data_3BJY
# 
_entry.id   3BJY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3BJY         
NDB   PD1051       
RCSB  RCSB045612   
WWPDB D_1000045612 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2AQ4 
_pdbx_database_related.details        'catalytic core of Rev1 in complex with DNA and incoming nulceotide' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3BJY 
_pdbx_database_status.recvd_initial_deposition_date   2007-12-05 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nair, D.T.'     1 
'Johnson, R.E.'  2 
'Prakash, L.'    3 
'Prakash, S.'    4 
'Aggarwal, A.K.' 5 
# 
_citation.id                        primary 
_citation.title                     
'Protein-template-directed synthesis across an acrolein-derived DNA adduct by yeast Rev1 DNA polymerase' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            16 
_citation.page_first                239 
_citation.page_last                 245 
_citation.year                      2008 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18275815 
_citation.pdbx_database_id_DOI      10.1016/j.str.2007.12.009 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nair, D.T.'     1 
primary 'Johnson, R.E.'  2 
primary 'Prakash, L.'    3 
primary 'Prakash, S.'    4 
primary 'Aggarwal, A.K.' 5 
# 
_cell.entry_id           3BJY 
_cell.length_a           181.062 
_cell.length_b           199.578 
_cell.length_c           55.677 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3BJY 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA repair protein REV1'                                                         49452.965 1   2.7.7.- ? 
'catalytic core' ? 
2 polymer     syn 
;DNA (5'-D(*DTP*DAP*DAP*(P)P*DGP*DTP*DAP*DGP*DGP*DGP*DGP*DAP*DGP*DGP*DAP*DT)-3')
;
5107.365  1   ?       ? ?                ? 
3 polymer     syn 
;DNA (5'-D(*DAP*DTP*DCP*DCP*DTP*DCP*DCP*DCP*DCP*DTP*DAP*(DOC))-3')
;
3502.308  1   ?       ? ?                ? 
4 non-polymer syn "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE"                                                467.157   1   ?       ? ? ? 
5 non-polymer syn 'MAGNESIUM ION'                                                                   24.305    2   ?       ? ? ? 
6 water       nat water                                                                             18.015    158 ?       ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;KRIVACDDPDFLTSYFAHSRLHHLSAWKANLKDKFLNENIHKYTKITDKDTYIIFHIDFDCFFATVAYLCRSSSFSACDF
KRDPIVVCHGTKNSDIASCNYVARSYGIKNGMWVSQAEKMLPNGIKLISLPYTFEQFQLKSEAFYSTLKRLNIFNLILPI
SIDEAVCVRIIPDNIHNTNTLNARLCEEIRQEIFQGTNGCTVSIGCSDSLVLARLALKMAKPNGYNITFKSNLSEEFWSS
FKLDDLPGVGHSTLSRLESTFDSPHSLNDLRKRYTLDALKASVGSKLGMKIHLALQGQDDEESLKILYDPKEVLQRKSLS
IDINWGIRFKNITQVDLFIERGCQYLLEKLNEINKTTSQITLKLMRRCKDAPIEPPKYMGMGRCDSFSRSSRLGIPTNEF
GIIATEMKSLYRTLGCPPMELRGLALQFNKLVDV
;
;KRIVACDDPDFLTSYFAHSRLHHLSAWKANLKDKFLNENIHKYTKITDKDTYIIFHIDFDCFFATVAYLCRSSSFSACDF
KRDPIVVCHGTKNSDIASCNYVARSYGIKNGMWVSQAEKMLPNGIKLISLPYTFEQFQLKSEAFYSTLKRLNIFNLILPI
SIDEAVCVRIIPDNIHNTNTLNARLCEEIRQEIFQGTNGCTVSIGCSDSLVLARLALKMAKPNGYNITFKSNLSEEFWSS
FKLDDLPGVGHSTLSRLESTFDSPHSLNDLRKRYTLDALKASVGSKLGMKIHLALQGQDDEESLKILYDPKEVLQRKSLS
IDINWGIRFKNITQVDLFIERGCQYLLEKLNEINKTTSQITLKLMRRCKDAPIEPPKYMGMGRCDSFSRSSRLGIPTNEF
GIIATEMKSLYRTLGCPPMELRGLALQFNKLVDV
;
A ? 
2 polydeoxyribonucleotide no yes '(DT)(DA)(DA)P(DG)(DT)(DA)(DG)(DG)(DG)(DG)(DA)(DG)(DG)(DA)(DT)' TAAPGTAGGGGAGGAT T ? 
3 polydeoxyribonucleotide no yes '(DA)(DT)(DC)(DC)(DT)(DC)(DC)(DC)(DC)(DT)(DA)(DOC)' ATCCTCCCCTAC P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LYS n 
1 2   ARG n 
1 3   ILE n 
1 4   VAL n 
1 5   ALA n 
1 6   CYS n 
1 7   ASP n 
1 8   ASP n 
1 9   PRO n 
1 10  ASP n 
1 11  PHE n 
1 12  LEU n 
1 13  THR n 
1 14  SER n 
1 15  TYR n 
1 16  PHE n 
1 17  ALA n 
1 18  HIS n 
1 19  SER n 
1 20  ARG n 
1 21  LEU n 
1 22  HIS n 
1 23  HIS n 
1 24  LEU n 
1 25  SER n 
1 26  ALA n 
1 27  TRP n 
1 28  LYS n 
1 29  ALA n 
1 30  ASN n 
1 31  LEU n 
1 32  LYS n 
1 33  ASP n 
1 34  LYS n 
1 35  PHE n 
1 36  LEU n 
1 37  ASN n 
1 38  GLU n 
1 39  ASN n 
1 40  ILE n 
1 41  HIS n 
1 42  LYS n 
1 43  TYR n 
1 44  THR n 
1 45  LYS n 
1 46  ILE n 
1 47  THR n 
1 48  ASP n 
1 49  LYS n 
1 50  ASP n 
1 51  THR n 
1 52  TYR n 
1 53  ILE n 
1 54  ILE n 
1 55  PHE n 
1 56  HIS n 
1 57  ILE n 
1 58  ASP n 
1 59  PHE n 
1 60  ASP n 
1 61  CYS n 
1 62  PHE n 
1 63  PHE n 
1 64  ALA n 
1 65  THR n 
1 66  VAL n 
1 67  ALA n 
1 68  TYR n 
1 69  LEU n 
1 70  CYS n 
1 71  ARG n 
1 72  SER n 
1 73  SER n 
1 74  SER n 
1 75  PHE n 
1 76  SER n 
1 77  ALA n 
1 78  CYS n 
1 79  ASP n 
1 80  PHE n 
1 81  LYS n 
1 82  ARG n 
1 83  ASP n 
1 84  PRO n 
1 85  ILE n 
1 86  VAL n 
1 87  VAL n 
1 88  CYS n 
1 89  HIS n 
1 90  GLY n 
1 91  THR n 
1 92  LYS n 
1 93  ASN n 
1 94  SER n 
1 95  ASP n 
1 96  ILE n 
1 97  ALA n 
1 98  SER n 
1 99  CYS n 
1 100 ASN n 
1 101 TYR n 
1 102 VAL n 
1 103 ALA n 
1 104 ARG n 
1 105 SER n 
1 106 TYR n 
1 107 GLY n 
1 108 ILE n 
1 109 LYS n 
1 110 ASN n 
1 111 GLY n 
1 112 MET n 
1 113 TRP n 
1 114 VAL n 
1 115 SER n 
1 116 GLN n 
1 117 ALA n 
1 118 GLU n 
1 119 LYS n 
1 120 MET n 
1 121 LEU n 
1 122 PRO n 
1 123 ASN n 
1 124 GLY n 
1 125 ILE n 
1 126 LYS n 
1 127 LEU n 
1 128 ILE n 
1 129 SER n 
1 130 LEU n 
1 131 PRO n 
1 132 TYR n 
1 133 THR n 
1 134 PHE n 
1 135 GLU n 
1 136 GLN n 
1 137 PHE n 
1 138 GLN n 
1 139 LEU n 
1 140 LYS n 
1 141 SER n 
1 142 GLU n 
1 143 ALA n 
1 144 PHE n 
1 145 TYR n 
1 146 SER n 
1 147 THR n 
1 148 LEU n 
1 149 LYS n 
1 150 ARG n 
1 151 LEU n 
1 152 ASN n 
1 153 ILE n 
1 154 PHE n 
1 155 ASN n 
1 156 LEU n 
1 157 ILE n 
1 158 LEU n 
1 159 PRO n 
1 160 ILE n 
1 161 SER n 
1 162 ILE n 
1 163 ASP n 
1 164 GLU n 
1 165 ALA n 
1 166 VAL n 
1 167 CYS n 
1 168 VAL n 
1 169 ARG n 
1 170 ILE n 
1 171 ILE n 
1 172 PRO n 
1 173 ASP n 
1 174 ASN n 
1 175 ILE n 
1 176 HIS n 
1 177 ASN n 
1 178 THR n 
1 179 ASN n 
1 180 THR n 
1 181 LEU n 
1 182 ASN n 
1 183 ALA n 
1 184 ARG n 
1 185 LEU n 
1 186 CYS n 
1 187 GLU n 
1 188 GLU n 
1 189 ILE n 
1 190 ARG n 
1 191 GLN n 
1 192 GLU n 
1 193 ILE n 
1 194 PHE n 
1 195 GLN n 
1 196 GLY n 
1 197 THR n 
1 198 ASN n 
1 199 GLY n 
1 200 CYS n 
1 201 THR n 
1 202 VAL n 
1 203 SER n 
1 204 ILE n 
1 205 GLY n 
1 206 CYS n 
1 207 SER n 
1 208 ASP n 
1 209 SER n 
1 210 LEU n 
1 211 VAL n 
1 212 LEU n 
1 213 ALA n 
1 214 ARG n 
1 215 LEU n 
1 216 ALA n 
1 217 LEU n 
1 218 LYS n 
1 219 MET n 
1 220 ALA n 
1 221 LYS n 
1 222 PRO n 
1 223 ASN n 
1 224 GLY n 
1 225 TYR n 
1 226 ASN n 
1 227 ILE n 
1 228 THR n 
1 229 PHE n 
1 230 LYS n 
1 231 SER n 
1 232 ASN n 
1 233 LEU n 
1 234 SER n 
1 235 GLU n 
1 236 GLU n 
1 237 PHE n 
1 238 TRP n 
1 239 SER n 
1 240 SER n 
1 241 PHE n 
1 242 LYS n 
1 243 LEU n 
1 244 ASP n 
1 245 ASP n 
1 246 LEU n 
1 247 PRO n 
1 248 GLY n 
1 249 VAL n 
1 250 GLY n 
1 251 HIS n 
1 252 SER n 
1 253 THR n 
1 254 LEU n 
1 255 SER n 
1 256 ARG n 
1 257 LEU n 
1 258 GLU n 
1 259 SER n 
1 260 THR n 
1 261 PHE n 
1 262 ASP n 
1 263 SER n 
1 264 PRO n 
1 265 HIS n 
1 266 SER n 
1 267 LEU n 
1 268 ASN n 
1 269 ASP n 
1 270 LEU n 
1 271 ARG n 
1 272 LYS n 
1 273 ARG n 
1 274 TYR n 
1 275 THR n 
1 276 LEU n 
1 277 ASP n 
1 278 ALA n 
1 279 LEU n 
1 280 LYS n 
1 281 ALA n 
1 282 SER n 
1 283 VAL n 
1 284 GLY n 
1 285 SER n 
1 286 LYS n 
1 287 LEU n 
1 288 GLY n 
1 289 MET n 
1 290 LYS n 
1 291 ILE n 
1 292 HIS n 
1 293 LEU n 
1 294 ALA n 
1 295 LEU n 
1 296 GLN n 
1 297 GLY n 
1 298 GLN n 
1 299 ASP n 
1 300 ASP n 
1 301 GLU n 
1 302 GLU n 
1 303 SER n 
1 304 LEU n 
1 305 LYS n 
1 306 ILE n 
1 307 LEU n 
1 308 TYR n 
1 309 ASP n 
1 310 PRO n 
1 311 LYS n 
1 312 GLU n 
1 313 VAL n 
1 314 LEU n 
1 315 GLN n 
1 316 ARG n 
1 317 LYS n 
1 318 SER n 
1 319 LEU n 
1 320 SER n 
1 321 ILE n 
1 322 ASP n 
1 323 ILE n 
1 324 ASN n 
1 325 TRP n 
1 326 GLY n 
1 327 ILE n 
1 328 ARG n 
1 329 PHE n 
1 330 LYS n 
1 331 ASN n 
1 332 ILE n 
1 333 THR n 
1 334 GLN n 
1 335 VAL n 
1 336 ASP n 
1 337 LEU n 
1 338 PHE n 
1 339 ILE n 
1 340 GLU n 
1 341 ARG n 
1 342 GLY n 
1 343 CYS n 
1 344 GLN n 
1 345 TYR n 
1 346 LEU n 
1 347 LEU n 
1 348 GLU n 
1 349 LYS n 
1 350 LEU n 
1 351 ASN n 
1 352 GLU n 
1 353 ILE n 
1 354 ASN n 
1 355 LYS n 
1 356 THR n 
1 357 THR n 
1 358 SER n 
1 359 GLN n 
1 360 ILE n 
1 361 THR n 
1 362 LEU n 
1 363 LYS n 
1 364 LEU n 
1 365 MET n 
1 366 ARG n 
1 367 ARG n 
1 368 CYS n 
1 369 LYS n 
1 370 ASP n 
1 371 ALA n 
1 372 PRO n 
1 373 ILE n 
1 374 GLU n 
1 375 PRO n 
1 376 PRO n 
1 377 LYS n 
1 378 TYR n 
1 379 MET n 
1 380 GLY n 
1 381 MET n 
1 382 GLY n 
1 383 ARG n 
1 384 CYS n 
1 385 ASP n 
1 386 SER n 
1 387 PHE n 
1 388 SER n 
1 389 ARG n 
1 390 SER n 
1 391 SER n 
1 392 ARG n 
1 393 LEU n 
1 394 GLY n 
1 395 ILE n 
1 396 PRO n 
1 397 THR n 
1 398 ASN n 
1 399 GLU n 
1 400 PHE n 
1 401 GLY n 
1 402 ILE n 
1 403 ILE n 
1 404 ALA n 
1 405 THR n 
1 406 GLU n 
1 407 MET n 
1 408 LYS n 
1 409 SER n 
1 410 LEU n 
1 411 TYR n 
1 412 ARG n 
1 413 THR n 
1 414 LEU n 
1 415 GLY n 
1 416 CYS n 
1 417 PRO n 
1 418 PRO n 
1 419 MET n 
1 420 GLU n 
1 421 LEU n 
1 422 ARG n 
1 423 GLY n 
1 424 LEU n 
1 425 ALA n 
1 426 LEU n 
1 427 GLN n 
1 428 PHE n 
1 429 ASN n 
1 430 LYS n 
1 431 LEU n 
1 432 VAL n 
1 433 ASP n 
1 434 VAL n 
2 1   DT  n 
2 2   DA  n 
2 3   DA  n 
2 4   P   n 
2 5   DG  n 
2 6   DT  n 
2 7   DA  n 
2 8   DG  n 
2 9   DG  n 
2 10  DG  n 
2 11  DG  n 
2 12  DA  n 
2 13  DG  n 
2 14  DG  n 
2 15  DA  n 
2 16  DT  n 
3 1   DA  n 
3 2   DT  n 
3 3   DC  n 
3 4   DC  n 
3 5   DT  n 
3 6   DC  n 
3 7   DC  n 
3 8   DC  n 
3 9   DC  n 
3 10  DT  n 
3 11  DA  n 
3 12  DOC n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               yeast 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 REV1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     4932 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               yeast 
_entity_src_gen.pdbx_host_org_scientific_name      'Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4932 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BJ5464 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pBJ954 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP REV1_YEAST P12689 1 
;KRIVACDDPDFLTSYFAHSRLHHLSAWKANLKDKFLNENIHKYTKITDKDTYIIFHIDFDCFFATVAYLCRSSSFSACDF
KRDPIVVCHGTKNSDIASCNYVARSYGIKNGMWVSQAEKMLPNGIKLISLPYTFEQFQLKSEAFYSTLKRLNIFNLILPI
SIDEAVCVRIIPDNIHNTNTLNARLCEEIRQEIFQGTNGCTVSIGCSDSLVLARLALKMAKPNGYNITFKSNLSEEFWSS
FKLDDLPGVGHSTLSRLESTFDSPHSLNDLRKRYTLDALKASVGSKLGMKIHLALQGQDDEESLKILYDPKEVLQRKSLS
IDINWGIRFKNITQVDLFIERGCQYLLEKLNEINKTTSQITLKLMRRCKDAPIEPPKYMGMGRCDSFSRSSRLGIPTNEF
GIIATEMKSLYRTLGCPPMELRGLALQFNKLVDV
;
305 ? 
2 PDB 3BJY       3BJY   2 TAAPGTAGGGGAGGAT 1   ? 
3 PDB 3BJY       3BJY   3 'ATCCTCCCCTA(DOC)' 1   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3BJY A 1 ? 434 ? P12689 305 ? 738 ? 305 738 
2 2 3BJY T 1 ? 16  ? 3BJY   1   ? 16  ? 1   16  
3 3 3BJY P 1 ? 12  ? 3BJY   1   ? 12  ? 1   12  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                          ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                         ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                       ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                  ? 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                                         ? 'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"             ? 'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"              ? 'C9 H14 N3 O7 P'   307.197 
DCP non-polymer         . "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE"               ? 'C9 H16 N3 O13 P3' 467.157 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"             ? 'C10 H14 N5 O7 P'  347.221 
DOC 'DNA linking'       n "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE"         ? 'C9 H14 N3 O6 P'   291.198 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                     ? 'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                                        ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                  ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                          ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                        ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                            ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                       ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                          ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                           ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                       ? 'C5 H11 N O2 S'    149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                  ? 'Mg 2'             24.305  
P   'DNA linking'       n 
;2'-DEOXY-N1,N2-PROPANO GUANOSINE MONOPHOSPHATE
;
? 'C13 H18 N5 O7 P'  387.285 
PHE 'L-peptide linking' y PHENYLALANINE                                    ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                          ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                           ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                        ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                       ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                         ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                           ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          3BJY 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.35 
_exptl_crystal.density_percent_sol   71.74 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'16% PEG 5K MME, 0.4M Ammonoium sulfate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 PEG                 ? ? ? 
1 2 1 'Ammonoium sulfate' ? ? ? 
1 3 1 HOH                 ? ? ? 
1 4 2 PEG                 ? ? ? 
1 5 2 'Ammonoium sulfate' ? ? ? 
1 6 2 HOH                 ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2005-07-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.00 
# 
_reflns.entry_id                     3BJY 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.41 
_reflns.d_resolution_low             50 
_reflns.number_all                   ? 
_reflns.number_obs                   38556 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.049 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        32.1 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.4 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.41 
_reflns_shell.d_res_low              2.5 
_reflns_shell.percent_possible_all   98.4 
_reflns_shell.Rmerge_I_obs           0.164 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    8.8 
_reflns_shell.pdbx_redundancy        4.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3BJY 
_refine.ls_d_res_high                            2.41 
_refine.ls_d_res_low                             50 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     38556 
_refine.ls_number_reflns_R_free                  3862 
_refine.ls_percent_reflns_obs                    99.4 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.231 
_refine.ls_R_factor_R_free                       0.241 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2AQ4 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3370 
_refine_hist.pdbx_number_atoms_nucleic_acid   572 
_refine_hist.pdbx_number_atoms_ligand         30 
_refine_hist.number_atoms_solvent             158 
_refine_hist.number_atoms_total               4130 
_refine_hist.d_res_high                       2.41 
_refine_hist.d_res_low                        50 
# 
_struct.entry_id                  3BJY 
_struct.title                     'Catalytic core of Rev1 in complex with DNA (modified template guanine) and incoming nucleotide' 
_struct.pdbx_descriptor           'DNA repair protein REV1(E.C.2.7.7.-)/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3BJY 
_struct_keywords.pdbx_keywords   Transferase/DNA 
_struct_keywords.text            
;DNA Polymerase, Protein-DNA complex, adduct, bypass, DNA damage, DNA repair, DNA synthesis, DNA-binding, Magnesium, Metal-binding, Nucleotidyltransferase, Nucleus, Transferase, Transferase-DNA COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 6 ? 
I N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 10  ? SER A 19  ? ASP A 314 SER A 323 1 ? 10 
HELX_P HELX_P2  2  SER A 19  ? ASN A 39  ? SER A 323 ASN A 343 1 ? 21 
HELX_P HELX_P3  3  CYS A 61  ? CYS A 70  ? CYS A 365 CYS A 374 1 ? 10 
HELX_P HELX_P4  4  SER A 72  ? SER A 76  ? SER A 376 SER A 380 5 ? 5  
HELX_P HELX_P5  5  ASN A 100 ? TYR A 106 ? ASN A 404 TYR A 410 1 ? 7  
HELX_P HELX_P6  6  TRP A 113 ? MET A 120 ? TRP A 417 MET A 424 1 ? 8  
HELX_P HELX_P7  7  THR A 133 ? LEU A 151 ? THR A 437 LEU A 455 1 ? 19 
HELX_P HELX_P8  8  THR A 180 ? ASN A 198 ? THR A 484 ASN A 502 1 ? 19 
HELX_P HELX_P9  9  SER A 209 ? LYS A 221 ? SER A 513 LYS A 525 1 ? 13 
HELX_P HELX_P10 10 PHE A 229 ? LEU A 233 ? PHE A 533 LEU A 537 5 ? 5  
HELX_P HELX_P11 11 SER A 234 ? SER A 239 ? SER A 538 SER A 543 1 ? 6  
HELX_P HELX_P12 12 LYS A 242 ? LEU A 246 ? LYS A 546 LEU A 550 5 ? 5  
HELX_P HELX_P13 13 GLY A 250 ? PHE A 261 ? GLY A 554 PHE A 565 1 ? 12 
HELX_P HELX_P14 14 SER A 266 ? TYR A 274 ? SER A 570 TYR A 578 1 ? 9  
HELX_P HELX_P15 15 THR A 275 ? GLY A 284 ? THR A 579 GLY A 588 1 ? 10 
HELX_P HELX_P16 16 GLY A 284 ? LEU A 295 ? GLY A 588 LEU A 599 1 ? 12 
HELX_P HELX_P17 17 ASP A 300 ? ASP A 309 ? ASP A 604 ASP A 613 1 ? 10 
HELX_P HELX_P18 18 ASP A 309 ? LEU A 314 ? ASP A 613 LEU A 618 1 ? 6  
HELX_P HELX_P19 19 ASN A 331 ? ILE A 353 ? ASN A 635 ILE A 657 1 ? 23 
HELX_P HELX_P20 20 GLU A 399 ? GLY A 415 ? GLU A 703 GLY A 719 1 ? 17 
HELX_P HELX_P21 21 PRO A 417 ? MET A 419 ? PRO A 721 MET A 723 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? B DG 5  N1 ? ? ? 1_555 C DOC 12 N3 ? ? T DG 5  P DOC 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? B DG 5  N2 ? ? ? 1_555 C DOC 12 O2 ? ? T DG 5  P DOC 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? B DG 5  O6 ? ? ? 1_555 C DOC 12 N4 ? ? T DG 5  P DOC 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? B DT 6  N3 ? ? ? 1_555 C DA  11 N1 ? ? T DT 6  P DA  11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? B DT 6  O4 ? ? ? 1_555 C DA  11 N6 ? ? T DT 6  P DA  11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? B DA 7  N1 ? ? ? 1_555 C DT  10 N3 ? ? T DA 7  P DT  10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? B DA 7  N6 ? ? ? 1_555 C DT  10 O4 ? ? T DA 7  P DT  10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? B DG 8  N1 ? ? ? 1_555 C DC  9  N3 ? ? T DG 8  P DC  9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? B DG 8  N2 ? ? ? 1_555 C DC  9  O2 ? ? T DG 8  P DC  9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? B DG 8  O6 ? ? ? 1_555 C DC  9  N4 ? ? T DG 8  P DC  9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? B DG 9  N1 ? ? ? 1_555 C DC  8  N3 ? ? T DG 9  P DC  8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? B DG 9  N2 ? ? ? 1_555 C DC  8  O2 ? ? T DG 9  P DC  8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? B DG 9  O6 ? ? ? 1_555 C DC  8  N4 ? ? T DG 9  P DC  8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? B DG 10 N1 ? ? ? 1_555 C DC  7  N3 ? ? T DG 10 P DC  7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? B DG 10 N2 ? ? ? 1_555 C DC  7  O2 ? ? T DG 10 P DC  7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? B DG 10 O6 ? ? ? 1_555 C DC  7  N4 ? ? T DG 10 P DC  7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? B DG 11 N1 ? ? ? 1_555 C DC  6  N3 ? ? T DG 11 P DC  6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? B DG 11 N2 ? ? ? 1_555 C DC  6  O2 ? ? T DG 11 P DC  6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? B DG 11 O6 ? ? ? 1_555 C DC  6  N4 ? ? T DG 11 P DC  6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? B DA 12 N1 ? ? ? 1_555 C DT  5  N3 ? ? T DA 12 P DT  5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? B DA 12 N6 ? ? ? 1_555 C DT  5  O4 ? ? T DA 12 P DT  5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? B DG 13 N1 ? ? ? 1_555 C DC  4  N3 ? ? T DG 13 P DC  4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? B DG 13 N2 ? ? ? 1_555 C DC  4  O2 ? ? T DG 13 P DC  4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? B DG 13 O6 ? ? ? 1_555 C DC  4  N4 ? ? T DG 13 P DC  4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? B DG 14 N1 ? ? ? 1_555 C DC  3  N3 ? ? T DG 14 P DC  3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? B DG 14 N2 ? ? ? 1_555 C DC  3  O2 ? ? T DG 14 P DC  3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? B DG 14 O6 ? ? ? 1_555 C DC  3  N4 ? ? T DG 14 P DC  3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? B DA 15 N1 ? ? ? 1_555 C DT  2  N3 ? ? T DA 15 P DT  2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? B DA 15 N6 ? ? ? 1_555 C DT  2  O4 ? ? T DA 15 P DT  2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? B DT 16 N3 ? ? ? 1_555 C DA  1  N1 ? ? T DT 16 P DA  1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? B DT 16 O4 ? ? ? 1_555 C DA  1  N6 ? ? T DT 16 P DA  1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 156 ? SER A 161 ? LEU A 460 SER A 465 
A 2 GLU A 164 ? ILE A 170 ? GLU A 468 ILE A 474 
A 3 TYR A 52  ? PHE A 59  ? TYR A 356 PHE A 363 
A 4 VAL A 202 ? SER A 207 ? VAL A 506 SER A 511 
A 5 TYR A 225 ? ASN A 226 ? TYR A 529 ASN A 530 
B 1 SER A 98  ? CYS A 99  ? SER A 402 CYS A 403 
B 2 ILE A 85  ? VAL A 87  ? ILE A 389 VAL A 391 
B 3 ILE A 128 ? LEU A 130 ? ILE A 432 LEU A 434 
C 1 LEU A 319 ? ILE A 323 ? LEU A 623 ILE A 627 
C 2 LEU A 421 ? ASP A 433 ? LEU A 725 ASP A 737 
C 3 LYS A 355 ? ARG A 367 ? LYS A 659 ARG A 671 
C 4 CYS A 384 ? THR A 397 ? CYS A 688 THR A 701 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 156 ? N LEU A 460 O VAL A 168 ? O VAL A 472 
A 2 3 O ALA A 165 ? O ALA A 469 N ILE A 57  ? N ILE A 361 
A 3 4 N ILE A 54  ? N ILE A 358 O SER A 207 ? O SER A 511 
A 4 5 N CYS A 206 ? N CYS A 510 O ASN A 226 ? O ASN A 530 
B 1 2 O SER A 98  ? O SER A 402 N VAL A 87  ? N VAL A 391 
B 2 3 N VAL A 86  ? N VAL A 390 O LEU A 130 ? O LEU A 434 
C 1 2 N LEU A 319 ? N LEU A 623 O PHE A 428 ? O PHE A 732 
C 2 3 O ALA A 425 ? O ALA A 729 N LYS A 363 ? N LYS A 667 
C 3 4 N SER A 358 ? N SER A 662 O LEU A 393 ? O LEU A 697 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE DCP A 739' 
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 297'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 298'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 21 MG  E .   ? MG  A 297 . ? 1_555 ? 
2  AC1 21 MG  F .   ? MG  A 298 . ? 1_555 ? 
3  AC1 21 ARG A 20  ? ARG A 324 . ? 1_555 ? 
4  AC1 21 LEU A 24  ? LEU A 328 . ? 1_555 ? 
5  AC1 21 ASP A 58  ? ASP A 362 . ? 1_555 ? 
6  AC1 21 PHE A 59  ? PHE A 363 . ? 1_555 ? 
7  AC1 21 ASP A 60  ? ASP A 364 . ? 1_555 ? 
8  AC1 21 CYS A 61  ? CYS A 365 . ? 1_555 ? 
9  AC1 21 PHE A 62  ? PHE A 366 . ? 1_555 ? 
10 AC1 21 PHE A 63  ? PHE A 367 . ? 1_555 ? 
11 AC1 21 ALA A 97  ? ALA A 401 . ? 1_555 ? 
12 AC1 21 SER A 98  ? SER A 402 . ? 1_555 ? 
13 AC1 21 TYR A 101 ? TYR A 405 . ? 1_555 ? 
14 AC1 21 ARG A 104 ? ARG A 408 . ? 1_555 ? 
15 AC1 21 ASN A 110 ? ASN A 414 . ? 1_555 ? 
16 AC1 21 ASP A 163 ? ASP A 467 . ? 1_555 ? 
17 AC1 21 LYS A 221 ? LYS A 525 . ? 1_555 ? 
18 AC1 21 HOH G .   ? HOH A 748 . ? 1_555 ? 
19 AC1 21 HOH G .   ? HOH A 753 . ? 1_555 ? 
20 AC1 21 HOH G .   ? HOH A 791 . ? 1_555 ? 
21 AC1 21 HOH G .   ? HOH A 850 . ? 1_555 ? 
22 AC2 6  MG  F .   ? MG  A 298 . ? 1_555 ? 
23 AC2 6  ASP A 58  ? ASP A 362 . ? 1_555 ? 
24 AC2 6  ASP A 163 ? ASP A 467 . ? 1_555 ? 
25 AC2 6  GLU A 164 ? GLU A 468 . ? 1_555 ? 
26 AC2 6  DCP D .   ? DCP A 739 . ? 1_555 ? 
27 AC2 6  DOC C 12  ? DOC P 12  . ? 1_555 ? 
28 AC3 5  MG  E .   ? MG  A 297 . ? 1_555 ? 
29 AC3 5  ASP A 58  ? ASP A 362 . ? 1_555 ? 
30 AC3 5  PHE A 59  ? PHE A 363 . ? 1_555 ? 
31 AC3 5  ASP A 163 ? ASP A 467 . ? 1_555 ? 
32 AC3 5  DCP D .   ? DCP A 739 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3BJY 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3BJY 
_atom_sites.fract_transf_matrix[1][1]   0.005523 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005011 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017961 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . LYS A 1 1   ? 35.668 58.445 14.748  1.00 44.21 ? 305 LYS A N     1 
ATOM   2    C  CA    . LYS A 1 1   ? 36.488 57.720 13.737  1.00 44.03 ? 305 LYS A CA    1 
ATOM   3    C  C     . LYS A 1 1   ? 37.609 57.202 14.644  1.00 43.29 ? 305 LYS A C     1 
ATOM   4    O  O     . LYS A 1 1   ? 37.592 57.515 15.817  1.00 45.60 ? 305 LYS A O     1 
ATOM   5    C  CB    . LYS A 1 1   ? 36.999 58.713 12.663  1.00 42.90 ? 305 LYS A CB    1 
ATOM   6    N  N     . ARG A 1 2   ? 38.574 56.438 14.158  1.00 41.81 ? 306 ARG A N     1 
ATOM   7    C  CA    . ARG A 1 2   ? 39.622 55.884 15.045  1.00 40.67 ? 306 ARG A CA    1 
ATOM   8    C  C     . ARG A 1 2   ? 39.053 54.787 15.928  1.00 38.12 ? 306 ARG A C     1 
ATOM   9    O  O     . ARG A 1 2   ? 38.350 55.025 16.921  1.00 37.36 ? 306 ARG A O     1 
ATOM   10   C  CB    . ARG A 1 2   ? 40.319 56.921 15.953  1.00 41.72 ? 306 ARG A CB    1 
ATOM   11   C  CG    . ARG A 1 2   ? 41.444 56.262 16.842  1.00 42.65 ? 306 ARG A CG    1 
ATOM   12   C  CD    . ARG A 1 2   ? 42.506 57.230 17.442  1.00 45.30 ? 306 ARG A CD    1 
ATOM   13   N  NE    . ARG A 1 2   ? 43.834 56.944 16.888  1.00 47.28 ? 306 ARG A NE    1 
ATOM   14   C  CZ    . ARG A 1 2   ? 44.665 57.854 16.382  1.00 47.36 ? 306 ARG A CZ    1 
ATOM   15   N  NH1   . ARG A 1 2   ? 44.329 59.139 16.366  1.00 47.80 ? 306 ARG A NH1   1 
ATOM   16   N  NH2   . ARG A 1 2   ? 45.808 57.466 15.823  1.00 46.66 ? 306 ARG A NH2   1 
ATOM   17   N  N     . ILE A 1 3   ? 39.416 53.580 15.527  1.00 34.87 ? 307 ILE A N     1 
ATOM   18   C  CA    . ILE A 1 3   ? 39.008 52.339 16.132  1.00 33.06 ? 307 ILE A CA    1 
ATOM   19   C  C     . ILE A 1 3   ? 39.455 52.142 17.569  1.00 30.38 ? 307 ILE A C     1 
ATOM   20   O  O     . ILE A 1 3   ? 40.596 52.423 17.926  1.00 29.12 ? 307 ILE A O     1 
ATOM   21   C  CB    . ILE A 1 3   ? 39.505 51.203 15.226  1.00 32.77 ? 307 ILE A CB    1 
ATOM   22   C  CG1   . ILE A 1 3   ? 38.886 51.428 13.841  1.00 32.83 ? 307 ILE A CG1   1 
ATOM   23   C  CG2   . ILE A 1 3   ? 39.190 49.838 15.826  1.00 32.18 ? 307 ILE A CG2   1 
ATOM   24   C  CD1   . ILE A 1 3   ? 39.111 50.345 12.835  1.00 33.64 ? 307 ILE A CD1   1 
ATOM   25   N  N     . VAL A 1 4   ? 38.535 51.657 18.390  1.00 28.92 ? 308 VAL A N     1 
ATOM   26   C  CA    . VAL A 1 4   ? 38.826 51.406 19.789  1.00 28.01 ? 308 VAL A CA    1 
ATOM   27   C  C     . VAL A 1 4   ? 39.775 50.217 19.880  1.00 28.13 ? 308 VAL A C     1 
ATOM   28   O  O     . VAL A 1 4   ? 39.525 49.168 19.280  1.00 29.58 ? 308 VAL A O     1 
ATOM   29   C  CB    . VAL A 1 4   ? 37.531 51.114 20.535  1.00 27.37 ? 308 VAL A CB    1 
ATOM   30   C  CG1   . VAL A 1 4   ? 37.823 50.727 21.969  1.00 24.80 ? 308 VAL A CG1   1 
ATOM   31   C  CG2   . VAL A 1 4   ? 36.623 52.343 20.453  1.00 25.57 ? 308 VAL A CG2   1 
ATOM   32   N  N     . ALA A 1 5   ? 40.871 50.383 20.611  1.00 26.90 ? 309 ALA A N     1 
ATOM   33   C  CA    . ALA A 1 5   ? 41.857 49.314 20.751  1.00 27.27 ? 309 ALA A CA    1 
ATOM   34   C  C     . ALA A 1 5   ? 41.453 48.241 21.758  1.00 26.79 ? 309 ALA A C     1 
ATOM   35   O  O     . ALA A 1 5   ? 40.608 48.468 22.631  1.00 25.17 ? 309 ALA A O     1 
ATOM   36   C  CB    . ALA A 1 5   ? 43.217 49.898 21.133  1.00 26.11 ? 309 ALA A CB    1 
ATOM   37   N  N     . CYS A 1 6   ? 42.090 47.079 21.639  1.00 27.10 ? 310 CYS A N     1 
ATOM   38   C  CA    . CYS A 1 6   ? 41.805 45.935 22.496  1.00 27.77 ? 310 CYS A CA    1 
ATOM   39   C  C     . CYS A 1 6   ? 42.092 46.105 23.988  1.00 28.43 ? 310 CYS A C     1 
ATOM   40   O  O     . CYS A 1 6   ? 41.680 45.269 24.789  1.00 28.86 ? 310 CYS A O     1 
ATOM   41   C  CB    . CYS A 1 6   ? 42.542 44.699 21.972  1.00 27.58 ? 310 CYS A CB    1 
ATOM   42   S  SG    . CYS A 1 6   ? 44.334 44.859 21.943  1.00 29.01 ? 310 CYS A SG    1 
ATOM   43   N  N     . ASP A 1 7   ? 42.801 47.161 24.372  1.00 28.44 ? 311 ASP A N     1 
ATOM   44   C  CA    . ASP A 1 7   ? 43.086 47.376 25.790  1.00 29.14 ? 311 ASP A CA    1 
ATOM   45   C  C     . ASP A 1 7   ? 42.099 48.385 26.369  1.00 29.40 ? 311 ASP A C     1 
ATOM   46   O  O     . ASP A 1 7   ? 42.228 48.825 27.512  1.00 29.52 ? 311 ASP A O     1 
ATOM   47   C  CB    . ASP A 1 7   ? 44.535 47.853 26.002  1.00 29.46 ? 311 ASP A CB    1 
ATOM   48   C  CG    . ASP A 1 7   ? 44.826 49.206 25.364  1.00 33.41 ? 311 ASP A CG    1 
ATOM   49   O  OD1   . ASP A 1 7   ? 44.117 49.619 24.421  1.00 34.43 ? 311 ASP A OD1   1 
ATOM   50   O  OD2   . ASP A 1 7   ? 45.800 49.859 25.799  1.00 36.84 ? 311 ASP A OD2   1 
ATOM   51   N  N     . ASP A 1 8   ? 41.100 48.738 25.571  1.00 28.64 ? 312 ASP A N     1 
ATOM   52   C  CA    . ASP A 1 8   ? 40.087 49.686 26.000  1.00 28.98 ? 312 ASP A CA    1 
ATOM   53   C  C     . ASP A 1 8   ? 38.846 48.982 26.553  1.00 28.22 ? 312 ASP A C     1 
ATOM   54   O  O     . ASP A 1 8   ? 38.345 48.028 25.974  1.00 25.51 ? 312 ASP A O     1 
ATOM   55   C  CB    . ASP A 1 8   ? 39.672 50.565 24.830  1.00 31.75 ? 312 ASP A CB    1 
ATOM   56   C  CG    . ASP A 1 8   ? 38.683 51.637 25.232  1.00 34.45 ? 312 ASP A CG    1 
ATOM   57   O  OD1   . ASP A 1 8   ? 39.047 52.823 25.119  1.00 38.90 ? 312 ASP A OD1   1 
ATOM   58   O  OD2   . ASP A 1 8   ? 37.553 51.311 25.660  1.00 36.27 ? 312 ASP A OD2   1 
ATOM   59   N  N     . PRO A 1 9   ? 38.322 49.472 27.679  1.00 28.80 ? 313 PRO A N     1 
ATOM   60   C  CA    . PRO A 1 9   ? 37.134 48.867 28.278  1.00 28.91 ? 313 PRO A CA    1 
ATOM   61   C  C     . PRO A 1 9   ? 35.981 48.644 27.317  1.00 29.40 ? 313 PRO A C     1 
ATOM   62   O  O     . PRO A 1 9   ? 35.205 47.725 27.522  1.00 29.15 ? 313 PRO A O     1 
ATOM   63   C  CB    . PRO A 1 9   ? 36.760 49.835 29.387  1.00 29.36 ? 313 PRO A CB    1 
ATOM   64   C  CG    . PRO A 1 9   ? 38.084 50.421 29.783  1.00 30.49 ? 313 PRO A CG    1 
ATOM   65   C  CD    . PRO A 1 9   ? 38.773 50.638 28.458  1.00 29.08 ? 313 PRO A CD    1 
ATOM   66   N  N     . ASP A 1 10  ? 35.786 49.448 26.284  1.00 30.74 ? 314 ASP A N     1 
ATOM   67   C  CA    . ASP A 1 10  ? 34.659 49.023 25.475  1.00 32.20 ? 314 ASP A CA    1 
ATOM   68   C  C     . ASP A 1 10  ? 34.976 48.466 24.098  1.00 30.90 ? 314 ASP A C     1 
ATOM   69   O  O     . ASP A 1 10  ? 34.184 48.588 23.163  1.00 30.67 ? 314 ASP A O     1 
ATOM   70   C  CB    . ASP A 1 10  ? 33.541 50.071 25.374  1.00 37.32 ? 314 ASP A CB    1 
ATOM   71   C  CG    . ASP A 1 10  ? 33.744 51.263 26.276  1.00 42.25 ? 314 ASP A CG    1 
ATOM   72   O  OD1   . ASP A 1 10  ? 33.494 51.195 27.512  1.00 42.05 ? 314 ASP A OD1   1 
ATOM   73   O  OD2   . ASP A 1 10  ? 34.152 52.296 25.711  1.00 45.28 ? 314 ASP A OD2   1 
ATOM   74   N  N     . PHE A 1 11  ? 36.123 47.798 24.011  1.00 28.67 ? 315 PHE A N     1 
ATOM   75   C  CA    . PHE A 1 11  ? 36.569 47.153 22.786  1.00 25.61 ? 315 PHE A CA    1 
ATOM   76   C  C     . PHE A 1 11  ? 35.515 46.184 22.249  1.00 23.29 ? 315 PHE A C     1 
ATOM   77   O  O     . PHE A 1 11  ? 35.177 46.208 21.072  1.00 23.07 ? 315 PHE A O     1 
ATOM   78   C  CB    . PHE A 1 11  ? 37.835 46.343 23.046  1.00 24.54 ? 315 PHE A CB    1 
ATOM   79   C  CG    . PHE A 1 11  ? 38.280 45.569 21.856  1.00 25.50 ? 315 PHE A CG    1 
ATOM   80   C  CD1   . PHE A 1 11  ? 38.898 46.229 20.810  1.00 24.15 ? 315 PHE A CD1   1 
ATOM   81   C  CD2   . PHE A 1 11  ? 37.985 44.206 21.722  1.00 24.56 ? 315 PHE A CD2   1 
ATOM   82   C  CE1   . PHE A 1 11  ? 39.218 45.568 19.640  1.00 24.86 ? 315 PHE A CE1   1 
ATOM   83   C  CE2   . PHE A 1 11  ? 38.300 43.526 20.548  1.00 26.04 ? 315 PHE A CE2   1 
ATOM   84   C  CZ    . PHE A 1 11  ? 38.920 44.213 19.498  1.00 26.22 ? 315 PHE A CZ    1 
ATOM   85   N  N     . LEU A 1 12  ? 35.027 45.308 23.121  1.00 22.77 ? 316 LEU A N     1 
ATOM   86   C  CA    . LEU A 1 12  ? 34.041 44.309 22.724  1.00 23.00 ? 316 LEU A CA    1 
ATOM   87   C  C     . LEU A 1 12  ? 32.805 44.936 22.129  1.00 22.21 ? 316 LEU A C     1 
ATOM   88   O  O     . LEU A 1 12  ? 32.330 44.524 21.078  1.00 21.41 ? 316 LEU A O     1 
ATOM   89   C  CB    . LEU A 1 12  ? 33.646 43.442 23.917  1.00 20.16 ? 316 LEU A CB    1 
ATOM   90   C  CG    . LEU A 1 12  ? 34.744 42.497 24.401  1.00 19.59 ? 316 LEU A CG    1 
ATOM   91   C  CD1   . LEU A 1 12  ? 34.235 41.720 25.608  1.00 19.90 ? 316 LEU A CD1   1 
ATOM   92   C  CD2   . LEU A 1 12  ? 35.143 41.544 23.289  1.00 18.63 ? 316 LEU A CD2   1 
ATOM   93   N  N     . THR A 1 13  ? 32.301 45.948 22.814  1.00 24.01 ? 317 THR A N     1 
ATOM   94   C  CA    . THR A 1 13  ? 31.103 46.662 22.403  1.00 25.56 ? 317 THR A CA    1 
ATOM   95   C  C     . THR A 1 13  ? 31.221 47.232 21.002  1.00 26.16 ? 317 THR A C     1 
ATOM   96   O  O     . THR A 1 13  ? 30.332 47.065 20.164  1.00 26.28 ? 317 THR A O     1 
ATOM   97   C  CB    . THR A 1 13  ? 30.841 47.823 23.360  1.00 26.74 ? 317 THR A CB    1 
ATOM   98   O  OG1   . THR A 1 13  ? 30.795 47.315 24.692  1.00 31.91 ? 317 THR A OG1   1 
ATOM   99   C  CG2   . THR A 1 13  ? 29.527 48.519 23.043  1.00 26.34 ? 317 THR A CG2   1 
ATOM   100  N  N     . SER A 1 14  ? 32.330 47.924 20.780  1.00 24.59 ? 318 SER A N     1 
ATOM   101  C  CA    . SER A 1 14  ? 32.620 48.584 19.519  1.00 24.92 ? 318 SER A CA    1 
ATOM   102  C  C     . SER A 1 14  ? 32.952 47.592 18.402  1.00 23.19 ? 318 SER A C     1 
ATOM   103  O  O     . SER A 1 14  ? 32.538 47.771 17.261  1.00 22.53 ? 318 SER A O     1 
ATOM   104  C  CB    . SER A 1 14  ? 33.768 49.568 19.759  1.00 26.48 ? 318 SER A CB    1 
ATOM   105  O  OG    . SER A 1 14  ? 34.164 50.218 18.573  1.00 32.42 ? 318 SER A OG    1 
ATOM   106  N  N     . TYR A 1 15  ? 33.701 46.547 18.741  1.00 20.60 ? 319 TYR A N     1 
ATOM   107  C  CA    . TYR A 1 15  ? 34.054 45.524 17.769  1.00 20.66 ? 319 TYR A CA    1 
ATOM   108  C  C     . TYR A 1 15  ? 32.781 44.777 17.342  1.00 20.61 ? 319 TYR A C     1 
ATOM   109  O  O     . TYR A 1 15  ? 32.489 44.658 16.155  1.00 20.38 ? 319 TYR A O     1 
ATOM   110  C  CB    . TYR A 1 15  ? 35.071 44.555 18.379  1.00 18.57 ? 319 TYR A CB    1 
ATOM   111  C  CG    . TYR A 1 15  ? 35.458 43.439 17.448  1.00 19.93 ? 319 TYR A CG    1 
ATOM   112  C  CD1   . TYR A 1 15  ? 35.917 43.713 16.159  1.00 19.38 ? 319 TYR A CD1   1 
ATOM   113  C  CD2   . TYR A 1 15  ? 35.366 42.110 17.847  1.00 19.89 ? 319 TYR A CD2   1 
ATOM   114  C  CE1   . TYR A 1 15  ? 36.277 42.692 15.290  1.00 20.19 ? 319 TYR A CE1   1 
ATOM   115  C  CE2   . TYR A 1 15  ? 35.718 41.072 16.981  1.00 21.40 ? 319 TYR A CE2   1 
ATOM   116  C  CZ    . TYR A 1 15  ? 36.172 41.373 15.701  1.00 19.92 ? 319 TYR A CZ    1 
ATOM   117  O  OH    . TYR A 1 15  ? 36.493 40.365 14.828  1.00 18.24 ? 319 TYR A OH    1 
ATOM   118  N  N     . PHE A 1 16  ? 32.023 44.281 18.313  1.00 20.35 ? 320 PHE A N     1 
ATOM   119  C  CA    . PHE A 1 16  ? 30.778 43.586 17.995  1.00 22.96 ? 320 PHE A CA    1 
ATOM   120  C  C     . PHE A 1 16  ? 29.801 44.472 17.228  1.00 23.56 ? 320 PHE A C     1 
ATOM   121  O  O     . PHE A 1 16  ? 29.099 43.978 16.345  1.00 25.03 ? 320 PHE A O     1 
ATOM   122  C  CB    . PHE A 1 16  ? 30.101 43.053 19.267  1.00 21.09 ? 320 PHE A CB    1 
ATOM   123  C  CG    . PHE A 1 16  ? 30.819 41.888 19.881  1.00 20.77 ? 320 PHE A CG    1 
ATOM   124  C  CD1   . PHE A 1 16  ? 30.571 41.502 21.197  1.00 20.35 ? 320 PHE A CD1   1 
ATOM   125  C  CD2   . PHE A 1 16  ? 31.749 41.175 19.138  1.00 21.89 ? 320 PHE A CD2   1 
ATOM   126  C  CE1   . PHE A 1 16  ? 31.253 40.412 21.760  1.00 22.22 ? 320 PHE A CE1   1 
ATOM   127  C  CE2   . PHE A 1 16  ? 32.435 40.091 19.683  1.00 22.87 ? 320 PHE A CE2   1 
ATOM   128  C  CZ    . PHE A 1 16  ? 32.190 39.705 20.997  1.00 22.67 ? 320 PHE A CZ    1 
ATOM   129  N  N     . ALA A 1 17  ? 29.751 45.767 17.530  1.00 23.76 ? 321 ALA A N     1 
ATOM   130  C  CA    . ALA A 1 17  ? 28.816 46.639 16.811  1.00 25.57 ? 321 ALA A CA    1 
ATOM   131  C  C     . ALA A 1 17  ? 29.170 46.716 15.340  1.00 26.05 ? 321 ALA A C     1 
ATOM   132  O  O     . ALA A 1 17  ? 28.314 47.000 14.501  1.00 28.82 ? 321 ALA A O     1 
ATOM   133  C  CB    . ALA A 1 17  ? 28.816 48.044 17.401  1.00 22.80 ? 321 ALA A CB    1 
ATOM   134  N  N     . HIS A 1 18  ? 30.434 46.448 15.031  1.00 25.16 ? 322 HIS A N     1 
ATOM   135  C  CA    . HIS A 1 18  ? 30.918 46.531 13.660  1.00 24.87 ? 322 HIS A CA    1 
ATOM   136  C  C     . HIS A 1 18  ? 31.090 45.199 12.936  1.00 24.30 ? 322 HIS A C     1 
ATOM   137  O  O     . HIS A 1 18  ? 31.044 45.166 11.712  1.00 23.81 ? 322 HIS A O     1 
ATOM   138  C  CB    . HIS A 1 18  ? 32.259 47.290 13.629  1.00 25.74 ? 322 HIS A CB    1 
ATOM   139  C  CG    . HIS A 1 18  ? 32.148 48.739 13.996  1.00 27.45 ? 322 HIS A CG    1 
ATOM   140  N  ND1   . HIS A 1 18  ? 31.994 49.739 13.057  1.00 29.11 ? 322 HIS A ND1   1 
ATOM   141  C  CD2   . HIS A 1 18  ? 32.137 49.354 15.202  1.00 27.09 ? 322 HIS A CD2   1 
ATOM   142  C  CE1   . HIS A 1 18  ? 31.894 50.906 13.670  1.00 28.16 ? 322 HIS A CE1   1 
ATOM   143  N  NE2   . HIS A 1 18  ? 31.977 50.699 14.973  1.00 29.52 ? 322 HIS A NE2   1 
ATOM   144  N  N     . SER A 1 19  ? 31.290 44.110 13.676  1.00 23.81 ? 323 SER A N     1 
ATOM   145  C  CA    . SER A 1 19  ? 31.510 42.800 13.056  1.00 23.09 ? 323 SER A CA    1 
ATOM   146  C  C     . SER A 1 19  ? 30.238 42.116 12.564  1.00 24.29 ? 323 SER A C     1 
ATOM   147  O  O     . SER A 1 19  ? 29.363 41.755 13.358  1.00 23.97 ? 323 SER A O     1 
ATOM   148  C  CB    . SER A 1 19  ? 32.262 41.892 14.042  1.00 20.27 ? 323 SER A CB    1 
ATOM   149  O  OG    . SER A 1 19  ? 32.002 40.516 13.818  1.00 21.35 ? 323 SER A OG    1 
ATOM   150  N  N     . ARG A 1 20  ? 30.135 41.931 11.249  1.00 23.22 ? 324 ARG A N     1 
ATOM   151  C  CA    . ARG A 1 20  ? 28.954 41.292 10.703  1.00 21.30 ? 324 ARG A CA    1 
ATOM   152  C  C     . ARG A 1 20  ? 28.897 39.819 11.118  1.00 21.19 ? 324 ARG A C     1 
ATOM   153  O  O     . ARG A 1 20  ? 27.815 39.253 11.218  1.00 21.19 ? 324 ARG A O     1 
ATOM   154  C  CB    . ARG A 1 20  ? 28.912 41.439 9.173   1.00 21.94 ? 324 ARG A CB    1 
ATOM   155  C  CG    . ARG A 1 20  ? 29.386 40.240 8.365   1.00 21.87 ? 324 ARG A CG    1 
ATOM   156  C  CD    . ARG A 1 20  ? 30.907 40.188 8.164   1.00 20.02 ? 324 ARG A CD    1 
ATOM   157  N  NE    . ARG A 1 20  ? 31.232 39.129 7.212   1.00 18.18 ? 324 ARG A NE    1 
ATOM   158  C  CZ    . ARG A 1 20  ? 32.459 38.727 6.890   1.00 18.99 ? 324 ARG A CZ    1 
ATOM   159  N  NH1   . ARG A 1 20  ? 33.528 39.299 7.439   1.00 14.13 ? 324 ARG A NH1   1 
ATOM   160  N  NH2   . ARG A 1 20  ? 32.612 37.731 6.022   1.00 15.43 ? 324 ARG A NH2   1 
ATOM   161  N  N     . LEU A 1 21  ? 30.044 39.195 11.373  1.00 19.06 ? 325 LEU A N     1 
ATOM   162  C  CA    . LEU A 1 21  ? 30.021 37.795 11.783  1.00 18.95 ? 325 LEU A CA    1 
ATOM   163  C  C     . LEU A 1 21  ? 29.460 37.668 13.214  1.00 20.15 ? 325 LEU A C     1 
ATOM   164  O  O     . LEU A 1 21  ? 28.784 36.690 13.548  1.00 19.09 ? 325 LEU A O     1 
ATOM   165  C  CB    . LEU A 1 21  ? 31.422 37.180 11.665  1.00 18.95 ? 325 LEU A CB    1 
ATOM   166  C  CG    . LEU A 1 21  ? 31.934 37.064 10.220  1.00 19.54 ? 325 LEU A CG    1 
ATOM   167  C  CD1   . LEU A 1 21  ? 33.359 36.508 10.226  1.00 21.57 ? 325 LEU A CD1   1 
ATOM   168  C  CD2   . LEU A 1 21  ? 31.010 36.153 9.400   1.00 19.73 ? 325 LEU A CD2   1 
ATOM   169  N  N     . HIS A 1 22  ? 29.744 38.647 14.066  1.00 21.42 ? 326 HIS A N     1 
ATOM   170  C  CA    . HIS A 1 22  ? 29.177 38.626 15.406  1.00 21.97 ? 326 HIS A CA    1 
ATOM   171  C  C     . HIS A 1 22  ? 27.656 38.803 15.260  1.00 24.21 ? 326 HIS A C     1 
ATOM   172  O  O     . HIS A 1 22  ? 26.879 38.143 15.957  1.00 23.88 ? 326 HIS A O     1 
ATOM   173  C  CB    . HIS A 1 22  ? 29.718 39.763 16.272  1.00 18.92 ? 326 HIS A CB    1 
ATOM   174  C  CG    . HIS A 1 22  ? 28.927 39.983 17.525  1.00 18.67 ? 326 HIS A CG    1 
ATOM   175  N  ND1   . HIS A 1 22  ? 27.911 40.912 17.619  1.00 19.98 ? 326 HIS A ND1   1 
ATOM   176  C  CD2   . HIS A 1 22  ? 28.961 39.349 18.718  1.00 17.62 ? 326 HIS A CD2   1 
ATOM   177  C  CE1   . HIS A 1 22  ? 27.354 40.837 18.814  1.00 16.87 ? 326 HIS A CE1   1 
ATOM   178  N  NE2   . HIS A 1 22  ? 27.972 39.895 19.499  1.00 19.31 ? 326 HIS A NE2   1 
ATOM   179  N  N     . HIS A 1 23  ? 27.221 39.688 14.363  1.00 23.57 ? 327 HIS A N     1 
ATOM   180  C  CA    . HIS A 1 23  ? 25.778 39.892 14.194  1.00 26.18 ? 327 HIS A CA    1 
ATOM   181  C  C     . HIS A 1 23  ? 25.092 38.629 13.735  1.00 26.24 ? 327 HIS A C     1 
ATOM   182  O  O     . HIS A 1 23  ? 24.013 38.290 14.215  1.00 25.50 ? 327 HIS A O     1 
ATOM   183  C  CB    . HIS A 1 23  ? 25.475 40.997 13.184  1.00 26.79 ? 327 HIS A CB    1 
ATOM   184  C  CG    . HIS A 1 23  ? 25.679 42.374 13.725  1.00 28.50 ? 327 HIS A CG    1 
ATOM   185  N  ND1   . HIS A 1 23  ? 24.642 43.154 14.194  1.00 32.22 ? 327 HIS A ND1   1 
ATOM   186  C  CD2   . HIS A 1 23  ? 26.807 43.094 13.916  1.00 28.65 ? 327 HIS A CD2   1 
ATOM   187  C  CE1   . HIS A 1 23  ? 25.124 44.296 14.652  1.00 30.96 ? 327 HIS A CE1   1 
ATOM   188  N  NE2   . HIS A 1 23  ? 26.436 44.285 14.496  1.00 32.21 ? 327 HIS A NE2   1 
ATOM   189  N  N     . LEU A 1 24  ? 25.730 37.936 12.801  1.00 26.06 ? 328 LEU A N     1 
ATOM   190  C  CA    . LEU A 1 24  ? 25.175 36.717 12.263  1.00 26.56 ? 328 LEU A CA    1 
ATOM   191  C  C     . LEU A 1 24  ? 24.939 35.738 13.406  1.00 27.01 ? 328 LEU A C     1 
ATOM   192  O  O     . LEU A 1 24  ? 23.850 35.166 13.535  1.00 26.38 ? 328 LEU A O     1 
ATOM   193  C  CB    . LEU A 1 24  ? 26.145 36.133 11.248  1.00 26.99 ? 328 LEU A CB    1 
ATOM   194  C  CG    . LEU A 1 24  ? 25.753 35.826 9.802   1.00 28.63 ? 328 LEU A CG    1 
ATOM   195  C  CD1   . LEU A 1 24  ? 24.763 36.831 9.199   1.00 29.14 ? 328 LEU A CD1   1 
ATOM   196  C  CD2   . LEU A 1 24  ? 27.064 35.811 9.032   1.00 26.37 ? 328 LEU A CD2   1 
ATOM   197  N  N     . SER A 1 25  ? 25.958 35.557 14.242  1.00 26.23 ? 329 SER A N     1 
ATOM   198  C  CA    . SER A 1 25  ? 25.846 34.639 15.364  1.00 25.75 ? 329 SER A CA    1 
ATOM   199  C  C     . SER A 1 25  ? 24.813 35.077 16.385  1.00 25.97 ? 329 SER A C     1 
ATOM   200  O  O     . SER A 1 25  ? 24.020 34.262 16.855  1.00 27.08 ? 329 SER A O     1 
ATOM   201  C  CB    . SER A 1 25  ? 27.189 34.467 16.051  1.00 23.69 ? 329 SER A CB    1 
ATOM   202  O  OG    . SER A 1 25  ? 28.001 33.619 15.283  1.00 26.10 ? 329 SER A OG    1 
ATOM   203  N  N     . ALA A 1 26  ? 24.820 36.361 16.726  1.00 25.43 ? 330 ALA A N     1 
ATOM   204  C  CA    . ALA A 1 26  ? 23.870 36.874 17.699  1.00 26.61 ? 330 ALA A CA    1 
ATOM   205  C  C     . ALA A 1 26  ? 22.444 36.732 17.167  1.00 28.10 ? 330 ALA A C     1 
ATOM   206  O  O     . ALA A 1 26  ? 21.545 36.304 17.901  1.00 28.81 ? 330 ALA A O     1 
ATOM   207  C  CB    . ALA A 1 26  ? 24.171 38.330 18.022  1.00 22.87 ? 330 ALA A CB    1 
ATOM   208  N  N     . TRP A 1 27  ? 22.227 37.083 15.901  1.00 27.36 ? 331 TRP A N     1 
ATOM   209  C  CA    . TRP A 1 27  ? 20.886 36.956 15.352  1.00 28.05 ? 331 TRP A CA    1 
ATOM   210  C  C     . TRP A 1 27  ? 20.436 35.501 15.386  1.00 28.75 ? 331 TRP A C     1 
ATOM   211  O  O     . TRP A 1 27  ? 19.291 35.222 15.728  1.00 29.36 ? 331 TRP A O     1 
ATOM   212  C  CB    . TRP A 1 27  ? 20.802 37.435 13.909  1.00 26.91 ? 331 TRP A CB    1 
ATOM   213  C  CG    . TRP A 1 27  ? 20.807 38.897 13.740  1.00 27.29 ? 331 TRP A CG    1 
ATOM   214  C  CD1   . TRP A 1 27  ? 20.175 39.816 14.513  1.00 27.91 ? 331 TRP A CD1   1 
ATOM   215  C  CD2   . TRP A 1 27  ? 21.465 39.624 12.699  1.00 27.33 ? 331 TRP A CD2   1 
ATOM   216  N  NE1   . TRP A 1 27  ? 20.400 41.081 14.021  1.00 30.19 ? 331 TRP A NE1   1 
ATOM   217  C  CE2   . TRP A 1 27  ? 21.191 40.988 12.905  1.00 28.48 ? 331 TRP A CE2   1 
ATOM   218  C  CE3   . TRP A 1 27  ? 22.260 39.250 11.609  1.00 26.50 ? 331 TRP A CE3   1 
ATOM   219  C  CZ2   . TRP A 1 27  ? 21.685 41.985 12.061  1.00 27.78 ? 331 TRP A CZ2   1 
ATOM   220  C  CZ3   . TRP A 1 27  ? 22.751 40.236 10.772  1.00 25.66 ? 331 TRP A CZ3   1 
ATOM   221  C  CH2   . TRP A 1 27  ? 22.462 41.589 11.003  1.00 27.53 ? 331 TRP A CH2   1 
ATOM   222  N  N     . LYS A 1 28  ? 21.337 34.586 15.024  1.00 27.34 ? 332 LYS A N     1 
ATOM   223  C  CA    . LYS A 1 28  ? 21.034 33.155 15.003  1.00 27.09 ? 332 LYS A CA    1 
ATOM   224  C  C     . LYS A 1 28  ? 20.610 32.707 16.404  1.00 27.84 ? 332 LYS A C     1 
ATOM   225  O  O     . LYS A 1 28  ? 19.549 32.097 16.571  1.00 25.98 ? 332 LYS A O     1 
ATOM   226  C  CB    . LYS A 1 28  ? 22.261 32.346 14.520  1.00 26.81 ? 332 LYS A CB    1 
ATOM   227  C  CG    . LYS A 1 28  ? 22.082 30.792 14.332  1.00 32.76 ? 332 LYS A CG    1 
ATOM   228  C  CD    . LYS A 1 28  ? 23.407 30.124 13.830  1.00 35.03 ? 332 LYS A CD    1 
ATOM   229  C  CE    . LYS A 1 28  ? 23.340 28.594 13.572  1.00 38.10 ? 332 LYS A CE    1 
ATOM   230  N  NZ    . LYS A 1 28  ? 22.319 28.140 12.573  1.00 40.67 ? 332 LYS A NZ    1 
ATOM   231  N  N     . ALA A 1 29  ? 21.426 33.023 17.409  1.00 26.61 ? 333 ALA A N     1 
ATOM   232  C  CA    . ALA A 1 29  ? 21.120 32.648 18.786  1.00 26.22 ? 333 ALA A CA    1 
ATOM   233  C  C     . ALA A 1 29  ? 19.767 33.192 19.241  1.00 26.20 ? 333 ALA A C     1 
ATOM   234  O  O     . ALA A 1 29  ? 18.998 32.471 19.885  1.00 27.05 ? 333 ALA A O     1 
ATOM   235  C  CB    . ALA A 1 29  ? 22.220 33.138 19.731  1.00 22.39 ? 333 ALA A CB    1 
ATOM   236  N  N     . ASN A 1 30  ? 19.473 34.450 18.916  1.00 25.52 ? 334 ASN A N     1 
ATOM   237  C  CA    . ASN A 1 30  ? 18.196 35.027 19.329  1.00 28.64 ? 334 ASN A CA    1 
ATOM   238  C  C     . ASN A 1 30  ? 17.025 34.336 18.642  1.00 29.01 ? 334 ASN A C     1 
ATOM   239  O  O     . ASN A 1 30  ? 15.988 34.104 19.266  1.00 29.18 ? 334 ASN A O     1 
ATOM   240  C  CB    . ASN A 1 30  ? 18.136 36.527 19.035  1.00 28.55 ? 334 ASN A CB    1 
ATOM   241  C  CG    . ASN A 1 30  ? 19.005 37.341 19.973  1.00 32.32 ? 334 ASN A CG    1 
ATOM   242  O  OD1   . ASN A 1 30  ? 19.423 36.859 21.031  1.00 30.69 ? 334 ASN A OD1   1 
ATOM   243  N  ND2   . ASN A 1 30  ? 19.269 38.594 19.597  1.00 31.84 ? 334 ASN A ND2   1 
ATOM   244  N  N     . LEU A 1 31  ? 17.190 34.003 17.363  1.00 28.49 ? 335 LEU A N     1 
ATOM   245  C  CA    . LEU A 1 31  ? 16.124 33.341 16.630  1.00 29.36 ? 335 LEU A CA    1 
ATOM   246  C  C     . LEU A 1 31  ? 15.811 31.965 17.193  1.00 30.42 ? 335 LEU A C     1 
ATOM   247  O  O     . LEU A 1 31  ? 14.643 31.595 17.294  1.00 30.50 ? 335 LEU A O     1 
ATOM   248  C  CB    . LEU A 1 31  ? 16.473 33.241 15.151  1.00 28.54 ? 335 LEU A CB    1 
ATOM   249  C  CG    . LEU A 1 31  ? 16.299 34.574 14.427  1.00 31.48 ? 335 LEU A CG    1 
ATOM   250  C  CD1   . LEU A 1 31  ? 16.927 34.502 13.048  1.00 32.28 ? 335 LEU A CD1   1 
ATOM   251  C  CD2   . LEU A 1 31  ? 14.813 34.918 14.325  1.00 31.72 ? 335 LEU A CD2   1 
ATOM   252  N  N     . LYS A 1 32  ? 16.847 31.206 17.548  1.00 32.65 ? 336 LYS A N     1 
ATOM   253  C  CA    . LYS A 1 32  ? 16.648 29.884 18.124  1.00 34.91 ? 336 LYS A CA    1 
ATOM   254  C  C     . LYS A 1 32  ? 15.818 30.096 19.403  1.00 36.59 ? 336 LYS A C     1 
ATOM   255  O  O     . LYS A 1 32  ? 14.807 29.426 19.631  1.00 36.75 ? 336 LYS A O     1 
ATOM   256  C  CB    . LYS A 1 32  ? 17.992 29.238 18.476  1.00 34.87 ? 336 LYS A CB    1 
ATOM   257  C  CG    . LYS A 1 32  ? 18.892 28.775 17.309  1.00 37.56 ? 336 LYS A CG    1 
ATOM   258  C  CD    . LYS A 1 32  ? 20.086 28.067 17.955  1.00 41.09 ? 336 LYS A CD    1 
ATOM   259  C  CE    . LYS A 1 32  ? 21.208 27.613 17.048  1.00 43.81 ? 336 LYS A CE    1 
ATOM   260  N  NZ    . LYS A 1 32  ? 22.210 26.998 17.986  1.00 47.33 ? 336 LYS A NZ    1 
ATOM   261  N  N     . ASP A 1 33  ? 16.245 31.057 20.216  1.00 37.51 ? 337 ASP A N     1 
ATOM   262  C  CA    . ASP A 1 33  ? 15.574 31.379 21.463  1.00 39.51 ? 337 ASP A CA    1 
ATOM   263  C  C     . ASP A 1 33  ? 14.099 31.743 21.271  1.00 39.45 ? 337 ASP A C     1 
ATOM   264  O  O     . ASP A 1 33  ? 13.223 31.249 21.988  1.00 39.32 ? 337 ASP A O     1 
ATOM   265  C  CB    . ASP A 1 33  ? 16.286 32.533 22.133  1.00 43.56 ? 337 ASP A CB    1 
ATOM   266  C  CG    . ASP A 1 33  ? 16.527 32.270 23.575  1.00 47.72 ? 337 ASP A CG    1 
ATOM   267  O  OD1   . ASP A 1 33  ? 16.202 33.150 24.401  1.00 50.29 ? 337 ASP A OD1   1 
ATOM   268  O  OD2   . ASP A 1 33  ? 17.044 31.169 23.874  1.00 50.23 ? 337 ASP A OD2   1 
ATOM   269  N  N     . LYS A 1 34  ? 13.841 32.637 20.324  1.00 38.21 ? 338 LYS A N     1 
ATOM   270  C  CA    . LYS A 1 34  ? 12.493 33.077 20.040  1.00 38.08 ? 338 LYS A CA    1 
ATOM   271  C  C     . LYS A 1 34  ? 11.657 31.864 19.648  1.00 37.97 ? 338 LYS A C     1 
ATOM   272  O  O     . LYS A 1 34  ? 10.493 31.750 20.025  1.00 37.59 ? 338 LYS A O     1 
ATOM   273  C  CB    . LYS A 1 34  ? 12.514 34.127 18.921  1.00 39.06 ? 338 LYS A CB    1 
ATOM   274  C  CG    . LYS A 1 34  ? 11.137 34.634 18.479  1.00 41.55 ? 338 LYS A CG    1 
ATOM   275  C  CD    . LYS A 1 34  ? 11.222 35.617 17.297  1.00 43.84 ? 338 LYS A CD    1 
ATOM   276  C  CE    . LYS A 1 34  ? 9.865  36.272 17.012  1.00 45.96 ? 338 LYS A CE    1 
ATOM   277  N  NZ    . LYS A 1 34  ? 9.987  37.688 16.549  1.00 48.77 ? 338 LYS A NZ    1 
ATOM   278  N  N     . PHE A 1 35  ? 12.249 30.936 18.911  1.00 37.31 ? 339 PHE A N     1 
ATOM   279  C  CA    . PHE A 1 35  ? 11.498 29.759 18.530  1.00 38.01 ? 339 PHE A CA    1 
ATOM   280  C  C     . PHE A 1 35  ? 11.124 28.965 19.780  1.00 39.29 ? 339 PHE A C     1 
ATOM   281  O  O     . PHE A 1 35  ? 10.003 28.466 19.889  1.00 39.53 ? 339 PHE A O     1 
ATOM   282  C  CB    . PHE A 1 35  ? 12.307 28.868 17.597  1.00 38.04 ? 339 PHE A CB    1 
ATOM   283  C  CG    . PHE A 1 35  ? 11.583 27.617 17.192  1.00 38.12 ? 339 PHE A CG    1 
ATOM   284  C  CD1   . PHE A 1 35  ? 10.863 27.568 16.007  1.00 37.71 ? 339 PHE A CD1   1 
ATOM   285  C  CD2   . PHE A 1 35  ? 11.615 26.490 18.005  1.00 37.51 ? 339 PHE A CD2   1 
ATOM   286  C  CE1   . PHE A 1 35  ? 10.187 26.411 15.634  1.00 39.49 ? 339 PHE A CE1   1 
