632  345 HOH C O   
3269 O O   . HOH G .  ? 0.2333 0.4979 0.3195 0.0022  0.0473  -0.0066 346 HOH C O   
3270 O O   . HOH G .  ? 0.2368 0.4610 0.3839 0.0115  -0.0133 -0.0044 347 HOH C O   
3271 O O   . HOH G .  ? 0.4722 0.3112 0.3807 -0.0301 0.0101  0.0142  348 HOH C O   
3272 O O   . HOH G .  ? 0.2276 0.3982 0.4268 -0.1113 -0.0398 -0.0046 349 HOH C O   
3273 O O   . HOH G .  ? 0.3812 0.4694 0.4495 0.0716  -0.0429 -0.0179 350 HOH C O   
3274 O O   . HOH G .  ? 0.3724 0.4161 0.4365 0.0212  -0.0029 -0.0080 351 HOH C O   
3275 O O   . HOH G .  ? 0.3311 0.4561 0.5151 0.0054  -0.0020 -0.0028 352 HOH C O   
3276 O O   . HOH G .  ? 0.3459 0.3104 0.3935 -0.0235 0.0236  -0.0102 353 HOH C O   
3277 O O   . HOH G .  ? 0.5159 0.4360 0.3640 -0.0467 -0.0044 0.0966  354 HOH C O   
3278 O O   . HOH G .  ? 0.2844 0.3046 0.2656 -0.0277 -0.0235 -0.0084 355 HOH C O   
3279 O O   . HOH G .  ? 0.3092 0.2763 0.3491 -0.0045 0.0082  0.0319  356 HOH C O   
3280 O O   . HOH G .  ? 0.2703 0.3398 0.3480 -0.0001 0.0298  0.0181  357 HOH C O   
3281 O O   . HOH G .  ? 0.2652 0.3141 0.3547 -0.0119 0.0178  -0.0280 358 HOH C O   
3282 O O   . HOH G .  ? 0.4458 0.3547 0.3091 -0.0457 -0.0377 -0.0259 359 HOH C O   
3283 O O   . HOH G .  ? 0.3185 0.3899 0.4301 -0.0483 0.0179  -0.0174 360 HOH C O   
3284 O O   . HOH G .  ? 0.3038 0.4474 0.3268 0.0334  0.0130  -0.0108 361 HOH C O   
3285 O O   . HOH G .  ? 0.2535 0.3652 0.2871 -0.0344 -0.0141 0.0275  362 HOH C O   
3286 O O   . HOH G .  ? 0.5058 0.3722 0.5090 -0.0172 -0.0154 -0.0366 363 HOH C O   
3287 O O   . HOH G .  ? 0.3635 0.3634 0.3558 -0.0577 -0.0131 -0.0453 364 HOH C O   
3288 O O   . HOH G .  ? 0.4791 0.3816 0.4102 -0.0601 -0.0503 -0.0400 365 HOH C O   
3289 O O   . HOH G .  ? 0.3675 0.5047 0.3153 0.0055  0.0008  0.0172  366 HOH C O   
3290 O O   . HOH G .  ? 0.4393 0.4124 0.3522 0.0062  -0.0174 -0.0122 367 HOH C O   
3291 O O   . HOH G .  ? 0.3884 0.3577 0.3498 0.0060  0.0422  0.0559  368 HOH C O   
3292 O O   . HOH G .  ? 0.3175 0.4273 0.3241 0.0479  -0.0016 -0.0386 369 HOH C O   
3293 O O   . HOH G .  ? 0.3659 0.3756 0.4830 0.0346  0.0204  0.0024  370 HOH C O   
3294 O O   . HOH G .  ? 0.3588 0.4525 0.4473 -0.0546 0.0296  0.0019  371 HOH C O   
3295 O O   . HOH G .  ? 0.3190 0.3552 0.3691 -0.0730 0.0443  0.0528  372 HOH C O   
3296 O O   . HOH G .  ? 0.3291 0.4175 0.3628 0.0958  0.0451  -0.0308 373 HOH C O   
3297 O O   . HOH G .  ? 0.2468 0.4698 0.3715 -0.0307 -0.0093 0.0171  374 HOH C O   
3298 O O   . HOH G .  ? 0.3946 0.4567 0.4867 0.1052  0.0162  -0.0086 375 HOH C O   
3299 O O   . HOH G .  ? 0.3279 0.4321 0.3638 0.0078  0.0775  0.0520  376 HOH C O   
3300 O O   . HOH G .  ? 0.4351 0.3796 0.4569 -0.0597 -0.0058 0.0558  377 HOH C O   
3301 O O   . HOH G .  ? 0.2999 0.4611 0.4072 -0.0016 0.0125  0.0273  378 HOH C O   
3302 O O   . HOH G .  ? 0.3586 0.4271 0.5094 0.0420  -0.0338 0.0421  379 HOH C O   
3303 O O   . HOH G .  ? 0.4440 0.4792 0.4489 -0.0556 -0.0062 -0.0299 380 HOH C O   
3304 O O   . HOH G .  ? 0.4420 0.3888 0.3307 0.0343  0.0170  0.0382  381 HOH C O   
3305 O O   . HOH G .  ? 0.3118 0.3940 0.4399 0.0472  0.0106  0.0018  382 HOH C O   
3306 O O   . HOH G .  ? 0.5054 0.4304 0.5062 -0.0197 -0.0068 0.0080  383 HOH C O   
3307 O O   A HOH G .  ? 0.2399 0.3935 0.3336 0.0147  0.0778  0.0029  384 HOH C O   
3308 O O   B HOH G .  ? 0.1225 0.1127 0.1811 0.0195  0.0879  -0.0620 384 HOH C O   
3309 O O   . HOH G .  ? 0.4442 0.5159 0.4858 -0.0010 -0.0333 0.0069  385 HOH C O   
3310 O O   . HOH G .  ? 0.4655 0.5140 0.5697 -0.0182 0.0213  -0.0094 386 HOH C O   
3311 O O   . HOH G .  ? 0.3703 0.4426 0.3687 0.0019  -0.0301 0.0254  387 HOH C O   
3312 O O   . HOH G .  ? 0.4676 0.5132 0.5229 -0.0092 -0.0074 -0.0249 388 HOH C O   
3313 O O   . HOH G .  ? 0.2685 0.4551 0.3301 0.0275  -0.0190 0.0261  389 HOH C O   
3314 O O   . HOH G .  ? 0.4729 0.4168 0.4014 0.0096  -0.0175 -0.0151 390 HOH C O   
3315 O O   . HOH G .  ? 0.3576 0.3846 0.4409 0.0395  0.0382  -0.0209 391 HOH C O   
3316 O O   . HOH G .  ? 0.5027 0.4985 0.5540 -0.0234 0.0126  0.0012  392 HOH C O   
3317 O O   . HOH G .  ? 0.3843 0.4182 0.4488 -0.0215 -0.0161 0.0385  393 HOH C O   
3318 O O   . HOH G .  ? 0.5107 0.4977 0.5075 -0.0269 0.0087  0.0421  394 HOH C O   
3319 O O   . HOH G .  ? 0.5384 0.6023 0.5917 0.0091  -0.0003 0.0105  395 HOH C O   
3320 O O   . HOH G .  ? 0.4280 0.4984 0.4958 -0.0479 -0.0213 -0.0104 396 HOH C O   
3321 O O   . HOH G .  ? 0.6629 0.6281 0.6770 -0.0012 0.0008  -0.0020 397 HOH C O   
3322 O O   . HOH G .  ? 0.3091 0.4439 0.4257 0.0511  0.0389  0.0002  398 HOH C O   
3323 O O   . HOH G .  ? 0.4123 0.4167 0.5207 0.0694  0.0207  -0.0587 399 HOH C O   
3324 O O   . HOH G .  ? 0.5649 0.4507 0.4567 -0.0115 0.0049  -0.0078 400 HOH C O   
3325 O O   . HOH G .  ? 0.4169 0.4255 0.3945 0.0318  -0.0525 0.0649  401 HOH C O   
3326 O O   . HOH G .  ? 0.5863 0.6080 0.6259 -0.0049 -0.0007 0.0044  402 HOH C O   
3327 O O   . HOH G .  ? 0.3862 0.4691 0.4306 -0.0390 -0.0189 0.0212  403 HOH C O   
3328 O O   . HOH G .  ? 0.3028 0.4641 0.5532 -0.0572 0.0505  0.0126  404 HOH C O   
3329 O O   . HOH G .  ? 0.4266 0.4859 0.4386 -0.0204 -0.0046 0.0000  405 HOH C O   
3330 O O   . HOH G .  ? 0.5693 0.4986 0.5440 0.0110  0.0046  -0.0202 406 HOH C O   
3331 O O   . HOH G .  ? 0.5554 0.5284 0.5420 -0.0108 -0.0018 0.0117  407 HOH C O   
3332 O O   . HOH G .  ? 0.6838 0.6507 0.6897 0.0073  -0.0009 0.0118  408 HOH C O   
3333 O O   . HOH G .  ? 0.5645 0.5396 0.5284 0.0209  0.0119  0.0093  409 HOH C O   
3334 O O   . HOH G .  ? 1.1632 1.1517 1.1535 0.0007  0.0011  0.0008  410 HOH C O   
3335 O O   . HOH G .  ? 0.4321 0.4882 0.4979 0.0555  -0.0102 0.0301  411 HOH C O   