ATOM   287  C  CE2   . PHE A 1 35  ? 10.946 25.333 17.647  1.00 38.18 ? 339 PHE A CE2   1 
ATOM   288  C  CZ    . PHE A 1 35  ? 10.229 25.288 16.458  1.00 39.33 ? 339 PHE A CZ    1 
ATOM   289  N  N     . LEU A 1 36  ? 12.064 28.829 20.714  1.00 38.78 ? 340 LEU A N     1 
ATOM   290  C  CA    . LEU A 1 36  ? 11.779 28.089 21.933  1.00 39.26 ? 340 LEU A CA    1 
ATOM   291  C  C     . LEU A 1 36  ? 10.719 28.788 22.772  1.00 39.68 ? 340 LEU A C     1 
ATOM   292  O  O     . LEU A 1 36  ? 9.884  28.130 23.380  1.00 38.34 ? 340 LEU A O     1 
ATOM   293  C  CB    . LEU A 1 36  ? 13.043 27.893 22.765  1.00 38.28 ? 340 LEU A CB    1 
ATOM   294  C  CG    . LEU A 1 36  ? 14.075 26.993 22.094  1.00 38.86 ? 340 LEU A CG    1 
ATOM   295  C  CD1   . LEU A 1 36  ? 15.300 26.864 22.980  1.00 35.39 ? 340 LEU A CD1   1 
ATOM   296  C  CD2   . LEU A 1 36  ? 13.449 25.629 21.810  1.00 35.97 ? 340 LEU A CD2   1 
ATOM   297  N  N     . ASN A 1 37  ? 10.746 30.116 22.806  1.00 40.62 ? 341 ASN A N     1 
ATOM   298  C  CA    . ASN A 1 37  ? 9.756  30.845 23.590  1.00 44.04 ? 341 ASN A CA    1 
ATOM   299  C  C     . ASN A 1 37  ? 8.350  30.776 22.981  1.00 45.12 ? 341 ASN A C     1 
ATOM   300  O  O     . ASN A 1 37  ? 7.373  30.594 23.704  1.00 44.54 ? 341 ASN A O     1 
ATOM   301  C  CB    . ASN A 1 37  ? 10.152 32.316 23.764  1.00 44.77 ? 341 ASN A CB    1 
ATOM   302  C  CG    . ASN A 1 37  ? 11.422 32.494 24.579  1.00 48.19 ? 341 ASN A CG    1 
ATOM   303  O  OD1   . ASN A 1 37  ? 11.685 31.741 25.523  1.00 48.55 ? 341 ASN A OD1   1 
ATOM   304  N  ND2   . ASN A 1 37  ? 12.212 33.511 24.227  1.00 48.87 ? 341 ASN A ND2   1 
ATOM   305  N  N     . GLU A 1 38  ? 8.258  30.922 21.659  1.00 45.78 ? 342 GLU A N     1 
ATOM   306  C  CA    . GLU A 1 38  ? 6.977  30.886 20.955  1.00 46.83 ? 342 GLU A CA    1 
ATOM   307  C  C     . GLU A 1 38  ? 6.348  29.505 20.964  1.00 46.62 ? 342 GLU A C     1 
ATOM   308  O  O     . GLU A 1 38  ? 5.136  29.366 20.831  1.00 47.39 ? 342 GLU A O     1 
ATOM   309  C  CB    . GLU A 1 38  ? 7.141  31.345 19.497  1.00 48.52 ? 342 GLU A CB    1 
ATOM   310  C  CG    . GLU A 1 38  ? 7.425  32.830 19.345  1.00 51.23 ? 342 GLU A CG    1 
ATOM   311  C  CD    . GLU A 1 38  ? 7.662  33.266 17.900  1.00 53.87 ? 342 GLU A CD    1 
ATOM   312  O  OE1   . GLU A 1 38  ? 7.813  32.403 17.001  1.00 53.86 ? 342 GLU A OE1   1 
ATOM   313  O  OE2   . GLU A 1 38  ? 7.707  34.493 17.670  1.00 55.51 ? 342 GLU A OE2   1 
ATOM   314  N  N     . ASN A 1 39  ? 7.165  28.475 21.112  1.00 45.73 ? 343 ASN A N     1 
ATOM   315  C  CA    . ASN A 1 39  ? 6.620  27.130 21.120  1.00 44.85 ? 343 ASN A CA    1 
ATOM   316  C  C     . ASN A 1 39  ? 6.695  26.419 22.473  1.00 45.27 ? 343 ASN A C     1 
ATOM   317  O  O     . ASN A 1 39  ? 6.645  25.193 22.511  1.00 44.57 ? 343 ASN A O     1 
ATOM   318  C  CB    . ASN A 1 39  ? 7.299  26.273 20.037  1.00 44.70 ? 343 ASN A CB    1 
ATOM   319  C  CG    . ASN A 1 39  ? 6.979  26.746 18.621  1.00 45.84 ? 343 ASN A CG    1 
ATOM   320  O  OD1   . ASN A 1 39  ? 5.913  26.450 18.072  1.00 46.69 ? 343 ASN A OD1   1 
ATOM   321  N  ND2   . ASN A 1 39  ? 7.901  27.493 18.029  1.00 45.53 ? 343 ASN A ND2   1 
ATOM   322  N  N     . ILE A 1 40  ? 6.806  27.161 23.580  1.00 46.81 ? 344 ILE A N     1 
ATOM   323  C  CA    . ILE A 1 40  ? 6.850  26.516 24.901  1.00 49.22 ? 344 ILE A CA    1 
ATOM   324  C  C     . ILE A 1 40  ? 5.671  25.558 25.076  1.00 51.39 ? 344 ILE A C     1 
ATOM   325  O  O     . ILE A 1 40  ? 5.814  24.474 25.647  1.00 50.62 ? 344 ILE A O     1 
ATOM   326  C  CB    . ILE A 1 40  ? 6.814  27.538 26.116  1.00 50.32 ? 344 ILE A CB    1 
ATOM   327  C  CG1   . ILE A 1 40  ? 6.013  28.808 25.775  1.00 51.01 ? 344 ILE A CG1   1 
ATOM   328  C  CG2   . ILE A 1 40  ? 8.223  27.851 26.561  1.00 51.25 ? 344 ILE A CG2   1 
ATOM   329  C  CD1   . ILE A 1 40  ? 6.278  30.030 26.720  1.00 53.11 ? 344 ILE A CD1   1 
ATOM   330  N  N     . HIS A 1 41  ? 4.513  25.958 24.553  1.00 53.38 ? 345 HIS A N     1 
ATOM   331  C  CA    . HIS A 1 41  ? 3.286  25.174 24.664  1.00 55.77 ? 345 HIS A CA    1 
ATOM   332  C  C     . HIS A 1 41  ? 2.740  24.596 23.364  1.00 58.42 ? 345 HIS A C     1 
ATOM   333  O  O     . HIS A 1 41  ? 1.528  24.563 23.167  1.00 59.54 ? 345 HIS A O     1 
ATOM   334  C  CB    . HIS A 1 41  ? 2.198  26.040 25.284  1.00 54.38 ? 345 HIS A CB    1 
ATOM   335  C  CG    . HIS A 1 41  ? 2.605  26.690 26.566  1.00 53.39 ? 345 HIS A CG    1 
ATOM   336  N  ND1   . HIS A 1 41  ? 3.136  25.980 27.620  1.00 52.36 ? 345 HIS A ND1   1 
ATOM   337  C  CD2   . HIS A 1 41  ? 2.520  27.977 26.981  1.00 52.55 ? 345 HIS A CD2   1 
ATOM   338  C  CE1   . HIS A 1 41  ? 3.357  26.800 28.632  1.00 51.26 ? 345 HIS A CE1   1 
ATOM   339  N  NE2   . HIS A 1 41  ? 2.991  28.016 28.271  1.00 51.77 ? 345 HIS A NE2   1 
ATOM   340  N  N     . LYS A 1 42  ? 3.610  24.132 22.479  1.00 61.20 ? 346 LYS A N     1 
ATOM   341  C  CA    . LYS A 1 42  ? 3.143  23.575 21.218  1.00 63.46 ? 346 LYS A CA    1 
ATOM   342  C  C     . LYS A 1 42  ? 3.815  22.250 20.912  1.00 65.66 ? 346 LYS A C     1 
ATOM   343  O  O     . LYS A 1 42  ? 5.044  22.191 20.870  1.00 66.38 ? 346 LYS A O     1 
ATOM   344  C  CB    . LYS A 1 42  ? 3.430  24.559 20.085  1.00 63.61 ? 346 LYS A CB    1 
ATOM   345  C  CG    . LYS A 1 42  ? 2.285  25.471 19.704  1.00 63.54 ? 346 LYS A CG    1 
ATOM   346  C  CD    . LYS A 1 42  ? 1.329  24.760 18.757  1.00 64.64 ? 346 LYS A CD    1 
ATOM   347  C  CE    . LYS A 1 42  ? 0.777  25.707 17.695  1.00 64.51 ? 346 LYS A CE    1 
ATOM   348  N  NZ    . LYS A 1 42  ? 1.226  27.107 17.885  1.00 64.60 ? 346 LYS A NZ    1 
ATOM   349  N  N     . TYR A 1 43  ? 3.014  21.193 20.718  1.00 68.05 ? 347 TYR A N     1 
ATOM   350  C  CA    . TYR A 1 43  ? 3.546  19.868 20.371  1.00 71.27 ? 347 TYR A CA    1 
ATOM   351  C  C     . TYR A 1 43  ? 4.210  20.160 19.030  1.00 73.22 ? 347 TYR A C     1 
ATOM   352  O  O     . TYR A 1 43  ? 3.572  20.647 18.089  1.00 73.22 ? 347 TYR A O     1 
ATOM   353  C  CB    . TYR A 1 43  ? 2.430  18.848 20.247  1.00 71.02 ? 347 TYR A CB    1 
ATOM   354  N  N     . THR A 1 44  ? 5.485  19.798 18.959  1.00 75.66 ? 348 THR A N     1 
ATOM   355  C  CA    . THR A 1 44  ? 6.365  20.187 17.872  1.00 77.76 ? 348 THR A CA    1 
ATOM   356  C  C     . THR A 1 44  ? 7.131  19.169 16.990  1.00 78.50 ? 348 THR A C     1 
ATOM   357  O  O     . THR A 1 44  ? 7.426  19.454 15.817  1.00 78.82 ? 348 THR A O     1 
ATOM   358  C  CB    . THR A 1 44  ? 7.351  21.138 18.566  1.00 78.14 ? 348 THR A CB    1 
ATOM   359  O  OG1   . THR A 1 44  ? 8.060  21.941 17.626  1.00 79.12 ? 348 THR A OG1   1 
ATOM   360  C  CG2   . THR A 1 44  ? 8.306  20.319 19.422  1.00 78.34 ? 348 THR A CG2   1 
ATOM   361  N  N     . LYS A 1 45  ? 7.466  18.010 17.561  1.00 79.39 ? 349 LYS A N     1 
ATOM   362  C  CA    . LYS A 1 45  ? 8.226  16.960 16.866  1.00 79.83 ? 349 LYS A CA    1 
ATOM   363  C  C     . LYS A 1 45  ? 7.497  16.279 15.708  1.00 79.54 ? 349 LYS A C     1 
ATOM   364  O  O     . LYS A 1 45  ? 6.279  16.074 15.736  1.00 79.28 ? 349 LYS A O     1 
ATOM   365  C  CB    . LYS A 1 45  ? 8.657  15.842 17.841  1.00 80.57 ? 349 LYS A CB    1 
ATOM   366  C  CG    . LYS A 1 45  ? 9.452  16.238 19.093  1.00 81.55 ? 349 LYS A CG    1 
ATOM   367  C  CD    . LYS A 1 45  ? 9.833  14.988 19.924  1.00 82.06 ? 349 LYS A CD    1 
ATOM   368  C  CE    . LYS A 1 45  ? 9.830  15.273 21.427  1.00 82.88 ? 349 LYS A CE    1 
ATOM   369  N  NZ    . LYS A 1 45  ? 10.935 14.586 22.155  1.00 83.11 ? 349 LYS A NZ    1 
ATOM   370  N  N     . ILE A 1 46  ? 8.271  15.911 14.696  1.00 78.67 ? 350 ILE A N     1 
ATOM   371  C  CA    . ILE A 1 46  ? 7.748  15.208 13.543  1.00 77.32 ? 350 ILE A CA    1 
ATOM   372  C  C     . ILE A 1 46  ? 8.191  13.766 13.764  1.00 76.82 ? 350 ILE A C     1 
ATOM   373  O  O     . ILE A 1 46  ? 9.187  13.529 14.453  1.00 77.22 ? 350 ILE A O     1 
ATOM   374  C  CB    . ILE A 1 46  ? 8.318  15.819 12.264  1.00 76.97 ? 350 ILE A CB    1 
ATOM   375  C  CG1   . ILE A 1 46  ? 7.676  17.196 12.075  1.00 76.10 ? 350 ILE A CG1   1 
ATOM   376  C  CG2   . ILE A 1 46  ? 8.070  14.916 11.076  1.00 76.85 ? 350 ILE A CG2   1 
ATOM   377  C  CD1   . ILE A 1 46  ? 8.130  17.935 10.868  1.00 75.12 ? 350 ILE A CD1   1 
ATOM   378  N  N     . THR A 1 47  ? 7.446  12.810 13.207  1.00 75.64 ? 351 THR A N     1 
ATOM   379  C  CA    . THR A 1 47  ? 7.733  11.384 13.403  1.00 75.11 ? 351 THR A CA    1 
ATOM   380  C  C     . THR A 1 47  ? 8.157  10.605 12.146  1.00 74.28 ? 351 THR A C     1 
ATOM   381  O  O     . THR A 1 47  ? 8.215  11.164 11.053  1.00 74.15 ? 351 THR A O     1 
ATOM   382  C  CB    . THR A 1 47  ? 6.494  10.688 14.032  1.00 75.41 ? 351 THR A CB    1 
ATOM   383  O  OG1   . THR A 1 47  ? 5.409  10.688 13.093  1.00 76.34 ? 351 THR A OG1   1 
ATOM   384  C  CG2   . THR A 1 47  ? 6.043  11.436 15.288  1.00 75.57 ? 351 THR A CG2   1 
ATOM   385  N  N     . ASP A 1 48  ? 8.469  9.316  12.315  1.00 73.92 ? 352 ASP A N     1 
ATOM   386  C  CA    . ASP A 1 48  ? 8.865  8.452  11.190  1.00 73.56 ? 352 ASP A CA    1 
ATOM   387  C  C     . ASP A 1 48  ? 7.655  8.244  10.296  1.00 72.78 ? 352 ASP A C     1 
ATOM   388  O  O     . ASP A 1 48  ? 7.763  8.200  9.072   1.00 72.84 ? 352 ASP A O     1 
ATOM   389  C  CB    . ASP A 1 48  ? 9.299  7.053  11.653  1.00 73.99 ? 352 ASP A CB    1 
ATOM   390  C  CG    . ASP A 1 48  ? 10.581 7.055  12.448  1.00 74.81 ? 352 ASP A CG    1 
ATOM   391  O  OD1   . ASP A 1 48  ? 11.449 7.917  12.193  1.00 75.40 ? 352 ASP A OD1   1 
ATOM   392  O  OD2   . ASP A 1 48  ? 10.727 6.169  13.318  1.00 74.96 ? 352 ASP A OD2   1 
ATOM   393  N  N     . LYS A 1 49  ? 6.507  8.088  10.950  1.00 71.90 ? 353 LYS A N     1 
ATOM   394  C  CA    . LYS A 1 49  ? 5.218  7.849  10.305  1.00 70.33 ? 353 LYS A CA    1 
ATOM   395  C  C     . LYS A 1 49  ? 4.731  8.992  9.393   1.00 68.96 ? 353 LYS A C     1 
ATOM   396  O  O     . LYS A 1 49  ? 3.972  8.752  8.452   1.00 69.21 ? 353 LYS A O     1 
ATOM   397  C  CB    . LYS A 1 49  ? 4.160  7.542  11.391  1.00 69.96 ? 353 LYS A CB    1 
ATOM   398  N  N     . ASP A 1 50  ? 5.187  10.216 9.674   1.00 66.74 ? 354 ASP A N     1 
ATOM   399  C  CA    . ASP A 1 50  ? 4.818  11.446 8.942   1.00 64.12 ? 354 ASP A CA    1 
ATOM   400  C  C     . ASP A 1 50  ? 5.359  11.624 7.501   1.00 61.62 ? 354 ASP A C     1 
ATOM   401  O  O     . ASP A 1 50  ? 6.498  11.265 7.209   1.00 61.01 ? 354 ASP A O     1 
ATOM   402  C  CB    . ASP A 1 50  ? 5.273  12.692 9.740   1.00 66.29 ? 354 ASP A CB    1 
ATOM   403  C  CG    . ASP A 1 50  ? 4.398  13.003 10.962  1.00 68.43 ? 354 ASP A CG    1 
ATOM   404  O  OD1   . ASP A 1 50  ? 3.180  12.717 10.940  1.00 69.82 ? 354 ASP A OD1   1 
ATOM   405  O  OD2   . ASP A 1 50  ? 4.935  13.576 11.943  1.00 68.94 ? 354 ASP A OD2   1 
ATOM   406  N  N     . THR A 1 51  ? 4.551  12.205 6.612   1.00 58.26 ? 355 THR A N     1 
ATOM   407  C  CA    . THR A 1 51  ? 4.993  12.481 5.239   1.00 55.36 ? 355 THR A CA    1 
ATOM   408  C  C     . THR A 1 51  ? 5.121  13.995 5.168   1.00 53.97 ? 355 THR A C     1 
ATOM   409  O  O     . THR A 1 51  ? 4.191  14.718 5.539   1.00 54.32 ? 355 THR A O     1 
ATOM   410  C  CB    . THR A 1 51  ? 3.979  11.998 4.176   1.00 55.08 ? 355 THR A CB    1 
ATOM   411  O  OG1   . THR A 1 51  ? 3.829  10.579 4.283   1.00 55.56 ? 355 THR A OG1   1 
ATOM   412  C  CG2   . THR A 1 51  ? 4.469  12.326 2.770   1.00 52.97 ? 355 THR A CG2   1 
ATOM   413  N  N     . TYR A 1 52  ? 6.262  14.481 4.688   1.00 51.52 ? 356 TYR A N     1 
ATOM   414  C  CA    . TYR A 1 52  ? 6.482  15.923 4.661   1.00 50.05 ? 356 TYR A CA    1 
ATOM   415  C  C     . TYR A 1 52  ? 7.219  16.493 3.455   1.00 48.91 ? 356 TYR A C     1 
ATOM   416  O  O     . TYR A 1 52  ? 7.968  15.798 2.776   1.00 49.49 ? 356 TYR A O     1 
ATOM   417  C  CB    . TYR A 1 52  ? 7.220  16.323 5.948   1.00 49.00 ? 356 TYR A CB    1 
ATOM   418  C  CG    . TYR A 1 52  ? 8.538  15.598 6.150   1.00 48.66 ? 356 TYR A CG    1 
ATOM   419  C  CD1   . TYR A 1 52  ? 9.651  15.907 5.367   1.00 49.16 ? 356 TYR A CD1   1 
ATOM   420  C  CD2   . TYR A 1 52  ? 8.671  14.595 7.109   1.00 47.74 ? 356 TYR A CD2   1 
ATOM   421  C  CE1   . TYR A 1 52  ? 10.864 15.233 5.531   1.00 48.75 ? 356 TYR A CE1   1 
ATOM   422  C  CE2   . TYR A 1 52  ? 9.883  13.915 7.282   1.00 48.82 ? 356 TYR A CE2   1 
ATOM   423  C  CZ    . TYR A 1 52  ? 10.973 14.240 6.486   1.00 48.78 ? 356 TYR A CZ    1 
ATOM   424  O  OH    . TYR A 1 52  ? 12.166 13.566 6.625   1.00 50.38 ? 356 TYR A OH    1 
ATOM   425  N  N     . ILE A 1 53  ? 7.000  17.777 3.208   1.00 47.49 ? 357 ILE A N     1 
ATOM   426  C  CA    . ILE A 1 53  ? 7.643  18.484 2.111   1.00 46.50 ? 357 ILE A CA    1 
ATOM   427  C  C     . ILE A 1 53  ? 8.459  19.639 2.702   1.00 45.08 ? 357 ILE A C     1 
ATOM   428  O  O     . ILE A 1 53  ? 7.959  20.378 3.549   1.00 45.51 ? 357 ILE A O     1 
ATOM   429  C  CB    . ILE A 1 53  ? 6.559  19.013 1.146   1.00 47.46 ? 357 ILE A CB    1 
ATOM   430  C  CG1   . ILE A 1 53  ? 5.758  17.826 0.594   1.00 48.67 ? 357 ILE A CG1   1 
ATOM   431  C  CG2   . ILE A 1 53  ? 7.191  19.855 0.044   1.00 47.83 ? 357 ILE A CG2   1 
ATOM   432  C  CD1   . ILE A 1 53  ? 5.999  17.523 -0.853  1.00 48.95 ? 357 ILE A CD1   1 
ATOM   433  N  N     . ILE A 1 54  ? 9.709  19.770 2.284   1.00 43.26 ? 358 ILE A N     1 
ATOM   434  C  CA    . ILE A 1 54  ? 10.578 20.815 2.786   1.00 40.39 ? 358 ILE A CA    1 
ATOM   435  C  C     . ILE A 1 54  ? 10.666 21.965 1.834   1.00 39.71 ? 358 ILE A C     1 
ATOM   436  O  O     . ILE A 1 54  ? 10.820 21.792 0.609   1.00 39.37 ? 358 ILE A O     1 
ATOM   437  C  CB    . ILE A 1 54  ? 12.047 20.347 2.905   1.00 39.52 ? 358 ILE A CB    1 
ATOM   438  C  CG1   . ILE A 1 54  ? 12.130 19.069 3.749   1.00 37.55 ? 358 ILE A CG1   1 
ATOM   439  C  CG2   . ILE A 1 54  ? 12.928 21.463 3.435   1.00 39.40 ? 358 ILE A CG2   1 
ATOM   440  C  CD1   . ILE A 1 54  ? 11.503 19.182 5.110   1.00 38.75 ? 358 ILE A CD1   1 
ATOM   441  N  N     . PHE A 1 55  ? 10.501 23.166 2.337   1.00 38.15 ? 359 PHE A N     1 
ATOM   442  C  CA    . PHE A 1 55  ? 10.580 24.331 1.474   1.00 37.35 ? 359 PHE A CA    1 
ATOM   443  C  C     . PHE A 1 55  ? 11.699 25.122 2.086   1.00 35.79 ? 359 PHE A C     1 
ATOM   444  O  O     . PHE A 1 55  ? 11.488 25.743 3.103   1.00 33.82 ? 359 PHE A O     1 
ATOM   445  C  CB    . PHE A 1 55  ? 9.264  25.059 1.697   1.00 38.10 ? 359 PHE A CB    1 
ATOM   446  C  CG    . PHE A 1 55  ? 8.161  24.637 0.814   1.00 40.10 ? 359 PHE A CG    1 
ATOM   447  C  CD1   . PHE A 1 55  ? 7.426  23.479 1.059   1.00 40.21 ? 359 PHE A CD1   1 
ATOM   448  C  CD2   . PHE A 1 55  ? 7.795  25.464 -0.221  1.00 40.31 ? 359 PHE A CD2   1 
ATOM   449  C  CE1   . PHE A 1 55  ? 6.324  23.174 0.261   1.00 40.33 ? 359 PHE A CE1   1 
ATOM   450  C  CE2   . PHE A 1 55  ? 6.731  25.178 -0.999  1.00 40.62 ? 359 PHE A CE2   1 
ATOM   451  C  CZ    . PHE A 1 55  ? 5.983  24.043 -0.774  1.00 40.67 ? 359 PHE A CZ    1 
ATOM   452  N  N     . HIS A 1 56  ? 12.871 25.116 1.483   1.00 34.08 ? 360 HIS A N     1 
ATOM   453  C  CA    . HIS A 1 56  ? 14.000 25.857 2.039   1.00 32.21 ? 360 HIS A CA    1 
ATOM   454  C  C     . HIS A 1 56  ? 14.016 27.253 1.415   1.00 31.36 ? 360 HIS A C     1 
ATOM   455  O  O     . HIS A 1 56  ? 14.195 27.378 0.211   1.00 32.53 ? 360 HIS A O     1 
ATOM   456  C  CB    . HIS A 1 56  ? 15.288 25.081 1.746   1.00 33.33 ? 360 HIS A CB    1 
ATOM   457  C  CG    . HIS A 1 56  ? 16.449 25.455 2.620   1.00 34.59 ? 360 HIS A CG    1 
ATOM   458  N  ND1   . HIS A 1 56  ? 17.284 24.512 3.179   1.00 35.53 ? 360 HIS A ND1   1 
ATOM   459  C  CD2   . HIS A 1 56  ? 16.943 26.659 2.992   1.00 33.10 ? 360 HIS A CD2   1 
ATOM   460  C  CE1   . HIS A 1 56  ? 18.240 25.117 3.859   1.00 35.36 ? 360 HIS A CE1   1 
ATOM   461  N  NE2   . HIS A 1 56  ? 18.057 26.421 3.762   1.00 35.92 ? 360 HIS A NE2   1 
ATOM   462  N  N     . ILE A 1 57  ? 13.811 28.286 2.237   1.00 30.48 ? 361 ILE A N     1 
ATOM   463  C  CA    . ILE A 1 57  ? 13.704 29.674 1.773   1.00 30.08 ? 361 ILE A CA    1 
ATOM   464  C  C     . ILE A 1 57  ? 14.863 30.546 2.256   1.00 31.21 ? 361 ILE A C     1 
ATOM   465  O  O     . ILE A 1 57  ? 15.167 30.584 3.449   1.00 30.73 ? 361 ILE A O     1 
ATOM   466  C  CB    . ILE A 1 57  ? 12.362 30.239 2.260   1.00 30.55 ? 361 ILE A CB    1 
ATOM   467  C  CG1   . ILE A 1 57  ? 11.292 29.156 2.105   1.00 31.33 ? 361 ILE A CG1   1 
ATOM   468  C  CG2   . ILE A 1 57  ? 11.977 31.483 1.481   1.00 28.55 ? 361 ILE A CG2   1 
ATOM   469  C  CD1   . ILE A 1 57  ? 9.877  29.631 2.348   1.00 33.35 ? 361 ILE A CD1   1 
ATOM   470  N  N     . ASP A 1 58  ? 15.463 31.289 1.329   1.00 31.16 ? 362 ASP A N     1 
ATOM   471  C  CA    . ASP A 1 58  ? 16.653 32.095 1.618   1.00 30.97 ? 362 ASP A CA    1 
ATOM   472  C  C     . ASP A 1 58  ? 16.653 33.396 0.818   1.00 30.08 ? 362 ASP A C     1 
ATOM   473  O  O     . ASP A 1 58  ? 16.307 33.385 -0.356  1.00 29.66 ? 362 ASP A O     1 
ATOM   474  C  CB    . ASP A 1 58  ? 17.865 31.214 1.227   1.00 34.22 ? 362 ASP A CB    1 
ATOM   475  C  CG    . ASP A 1 58  ? 19.206 31.889 1.411   1.00 34.27 ? 362 ASP A CG    1 
ATOM   476  O  OD1   . ASP A 1 58  ? 19.537 32.827 0.664   1.00 37.15 ? 362 ASP A OD1   1 
ATOM   477  O  OD2   . ASP A 1 58  ? 19.955 31.454 2.309   1.00 40.83 ? 362 ASP A OD2   1 
ATOM   478  N  N     . PHE A 1 59  ? 17.021 34.516 1.435   1.00 28.69 ? 363 PHE A N     1 
ATOM   479  C  CA    . PHE A 1 59  ? 17.093 35.768 0.682   1.00 28.34 ? 363 PHE A CA    1 
ATOM   480  C  C     . PHE A 1 59  ? 18.247 35.673 -0.314  1.00 29.77 ? 363 PHE A C     1 
ATOM   481  O  O     . PHE A 1 59  ? 19.282 35.075 -0.021  1.00 28.32 ? 363 PHE A O     1 
ATOM   482  C  CB    . PHE A 1 59  ? 17.461 36.954 1.564   1.00 29.13 ? 363 PHE A CB    1 
ATOM   483  C  CG    . PHE A 1 59  ? 16.334 37.534 2.332   1.00 29.20 ? 363 PHE A CG    1 
ATOM   484  C  CD1   . PHE A 1 59  ? 15.766 36.841 3.390   1.00 29.41 ? 363 PHE A CD1   1 
ATOM   485  C  CD2   . PHE A 1 59  ? 15.893 38.821 2.052   1.00 30.14 ? 363 PHE A CD2   1 
ATOM   486  C  CE1   . PHE A 1 59  ? 14.777 37.424 4.163   1.00 30.05 ? 363 PHE A CE1   1 
ATOM   487  C  CE2   . PHE A 1 59  ? 14.901 39.415 2.825   1.00 31.50 ? 363 PHE A CE2   1 
ATOM   488  C  CZ    . PHE A 1 59  ? 14.343 38.718 3.882   1.00 30.27 ? 363 PHE A CZ    1 
ATOM   489  N  N     . ASP A 1 60  ? 18.101 36.297 -1.477  1.00 30.81 ? 364 ASP A N     1 
ATOM   490  C  CA    . ASP A 1 60  ? 19.200 36.312 -2.440  1.00 30.69 ? 364 ASP A CA    1 
ATOM   491  C  C     . ASP A 1 60  ? 20.158 37.444 -2.044  1.00 30.13 ? 364 ASP A C     1 
ATOM   492  O  O     . ASP A 1 60  ? 19.708 38.553 -1.718  1.00 29.58 ? 364 ASP A O     1 
ATOM   493  C  CB    . ASP A 1 60  ? 18.694 36.574 -3.855  1.00 31.81 ? 364 ASP A CB    1 
ATOM   494  C  CG    . ASP A 1 60  ? 17.711 35.527 -4.328  1.00 34.89 ? 364 ASP A CG    1 
ATOM   495  O  OD1   . ASP A 1 60  ? 17.966 34.317 -4.163  1.00 32.36 ? 364 ASP A OD1   1 
ATOM   496  O  OD2   . ASP A 1 60  ? 16.678 35.922 -4.885  1.00 37.97 ? 364 ASP A OD2   1 
ATOM   497  N  N     . CYS A 1 61  ? 21.463 37.157 -2.091  1.00 28.31 ? 365 CYS A N     1 
ATOM   498  C  CA    . CYS A 1 61  ? 22.526 38.120 -1.741  1.00 28.56 ? 365 CYS A CA    1 
ATOM   499  C  C     . CYS A 1 61  ? 21.963 39.164 -0.792  1.00 26.84 ? 365 CYS A C     1 
ATOM   500  O  O     . CYS A 1 61  ? 21.874 40.348 -1.107  1.00 26.10 ? 365 CYS A O     1 
ATOM   501  C  CB    . CYS A 1 61  ? 23.098 38.788 -2.996  1.00 28.72 ? 365 CYS A CB    1 
ATOM   502  S  SG    . CYS A 1 61  ? 21.939 39.785 -3.958  1.00 31.50 ? 365 CYS A SG    1 
ATOM   503  N  N     . PHE A 1 62  ? 21.602 38.668 0.383   1.00 26.76 ? 366 PHE A N     1 
ATOM   504  C  CA    . PHE A 1 62  ? 20.936 39.412 1.438   1.00 27.45 ? 366 PHE A CA    1 
ATOM   505  C  C     . PHE A 1 62  ? 21.382 40.805 1.874   1.00 27.78 ? 366 PHE A C     1 
ATOM   506  O  O     . PHE A 1 62  ? 20.565 41.723 1.930   1.00 30.64 ? 366 PHE A O     1 
ATOM   507  C  CB    . PHE A 1 62  ? 20.809 38.488 2.648   1.00 26.82 ? 366 PHE A CB    1 
ATOM   508  C  CG    . PHE A 1 62  ? 20.020 39.078 3.773   1.00 28.18 ? 366 PHE A CG    1 
ATOM   509  C  CD1   . PHE A 1 62  ? 18.755 39.643 3.558   1.00 27.89 ? 366 PHE A CD1   1 
ATOM   510  C  CD2   . PHE A 1 62  ? 20.537 39.057 5.063   1.00 26.08 ? 366 PHE A CD2   1 
ATOM   511  C  CE1   . PHE A 1 62  ? 18.030 40.182 4.621   1.00 28.10 ? 366 PHE A CE1   1 
ATOM   512  C  CE2   . PHE A 1 62  ? 19.825 39.589 6.132   1.00 26.63 ? 366 PHE A CE2   1 
ATOM   513  C  CZ    . PHE A 1 62  ? 18.561 40.154 5.908   1.00 27.84 ? 366 PHE A CZ    1 
ATOM   514  N  N     . PHE A 1 63  ? 22.648 40.976 2.214   1.00 25.74 ? 367 PHE A N     1 
ATOM   515  C  CA    . PHE A 1 63  ? 23.100 42.285 2.643   1.00 25.10 ? 367 PHE A CA    1 
ATOM   516  C  C     . PHE A 1 63  ? 23.203 43.213 1.443   1.00 24.82 ? 367 PHE A C     1 
ATOM   517  O  O     . PHE A 1 63  ? 22.887 44.401 1.511   1.00 25.67 ? 367 PHE A O     1 
ATOM   518  C  CB    . PHE A 1 63  ? 24.473 42.172 3.241   1.00 24.60 ? 367 PHE A CB    1 
ATOM   519  C  CG    . PHE A 1 63  ? 24.545 41.650 4.658   1.00 23.77 ? 367 PHE A CG    1 
ATOM   520  C  CD1   . PHE A 1 63  ? 23.510 40.996 5.346   1.00 22.04 ? 367 PHE A CD1   1 
ATOM   521  C  CD2   . PHE A 1 63  ? 25.760 41.820 5.292   1.00 23.87 ? 367 PHE A CD2   1 
ATOM   522  C  CE1   . PHE A 1 63  ? 23.744 40.531 6.665   1.00 22.76 ? 367 PHE A CE1   1 
ATOM   523  C  CE2   . PHE A 1 63  ? 25.998 41.377 6.561   1.00 24.08 ? 367 PHE A CE2   1 
ATOM   524  C  CZ    . PHE A 1 63  ? 25.005 40.730 7.270   1.00 23.58 ? 367 PHE A CZ    1 
ATOM   525  N  N     . ALA A 1 64  ? 23.690 42.655 0.344   1.00 24.30 ? 368 ALA A N     1 
ATOM   526  C  CA    . ALA A 1 64  ? 23.843 43.416 -0.884  1.00 25.94 ? 368 ALA A CA    1 
ATOM   527  C  C     . ALA A 1 64  ? 22.493 43.980 -1.296  1.00 26.68 ? 368 ALA A C     1 
ATOM   528  O  O     . ALA A 1 64  ? 22.380 45.165 -1.596  1.00 27.62 ? 368 ALA A O     1 
ATOM   529  C  CB    . ALA A 1 64  ? 24.408 42.531 -1.991  1.00 26.20 ? 368 ALA A CB    1 
ATOM   530  N  N     . THR A 1 65  ? 21.465 43.133 -1.293  1.00 26.54 ? 369 THR A N     1 
ATOM   531  C  CA    . THR A 1 65  ? 20.119 43.571 -1.663  1.00 27.30 ? 369 THR A CA    1 
ATOM   532  C  C     . THR A 1 65  ? 19.610 44.648 -0.719  1.00 26.79 ? 369 THR A C     1 
ATOM   533  O  O     . THR A 1 65  ? 19.189 45.717 -1.149  1.00 26.20 ? 369 THR A O     1 
ATOM   534  C  CB    . THR A 1 65  ? 19.113 42.403 -1.628  1.00 27.95 ? 369 THR A CB    1 
ATOM   535  O  OG1   . THR A 1 65  ? 19.472 41.444 -2.626  1.00 28.05 ? 369 THR A OG1   1 
ATOM   536  C  CG2   . THR A 1 65  ? 17.697 42.902 -1.881  1.00 27.32 ? 369 THR A CG2   1 
ATOM   537  N  N     . VAL A 1 66  ? 19.652 44.370 0.573   1.00 27.14 ? 370 VAL A N     1 
ATOM   538  C  CA    . VAL A 1 66  ? 19.159 45.337 1.534   1.00 27.97 ? 370 VAL A CA    1 
ATOM   539  C  C     . VAL A 1 66  ? 19.969 46.635 1.565   1.00 30.57 ? 370 VAL A C     1 
ATOM   540  O  O     . VAL A 1 66  ? 19.389 47.729 1.618   1.00 30.46 ? 370 VAL A O     1 
ATOM   541  C  CB    . VAL A 1 66  ? 19.087 44.706 2.937   1.00 27.61 ? 370 VAL A CB    1 
ATOM   542  C  CG1   . VAL A 1 66  ? 18.627 45.735 3.953   1.00 28.15 ? 370 VAL A CG1   1 
ATOM   543  C  CG2   . VAL A 1 66  ? 18.124 43.514 2.909   1.00 25.31 ? 370 VAL A CG2   1 
ATOM   544  N  N     . ALA A 1 67  ? 21.297 46.524 1.514   1.00 31.70 ? 371 ALA A N     1 
ATOM   545  C  CA    . ALA A 1 67  ? 22.160 47.704 1.533   1.00 33.49 ? 371 ALA A CA    1 
ATOM   546  C  C     . ALA A 1 67  ? 21.894 48.561 0.309   1.00 34.63 ? 371 ALA A C     1 
ATOM   547  O  O     . ALA A 1 67  ? 22.011 49.785 0.363   1.00 37.44 ? 371 ALA A O     1 
ATOM   548  C  CB    . ALA A 1 67  ? 23.638 47.298 1.579   1.00 33.29 ? 371 ALA A CB    1 
ATOM   549  N  N     . TYR A 1 68  ? 21.546 47.921 -0.802  1.00 35.38 ? 372 TYR A N     1 
ATOM   550  C  CA    . TYR A 1 68  ? 21.257 48.666 -2.013  1.00 36.91 ? 372 TYR A CA    1 
ATOM   551  C  C     . TYR A 1 68  ? 19.923 49.405 -1.886  1.00 38.93 ? 372 TYR A C     1 
ATOM   552  O  O     . TYR A 1 68  ? 19.842 50.586 -2.195  1.00 38.35 ? 372 TYR A O     1 
ATOM   553  C  CB    . TYR A 1 68  ? 21.207 47.742 -3.231  1.00 37.43 ? 372 TYR A CB    1 
ATOM   554  C  CG    . TYR A 1 68  ? 20.763 48.455 -4.497  1.00 37.58 ? 372 TYR A CG    1 
ATOM   555  C  CD1   . TYR A 1 68  ? 21.636 49.287 -5.197  1.00 38.04 ? 372 TYR A CD1   1 
ATOM   556  C  CD2   . TYR A 1 68  ? 19.457 48.315 -4.979  1.00 38.39 ? 372 TYR A CD2   1 
ATOM   557  C  CE1   . TYR A 1 68  ? 21.224 49.960 -6.351  1.00 38.77 ? 372 TYR A CE1   1 
ATOM   558  C  CE2   . TYR A 1 68  ? 19.032 48.986 -6.131  1.00 37.96 ? 372 TYR A CE2   1 
ATOM   559  C  CZ    . TYR A 1 68  ? 19.924 49.803 -6.813  1.00 39.12 ? 372 TYR A CZ    1 
ATOM   560  O  OH    . TYR A 1 68  ? 19.536 50.430 -7.974  1.00 39.82 ? 372 TYR A OH    1 
ATOM   561  N  N     . LEU A 1 69  ? 18.877 48.720 -1.432  1.00 40.24 ? 373 LEU A N     1 
ATOM   562  C  CA    . LEU A 1 69  ? 17.583 49.378 -1.296  1.00 42.18 ? 373 LEU A CA    1 
ATOM   563  C  C     . LEU A 1 69  ? 17.620 50.563 -0.313  1.00 43.97 ? 373 LEU A C     1 
ATOM   564  O  O     . LEU A 1 69  ? 16.843 51.501 -0.451  1.00 44.29 ? 373 LEU A O     1 
ATOM   565  C  CB    . LEU A 1 69  ? 16.512 48.356 -0.883  1.00 41.15 ? 373 LEU A CB    1 
ATOM   566  C  CG    . LEU A 1 69  ? 16.215 47.251 -1.915  1.00 41.52 ? 373 LEU A CG    1 
ATOM   567  C  CD1   . LEU A 1 69  ? 15.496 46.097 -1.236  1.00 41.14 ? 373 LEU A CD1   1 
ATOM   568  C  CD2   . LEU A 1 69  ? 15.388 47.809 -3.080  1.00 40.22 ? 373 LEU A CD2   1 
ATOM   569  N  N     . CYS A 1 70  ? 18.547 50.529 0.647   1.00 46.71 ? 374 CYS A N     1 
ATOM   570  C  CA    . CYS A 1 70  ? 18.703 51.575 1.674   1.00 48.63 ? 374 CYS A CA    1 
ATOM   571  C  C     . CYS A 1 70  ? 19.901 52.479 1.466   1.00 49.74 ? 374 CYS A C     1 
ATOM   572  O  O     . CYS A 1 70  ? 20.315 53.183 2.387   1.00 50.86 ? 374 CYS A O     1 
ATOM   573  C  CB    . CYS A 1 70  ? 18.899 50.942 3.045   1.00 48.91 ? 374 CYS A CB    1 
ATOM   574  S  SG    . CYS A 1 70  ? 17.582 49.864 3.525   1.00 54.53 ? 374 CYS A SG    1 
ATOM   575  N  N     . ARG A 1 71  ? 20.469 52.470 0.277   1.00 50.71 ? 375 ARG A N     1 
ATOM   576  C  CA    . ARG A 1 71  ? 21.663 53.259 0.042   1.00 52.86 ? 375 ARG A CA    1 
ATOM   577  C  C     . ARG A 1 71  ? 21.512 54.789 0.085   1.00 54.08 ? 375 ARG A C     1 
ATOM   578  O  O     . ARG A 1 71  ? 20.520 55.344 -0.393  1.00 53.88 ? 375 ARG A O     1 
ATOM   579  C  CB    . ARG A 1 71  ? 22.280 52.815 -1.285  1.00 52.80 ? 375 ARG A CB    1 
ATOM   580  C  CG    . ARG A 1 71  ? 21.739 53.549 -2.489  1.00 53.57 ? 375 ARG A CG    1 
ATOM   581  C  CD    . ARG A 1 71  ? 21.810 52.730 -3.759  1.00 54.53 ? 375 ARG A CD    1 
ATOM   582  N  NE    . ARG A 1 71  ? 20.460 52.377 -4.181  1.00 56.76 ? 375 ARG A NE    1 
ATOM   583  C  CZ    . ARG A 1 71  ? 19.875 52.813 -5.289  1.00 56.94 ? 375 ARG A CZ    1 
ATOM   584  N  NH1   . ARG A 1 71  ? 20.523 53.621 -6.116  1.00 57.03 ? 375 ARG A NH1   1 
ATOM   585  N  NH2   . ARG A 1 71  ? 18.625 52.460 -5.553  1.00 59.07 ? 375 ARG A NH2   1 
ATOM   586  N  N     . SER A 1 72  ? 22.513 55.452 0.671   1.00 55.74 ? 376 SER A N     1 
ATOM   587  C  CA    . SER A 1 72  ? 22.557 56.915 0.787   1.00 56.92 ? 376 SER A CA    1 
ATOM   588  C  C     . SER A 1 72  ? 22.498 57.510 -0.622  1.00 58.11 ? 376 SER A C     1 
ATOM   589  O  O     . SER A 1 72  ? 22.788 56.817 -1.592  1.00 57.94 ? 376 SER A O     1 
ATOM   590  C  CB    . SER A 1 72  ? 23.855 57.345 1.464   1.00 57.38 ? 376 SER A CB    1 
ATOM   591  O  OG    . SER A 1 72  ? 24.958 57.090 0.613   1.00 57.56 ? 376 SER A OG    1 
ATOM   592  N  N     . SER A 1 73  ? 22.159 58.790 -0.743  1.00 59.09 ? 377 SER A N     1 
ATOM   593  C  CA    . SER A 1 73  ? 22.026 59.399 -2.065  1.00 60.79 ? 377 SER A CA    1 
ATOM   594  C  C     . SER A 1 73  ? 23.268 59.492 -2.953  1.00 61.73 ? 377 SER A C     1 
ATOM   595  O  O     . SER A 1 73  ? 23.140 59.623 -4.174  1.00 62.36 ? 377 SER A O     1 
ATOM   596  C  CB    . SER A 1 73  ? 21.405 60.790 -1.943  1.00 61.28 ? 377 SER A CB    1 
ATOM   597  O  OG    . SER A 1 73  ? 22.310 61.689 -1.333  1.00 62.70 ? 377 SER A OG    1 
ATOM   598  N  N     . SER A 1 74  ? 24.462 59.438 -2.370  1.00 62.53 ? 378 SER A N     1 
ATOM   599  C  CA    . SER A 1 74  ? 25.665 59.524 -3.191  1.00 62.97 ? 378 SER A CA    1 
ATOM   600  C  C     . SER A 1 74  ? 25.842 58.273 -4.050  1.00 63.10 ? 378 SER A C     1 
ATOM   601  O  O     . SER A 1 74  ? 26.695 58.241 -4.940  1.00 63.55 ? 378 SER A O     1 
ATOM   602  C  CB    . SER A 1 74  ? 26.900 59.775 -2.322  1.00 63.33 ? 378 SER A CB    1 
ATOM   603  O  OG    . SER A 1 74  ? 26.982 58.843 -1.262  1.00 62.22 ? 378 SER A OG    1 
ATOM   604  N  N     . PHE A 1 75  ? 25.043 57.239 -3.778  1.00 62.61 ? 379 PHE A N     1 
ATOM   605  C  CA    . PHE A 1 75  ? 25.080 56.021 -4.595  1.00 61.81 ? 379 PHE A CA    1 
ATOM   606  C  C     . PHE A 1 75  ? 23.767 55.894 -5.371  1.00 61.44 ? 379 PHE A C     1 
ATOM   607  O  O     . PHE A 1 75  ? 23.450 54.809 -5.834  1.00 61.15 ? 379 PHE A O     1 
ATOM   608  C  CB    . PHE A 1 75  ? 25.207 54.717 -3.779  1.00 60.68 ? 379 PHE A CB    1 
ATOM   609  C  CG    . PHE A 1 75  ? 26.439 54.612 -2.935  1.00 59.10 ? 379 PHE A CG    1 
ATOM   610  C  CD1   . PHE A 1 75  ? 26.349 54.790 -1.562  1.00 58.49 ? 379 PHE A CD1   1 
ATOM   611  C  CD2   . PHE A 1 75  ? 27.678 54.306 -3.496  1.00 58.86 ? 379 PHE A CD2   1 
ATOM   612  C  CE1   . PHE A 1 75  ? 27.467 54.668 -0.751  1.00 58.28 ? 379 PHE A CE1   1 
ATOM   613  C  CE2   . PHE A 1 75  ? 28.810 54.182 -2.688  1.00 58.60 ? 379 PHE A CE2   1 
ATOM   614  C  CZ    . PHE A 1 75  ? 28.700 54.364 -1.312  1.00 57.83 ? 379 PHE A CZ    1 
ATOM   615  N  N     . SER A 1 76  ? 22.981 56.956 -5.512  1.00 61.24 ? 380 SER A N     1 
ATOM   616  C  CA    . SER A 1 76  ? 21.725 56.796 -6.250  1.00 60.99 ? 380 SER A CA    1 
ATOM   617  C  C     . SER A 1 76  ? 21.952 56.305 -7.693  1.00 60.52 ? 380 SER A C     1 
ATOM   618  O  O     . SER A 1 76  ? 21.093 55.632 -8.266  1.00 59.68 ? 380 SER A O     1 
ATOM   619  C  CB    . SER A 1 76  ? 20.938 58.115 -6.280  1.00 62.22 ? 380 SER A CB    1 
ATOM   620  O  OG    . SER A 1 76  ? 21.599 59.100 -7.058  1.00 63.68 ? 380 SER A OG    1 
ATOM   621  N  N     . ALA A 1 77  ? 23.128 56.631 -8.238  1.00 59.65 ? 381 ALA A N     1 
ATOM   622  C  CA    . ALA A 1 77  ? 23.571 56.332 -9.622  1.00 59.66 ? 381 ALA A CA    1 
ATOM   623  C  C     . ALA A 1 77  ? 23.737 54.866 -10.025 1.00 59.34 ? 381 ALA A C     1 
ATOM   624  O  O     . ALA A 1 77  ? 23.936 54.521 -11.206 1.00 59.22 ? 381 ALA A O     1 
ATOM   625  C  CB    . ALA A 1 77  ? 24.874 57.064 -9.867  1.00 60.05 ? 381 ALA A CB    1 
ATOM   626  N  N     . CYS A 1 78  ? 23.662 54.049 -8.977  1.00 58.83 ? 382 CYS A N     1 
ATOM   627  C  CA    . CYS A 1 78  ? 23.814 52.596 -8.964  1.00 57.96 ? 382 CYS A CA    1 
ATOM   628  C  C     . CYS A 1 78  ? 22.608 51.834 -9.490  1.00 55.78 ? 382 CYS A C     1 
ATOM   629  O  O     . CYS A 1 78  ? 21.458 52.171 -9.171  1.00 55.79 ? 382 CYS A O     1 
ATOM   630  C  CB    . CYS A 1 78  ? 24.071 52.220 -7.532  1.00 59.58 ? 382 CYS A CB    1 
ATOM   631  S  SG    . CYS A 1 78  ? 25.351 51.031 -7.253  1.00 64.58 ? 382 CYS A SG    1 
ATOM   632  N  N     . ASP A 1 79  ? 22.876 50.741 -10.199 1.00 52.54 ? 383 ASP A N     1 
ATOM   633  C  CA    . ASP A 1 79  ? 21.844 49.914 -10.804 1.00 50.25 ? 383 ASP A CA    1 
ATOM   634  C  C     . ASP A 1 79  ? 22.126 48.438 -10.428 1.00 48.03 ? 383 ASP A C     1 
ATOM   635  O  O     . ASP A 1 79  ? 23.054 47.809 -10.937 1.00 46.24 ? 383 ASP A O     1 
ATOM   636  C  CB    . ASP A 1 79  ? 21.889 50.187 -12.308 1.00 50.62 ? 383 ASP A CB    1 
ATOM   637  C  CG    . ASP A 1 79  ? 20.948 49.309 -13.113 1.00 51.58 ? 383 ASP A CG    1 
ATOM   638  O  OD1   . ASP A 1 79  ? 20.144 48.554 -12.537 1.00 51.81 ? 383 ASP A OD1   1 
ATOM   639  O  OD2   . ASP A 1 79  ? 21.032 49.403 -14.362 1.00 53.68 ? 383 ASP A OD2   1 
ATOM   640  N  N     . PHE A 1 80  ? 21.307 47.898 -9.529  1.00 45.16 ? 384 PHE A N     1 
ATOM   641  C  CA    . PHE A 1 80  ? 21.468 46.535 -9.054  1.00 43.28 ? 384 PHE A CA    1 
ATOM   642  C  C     . PHE A 1 80  ? 21.552 45.468 -10.141 1.00 43.44 ? 384 PHE A C     1 
ATOM   643  O  O     . PHE A 1 80  ? 22.198 44.431 -9.954  1.00 42.45 ? 384 PHE A O     1 
ATOM   644  C  CB    . PHE A 1 80  ? 20.330 46.214 -8.092  1.00 40.62 ? 384 PHE A CB    1 
ATOM   645  C  CG    . PHE A 1 80  ? 20.652 45.138 -7.117  1.00 39.29 ? 384 PHE A CG    1 
ATOM   646  C  CD1   . PHE A 1 80  ? 21.563 45.365 -6.086  1.00 39.30 ? 384 PHE A CD1   1 
ATOM   647  C  CD2   . PHE A 1 80  ? 20.046 43.895 -7.221  1.00 38.31 ? 384 PHE A CD2   1 
ATOM   648  C  CE1   . PHE A 1 80  ? 21.867 44.367 -5.173  1.00 38.20 ? 384 PHE A CE1   1 
ATOM   649  C  CE2   . PHE A 1 80  ? 20.341 42.887 -6.315  1.00 38.65 ? 384 PHE A CE2   1 
ATOM   650  C  CZ    . PHE A 1 80  ? 21.253 43.121 -5.285  1.00 38.80 ? 384 PHE A CZ    1 
ATOM   651  N  N     . LYS A 1 81  ? 20.907 45.722 -11.276 1.00 43.36 ? 385 LYS A N     1 
ATOM   652  C  CA    . LYS A 1 81  ? 20.885 44.740 -12.351 1.00 43.97 ? 385 LYS A CA    1 
ATOM   653  C  C     . LYS A 1 81  ? 22.076 44.778 -13.334 1.00 43.30 ? 385 LYS A C     1 
ATOM   654  O  O     . LYS A 1 81  ? 22.340 43.781 -13.999 1.00 43.17 ? 385 LYS A O     1 
ATOM   655  C  CB    . LYS A 1 81  ? 19.528 44.823 -13.107 1.00 44.67 ? 385 LYS A CB    1 
ATOM   656  C  CG    . LYS A 1 81  ? 18.239 44.415 -12.282 1.00 48.51 ? 385 LYS A CG    1 
ATOM   657  C  CD    . LYS A 1 81  ? 18.079 42.868 -12.023 1.00 51.52 ? 385 LYS A CD    1 
ATOM   658  C  CE    . LYS A 1 81  ? 17.705 42.474 -10.539 1.00 54.11 ? 385 LYS A CE    1 
ATOM   659  N  NZ    . LYS A 1 81  ? 18.504 41.325 -9.924  1.00 53.84 ? 385 LYS A NZ    1 
ATOM   660  N  N     . ARG A 1 82  ? 22.816 45.888 -13.403 1.00 42.75 ? 386 ARG A N     1 
ATOM   661  C  CA    . ARG A 1 82  ? 23.950 46.002 -14.341 1.00 42.03 ? 386 ARG A CA    1 
ATOM   662  C  C     . ARG A 1 82  ? 25.344 46.156 -13.717 1.00 41.34 ? 386 ARG A C     1 
ATOM   663  O  O     . ARG A 1 82  ? 26.358 45.851 -14.354 1.00 41.06 ? 386 ARG A O     1 
ATOM   664  C  CB    . ARG A 1 82  ? 23.705 47.177 -15.299 1.00 42.64 ? 386 ARG A CB    1 
ATOM   665  N  N     . ASP A 1 83  ? 25.376 46.631 -12.475 1.00 40.35 ? 387 ASP A N     1 
ATOM   666  C  CA    . ASP A 1 83  ? 26.610 46.905 -11.730 1.00 39.56 ? 387 ASP A CA    1 
ATOM   667  C  C     . ASP A 1 83  ? 27.028 45.842 -10.697 1.00 38.17 ? 387 ASP A C     1 
ATOM   668  O  O     . ASP A 1 83  ? 26.176 45.229 -10.057 1.00 37.24 ? 387 ASP A O     1 
ATOM   669  C  CB    . ASP A 1 83  ? 26.443 48.241 -10.998 1.00 42.08 ? 387 ASP A CB    1 
ATOM   670  C  CG    . ASP A 1 83  ? 26.424 49.449 -11.936 1.00 44.50 ? 387 ASP A CG    1 
ATOM   671  O  OD1   . ASP A 1 83  ? 26.286 49.280 -13.169 1.00 46.99 ? 387 ASP A OD1   1 
ATOM   672  O  OD2   . ASP A 1 83  ? 26.547 50.581 -11.422 1.00 47.96 ? 387 ASP A OD2   1 
ATOM   673  N  N     . PRO A 1 84  ? 28.352 45.614 -10.520 1.00 36.51 ? 388 PRO A N     1 
ATOM   674  C  CA    . PRO A 1 84  ? 28.822 44.624 -9.540  1.00 33.72 ? 388 PRO A CA    1 
ATOM   675  C  C     . PRO A 1 84  ? 28.829 45.318 -8.187  1.00 31.81 ? 388 PRO A C     1 
ATOM   676  O  O     . PRO A 1 84  ? 29.550 46.299 -7.995  1.00 31.20 ? 388 PRO A O     1 
ATOM   677  C  CB    . PRO A 1 84  ? 30.249 44.301 -9.989  1.00 34.15 ? 388 PRO A CB    1 
ATOM   678  C  CG    . PRO A 1 84  ? 30.457 45.062 -11.259 1.00 33.96 ? 388 PRO A CG    1 
ATOM   679  C  CD    . PRO A 1 84  ? 29.491 46.202 -11.239 1.00 34.75 ? 388 PRO A CD    1 
ATOM   680  N  N     . ILE A 1 85  ? 28.048 44.805 -7.249  1.00 29.78 ? 389 ILE A N     1 
ATOM   681  C  CA    . ILE A 1 85  ? 27.957 45.440 -5.949  1.00 28.35 ? 389 ILE A CA    1 
ATOM   682  C  C     . ILE A 1 85  ? 28.327 44.549 -4.791  1.00 26.01 ? 389 ILE A C     1 
ATOM   683  O  O     . ILE A 1 85  ? 28.029 43.360 -4.782  1.00 25.94 ? 389 ILE A O     1 
ATOM   684  C  CB    . ILE A 1 85  ? 26.539 45.985 -5.750  1.00 29.27 ? 389 ILE A CB    1 
ATOM   685  C  CG1   . ILE A 1 85  ? 26.305 47.082 -6.775  1.00 30.27 ? 389 ILE A CG1   1 
ATOM   686  C  CG2   . ILE A 1 85  ? 26.352 46.548 -4.355  1.00 27.90 ? 389 ILE A CG2   1 
ATOM   687  C  CD1   . ILE A 1 85  ? 24.857 47.339 -7.021  1.00 34.37 ? 389 ILE A CD1   1 
ATOM   688  N  N     . VAL A 1 86  ? 28.985 45.140 -3.808  1.00 23.48 ? 390 VAL A N     1 
ATOM   689  C  CA    . VAL A 1 86  ? 29.379 44.400 -2.633  1.00 23.36 ? 390 VAL A CA    1 
ATOM   690  C  C     . VAL A 1 86  ? 29.148 45.254 -1.408  1.00 24.45 ? 390 VAL A C     1 
ATOM   691  O  O     . VAL A 1 86  ? 28.960 46.469 -1.511  1.00 24.77 ? 390 VAL A O     1 
ATOM   692  C  CB    . VAL A 1 86  ? 30.876 43.992 -2.696  1.00 24.29 ? 390 VAL A CB    1 
ATOM   693  C  CG1   . VAL A 1 86  ? 31.144 43.210 -3.982  1.00 23.88 ? 390 VAL A CG1   1 
ATOM   694  C  CG2   . VAL A 1 86  ? 31.774 45.225 -2.618  1.00 19.03 ? 390 VAL A CG2   1 
ATOM   695  N  N     . VAL A 1 87  ? 29.139 44.593 -0.256  1.00 23.95 ? 391 VAL A N     1 
ATOM   696  C  CA    . VAL A 1 87  ? 28.976 45.245 1.030   1.00 24.63 ? 391 VAL A CA    1 
ATOM   697  C  C     . VAL A 1 87  ? 30.264 44.923 1.774   1.00 25.09 ? 391 VAL A C     1 
ATOM   698  O  O     . VAL A 1 87  ? 30.623 43.747 1.893   1.00 25.76 ? 391 VAL A O     1 
ATOM   699  C  CB    . VAL A 1 87  ? 27.815 44.650 1.828   1.00 24.17 ? 391 VAL A CB    1 
ATOM   700  C  CG1   . VAL A 1 87  ? 27.827 45.211 3.247   1.00 22.84 ? 391 VAL A CG1   1 
ATOM   701  C  CG2   . VAL A 1 87  ? 26.503 44.957 1.140   1.00 23.80 ? 391 VAL A CG2   1 
ATOM   702  N  N     . CYS A 1 88  ? 30.959 45.947 2.265   1.00 23.71 ? 392 CYS A N     1 
ATOM   703  C  CA    . CYS A 1 88  ? 32.206 45.724 2.992   1.00 24.42 ? 392 CYS A CA    1 
ATOM   704  C  C     . CYS A 1 88  ? 32.642 46.968 3.755   1.00 24.47 ? 392 CYS A C     1 
ATOM   705  O  O     . CYS A 1 88  ? 32.066 48.042 3.604   1.00 24.15 ? 392 CYS A O     1 
ATOM   706  C  CB    . CYS A 1 88  ? 33.310 45.315 2.018   1.00 23.10 ? 392 CYS A CB    1 
ATOM   707  S  SG    . CYS A 1 88  ? 33.709 46.583 0.790   1.00 25.35 ? 392 CYS A SG    1 
ATOM   708  N  N     . HIS A 1 89  ? 33.668 46.829 4.580   1.00 24.80 ? 393 HIS A N     1 
ATOM   709  C  CA    . HIS A 1 89  ? 34.145 47.973 5.351   1.00 24.72 ? 393 HIS A CA    1 
ATOM   710  C  C     . HIS A 1 89  ? 35.211 48.776 4.651   1.00 24.20 ? 393 HIS A C     1 
ATOM   711  O  O     . HIS A 1 89  ? 35.215 50.004 4.712   1.00 25.26 ? 393 HIS A O     1 
ATOM   712  C  CB    . HIS A 1 89  ? 34.756 47.535 6.675   1.00 25.35 ? 393 HIS A CB    1 
ATOM   713  C  CG    . HIS A 1 89  ? 33.760 47.120 7.706   1.00 25.42 ? 393 HIS A CG    1 
ATOM   714  N  ND1   . HIS A 1 89  ? 32.733 47.940 8.127   1.00 26.35 ? 393 HIS A ND1   1 
ATOM   715  C  CD2   . HIS A 1 89  ? 33.690 46.007 8.469   1.00 24.53 ? 393 HIS A CD2   1 
ATOM   716  C  CE1   . HIS A 1 89  ? 32.078 47.349 9.110   1.00 25.52 ? 393 HIS A CE1   1 
ATOM   717  N  NE2   . HIS A 1 89  ? 32.640 46.176 9.338   1.00 25.81 ? 393 HIS A NE2   1 
ATOM   718  N  N     . GLY A 1 90  ? 36.130 48.072 4.005   1.00 24.71 ? 394 GLY A N     1 
ATOM   719  C  CA    . GLY A 1 90  ? 37.239 48.749 3.379   1.00 24.46 ? 394 GLY A CA    1 
ATOM   720  C  C     . GLY A 1 90  ? 37.449 48.706 1.891   1.00 25.50 ? 394 GLY A C     1 
ATOM   721  O  O     . GLY A 1 90  ? 36.522 48.559 1.095   1.00 25.82 ? 394 GLY A O     1 
ATOM   722  N  N     . THR A 1 91  ? 38.730 48.786 1.552   1.00 25.74 ? 395 THR A N     1 
ATOM   723  C  CA    . THR A 1 91  ? 39.206 48.879 0.187   1.00 24.70 ? 395 THR A CA    1 
ATOM   724  C  C     . THR A 1 91  ? 40.261 47.864 -0.279  1.00 25.68 ? 395 THR A C     1 
ATOM   725  O  O     . THR A 1 91  ? 40.536 47.775 -1.478  1.00 26.75 ? 395 THR A O     1 
ATOM   726  C  CB    . THR A 1 91  ? 39.779 50.278 0.014   1.00 24.27 ? 395 THR A CB    1 
ATOM   727  O  OG1   . THR A 1 91  ? 40.797 50.474 1.002   1.00 21.73 ? 395 THR A OG1   1 
ATOM   728  C  CG2   . THR A 1 91  ? 38.700 51.335 0.259   1.00 21.51 ? 395 THR A CG2   1 
ATOM   729  N  N     . LYS A 1 92  ? 40.871 47.118 0.640   1.00 25.91 ? 396 LYS A N     1 
ATOM   730  C  CA    . LYS A 1 92  ? 41.893 46.146 0.238   1.00 26.36 ? 396 LYS A CA    1 
ATOM   731  C  C     . LYS A 1 92  ? 41.654 44.727 0.772   1.00 24.99 ? 396 LYS A C     1 
ATOM   732  O  O     . LYS A 1 92  ? 41.027 43.911 0.096   1.00 24.69 ? 396 LYS A O     1 
ATOM   733  C  CB    . LYS A 1 92  ? 43.308 46.622 0.651   1.00 27.58 ? 396 LYS A CB    1 
ATOM   734  C  CG    . LYS A 1 92  ? 44.427 45.925 -0.142  1.00 31.13 ? 396 LYS A CG    1 
ATOM   735  C  CD    . LYS A 1 92  ? 45.810 45.930 0.534   1.00 33.88 ? 396 LYS A CD    1 
ATOM   736  C  CE    . LYS A 1 92  ? 46.703 47.116 0.130   1.00 36.49 ? 396 LYS A CE    1 
ATOM   737  N  NZ    . LYS A 1 92  ? 46.767 48.221 1.147   1.00 35.99 ? 396 LYS A NZ    1 
ATOM   738  N  N     . ASN A 1 93  ? 42.158 44.428 1.969   1.00 23.42 ? 397 ASN A N     1 
ATOM   739  C  CA    . ASN A 1 93  ? 41.997 43.098 2.546   1.00 23.82 ? 397 ASN A CA    1 
ATOM   740  C  C     . ASN A 1 93  ? 40.820 43.068 3.494   1.00 24.21 ? 397 ASN A C     1 
ATOM   741  O  O     . ASN A 1 93  ? 40.893 42.616 4.645   1.00 24.26 ? 397 ASN A O     1 
ATOM   742  C  CB    . ASN A 1 93  ? 43.294 42.677 3.227   1.00 24.38 ? 397 ASN A CB    1 
ATOM   743  C  CG    . ASN A 1 93  ? 44.469 42.763 2.281   1.00 25.59 ? 397 ASN A CG    1 
ATOM   744  O  OD1   . ASN A 1 93  ? 44.318 42.513 1.082   1.00 26.54 ? 397 ASN A OD1   1 
ATOM   745  N  ND2   . ASN A 1 93  ? 45.635 43.120 2.799   1.00 23.08 ? 397 ASN A ND2   1 
ATOM   746  N  N     . SER A 1 94  ? 39.719 43.568 2.956   1.00 24.94 ? 398 SER A N     1 
ATOM   747  C  CA    . SER A 1 94  ? 38.455 43.665 3.650   1.00 24.38 ? 398 SER A CA    1 
ATOM   748  C  C     . SER A 1 94  ? 37.475 42.650 3.079   1.00 23.51 ? 398 SER A C     1 
ATOM   749  O  O     . SER A 1 94  ? 37.334 42.514 1.860   1.00 23.48 ? 398 SER A O     1 
ATOM   750  C  CB    . SER A 1 94  ? 37.898 45.074 3.482   1.00 24.98 ? 398 SER A CB    1 
ATOM   751  O  OG    . SER A 1 94  ? 36.551 45.142 3.933   1.00 24.88 ? 398 SER A OG    1 
ATOM   752  N  N     . ASP A 1 95  ? 36.801 41.937 3.967   1.00 23.37 ? 399 ASP A N     1 
ATOM   753  C  CA    . ASP A 1 95  ? 35.836 40.923 3.555   1.00 22.75 ? 399 ASP A CA    1 
ATOM   754  C  C     . ASP A 1 95  ? 34.613 41.474 2.864   1.00 22.72 ? 399 ASP A C     1 
ATOM   755  O  O     . ASP A 1 95  ? 33.995 42.431 3.328   1.00 21.60 ? 399 ASP A O     1 
ATOM   756  C  CB    . ASP A 1 95  ? 35.325 40.149 4.753   1.00 23.99 ? 399 ASP A CB    1 
ATOM   757  C  CG    . ASP A 1 95  ? 36.205 38.997 5.125   1.00 26.42 ? 399 ASP A CG    1 
ATOM   758  O  OD1   . ASP A 1 95  ? 37.403 39.006 4.782   1.00 27.98 ? 399 ASP A OD1   1 
ATOM   759  O  OD2   . ASP A 1 95  ? 35.688 38.077 5.785   1.00 30.64 ? 399 ASP A OD2   1 
ATOM   760  N  N     . ILE A 1 96  ? 34.258 40.847 1.758   1.00 21.59 ? 400 ILE A N     1 
ATOM   761  C  CA    . ILE A 1 96  ? 33.062 41.208 1.037   1.00 22.33 ? 400 ILE A CA    1 
ATOM   762  C  C     . ILE A 1 96  ? 32.002 40.370 1.736   1.00 22.95 ? 400 ILE A C     1 
ATOM   763  O  O     . ILE A 1 96  ? 31.953 39.159 1.539   1.00 22.69 ? 400 ILE A O     1 
ATOM   764  C  CB    . ILE A 1 96  ? 33.158 40.756 -0.417  1.00 22.45 ? 400 ILE A CB    1 
ATOM   765  C  CG1   . ILE A 1 96  ? 34.114 41.691 -1.155  1.00 21.32 ? 400 ILE A CG1   1 
ATOM   766  C  CG2   . ILE A 1 96  ? 31.757 40.649 -1.035  1.00 21.91 ? 400 ILE A CG2   1 
ATOM   767  C  CD1   . ILE A 1 96  ? 34.416 41.283 -2.567  1.00 21.30 ? 400 ILE A CD1   1 
ATOM   768  N  N     . ALA A 1 97  ? 31.162 40.980 2.562   1.00 23.22 ? 401 ALA A N     1 
ATOM   769  C  CA    . ALA A 1 97  ? 30.142 40.184 3.250   1.00 23.67 ? 401 ALA A CA    1 
ATOM   770  C  C     . ALA A 1 97  ? 29.167 39.566 2.255   1.00 24.35 ? 401 ALA A C     1 
ATOM   771  O  O     . ALA A 1 97  ? 28.819 38.387 2.354   1.00 24.40 ? 401 ALA A O     1 
ATOM   772  C  CB    . ALA A 1 97  ? 29.372 41.040 4.255   1.00 23.09 ? 401 ALA A CB    1 
ATOM   773  N  N     . SER A 1 98  ? 28.746 40.360 1.280   1.00 24.37 ? 402 SER A N     1 
ATOM   774  C  CA    . SER A 1 98  ? 27.780 39.892 0.307   1.00 25.24 ? 402 SER A CA    1 
ATOM   775  C  C     . SER A 1 98  ? 27.983 40.591 -1.025  1.00 26.27 ? 402 SER A C     1 
ATOM   776  O  O     . SER A 1 98  ? 28.295 41.779 -1.060  1.00 27.36 ? 402 SER A O     1 
ATOM   777  C  CB    . SER A 1 98  ? 26.367 40.183 0.832   1.00 25.11 ? 402 SER A CB    1 
ATOM   778  O  OG    . SER A 1 98  ? 25.364 39.687 -0.036  1.00 21.59 ? 402 SER A OG    1 
ATOM   779  N  N     . CYS A 1 99  ? 27.804 39.856 -2.121  1.00 26.63 ? 403 CYS A N     1 
ATOM   780  C  CA    . CYS A 1 99  ? 27.931 40.432 -3.460  1.00 26.04 ? 403 CYS A CA    1 
ATOM   781  C  C     . CYS A 1 99  ? 26.730 40.020 -4.301  1.00 25.95 ? 403 CYS A C     1 
ATOM   782  O  O     . CYS A 1 99  ? 26.209 38.912 -4.146  1.00 25.73 ? 403 CYS A O     1 
ATOM   783  C  CB    . CYS A 1 99  ? 29.212 39.959 -4.151  1.00 25.16 ? 403 CYS A CB    1 
ATOM   784  S  SG    . CYS A 1 99  ? 29.389 38.169 -4.280  1.00 26.12 ? 403 CYS A SG    1 
ATOM   785  N  N     . ASN A 1 100 ? 26.292 40.911 -5.187  1.00 25.45 ? 404 ASN A N     1 
ATOM   786  C  CA    . ASN A 1 100 ? 25.150 40.608 -6.035  1.00 27.04 ? 404 ASN A CA    1 
ATOM   787  C  C     . ASN A 1 100 ? 25.530 39.710 -7.208  1.00 28.44 ? 404 ASN A C     1 
ATOM   788  O  O     . ASN A 1 100 ? 26.716 39.500 -7.507  1.00 28.69 ? 404 ASN A O     1 
ATOM   789  C  CB    . ASN A 1 100 ? 24.468 41.897 -6.514  1.00 27.31 ? 404 ASN A CB    1 
ATOM   790  C  CG    . ASN A 1 100 ? 25.251 42.642 -7.598  1.00 27.70 ? 404 ASN A CG    1 
ATOM   791  O  OD1   . ASN A 1 100 ? 26.452 42.429 -7.812  1.00 28.79 ? 404 ASN A OD1   1 
ATOM   792  N  ND2   . ASN A 1 100 ? 24.561 43.547 -8.272  1.00 24.62 ? 404 ASN A ND2   1 
ATOM   793  N  N     . TYR A 1 101 ? 24.518 39.168 -7.869  1.00 28.56 ? 405 TYR A N     1 
ATOM   794  C  CA    . TYR A 1 101 ? 24.775 38.250 -8.956  1.00 29.83 ? 405 TYR A CA    1 
ATOM   795  C  C     . TYR A 1 101 ? 25.551 38.827 -10.128 1.00 29.73 ? 405 TYR A C     1 
ATOM   796  O  O     . TYR A 1 101 ? 26.246 38.092 -10.831 1.00 31.56 ? 405 TYR A O     1 
ATOM   797  C  CB    . TYR A 1 101 ? 23.470 37.551 -9.352  1.00 28.54 ? 405 TYR A CB    1 
ATOM   798  C  CG    . TYR A 1 101 ? 23.080 36.536 -8.280  1.00 29.60 ? 405 TYR A CG    1 
ATOM   799  C  CD1   . TYR A 1 101 ? 22.628 36.951 -7.023  1.00 28.11 ? 405 TYR A CD1   1 
ATOM   800  C  CD2   . TYR A 1 101 ? 23.278 35.169 -8.479  1.00 28.69 ? 405 TYR A CD2   1 
ATOM   801  C  CE1   . TYR A 1 101 ? 22.392 36.029 -5.993  1.00 28.43 ? 405 TYR A CE1   1 
ATOM   802  C  CE2   . TYR A 1 101 ? 23.044 34.241 -7.453  1.00 29.23 ? 405 TYR A CE2   1 
ATOM   803  C  CZ    . TYR A 1 101 ? 22.605 34.678 -6.216  1.00 29.12 ? 405 TYR A CZ    1 
ATOM   804  O  OH    . TYR A 1 101 ? 22.392 33.748 -5.214  1.00 29.81 ? 405 TYR A OH    1 
ATOM   805  N  N     . VAL A 1 102 ? 25.480 40.135 -10.334 1.00 28.77 ? 406 VAL A N     1 
ATOM   806  C  CA    . VAL A 1 102 ? 26.285 40.697 -11.396 1.00 28.22 ? 406 VAL A CA    1 
ATOM   807  C  C     . VAL A 1 102 ? 27.744 40.514 -10.959 1.00 27.72 ? 406 VAL A C     1 
ATOM   808  O  O     . VAL A 1 102 ? 28.569 40.061 -11.737 1.00 27.48 ? 406 VAL A O     1 
ATOM   809  C  CB    . VAL A 1 102 ? 25.991 42.184 -11.629 1.00 29.32 ? 406 VAL A CB    1 
ATOM   810  C  CG1   . VAL A 1 102 ? 27.063 42.781 -12.499 1.00 27.26 ? 406 VAL A CG1   1 
ATOM   811  C  CG2   . VAL A 1 102 ? 24.644 42.344 -12.307 1.00 28.76 ? 406 VAL A CG2   1 
ATOM   812  N  N     . ALA A 1 103 ? 28.071 40.831 -9.713  1.00 27.65 ? 407 ALA A N     1 
ATOM   813  C  CA    . ALA A 1 103 ? 29.453 40.638 -9.274  1.00 27.82 ? 407 ALA A CA    1 
ATOM   814  C  C     . ALA A 1 103 ? 29.854 39.159 -9.371  1.00 28.17 ? 407 ALA A C     1 
ATOM   815  O  O     . ALA A 1 103 ? 30.997 38.838 -9.731  1.00 27.05 ? 407 ALA A O     1 
ATOM   816  C  CB    . ALA A 1 103 ? 29.653 41.156 -7.834  1.00 27.09 ? 407 ALA A CB    1 
ATOM   817  N  N     . ARG A 1 104 ? 28.924 38.256 -9.063  1.00 28.52 ? 408 ARG A N     1 
ATOM   818  C  CA    . ARG A 1 104 ? 29.234 36.828 -9.140  1.00 28.60 ? 408 ARG A CA    1 
ATOM   819  C  C     . ARG A 1 104 ? 29.485 36.372 -10.569 1.00 28.21 ? 408 ARG A C     1 
ATOM   820  O  O     . ARG A 1 104 ? 30.188 35.394 -10.798 1.00 28.96 ? 408 ARG A O     1 
ATOM   821  C  CB    . ARG A 1 104 ? 28.116 35.991 -8.518  1.00 28.79 ? 408 ARG A CB    1 
ATOM   822  C  CG    . ARG A 1 104 ? 28.005 36.205 -7.025  1.00 29.93 ? 408 ARG A CG    1 
ATOM   823  C  CD    . ARG A 1 104 ? 26.793 35.555 -6.416  1.00 29.89 ? 408 ARG A CD    1 
ATOM   824  N  NE    . ARG A 1 104 ? 26.491 36.168 -5.127  1.00 29.89 ? 408 ARG A NE    1 
ATOM   825  C  CZ    . ARG A 1 104 ? 25.870 35.544 -4.136  1.00 29.19 ? 408 ARG A CZ    1 
ATOM   826  N  NH1   . ARG A 1 104 ? 25.486 34.279 -4.285  1.00 25.17 ? 408 ARG A NH1   1 
ATOM   827  N  NH2   . ARG A 1 104 ? 25.635 36.187 -3.001  1.00 30.58 ? 408 ARG A NH2   1 
ATOM   828  N  N     . SER A 1 105 ? 28.938 37.084 -11.542 1.00 28.87 ? 409 SER A N     1 
ATOM   829  C  CA    . SER A 1 105 ? 29.161 36.661 -12.910 1.00 31.33 ? 409 SER A CA    1 
ATOM   830  C  C     . SER A 1 105 ? 30.640 36.830 -13.272 1.00 32.30 ? 409 SER A C     1 
ATOM   831  O  O     . SER A 1 105 ? 31.122 36.214 -14.220 1.00 34.43 ? 409 SER A O     1 
ATOM   832  C  CB    . SER A 1 105 ? 28.257 37.436 -13.879 1.00 31.16 ? 409 SER A CB    1 
ATOM   833  O  OG    . SER A 1 105 ? 28.833 38.661 -14.276 1.00 32.63 ? 409 SER A OG    1 
ATOM   834  N  N     . TYR A 1 106 ? 31.368 37.638 -12.506 1.00 31.53 ? 410 TYR A N     1 
ATOM   835  C  CA    . TYR A 1 106 ? 32.792 37.832 -12.768 1.00 31.25 ? 410 TYR A CA    1 
ATOM   836  C  C     . TYR A 1 106 ? 33.658 36.898 -11.936 1.00 30.99 ? 410 TYR A C     1 
ATOM   837  O  O     . TYR A 1 106 ? 34.882 36.893 -12.078 1.00 30.46 ? 410 TYR A O     1 
ATOM   838  C  CB    . TYR A 1 106 ? 33.211 39.278 -12.486 1.00 32.29 ? 410 TYR A CB    1 