3336 O O   . HOH G .  ? 0.2946 0.4600 0.4182 -0.0173 -0.0451 -0.0142 412 HOH C O   
3337 O O   . HOH G .  ? 0.5183 0.5564 0.5351 -0.0163 -0.0115 0.0078  413 HOH C O   
3338 O O   . HOH G .  ? 0.5184 0.4014 0.5603 0.0253  0.0052  -0.0056 414 HOH C O   
3339 O O   . HOH G .  ? 0.5056 0.5231 0.5114 0.0238  -0.0095 0.0074  415 HOH C O   
3340 O O   . HOH G .  ? 0.5805 0.5929 0.5704 0.0057  -0.0086 -0.0049 416 HOH C O   
3341 O O   . HOH G .  ? 0.2728 0.4092 0.4693 -0.0668 -0.0492 0.0739  417 HOH C O   
3342 O O   . HOH G .  ? 0.2618 0.4235 0.4406 0.0430  0.0680  -0.0281 418 HOH C O   
3343 O O   . HOH H .  ? 0.1678 0.1947 0.1873 0.0063  0.0054  0.0320  315 HOH D O   
3344 O O   . HOH H .  ? 0.1747 0.2111 0.2122 -0.0023 0.0124  -0.0020 316 HOH D O   
3345 O O   . HOH H .  ? 0.1574 0.1804 0.2000 0.0247  -0.0052 -0.0096 317 HOH D O   
3346 O O   . HOH H .  ? 0.1172 0.2909 0.2425 -0.0013 -0.0056 -0.0285 318 HOH D O   
3347 O O   . HOH H .  ? 0.1337 0.1848 0.2139 0.0119  0.0088  0.0030  319 HOH D O   
3348 O O   . HOH H .  ? 0.1515 0.2280 0.2033 0.0381  -0.0026 0.0030  320 HOH D O   
3349 O O   . HOH H .  ? 0.2023 0.2011 0.2398 -0.0478 -0.0111 -0.0022 321 HOH D O   
3350 O O   . HOH H .  ? 0.2380 0.2555 0.2620 0.0737  0.0159  0.0082  322 HOH D O   
3351 O O   . HOH H .  ? 0.2180 0.2420 0.3394 -0.0023 -0.0732 -0.0838 323 HOH D O   
3352 O O   . HOH H .  ? 0.2962 0.1808 0.2834 0.0489  0.0114  -0.0669 324 HOH D O   
3353 O O   . HOH H .  ? 0.2767 0.2599 0.2011 0.0907  0.0550  0.0155  325 HOH D O   
3354 O O   . HOH H .  ? 0.2244 0.3062 0.2716 0.0674  0.0123  0.0179  326 HOH D O   
3355 O O   . HOH H .  ? 0.1910 0.3255 0.2882 -0.0037 0.0340  0.0395  327 HOH D O   
3356 O O   . HOH H .  ? 0.3429 0.2897 0.2394 0.0675  0.0705  -0.0129 328 HOH D O   
3357 O O   . HOH H .  ? 0.2284 0.2422 0.3217 -0.0044 -0.0630 -0.0015 329 HOH D O   
3358 O O   . HOH H .  ? 0.3616 0.4323 0.3848 -0.0073 0.0039  -0.0853 330 HOH D O   
3359 O O   . HOH H .  ? 0.2626 0.3131 0.3048 -0.0502 -0.0245 -0.0546 331 HOH D O   
3360 O O   . HOH H .  ? 0.2243 0.2370 0.4086 0.0426  -0.0024 -0.0342 332 HOH D O   
3361 O O   . HOH H .  ? 0.1971 0.4074 0.2985 -0.0525 -0.0233 0.0107  333 HOH D O   
3362 O O   . HOH H .  ? 0.1738 0.3044 0.3042 -0.0284 -0.0143 -0.0183 334 HOH D O   
3363 O O   . HOH H .  ? 0.3947 0.3730 0.3336 0.0086  -0.0256 -0.0791 335 HOH D O   
3364 O O   . HOH H .  ? 0.3510 0.2942 0.2493 -0.0174 0.0405  -0.0332 336 HOH D O   
3365 O O   . HOH H .  ? 0.2514 0.2449 0.4652 -0.0060 -0.0564 -0.0141 337 HOH D O   
3366 O O   . HOH H .  ? 0.2689 0.3899 0.3625 0.0568  0.0984  -0.0128 338 HOH D O   
3367 O O   . HOH H .  ? 0.2297 0.3081 0.2593 0.0328  -0.0456 -0.0077 339 HOH D O   
3368 O O   . HOH H .  ? 0.2764 0.4668 0.4304 -0.0135 -0.0084 -0.0373 340 HOH D O   
3369 O O   . HOH H .  ? 0.2942 0.4303 0.3527 0.0060  -0.0448 -0.0487 341 HOH D O   
3370 O O   . HOH H .  ? 0.3492 0.3250 0.3930 0.0295  0.0481  -0.0695 342 HOH D O   
3371 O O   . HOH H .  ? 0.2762 0.3397 0.3434 -0.0686 -0.0142 0.0148  343 HOH D O   
3372 O O   . HOH H .  ? 0.4108 0.2599 0.2548 -0.0473 -0.0324 0.0323  344 HOH D O   
3373 O O   . HOH H .  ? 0.2160 0.3852 0.4502 -0.0804 0.0200  0.0143  345 HOH D O   
3374 O O   . HOH H .  ? 0.2973 0.4308 0.3594 -0.0281 -0.0701 0.0496  346 HOH D O   
3375 O O   . HOH H .  ? 0.2530 0.5013 0.3083 -0.0299 -0.0036 0.0092  347 HOH D O   
3376 O O   . HOH H .  ? 0.3807 0.5606 0.3628 0.0149  0.0473  -0.0019 348 HOH D O   
3377 O O   . HOH H .  ? 0.2834 0.3389 0.2855 0.0283  0.0360  0.0145  349 HOH D O   
3378 O O   . HOH H .  ? 0.3562 0.2778 0.3126 -0.0325 -0.0013 0.0488  350 HOH D O   
3379 O O   . HOH H .  ? 0.3362 0.5028 0.4127 0.0131  -0.0061 0.0028  351 HOH D O   
3380 O O   . HOH H .  ? 0.4474 0.3763 0.4619 0.0561  0.0248  0.0209  352 HOH D O   
3381 O O   . HOH H .  ? 0.5121 0.4737 0.4632 0.0099  0.0082  0.0158  353 HOH D O   
3382 O O   . HOH H .  ? 0.3840 0.3113 0.3787 0.0125  0.0003  -0.0075 354 HOH D O   
3383 O O   . HOH H .  ? 0.2066 0.3813 0.3281 -0.1092 0.0026  -0.0694 355 HOH D O   
3384 O O   . HOH H .  ? 0.2465 0.4811 0.3375 -0.0509 0.0438  0.0013  356 HOH D O   
3385 O O   . HOH H .  ? 0.3928 0.4351 0.3458 -0.0129 0.0177  -0.0165 357 HOH D O   
3386 O O   . HOH H .  ? 0.4849 0.2891 0.4532 0.0247  0.0079  -0.0511 358 HOH D O   
3387 O O   . HOH H .  ? 0.4066 0.3373 0.3278 0.0378  0.0330  -0.0195 359 HOH D O   
3388 O O   . HOH H .  ? 0.2451 0.4216 0.3394 -0.0176 0.0264  0.0196  360 HOH D O   
3389 O O   . HOH H .  ? 0.2706 0.4647 0.3098 -0.0565 0.0082  -0.0127 361 HOH D O   
3390 O O   . HOH H .  ? 0.3474 0.4512 0.4122 0.0214  0.0369  0.0191  362 HOH D O   
3391 O O   . HOH H .  ? 0.3989 0.4167 0.5098 -0.0313 0.0018  0.0008  363 HOH D O   
3392 O O   . HOH H .  ? 0.3372 0.2772 0.4137 0.0092  -0.0856 0.0326  364 HOH D O   
3393 O O   . HOH H .  ? 0.3451 0.4112 0.4890 -0.0340 0.0514  0.0511  365 HOH D O   
3394 O O   . HOH H .  ? 0.2479 0.4072 0.3960 -0.0772 -0.0562 -0.0313 366 HOH D O   
3395 O O   . HOH H .  ? 0.2769 0.3618 0.3362 0.0001  0.0120  0.0144  367 HOH D O   
3396 O O   . HOH H .  ? 0.2689 0.3594 0.3509 0.0765  -0.0318 0.0476  368 HOH D O   
3397 O O   . HOH H .  ? 0.3604 0.3685 0.3857 0.0304  0.0282  -0.0528 369 HOH D O   
3398 O O   . HOH H .  ? 0.4252 0.4054 0.4275 0.0732  0.0573  -0.0093 370 HOH D O   
3399 O O   . HOH H .  ? 0.3701 0.3706 0.4194 0.0847  0.0122  -0.0465 371 HOH D O   
3400 O O   . HOH H .  ? 0.3605 0.4560 0.4144 -0.0144 -0.0348 0.0046  372 HOH D O   
3401 O O   . HOH H .  ? 0.3831 0.4155 0.4533 -0.0903 -0.0218 -0.0805 373 HOH D O   
3402 O O   . HOH H .  ? 0.2592 0.3235 0.3823 0.0275  -0.0241 -0.0273 374 HOH D O   