ATOM   839  C  CG    . TYR A 1 106 ? 32.538 40.272 -13.389 1.00 34.69 ? 410 TYR A CG    1 
ATOM   840  C  CD1   . TYR A 1 106 ? 31.469 41.048 -12.938 1.00 34.01 ? 410 TYR A CD1   1 
ATOM   841  C  CD2   . TYR A 1 106 ? 32.934 40.399 -14.720 1.00 35.27 ? 410 TYR A CD2   1 
ATOM   842  C  CE1   . TYR A 1 106 ? 30.811 41.924 -13.795 1.00 34.68 ? 410 TYR A CE1   1 
ATOM   843  C  CE2   . TYR A 1 106 ? 32.282 41.269 -15.587 1.00 35.61 ? 410 TYR A CE2   1 
ATOM   844  C  CZ    . TYR A 1 106 ? 31.225 42.028 -15.125 1.00 35.82 ? 410 TYR A CZ    1 
ATOM   845  O  OH    . TYR A 1 106 ? 30.588 42.886 -16.004 1.00 36.27 ? 410 TYR A OH    1 
ATOM   846  N  N     . GLY A 1 107 ? 33.022 36.120 -11.061 1.00 29.99 ? 411 GLY A N     1 
ATOM   847  C  CA    . GLY A 1 107 ? 33.760 35.199 -10.215 1.00 28.69 ? 411 GLY A CA    1 
ATOM   848  C  C     . GLY A 1 107 ? 33.870 35.642 -8.764  1.00 28.83 ? 411 GLY A C     1 
ATOM   849  O  O     . GLY A 1 107 ? 34.416 34.931 -7.927  1.00 30.38 ? 411 GLY A O     1 
ATOM   850  N  N     . ILE A 1 108 ? 33.349 36.820 -8.458  1.00 28.50 ? 412 ILE A N     1 
ATOM   851  C  CA    . ILE A 1 108 ? 33.392 37.347 -7.106  1.00 29.02 ? 412 ILE A CA    1 
ATOM   852  C  C     . ILE A 1 108 ? 32.514 36.481 -6.180  1.00 30.80 ? 412 ILE A C     1 
ATOM   853  O  O     . ILE A 1 108 ? 31.448 36.016 -6.587  1.00 29.50 ? 412 ILE A O     1 
ATOM   854  C  CB    . ILE A 1 108 ? 32.934 38.826 -7.144  1.00 29.49 ? 412 ILE A CB    1 
ATOM   855  C  CG1   . ILE A 1 108 ? 33.859 39.582 -8.112  1.00 28.11 ? 412 ILE A CG1   1 
ATOM   856  C  CG2   . ILE A 1 108 ? 32.916 39.435 -5.745  1.00 28.51 ? 412 ILE A CG2   1 
ATOM   857  C  CD1   . ILE A 1 108 ? 33.954 41.072 -7.903  1.00 28.32 ? 412 ILE A CD1   1 
ATOM   858  N  N     . LYS A 1 109 ? 32.973 36.240 -4.950  1.00 31.23 ? 413 LYS A N     1 
ATOM   859  C  CA    . LYS A 1 109 ? 32.226 35.410 -3.989  1.00 31.17 ? 413 LYS A CA    1 
ATOM   860  C  C     . LYS A 1 109 ? 32.137 36.046 -2.609  1.00 30.30 ? 413 LYS A C     1 
ATOM   861  O  O     . LYS A 1 109 ? 32.913 36.931 -2.273  1.00 30.48 ? 413 LYS A O     1 
ATOM   862  C  CB    . LYS A 1 109 ? 32.905 34.052 -3.797  1.00 34.74 ? 413 LYS A CB    1 
ATOM   863  C  CG    . LYS A 1 109 ? 33.008 33.192 -5.033  1.00 39.12 ? 413 LYS A CG    1 
ATOM   864  C  CD    . LYS A 1 109 ? 33.645 31.849 -4.698  1.00 42.39 ? 413 LYS A CD    1 
ATOM   865  C  CE    . LYS A 1 109 ? 33.722 30.955 -5.930  1.00 46.04 ? 413 LYS A CE    1 
ATOM   866  N  NZ    . LYS A 1 109 ? 32.376 30.746 -6.555  1.00 48.48 ? 413 LYS A NZ    1 
ATOM   867  N  N     . ASN A 1 110 ? 31.190 35.584 -1.804  1.00 28.42 ? 414 ASN A N     1 
ATOM   868  C  CA    . ASN A 1 110 ? 31.069 36.097 -0.447  1.00 27.81 ? 414 ASN A CA    1 
ATOM   869  C  C     . ASN A 1 110 ? 32.326 35.564 0.240   1.00 26.47 ? 414 ASN A C     1 
ATOM   870  O  O     . ASN A 1 110 ? 32.753 34.453 -0.052  1.00 25.51 ? 414 ASN A O     1 
ATOM   871  C  CB    . ASN A 1 110 ? 29.805 35.536 0.229   1.00 26.67 ? 414 ASN A CB    1 
ATOM   872  C  CG    . ASN A 1 110 ? 28.534 36.182 -0.291  1.00 30.02 ? 414 ASN A CG    1 
ATOM   873  O  OD1   . ASN A 1 110 ? 28.582 37.082 -1.140  1.00 29.26 ? 414 ASN A OD1   1 
ATOM   874  N  ND2   . ASN A 1 110 ? 27.384 35.731 0.217   1.00 28.65 ? 414 ASN A ND2   1 
ATOM   875  N  N     . GLY A 1 111 ? 32.940 36.336 1.127   1.00 25.48 ? 415 GLY A N     1 
ATOM   876  C  CA    . GLY A 1 111 ? 34.125 35.825 1.784   1.00 25.93 ? 415 GLY A CA    1 
ATOM   877  C  C     . GLY A 1 111 ? 35.424 36.258 1.126   1.00 26.86 ? 415 GLY A C     1 
ATOM   878  O  O     . GLY A 1 111 ? 36.490 36.147 1.722   1.00 28.60 ? 415 GLY A O     1 
ATOM   879  N  N     . MET A 1 112 ? 35.338 36.756 -0.101  1.00 26.17 ? 416 MET A N     1 
ATOM   880  C  CA    . MET A 1 112 ? 36.495 37.218 -0.858  1.00 25.74 ? 416 MET A CA    1 
ATOM   881  C  C     . MET A 1 112 ? 36.930 38.623 -0.397  1.00 26.41 ? 416 MET A C     1 
ATOM   882  O  O     . MET A 1 112 ? 36.106 39.413 0.070   1.00 25.86 ? 416 MET A O     1 
ATOM   883  C  CB    . MET A 1 112 ? 36.106 37.248 -2.345  1.00 26.44 ? 416 MET A CB    1 
ATOM   884  C  CG    . MET A 1 112 ? 37.244 37.334 -3.339  1.00 27.40 ? 416 MET A CG    1 
ATOM   885  S  SD    . MET A 1 112 ? 36.690 37.144 -5.069  1.00 29.79 ? 416 MET A SD    1 
ATOM   886  C  CE    . MET A 1 112 ? 36.917 35.359 -5.297  1.00 28.28 ? 416 MET A CE    1 
ATOM   887  N  N     . TRP A 1 113 ? 38.218 38.937 -0.513  1.00 25.42 ? 417 TRP A N     1 
ATOM   888  C  CA    . TRP A 1 113 ? 38.681 40.269 -0.138  1.00 25.87 ? 417 TRP A CA    1 
ATOM   889  C  C     . TRP A 1 113 ? 38.454 41.214 -1.321  1.00 27.60 ? 417 TRP A C     1 
ATOM   890  O  O     . TRP A 1 113 ? 38.527 40.796 -2.484  1.00 27.34 ? 417 TRP A O     1 
ATOM   891  C  CB    . TRP A 1 113 ? 40.174 40.276 0.200   1.00 25.54 ? 417 TRP A CB    1 
ATOM   892  C  CG    . TRP A 1 113 ? 40.529 39.757 1.554   1.00 28.01 ? 417 TRP A CG    1 
ATOM   893  C  CD1   . TRP A 1 113 ? 39.677 39.495 2.598   1.00 27.90 ? 417 TRP A CD1   1 
ATOM   894  C  CD2   . TRP A 1 113 ? 41.845 39.452 2.025   1.00 27.87 ? 417 TRP A CD2   1 
ATOM   895  N  NE1   . TRP A 1 113 ? 40.390 39.042 3.687   1.00 28.44 ? 417 TRP A NE1   1 
ATOM   896  C  CE2   . TRP A 1 113 ? 41.722 39.007 3.363   1.00 29.41 ? 417 TRP A CE2   1 
ATOM   897  C  CE3   . TRP A 1 113 ? 43.117 39.512 1.446   1.00 29.24 ? 417 TRP A CE3   1 
ATOM   898  C  CZ2   . TRP A 1 113 ? 42.829 38.624 4.132   1.00 28.49 ? 417 TRP A CZ2   1 
ATOM   899  C  CZ3   . TRP A 1 113 ? 44.217 39.133 2.203   1.00 28.63 ? 417 TRP A CZ3   1 
ATOM   900  C  CH2   . TRP A 1 113 ? 44.066 38.694 3.536   1.00 30.84 ? 417 TRP A CH2   1 
ATOM   901  N  N     . VAL A 1 114 ? 38.194 42.484 -1.029  1.00 26.37 ? 418 VAL A N     1 
ATOM   902  C  CA    . VAL A 1 114 ? 37.984 43.461 -2.082  1.00 27.87 ? 418 VAL A CA    1 
ATOM   903  C  C     . VAL A 1 114 ? 39.133 43.483 -3.099  1.00 29.10 ? 418 VAL A C     1 
ATOM   904  O  O     . VAL A 1 114 ? 38.887 43.565 -4.304  1.00 29.36 ? 418 VAL A O     1 
ATOM   905  C  CB    . VAL A 1 114 ? 37.792 44.870 -1.486  1.00 27.85 ? 418 VAL A CB    1 
ATOM   906  C  CG1   . VAL A 1 114 ? 37.768 45.910 -2.584  1.00 27.84 ? 418 VAL A CG1   1 
ATOM   907  C  CG2   . VAL A 1 114 ? 36.488 44.919 -0.730  1.00 29.25 ? 418 VAL A CG2   1 
ATOM   908  N  N     . SER A 1 115 ? 40.380 43.404 -2.632  1.00 29.63 ? 419 SER A N     1 
ATOM   909  C  CA    . SER A 1 115 ? 41.523 43.420 -3.557  1.00 30.34 ? 419 SER A CA    1 
ATOM   910  C  C     . SER A 1 115 ? 41.447 42.271 -4.565  1.00 29.32 ? 419 SER A C     1 
ATOM   911  O  O     . SER A 1 115 ? 41.709 42.472 -5.746  1.00 27.82 ? 419 SER A O     1 
ATOM   912  C  CB    . SER A 1 115 ? 42.860 43.370 -2.792  1.00 30.51 ? 419 SER A CB    1 
ATOM   913  O  OG    . SER A 1 115 ? 42.897 42.311 -1.836  1.00 33.21 ? 419 SER A OG    1 
ATOM   914  N  N     . GLN A 1 116 ? 41.088 41.079 -4.086  1.00 30.88 ? 420 GLN A N     1 
ATOM   915  C  CA    . GLN A 1 116 ? 40.927 39.883 -4.926  1.00 32.59 ? 420 GLN A CA    1 
ATOM   916  C  C     . GLN A 1 116 ? 39.837 40.155 -5.968  1.00 31.50 ? 420 GLN A C     1 
ATOM   917  O  O     . GLN A 1 116 ? 40.022 39.920 -7.161  1.00 30.85 ? 420 GLN A O     1 
ATOM   918  C  CB    . GLN A 1 116 ? 40.447 38.687 -4.085  1.00 36.59 ? 420 GLN A CB    1 
ATOM   919  C  CG    . GLN A 1 116 ? 41.397 37.502 -3.893  1.00 44.35 ? 420 GLN A CG    1 
ATOM   920  C  CD    . GLN A 1 116 ? 40.640 36.163 -3.800  1.00 48.67 ? 420 GLN A CD    1 
ATOM   921  O  OE1   . GLN A 1 116 ? 40.794 35.293 -4.660  1.00 51.36 ? 420 GLN A OE1   1 
ATOM   922  N  NE2   . GLN A 1 116 ? 39.816 36.006 -2.758  1.00 50.29 ? 420 GLN A NE2   1 
ATOM   923  N  N     . ALA A 1 117 ? 38.692 40.645 -5.497  1.00 30.76 ? 421 ALA A N     1 
ATOM   924  C  CA    . ALA A 1 117 ? 37.544 40.902 -6.364  1.00 32.09 ? 421 ALA A CA    1 
ATOM   925  C  C     . ALA A 1 117 ? 37.797 41.881 -7.501  1.00 32.40 ? 421 ALA A C     1 
ATOM   926  O  O     . ALA A 1 117 ? 37.409 41.626 -8.640  1.00 32.07 ? 421 ALA A O     1 
ATOM   927  C  CB    . ALA A 1 117 ? 36.348 41.370 -5.531  1.00 28.68 ? 421 ALA A CB    1 
ATOM   928  N  N     . GLU A 1 118 ? 38.441 43.000 -7.194  1.00 33.60 ? 422 GLU A N     1 
ATOM   929  C  CA    . GLU A 1 118 ? 38.720 43.995 -8.212  1.00 35.61 ? 422 GLU A CA    1 
ATOM   930  C  C     . GLU A 1 118 ? 39.611 43.493 -9.324  1.00 35.19 ? 422 GLU A C     1 
ATOM   931  O  O     . GLU A 1 118 ? 39.484 43.944 -10.460 1.00 36.47 ? 422 GLU A O     1 
ATOM   932  C  CB    . GLU A 1 118 ? 39.298 45.245 -7.577  1.00 37.55 ? 422 GLU A CB    1 
ATOM   933  C  CG    . GLU A 1 118 ? 38.221 46.007 -6.859  1.00 43.24 ? 422 GLU A CG    1 
ATOM   934  C  CD    . GLU A 1 118 ? 38.721 47.285 -6.266  1.00 46.26 ? 422 GLU A CD    1 
ATOM   935  O  OE1   . GLU A 1 118 ? 39.832 47.268 -5.682  1.00 47.68 ? 422 GLU A OE1   1 
ATOM   936  O  OE2   . GLU A 1 118 ? 37.997 48.300 -6.379  1.00 46.58 ? 422 GLU A OE2   1 
ATOM   937  N  N     . LYS A 1 119 ? 40.505 42.559 -9.017  1.00 34.24 ? 423 LYS A N     1 
ATOM   938  C  CA    . LYS A 1 119 ? 41.354 42.006 -10.061 1.00 34.60 ? 423 LYS A CA    1 
ATOM   939  C  C     . LYS A 1 119 ? 40.505 41.206 -11.037 1.00 33.63 ? 423 LYS A C     1 
ATOM   940  O  O     . LYS A 1 119 ? 40.903 40.998 -12.168 1.00 33.29 ? 423 LYS A O     1 
ATOM   941  C  CB    . LYS A 1 119 ? 42.411 41.071 -9.481  1.00 36.58 ? 423 LYS A CB    1 
ATOM   942  C  CG    . LYS A 1 119 ? 43.467 41.764 -8.664  1.00 39.03 ? 423 LYS A CG    1 
ATOM   943  C  CD    . LYS A 1 119 ? 44.356 40.790 -7.897  1.00 42.98 ? 423 LYS A CD    1 
ATOM   944  C  CE    . LYS A 1 119 ? 45.414 41.601 -7.153  1.00 45.35 ? 423 LYS A CE    1 
ATOM   945  N  NZ    . LYS A 1 119 ? 46.160 40.892 -6.067  1.00 50.53 ? 423 LYS A NZ    1 
ATOM   946  N  N     . MET A 1 120 ? 39.332 40.751 -10.618 1.00 32.96 ? 424 MET A N     1 
ATOM   947  C  CA    . MET A 1 120 ? 38.522 39.947 -11.526 1.00 33.01 ? 424 MET A CA    1 
ATOM   948  C  C     . MET A 1 120 ? 37.673 40.736 -12.493 1.00 33.09 ? 424 MET A C     1 
ATOM   949  O  O     . MET A 1 120 ? 37.042 40.161 -13.380 1.00 33.21 ? 424 MET A O     1 
ATOM   950  C  CB    . MET A 1 120 ? 37.642 38.992 -10.733 1.00 32.48 ? 424 MET A CB    1 
ATOM   951  C  CG    . MET A 1 120 ? 38.452 38.115 -9.822  1.00 33.46 ? 424 MET A CG    1 
ATOM   952  S  SD    . MET A 1 120 ? 37.395 37.055 -8.872  1.00 37.71 ? 424 MET A SD    1 
ATOM   953  C  CE    . MET A 1 120 ? 37.364 35.653 -9.991  1.00 36.55 ? 424 MET A CE    1 
ATOM   954  N  N     . LEU A 1 121 ? 37.668 42.055 -12.345 1.00 33.23 ? 425 LEU A N     1 
ATOM   955  C  CA    . LEU A 1 121 ? 36.852 42.879 -13.219 1.00 33.27 ? 425 LEU A CA    1 
ATOM   956  C  C     . LEU A 1 121 ? 37.525 43.396 -14.471 1.00 33.39 ? 425 LEU A C     1 
ATOM   957  O  O     . LEU A 1 121 ? 38.590 44.015 -14.416 1.00 34.91 ? 425 LEU A O     1 
ATOM   958  C  CB    . LEU A 1 121 ? 36.300 44.069 -12.456 1.00 31.57 ? 425 LEU A CB    1 
ATOM   959  C  CG    . LEU A 1 121 ? 35.453 43.742 -11.238 1.00 32.45 ? 425 LEU A CG    1 
ATOM   960  C  CD1   . LEU A 1 121 ? 35.082 45.064 -10.577 1.00 30.73 ? 425 LEU A CD1   1 
ATOM   961  C  CD2   . LEU A 1 121 ? 34.208 42.945 -11.629 1.00 31.43 ? 425 LEU A CD2   1 
ATOM   962  N  N     . PRO A 1 122 ? 36.892 43.161 -15.625 1.00 32.48 ? 426 PRO A N     1 
ATOM   963  C  CA    . PRO A 1 122 ? 37.453 43.629 -16.888 1.00 32.45 ? 426 PRO A CA    1 
ATOM   964  C  C     . PRO A 1 122 ? 37.440 45.145 -16.955 1.00 32.11 ? 426 PRO A C     1 
ATOM   965  O  O     . PRO A 1 122 ? 36.749 45.821 -16.188 1.00 31.52 ? 426 PRO A O     1 
ATOM   966  C  CB    . PRO A 1 122 ? 36.544 42.989 -17.945 1.00 32.10 ? 426 PRO A CB    1 
ATOM   967  C  CG    . PRO A 1 122 ? 35.237 42.803 -17.237 1.00 32.23 ? 426 PRO A CG    1 
ATOM   968  C  CD    . PRO A 1 122 ? 35.627 42.431 -15.823 1.00 32.52 ? 426 PRO A CD    1 
ATOM   969  N  N     . ASN A 1 123 ? 38.246 45.647 -17.876 1.00 33.31 ? 427 ASN A N     1 
ATOM   970  C  CA    . ASN A 1 123 ? 38.385 47.056 -18.158 1.00 35.45 ? 427 ASN A CA    1 
ATOM   971  C  C     . ASN A 1 123 ? 37.035 47.687 -18.356 1.00 37.29 ? 427 ASN A C     1 
ATOM   972  O  O     . ASN A 1 123 ? 36.254 47.236 -19.195 1.00 37.79 ? 427 ASN A O     1 
ATOM   973  C  CB    . ASN A 1 123 ? 39.147 47.225 -19.450 1.00 37.06 ? 427 ASN A CB    1 
ATOM   974  C  CG    . ASN A 1 123 ? 40.589 47.516 -19.229 1.00 37.18 ? 427 ASN A CG    1 
ATOM   975  O  OD1   . ASN A 1 123 ? 41.152 47.177 -18.192 1.00 37.11 ? 427 ASN A OD1   1 
ATOM   976  N  ND2   . ASN A 1 123 ? 41.214 48.141 -20.215 1.00 37.86 ? 427 ASN A ND2   1 
ATOM   977  N  N     . GLY A 1 124 ? 36.754 48.739 -17.605 1.00 37.77 ? 428 GLY A N     1 
ATOM   978  C  CA    . GLY A 1 124 ? 35.486 49.407 -17.796 1.00 39.28 ? 428 GLY A CA    1 
ATOM   979  C  C     . GLY A 1 124 ? 34.392 48.988 -16.845 1.00 40.22 ? 428 GLY A C     1 
ATOM   980  O  O     . GLY A 1 124 ? 33.266 49.462 -16.948 1.00 41.11 ? 428 GLY A O     1 
ATOM   981  N  N     . ILE A 1 125 ? 34.702 48.101 -15.918 1.00 39.62 ? 429 ILE A N     1 
ATOM   982  C  CA    . ILE A 1 125 ? 33.698 47.677 -14.972 1.00 38.46 ? 429 ILE A CA    1 
ATOM   983  C  C     . ILE A 1 125 ? 34.291 48.064 -13.624 1.00 38.49 ? 429 ILE A C     1 
ATOM   984  O  O     . ILE A 1 125 ? 35.444 47.751 -13.320 1.00 38.75 ? 429 ILE A O     1 
ATOM   985  C  CB    . ILE A 1 125 ? 33.435 46.167 -15.155 1.00 38.19 ? 429 ILE A CB    1 
ATOM   986  C  CG1   . ILE A 1 125 ? 33.070 45.916 -16.630 1.00 36.94 ? 429 ILE A CG1   1 
ATOM   987  C  CG2   . ILE A 1 125 ? 32.352 45.674 -14.193 1.00 37.66 ? 429 ILE A CG2   1 
ATOM   988  C  CD1   . ILE A 1 125 ? 31.600 45.680 -16.931 1.00 36.60 ? 429 ILE A CD1   1 
ATOM   989  N  N     . LYS A 1 126 ? 33.518 48.825 -12.857 1.00 38.24 ? 430 LYS A N     1 
ATOM   990  C  CA    . LYS A 1 126 ? 33.956 49.297 -11.550 1.00 36.87 ? 430 LYS A CA    1 
ATOM   991  C  C     . LYS A 1 126 ? 33.122 48.675 -10.442 1.00 36.71 ? 430 LYS A C     1 
ATOM   992  O  O     . LYS A 1 126 ? 31.901 48.539 -10.553 1.00 37.10 ? 430 LYS A O     1 
ATOM   993  C  CB    . LYS A 1 126 ? 33.871 50.818 -11.486 1.00 36.96 ? 430 LYS A CB    1 
ATOM   994  N  N     . LEU A 1 127 ? 33.807 48.292 -9.375  1.00 35.74 ? 431 LEU A N     1 
ATOM   995  C  CA    . LEU A 1 127 ? 33.191 47.670 -8.215  1.00 33.85 ? 431 LEU A CA    1 
ATOM   996  C  C     . LEU A 1 127 ? 32.521 48.720 -7.360  1.00 32.84 ? 431 LEU A C     1 
ATOM   997  O  O     . LEU A 1 127 ? 33.114 49.744 -7.040  1.00 32.47 ? 431 LEU A O     1 
ATOM   998  C  CB    . LEU A 1 127 ? 34.274 47.004 -7.382  1.00 33.93 ? 431 LEU A CB    1 
ATOM   999  C  CG    . LEU A 1 127 ? 34.070 45.700 -6.616  1.00 33.91 ? 431 LEU A CG    1 
ATOM   1000 C  CD1   . LEU A 1 127 ? 34.439 45.998 -5.195  1.00 33.31 ? 431 LEU A CD1   1 
ATOM   1001 C  CD2   . LEU A 1 127 ? 32.656 45.137 -6.736  1.00 32.60 ? 431 LEU A CD2   1 
ATOM   1002 N  N     . ILE A 1 128 ? 31.294 48.463 -6.959  1.00 31.91 ? 432 ILE A N     1 
ATOM   1003 C  CA    . ILE A 1 128 ? 30.618 49.411 -6.108  1.00 31.29 ? 432 ILE A CA    1 
ATOM   1004 C  C     . ILE A 1 128 ? 30.531 48.827 -4.712  1.00 30.56 ? 432 ILE A C     1 
ATOM   1005 O  O     . ILE A 1 128 ? 30.008 47.732 -4.529  1.00 32.18 ? 432 ILE A O     1 
ATOM   1006 C  CB    . ILE A 1 128 ? 29.256 49.739 -6.711  1.00 32.59 ? 432 ILE A CB    1 
ATOM   1007 C  CG1   . ILE A 1 128 ? 29.536 50.419 -8.061  1.00 33.16 ? 432 ILE A CG1   1 
ATOM   1008 C  CG2   . ILE A 1 128 ? 28.385 50.524 -5.717  1.00 29.44 ? 432 ILE A CG2   1 
ATOM   1009 C  CD1   . ILE A 1 128 ? 28.645 51.532 -8.428  1.00 31.32 ? 432 ILE A CD1   1 
ATOM   1010 N  N     . SER A 1 129 ? 31.079 49.555 -3.739  1.00 29.70 ? 433 SER A N     1 
ATOM   1011 C  CA    . SER A 1 129 ? 31.106 49.122 -2.342  1.00 29.25 ? 433 SER A CA    1 
ATOM   1012 C  C     . SER A 1 129 ? 30.096 49.829 -1.446  1.00 30.55 ? 433 SER A C     1 
ATOM   1013 O  O     . SER A 1 129 ? 30.177 51.036 -1.256  1.00 31.73 ? 433 SER A O     1 
ATOM   1014 C  CB    . SER A 1 129 ? 32.495 49.357 -1.745  1.00 28.61 ? 433 SER A CB    1 
ATOM   1015 O  OG    . SER A 1 129 ? 33.486 48.603 -2.416  1.00 29.82 ? 433 SER A OG    1 
ATOM   1016 N  N     . LEU A 1 130 ? 29.163 49.082 -0.867  1.00 30.11 ? 434 LEU A N     1 
ATOM   1017 C  CA    . LEU A 1 130 ? 28.172 49.683 0.022   1.00 29.74 ? 434 LEU A CA    1 
ATOM   1018 C  C     . LEU A 1 130 ? 28.496 49.393 1.478   1.00 29.78 ? 434 LEU A C     1 
ATOM   1019 O  O     . LEU A 1 130 ? 29.141 48.394 1.786   1.00 30.61 ? 434 LEU A O     1 
ATOM   1020 C  CB    . LEU A 1 130 ? 26.781 49.126 -0.271  1.00 28.19 ? 434 LEU A CB    1 
ATOM   1021 C  CG    . LEU A 1 130 ? 26.220 49.428 -1.656  1.00 28.88 ? 434 LEU A CG    1 
ATOM   1022 C  CD1   . LEU A 1 130 ? 24.892 48.718 -1.853  1.00 27.03 ? 434 LEU A CD1   1 
ATOM   1023 C  CD2   . LEU A 1 130 ? 26.051 50.935 -1.791  1.00 29.73 ? 434 LEU A CD2   1 
ATOM   1024 N  N     . PRO A 1 131 ? 28.060 50.272 2.395   1.00 29.74 ? 435 PRO A N     1 
ATOM   1025 C  CA    . PRO A 1 131 ? 28.310 50.069 3.826   1.00 29.11 ? 435 PRO A CA    1 
ATOM   1026 C  C     . PRO A 1 131 ? 27.288 49.076 4.381   1.00 29.31 ? 435 PRO A C     1 
ATOM   1027 O  O     . PRO A 1 131 ? 26.310 48.746 3.714   1.00 27.34 ? 435 PRO A O     1 
ATOM   1028 C  CB    . PRO A 1 131 ? 28.106 51.463 4.411   1.00 28.39 ? 435 PRO A CB    1 
ATOM   1029 C  CG    . PRO A 1 131 ? 27.039 52.028 3.535   1.00 27.89 ? 435 PRO A CG    1 
ATOM   1030 C  CD    . PRO A 1 131 ? 27.521 51.624 2.151   1.00 28.62 ? 435 PRO A CD    1 
ATOM   1031 N  N     . TYR A 1 132 ? 27.526 48.587 5.591   1.00 29.84 ? 436 TYR A N     1 
ATOM   1032 C  CA    . TYR A 1 132 ? 26.588 47.676 6.217   1.00 29.53 ? 436 TYR A CA    1 
ATOM   1033 C  C     . TYR A 1 132 ? 25.461 48.521 6.779   1.00 30.98 ? 436 TYR A C     1 
ATOM   1034 O  O     . TYR A 1 132 ? 25.691 49.646 7.209   1.00 31.22 ? 436 TYR A O     1 
ATOM   1035 C  CB    . TYR A 1 132 ? 27.223 46.950 7.393   1.00 27.10 ? 436 TYR A CB    1 
ATOM   1036 C  CG    . TYR A 1 132 ? 28.315 46.000 7.027   1.00 25.88 ? 436 TYR A CG    1 
ATOM   1037 C  CD1   . TYR A 1 132 ? 29.637 46.433 6.909   1.00 24.39 ? 436 TYR A CD1   1 
ATOM   1038 C  CD2   . TYR A 1 132 ? 28.036 44.654 6.824   1.00 23.25 ? 436 TYR A CD2   1 
ATOM   1039 C  CE1   . TYR A 1 132 ? 30.650 45.543 6.607   1.00 22.03 ? 436 TYR A CE1   1 
ATOM   1040 C  CE2   . TYR A 1 132 ? 29.030 43.764 6.521   1.00 23.71 ? 436 TYR A CE2   1 
ATOM   1041 C  CZ    . TYR A 1 132 ? 30.341 44.211 6.418   1.00 22.88 ? 436 TYR A CZ    1 
ATOM   1042 O  OH    . TYR A 1 132 ? 31.340 43.305 6.163   1.00 21.87 ? 436 TYR A OH    1 
ATOM   1043 N  N     . THR A 1 133 ? 24.253 47.972 6.775   1.00 31.02 ? 437 THR A N     1 
ATOM   1044 C  CA    . THR A 1 133 ? 23.089 48.637 7.348   1.00 31.96 ? 437 THR A CA    1 
ATOM   1045 C  C     . THR A 1 133 ? 22.473 47.563 8.248   1.00 31.77 ? 437 THR A C     1 
ATOM   1046 O  O     . THR A 1 133 ? 21.463 46.939 7.900   1.00 30.74 ? 437 THR A O     1 
ATOM   1047 C  CB    . THR A 1 133 ? 22.079 49.048 6.256   1.00 34.41 ? 437 THR A CB    1 
ATOM   1048 O  OG1   . THR A 1 133 ? 21.730 47.901 5.468   1.00 35.50 ? 437 THR A OG1   1 
ATOM   1049 C  CG2   . THR A 1 133 ? 22.681 50.116 5.349   1.00 34.07 ? 437 THR A CG2   1 
ATOM   1050 N  N     . PHE A 1 134 ? 23.095 47.334 9.401   1.00 30.66 ? 438 PHE A N     1 
ATOM   1051 C  CA    . PHE A 1 134 ? 22.627 46.297 10.315  1.00 31.05 ? 438 PHE A CA    1 
ATOM   1052 C  C     . PHE A 1 134 ? 21.185 46.346 10.770  1.00 31.29 ? 438 PHE A C     1 
ATOM   1053 O  O     . PHE A 1 134 ? 20.514 45.318 10.770  1.00 31.35 ? 438 PHE A O     1 
ATOM   1054 C  CB    . PHE A 1 134 ? 23.519 46.225 11.545  1.00 30.18 ? 438 PHE A CB    1 
ATOM   1055 C  CG    . PHE A 1 134 ? 24.897 45.752 11.246  1.00 32.10 ? 438 PHE A CG    1 
ATOM   1056 C  CD1   . PHE A 1 134 ? 25.987 46.591 11.448  1.00 32.30 ? 438 PHE A CD1   1 
ATOM   1057 C  CD2   . PHE A 1 134 ? 25.109 44.476 10.732  1.00 29.58 ? 438 PHE A CD2   1 
ATOM   1058 C  CE1   . PHE A 1 134 ? 27.267 46.170 11.144  1.00 31.97 ? 438 PHE A CE1   1 
ATOM   1059 C  CE2   . PHE A 1 134 ? 26.384 44.043 10.423  1.00 30.96 ? 438 PHE A CE2   1 
ATOM   1060 C  CZ    . PHE A 1 134 ? 27.471 44.889 10.628  1.00 32.40 ? 438 PHE A CZ    1 
ATOM   1061 N  N     . GLU A 1 135 ? 20.714 47.520 11.175  1.00 31.08 ? 439 GLU A N     1 
ATOM   1062 C  CA    . GLU A 1 135 ? 19.342 47.647 11.643  1.00 33.08 ? 439 GLU A CA    1 
ATOM   1063 C  C     . GLU A 1 135 ? 18.382 47.268 10.518  1.00 33.83 ? 439 GLU A C     1 
ATOM   1064 O  O     . GLU A 1 135 ? 17.388 46.561 10.744  1.00 34.65 ? 439 GLU A O     1 
ATOM   1065 C  CB    . GLU A 1 135 ? 19.069 49.078 12.147  1.00 31.92 ? 439 GLU A CB    1 
ATOM   1066 N  N     . GLN A 1 136 ? 18.674 47.712 9.301   1.00 33.22 ? 440 GLN A N     1 
ATOM   1067 C  CA    . GLN A 1 136 ? 17.808 47.353 8.190   1.00 33.88 ? 440 GLN A CA    1 
ATOM   1068 C  C     . GLN A 1 136 ? 17.855 45.848 7.896   1.00 33.81 ? 440 GLN A C     1 
ATOM   1069 O  O     . GLN A 1 136 ? 16.825 45.264 7.552   1.00 34.40 ? 440 GLN A O     1 
ATOM   1070 C  CB    . GLN A 1 136 ? 18.165 48.136 6.927   1.00 35.94 ? 440 GLN A CB    1 
ATOM   1071 C  CG    . GLN A 1 136 ? 17.799 49.632 6.941   1.00 40.33 ? 440 GLN A CG    1 
ATOM   1072 C  CD    . GLN A 1 136 ? 16.327 49.913 7.264   1.00 42.81 ? 440 GLN A CD    1 
ATOM   1073 O  OE1   . GLN A 1 136 ? 15.413 49.273 6.726   1.00 41.92 ? 440 GLN A OE1   1 
ATOM   1074 N  NE2   . GLN A 1 136 ? 16.099 50.891 8.136   1.00 44.40 ? 440 GLN A NE2   1 
ATOM   1075 N  N     . PHE A 1 137 ? 19.017 45.201 8.023   1.00 32.30 ? 441 PHE A N     1 
ATOM   1076 C  CA    . PHE A 1 137 ? 19.055 43.753 7.751   1.00 31.69 ? 441 PHE A CA    1 
ATOM   1077 C  C     . PHE A 1 137 ? 18.073 43.086 8.702   1.00 30.73 ? 441 PHE A C     1 
ATOM   1078 O  O     . PHE A 1 137 ? 17.368 42.144 8.343   1.00 29.50 ? 441 PHE A O     1 
ATOM   1079 C  CB    . PHE A 1 137 ? 20.432 43.121 8.023   1.00 30.06 ? 441 PHE A CB    1 
ATOM   1080 C  CG    . PHE A 1 137 ? 21.553 43.694 7.216   1.00 29.78 ? 441 PHE A CG    1 
ATOM   1081 C  CD1   . PHE A 1 137 ? 22.830 43.748 7.758   1.00 30.23 ? 441 PHE A CD1   1 
ATOM   1082 C  CD2   . PHE A 1 137 ? 21.349 44.174 5.927   1.00 29.61 ? 441 PHE A CD2   1 
ATOM   1083 C  CE1   . PHE A 1 137 ? 23.894 44.274 7.036   1.00 31.28 ? 441 PHE A CE1   1 
ATOM   1084 C  CE2   . PHE A 1 137 ? 22.408 44.705 5.195   1.00 30.90 ? 441 PHE A CE2   1 
ATOM   1085 C  CZ    . PHE A 1 137 ? 23.686 44.756 5.752   1.00 31.14 ? 441 PHE A CZ    1 
ATOM   1086 N  N     . GLN A 1 138 ? 18.054 43.570 9.934   1.00 30.25 ? 442 GLN A N     1 
ATOM   1087 C  CA    . GLN A 1 138 ? 17.178 42.992 10.927  1.00 31.98 ? 442 GLN A CA    1 
ATOM   1088 C  C     . GLN A 1 138 ? 15.691 43.260 10.646  1.00 30.96 ? 442 GLN A C     1 
ATOM   1089 O  O     . GLN A 1 138 ? 14.868 42.366 10.808  1.00 30.19 ? 442 GLN A O     1 
ATOM   1090 C  CB    . GLN A 1 138 ? 17.576 43.480 12.326  1.00 34.24 ? 442 GLN A CB    1 
ATOM   1091 C  CG    . GLN A 1 138 ? 16.897 42.703 13.441  1.00 36.96 ? 442 GLN A CG    1 
ATOM   1092 C  CD    . GLN A 1 138 ? 17.319 43.153 14.831  1.00 40.74 ? 442 GLN A CD    1 
ATOM   1093 O  OE1   . GLN A 1 138 ? 16.475 43.506 15.657  1.00 42.63 ? 442 GLN A OE1   1 
ATOM   1094 N  NE2   . GLN A 1 138 ? 18.624 43.132 15.100  1.00 41.18 ? 442 GLN A NE2   1 
ATOM   1095 N  N     . LEU A 1 139 ? 15.340 44.468 10.220  1.00 31.29 ? 443 LEU A N     1 
ATOM   1096 C  CA    . LEU A 1 139 ? 13.937 44.756 9.930   1.00 33.30 ? 443 LEU A CA    1 
ATOM   1097 C  C     . LEU A 1 139 ? 13.412 43.894 8.774   1.00 34.25 ? 443 LEU A C     1 
ATOM   1098 O  O     . LEU A 1 139 ? 12.275 43.400 8.829   1.00 35.13 ? 443 LEU A O     1 
ATOM   1099 C  CB    . LEU A 1 139 ? 13.744 46.242 9.622   1.00 33.68 ? 443 LEU A CB    1 
ATOM   1100 C  CG    . LEU A 1 139 ? 13.786 47.170 10.843  1.00 36.64 ? 443 LEU A CG    1 
ATOM   1101 C  CD1   . LEU A 1 139 ? 13.998 48.578 10.341  1.00 37.95 ? 443 LEU A CD1   1 
ATOM   1102 C  CD2   . LEU A 1 139 ? 12.492 47.070 11.691  1.00 36.96 ? 443 LEU A CD2   1 
ATOM   1103 N  N     . LYS A 1 140 ? 14.229 43.691 7.740   1.00 33.25 ? 444 LYS A N     1 
ATOM   1104 C  CA    . LYS A 1 140 ? 13.796 42.863 6.622   1.00 31.70 ? 444 LYS A CA    1 
ATOM   1105 C  C     . LYS A 1 140 ? 13.654 41.424 7.093   1.00 31.44 ? 444 LYS A C     1 
ATOM   1106 O  O     . LYS A 1 140 ? 12.753 40.702 6.657   1.00 30.75 ? 444 LYS A O     1 
ATOM   1107 C  CB    . LYS A 1 140 ? 14.792 42.944 5.475   1.00 31.99 ? 444 LYS A CB    1 
ATOM   1108 C  CG    . LYS A 1 140 ? 15.034 44.360 4.993   1.00 34.56 ? 444 LYS A CG    1 
ATOM   1109 C  CD    . LYS A 1 140 ? 13.740 45.033 4.548   1.00 33.40 ? 444 LYS A CD    1 
ATOM   1110 C  CE    . LYS A 1 140 ? 14.027 46.348 3.848   1.00 34.90 ? 444 LYS A CE    1 
ATOM   1111 N  NZ    . LYS A 1 140 ? 12.768 47.105 3.585   1.00 39.22 ? 444 LYS A NZ    1 
ATOM   1112 N  N     . SER A 1 141 ? 14.526 40.998 7.997   1.00 29.48 ? 445 SER A N     1 
ATOM   1113 C  CA    . SER A 1 141 ? 14.402 39.636 8.483   1.00 30.37 ? 445 SER A CA    1 
ATOM   1114 C  C     . SER A 1 141 ? 13.097 39.452 9.263   1.00 31.03 ? 445 SER A C     1 
ATOM   1115 O  O     . SER A 1 141 ? 12.445 38.413 9.154   1.00 30.89 ? 445 SER A O     1 
ATOM   1116 C  CB    . SER A 1 141 ? 15.585 39.266 9.369   1.00 28.52 ? 445 SER A CB    1 
ATOM   1117 O  OG    . SER A 1 141 ? 15.371 37.996 9.954   1.00 28.14 ? 445 SER A OG    1 
ATOM   1118 N  N     . GLU A 1 142 ? 12.711 40.456 10.046  1.00 32.27 ? 446 GLU A N     1 
ATOM   1119 C  CA    . GLU A 1 142 ? 11.485 40.362 10.832  1.00 34.12 ? 446 GLU A CA    1 
ATOM   1120 C  C     . GLU A 1 142 ? 10.263 40.265 9.902   1.00 33.80 ? 446 GLU A C     1 
ATOM   1121 O  O     . GLU A 1 142 ? 9.383  39.429 10.113  1.00 32.70 ? 446 GLU A O     1 
ATOM   1122 C  CB    . GLU A 1 142 ? 11.411 41.554 11.808  1.00 36.93 ? 446 GLU A CB    1 
ATOM   1123 C  CG    . GLU A 1 142 ? 12.416 41.408 12.976  1.00 39.94 ? 446 GLU A CG    1 
ATOM   1124 C  CD    . GLU A 1 142 ? 12.758 42.710 13.702  1.00 43.84 ? 446 GLU A CD    1 
ATOM   1125 O  OE1   . GLU A 1 142 ? 12.084 43.742 13.475  1.00 45.05 ? 446 GLU A OE1   1 
ATOM   1126 O  OE2   . GLU A 1 142 ? 13.713 42.687 14.517  1.00 43.89 ? 446 GLU A OE2   1 
ATOM   1127 N  N     . ALA A 1 143 ? 10.235 41.084 8.852   1.00 33.68 ? 447 ALA A N     1 
ATOM   1128 C  CA    . ALA A 1 143 ? 9.143  41.053 7.880   1.00 35.19 ? 447 ALA A CA    1 
ATOM   1129 C  C     . ALA A 1 143 ? 9.058  39.659 7.244   1.00 36.72 ? 447 ALA A C     1 
ATOM   1130 O  O     . ALA A 1 143 ? 7.973  39.073 7.113   1.00 38.41 ? 447 ALA A O     1 
ATOM   1131 C  CB    . ALA A 1 143 ? 9.379  42.096 6.812   1.00 33.92 ? 447 ALA A CB    1 
ATOM   1132 N  N     . PHE A 1 144 ? 10.218 39.139 6.854   1.00 36.78 ? 448 PHE A N     1 
ATOM   1133 C  CA    . PHE A 1 144 ? 10.338 37.815 6.252   1.00 35.65 ? 448 PHE A CA    1 
ATOM   1134 C  C     . PHE A 1 144 ? 9.685  36.808 7.179   1.00 35.00 ? 448 PHE A C     1 
ATOM   1135 O  O     . PHE A 1 144 ? 8.756  36.112 6.782   1.00 34.75 ? 448 PHE A O     1 
ATOM   1136 C  CB    . PHE A 1 144 ? 11.828 37.493 6.061   1.00 35.83 ? 448 PHE A CB    1 
ATOM   1137 C  CG    . PHE A 1 144 ? 12.141 36.044 5.790   1.00 35.07 ? 448 PHE A CG    1 
ATOM   1138 C  CD1   . PHE A 1 144 ? 11.949 35.487 4.529   1.00 35.94 ? 448 PHE A CD1   1 
ATOM   1139 C  CD2   . PHE A 1 144 ? 12.741 35.266 6.778   1.00 35.70 ? 448 PHE A CD2   1 
ATOM   1140 C  CE1   . PHE A 1 144 ? 12.368 34.173 4.256   1.00 38.42 ? 448 PHE A CE1   1 
ATOM   1141 C  CE2   . PHE A 1 144 ? 13.163 33.955 6.516   1.00 37.19 ? 448 PHE A CE2   1 
ATOM   1142 C  CZ    . PHE A 1 144 ? 12.979 33.409 5.253   1.00 37.09 ? 448 PHE A CZ    1 
ATOM   1143 N  N     . TYR A 1 145 ? 10.156 36.740 8.422   1.00 34.14 ? 449 TYR A N     1 
ATOM   1144 C  CA    . TYR A 1 145 ? 9.585  35.779 9.359   1.00 33.96 ? 449 TYR A CA    1 
ATOM   1145 C  C     . TYR A 1 145 ? 8.117  36.028 9.725   1.00 35.29 ? 449 TYR A C     1 
ATOM   1146 O  O     . TYR A 1 145 ? 7.364  35.066 9.877   1.00 33.41 ? 449 TYR A O     1 
ATOM   1147 C  CB    . TYR A 1 145 ? 10.425 35.674 10.640  1.00 32.55 ? 449 TYR A CB    1 
ATOM   1148 C  CG    . TYR A 1 145 ? 11.665 34.802 10.504  1.00 33.59 ? 449 TYR A CG    1 
ATOM   1149 C  CD1   . TYR A 1 145 ? 12.937 35.370 10.346  1.00 30.77 ? 449 TYR A CD1   1 
ATOM   1150 C  CD2   . TYR A 1 145 ? 11.567 33.410 10.540  1.00 32.62 ? 449 TYR A CD2   1 
ATOM   1151 C  CE1   . TYR A 1 145 ? 14.070 34.578 10.232  1.00 30.27 ? 449 TYR A CE1   1 
ATOM   1152 C  CE2   . TYR A 1 145 ? 12.704 32.603 10.424  1.00 34.12 ? 449 TYR A CE2   1 
ATOM   1153 C  CZ    . TYR A 1 145 ? 13.951 33.199 10.272  1.00 33.16 ? 449 TYR A CZ    1 
ATOM   1154 O  OH    . TYR A 1 145 ? 15.074 32.412 10.174  1.00 32.02 ? 449 TYR A OH    1 
ATOM   1155 N  N     . SER A 1 146 ? 7.680  37.279 9.869   1.00 36.03 ? 450 SER A N     1 
ATOM   1156 C  CA    . SER A 1 146 ? 6.274  37.457 10.213  1.00 38.62 ? 450 SER A CA    1 
ATOM   1157 C  C     . SER A 1 146 ? 5.406  37.080 9.012   1.00 39.71 ? 450 SER A C     1 
ATOM   1158 O  O     . SER A 1 146 ? 4.356  36.453 9.167   1.00 40.47 ? 450 SER A O     1 
ATOM   1159 C  CB    . SER A 1 146 ? 5.970  38.879 10.734  1.00 38.17 ? 450 SER A CB    1 
ATOM   1160 O  OG    . SER A 1 146 ? 6.416  39.914 9.888   1.00 39.53 ? 450 SER A OG    1 
ATOM   1161 N  N     . THR A 1 147 ? 5.873  37.412 7.815   1.00 40.27 ? 451 THR A N     1 
ATOM   1162 C  CA    . THR A 1 147 ? 5.147  37.072 6.606   1.00 40.59 ? 451 THR A CA    1 
ATOM   1163 C  C     . THR A 1 147 ? 4.977  35.559 6.479   1.00 42.05 ? 451 THR A C     1 
ATOM   1164 O  O     . THR A 1 147 ? 3.910  35.075 6.093   1.00 42.74 ? 451 THR A O     1 
ATOM   1165 C  CB    . THR A 1 147 ? 5.882  37.609 5.384   1.00 40.37 ? 451 THR A CB    1 
ATOM   1166 O  OG1   . THR A 1 147 ? 5.747  39.032 5.348   1.00 39.67 ? 451 THR A OG1   1 
ATOM   1167 C  CG2   . THR A 1 147 ? 5.330  37.005 4.114   1.00 40.23 ? 451 THR A CG2   1 
ATOM   1168 N  N     . LEU A 1 148 ? 6.021  34.806 6.802   1.00 42.60 ? 452 LEU A N     1 
ATOM   1169 C  CA    . LEU A 1 148 ? 5.911  33.365 6.707   1.00 43.33 ? 452 LEU A CA    1 
ATOM   1170 C  C     . LEU A 1 148 ? 4.798  32.897 7.640   1.00 43.88 ? 452 LEU A C     1 
ATOM   1171 O  O     . LEU A 1 148 ? 3.869  32.233 7.195   1.00 44.71 ? 452 LEU A O     1 
ATOM   1172 C  CB    . LEU A 1 148 ? 7.257  32.692 7.033   1.00 42.93 ? 452 LEU A CB    1 
ATOM   1173 C  CG    . LEU A 1 148 ? 8.352  32.966 5.987   1.00 43.22 ? 452 LEU A CG    1 
ATOM   1174 C  CD1   . LEU A 1 148 ? 9.706  32.372 6.403   1.00 42.85 ? 452 LEU A CD1   1 
ATOM   1175 C  CD2   . LEU A 1 148 ? 7.899  32.383 4.661   1.00 42.26 ? 452 LEU A CD2   1 
ATOM   1176 N  N     . LYS A 1 149 ? 4.864  33.271 8.916   1.00 44.45 ? 453 LYS A N     1 
ATOM   1177 C  CA    . LYS A 1 149 ? 3.833  32.869 9.869   1.00 45.20 ? 453 LYS A CA    1 
ATOM   1178 C  C     . LYS A 1 149 ? 2.431  33.279 9.396   1.00 45.88 ? 453 LYS A C     1 
ATOM   1179 O  O     . LYS A 1 149 ? 1.500  32.477 9.471   1.00 45.20 ? 453 LYS A O     1 
ATOM   1180 C  CB    . LYS A 1 149 ? 4.123  33.461 11.268  1.00 44.90 ? 453 LYS A CB    1 
ATOM   1181 N  N     . ARG A 1 150 ? 2.287  34.505 8.887   1.00 47.17 ? 454 ARG A N     1 
ATOM   1182 C  CA    . ARG A 1 150 ? 0.985  35.010 8.418   1.00 49.30 ? 454 ARG A CA    1 
ATOM   1183 C  C     . ARG A 1 150 ? 0.292  34.185 7.319   1.00 50.28 ? 454 ARG A C     1 
ATOM   1184 O  O     . ARG A 1 150 ? -0.923 33.987 7.375   1.00 50.53 ? 454 ARG A O     1 
ATOM   1185 C  CB    . ARG A 1 150 ? 1.112  36.472 7.968   1.00 49.70 ? 454 ARG A CB    1 
ATOM   1186 C  CG    . ARG A 1 150 ? -0.186 37.090 7.434   1.00 52.14 ? 454 ARG A CG    1 
ATOM   1187 C  CD    . ARG A 1 150 ? -0.044 38.594 7.167   1.00 54.57 ? 454 ARG A CD    1 
ATOM   1188 N  NE    . ARG A 1 150 ? 0.866  38.878 6.061   1.00 57.84 ? 454 ARG A NE    1 
ATOM   1189 C  CZ    . ARG A 1 150 ? 0.595  38.627 4.782   1.00 60.31 ? 454 ARG A CZ    1 
ATOM   1190 N  NH1   . ARG A 1 150 ? -0.572 38.087 4.431   1.00 60.31 ? 454 ARG A NH1   1 
ATOM   1191 N  NH2   . ARG A 1 150 ? 1.504  38.897 3.851   1.00 61.64 ? 454 ARG A NH2   1 
ATOM   1192 N  N     . LEU A 1 151 ? 1.040  33.732 6.313   1.00 50.61 ? 455 LEU A N     1 
ATOM   1193 C  CA    . LEU A 1 151 ? 0.462  32.887 5.262   1.00 51.77 ? 455 LEU A CA    1 
ATOM   1194 C  C     . LEU A 1 151 ? 0.175  31.686 6.138   1.00 52.58 ? 455 LEU A C     1 
ATOM   1195 O  O     . LEU A 1 151 ? 0.893  31.473 7.099   1.00 53.92 ? 455 LEU A O     1 
ATOM   1196 C  CB    . LEU A 1 151 ? 1.530  32.566 4.212   1.00 51.11 ? 455 LEU A CB    1 
ATOM   1197 C  CG    . LEU A 1 151 ? 2.141  33.825 3.586   1.00 51.70 ? 455 LEU A CG    1 
ATOM   1198 C  CD1   . LEU A 1 151 ? 3.223  33.443 2.596   1.00 51.71 ? 455 LEU A CD1   1 
ATOM   1199 C  CD2   . LEU A 1 151 ? 1.054  34.639 2.899   1.00 51.78 ? 455 LEU A CD2   1 
ATOM   1200 N  N     . ASN A 1 152 ? -0.841 30.887 5.924   1.00 52.90 ? 456 ASN A N     1 
ATOM   1201 C  CA    . ASN A 1 152 ? -0.881 29.853 6.936   1.00 52.95 ? 456 ASN A CA    1 
ATOM   1202 C  C     . ASN A 1 152 ? -0.596 28.577 6.256   1.00 51.57 ? 456 ASN A C     1 
ATOM   1203 O  O     . ASN A 1 152 ? -1.426 27.688 6.146   1.00 52.18 ? 456 ASN A O     1 
ATOM   1204 C  CB    . ASN A 1 152 ? -2.200 29.858 7.677   1.00 55.57 ? 456 ASN A CB    1 
ATOM   1205 C  CG    . ASN A 1 152 ? -2.001 29.762 9.168   1.00 57.62 ? 456 ASN A CG    1 
ATOM   1206 O  OD1   . ASN A 1 152 ? -2.566 28.891 9.812   1.00 59.88 ? 456 ASN A OD1   1 
ATOM   1207 N  ND2   . ASN A 1 152 ? -1.184 30.657 9.727   1.00 59.64 ? 456 ASN A ND2   1 
ATOM   1208 N  N     . ILE A 1 153 ? 0.647  28.501 5.828   1.00 49.63 ? 457 ILE A N     1 
ATOM   1209 C  CA    . ILE A 1 153 ? 1.111  27.398 5.038   1.00 47.23 ? 457 ILE A CA    1 
ATOM   1210 C  C     . ILE A 1 153 ? 1.866  26.261 5.676   1.00 46.16 ? 457 ILE A C     1 
ATOM   1211 O  O     . ILE A 1 153 ? 1.714  25.114 5.262   1.00 46.33 ? 457 ILE A O     1 
ATOM   1212 C  CB    . ILE A 1 153 ? 1.963  27.966 3.909   1.00 47.73 ? 457 ILE A CB    1 
ATOM   1213 C  CG1   . ILE A 1 153 ? 1.077  28.803 2.987   1.00 46.51 ? 457 ILE A CG1   1 
ATOM   1214 C  CG2   . ILE A 1 153 ? 2.664  26.860 3.170   1.00 47.14 ? 457 ILE A CG2   1 
ATOM   1215 C  CD1   . ILE A 1 153 ? 1.840  29.764 2.124   1.00 46.50 ? 457 ILE A CD1   1 
ATOM   1216 N  N     . PHE A 1 154 ? 2.666  26.570 6.686   1.00 45.97 ? 458 PHE A N     1 
ATOM   1217 C  CA    . PHE A 1 154 ? 3.512  25.561 7.295   1.00 45.25 ? 458 PHE A CA    1 
ATOM   1218 C  C     . PHE A 1 154 ? 3.201  25.049 8.688   1.00 45.72 ? 458 PHE A C     1 
ATOM   1219 O  O     . PHE A 1 154 ? 2.692  25.766 9.547   1.00 45.54 ? 458 PHE A O     1 
ATOM   1220 C  CB    . PHE A 1 154 ? 4.955  26.062 7.272   1.00 43.43 ? 458 PHE A CB    1 
ATOM   1221 C  CG    . PHE A 1 154 ? 5.433  26.492 5.906   1.00 41.34 ? 458 PHE A CG    1 
ATOM   1222 C  CD1   . PHE A 1 154 ? 5.699  27.832 5.632   1.00 39.68 ? 458 PHE A CD1   1 
ATOM   1223 C  CD2   . PHE A 1 154 ? 5.648  25.551 4.905   1.00 40.10 ? 458 PHE A CD2   1 
ATOM   1224 C  CE1   . PHE A 1 154 ? 6.175  28.221 4.384   1.00 39.60 ? 458 PHE A CE1   1 
ATOM   1225 C  CE2   . PHE A 1 154 ? 6.123  25.931 3.654   1.00 37.40 ? 458 PHE A CE2   1 
ATOM   1226 C  CZ    . PHE A 1 154 ? 6.388  27.264 3.393   1.00 38.73 ? 458 PHE A CZ    1 
ATOM   1227 N  N     . ASN A 1 155 ? 3.546  23.788 8.902   1.00 46.76 ? 459 ASN A N     1 
ATOM   1228 C  CA    . ASN A 1 155 ? 3.341  23.158 10.183  1.00 48.22 ? 459 ASN A CA    1 
ATOM   1229 C  C     . ASN A 1 155 ? 4.475  23.581 11.070  1.00 48.65 ? 459 ASN A C     1 
ATOM   1230 O  O     . ASN A 1 155 ? 4.345  23.643 12.293  1.00 48.86 ? 459 ASN A O     1 
ATOM   1231 C  CB    . ASN A 1 155 ? 3.311  21.659 10.014  1.00 50.40 ? 459 ASN A CB    1 
ATOM   1232 C  CG    . ASN A 1 155 ? 2.137  21.222 9.209   1.00 54.04 ? 459 ASN A CG    1 
ATOM   1233 O  OD1   . ASN A 1 155 ? 1.491  20.225 9.510   1.00 56.62 ? 459 ASN A OD1   1 
ATOM   1234 N  ND2   . ASN A 1 155 ? 1.837  21.977 8.185   1.00 54.82 ? 459 ASN A ND2   1 
ATOM   1235 N  N     . LEU A 1 156 ? 5.607  23.873 10.456  1.00 47.52 ? 460 LEU A N     1 
ATOM   1236 C  CA    . LEU A 1 156 ? 6.686  24.345 11.264  1.00 46.48 ? 460 LEU A CA    1 
ATOM   1237 C  C     . LEU A 1 156 ? 7.729  25.113 10.482  1.00 44.85 ? 460 LEU A C     1 
ATOM   1238 O  O     . LEU A 1 156 ? 8.025  24.833 9.315   1.00 45.15 ? 460 LEU A O     1 
ATOM   1239 C  CB    . LEU A 1 156 ? 7.236  23.208 12.130  1.00 48.35 ? 460 LEU A CB    1 
ATOM   1240 C  CG    . LEU A 1 156 ? 8.368  22.244 11.869  1.00 49.21 ? 460 LEU A CG    1 
ATOM   1241 C  CD1   . LEU A 1 156 ? 9.450  22.924 11.115  1.00 51.56 ? 460 LEU A CD1   1 
ATOM   1242 C  CD2   . LEU A 1 156 ? 8.891  21.779 13.213  1.00 50.42 ? 460 LEU A CD2   1 
ATOM   1243 N  N     . ILE A 1 157 ? 8.238  26.132 11.153  1.00 42.74 ? 461 ILE A N     1 
ATOM   1244 C  CA    . ILE A 1 157 ? 9.185  27.060 10.585  1.00 39.84 ? 461 ILE A CA    1 
ATOM   1245 C  C     . ILE A 1 157 ? 10.441 27.106 11.434  1.00 39.03 ? 461 ILE A C     1 
ATOM   1246 O  O     . ILE A 1 157 ? 10.441 27.654 12.532  1.00 38.61 ? 461 ILE A O     1 
ATOM   1247 C  CB    . ILE A 1 157 ? 8.491  28.422 10.512  1.00 39.51 ? 461 ILE A CB    1 
ATOM   1248 C  CG1   . ILE A 1 157 ? 7.279  28.295 9.581   1.00 40.67 ? 461 ILE A CG1   1 
ATOM   1249 C  CG2   . ILE A 1 157 ? 9.446  29.506 10.070  1.00 38.05 ? 461 ILE A CG2   1 
ATOM   1250 C  CD1   . ILE A 1 157 ? 6.472  29.565 9.419   1.00 37.98 ? 461 ILE A CD1   1 
ATOM   1251 N  N     . LEU A 1 158 ? 11.503 26.504 10.913  1.00 38.73 ? 462 LEU A N     1 
ATOM   1252 C  CA    . LEU A 1 158 ? 12.780 26.435 11.603  1.00 38.36 ? 462 LEU A CA    1 
ATOM   1253 C  C     . LEU A 1 158 ? 13.710 27.555 11.157  1.00 38.32 ? 462 LEU A C     1 
ATOM   1254 O  O     . LEU A 1 158 ? 14.100 27.628 9.992   1.00 38.21 ? 462 LEU A O     1 
ATOM   1255 C  CB    . LEU A 1 158 ? 13.428 25.069 11.342  1.00 37.73 ? 462 LEU A CB    1 
ATOM   1256 C  CG    . LEU A 1 158 ? 12.623 23.853 11.827  1.00 38.07 ? 462 LEU A CG    1 
ATOM   1257 C  CD1   . LEU A 1 158 ? 13.177 22.557 11.249  1.00 37.58 ? 462 LEU A CD1   1 
ATOM   1258 C  CD2   . LEU A 1 158 ? 12.657 23.808 13.345  1.00 37.80 ? 462 LEU A CD2   1 
ATOM   1259 N  N     . PRO A 1 159 ? 14.059 28.466 12.077  1.00 39.06 ? 463 PRO A N     1 
ATOM   1260 C  CA    . PRO A 1 159 ? 14.960 29.549 11.676  1.00 39.30 ? 463 PRO A CA    1 
ATOM   1261 C  C     . PRO A 1 159 ? 16.359 28.961 11.554  1.00 39.13 ? 463 PRO A C     1 
ATOM   1262 O  O     . PRO A 1 159 ? 16.814 28.248 12.443  1.00 40.15 ? 463 PRO A O     1 
ATOM   1263 C  CB    . PRO A 1 159 ? 14.844 30.535 12.833  1.00 39.38 ? 463 PRO A CB    1 
ATOM   1264 C  CG    . PRO A 1 159 ? 14.669 29.621 14.013  1.00 39.92 ? 463 PRO A CG    1 
ATOM   1265 C  CD    . PRO A 1 159 ? 13.672 28.593 13.495  1.00 38.69 ? 463 PRO A CD    1 
ATOM   1266 N  N     . ILE A 1 160 ? 17.026 29.223 10.442  1.00 37.95 ? 464 ILE A N     1 
ATOM   1267 C  CA    . ILE A 1 160 ? 18.372 28.713 10.247  1.00 36.41 ? 464 ILE A CA    1 
ATOM   1268 C  C     . ILE A 1 160 ? 19.306 29.887 10.427  1.00 35.13 ? 464 ILE A C     1 
ATOM   1269 O  O     . ILE A 1 160 ? 20.378 29.789 11.028  1.00 34.49 ? 464 ILE A O     1 
ATOM   1270 C  CB    . ILE A 1 160 ? 18.557 28.168 8.812   1.00 36.85 ? 464 ILE A CB    1 
ATOM   1271 C  CG1   . ILE A 1 160 ? 17.530 27.068 8.549   1.00 36.66 ? 464 ILE A CG1   1 
ATOM   1272 C  CG2   . ILE A 1 160 ? 19.977 27.655 8.609   1.00 35.37 ? 464 ILE A CG2   1 
ATOM   1273 C  CD1   . ILE A 1 160 ? 17.475 26.015 9.628   1.00 34.88 ? 464 ILE A CD1   1 
ATOM   1274 N  N     . SER A 1 161 ? 18.854 31.022 9.926   1.00 33.84 ? 465 SER A N     1 
ATOM   1275 C  CA    . SER A 1 161 ? 19.664 32.206 9.957   1.00 32.28 ? 465 SER A CA    1 
ATOM   1276 C  C     . SER A 1 161 ? 18.839 33.463 9.803   1.00 31.37 ? 465 SER A C     1 
ATOM   1277 O  O     . SER A 1 161 ? 17.627 33.419 9.577   1.00 31.75 ? 465 SER A O     1 
ATOM   1278 C  CB    . SER A 1 161 ? 20.670 32.102 8.821   1.00 34.12 ? 465 SER A CB    1 
ATOM   1279 O  OG    . SER A 1 161 ? 21.281 33.342 8.552   1.00 35.47 ? 465 SER A OG    1 
ATOM   1280 N  N     . ILE A 1 162 ? 19.505 34.596 9.897   1.00 28.99 ? 466 ILE A N     1 
ATOM   1281 C  CA    . ILE A 1 162 ? 18.790 35.826 9.770   1.00 28.34 ? 466 ILE A CA    1 
ATOM   1282 C  C     . ILE A 1 162 ? 18.027 35.993 8.449   1.00 28.14 ? 466 ILE A C     1 
ATOM   1283 O  O     . ILE A 1 162 ? 17.076 36.762 8.394   1.00 28.20 ? 466 ILE A O     1 
ATOM   1284 C  CB    . ILE A 1 162 ? 19.721 36.995 9.991   1.00 29.86 ? 466 ILE A CB    1 
ATOM   1285 C  CG1   . ILE A 1 162 ? 18.866 38.180 10.434  1.00 29.25 ? 466 ILE A CG1   1 
ATOM   1286 C  CG2   . ILE A 1 162 ? 20.618 37.206 8.761   1.00 27.54 ? 466 ILE A CG2   1 
ATOM   1287 C  CD1   . ILE A 1 162 ? 19.022 39.351 9.603   1.00 31.88 ? 466 ILE A CD1   1 
ATOM   1288 N  N     . ASP A 1 163 ? 18.427 35.282 7.394   1.00 27.81 ? 467 ASP A N     1 
ATOM   1289 C  CA    . ASP A 1 163 ? 17.725 35.380 6.105   1.00 28.43 ? 467 ASP A CA    1 
ATOM   1290 C  C     . ASP A 1 163 ? 17.342 34.002 5.562   1.00 28.48 ? 467 ASP A C     1 
ATOM   1291 O  O     . ASP A 1 163 ? 17.181 33.830 4.350   1.00 29.03 ? 467 ASP A O     1 
ATOM   1292 C  CB    . ASP A 1 163 ? 18.604 36.056 5.048   1.00 27.01 ? 467 ASP A CB    1 
ATOM   1293 C  CG    . ASP A 1 163 ? 19.678 35.117 4.498   1.00 26.55 ? 467 ASP A CG    1 
ATOM   1294 O  OD1   . ASP A 1 163 ? 20.014 35.222 3.303   1.00 27.45 ? 467 ASP A OD1   1 
ATOM   1295 O  OD2   . ASP A 1 163 ? 20.188 34.270 5.266   1.00 24.70 ? 467 ASP A OD2   1 
ATOM   1296 N  N     . GLU A 1 164 ? 17.173 33.023 6.436   1.00 28.35 ? 468 GLU A N     1 
ATOM   1297 C  CA    . GLU A 1 164 ? 16.885 31.694 5.937   1.00 30.61 ? 468 GLU A CA    1 
ATOM   1298 C  C     . GLU A 1 164 ? 16.068 30.840 6.884   1.00 30.33 ? 468 GLU A C     1 
ATOM   1299 O  O     . GLU A 1 164 ? 16.314 30.814 8.084   1.00 31.24 ? 468 GLU A O     1 
ATOM   1300 C  CB    . GLU A 1 164 ? 18.225 31.046 5.613   1.00 31.68 ? 468 GLU A CB    1 
ATOM   1301 C  CG    . GLU A 1 164 ? 18.262 29.576 5.306   1.00 36.42 ? 468 GLU A CG    1 
ATOM   1302 C  CD    . GLU A 1 164 ? 19.678 29.154 4.904   1.00 40.95 ? 468 GLU A CD    1 
ATOM   1303 O  OE1   . GLU A 1 164 ? 19.881 27.991 4.496   1.00 41.52 ? 468 GLU A OE1   1 
ATOM   1304 O  OE2   . GLU A 1 164 ? 20.597 30.003 4.995   1.00 41.92 ? 468 GLU A OE2   1 
ATOM   1305 N  N     . ALA A 1 165 ? 15.094 30.135 6.325   1.00 30.54 ? 469 ALA A N     1 
ATOM   1306 C  CA    . ALA A 1 165 ? 14.225 29.277 7.109   1.00 30.77 ? 469 ALA A CA    1 
ATOM   1307 C  C     . ALA A 1 165 ? 13.881 27.984 6.395   1.00 32.45 ? 469 ALA A C     1 
ATOM   1308 O  O     . ALA A 1 165 ? 13.726 27.942 5.167   1.00 32.16 ? 469 ALA A O     1 
ATOM   1309 C  CB    . ALA A 1 165 ? 12.941 30.018 7.452   1.00 30.53 ? 469 ALA A CB    1 
ATOM   1310 N  N     . VAL A 1 166 ? 13.779 26.926 7.186   1.00 33.13 ? 470 VAL A N     1 
ATOM   1311 C  CA    . VAL A 1 166 ? 13.392 25.626 6.688   1.00 34.96 ? 470 VAL A CA    1 
ATOM   1312 C  C     . VAL A 1 166 ? 11.943 25.470 7.133   1.00 37.02 ? 470 VAL A C     1 
ATOM   1313 O  O     . VAL A 1 166 ? 11.655 25.322 8.321   1.00 36.13 ? 470 VAL A O     1 
ATOM   1314 C  CB    . VAL A 1 166 ? 14.262 24.537 7.298   1.00 34.88 ? 470 VAL A CB    1 
ATOM   1315 C  CG1   . VAL A 1 166 ? 13.640 23.171 7.080   1.00 34.74 ? 470 VAL A CG1   1 
ATOM   1316 C  CG2   . VAL A 1 166 ? 15.614 24.586 6.651   1.00 34.39 ? 470 VAL A CG2   1 
ATOM   1317 N  N     . CYS A 1 167 ? 11.030 25.545 6.174   1.00 39.06 ? 471 CYS A N     1 
ATOM   1318 C  CA    . CYS A 1 167 ? 9.609  25.436 6.469   1.00 40.16 ? 471 CYS A CA    1 
ATOM   1319 C  C     . CYS A 1 167 ? 9.106  24.053 6.083   1.00 41.78 ? 471 CYS A C     1 
ATOM   1320 O  O     . CYS A 1 167 ? 9.438  23.531 5.027   1.00 41.36 ? 471 CYS A O     1 
ATOM   1321 C  CB    . CYS A 1 167 ? 8.870  26.528 5.713   1.00 39.42 ? 471 CYS A CB    1 
ATOM   1322 S  SG    . CYS A 1 167 ? 9.624  28.147 5.965   1.00 38.64 ? 471 CYS A SG    1 
ATOM   1323 N  N     . VAL A 1 168 ? 8.296  23.462 6.946   1.00 44.59 ? 472 VAL A N     1 
ATOM   1324 C  CA    . VAL A 1 168 ? 7.798  22.116 6.708   1.00 47.03 ? 472 VAL A CA    1 
ATOM   1325 C  C     . VAL A 1 168 ? 6.277  22.014 6.587   1.00 49.07 ? 472 VAL A C     1 
ATOM   1326 O  O     . VAL A 1 168 ? 5.555  22.586 7.408   1.00 48.28 ? 472 VAL A O     1 
ATOM   1327 C  CB    . VAL A 1 168 ? 8.238  21.187 7.864   1.00 46.82 ? 472 VAL A CB    1 
ATOM   1328 C  CG1   . VAL A 1 168 ? 7.980  19.730 7.506   1.00 47.46 ? 472 VAL A CG1   1 
ATOM   1329 C  CG2   . VAL A 1 168 ? 9.696  21.425 8.194   1.00 46.30 ? 472 VAL A CG2   1 
ATOM   1330 N  N     . ARG A 1 169 ? 5.802  21.310 5.554   1.00 51.06 ? 473 ARG A N     1 
ATOM   1331 C  CA    . ARG A 1 169 ? 4.369  21.064 5.370   1.00 54.09 ? 473 ARG A CA    1 
ATOM   1332 C  C     . ARG A 1 169 ? 4.197  19.580 5.595   1.00 56.50 ? 473 ARG A C     1 
ATOM   1333 O  O     . ARG A 1 169 ? 4.876  18.760 4.970   1.00 56.21 ? 473 ARG A O     1 
ATOM   1334 C  CB    . ARG A 1 169 ? 3.860  21.326 3.950   1.00 54.54 ? 473 ARG A CB    1 
ATOM   1335 C  CG    . ARG A 1 169 ? 3.820  22.754 3.463   1.00 55.96 ? 473 ARG A CG    1 
ATOM   1336 C  CD    . ARG A 1 169 ? 2.951  22.852 2.198   1.00 57.97 ? 473 ARG A CD    1 
ATOM   1337 N  NE    . ARG A 1 169 ? 1.536  23.042 2.524   1.00 60.28 ? 473 ARG A NE    1 
ATOM   1338 C  CZ    . ARG A 1 169 ? 0.529  22.354 1.993   1.00 61.22 ? 473 ARG A CZ    1 
ATOM   1339 N  NH1   . ARG A 1 169 ? 0.755  21.410 1.091   1.00 61.24 ? 473 ARG A NH1   1 
ATOM   1340 N  NH2   . ARG A 1 169 ? -0.713 22.608 2.378   1.00 63.34 ? 473 ARG A NH2   1 
ATOM   1341 N  N     . ILE A 1 170 ? 3.290  19.233 6.489   1.00 59.76 ? 474 ILE A N     1 
ATOM   1342 C  CA    . ILE A 1 170 ? 3.014  17.842 6.757   1.00 62.92 ? 474 ILE A CA    1 
ATOM   1343 C  C     . ILE A 1 170 ? 1.846  17.502 5.854   1.00 65.26 ? 474 ILE A C     1 
ATOM   1344 O  O     . ILE A 1 170 ? 0.853  18.226 5.810   1.00 65.96 ? 474 ILE A O     1 
ATOM   1345 C  CB    . ILE A 1 170 ? 2.660  17.659 8.217   1.00 62.84 ? 474 ILE A CB    1 
ATOM   1346 C  CG1   . ILE A 1 170 ? 3.947  17.703 9.032   1.00 62.62 ? 474 ILE A CG1   1 
ATOM   1347 C  CG2   . ILE A 1 170 ? 1.912  16.364 8.427   1.00 63.14 ? 474 ILE A CG2   1 
ATOM   1348 C  CD1   . ILE A 1 170 ? 3.725  17.966 10.479  1.00 63.46 ? 474 ILE A CD1   1 
ATOM   1349 N  N     . ILE A 1 171 ? 1.982  16.416 5.109   1.00 67.81 ? 475 ILE A N     1 
ATOM   1350 C  CA    . ILE A 1 171 ? 0.939  16.010 4.188   1.00 70.57 ? 475 ILE A CA    1 
ATOM   1351 C  C     . ILE A 1 171 ? 0.182  14.798 4.721   1.00 73.13 ? 475 ILE A C     1 
ATOM   1352 O  O     . ILE A 1 171 ? 0.786  13.752 4.965   1.00 72.87 ? 475 ILE A O     1 
ATOM   1353 C  CB    . ILE A 1 171 ? 1.553  15.664 2.800   1.00 69.84 ? 475 ILE A CB    1 
ATOM   1354 C  CG1   . ILE A 1 171 ? 2.243  16.899 2.211   1.00 68.30 ? 475 ILE A CG1   1 
ATOM   1355 C  CG2   . ILE A 1 171 ? 0.485  15.126 1.862   1.00 70.59 ? 475 ILE A CG2   1 
ATOM   1356 C  CD1   . ILE A 1 171 ? 1.379  18.135 2.185   1.00 66.52 ? 475 ILE A CD1   1 
ATOM   1357 N  N     . PRO A 1 172 ? -1.137 14.932 4.970   1.00 75.94 ? 476 PRO A N     1 
ATOM   1358 C  CA    . PRO A 1 172 ? -1.790 13.712 5.460   1.00 77.90 ? 476 PRO A CA    1 
ATOM   1359 C  C     . PRO A 1 172 ? -1.914 12.792 4.218   1.00 79.45 ? 476 PRO A C     1 
ATOM   1360 O  O     . PRO A 1 172 ? -2.090 13.287 3.100   1.00 79.17 ? 476 PRO A O     1 
ATOM   1361 C  CB    . PRO A 1 172 ? -3.137 14.222 6.001   1.00 77.67 ? 476 PRO A CB    1 
ATOM   1362 C  CG    . PRO A 1 172 ? -2.870 15.693 6.330   1.00 77.11 ? 476 PRO A CG    1 
ATOM   1363 C  CD    . PRO A 1 172 ? -2.000 16.115 5.162   1.00 76.93 ? 476 PRO A CD    1 
ATOM   1364 N  N     . ASP A 1 173 ? -1.808 11.476 4.425   1.00 81.01 ? 477 ASP A N     1 
ATOM   1365 C  CA    . ASP A 1 173 ? -1.832 10.440 3.368   1.00 82.73 ? 477 ASP A CA    1 
ATOM   1366 C  C     . ASP A 1 173 ? -1.587 10.828 1.900   1.00 83.06 ? 477 ASP A C     1 
ATOM   1367 O  O     . ASP A 1 173 ? -2.309 11.615 1.289   1.00 83.73 ? 477 ASP A O     1 
ATOM   1368 C  CB    . ASP A 1 173 ? -3.095 9.541  3.485   1.00 83.23 ? 477 ASP A CB    1 
ATOM   1369 C  CG    . ASP A 1 173 ? -4.407 10.287 3.269   1.00 84.15 ? 477 ASP A CG    1 
ATOM   1370 O  OD1   . ASP A 1 173 ? -4.782 10.524 2.100   1.00 84.45 ? 477 ASP A OD1   1 
ATOM   1371 O  OD2   . ASP A 1 173 ? -5.071 10.622 4.275   1.00 84.73 ? 477 ASP A OD2   1 
ATOM   1372 N  N     . THR A 1 180 ? 2.220  20.520 -8.186  1.00 57.36 ? 484 THR A N     1 
ATOM   1373 C  CA    . THR A 1 180 ? 1.376  21.561 -8.769  1.00 56.48 ? 484 THR A CA    1 
ATOM   1374 C  C     . THR A 1 180 ? 0.967  22.631 -7.746  1.00 55.28 ? 484 THR A C     1 
ATOM   1375 O  O     . THR A 1 180 ? 1.098  23.834 -7.992  1.00 54.90 ? 484 THR A O     1 
ATOM   1376 C  CB    . THR A 1 180 ? 0.119  20.953 -9.399  1.00 56.85 ? 484 THR A CB    1 
ATOM   1377 O  OG1   . THR A 1 180 ? -0.784 22.015 -9.731  1.00 56.84 ? 484 THR A OG1   1 
ATOM   1378 C  CG2   . THR A 1 180 ? -0.543 19.930 -8.442  1.00 56.81 ? 484 THR A CG2   1 
ATOM   1379 N  N     . LEU A 1 181 ? 0.448  22.183 -6.611  1.00 52.86 ? 485 LEU A N     1 
ATOM   1380 C  CA    . LEU A 1 181 ? 0.091  23.094 -5.542  1.00 50.66 ? 485 LEU A CA    1 
ATOM   1381 C  C     . LEU A 1 181 ? 1.416  23.737 -5.103  1.00 48.81 ? 485 LEU A C     1 
ATOM   1382 O  O     . LEU A 1 181 ? 1.513  24.959 -4.967  1.00 47.94 ? 485 LEU A O     1 
ATOM   1383 C  CB    . LEU A 1 181 ? -0.527 22.315 -4.371  1.00 50.45 ? 485 LEU A CB    1 
ATOM   1384 C  CG    . LEU A 1 181 ? -0.668 23.084 -3.054  1.00 50.80 ? 485 LEU A CG    1 
ATOM   1385 C  CD1   . LEU A 1 181 ? -1.515 24.320 -3.302  1.00 49.63 ? 485 LEU A CD1   1 
ATOM   1386 C  CD2   . LEU A 1 181 ? -1.283 22.202 -1.968  1.00 51.31 ? 485 LEU A CD2   1 
ATOM   1387 N  N     . ASN A 1 182 ? 2.439  22.904 -4.912  1.00 46.43 ? 486 ASN A N     1 
ATOM   1388 C  CA    . ASN A 1 182 ? 3.748  23.384 -4.474  1.00 44.19 ? 486 ASN A CA    1 
ATOM   1389 C  C     . ASN A 1 182 ? 4.292  24.572 -5.272  1.00 42.79 ? 486 ASN A C     1 
ATOM   1390 O  O     . ASN A 1 182 ? 4.888  25.488 -4.698  1.00 40.90 ? 486 ASN A O     1 