3403 O O   . HOH H .  ? 0.3472 0.4126 0.3590 -0.1071 -0.0220 -0.0145 375 HOH D O   
3404 O O   . HOH H .  ? 0.6797 0.7092 0.7194 0.0027  0.0020  0.0008  376 HOH D O   
3405 O O   . HOH H .  ? 0.3417 0.4978 0.4526 0.0003  0.0054  0.0194  377 HOH D O   
3406 O O   . HOH H .  ? 0.5159 0.3386 0.4193 0.0036  0.0032  -0.0338 378 HOH D O   
3407 O O   . HOH H .  ? 0.5022 0.4706 0.4090 -0.0263 -0.0072 0.0306  379 HOH D O   
3408 O O   . HOH H .  ? 0.4024 0.5030 0.3417 -0.0142 0.0103  0.0211  380 HOH D O   
3409 O O   . HOH H .  ? 0.4095 0.4457 0.3847 -0.0129 0.0449  0.0556  381 HOH D O   
3410 O O   . HOH H .  ? 0.4622 0.2849 0.4005 0.0155  -0.0069 0.0140  382 HOH D O   
3411 O O   . HOH H .  ? 0.4236 0.4363 0.4556 -0.0522 -0.0224 0.0506  383 HOH D O   
3412 O O   . HOH H .  ? 0.2941 0.4185 0.4174 0.0037  0.0912  0.0143  384 HOH D O   
3413 O O   . HOH H .  ? 0.3681 0.3789 0.4395 -0.0586 -0.0203 -0.0195 385 HOH D O   
3414 O O   . HOH H .  ? 0.4688 0.5025 0.5696 0.0308  -0.0144 0.0087  386 HOH D O   
3415 O O   . HOH H .  ? 0.5118 0.5465 0.4991 0.0304  0.0025  -0.0054 387 HOH D O   
3416 O O   . HOH H .  ? 0.4364 0.4447 0.5002 0.0113  0.0071  -0.0257 388 HOH D O   
3417 O O   . HOH H .  ? 0.3853 0.4697 0.4914 -0.0932 -0.0188 0.0055  389 HOH D O   
3418 O O   . HOH H .  ? 0.3400 0.4436 0.4805 0.0066  0.0198  0.0205  390 HOH D O   
3419 O O   . HOH H .  ? 0.4987 0.4321 0.4907 -0.0081 0.0190  -0.0395 391 HOH D O   
3420 O O   . HOH H .  ? 0.5165 0.5086 0.5056 -0.0371 -0.0026 0.0171  392 HOH D O   
3421 O O   . HOH H .  ? 0.2815 0.4505 0.4269 0.0009  0.0326  -0.0059 393 HOH D O   
3422 O O   . HOH H .  ? 0.4401 0.4514 0.3575 -0.0081 0.0702  0.0454  394 HOH D O   
3423 O O   . HOH H .  ? 0.5918 0.4817 0.5832 -0.0015 -0.0036 -0.0100 395 HOH D O   
3424 O O   . HOH H .  ? 0.5210 0.4558 0.5106 -0.0250 0.0214  0.0010  396 HOH D O   
3425 O O   . HOH H .  ? 0.3989 0.4014 0.4101 0.0101  0.0248  -0.0010 397 HOH D O   
3426 O O   . HOH H .  ? 0.5917 0.5787 0.6221 0.0102  -0.0046 -0.0129 398 HOH D O   
3427 O O   . HOH H .  ? 0.4567 0.4545 0.4303 -0.0188 0.0302  -0.0141 399 HOH D O   
3428 O O   . HOH H .  ? 0.4022 0.4834 0.4323 -0.0328 0.0012  0.0016  400 HOH D O   
3429 O O   . HOH H .  ? 0.4025 0.5190 0.5151 0.0226  0.0101  0.0271  401 HOH D O   
3430 O O   . HOH H .  ? 0.5966 0.5818 0.5933 0.0061  -0.0256 -0.0119 402 HOH D O   
3431 O O   . HOH H .  ? 0.5199 0.5152 0.5790 -0.0003 0.0176  -0.0200 403 HOH D O   
3432 O O   . HOH H .  ? 0.5631 0.5805 0.5761 -0.0122 0.0294  0.0090  404 HOH D O   
3433 O O   . HOH H .  ? 0.3386 0.3090 0.4233 -0.0171 0.0521  0.0317  405 HOH D O   
3434 O O   A HOH H .  ? 0.3343 0.3273 0.3210 -0.0599 0.0127  -0.0166 406 HOH D O   
3435 O O   B HOH H .  ? 0.2900 0.2563 0.2833 -0.0213 -0.0147 0.0298  406 HOH D O   
3436 O O   . HOH H .  ? 0.3637 0.4714 0.5598 -0.0270 0.0130  -0.0018 407 HOH D O   
3437 O O   . HOH H .  ? 0.3842 0.4995 0.4415 -0.0027 0.0474  -0.0061 408 HOH D O   
3438 O O   . HOH H .  ? 0.5150 0.5637 0.4983 0.0427  0.0077  0.0223  409 HOH D O   
3439 O O   . HOH H .  ? 0.5803 0.6380 0.5951 -0.0080 0.0180  -0.0069 410 HOH D O   
3440 O O   . HOH H .  ? 0.5816 0.5156 0.6156 -0.0239 -0.0005 -0.0026 411 HOH D O   
3441 O O   . HOH H .  ? 0.4750 0.4964 0.4472 0.0292  0.0096  -0.0202 412 HOH D O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  224 ?   ?   ?   A . n 
A 1 2  SER 2  225 225 SER SER A . n 
A 1 3  LYS 3  226 226 LYS LYS A . n 
A 1 4  LEU 4  227 227 LEU LEU A . n 
A 1 5  GLN 5  228 228 GLN GLN A . n 
A 1 6  ILE 6  229 229 ILE ILE A . n 
A 1 7  CYS 7  230 230 CYS CYS A . n 
A 1 8  VAL 8  231 231 VAL VAL A . n 
A 1 9  GLU 9  232 232 GLU GLU A . n 
A 1 10 PRO 10 233 233 PRO PRO A . n 
A 1 11 THR 11 234 234 THR THR A . n 
A 1 12 SER 12 235 235 SER SER A . n 
A 1 13 GLN 13 236 236 GLN GLN A . n 
A 1 14 LYS 14 237 237 LYS LYS A . n 
A 1 15 LEU 15 238 238 LEU LEU A . n 
A 1 16 MET 16 239 239 MET MET A . n 
A 1 17 PRO 17 240 240 PRO PRO A . n 
A 1 18 GLY 18 241 241 GLY GLY A . n 
A 1 19 SER 19 242 242 SER SER A . n 
A 1 20 THR 20 243 243 THR THR A . n 
A 1 21 LEU 21 244 244 LEU LEU A . n 
A 1 22 VAL 22 245 245 VAL VAL A . n 
A 1 23 LEU 23 246 246 LEU LEU A . n 
A 1 24 GLN 24 247 247 GLN GLN A . n 
A 1 25 CYS 25 248 248 CYS CYS A . n 
A 1 26 VAL 26 249 249 VAL VAL A . n 
A 1 27 ALA 27 250 250 ALA ALA A . n 
A 1 28 VAL 28 251 251 VAL VAL A . n 
A 1 29 GLY 29 252 252 GLY GLY A . n 
A 1 30 SER 30 253 253 SER SER A . n 
A 1 31 PRO 31 254 254 PRO PRO A . n 
A 1 32 ILE 32 255 255 ILE ILE A . n 
A 1 33 PRO 33 256 256 PRO PRO A . n 
A 1 34 HIS 34 257 257 HIS HIS A . n 
A 1 35 TYR 35 258 258 TYR TYR A . n 
A 1 36 GLN 36 259 259 GLN GLN A . n 
A 1 37 TRP 37 260 260 TRP TRP A . n 
A 1 38 PHE 38 261 261 PHE PHE A . n 
A 1 39 LYS 39 262 262 LYS LYS A . n 
A 1 40 ASN 40 263 263 ASN ASN A . n 
A 1 41 GLU 41 264 264 GLU GLU A . n 
A 1 42 LEU 42 265 265 LEU LEU A . n 
A 1 43 PRO 43 266 266 PRO PRO A . n 
A 1 44 LEU 44 267 267 LEU LEU A . n 
A 1 45 THR 45 268 268 THR THR A . n 
A 1 46 HIS 46 269 269 HIS HIS A . n 
A 1 47 GLU 47 270 270 GLU GLU A . n 
A 1 48 THR 48 271 271 THR THR A . n 
A 1 49 LYS 49 272 272 LYS LYS A . n 
A 1 50 LYS 50 273 273 LYS LYS A . n 
A 1 51 LEU 51 274 274 LEU LEU A . n 
A 1 52 TYR 52 275 275 TYR TYR A . n 
A 1 53 MET 53 276 276 MET MET A . n 
A 1 54 VAL 54 277 277 VAL VAL A . n 
A 1 55 PRO 55 278 278 PRO PRO A . n 
A 1 56 TYR 56 279 279 TYR TYR A . n 
A 1 57 VAL 57 280 280 VAL VAL A . n 
A 1 58 ASP 58 281 281 ASP ASP A . n 
A 1 59 LEU 59 282 282 LEU LEU A . n 
A 1 60 GLU 60 283 283 GLU GLU A . n 
A 1 61 HIS 61 284 284 HIS HIS A . n 
A 1 62 GLN 62 285 285 GLN GLN A . n 