ATOM   1391 C  CB    . ASN A 1 182 ? 4.756  22.228 -4.451  1.00 44.10 ? 486 ASN A CB    1 
ATOM   1392 C  CG    . ASN A 1 182 ? 4.424  21.192 -3.386  1.00 44.38 ? 486 ASN A CG    1 
ATOM   1393 O  OD1   . ASN A 1 182 ? 3.901  21.532 -2.324  1.00 45.64 ? 486 ASN A OD1   1 
ATOM   1394 N  ND2   . ASN A 1 182 ? 4.740  19.928 -3.656  1.00 44.11 ? 486 ASN A ND2   1 
ATOM   1395 N  N     . ALA A 1 183 ? 4.078  24.584 -6.582  1.00 42.00 ? 487 ALA A N     1 
ATOM   1396 C  CA    . ALA A 1 183 ? 4.551  25.708 -7.369  1.00 42.66 ? 487 ALA A CA    1 
ATOM   1397 C  C     . ALA A 1 183 ? 3.736  26.973 -7.070  1.00 42.84 ? 487 ALA A C     1 
ATOM   1398 O  O     . ALA A 1 183 ? 4.320  28.051 -6.959  1.00 43.83 ? 487 ALA A O     1 
ATOM   1399 C  CB    . ALA A 1 183 ? 4.505  25.381 -8.854  1.00 41.30 ? 487 ALA A CB    1 
ATOM   1400 N  N     . ARG A 1 184 ? 2.406  26.860 -6.936  1.00 43.14 ? 488 ARG A N     1 
ATOM   1401 C  CA    . ARG A 1 184 ? 1.582  28.045 -6.633  1.00 43.66 ? 488 ARG A CA    1 
ATOM   1402 C  C     . ARG A 1 184 ? 2.029  28.585 -5.273  1.00 41.24 ? 488 ARG A C     1 
ATOM   1403 O  O     . ARG A 1 184 ? 2.094  29.796 -5.077  1.00 40.46 ? 488 ARG A O     1 
ATOM   1404 C  CB    . ARG A 1 184 ? 0.060  27.736 -6.533  1.00 46.19 ? 488 ARG A CB    1 
ATOM   1405 C  CG    . ARG A 1 184 ? -0.724 27.300 -7.801  1.00 50.58 ? 488 ARG A CG    1 
ATOM   1406 C  CD    . ARG A 1 184 ? -2.226 26.933 -7.473  1.00 54.51 ? 488 ARG A CD    1 
ATOM   1407 N  NE    . ARG A 1 184 ? -2.371 25.837 -6.503  1.00 57.76 ? 488 ARG A NE    1 
ATOM   1408 C  CZ    . ARG A 1 184 ? -2.767 24.595 -6.794  1.00 59.26 ? 488 ARG A CZ    1 
ATOM   1409 N  NH1   . ARG A 1 184 ? -3.074 24.256 -8.038  1.00 60.77 ? 488 ARG A NH1   1 
ATOM   1410 N  NH2   . ARG A 1 184 ? -2.838 23.675 -5.839  1.00 60.95 ? 488 ARG A NH2   1 
ATOM   1411 N  N     . LEU A 1 185 ? 2.309  27.686 -4.330  1.00 40.49 ? 489 LEU A N     1 
ATOM   1412 C  CA    . LEU A 1 185 ? 2.747  28.108 -2.998  1.00 41.19 ? 489 LEU A CA    1 
ATOM   1413 C  C     . LEU A 1 185 ? 4.088  28.837 -3.113  1.00 41.85 ? 489 LEU A C     1 
ATOM   1414 O  O     . LEU A 1 185 ? 4.254  29.927 -2.561  1.00 41.87 ? 489 LEU A O     1 
ATOM   1415 C  CB    . LEU A 1 185 ? 2.893  26.911 -2.054  1.00 40.63 ? 489 LEU A CB    1 
ATOM   1416 C  CG    . LEU A 1 185 ? 1.657  26.149 -1.564  1.00 40.57 ? 489 LEU A CG    1 
ATOM   1417 C  CD1   . LEU A 1 185 ? 2.120  24.919 -0.807  1.00 40.01 ? 489 LEU A CD1   1 
ATOM   1418 C  CD2   . LEU A 1 185 ? 0.785  27.024 -0.668  1.00 42.08 ? 489 LEU A CD2   1 
ATOM   1419 N  N     . CYS A 1 186 ? 5.041  28.250 -3.834  1.00 40.79 ? 490 CYS A N     1 
ATOM   1420 C  CA    . CYS A 1 186 ? 6.332  28.905 -3.995  1.00 40.79 ? 490 CYS A CA    1 
ATOM   1421 C  C     . CYS A 1 186 ? 6.166  30.310 -4.563  1.00 41.94 ? 490 CYS A C     1 
ATOM   1422 O  O     . CYS A 1 186 ? 6.857  31.239 -4.141  1.00 41.25 ? 490 CYS A O     1 
ATOM   1423 C  CB    . CYS A 1 186 ? 7.254  28.086 -4.901  1.00 37.89 ? 490 CYS A CB    1 
ATOM   1424 S  SG    . CYS A 1 186 ? 7.976  26.658 -4.080  1.00 36.22 ? 490 CYS A SG    1 
ATOM   1425 N  N     . GLU A 1 187 ? 5.242  30.473 -5.507  1.00 43.11 ? 491 GLU A N     1 
ATOM   1426 C  CA    . GLU A 1 187 ? 5.025  31.781 -6.122  1.00 44.86 ? 491 GLU A CA    1 
ATOM   1427 C  C     . GLU A 1 187 ? 4.375  32.775 -5.176  1.00 44.45 ? 491 GLU A C     1 
ATOM   1428 O  O     . GLU A 1 187 ? 4.647  33.972 -5.240  1.00 46.35 ? 491 GLU A O     1 
ATOM   1429 C  CB    . GLU A 1 187 ? 4.199  31.632 -7.412  1.00 47.18 ? 491 GLU A CB    1 
ATOM   1430 C  CG    . GLU A 1 187 ? 5.014  30.999 -8.547  1.00 51.01 ? 491 GLU A CG    1 
ATOM   1431 C  CD    . GLU A 1 187 ? 4.225  30.659 -9.819  1.00 54.44 ? 491 GLU A CD    1 
ATOM   1432 O  OE1   . GLU A 1 187 ? 3.007  30.952 -9.910  1.00 55.42 ? 491 GLU A OE1   1 
ATOM   1433 O  OE2   . GLU A 1 187 ? 4.851  30.086 -10.743 1.00 54.54 ? 491 GLU A OE2   1 
ATOM   1434 N  N     . GLU A 1 188 ? 3.533  32.275 -4.283  1.00 44.44 ? 492 GLU A N     1 
ATOM   1435 C  CA    . GLU A 1 188 ? 2.851  33.136 -3.333  1.00 44.77 ? 492 GLU A CA    1 
ATOM   1436 C  C     . GLU A 1 188 ? 3.863  33.646 -2.319  1.00 42.24 ? 492 GLU A C     1 
ATOM   1437 O  O     . GLU A 1 188 ? 3.952  34.845 -2.056  1.00 41.79 ? 492 GLU A O     1 
ATOM   1438 C  CB    . GLU A 1 188 ? 1.751  32.344 -2.629  1.00 46.82 ? 492 GLU A CB    1 
ATOM   1439 C  CG    . GLU A 1 188 ? 0.646  33.192 -2.063  1.00 50.69 ? 492 GLU A CG    1 
ATOM   1440 C  CD    . GLU A 1 188 ? -0.358 32.362 -1.298  1.00 53.78 ? 492 GLU A CD    1 
ATOM   1441 O  OE1   . GLU A 1 188 ? -0.678 32.737 -0.151  1.00 55.35 ? 492 GLU A OE1   1 
ATOM   1442 O  OE2   . GLU A 1 188 ? -0.827 31.334 -1.837  1.00 55.61 ? 492 GLU A OE2   1 
ATOM   1443 N  N     . ILE A 1 189 ? 4.630  32.720 -1.757  1.00 40.97 ? 493 ILE A N     1 
ATOM   1444 C  CA    . ILE A 1 189 ? 5.638  33.075 -0.774  1.00 39.89 ? 493 ILE A CA    1 
ATOM   1445 C  C     . ILE A 1 189 ? 6.605  34.095 -1.350  1.00 39.19 ? 493 ILE A C     1 
ATOM   1446 O  O     . ILE A 1 189 ? 6.839  35.128 -0.735  1.00 38.77 ? 493 ILE A O     1 
ATOM   1447 C  CB    . ILE A 1 189 ? 6.396  31.834 -0.287  1.00 38.40 ? 493 ILE A CB    1 
ATOM   1448 C  CG1   . ILE A 1 189 ? 5.413  30.886 0.392   1.00 36.37 ? 493 ILE A CG1   1 
ATOM   1449 C  CG2   . ILE A 1 189 ? 7.469  32.235 0.716   1.00 39.17 ? 493 ILE A CG2   1 
ATOM   1450 C  CD1   . ILE A 1 189 ? 5.941  29.502 0.614   1.00 35.51 ? 493 ILE A CD1   1 
ATOM   1451 N  N     . ARG A 1 190 ? 7.143  33.837 -2.538  1.00 38.91 ? 494 ARG A N     1 
ATOM   1452 C  CA    . ARG A 1 190 ? 8.071  34.791 -3.127  1.00 38.77 ? 494 ARG A CA    1 
ATOM   1453 C  C     . ARG A 1 190 ? 7.431  36.159 -3.320  1.00 39.68 ? 494 ARG A C     1 
ATOM   1454 O  O     . ARG A 1 190 ? 8.060  37.183 -3.060  1.00 39.75 ? 494 ARG A O     1 
ATOM   1455 C  CB    . ARG A 1 190 ? 8.616  34.262 -4.458  1.00 37.30 ? 494 ARG A CB    1 
ATOM   1456 C  CG    . ARG A 1 190 ? 9.683  33.182 -4.275  1.00 36.08 ? 494 ARG A CG    1 
ATOM   1457 C  CD    . ARG A 1 190 ? 9.900  32.360 -5.536  1.00 34.62 ? 494 ARG A CD    1 
ATOM   1458 N  NE    . ARG A 1 190 ? 9.824  33.172 -6.749  1.00 35.11 ? 494 ARG A NE    1 
ATOM   1459 C  CZ    . ARG A 1 190 ? 10.715 34.090 -7.115  1.00 35.34 ? 494 ARG A CZ    1 
ATOM   1460 N  NH1   . ARG A 1 190 ? 11.783 34.330 -6.367  1.00 34.41 ? 494 ARG A NH1   1 
ATOM   1461 N  NH2   . ARG A 1 190 ? 10.521 34.787 -8.229  1.00 33.13 ? 494 ARG A NH2   1 
ATOM   1462 N  N     . GLN A 1 191 ? 6.175  36.185 -3.748  1.00 41.06 ? 495 GLN A N     1 
ATOM   1463 C  CA    . GLN A 1 191 ? 5.499  37.458 -3.973  1.00 42.61 ? 495 GLN A CA    1 
ATOM   1464 C  C     . GLN A 1 191 ? 5.209  38.244 -2.701  1.00 42.20 ? 495 GLN A C     1 
ATOM   1465 O  O     . GLN A 1 191 ? 5.497  39.439 -2.611  1.00 41.35 ? 495 GLN A O     1 
ATOM   1466 C  CB    . GLN A 1 191 ? 4.193  37.227 -4.720  1.00 46.55 ? 495 GLN A CB    1 
ATOM   1467 C  CG    . GLN A 1 191 ? 4.061  38.058 -5.982  1.00 51.30 ? 495 GLN A CG    1 
ATOM   1468 C  CD    . GLN A 1 191 ? 4.098  39.546 -5.714  1.00 55.15 ? 495 GLN A CD    1 
ATOM   1469 O  OE1   . GLN A 1 191 ? 3.318  40.055 -4.917  1.00 57.40 ? 495 GLN A OE1   1 
ATOM   1470 N  NE2   . GLN A 1 191 ? 5.001  40.254 -6.387  1.00 56.66 ? 495 GLN A NE2   1 
ATOM   1471 N  N     . GLU A 1 192 ? 4.623  37.573 -1.720  1.00 42.05 ? 496 GLU A N     1 
ATOM   1472 C  CA    . GLU A 1 192 ? 4.298  38.234 -0.475  1.00 42.99 ? 496 GLU A CA    1 
ATOM   1473 C  C     . GLU A 1 192 ? 5.566  38.686 0.232   1.00 41.59 ? 496 GLU A C     1 
ATOM   1474 O  O     . GLU A 1 192 ? 5.588  39.757 0.830   1.00 40.93 ? 496 GLU A O     1 
ATOM   1475 C  CB    . GLU A 1 192 ? 3.466  37.304 0.405   1.00 46.33 ? 496 GLU A CB    1 
ATOM   1476 C  CG    . GLU A 1 192 ? 2.126  36.918 -0.227  1.00 51.45 ? 496 GLU A CG    1 
ATOM   1477 C  CD    . GLU A 1 192 ? 1.005  37.912 0.060   1.00 54.88 ? 496 GLU A CD    1 
ATOM   1478 O  OE1   . GLU A 1 192 ? 1.216  38.866 0.845   1.00 56.95 ? 496 GLU A OE1   1 
ATOM   1479 O  OE2   . GLU A 1 192 ? -0.100 37.723 -0.496  1.00 58.22 ? 496 GLU A OE2   1 
ATOM   1480 N  N     . ILE A 1 193 ? 6.635  37.897 0.169   1.00 40.42 ? 497 ILE A N     1 
ATOM   1481 C  CA    . ILE A 1 193 ? 7.857  38.352 0.814   1.00 38.09 ? 497 ILE A CA    1 
ATOM   1482 C  C     . ILE A 1 193 ? 8.430  39.542 0.049   1.00 37.93 ? 497 ILE A C     1 
ATOM   1483 O  O     . ILE A 1 193 ? 8.907  40.494 0.656   1.00 36.08 ? 497 ILE A O     1 
ATOM   1484 C  CB    . ILE A 1 193 ? 8.890  37.229 0.958   1.00 37.18 ? 497 ILE A CB    1 
ATOM   1485 C  CG1   . ILE A 1 193 ? 8.460  36.317 2.109   1.00 36.16 ? 497 ILE A CG1   1 
ATOM   1486 C  CG2   . ILE A 1 193 ? 10.253 37.811 1.296   1.00 35.37 ? 497 ILE A CG2   1 
ATOM   1487 C  CD1   . ILE A 1 193 ? 9.141  34.980 2.132   1.00 38.58 ? 497 ILE A CD1   1 
ATOM   1488 N  N     . PHE A 1 194 ? 8.369  39.519 -1.277  1.00 39.06 ? 498 PHE A N     1 
ATOM   1489 C  CA    . PHE A 1 194 ? 8.870  40.667 -2.026  1.00 40.43 ? 498 PHE A CA    1 
ATOM   1490 C  C     . PHE A 1 194 ? 8.101  41.928 -1.567  1.00 42.48 ? 498 PHE A C     1 
ATOM   1491 O  O     . PHE A 1 194 ? 8.708  42.972 -1.362  1.00 41.66 ? 498 PHE A O     1 
ATOM   1492 C  CB    . PHE A 1 194 ? 8.705  40.421 -3.535  1.00 40.71 ? 498 PHE A CB    1 
ATOM   1493 C  CG    . PHE A 1 194 ? 9.153  41.571 -4.419  1.00 40.58 ? 498 PHE A CG    1 
ATOM   1494 C  CD1   . PHE A 1 194 ? 10.507 41.827 -4.656  1.00 38.96 ? 498 PHE A CD1   1 
ATOM   1495 C  CD2   . PHE A 1 194 ? 8.203  42.355 -5.072  1.00 40.27 ? 498 PHE A CD2   1 
ATOM   1496 C  CE1   . PHE A 1 194 ? 10.899 42.848 -5.541  1.00 39.43 ? 498 PHE A CE1   1 
ATOM   1497 C  CE2   . PHE A 1 194 ? 8.584  43.371 -5.951  1.00 40.70 ? 498 PHE A CE2   1 
ATOM   1498 C  CZ    . PHE A 1 194 ? 9.936  43.617 -6.187  1.00 39.85 ? 498 PHE A CZ    1 
ATOM   1499 N  N     . GLN A 1 195 ? 6.781  41.837 -1.372  1.00 44.41 ? 499 GLN A N     1 
ATOM   1500 C  CA    . GLN A 1 195 ? 6.006  43.012 -0.934  1.00 45.83 ? 499 GLN A CA    1 
ATOM   1501 C  C     . GLN A 1 195 ? 6.211  43.375 0.551   1.00 44.84 ? 499 GLN A C     1 
ATOM   1502 O  O     . GLN A 1 195 ? 6.386  44.546 0.889   1.00 44.00 ? 499 GLN A O     1 
ATOM   1503 C  CB    . GLN A 1 195 ? 4.490  42.808 -1.178  1.00 49.30 ? 499 GLN A CB    1 
ATOM   1504 C  CG    . GLN A 1 195 ? 4.000  42.718 -2.647  1.00 54.91 ? 499 GLN A CG    1 
ATOM   1505 C  CD    . GLN A 1 195 ? 2.514  42.307 -2.753  1.00 58.37 ? 499 GLN A CD    1 
ATOM   1506 O  OE1   . GLN A 1 195 ? 1.656  42.835 -2.043  1.00 60.15 ? 499 GLN A OE1   1 
ATOM   1507 N  NE2   . GLN A 1 195 ? 2.216  41.370 -3.644  1.00 58.95 ? 499 GLN A NE2   1 
ATOM   1508 N  N     . GLY A 1 196 ? 6.187  42.378 1.434   1.00 44.05 ? 500 GLY A N     1 
ATOM   1509 C  CA    . GLY A 1 196 ? 6.324  42.652 2.862   1.00 44.36 ? 500 GLY A CA    1 
ATOM   1510 C  C     . GLY A 1 196 ? 7.667  43.205 3.292   1.00 44.19 ? 500 GLY A C     1 
ATOM   1511 O  O     . GLY A 1 196 ? 7.848  43.754 4.380   1.00 43.69 ? 500 GLY A O     1 
ATOM   1512 N  N     . THR A 1 197 ? 8.587  43.094 2.353   1.00 44.40 ? 501 THR A N     1 
ATOM   1513 C  CA    . THR A 1 197 ? 9.981  43.449 2.481   1.00 44.53 ? 501 THR A CA    1 
ATOM   1514 C  C     . THR A 1 197 ? 10.390 44.688 1.672   1.00 45.50 ? 501 THR A C     1 
ATOM   1515 O  O     . THR A 1 197 ? 11.436 45.299 1.921   1.00 45.27 ? 501 THR A O     1 
ATOM   1516 C  CB    . THR A 1 197 ? 10.743 42.231 1.971   1.00 44.15 ? 501 THR A CB    1 
ATOM   1517 O  OG1   . THR A 1 197 ? 11.250 41.472 3.068   1.00 44.00 ? 501 THR A OG1   1 
ATOM   1518 C  CG2   . THR A 1 197 ? 11.789 42.625 1.030   1.00 43.03 ? 501 THR A CG2   1 
ATOM   1519 N  N     . ASN A 1 198 ? 9.547  45.041 0.709   1.00 46.34 ? 502 ASN A N     1 
ATOM   1520 C  CA    . ASN A 1 198 ? 9.791  46.129 -0.226  1.00 47.92 ? 502 ASN A CA    1 
ATOM   1521 C  C     . ASN A 1 198 ? 10.700 45.538 -1.288  1.00 47.75 ? 502 ASN A C     1 
ATOM   1522 O  O     . ASN A 1 198 ? 10.466 44.412 -1.697  1.00 49.40 ? 502 ASN A O     1 
ATOM   1523 C  CB    . ASN A 1 198 ? 10.357 47.362 0.464   1.00 50.20 ? 502 ASN A CB    1 
ATOM   1524 C  CG    . ASN A 1 198 ? 9.258  48.187 1.091   1.00 52.55 ? 502 ASN A CG    1 
ATOM   1525 O  OD1   . ASN A 1 198 ? 8.573  47.723 2.006   1.00 53.52 ? 502 ASN A OD1   1 
ATOM   1526 N  ND2   . ASN A 1 198 ? 9.044  49.396 0.572   1.00 52.07 ? 502 ASN A ND2   1 
ATOM   1527 N  N     . GLY A 1 199 ? 11.736 46.192 -1.759  1.00 46.27 ? 503 GLY A N     1 
ATOM   1528 C  CA    . GLY A 1 199 ? 12.460 45.493 -2.812  1.00 45.16 ? 503 GLY A CA    1 
ATOM   1529 C  C     . GLY A 1 199 ? 13.129 44.116 -2.656  1.00 42.66 ? 503 GLY A C     1 
ATOM   1530 O  O     . GLY A 1 199 ? 13.769 43.708 -3.615  1.00 44.65 ? 503 GLY A O     1 
ATOM   1531 N  N     . CYS A 1 200 ? 12.999 43.364 -1.559  1.00 40.32 ? 504 CYS A N     1 
ATOM   1532 C  CA    . CYS A 1 200 ? 13.767 42.102 -1.493  1.00 38.22 ? 504 CYS A CA    1 
ATOM   1533 C  C     . CYS A 1 200 ? 13.245 40.817 -2.083  1.00 37.40 ? 504 CYS A C     1 
ATOM   1534 O  O     . CYS A 1 200 ? 12.055 40.489 -2.050  1.00 37.28 ? 504 CYS A O     1 
ATOM   1535 C  CB    . CYS A 1 200 ? 14.224 41.745 -0.070  1.00 37.41 ? 504 CYS A CB    1 
ATOM   1536 S  SG    . CYS A 1 200 ? 14.877 43.070 0.936   1.00 38.88 ? 504 CYS A SG    1 
ATOM   1537 N  N     . THR A 1 201 ? 14.217 40.049 -2.541  1.00 35.26 ? 505 THR A N     1 
ATOM   1538 C  CA    . THR A 1 201 ? 13.975 38.794 -3.186  1.00 33.84 ? 505 THR A CA    1 
ATOM   1539 C  C     . THR A 1 201 ? 14.433 37.581 -2.403  1.00 32.21 ? 505 THR A C     1 
ATOM   1540 O  O     . THR A 1 201 ? 15.456 37.593 -1.728  1.00 31.86 ? 505 THR A O     1 
ATOM   1541 C  CB    . THR A 1 201 ? 14.618 38.837 -4.548  1.00 35.36 ? 505 THR A CB    1 
ATOM   1542 O  OG1   . THR A 1 201 ? 13.780 39.590 -5.428  1.00 36.69 ? 505 THR A OG1   1 
ATOM   1543 C  CG2   . THR A 1 201 ? 14.795 37.486 -5.082  1.00 36.87 ? 505 THR A CG2   1 
ATOM   1544 N  N     . VAL A 1 202 ? 13.672 36.511 -2.557  1.00 31.62 ? 506 VAL A N     1 
ATOM   1545 C  CA    . VAL A 1 202 ? 13.907 35.278 -1.831  1.00 32.37 ? 506 VAL A CA    1 
ATOM   1546 C  C     . VAL A 1 202 ? 13.793 34.085 -2.812  1.00 32.37 ? 506 VAL A C     1 
ATOM   1547 O  O     . VAL A 1 202 ? 12.980 34.128 -3.734  1.00 32.69 ? 506 VAL A O     1 
ATOM   1548 C  CB    . VAL A 1 202 ? 12.831 35.234 -0.704  1.00 33.73 ? 506 VAL A CB    1 
ATOM   1549 C  CG1   . VAL A 1 202 ? 11.609 34.444 -1.156  1.00 34.38 ? 506 VAL A CG1   1 
ATOM   1550 C  CG2   . VAL A 1 202 ? 13.414 34.740 0.579   1.00 34.39 ? 506 VAL A CG2   1 
ATOM   1551 N  N     . SER A 1 203 ? 14.628 33.055 -2.670  1.00 30.86 ? 507 SER A N     1 
ATOM   1552 C  CA    . SER A 1 203 ? 14.514 31.891 -3.556  1.00 28.69 ? 507 SER A CA    1 
ATOM   1553 C  C     . SER A 1 203 ? 14.045 30.727 -2.712  1.00 28.37 ? 507 SER A C     1 
ATOM   1554 O  O     . SER A 1 203 ? 14.177 30.751 -1.487  1.00 27.13 ? 507 SER A O     1 
ATOM   1555 C  CB    . SER A 1 203 ? 15.838 31.542 -4.243  1.00 29.37 ? 507 SER A CB    1 
ATOM   1556 O  OG    . SER A 1 203 ? 16.097 32.445 -5.303  1.00 31.12 ? 507 SER A OG    1 
ATOM   1557 N  N     . ILE A 1 204 ? 13.496 29.708 -3.364  1.00 28.00 ? 508 ILE A N     1 
ATOM   1558 C  CA    . ILE A 1 204 ? 12.957 28.559 -2.652  1.00 27.68 ? 508 ILE A CA    1 
ATOM   1559 C  C     . ILE A 1 204 ? 13.311 27.215 -3.268  1.00 28.38 ? 508 ILE A C     1 
ATOM   1560 O  O     . ILE A 1 204 ? 13.201 27.024 -4.476  1.00 28.54 ? 508 ILE A O     1 
ATOM   1561 C  CB    . ILE A 1 204 ? 11.410 28.639 -2.599  1.00 26.83 ? 508 ILE A CB    1 
ATOM   1562 C  CG1   . ILE A 1 204 ? 10.977 29.910 -1.862  1.00 27.06 ? 508 ILE A CG1   1 
ATOM   1563 C  CG2   . ILE A 1 204 ? 10.842 27.362 -1.984  1.00 23.63 ? 508 ILE A CG2   1 
ATOM   1564 C  CD1   . ILE A 1 204 ? 9.468  30.167 -1.901  1.00 27.56 ? 508 ILE A CD1   1 
ATOM   1565 N  N     . GLY A 1 205 ? 13.725 26.292 -2.409  1.00 29.28 ? 509 GLY A N     1 
ATOM   1566 C  CA    . GLY A 1 205 ? 14.048 24.943 -2.822  1.00 32.00 ? 509 GLY A CA    1 
ATOM   1567 C  C     . GLY A 1 205 ? 12.966 24.111 -2.160  1.00 34.43 ? 509 GLY A C     1 
ATOM   1568 O  O     . GLY A 1 205 ? 12.735 24.226 -0.959  1.00 34.53 ? 509 GLY A O     1 
ATOM   1569 N  N     . CYS A 1 206 ? 12.292 23.276 -2.933  1.00 35.37 ? 510 CYS A N     1 
ATOM   1570 C  CA    . CYS A 1 206 ? 11.212 22.483 -2.390  1.00 37.46 ? 510 CYS A CA    1 
ATOM   1571 C  C     . CYS A 1 206 ? 11.454 21.020 -2.692  1.00 37.32 ? 510 CYS A C     1 
ATOM   1572 O  O     . CYS A 1 206 ? 11.648 20.656 -3.840  1.00 37.43 ? 510 CYS A O     1 
ATOM   1573 C  CB    . CYS A 1 206 ? 9.906  22.966 -3.016  1.00 38.06 ? 510 CYS A CB    1 
ATOM   1574 S  SG    . CYS A 1 206 ? 8.503  21.902 -2.720  1.00 45.57 ? 510 CYS A SG    1 
ATOM   1575 N  N     . SER A 1 207 ? 11.438 20.178 -1.669  1.00 37.22 ? 511 SER A N     1 
ATOM   1576 C  CA    . SER A 1 207 ? 11.689 18.767 -1.893  1.00 38.40 ? 511 SER A CA    1 
ATOM   1577 C  C     . SER A 1 207 ? 11.202 17.908 -0.742  1.00 39.80 ? 511 SER A C     1 
ATOM   1578 O  O     . SER A 1 207 ? 10.627 18.415 0.218   1.00 40.20 ? 511 SER A O     1 
ATOM   1579 C  CB    . SER A 1 207 ? 13.190 18.555 -2.080  1.00 37.43 ? 511 SER A CB    1 
ATOM   1580 O  OG    . SER A 1 207 ? 13.493 17.194 -2.324  1.00 39.08 ? 511 SER A OG    1 
ATOM   1581 N  N     . ASP A 1 208 ? 11.433 16.601 -0.853  1.00 42.07 ? 512 ASP A N     1 
ATOM   1582 C  CA    . ASP A 1 208 ? 11.053 15.682 0.205   1.00 43.99 ? 512 ASP A CA    1 
ATOM   1583 C  C     . ASP A 1 208 ? 12.219 15.269 1.106   1.00 43.43 ? 512 ASP A C     1 
ATOM   1584 O  O     . ASP A 1 208 ? 12.093 14.331 1.888   1.00 45.03 ? 512 ASP A O     1 
ATOM   1585 C  CB    . ASP A 1 208 ? 10.295 14.444 -0.333  1.00 47.46 ? 512 ASP A CB    1 
ATOM   1586 C  CG    . ASP A 1 208 ? 11.061 13.662 -1.401  1.00 52.42 ? 512 ASP A CG    1 
ATOM   1587 O  OD1   . ASP A 1 208 ? 10.619 12.526 -1.701  1.00 54.78 ? 512 ASP A OD1   1 
ATOM   1588 O  OD2   . ASP A 1 208 ? 12.073 14.155 -1.952  1.00 53.18 ? 512 ASP A OD2   1 
ATOM   1589 N  N     . SER A 1 209 ? 13.363 15.939 0.971   1.00 42.13 ? 513 SER A N     1 
ATOM   1590 C  CA    . SER A 1 209 ? 14.503 15.719 1.875   1.00 39.82 ? 513 SER A CA    1 
ATOM   1591 C  C     . SER A 1 209 ? 15.074 17.074 2.136   1.00 37.95 ? 513 SER A C     1 
ATOM   1592 O  O     . SER A 1 209 ? 14.902 18.000 1.343   1.00 38.42 ? 513 SER A O     1 
ATOM   1593 C  CB    . SER A 1 209 ? 15.650 14.849 1.327   1.00 40.54 ? 513 SER A CB    1 
ATOM   1594 O  OG    . SER A 1 209 ? 15.668 14.720 -0.072  1.00 44.51 ? 513 SER A OG    1 
ATOM   1595 N  N     . LEU A 1 210 ? 15.752 17.198 3.258   1.00 36.12 ? 514 LEU A N     1 
ATOM   1596 C  CA    . LEU A 1 210 ? 16.374 18.453 3.568   1.00 34.37 ? 514 LEU A CA    1 
ATOM   1597 C  C     . LEU A 1 210 ? 17.512 18.686 2.578   1.00 33.57 ? 514 LEU A C     1 
ATOM   1598 O  O     . LEU A 1 210 ? 17.657 19.796 2.075   1.00 32.88 ? 514 LEU A O     1 
ATOM   1599 C  CB    . LEU A 1 210 ? 16.920 18.428 4.983   1.00 32.48 ? 514 LEU A CB    1 
ATOM   1600 C  CG    . LEU A 1 210 ? 15.899 18.344 6.111   1.00 32.20 ? 514 LEU A CG    1 
ATOM   1601 C  CD1   . LEU A 1 210 ? 16.660 18.049 7.381   1.00 31.78 ? 514 LEU A CD1   1 
ATOM   1602 C  CD2   . LEU A 1 210 ? 15.093 19.638 6.233   1.00 29.96 ? 514 LEU A CD2   1 
ATOM   1603 N  N     . VAL A 1 211 ? 18.302 17.650 2.272   1.00 32.89 ? 515 VAL A N     1 
ATOM   1604 C  CA    . VAL A 1 211 ? 19.427 17.852 1.352   1.00 33.49 ? 515 VAL A CA    1 
ATOM   1605 C  C     . VAL A 1 211 ? 19.014 18.343 -0.016  1.00 33.82 ? 515 VAL A C     1 
ATOM   1606 O  O     . VAL A 1 211 ? 19.601 19.287 -0.539  1.00 34.52 ? 515 VAL A O     1 
ATOM   1607 C  CB    . VAL A 1 211 ? 20.276 16.600 1.039   1.00 33.47 ? 515 VAL A CB    1 
ATOM   1608 C  CG1   . VAL A 1 211 ? 21.662 17.060 0.619   1.00 33.87 ? 515 VAL A CG1   1 
ATOM   1609 C  CG2   . VAL A 1 211 ? 20.349 15.665 2.196   1.00 35.12 ? 515 VAL A CG2   1 
ATOM   1610 N  N     . LEU A 1 212 ? 18.028 17.684 -0.616  1.00 33.96 ? 516 LEU A N     1 
ATOM   1611 C  CA    . LEU A 1 212 ? 17.593 18.084 -1.945  1.00 33.85 ? 516 LEU A CA    1 
ATOM   1612 C  C     . LEU A 1 212 ? 16.968 19.461 -1.968  1.00 32.68 ? 516 LEU A C     1 
ATOM   1613 O  O     . LEU A 1 212 ? 17.113 20.199 -2.949  1.00 32.48 ? 516 LEU A O     1 
ATOM   1614 C  CB    . LEU A 1 212 ? 16.628 17.061 -2.534  1.00 34.17 ? 516 LEU A CB    1 
ATOM   1615 C  CG    . LEU A 1 212 ? 17.278 15.762 -3.003  1.00 35.74 ? 516 LEU A CG    1 
ATOM   1616 C  CD1   . LEU A 1 212 ? 16.258 14.999 -3.825  1.00 35.96 ? 516 LEU A CD1   1 
ATOM   1617 C  CD2   . LEU A 1 212 ? 18.533 16.053 -3.848  1.00 36.37 ? 516 LEU A CD2   1 
ATOM   1618 N  N     . ALA A 1 213 ? 16.275 19.803 -0.888  1.00 32.27 ? 517 ALA A N     1 
ATOM   1619 C  CA    . ALA A 1 213 ? 15.651 21.113 -0.771  1.00 32.89 ? 517 ALA A CA    1 
ATOM   1620 C  C     . ALA A 1 213 ? 16.768 22.155 -0.806  1.00 32.45 ? 517 ALA A C     1 
ATOM   1621 O  O     . ALA A 1 213 ? 16.630 23.216 -1.416  1.00 32.81 ? 517 ALA A O     1 
ATOM   1622 C  CB    . ALA A 1 213 ? 14.875 21.213 0.549   1.00 33.20 ? 517 ALA A CB    1 
ATOM   1623 N  N     . ARG A 1 214 ? 17.888 21.845 -0.161  1.00 33.49 ? 518 ARG A N     1 
ATOM   1624 C  CA    . ARG A 1 214 ? 18.992 22.791 -0.137  1.00 34.84 ? 518 ARG A CA    1 
ATOM   1625 C  C     . ARG A 1 214 ? 19.672 22.883 -1.491  1.00 33.51 ? 518 ARG A C     1 
ATOM   1626 O  O     . ARG A 1 214 ? 20.103 23.961 -1.900  1.00 33.11 ? 518 ARG A O     1 
ATOM   1627 C  CB    . ARG A 1 214 ? 20.007 22.421 0.947   1.00 37.47 ? 518 ARG A CB    1 
ATOM   1628 C  CG    . ARG A 1 214 ? 20.594 23.649 1.630   1.00 42.42 ? 518 ARG A CG    1 
ATOM   1629 C  CD    . ARG A 1 214 ? 21.777 24.206 0.864   1.00 47.02 ? 518 ARG A CD    1 
ATOM   1630 N  NE    . ARG A 1 214 ? 22.000 25.629 1.121   1.00 50.26 ? 518 ARG A NE    1 
ATOM   1631 C  CZ    . ARG A 1 214 ? 22.258 26.526 0.173   1.00 52.90 ? 518 ARG A CZ    1 
ATOM   1632 N  NH1   . ARG A 1 214 ? 22.323 26.156 -1.101  1.00 53.43 ? 518 ARG A NH1   1 
ATOM   1633 N  NH2   . ARG A 1 214 ? 22.456 27.797 0.503   1.00 56.41 ? 518 ARG A NH2   1 
ATOM   1634 N  N     . LEU A 1 215 ? 19.771 21.761 -2.194  1.00 31.32 ? 519 LEU A N     1 
ATOM   1635 C  CA    . LEU A 1 215 ? 20.398 21.788 -3.502  1.00 30.59 ? 519 LEU A CA    1 
ATOM   1636 C  C     . LEU A 1 215 ? 19.459 22.465 -4.487  1.00 30.24 ? 519 LEU A C     1 
ATOM   1637 O  O     . LEU A 1 215 ? 19.892 23.209 -5.377  1.00 29.93 ? 519 LEU A O     1 
ATOM   1638 C  CB    . LEU A 1 215 ? 20.733 20.369 -3.959  1.00 30.65 ? 519 LEU A CB    1 
ATOM   1639 C  CG    . LEU A 1 215 ? 21.888 19.727 -3.178  1.00 32.11 ? 519 LEU A CG    1 
ATOM   1640 C  CD1   . LEU A 1 215 ? 22.013 18.259 -3.536  1.00 29.47 ? 519 LEU A CD1   1 
ATOM   1641 C  CD2   . LEU A 1 215 ? 23.189 20.474 -3.484  1.00 30.63 ? 519 LEU A CD2   1 
ATOM   1642 N  N     . ALA A 1 216 ? 18.165 22.225 -4.318  1.00 29.66 ? 520 ALA A N     1 
ATOM   1643 C  CA    . ALA A 1 216 ? 17.193 22.832 -5.208  1.00 29.54 ? 520 ALA A CA    1 
ATOM   1644 C  C     . ALA A 1 216 ? 17.235 24.335 -4.995  1.00 29.10 ? 520 ALA A C     1 
ATOM   1645 O  O     . ALA A 1 216 ? 17.066 25.109 -5.938  1.00 30.90 ? 520 ALA A O     1 
ATOM   1646 C  CB    . ALA A 1 216 ? 15.801 22.283 -4.923  1.00 29.17 ? 520 ALA A CB    1 
ATOM   1647 N  N     . LEU A 1 217 ? 17.471 24.749 -3.755  1.00 29.15 ? 521 LEU A N     1 
ATOM   1648 C  CA    . LEU A 1 217 ? 17.552 26.172 -3.454  1.00 30.18 ? 521 LEU A CA    1 
ATOM   1649 C  C     . LEU A 1 217 ? 18.686 26.813 -4.272  1.00 30.22 ? 521 LEU A C     1 
ATOM   1650 O  O     . LEU A 1 217 ? 18.483 27.837 -4.918  1.00 29.46 ? 521 LEU A O     1 
ATOM   1651 C  CB    . LEU A 1 217 ? 17.810 26.387 -1.962  1.00 30.27 ? 521 LEU A CB    1 
ATOM   1652 C  CG    . LEU A 1 217 ? 18.033 27.848 -1.581  1.00 32.52 ? 521 LEU A CG    1 
ATOM   1653 C  CD1   . LEU A 1 217 ? 16.760 28.640 -1.825  1.00 30.95 ? 521 LEU A CD1   1 
ATOM   1654 C  CD2   . LEU A 1 217 ? 18.447 27.930 -0.122  1.00 33.35 ? 521 LEU A CD2   1 
ATOM   1655 N  N     . LYS A 1 218 ? 19.870 26.198 -4.235  1.00 30.82 ? 522 LYS A N     1 
ATOM   1656 C  CA    . LYS A 1 218 ? 21.054 26.688 -4.956  1.00 32.89 ? 522 LYS A CA    1 
ATOM   1657 C  C     . LYS A 1 218 ? 20.721 26.808 -6.447  1.00 33.01 ? 522 LYS A C     1 
ATOM   1658 O  O     . LYS A 1 218 ? 20.988 27.834 -7.077  1.00 31.08 ? 522 LYS A O     1 
ATOM   1659 C  CB    . LYS A 1 218 ? 22.226 25.710 -4.722  1.00 33.47 ? 522 LYS A CB    1 
ATOM   1660 C  CG    . LYS A 1 218 ? 23.673 26.103 -5.167  1.00 36.04 ? 522 LYS A CG    1 
ATOM   1661 C  CD    . LYS A 1 218 ? 23.933 27.560 -5.546  1.00 36.36 ? 522 LYS A CD    1 
ATOM   1662 C  CE    . LYS A 1 218 ? 25.342 27.732 -6.144  1.00 36.82 ? 522 LYS A CE    1 
ATOM   1663 N  NZ    . LYS A 1 218 ? 25.434 27.387 -7.602  1.00 39.06 ? 522 LYS A NZ    1 
ATOM   1664 N  N     . MET A 1 219 ? 20.109 25.767 -7.001  1.00 33.48 ? 523 MET A N     1 
ATOM   1665 C  CA    . MET A 1 219 ? 19.748 25.773 -8.411  1.00 34.98 ? 523 MET A CA    1 
ATOM   1666 C  C     . MET A 1 219 ? 18.684 26.821 -8.766  1.00 35.40 ? 523 MET A C     1 
ATOM   1667 O  O     . MET A 1 219 ? 18.634 27.308 -9.893  1.00 34.34 ? 523 MET A O     1 
ATOM   1668 C  CB    . MET A 1 219 ? 19.275 24.380 -8.817  1.00 36.76 ? 523 MET A CB    1 
ATOM   1669 C  CG    . MET A 1 219 ? 18.647 24.335 -10.180 1.00 40.36 ? 523 MET A CG    1 
ATOM   1670 S  SD    . MET A 1 219 ? 18.872 22.720 -10.908 1.00 45.11 ? 523 MET A SD    1 
ATOM   1671 C  CE    . MET A 1 219 ? 17.472 22.022 -10.436 1.00 43.29 ? 523 MET A CE    1 
ATOM   1672 N  N     . ALA A 1 220 ? 17.841 27.172 -7.804  1.00 35.44 ? 524 ALA A N     1 
ATOM   1673 C  CA    . ALA A 1 220 ? 16.801 28.159 -8.050  1.00 37.55 ? 524 ALA A CA    1 
ATOM   1674 C  C     . ALA A 1 220 ? 17.307 29.576 -7.868  1.00 38.74 ? 524 ALA A C     1 
ATOM   1675 O  O     . ALA A 1 220 ? 16.805 30.505 -8.496  1.00 38.22 ? 524 ALA A O     1 
ATOM   1676 C  CB    . ALA A 1 220 ? 15.655 27.949 -7.075  1.00 36.39 ? 524 ALA A CB    1 
ATOM   1677 N  N     . LYS A 1 221 ? 18.310 29.695 -7.000  1.00 41.16 ? 525 LYS A N     1 
ATOM   1678 C  CA    . LYS A 1 221 ? 18.861 30.958 -6.468  1.00 43.69 ? 525 LYS A CA    1 
ATOM   1679 C  C     . LYS A 1 221 ? 18.603 32.337 -7.077  1.00 45.84 ? 525 LYS A C     1 
ATOM   1680 O  O     . LYS A 1 221 ? 18.063 33.188 -6.388  1.00 50.04 ? 525 LYS A O     1 
ATOM   1681 C  CB    . LYS A 1 221 ? 20.346 30.788 -6.106  1.00 44.16 ? 525 LYS A CB    1 
ATOM   1682 C  CG    . LYS A 1 221 ? 20.662 31.461 -4.743  1.00 44.52 ? 525 LYS A CG    1 
ATOM   1683 C  CD    . LYS A 1 221 ? 19.943 30.815 -3.560  1.00 44.05 ? 525 LYS A CD    1 
ATOM   1684 C  CE    . LYS A 1 221 ? 20.174 31.603 -2.279  1.00 42.62 ? 525 LYS A CE    1 
ATOM   1685 N  NZ    . LYS A 1 221 ? 18.921 31.783 -1.513  1.00 45.02 ? 525 LYS A NZ    1 
ATOM   1686 N  N     . PRO A 1 222 ? 19.070 32.639 -8.307  1.00 43.69 ? 526 PRO A N     1 
ATOM   1687 C  CA    . PRO A 1 222 ? 18.729 33.969 -8.795  1.00 42.03 ? 526 PRO A CA    1 
ATOM   1688 C  C     . PRO A 1 222 ? 17.228 34.213 -8.847  1.00 40.00 ? 526 PRO A C     1 
ATOM   1689 O  O     . PRO A 1 222 ? 16.576 33.997 -9.879  1.00 40.18 ? 526 PRO A O     1 
ATOM   1690 C  CB    . PRO A 1 222 ? 19.311 33.974 -10.193 1.00 43.12 ? 526 PRO A CB    1 
ATOM   1691 C  CG    . PRO A 1 222 ? 20.633 33.354 -9.923  1.00 43.71 ? 526 PRO A CG    1 
ATOM   1692 C  CD    . PRO A 1 222 ? 20.489 32.513 -8.641  1.00 44.88 ? 526 PRO A CD    1 
ATOM   1693 N  N     . ASN A 1 223 ? 16.672 34.625 -7.721  1.00 36.98 ? 527 ASN A N     1 
ATOM   1694 C  CA    . ASN A 1 223 ? 15.263 34.974 -7.617  1.00 34.71 ? 527 ASN A CA    1 
ATOM   1695 C  C     . ASN A 1 223 ? 14.286 34.001 -8.277  1.00 33.81 ? 527 ASN A C     1 
ATOM   1696 O  O     . ASN A 1 223 ? 13.618 34.345 -9.253  1.00 32.78 ? 527 ASN A O     1 
ATOM   1697 C  CB    . ASN A 1 223 ? 15.114 36.383 -8.192  1.00 34.81 ? 527 ASN A CB    1 
ATOM   1698 C  CG    . ASN A 1 223 ? 13.670 36.856 -8.284  1.00 37.58 ? 527 ASN A CG    1 
ATOM   1699 O  OD1   . ASN A 1 223 ? 12.807 36.455 -7.502  1.00 38.17 ? 527 ASN A OD1   1 
ATOM   1700 N  ND2   . ASN A 1 223 ? 13.408 37.738 -9.247  1.00 34.93 ? 527 ASN A ND2   1 
ATOM   1701 N  N     . GLY A 1 224 ? 14.187 32.791 -7.739  1.00 32.12 ? 528 GLY A N     1 
ATOM   1702 C  CA    . GLY A 1 224 ? 13.274 31.821 -8.315  1.00 31.02 ? 528 GLY A CA    1 
ATOM   1703 C  C     . GLY A 1 224 ? 13.035 30.643 -7.392  1.00 30.30 ? 528 GLY A C     1 
ATOM   1704 O  O     . GLY A 1 224 ? 13.340 30.716 -6.206  1.00 29.52 ? 528 GLY A O     1 
ATOM   1705 N  N     . TYR A 1 225 ? 12.471 29.562 -7.918  1.00 29.28 ? 529 TYR A N     1 
ATOM   1706 C  CA    . TYR A 1 225 ? 12.235 28.385 -7.100  1.00 29.61 ? 529 TYR A CA    1 
ATOM   1707 C  C     . TYR A 1 225 ? 12.475 27.150 -7.942  1.00 29.09 ? 529 TYR A C     1 
ATOM   1708 O  O     . TYR A 1 225 ? 12.464 27.218 -9.155  1.00 28.26 ? 529 TYR A O     1 
ATOM   1709 C  CB    . TYR A 1 225 ? 10.809 28.397 -6.537  1.00 32.22 ? 529 TYR A CB    1 
ATOM   1710 C  CG    . TYR A 1 225 ? 9.714  28.318 -7.574  1.00 33.05 ? 529 TYR A CG    1 
ATOM   1711 C  CD1   . TYR A 1 225 ? 9.139  27.093 -7.909  1.00 34.20 ? 529 TYR A CD1   1 
ATOM   1712 C  CD2   . TYR A 1 225 ? 9.243  29.466 -8.205  1.00 33.02 ? 529 TYR A CD2   1 
ATOM   1713 C  CE1   . TYR A 1 225 ? 8.117  27.010 -8.844  1.00 35.15 ? 529 TYR A CE1   1 
ATOM   1714 C  CE2   . TYR A 1 225 ? 8.219  29.399 -9.147  1.00 34.58 ? 529 TYR A CE2   1 
ATOM   1715 C  CZ    . TYR A 1 225 ? 7.662  28.162 -9.458  1.00 35.77 ? 529 TYR A CZ    1 
ATOM   1716 O  OH    . TYR A 1 225 ? 6.652  28.053 -10.381 1.00 38.15 ? 529 TYR A OH    1 
ATOM   1717 N  N     . ASN A 1 226 ? 12.721 26.026 -7.294  1.00 29.83 ? 530 ASN A N     1 
ATOM   1718 C  CA    . ASN A 1 226 ? 12.970 24.790 -8.009  1.00 32.59 ? 530 ASN A CA    1 
ATOM   1719 C  C     . ASN A 1 226 ? 12.368 23.656 -7.217  1.00 35.14 ? 530 ASN A C     1 
ATOM   1720 O  O     . ASN A 1 226 ? 12.558 23.594 -6.006  1.00 35.27 ? 530 ASN A O     1 
ATOM   1721 C  CB    . ASN A 1 226 ? 14.463 24.528 -8.146  1.00 31.88 ? 530 ASN A CB    1 
ATOM   1722 C  CG    . ASN A 1 226 ? 14.742 23.158 -8.712  1.00 32.25 ? 530 ASN A CG    1 
ATOM   1723 O  OD1   . ASN A 1 226 ? 14.828 22.173 -7.980  1.00 31.40 ? 530 ASN A OD1   1 
ATOM   1724 N  ND2   . ASN A 1 226 ? 14.845 23.082 -10.029 1.00 31.44 ? 530 ASN A ND2   1 
ATOM   1725 N  N     . ILE A 1 227 ? 11.670 22.735 -7.869  1.00 37.77 ? 531 ILE A N     1 
ATOM   1726 C  CA    . ILE A 1 227 ? 11.097 21.673 -7.075  1.00 39.91 ? 531 ILE A CA    1 
ATOM   1727 C  C     . ILE A 1 227 ? 11.922 20.384 -6.917  1.00 42.57 ? 531 ILE A C     1 
ATOM   1728 O  O     . ILE A 1 227 ? 12.420 20.163 -5.833  1.00 45.06 ? 531 ILE A O     1 
ATOM   1729 C  CB    . ILE A 1 227 ? 9.621  21.481 -7.447  1.00 40.24 ? 531 ILE A CB    1 
ATOM   1730 C  CG1   . ILE A 1 227 ? 8.862  22.717 -6.921  1.00 39.72 ? 531 ILE A CG1   1 
ATOM   1731 C  CG2   . ILE A 1 227 ? 9.056  20.245 -6.775  1.00 38.95 ? 531 ILE A CG2   1 
ATOM   1732 C  CD1   . ILE A 1 227 ? 7.392  22.817 -7.284  1.00 39.50 ? 531 ILE A CD1   1 
ATOM   1733 N  N     . THR A 1 228 ? 12.096 19.501 -7.880  1.00 43.67 ? 532 THR A N     1 
ATOM   1734 C  CA    . THR A 1 228 ? 13.012 18.372 -7.569  1.00 46.10 ? 532 THR A CA    1 
ATOM   1735 C  C     . THR A 1 228 ? 12.890 17.448 -6.312  1.00 47.70 ? 532 THR A C     1 
ATOM   1736 O  O     . THR A 1 228 ? 13.478 17.736 -5.257  1.00 47.96 ? 532 THR A O     1 
ATOM   1737 C  CB    . THR A 1 228 ? 14.461 18.892 -7.516  1.00 45.53 ? 532 THR A CB    1 
ATOM   1738 O  OG1   . THR A 1 228 ? 14.667 19.860 -8.549  1.00 46.96 ? 532 THR A OG1   1 
ATOM   1739 C  CG2   . THR A 1 228 ? 15.434 17.754 -7.704  1.00 44.65 ? 532 THR A CG2   1 
ATOM   1740 N  N     . PHE A 1 229 ? 12.194 16.317 -6.465  1.00 49.50 ? 533 PHE A N     1 
ATOM   1741 C  CA    . PHE A 1 229 ? 12.019 15.304 -5.407  1.00 51.94 ? 533 PHE A CA    1 
ATOM   1742 C  C     . PHE A 1 229 ? 13.009 14.148 -5.624  1.00 52.55 ? 533 PHE A C     1 
ATOM   1743 O  O     . PHE A 1 229 ? 13.626 14.068 -6.683  1.00 52.76 ? 533 PHE A O     1 
ATOM   1744 C  CB    . PHE A 1 229 ? 10.607 14.721 -5.444  1.00 52.96 ? 533 PHE A CB    1 
ATOM   1745 C  CG    . PHE A 1 229 ? 9.579  15.568 -4.774  1.00 54.28 ? 533 PHE A CG    1 
ATOM   1746 C  CD1   . PHE A 1 229 ? 9.112  16.730 -5.373  1.00 55.50 ? 533 PHE A CD1   1 
ATOM   1747 C  CD2   . PHE A 1 229 ? 9.075  15.200 -3.535  1.00 56.21 ? 533 PHE A CD2   1 
ATOM   1748 C  CE1   . PHE A 1 229 ? 8.154  17.515 -4.745  1.00 56.47 ? 533 PHE A CE1   1 
ATOM   1749 C  CE2   . PHE A 1 229 ? 8.119  15.977 -2.899  1.00 57.09 ? 533 PHE A CE2   1 
ATOM   1750 C  CZ    . PHE A 1 229 ? 7.658  17.139 -3.508  1.00 56.16 ? 533 PHE A CZ    1 
ATOM   1751 N  N     . LYS A 1 230 ? 13.142 13.248 -4.643  1.00 54.17 ? 534 LYS A N     1 
ATOM   1752 C  CA    . LYS A 1 230 ? 14.068 12.113 -4.763  1.00 55.96 ? 534 LYS A CA    1 
ATOM   1753 C  C     . LYS A 1 230 ? 13.881 11.418 -6.113  1.00 56.35 ? 534 LYS A C     1 
ATOM   1754 O  O     . LYS A 1 230 ? 14.839 10.948 -6.721  1.00 57.06 ? 534 LYS A O     1 
ATOM   1755 C  CB    . LYS A 1 230 ? 13.886 11.104 -3.593  1.00 57.32 ? 534 LYS A CB    1 
ATOM   1756 C  CG    . LYS A 1 230 ? 14.761 11.389 -2.330  1.00 60.65 ? 534 LYS A CG    1 
ATOM   1757 C  CD    . LYS A 1 230 ? 14.434 10.487 -1.109  1.00 62.77 ? 534 LYS A CD    1 
ATOM   1758 C  CE    . LYS A 1 230 ? 13.069 10.814 -0.494  1.00 63.96 ? 534 LYS A CE    1 
ATOM   1759 N  NZ    . LYS A 1 230 ? 12.304 9.604  -0.054  1.00 65.08 ? 534 LYS A NZ    1 
ATOM   1760 N  N     . SER A 1 231 ? 12.651 11.388 -6.607  1.00 56.93 ? 535 SER A N     1 
ATOM   1761 C  CA    . SER A 1 231 ? 12.393 10.742 -7.883  1.00 57.27 ? 535 SER A CA    1 
ATOM   1762 C  C     . SER A 1 231 ? 12.642 11.619 -9.119  1.00 56.49 ? 535 SER A C     1 
ATOM   1763 O  O     . SER A 1 231 ? 12.431 11.168 -10.241 1.00 56.59 ? 535 SER A O     1 
ATOM   1764 C  CB    . SER A 1 231 ? 10.964 10.197 -7.902  1.00 57.79 ? 535 SER A CB    1 
ATOM   1765 O  OG    . SER A 1 231 ? 10.040 11.221 -7.591  1.00 58.13 ? 535 SER A OG    1 
ATOM   1766 N  N     . ASN A 1 232 ? 13.086 12.860 -8.926  1.00 55.12 ? 536 ASN A N     1 
ATOM   1767 C  CA    . ASN A 1 232 ? 13.359 13.746 -10.063 1.00 53.42 ? 536 ASN A CA    1 
ATOM   1768 C  C     . ASN A 1 232 ? 14.855 13.832 -10.338 1.00 52.56 ? 536 ASN A C     1 
ATOM   1769 O  O     . ASN A 1 232 ? 15.290 14.580 -11.216 1.00 52.07 ? 536 ASN A O     1 
ATOM   1770 C  CB    . ASN A 1 232 ? 12.845 15.175 -9.811  1.00 54.16 ? 536 ASN A CB    1 
ATOM   1771 C  CG    . ASN A 1 232 ? 11.332 15.262 -9.739  1.00 55.06 ? 536 ASN A CG    1 
ATOM   1772 O  OD1   . ASN A 1 232 ? 10.621 14.661 -10.550 1.00 56.12 ? 536 ASN A OD1   1 
ATOM   1773 N  ND2   . ASN A 1 232 ? 10.831 16.032 -8.776  1.00 53.29 ? 536 ASN A ND2   1 
ATOM   1774 N  N     . LEU A 1 233 ? 15.646 13.074 -9.589  1.00 50.77 ? 537 LEU A N     1 
ATOM   1775 C  CA    . LEU A 1 233 ? 17.086 13.116 -9.765  1.00 50.83 ? 537 LEU A CA    1 
ATOM   1776 C  C     . LEU A 1 233 ? 17.538 12.630 -11.127 1.00 51.10 ? 537 LEU A C     1 
ATOM   1777 O  O     . LEU A 1 233 ? 17.063 11.615 -11.633 1.00 52.02 ? 537 LEU A O     1 
ATOM   1778 C  CB    . LEU A 1 233 ? 17.772 12.327 -8.653  1.00 49.46 ? 537 LEU A CB    1 
ATOM   1779 C  CG    . LEU A 1 233 ? 17.478 12.988 -7.305  1.00 50.15 ? 537 LEU A CG    1 
ATOM   1780 C  CD1   . LEU A 1 233 ? 17.977 12.109 -6.185  1.00 49.20 ? 537 LEU A CD1   1 
ATOM   1781 C  CD2   . LEU A 1 233 ? 18.123 14.371 -7.248  1.00 49.91 ? 537 LEU A CD2   1 
ATOM   1782 N  N     . SER A 1 234 ? 18.455 13.384 -11.718 1.00 50.51 ? 538 SER A N     1 
ATOM   1783 C  CA    . SER A 1 234 ? 18.994 13.069 -13.029 1.00 49.87 ? 538 SER A CA    1 
ATOM   1784 C  C     . SER A 1 234 ? 20.449 13.486 -13.078 1.00 50.11 ? 538 SER A C     1 
ATOM   1785 O  O     . SER A 1 234 ? 20.958 14.131 -12.159 1.00 51.06 ? 538 SER A O     1 
ATOM   1786 C  CB    . SER A 1 234 ? 18.239 13.835 -14.109 1.00 49.71 ? 538 SER A CB    1 
ATOM   1787 O  OG    . SER A 1 234 ? 18.481 15.226 -13.989 1.00 48.00 ? 538 SER A OG    1 
ATOM   1788 N  N     . GLU A 1 235 ? 21.113 13.121 -14.166 1.00 49.08 ? 539 GLU A N     1 
ATOM   1789 C  CA    . GLU A 1 235 ? 22.506 13.468 -14.342 1.00 48.68 ? 539 GLU A CA    1 
ATOM   1790 C  C     . GLU A 1 235 ? 22.628 14.952 -14.652 1.00 46.59 ? 539 GLU A C     1 
ATOM   1791 O  O     . GLU A 1 235 ? 23.617 15.587 -14.294 1.00 45.51 ? 539 GLU A O     1 
ATOM   1792 C  CB    . GLU A 1 235 ? 23.130 12.649 -15.475 1.00 51.25 ? 539 GLU A CB    1 
ATOM   1793 C  CG    . GLU A 1 235 ? 23.732 11.324 -15.035 1.00 55.31 ? 539 GLU A CG    1 
ATOM   1794 C  CD    . GLU A 1 235 ? 24.625 10.702 -16.104 1.00 58.82 ? 539 GLU A CD    1 
ATOM   1795 O  OE1   . GLU A 1 235 ? 24.762 11.294 -17.199 1.00 61.38 ? 539 GLU A OE1   1 
ATOM   1796 O  OE2   . GLU A 1 235 ? 25.197 9.620  -15.848 1.00 60.85 ? 539 GLU A OE2   1 
ATOM   1797 N  N     . GLU A 1 236 ? 21.632 15.513 -15.324 1.00 44.56 ? 540 GLU A N     1 
ATOM   1798 C  CA    . GLU A 1 236 ? 21.706 16.927 -15.631 1.00 43.30 ? 540 GLU A CA    1 
ATOM   1799 C  C     . GLU A 1 236 ? 21.639 17.697 -14.319 1.00 42.25 ? 540 GLU A C     1 
ATOM   1800 O  O     . GLU A 1 236 ? 22.261 18.743 -14.172 1.00 42.59 ? 540 GLU A O     1 
ATOM   1801 C  CB    . GLU A 1 236 ? 20.573 17.337 -16.558 1.00 42.95 ? 540 GLU A CB    1 
ATOM   1802 N  N     . PHE A 1 237 ? 20.900 17.168 -13.354 1.00 39.51 ? 541 PHE A N     1 
ATOM   1803 C  CA    . PHE A 1 237 ? 20.782 17.840 -12.073 1.00 37.40 ? 541 PHE A CA    1 
ATOM   1804 C  C     . PHE A 1 237 ? 22.071 17.815 -11.266 1.00 37.07 ? 541 PHE A C     1 
ATOM   1805 O  O     . PHE A 1 237 ? 22.382 18.755 -10.549 1.00 36.89 ? 541 PHE A O     1 
ATOM   1806 C  CB    . PHE A 1 237 ? 19.676 17.189 -11.245 1.00 35.35 ? 541 PHE A CB    1 
ATOM   1807 C  CG    . PHE A 1 237 ? 19.551 17.729 -9.849  1.00 34.12 ? 541 PHE A CG    1 
ATOM   1808 C  CD1   . PHE A 1 237 ? 18.756 18.838 -9.589  1.00 32.86 ? 541 PHE A CD1   1 
ATOM   1809 C  CD2   . PHE A 1 237 ? 20.188 17.096 -8.783  1.00 33.42 ? 541 PHE A CD2   1 
ATOM   1810 C  CE1   . PHE A 1 237 ? 18.584 19.307 -8.286  1.00 33.55 ? 541 PHE A CE1   1 
ATOM   1811 C  CE2   . PHE A 1 237 ? 20.023 17.559 -7.473  1.00 33.25 ? 541 PHE A CE2   1 
ATOM   1812 C  CZ    . PHE A 1 237 ? 19.216 18.669 -7.227  1.00 32.39 ? 541 PHE A CZ    1 
ATOM   1813 N  N     . TRP A 1 238 ? 22.821 16.731 -11.386 1.00 36.69 ? 542 TRP A N     1 
ATOM   1814 C  CA    . TRP A 1 238 ? 24.044 16.542 -10.609 1.00 36.84 ? 542 TRP A CA    1 
ATOM   1815 C  C     . TRP A 1 238 ? 25.217 17.340 -11.105 1.00 36.93 ? 542 TRP A C     1 
ATOM   1816 O  O     . TRP A 1 238 ? 26.004 17.936 -10.355 1.00 37.43 ? 542 TRP A O     1 
ATOM   1817 C  CB    . TRP A 1 238 ? 24.372 15.058 -10.624 1.00 37.11 ? 542 TRP A CB    1 
ATOM   1818 C  CG    . TRP A 1 238 ? 23.562 14.370 -9.606  1.00 39.77 ? 542 TRP A CG    1 
ATOM   1819 C  CD1   . TRP A 1 238 ? 22.773 13.258 -9.748  1.00 38.93 ? 542 TRP A CD1   1 
ATOM   1820 C  CD2   . TRP A 1 238 ? 23.441 14.776 -8.248  1.00 39.14 ? 542 TRP A CD2   1 
ATOM   1821 N  NE1   . TRP A 1 238 ? 22.165 12.955 -8.544  1.00 38.05 ? 542 TRP A NE1   1 
ATOM   1822 C  CE2   . TRP A 1 238 ? 22.561 13.876 -7.614  1.00 39.31 ? 542 TRP A CE2   1 
ATOM   1823 C  CE3   . TRP A 1 238 ? 23.993 15.825 -7.514  1.00 39.57 ? 542 TRP A CE3   1 
ATOM   1824 C  CZ2   . TRP A 1 238 ? 22.228 13.997 -6.261  1.00 40.17 ? 542 TRP A CZ2   1 
ATOM   1825 C  CZ3   . TRP A 1 238 ? 23.666 15.946 -6.179  1.00 40.15 ? 542 TRP A CZ3   1 
ATOM   1826 C  CH2   . TRP A 1 238 ? 22.792 15.043 -5.564  1.00 39.22 ? 542 TRP A CH2   1 
ATOM   1827 N  N     . SER A 1 239 ? 25.287 17.306 -12.417 1.00 35.62 ? 543 SER A N     1 
ATOM   1828 C  CA    . SER A 1 239 ? 26.275 17.965 -13.202 1.00 35.69 ? 543 SER A CA    1 
ATOM   1829 C  C     . SER A 1 239 ? 26.259 19.445 -12.961 1.00 34.40 ? 543 SER A C     1 
ATOM   1830 O  O     . SER A 1 239 ? 27.237 20.112 -13.253 1.00 33.82 ? 543 SER A O     1 
ATOM   1831 C  CB    . SER A 1 239 ? 25.997 17.695 -14.674 1.00 34.45 ? 543 SER A CB    1 
ATOM   1832 O  OG    . SER A 1 239 ? 26.375 16.377 -15.007 1.00 34.46 ? 543 SER A OG    1 
ATOM   1833 N  N     . SER A 1 240 ? 25.167 19.975 -12.429 1.00 34.50 ? 544 SER A N     1 
ATOM   1834 C  CA    . SER A 1 240 ? 25.124 21.415 -12.235 1.00 33.87 ? 544 SER A CA    1 
ATOM   1835 C  C     . SER A 1 240 ? 25.735 21.901 -10.917 1.00 32.88 ? 544 SER A C     1 
ATOM   1836 O  O     . SER A 1 240 ? 25.851 23.106 -10.694 1.00 32.16 ? 544 SER A O     1 
ATOM   1837 C  CB    . SER A 1 240 ? 23.686 21.906 -12.334 1.00 33.23 ? 544 SER A CB    1 
ATOM   1838 O  OG    . SER A 1 240 ? 23.020 21.670 -11.109 1.00 40.09 ? 544 SER A OG    1 
ATOM   1839 N  N     . PHE A 1 241 ? 26.156 20.976 -10.061 1.00 33.10 ? 545 PHE A N     1 
ATOM   1840 C  CA    . PHE A 1 241 ? 26.708 21.340 -8.750  1.00 32.49 ? 545 PHE A CA    1 
ATOM   1841 C  C     . PHE A 1 241 ? 28.194 21.101 -8.494  1.00 33.28 ? 545 PHE A C     1 
ATOM   1842 O  O     . PHE A 1 241 ? 28.723 20.059 -8.880  1.00 33.91 ? 545 PHE A O     1 
ATOM   1843 C  CB    . PHE A 1 241 ? 25.950 20.594 -7.653  1.00 31.25 ? 545 PHE A CB    1 
ATOM   1844 C  CG    . PHE A 1 241 ? 24.487 20.893 -7.610  1.00 30.09 ? 545 PHE A CG    1 
ATOM   1845 C  CD1   . PHE A 1 241 ? 23.563 20.000 -8.140  1.00 29.76 ? 545 PHE A CD1   1 
ATOM   1846 C  CD2   . PHE A 1 241 ? 24.030 22.064 -7.020  1.00 29.18 ? 545 PHE A CD2   1 
ATOM   1847 C  CE1   . PHE A 1 241 ? 22.194 20.267 -8.079  1.00 28.59 ? 545 PHE A CE1   1 
ATOM   1848 C  CE2   . PHE A 1 241 ? 22.672 22.345 -6.954  1.00 29.30 ? 545 PHE A CE2   1 
ATOM   1849 C  CZ    . PHE A 1 241 ? 21.747 21.439 -7.486  1.00 30.27 ? 545 PHE A CZ    1 
ATOM   1850 N  N     . LYS A 1 242 ? 28.847 22.055 -7.817  1.00 33.81 ? 546 LYS A N     1 
ATOM   1851 C  CA    . LYS A 1 242 ? 30.265 21.930 -7.427  1.00 34.64 ? 546 LYS A CA    1 
ATOM   1852 C  C     . LYS A 1 242 ? 30.223 20.962 -6.209  1.00 34.83 ? 546 LYS A C     1 
ATOM   1853 O  O     . LYS A 1 242 ? 29.162 20.783 -5.598  1.00 33.57 ? 546 LYS A O     1 
ATOM   1854 C  CB    . LYS A 1 242 ? 30.871 23.289 -6.967  1.00 36.12 ? 546 LYS A CB    1 
ATOM   1855 C  CG    . LYS A 1 242 ? 30.753 24.563 -7.899  1.00 41.86 ? 546 LYS A CG    1 
ATOM   1856 C  CD    . LYS A 1 242 ? 31.957 24.862 -8.865  1.00 47.05 ? 546 LYS A CD    1 
ATOM   1857 C  CE    . LYS A 1 242 ? 31.800 26.239 -9.627  1.00 52.21 ? 546 LYS A CE    1 
ATOM   1858 N  NZ    . LYS A 1 242 ? 32.203 26.337 -11.110 1.00 55.48 ? 546 LYS A NZ    1 
ATOM   1859 N  N     . LEU A 1 243 ? 31.346 20.343 -5.846  1.00 34.87 ? 547 LEU A N     1 
ATOM   1860 C  CA    . LEU A 1 243 ? 31.340 19.429 -4.697  1.00 36.54 ? 547 LEU A CA    1 
ATOM   1861 C  C     . LEU A 1 243 ? 30.955 20.110 -3.400  1.00 37.32 ? 547 LEU A C     1 
ATOM   1862 O  O     . LEU A 1 243 ? 30.243 19.526 -2.575  1.00 38.12 ? 547 LEU A O     1 
ATOM   1863 C  CB    . LEU A 1 243 ? 32.700 18.775 -4.488  1.00 36.66 ? 547 LEU A CB    1 
ATOM   1864 C  CG    . LEU A 1 243 ? 33.274 18.045 -5.694  1.00 37.61 ? 547 LEU A CG    1 
ATOM   1865 C  CD1   . LEU A 1 243 ? 34.452 17.214 -5.255  1.00 38.05 ? 547 LEU A CD1   1 
ATOM   1866 C  CD2   . LEU A 1 243 ? 32.221 17.166 -6.322  1.00 37.20 ? 547 LEU A CD2   1 
ATOM   1867 N  N     . ASP A 1 244 ? 31.427 21.337 -3.195  1.00 37.05 ? 548 ASP A N     1 
ATOM   1868 C  CA    . ASP A 1 244 ? 31.081 22.012 -1.954  1.00 36.75 ? 548 ASP A CA    1 
ATOM   1869 C  C     . ASP A 1 244 ? 29.693 22.637 -1.936  1.00 35.88 ? 548 ASP A C     1 
ATOM   1870 O  O     . ASP A 1 244 ? 29.392 23.458 -1.079  1.00 36.28 ? 548 ASP A O     1 
ATOM   1871 C  CB    . ASP A 1 244 ? 32.167 23.022 -1.523  1.00 37.26 ? 548 ASP A CB    1 
ATOM   1872 C  CG    . ASP A 1 244 ? 32.496 24.063 -2.588  1.00 39.33 ? 548 ASP A CG    1 
ATOM   1873 O  OD1   . ASP A 1 244 ? 32.323 23.787 -3.793  1.00 40.65 ? 548 ASP A OD1   1 
ATOM   1874 O  OD2   . ASP A 1 244 ? 32.970 25.158 -2.210  1.00 38.86 ? 548 ASP A OD2   1 
ATOM   1875 N  N     . ASP A 1 245 ? 28.844 22.251 -2.882  1.00 35.13 ? 549 ASP A N     1 
ATOM   1876 C  CA    . ASP A 1 245 ? 27.479 22.738 -2.844  1.00 35.81 ? 549 ASP A CA    1 
ATOM   1877 C  C     . ASP A 1 245 ? 26.743 21.776 -1.891  1.00 36.54 ? 549 ASP A C     1 
ATOM   1878 O  O     . ASP A 1 245 ? 25.616 22.036 -1.507  1.00 36.51 ? 549 ASP A O     1 
ATOM   1879 C  CB    . ASP A 1 245 ? 26.799 22.728 -4.225  1.00 35.78 ? 549 ASP A CB    1 
ATOM   1880 C  CG    . ASP A 1 245 ? 27.213 23.909 -5.102  1.00 37.60 ? 549 ASP A CG    1 
ATOM   1881 O  OD1   . ASP A 1 245 ? 27.398 25.020 -4.562  1.00 38.32 ? 549 ASP A OD1   1 
ATOM   1882 O  OD2   . ASP A 1 245 ? 27.337 23.737 -6.338  1.00 38.54 ? 549 ASP A OD2   1 
ATOM   1883 N  N     . LEU A 1 246 ? 27.371 20.664 -1.500  1.00 37.02 ? 550 LEU A N     1 
ATOM   1884 C  CA    . LEU A 1 246 ? 26.721 19.737 -0.568  1.00 37.62 ? 550 LEU A CA    1 
ATOM   1885 C  C     . LEU A 1 246 ? 26.695 20.306 0.840   1.00 38.42 ? 550 LEU A C     1 
ATOM   1886 O  O     . LEU A 1 246 ? 27.595 21.038 1.224   1.00 39.26 ? 550 LEU A O     1 
ATOM   1887 C  CB    . LEU A 1 246 ? 27.430 18.379 -0.556  1.00 36.43 ? 550 LEU A CB    1 
ATOM   1888 C  CG    . LEU A 1 246 ? 27.045 17.392 -1.661  1.00 35.46 ? 550 LEU A CG    1 
ATOM   1889 C  CD1   . LEU A 1 246 ? 27.734 16.058 -1.457  1.00 34.19 ? 550 LEU A CD1   1 
ATOM   1890 C  CD2   . LEU A 1 246 ? 25.522 17.212 -1.646  1.00 34.41 ? 550 LEU A CD2   1 
ATOM   1891 N  N     . PRO A 1 247 ? 25.608 20.084 1.607   1.00 39.42 ? 551 PRO A N     1 
ATOM   1892 C  CA    . PRO A 1 247 ? 25.683 20.646 2.960   1.00 38.69 ? 551 PRO A CA    1 
ATOM   1893 C  C     . PRO A 1 247 ? 26.779 19.876 3.678   1.00 37.84 ? 551 PRO A C     1 
ATOM   1894 O  O     . PRO A 1 247 ? 26.931 18.665 3.478   1.00 38.20 ? 551 PRO A O     1 
ATOM   1895 C  CB    . PRO A 1 247 ? 24.353 20.266 3.599   1.00 39.13 ? 551 PRO A CB    1 
ATOM   1896 C  CG    . PRO A 1 247 ? 23.414 20.210 2.418   1.00 41.02 ? 551 PRO A CG    1 
ATOM   1897 C  CD    . PRO A 1 247 ? 24.235 20.311 1.151   1.00 40.12 ? 551 PRO A CD    1 
ATOM   1898 N  N     . GLY A 1 248 ? 27.577 20.533 4.497   1.00 36.93 ? 552 GLY A N     1 
ATOM   1899 C  CA    . GLY A 1 248 ? 28.596 19.769 5.195   1.00 34.67 ? 552 GLY A CA    1 
ATOM   1900 C  C     . GLY A 1 248 ? 29.916 19.632 4.470   1.00 34.13 ? 552 GLY A C     1 
ATOM   1901 O  O     . GLY A 1 248 ? 30.849 19.081 5.041   1.00 33.22 ? 552 GLY A O     1 
ATOM   1902 N  N     . VAL A 1 249 ? 30.013 20.115 3.237   1.00 34.57 ? 553 VAL A N     1 
ATOM   1903 C  CA    . VAL A 1 249 ? 31.275 20.051 2.525   1.00 34.55 ? 553 VAL A CA    1 
ATOM   1904 C  C     . VAL A 1 249 ? 31.817 21.459 2.303   1.00 34.58 ? 553 VAL A C     1 
ATOM   1905 O  O     . VAL A 1 249 ? 31.181 22.283 1.648   1.00 34.42 ? 553 VAL A O     1 
ATOM   1906 C  CB    . VAL A 1 249 ? 31.117 19.314 1.174   1.00 34.73 ? 553 VAL A CB    1 
ATOM   1907 C  CG1   . VAL A 1 249 ? 32.476 19.203 0.477   1.00 33.14 ? 553 VAL A CG1   1 
ATOM   1908 C  CG2   . VAL A 1 249 ? 30.525 17.927 1.405   1.00 33.39 ? 553 VAL A CG2   1 
ATOM   1909 N  N     . GLY A 1 250 ? 32.982 21.728 2.887   1.00 35.47 ? 554 GLY A N     1 
ATOM   1910 C  CA    . GLY A 1 250 ? 33.607 23.036 2.772   1.00 35.72 ? 554 GLY A CA    1 
ATOM   1911 C  C     . GLY A 1 250 ? 34.965 22.932 2.087   1.00 36.35 ? 554 GLY A C     1 
ATOM   1912 O  O     . GLY A 1 250 ? 35.202 21.970 1.369   1.00 36.66 ? 554 GLY A O     1 
ATOM   1913 N  N     . HIS A 1 251 ? 35.864 23.890 2.316   1.00 37.40 ? 555 HIS A N     1 
ATOM   1914 C  CA    . HIS A 1 251 ? 37.167 23.863 1.672   1.00 37.84 ? 555 HIS A CA    1 
ATOM   1915 C  C     . HIS A 1 251 ? 37.982 22.582 1.899   1.00 36.05 ? 555 HIS A C     1 
ATOM   1916 O  O     . HIS A 1 251 ? 38.408 21.971 0.927   1.00 35.05 ? 555 HIS A O     1 
ATOM   1917 C  CB    . HIS A 1 251 ? 38.021 25.094 2.026   1.00 41.96 ? 555 HIS A CB    1 
ATOM   1918 C  CG    . HIS A 1 251 ? 38.442 25.139 3.467   1.00 49.59 ? 555 HIS A CG    1 
ATOM   1919 N  ND1   . HIS A 1 251 ? 37.606 25.600 4.463   1.00 52.90 ? 555 HIS A ND1   1 
ATOM   1920 C  CD2   . HIS A 1 251 ? 39.549 24.677 4.089   1.00 51.79 ? 555 HIS A CD2   1 
ATOM   1921 C  CE1   . HIS A 1 251 ? 38.182 25.417 5.642   1.00 54.26 ? 555 HIS A CE1   1 
ATOM   1922 N  NE2   . HIS A 1 251 ? 39.365 24.858 5.444   1.00 54.48 ? 555 HIS A NE2   1 
ATOM   1923 N  N     . SER A 1 252 ? 38.199 22.154 3.146   1.00 34.83 ? 556 SER A N     1 
ATOM   1924 C  CA    . SER A 1 252 ? 39.011 20.938 3.368   1.00 34.86 ? 556 SER A CA    1 
ATOM   1925 C  C     . SER A 1 252 ? 38.404 19.670 2.812   1.00 33.18 ? 556 SER A C     1 
ATOM   1926 O  O     . SER A 1 252 ? 39.108 18.893 2.174   1.00 33.94 ? 556 SER A O     1 
ATOM   1927 C  CB    . SER A 1 252 ? 39.309 20.679 4.843   1.00 35.49 ? 556 SER A CB    1 
ATOM   1928 O  OG    . SER A 1 252 ? 38.843 21.734 5.654   1.00 42.70 ? 556 SER A OG    1 
ATOM   1929 N  N     . THR A 1 253 ? 37.118 19.437 3.066   1.00 31.25 ? 557 THR A N     1 
ATOM   1930 C  CA    . THR A 1 253 ? 36.494 18.233 2.540   1.00 31.41 ? 557 THR A CA    1 
ATOM   1931 C  C     . THR A 1 253 ? 36.639 18.236 1.013   1.00 32.15 ? 557 THR A C     1 
ATOM   1932 O  O     . THR A 1 253 ? 36.943 17.196 0.427   1.00 30.96 ? 557 THR A O     1 
ATOM   1933 C  CB    . THR A 1 253 ? 35.002 18.140 2.919   1.00 30.97 ? 557 THR A CB    1 
ATOM   1934 O  OG1   . THR A 1 253 ? 34.875 18.190 4.341   1.00 32.14 ? 557 THR A OG1   1 
ATOM   1935 C  CG2   . THR A 1 253 ? 34.405 16.831 2.433   1.00 28.79 ? 557 THR A CG2   1 
ATOM   1936 N  N     . LEU A 1 254 ? 36.447 19.402 0.383   1.00 32.00 ? 558 LEU A N     1 
ATOM   1937 C  CA    . LEU A 1 254 ? 36.563 19.525 -1.076  1.00 33.40 ? 558 LEU A CA    1 
ATOM   1938 C  C     . LEU A 1 254 ? 37.960 19.099 -1.499  1.00 34.75 ? 558 LEU A C     1 
ATOM   1939 O  O     . LEU A 1 254 ? 38.143 18.292 -2.415  1.00 34.73 ? 558 LEU A O     1 
ATOM   1940 C  CB    . LEU A 1 254 ? 36.344 20.977 -1.535  1.00 34.09 ? 558 LEU A CB    1 
ATOM   1941 C  CG    . LEU A 1 254 ? 35.785 21.228 -2.953  1.00 35.86 ? 558 LEU A CG    1 
ATOM   1942 C  CD1   . LEU A 1 254 ? 35.847 22.699 -3.316  1.00 35.96 ? 558 LEU A CD1   1 