A 1 63 GLY 63 286 286 GLY GLY A . n 
A 1 64 THR 64 287 287 THR THR A . n 
A 1 65 TYR 65 288 288 TYR TYR A . n 
A 1 66 TRP 66 289 289 TRP TRP A . n 
A 1 67 CYS 67 290 290 CYS CYS A . n 
A 1 68 HIS 68 291 291 HIS HIS A . n 
A 1 69 VAL 69 292 292 VAL VAL A . n 
A 1 70 TYR 70 293 293 TYR TYR A . n 
A 1 71 ASN 71 294 294 ASN ASN A . n 
A 1 72 ASP 72 295 295 ASP ASP A . n 
A 1 73 ARG 73 296 296 ARG ARG A . n 
A 1 74 ASP 74 297 297 ASP ASP A . n 
A 1 75 SER 75 298 298 SER SER A . n 
A 1 76 GLN 76 299 299 GLN GLN A . n 
A 1 77 ASP 77 300 300 ASP ASP A . n 
A 1 78 SER 78 301 301 SER SER A . n 
A 1 79 LYS 79 302 302 LYS LYS A . n 
A 1 80 LYS 80 303 303 LYS LYS A . n 
A 1 81 VAL 81 304 304 VAL VAL A . n 
A 1 82 GLU 82 305 305 GLU GLU A . n 
A 1 83 ILE 83 306 306 ILE ILE A . n 
A 1 84 ILE 84 307 307 ILE ILE A . n 
A 1 85 ILE 85 308 308 ILE ILE A . n 
A 1 86 ASP 86 309 309 ASP ASP A . n 
A 1 87 GLU 87 310 ?   ?   ?   A . n 
A 1 88 LEU 88 311 ?   ?   ?   A . n 
A 1 89 ASN 89 312 ?   ?   ?   A . n 
A 1 90 ASN 90 313 ?   ?   ?   A . n 
A 1 91 LEU 91 314 ?   ?   ?   A . n 
B 1 1  GLY 1  224 ?   ?   ?   B . n 
B 1 2  SER 2  225 225 SER SER B . n 
B 1 3  LYS 3  226 226 LYS LYS B . n 
B 1 4  LEU 4  227 227 LEU LEU B . n 
B 1 5  GLN 5  228 228 GLN GLN B . n 
B 1 6  ILE 6  229 229 ILE ILE B . n 
B 1 7  CYS 7  230 230 CYS CYS B . n 
B 1 8  VAL 8  231 231 VAL VAL B . n 
B 1 9  GLU 9  232 232 GLU GLU B . n 
B 1 10 PRO 10 233 233 PRO PRO B . n 
B 1 11 THR 11 234 234 THR THR B . n 
B 1 12 SER 12 235 235 SER SER B . n 
B 1 13 GLN 13 236 236 GLN GLN B . n 
B 1 14 LYS 14 237 237 LYS LYS B . n 
B 1 15 LEU 15 238 238 LEU LEU B . n 
B 1 16 MET 16 239 239 MET MET B . n 
B 1 17 PRO 17 240 240 PRO PRO B . n 
B 1 18 GLY 18 241 241 GLY GLY B . n 
B 1 19 SER 19 242 242 SER SER B . n 
B 1 20 THR 20 243 243 THR THR B . n 
B 1 21 LEU 21 244 244 LEU LEU B . n 
B 1 22 VAL 22 245 245 VAL VAL B . n 
B 1 23 LEU 23 246 246 LEU LEU B . n 
B 1 24 GLN 24 247 247 GLN GLN B . n 
B 1 25 CYS 25 248 248 CYS CYS B . n 
B 1 26 VAL 26 249 249 VAL VAL B . n 
B 1 27 ALA 27 250 250 ALA ALA B . n 
B 1 28 VAL 28 251 251 VAL VAL B . n 
B 1 29 GLY 29 252 252 GLY GLY B . n 
B 1 30 SER 30 253 253 SER SER B . n 
B 1 31 PRO 31 254 254 PRO PRO B . n 
B 1 32 ILE 32 255 255 ILE ILE B . n 
B 1 33 PRO 33 256 256 PRO PRO B . n 
B 1 34 HIS 34 257 257 HIS HIS B . n 
B 1 35 TYR 35 258 258 TYR TYR B . n 
B 1 36 GLN 36 259 259 GLN GLN B . n 
B 1 37 TRP 37 260 260 TRP TRP B . n 
B 1 38 PHE 38 261 261 PHE PHE B . n 
B 1 39 LYS 39 262 262 LYS LYS B . n 
B 1 40 ASN 40 263 263 ASN ASN B . n 
B 1 41 GLU 41 264 264 GLU GLU B . n 
B 1 42 LEU 42 265 265 LEU LEU B . n 
B 1 43 PRO 43 266 266 PRO PRO B . n 
B 1 44 LEU 44 267 267 LEU LEU B . n 
B 1 45 THR 45 268 268 THR THR B . n 
B 1 46 HIS 46 269 269 HIS HIS B . n 
B 1 47 GLU 47 270 270 GLU GLU B . n 
B 1 48 THR 48 271 271 THR THR B . n 
B 1 49 LYS 49 272 272 LYS LYS B . n 
B 1 50 LYS 50 273 273 LYS LYS B . n 
B 1 51 LEU 51 274 274 LEU LEU B . n 
B 1 52 TYR 52 275 275 TYR TYR B . n 
B 1 53 MET 53 276 276 MET MET B . n 
B 1 54 VAL 54 277 277 VAL VAL B . n 
B 1 55 PRO 55 278 278 PRO PRO B . n 
B 1 56 TYR 56 279 279 TYR TYR B . n 
B 1 57 VAL 57 280 280 VAL VAL B . n 
B 1 58 ASP 58 281 281 ASP ASP B . n 
B 1 59 LEU 59 282 282 LEU LEU B . n 
B 1 60 GLU 60 283 283 GLU GLU B . n 
B 1 61 HIS 61 284 284 HIS HIS B . n 
B 1 62 GLN 62 285 285 GLN GLN B . n 
B 1 63 GLY 63 286 286 GLY GLY B . n 
B 1 64 THR 64 287 287 THR THR B . n 
B 1 65 TYR 65 288 288 TYR TYR B . n 
B 1 66 TRP 66 289 289 TRP TRP B . n 
B 1 67 CYS 67 290 290 CYS CYS B . n 
B 1 68 HIS 68 291 291 HIS HIS B . n 
B 1 69 VAL 69 292 292 VAL VAL B . n 
B 1 70 TYR 70 293 293 TYR TYR B . n 
B 1 71 ASN 71 294 294 ASN ASN B . n 
B 1 72 ASP 72 295 295 ASP ASP B . n 
B 1 73 ARG 73 296 296 ARG ARG B . n 
B 1 74 ASP 74 297 297 ASP ASP B . n 
B 1 75 SER 75 298 298 SER SER B . n 
B 1 76 GLN 76 299 299 GLN GLN B . n 
B 1 77 ASP 77 300 300 ASP ASP B . n 
B 1 78 SER 78 301 301 SER SER B . n 
B 1 79 LYS 79 302 302 LYS LYS B . n 
B 1 80 LYS 80 303 303 LYS LYS B . n 
B 1 81 VAL 81 304 304 VAL VAL B . n 
B 1 82 GLU 82 305 305 GLU GLU B . n 
B 1 83 ILE 83 306 306 ILE ILE B . n 
B 1 84 ILE 84 307 307 ILE ILE B . n 
B 1 85 ILE 85 308 308 ILE ILE B . n 
B 1 86 ASP 86 309 309 ASP ASP B . n 
B 1 87 GLU 87 310 ?   ?   ?   B . n 
B 1 88 LEU 88 311 ?   ?   ?   B . n 
B 1 89 ASN 89 312 ?   ?   ?   B . n 
B 1 90 ASN 90 313 ?   ?   ?   B . n 
B 1 91 LEU 91 314 ?   ?   ?   B . n 
C 1 1  GLY 1  224 ?   ?   ?   C . n 
C 1 2  SER 2  225 225 SER SER C . n 
C 1 3  LYS 3  226 226 LYS LYS C . n 
C 1 4  LEU 4  227 227 LEU LEU C . n 
C 1 5  GLN 5  228 228 GLN GLN C . n 
C 1 6  ILE 6  229 229 ILE ILE C . n 
C 1 7  CYS 7  230 230 CYS CYS C . n 
C 1 8  VAL 8  231 231 VAL VAL C . n 
C 1 9  GLU 9  232 232 GLU GLU C . n 
C 1 10 PRO 10 233 233 PRO PRO C . n 
C 1 11 THR 11 234 234 THR THR C . n 
C 1 12 SER 12 235 235 SER SER C . n 
C 1 13 GLN 13 236 236 GLN GLN C . n 
C 1 14 LYS 14 237 237 LYS LYS C . n 
C 1 15 LEU 15 238 238 LEU LEU C . n 
C 1 16 MET 16 239 239 MET MET C . n 
C 1 17 PRO 17 240 240 PRO PRO C . n 
C 1 18 GLY 18 241 241 GLY GLY C . n 
C 1 19 SER 19 242 242 SER SER C . n 
C 1 20 THR 20 243 243 THR THR C . n 
C 1 21 LEU 21 244 244 LEU LEU C . n 
C 1 22 VAL 22 245 245 VAL VAL C . n 
C 1 23 LEU 23 246 246 LEU LEU C . n 
C 1 24 GLN 24 247 247 GLN GLN C . n 
C 1 25 CYS 25 248 248 CYS CYS C . n 
C 1 26 VAL 26 249 249 VAL VAL C . n 
C 1 27 ALA 27 250 250 ALA ALA C . n 
C 1 28 VAL 28 251 251 VAL VAL C . n 
C 1 29 GLY 29 252 252 GLY GLY C . n 
C 1 30 SER 30 253 253 SER SER C . n 
C 1 31 PRO 31 254 254 PRO PRO C . n 
C 1 32 ILE 32 255 255 ILE ILE C . n 
C 1 33 PRO 33 256 256 PRO PRO C . n 
C 1 34 HIS 34 257 257 HIS HIS C . n 
C 1 35 TYR 35 258 258 TYR TYR C . n 
C 1 36 GLN 36 259 259 GLN GLN C . n 
C 1 37 TRP 37 260 260 TRP TRP C . n 
C 1 38 PHE 38 261 261 PHE PHE C . n 
C 1 39 LYS 39 262 262 LYS LYS C . n 
C 1 40 ASN 40 263 263 ASN ASN C . n 
C 1 41 GLU 41 264 264 GLU GLU C . n 
C 1 42 LEU 42 265 265 LEU LEU C . n 
C 1 43 PRO 43 266 266 PRO PRO C . n 
C 1 44 LEU 44 267 267 LEU LEU C . n 
C 1 45 THR 45 268 268 THR THR C . n 
C 1 46 HIS 46 269 269 HIS HIS C . n 
C 1 47 GLU 47 270 270 GLU GLU C . n 
C 1 48 THR 48 271 271 THR THR C . n 
C 1 49 LYS 49 272 272 LYS LYS C . n 
C 1 50 LYS 50 273 273 LYS LYS C . n 
C 1 51 LEU 51 274 274 LEU LEU C . n 
C 1 52 TYR 52 275 275 TYR TYR C . n 
C 1 53 MET 53 276 276 MET MET C . n 
C 1 54 VAL 54 277 277 VAL VAL C . n 
C 1 55 PRO 55 278 278 PRO PRO C . n 
C 1 56 TYR 56 279 279 TYR TYR C . n 
C 1 57 VAL 57 280 280 VAL VAL C . n 
C 1 58 ASP 58 281 281 ASP ASP C . n 
C 1 59 LEU 59 282 282 LEU LEU C . n 
C 1 60 GLU 60 283 283 GLU GLU C . n 
C 1 61 HIS 61 284 284 HIS HIS C . n 
C 1 62 GLN 62 285 285 GLN GLN C . n 
C 1 63 GLY 63 286 286 GLY GLY C . n 
C 1 64 THR 64 287 287 THR THR C . n 
C 1 65 TYR 65 288 288 TYR TYR C . n 
C 1 66 TRP 66 289 289 TRP TRP C . n 
C 1 67 CYS 67 290 290 CYS CYS C . n 
C 1 68 HIS 68 291 291 HIS HIS C . n 
C 1 69 VAL 69 292 292 VAL VAL C . n 
C 1 70 TYR 70 293 293 TYR TYR C . n 
C 1 71 ASN 71 294 294 ASN ASN C . n 
C 1 72 ASP 72 295 295 ASP ASP C . n 
C 1 73 ARG 73 296 296 ARG ARG C . n 
C 1 74 ASP 74 297 297 ASP ASP C . n 
C 1 75 SER 75 298 298 SER SER C . n 
C 1 76 GLN 76 299 299 GLN GLN C . n 
C 1 77 ASP 77 300 300 ASP ASP C . n 
C 1 78 SER 78 301 301 SER SER C . n 
C 1 79 LYS 79 302 302 LYS LYS C . n 
C 1 80 LYS 80 303 303 LYS LYS C . n 
C 1 81 VAL 81 304 304 VAL VAL C . n 
C 1 82 GLU 82 305 305 GLU GLU C . n 
C 1 83 ILE 83 306 306 ILE ILE C . n 
C 1 84 ILE 84 307 307 ILE ILE C . n 
C 1 85 ILE 85 308 308 ILE ILE C . n 
C 1 86 ASP 86 309 309 ASP ASP C . n 
C 1 87 GLU 87 310 ?   ?   ?   C . n 
C 1 88 LEU 88 311 ?   ?   ?   C . n 
C 1 89 ASN 89 312 ?   ?   ?   C . n 
C 1 90 ASN 90 313 ?   ?   ?   C . n 
C 1 91 LEU 91 314 ?   ?   ?   C . n 
D 1 1  GLY 1  224 ?   ?   ?   D . n 
D 1 2  SER 2  225 225 SER SER D . n 
D 1 3  LYS 3  226 226 LYS LYS D . n 
D 1 4  LEU 4  227 227 LEU LEU D . n 
D 1 5  GLN 5  228 228 GLN GLN D . n 
D 1 6  ILE 6  229 229 ILE ILE D . n 
D 1 7  CYS 7  230 230 CYS CYS D . n 
D 1 8  VAL 8  231 231 VAL VAL D . n 
D 1 9  GLU 9  232 232 GLU GLU D . n 
D 1 10 PRO 10 233 233 PRO PRO D . n 
D 1 11 THR 11 234 234 THR THR D . n 
D 1 12 SER 12 235 235 SER SER D . n 
D 1 13 GLN 13 236 236 GLN GLN D . n 
D 1 14 LYS 14 237 237 LYS LYS D . n 
D 1 15 LEU 15 238 238 LEU LEU D . n 
D 1 16 MET 16 239 239 MET MET D . n 
D 1 17 PRO 17 240 240 PRO PRO D . n 
D 1 18 GLY 18 241 241 GLY GLY D . n 
D 1 19 SER 19 242 242 SER SER D . n 
D 1 20 THR 20 243 243 THR THR D . n 
D 1 21 LEU 21 244 244 LEU LEU D . n 
D 1 22 VAL 22 245 245 VAL VAL D . n 
D 1 23 LEU 23 246 246 LEU LEU D . n 
D 1 24 GLN 24 247 247 GLN GLN D . n 
D 1 25 CYS 25 248 248 CYS CYS D . n 
D 1 26 VAL 26 249 249 VAL VAL D . n 
D 1 27 ALA 27 250 250 ALA ALA D . n 
D 1 28 VAL 28 251 251 VAL VAL D . n 
D 1 29 GLY 29 252 252 GLY GLY D . n 
D 1 30 SER 30 253 253 SER SER D . n 
D 1 31 PRO 31 254 254 PRO PRO D . n 
D 1 32 ILE 32 255 255 ILE ILE D . n 
D 1 33 PRO 33 256 256 PRO PRO D . n 
D 1 34 HIS 34 257 257 HIS HIS D . n 
D 1 35 TYR 35 258 258 TYR TYR D . n 
D 1 36 GLN 36 259 259 GLN GLN D . n 
D 1 37 TRP 37 260 260 TRP TRP D . n 
D 1 38 PHE 38 261 261 PHE PHE D . n 
D 1 39 LYS 39 262 262 LYS LYS D . n 
D 1 40 ASN 40 263 263 ASN ASN D . n 
D 1 41 GLU 41 264 264 GLU GLU D . n 
D 1 42 LEU 42 265 265 LEU LEU D . n 
D 1 43 PRO 43 266 266 PRO PRO D . n 
D 1 44 LEU 44 267 267 LEU LEU D . n 
D 1 45 THR 45 268 268 THR THR D . n 
D 1 46 HIS 46 269 269 HIS HIS D . n 
D 1 47 GLU 47 270 270 GLU GLU D . n 
D 1 48 THR 48 271 271 THR THR D . n 
D 1 49 LYS 49 272 272 LYS LYS D . n 
D 1 50 LYS 50 273 273 LYS LYS D . n 
D 1 51 LEU 51 274 274 LEU LEU D . n 
D 1 52 TYR 52 275 275 TYR TYR D . n 
D 1 53 MET 53 276 276 MET MET D . n 
D 1 54 VAL 54 277 277 VAL VAL D . n 
D 1 55 PRO 55 278 278 PRO PRO D . n 
D 1 56 TYR 56 279 279 TYR TYR D . n 
D 1 57 VAL 57 280 280 VAL VAL D . n 
D 1 58 ASP 58 281 281 ASP ASP D . n 
D 1 59 LEU 59 282 282 LEU LEU D . n 
D 1 60 GLU 60 283 283 GLU GLU D . n 
D 1 61 HIS 61 284 284 HIS HIS D . n 
D 1 62 GLN 62 285 285 GLN GLN D . n 
D 1 63 GLY 63 286 286 GLY GLY D . n 
D 1 64 THR 64 287 287 THR THR D . n 
D 1 65 TYR 65 288 288 TYR TYR D . n 
D 1 66 TRP 66 289 289 TRP TRP D . n 
D 1 67 CYS 67 290 290 CYS CYS D . n 
D 1 68 HIS 68 291 291 HIS HIS D . n 
D 1 69 VAL 69 292 292 VAL VAL D . n 
D 1 70 TYR 70 293 293 TYR TYR D . n 
D 1 71 ASN 71 294 294 ASN ASN D . n 
D 1 72 ASP 72 295 295 ASP ASP D . n 
D 1 73 ARG 73 296 296 ARG ARG D . n 
D 1 74 ASP 74 297 297 ASP ASP D . n 
D 1 75 SER 75 298 298 SER SER D . n 
D 1 76 GLN 76 299 299 GLN GLN D . n 
D 1 77 ASP 77 300 300 ASP ASP D . n 
D 1 78 SER 78 301 301 SER SER D . n 
D 1 79 LYS 79 302 302 LYS LYS D . n 
D 1 80 LYS 80 303 303 LYS LYS D . n 
D 1 81 VAL 81 304 304 VAL VAL D . n 
D 1 82 GLU 82 305 305 GLU GLU D . n 
D 1 83 ILE 83 306 306 ILE ILE D . n 
D 1 84 ILE 84 307 307 ILE ILE D . n 
D 1 85 ILE 85 308 308 ILE ILE D . n 
D 1 86 ASP 86 309 309 ASP ASP D . n 
D 1 87 GLU 87 310 ?   ?   ?   D . n 
D 1 88 LEU 88 311 ?   ?   ?   D . n 
D 1 89 ASN 89 312 ?   ?   ?   D . n 
D 1 90 ASN 90 313 ?   ?   ?   D . n 
D 1 91 LEU 91 314 ?   ?   ?   D . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 HOH 1   315 4   HOH HOH A . 