ATOM   1943 C  CD2   . LEU A 1 254 ? 36.568 20.456 -3.964  1.00 35.70 ? 558 LEU A CD2   1 
ATOM   1944 N  N     . SER A 1 255 ? 38.950 19.660 -0.831  1.00 33.65 ? 559 SER A N     1 
ATOM   1945 C  CA    . SER A 1 255 ? 40.311 19.338 -1.153  1.00 35.59 ? 559 SER A CA    1 
ATOM   1946 C  C     . SER A 1 255 ? 40.590 17.835 -0.956  1.00 36.14 ? 559 SER A C     1 
ATOM   1947 O  O     . SER A 1 255 ? 41.282 17.222 -1.777  1.00 35.95 ? 559 SER A O     1 
ATOM   1948 C  CB    . SER A 1 255 ? 41.225 20.235 -0.318  1.00 37.16 ? 559 SER A CB    1 
ATOM   1949 O  OG    . SER A 1 255 ? 42.533 19.724 -0.223  1.00 39.87 ? 559 SER A OG    1 
ATOM   1950 N  N     . ARG A 1 256 ? 40.038 17.225 0.094   1.00 35.41 ? 560 ARG A N     1 
ATOM   1951 C  CA    . ARG A 1 256 ? 40.263 15.793 0.302   1.00 36.08 ? 560 ARG A CA    1 
ATOM   1952 C  C     . ARG A 1 256 ? 39.544 14.989 -0.788  1.00 35.40 ? 560 ARG A C     1 
ATOM   1953 O  O     . ARG A 1 256 ? 40.111 14.048 -1.330  1.00 36.52 ? 560 ARG A O     1 
ATOM   1954 C  CB    . ARG A 1 256 ? 39.781 15.339 1.690   1.00 36.65 ? 560 ARG A CB    1 
ATOM   1955 C  CG    . ARG A 1 256 ? 40.432 16.055 2.877   1.00 41.13 ? 560 ARG A CG    1 
ATOM   1956 C  CD    . ARG A 1 256 ? 39.801 15.642 4.212   1.00 45.18 ? 560 ARG A CD    1 
ATOM   1957 N  NE    . ARG A 1 256 ? 40.809 15.220 5.185   1.00 52.02 ? 560 ARG A NE    1 
ATOM   1958 C  CZ    . ARG A 1 256 ? 41.293 15.979 6.170   1.00 56.30 ? 560 ARG A CZ    1 
ATOM   1959 N  NH1   . ARG A 1 256 ? 40.864 17.227 6.342   1.00 58.06 ? 560 ARG A NH1   1 
ATOM   1960 N  NH2   . ARG A 1 256 ? 42.223 15.487 6.985   1.00 57.68 ? 560 ARG A NH2   1 
ATOM   1961 N  N     . LEU A 1 257 ? 38.306 15.355 -1.116  1.00 34.25 ? 561 LEU A N     1 
ATOM   1962 C  CA    . LEU A 1 257 ? 37.575 14.639 -2.163  1.00 34.28 ? 561 LEU A CA    1 
ATOM   1963 C  C     . LEU A 1 257 ? 38.350 14.704 -3.466  1.00 35.15 ? 561 LEU A C     1 
ATOM   1964 O  O     . LEU A 1 257 ? 38.437 13.730 -4.200  1.00 34.78 ? 561 LEU A O     1 
ATOM   1965 C  CB    . LEU A 1 257 ? 36.184 15.241 -2.391  1.00 31.89 ? 561 LEU A CB    1 
ATOM   1966 C  CG    . LEU A 1 257 ? 35.197 15.017 -1.253  1.00 30.90 ? 561 LEU A CG    1 
ATOM   1967 C  CD1   . LEU A 1 257 ? 33.861 15.690 -1.529  1.00 31.02 ? 561 LEU A CD1   1 
ATOM   1968 C  CD2   . LEU A 1 257 ? 35.025 13.527 -1.080  1.00 28.91 ? 561 LEU A CD2   1 
ATOM   1969 N  N     . GLU A 1 258 ? 38.920 15.864 -3.752  1.00 37.05 ? 562 GLU A N     1 
ATOM   1970 C  CA    . GLU A 1 258 ? 39.661 16.011 -4.984  1.00 39.74 ? 562 GLU A CA    1 
ATOM   1971 C  C     . GLU A 1 258 ? 40.911 15.157 -5.003  1.00 41.06 ? 562 GLU A C     1 
ATOM   1972 O  O     . GLU A 1 258 ? 41.225 14.537 -6.016  1.00 41.58 ? 562 GLU A O     1 
ATOM   1973 C  CB    . GLU A 1 258 ? 40.023 17.475 -5.223  1.00 39.83 ? 562 GLU A CB    1 
ATOM   1974 C  CG    . GLU A 1 258 ? 38.849 18.321 -5.700  1.00 41.59 ? 562 GLU A CG    1 
ATOM   1975 C  CD    . GLU A 1 258 ? 39.212 19.786 -5.817  1.00 42.56 ? 562 GLU A CD    1 
ATOM   1976 O  OE1   . GLU A 1 258 ? 40.220 20.195 -5.198  1.00 43.85 ? 562 GLU A OE1   1 
ATOM   1977 O  OE2   . GLU A 1 258 ? 38.491 20.533 -6.508  1.00 42.97 ? 562 GLU A OE2   1 
ATOM   1978 N  N     . SER A 1 259 ? 41.622 15.102 -3.888  1.00 41.93 ? 563 SER A N     1 
ATOM   1979 C  CA    . SER A 1 259 ? 42.837 14.312 -3.846  1.00 43.05 ? 563 SER A CA    1 
ATOM   1980 C  C     . SER A 1 259 ? 42.538 12.806 -3.962  1.00 42.46 ? 563 SER A C     1 
ATOM   1981 O  O     . SER A 1 259 ? 43.301 12.059 -4.575  1.00 42.37 ? 563 SER A O     1 
ATOM   1982 C  CB    . SER A 1 259 ? 43.605 14.653 -2.564  1.00 44.21 ? 563 SER A CB    1 
ATOM   1983 O  OG    . SER A 1 259 ? 44.675 13.760 -2.330  1.00 48.99 ? 563 SER A OG    1 
ATOM   1984 N  N     . THR A 1 260 ? 41.403 12.371 -3.425  1.00 41.38 ? 564 THR A N     1 
ATOM   1985 C  CA    . THR A 1 260 ? 41.031 10.958 -3.471  1.00 40.22 ? 564 THR A CA    1 
ATOM   1986 C  C     . THR A 1 260 ? 40.421 10.465 -4.790  1.00 41.87 ? 564 THR A C     1 
ATOM   1987 O  O     . THR A 1 260 ? 40.737 9.369  -5.243  1.00 43.37 ? 564 THR A O     1 
ATOM   1988 C  CB    . THR A 1 260 ? 40.038 10.610 -2.327  1.00 37.86 ? 564 THR A CB    1 
ATOM   1989 O  OG1   . THR A 1 260 ? 40.653 10.888 -1.065  1.00 36.30 ? 564 THR A OG1   1 
ATOM   1990 C  CG2   . THR A 1 260 ? 39.646 9.145  -2.374  1.00 35.72 ? 564 THR A CG2   1 
ATOM   1991 N  N     . PHE A 1 261 ? 39.562 11.264 -5.417  1.00 42.91 ? 565 PHE A N     1 
ATOM   1992 C  CA    . PHE A 1 261 ? 38.896 10.819 -6.644  1.00 43.55 ? 565 PHE A CA    1 
ATOM   1993 C  C     . PHE A 1 261 ? 39.245 11.545 -7.963  1.00 44.31 ? 565 PHE A C     1 
ATOM   1994 O  O     . PHE A 1 261 ? 38.363 11.797 -8.784  1.00 44.43 ? 565 PHE A O     1 
ATOM   1995 C  CB    . PHE A 1 261 ? 37.375 10.858 -6.424  1.00 43.72 ? 565 PHE A CB    1 
ATOM   1996 C  CG    . PHE A 1 261 ? 36.925 10.204 -5.132  1.00 43.91 ? 565 PHE A CG    1 
ATOM   1997 C  CD1   . PHE A 1 261 ? 36.469 10.978 -4.059  1.00 44.34 ? 565 PHE A CD1   1 
ATOM   1998 C  CD2   . PHE A 1 261 ? 36.952 8.818  -4.987  1.00 44.10 ? 565 PHE A CD2   1 
ATOM   1999 C  CE1   . PHE A 1 261 ? 36.042 10.381 -2.862  1.00 44.31 ? 565 PHE A CE1   1 
ATOM   2000 C  CE2   . PHE A 1 261 ? 36.528 8.210  -3.792  1.00 45.56 ? 565 PHE A CE2   1 
ATOM   2001 C  CZ    . PHE A 1 261 ? 36.073 8.994  -2.731  1.00 44.70 ? 565 PHE A CZ    1 
ATOM   2002 N  N     . ASP A 1 262 ? 40.526 11.846 -8.177  1.00 44.73 ? 566 ASP A N     1 
ATOM   2003 C  CA    . ASP A 1 262 ? 41.014 12.538 -9.384  1.00 46.59 ? 566 ASP A CA    1 
ATOM   2004 C  C     . ASP A 1 262 ? 40.228 13.785 -9.766  1.00 45.53 ? 566 ASP A C     1 
ATOM   2005 O  O     . ASP A 1 262 ? 39.658 13.872 -10.856 1.00 46.77 ? 566 ASP A O     1 
ATOM   2006 C  CB    . ASP A 1 262 ? 41.061 11.607 -10.601 1.00 48.91 ? 566 ASP A CB    1 
ATOM   2007 C  CG    . ASP A 1 262 ? 41.884 12.198 -11.746 1.00 52.41 ? 566 ASP A CG    1 
ATOM   2008 O  OD1   . ASP A 1 262 ? 42.954 12.779 -11.448 1.00 54.37 ? 566 ASP A OD1   1 
ATOM   2009 O  OD2   . ASP A 1 262 ? 41.473 12.086 -12.923 1.00 53.46 ? 566 ASP A OD2   1 
ATOM   2010 N  N     . SER A 1 263 ? 40.219 14.745 -8.856  1.00 43.80 ? 567 SER A N     1 
ATOM   2011 C  CA    . SER A 1 263 ? 39.553 16.004 -9.072  1.00 41.74 ? 567 SER A CA    1 
ATOM   2012 C  C     . SER A 1 263 ? 38.234 15.947 -9.837  1.00 39.68 ? 567 SER A C     1 
ATOM   2013 O  O     . SER A 1 263 ? 38.173 16.319 -11.009 1.00 39.21 ? 567 SER A O     1 
ATOM   2014 C  CB    . SER A 1 263 ? 40.486 16.970 -9.802  1.00 41.71 ? 567 SER A CB    1 
ATOM   2015 O  OG    . SER A 1 263 ? 41.543 17.388 -8.958  1.00 43.28 ? 567 SER A OG    1 
ATOM   2016 N  N     . PRO A 1 264 ? 37.167 15.437 -9.206  1.00 38.78 ? 568 PRO A N     1 
ATOM   2017 C  CA    . PRO A 1 264 ? 35.897 15.411 -9.937  1.00 38.61 ? 568 PRO A CA    1 
ATOM   2018 C  C     . PRO A 1 264 ? 35.418 16.866 -9.895  1.00 37.83 ? 568 PRO A C     1 
ATOM   2019 O  O     . PRO A 1 264 ? 35.587 17.532 -8.881  1.00 38.39 ? 568 PRO A O     1 
ATOM   2020 C  CB    . PRO A 1 264 ? 35.031 14.448 -9.114  1.00 37.36 ? 568 PRO A CB    1 
ATOM   2021 C  CG    . PRO A 1 264 ? 35.610 14.508 -7.746  1.00 38.36 ? 568 PRO A CG    1 
ATOM   2022 C  CD    . PRO A 1 264 ? 37.094 14.679 -7.947  1.00 39.16 ? 568 PRO A CD    1 
ATOM   2023 N  N     . HIS A 1 265 ? 34.859 17.368 -10.994 1.00 37.67 ? 569 HIS A N     1 
ATOM   2024 C  CA    . HIS A 1 265 ? 34.418 18.765 -11.036 1.00 37.33 ? 569 HIS A CA    1 
ATOM   2025 C  C     . HIS A 1 265 ? 32.955 19.047 -10.709 1.00 35.25 ? 569 HIS A C     1 
ATOM   2026 O  O     . HIS A 1 265 ? 32.584 20.189 -10.465 1.00 35.84 ? 569 HIS A O     1 
ATOM   2027 C  CB    . HIS A 1 265 ? 34.768 19.366 -12.394 1.00 38.73 ? 569 HIS A CB    1 
ATOM   2028 C  CG    . HIS A 1 265 ? 36.223 19.266 -12.717 1.00 40.36 ? 569 HIS A CG    1 
ATOM   2029 N  ND1   . HIS A 1 265 ? 37.193 19.851 -11.932 1.00 41.63 ? 569 HIS A ND1   1 
ATOM   2030 C  CD2   . HIS A 1 265 ? 36.881 18.569 -13.674 1.00 41.23 ? 569 HIS A CD2   1 
ATOM   2031 C  CE1   . HIS A 1 265 ? 38.387 19.513 -12.386 1.00 41.64 ? 569 HIS A CE1   1 
ATOM   2032 N  NE2   . HIS A 1 265 ? 38.226 18.735 -13.442 1.00 40.81 ? 569 HIS A NE2   1 
ATOM   2033 N  N     . SER A 1 266 ? 32.120 18.021 -10.705 1.00 33.55 ? 570 SER A N     1 
ATOM   2034 C  CA    . SER A 1 266 ? 30.715 18.230 -10.390 1.00 31.84 ? 570 SER A CA    1 
ATOM   2035 C  C     . SER A 1 266 ? 30.268 17.072 -9.531  1.00 31.74 ? 570 SER A C     1 
ATOM   2036 O  O     . SER A 1 266 ? 30.960 16.067 -9.442  1.00 31.94 ? 570 SER A O     1 
ATOM   2037 C  CB    . SER A 1 266 ? 29.882 18.253 -11.662 1.00 31.02 ? 570 SER A CB    1 
ATOM   2038 O  OG    . SER A 1 266 ? 29.740 16.940 -12.172 1.00 31.72 ? 570 SER A OG    1 
ATOM   2039 N  N     . LEU A 1 267 ? 29.113 17.201 -8.896  1.00 32.05 ? 571 LEU A N     1 
ATOM   2040 C  CA    . LEU A 1 267 ? 28.627 16.118 -8.063  1.00 32.37 ? 571 LEU A CA    1 
ATOM   2041 C  C     . LEU A 1 267 ? 28.393 14.889 -8.919  1.00 33.71 ? 571 LEU A C     1 
ATOM   2042 O  O     . LEU A 1 267 ? 28.546 13.764 -8.447  1.00 32.73 ? 571 LEU A O     1 
ATOM   2043 C  CB    . LEU A 1 267 ? 27.334 16.518 -7.341  1.00 30.18 ? 571 LEU A CB    1 
ATOM   2044 C  CG    . LEU A 1 267 ? 27.575 17.526 -6.218  1.00 30.62 ? 571 LEU A CG    1 
ATOM   2045 C  CD1   . LEU A 1 267 ? 26.271 17.901 -5.528  1.00 29.71 ? 571 LEU A CD1   1 
ATOM   2046 C  CD2   . LEU A 1 267 ? 28.548 16.918 -5.223  1.00 28.06 ? 571 LEU A CD2   1 
ATOM   2047 N  N     . ASN A 1 268 ? 28.048 15.087 -10.188 1.00 35.83 ? 572 ASN A N     1 
ATOM   2048 C  CA    . ASN A 1 268 ? 27.803 13.929 -11.028 1.00 37.24 ? 572 ASN A CA    1 
ATOM   2049 C  C     . ASN A 1 268 ? 29.062 13.100 -11.235 1.00 37.75 ? 572 ASN A C     1 
ATOM   2050 O  O     . ASN A 1 268 ? 29.005 11.872 -11.268 1.00 38.35 ? 572 ASN A O     1 
ATOM   2051 C  CB    . ASN A 1 268 ? 27.243 14.326 -12.384 1.00 38.42 ? 572 ASN A CB    1 
ATOM   2052 C  CG    . ASN A 1 268 ? 26.605 13.148 -13.096 1.00 40.36 ? 572 ASN A CG    1 
ATOM   2053 O  OD1   . ASN A 1 268 ? 26.851 12.916 -14.273 1.00 43.09 ? 572 ASN A OD1   1 
ATOM   2054 N  ND2   . ASN A 1 268 ? 25.777 12.396 -12.375 1.00 41.49 ? 572 ASN A ND2   1 
ATOM   2055 N  N     . ASP A 1 269 ? 30.193 13.778 -11.386 1.00 38.03 ? 573 ASP A N     1 
ATOM   2056 C  CA    . ASP A 1 269 ? 31.480 13.117 -11.588 1.00 39.03 ? 573 ASP A CA    1 
ATOM   2057 C  C     . ASP A 1 269 ? 31.868 12.345 -10.339 1.00 38.60 ? 573 ASP A C     1 
ATOM   2058 O  O     . ASP A 1 269 ? 32.500 11.288 -10.408 1.00 37.02 ? 573 ASP A O     1 
ATOM   2059 C  CB    . ASP A 1 269 ? 32.587 14.140 -11.842 1.00 43.34 ? 573 ASP A CB    1 
ATOM   2060 C  CG    . ASP A 1 269 ? 32.539 14.748 -13.232 1.00 46.94 ? 573 ASP A CG    1 
ATOM   2061 O  OD1   . ASP A 1 269 ? 31.733 14.301 -14.083 1.00 47.26 ? 573 ASP A OD1   1 
ATOM   2062 O  OD2   . ASP A 1 269 ? 33.342 15.681 -13.466 1.00 48.39 ? 573 ASP A OD2   1 
ATOM   2063 N  N     . LEU A 1 270 ? 31.517 12.909 -9.191  1.00 37.21 ? 574 LEU A N     1 
ATOM   2064 C  CA    . LEU A 1 270 ? 31.835 12.280 -7.926  1.00 36.97 ? 574 LEU A CA    1 
ATOM   2065 C  C     . LEU A 1 270 ? 30.955 11.066 -7.759  1.00 37.38 ? 574 LEU A C     1 
ATOM   2066 O  O     . LEU A 1 270 ? 31.434 9.996  -7.410  1.00 36.87 ? 574 LEU A O     1 
ATOM   2067 C  CB    . LEU A 1 270 ? 31.578 13.238 -6.763  1.00 34.47 ? 574 LEU A CB    1 
ATOM   2068 C  CG    . LEU A 1 270 ? 32.248 13.103 -5.384  1.00 34.45 ? 574 LEU A CG    1 
ATOM   2069 C  CD1   . LEU A 1 270 ? 31.142 13.148 -4.369  1.00 31.68 ? 574 LEU A CD1   1 
ATOM   2070 C  CD2   . LEU A 1 270 ? 33.088 11.838 -5.203  1.00 33.57 ? 574 LEU A CD2   1 
ATOM   2071 N  N     . ARG A 1 271 ? 29.664 11.200 -8.018  1.00 38.92 ? 575 ARG A N     1 
ATOM   2072 C  CA    . ARG A 1 271 ? 28.859 10.030 -7.796  1.00 41.20 ? 575 ARG A CA    1 
ATOM   2073 C  C     . ARG A 1 271 ? 29.149 8.902  -8.774  1.00 41.59 ? 575 ARG A C     1 
ATOM   2074 O  O     . ARG A 1 271 ? 28.858 7.756  -8.467  1.00 42.19 ? 575 ARG A O     1 
ATOM   2075 C  CB    . ARG A 1 271 ? 27.375 10.395 -7.718  1.00 42.54 ? 575 ARG A CB    1 
ATOM   2076 C  CG    . ARG A 1 271 ? 26.575 10.250 -8.953  1.00 45.16 ? 575 ARG A CG    1 
ATOM   2077 C  CD    . ARG A 1 271 ? 25.199 10.783 -8.653  1.00 49.46 ? 575 ARG A CD    1 
ATOM   2078 N  NE    . ARG A 1 271 ? 24.399 9.869  -7.847  1.00 52.22 ? 575 ARG A NE    1 
ATOM   2079 C  CZ    . ARG A 1 271 ? 23.737 8.837  -8.356  1.00 54.69 ? 575 ARG A CZ    1 
ATOM   2080 N  NH1   . ARG A 1 271 ? 23.795 8.600  -9.661  1.00 55.45 ? 575 ARG A NH1   1 
ATOM   2081 N  NH2   . ARG A 1 271 ? 22.997 8.062  -7.572  1.00 55.58 ? 575 ARG A NH2   1 
ATOM   2082 N  N     . LYS A 1 272 ? 29.751 9.197  -9.926  1.00 42.44 ? 576 LYS A N     1 
ATOM   2083 C  CA    . LYS A 1 272 ? 30.094 8.127  -10.867 1.00 43.58 ? 576 LYS A CA    1 
ATOM   2084 C  C     . LYS A 1 272 ? 31.410 7.438  -10.468 1.00 43.70 ? 576 LYS A C     1 
ATOM   2085 O  O     . LYS A 1 272 ? 31.671 6.318  -10.890 1.00 44.43 ? 576 LYS A O     1 
ATOM   2086 C  CB    . LYS A 1 272 ? 30.287 8.658  -12.296 1.00 44.50 ? 576 LYS A CB    1 
ATOM   2087 C  CG    . LYS A 1 272 ? 29.051 8.909  -13.160 1.00 47.91 ? 576 LYS A CG    1 
ATOM   2088 C  CD    . LYS A 1 272 ? 29.546 9.262  -14.578 1.00 50.65 ? 576 LYS A CD    1 
ATOM   2089 C  CE    . LYS A 1 272 ? 28.461 9.783  -15.508 1.00 54.06 ? 576 LYS A CE    1 
ATOM   2090 N  NZ    . LYS A 1 272 ? 29.064 10.579 -16.633 1.00 56.99 ? 576 LYS A NZ    1 
ATOM   2091 N  N     . ARG A 1 273 ? 32.241 8.096  -9.664  1.00 42.87 ? 577 ARG A N     1 
ATOM   2092 C  CA    . ARG A 1 273 ? 33.535 7.519  -9.304  1.00 43.37 ? 577 ARG A CA    1 
ATOM   2093 C  C     . ARG A 1 273 ? 33.697 6.893  -7.933  1.00 43.30 ? 577 ARG A C     1 
ATOM   2094 O  O     . ARG A 1 273 ? 34.488 5.964  -7.766  1.00 43.17 ? 577 ARG A O     1 
ATOM   2095 C  CB    . ARG A 1 273 ? 34.630 8.577  -9.435  1.00 44.45 ? 577 ARG A CB    1 
ATOM   2096 C  CG    . ARG A 1 273 ? 34.776 9.176  -10.809 1.00 45.15 ? 577 ARG A CG    1 
ATOM   2097 C  CD    . ARG A 1 273 ? 35.657 10.400 -10.744 1.00 44.45 ? 577 ARG A CD    1 
ATOM   2098 N  NE    . ARG A 1 273 ? 35.731 11.097 -12.022 1.00 46.90 ? 577 ARG A NE    1 
ATOM   2099 C  CZ    . ARG A 1 273 ? 36.590 12.080 -12.273 1.00 47.69 ? 577 ARG A CZ    1 
ATOM   2100 N  NH1   . ARG A 1 273 ? 37.440 12.465 -11.328 1.00 46.83 ? 577 ARG A NH1   1 
ATOM   2101 N  NH2   . ARG A 1 273 ? 36.603 12.681 -13.461 1.00 48.20 ? 577 ARG A NH2   1 
ATOM   2102 N  N     . TYR A 1 274 ? 32.964 7.415  -6.957  1.00 42.54 ? 578 TYR A N     1 
ATOM   2103 C  CA    . TYR A 1 274 ? 33.084 6.965  -5.577  1.00 42.18 ? 578 TYR A CA    1 
ATOM   2104 C  C     . TYR A 1 274 ? 32.612 5.567  -5.215  1.00 43.65 ? 578 TYR A C     1 
ATOM   2105 O  O     . TYR A 1 274 ? 31.760 4.972  -5.881  1.00 43.23 ? 578 TYR A O     1 
ATOM   2106 C  CB    . TYR A 1 274 ? 32.380 7.965  -4.645  1.00 38.92 ? 578 TYR A CB    1 
ATOM   2107 C  CG    . TYR A 1 274 ? 30.931 7.637  -4.307  1.00 36.02 ? 578 TYR A CG    1 
ATOM   2108 C  CD1   . TYR A 1 274 ? 30.589 7.052  -3.084  1.00 35.86 ? 578 TYR A CD1   1 
ATOM   2109 C  CD2   . TYR A 1 274 ? 29.906 7.922  -5.203  1.00 35.43 ? 578 TYR A CD2   1 
ATOM   2110 C  CE1   . TYR A 1 274 ? 29.252 6.762  -2.765  1.00 34.71 ? 578 TYR A CE1   1 
ATOM   2111 C  CE2   . TYR A 1 274 ? 28.573 7.637  -4.896  1.00 35.88 ? 578 TYR A CE2   1 
ATOM   2112 C  CZ    . TYR A 1 274 ? 28.255 7.059  -3.676  1.00 35.20 ? 578 TYR A CZ    1 
ATOM   2113 O  OH    . TYR A 1 274 ? 26.939 6.798  -3.378  1.00 36.62 ? 578 TYR A OH    1 
ATOM   2114 N  N     . THR A 1 275 ? 33.210 5.059  -4.142  1.00 44.58 ? 579 THR A N     1 
ATOM   2115 C  CA    . THR A 1 275 ? 32.851 3.781  -3.544  1.00 46.43 ? 579 THR A CA    1 
ATOM   2116 C  C     . THR A 1 275 ? 32.686 4.208  -2.085  1.00 46.50 ? 579 THR A C     1 
ATOM   2117 O  O     . THR A 1 275 ? 33.463 5.020  -1.583  1.00 46.65 ? 579 THR A O     1 
ATOM   2118 C  CB    . THR A 1 275 ? 33.969 2.706  -3.687  1.00 46.56 ? 579 THR A CB    1 
ATOM   2119 O  OG1   . THR A 1 275 ? 35.209 3.210  -3.178  1.00 48.07 ? 579 THR A OG1   1 
ATOM   2120 C  CG2   . THR A 1 275 ? 34.138 2.296  -5.153  1.00 46.61 ? 579 THR A CG2   1 
ATOM   2121 N  N     . LEU A 1 276 ? 31.666 3.708  -1.406  1.00 46.61 ? 580 LEU A N     1 
ATOM   2122 C  CA    . LEU A 1 276 ? 31.468 4.127  -0.028  1.00 47.37 ? 580 LEU A CA    1 
ATOM   2123 C  C     . LEU A 1 276 ? 32.751 4.016  0.798   1.00 48.16 ? 580 LEU A C     1 
ATOM   2124 O  O     . LEU A 1 276 ? 33.188 4.993  1.391   1.00 48.57 ? 580 LEU A O     1 
ATOM   2125 C  CB    . LEU A 1 276 ? 30.328 3.331  0.612   1.00 47.41 ? 580 LEU A CB    1 
ATOM   2126 C  CG    . LEU A 1 276 ? 29.797 3.722  1.997   1.00 48.31 ? 580 LEU A CG    1 
ATOM   2127 C  CD1   . LEU A 1 276 ? 29.835 5.231  2.195   1.00 47.41 ? 580 LEU A CD1   1 
ATOM   2128 C  CD2   . LEU A 1 276 ? 28.368 3.196  2.141   1.00 47.23 ? 580 LEU A CD2   1 
ATOM   2129 N  N     . ASP A 1 277 ? 33.383 2.849  0.813   1.00 49.22 ? 581 ASP A N     1 
ATOM   2130 C  CA    . ASP A 1 277 ? 34.605 2.679  1.601   1.00 49.15 ? 581 ASP A CA    1 
ATOM   2131 C  C     . ASP A 1 277 ? 35.677 3.749  1.395   1.00 48.52 ? 581 ASP A C     1 
ATOM   2132 O  O     . ASP A 1 277 ? 36.240 4.253  2.365   1.00 48.54 ? 581 ASP A O     1 
ATOM   2133 C  CB    . ASP A 1 277 ? 35.239 1.309  1.336   1.00 51.42 ? 581 ASP A CB    1 
ATOM   2134 C  CG    . ASP A 1 277 ? 34.402 0.157  1.858   1.00 53.59 ? 581 ASP A CG    1 
ATOM   2135 O  OD1   . ASP A 1 277 ? 33.240 0.381  2.274   1.00 53.71 ? 581 ASP A OD1   1 
ATOM   2136 O  OD2   . ASP A 1 277 ? 34.919 -0.983 1.840   1.00 55.36 ? 581 ASP A OD2   1 
ATOM   2137 N  N     . ALA A 1 278 ? 35.976 4.088  0.144   1.00 47.34 ? 582 ALA A N     1 
ATOM   2138 C  CA    . ALA A 1 278 ? 37.011 5.084  -0.137  1.00 45.86 ? 582 ALA A CA    1 
ATOM   2139 C  C     . ALA A 1 278 ? 36.616 6.473  0.367   1.00 44.27 ? 582 ALA A C     1 
ATOM   2140 O  O     . ALA A 1 278 ? 37.462 7.241  0.839   1.00 43.85 ? 582 ALA A O     1 
ATOM   2141 C  CB    . ALA A 1 278 ? 37.305 5.125  -1.634  1.00 44.96 ? 582 ALA A CB    1 
ATOM   2142 N  N     . LEU A 1 279 ? 35.327 6.778  0.242   1.00 42.05 ? 583 LEU A N     1 
ATOM   2143 C  CA    . LEU A 1 279 ? 34.759 8.036  0.699   1.00 41.17 ? 583 LEU A CA    1 
ATOM   2144 C  C     . LEU A 1 279 ? 35.085 8.139  2.182   1.00 41.78 ? 583 LEU A C     1 
ATOM   2145 O  O     . LEU A 1 279 ? 35.790 9.047  2.625   1.00 41.92 ? 583 LEU A O     1 
ATOM   2146 C  CB    . LEU A 1 279 ? 33.238 8.013  0.536   1.00 39.02 ? 583 LEU A CB    1 
ATOM   2147 C  CG    . LEU A 1 279 ? 32.559 9.169  -0.194  1.00 38.17 ? 583 LEU A CG    1 
ATOM   2148 C  CD1   . LEU A 1 279 ? 31.058 9.137  0.056   1.00 36.49 ? 583 LEU A CD1   1 
ATOM   2149 C  CD2   . LEU A 1 279 ? 33.145 10.480 0.286   1.00 36.57 ? 583 LEU A CD2   1 
ATOM   2150 N  N     . LYS A 1 280 ? 34.555 7.183  2.939   1.00 41.98 ? 584 LYS A N     1 
ATOM   2151 C  CA    . LYS A 1 280 ? 34.765 7.127  4.373   1.00 42.29 ? 584 LYS A CA    1 
ATOM   2152 C  C     . LYS A 1 280 ? 36.243 7.262  4.758   1.00 42.31 ? 584 LYS A C     1 
ATOM   2153 O  O     . LYS A 1 280 ? 36.561 7.985  5.698   1.00 43.47 ? 584 LYS A O     1 
ATOM   2154 C  CB    . LYS A 1 280 ? 34.173 5.830  4.937   1.00 43.23 ? 584 LYS A CB    1 
ATOM   2155 C  CG    . LYS A 1 280 ? 32.636 5.776  4.972   1.00 45.66 ? 584 LYS A CG    1 
ATOM   2156 C  CD    . LYS A 1 280 ? 32.176 4.416  5.499   1.00 47.08 ? 584 LYS A CD    1 
ATOM   2157 C  CE    . LYS A 1 280 ? 30.886 4.471  6.301   1.00 48.59 ? 584 LYS A CE    1 
ATOM   2158 N  NZ    . LYS A 1 280 ? 30.918 3.345  7.285   1.00 49.26 ? 584 LYS A NZ    1 
ATOM   2159 N  N     . ALA A 1 281 ? 37.146 6.593  4.044   1.00 41.66 ? 585 ALA A N     1 
ATOM   2160 C  CA    . ALA A 1 281 ? 38.576 6.690  4.364   1.00 41.66 ? 585 ALA A CA    1 
ATOM   2161 C  C     . ALA A 1 281 ? 39.053 8.121  4.136   1.00 42.34 ? 585 ALA A C     1 
ATOM   2162 O  O     . ALA A 1 281 ? 39.851 8.673  4.904   1.00 42.34 ? 585 ALA A O     1 
ATOM   2163 C  CB    . ALA A 1 281 ? 39.395 5.732  3.480   1.00 41.16 ? 585 ALA A CB    1 
ATOM   2164 N  N     . SER A 1 282 ? 38.530 8.719  3.074   1.00 41.66 ? 586 SER A N     1 
ATOM   2165 C  CA    . SER A 1 282 ? 38.901 10.065 2.677   1.00 41.09 ? 586 SER A CA    1 
ATOM   2166 C  C     . SER A 1 282 ? 38.444 11.241 3.539   1.00 40.03 ? 586 SER A C     1 
ATOM   2167 O  O     . SER A 1 282 ? 39.247 12.100 3.900   1.00 39.08 ? 586 SER A O     1 
ATOM   2168 C  CB    . SER A 1 282 ? 38.428 10.305 1.247   1.00 41.75 ? 586 SER A CB    1 
ATOM   2169 O  OG    . SER A 1 282 ? 38.664 11.647 0.859   1.00 42.52 ? 586 SER A OG    1 
ATOM   2170 N  N     . VAL A 1 283 ? 37.164 11.281 3.872   1.00 38.82 ? 587 VAL A N     1 
ATOM   2171 C  CA    . VAL A 1 283 ? 36.628 12.408 4.618   1.00 39.42 ? 587 VAL A CA    1 
ATOM   2172 C  C     . VAL A 1 283 ? 36.042 12.139 5.996   1.00 41.06 ? 587 VAL A C     1 
ATOM   2173 O  O     . VAL A 1 283 ? 35.532 13.051 6.637   1.00 41.61 ? 587 VAL A O     1 
ATOM   2174 C  CB    . VAL A 1 283 ? 35.534 13.074 3.801   1.00 36.98 ? 587 VAL A CB    1 
ATOM   2175 C  CG1   . VAL A 1 283 ? 36.066 13.490 2.438   1.00 36.64 ? 587 VAL A CG1   1 
ATOM   2176 C  CG2   . VAL A 1 283 ? 34.371 12.108 3.640   1.00 34.23 ? 587 VAL A CG2   1 
ATOM   2177 N  N     . GLY A 1 284 ? 36.104 10.906 6.469   1.00 42.01 ? 588 GLY A N     1 
ATOM   2178 C  CA    . GLY A 1 284 ? 35.518 10.624 7.770   1.00 41.94 ? 588 GLY A CA    1 
ATOM   2179 C  C     . GLY A 1 284 ? 34.385 9.687  7.451   1.00 42.24 ? 588 GLY A C     1 
ATOM   2180 O  O     . GLY A 1 284 ? 34.014 9.572  6.286   1.00 42.61 ? 588 GLY A O     1 
ATOM   2181 N  N     . SER A 1 285 ? 33.805 8.998  8.416   1.00 42.74 ? 589 SER A N     1 
ATOM   2182 C  CA    . SER A 1 285 ? 32.789 8.077  7.961   1.00 44.12 ? 589 SER A CA    1 
ATOM   2183 C  C     . SER A 1 285 ? 31.419 8.683  7.891   1.00 43.79 ? 589 SER A C     1 
ATOM   2184 O  O     . SER A 1 285 ? 30.738 8.597  6.869   1.00 46.14 ? 589 SER A O     1 
ATOM   2185 C  CB    . SER A 1 285 ? 32.787 6.819  8.820   1.00 45.91 ? 589 SER A CB    1 
ATOM   2186 O  OG    . SER A 1 285 ? 32.282 7.066  10.117  1.00 50.09 ? 589 SER A OG    1 
ATOM   2187 N  N     . LYS A 1 286 ? 31.030 9.290  8.997   1.00 42.42 ? 590 LYS A N     1 
ATOM   2188 C  CA    . LYS A 1 286 ? 29.763 9.962  9.120   1.00 41.98 ? 590 LYS A CA    1 
ATOM   2189 C  C     . LYS A 1 286 ? 29.590 10.942 7.993   1.00 39.50 ? 590 LYS A C     1 
ATOM   2190 O  O     . LYS A 1 286 ? 28.533 11.021 7.373   1.00 39.52 ? 590 LYS A O     1 
ATOM   2191 C  CB    . LYS A 1 286 ? 29.756 10.706 10.435  1.00 43.75 ? 590 LYS A CB    1 
ATOM   2192 C  CG    . LYS A 1 286 ? 29.528 9.821  11.603  1.00 46.98 ? 590 LYS A CG    1 
ATOM   2193 C  CD    . LYS A 1 286 ? 28.131 10.095 12.072  1.00 51.56 ? 590 LYS A CD    1 
ATOM   2194 C  CE    . LYS A 1 286 ? 27.586 8.975  12.917  1.00 53.00 ? 590 LYS A CE    1 
ATOM   2195 N  NZ    . LYS A 1 286 ? 27.374 9.423  14.316  1.00 55.14 ? 590 LYS A NZ    1 
ATOM   2196 N  N     . LEU A 1 287 ? 30.644 11.708 7.737   1.00 38.28 ? 591 LEU A N     1 
ATOM   2197 C  CA    . LEU A 1 287 ? 30.574 12.685 6.665   1.00 37.62 ? 591 LEU A CA    1 
ATOM   2198 C  C     . LEU A 1 287 ? 30.506 11.885 5.376   1.00 37.15 ? 591 LEU A C     1 
ATOM   2199 O  O     . LEU A 1 287 ? 29.691 12.183 4.502   1.00 37.09 ? 591 LEU A O     1 
ATOM   2200 C  CB    . LEU A 1 287 ? 31.795 13.613 6.636   1.00 36.30 ? 591 LEU A CB    1 
ATOM   2201 C  CG    . LEU A 1 287 ? 31.526 15.082 6.230   1.00 37.08 ? 591 LEU A CG    1 
ATOM   2202 C  CD1   . LEU A 1 287 ? 32.712 15.610 5.446   1.00 36.17 ? 591 LEU A CD1   1 
ATOM   2203 C  CD2   . LEU A 1 287 ? 30.273 15.223 5.374   1.00 35.18 ? 591 LEU A CD2   1 
ATOM   2204 N  N     . GLY A 1 288 ? 31.342 10.853 5.278   1.00 35.93 ? 592 GLY A N     1 
ATOM   2205 C  CA    . GLY A 1 288 ? 31.343 10.018 4.089   1.00 37.41 ? 592 GLY A CA    1 
ATOM   2206 C  C     . GLY A 1 288 ? 29.968 9.419  3.860   1.00 37.64 ? 592 GLY A C     1 
ATOM   2207 O  O     . GLY A 1 288 ? 29.445 9.391  2.742   1.00 36.47 ? 592 GLY A O     1 
ATOM   2208 N  N     . MET A 1 289 ? 29.387 8.949  4.954   1.00 38.09 ? 593 MET A N     1 
ATOM   2209 C  CA    . MET A 1 289 ? 28.069 8.345  4.975   1.00 39.74 ? 593 MET A CA    1 
ATOM   2210 C  C     . MET A 1 289 ? 27.052 9.416  4.559   1.00 38.49 ? 593 MET A C     1 
ATOM   2211 O  O     . MET A 1 289 ? 26.174 9.145  3.750   1.00 39.56 ? 593 MET A O     1 
ATOM   2212 C  CB    . MET A 1 289 ? 27.812 7.821  6.400   1.00 44.34 ? 593 MET A CB    1 
ATOM   2213 C  CG    . MET A 1 289 ? 26.718 6.767  6.591   1.00 49.83 ? 593 MET A CG    1 
ATOM   2214 S  SD    . MET A 1 289 ? 26.646 5.426  5.371   1.00 55.70 ? 593 MET A SD    1 
ATOM   2215 C  CE    . MET A 1 289 ? 25.016 5.814  4.624   1.00 53.99 ? 593 MET A CE    1 
ATOM   2216 N  N     . LYS A 1 290 ? 27.195 10.634 5.089   1.00 36.44 ? 594 LYS A N     1 
ATOM   2217 C  CA    . LYS A 1 290 ? 26.288 11.748 4.775   1.00 34.47 ? 594 LYS A CA    1 
ATOM   2218 C  C     . LYS A 1 290 ? 26.324 12.100 3.285   1.00 33.63 ? 594 LYS A C     1 
ATOM   2219 O  O     . LYS A 1 290 ? 25.291 12.373 2.669   1.00 32.26 ? 594 LYS A O     1 
ATOM   2220 C  CB    . LYS A 1 290 ? 26.662 12.984 5.627   1.00 34.33 ? 594 LYS A CB    1 
ATOM   2221 C  CG    . LYS A 1 290 ? 25.900 14.301 5.344   1.00 32.04 ? 594 LYS A CG    1 
ATOM   2222 C  CD    . LYS A 1 290 ? 26.263 15.384 6.382   1.00 31.65 ? 594 LYS A CD    1 
ATOM   2223 C  CE    . LYS A 1 290 ? 25.552 16.708 6.125   1.00 30.39 ? 594 LYS A CE    1 
ATOM   2224 N  NZ    . LYS A 1 290 ? 24.074 16.559 6.141   1.00 32.69 ? 594 LYS A NZ    1 
ATOM   2225 N  N     . ILE A 1 291 ? 27.518 12.092 2.710   1.00 33.91 ? 595 ILE A N     1 
ATOM   2226 C  CA    . ILE A 1 291 ? 27.683 12.422 1.302   1.00 34.85 ? 595 ILE A CA    1 
ATOM   2227 C  C     . ILE A 1 291 ? 27.032 11.324 0.469   1.00 36.33 ? 595 ILE A C     1 
ATOM   2228 O  O     . ILE A 1 291 ? 26.284 11.593 -0.475  1.00 36.11 ? 595 ILE A O     1 
ATOM   2229 C  CB    . ILE A 1 291 ? 29.185 12.603 0.985   1.00 33.87 ? 595 ILE A CB    1 
ATOM   2230 C  CG1   . ILE A 1 291 ? 29.666 13.904 1.647   1.00 31.26 ? 595 ILE A CG1   1 
ATOM   2231 C  CG2   . ILE A 1 291 ? 29.423 12.604 -0.522  1.00 32.31 ? 595 ILE A CG2   1 
ATOM   2232 C  CD1   . ILE A 1 291 ? 31.166 14.136 1.606   1.00 31.76 ? 595 ILE A CD1   1 
ATOM   2233 N  N     . HIS A 1 292 ? 27.294 10.086 0.868   1.00 38.61 ? 596 HIS A N     1 
ATOM   2234 C  CA    . HIS A 1 292 ? 26.738 8.897  0.234   1.00 40.74 ? 596 HIS A CA    1 
ATOM   2235 C  C     . HIS A 1 292 ? 25.216 8.998  0.114   1.00 40.32 ? 596 HIS A C     1 
ATOM   2236 O  O     . HIS A 1 292 ? 24.661 8.832  -0.969  1.00 40.14 ? 596 HIS A O     1 
ATOM   2237 C  CB    . HIS A 1 292 ? 27.082 7.678  1.078   1.00 44.11 ? 596 HIS A CB    1 
ATOM   2238 C  CG    . HIS A 1 292 ? 26.561 6.392  0.523   1.00 49.50 ? 596 HIS A CG    1 
ATOM   2239 N  ND1   . HIS A 1 292 ? 27.337 5.548  -0.242  1.00 51.77 ? 596 HIS A ND1   1 
ATOM   2240 C  CD2   . HIS A 1 292 ? 25.343 5.806  0.613   1.00 50.81 ? 596 HIS A CD2   1 
ATOM   2241 C  CE1   . HIS A 1 292 ? 26.620 4.496  -0.596  1.00 51.90 ? 596 HIS A CE1   1 
ATOM   2242 N  NE2   . HIS A 1 292 ? 25.406 4.628  -0.091  1.00 51.16 ? 596 HIS A NE2   1 
ATOM   2243 N  N     . LEU A 1 293 ? 24.550 9.259  1.236   1.00 40.29 ? 597 LEU A N     1 
ATOM   2244 C  CA    . LEU A 1 293 ? 23.091 9.381  1.262   1.00 39.59 ? 597 LEU A CA    1 
ATOM   2245 C  C     . LEU A 1 293 ? 22.630 10.568 0.441   1.00 38.64 ? 597 LEU A C     1 
ATOM   2246 O  O     . LEU A 1 293 ? 21.671 10.470 -0.327  1.00 38.85 ? 597 LEU A O     1 
ATOM   2247 C  CB    . LEU A 1 293 ? 22.583 9.523  2.706   1.00 39.55 ? 597 LEU A CB    1 
ATOM   2248 C  CG    . LEU A 1 293 ? 22.773 8.287  3.601   1.00 41.67 ? 597 LEU A CG    1 
ATOM   2249 C  CD1   . LEU A 1 293 ? 22.359 8.610  5.029   1.00 40.86 ? 597 LEU A CD1   1 
ATOM   2250 C  CD2   . LEU A 1 293 ? 21.945 7.113  3.063   1.00 41.14 ? 597 LEU A CD2   1 
ATOM   2251 N  N     . ALA A 1 294 ? 23.325 11.688 0.602   1.00 37.41 ? 598 ALA A N     1 
ATOM   2252 C  CA    . ALA A 1 294 ? 22.987 12.910 -0.117  1.00 36.65 ? 598 ALA A CA    1 
ATOM   2253 C  C     . ALA A 1 294 ? 22.943 12.683 -1.631  1.00 37.03 ? 598 ALA A C     1 
ATOM   2254 O  O     . ALA A 1 294 ? 22.107 13.258 -2.335  1.00 34.78 ? 598 ALA A O     1 
ATOM   2255 C  CB    . ALA A 1 294 ? 23.994 13.993 0.216   1.00 35.31 ? 598 ALA A CB    1 
ATOM   2256 N  N     . LEU A 1 295 ? 23.847 11.846 -2.127  1.00 37.30 ? 599 LEU A N     1 
ATOM   2257 C  CA    . LEU A 1 295 ? 23.905 11.557 -3.552  1.00 39.10 ? 599 LEU A CA    1 
ATOM   2258 C  C     . LEU A 1 295 ? 22.766 10.680 -4.019  1.00 41.11 ? 599 LEU A C     1 
ATOM   2259 O  O     . LEU A 1 295 ? 22.662 10.358 -5.197  1.00 42.46 ? 599 LEU A O     1 
ATOM   2260 C  CB    . LEU A 1 295 ? 25.230 10.904 -3.903  1.00 37.60 ? 599 LEU A CB    1 
ATOM   2261 C  CG    . LEU A 1 295 ? 26.355 11.928 -3.827  1.00 37.03 ? 599 LEU A CG    1 
ATOM   2262 C  CD1   . LEU A 1 295 ? 27.693 11.248 -3.960  1.00 33.87 ? 599 LEU A CD1   1 
ATOM   2263 C  CD2   . LEU A 1 295 ? 26.147 12.970 -4.926  1.00 36.40 ? 599 LEU A CD2   1 
ATOM   2264 N  N     . GLN A 1 296 ? 21.912 10.285 -3.089  1.00 43.10 ? 600 GLN A N     1 
ATOM   2265 C  CA    . GLN A 1 296 ? 20.764 9.474  -3.438  1.00 45.27 ? 600 GLN A CA    1 
ATOM   2266 C  C     . GLN A 1 296 ? 19.571 10.262 -2.959  1.00 45.41 ? 600 GLN A C     1 
ATOM   2267 O  O     . GLN A 1 296 ? 18.459 9.749  -2.860  1.00 45.77 ? 600 GLN A O     1 
ATOM   2268 C  CB    . GLN A 1 296 ? 20.812 8.138  -2.725  1.00 46.60 ? 600 GLN A CB    1 
ATOM   2269 C  CG    . GLN A 1 296 ? 22.025 7.319  -3.024  1.00 49.52 ? 600 GLN A CG    1 
ATOM   2270 C  CD    . GLN A 1 296 ? 22.195 6.258  -1.977  1.00 52.60 ? 600 GLN A CD    1 
ATOM   2271 O  OE1   . GLN A 1 296 ? 21.303 5.441  -1.762  1.00 53.77 ? 600 GLN A OE1   1 
ATOM   2272 N  NE2   . GLN A 1 296 ? 23.334 6.272  -1.297  1.00 54.85 ? 600 GLN A NE2   1 
ATOM   2273 N  N     . GLY A 1 297 ? 19.830 11.523 -2.640  1.00 45.90 ? 601 GLY A N     1 
ATOM   2274 C  CA    . GLY A 1 297 ? 18.783 12.404 -2.166  1.00 46.06 ? 601 GLY A CA    1 
ATOM   2275 C  C     . GLY A 1 297 ? 18.317 12.125 -0.749  1.00 46.40 ? 601 GLY A C     1 
ATOM   2276 O  O     . GLY A 1 297 ? 17.250 12.581 -0.363  1.00 46.34 ? 601 GLY A O     1 
ATOM   2277 N  N     . GLN A 1 298 ? 19.097 11.406 0.045   1.00 46.82 ? 602 GLN A N     1 
ATOM   2278 C  CA    . GLN A 1 298 ? 18.646 11.117 1.398   1.00 49.06 ? 602 GLN A CA    1 
ATOM   2279 C  C     . GLN A 1 298 ? 19.409 11.827 2.525   1.00 48.32 ? 602 GLN A C     1 
ATOM   2280 O  O     . GLN A 1 298 ? 20.614 12.069 2.430   1.00 48.39 ? 602 GLN A O     1 
ATOM   2281 C  CB    . GLN A 1 298 ? 18.635 9.592  1.612   1.00 51.87 ? 602 GLN A CB    1 
ATOM   2282 C  CG    . GLN A 1 298 ? 17.522 8.862  0.820   1.00 56.42 ? 602 GLN A CG    1 
ATOM   2283 C  CD    . GLN A 1 298 ? 17.841 7.394  0.516   1.00 58.42 ? 602 GLN A CD    1 
ATOM   2284 O  OE1   . GLN A 1 298 ? 18.528 6.716  1.286   1.00 59.13 ? 602 GLN A OE1   1 
ATOM   2285 N  NE2   . GLN A 1 298 ? 17.323 6.898  -0.609  1.00 60.00 ? 602 GLN A NE2   1 
ATOM   2286 N  N     . ASP A 1 299 ? 18.671 12.164 3.582   1.00 48.06 ? 603 ASP A N     1 
ATOM   2287 C  CA    . ASP A 1 299 ? 19.192 12.840 4.776   1.00 48.04 ? 603 ASP A CA    1 
ATOM   2288 C  C     . ASP A 1 299 ? 19.819 11.844 5.749   1.00 48.55 ? 603 ASP A C     1 
ATOM   2289 O  O     . ASP A 1 299 ? 19.317 10.736 5.897   1.00 49.35 ? 603 ASP A O     1 
ATOM   2290 C  CB    . ASP A 1 299 ? 18.057 13.544 5.524   1.00 47.85 ? 603 ASP A CB    1 
ATOM   2291 C  CG    . ASP A 1 299 ? 17.411 14.648 4.716   1.00 49.29 ? 603 ASP A CG    1 
ATOM   2292 O  OD1   . ASP A 1 299 ? 18.147 15.356 4.002   1.00 49.49 ? 603 ASP A OD1   1 
ATOM   2293 O  OD2   . ASP A 1 299 ? 16.173 14.825 4.813   1.00 49.38 ? 603 ASP A OD2   1 
ATOM   2294 N  N     . ASP A 1 300 ? 20.902 12.228 6.422   1.00 48.79 ? 604 ASP A N     1 
ATOM   2295 C  CA    . ASP A 1 300 ? 21.521 11.328 7.403   1.00 48.83 ? 604 ASP A CA    1 
ATOM   2296 C  C     . ASP A 1 300 ? 20.734 11.506 8.687   1.00 48.56 ? 604 ASP A C     1 
ATOM   2297 O  O     . ASP A 1 300 ? 20.019 12.498 8.832   1.00 47.05 ? 604 ASP A O     1 
ATOM   2298 C  CB    . ASP A 1 300 ? 22.994 11.683 7.657   1.00 49.41 ? 604 ASP A CB    1 
ATOM   2299 C  CG    . ASP A 1 300 ? 23.186 13.128 8.078   1.00 50.64 ? 604 ASP A CG    1 
ATOM   2300 O  OD1   . ASP A 1 300 ? 22.763 14.016 7.308   1.00 51.57 ? 604 ASP A OD1   1 
ATOM   2301 O  OD2   . ASP A 1 300 ? 23.759 13.373 9.164   1.00 51.67 ? 604 ASP A OD2   1 
ATOM   2302 N  N     . GLU A 1 301 ? 20.834 10.566 9.623   1.00 50.40 ? 605 GLU A N     1 
ATOM   2303 C  CA    . GLU A 1 301 ? 20.067 10.751 10.851  1.00 51.61 ? 605 GLU A CA    1 
ATOM   2304 C  C     . GLU A 1 301 ? 20.468 12.075 11.540  1.00 50.96 ? 605 GLU A C     1 
ATOM   2305 O  O     . GLU A 1 301 ? 19.583 12.884 11.813  1.00 50.96 ? 605 GLU A O     1 
ATOM   2306 C  CB    . GLU A 1 301 ? 20.212 9.557  11.823  1.00 53.47 ? 605 GLU A CB    1 
ATOM   2307 C  CG    . GLU A 1 301 ? 19.374 8.281  11.487  1.00 57.28 ? 605 GLU A CG    1 
ATOM   2308 C  CD    . GLU A 1 301 ? 17.965 8.547  10.933  1.00 60.28 ? 605 GLU A CD    1 
ATOM   2309 O  OE1   . GLU A 1 301 ? 17.129 9.170  11.630  1.00 61.15 ? 605 GLU A OE1   1 
ATOM   2310 O  OE2   . GLU A 1 301 ? 17.697 8.114  9.789   1.00 62.34 ? 605 GLU A OE2   1 
ATOM   2311 N  N     . GLU A 1 302 ? 21.763 12.325 11.795  1.00 49.97 ? 606 GLU A N     1 
ATOM   2312 C  CA    . GLU A 1 302 ? 22.155 13.580 12.470  1.00 49.12 ? 606 GLU A CA    1 
ATOM   2313 C  C     . GLU A 1 302 ? 21.351 14.760 11.923  1.00 48.00 ? 606 GLU A C     1 
ATOM   2314 O  O     . GLU A 1 302 ? 20.721 15.483 12.689  1.00 45.71 ? 606 GLU A O     1 
ATOM   2315 C  CB    . GLU A 1 302 ? 23.663 13.876 12.353  1.00 50.22 ? 606 GLU A CB    1 
ATOM   2316 C  CG    . GLU A 1 302 ? 24.164 15.041 13.244  1.00 52.82 ? 606 GLU A CG    1 
ATOM   2317 C  CD    . GLU A 1 302 ? 23.764 14.886 14.710  1.00 54.82 ? 606 GLU A CD    1 
ATOM   2318 O  OE1   . GLU A 1 302 ? 23.980 13.787 15.271  1.00 56.50 ? 606 GLU A OE1   1 
ATOM   2319 O  OE2   . GLU A 1 302 ? 23.240 15.855 15.300  1.00 55.14 ? 606 GLU A OE2   1 
ATOM   2320 N  N     . SER A 1 303 ? 21.340 14.943 10.606  1.00 47.54 ? 607 SER A N     1 
ATOM   2321 C  CA    . SER A 1 303 ? 20.596 16.047 9.996   1.00 48.01 ? 607 SER A CA    1 
ATOM   2322 C  C     . SER A 1 303 ? 19.114 16.054 10.309  1.00 47.37 ? 607 SER A C     1 
ATOM   2323 O  O     . SER A 1 303 ? 18.480 17.107 10.346  1.00 45.34 ? 607 SER A O     1 
ATOM   2324 C  CB    . SER A 1 303 ? 20.725 16.019 8.474   1.00 49.37 ? 607 SER A CB    1 
ATOM   2325 O  OG    . SER A 1 303 ? 22.071 16.124 8.066   1.00 54.25 ? 607 SER A OG    1 
ATOM   2326 N  N     . LEU A 1 304 ? 18.553 14.871 10.506  1.00 48.15 ? 608 LEU A N     1 
ATOM   2327 C  CA    . LEU A 1 304 ? 17.125 14.763 10.763  1.00 48.00 ? 608 LEU A CA    1 
ATOM   2328 C  C     . LEU A 1 304 ? 16.673 15.097 12.195  1.00 47.52 ? 608 LEU A C     1 
ATOM   2329 O  O     . LEU A 1 304 ? 15.483 15.343 12.417  1.00 46.11 ? 608 LEU A O     1 
ATOM   2330 C  CB    . LEU A 1 304 ? 16.637 13.361 10.348  1.00 49.06 ? 608 LEU A CB    1 
ATOM   2331 C  CG    . LEU A 1 304 ? 16.557 12.989 8.850   1.00 49.69 ? 608 LEU A CG    1 
ATOM   2332 C  CD1   . LEU A 1 304 ? 16.484 11.465 8.689   1.00 48.67 ? 608 LEU A CD1   1 
ATOM   2333 C  CD2   . LEU A 1 304 ? 15.333 13.648 8.205   1.00 48.61 ? 608 LEU A CD2   1 
ATOM   2334 N  N     . LYS A 1 305 ? 17.593 15.132 13.161  1.00 46.59 ? 609 LYS A N     1 
ATOM   2335 C  CA    . LYS A 1 305 ? 17.184 15.443 14.530  1.00 46.01 ? 609 LYS A CA    1 
ATOM   2336 C  C     . LYS A 1 305 ? 16.436 16.775 14.575  1.00 46.68 ? 609 LYS A C     1 
ATOM   2337 O  O     . LYS A 1 305 ? 15.488 16.935 15.343  1.00 46.18 ? 609 LYS A O     1 
ATOM   2338 C  CB    . LYS A 1 305 ? 18.392 15.465 15.487  1.00 44.92 ? 609 LYS A CB    1 
ATOM   2339 C  CG    . LYS A 1 305 ? 19.000 14.079 15.747  1.00 43.84 ? 609 LYS A CG    1 
ATOM   2340 C  CD    . LYS A 1 305 ? 20.203 14.107 16.697  1.00 44.93 ? 609 LYS A CD    1 
ATOM   2341 C  CE    . LYS A 1 305 ? 20.805 12.713 16.882  1.00 45.66 ? 609 LYS A CE    1 
ATOM   2342 N  NZ    . LYS A 1 305 ? 22.097 12.767 17.622  1.00 47.67 ? 609 LYS A NZ    1 
ATOM   2343 N  N     . ILE A 1 306 ? 16.822 17.719 13.724  1.00 47.25 ? 610 ILE A N     1 
ATOM   2344 C  CA    . ILE A 1 306 ? 16.163 19.014 13.742  1.00 47.99 ? 610 ILE A CA    1 
ATOM   2345 C  C     . ILE A 1 306 ? 14.665 18.923 13.420  1.00 49.18 ? 610 ILE A C     1 
ATOM   2346 O  O     . ILE A 1 306 ? 13.905 19.832 13.750  1.00 48.82 ? 610 ILE A O     1 
ATOM   2347 C  CB    . ILE A 1 306 ? 16.867 20.023 12.794  1.00 47.65 ? 610 ILE A CB    1 
ATOM   2348 C  CG1   . ILE A 1 306 ? 16.542 21.450 13.251  1.00 47.69 ? 610 ILE A CG1   1 
ATOM   2349 C  CG2   . ILE A 1 306 ? 16.486 19.754 11.348  1.00 47.21 ? 610 ILE A CG2   1 
ATOM   2350 C  CD1   . ILE A 1 306 ? 16.751 22.530 12.200  1.00 50.28 ? 610 ILE A CD1   1 
ATOM   2351 N  N     . LEU A 1 307 ? 14.226 17.830 12.799  1.00 49.76 ? 611 LEU A N     1 
ATOM   2352 C  CA    . LEU A 1 307 ? 12.802 17.677 12.491  1.00 49.94 ? 611 LEU A CA    1 
ATOM   2353 C  C     . LEU A 1 307 ? 12.090 16.807 13.533  1.00 50.43 ? 611 LEU A C     1 
ATOM   2354 O  O     . LEU A 1 307 ? 10.928 17.038 13.857  1.00 49.96 ? 611 LEU A O     1 
ATOM   2355 C  CB    . LEU A 1 307 ? 12.613 17.050 11.106  1.00 49.58 ? 611 LEU A CB    1 
ATOM   2356 C  CG    . LEU A 1 307 ? 13.148 17.776 9.870   1.00 48.85 ? 611 LEU A CG    1 
ATOM   2357 C  CD1   . LEU A 1 307 ? 13.079 16.851 8.670   1.00 49.37 ? 611 LEU A CD1   1 
ATOM   2358 C  CD2   . LEU A 1 307 ? 12.350 19.035 9.611   1.00 47.59 ? 611 LEU A CD2   1 
ATOM   2359 N  N     . TYR A 1 308 ? 12.802 15.811 14.050  1.00 51.76 ? 612 TYR A N     1 
ATOM   2360 C  CA    . TYR A 1 308 ? 12.258 14.874 15.021  1.00 52.90 ? 612 TYR A CA    1 
ATOM   2361 C  C     . TYR A 1 308 ? 12.307 15.438 16.459  1.00 53.73 ? 612 TYR A C     1 
ATOM   2362 O  O     . TYR A 1 308 ? 11.738 14.866 17.388  1.00 54.68 ? 612 TYR A O     1 
ATOM   2363 C  CB    . TYR A 1 308 ? 13.016 13.533 14.899  1.00 53.38 ? 612 TYR A CB    1 
ATOM   2364 C  CG    . TYR A 1 308 ? 12.851 12.822 13.546  1.00 54.69 ? 612 TYR A CG    1 
ATOM   2365 C  CD1   . TYR A 1 308 ? 13.734 11.808 13.154  1.00 55.77 ? 612 TYR A CD1   1 
ATOM   2366 C  CD2   . TYR A 1 308 ? 11.795 13.138 12.679  1.00 55.45 ? 612 TYR A CD2   1 
ATOM   2367 C  CE1   . TYR A 1 308 ? 13.569 11.119 11.935  1.00 57.02 ? 612 TYR A CE1   1 
ATOM   2368 C  CE2   . TYR A 1 308 ? 11.621 12.456 11.459  1.00 56.52 ? 612 TYR A CE2   1 
ATOM   2369 C  CZ    . TYR A 1 308 ? 12.512 11.449 11.096  1.00 57.40 ? 612 TYR A CZ    1 
ATOM   2370 O  OH    . TYR A 1 308 ? 12.328 10.770 9.909   1.00 58.41 ? 612 TYR A OH    1 
ATOM   2371 N  N     . ASP A 1 309 ? 12.995 16.559 16.623  1.00 53.61 ? 613 ASP A N     1 
ATOM   2372 C  CA    . ASP A 1 309 ? 13.090 17.241 17.884  1.00 52.06 ? 613 ASP A CA    1 
ATOM   2373 C  C     . ASP A 1 309 ? 13.802 18.575 17.670  1.00 50.72 ? 613 ASP A C     1 
ATOM   2374 O  O     . ASP A 1 309 ? 15.022 18.670 17.737  1.00 52.65 ? 613 ASP A O     1 
ATOM   2375 C  CB    . ASP A 1 309 ? 13.847 16.399 18.939  1.00 52.45 ? 613 ASP A CB    1 
ATOM   2376 C  CG    . ASP A 1 309 ? 13.446 16.738 20.381  1.00 54.30 ? 613 ASP A CG    1 
ATOM   2377 O  OD1   . ASP A 1 309 ? 12.538 17.568 20.584  1.00 54.07 ? 613 ASP A OD1   1 
ATOM   2378 O  OD2   . ASP A 1 309 ? 14.051 16.159 21.313  1.00 54.82 ? 613 ASP A OD2   1 
ATOM   2379 N  N     . PRO A 1 310 ? 13.034 19.610 17.314  1.00 49.43 ? 614 PRO A N     1 
ATOM   2380 C  CA    . PRO A 1 310 ? 13.663 20.917 17.128  1.00 48.50 ? 614 PRO A CA    1 
ATOM   2381 C  C     . PRO A 1 310 ? 14.043 21.551 18.447  1.00 47.72 ? 614 PRO A C     1 
ATOM   2382 O  O     . PRO A 1 310 ? 15.072 22.219 18.547  1.00 47.79 ? 614 PRO A O     1 
ATOM   2383 C  CB    . PRO A 1 310 ? 12.606 21.722 16.361  1.00 47.74 ? 614 PRO A CB    1 
ATOM   2384 C  CG    . PRO A 1 310 ? 11.332 20.938 16.521  1.00 47.54 ? 614 PRO A CG    1 
ATOM   2385 C  CD    . PRO A 1 310 ? 11.794 19.518 16.529  1.00 48.25 ? 614 PRO A CD    1 
ATOM   2386 N  N     . LYS A 1 311 ? 13.223 21.328 19.464  1.00 47.06 ? 615 LYS A N     1 
ATOM   2387 C  CA    . LYS A 1 311 ? 13.519 21.916 20.755  1.00 46.32 ? 615 LYS A CA    1 
ATOM   2388 C  C     . LYS A 1 311 ? 14.855 21.480 21.350  1.00 45.15 ? 615 LYS A C     1 
ATOM   2389 O  O     . LYS A 1 311 ? 15.509 22.280 22.011  1.00 45.73 ? 615 LYS A O     1 
ATOM   2390 C  CB    . LYS A 1 311 ? 12.381 21.662 21.735  1.00 45.97 ? 615 LYS A CB    1 
ATOM   2391 C  CG    . LYS A 1 311 ? 11.070 22.251 21.251  1.00 47.42 ? 615 LYS A CG    1 
ATOM   2392 C  CD    . LYS A 1 311 ? 10.004 22.130 22.306  1.00 47.51 ? 615 LYS A CD    1 
ATOM   2393 C  CE    . LYS A 1 311 ? 8.661  22.613 21.809  1.00 48.32 ? 615 LYS A CE    1 
ATOM   2394 N  NZ    . LYS A 1 311 ? 7.651  22.485 22.894  1.00 49.78 ? 615 LYS A NZ    1 
ATOM   2395 N  N     . GLU A 1 312 ? 15.284 20.241 21.131  1.00 43.14 ? 616 GLU A N     1 
ATOM   2396 C  CA    . GLU A 1 312 ? 16.583 19.867 21.676  1.00 43.50 ? 616 GLU A CA    1 
ATOM   2397 C  C     . GLU A 1 312 ? 17.689 20.386 20.759  1.00 43.30 ? 616 GLU A C     1 
ATOM   2398 O  O     . GLU A 1 312 ? 18.708 20.889 21.230  1.00 44.78 ? 616 GLU A O     1 
ATOM   2399 C  CB    . GLU A 1 312 ? 16.702 18.351 21.851  1.00 42.76 ? 616 GLU A CB    1 
ATOM   2400 N  N     . VAL A 1 313 ? 17.497 20.295 19.449  1.00 42.43 ? 617 VAL A N     1 
ATOM   2401 C  CA    . VAL A 1 313 ? 18.539 20.770 18.553  1.00 41.66 ? 617 VAL A CA    1 
ATOM   2402 C  C     . VAL A 1 313 ? 18.790 22.275 18.684  1.00 40.69 ? 617 VAL A C     1 
ATOM   2403 O  O     . VAL A 1 313 ? 19.940 22.723 18.658  1.00 41.27 ? 617 VAL A O     1 
ATOM   2404 C  CB    . VAL A 1 313 ? 18.215 20.405 17.090  1.00 41.29 ? 617 VAL A CB    1 
ATOM   2405 C  CG1   . VAL A 1 313 ? 19.168 21.111 16.143  1.00 40.26 ? 617 VAL A CG1   1 
ATOM   2406 C  CG2   . VAL A 1 313 ? 18.343 18.907 16.910  1.00 41.64 ? 617 VAL A CG2   1 
ATOM   2407 N  N     . LEU A 1 314 ? 17.716 23.041 18.853  1.00 39.49 ? 618 LEU A N     1 
ATOM   2408 C  CA    . LEU A 1 314 ? 17.806 24.491 18.973  1.00 38.83 ? 618 LEU A CA    1 
ATOM   2409 C  C     . LEU A 1 314 ? 18.141 25.002 20.375  1.00 39.00 ? 618 LEU A C     1 
ATOM   2410 O  O     . LEU A 1 314 ? 18.352 26.205 20.568  1.00 38.42 ? 618 LEU A O     1 
ATOM   2411 C  CB    . LEU A 1 314 ? 16.505 25.134 18.487  1.00 38.06 ? 618 LEU A CB    1 
ATOM   2412 C  CG    . LEU A 1 314 ? 16.193 24.986 16.994  1.00 38.95 ? 618 LEU A CG    1 
ATOM   2413 C  CD1   . LEU A 1 314 ? 15.065 25.923 16.627  1.00 37.55 ? 618 LEU A CD1   1 
ATOM   2414 C  CD2   . LEU A 1 314 ? 17.425 25.325 16.159  1.00 39.67 ? 618 LEU A CD2   1 
ATOM   2415 N  N     . GLN A 1 315 ? 18.187 24.092 21.346  1.00 38.71 ? 619 GLN A N     1 
ATOM   2416 C  CA    . GLN A 1 315 ? 18.512 24.453 22.719  1.00 39.33 ? 619 GLN A CA    1 
ATOM   2417 C  C     . GLN A 1 315 ? 20.028 24.675 22.754  1.00 37.65 ? 619 GLN A C     1 
ATOM   2418 O  O     . GLN A 1 315 ? 20.816 23.798 22.392  1.00 35.70 ? 619 GLN A O     1 
ATOM   2419 C  CB    . GLN A 1 315 ? 18.118 23.317 23.684  1.00 41.24 ? 619 GLN A CB    1 
ATOM   2420 C  CG    . GLN A 1 315 ? 17.570 23.737 25.074  1.00 47.20 ? 619 GLN A CG    1 
ATOM   2421 C  CD    . GLN A 1 315 ? 16.032 23.903 25.124  1.00 51.36 ? 619 GLN A CD    1 
ATOM   2422 O  OE1   . GLN A 1 315 ? 15.267 22.981 24.788  1.00 51.17 ? 619 GLN A OE1   1 
ATOM   2423 N  NE2   . GLN A 1 315 ? 15.582 25.080 25.561  1.00 51.72 ? 619 GLN A NE2   1 
ATOM   2424 N  N     . ARG A 1 316 ? 20.412 25.873 23.169  1.00 36.97 ? 620 ARG A N     1 
ATOM   2425 C  CA    . ARG A 1 316 ? 21.804 26.277 23.289  1.00 36.68 ? 620 ARG A CA    1 
ATOM   2426 C  C     . ARG A 1 316 ? 22.519 25.382 24.305  1.00 36.01 ? 620 ARG A C     1 
ATOM   2427 O  O     . ARG A 1 316 ? 22.018 25.174 25.407  1.00 36.57 ? 620 ARG A O     1 
ATOM   2428 C  CB    . ARG A 1 316 ? 21.849 27.734 23.761  1.00 36.45 ? 620 ARG A CB    1 
ATOM   2429 C  CG    . ARG A 1 316 ? 23.240 28.274 23.951  1.00 36.86 ? 620 ARG A CG    1 
ATOM   2430 C  CD    . ARG A 1 316 ? 23.228 29.534 24.796  1.00 36.36 ? 620 ARG A CD    1 
ATOM   2431 N  NE    . ARG A 1 316 ? 23.091 30.768 24.026  1.00 36.53 ? 620 ARG A NE    1 
ATOM   2432 C  CZ    . ARG A 1 316 ? 24.046 31.293 23.261  1.00 36.72 ? 620 ARG A CZ    1 
ATOM   2433 N  NH1   . ARG A 1 316 ? 25.234 30.694 23.137  1.00 35.99 ? 620 ARG A NH1   1 
ATOM   2434 N  NH2   . ARG A 1 316 ? 23.823 32.447 22.641  1.00 35.45 ? 620 ARG A NH2   1 
ATOM   2435 N  N     . LYS A 1 317 ? 23.684 24.856 23.938  1.00 35.82 ? 621 LYS A N     1 
ATOM   2436 C  CA    . LYS A 1 317 ? 24.452 23.994 24.837  1.00 34.89 ? 621 LYS A CA    1 
ATOM   2437 C  C     . LYS A 1 317 ? 25.793 24.606 25.269  1.00 33.83 ? 621 LYS A C     1 
ATOM   2438 O  O     . LYS A 1 317 ? 26.459 24.088 26.165  1.00 34.15 ? 621 LYS A O     1 
ATOM   2439 C  CB    . LYS A 1 317 ? 24.665 22.617 24.194  1.00 35.76 ? 621 LYS A CB    1 
ATOM   2440 C  CG    . LYS A 1 317 ? 23.398 21.746 24.180  1.00 39.17 ? 621 LYS A CG    1 
ATOM   2441 C  CD    . LYS A 1 317 ? 23.338 20.839 22.943  1.00 43.39 ? 621 LYS A CD    1 
ATOM   2442 C  CE    . LYS A 1 317 ? 22.125 21.166 22.045  1.00 47.11 ? 621 LYS A CE    1 
ATOM   2443 N  NZ    . LYS A 1 317 ? 22.474 21.375 20.593  1.00 50.04 ? 621 LYS A NZ    1 
ATOM   2444 N  N     . SER A 1 318 ? 26.192 25.706 24.638  1.00 31.52 ? 622 SER A N     1 
ATOM   2445 C  CA    . SER A 1 318 ? 27.427 26.374 25.028  1.00 30.75 ? 622 SER A CA    1 
ATOM   2446 C  C     . SER A 1 318 ? 27.353 27.861 24.755  1.00 29.52 ? 622 SER A C     1 
ATOM   2447 O  O     . SER A 1 318 ? 26.475 28.335 24.042  1.00 31.11 ? 622 SER A O     1 
ATOM   2448 C  CB    . SER A 1 318 ? 28.658 25.760 24.337  1.00 30.23 ? 622 SER A CB    1 
ATOM   2449 O  OG    . SER A 1 318 ? 28.587 25.858 22.930  1.00 29.46 ? 622 SER A OG    1 
ATOM   2450 N  N     . LEU A 1 319 ? 28.290 28.597 25.330  1.00 28.68 ? 623 LEU A N     1 
ATOM   2451 C  CA    . LEU A 1 319 ? 28.304 30.037 25.184  1.00 28.22 ? 623 LEU A CA    1 
ATOM   2452 C  C     . LEU A 1 319 ? 29.735 30.557 25.146  1.00 27.51 ? 623 LEU A C     1 
ATOM   2453 O  O     . LEU A 1 319 ? 30.565 30.143 25.959  1.00 26.77 ? 623 LEU A O     1 
ATOM   2454 C  CB    . LEU A 1 319 ? 27.551 30.644 26.359  1.00 27.03 ? 623 LEU A CB    1 
ATOM   2455 C  CG    . LEU A 1 319 ? 27.556 32.157 26.382  1.00 27.75 ? 623 LEU A CG    1 
ATOM   2456 C  CD1   . LEU A 1 319 ? 26.910 32.696 25.112  1.00 25.12 ? 623 LEU A CD1   1 
ATOM   2457 C  CD2   . LEU A 1 319 ? 26.825 32.623 27.633  1.00 27.95 ? 623 LEU A CD2   1 
ATOM   2458 N  N     . SER A 1 320 ? 30.033 31.478 24.231  1.00 26.25 ? 624 SER A N     1 
ATOM   2459 C  CA    . SER A 1 320 ? 31.405 31.958 24.160  1.00 25.32 ? 624 SER A CA    1 
ATOM   2460 C  C     . SER A 1 320 ? 31.643 33.183 23.325  1.00 24.77 ? 624 SER A C     1 
ATOM   2461 O  O     . SER A 1 320 ? 30.772 33.643 22.595  1.00 24.25 ? 624 SER A O     1 
ATOM   2462 C  CB    . SER A 1 320 ? 32.303 30.862 23.577  1.00 26.78 ? 624 SER A CB    1 
ATOM   2463 O  OG    . SER A 1 320 ? 32.182 30.817 22.155  1.00 26.95 ? 624 SER A OG    1 
ATOM   2464 N  N     . ILE A 1 321 ? 32.849 33.722 23.458  1.00 24.60 ? 625 ILE A N     1 
ATOM   2465 C  CA    . ILE A 1 321 ? 33.252 34.820 22.600  1.00 23.75 ? 625 ILE A CA    1 
ATOM   2466 C  C     . ILE A 1 321 ? 34.543 34.344 21.958  1.00 25.42 ? 625 ILE A C     1 
ATOM   2467 O  O     . ILE A 1 321 ? 35.279 33.506 22.517  1.00 25.77 ? 625 ILE A O     1 
ATOM   2468 C  CB    . ILE A 1 321 ? 33.447 36.169 23.312  1.00 21.76 ? 625 ILE A CB    1 
ATOM   2469 C  CG1   . ILE A 1 321 ? 34.407 36.035 24.485  1.00 20.42 ? 625 ILE A CG1   1 
ATOM   2470 C  CG2   . ILE A 1 321 ? 32.088 36.736 23.671  1.00 20.77 ? 625 ILE A CG2   1 
ATOM   2471 C  CD1   . ILE A 1 321 ? 34.878 37.381 24.991  1.00 20.35 ? 625 ILE A CD1   1 
ATOM   2472 N  N     . ASP A 1 322 ? 34.803 34.866 20.770  1.00 26.07 ? 626 ASP A N     1 
ATOM   2473 C  CA    . ASP A 1 322 ? 35.960 34.455 19.993  1.00 27.83 ? 626 ASP A CA    1 
ATOM   2474 C  C     . ASP A 1 322 ? 36.413 35.703 19.234  1.00 28.86 ? 626 ASP A C     1 
ATOM   2475 O  O     . ASP A 1 322 ? 35.802 36.061 18.222  1.00 28.75 ? 626 ASP A O     1 
ATOM   2476 C  CB    . ASP A 1 322 ? 35.494 33.393 18.992  1.00 29.55 ? 626 ASP A CB    1 
ATOM   2477 C  CG    . ASP A 1 322 ? 36.520 32.304 18.721  1.00 33.02 ? 626 ASP A CG    1 
ATOM   2478 O  OD1   . ASP A 1 322 ? 37.747 32.559 18.626  1.00 30.44 ? 626 ASP A OD1   1 
ATOM   2479 O  OD2   . ASP A 1 322 ? 36.057 31.154 18.563  1.00 37.21 ? 626 ASP A OD2   1 
ATOM   2480 N  N     . ILE A 1 323 ? 37.479 36.345 19.718  1.00 27.62 ? 627 ILE A N     1 
ATOM   2481 C  CA    . ILE A 1 323 ? 38.030 37.567 19.123  1.00 26.57 ? 627 ILE A CA    1 
ATOM   2482 C  C     . ILE A 1 323 ? 39.367 37.279 18.423  1.00 26.57 ? 627 ILE A C     1 
ATOM   2483 O  O     . ILE A 1 323 ? 40.334 36.861 19.069  1.00 24.75 ? 627 ILE A O     1 
ATOM   2484 C  CB    . ILE A 1 323 ? 38.271 38.610 20.226  1.00 27.55 ? 627 ILE A CB    1 
ATOM   2485 C  CG1   . ILE A 1 323 ? 37.047 38.667 21.142  1.00 26.95 ? 627 ILE A CG1   1 
ATOM   2486 C  CG2   . ILE A 1 323 ? 38.545 39.970 19.617  1.00 23.04 ? 627 ILE A CG2   1 
ATOM   2487 C  CD1   . ILE A 1 323 ? 35.844 39.298 20.498  1.00 30.69 ? 627 ILE A CD1   1 
ATOM   2488 N  N     . ASN A 1 324 ? 39.433 37.524 17.116  1.00 26.17 ? 628 ASN A N     1 
ATOM   2489 C  CA    . ASN A 1 324 ? 40.655 37.240 16.369  1.00 25.39 ? 628 ASN A CA    1 
ATOM   2490 C  C     . ASN A 1 324 ? 41.095 38.367 15.449  1.00 25.82 ? 628 ASN A C     1 
ATOM   2491 O  O     . ASN A 1 324 ? 41.864 38.169 14.503  1.00 25.79 ? 628 ASN A O     1 
ATOM   2492 C  CB    . ASN A 1 324 ? 40.460 35.946 15.595  1.00 24.11 ? 628 ASN A CB    1 
ATOM   2493 C  CG    . ASN A 1 324 ? 40.249 34.765 16.520  1.00 26.01 ? 628 ASN A CG    1 
ATOM   2494 O  OD1   . ASN A 1 324 ? 41.210 34.234 17.094  1.00 23.83 ? 628 ASN A OD1   1 
ATOM   2495 N  ND2   . ASN A 1 324 ? 38.988 34.368 16.703  1.00 21.91 ? 628 ASN A ND2   1 
ATOM   2496 N  N     . TRP A 1 325 ? 40.602 39.559 15.747  1.00 24.88 ? 629 TRP A N     1 
ATOM   2497 C  CA    . TRP A 1 325 ? 40.947 40.742 14.985  1.00 25.02 ? 629 TRP A CA    1 
ATOM   2498 C  C     . TRP A 1 325 ? 41.178 41.851 15.985  1.00 24.94 ? 629 TRP A C     1 
ATOM   2499 O  O     . TRP A 1 325 ? 40.459 41.959 16.975  1.00 24.72 ? 629 TRP A O     1 
ATOM   2500 C  CB    . TRP A 1 325 ? 39.816 41.147 14.051  1.00 23.71 ? 629 TRP A CB    1 
ATOM   2501 C  CG    . TRP A 1 325 ? 40.215 42.243 13.106  1.00 23.98 ? 629 TRP A CG    1 
ATOM   2502 C  CD1   . TRP A 1 325 ? 40.878 42.102 11.919  1.00 22.67 ? 629 TRP A CD1   1 
ATOM   2503 C  CD2   . TRP A 1 325 ? 39.943 43.643 13.249  1.00 22.28 ? 629 TRP A CD2   1 
ATOM   2504 N  NE1   . TRP A 1 325 ? 41.023 43.325 11.310  1.00 22.77 ? 629 TRP A NE1   1 
ATOM   2505 C  CE2   . TRP A 1 325 ? 40.460 44.288 12.104  1.00 22.46 ? 629 TRP A CE2   1 
ATOM   2506 C  CE3   . TRP A 1 325 ? 39.313 44.414 14.232  1.00 22.37 ? 629 TRP A CE3   1 
ATOM   2507 C  CZ2   . TRP A 1 325 ? 40.363 45.673 11.913  1.00 23.39 ? 629 TRP A CZ2   1 
ATOM   2508 C  CZ3   . TRP A 1 325 ? 39.214 45.796 14.043  1.00 22.49 ? 629 TRP A CZ3   1 
ATOM   2509 C  CH2   . TRP A 1 325 ? 39.737 46.407 12.891  1.00 22.71 ? 629 TRP A CH2   1 
ATOM   2510 N  N     . GLY A 1 326 ? 42.195 42.663 15.731  1.00 25.13 ? 630 GLY A N     1 
ATOM   2511 C  CA    . GLY A 1 326 ? 42.494 43.758 16.628  1.00 23.64 ? 630 GLY A CA    1 
ATOM   2512 C  C     . GLY A 1 326 ? 43.149 43.333 17.926  1.00 23.95 ? 630 GLY A C     1 
ATOM   2513 O  O     . GLY A 1 326 ? 43.212 44.128 18.865  1.00 25.58 ? 630 GLY A O     1 
ATOM   2514 N  N     . ILE A 1 327 ? 43.637 42.098 18.006  1.00 22.69 ? 631 ILE A N     1 
ATOM   2515 C  CA    . ILE A 1 327 ? 44.283 41.661 19.236  1.00 23.33 ? 631 ILE A CA    1 
ATOM   2516 C  C     . ILE A 1 327 ? 45.799 41.910 19.239  1.00 24.85 ? 631 ILE A C     1 
ATOM   2517 O  O     . ILE A 1 327 ? 46.572 41.221 18.569  1.00 22.96 ? 631 ILE A O     1 
ATOM   2518 C  CB    . ILE A 1 327 ? 43.932 40.178 19.552  1.00 24.64 ? 631 ILE A CB    1 
ATOM   2519 C  CG1   . ILE A 1 327 ? 42.809 40.139 20.583  1.00 27.96 ? 631 ILE A CG1   1 
ATOM   2520 C  CG2   . ILE A 1 327 ? 45.026 39.481 20.311  1.00 23.81 ? 631 ILE A CG2   1 
ATOM   2521 C  CD1   . ILE A 1 327 ? 41.482 40.163 20.034  1.00 28.19 ? 631 ILE A CD1   1 
ATOM   2522 N  N     . ARG A 1 328 ? 46.207 42.924 19.999  1.00 25.15 ? 632 ARG A N     1 
ATOM   2523 C  CA    . ARG A 1 328 ? 47.616 43.306 20.106  1.00 25.66 ? 632 ARG A CA    1 
ATOM   2524 C  C     . ARG A 1 328 ? 47.901 43.712 21.549  1.00 25.41 ? 632 ARG A C     1 
ATOM   2525 O  O     . ARG A 1 328 ? 47.420 44.746 22.019  1.00 26.50 ? 632 ARG A O     1 
ATOM   2526 C  CB    . ARG A 1 328 ? 47.922 44.491 19.171  1.00 23.82 ? 632 ARG A CB    1 
ATOM   2527 C  CG    . ARG A 1 328 ? 47.639 44.237 17.698  1.00 22.55 ? 632 ARG A CG    1 
ATOM   2528 C  CD    . ARG A 1 328 ? 48.550 43.174 17.147  1.00 23.53 ? 632 ARG A CD    1 
ATOM   2529 N  NE    . ARG A 1 328 ? 47.864 42.313 16.190  1.00 31.93 ? 632 ARG A NE    1 
ATOM   2530 C  CZ    . ARG A 1 328 ? 47.805 42.569 14.895  1.00 32.71 ? 632 ARG A CZ    1 
ATOM   2531 N  NH1   . ARG A 1 328 ? 48.393 43.651 14.433  1.00 36.67 ? 632 ARG A NH1   1 
ATOM   2532 N  NH2   . ARG A 1 328 ? 47.170 41.764 14.068  1.00 34.59 ? 632 ARG A NH2   1 
ATOM   2533 N  N     . PHE A 1 329 ? 48.687 42.903 22.250  1.00 24.95 ? 633 PHE A N     1 
ATOM   2534 C  CA    . PHE A 1 329 ? 49.011 43.191 23.646  1.00 24.99 ? 633 PHE A CA    1 
ATOM   2535 C  C     . PHE A 1 329 ? 50.510 43.229 23.910  1.00 24.75 ? 633 PHE A C     1 
ATOM   2536 O  O     . PHE A 1 329 ? 51.292 42.611 23.195  1.00 24.80 ? 633 PHE A O     1 
ATOM   2537 C  CB    . PHE A 1 329 ? 48.367 42.143 24.563  1.00 23.31 ? 633 PHE A CB    1 
ATOM   2538 C  CG    . PHE A 1 329 ? 46.860 42.212 24.616  1.00 25.54 ? 633 PHE A CG    1 
ATOM   2539 C  CD1   . PHE A 1 329 ? 46.077 41.202 24.073  1.00 25.57 ? 633 PHE A CD1   1 
ATOM   2540 C  CD2   . PHE A 1 329 ? 46.228 43.273 25.245  1.00 27.91 ? 633 PHE A CD2   1 
ATOM   2541 C  CE1   . PHE A 1 329 ? 44.683 41.245 24.162  1.00 27.42 ? 633 PHE A CE1   1 
ATOM   2542 C  CE2   . PHE A 1 329 ? 44.837 43.331 25.341  1.00 31.08 ? 633 PHE A CE2   1 
ATOM   2543 C  CZ    . PHE A 1 329 ? 44.059 42.311 24.798  1.00 29.66 ? 633 PHE A CZ    1 
ATOM   2544 N  N     . LYS A 1 330 ? 50.911 43.946 24.950  1.00 26.26 ? 634 LYS A N     1 
ATOM   2545 C  CA    . LYS A 1 330 ? 52.324 44.015 25.293  1.00 28.36 ? 634 LYS A CA    1 
ATOM   2546 C  C     . LYS A 1 330 ? 52.686 43.263 26.577  1.00 28.78 ? 634 LYS A C     1 
ATOM   2547 O  O     . LYS A 1 330 ? 53.780 42.710 26.665  1.00 31.23 ? 634 LYS A O     1 
ATOM   2548 C  CB    . LYS A 1 330 ? 52.778 45.471 25.393  1.00 26.78 ? 634 LYS A CB    1 
ATOM   2549 C  CG    . LYS A 1 330 ? 52.763 46.207 24.062  1.00 28.16 ? 634 LYS A CG    1 
ATOM   2550 C  CD    . LYS A 1 330 ? 52.925 47.693 24.306  1.00 32.32 ? 634 LYS A CD    1 
ATOM   2551 C  CE    . LYS A 1 330 ? 52.893 48.517 23.037  1.00 31.50 ? 634 LYS A CE    1 
ATOM   2552 N  NZ    . LYS A 1 330 ? 53.414 49.875 23.370  1.00 32.24 ? 634 LYS A NZ    1 
ATOM   2553 N  N     . ASN A 1 331 ? 51.789 43.211 27.559  1.00 28.67 ? 635 ASN A N     1 
ATOM   2554 C  CA    . ASN A 1 331 ? 52.099 42.515 28.805  1.00 27.56 ? 635 ASN A CA    1 
ATOM   2555 C  C     . ASN A 1 331 ? 50.963 41.671 29.388  1.00 27.68 ? 635 ASN A C     1 
ATOM   2556 O  O     . ASN A 1 331 ? 49.798 41.895 29.053  1.00 27.44 ? 635 ASN A O     1 
ATOM   2557 C  CB    . ASN A 1 331 ? 52.567 43.516 29.867  1.00 26.70 ? 635 ASN A CB    1 
ATOM   2558 C  CG    . ASN A 1 331 ? 51.500 44.543 30.227  1.00 27.59 ? 635 ASN A CG    1 
ATOM   2559 O  OD1   . ASN A 1 331 ? 51.756 45.739 30.203  1.00 27.64 ? 635 ASN A OD1   1 
ATOM   2560 N  ND2   . ASN A 1 331 ? 50.303 44.073 30.586  1.00 27.21 ? 635 ASN A ND2   1 
ATOM   2561 N  N     . ILE A 1 332 ? 51.277 40.728 30.276  1.00 27.17 ? 636 ILE A N     1 
ATOM   2562 C  CA    . ILE A 1 332 ? 50.244 39.908 30.851  1.00 26.57 ? 636 ILE A CA    1 
ATOM   2563 C  C     . ILE A 1 332 ? 49.145 40.692 31.591  1.00 26.36 ? 636 ILE A C     1 
ATOM   2564 O  O     . ILE A 1 332 ? 48.005 40.251 31.596  1.00 26.56 ? 636 ILE A O     1 
ATOM   2565 C  CB    . ILE A 1 332 ? 50.813 38.802 31.824  1.00 28.05 ? 636 ILE A CB    1 
ATOM   2566 C  CG1   . ILE A 1 332 ? 49.686 37.802 32.163  1.00 29.12 ? 636 ILE A CG1   1 
ATOM   2567 C  CG2   . ILE A 1 332 ? 51.340 39.435 33.097  1.00 26.68 ? 636 ILE A CG2   1 
ATOM   2568 C  CD1   . ILE A 1 332 ? 49.672 36.604 31.259  1.00 31.01 ? 636 ILE A CD1   1 
ATOM   2569 N  N     . THR A 1 333 ? 49.459 41.842 32.187  1.00 25.23 ? 637 THR A N     1 
ATOM   2570 C  CA    . THR A 1 333 ? 48.434 42.627 32.896  1.00 24.46 ? 637 THR A CA    1 
ATOM   2571 C  C     . THR A 1 333 ? 47.257 43.051 32.000  1.00 23.95 ? 637 THR A C     1 
ATOM   2572 O  O     . THR A 1 333 ? 46.083 42.977 32.399  1.00 24.58 ? 637 THR A O     1 
ATOM   2573 C  CB    . THR A 1 333 ? 49.045 43.895 33.540  1.00 25.09 ? 637 THR A CB    1 
ATOM   2574 O  OG1   . THR A 1 333 ? 50.065 43.510 34.465  1.00 27.91 ? 637 THR A OG1   1 
ATOM   2575 C  CG2   . THR A 1 333 ? 47.990 44.709 34.281  1.00 22.33 ? 637 THR A CG2   1 
ATOM   2576 N  N     . GLN A 1 334 ? 47.567 43.488 30.786  1.00 22.29 ? 638 GLN A N     1 
ATOM   2577 C  CA    . GLN A 1 334 ? 46.530 43.890 29.840  1.00 23.01 ? 638 GLN A CA    1 
ATOM   2578 C  C     . GLN A 1 334 ? 45.699 42.658 29.471  1.00 22.85 ? 638 GLN A C     1 
ATOM   2579 O  O     . GLN A 1 334 ? 44.473 42.726 29.381  1.00 22.82 ? 638 GLN A O     1 
ATOM   2580 C  CB    . GLN A 1 334 ? 47.157 44.447 28.559  1.00 23.92 ? 638 GLN A CB    1 
ATOM   2581 C  CG    . GLN A 1 334 ? 48.116 45.640 28.686  1.00 23.98 ? 638 GLN A CG    1 
ATOM   2582 C  CD    . GLN A 1 334 ? 48.782 45.962 27.361  1.00 26.96 ? 638 GLN A CD    1 
ATOM   2583 O  OE1   . GLN A 1 334 ? 49.607 45.186 26.864  1.00 27.65 ? 638 GLN A OE1   1 
ATOM   2584 N  NE2   . GLN A 1 334 ? 48.386 47.116 26.759  1.00 24.61 ? 638 GLN A NE2   1 
ATOM   2585 N  N     . VAL A 1 335 ? 46.372 41.531 29.260  1.00 22.62 ? 639 VAL A N     1 
ATOM   2586 C  CA    . VAL A 1 335 ? 45.679 40.303 28.914  1.00 22.78 ? 639 VAL A CA    1 
ATOM   2587 C  C     . VAL A 1 335 ? 44.722 39.912 30.018  1.00 24.32 ? 639 VAL A C     1 
ATOM   2588 O  O     . VAL A 1 335 ? 43.556 39.581 29.757  1.00 24.46 ? 639 VAL A O     1 
ATOM   2589 C  CB    . VAL A 1 335 ? 46.668 39.148 28.671  1.00 22.31 ? 639 VAL A CB    1 
ATOM   2590 C  CG1   . VAL A 1 335 ? 45.913 37.836 28.493  1.00 20.77 ? 639 VAL A CG1   1 
ATOM   2591 C  CG2   . VAL A 1 335 ? 47.492 39.446 27.426  1.00 21.92 ? 639 VAL A CG2   1 
ATOM   2592 N  N     . ASP A 1 336 ? 45.202 39.954 31.257  1.00 24.56 ? 640 ASP A N     1 
ATOM   2593 C  CA    . ASP A 1 336 ? 44.328 39.596 32.365  1.00 26.18 ? 640 ASP A CA    1 
ATOM   2594 C  C     . ASP A 1 336 ? 43.112 40.496 32.400  1.00 25.55 ? 640 ASP A C     1 
ATOM   2595 O  O     . ASP A 1 336 ? 42.002 40.009 32.591  1.00 25.36 ? 640 ASP A O     1 
ATOM   2596 C  CB    . ASP A 1 336 ? 45.027 39.694 33.717  1.00 28.18 ? 640 ASP A CB    1 
ATOM   2597 C  CG    . ASP A 1 336 ? 45.893 38.481 34.031  1.00 34.86 ? 640 ASP A CG    1 
ATOM   2598 O  OD1   . ASP A 1 336 ? 45.872 37.483 33.261  1.00 32.88 ? 640 ASP A OD1   1 
ATOM   2599 O  OD2   . ASP A 1 336 ? 46.599 38.536 35.071  1.00 37.49 ? 640 ASP A OD2   1 
ATOM   2600 N  N     . LEU A 1 337 ? 43.302 41.800 32.218  1.00 23.88 ? 641 LEU A N     1 
ATOM   2601 C  CA    . LEU A 1 337 ? 42.156 42.700 32.270  1.00 24.46 ? 641 LEU A CA    1 
ATOM   2602 C  C     . LEU A 1 337 ? 41.187 42.402 31.146  1.00 23.88 ? 641 LEU A C     1 
ATOM   2603 O  O     . LEU A 1 337 ? 39.976 42.521 31.315  1.00 24.03 ? 641 LEU A O     1 
ATOM   2604 C  CB    . LEU A 1 337 ? 42.592 44.160 32.181  1.00 23.72 ? 641 LEU A CB    1 
ATOM   2605 C  CG    . LEU A 1 337 ? 43.468 44.619 33.342  1.00 24.88 ? 641 LEU A CG    1 
ATOM   2606 C  CD1   . LEU A 1 337 ? 44.143 45.926 32.978  1.00 21.86 ? 641 LEU A CD1   1 
ATOM   2607 C  CD2   . LEU A 1 337 ? 42.636 44.744 34.609  1.00 21.49 ? 641 LEU A CD2   1 
ATOM   2608 N  N     . PHE A 1 338 ? 41.726 42.017 29.996  1.00 22.17 ? 642 PHE A N     1 
ATOM   2609 C  CA    . PHE A 1 338 ? 40.896 41.710 28.854  1.00 20.77 ? 642 PHE A CA    1 
ATOM   2610 C  C     . PHE A 1 338 ? 40.075 40.449 29.157  1.00 22.64 ? 642 PHE A C     1 
ATOM   2611 O  O     . PHE A 1 338 ? 38.872 40.376 28.876  1.00 19.18 ? 642 PHE A O     1 
ATOM   2612 C  CB    . PHE A 1 338 ? 41.784 41.504 27.637  1.00 20.99 ? 642 PHE A CB    1 
ATOM   2613 C  CG    . PHE A 1 338 ? 41.031 41.173 26.385  1.00 20.81 ? 642 PHE A CG    1 
ATOM   2614 C  CD1   . PHE A 1 338 ? 40.567 42.173 25.534  1.00 19.38 ? 642 PHE A CD1   1 
ATOM   2615 C  CD2   . PHE A 1 338 ? 40.806 39.848 26.044  1.00 21.27 ? 642 PHE A CD2   1 
ATOM   2616 C  CE1   . PHE A 1 338 ? 39.897 41.850 24.355  1.00 19.05 ? 642 PHE A CE1   1 
ATOM   2617 C  CE2   . PHE A 1 338 ? 40.138 39.514 24.871  1.00 22.04 ? 642 PHE A CE2   1 
ATOM   2618 C  CZ    . PHE A 1 338 ? 39.683 40.517 24.023  1.00 20.03 ? 642 PHE A CZ    1 
ATOM   2619 N  N     . ILE A 1 339 ? 40.735 39.455 29.735  1.00 22.92 ? 643 ILE A N     1 
ATOM   2620 C  CA    . ILE A 1 339 ? 40.066 38.223 30.096  1.00 23.03 ? 643 ILE A CA    1 
ATOM   2621 C  C     . ILE A 1 339 ? 38.959 38.520 31.106  1.00 24.66 ? 643 ILE A C     1 
ATOM   2622 O  O     . ILE A 1 339 ? 37.837 37.999 30.996  1.00 23.63 ? 643 ILE A O     1 
ATOM   2623 C  CB    . ILE A 1 339 ? 41.080 37.242 30.678  1.00 23.85 ? 643 ILE A CB    1 
ATOM   2624 C  CG1   . ILE A 1 339 ? 41.938 36.691 29.540  1.00 23.01 ? 643 ILE A CG1   1 
ATOM   2625 C  CG2   . ILE A 1 339 ? 40.381 36.132 31.450  1.00 23.21 ? 643 ILE A CG2   1 
ATOM   2626 C  CD1   . ILE A 1 339 ? 42.995 35.728 30.000  1.00 22.44 ? 643 ILE A CD1   1 
ATOM   2627 N  N     . GLU A 1 340 ? 39.267 39.371 32.078  1.00 24.36 ? 644 GLU A N     1 
ATOM   2628 C  CA    . GLU A 1 340 ? 38.282 39.725 33.081  1.00 26.25 ? 644 GLU A CA    1 
ATOM   2629 C  C     . GLU A 1 340 ? 37.057 40.352 32.434  1.00 27.13 ? 644 GLU A C     1 
ATOM   2630 O  O     . GLU A 1 340 ? 35.926 39.958 32.731  1.00 25.47 ? 644 GLU A O     1 
ATOM   2631 C  CB    . GLU A 1 340 ? 38.886 40.682 34.099  1.00 28.04 ? 644 GLU A CB    1 
ATOM   2632 C  CG    . GLU A 1 340 ? 39.654 39.961 35.178  1.00 32.10 ? 644 GLU A CG    1 
ATOM   2633 C  CD    . GLU A 1 340 ? 40.483 40.885 36.042  1.00 34.36 ? 644 GLU A CD    1 
ATOM   2634 O  OE1   . GLU A 1 340 ? 40.094 42.064 36.227  1.00 36.01 ? 644 GLU A OE1   1 
ATOM   2635 O  OE2   . GLU A 1 340 ? 41.525 40.417 36.548  1.00 34.30 ? 644 GLU A OE2   1 
ATOM   2636 N  N     . ARG A 1 341 ? 37.277 41.325 31.549  1.00 26.56 ? 645 ARG A N     1 
ATOM   2637 C  CA    . ARG A 1 341 ? 36.161 41.975 30.867  1.00 27.58 ? 645 ARG A CA    1 
ATOM   2638 C  C     . ARG A 1 341 ? 35.380 40.980 30.037  1.00 25.72 ? 645 ARG A C     1 
ATOM   2639 O  O     . ARG A 1 341 ? 34.161 41.082 29.935  1.00 26.73 ? 645 ARG A O     1 
ATOM   2640 C  CB    . ARG A 1 341 ? 36.634 43.086 29.933  1.00 29.45 ? 645 ARG A CB    1 
ATOM   2641 C  CG    . ARG A 1 341 ? 37.167 44.320 30.617  1.00 34.38 ? 645 ARG A CG    1 
ATOM   2642 C  CD    . ARG A 1 341 ? 37.790 45.236 29.574  1.00 34.87 ? 645 ARG A CD    1 
ATOM   2643 N  NE    . ARG A 1 341 ? 38.953 45.950 30.093  1.00 38.82 ? 645 ARG A NE    1 
ATOM   2644 C  CZ    . ARG A 1 341 ? 40.148 45.963 29.508  1.00 38.76 ? 645 ARG A CZ    1 
ATOM   2645 N  NH1   . ARG A 1 341 ? 40.353 45.295 28.374  1.00 35.65 ? 645 ARG A NH1   1 
ATOM   2646 N  NH2   . ARG A 1 341 ? 41.135 46.660 30.059  1.00 41.24 ? 645 ARG A NH2   1 
ATOM   2647 N  N     . GLY A 1 342 ? 36.090 40.041 29.421  1.00 22.99 ? 646 GLY A N     1 
ATOM   2648 C  CA    . GLY A 1 342 ? 35.438 39.038 28.604  1.00 23.27 ? 646 GLY A CA    1 
ATOM   2649 C  C     . GLY A 1 342 ? 34.524 38.176 29.457  1.00 24.27 ? 646 GLY A C     1 
ATOM   2650 O  O     . GLY A 1 342 ? 33.417 37.840 29.036  1.00 24.58 ? 646 GLY A O     1 
ATOM   2651 N  N     . CYS A 1 343 ? 34.988 37.808 30.651  1.00 24.47 ? 647 CYS A N     1 
ATOM   2652 C  CA    . CYS A 1 343 ? 34.176 37.010 31.558  1.00 25.84 ? 647 CYS A CA    1 
ATOM   2653 C  C     . CYS A 1 343 ? 33.003 37.853 32.050  1.00 26.09 ? 647 CYS A C     1 
ATOM   2654 O  O     . CYS A 1 343 ? 31.923 37.320 32.288  1.00 24.92 ? 647 CYS A O     1 
ATOM   2655 C  CB    . CYS A 1 343 ? 34.996 36.524 32.757  1.00 26.59 ? 647 CYS A CB    1 
ATOM   2656 S  SG    . CYS A 1 343 ? 36.306 35.322 32.336  1.00 32.72 ? 647 CYS A SG    1 
ATOM   2657 N  N     . GLN A 1 344 ? 33.193 39.163 32.201  1.00 24.49 ? 648 GLN A N     1 
ATOM   2658 C  CA    . GLN A 1 344 ? 32.068 39.975 32.653  1.00 26.34 ? 648 GLN A CA    1 
ATOM   2659 C  C     . GLN A 1 344 ? 30.993 40.001 31.584  1.00 26.01 ? 648 GLN A C     1 
ATOM   2660 O  O     . GLN A 1 344 ? 29.800 39.939 31.891  1.00 25.68 ? 648 GLN A O     1 
ATOM   2661 C  CB    . GLN A 1 344 ? 32.480 41.407 32.966  1.00 25.97 ? 648 GLN A CB    1 
ATOM   2662 C  CG    . GLN A 1 344 ? 33.350 41.563 34.195  1.00 28.51 ? 648 GLN A CG    1 
ATOM   2663 C  CD    . GLN A 1 344 ? 33.736 43.012 34.405  1.00 27.94 ? 648 GLN A CD    1 
ATOM   2664 O  OE1   . GLN A 1 344 ? 33.186 43.700 35.269  1.00 28.60 ? 648 GLN A OE1   1 
ATOM   2665 N  NE2   . GLN A 1 344 ? 34.662 43.492 33.590  1.00 26.92 ? 648 GLN A NE2   1 
ATOM   2666 N  N     . TYR A 1 345 ? 31.420 40.083 30.326  1.00 25.83 ? 649 TYR A N     1 
ATOM   2667 C  CA    . TYR A 1 345 ? 30.488 40.125 29.204  1.00 25.82 ? 649 TYR A CA    1 
ATOM   2668 C  C     . TYR A 1 345 ? 29.720 38.810 29.106  1.00 26.09 ? 649 TYR A C     1 
ATOM   2669 O  O     . TYR A 1 345 ? 28.494 38.800 28.973  1.00 24.33 ? 649 TYR A O     1 
ATOM   2670 C  CB    . TYR A 1 345 ? 31.249 40.387 27.907  1.00 25.80 ? 649 TYR A CB    1 
ATOM   2671 C  CG    . TYR A 1 345 ? 30.414 40.294 26.657  1.00 24.00 ? 649 TYR A CG    1 
ATOM   2672 C  CD1   . TYR A 1 345 ? 29.776 41.417 26.128  1.00 25.05 ? 649 TYR A CD1   1 
ATOM   2673 C  CD2   . TYR A 1 345 ? 30.261 39.078 26.001  1.00 23.60 ? 649 TYR A CD2   1 
ATOM   2674 C  CE1   . TYR A 1 345 ? 28.993 41.326 24.955  1.00 23.01 ? 649 TYR A CE1   1 
ATOM   2675 C  CE2   . TYR A 1 345 ? 29.491 38.972 24.842  1.00 24.97 ? 649 TYR A CE2   1 
ATOM   2676 C  CZ    . TYR A 1 345 ? 28.861 40.100 24.325  1.00 24.08 ? 649 TYR A CZ    1 
ATOM   2677 O  OH    . TYR A 1 345 ? 28.113 39.973 23.182  1.00 26.08 ? 649 TYR A OH    1 
ATOM   2678 N  N     . LEU A 1 346 ? 30.447 37.702 29.188  1.00 26.21 ? 650 LEU A N     1 
ATOM   2679 C  CA    . LEU A 1 346 ? 29.824 36.396 29.119  1.00 26.73 ? 650 LEU A CA    1 
ATOM   2680 C  C     . LEU A 1 346 ? 28.887 36.123 30.280  1.00 27.24 ? 650 LEU A C     1 
ATOM   2681 O  O     . LEU A 1 346 ? 27.822 35.533 30.091  1.00 27.27 ? 650 LEU A O     1 
ATOM   2682 C  CB    . LEU A 1 346 ? 30.867 35.306 29.093  1.00 27.16 ? 650 LEU A CB    1 
ATOM   2683 C  CG    . LEU A 1 346 ? 31.599 35.065 27.788  1.00 30.61 ? 650 LEU A CG    1 
ATOM   2684 C  CD1   . LEU A 1 346 ? 32.534 33.907 28.048  1.00 30.41 ? 650 LEU A CD1   1 
ATOM   2685 C  CD2   . LEU A 1 346 ? 30.645 34.736 26.640  1.00 28.97 ? 650 LEU A CD2   1 
ATOM   2686 N  N     . LEU A 1 347 ? 29.278 36.530 31.484  1.00 27.17 ? 651 LEU A N     1 
ATOM   2687 C  CA    . LEU A 1 347 ? 28.418 36.287 32.623  1.00 28.40 ? 651 LEU A CA    1 
ATOM   2688 C  C     . LEU A 1 347 ? 27.087 37.056 32.480  1.00 29.89 ? 651 LEU A C     1 
ATOM   2689 O  O     . LEU A 1 347 ? 26.046 36.540 32.890  1.00 28.61 ? 651 LEU A O     1 
ATOM   2690 C  CB    . LEU A 1 347 ? 29.159 36.600 33.930  1.00 28.81 ? 651 LEU A CB    1 
ATOM   2691 C  CG    . LEU A 1 347 ? 30.208 35.520 34.261  1.00 30.04 ? 651 LEU A CG    1 
ATOM   2692 C  CD1   . LEU A 1 347 ? 31.048 35.917 35.462  1.00 31.42 ? 651 LEU A CD1   1 
ATOM   2693 C  CD2   . LEU A 1 347 ? 29.510 34.193 34.533  1.00 31.17 ? 651 LEU A CD2   1 
ATOM   2694 N  N     . GLU A 1 348 ? 27.111 38.248 31.869  1.00 30.93 ? 652 GLU A N     1 
ATOM   2695 C  CA    . GLU A 1 348 ? 25.887 39.028 31.638  1.00 33.78 ? 652 GLU A CA    1 
ATOM   2696 C  C     . GLU A 1 348 ? 24.952 38.157 30.784  1.00 33.87 ? 652 GLU A C     1 
ATOM   2697 O  O     . GLU A 1 348 ? 23.751 38.058 31.044  1.00 34.35 ? 652 GLU A O     1 
ATOM   2698 C  CB    . GLU A 1 348 ? 26.216 40.335 30.879  1.00 38.27 ? 652 GLU A CB    1 
ATOM   2699 C  CG    . GLU A 1 348 ? 25.664 41.639 31.458  1.00 45.35 ? 652 GLU A CG    1 
ATOM   2700 C  CD    . GLU A 1 348 ? 26.283 42.887 30.808  1.00 52.32 ? 652 GLU A CD    1 
ATOM   2701 O  OE1   . GLU A 1 348 ? 25.623 43.550 29.967  1.00 55.37 ? 652 GLU A OE1   1 
ATOM   2702 O  OE2   . GLU A 1 348 ? 27.458 43.193 31.134  1.00 56.07 ? 652 GLU A OE2   1 
ATOM   2703 N  N     . LYS A 1 349 ? 25.531 37.521 29.767  1.00 32.12 ? 653 LYS A N     1 
ATOM   2704 C  CA    . LYS A 1 349 ? 24.790 36.656 28.859  1.00 32.17 ? 653 LYS A CA    1 
ATOM   2705 C  C     . LYS A 1 349 ? 24.276 35.399 29.581  1.00 32.23 ? 653 LYS A C     1 
ATOM   2706 O  O     . LYS A 1 349 ? 23.101 35.031 29.468  1.00 32.79 ? 653 LYS A O     1 
ATOM   2707 C  CB    . LYS A 1 349 ? 25.677 36.265 27.667  1.00 31.20 ? 653 LYS A CB    1 
ATOM   2708 N  N     . LEU A 1 350 ? 25.160 34.753 30.330  1.00 31.31 ? 654 LEU A N     1 
ATOM   2709 C  CA    . LEU A 1 350 ? 24.802 33.553 31.068  1.00 32.40 ? 654 LEU A CA    1 
ATOM   2710 C  C     . LEU A 1 350 ? 23.617 33.777 31.996  1.00 33.44 ? 654 LEU A C     1 
ATOM   2711 O  O     . LEU A 1 350 ? 22.734 32.935 32.099  1.00 33.13 ? 654 LEU A O     1 
ATOM   2712 C  CB    . LEU A 1 350 ? 25.968 33.093 31.929  1.00 30.43 ? 654 LEU A CB    1 
ATOM   2713 C  CG    . LEU A 1 350 ? 26.457 31.646 31.905  1.00 32.20 ? 654 LEU A CG    1 
ATOM   2714 C  CD1   . LEU A 1 350 ? 26.956 31.331 33.299  1.00 28.35 ? 654 LEU A CD1   1 
ATOM   2715 C  CD2   . LEU A 1 350 ? 25.376 30.662 31.491  1.00 29.55 ? 654 LEU A CD2   1 
ATOM   2716 N  N     . ASN A 1 351 ? 23.625 34.909 32.688  1.00 34.12 ? 655 ASN A N     1 
ATOM   2717 C  CA    . ASN A 1 351 ? 22.569 35.217 33.627  1.00 36.87 ? 655 ASN A CA    1 
ATOM   2718 C  C     . ASN A 1 351 ? 21.243 35.588 32.934  1.00 37.83 ? 655 ASN A C     1 
ATOM   2719 O  O     . ASN A 1 351 ? 20.166 35.315 33.461  1.00 38.96 ? 655 ASN A O     1 
ATOM   2720 C  CB    . ASN A 1 351 ? 23.091 36.271 34.626  1.00 36.41 ? 655 ASN A CB    1 
ATOM   2721 C  CG    . ASN A 1 351 ? 24.233 35.711 35.504  1.00 38.97 ? 655 ASN A CG    1 
ATOM   2722 O  OD1   . ASN A 1 351 ? 24.221 34.522 35.851  1.00 41.77 ? 655 ASN A OD1   1 
ATOM   2723 N  ND2   . ASN A 1 351 ? 25.207 36.555 35.864  1.00 36.63 ? 655 ASN A ND2   1 
ATOM   2724 N  N     . GLU A 1 352 ? 21.344 36.142 31.727  1.00 38.33 ? 656 GLU A N     1 
ATOM   2725 C  CA    . GLU A 1 352 ? 20.211 36.529 30.867  1.00 40.16 ? 656 GLU A CA    1 
ATOM   2726 C  C     . GLU A 1 352 ? 19.471 35.247 30.423  1.00 39.99 ? 656 GLU A C     1 
ATOM   2727 O  O     . GLU A 1 352 ? 18.261 35.261 30.211  1.00 40.73 ? 656 GLU A O     1 
ATOM   2728 C  CB    . GLU A 1 352 ? 20.773 37.212 29.617  1.00 42.41 ? 656 GLU A CB    1 
ATOM   2729 C  CG    . GLU A 1 352 ? 20.088 38.429 29.024  1.00 47.44 ? 656 GLU A CG    1 
ATOM   2730 C  CD    . GLU A 1 352 ? 20.909 38.961 27.837  1.00 51.27 ? 656 GLU A CD    1 
ATOM   2731 O  OE1   . GLU A 1 352 ? 21.002 38.238 26.815  1.00 52.19 ? 656 GLU A OE1   1 
ATOM   2732 O  OE2   . GLU A 1 352 ? 21.484 40.076 27.931  1.00 51.30 ? 656 GLU A OE2   1 
ATOM   2733 N  N     . ILE A 1 353 ? 20.205 34.148 30.246  1.00 38.76 ? 657 ILE A N     1 
ATOM   2734 C  CA    . ILE A 1 353 ? 19.570 32.899 29.825  1.00 37.91 ? 657 ILE A CA    1 
ATOM   2735 C  C     . ILE A 1 353 ? 19.400 31.903 30.991  1.00 37.71 ? 657 ILE A C     1 
ATOM   2736 O  O     . ILE A 1 353 ? 19.153 30.720 30.770  1.00 37.17 ? 657 ILE A O     1 
ATOM   2737 C  CB    . ILE A 1 353 ? 20.351 32.215 28.642  1.00 38.11 ? 657 ILE A CB    1 
ATOM   2738 C  CG1   . ILE A 1 353 ? 21.716 31.690 29.105  1.00 37.64 ? 657 ILE A CG1   1 
ATOM   2739 C  CG2   . ILE A 1 353 ? 20.544 33.218 27.500  1.00 38.39 ? 657 ILE A CG2   1 
ATOM   2740 C  CD1   . ILE A 1 353 ? 22.456 30.909 28.038  1.00 37.48 ? 657 ILE A CD1   1 
ATOM   2741 N  N     . ASN A 1 354 ? 19.496 32.424 32.218  1.00 37.99 ? 658 ASN A N     1 
ATOM   2742 C  CA    . ASN A 1 354 ? 19.389 31.686 33.490  1.00 39.62 ? 658 ASN A CA    1 
ATOM   2743 C  C     . ASN A 1 354 ? 20.070 30.322 33.548  1.00 39.14 ? 658 ASN A C     1 
ATOM   2744 O  O     . ASN A 1 354 ? 19.439 29.299 33.843  1.00 39.35 ? 658 ASN A O     1 
ATOM   2745 C  CB    . ASN A 1 354 ? 17.929 31.516 33.941  1.00 42.96 ? 658 ASN A CB    1 
ATOM   2746 C  CG    . ASN A 1 354 ? 17.117 32.793 33.828  1.00 46.31 ? 658 ASN A CG    1 
ATOM   2747 O  OD1   . ASN A 1 354 ? 17.492 33.849 34.351  1.00 49.79 ? 658 ASN A OD1   1 
ATOM   2748 N  ND2   . ASN A 1 354 ? 15.985 32.697 33.144  1.00 46.93 ? 658 ASN A ND2   1 
ATOM   2749 N  N     . LYS A 1 355 ? 21.374 30.328 33.294  1.00 37.67 ? 659 LYS A N     1 
ATOM   2750 C  CA    . LYS A 1 355 ? 22.180 29.115 33.321  1.00 36.41 ? 659 LYS A CA    1 
ATOM   2751 C  C     . LYS A 1 355 ? 23.489 29.361 34.069  1.00 33.81 ? 659 LYS A C     1 
ATOM   2752 O  O     . LYS A 1 355 ? 23.833 30.497 34.382  1.00 33.63 ? 659 LYS A O     1 
ATOM   2753 C  CB    . LYS A 1 355 ? 22.470 28.647 31.884  1.00 38.10 ? 659 LYS A CB    1 
ATOM   2754 C  CG    . LYS A 1 355 ? 21.202 28.404 31.074  1.00 40.71 ? 659 LYS A CG    1 
ATOM   2755 C  CD    . LYS A 1 355 ? 21.376 27.432 29.898  1.00 45.13 ? 659 LYS A CD    1 
ATOM   2756 C  CE    . LYS A 1 355 ? 20.001 27.040 29.304  1.00 47.97 ? 659 LYS A CE    1 
ATOM   2757 N  NZ    . LYS A 1 355 ? 19.958 26.950 27.798  1.00 50.55 ? 659 LYS A NZ    1 
ATOM   2758 N  N     . THR A 1 356 ? 24.187 28.275 34.377  1.00 32.71 ? 660 THR A N     1 
ATOM   2759 C  CA    . THR A 1 356 ? 25.482 28.309 35.050  1.00 31.38 ? 660 THR A CA    1 
ATOM   2760 C  C     . THR A 1 356 ? 26.344 27.414 34.155  1.00 30.33 ? 660 THR A C     1 
ATOM   2761 O  O     . THR A 1 356 ? 25.817 26.790 33.232  1.00 29.45 ? 660 THR A O     1 
ATOM   2762 C  CB    . THR A 1 356 ? 25.424 27.682 36.466  1.00 32.95 ? 660 THR A CB    1 
ATOM   2763 O  OG1   . THR A 1 356 ? 24.959 26.331 36.365  1.00 34.12 ? 660 THR A OG1   1 
ATOM   2764 C  CG2   . THR A 1 356 ? 24.503 28.470 37.382  1.00 32.55 ? 660 THR A CG2   1 
ATOM   2765 N  N     . THR A 1 357 ? 27.647 27.338 34.425  1.00 28.38 ? 661 THR A N     1 
ATOM   2766 C  CA    . THR A 1 357 ? 28.561 26.509 33.630  1.00 27.62 ? 661 THR A CA    1 
ATOM   2767 C  C     . THR A 1 357 ? 29.318 25.555 34.512  1.00 26.22 ? 661 THR A C     1 
ATOM   2768 O  O     . THR A 1 357 ? 29.669 25.888 35.632  1.00 27.66 ? 661 THR A O     1 
ATOM   2769 C  CB    . THR A 1 357 ? 29.702 27.288 32.984  1.00 28.42 ? 661 THR A CB    1 
ATOM   2770 O  OG1   . THR A 1 357 ? 29.337 28.654 32.815  1.00 33.38 ? 661 THR A OG1   1 
ATOM   2771 C  CG2   . THR A 1 357 ? 30.061 26.676 31.671  1.00 27.35 ? 661 THR A CG2   1 
ATOM   2772 N  N     . SER A 1 358 ? 29.648 24.391 33.982  1.00 26.03 ? 662 SER A N     1 
ATOM   2773 C  CA    . SER A 1 358 ? 30.407 23.435 34.762  1.00 26.34 ? 662 SER A CA    1 
ATOM   2774 C  C     . SER A 1 358 ? 31.718 23.122 34.057  1.00 25.98 ? 662 SER A C     1 
ATOM   2775 O  O     . SER A 1 358 ? 32.535 22.357 34.580  1.00 25.88 ? 662 SER A O     1 
ATOM   2776 C  CB    . SER A 1 358 ? 29.597 22.159 34.960  1.00 26.16 ? 662 SER A CB    1 
ATOM   2777 O  OG    . SER A 1 358 ? 29.338 21.565 33.707  1.00 29.94 ? 662 SER A OG    1 
ATOM   2778 N  N     . GLN A 1 359 ? 31.921 23.719 32.878  1.00 26.25 ? 663 GLN A N     1 
ATOM   2779 C  CA    . GLN A 1 359 ? 33.149 23.499 32.104  1.00 26.42 ? 663 GLN A CA    1 
ATOM   2780 C  C     . GLN A 1 359 ? 33.559 24.691 31.227  1.00 26.10 ? 663 GLN A C     1 
ATOM   2781 O  O     . GLN A 1 359 ? 32.800 25.164 30.386  1.00 25.51 ? 663 GLN A O     1 
ATOM   2782 C  CB    . GLN A 1 359 ? 33.018 22.251 31.218  1.00 26.89 ? 663 GLN A CB    1 
ATOM   2783 C  CG    . GLN A 1 359 ? 34.357 21.800 30.627  1.00 27.74 ? 663 GLN A CG    1 
ATOM   2784 C  CD    . GLN A 1 359 ? 34.225 20.671 29.597  1.00 30.99 ? 663 GLN A CD    1 
ATOM   2785 O  OE1   . GLN A 1 359 ? 35.174 19.924 29.374  1.00 34.54 ? 663 GLN A OE1   1 
ATOM   2786 N  NE2   . GLN A 1 359 ? 33.060 20.555 28.971  1.00 32.15 ? 663 GLN A NE2   1 
ATOM   2787 N  N     . ILE A 1 360 ? 34.785 25.158 31.424  1.00 25.91 ? 664 ILE A N     1 
ATOM   2788 C  CA    . ILE A 1 360 ? 35.270 26.260 30.635  1.00 24.08 ? 664 ILE A CA    1 
ATOM   2789 C  C     . ILE A 1 360 ? 36.533 25.928 29.862  1.00 24.40 ? 664 ILE A C     1 
ATOM   2790 O  O     . ILE A 1 360 ? 37.282 25.010 30.205  1.00 23.57 ? 664 ILE A O     1 
ATOM   2791 C  CB    . ILE A 1 360 ? 35.440 27.536 31.495  1.00 24.95 ? 664 ILE A CB    1 
ATOM   2792 C  CG1   . ILE A 1 360 ? 36.443 27.308 32.626  1.00 23.55 ? 664 ILE A CG1   1 
ATOM   2793 C  CG2   . ILE A 1 360 ? 34.081 27.949 32.056  1.00 22.56 ? 664 ILE A CG2   1 
ATOM   2794 C  CD1   . ILE A 1 360 ? 36.800 28.587 33.398  1.00 24.59 ? 664 ILE A CD1   1 
ATOM   2795 N  N     . THR A 1 361 ? 36.723 26.695 28.796  1.00 24.08 ? 665 THR A N     1 
ATOM   2796 C  CA    . THR A 1 361 ? 37.843 26.553 27.889  1.00 25.45 ? 665 THR A CA    1 
ATOM   2797 C  C     . THR A 1 361 ? 38.375 27.925 27.490  1.00 25.50 ? 665 THR A C     1 
ATOM   2798 O  O     . THR A 1 361 ? 37.606 28.846 27.226  1.00 24.76 ? 665 THR A O     1 
ATOM   2799 C  CB    . THR A 1 361 ? 37.411 25.825 26.591  1.00 26.05 ? 665 THR A CB    1 
ATOM   2800 O  OG1   . THR A 1 361 ? 36.975 24.495 26.905  1.00 28.42 ? 665 THR A OG1   1 
ATOM   2801 C  CG2   . THR A 1 361 ? 38.565 25.776 25.591  1.00 23.89 ? 665 THR A CG2   1 
ATOM   2802 N  N     . LEU A 1 362 ? 39.694 28.058 27.464  1.00 26.12 ? 666 LEU A N     1 
ATOM   2803 C  CA    . LEU A 1 362 ? 40.340 29.290 27.012  1.00 27.59 ? 666 LEU A CA    1 
ATOM   2804 C  C     . LEU A 1 362 ? 41.104 28.783 25.787  1.00 28.03 ? 666 LEU A C     1 
ATOM   2805 O  O     . LEU A 1 362 ? 41.845 27.806 25.858  1.00 27.87 ? 666 LEU A O     1 
ATOM   2806 C  CB    . LEU A 1 362 ? 41.304 29.836 28.079  1.00 28.62 ? 666 LEU A CB    1 
ATOM   2807 C  CG    . LEU A 1 362 ? 42.353 30.972 27.918  1.00 29.91 ? 666 LEU A CG    1 
ATOM   2808 C  CD1   . LEU A 1 362 ? 42.936 30.992 26.523  1.00 28.81 ? 666 LEU A CD1   1 
ATOM   2809 C  CD2   . LEU A 1 362 ? 41.742 32.320 28.250  1.00 30.33 ? 666 LEU A CD2   1 
ATOM   2810 N  N     . LYS A 1 363 ? 40.904 29.426 24.654  1.00 29.81 ? 667 LYS A N     1 
ATOM   2811 C  CA    . LYS A 1 363 ? 41.575 28.998 23.438  1.00 30.59 ? 667 LYS A CA    1 
ATOM   2812 C  C     . LYS A 1 363 ? 42.264 30.238 22.871  1.00 29.27 ? 667 LYS A C     1 
ATOM   2813 O  O     . LYS A 1 363 ? 41.755 31.353 23.002  1.00 29.22 ? 667 LYS A O     1 
ATOM   2814 C  CB    . LYS A 1 363 ? 40.508 28.416 22.493  1.00 34.75 ? 667 LYS A CB    1 
ATOM   2815 C  CG    . LYS A 1 363 ? 40.962 27.825 21.155  1.00 40.33 ? 667 LYS A CG    1 
ATOM   2816 C  CD    . LYS A 1 363 ? 40.956 28.907 20.096  1.00 44.09 ? 667 LYS A CD    1 
ATOM   2817 C  CE    . LYS A 1 363 ? 40.580 28.427 18.705  1.00 47.08 ? 667 LYS A CE    1 
ATOM   2818 N  NZ    . LYS A 1 363 ? 41.030 29.506 17.785  1.00 48.54 ? 667 LYS A NZ    1 
ATOM   2819 N  N     . LEU A 1 364 ? 43.439 30.070 22.282  1.00 27.42 ? 668 LEU A N     1 
ATOM   2820 C  CA    . LEU A 1 364 ? 44.107 31.232 21.736  1.00 25.87 ? 668 LEU A CA    1 
ATOM   2821 C  C     . LEU A 1 364 ? 44.803 30.983 20.408  1.00 26.70 ? 668 LEU A C     1 
ATOM   2822 O  O     . LEU A 1 364 ? 45.100 29.843 20.053  1.00 27.39 ? 668 LEU A O     1 
ATOM   2823 C  CB    . LEU A 1 364 ? 45.087 31.784 22.763  1.00 24.10 ? 668 LEU A CB    1 
ATOM   2824 C  CG    . LEU A 1 364 ? 46.227 30.876 23.186  1.00 24.70 ? 668 LEU A CG    1 
ATOM   2825 C  CD1   . LEU A 1 364 ? 47.339 30.927 22.137  1.00 25.64 ? 668 LEU A CD1   1 
ATOM   2826 C  CD2   . LEU A 1 364 ? 46.741 31.342 24.538  1.00 24.09 ? 668 LEU A CD2   1 
ATOM   2827 N  N     . MET A 1 365 ? 45.020 32.061 19.660  1.00 26.52 ? 669 MET A N     1 
ATOM   2828 C  CA    . MET A 1 365 ? 45.705 31.994 18.381  1.00 26.72 ? 669 MET A CA    1 
ATOM   2829 C  C     . MET A 1 365 ? 47.050 32.656 18.625  1.00 27.46 ? 669 MET A C     1 
ATOM   2830 O  O     . MET A 1 365 ? 47.109 33.797 19.100  1.00 28.19 ? 669 MET A O     1 
ATOM   2831 C  CB    . MET A 1 365 ? 44.932 32.758 17.298  1.00 26.74 ? 669 MET A CB    1 
ATOM   2832 C  CG    . MET A 1 365 ? 43.638 32.097 16.884  1.00 29.55 ? 669 MET A CG    1 
ATOM   2833 S  SD    . MET A 1 365 ? 43.874 30.352 16.477  1.00 32.70 ? 669 MET A SD    1 
ATOM   2834 C  CE    . MET A 1 365 ? 43.998 30.408 14.687  1.00 30.37 ? 669 MET A CE    1 
ATOM   2835 N  N     . ARG A 1 366 ? 48.128 31.945 18.319  1.00 27.49 ? 670 ARG A N     1 
ATOM   2836 C  CA    . ARG A 1 366 ? 49.468 32.485 18.520  1.00 27.58 ? 670 ARG A CA    1 
ATOM   2837 C  C     . ARG A 1 366 ? 50.218 32.579 17.197  1.00 27.96 ? 670 ARG A C     1 
ATOM   2838 O  O     . ARG A 1 366 ? 50.169 31.651 16.401  1.00 27.37 ? 670 ARG A O     1 
ATOM   2839 C  CB    . ARG A 1 366 ? 50.241 31.596 19.497  1.00 26.68 ? 670 ARG A CB    1 
ATOM   2840 C  CG    . ARG A 1 366 ? 51.681 32.011 19.696  1.00 26.14 ? 670 ARG A CG    1 
ATOM   2841 C  CD    . ARG A 1 366 ? 52.357 31.150 20.741  1.00 25.83 ? 670 ARG A CD    1 
ATOM   2842 N  NE    . ARG A 1 366 ? 53.796 31.382 20.792  1.00 26.96 ? 670 ARG A NE    1 
ATOM   2843 C  CZ    . ARG A 1 366 ? 54.587 30.887 21.737  1.00 29.11 ? 670 ARG A CZ    1 
ATOM   2844 N  NH1   . ARG A 1 366 ? 54.068 30.137 22.707  1.00 29.89 ? 670 ARG A NH1   1 
ATOM   2845 N  NH2   . ARG A 1 366 ? 55.889 31.133 21.716  1.00 27.15 ? 670 ARG A NH2   1 
ATOM   2846 N  N     . ARG A 1 367 ? 50.899 33.702 16.973  1.00 29.65 ? 671 ARG A N     1 
ATOM   2847 C  CA    . ARG A 1 367 ? 51.683 33.950 15.752  1.00 32.63 ? 671 ARG A CA    1 
ATOM   2848 C  C     . ARG A 1 367 ? 52.616 32.770 15.441  1.00 33.38 ? 671 ARG A C     1 
ATOM   2849 O  O     . ARG A 1 367 ? 53.423 32.394 16.287  1.00 33.83 ? 671 ARG A O     1 
ATOM   2850 C  CB    . ARG A 1 367 ? 52.512 35.228 15.968  1.00 34.04 ? 671 ARG A CB    1 
ATOM   2851 C  CG    . ARG A 1 367 ? 53.453 35.665 14.860  1.00 37.61 ? 671 ARG A CG    1 
ATOM   2852 C  CD    . ARG A 1 367 ? 54.621 36.485 15.458  1.00 41.13 ? 671 ARG A CD    1 
ATOM   2853 N  NE    . ARG A 1 367 ? 55.858 36.086 14.803  1.00 46.20 ? 671 ARG A NE    1 
ATOM   2854 C  CZ    . ARG A 1 367 ? 56.929 35.584 15.409  1.00 48.76 ? 671 ARG A CZ    1 
ATOM   2855 N  NH1   . ARG A 1 367 ? 56.959 35.417 16.726  1.00 50.10 ? 671 ARG A NH1   1 
ATOM   2856 N  NH2   . ARG A 1 367 ? 57.964 35.197 14.675  1.00 52.02 ? 671 ARG A NH2   1 
ATOM   2857 N  N     . CYS A 1 368 ? 52.502 32.171 14.253  1.00 34.16 ? 672 CYS A N     1 
ATOM   2858 C  CA    . CYS A 1 368 ? 53.398 31.061 13.884  1.00 35.92 ? 672 CYS A CA    1 
ATOM   2859 C  C     . CYS A 1 368 ? 54.826 31.556 13.877  1.00 36.68 ? 672 CYS A C     1 
ATOM   2860 O  O     . CYS A 1 368 ? 55.079 32.698 13.512  1.00 36.84 ? 672 CYS A O     1 
ATOM   2861 C  CB    . CYS A 1 368 ? 53.123 30.544 12.479  1.00 34.80 ? 672 CYS A CB    1 
ATOM   2862 S  SG    . CYS A 1 368 ? 51.632 29.609 12.281  1.00 34.63 ? 672 CYS A SG    1 
ATOM   2863 N  N     . LYS A 1 369 ? 55.761 30.685 14.238  1.00 39.79 ? 673 LYS A N     1 
ATOM   2864 C  CA    . LYS A 1 369 ? 57.177 31.046 14.265  1.00 42.26 ? 673 LYS A CA    1 
ATOM   2865 C  C     . LYS A 1 369 ? 57.615 31.748 12.977  1.00 43.78 ? 673 LYS A C     1 
ATOM   2866 O  O     . LYS A 1 369 ? 58.344 32.739 13.021  1.00 44.29 ? 673 LYS A O     1 
ATOM   2867 C  CB    . LYS A 1 369 ? 58.035 29.794 14.489  1.00 41.78 ? 673 LYS A CB    1 
ATOM   2868 N  N     . ASP A 1 370 ? 57.147 31.244 11.840  1.00 44.38 ? 674 ASP A N     1 
ATOM   2869 C  CA    . ASP A 1 370 ? 57.517 31.786 10.529  1.00 46.71 ? 674 ASP A CA    1 
ATOM   2870 C  C     . ASP A 1 370 ? 56.763 32.993 9.966   1.00 45.45 ? 674 ASP A C     1 
ATOM   2871 O  O     . ASP A 1 370 ? 57.152 33.535 8.924   1.00 45.91 ? 674 ASP A O     1 
ATOM   2872 C  CB    . ASP A 1 370 ? 57.451 30.656 9.500   1.00 49.92 ? 674 ASP A CB    1 
ATOM   2873 C  CG    . ASP A 1 370 ? 58.720 29.839 9.463   1.00 54.66 ? 674 ASP A CG    1 
ATOM   2874 O  OD1   . ASP A 1 370 ? 58.733 28.791 8.779   1.00 56.78 ? 674 ASP A OD1   1 
ATOM   2875 O  OD2   . ASP A 1 370 ? 59.714 30.253 10.113  1.00 56.61 ? 674 ASP A OD2   1 
ATOM   2876 N  N     . ALA A 1 371 ? 55.709 33.420 10.655  1.00 42.90 ? 675 ALA A N     1 
ATOM   2877 C  CA    . ALA A 1 371 ? 54.861 34.515 10.191  1.00 39.71 ? 675 ALA A CA    1 
ATOM   2878 C  C     . ALA A 1 371 ? 55.261 35.938 10.532  1.00 37.09 ? 675 ALA A C     1 
ATOM   2879 O  O     . ALA A 1 371 ? 55.811 36.211 11.592  1.00 35.86 ? 675 ALA A O     1 
ATOM   2880 C  CB    . ALA A 1 371 ? 53.442 34.275 10.663  1.00 40.03 ? 675 ALA A CB    1 
ATOM   2881 N  N     . PRO A 1 372 ? 54.965 36.877 9.626   1.00 35.49 ? 676 PRO A N     1 
ATOM   2882 C  CA    . PRO A 1 372 ? 55.318 38.267 9.896   1.00 34.82 ? 676 PRO A CA    1 
ATOM   2883 C  C     . PRO A 1 372 ? 54.607 38.784 11.143  1.00 35.82 ? 676 PRO A C     1 
ATOM   2884 O  O     . PRO A 1 372 ? 53.489 38.361 11.455  1.00 37.31 ? 676 PRO A O     1 
ATOM   2885 C  CB    . PRO A 1 372 ? 54.873 38.989 8.627   1.00 34.85 ? 676 PRO A CB    1 
ATOM   2886 C  CG    . PRO A 1 372 ? 53.772 38.092 8.073   1.00 35.65 ? 676 PRO A CG    1 
ATOM   2887 C  CD    . PRO A 1 372 ? 54.349 36.729 8.297   1.00 34.82 ? 676 PRO A CD    1 
ATOM   2888 N  N     . ILE A 1 373 ? 55.275 39.697 11.843  1.00 35.83 ? 677 ILE A N     1 
ATOM   2889 C  CA    . ILE A 1 373 ? 54.761 40.311 13.057  1.00 36.01 ? 677 ILE A CA    1 
ATOM   2890 C  C     . ILE A 1 373 ? 53.486 41.118 12.755  1.00 36.96 ? 677 ILE A C     1 
ATOM   2891 O  O     . ILE A 1 373 ? 52.590 41.193 13.591  1.00 34.93 ? 677 ILE A O     1 
ATOM   2892 C  CB    . ILE A 1 373 ? 55.885 41.139 13.734  1.00 37.08 ? 677 ILE A CB    1 
ATOM   2893 C  CG1   . ILE A 1 373 ? 56.867 40.173 14.411  1.00 38.52 ? 677 ILE A CG1   1 
ATOM   2894 C  CG2   . ILE A 1 373 ? 55.316 42.125 14.733  1.00 36.24 ? 677 ILE A CG2   1 
ATOM   2895 C  CD1   . ILE A 1 373 ? 57.684 40.774 15.546  1.00 40.15 ? 677 ILE A CD1   1 
ATOM   2896 N  N     . GLU A 1 374 ? 53.392 41.732 11.577  1.00 38.50 ? 678 GLU A N     1 
ATOM   2897 C  CA    . GLU A 1 374 ? 52.144 42.398 11.202  1.00 41.28 ? 678 GLU A CA    1 
ATOM   2898 C  C     . GLU A 1 374 ? 51.677 41.760 9.887   1.00 40.55 ? 678 GLU A C     1 
ATOM   2899 O  O     . GLU A 1 374 ? 52.395 41.748 8.899   1.00 41.04 ? 678 GLU A O     1 
ATOM   2900 C  CB    . GLU A 1 374 ? 52.277 43.933 11.057  1.00 44.53 ? 678 GLU A CB    1 
ATOM   2901 C  CG    . GLU A 1 374 ? 52.128 44.803 12.354  1.00 49.47 ? 678 GLU A CG    1 
ATOM   2902 C  CD    . GLU A 1 374 ? 50.769 44.692 13.091  1.00 52.38 ? 678 GLU A CD    1 
ATOM   2903 O  OE1   . GLU A 1 374 ? 49.825 44.094 12.541  1.00 55.58 ? 678 GLU A OE1   1 
ATOM   2904 O  OE2   . GLU A 1 374 ? 50.649 45.206 14.227  1.00 53.50 ? 678 GLU A OE2   1 
ATOM   2905 N  N     . PRO A 1 375 ? 50.490 41.129 9.894   1.00 39.47 ? 679 PRO A N     1 
ATOM   2906 C  CA    . PRO A 1 375 ? 49.812 40.459 8.793   1.00 37.49 ? 679 PRO A CA    1 
ATOM   2907 C  C     . PRO A 1 375 ? 49.446 41.206 7.539   1.00 34.70 ? 679 PRO A C     1 
ATOM   2908 O  O     . PRO A 1 375 ? 49.415 42.432 7.507   1.00 35.31 ? 679 PRO A O     1 
ATOM   2909 C  CB    . PRO A 1 375 ? 48.536 39.970 9.447   1.00 39.31 ? 679 PRO A CB    1 
ATOM   2910 C  CG    . PRO A 1 375 ? 49.082 39.360 10.645  1.00 40.84 ? 679 PRO A CG    1 
ATOM   2911 C  CD    . PRO A 1 375 ? 50.309 40.225 11.041  1.00 41.14 ? 679 PRO A CD    1 
ATOM   2912 N  N     . PRO A 1 376 ? 49.261 40.473 6.438   1.00 32.94 ? 680 PRO A N     1 
ATOM   2913 C  CA    . PRO A 1 376 ? 48.850 41.231 5.273   1.00 31.18 ? 680 PRO A CA    1 
ATOM   2914 C  C     . PRO A 1 376 ? 47.581 42.021 5.632   1.00 29.18 ? 680 PRO A C     1 
ATOM   2915 O  O     . PRO A 1 376 ? 47.442 43.167 5.236   1.00 29.12 ? 680 PRO A O     1 
ATOM   2916 C  CB    . PRO A 1 376 ? 48.590 40.132 4.253   1.00 32.47 ? 680 PRO A CB    1 
ATOM   2917 C  CG    . PRO A 1 376 ? 49.822 39.254 4.480   1.00 33.06 ? 680 PRO A CG    1 
ATOM   2918 C  CD    . PRO A 1 376 ? 50.231 39.476 5.964   1.00 33.42 ? 680 PRO A CD    1 
ATOM   2919 N  N     . LYS A 1 377 ? 46.666 41.434 6.401   1.00 26.31 ? 681 LYS A N     1 
ATOM   2920 C  CA    . LYS A 1 377 ? 45.432 42.141 6.760   1.00 25.39 ? 681 LYS A CA    1 
ATOM   2921 C  C     . LYS A 1 377 ? 45.569 43.070 7.968   1.00 24.02 ? 681 LYS A C     1 
ATOM   2922 O  O     . LYS A 1 377 ? 45.928 42.633 9.061   1.00 22.57 ? 681 LYS A O     1 
ATOM   2923 C  CB    . LYS A 1 377 ? 44.324 41.125 7.017   1.00 25.99 ? 681 LYS A CB    1 
ATOM   2924 C  CG    . LYS A 1 377 ? 43.010 41.712 7.482   1.00 26.60 ? 681 LYS A CG    1 
ATOM   2925 C  CD    . LYS A 1 377 ? 42.084 40.584 7.877   1.00 25.20 ? 681 LYS A CD    1 
ATOM   2926 C  CE    . LYS A 1 377 ? 40.663 41.065 8.116   1.00 27.50 ? 681 LYS A CE    1 
ATOM   2927 N  NZ    . LYS A 1 377 ? 39.934 41.269 6.832   1.00 26.87 ? 681 LYS A NZ    1 
ATOM   2928 N  N     . TYR A 1 378 ? 45.264 44.351 7.767   1.00 23.12 ? 682 TYR A N     1 
ATOM   2929 C  CA    . TYR A 1 378 ? 45.367 45.333 8.836   1.00 22.27 ? 682 TYR A CA    1 
ATOM   2930 C  C     . TYR A 1 378 ? 44.646 44.833 10.085  1.00 23.06 ? 682 TYR A C     1 
ATOM   2931 O  O     . TYR A 1 378 ? 43.447 44.535 10.046  1.00 21.25 ? 682 TYR A O     1 
ATOM   2932 C  CB    . TYR A 1 378 ? 44.790 46.684 8.383   1.00 20.02 ? 682 TYR A CB    1 
ATOM   2933 C  CG    . TYR A 1 378 ? 44.922 47.804 9.416   1.00 20.38 ? 682 TYR A CG    1 
ATOM   2934 C  CD1   . TYR A 1 378 ? 46.170 48.333 9.767   1.00 15.71 ? 682 TYR A CD1   1 
ATOM   2935 C  CD2   . TYR A 1 378 ? 43.789 48.314 10.056  1.00 17.83 ? 682 TYR A CD2   1 
ATOM   2936 C  CE1   . TYR A 1 378 ? 46.273 49.346 10.739  1.00 19.43 ? 682 TYR A CE1   1 
ATOM   2937 C  CE2   . TYR A 1 378 ? 43.884 49.313 11.019  1.00 19.69 ? 682 TYR A CE2   1 
ATOM   2938 C  CZ    . TYR A 1 378 ? 45.117 49.827 11.362  1.00 19.09 ? 682 TYR A CZ    1 
ATOM   2939 O  OH    . TYR A 1 378 ? 45.154 50.800 12.342  1.00 22.22 ? 682 TYR A OH    1 
ATOM   2940 N  N     . MET A 1 379 ? 45.408 44.718 11.174  1.00 23.22 ? 683 MET A N     1 
ATOM   2941 C  CA    . MET A 1 379 ? 44.908 44.266 12.467  1.00 23.54 ? 683 MET A CA    1 
ATOM   2942 C  C     . MET A 1 379 ? 44.421 42.808 12.482  1.00 23.53 ? 683 MET A C     1 
ATOM   2943 O  O     . MET A 1 379 ? 43.788 42.344 13.436  1.00 23.26 ? 683 MET A O     1 
ATOM   2944 C  CB    . MET A 1 379 ? 43.821 45.231 12.943  1.00 27.58 ? 683 MET A CB    1 
ATOM   2945 C  CG    . MET A 1 379 ? 44.368 46.644 13.215  1.00 33.36 ? 683 MET A CG    1 
ATOM   2946 S  SD    . MET A 1 379 ? 45.450 46.744 14.710  1.00 39.97 ? 683 MET A SD    1 
ATOM   2947 C  CE    . MET A 1 379 ? 47.271 46.954 13.966  1.00 42.48 ? 683 MET A CE    1 
ATOM   2948 N  N     . GLY A 1 380 ? 44.749 42.069 11.430  1.00 23.58 ? 684 GLY A N     1 
ATOM   2949 C  CA    . GLY A 1 380 ? 44.343 40.677 11.376  1.00 22.90 ? 684 GLY A CA    1 
ATOM   2950 C  C     . GLY A 1 380 ? 45.163 39.780 12.287  1.00 23.74 ? 684 GLY A C     1 
ATOM   2951 O  O     . GLY A 1 380 ? 46.162 40.201 12.864  1.00 22.00 ? 684 GLY A O     1 
ATOM   2952 N  N     . MET A 1 381 ? 44.751 38.527 12.416  1.00 23.72 ? 685 MET A N     1 
ATOM   2953 C  CA    . MET A 1 381 ? 45.493 37.606 13.253  1.00 26.68 ? 685 MET A CA    1 
ATOM   2954 C  C     . MET A 1 381 ? 46.625 36.978 12.461  1.00 27.16 ? 685 MET A C     1 
ATOM   2955 O  O     . MET A 1 381 ? 47.597 36.512 13.046  1.00 25.44 ? 685 MET A O     1 
ATOM   2956 C  CB    . MET A 1 381 ? 44.586 36.501 13.772  1.00 29.17 ? 685 MET A CB    1 
ATOM   2957 C  CG    . MET A 1 381 ? 43.977 35.668 12.672  1.00 32.08 ? 685 MET A CG    1 
ATOM   2958 S  SD    . MET A 1 381 ? 42.891 34.414 13.356  1.00 36.92 ? 685 MET A SD    1 
ATOM   2959 C  CE    . MET A 1 381 ? 43.996 33.275 13.686  1.00 31.62 ? 685 MET A CE    1 
ATOM   2960 N  N     . GLY A 1 382 ? 46.500 36.974 11.134  1.00 27.46 ? 686 GLY A N     1 
ATOM   2961 C  CA    . GLY A 1 382 ? 47.522 36.361 10.302  1.00 28.99 ? 686 GLY A CA    1 
ATOM   2962 C  C     . GLY A 1 382 ? 47.604 34.851 10.509  1.00 30.34 ? 686 GLY A C     1 
ATOM   2963 O  O     . GLY A 1 382 ? 46.701 34.258 11.105  1.00 29.90 ? 686 GLY A O     1 
ATOM   2964 N  N     . ARG A 1 383 ? 48.683 34.233 10.023  1.00 31.51 ? 687 ARG A N     1 
ATOM   2965 C  CA    . ARG A 1 383 ? 48.886 32.784 10.149  1.00 33.06 ? 687 ARG A CA    1 
ATOM   2966 C  C     . ARG A 1 383 ? 49.306 32.474 11.594  1.00 31.34 ? 687 ARG A C     1 
ATOM   2967 O  O     . ARG A 1 383 ? 50.296 33.009 12.101  1.00 29.60 ? 687 ARG A O     1 
ATOM   2968 C  CB    . ARG A 1 383 ? 49.943 32.295 9.137   1.00 35.09 ? 687 ARG A CB    1 
ATOM   2969 C  CG    . ARG A 1 383 ? 49.586 30.966 8.454   1.00 41.56 ? 687 ARG A CG    1 
ATOM   2970 C  CD    . ARG A 1 383 ? 50.692 30.406 7.530   1.00 43.49 ? 687 ARG A CD    1 
ATOM   2971 N  NE    . ARG A 1 383 ? 51.956 30.121 8.215   1.00 45.98 ? 687 ARG A NE    1 
ATOM   2972 C  CZ    . ARG A 1 383 ? 53.026 30.913 8.162   1.00 47.57 ? 687 ARG A CZ    1 
ATOM   2973 N  NH1   . ARG A 1 383 ? 52.986 32.042 7.459   1.00 48.21 ? 687 ARG A NH1   1 
ATOM   2974 N  NH2   . ARG A 1 383 ? 54.144 30.572 8.794   1.00 49.32 ? 687 ARG A NH2   1 
ATOM   2975 N  N     . CYS A 1 384 ? 48.538 31.593 12.232  1.00 30.43 ? 688 CYS A N     1 
ATOM   2976 C  CA    . CYS A 1 384 ? 48.722 31.237 13.636  1.00 30.25 ? 688 CYS A CA    1 
ATOM   2977 C  C     . CYS A 1 384 ? 48.484 29.785 13.987  1.00 31.75 ? 688 CYS A C     1 
ATOM   2978 O  O     . CYS A 1 384 ? 47.861 29.037 13.239  1.00 32.70 ? 688 CYS A O     1 
ATOM   2979 C  CB    . CYS A 1 384 ? 47.724 32.009 14.498  1.00 29.92 ? 688 CYS A CB    1 
ATOM   2980 S  SG    . CYS A 1 384 ? 47.922 33.774 14.601  1.00 28.92 ? 688 CYS A SG    1 
ATOM   2981 N  N     . ASP A 1 385 ? 48.933 29.423 15.185  1.00 32.43 ? 689 ASP A N     1 
ATOM   2982 C  CA    . ASP A 1 385 ? 48.718 28.088 15.723  1.00 33.19 ? 689 ASP A CA    1 
ATOM   2983 C  C     . ASP A 1 385 ? 47.711 28.176 16.850  1.00 34.10 ? 689 ASP A C     1 
ATOM   2984 O  O     . ASP A 1 385 ? 47.689 29.154 17.603  1.00 34.50 ? 689 ASP A O     1 
ATOM   2985 C  CB    . ASP A 1 385 ? 49.996 27.508 16.299  1.00 34.36 ? 689 ASP A CB    1 
ATOM   2986 C  CG    . ASP A 1 385 ? 51.053 27.300 15.254  1.00 37.41 ? 689 ASP A CG    1 
ATOM   2987 O  OD1   . ASP A 1 385 ? 50.764 26.608 14.252  1.00 38.41 ? 689 ASP A OD1   1 
ATOM   2988 O  OD2   . ASP A 1 385 ? 52.171 27.826 15.439  1.00 36.15 ? 689 ASP A OD2   1 
ATOM   2989 N  N     . SER A 1 386 ? 46.889 27.143 16.973  1.00 34.62 ? 690 SER A N     1 
ATOM   2990 C  CA    . SER A 1 386 ? 45.893 27.076 18.032  1.00 36.18 ? 690 SER A CA    1 
ATOM   2991 C  C     . SER A 1 386 ? 46.393 26.367 19.281  1.00 35.11 ? 690 SER A C     1 
ATOM   2992 O  O     . SER A 1 386 ? 47.137 25.391 19.209  1.00 34.85 ? 690 SER A O     1 
ATOM   2993 C  CB    . SER A 1 386 ? 44.646 26.357 17.543  1.00 36.18 ? 690 SER A CB    1 
ATOM   2994 O  OG    . SER A 1 386 ? 43.921 27.213 16.694  1.00 44.24 ? 690 SER A OG    1 
ATOM   2995 N  N     . PHE A 1 387 ? 45.984 26.886 20.430  1.00 34.07 ? 691 PHE A N     1 
ATOM   2996 C  CA    . PHE A 1 387 ? 46.331 26.298 21.714  1.00 34.69 ? 691 PHE A CA    1 
ATOM   2997 C  C     . PHE A 1 387 ? 45.057 26.388 22.517  1.00 34.71 ? 691 PHE A C     1 
ATOM   2998 O  O     . PHE A 1 387 ? 44.420 27.445 22.589  1.00 35.29 ? 691 PHE A O     1 
ATOM   2999 C  CB    . PHE A 1 387 ? 47.441 27.068 22.429  1.00 34.53 ? 691 PHE A CB    1 
ATOM   3000 C  CG    . PHE A 1 387 ? 48.811 26.863 21.843  1.00 37.21 ? 691 PHE A CG    1 
ATOM   3001 C  CD1   . PHE A 1 387 ? 49.170 27.458 20.630  1.00 36.37 ? 691 PHE A CD1   1 
ATOM   3002 C  CD2   . PHE A 1 387 ? 49.766 26.112 22.533  1.00 38.07 ? 691 PHE A CD2   1 
ATOM   3003 C  CE1   . PHE A 1 387 ? 50.461 27.316 20.115  1.00 36.35 ? 691 PHE A CE1   1 
ATOM   3004 C  CE2   . PHE A 1 387 ? 51.064 25.961 22.029  1.00 38.74 ? 691 PHE A CE2   1 
ATOM   3005 C  CZ    . PHE A 1 387 ? 51.410 26.568 20.816  1.00 38.42 ? 691 PHE A CZ    1 
ATOM   3006 N  N     . SER A 1 388 ? 44.699 25.280 23.142  1.00 34.42 ? 692 SER A N     1 
ATOM   3007 C  CA    . SER A 1 388 ? 43.460 25.228 23.878  1.00 34.14 ? 692 SER A CA    1 
ATOM   3008 C  C     . SER A 1 388 ? 43.564 24.427 25.158  1.00 34.34 ? 692 SER A C     1 
ATOM   3009 O  O     . SER A 1 388 ? 44.289 23.434 25.225  1.00 32.51 ? 692 SER A O     1 
ATOM   3010 C  CB    . SER A 1 388 ? 42.404 24.599 22.973  1.00 33.34 ? 692 SER A CB    1 
ATOM   3011 O  OG    . SER A 1 388 ? 41.127 24.609 23.564  1.00 36.11 ? 692 SER A OG    1 
ATOM   3012 N  N     . ARG A 1 389 ? 42.846 24.868 26.181  1.00 34.20 ? 693 ARG A N     1 
ATOM   3013 C  CA    . ARG A 1 389 ? 42.821 24.120 27.420  1.00 34.16 ? 693 ARG A CA    1 
ATOM   3014 C  C     . ARG A 1 389 ? 41.537 24.347 28.185  1.00 33.49 ? 693 ARG A C     1 
ATOM   3015 O  O     . ARG A 1 389 ? 41.060 25.472 28.322  1.00 32.49 ? 693 ARG A O     1 
ATOM   3016 C  CB    . ARG A 1 389 ? 43.999 24.454 28.304  1.00 37.02 ? 693 ARG A CB    1 
ATOM   3017 C  CG    . ARG A 1 389 ? 44.116 23.486 29.452  1.00 41.66 ? 693 ARG A CG    1 
ATOM   3018 C  CD    . ARG A 1 389 ? 45.443 23.695 30.091  1.00 48.44 ? 693 ARG A CD    1 
ATOM   3019 N  NE    . ARG A 1 389 ? 46.153 22.443 30.308  1.00 53.62 ? 693 ARG A NE    1 
ATOM   3020 C  CZ    . ARG A 1 389 ? 45.973 21.663 31.367  1.00 55.70 ? 693 ARG A CZ    1 
ATOM   3021 N  NH1   . ARG A 1 389 ? 45.102 22.007 32.309  1.00 55.49 ? 693 ARG A NH1   1 
ATOM   3022 N  NH2   . ARG A 1 389 ? 46.675 20.544 31.488  1.00 57.21 ? 693 ARG A NH2   1 
ATOM   3023 N  N     . SER A 1 390 ? 40.987 23.259 28.701  1.00 32.90 ? 694 SER A N     1 
ATOM   3024 C  CA    . SER A 1 390 ? 39.740 23.328 29.429  1.00 32.37 ? 694 SER A CA    1 
ATOM   3025 C  C     . SER A 1 390 ? 39.801 22.802 30.866  1.00 31.92 ? 694 SER A C     1 
ATOM   3026 O  O     . SER A 1 390 ? 40.758 22.149 31.266  1.00 32.31 ? 694 SER A O     1 
ATOM   3027 C  CB    . SER A 1 390 ? 38.687 22.532 28.656  1.00 32.35 ? 694 SER A CB    1 
ATOM   3028 O  OG    . SER A 1 390 ? 39.052 21.159 28.579  1.00 37.17 ? 694 SER A OG    1 
ATOM   3029 N  N     . SER A 1 391 ? 38.801 23.151 31.663  1.00 31.34 ? 695 SER A N     1 
ATOM   3030 C  CA    . SER A 1 391 ? 38.695 22.584 32.998  1.00 32.66 ? 695 SER A CA    1 
ATOM   3031 C  C     . SER A 1 391 ? 37.270 22.453 33.409  1.00 31.78 ? 695 SER A C     1 
ATOM   3032 O  O     . SER A 1 391 ? 36.399 23.226 33.006  1.00 31.62 ? 695 SER A O     1 
ATOM   3033 C  CB    . SER A 1 391 ? 39.441 23.330 34.121  1.00 33.73 ? 695 SER A CB    1 
ATOM   3034 O  OG    . SER A 1 391 ? 39.730 24.668 33.836  1.00 38.31 ? 695 SER A OG    1 
ATOM   3035 N  N     . ARG A 1 392 ? 37.067 21.426 34.215  1.00 32.24 ? 696 ARG A N     1 
ATOM   3036 C  CA    . ARG A 1 392 ? 35.787 21.093 34.783  1.00 34.63 ? 696 ARG A CA    1 
ATOM   3037 C  C     . ARG A 1 392 ? 35.732 21.897 36.061  1.00 32.67 ? 696 ARG A C     1 
ATOM   3038 O  O     . ARG A 1 392 ? 36.703 21.914 36.816  1.00 32.35 ? 696 ARG A O     1 
ATOM   3039 C  CB    . ARG A 1 392 ? 35.756 19.613 35.134  1.00 37.34 ? 696 ARG A CB    1 
ATOM   3040 C  CG    . ARG A 1 392 ? 35.938 18.666 33.965  1.00 43.00 ? 696 ARG A CG    1 
ATOM   3041 C  CD    . ARG A 1 392 ? 34.594 18.140 33.491  1.00 49.09 ? 696 ARG A CD    1 
ATOM   3042 N  NE    . ARG A 1 392 ? 34.726 17.053 32.522  1.00 53.53 ? 696 ARG A NE    1 
ATOM   3043 C  CZ    . ARG A 1 392 ? 33.954 16.918 31.448  1.00 56.27 ? 696 ARG A CZ    1 
ATOM   3044 N  NH1   . ARG A 1 392 ? 32.997 17.804 31.201  1.00 57.92 ? 696 ARG A NH1   1 
ATOM   3045 N  NH2   . ARG A 1 392 ? 34.134 15.900 30.618  1.00 57.85 ? 696 ARG A NH2   1 
ATOM   3046 N  N     . LEU A 1 393 ? 34.621 22.577 36.303  1.00 31.70 ? 697 LEU A N     1 