E 2 HOH 2   316 11  HOH HOH A . 
E 2 HOH 3   317 15  HOH HOH A . 
E 2 HOH 4   318 19  HOH HOH A . 
E 2 HOH 5   319 23  HOH HOH A . 
E 2 HOH 6   320 24  HOH HOH A . 
E 2 HOH 7   321 26  HOH HOH A . 
E 2 HOH 8   322 27  HOH HOH A . 
E 2 HOH 9   323 38  HOH HOH A . 
E 2 HOH 10  324 41  HOH HOH A . 
E 2 HOH 11  325 49  HOH HOH A . 
E 2 HOH 12  326 54  HOH HOH A . 
E 2 HOH 13  327 57  HOH HOH A . 
E 2 HOH 14  328 58  HOH HOH A . 
E 2 HOH 15  329 62  HOH HOH A . 
E 2 HOH 16  330 74  HOH HOH A . 
E 2 HOH 17  331 86  HOH HOH A . 
E 2 HOH 18  332 88  HOH HOH A . 
E 2 HOH 19  333 90  HOH HOH A . 
E 2 HOH 20  334 91  HOH HOH A . 
E 2 HOH 21  335 110 HOH HOH A . 
E 2 HOH 22  336 117 HOH HOH A . 
E 2 HOH 23  337 119 HOH HOH A . 
E 2 HOH 24  338 123 HOH HOH A . 
E 2 HOH 25  339 125 HOH HOH A . 
E 2 HOH 26  340 126 HOH HOH A . 
E 2 HOH 27  341 130 HOH HOH A . 
E 2 HOH 28  342 131 HOH HOH A . 
E 2 HOH 29  343 133 HOH HOH A . 
E 2 HOH 30  344 134 HOH HOH A . 
E 2 HOH 31  345 136 HOH HOH A . 
E 2 HOH 32  346 138 HOH HOH A . 
E 2 HOH 33  347 139 HOH HOH A . 
E 2 HOH 34  348 144 HOH HOH A . 
E 2 HOH 35  349 145 HOH HOH A . 
E 2 HOH 36  350 147 HOH HOH A . 
E 2 HOH 37  351 148 HOH HOH A . 
E 2 HOH 38  352 150 HOH HOH A . 
E 2 HOH 39  353 156 HOH HOH A . 
E 2 HOH 40  354 159 HOH HOH A . 
E 2 HOH 41  355 160 HOH HOH A . 
E 2 HOH 42  356 161 HOH HOH A . 
E 2 HOH 43  357 163 HOH HOH A . 
E 2 HOH 44  358 165 HOH HOH A . 
E 2 HOH 45  359 187 HOH HOH A . 
E 2 HOH 46  360 188 HOH HOH A . 
E 2 HOH 47  361 193 HOH HOH A . 
E 2 HOH 48  362 196 HOH HOH A . 
E 2 HOH 49  363 198 HOH HOH A . 
E 2 HOH 50  364 207 HOH HOH A . 
E 2 HOH 51  365 215 HOH HOH A . 
E 2 HOH 52  366 217 HOH HOH A . 
E 2 HOH 53  367 220 HOH HOH A . 
E 2 HOH 54  368 225 HOH HOH A . 
E 2 HOH 55  369 232 HOH HOH A . 
E 2 HOH 56  370 237 HOH HOH A . 
E 2 HOH 57  371 239 HOH HOH A . 
E 2 HOH 58  372 253 HOH HOH A . 
E 2 HOH 59  373 255 HOH HOH A . 
E 2 HOH 60  374 256 HOH HOH A . 
E 2 HOH 61  375 265 HOH HOH A . 
E 2 HOH 62  376 269 HOH HOH A . 
E 2 HOH 63  377 272 HOH HOH A . 
E 2 HOH 64  378 274 HOH HOH A . 
E 2 HOH 65  379 276 HOH HOH A . 
E 2 HOH 66  380 284 HOH HOH A . 
E 2 HOH 67  381 308 HOH HOH A . 
E 2 HOH 68  382 311 HOH HOH A . 
E 2 HOH 69  383 312 HOH HOH A . 
E 2 HOH 70  384 314 HOH HOH A . 
E 2 HOH 71  385 315 HOH HOH A . 
E 2 HOH 72  386 316 HOH HOH A . 
E 2 HOH 73  387 317 HOH HOH A . 
E 2 HOH 74  388 318 HOH HOH A . 
E 2 HOH 75  389 319 HOH HOH A . 
E 2 HOH 76  390 321 HOH HOH A . 
E 2 HOH 77  391 322 HOH HOH A . 
E 2 HOH 78  392 324 HOH HOH A . 
E 2 HOH 79  393 329 HOH HOH A . 
E 2 HOH 80  394 334 HOH HOH A . 
E 2 HOH 81  395 335 HOH HOH A . 
E 2 HOH 82  396 336 HOH HOH A . 
E 2 HOH 83  397 340 HOH HOH A . 
E 2 HOH 84  398 341 HOH HOH A . 
E 2 HOH 85  399 345 HOH HOH A . 
E 2 HOH 86  400 348 HOH HOH A . 
E 2 HOH 87  401 350 HOH HOH A . 
E 2 HOH 88  402 356 HOH HOH A . 
E 2 HOH 89  403 359 HOH HOH A . 
E 2 HOH 90  404 361 HOH HOH A . 
E 2 HOH 91  405 362 HOH HOH A . 
E 2 HOH 92  406 375 HOH HOH A . 
E 2 HOH 93  407 378 HOH HOH A . 
E 2 HOH 94  408 387 HOH HOH A . 
E 2 HOH 95  409 394 HOH HOH A . 
E 2 HOH 96  410 395 HOH HOH A . 
F 2 HOH 1   315 2   HOH HOH B . 
F 2 HOH 2   316 3   HOH HOH B . 
F 2 HOH 3   317 7   HOH HOH B . 
F 2 HOH 4   318 10  HOH HOH B . 
F 2 HOH 5   319 25  HOH HOH B . 
F 2 HOH 6   320 28  HOH HOH B . 
F 2 HOH 7   321 31  HOH HOH B . 
F 2 HOH 8   322 32  HOH HOH B . 
F 2 HOH 9   323 35  HOH HOH B . 
F 2 HOH 10  324 42  HOH HOH B . 
F 2 HOH 11  325 44  HOH HOH B . 
F 2 HOH 12  326 48  HOH HOH B . 
F 2 HOH 13  327 51  HOH HOH B . 
F 2 HOH 14  328 56  HOH HOH B . 
F 2 HOH 15  329 59  HOH HOH B . 
F 2 HOH 16  330 63  HOH HOH B . 
F 2 HOH 17  331 64  HOH HOH B . 
F 2 HOH 18  332 68  HOH HOH B . 
F 2 HOH 19  333 73  HOH HOH B . 
F 2 HOH 20  334 79  HOH HOH B . 
F 2 HOH 21  335 89  HOH HOH B . 
F 2 HOH 22  336 92  HOH HOH B . 
F 2 HOH 23  337 93  HOH HOH B . 
F 2 HOH 24  338 98  HOH HOH B . 
F 2 HOH 25  339 99  HOH HOH B . 
F 2 HOH 26  340 103 HOH HOH B . 
F 2 HOH 27  341 107 HOH HOH B . 
F 2 HOH 28  342 111 HOH HOH B . 
F 2 HOH 29  343 113 HOH HOH B . 
F 2 HOH 30  344 114 HOH HOH B . 
F 2 HOH 31  345 116 HOH HOH B . 
F 2 HOH 32  346 120 HOH HOH B . 
F 2 HOH 33  347 122 HOH HOH B . 
F 2 HOH 34  348 129 HOH HOH B . 
F 2 HOH 35  349 141 HOH HOH B . 
F 2 HOH 36  350 151 HOH HOH B . 
F 2 HOH 37  351 153 HOH HOH B . 
F 2 HOH 38  352 162 HOH HOH B . 
F 2 HOH 39  353 166 HOH HOH B . 
F 2 HOH 40  354 167 HOH HOH B . 
F 2 HOH 41  355 170 HOH HOH B . 
F 2 HOH 42  356 171 HOH HOH B . 
F 2 HOH 43  357 175 HOH HOH B . 
F 2 HOH 44  358 179 HOH HOH B . 
F 2 HOH 45  359 185 HOH HOH B . 
F 2 HOH 46  360 190 HOH HOH B . 
F 2 HOH 47  361 199 HOH HOH B . 
F 2 HOH 48  362 200 HOH HOH B . 
F 2 HOH 49  363 202 HOH HOH B . 
F 2 HOH 50  364 208 HOH HOH B . 
F 2 HOH 51  365 213 HOH HOH B . 
F 2 HOH 52  366 218 HOH HOH B . 
F 2 HOH 53  367 219 HOH HOH B . 
F 2 HOH 54  368 222 HOH HOH B . 
F 2 HOH 55  369 226 HOH HOH B . 