ATOM   3047 C  CA    . LEU A 1 393 ? 34.492 23.342 37.539  1.00 31.38 ? 697 LEU A CA    1 
ATOM   3048 C  C     . LEU A 1 393 ? 33.912 22.360 38.562  1.00 31.79 ? 697 LEU A C     1 
ATOM   3049 O  O     . LEU A 1 393 ? 33.160 21.456 38.210  1.00 30.54 ? 697 LEU A O     1 
ATOM   3050 C  CB    . LEU A 1 393 ? 33.574 24.556 37.318  1.00 29.51 ? 697 LEU A CB    1 
ATOM   3051 C  CG    . LEU A 1 393 ? 34.038 25.468 36.161  1.00 30.15 ? 697 LEU A CG    1 
ATOM   3052 C  CD1   . LEU A 1 393 ? 33.080 26.633 35.972  1.00 27.12 ? 697 LEU A CD1   1 
ATOM   3053 C  CD2   . LEU A 1 393 ? 35.457 25.979 36.437  1.00 28.24 ? 697 LEU A CD2   1 
ATOM   3054 N  N     . GLY A 1 394 ? 34.283 22.495 39.824  1.00 33.51 ? 698 GLY A N     1 
ATOM   3055 C  CA    . GLY A 1 394 ? 33.742 21.568 40.797  1.00 35.55 ? 698 GLY A CA    1 
ATOM   3056 C  C     . GLY A 1 394 ? 32.219 21.537 40.800  1.00 36.50 ? 698 GLY A C     1 
ATOM   3057 O  O     . GLY A 1 394 ? 31.605 20.472 40.823  1.00 38.57 ? 698 GLY A O     1 
ATOM   3058 N  N     . ILE A 1 395 ? 31.612 22.715 40.732  1.00 36.87 ? 699 ILE A N     1 
ATOM   3059 C  CA    . ILE A 1 395 ? 30.160 22.860 40.785  1.00 36.40 ? 699 ILE A CA    1 
ATOM   3060 C  C     . ILE A 1 395 ? 29.634 23.885 39.772  1.00 34.46 ? 699 ILE A C     1 
ATOM   3061 O  O     . ILE A 1 395 ? 30.284 24.897 39.547  1.00 34.42 ? 699 ILE A O     1 
ATOM   3062 C  CB    . ILE A 1 395 ? 29.777 23.342 42.224  1.00 38.24 ? 699 ILE A CB    1 
ATOM   3063 C  CG1   . ILE A 1 395 ? 29.718 22.158 43.184  1.00 39.70 ? 699 ILE A CG1   1 
ATOM   3064 C  CG2   . ILE A 1 395 ? 28.486 24.135 42.208  1.00 39.42 ? 699 ILE A CG2   1 
ATOM   3065 C  CD1   . ILE A 1 395 ? 30.235 22.496 44.573  1.00 43.39 ? 699 ILE A CD1   1 
ATOM   3066 N  N     . PRO A 1 396 ? 28.503 23.602 39.091  1.00 33.98 ? 700 PRO A N     1 
ATOM   3067 C  CA    . PRO A 1 396 ? 28.027 24.628 38.164  1.00 32.58 ? 700 PRO A CA    1 
ATOM   3068 C  C     . PRO A 1 396 ? 27.938 25.953 38.892  1.00 31.42 ? 700 PRO A C     1 
ATOM   3069 O  O     . PRO A 1 396 ? 27.420 26.038 40.011  1.00 30.17 ? 700 PRO A O     1 
ATOM   3070 C  CB    . PRO A 1 396 ? 26.666 24.097 37.738  1.00 32.64 ? 700 PRO A CB    1 
ATOM   3071 C  CG    . PRO A 1 396 ? 26.869 22.574 37.743  1.00 34.01 ? 700 PRO A CG    1 
ATOM   3072 C  CD    . PRO A 1 396 ? 28.187 22.290 38.506  1.00 35.84 ? 700 PRO A CD    1 
ATOM   3073 N  N     . THR A 1 397 ? 28.457 26.979 38.233  1.00 30.21 ? 701 THR A N     1 
ATOM   3074 C  CA    . THR A 1 397 ? 28.517 28.313 38.790  1.00 30.25 ? 701 THR A CA    1 
ATOM   3075 C  C     . THR A 1 397 ? 28.384 29.387 37.726  1.00 29.74 ? 701 THR A C     1 
ATOM   3076 O  O     . THR A 1 397 ? 28.501 29.122 36.526  1.00 30.01 ? 701 THR A O     1 
ATOM   3077 C  CB    . THR A 1 397 ? 29.875 28.532 39.469  1.00 31.00 ? 701 THR A CB    1 
ATOM   3078 O  OG1   . THR A 1 397 ? 30.046 29.923 39.775  1.00 34.64 ? 701 THR A OG1   1 
ATOM   3079 C  CG2   . THR A 1 397 ? 30.999 28.095 38.527  1.00 30.71 ? 701 THR A CG2   1 
ATOM   3080 N  N     . ASN A 1 398 ? 28.154 30.606 38.201  1.00 29.03 ? 702 ASN A N     1 
ATOM   3081 C  CA    . ASN A 1 398 ? 28.064 31.775 37.353  1.00 29.29 ? 702 ASN A CA    1 
ATOM   3082 C  C     . ASN A 1 398 ? 28.900 32.843 38.070  1.00 29.30 ? 702 ASN A C     1 
ATOM   3083 O  O     . ASN A 1 398 ? 28.789 34.032 37.783  1.00 29.69 ? 702 ASN A O     1 
ATOM   3084 C  CB    . ASN A 1 398 ? 26.594 32.214 37.179  1.00 29.56 ? 702 ASN A CB    1 
ATOM   3085 C  CG    . ASN A 1 398 ? 25.961 32.690 38.471  1.00 29.09 ? 702 ASN A CG    1 
ATOM   3086 O  OD1   . ASN A 1 398 ? 26.550 32.575 39.533  1.00 30.95 ? 702 ASN A OD1   1 
ATOM   3087 N  ND2   . ASN A 1 398 ? 24.750 33.227 38.382  1.00 28.99 ? 702 ASN A ND2   1 
ATOM   3088 N  N     . GLU A 1 399 ? 29.753 32.404 38.998  1.00 29.21 ? 703 GLU A N     1 
ATOM   3089 C  CA    . GLU A 1 399 ? 30.587 33.342 39.757  1.00 30.99 ? 703 GLU A CA    1 
ATOM   3090 C  C     . GLU A 1 399 ? 31.791 33.846 38.996  1.00 29.93 ? 703 GLU A C     1 
ATOM   3091 O  O     . GLU A 1 399 ? 32.581 33.070 38.466  1.00 29.41 ? 703 GLU A O     1 
ATOM   3092 C  CB    . GLU A 1 399 ? 31.060 32.722 41.078  1.00 32.32 ? 703 GLU A CB    1 
ATOM   3093 C  CG    . GLU A 1 399 ? 29.918 32.454 42.025  1.00 35.05 ? 703 GLU A CG    1 
ATOM   3094 C  CD    . GLU A 1 399 ? 30.329 31.831 43.352  1.00 37.53 ? 703 GLU A CD    1 
ATOM   3095 O  OE1   . GLU A 1 399 ? 31.524 31.881 43.720  1.00 38.32 ? 703 GLU A OE1   1 
ATOM   3096 O  OE2   . GLU A 1 399 ? 29.431 31.301 44.044  1.00 37.65 ? 703 GLU A OE2   1 
ATOM   3097 N  N     . PHE A 1 400 ? 31.914 35.164 38.949  1.00 29.26 ? 704 PHE A N     1 
ATOM   3098 C  CA    . PHE A 1 400 ? 33.024 35.797 38.278  1.00 28.92 ? 704 PHE A CA    1 
ATOM   3099 C  C     . PHE A 1 400 ? 34.351 35.299 38.868  1.00 29.71 ? 704 PHE A C     1 
ATOM   3100 O  O     . PHE A 1 400 ? 35.254 34.908 38.139  1.00 30.51 ? 704 PHE A O     1 
ATOM   3101 C  CB    . PHE A 1 400 ? 32.921 37.303 38.453  1.00 28.68 ? 704 PHE A CB    1 
ATOM   3102 C  CG    . PHE A 1 400 ? 34.042 38.050 37.826  1.00 28.83 ? 704 PHE A CG    1 
ATOM   3103 C  CD1   . PHE A 1 400 ? 33.997 38.390 36.479  1.00 28.54 ? 704 PHE A CD1   1 
ATOM   3104 C  CD2   . PHE A 1 400 ? 35.172 38.377 38.566  1.00 29.15 ? 704 PHE A CD2   1 
ATOM   3105 C  CE1   . PHE A 1 400 ? 35.063 39.045 35.877  1.00 28.25 ? 704 PHE A CE1   1 
ATOM   3106 C  CE2   . PHE A 1 400 ? 36.247 39.031 37.975  1.00 28.53 ? 704 PHE A CE2   1 
ATOM   3107 C  CZ    . PHE A 1 400 ? 36.194 39.366 36.626  1.00 28.66 ? 704 PHE A CZ    1 
ATOM   3108 N  N     . GLY A 1 401 ? 34.455 35.304 40.193  1.00 30.00 ? 705 GLY A N     1 
ATOM   3109 C  CA    . GLY A 1 401 ? 35.678 34.879 40.858  1.00 29.74 ? 705 GLY A CA    1 
ATOM   3110 C  C     . GLY A 1 401 ? 36.257 33.537 40.449  1.00 29.73 ? 705 GLY A C     1 
ATOM   3111 O  O     . GLY A 1 401 ? 37.455 33.424 40.152  1.00 30.76 ? 705 GLY A O     1 
ATOM   3112 N  N     . ILE A 1 402 ? 35.410 32.516 40.453  1.00 28.15 ? 706 ILE A N     1 
ATOM   3113 C  CA    . ILE A 1 402 ? 35.814 31.171 40.087  1.00 27.30 ? 706 ILE A CA    1 
ATOM   3114 C  C     . ILE A 1 402 ? 36.200 31.103 38.616  1.00 26.91 ? 706 ILE A C     1 
ATOM   3115 O  O     . ILE A 1 402 ? 37.271 30.619 38.264  1.00 28.43 ? 706 ILE A O     1 
ATOM   3116 C  CB    . ILE A 1 402 ? 34.659 30.179 40.327  1.00 28.48 ? 706 ILE A CB    1 
ATOM   3117 C  CG1   . ILE A 1 402 ? 34.470 29.954 41.830  1.00 29.39 ? 706 ILE A CG1   1 
ATOM   3118 C  CG2   . ILE A 1 402 ? 34.917 28.872 39.597  1.00 26.40 ? 706 ILE A CG2   1 
ATOM   3119 C  CD1   . ILE A 1 402 ? 33.230 29.145 42.159  1.00 29.32 ? 706 ILE A CD1   1 
ATOM   3120 N  N     . ILE A 1 403 ? 35.319 31.603 37.762  1.00 24.83 ? 707 ILE A N     1 
ATOM   3121 C  CA    . ILE A 1 403 ? 35.529 31.566 36.326  1.00 25.71 ? 707 ILE A CA    1 
ATOM   3122 C  C     . ILE A 1 403 ? 36.688 32.407 35.785  1.00 26.04 ? 707 ILE A C     1 
ATOM   3123 O  O     . ILE A 1 403 ? 37.516 31.927 35.007  1.00 26.18 ? 707 ILE A O     1 
ATOM   3124 C  CB    . ILE A 1 403 ? 34.228 31.948 35.621  1.00 23.41 ? 707 ILE A CB    1 
ATOM   3125 C  CG1   . ILE A 1 403 ? 33.218 30.815 35.813  1.00 23.12 ? 707 ILE A CG1   1 
ATOM   3126 C  CG2   . ILE A 1 403 ? 34.471 32.191 34.146  1.00 22.65 ? 707 ILE A CG2   1 
ATOM   3127 C  CD1   . ILE A 1 403 ? 31.809 31.207 35.505  1.00 19.62 ? 707 ILE A CD1   1 
ATOM   3128 N  N     . ALA A 1 404 ? 36.743 33.663 36.189  1.00 25.73 ? 708 ALA A N     1 
ATOM   3129 C  CA    . ALA A 1 404 ? 37.810 34.535 35.730  1.00 26.32 ? 708 ALA A CA    1 
ATOM   3130 C  C     . ALA A 1 404 ? 39.168 34.045 36.222  1.00 26.30 ? 708 ALA A C     1 
ATOM   3131 O  O     . ALA A 1 404 ? 40.151 34.066 35.480  1.00 26.60 ? 708 ALA A O     1 
ATOM   3132 C  CB    . ALA A 1 404 ? 37.561 35.938 36.206  1.00 24.67 ? 708 ALA A CB    1 
ATOM   3133 N  N     . THR A 1 405 ? 39.230 33.596 37.469  1.00 26.98 ? 709 THR A N     1 
ATOM   3134 C  CA    . THR A 1 405 ? 40.496 33.113 38.004  1.00 26.15 ? 709 THR A CA    1 
ATOM   3135 C  C     . THR A 1 405 ? 40.962 31.881 37.242  1.00 26.08 ? 709 THR A C     1 
ATOM   3136 O  O     . THR A 1 405 ? 42.139 31.751 36.930  1.00 27.21 ? 709 THR A O     1 
ATOM   3137 C  CB    . THR A 1 405 ? 40.394 32.772 39.520  1.00 26.25 ? 709 THR A CB    1 
ATOM   3138 O  OG1   . THR A 1 405 ? 40.004 33.942 40.241  1.00 24.34 ? 709 THR A OG1   1 
ATOM   3139 C  CG2   . THR A 1 405 ? 41.743 32.294 40.066  1.00 22.62 ? 709 THR A CG2   1 
ATOM   3140 N  N     . GLU A 1 406 ? 40.049 30.974 36.925  1.00 26.28 ? 710 GLU A N     1 
ATOM   3141 C  CA    . GLU A 1 406 ? 40.462 29.778 36.205  1.00 27.33 ? 710 GLU A CA    1 
ATOM   3142 C  C     . GLU A 1 406 ? 40.877 30.155 34.767  1.00 26.94 ? 710 GLU A C     1 
ATOM   3143 O  O     . GLU A 1 406 ? 41.863 29.635 34.241  1.00 25.82 ? 710 GLU A O     1 
ATOM   3144 C  CB    . GLU A 1 406 ? 39.329 28.746 36.246  1.00 27.89 ? 710 GLU A CB    1 
ATOM   3145 C  CG    . GLU A 1 406 ? 39.648 27.367 35.659  1.00 31.52 ? 710 GLU A CG    1 
ATOM   3146 C  CD    . GLU A 1 406 ? 40.960 26.752 36.147  1.00 32.83 ? 710 GLU A CD    1 
ATOM   3147 O  OE1   . GLU A 1 406 ? 41.461 27.129 37.229  1.00 35.54 ? 710 GLU A OE1   1 
ATOM   3148 O  OE2   . GLU A 1 406 ? 41.489 25.869 35.440  1.00 34.57 ? 710 GLU A OE2   1 
ATOM   3149 N  N     . MET A 1 407 ? 40.151 31.082 34.148  1.00 26.08 ? 711 MET A N     1 
ATOM   3150 C  CA    . MET A 1 407 ? 40.497 31.519 32.801  1.00 27.67 ? 711 MET A CA    1 
ATOM   3151 C  C     . MET A 1 407 ? 41.916 32.072 32.769  1.00 28.34 ? 711 MET A C     1 
ATOM   3152 O  O     . MET A 1 407 ? 42.702 31.726 31.886  1.00 29.05 ? 711 MET A O     1 
ATOM   3153 C  CB    . MET A 1 407 ? 39.534 32.604 32.310  1.00 26.83 ? 711 MET A CB    1 
ATOM   3154 C  CG    . MET A 1 407 ? 38.176 32.095 31.904  1.00 27.29 ? 711 MET A CG    1 
ATOM   3155 S  SD    . MET A 1 407 ? 38.242 30.920 30.528  1.00 28.66 ? 711 MET A SD    1 
ATOM   3156 C  CE    . MET A 1 407 ? 36.525 30.797 30.120  1.00 27.95 ? 711 MET A CE    1 
ATOM   3157 N  N     . LYS A 1 408 ? 42.234 32.947 33.724  1.00 28.43 ? 712 LYS A N     1 
ATOM   3158 C  CA    . LYS A 1 408 ? 43.562 33.547 33.791  1.00 28.12 ? 712 LYS A CA    1 
ATOM   3159 C  C     . LYS A 1 408 ? 44.608 32.472 34.051  1.00 28.94 ? 712 LYS A C     1 
ATOM   3160 O  O     . LYS A 1 408 ? 45.743 32.552 33.577  1.00 29.85 ? 712 LYS A O     1 
ATOM   3161 C  CB    . LYS A 1 408 ? 43.621 34.615 34.892  1.00 28.44 ? 712 LYS A CB    1 
ATOM   3162 C  CG    . LYS A 1 408 ? 42.937 35.926 34.514  1.00 29.36 ? 712 LYS A CG    1 
ATOM   3163 C  CD    . LYS A 1 408 ? 43.180 37.062 35.512  1.00 30.64 ? 712 LYS A CD    1 
ATOM   3164 C  CE    . LYS A 1 408 ? 42.433 36.861 36.831  1.00 31.77 ? 712 LYS A CE    1 
ATOM   3165 N  NZ    . LYS A 1 408 ? 42.052 38.163 37.470  1.00 33.20 ? 712 LYS A NZ    1 
ATOM   3166 N  N     . SER A 1 409 ? 44.223 31.457 34.807  1.00 28.31 ? 713 SER A N     1 
ATOM   3167 C  CA    . SER A 1 409 ? 45.130 30.362 35.109  1.00 27.96 ? 713 SER A CA    1 
ATOM   3168 C  C     . SER A 1 409 ? 45.400 29.547 33.837  1.00 27.88 ? 713 SER A C     1 
ATOM   3169 O  O     . SER A 1 409 ? 46.544 29.187 33.538  1.00 30.48 ? 713 SER A O     1 
ATOM   3170 C  CB    . SER A 1 409 ? 44.513 29.482 36.198  1.00 26.45 ? 713 SER A CB    1 
ATOM   3171 O  OG    . SER A 1 409 ? 45.360 28.405 36.533  1.00 27.72 ? 713 SER A OG    1 
ATOM   3172 N  N     . LEU A 1 410 ? 44.346 29.264 33.082  1.00 27.57 ? 714 LEU A N     1 
ATOM   3173 C  CA    . LEU A 1 410 ? 44.490 28.510 31.848  1.00 27.55 ? 714 LEU A CA    1 
ATOM   3174 C  C     . LEU A 1 410 ? 45.414 29.236 30.876  1.00 28.04 ? 714 LEU A C     1 
ATOM   3175 O  O     . LEU A 1 410 ? 46.182 28.584 30.160  1.00 29.21 ? 714 LEU A O     1 
ATOM   3176 C  CB    . LEU A 1 410 ? 43.124 28.272 31.210  1.00 26.09 ? 714 LEU A CB    1 
ATOM   3177 C  CG    . LEU A 1 410 ? 42.234 27.280 31.961  1.00 26.55 ? 714 LEU A CG    1 
ATOM   3178 C  CD1   . LEU A 1 410 ? 40.812 27.378 31.426  1.00 24.87 ? 714 LEU A CD1   1 
ATOM   3179 C  CD2   . LEU A 1 410 ? 42.785 25.860 31.802  1.00 25.28 ? 714 LEU A CD2   1 
ATOM   3180 N  N     . TYR A 1 411 ? 45.350 30.571 30.846  1.00 26.29 ? 715 TYR A N     1 
ATOM   3181 C  CA    . TYR A 1 411 ? 46.237 31.320 29.961  1.00 26.14 ? 715 TYR A CA    1 
ATOM   3182 C  C     . TYR A 1 411 ? 47.695 31.090 30.370  1.00 26.50 ? 715 TYR A C     1 
ATOM   3183 O  O     . TYR A 1 411 ? 48.539 30.924 29.504  1.00 24.70 ? 715 TYR A O     1 
ATOM   3184 C  CB    . TYR A 1 411 ? 45.959 32.828 29.995  1.00 24.09 ? 715 TYR A CB    1 
ATOM   3185 C  CG    . TYR A 1 411 ? 46.769 33.625 28.984  1.00 23.22 ? 715 TYR A CG    1 
ATOM   3186 C  CD1   . TYR A 1 411 ? 46.298 33.830 27.684  1.00 21.82 ? 715 TYR A CD1   1 
ATOM   3187 C  CD2   . TYR A 1 411 ? 48.021 34.147 29.316  1.00 23.13 ? 715 TYR A CD2   1 
ATOM   3188 C  CE1   . TYR A 1 411 ? 47.051 34.533 26.742  1.00 22.82 ? 715 TYR A CE1   1 
ATOM   3189 C  CE2   . TYR A 1 411 ? 48.783 34.848 28.375  1.00 25.42 ? 715 TYR A CE2   1 
ATOM   3190 C  CZ    . TYR A 1 411 ? 48.290 35.034 27.096  1.00 23.87 ? 715 TYR A CZ    1 
ATOM   3191 O  OH    . TYR A 1 411 ? 49.044 35.712 26.177  1.00 26.95 ? 715 TYR A OH    1 
ATOM   3192 N  N     . ARG A 1 412 ? 48.009 31.077 31.669  1.00 28.19 ? 716 ARG A N     1 
ATOM   3193 C  CA    . ARG A 1 412 ? 49.413 30.869 32.057  1.00 31.07 ? 716 ARG A CA    1 
ATOM   3194 C  C     . ARG A 1 412 ? 49.878 29.484 31.619  1.00 31.20 ? 716 ARG A C     1 
ATOM   3195 O  O     . ARG A 1 412 ? 51.016 29.320 31.185  1.00 31.97 ? 716 ARG A O     1 
ATOM   3196 C  CB    . ARG A 1 412 ? 49.656 30.999 33.577  1.00 33.16 ? 716 ARG A CB    1 
ATOM   3197 C  CG    . ARG A 1 412 ? 48.855 32.070 34.288  1.00 36.97 ? 716 ARG A CG    1 
ATOM   3198 C  CD    . ARG A 1 412 ? 49.633 33.285 34.797  1.00 38.54 ? 716 ARG A CD    1 
ATOM   3199 N  NE    . ARG A 1 412 ? 48.752 34.444 34.651  1.00 42.85 ? 716 ARG A NE    1 
ATOM   3200 C  CZ    . ARG A 1 412 ? 48.928 35.643 35.195  1.00 43.60 ? 716 ARG A CZ    1 
ATOM   3201 N  NH1   . ARG A 1 412 ? 49.976 35.904 35.967  1.00 45.75 ? 716 ARG A NH1   1 
ATOM   3202 N  NH2   . ARG A 1 412 ? 48.039 36.592 34.947  1.00 43.41 ? 716 ARG A NH2   1 
ATOM   3203 N  N     . THR A 1 413 ? 49.000 28.493 31.725  1.00 30.71 ? 717 THR A N     1 
ATOM   3204 C  CA    . THR A 1 413 ? 49.355 27.138 31.338  1.00 31.70 ? 717 THR A CA    1 
ATOM   3205 C  C     . THR A 1 413 ? 49.657 27.018 29.854  1.00 32.70 ? 717 THR A C     1 
ATOM   3206 O  O     . THR A 1 413 ? 50.502 26.221 29.452  1.00 34.33 ? 717 THR A O     1 
ATOM   3207 C  CB    . THR A 1 413 ? 48.235 26.133 31.692  1.00 32.95 ? 717 THR A CB    1 
ATOM   3208 O  OG1   . THR A 1 413 ? 48.138 26.015 33.116  1.00 31.63 ? 717 THR A OG1   1 
ATOM   3209 C  CG2   . THR A 1 413 ? 48.524 24.755 31.087  1.00 32.52 ? 717 THR A CG2   1 
ATOM   3210 N  N     . LEU A 1 414 ? 48.971 27.784 29.019  1.00 32.34 ? 718 LEU A N     1 
ATOM   3211 C  CA    . LEU A 1 414 ? 49.255 27.678 27.597  1.00 31.84 ? 718 LEU A CA    1 
ATOM   3212 C  C     . LEU A 1 414 ? 50.520 28.455 27.244  1.00 31.87 ? 718 LEU A C     1 
ATOM   3213 O  O     . LEU A 1 414 ? 51.084 28.283 26.165  1.00 32.43 ? 718 LEU A O     1 
ATOM   3214 C  CB    . LEU A 1 414 ? 48.055 28.153 26.778  1.00 30.95 ? 718 LEU A CB    1 
ATOM   3215 C  CG    . LEU A 1 414 ? 46.822 27.261 26.974  1.00 30.68 ? 718 LEU A CG    1 
ATOM   3216 C  CD1   . LEU A 1 414 ? 45.625 27.875 26.276  1.00 28.70 ? 718 LEU A CD1   1 
ATOM   3217 C  CD2   . LEU A 1 414 ? 47.112 25.858 26.437  1.00 29.47 ? 718 LEU A CD2   1 
ATOM   3218 N  N     . GLY A 1 415 ? 50.951 29.309 28.169  1.00 32.23 ? 719 GLY A N     1 
ATOM   3219 C  CA    . GLY A 1 415 ? 52.163 30.094 28.002  1.00 32.91 ? 719 GLY A CA    1 
ATOM   3220 C  C     . GLY A 1 415 ? 52.447 30.846 26.715  1.00 33.57 ? 719 GLY A C     1 
ATOM   3221 O  O     . GLY A 1 415 ? 53.546 30.759 26.163  1.00 34.61 ? 719 GLY A O     1 
ATOM   3222 N  N     . CYS A 1 416 ? 51.475 31.591 26.218  1.00 32.35 ? 720 CYS A N     1 
ATOM   3223 C  CA    . CYS A 1 416 ? 51.718 32.355 25.015  1.00 31.34 ? 720 CYS A CA    1 
ATOM   3224 C  C     . CYS A 1 416 ? 52.170 33.744 25.454  1.00 31.61 ? 720 CYS A C     1 
ATOM   3225 O  O     . CYS A 1 416 ? 51.446 34.435 26.172  1.00 32.22 ? 720 CYS A O     1 
ATOM   3226 C  CB    . CYS A 1 416 ? 50.442 32.460 24.179  1.00 29.64 ? 720 CYS A CB    1 
ATOM   3227 S  SG    . CYS A 1 416 ? 50.581 33.582 22.775  1.00 30.20 ? 720 CYS A SG    1 
ATOM   3228 N  N     . PRO A 1 417 ? 53.388 34.158 25.060  1.00 30.55 ? 721 PRO A N     1 
ATOM   3229 C  CA    . PRO A 1 417 ? 53.846 35.497 25.458  1.00 31.08 ? 721 PRO A CA    1 
ATOM   3230 C  C     . PRO A 1 417 ? 52.805 36.487 24.920  1.00 31.43 ? 721 PRO A C     1 
ATOM   3231 O  O     . PRO A 1 417 ? 52.349 36.341 23.791  1.00 31.42 ? 721 PRO A O     1 
ATOM   3232 C  CB    . PRO A 1 417 ? 55.180 35.652 24.723  1.00 29.87 ? 721 PRO A CB    1 
ATOM   3233 C  CG    . PRO A 1 417 ? 55.632 34.243 24.476  1.00 30.84 ? 721 PRO A CG    1 
ATOM   3234 C  CD    . PRO A 1 417 ? 54.371 33.473 24.203  1.00 29.79 ? 721 PRO A CD    1 
ATOM   3235 N  N     . PRO A 1 418 ? 52.419 37.499 25.709  1.00 31.71 ? 722 PRO A N     1 
ATOM   3236 C  CA    . PRO A 1 418 ? 51.421 38.467 25.226  1.00 31.74 ? 722 PRO A CA    1 
ATOM   3237 C  C     . PRO A 1 418 ? 51.671 39.058 23.835  1.00 32.68 ? 722 PRO A C     1 
ATOM   3238 O  O     . PRO A 1 418 ? 50.750 39.190 23.030  1.00 31.66 ? 722 PRO A O     1 
ATOM   3239 C  CB    . PRO A 1 418 ? 51.437 39.546 26.297  1.00 30.28 ? 722 PRO A CB    1 
ATOM   3240 C  CG    . PRO A 1 418 ? 51.751 38.779 27.545  1.00 31.41 ? 722 PRO A CG    1 
ATOM   3241 C  CD    . PRO A 1 418 ? 52.820 37.792 27.098  1.00 31.42 ? 722 PRO A CD    1 
ATOM   3242 N  N     . MET A 1 419 ? 52.907 39.437 23.550  1.00 33.47 ? 723 MET A N     1 
ATOM   3243 C  CA    . MET A 1 419 ? 53.201 40.004 22.243  1.00 34.11 ? 723 MET A CA    1 
ATOM   3244 C  C     . MET A 1 419 ? 52.953 39.044 21.076  1.00 31.60 ? 723 MET A C     1 
ATOM   3245 O  O     . MET A 1 419 ? 52.886 39.477 19.928  1.00 29.27 ? 723 MET A O     1 
ATOM   3246 C  CB    . MET A 1 419 ? 54.638 40.501 22.199  1.00 38.70 ? 723 MET A CB    1 
ATOM   3247 C  CG    . MET A 1 419 ? 54.755 41.996 22.347  1.00 46.59 ? 723 MET A CG    1 
ATOM   3248 S  SD    . MET A 1 419 ? 56.405 42.436 22.926  1.00 57.37 ? 723 MET A SD    1 
ATOM   3249 C  CE    . MET A 1 419 ? 57.289 42.807 21.330  1.00 55.91 ? 723 MET A CE    1 
ATOM   3250 N  N     . GLU A 1 420 ? 52.815 37.751 21.357  1.00 29.52 ? 724 GLU A N     1 
ATOM   3251 C  CA    . GLU A 1 420 ? 52.572 36.780 20.284  1.00 30.82 ? 724 GLU A CA    1 
ATOM   3252 C  C     . GLU A 1 420 ? 51.092 36.467 20.161  1.00 28.56 ? 724 GLU A C     1 
ATOM   3253 O  O     . GLU A 1 420 ? 50.677 35.767 19.246  1.00 29.29 ? 724 GLU A O     1 
ATOM   3254 C  CB    . GLU A 1 420 ? 53.278 35.456 20.550  1.00 33.48 ? 724 GLU A CB    1 
ATOM   3255 C  CG    . GLU A 1 420 ? 54.674 35.567 21.085  1.00 40.25 ? 724 GLU A CG    1 
ATOM   3256 C  CD    . GLU A 1 420 ? 55.704 35.399 20.006  1.00 46.21 ? 724 GLU A CD    1 
ATOM   3257 O  OE1   . GLU A 1 420 ? 55.683 36.197 19.036  1.00 46.26 ? 724 GLU A OE1   1 
ATOM   3258 O  OE2   . GLU A 1 420 ? 56.530 34.460 20.130  1.00 50.73 ? 724 GLU A OE2   1 
ATOM   3259 N  N     . LEU A 1 421 ? 50.300 36.956 21.098  1.00 26.39 ? 725 LEU A N     1 
ATOM   3260 C  CA    . LEU A 1 421 ? 48.873 36.693 21.073  1.00 26.42 ? 725 LEU A CA    1 
ATOM   3261 C  C     . LEU A 1 421 ? 48.213 37.369 19.880  1.00 26.18 ? 725 LEU A C     1 
ATOM   3262 O  O     . LEU A 1 421 ? 48.477 38.532 19.609  1.00 27.54 ? 725 LEU A O     1 
ATOM   3263 C  CB    . LEU A 1 421 ? 48.242 37.205 22.357  1.00 25.07 ? 725 LEU A CB    1 
ATOM   3264 C  CG    . LEU A 1 421 ? 46.856 36.666 22.638  1.00 24.13 ? 725 LEU A CG    1 
ATOM   3265 C  CD1   . LEU A 1 421 ? 46.888 35.140 22.670  1.00 24.13 ? 725 LEU A CD1   1 
ATOM   3266 C  CD2   . LEU A 1 421 ? 46.392 37.245 23.970  1.00 25.36 ? 725 LEU A CD2   1 
ATOM   3267 N  N     . ARG A 1 422 ? 47.353 36.653 19.164  1.00 25.49 ? 726 ARG A N     1 
ATOM   3268 C  CA    . ARG A 1 422 ? 46.678 37.256 18.016  1.00 24.47 ? 726 ARG A CA    1 
ATOM   3269 C  C     . ARG A 1 422 ? 45.179 36.986 17.997  1.00 25.05 ? 726 ARG A C     1 
ATOM   3270 O  O     . ARG A 1 422 ? 44.446 37.528 17.163  1.00 23.60 ? 726 ARG A O     1 
ATOM   3271 C  CB    . ARG A 1 422 ? 47.295 36.752 16.712  1.00 25.40 ? 726 ARG A CB    1 
ATOM   3272 C  CG    . ARG A 1 422 ? 48.681 37.307 16.419  1.00 27.61 ? 726 ARG A CG    1 
ATOM   3273 C  CD    . ARG A 1 422 ? 48.625 38.776 16.013  1.00 29.40 ? 726 ARG A CD    1 
ATOM   3274 N  NE    . ARG A 1 422 ? 49.948 39.304 15.690  1.00 30.43 ? 726 ARG A NE    1 
ATOM   3275 C  CZ    . ARG A 1 422 ? 50.831 39.728 16.589  1.00 33.79 ? 726 ARG A CZ    1 
ATOM   3276 N  NH1   . ARG A 1 422 ? 50.533 39.700 17.884  1.00 33.44 ? 726 ARG A NH1   1 
ATOM   3277 N  NH2   . ARG A 1 422 ? 52.026 40.158 16.193  1.00 34.44 ? 726 ARG A NH2   1 
ATOM   3278 N  N     . GLY A 1 423 ? 44.725 36.146 18.916  1.00 25.11 ? 727 GLY A N     1 
ATOM   3279 C  CA    . GLY A 1 423 ? 43.318 35.816 18.975  1.00 26.83 ? 727 GLY A CA    1 
ATOM   3280 C  C     . GLY A 1 423 ? 43.068 35.172 20.313  1.00 28.40 ? 727 GLY A C     1 
ATOM   3281 O  O     . GLY A 1 423 ? 43.969 34.551 20.887  1.00 29.41 ? 727 GLY A O     1 
ATOM   3282 N  N     . LEU A 1 424 ? 41.838 35.279 20.794  1.00 28.16 ? 728 LEU A N     1 
ATOM   3283 C  CA    . LEU A 1 424 ? 41.511 34.752 22.103  1.00 28.41 ? 728 LEU A CA    1 
ATOM   3284 C  C     . LEU A 1 424 ? 40.036 34.352 22.180  1.00 27.91 ? 728 LEU A C     1 
ATOM   3285 O  O     . LEU A 1 424 ? 39.171 35.106 21.744  1.00 28.76 ? 728 LEU A O     1 
ATOM   3286 C  CB    . LEU A 1 424 ? 41.824 35.854 23.108  1.00 28.90 ? 728 LEU A CB    1 
ATOM   3287 C  CG    . LEU A 1 424 ? 41.960 35.632 24.609  1.00 32.15 ? 728 LEU A CG    1 
ATOM   3288 C  CD1   . LEU A 1 424 ? 40.773 34.863 25.105  1.00 35.03 ? 728 LEU A CD1   1 
ATOM   3289 C  CD2   . LEU A 1 424 ? 43.231 34.875 24.917  1.00 34.15 ? 728 LEU A CD2   1 
ATOM   3290 N  N     . ALA A 1 425 ? 39.748 33.170 22.719  1.00 25.67 ? 729 ALA A N     1 
ATOM   3291 C  CA    . ALA A 1 425 ? 38.365 32.724 22.853  1.00 25.33 ? 729 ALA A CA    1 
ATOM   3292 C  C     . ALA A 1 425 ? 38.064 32.281 24.288  1.00 24.59 ? 729 ALA A C     1 
ATOM   3293 O  O     . ALA A 1 425 ? 38.866 31.572 24.893  1.00 23.93 ? 729 ALA A O     1 
ATOM   3294 C  CB    . ALA A 1 425 ? 38.090 31.581 21.880  1.00 22.67 ? 729 ALA A CB    1 
ATOM   3295 N  N     . LEU A 1 426 ? 36.926 32.718 24.834  1.00 23.75 ? 730 LEU A N     1 
ATOM   3296 C  CA    . LEU A 1 426 ? 36.515 32.325 26.187  1.00 24.05 ? 730 LEU A CA    1 
ATOM   3297 C  C     . LEU A 1 426 ? 35.231 31.549 26.006  1.00 25.57 ? 730 LEU A C     1 
ATOM   3298 O  O     . LEU A 1 426 ? 34.245 32.085 25.477  1.00 26.24 ? 730 LEU A O     1 
ATOM   3299 C  CB    . LEU A 1 426 ? 36.262 33.536 27.068  1.00 23.28 ? 730 LEU A CB    1 
ATOM   3300 C  CG    . LEU A 1 426 ? 37.467 34.465 27.168  1.00 26.12 ? 730 LEU A CG    1 
ATOM   3301 C  CD1   . LEU A 1 426 ? 37.128 35.593 28.117  1.00 25.04 ? 730 LEU A CD1   1 
ATOM   3302 C  CD2   . LEU A 1 426 ? 38.704 33.696 27.650  1.00 26.73 ? 730 LEU A CD2   1 
ATOM   3303 N  N     . GLN A 1 427 ? 35.248 30.296 26.455  1.00 24.92 ? 731 GLN A N     1 
ATOM   3304 C  CA    . GLN A 1 427 ? 34.116 29.396 26.274  1.00 26.81 ? 731 GLN A CA    1 
ATOM   3305 C  C     . GLN A 1 427 ? 33.538 28.755 27.536  1.00 26.05 ? 731 GLN A C     1 
ATOM   3306 O  O     . GLN A 1 427 ? 34.276 28.324 28.418  1.00 24.57 ? 731 GLN A O     1 
ATOM   3307 C  CB    . GLN A 1 427 ? 34.518 28.242 25.327  1.00 27.13 ? 731 GLN A CB    1 
ATOM   3308 C  CG    . GLN A 1 427 ? 35.275 28.634 24.043  1.00 30.98 ? 731 GLN A CG    1 
ATOM   3309 C  CD    . GLN A 1 427 ? 35.661 27.423 23.160  1.00 32.49 ? 731 GLN A CD    1 
ATOM   3310 O  OE1   . GLN A 1 427 ? 35.753 26.288 23.637  1.00 33.93 ? 731 GLN A OE1   1 
ATOM   3311 N  NE2   . GLN A 1 427 ? 35.915 27.681 21.877  1.00 32.43 ? 731 GLN A NE2   1 
ATOM   3312 N  N     . PHE A 1 428 ? 32.210 28.706 27.605  1.00 25.44 ? 732 PHE A N     1 
ATOM   3313 C  CA    . PHE A 1 428 ? 31.510 28.010 28.682  1.00 26.60 ? 732 PHE A CA    1 
ATOM   3314 C  C     . PHE A 1 428 ? 30.938 26.808 27.893  1.00 27.79 ? 732 PHE A C     1 
ATOM   3315 O  O     . PHE A 1 428 ? 29.949 26.950 27.168  1.00 26.82 ? 732 PHE A O     1 
ATOM   3316 C  CB    . PHE A 1 428 ? 30.380 28.869 29.278  1.00 25.68 ? 732 PHE A CB    1 
ATOM   3317 C  CG    . PHE A 1 428 ? 30.853 30.132 29.986  1.00 27.07 ? 732 PHE A CG    1 
ATOM   3318 C  CD1   . PHE A 1 428 ? 32.202 30.342 30.291  1.00 25.04 ? 732 PHE A CD1   1 
ATOM   3319 C  CD2   . PHE A 1 428 ? 29.924 31.113 30.361  1.00 28.07 ? 732 PHE A CD2   1 
ATOM   3320 C  CE1   . PHE A 1 428 ? 32.612 31.509 30.955  1.00 25.25 ? 732 PHE A CE1   1 
ATOM   3321 C  CE2   . PHE A 1 428 ? 30.327 32.282 31.028  1.00 25.86 ? 732 PHE A CE2   1 
ATOM   3322 C  CZ    . PHE A 1 428 ? 31.671 32.477 31.323  1.00 26.50 ? 732 PHE A CZ    1 
ATOM   3323 N  N     . ASN A 1 429 ? 31.586 25.645 28.017  1.00 28.87 ? 733 ASN A N     1 
ATOM   3324 C  CA    . ASN A 1 429 ? 31.217 24.429 27.277  1.00 31.90 ? 733 ASN A CA    1 
ATOM   3325 C  C     . ASN A 1 429 ? 30.006 23.597 27.691  1.00 34.75 ? 733 ASN A C     1 
ATOM   3326 O  O     . ASN A 1 429 ? 29.329 23.038 26.832  1.00 36.14 ? 733 ASN A O     1 
ATOM   3327 C  CB    . ASN A 1 429 ? 32.419 23.495 27.193  1.00 30.76 ? 733 ASN A CB    1 
ATOM   3328 C  CG    . ASN A 1 429 ? 33.673 24.204 26.742  1.00 32.16 ? 733 ASN A CG    1 
ATOM   3329 O  OD1   . ASN A 1 429 ? 33.860 24.497 25.554  1.00 32.98 ? 733 ASN A OD1   1 
ATOM   3330 N  ND2   . ASN A 1 429 ? 34.539 24.506 27.697  1.00 28.17 ? 733 ASN A ND2   1 
ATOM   3331 N  N     . LYS A 1 430 ? 29.756 23.446 28.982  1.00 37.26 ? 734 LYS A N     1 
ATOM   3332 C  CA    . LYS A 1 430 ? 28.587 22.685 29.400  1.00 39.43 ? 734 LYS A CA    1 
ATOM   3333 C  C     . LYS A 1 430 ? 27.799 23.681 30.213  1.00 40.25 ? 734 LYS A C     1 
ATOM   3334 O  O     . LYS A 1 430 ? 28.355 24.368 31.065  1.00 40.45 ? 734 LYS A O     1 
ATOM   3335 C  CB    . LYS A 1 430 ? 28.975 21.472 30.255  1.00 41.11 ? 734 LYS A CB    1 
ATOM   3336 C  CG    . LYS A 1 430 ? 29.635 20.339 29.482  1.00 45.83 ? 734 LYS A CG    1 
ATOM   3337 C  CD    . LYS A 1 430 ? 30.249 19.334 30.445  1.00 49.55 ? 734 LYS A CD    1 
ATOM   3338 C  CE    . LYS A 1 430 ? 30.703 18.073 29.724  1.00 52.87 ? 734 LYS A CE    1 
ATOM   3339 N  NZ    . LYS A 1 430 ? 30.306 16.833 30.476  1.00 55.26 ? 734 LYS A NZ    1 
ATOM   3340 N  N     . LEU A 1 431 ? 26.514 23.788 29.912  1.00 41.53 ? 735 LEU A N     1 
ATOM   3341 C  CA    . LEU A 1 431 ? 25.637 24.714 30.601  1.00 41.78 ? 735 LEU A CA    1 
ATOM   3342 C  C     . LEU A 1 431 ? 24.674 23.907 31.435  1.00 44.35 ? 735 LEU A C     1 
ATOM   3343 O  O     . LEU A 1 431 ? 24.105 22.917 30.971  1.00 44.13 ? 735 LEU A O     1 
ATOM   3344 C  CB    . LEU A 1 431 ? 24.856 25.551 29.595  1.00 38.76 ? 735 LEU A CB    1 
ATOM   3345 C  CG    . LEU A 1 431 ? 25.708 26.348 28.617  1.00 38.74 ? 735 LEU A CG    1 
ATOM   3346 C  CD1   . LEU A 1 431 ? 24.819 27.109 27.648  1.00 35.84 ? 735 LEU A CD1   1 
ATOM   3347 C  CD2   . LEU A 1 431 ? 26.607 27.302 29.393  1.00 36.51 ? 735 LEU A CD2   1 
ATOM   3348 N  N     . VAL A 1 432 ? 24.515 24.313 32.684  1.00 47.20 ? 736 VAL A N     1 
ATOM   3349 C  CA    . VAL A 1 432 ? 23.601 23.615 33.554  1.00 49.76 ? 736 VAL A CA    1 
ATOM   3350 C  C     . VAL A 1 432 ? 22.485 24.557 33.881  1.00 52.75 ? 736 VAL A C     1 
ATOM   3351 O  O     . VAL A 1 432 ? 22.650 25.777 33.942  1.00 52.59 ? 736 VAL A O     1 
ATOM   3352 C  CB    . VAL A 1 432 ? 24.284 23.119 34.816  1.00 48.89 ? 736 VAL A CB    1 
ATOM   3353 C  CG1   . VAL A 1 432 ? 23.293 22.321 35.669  1.00 48.13 ? 736 VAL A CG1   1 
ATOM   3354 C  CG2   . VAL A 1 432 ? 25.470 22.250 34.439  1.00 48.47 ? 736 VAL A CG2   1 
ATOM   3355 N  N     . ASP A 1 433 ? 21.336 23.964 34.109  1.00 55.93 ? 737 ASP A N     1 
ATOM   3356 C  CA    . ASP A 1 433 ? 20.177 24.750 34.327  1.00 58.83 ? 737 ASP A CA    1 
ATOM   3357 C  C     . ASP A 1 433 ? 19.873 25.398 35.654  1.00 60.40 ? 737 ASP A C     1 
ATOM   3358 O  O     . ASP A 1 433 ? 20.493 25.147 36.698  1.00 60.52 ? 737 ASP A O     1 
ATOM   3359 C  CB    . ASP A 1 433 ? 18.965 23.956 33.891  1.00 60.77 ? 737 ASP A CB    1 
ATOM   3360 C  CG    . ASP A 1 433 ? 18.078 24.745 32.976  1.00 63.34 ? 737 ASP A CG    1 
ATOM   3361 O  OD1   . ASP A 1 433 ? 17.573 24.158 32.002  1.00 64.63 ? 737 ASP A OD1   1 
ATOM   3362 O  OD2   . ASP A 1 433 ? 17.888 25.959 33.227  1.00 64.68 ? 737 ASP A OD2   1 
ATOM   3363 N  N     . VAL A 1 434 ? 18.890 26.283 35.523  1.00 62.46 ? 738 VAL A N     1 
ATOM   3364 C  CA    . VAL A 1 434 ? 18.283 27.077 36.569  1.00 64.80 ? 738 VAL A CA    1 
ATOM   3365 C  C     . VAL A 1 434 ? 19.289 27.641 37.569  1.00 65.80 ? 738 VAL A C     1 
ATOM   3366 O  O     . VAL A 1 434 ? 20.180 28.399 37.120  1.00 66.06 ? 738 VAL A O     1 
ATOM   3367 C  CB    . VAL A 1 434 ? 17.138 26.229 37.223  1.00 64.98 ? 738 VAL A CB    1 
ATOM   3368 C  CG1   . VAL A 1 434 ? 16.979 26.534 38.692  1.00 64.86 ? 738 VAL A CG1   1 
ATOM   3369 C  CG2   . VAL A 1 434 ? 15.813 26.504 36.495  1.00 65.23 ? 738 VAL A CG2   1 
ATOM   3370 O  OXT   . VAL A 1 434 ? 19.196 27.349 38.774  1.00 67.61 ? 738 VAL A OXT   1 
ATOM   3371 O  "O5'" . DT  B 2 1   ? 40.534 51.645 3.247   1.00 31.14 ? 1   DT  T "O5'" 1 
ATOM   3372 C  "C5'" . DT  B 2 1   ? 41.369 51.831 4.402   1.00 28.88 ? 1   DT  T "C5'" 1 
ATOM   3373 C  "C4'" . DT  B 2 1   ? 42.368 50.713 4.586   1.00 27.81 ? 1   DT  T "C4'" 1 
ATOM   3374 O  "O4'" . DT  B 2 1   ? 43.591 51.205 5.195   1.00 27.00 ? 1   DT  T "O4'" 1 
ATOM   3375 C  "C3'" . DT  B 2 1   ? 41.882 49.585 5.495   1.00 26.70 ? 1   DT  T "C3'" 1 
ATOM   3376 O  "O3'" . DT  B 2 1   ? 42.475 48.375 5.033   1.00 26.11 ? 1   DT  T "O3'" 1 
ATOM   3377 C  "C2'" . DT  B 2 1   ? 42.517 49.938 6.821   1.00 26.44 ? 1   DT  T "C2'" 1 
ATOM   3378 C  "C1'" . DT  B 2 1   ? 43.876 50.389 6.323   1.00 26.02 ? 1   DT  T "C1'" 1 
ATOM   3379 N  N1    . DT  B 2 1   ? 44.615 51.176 7.300   1.00 25.22 ? 1   DT  T N1    1 
ATOM   3380 C  C2    . DT  B 2 1   ? 45.978 50.987 7.423   1.00 26.47 ? 1   DT  T C2    1 
ATOM   3381 O  O2    . DT  B 2 1   ? 46.609 50.189 6.744   1.00 26.55 ? 1   DT  T O2    1 
ATOM   3382 N  N3    . DT  B 2 1   ? 46.575 51.759 8.392   1.00 23.80 ? 1   DT  T N3    1 
ATOM   3383 C  C4    . DT  B 2 1   ? 45.946 52.656 9.238   1.00 25.56 ? 1   DT  T C4    1 
ATOM   3384 O  O4    . DT  B 2 1   ? 46.591 53.246 10.090  1.00 24.30 ? 1   DT  T O4    1 
ATOM   3385 C  C5    . DT  B 2 1   ? 44.518 52.806 9.038   1.00 26.02 ? 1   DT  T C5    1 
ATOM   3386 C  C7    . DT  B 2 1   ? 43.758 53.766 9.897   1.00 24.71 ? 1   DT  T C7    1 
ATOM   3387 C  C6    . DT  B 2 1   ? 43.938 52.073 8.089   1.00 25.32 ? 1   DT  T C6    1 
ATOM   3388 P  P     . DA  B 2 2   ? 41.572 47.299 4.279   1.00 23.03 ? 2   DA  T P     1 
ATOM   3389 O  OP1   . DA  B 2 2   ? 42.447 46.255 3.731   1.00 22.94 ? 2   DA  T OP1   1 
ATOM   3390 O  OP2   . DA  B 2 2   ? 40.624 48.027 3.387   1.00 26.59 ? 2   DA  T OP2   1 
ATOM   3391 O  "O5'" . DA  B 2 2   ? 40.769 46.663 5.478   1.00 26.76 ? 2   DA  T "O5'" 1 
ATOM   3392 C  "C5'" . DA  B 2 2   ? 41.482 46.090 6.564   1.00 27.98 ? 2   DA  T "C5'" 1 
ATOM   3393 C  "C4'" . DA  B 2 2   ? 40.555 45.884 7.734   1.00 28.86 ? 2   DA  T "C4'" 1 
ATOM   3394 O  "O4'" . DA  B 2 2   ? 40.478 47.135 8.465   1.00 28.26 ? 2   DA  T "O4'" 1 
ATOM   3395 C  "C3'" . DA  B 2 2   ? 39.138 45.525 7.276   1.00 28.66 ? 2   DA  T "C3'" 1 
ATOM   3396 O  "O3'" . DA  B 2 2   ? 38.644 44.324 7.843   1.00 28.05 ? 2   DA  T "O3'" 1 
ATOM   3397 C  "C2'" . DA  B 2 2   ? 38.279 46.702 7.691   1.00 30.06 ? 2   DA  T "C2'" 1 
ATOM   3398 C  "C1'" . DA  B 2 2   ? 39.136 47.592 8.591   1.00 28.06 ? 2   DA  T "C1'" 1 
ATOM   3399 N  N9    . DA  B 2 2   ? 39.067 48.970 8.081   1.00 25.95 ? 2   DA  T N9    1 
ATOM   3400 C  C8    . DA  B 2 2   ? 38.432 49.305 6.906   1.00 23.87 ? 2   DA  T C8    1 
ATOM   3401 N  N7    . DA  B 2 2   ? 38.430 50.583 6.644   1.00 27.19 ? 2   DA  T N7    1 
ATOM   3402 C  C5    . DA  B 2 2   ? 39.128 51.140 7.701   1.00 26.66 ? 2   DA  T C5    1 
ATOM   3403 C  C6    . DA  B 2 2   ? 39.473 52.464 7.992   1.00 25.99 ? 2   DA  T C6    1 
ATOM   3404 N  N6    . DA  B 2 2   ? 39.148 53.491 7.208   1.00 25.82 ? 2   DA  T N6    1 
ATOM   3405 N  N1    . DA  B 2 2   ? 40.169 52.698 9.126   1.00 26.86 ? 2   DA  T N1    1 
ATOM   3406 C  C2    . DA  B 2 2   ? 40.495 51.653 9.903   1.00 26.50 ? 2   DA  T C2    1 
ATOM   3407 N  N3    . DA  B 2 2   ? 40.232 50.351 9.731   1.00 25.77 ? 2   DA  T N3    1 
ATOM   3408 C  C4    . DA  B 2 2   ? 39.534 50.158 8.598   1.00 25.99 ? 2   DA  T C4    1 
ATOM   3409 P  P     . DA  B 2 3   ? 37.217 43.727 7.368   1.00 26.19 ? 3   DA  T P     1 
ATOM   3410 O  OP1   . DA  B 2 3   ? 37.459 42.319 6.995   1.00 26.76 ? 3   DA  T OP1   1 
ATOM   3411 O  OP2   . DA  B 2 3   ? 36.528 44.633 6.416   1.00 24.33 ? 3   DA  T OP2   1 
ATOM   3412 O  "O5'" . DA  B 2 3   ? 36.475 43.700 8.765   1.00 25.23 ? 3   DA  T "O5'" 1 
ATOM   3413 C  "C5'" . DA  B 2 3   ? 37.287 43.416 9.895   1.00 22.53 ? 3   DA  T "C5'" 1 
ATOM   3414 C  "C4'" . DA  B 2 3   ? 36.497 43.376 11.173  1.00 25.36 ? 3   DA  T "C4'" 1 
ATOM   3415 O  "O4'" . DA  B 2 3   ? 36.818 44.592 11.881  1.00 22.55 ? 3   DA  T "O4'" 1 
ATOM   3416 C  "C3'" . DA  B 2 3   ? 34.972 43.300 11.050  1.00 25.17 ? 3   DA  T "C3'" 1 
ATOM   3417 O  "O3'" . DA  B 2 3   ? 34.423 42.210 11.769  1.00 25.28 ? 3   DA  T "O3'" 1 
ATOM   3418 C  "C2'" . DA  B 2 3   ? 34.482 44.592 11.669  1.00 25.36 ? 3   DA  T "C2'" 1 
ATOM   3419 C  "C1'" . DA  B 2 3   ? 35.662 45.115 12.482  1.00 24.99 ? 3   DA  T "C1'" 1 
ATOM   3420 N  N9    . DA  B 2 3   ? 35.695 46.571 12.363  1.00 24.19 ? 3   DA  T N9    1 
ATOM   3421 C  C8    . DA  B 2 3   ? 35.581 47.294 11.196  1.00 23.45 ? 3   DA  T C8    1 
ATOM   3422 N  N7    . DA  B 2 3   ? 35.402 48.582 11.387  1.00 23.80 ? 3   DA  T N7    1 
ATOM   3423 C  C5    . DA  B 2 3   ? 35.463 48.726 12.768  1.00 23.52 ? 3   DA  T C5    1 
ATOM   3424 C  C6    . DA  B 2 3   ? 35.347 49.850 13.612  1.00 23.61 ? 3   DA  T C6    1 
ATOM   3425 N  N6    . DA  B 2 3   ? 35.093 51.082 13.176  1.00 23.90 ? 3   DA  T N6    1 
ATOM   3426 N  N1    . DA  B 2 3   ? 35.481 49.651 14.943  1.00 25.48 ? 3   DA  T N1    1 
ATOM   3427 C  C2    . DA  B 2 3   ? 35.704 48.406 15.387  1.00 21.71 ? 3   DA  T C2    1 
ATOM   3428 N  N3    . DA  B 2 3   ? 35.823 47.272 14.697  1.00 23.34 ? 3   DA  T N3    1 
ATOM   3429 C  C4    . DA  B 2 3   ? 35.692 47.500 13.379  1.00 23.32 ? 3   DA  T C4    1 
HETATM 3430 P  P     . P   B 2 4   ? 34.217 40.810 11.018  1.00 25.83 ? 4   P   T P     1 
HETATM 3431 O  OP1   . P   B 2 4   ? 34.188 41.081 9.570   1.00 20.42 ? 4   P   T OP1   1 
HETATM 3432 O  OP2   . P   B 2 4   ? 33.130 39.988 11.611  1.00 26.38 ? 4   P   T OP2   1 
HETATM 3433 O  "O5'" . P   B 2 4   ? 35.522 40.030 11.477  1.00 27.06 ? 4   P   T "O5'" 1 
HETATM 3434 C  "C5'" . P   B 2 4   ? 36.581 39.734 10.627  1.00 24.33 ? 4   P   T "C5'" 1 
HETATM 3435 C  "C4'" . P   B 2 4   ? 36.928 38.272 10.841  1.00 25.39 ? 4   P   T "C4'" 1 
HETATM 3436 O  "O4'" . P   B 2 4   ? 38.117 38.005 10.059  1.00 26.57 ? 4   P   T "O4'" 1 
HETATM 3437 C  "C3'" . P   B 2 4   ? 37.307 37.849 12.338  1.00 25.68 ? 4   P   T "C3'" 1 
HETATM 3438 O  "O3'" . P   B 2 4   ? 36.273 37.189 13.146  1.00 27.06 ? 4   P   T "O3'" 1 
HETATM 3439 C  "C2'" . P   B 2 4   ? 38.356 36.813 12.091  1.00 25.79 ? 4   P   T "C2'" 1 
HETATM 3440 C  "C1'" . P   B 2 4   ? 38.821 36.959 10.662  1.00 27.36 ? 4   P   T "C1'" 1 
HETATM 3441 N  N9    . P   B 2 4   ? 40.224 37.272 10.558  1.00 26.53 ? 4   P   T N9    1 
HETATM 3442 C  C8    . P   B 2 4   ? 41.011 37.940 11.454  1.00 26.29 ? 4   P   T C8    1 
HETATM 3443 N  N7    . P   B 2 4   ? 42.244 38.043 11.065  1.00 27.05 ? 4   P   T N7    1 
HETATM 3444 C  C5    . P   B 2 4   ? 42.262 37.395 9.838   1.00 27.17 ? 4   P   T C5    1 
HETATM 3445 C  C6    . P   B 2 4   ? 43.326 37.172 8.926   1.00 27.75 ? 4   P   T C6    1 
HETATM 3446 O  O6    . P   B 2 4   ? 44.503 37.502 9.034   1.00 29.71 ? 4   P   T O6    1 
HETATM 3447 N  N1    . P   B 2 4   ? 42.900 36.467 7.795   1.00 27.88 ? 4   P   T N1    1 
HETATM 3448 C  C2    . P   B 2 4   ? 41.597 36.041 7.580   1.00 26.27 ? 4   P   T C2    1 
HETATM 3449 N  N2    . P   B 2 4   ? 41.301 35.370 6.441   1.00 27.47 ? 4   P   T N2    1 
HETATM 3450 N  N3    . P   B 2 4   ? 40.614 36.255 8.431   1.00 28.14 ? 4   P   T N3    1 
HETATM 3451 C  C4    . P   B 2 4   ? 41.020 36.934 9.520   1.00 26.36 ? 4   P   T C4    1 
HETATM 3452 C  C6A   . P   B 2 4   ? 42.272 35.049 5.377   1.00 27.67 ? 4   P   T C6A   1 
HETATM 3453 C  C7A   . P   B 2 4   ? 43.659 34.904 5.984   1.00 28.64 ? 4   P   T C7A   1 
HETATM 3454 C  C8A   . P   B 2 4   ? 43.953 36.172 6.788   1.00 26.64 ? 4   P   T C8A   1 
ATOM   3455 P  P     . DG  B 2 5   ? 36.547 36.813 14.611  1.00 22.93 ? 5   DG  T P     1 
ATOM   3456 O  OP1   . DG  B 2 5   ? 37.131 37.939 15.349  1.00 21.25 ? 5   DG  T OP1   1 
ATOM   3457 O  OP2   . DG  B 2 5   ? 37.033 35.444 14.865  1.00 23.43 ? 5   DG  T OP2   1 
ATOM   3458 O  "O5'" . DG  B 2 5   ? 35.021 36.735 15.173  1.00 22.49 ? 5   DG  T "O5'" 1 
ATOM   3459 C  "C5'" . DG  B 2 5   ? 34.154 37.862 15.148  1.00 20.97 ? 5   DG  T "C5'" 1 
ATOM   3460 C  "C4'" . DG  B 2 5   ? 32.798 37.510 15.686  1.00 23.53 ? 5   DG  T "C4'" 1 
ATOM   3461 O  "O4'" . DG  B 2 5   ? 32.136 36.541 14.835  1.00 22.05 ? 5   DG  T "O4'" 1 
ATOM   3462 C  "C3'" . DG  B 2 5   ? 32.909 36.840 17.028  1.00 23.62 ? 5   DG  T "C3'" 1 
ATOM   3463 O  "O3'" . DG  B 2 5   ? 31.716 37.204 17.686  1.00 23.29 ? 5   DG  T "O3'" 1 
ATOM   3464 C  "C2'" . DG  B 2 5   ? 33.023 35.369 16.655  1.00 23.16 ? 5   DG  T "C2'" 1 
ATOM   3465 C  "C1'" . DG  B 2 5   ? 32.158 35.257 15.426  1.00 23.66 ? 5   DG  T "C1'" 1 
ATOM   3466 N  N9    . DG  B 2 5   ? 32.404 34.322 14.348  1.00 26.83 ? 5   DG  T N9    1 
ATOM   3467 C  C8    . DG  B 2 5   ? 33.654 34.072 13.895  1.00 26.09 ? 5   DG  T C8    1 
ATOM   3468 N  N7    . DG  B 2 5   ? 33.699 33.460 12.764  1.00 26.21 ? 5   DG  T N7    1 
ATOM   3469 C  C5    . DG  B 2 5   ? 32.362 33.236 12.451  1.00 26.66 ? 5   DG  T C5    1 
ATOM   3470 C  C6    . DG  B 2 5   ? 31.803 32.619 11.331  1.00 26.54 ? 5   DG  T C6    1 
ATOM   3471 O  O6    . DG  B 2 5   ? 32.388 32.193 10.345  1.00 24.36 ? 5   DG  T O6    1 
ATOM   3472 N  N1    . DG  B 2 5   ? 30.414 32.580 11.400  1.00 26.25 ? 5   DG  T N1    1 
ATOM   3473 C  C2    . DG  B 2 5   ? 29.664 33.089 12.423  1.00 28.46 ? 5   DG  T C2    1 
ATOM   3474 N  N2    . DG  B 2 5   ? 28.321 32.934 12.286  1.00 28.80 ? 5   DG  T N2    1 
ATOM   3475 N  N3    . DG  B 2 5   ? 30.180 33.689 13.500  1.00 28.26 ? 5   DG  T N3    1 
ATOM   3476 C  C4    . DG  B 2 5   ? 31.537 33.731 13.440  1.00 25.70 ? 5   DG  T C4    1 
ATOM   3477 P  P     . DT  B 2 6   ? 31.326 36.543 19.088  1.00 23.97 ? 6   DT  T P     1 
ATOM   3478 O  OP1   . DT  B 2 6   ? 30.307 37.420 19.729  1.00 24.49 ? 6   DT  T OP1   1 
ATOM   3479 O  OP2   . DT  B 2 6   ? 32.522 36.129 19.866  1.00 22.82 ? 6   DT  T OP2   1 
ATOM   3480 O  "O5'" . DT  B 2 6   ? 30.522 35.307 18.545  1.00 24.63 ? 6   DT  T "O5'" 1 
ATOM   3481 C  "C5'" . DT  B 2 6   ? 30.501 34.140 19.235  1.00 25.25 ? 6   DT  T "C5'" 1 
ATOM   3482 C  "C4'" . DT  B 2 6   ? 29.628 33.148 18.526  1.00 27.74 ? 6   DT  T "C4'" 1 
ATOM   3483 O  "O4'" . DT  B 2 6   ? 30.158 32.809 17.198  1.00 27.37 ? 6   DT  T "O4'" 1 
ATOM   3484 C  "C3'" . DT  B 2 6   ? 29.921 31.945 19.397  1.00 28.52 ? 6   DT  T "C3'" 1 
ATOM   3485 O  "O3'" . DT  B 2 6   ? 28.789 31.145 19.557  1.00 29.43 ? 6   DT  T "O3'" 1 
ATOM   3486 C  "C2'" . DT  B 2 6   ? 31.072 31.262 18.686  1.00 28.37 ? 6   DT  T "C2'" 1 
ATOM   3487 C  "C1'" . DT  B 2 6   ? 30.632 31.469 17.256  1.00 28.69 ? 6   DT  T "C1'" 1 
ATOM   3488 N  N1    . DT  B 2 6   ? 31.602 31.173 16.152  1.00 30.35 ? 6   DT  T N1    1 
ATOM   3489 C  C2    . DT  B 2 6   ? 31.105 30.574 15.001  1.00 31.91 ? 6   DT  T C2    1 
ATOM   3490 O  O2    . DT  B 2 6   ? 29.931 30.298 14.841  1.00 34.85 ? 6   DT  T O2    1 
ATOM   3491 N  N3    . DT  B 2 6   ? 32.047 30.296 14.038  1.00 31.28 ? 6   DT  T N3    1 
ATOM   3492 C  C4    . DT  B 2 6   ? 33.400 30.538 14.096  1.00 32.65 ? 6   DT  T C4    1 
ATOM   3493 O  O4    . DT  B 2 6   ? 34.116 30.230 13.141  1.00 33.90 ? 6   DT  T O4    1 
ATOM   3494 C  C5    . DT  B 2 6   ? 33.861 31.163 15.323  1.00 31.81 ? 6   DT  T C5    1 
ATOM   3495 C  C7    . DT  B 2 6   ? 35.320 31.463 15.472  1.00 32.21 ? 6   DT  T C7    1 
ATOM   3496 C  C6    . DT  B 2 6   ? 32.951 31.450 16.274  1.00 31.18 ? 6   DT  T C6    1 
ATOM   3497 P  P     . DA  B 2 7   ? 28.584 30.363 20.930  1.00 31.76 ? 7   DA  T P     1 
ATOM   3498 O  OP1   . DA  B 2 7   ? 27.867 31.307 21.825  1.00 35.24 ? 7   DA  T OP1   1 
ATOM   3499 O  OP2   . DA  B 2 7   ? 29.848 29.732 21.391  1.00 32.30 ? 7   DA  T OP2   1 
ATOM   3500 O  "O5'" . DA  B 2 7   ? 27.604 29.211 20.450  1.00 34.32 ? 7   DA  T "O5'" 1 
ATOM   3501 C  "C5'" . DA  B 2 7   ? 26.511 29.539 19.600  1.00 30.84 ? 7   DA  T "C5'" 1 
ATOM   3502 C  "C4'" . DA  B 2 7   ? 26.042 28.336 18.815  1.00 32.24 ? 7   DA  T "C4'" 1 
ATOM   3503 O  "O4'" . DA  B 2 7   ? 26.951 28.062 17.714  1.00 32.88 ? 7   DA  T "O4'" 1 
ATOM   3504 C  "C3'" . DA  B 2 7   ? 26.030 27.054 19.647  1.00 32.86 ? 7   DA  T "C3'" 1 
ATOM   3505 O  "O3'" . DA  B 2 7   ? 24.945 26.219 19.248  1.00 33.47 ? 7   DA  T "O3'" 1 
ATOM   3506 C  "C2'" . DA  B 2 7   ? 27.407 26.454 19.394  1.00 31.33 ? 7   DA  T "C2'" 1 
ATOM   3507 C  "C1'" . DA  B 2 7   ? 27.662 26.839 17.934  1.00 32.24 ? 7   DA  T "C1'" 1 
ATOM   3508 N  N9    . DA  B 2 7   ? 29.063 27.032 17.527  1.00 31.19 ? 7   DA  T N9    1 
ATOM   3509 C  C8    . DA  B 2 7   ? 30.080 27.580 18.271  1.00 32.35 ? 7   DA  T C8    1 
ATOM   3510 N  N7    . DA  B 2 7   ? 31.232 27.642 17.636  1.00 31.33 ? 7   DA  T N7    1 
ATOM   3511 C  C5    . DA  B 2 7   ? 30.960 27.091 16.393  1.00 31.44 ? 7   DA  T C5    1 
ATOM   3512 C  C6    . DA  B 2 7   ? 31.771 26.867 15.253  1.00 31.04 ? 7   DA  T C6    1 
ATOM   3513 N  N6    . DA  B 2 7   ? 33.063 27.183 15.182  1.00 31.18 ? 7   DA  T N6    1 
ATOM   3514 N  N1    . DA  B 2 7   ? 31.195 26.300 14.178  1.00 30.58 ? 7   DA  T N1    1 
ATOM   3515 C  C2    . DA  B 2 7   ? 29.895 25.979 14.245  1.00 30.41 ? 7   DA  T C2    1 
ATOM   3516 N  N3    . DA  B 2 7   ? 29.031 26.136 15.251  1.00 31.12 ? 7   DA  T N3    1 
ATOM   3517 C  C4    . DA  B 2 7   ? 29.630 26.705 16.310  1.00 31.44 ? 7   DA  T C4    1 
ATOM   3518 P  P     . DG  B 2 8   ? 24.568 24.923 20.121  1.00 34.96 ? 8   DG  T P     1 
ATOM   3519 O  OP1   . DG  B 2 8   ? 23.093 24.787 20.073  1.00 33.73 ? 8   DG  T OP1   1 
ATOM   3520 O  OP2   . DG  B 2 8   ? 25.262 24.956 21.435  1.00 32.74 ? 8   DG  T OP2   1 
ATOM   3521 O  "O5'" . DG  B 2 8   ? 25.202 23.729 19.283  1.00 33.72 ? 8   DG  T "O5'" 1 
ATOM   3522 C  "C5'" . DG  B 2 8   ? 24.872 23.541 17.914  1.00 33.43 ? 8   DG  T "C5'" 1 
ATOM   3523 C  "C4'" . DG  B 2 8   ? 25.790 22.514 17.297  1.00 35.49 ? 8   DG  T "C4'" 1 
ATOM   3524 O  "O4'" . DG  B 2 8   ? 27.091 23.114 16.995  1.00 35.30 ? 8   DG  T "O4'" 1 
ATOM   3525 C  "C3'" . DG  B 2 8   ? 26.073 21.430 18.357  1.00 36.56 ? 8   DG  T "C3'" 1 
ATOM   3526 O  "O3'" . DG  B 2 8   ? 26.446 20.233 17.652  1.00 40.16 ? 8   DG  T "O3'" 1 
ATOM   3527 C  "C2'" . DG  B 2 8   ? 27.313 21.978 19.053  1.00 36.33 ? 8   DG  T "C2'" 1 
ATOM   3528 C  "C1'" . DG  B 2 8   ? 28.022 22.448 17.812  1.00 35.36 ? 8   DG  T "C1'" 1 
ATOM   3529 N  N9    . DG  B 2 8   ? 29.374 23.013 17.747  1.00 35.05 ? 8   DG  T N9    1 
ATOM   3530 C  C8    . DG  B 2 8   ? 30.014 23.617 18.793  1.00 34.24 ? 8   DG  T C8    1 
ATOM   3531 N  N7    . DG  B 2 8   ? 31.220 24.005 18.510  1.00 33.93 ? 8   DG  T N7    1 
ATOM   3532 C  C5    . DG  B 2 8   ? 31.411 23.637 17.190  1.00 33.90 ? 8   DG  T C5    1 
ATOM   3533 C  C6    . DG  B 2 8   ? 32.537 23.805 16.393  1.00 33.24 ? 8   DG  T C6    1 
ATOM   3534 O  O6    . DG  B 2 8   ? 33.583 24.379 16.698  1.00 30.92 ? 8   DG  T O6    1 
ATOM   3535 N  N1    . DG  B 2 8   ? 32.359 23.281 15.116  1.00 33.48 ? 8   DG  T N1    1 
ATOM   3536 C  C2    . DG  B 2 8   ? 31.209 22.676 14.666  1.00 34.14 ? 8   DG  T C2    1 
ATOM   3537 N  N2    . DG  B 2 8   ? 31.251 22.243 13.381  1.00 34.07 ? 8   DG  T N2    1 
ATOM   3538 N  N3    . DG  B 2 8   ? 30.111 22.511 15.424  1.00 34.04 ? 8   DG  T N3    1 
ATOM   3539 C  C4    . DG  B 2 8   ? 30.285 23.015 16.679  1.00 34.73 ? 8   DG  T C4    1 
ATOM   3540 P  P     . DG  B 2 9   ? 26.128 18.760 18.250  1.00 40.30 ? 9   DG  T P     1 
ATOM   3541 O  OP1   . DG  B 2 9   ? 24.652 18.612 18.373  1.00 39.31 ? 9   DG  T OP1   1 
ATOM   3542 O  OP2   . DG  B 2 9   ? 26.996 18.435 19.408  1.00 39.83 ? 9   DG  T OP2   1 
ATOM   3543 O  "O5'" . DG  B 2 9   ? 26.676 17.812 17.093  1.00 40.11 ? 9   DG  T "O5'" 1 
ATOM   3544 C  "C5'" . DG  B 2 9   ? 25.957 17.722 15.894  1.00 38.00 ? 9   DG  T "C5'" 1 
ATOM   3545 C  "C4'" . DG  B 2 9   ? 26.843 17.525 14.678  1.00 38.14 ? 9   DG  T "C4'" 1 
ATOM   3546 O  "O4'" . DG  B 2 9   ? 27.917 18.525 14.557  1.00 37.37 ? 9   DG  T "O4'" 1 
ATOM   3547 C  "C3'" . DG  B 2 9   ? 27.573 16.184 14.761  1.00 38.46 ? 9   DG  T "C3'" 1 
ATOM   3548 O  "O3'" . DG  B 2 9   ? 27.693 15.564 13.485  1.00 40.05 ? 9   DG  T "O3'" 1 
ATOM   3549 C  "C2'" . DG  B 2 9   ? 28.916 16.550 15.345  1.00 37.11 ? 9   DG  T "C2'" 1 
ATOM   3550 C  "C1'" . DG  B 2 9   ? 29.204 17.866 14.657  1.00 35.94 ? 9   DG  T "C1'" 1 
ATOM   3551 N  N9    . DG  B 2 9   ? 30.161 18.694 15.377  1.00 35.78 ? 9   DG  T N9    1 
ATOM   3552 C  C8    . DG  B 2 9   ? 29.820 19.222 16.567  1.00 35.61 ? 9   DG  T C8    1 
ATOM   3553 N  N7    . DG  B 2 9   ? 30.774 19.845 17.177  1.00 33.96 ? 9   DG  T N7    1 
ATOM   3554 C  C5    . DG  B 2 9   ? 31.859 19.757 16.318  1.00 34.78 ? 9   DG  T C5    1 
ATOM   3555 C  C6    . DG  B 2 9   ? 33.180 20.262 16.465  1.00 36.07 ? 9   DG  T C6    1 
ATOM   3556 O  O6    . DG  B 2 9   ? 33.663 20.886 17.421  1.00 35.75 ? 9   DG  T O6    1 
ATOM   3557 N  N1    . DG  B 2 9   ? 33.972 19.959 15.357  1.00 37.09 ? 9   DG  T N1    1 
ATOM   3558 C  C2    . DG  B 2 9   ? 33.556 19.248 14.260  1.00 36.94 ? 9   DG  T C2    1 
ATOM   3559 N  N2    . DG  B 2 9   ? 34.508 19.076 13.318  1.00 34.83 ? 9   DG  T N2    1 
ATOM   3560 N  N3    . DG  B 2 9   ? 32.311 18.763 14.102  1.00 36.51 ? 9   DG  T N3    1 
ATOM   3561 C  C4    . DG  B 2 9   ? 31.516 19.050 15.176  1.00 34.71 ? 9   DG  T C4    1 
ATOM   3562 P  P     . DG  B 2 10  ? 27.817 13.961 13.383  1.00 39.19 ? 10  DG  T P     1 
ATOM   3563 O  OP1   . DG  B 2 10  ? 27.448 13.629 11.994  1.00 39.23 ? 10  DG  T OP1   1 
ATOM   3564 O  OP2   . DG  B 2 10  ? 27.148 13.272 14.528  1.00 40.89 ? 10  DG  T OP2   1 
ATOM   3565 O  "O5'" . DG  B 2 10  ? 29.373 13.685 13.485  1.00 39.00 ? 10  DG  T "O5'" 1 
ATOM   3566 C  "C5'" . DG  B 2 10  ? 30.221 14.776 13.512  1.00 38.83 ? 10  DG  T "C5'" 1 
ATOM   3567 C  "C4'" . DG  B 2 10  ? 31.577 14.481 12.936  1.00 40.55 ? 10  DG  T "C4'" 1 
ATOM   3568 O  "O4'" . DG  B 2 10  ? 32.304 15.634 13.429  1.00 40.48 ? 10  DG  T "O4'" 1 
ATOM   3569 C  "C3'" . DG  B 2 10  ? 32.295 13.259 13.513  1.00 40.67 ? 10  DG  T "C3'" 1 
ATOM   3570 O  "O3'" . DG  B 2 10  ? 33.304 12.756 12.633  1.00 41.60 ? 10  DG  T "O3'" 1 
ATOM   3571 C  "C2'" . DG  B 2 10  ? 32.949 13.817 14.753  1.00 40.43 ? 10  DG  T "C2'" 1 
ATOM   3572 C  "C1'" . DG  B 2 10  ? 33.280 15.244 14.370  1.00 40.09 ? 10  DG  T "C1'" 1 
ATOM   3573 N  N9    . DG  B 2 10  ? 33.238 16.074 15.581  1.00 40.11 ? 10  DG  T N9    1 
ATOM   3574 C  C8    . DG  B 2 10  ? 32.178 16.248 16.458  1.00 39.96 ? 10  DG  T C8    1 
ATOM   3575 N  N7    . DG  B 2 10  ? 32.512 16.870 17.563  1.00 38.70 ? 10  DG  T N7    1 
ATOM   3576 C  C5    . DG  B 2 10  ? 33.871 17.147 17.412  1.00 37.82 ? 10  DG  T C5    1 
ATOM   3577 C  C6    . DG  B 2 10  ? 34.796 17.845 18.262  1.00 37.18 ? 10  DG  T C6    1 
ATOM   3578 O  O6    . DG  B 2 10  ? 34.604 18.324 19.405  1.00 35.38 ? 10  DG  T O6    1 
ATOM   3579 N  N1    . DG  B 2 10  ? 36.062 17.914 17.681  1.00 37.44 ? 10  DG  T N1    1 
ATOM   3580 C  C2    . DG  B 2 10  ? 36.397 17.412 16.446  1.00 37.54 ? 10  DG  T C2    1 
ATOM   3581 N  N2    . DG  B 2 10  ? 37.682 17.563 16.071  1.00 35.82 ? 10  DG  T N2    1 
ATOM   3582 N  N3    . DG  B 2 10  ? 35.561 16.775 15.658  1.00 37.65 ? 10  DG  T N3    1 
ATOM   3583 C  C4    . DG  B 2 10  ? 34.322 16.694 16.172  1.00 38.04 ? 10  DG  T C4    1 
ATOM   3584 P  P     . DG  B 2 11  ? 33.695 11.192 12.684  1.00 41.00 ? 11  DG  T P     1 
ATOM   3585 O  OP1   . DG  B 2 11  ? 33.409 10.640 11.335  1.00 42.52 ? 11  DG  T OP1   1 
ATOM   3586 O  OP2   . DG  B 2 11  ? 33.117 10.536 13.886  1.00 39.21 ? 11  DG  T OP2   1 
ATOM   3587 O  "O5'" . DG  B 2 11  ? 35.269 11.240 12.809  1.00 40.10 ? 11  DG  T "O5'" 1 
ATOM   3588 C  "C5'" . DG  B 2 11  ? 36.003 12.085 11.936  1.00 42.26 ? 11  DG  T "C5'" 1 
ATOM   3589 C  "C4'" . DG  B 2 11  ? 37.403 12.264 12.457  1.00 43.56 ? 11  DG  T "C4'" 1 
ATOM   3590 O  "O4'" . DG  B 2 11  ? 37.444 13.126 13.639  1.00 44.66 ? 11  DG  T "O4'" 1 
ATOM   3591 C  "C3'" . DG  B 2 11  ? 37.898 10.916 12.948  1.00 44.34 ? 11  DG  T "C3'" 1 
ATOM   3592 O  "O3'" . DG  B 2 11  ? 39.297 11.030 12.892  1.00 47.48 ? 11  DG  T "O3'" 1 
ATOM   3593 C  "C2'" . DG  B 2 11  ? 37.481 10.932 14.413  1.00 43.05 ? 11  DG  T "C2'" 1 
ATOM   3594 C  "C1'" . DG  B 2 11  ? 37.770 12.358 14.775  1.00 41.92 ? 11  DG  T "C1'" 1 
ATOM   3595 N  N9    . DG  B 2 11  ? 37.270 12.997 15.987  1.00 39.67 ? 11  DG  T N9    1 
ATOM   3596 C  C8    . DG  B 2 11  ? 35.994 12.798 16.413  1.00 37.95 ? 11  DG  T C8    1 
ATOM   3597 N  N7    . DG  B 2 11  ? 35.653 13.496 17.444  1.00 36.78 ? 11  DG  T N7    1 
ATOM   3598 C  C5    . DG  B 2 11  ? 36.803 14.219 17.762  1.00 36.06 ? 11  DG  T C5    1 