F 2 HOH 56  370 229 HOH HOH B . 
F 2 HOH 57  371 241 HOH HOH B . 
F 2 HOH 58  372 252 HOH HOH B . 
F 2 HOH 59  373 254 HOH HOH B . 
F 2 HOH 60  374 258 HOH HOH B . 
F 2 HOH 61  375 260 HOH HOH B . 
F 2 HOH 62  376 266 HOH HOH B . 
F 2 HOH 63  377 268 HOH HOH B . 
F 2 HOH 64  378 275 HOH HOH B . 
F 2 HOH 65  379 277 HOH HOH B . 
F 2 HOH 66  380 280 HOH HOH B . 
F 2 HOH 67  381 281 HOH HOH B . 
F 2 HOH 68  382 282 HOH HOH B . 
F 2 HOH 69  383 285 HOH HOH B . 
F 2 HOH 70  384 286 HOH HOH B . 
F 2 HOH 71  385 288 HOH HOH B . 
F 2 HOH 72  386 292 HOH HOH B . 
F 2 HOH 73  387 300 HOH HOH B . 
F 2 HOH 74  388 302 HOH HOH B . 
F 2 HOH 75  389 309 HOH HOH B . 
F 2 HOH 76  390 320 HOH HOH B . 
F 2 HOH 77  391 325 HOH HOH B . 
F 2 HOH 78  392 327 HOH HOH B . 
F 2 HOH 79  393 333 HOH HOH B . 
F 2 HOH 80  394 342 HOH HOH B . 
F 2 HOH 81  395 344 HOH HOH B . 
F 2 HOH 82  396 346 HOH HOH B . 
F 2 HOH 83  397 347 HOH HOH B . 
F 2 HOH 84  398 349 HOH HOH B . 
F 2 HOH 85  399 353 HOH HOH B . 
F 2 HOH 86  400 364 HOH HOH B . 
F 2 HOH 87  401 367 HOH HOH B . 
F 2 HOH 88  402 370 HOH HOH B . 
F 2 HOH 89  403 372 HOH HOH B . 
F 2 HOH 90  404 373 HOH HOH B . 
F 2 HOH 91  405 377 HOH HOH B . 
F 2 HOH 92  406 379 HOH HOH B . 
F 2 HOH 93  407 382 HOH HOH B . 
F 2 HOH 94  408 383 HOH HOH B . 
F 2 HOH 95  409 386 HOH HOH B . 
F 2 HOH 96  410 388 HOH HOH B . 
F 2 HOH 97  411 389 HOH HOH B . 
F 2 HOH 98  412 393 HOH HOH B . 
F 2 HOH 99  413 396 HOH HOH B . 
F 2 HOH 100 414 397 HOH HOH B . 
G 2 HOH 1   315 8   HOH HOH C . 
G 2 HOH 2   316 9   HOH HOH C . 
G 2 HOH 3   317 13  HOH HOH C . 
G 2 HOH 4   318 16  HOH HOH C . 
G 2 HOH 5   319 20  HOH HOH C . 
G 2 HOH 6   320 21  HOH HOH C . 
G 2 HOH 7   321 22  HOH HOH C . 
G 2 HOH 8   322 36  HOH HOH C . 
G 2 HOH 9   323 37  HOH HOH C . 
G 2 HOH 10  324 39  HOH HOH C . 
G 2 HOH 11  325 40  HOH HOH C . 
G 2 HOH 12  326 43  HOH HOH C . 
G 2 HOH 13  327 50  HOH HOH C . 
G 2 HOH 14  328 52  HOH HOH C . 
G 2 HOH 15  329 53  HOH HOH C . 
G 2 HOH 16  330 55  HOH HOH C . 
G 2 HOH 17  331 60  HOH HOH C . 
G 2 HOH 18  332 61  HOH HOH C . 
G 2 HOH 19  333 65  HOH HOH C . 
G 2 HOH 20  334 70  HOH HOH C . 
G 2 HOH 21  335 76  HOH HOH C . 
G 2 HOH 22  336 78  HOH HOH C . 
G 2 HOH 23  337 81  HOH HOH C . 
G 2 HOH 24  338 83  HOH HOH C . 
G 2 HOH 25  339 94  HOH HOH C . 
G 2 HOH 26  340 97  HOH HOH C . 
G 2 HOH 27  341 101 HOH HOH C . 
G 2 HOH 28  342 102 HOH HOH C . 
G 2 HOH 29  343 105 HOH HOH C . 
G 2 HOH 30  344 106 HOH HOH C . 
G 2 HOH 31  345 108 HOH HOH C . 
G 2 HOH 32  346 109 HOH HOH C . 
G 2 HOH 33  347 112 HOH HOH C . 
G 2 HOH 34  348 115 HOH HOH C . 
G 2 HOH 35  349 118 HOH HOH C . 
G 2 HOH 36  350 121 HOH HOH C . 
G 2 HOH 37  351 124 HOH HOH C . 
G 2 HOH 38  352 127 HOH HOH C . 
G 2 HOH 39  353 140 HOH HOH C . 
G 2 HOH 40  354 143 HOH HOH C . 
G 2 HOH 41  355 157 HOH HOH C . 
G 2 HOH 42  356 164 HOH HOH C . 
G 2 HOH 43  357 169 HOH HOH C . 
G 2 HOH 44  358 173 HOH HOH C . 
G 2 HOH 45  359 174 HOH HOH C . 
G 2 HOH 46  360 176 HOH HOH C . 
G 2 HOH 47  361 182 HOH HOH C . 
G 2 HOH 48  362 183 HOH HOH C . 
G 2 HOH 49  363 186 HOH HOH C . 
G 2 HOH 50  364 192 HOH HOH C . 
G 2 HOH 51  365 194 HOH HOH C . 
G 2 HOH 52  366 195 HOH HOH C . 
G 2 HOH 53  367 203 HOH HOH C . 
G 2 HOH 54  368 204 HOH HOH C . 
G 2 HOH 55  369 210 HOH HOH C . 
G 2 HOH 56  370 211 HOH HOH C . 
G 2 HOH 57  371 216 HOH HOH C . 
G 2 HOH 58  372 221 HOH HOH C . 
G 2 HOH 59  373 224 HOH HOH C . 
G 2 HOH 60  374 228 HOH HOH C . 
G 2 HOH 61  375 230 HOH HOH C . 
G 2 HOH 62  376 233 HOH HOH C . 
G 2 HOH 63  377 242 HOH HOH C . 
G 2 HOH 64  378 243 HOH HOH C . 
G 2 HOH 65  379 248 HOH HOH C . 
G 2 HOH 66  380 249 HOH HOH C . 
G 2 HOH 67  381 251 HOH HOH C . 
G 2 HOH 68  382 261 HOH HOH C . 
G 2 HOH 69  383 262 HOH HOH C . 
G 2 HOH 70  384 263 HOH HOH C . 
G 2 HOH 71  385 271 HOH HOH C . 
G 2 HOH 72  386 283 HOH HOH C . 
G 2 HOH 73  387 290 HOH HOH C . 
G 2 HOH 74  388 291 HOH HOH C . 
G 2 HOH 75  389 293 HOH HOH C . 
G 2 HOH 76  390 295 HOH HOH C . 
G 2 HOH 77  391 296 HOH HOH C . 
G 2 HOH 78  392 297 HOH HOH C . 
G 2 HOH 79  393 299 HOH HOH C . 
G 2 HOH 80  394 303 HOH HOH C . 
G 2 HOH 81  395 304 HOH HOH C . 
G 2 HOH 82  396 306 HOH HOH C . 
G 2 HOH 83  397 307 HOH HOH C . 
G 2 HOH 84  398 323 HOH HOH C . 
G 2 HOH 85  399 328 HOH HOH C . 
G 2 HOH 86  400 330 HOH HOH C . 
G 2 HOH 87  401 331 HOH HOH C . 
G 2 HOH 88  402 338 HOH HOH C . 
G 2 HOH 89  403 339 HOH HOH C . 
G 2 HOH 90  404 355 HOH HOH C . 
G 2 HOH 91  405 357 HOH HOH C . 
G 2 HOH 92  406 358 HOH HOH C . 
G 2 HOH 93  407 360 HOH HOH C . 
G 2 HOH 94  408 363 HOH HOH C . 
G 2 HOH 95  409 365 HOH HOH C . 
G 2 HOH 96  410 366 HOH HOH C . 
G 2 HOH 97  411 368 HOH HOH C . 
G 2 HOH 98  412 371 HOH HOH C . 
G 2 HOH 99  413 381 HOH HOH C . 
G 2 HOH 100 414 385 HOH HOH C . 
G 2 HOH 101 415 390 HOH HOH C . 
G 2 HOH 102 416 391 HOH HOH C . 
G 2 HOH 103 417 392 HOH HOH C . 
G 2 HOH 104 418 398 HOH HOH C . 
H 2 HOH 1   315 1   HOH HOH D . 
H 2 HOH 2   316 5   HOH HOH D . 
H 2 HOH 3   317 6   HOH HOH D . 
H 2 HOH 4   318 12  HOH HOH D . 
H 2 HOH 5   319 14  HOH HOH D . 
H 2 HOH 6   320 17  HOH HOH D . 
H 2 HOH 7   321 18  HOH HOH D . 
H 2 HOH 8   322 29  HOH HOH D . 
H 2 HOH 9   323 30  HOH HOH D . 
H 2 HOH 10  324 33  HOH HOH D . 
H 2 HOH 11  325 34  HOH HOH D . 
H 2 HOH 12  326 45  HOH HOH D . 
H 2 HOH 13  327 46  HOH HOH D . 
H 2 HOH 14  328 47  HOH HOH D . 
H 2 HOH 15  329 66  HOH HOH D . 
H 2 HOH 16  330 67  HOH HOH D . 
H 2 HOH 17  331 69  HOH HOH D . 
H 2 HOH 18  332 71  HOH HOH D . 
H 2 HOH 19  333 72  HOH HOH D . 
H 2 HOH 20  334 75  HOH HOH D . 
H 2 HOH 21  335 77  HOH HOH D . 
H 2 HOH 22  336 80  HOH HOH D . 
H 2 HOH 23  337 82  HOH HOH D . 
H 2 HOH 24  338 84  HOH HOH D . 
H 2 HOH 25  339 85  HOH HOH D . 
H 2 HOH 26  340 87  HOH HOH D . 
H 2 HOH 27  341 95  HOH HOH D . 
H 2 HOH 28  342 96  HOH HOH D . 
H 2 HOH 29  343 100 HOH HOH D . 
H 2 HOH 30  344 104 HOH HOH D . 
H 2 HOH 31  345 128 HOH HOH D . 
H 2 HOH 32  346 132 HOH HOH D . 
H 2 HOH 33  347 135 HOH HOH D . 
H 2 HOH 34  348 137 HOH HOH D . 
H 2 HOH 35  349 142 HOH HOH D . 
H 2 HOH 36  350 146 HOH HOH D . 
H 2 HOH 37  351 149 HOH HOH D . 
H 2 HOH 38  352 152 HOH HOH D . 
H 2 HOH 39  353 154 HOH HOH D . 
H 2 HOH 40  354 155 HOH HOH D . 
H 2 HOH 41  355 158 HOH HOH D . 
H 2 HOH 42  356 168 HOH HOH D . 
H 2 HOH 43  357 172 HOH HOH D . 
H 2 HOH 44  358 177 HOH HOH D . 
H 2 HOH 45  359 178 HOH HOH D . 
H 2 HOH 46  360 180 HOH HOH D . 
H 2 HOH 47  361 181 HOH HOH D . 
H 2 HOH 48  362 184 HOH HOH D . 
H 2 HOH 49  363 189 HOH HOH D . 
H 2 HOH 50  364 191 HOH HOH D . 
H 2 HOH 51  365 197 HOH HOH D . 
H 2 HOH 52  366 201 HOH HOH D . 
H 2 HOH 53  367 205 HOH HOH D . 
H 2 HOH 54  368 206 HOH HOH D . 
H 2 HOH 55  369 209 HOH HOH D . 
H 2 HOH 56  370 212 HOH HOH D . 
H 2 HOH 57  371 214 HOH HOH D . 
H 2 HOH 58  372 223 HOH HOH D . 
H 2 HOH 59  373 227 HOH HOH D . 
H 2 HOH 60  374 231 HOH HOH D . 
H 2 HOH 61  375 234 HOH HOH D . 
H 2 HOH 62  376 235 HOH HOH D . 
H 2 HOH 63  377 236 HOH HOH D . 
H 2 HOH 64  378 238 HOH HOH D . 
H 2 HOH 65  379 240 HOH HOH D . 
H 2 HOH 66  380 244 HOH HOH D . 
H 2 HOH 67  381 245 HOH HOH D . 
H 2 HOH 68  382 246 HOH HOH D . 
H 2 HOH 69  383 247 HOH HOH D . 
H 2 HOH 70  384 250 HOH HOH D . 
H 2 HOH 71  385 257 HOH HOH D . 
H 2 HOH 72  386 259 HOH HOH D . 
H 2 HOH 73  387 264 HOH HOH D . 
H 2 HOH 74  388 267 HOH HOH D . 
H 2 HOH 75  389 270 HOH HOH D . 
H 2 HOH 76  390 273 HOH HOH D . 
H 2 HOH 77  391 278 HOH HOH D . 
H 2 HOH 78  392 279 HOH HOH D . 
H 2 HOH 79  393 287 HOH HOH D . 
H 2 HOH 80  394 289 HOH HOH D . 
H 2 HOH 81  395 294 HOH HOH D . 
H 2 HOH 82  396 298 HOH HOH D . 
H 2 HOH 83  397 301 HOH HOH D . 
H 2 HOH 84  398 305 HOH HOH D . 
H 2 HOH 85  399 310 HOH HOH D . 
H 2 HOH 86  400 313 HOH HOH D . 
H 2 HOH 87  401 326 HOH HOH D . 
H 2 HOH 88  402 332 HOH HOH D . 
H 2 HOH 89  403 337 HOH HOH D . 
H 2 HOH 90  404 343 HOH HOH D . 
H 2 HOH 91  405 351 HOH HOH D . 
H 2 HOH 92  406 352 HOH HOH D . 
H 2 HOH 93  407 354 HOH HOH D . 
H 2 HOH 94  408 369 HOH HOH D . 
H 2 HOH 95  409 374 HOH HOH D . 
H 2 HOH 96  410 376 HOH HOH D . 
H 2 HOH 97  411 380 HOH HOH D . 
H 2 HOH 98  412 384 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
3 author_and_software_defined_assembly PISA monomeric 1 
4 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,E 
2 1 B,F 
3 1 C,G 
4 1 D,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-12-11 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement        5.2.0019 ? 1 
HKL-2000 'data collection' .        ? 2 
HKL-2000 'data reduction'  .        ? 3 
HKL-2000 'data scaling'    .        ? 4 
PHASER   phasing           .        ? 5 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            C 
_pdbx_validate_rmsd_bond.auth_comp_id_1            VAL 
_pdbx_validate_rmsd_bond.auth_seq_id_1             280 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CG1 
_pdbx_validate_rmsd_bond.auth_asym_id_2            C 
_pdbx_validate_rmsd_bond.auth_comp_id_2            VAL 
_pdbx_validate_rmsd_bond.auth_seq_id_2             280 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.385 
_pdbx_validate_rmsd_bond.bond_target_value         1.524 
_pdbx_validate_rmsd_bond.bond_deviation            -0.139 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.021 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 237 ? CE  ? A LYS 14 CE  
2  1 Y 1 A LYS 237 ? NZ  ? A LYS 14 NZ  
3  1 Y 1 A HIS 269 ? CG  ? A HIS 46 CG  
4  1 Y 1 A HIS 269 ? ND1 ? A HIS 46 ND1 
5  1 Y 1 A HIS 269 ? CD2 ? A HIS 46 CD2 
6  1 Y 1 A HIS 269 ? CE1 ? A HIS 46 CE1 
7  1 Y 1 A HIS 269 ? NE2 ? A HIS 46 NE2 
8  1 Y 1 A LYS 303 ? NZ  ? A LYS 80 NZ  
9  1 Y 1 A ASP 309 ? CG  ? A ASP 86 CG  
10 1 Y 1 A ASP 309 ? OD1 ? A ASP 86 OD1 
11 1 Y 1 A ASP 309 ? OD2 ? A ASP 86 OD2 
12 1 Y 1 B HIS 269 ? CG  ? B HIS 46 CG  
13 1 Y 1 B HIS 269 ? ND1 ? B HIS 46 ND1 
14 1 Y 1 B HIS 269 ? CD2 ? B HIS 46 CD2 
15 1 Y 1 B HIS 269 ? CE1 ? B HIS 46 CE1 
16 1 Y 1 B HIS 269 ? NE2 ? B HIS 46 NE2 
17 1 Y 1 C ASP 309 ? CG  ? C ASP 86 CG  
18 1 Y 1 C ASP 309 ? OD1 ? C ASP 86 OD1 
19 1 Y 1 C ASP 309 ? OD2 ? C ASP 86 OD2 
20 1 Y 1 D ASP 309 ? CG  ? D ASP 86 CG  
21 1 Y 1 D ASP 309 ? OD1 ? D ASP 86 OD1 
22 1 Y 1 D ASP 309 ? OD2 ? D ASP 86 OD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 224 ? A GLY 1  
2  1 Y 1 A GLU 310 ? A GLU 87 
3  1 Y 1 A LEU 311 ? A LEU 88 
4  1 Y 1 A ASN 312 ? A ASN 89 
5  1 Y 1 A ASN 313 ? A ASN 90 
6  1 Y 1 A LEU 314 ? A LEU 91 
7  1 Y 1 B GLY 224 ? B GLY 1  
8  1 Y 1 B GLU 310 ? B GLU 87 
9  1 Y 1 B LEU 311 ? B LEU 88 
10 1 Y 1 B ASN 312 ? B ASN 89 
11 1 Y 1 B ASN 313 ? B ASN 90 
12 1 Y 1 B LEU 314 ? B LEU 91 
13 1 Y 1 C GLY 224 ? C GLY 1  
14 1 Y 1 C GLU 310 ? C GLU 87 
15 1 Y 1 C LEU 311 ? C LEU 88 
16 1 Y 1 C ASN 312 ? C ASN 89 
17 1 Y 1 C ASN 313 ? C ASN 90 
18 1 Y 1 C LEU 314 ? C LEU 91 
19 1 Y 1 D GLY 224 ? D GLY 1  
20 1 Y 1 D GLU 310 ? D GLU 87 
21 1 Y 1 D LEU 311 ? D LEU 88 
22 1 Y 1 D ASN 312 ? D ASN 89 
23 1 Y 1 D ASN 313 ? D ASN 90 
24 1 Y 1 D LEU 314 ? D LEU 91 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#