ATOM   3599 C  C6    . DG  B 2 11  ? 37.023 15.142 18.810  1.00 34.46 ? 11  DG  T C6    1 
ATOM   3600 O  O6    . DG  B 2 11  ? 36.212 15.544 19.645  1.00 34.00 ? 11  DG  T O6    1 
ATOM   3601 N  N1    . DG  B 2 11  ? 38.325 15.638 18.803  1.00 32.27 ? 11  DG  T N1    1 
ATOM   3602 C  C2    . DG  B 2 11  ? 39.289 15.300 17.898  1.00 32.77 ? 11  DG  T C2    1 
ATOM   3603 N  N2    . DG  B 2 11  ? 40.480 15.919 18.101  1.00 30.64 ? 11  DG  T N2    1 
ATOM   3604 N  N3    . DG  B 2 11  ? 39.108 14.424 16.881  1.00 33.84 ? 11  DG  T N3    1 
ATOM   3605 C  C4    . DG  B 2 11  ? 37.836 13.922 16.878  1.00 36.50 ? 11  DG  T C4    1 
ATOM   3606 P  P     . DA  B 2 12  ? 40.235 9.736  12.932  1.00 49.64 ? 12  DA  T P     1 
ATOM   3607 O  OP1   . DA  B 2 12  ? 40.816 9.595  11.571  1.00 47.74 ? 12  DA  T OP1   1 
ATOM   3608 O  OP2   . DA  B 2 12  ? 39.560 8.576  13.581  1.00 48.90 ? 12  DA  T OP2   1 
ATOM   3609 O  "O5'" . DA  B 2 12  ? 41.414 10.242 13.867  1.00 48.73 ? 12  DA  T "O5'" 1 
ATOM   3610 C  "C5'" . DA  B 2 12  ? 42.157 11.397 13.502  1.00 48.10 ? 12  DA  T "C5'" 1 
ATOM   3611 C  "C4'" . DA  B 2 12  ? 43.249 11.640 14.507  1.00 48.51 ? 12  DA  T "C4'" 1 
ATOM   3612 O  "O4'" . DA  B 2 12  ? 42.665 12.104 15.745  1.00 48.74 ? 12  DA  T "O4'" 1 
ATOM   3613 C  "C3'" . DA  B 2 12  ? 43.965 10.352 14.867  1.00 49.66 ? 12  DA  T "C3'" 1 
ATOM   3614 O  "O3'" . DA  B 2 12  ? 45.292 10.689 15.230  1.00 52.00 ? 12  DA  T "O3'" 1 
ATOM   3615 C  "C2'" . DA  B 2 12  ? 43.144 9.815  16.032  1.00 48.16 ? 12  DA  T "C2'" 1 
ATOM   3616 C  "C1'" . DA  B 2 12  ? 42.727 11.094 16.745  1.00 47.51 ? 12  DA  T "C1'" 1 
ATOM   3617 N  N9    . DA  B 2 12  ? 41.425 11.078 17.417  1.00 46.28 ? 12  DA  T N9    1 
ATOM   3618 C  C8    . DA  B 2 12  ? 40.291 10.372 17.095  1.00 44.22 ? 12  DA  T C8    1 
ATOM   3619 N  N7    . DA  B 2 12  ? 39.262 10.648 17.863  1.00 44.40 ? 12  DA  T N7    1 
ATOM   3620 C  C5    . DA  B 2 12  ? 39.754 11.586 18.762  1.00 43.18 ? 12  DA  T C5    1 
ATOM   3621 C  C6    . DA  B 2 12  ? 39.159 12.284 19.840  1.00 42.53 ? 12  DA  T C6    1 
ATOM   3622 N  N6    . DA  B 2 12  ? 37.884 12.153 20.208  1.00 41.23 ? 12  DA  T N6    1 
ATOM   3623 N  N1    . DA  B 2 12  ? 39.936 13.141 20.536  1.00 43.38 ? 12  DA  T N1    1 
ATOM   3624 C  C2    . DA  B 2 12  ? 41.216 13.287 20.170  1.00 42.97 ? 12  DA  T C2    1 
ATOM   3625 N  N3    . DA  B 2 12  ? 41.886 12.695 19.182  1.00 43.54 ? 12  DA  T N3    1 
ATOM   3626 C  C4    . DA  B 2 12  ? 41.089 11.847 18.508  1.00 44.56 ? 12  DA  T C4    1 
ATOM   3627 P  P     . DG  B 2 13  ? 46.349 9.532  15.518  1.00 54.21 ? 13  DG  T P     1 
ATOM   3628 O  OP1   . DG  B 2 13  ? 47.621 9.962  14.887  1.00 54.22 ? 13  DG  T OP1   1 
ATOM   3629 O  OP2   . DG  B 2 13  ? 45.752 8.216  15.171  1.00 53.38 ? 13  DG  T OP2   1 
ATOM   3630 O  "O5'" . DG  B 2 13  ? 46.507 9.570  17.098  1.00 53.63 ? 13  DG  T "O5'" 1 
ATOM   3631 C  "C5'" . DG  B 2 13  ? 46.922 10.748 17.764  1.00 52.80 ? 13  DG  T "C5'" 1 
ATOM   3632 C  "C4'" . DG  B 2 13  ? 46.721 10.590 19.249  1.00 52.81 ? 13  DG  T "C4'" 1 
ATOM   3633 O  "O4'" . DG  B 2 13  ? 45.297 10.576 19.588  1.00 50.52 ? 13  DG  T "O4'" 1 
ATOM   3634 C  "C3'" . DG  B 2 13  ? 47.223 9.198  19.635  1.00 54.17 ? 13  DG  T "C3'" 1 
ATOM   3635 O  "O3'" . DG  B 2 13  ? 47.538 9.287  21.021  1.00 58.99 ? 13  DG  T "O3'" 1 
ATOM   3636 C  "C2'" . DG  B 2 13  ? 45.968 8.342  19.486  1.00 51.17 ? 13  DG  T "C2'" 1 
ATOM   3637 C  "C1'" . DG  B 2 13  ? 44.985 9.301  20.099  1.00 48.28 ? 13  DG  T "C1'" 1 
ATOM   3638 N  N9    . DG  B 2 13  ? 43.535 9.070  20.187  1.00 44.96 ? 13  DG  T N9    1 
ATOM   3639 C  C8    . DG  B 2 13  ? 42.830 8.217  19.381  1.00 42.84 ? 13  DG  T C8    1 
ATOM   3640 N  N7    . DG  B 2 13  ? 41.553 8.191  19.636  1.00 42.40 ? 13  DG  T N7    1 
ATOM   3641 C  C5    . DG  B 2 13  ? 41.385 9.078  20.688  1.00 40.87 ? 13  DG  T C5    1 
ATOM   3642 C  C6    . DG  B 2 13  ? 40.208 9.435  21.366  1.00 39.75 ? 13  DG  T C6    1 
ATOM   3643 O  O6    . DG  B 2 13  ? 39.056 9.082  21.109  1.00 39.70 ? 13  DG  T O6    1 
ATOM   3644 N  N1    . DG  B 2 13  ? 40.451 10.348 22.387  1.00 39.04 ? 13  DG  T N1    1 
ATOM   3645 C  C2    . DG  B 2 13  ? 41.680 10.860 22.705  1.00 39.99 ? 13  DG  T C2    1 
ATOM   3646 N  N2    . DG  B 2 13  ? 41.686 11.735 23.735  1.00 40.08 ? 13  DG  T N2    1 
ATOM   3647 N  N3    . DG  B 2 13  ? 42.817 10.536 22.062  1.00 40.78 ? 13  DG  T N3    1 
ATOM   3648 C  C4    . DG  B 2 13  ? 42.595 9.637  21.065  1.00 41.83 ? 13  DG  T C4    1 
ATOM   3649 P  P     . DG  B 2 14  ? 48.710 8.398  21.658  1.00 61.81 ? 14  DG  T P     1 
ATOM   3650 O  OP1   . DG  B 2 14  ? 50.037 8.993  21.349  1.00 60.50 ? 14  DG  T OP1   1 
ATOM   3651 O  OP2   . DG  B 2 14  ? 48.438 6.978  21.313  1.00 61.99 ? 14  DG  T OP2   1 
ATOM   3652 O  "O5'" . DG  B 2 14  ? 48.465 8.620  23.210  1.00 60.36 ? 14  DG  T "O5'" 1 
ATOM   3653 C  "C5'" . DG  B 2 14  ? 48.313 9.936  23.713  1.00 59.30 ? 14  DG  T "C5'" 1 
ATOM   3654 C  "C4'" . DG  B 2 14  ? 47.469 9.918  24.961  1.00 59.39 ? 14  DG  T "C4'" 1 
ATOM   3655 O  "O4'" . DG  B 2 14  ? 46.076 9.604  24.637  1.00 57.53 ? 14  DG  T "O4'" 1 
ATOM   3656 C  "C3'" . DG  B 2 14  ? 47.932 8.782  25.865  1.00 60.54 ? 14  DG  T "C3'" 1 
ATOM   3657 O  "O3'" . DG  B 2 14  ? 47.627 9.198  27.210  1.00 64.68 ? 14  DG  T "O3'" 1 
ATOM   3658 C  "C2'" . DG  B 2 14  ? 47.047 7.631  25.393  1.00 59.18 ? 14  DG  T "C2'" 1 
ATOM   3659 C  "C1'" . DG  B 2 14  ? 45.745 8.347  25.161  1.00 56.17 ? 14  DG  T "C1'" 1 
ATOM   3660 N  N9    . DG  B 2 14  ? 44.583 7.782  24.473  1.00 53.01 ? 14  DG  T N9    1 
ATOM   3661 C  C8    . DG  B 2 14  ? 44.685 7.026  23.341  1.00 52.38 ? 14  DG  T C8    1 
ATOM   3662 N  N7    . DG  B 2 14  ? 43.547 6.663  22.834  1.00 50.81 ? 14  DG  T N7    1 
ATOM   3663 C  C5    . DG  B 2 14  ? 42.600 7.203  23.700  1.00 48.96 ? 14  DG  T C5    1 
ATOM   3664 C  C6    . DG  B 2 14  ? 41.209 7.116  23.648  1.00 47.10 ? 14  DG  T C6    1 
ATOM   3665 O  O6    . DG  B 2 14  ? 40.531 6.571  22.786  1.00 46.69 ? 14  DG  T O6    1 
ATOM   3666 N  N1    . DG  B 2 14  ? 40.602 7.777  24.713  1.00 47.32 ? 14  DG  T N1    1 
ATOM   3667 C  C2    . DG  B 2 14  ? 41.264 8.449  25.704  1.00 49.18 ? 14  DG  T C2    1 
ATOM   3668 N  N2    . DG  B 2 14  ? 40.454 9.013  26.642  1.00 50.46 ? 14  DG  T N2    1 
ATOM   3669 N  N3    . DG  B 2 14  ? 42.607 8.552  25.775  1.00 49.39 ? 14  DG  T N3    1 
ATOM   3670 C  C4    . DG  B 2 14  ? 43.211 7.900  24.736  1.00 50.64 ? 14  DG  T C4    1 
ATOM   3671 P  P     . DA  B 2 15  ? 47.833 8.196  28.461  1.00 68.45 ? 15  DA  T P     1 
ATOM   3672 O  OP1   . DA  B 2 15  ? 48.725 8.830  29.476  1.00 68.30 ? 15  DA  T OP1   1 
ATOM   3673 O  OP2   . DA  B 2 15  ? 48.174 6.846  27.941  1.00 67.45 ? 15  DA  T OP2   1 
ATOM   3674 O  "O5'" . DA  B 2 15  ? 46.370 8.098  29.097  1.00 69.86 ? 15  DA  T "O5'" 1 
ATOM   3675 C  "C5'" . DA  B 2 15  ? 45.625 9.259  29.488  1.00 71.82 ? 15  DA  T "C5'" 1 
ATOM   3676 C  "C4'" . DA  B 2 15  ? 44.382 8.833  30.234  1.00 72.50 ? 15  DA  T "C4'" 1 
ATOM   3677 O  "O4'" . DA  B 2 15  ? 43.442 8.249  29.275  1.00 71.61 ? 15  DA  T "O4'" 1 
ATOM   3678 C  "C3'" . DA  B 2 15  ? 44.763 7.690  31.185  1.00 73.40 ? 15  DA  T "C3'" 1 
ATOM   3679 O  "O3'" . DA  B 2 15  ? 44.007 7.693  32.414  1.00 76.53 ? 15  DA  T "O3'" 1 
ATOM   3680 C  "C2'" . DA  B 2 15  ? 44.552 6.451  30.327  1.00 72.42 ? 15  DA  T "C2'" 1 
ATOM   3681 C  "C1'" . DA  B 2 15  ? 43.329 6.843  29.503  1.00 70.34 ? 15  DA  T "C1'" 1 
ATOM   3682 N  N9    . DA  B 2 15  ? 43.092 6.129  28.231  1.00 67.53 ? 15  DA  T N9    1 
ATOM   3683 C  C8    . DA  B 2 15  ? 44.032 5.669  27.339  1.00 66.31 ? 15  DA  T C8    1 
ATOM   3684 N  N7    . DA  B 2 15  ? 43.524 5.013  26.317  1.00 65.11 ? 15  DA  T N7    1 
ATOM   3685 C  C5    . DA  B 2 15  ? 42.155 5.051  26.538  1.00 64.51 ? 15  DA  T C5    1 
ATOM   3686 C  C6    . DA  B 2 15  ? 41.061 4.534  25.805  1.00 64.42 ? 15  DA  T C6    1 
ATOM   3687 N  N6    . DA  B 2 15  ? 41.185 3.852  24.663  1.00 65.13 ? 15  DA  T N6    1 
ATOM   3688 N  N1    . DA  B 2 15  ? 39.820 4.746  26.294  1.00 64.80 ? 15  DA  T N1    1 
ATOM   3689 C  C2    . DA  B 2 15  ? 39.694 5.427  27.437  1.00 65.42 ? 15  DA  T C2    1 
ATOM   3690 N  N3    . DA  B 2 15  ? 40.641 5.963  28.218  1.00 65.64 ? 15  DA  T N3    1 
ATOM   3691 C  C4    . DA  B 2 15  ? 41.867 5.740  27.708  1.00 66.00 ? 15  DA  T C4    1 
ATOM   3692 P  P     . DT  B 2 16  ? 44.272 6.554  33.541  1.00 79.50 ? 16  DT  T P     1 
ATOM   3693 O  OP1   . DT  B 2 16  ? 44.358 7.202  34.872  1.00 79.42 ? 16  DT  T OP1   1 
ATOM   3694 O  OP2   . DT  B 2 16  ? 45.345 5.603  33.117  1.00 78.78 ? 16  DT  T OP2   1 
ATOM   3695 O  "O5'" . DT  B 2 16  ? 42.896 5.762  33.510  1.00 79.17 ? 16  DT  T "O5'" 1 
ATOM   3696 C  "C5'" . DT  B 2 16  ? 42.214 5.654  32.274  1.00 78.03 ? 16  DT  T "C5'" 1 
ATOM   3697 C  "C4'" . DT  B 2 16  ? 40.800 5.176  32.462  1.00 76.17 ? 16  DT  T "C4'" 1 
ATOM   3698 O  "O4'" . DT  B 2 16  ? 40.437 4.624  31.181  1.00 74.66 ? 16  DT  T "O4'" 1 
ATOM   3699 C  "C3'" . DT  B 2 16  ? 40.667 4.027  33.459  1.00 76.08 ? 16  DT  T "C3'" 1 
ATOM   3700 O  "O3'" . DT  B 2 16  ? 39.269 3.934  33.809  1.00 77.37 ? 16  DT  T "O3'" 1 
ATOM   3701 C  "C2'" . DT  B 2 16  ? 40.995 2.815  32.605  1.00 75.19 ? 16  DT  T "C2'" 1 
ATOM   3702 C  "C1'" . DT  B 2 16  ? 40.396 3.211  31.269  1.00 73.88 ? 16  DT  T "C1'" 1 
ATOM   3703 N  N1    . DT  B 2 16  ? 41.001 2.655  30.046  1.00 71.77 ? 16  DT  T N1    1 
ATOM   3704 C  C2    . DT  B 2 16  ? 40.084 2.296  29.104  1.00 70.70 ? 16  DT  T C2    1 
ATOM   3705 O  O2    . DT  B 2 16  ? 38.885 2.432  29.287  1.00 69.94 ? 16  DT  T O2    1 
ATOM   3706 N  N3    . DT  B 2 16  ? 40.610 1.775  27.950  1.00 69.90 ? 16  DT  T N3    1 
ATOM   3707 C  C4    . DT  B 2 16  ? 41.946 1.586  27.657  1.00 69.24 ? 16  DT  T C4    1 
ATOM   3708 O  O4    . DT  B 2 16  ? 42.270 1.111  26.575  1.00 67.96 ? 16  DT  T O4    1 
ATOM   3709 C  C5    . DT  B 2 16  ? 42.873 1.985  28.700  1.00 69.04 ? 16  DT  T C5    1 
ATOM   3710 C  C7    . DT  B 2 16  ? 44.342 1.810  28.467  1.00 68.25 ? 16  DT  T C7    1 
ATOM   3711 C  C6    . DT  B 2 16  ? 42.361 2.496  29.834  1.00 70.20 ? 16  DT  T C6    1 
ATOM   3712 O  "O5'" . DA  C 3 1   ? 33.543 -1.571 19.212  1.00 83.38 ? 1   DA  P "O5'" 1 
ATOM   3713 C  "C5'" . DA  C 3 1   ? 34.056 -2.390 20.287  1.00 82.58 ? 1   DA  P "C5'" 1 
ATOM   3714 C  "C4'" . DA  C 3 1   ? 33.442 -2.139 21.649  1.00 81.96 ? 1   DA  P "C4'" 1 
ATOM   3715 O  "O4'" . DA  C 3 1   ? 34.476 -2.275 22.662  1.00 80.26 ? 1   DA  P "O4'" 1 
ATOM   3716 C  "C3'" . DA  C 3 1   ? 32.982 -0.684 21.758  1.00 81.40 ? 1   DA  P "C3'" 1 
ATOM   3717 O  "O3'" . DA  C 3 1   ? 31.973 -0.496 22.747  1.00 83.06 ? 1   DA  P "O3'" 1 
ATOM   3718 C  "C2'" . DA  C 3 1   ? 34.207 0.028  22.269  1.00 79.81 ? 1   DA  P "C2'" 1 
ATOM   3719 C  "C1'" . DA  C 3 1   ? 34.746 -0.997 23.238  1.00 77.87 ? 1   DA  P "C1'" 1 
ATOM   3720 N  N9    . DA  C 3 1   ? 36.179 -0.848 23.434  1.00 75.19 ? 1   DA  P N9    1 
ATOM   3721 C  C8    . DA  C 3 1   ? 37.153 -1.237 22.560  1.00 74.59 ? 1   DA  P C8    1 
ATOM   3722 N  N7    . DA  C 3 1   ? 38.361 -0.918 22.939  1.00 72.80 ? 1   DA  P N7    1 
ATOM   3723 C  C5    . DA  C 3 1   ? 38.174 -0.289 24.157  1.00 71.39 ? 1   DA  P C5    1 
ATOM   3724 C  C6    . DA  C 3 1   ? 39.077 0.273  25.054  1.00 70.09 ? 1   DA  P C6    1 
ATOM   3725 N  N6    . DA  C 3 1   ? 40.389 0.286  24.830  1.00 68.66 ? 1   DA  P N6    1 
ATOM   3726 N  N1    . DA  C 3 1   ? 38.590 0.820  26.188  1.00 68.26 ? 1   DA  P N1    1 
ATOM   3727 C  C2    . DA  C 3 1   ? 37.265 0.793  26.385  1.00 68.97 ? 1   DA  P C2    1 
ATOM   3728 N  N3    . DA  C 3 1   ? 36.305 0.290  25.604  1.00 71.13 ? 1   DA  P N3    1 
ATOM   3729 C  C4    . DA  C 3 1   ? 36.835 -0.247 24.488  1.00 72.66 ? 1   DA  P C4    1 
ATOM   3730 P  P     . DT  C 3 2   ? 31.036 0.809  22.662  1.00 85.63 ? 2   DT  P P     1 
ATOM   3731 O  OP1   . DT  C 3 2   ? 29.774 0.336  22.047  1.00 85.45 ? 2   DT  P OP1   1 
ATOM   3732 O  OP2   . DT  C 3 2   ? 31.827 1.888  22.004  1.00 86.36 ? 2   DT  P OP2   1 
ATOM   3733 O  "O5'" . DT  C 3 2   ? 30.840 1.278  24.172  1.00 83.03 ? 2   DT  P "O5'" 1 
ATOM   3734 C  "C5'" . DT  C 3 2   ? 32.005 1.444  24.971  1.00 77.97 ? 2   DT  P "C5'" 1 
ATOM   3735 C  "C4'" . DT  C 3 2   ? 31.941 2.672  25.850  1.00 73.63 ? 2   DT  P "C4'" 1 
ATOM   3736 O  "O4'" . DT  C 3 2   ? 33.314 2.978  26.183  1.00 71.16 ? 2   DT  P "O4'" 1 
ATOM   3737 C  "C3'" . DT  C 3 2   ? 31.377 3.986  25.309  1.00 72.13 ? 2   DT  P "C3'" 1 
ATOM   3738 O  "O3'" . DT  C 3 2   ? 30.926 4.663  26.499  1.00 72.12 ? 2   DT  P "O3'" 1 
ATOM   3739 C  "C2'" . DT  C 3 2   ? 32.587 4.615  24.630  1.00 69.82 ? 2   DT  P "C2'" 1 
ATOM   3740 C  "C1'" . DT  C 3 2   ? 33.745 4.160  25.520  1.00 67.68 ? 2   DT  P "C1'" 1 
ATOM   3741 N  N1    . DT  C 3 2   ? 35.074 3.875  24.887  1.00 62.81 ? 2   DT  P N1    1 
ATOM   3742 C  C2    . DT  C 3 2   ? 36.196 4.132  25.657  1.00 60.19 ? 2   DT  P C2    1 
ATOM   3743 O  O2    . DT  C 3 2   ? 36.141 4.580  26.789  1.00 59.30 ? 2   DT  P O2    1 
ATOM   3744 N  N3    . DT  C 3 2   ? 37.395 3.844  25.049  1.00 56.80 ? 2   DT  P N3    1 
ATOM   3745 C  C4    . DT  C 3 2   ? 37.588 3.338  23.782  1.00 56.09 ? 2   DT  P C4    1 
ATOM   3746 O  O4    . DT  C 3 2   ? 38.724 3.122  23.375  1.00 53.27 ? 2   DT  P O4    1 
ATOM   3747 C  C5    . DT  C 3 2   ? 36.385 3.096  23.025  1.00 57.62 ? 2   DT  P C5    1 
ATOM   3748 C  C7    . DT  C 3 2   ? 36.512 2.554  21.636  1.00 57.75 ? 2   DT  P C7    1 
ATOM   3749 C  C6    . DT  C 3 2   ? 35.199 3.372  23.603  1.00 60.09 ? 2   DT  P C6    1 
ATOM   3750 P  P     . DC  C 3 3   ? 30.664 6.250  26.528  1.00 73.45 ? 3   DC  P P     1 
ATOM   3751 O  OP1   . DC  C 3 3   ? 29.635 6.468  27.591  1.00 72.93 ? 3   DC  P OP1   1 
ATOM   3752 O  OP2   . DC  C 3 3   ? 30.453 6.814  25.173  1.00 73.86 ? 3   DC  P OP2   1 
ATOM   3753 O  "O5'" . DC  C 3 3   ? 32.023 6.833  27.108  1.00 70.23 ? 3   DC  P "O5'" 1 
ATOM   3754 C  "C5'" . DC  C 3 3   ? 32.404 6.566  28.447  1.00 65.39 ? 3   DC  P "C5'" 1 
ATOM   3755 C  "C4'" . DC  C 3 3   ? 33.515 7.497  28.861  1.00 61.99 ? 3   DC  P "C4'" 1 
ATOM   3756 O  "O4'" . DC  C 3 3   ? 34.713 7.216  28.082  1.00 58.53 ? 3   DC  P "O4'" 1 
ATOM   3757 C  "C3'" . DC  C 3 3   ? 33.125 8.928  28.489  1.00 61.38 ? 3   DC  P "C3'" 1 
ATOM   3758 O  "O3'" . DC  C 3 3   ? 33.721 9.821  29.416  1.00 62.18 ? 3   DC  P "O3'" 1 
ATOM   3759 C  "C2'" . DC  C 3 3   ? 33.686 9.094  27.085  1.00 58.34 ? 3   DC  P "C2'" 1 
ATOM   3760 C  "C1'" . DC  C 3 3   ? 34.982 8.319  27.216  1.00 55.74 ? 3   DC  P "C1'" 1 
ATOM   3761 N  N1    . DC  C 3 3   ? 35.688 7.853  25.998  1.00 50.64 ? 3   DC  P N1    1 
ATOM   3762 C  C2    . DC  C 3 3   ? 37.094 7.841  26.014  1.00 48.39 ? 3   DC  P C2    1 
ATOM   3763 O  O2    . DC  C 3 3   ? 37.684 8.216  27.035  1.00 47.85 ? 3   DC  P O2    1 
ATOM   3764 N  N3    . DC  C 3 3   ? 37.769 7.426  24.921  1.00 45.59 ? 3   DC  P N3    1 
ATOM   3765 C  C4    . DC  C 3 3   ? 37.103 7.032  23.835  1.00 46.09 ? 3   DC  P C4    1 
ATOM   3766 N  N4    . DC  C 3 3   ? 37.811 6.619  22.778  1.00 43.88 ? 3   DC  P N4    1 
ATOM   3767 C  C5    . DC  C 3 3   ? 35.676 7.040  23.782  1.00 46.76 ? 3   DC  P C5    1 
ATOM   3768 C  C6    . DC  C 3 3   ? 35.013 7.453  24.877  1.00 48.76 ? 3   DC  P C6    1 
ATOM   3769 P  P     . DC  C 3 4   ? 33.313 11.367 29.414  1.00 64.85 ? 4   DC  P P     1 
ATOM   3770 O  OP1   . DC  C 3 4   ? 32.836 11.662 30.787  1.00 63.34 ? 4   DC  P OP1   1 
ATOM   3771 O  OP2   . DC  C 3 4   ? 32.438 11.672 28.246  1.00 64.78 ? 4   DC  P OP2   1 
ATOM   3772 O  "O5'" . DC  C 3 4   ? 34.742 12.041 29.245  1.00 61.67 ? 4   DC  P "O5'" 1 
ATOM   3773 C  "C5'" . DC  C 3 4   ? 35.814 11.557 30.048  1.00 56.10 ? 4   DC  P "C5'" 1 
ATOM   3774 C  "C4'" . DC  C 3 4   ? 37.105 12.269 29.733  1.00 53.03 ? 4   DC  P "C4'" 1 
ATOM   3775 O  "O4'" . DC  C 3 4   ? 37.709 11.681 28.545  1.00 50.80 ? 4   DC  P "O4'" 1 
ATOM   3776 C  "C3'" . DC  C 3 4   ? 36.799 13.718 29.357  1.00 51.58 ? 4   DC  P "C3'" 1 
ATOM   3777 O  "O3'" . DC  C 3 4   ? 37.812 14.623 29.755  1.00 52.22 ? 4   DC  P "O3'" 1 
ATOM   3778 C  "C2'" . DC  C 3 4   ? 36.651 13.669 27.852  1.00 49.56 ? 4   DC  P "C2'" 1 
ATOM   3779 C  "C1'" . DC  C 3 4   ? 37.691 12.630 27.484  1.00 48.15 ? 4   DC  P "C1'" 1 
ATOM   3780 N  N1    . DC  C 3 4   ? 37.465 11.950 26.195  1.00 45.22 ? 4   DC  P N1    1 
ATOM   3781 C  C2    . DC  C 3 4   ? 38.559 11.738 25.347  1.00 43.59 ? 4   DC  P C2    1 
ATOM   3782 O  O2    . DC  C 3 4   ? 39.689 12.071 25.730  1.00 42.78 ? 4   DC  P O2    1 
ATOM   3783 N  N3    . DC  C 3 4   ? 38.356 11.182 24.131  1.00 40.87 ? 4   DC  P N3    1 
ATOM   3784 C  C4    . DC  C 3 4   ? 37.130 10.836 23.751  1.00 40.78 ? 4   DC  P C4    1 
ATOM   3785 N  N4    . DC  C 3 4   ? 36.985 10.298 22.540  1.00 39.59 ? 4   DC  P N4    1 
ATOM   3786 C  C5    . DC  C 3 4   ? 35.997 11.024 24.597  1.00 41.99 ? 4   DC  P C5    1 
ATOM   3787 C  C6    . DC  C 3 4   ? 36.209 11.572 25.804  1.00 43.56 ? 4   DC  P C6    1 
ATOM   3788 P  P     . DT  C 3 5   ? 37.532 16.203 29.674  1.00 52.04 ? 5   DT  P P     1 
ATOM   3789 O  OP1   . DT  C 3 5   ? 37.747 16.698 31.060  1.00 52.11 ? 5   DT  P OP1   1 
ATOM   3790 O  OP2   . DT  C 3 5   ? 36.256 16.498 28.967  1.00 49.58 ? 5   DT  P OP2   1 
ATOM   3791 O  "O5'" . DT  C 3 5   ? 38.766 16.685 28.802  1.00 48.17 ? 5   DT  P "O5'" 1 
ATOM   3792 C  "C5'" . DT  C 3 5   ? 40.045 16.222 29.184  1.00 42.50 ? 5   DT  P "C5'" 1 
ATOM   3793 C  "C4'" . DT  C 3 5   ? 41.091 16.494 28.132  1.00 39.25 ? 5   DT  P "C4'" 1 
ATOM   3794 O  "O4'" . DT  C 3 5   ? 40.878 15.666 26.953  1.00 36.30 ? 5   DT  P "O4'" 1 
ATOM   3795 C  "C3'" . DT  C 3 5   ? 41.013 17.931 27.626  1.00 37.22 ? 5   DT  P "C3'" 1 
ATOM   3796 O  "O3'" . DT  C 3 5   ? 42.326 18.367 27.311  1.00 35.37 ? 5   DT  P "O3'" 1 
ATOM   3797 C  "C2'" . DT  C 3 5   ? 40.109 17.823 26.410  1.00 36.57 ? 5   DT  P "C2'" 1 
ATOM   3798 C  "C1'" . DT  C 3 5   ? 40.545 16.482 25.841  1.00 34.57 ? 5   DT  P "C1'" 1 
ATOM   3799 N  N1    . DT  C 3 5   ? 39.584 15.766 24.971  1.00 34.20 ? 5   DT  P N1    1 
ATOM   3800 C  C2    . DT  C 3 5   ? 40.056 15.161 23.807  1.00 34.33 ? 5   DT  P C2    1 
ATOM   3801 O  O2    . DT  C 3 5   ? 41.229 15.145 23.481  1.00 35.89 ? 5   DT  P O2    1 
ATOM   3802 N  N3    . DT  C 3 5   ? 39.088 14.571 23.033  1.00 31.45 ? 5   DT  P N3    1 
ATOM   3803 C  C4    . DT  C 3 5   ? 37.734 14.520 23.295  1.00 33.40 ? 5   DT  P C4    1 
ATOM   3804 O  O4    . DT  C 3 5   ? 36.981 13.965 22.506  1.00 32.46 ? 5   DT  P O4    1 
ATOM   3805 C  C5    . DT  C 3 5   ? 37.314 15.154 24.527  1.00 32.29 ? 5   DT  P C5    1 
ATOM   3806 C  C7    . DT  C 3 5   ? 35.864 15.142 24.886  1.00 32.87 ? 5   DT  P C7    1 
ATOM   3807 C  C6    . DT  C 3 5   ? 38.248 15.730 25.295  1.00 33.11 ? 5   DT  P C6    1 
ATOM   3808 P  P     . DC  C 3 6   ? 42.598 19.905 26.998  1.00 32.31 ? 6   DC  P P     1 
ATOM   3809 O  OP1   . DC  C 3 6   ? 43.873 20.205 27.688  1.00 33.20 ? 6   DC  P OP1   1 
ATOM   3810 O  OP2   . DC  C 3 6   ? 41.381 20.695 27.304  1.00 33.57 ? 6   DC  P OP2   1 
ATOM   3811 O  "O5'" . DC  C 3 6   ? 42.890 19.890 25.432  1.00 33.74 ? 6   DC  P "O5'" 1 
ATOM   3812 C  "C5'" . DC  C 3 6   ? 44.019 19.160 24.956  1.00 32.37 ? 6   DC  P "C5'" 1 
ATOM   3813 C  "C4'" . DC  C 3 6   ? 44.122 19.180 23.447  1.00 33.77 ? 6   DC  P "C4'" 1 
ATOM   3814 O  "O4'" . DC  C 3 6   ? 43.041 18.420 22.842  1.00 33.38 ? 6   DC  P "O4'" 1 
ATOM   3815 C  "C3'" . DC  C 3 6   ? 43.976 20.594 22.874  1.00 33.50 ? 6   DC  P "C3'" 1 
ATOM   3816 O  "O3'" . DC  C 3 6   ? 44.674 20.670 21.633  1.00 33.13 ? 6   DC  P "O3'" 1 
ATOM   3817 C  "C2'" . DC  C 3 6   ? 42.485 20.700 22.614  1.00 31.87 ? 6   DC  P "C2'" 1 
ATOM   3818 C  "C1'" . DC  C 3 6   ? 42.208 19.301 22.107  1.00 31.56 ? 6   DC  P "C1'" 1 
ATOM   3819 N  N1    . DC  C 3 6   ? 40.821 18.799 22.086  1.00 31.70 ? 6   DC  P N1    1 
ATOM   3820 C  C2    . DC  C 3 6   ? 40.476 17.824 21.131  1.00 31.40 ? 6   DC  P C2    1 
ATOM   3821 O  O2    . DC  C 3 6   ? 41.358 17.382 20.377  1.00 30.36 ? 6   DC  P O2    1 
ATOM   3822 N  N3    . DC  C 3 6   ? 39.194 17.396 21.051  1.00 31.36 ? 6   DC  P N3    1 
ATOM   3823 C  C4    . DC  C 3 6   ? 38.273 17.896 21.877  1.00 32.57 ? 6   DC  P C4    1 
ATOM   3824 N  N4    . DC  C 3 6   ? 37.017 17.448 21.758  1.00 34.58 ? 6   DC  P N4    1 
ATOM   3825 C  C5    . DC  C 3 6   ? 38.597 18.875 22.865  1.00 31.53 ? 6   DC  P C5    1 
ATOM   3826 C  C6    . DC  C 3 6   ? 39.872 19.288 22.939  1.00 30.61 ? 6   DC  P C6    1 
ATOM   3827 P  P     . DC  C 3 7   ? 45.347 22.047 21.165  1.00 34.30 ? 7   DC  P P     1 
ATOM   3828 O  OP1   . DC  C 3 7   ? 46.111 21.733 19.938  1.00 36.41 ? 7   DC  P OP1   1 
ATOM   3829 O  OP2   . DC  C 3 7   ? 46.044 22.651 22.319  1.00 34.54 ? 7   DC  P OP2   1 
ATOM   3830 O  "O5'" . DC  C 3 7   ? 44.162 23.057 20.783  1.00 36.61 ? 7   DC  P "O5'" 1 
ATOM   3831 C  "C5'" . DC  C 3 7   ? 43.112 22.803 19.807  1.00 37.95 ? 7   DC  P "C5'" 1 
ATOM   3832 C  "C4'" . DC  C 3 7   ? 43.483 21.762 18.774  1.00 38.55 ? 7   DC  P "C4'" 1 
ATOM   3833 O  "O4'" . DC  C 3 7   ? 42.614 20.635 19.118  1.00 39.22 ? 7   DC  P "O4'" 1 
ATOM   3834 C  "C3'" . DC  C 3 7   ? 43.016 22.210 17.375  1.00 38.96 ? 7   DC  P "C3'" 1 
ATOM   3835 O  "O3'" . DC  C 3 7   ? 43.806 21.943 16.209  1.00 40.31 ? 7   DC  P "O3'" 1 
ATOM   3836 C  "C2'" . DC  C 3 7   ? 41.605 21.696 17.255  1.00 37.85 ? 7   DC  P "C2'" 1 
ATOM   3837 C  "C1'" . DC  C 3 7   ? 41.569 20.473 18.142  1.00 36.42 ? 7   DC  P "C1'" 1 
ATOM   3838 N  N1    . DC  C 3 7   ? 40.246 20.500 18.806  1.00 32.84 ? 7   DC  P N1    1 
ATOM   3839 C  C2    . DC  C 3 7   ? 39.263 19.626 18.329  1.00 31.15 ? 7   DC  P C2    1 
ATOM   3840 O  O2    . DC  C 3 7   ? 39.568 18.821 17.442  1.00 32.61 ? 7   DC  P O2    1 
ATOM   3841 N  N3    . DC  C 3 7   ? 38.009 19.684 18.833  1.00 30.23 ? 7   DC  P N3    1 
ATOM   3842 C  C4    . DC  C 3 7   ? 37.713 20.570 19.784  1.00 29.64 ? 7   DC  P C4    1 
ATOM   3843 N  N4    . DC  C 3 7   ? 36.457 20.589 20.241  1.00 27.72 ? 7   DC  P N4    1 
ATOM   3844 C  C5    . DC  C 3 7   ? 38.695 21.469 20.310  1.00 29.46 ? 7   DC  P C5    1 
ATOM   3845 C  C6    . DC  C 3 7   ? 39.946 21.391 19.805  1.00 30.67 ? 7   DC  P C6    1 
ATOM   3846 P  P     . DC  C 3 8   ? 43.651 22.929 14.928  1.00 38.60 ? 8   DC  P P     1 
ATOM   3847 O  OP1   . DC  C 3 8   ? 44.977 23.024 14.272  1.00 40.52 ? 8   DC  P OP1   1 
ATOM   3848 O  OP2   . DC  C 3 8   ? 42.949 24.164 15.358  1.00 39.57 ? 8   DC  P OP2   1 
ATOM   3849 O  "O5'" . DC  C 3 8   ? 42.640 22.183 13.947  1.00 38.66 ? 8   DC  P "O5'" 1 
ATOM   3850 C  "C5'" . DC  C 3 8   ? 42.900 20.846 13.549  1.00 36.37 ? 8   DC  P "C5'" 1 
ATOM   3851 C  "C4'" . DC  C 3 8   ? 41.850 20.330 12.592  1.00 35.71 ? 8   DC  P "C4'" 1 
ATOM   3852 O  "O4'" . DC  C 3 8   ? 40.628 19.993 13.309  1.00 34.47 ? 8   DC  P "O4'" 1 
ATOM   3853 C  "C3'" . DC  C 3 8   ? 41.430 21.375 11.551  1.00 34.22 ? 8   DC  P "C3'" 1 
ATOM   3854 O  "O3'" . DC  C 3 8   ? 41.059 20.706 10.345  1.00 34.75 ? 8   DC  P "O3'" 1 
ATOM   3855 C  "C2'" . DC  C 3 8   ? 40.239 22.046 12.211  1.00 34.72 ? 8   DC  P "C2'" 1 
ATOM   3856 C  "C1'" . DC  C 3 8   ? 39.576 20.861 12.908  1.00 34.26 ? 8   DC  P "C1'" 1 
ATOM   3857 N  N1    . DC  C 3 8   ? 38.721 21.173 14.072  1.00 33.29 ? 8   DC  P N1    1 
ATOM   3858 C  C2    . DC  C 3 8   ? 37.410 20.634 14.140  1.00 32.35 ? 8   DC  P C2    1 
ATOM   3859 O  O2    . DC  C 3 8   ? 37.019 19.865 13.252  1.00 33.39 ? 8   DC  P O2    1 
ATOM   3860 N  N3    . DC  C 3 8   ? 36.613 20.974 15.179  1.00 31.00 ? 8   DC  P N3    1 
ATOM   3861 C  C4    . DC  C 3 8   ? 37.070 21.800 16.129  1.00 31.27 ? 8   DC  P C4    1 
ATOM   3862 N  N4    . DC  C 3 8   ? 36.252 22.118 17.131  1.00 28.04 ? 8   DC  P N4    1 
ATOM   3863 C  C5    . DC  C 3 8   ? 38.389 22.337 16.094  1.00 30.32 ? 8   DC  P C5    1 
ATOM   3864 C  C6    . DC  C 3 8   ? 39.174 21.997 15.061  1.00 33.20 ? 8   DC  P C6    1 
ATOM   3865 P  P     . DC  C 3 9   ? 41.005 21.500 8.940   1.00 35.52 ? 9   DC  P P     1 
ATOM   3866 O  OP1   . DC  C 3 9   ? 41.583 20.527 7.985   1.00 37.08 ? 9   DC  P OP1   1 
ATOM   3867 O  OP2   . DC  C 3 9   ? 41.553 22.875 9.019   1.00 36.22 ? 9   DC  P OP2   1 
ATOM   3868 O  "O5'" . DC  C 3 9   ? 39.442 21.556 8.667   1.00 34.20 ? 9   DC  P "O5'" 1 
ATOM   3869 C  "C5'" . DC  C 3 9   ? 38.629 20.656 9.396   1.00 31.52 ? 9   DC  P "C5'" 1 
ATOM   3870 C  "C4'" . DC  C 3 9   ? 37.221 20.582 8.865   1.00 32.11 ? 9   DC  P "C4'" 1 
ATOM   3871 O  "O4'" . DC  C 3 9   ? 36.370 20.758 10.033  1.00 33.27 ? 9   DC  P "O4'" 1 
ATOM   3872 C  "C3'" . DC  C 3 9   ? 36.793 21.676 7.886   1.00 31.10 ? 9   DC  P "C3'" 1 
ATOM   3873 O  "O3'" . DC  C 3 9   ? 35.814 21.122 7.002   1.00 28.87 ? 9   DC  P "O3'" 1 
ATOM   3874 C  "C2'" . DC  C 3 9   ? 36.262 22.766 8.806   1.00 30.28 ? 9   DC  P "C2'" 1 
ATOM   3875 C  "C1'" . DC  C 3 9   ? 35.655 21.985 9.967   1.00 31.20 ? 9   DC  P "C1'" 1 
ATOM   3876 N  N1    . DC  C 3 9   ? 35.691 22.653 11.299  1.00 31.19 ? 9   DC  P N1    1 
ATOM   3877 C  C2    . DC  C 3 9   ? 34.525 22.653 12.111  1.00 30.97 ? 9   DC  P C2    1 
ATOM   3878 O  O2    . DC  C 3 9   ? 33.522 22.037 11.734  1.00 32.25 ? 9   DC  P O2    1 
ATOM   3879 N  N3    . DC  C 3 9   ? 34.533 23.336 13.287  1.00 31.44 ? 9   DC  P N3    1 
ATOM   3880 C  C4    . DC  C 3 9   ? 35.634 23.996 13.671  1.00 30.88 ? 9   DC  P C4    1 
ATOM   3881 N  N4    . DC  C 3 9   ? 35.590 24.675 14.826  1.00 28.04 ? 9   DC  P N4    1 
ATOM   3882 C  C5    . DC  C 3 9   ? 36.829 23.992 12.886  1.00 29.34 ? 9   DC  P C5    1 
ATOM   3883 C  C6    . DC  C 3 9   ? 36.818 23.306 11.727  1.00 31.79 ? 9   DC  P C6    1 
ATOM   3884 P  P     . DT  C 3 10  ? 35.379 21.902 5.663   1.00 32.43 ? 10  DT  P P     1 
ATOM   3885 O  OP1   . DT  C 3 10  ? 35.226 20.864 4.613   1.00 32.64 ? 10  DT  P OP1   1 
ATOM   3886 O  OP2   . DT  C 3 10  ? 36.270 23.063 5.417   1.00 33.52 ? 10  DT  P OP2   1 
ATOM   3887 O  "O5'" . DT  C 3 10  ? 33.916 22.389 6.053   1.00 29.42 ? 10  DT  P "O5'" 1 
ATOM   3888 C  "C5'" . DT  C 3 10  ? 33.187 21.601 6.984   1.00 29.53 ? 10  DT  P "C5'" 1 
ATOM   3889 C  "C4'" . DT  C 3 10  ? 31.761 22.067 7.141   1.00 31.76 ? 10  DT  P "C4'" 1 
ATOM   3890 O  "O4'" . DT  C 3 10  ? 31.592 22.652 8.465   1.00 32.90 ? 10  DT  P "O4'" 1 
ATOM   3891 C  "C3'" . DT  C 3 10  ? 31.361 23.167 6.168   1.00 32.24 ? 10  DT  P "C3'" 1 
ATOM   3892 O  "O3'" . DT  C 3 10  ? 30.004 22.969 5.775   1.00 36.77 ? 10  DT  P "O3'" 1 
ATOM   3893 C  "C2'" . DT  C 3 10  ? 31.661 24.446 6.941   1.00 29.77 ? 10  DT  P "C2'" 1 
ATOM   3894 C  "C1'" . DT  C 3 10  ? 31.339 24.054 8.377   1.00 29.70 ? 10  DT  P "C1'" 1 
ATOM   3895 N  N1    . DT  C 3 10  ? 32.098 24.759 9.461   1.00 29.95 ? 10  DT  P N1    1 
ATOM   3896 C  C2    . DT  C 3 10  ? 31.502 24.924 10.711  1.00 29.02 ? 10  DT  P C2    1 
ATOM   3897 O  O2    . DT  C 3 10  ? 30.388 24.536 10.978  1.00 29.42 ? 10  DT  P O2    1 
ATOM   3898 N  N3    . DT  C 3 10  ? 32.276 25.576 11.641  1.00 28.91 ? 10  DT  P N3    1 
ATOM   3899 C  C4    . DT  C 3 10  ? 33.550 26.073 11.462  1.00 28.17 ? 10  DT  P C4    1 
ATOM   3900 O  O4    . DT  C 3 10  ? 34.122 26.628 12.389  1.00 30.30 ? 10  DT  P O4    1 
ATOM   3901 C  C5    . DT  C 3 10  ? 34.112 25.878 10.142  1.00 28.55 ? 10  DT  P C5    1 
ATOM   3902 C  C7    . DT  C 3 10  ? 35.489 26.392 9.859   1.00 26.40 ? 10  DT  P C7    1 
ATOM   3903 C  C6    . DT  C 3 10  ? 33.369 25.242 9.223   1.00 26.76 ? 10  DT  P C6    1 
ATOM   3904 P  P     . DA  C 3 11  ? 29.209 24.134 5.026   1.00 40.89 ? 11  DA  P P     1 
ATOM   3905 O  OP1   . DA  C 3 11  ? 28.147 23.536 4.198   1.00 38.94 ? 11  DA  P OP1   1 
ATOM   3906 O  OP2   . DA  C 3 11  ? 30.198 25.050 4.403   1.00 41.64 ? 11  DA  P OP2   1 
ATOM   3907 O  "O5'" . DA  C 3 11  ? 28.526 24.870 6.256   1.00 43.54 ? 11  DA  P "O5'" 1 
ATOM   3908 C  "C5'" . DA  C 3 11  ? 27.784 24.129 7.218   1.00 48.91 ? 11  DA  P "C5'" 1 
ATOM   3909 C  "C4'" . DA  C 3 11  ? 26.861 25.065 7.948   1.00 52.43 ? 11  DA  P "C4'" 1 
ATOM   3910 O  "O4'" . DA  C 3 11  ? 27.610 25.852 8.896   1.00 52.04 ? 11  DA  P "O4'" 1 
ATOM   3911 C  "C3'" . DA  C 3 11  ? 26.333 26.068 6.940   1.00 55.29 ? 11  DA  P "C3'" 1 
ATOM   3912 O  "O3'" . DA  C 3 11  ? 25.158 26.611 7.455   1.00 62.97 ? 11  DA  P "O3'" 1 
ATOM   3913 C  "C2'" . DA  C 3 11  ? 27.359 27.171 6.966   1.00 53.67 ? 11  DA  P "C2'" 1 
ATOM   3914 C  "C1'" . DA  C 3 11  ? 27.699 27.192 8.431   1.00 50.64 ? 11  DA  P "C1'" 1 
ATOM   3915 N  N9    . DA  C 3 11  ? 29.056 27.640 8.642   1.00 48.16 ? 11  DA  P N9    1 
ATOM   3916 C  C8    . DA  C 3 11  ? 30.068 27.719 7.726   1.00 45.08 ? 11  DA  P C8    1 
ATOM   3917 N  N7    . DA  C 3 11  ? 31.188 28.157 8.225   1.00 45.00 ? 11  DA  P N7    1 
ATOM   3918 C  C5    . DA  C 3 11  ? 30.888 28.382 9.560   1.00 45.11 ? 11  DA  P C5    1 
ATOM   3919 C  C6    . DA  C 3 11  ? 31.648 28.848 10.625  1.00 44.70 ? 11  DA  P C6    1 
ATOM   3920 N  N6    . DA  C 3 11  ? 32.934 29.184 10.518  1.00 44.78 ? 11  DA  P N6    1 
ATOM   3921 N  N1    . DA  C 3 11  ? 31.042 28.961 11.826  1.00 45.17 ? 11  DA  P N1    1 
ATOM   3922 C  C2    . DA  C 3 11  ? 29.753 28.619 11.932  1.00 45.53 ? 11  DA  P C2    1 
ATOM   3923 N  N3    . DA  C 3 11  ? 28.934 28.164 11.000  1.00 46.34 ? 11  DA  P N3    1 
ATOM   3924 C  C4    . DA  C 3 11  ? 29.575 28.070 9.824   1.00 46.61 ? 11  DA  P C4    1 
HETATM 3925 N  N1    . DOC C 3 12  ? 27.259 31.653 7.644   1.00 48.22 ? 12  DOC P N1    1 
HETATM 3926 C  C2    . DOC C 3 12  ? 27.838 31.636 8.926   1.00 44.92 ? 12  DOC P C2    1 
HETATM 3927 N  N3    . DOC C 3 12  ? 29.184 31.527 9.028   1.00 41.83 ? 12  DOC P N3    1 
HETATM 3928 C  C4    . DOC C 3 12  ? 29.933 31.423 7.919   1.00 42.15 ? 12  DOC P C4    1 
HETATM 3929 C  C5    . DOC C 3 12  ? 29.359 31.391 6.622   1.00 43.15 ? 12  DOC P C5    1 
HETATM 3930 C  C6    . DOC C 3 12  ? 28.038 31.498 6.533   1.00 45.61 ? 12  DOC P C6    1 
HETATM 3931 O  O2    . DOC C 3 12  ? 27.111 31.720 9.925   1.00 44.96 ? 12  DOC P O2    1 
HETATM 3932 N  N4    . DOC C 3 12  ? 31.254 31.349 8.047   1.00 38.10 ? 12  DOC P N4    1 
HETATM 3933 C  "C1'" . DOC C 3 12  ? 25.821 31.894 7.461   1.00 51.97 ? 12  DOC P "C1'" 1 
HETATM 3934 C  "C2'" . DOC C 3 12  ? 25.334 31.315 6.146   1.00 56.84 ? 12  DOC P "C2'" 1 
HETATM 3935 C  "C3'" . DOC C 3 12  ? 23.904 30.941 6.459   1.00 58.51 ? 12  DOC P "C3'" 1 
HETATM 3936 C  "C4'" . DOC C 3 12  ? 23.971 30.520 7.924   1.00 59.32 ? 12  DOC P "C4'" 1 
HETATM 3937 O  "O4'" . DOC C 3 12  ? 25.097 31.240 8.488   1.00 56.32 ? 12  DOC P "O4'" 1 
HETATM 3938 C  "C5'" . DOC C 3 12  ? 24.290 29.055 8.033   1.00 63.06 ? 12  DOC P "C5'" 1 
HETATM 3939 O  "O5'" . DOC C 3 12  ? 23.427 28.309 7.183   1.00 65.71 ? 12  DOC P "O5'" 1 
HETATM 3940 P  P     . DOC C 3 12  ? 24.003 27.025 6.457   1.00 68.89 ? 12  DOC P P     1 
HETATM 3941 O  OP1   . DOC C 3 12  ? 23.059 25.887 6.500   1.00 67.75 ? 12  DOC P OP1   1 
HETATM 3942 O  OP2   . DOC C 3 12  ? 24.662 27.412 5.176   1.00 67.27 ? 12  DOC P OP2   1 
HETATM 3943 N  N1    . DCP D 4 .   ? 27.717 36.458 5.142   1.00 27.19 ? 739 DCP A N1    1 
HETATM 3944 C  C2    . DCP D 4 .   ? 28.935 37.089 5.506   1.00 25.32 ? 739 DCP A C2    1 
HETATM 3945 N  N3    . DCP D 4 .   ? 30.089 36.454 5.189   1.00 27.16 ? 739 DCP A N3    1 
HETATM 3946 C  C4    . DCP D 4 .   ? 30.089 35.255 4.542   1.00 29.28 ? 739 DCP A C4    1 
HETATM 3947 C  C5    . DCP D 4 .   ? 28.865 34.586 4.167   1.00 27.08 ? 739 DCP A C5    1 
HETATM 3948 C  C6    . DCP D 4 .   ? 27.713 35.238 4.492   1.00 27.75 ? 739 DCP A C6    1 
HETATM 3949 O  O2    . DCP D 4 .   ? 28.927 38.183 6.081   1.00 28.75 ? 739 DCP A O2    1 
HETATM 3950 N  N4    . DCP D 4 .   ? 31.249 34.702 4.256   1.00 29.27 ? 739 DCP A N4    1 
HETATM 3951 C  "C1'" . DCP D 4 .   ? 26.401 37.299 5.505   1.00 25.27 ? 739 DCP A "C1'" 1 
HETATM 3952 C  "C2'" . DCP D 4 .   ? 26.278 38.013 4.145   1.00 25.29 ? 739 DCP A "C2'" 1 
HETATM 3953 C  "C3'" . DCP D 4 .   ? 24.996 37.500 3.517   1.00 27.08 ? 739 DCP A "C3'" 1 
HETATM 3954 C  "C4'" . DCP D 4 .   ? 24.343 36.649 4.593   1.00 28.43 ? 739 DCP A "C4'" 1 
HETATM 3955 O  "O4'" . DCP D 4 .   ? 25.213 36.531 5.746   1.00 27.82 ? 739 DCP A "O4'" 1 
HETATM 3956 O  "O3'" . DCP D 4 .   ? 24.067 38.415 2.954   1.00 24.85 ? 739 DCP A "O3'" 1 
HETATM 3957 C  "C5'" . DCP D 4 .   ? 23.693 35.461 3.979   1.00 27.06 ? 739 DCP A "C5'" 1 
HETATM 3958 O  "O5'" . DCP D 4 .   ? 24.556 34.201 3.647   1.00 27.20 ? 739 DCP A "O5'" 1 
HETATM 3959 P  PA    . DCP D 4 .   ? 24.354 33.532 2.453   1.00 27.94 ? 739 DCP A PA    1 
HETATM 3960 O  O1A   . DCP D 4 .   ? 23.037 33.155 2.324   1.00 29.91 ? 739 DCP A O1A   1 
HETATM 3961 O  O2A   . DCP D 4 .   ? 25.188 32.252 2.145   1.00 29.30 ? 739 DCP A O2A   1 
HETATM 3962 O  O3A   . DCP D 4 .   ? 24.823 34.795 1.434   1.00 27.72 ? 739 DCP A O3A   1 
HETATM 3963 P  PB    . DCP D 4 .   ? 23.848 35.599 0.361   1.00 25.60 ? 739 DCP A PB    1 
HETATM 3964 O  O1B   . DCP D 4 .   ? 24.481 37.028 0.274   1.00 29.57 ? 739 DCP A O1B   1 
HETATM 3965 O  O2B   . DCP D 4 .   ? 22.394 35.559 0.999   1.00 30.17 ? 739 DCP A O2B   1 
HETATM 3966 O  O3B   . DCP D 4 .   ? 24.022 34.786 -1.044  1.00 28.44 ? 739 DCP A O3B   1 
HETATM 3967 P  PG    . DCP D 4 .   ? 22.925 33.815 -1.765  1.00 26.03 ? 739 DCP A PG    1 
HETATM 3968 O  O1G   . DCP D 4 .   ? 23.881 32.765 -2.493  1.00 28.64 ? 739 DCP A O1G   1 
HETATM 3969 O  O2G   . DCP D 4 .   ? 22.034 34.633 -2.771  1.00 28.06 ? 739 DCP A O2G   1 
HETATM 3970 O  O3G   . DCP D 4 .   ? 22.007 33.141 -0.695  1.00 23.30 ? 739 DCP A O3G   1 
HETATM 3971 MG MG    . MG  E 5 .   ? 21.402 32.451 4.345   1.00 47.72 ? 297 MG  A MG    1 
HETATM 3972 MG MG    . MG  F 5 .   ? 20.980 34.197 1.285   1.00 33.38 ? 298 MG  A MG    1 
HETATM 3973 O  O     . HOH G 6 .   ? 33.863 43.946 5.533   1.00 17.73 ? 740 HOH A O     1 
HETATM 3974 O  O     . HOH G 6 .   ? 44.051 40.019 15.809  1.00 13.01 ? 741 HOH A O     1 
HETATM 3975 O  O     . HOH G 6 .   ? 46.689 38.707 7.241   1.00 30.69 ? 742 HOH A O     1 
HETATM 3976 O  O     . HOH G 6 .   ? 44.840 45.150 5.143   1.00 21.47 ? 743 HOH A O     1 
HETATM 3977 O  O     . HOH G 6 .   ? 36.005 51.361 17.231  1.00 23.88 ? 744 HOH A O     1 
HETATM 3978 O  O     . HOH G 6 .   ? 28.674 23.184 1.373   1.00 31.50 ? 745 HOH A O     1 
HETATM 3979 O  O     . HOH G 6 .   ? 27.679 23.907 21.566  1.00 28.93 ? 746 HOH A O     1 
HETATM 3980 O  O     . HOH G 6 .   ? 43.276 50.644 0.345   1.00 33.24 ? 747 HOH A O     1 
HETATM 3981 O  O     . HOH G 6 .   ? 27.620 32.902 1.267   1.00 32.17 ? 748 HOH A O     1 
HETATM 3982 O  O     . HOH G 6 .   ? 39.590 45.713 25.912  1.00 33.37 ? 749 HOH A O     1 
HETATM 3983 O  O     . HOH G 6 .   ? 35.873 49.228 -1.446  1.00 26.74 ? 750 HOH A O     1 
HETATM 3984 O  O     . HOH G 6 .   ? 51.289 29.302 23.263  1.00 32.61 ? 751 HOH A O     1 
HETATM 3985 O  O     . HOH G 6 .   ? 31.952 50.526 2.797   1.00 42.03 ? 752 HOH A O     1 
HETATM 3986 O  O     . HOH G 6 .   ? 22.041 30.901 0.459   1.00 40.07 ? 753 HOH A O     1 
HETATM 3987 O  O     . HOH G 6 .   ? 21.847 40.053 -7.782  1.00 32.62 ? 754 HOH A O     1 
HETATM 3988 O  O     . HOH G 6 .   ? 31.774 42.973 9.158   1.00 24.14 ? 755 HOH A O     1 
HETATM 3989 O  O     . HOH G 6 .   ? 26.375 10.330 8.671   1.00 37.90 ? 756 HOH A O     1 
HETATM 3990 O  O     . HOH G 6 .   ? 29.125 49.963 7.385   1.00 35.70 ? 757 HOH A O     1 
HETATM 3991 O  O     . HOH G 6 .   ? 10.178 38.204 -6.745  1.00 46.96 ? 758 HOH A O     1 
HETATM 3992 O  O     . HOH G 6 .   ? 56.123 49.687 23.370  1.00 31.61 ? 759 HOH A O     1 
HETATM 3993 O  O     . HOH G 6 .   ? 24.814 16.249 9.629   1.00 49.37 ? 760 HOH A O     1 
HETATM 3994 O  O     . HOH G 6 .   ? 31.874 52.462 -4.101  1.00 43.07 ? 761 HOH A O     1 
HETATM 3995 O  O     . HOH G 6 .   ? 49.763 40.745 21.013  1.00 18.51 ? 762 HOH A O     1 
HETATM 3996 O  O     . HOH G 6 .   ? 42.213 18.996 3.785   1.00 33.96 ? 763 HOH A O     1 
HETATM 3997 O  O     . HOH G 6 .   ? 41.411 28.547 39.521  1.00 29.01 ? 764 HOH A O     1 
HETATM 3998 O  O     . HOH G 6 .   ? 37.317 41.121 26.407  1.00 26.02 ? 765 HOH A O     1 
HETATM 3999 O  O     . HOH G 6 .   ? 23.302 29.661 -8.178  1.00 36.93 ? 766 HOH A O     1 
HETATM 4000 O  O     . HOH G 6 .   ? 43.328 45.163 28.273  1.00 26.39 ? 767 HOH A O     1 
HETATM 4001 O  O     . HOH G 6 .   ? 30.936 33.299 -7.867  1.00 49.32 ? 768 HOH A O     1 
HETATM 4002 O  O     . HOH G 6 .   ? 29.035 33.876 -2.925  1.00 25.40 ? 769 HOH A O     1 
HETATM 4003 O  O     . HOH G 6 .   ? 43.988 26.283 38.640  1.00 44.39 ? 770 HOH A O     1 
HETATM 4004 O  O     . HOH G 6 .   ? 18.529 28.305 22.196  1.00 29.01 ? 771 HOH A O     1 
HETATM 4005 O  O     . HOH G 6 .   ? 40.800 32.314 19.224  1.00 21.49 ? 772 HOH A O     1 
HETATM 4006 O  O     . HOH G 6 .   ? 43.167 47.086 18.923  1.00 31.26 ? 773 HOH A O     1 
HETATM 4007 O  O     . HOH G 6 .   ? 32.294 43.235 29.702  1.00 36.73 ? 774 HOH A O     1 
HETATM 4008 O  O     . HOH G 6 .   ? 27.329 36.270 37.999  1.00 30.11 ? 775 HOH A O     1 
HETATM 4009 O  O     . HOH G 6 .   ? 28.845 40.616 34.451  1.00 31.77 ? 776 HOH A O     1 
HETATM 4010 O  O     . HOH G 6 .   ? 47.782 35.922 6.669   1.00 30.06 ? 777 HOH A O     1 
HETATM 4011 O  O     . HOH G 6 .   ? 31.021 52.521 1.321   1.00 53.26 ? 778 HOH A O     1 
HETATM 4012 O  O     . HOH G 6 .   ? 12.471 32.328 15.483  1.00 43.06 ? 779 HOH A O     1 
HETATM 4013 O  O     . HOH G 6 .   ? 48.993 31.772 27.077  1.00 44.49 ? 780 HOH A O     1 
HETATM 4014 O  O     . HOH G 6 .   ? 39.297 38.387 6.420   1.00 28.44 ? 781 HOH A O     1 
HETATM 4015 O  O     . HOH G 6 .   ? 33.688 21.135 -7.291  1.00 33.04 ? 782 HOH A O     1 
HETATM 4016 O  O     . HOH G 6 .   ? 52.648 42.994 33.313  1.00 30.86 ? 783 HOH A O     1 
HETATM 4017 O  O     . HOH G 6 .   ? 44.745 32.634 38.062  1.00 44.69 ? 784 HOH A O     1 
HETATM 4018 O  O     . HOH G 6 .   ? 34.444 51.021 1.715   1.00 49.18 ? 785 HOH A O     1 
HETATM 4019 O  O     . HOH G 6 .   ? 41.328 52.830 22.041  1.00 42.62 ? 786 HOH A O     1 
HETATM 4020 O  O     . HOH G 6 .   ? 20.211 30.308 21.430  1.00 26.38 ? 787 HOH A O     1 
HETATM 4021 O  O     . HOH G 6 .   ? 37.890 47.254 32.572  1.00 54.10 ? 788 HOH A O     1 
HETATM 4022 O  O     . HOH G 6 .   ? 36.898 36.551 7.737   1.00 31.46 ? 789 HOH A O     1 
HETATM 4023 O  O     . HOH G 6 .   ? 14.568 38.313 12.570  1.00 34.03 ? 790 HOH A O     1 
HETATM 4024 O  O     . HOH G 6 .   ? 26.608 32.731 -1.461  1.00 30.01 ? 791 HOH A O     1 
HETATM 4025 O  O     . HOH G 6 .   ? 31.802 50.337 7.410   1.00 38.05 ? 792 HOH A O     1 
HETATM 4026 O  O     . HOH G 6 .   ? 24.438 49.702 10.284  1.00 38.51 ? 793 HOH A O     1 
HETATM 4027 O  O     . HOH G 6 .   ? 43.722 42.037 37.182  1.00 36.28 ? 794 HOH A O     1 
HETATM 4028 O  O     . HOH G 6 .   ? 44.480 33.599 9.387   1.00 44.32 ? 795 HOH A O     1 
HETATM 4029 O  O     . HOH G 6 .   ? 35.058 45.223 26.189  1.00 28.54 ? 796 HOH A O     1 
HETATM 4030 O  O     . HOH G 6 .   ? 30.654 39.844 36.405  1.00 36.61 ? 797 HOH A O     1 
HETATM 4031 O  O     . HOH G 6 .   ? 28.285 34.832 22.594  1.00 46.61 ? 798 HOH A O     1 
HETATM 4032 O  O     . HOH G 6 .   ? 37.236 21.480 -10.004 1.00 37.59 ? 799 HOH A O     1 
HETATM 4033 O  O     . HOH G 6 .   ? 48.357 45.235 11.273  1.00 49.40 ? 800 HOH A O     1 
HETATM 4034 O  O     . HOH G 6 .   ? 33.624 33.173 42.822  1.00 35.52 ? 801 HOH A O     1 
HETATM 4035 O  O     . HOH G 6 .   ? 35.713 24.969 40.526  1.00 39.60 ? 802 HOH A O     1 
HETATM 4036 O  O     . HOH G 6 .   ? 32.535 25.704 40.896  1.00 38.39 ? 803 HOH A O     1 
HETATM 4037 O  O     . HOH G 6 .   ? 46.919 36.386 3.903   1.00 51.99 ? 804 HOH A O     1 
HETATM 4038 O  O     . HOH G 6 .   ? 51.501 43.035 19.843  1.00 37.72 ? 805 HOH A O     1 
HETATM 4039 O  O     . HOH G 6 .   ? 22.692 13.628 3.478   1.00 38.57 ? 806 HOH A O     1 
HETATM 4040 O  O     . HOH G 6 .   ? 53.893 40.628 30.739  1.00 31.61 ? 807 HOH A O     1 
HETATM 4041 O  O     . HOH G 6 .   ? 10.770 36.795 -3.503  1.00 27.32 ? 808 HOH A O     1 
HETATM 4042 O  O     . HOH G 6 .   ? 0.656  22.426 6.591   1.00 51.78 ? 809 HOH A O     1 
HETATM 4043 O  O     . HOH G 6 .   ? 37.950 19.729 30.977  1.00 33.88 ? 810 HOH A O     1 
HETATM 4044 O  O     . HOH G 6 .   ? 42.624 50.764 16.740  1.00 45.72 ? 811 HOH A O     1 
HETATM 4045 O  O     . HOH G 6 .   ? 25.829 31.978 -6.378  1.00 32.48 ? 812 HOH A O     1 
HETATM 4046 O  O     . HOH G 6 .   ? 48.268 43.001 1.509   1.00 50.17 ? 813 HOH A O     1 
HETATM 4047 O  O     . HOH G 6 .   ? 22.890 19.223 6.525   1.00 48.92 ? 814 HOH A O     1 
HETATM 4048 O  O     . HOH G 6 .   ? 13.597 49.329 1.644   1.00 57.70 ? 815 HOH A O     1 
HETATM 4049 O  O     . HOH G 6 .   ? 19.033 29.363 25.397  1.00 52.70 ? 816 HOH A O     1 
HETATM 4050 O  O     . HOH G 6 .   ? 27.820 46.098 20.528  1.00 36.59 ? 817 HOH A O     1 
HETATM 4051 O  O     . HOH G 6 .   ? 7.558  33.404 -8.681  1.00 35.89 ? 818 HOH A O     1 
HETATM 4052 O  O     . HOH G 6 .   ? 41.743 19.122 30.937  1.00 55.55 ? 819 HOH A O     1 
HETATM 4053 O  O     . HOH G 6 .   ? 7.754  35.982 13.549  1.00 43.98 ? 820 HOH A O     1 
HETATM 4054 O  O     . HOH G 6 .   ? 36.579 48.125 18.683  1.00 31.97 ? 821 HOH A O     1 
HETATM 4055 O  O     . HOH G 6 .   ? 26.702 40.849 27.682  1.00 52.65 ? 822 HOH A O     1 
HETATM 4056 O  O     . HOH G 6 .   ? 51.414 37.176 10.404  1.00 26.10 ? 823 HOH A O     1 
HETATM 4057 O  O     . HOH G 6 .   ? 36.772 37.736 -13.909 1.00 29.30 ? 824 HOH A O     1 
HETATM 4058 O  O     . HOH G 6 .   ? 19.158 39.244 -6.737  1.00 30.93 ? 825 HOH A O     1 
HETATM 4059 O  O     . HOH G 6 .   ? 16.862 22.130 3.858   1.00 33.33 ? 826 HOH A O     1 
HETATM 4060 O  O     . HOH G 6 .   ? 6.541  26.674 13.524  1.00 48.64 ? 827 HOH A O     1 
HETATM 4061 O  O     . HOH G 6 .   ? 29.004 45.224 -15.013 1.00 41.60 ? 828 HOH A O     1 
HETATM 4062 O  O     . HOH G 6 .   ? 19.629 18.184 13.355  1.00 40.16 ? 829 HOH A O     1 
HETATM 4063 O  O     . HOH G 6 .   ? 36.619 45.067 34.397  1.00 26.57 ? 830 HOH A O     1 
HETATM 4064 O  O     . HOH G 6 .   ? 46.197 21.974 26.846  1.00 42.26 ? 831 HOH A O     1 
HETATM 4065 O  O     . HOH G 6 .   ? 38.983 44.165 34.725  1.00 53.22 ? 832 HOH A O     1 
HETATM 4066 O  O     . HOH G 6 .   ? 51.396 38.166 13.303  1.00 36.19 ? 833 HOH A O     1 
HETATM 4067 O  O     . HOH G 6 .   ? 17.155 37.865 15.748  1.00 41.22 ? 834 HOH A O     1 
HETATM 4068 O  O     . HOH G 6 .   ? 25.427 21.975 27.879  1.00 35.67 ? 835 HOH A O     1 
HETATM 4069 O  O     . HOH G 6 .   ? 39.442 48.783 -3.605  1.00 33.79 ? 836 HOH A O     1 
HETATM 4070 O  O     . HOH G 6 .   ? 38.740 29.327 40.192  1.00 33.47 ? 837 HOH A O     1 
HETATM 4071 O  O     . HOH G 6 .   ? 36.272 19.946 -7.382  1.00 34.83 ? 838 HOH A O     1 
HETATM 4072 O  O     . HOH G 6 .   ? 50.582 35.734 7.846   1.00 33.85 ? 839 HOH A O     1 
HETATM 4073 O  O     . HOH G 6 .   ? 47.016 25.403 14.761  1.00 52.72 ? 840 HOH A O     1 
HETATM 4074 O  O     . HOH G 6 .   ? 11.491 35.837 22.564  1.00 50.36 ? 841 HOH A O     1 
HETATM 4075 O  O     . HOH G 6 .   ? 16.125 42.829 -5.213  1.00 38.04 ? 842 HOH A O     1 
HETATM 4076 O  O     . HOH G 6 .   ? 11.192 34.595 14.112  1.00 43.84 ? 843 HOH A O     1 
HETATM 4077 O  O     . HOH G 6 .   ? 52.298 35.138 5.555   1.00 49.44 ? 844 HOH A O     1 
HETATM 4078 O  O     . HOH G 6 .   ? 55.037 27.859 14.846  1.00 34.20 ? 845 HOH A O     1 
HETATM 4079 O  O     . HOH G 6 .   ? 43.033 52.262 24.624  1.00 52.69 ? 846 HOH A O     1 
HETATM 4080 O  O     . HOH G 6 .   ? 3.705  28.143 23.225  1.00 41.33 ? 847 HOH A O     1 
HETATM 4081 O  O     . HOH G 6 .   ? 55.142 39.314 25.251  1.00 31.88 ? 848 HOH A O     1 
HETATM 4082 O  O     . HOH G 6 .   ? 39.069 30.635 42.810  1.00 40.96 ? 849 HOH A O     1 
HETATM 4083 O  O     . HOH G 6 .   ? 23.987 30.315 -3.236  1.00 26.93 ? 850 HOH A O     1 
HETATM 4084 O  O     . HOH G 6 .   ? 47.225 52.161 24.846  1.00 39.34 ? 851 HOH A O     1 
HETATM 4085 O  O     . HOH G 6 .   ? 40.270 35.668 1.267   1.00 44.97 ? 852 HOH A O     1 
HETATM 4086 O  O     . HOH G 6 .   ? 49.247 48.211 24.090  1.00 32.08 ? 853 HOH A O     1 
HETATM 4087 O  O     . HOH G 6 .   ? 36.794 35.822 4.304   1.00 31.50 ? 854 HOH A O     1 
HETATM 4088 O  O     . HOH G 6 .   ? 22.056 40.124 21.096  1.00 56.16 ? 855 HOH A O     1 
HETATM 4089 O  O     . HOH G 6 .   ? 3.642  29.798 7.486   1.00 49.27 ? 856 HOH A O     1 
HETATM 4090 O  O     . HOH G 6 .   ? 50.151 35.910 12.729  1.00 26.49 ? 857 HOH A O     1 
HETATM 4091 O  O     . HOH G 6 .   ? 7.961  18.479 21.895  1.00 42.98 ? 858 HOH A O     1 
HETATM 4092 O  O     . HOH G 6 .   ? 16.841 39.516 -1.370  1.00 25.69 ? 859 HOH A O     1 
HETATM 4093 O  O     . HOH G 6 .   ? 24.033 51.080 1.786   1.00 46.95 ? 860 HOH A O     1 
HETATM 4094 O  O     . HOH G 6 .   ? -5.112 23.826 -3.750  1.00 56.94 ? 861 HOH A O     1 
HETATM 4095 O  O     . HOH G 6 .   ? 22.680 29.462 20.366  1.00 31.76 ? 862 HOH A O     1 
HETATM 4096 O  O     . HOH G 6 .   ? 24.276 42.872 19.328  1.00 41.78 ? 863 HOH A O     1 
HETATM 4097 O  O     . HOH G 6 .   ? 37.072 19.207 26.338  1.00 36.95 ? 864 HOH A O     1 
HETATM 4098 O  O     . HOH G 6 .   ? 17.668 39.914 17.534  1.00 46.07 ? 865 HOH A O     1 
HETATM 4099 O  O     . HOH G 6 .   ? 54.688 33.570 5.646   1.00 46.34 ? 866 HOH A O     1 
HETATM 4100 O  O     . HOH G 6 .   ? 29.627 49.269 10.551  1.00 32.11 ? 867 HOH A O     1 
HETATM 4101 O  O     . HOH G 6 .   ? 17.696 40.375 -4.768  1.00 48.22 ? 868 HOH A O     1 
HETATM 4102 O  O     . HOH G 6 .   ? 39.661 37.570 39.300  1.00 49.17 ? 869 HOH A O     1 
HETATM 4103 O  O     . HOH G 6 .   ? 39.432 23.972 38.628  1.00 46.97 ? 870 HOH A O     1 
HETATM 4104 O  O     . HOH G 6 .   ? 29.011 47.914 -14.742 1.00 53.58 ? 871 HOH A O     1 
HETATM 4105 O  O     . HOH G 6 .   ? 11.852 37.551 13.611  1.00 41.12 ? 872 HOH A O     1 
HETATM 4106 O  O     . HOH G 6 .   ? 24.917 31.443 17.062  1.00 44.74 ? 873 HOH A O     1 
HETATM 4107 O  O     . HOH G 6 .   ? 9.041  38.662 13.049  1.00 45.09 ? 874 HOH A O     1 
HETATM 4108 O  O     . HOH G 6 .   ? 47.029 48.879 22.125  1.00 56.12 ? 875 HOH A O     1 
HETATM 4109 O  O     . HOH G 6 .   ? 14.644 51.631 -2.481  1.00 50.46 ? 876 HOH A O     1 
HETATM 4110 O  O     . HOH G 6 .   ? 37.456 43.995 26.229  1.00 26.98 ? 877 HOH A O     1 
HETATM 4111 O  O     . HOH G 6 .   ? 45.314 52.089 2.086   1.00 43.37 ? 878 HOH A O     1 
HETATM 4112 O  O     . HOH G 6 .   ? 16.017 10.432 4.163   1.00 45.70 ? 879 HOH A O     1 
HETATM 4113 O  O     . HOH G 6 .   ? 30.907 18.628 7.940   1.00 27.41 ? 880 HOH A O     1 
HETATM 4114 O  O     . HOH G 6 .   ? 26.178 44.766 18.716  1.00 50.80 ? 881 HOH A O     1 
HETATM 4115 O  O     . HOH G 6 .   ? 37.675 56.385 19.487  1.00 45.59 ? 882 HOH A O     1 
HETATM 4116 O  O     . HOH G 6 .   ? 33.486 47.059 -20.355 1.00 44.74 ? 883 HOH A O     1 
HETATM 4117 O  O     . HOH H 6 .   ? 35.236 50.553 8.996   1.00 43.34 ? 17  HOH T O     1 
HETATM 4118 O  O     . HOH H 6 .   ? 38.846 34.777 5.755   1.00 36.88 ? 18  HOH T O     1 
HETATM 4119 O  O     . HOH H 6 .   ? 37.903 33.584 13.357  1.00 34.67 ? 19  HOH T O     1 
HETATM 4120 O  O     . HOH H 6 .   ? 28.590 37.530 21.885  1.00 38.68 ? 20  HOH T O     1 
HETATM 4121 O  O     . HOH H 6 .   ? 32.726 25.148 20.742  1.00 50.38 ? 21  HOH T O     1 
HETATM 4122 O  O     . HOH H 6 .   ? 33.384 12.277 9.109   1.00 33.01 ? 22  HOH T O     1 
HETATM 4123 O  O     . HOH H 6 .   ? 28.763 16.296 19.478  1.00 49.58 ? 23  HOH T O     1 
HETATM 4124 O  O     . HOH H 6 .   ? 36.038 53.138 9.795   1.00 37.18 ? 24  HOH T O     1 
HETATM 4125 O  O     . HOH I 6 .   ? 30.208 25.435 1.349   1.00 30.38 ? 31  HOH P O     1 
HETATM 4126 O  O     . HOH I 6 .   ? 38.399 26.343 15.770  1.00 37.57 ? 83  HOH P O     1 
HETATM 4127 O  O     . HOH I 6 .   ? 23.510 32.284 10.723  1.00 40.69 ? 98  HOH P O     1 
HETATM 4128 O  O     . HOH I 6 .   ? 38.899 24.730 9.426   1.00 45.23 ? 133 HOH P O     1 
HETATM 4129 O  O     . HOH I 6 .   ? 24.885 27.897 3.138   1.00 40.82 ? 144 HOH P O     1 
HETATM 4130 O  O     . HOH I 6 .   ? 40.017 24.817 18.648  1.00 36.82 ? 155 HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LYS 1   305 305 LYS LYS A . n 
A 1 2   ARG 2   306 306 ARG ARG A . n 
A 1 3   ILE 3   307 307 ILE ILE A . n 
A 1 4   VAL 4   308 308 VAL VAL A . n 
A 1 5   ALA 5   309 309 ALA ALA A . n 
A 1 6   CYS 6   310 310 CYS CYS A . n 
A 1 7   ASP 7   311 311 ASP ASP A . n 
A 1 8   ASP 8   312 312 ASP ASP A . n 
A 1 9   PRO 9   313 313 PRO PRO A . n 
A 1 10  ASP 10  314 314 ASP ASP A . n 
A 1 11  PHE 11  315 315 PHE PHE A . n 
A 1 12  LEU 12  316 316 LEU LEU A . n 
A 1 13  THR 13  317 317 THR THR A . n 
A 1 14  SER 14  318 318 SER SER A . n 
A 1 15  TYR 15  319 319 TYR TYR A . n 
A 1 16  PHE 16  320 320 PHE PHE A . n 
A 1 17  ALA 17  321 321 ALA ALA A . n 
A 1 18  HIS 18  322 322 HIS HIS A . n 
A 1 19  SER 19  323 323 SER SER A . n 
A 1 20  ARG 20  324 324 ARG ARG A . n 
A 1 21  LEU 21  325 325 LEU LEU A . n 
A 1 22  HIS 22  326 326 HIS HIS A . n 
A 1 23  HIS 23  327 327 HIS HIS A . n 
A 1 24  LEU 24  328 328 LEU LEU A . n 
A 1 25  SER 25  329 329 SER SER A . n 
A 1 26  ALA 26  330 330 ALA ALA A . n 
A 1 27  TRP 27  331 331 TRP TRP A . n 
A 1 28  LYS 28  332 332 LYS LYS A . n 
A 1 29  ALA 29  333 333 ALA ALA A . n 
A 1 30  ASN 30  334 334 ASN ASN A . n 
A 1 31  LEU 31  335 335 LEU LEU A . n 
A 1 32  LYS 32  336 336 LYS LYS A . n 
A 1 33  ASP 33  337 337 ASP ASP A . n 
A 1 34  LYS 34  338 338 LYS LYS A . n 
A 1 35  PHE 35  339 339 PHE PHE A . n 
A 1 36  LEU 36  340 340 LEU LEU A . n 
A 1 37  ASN 37  341 341 ASN ASN A . n 
A 1 38  GLU 38  342 342 GLU GLU A . n 
A 1 39  ASN 39  343 343 ASN ASN A . n 
A 1 40  ILE 40  344 344 ILE ILE A . n 
A 1 41  HIS 41  345 345 HIS HIS A . n 
A 1 42  LYS 42  346 346 LYS LYS A . n 
A 1 43  TYR 43  347 347 TYR TYR A . n 
A 1 44  THR 44  348 348 THR THR A . n 
A 1 45  LYS 45  349 349 LYS LYS A . n 
A 1 46  ILE 46  350 350 ILE ILE A . n 
A 1 47  THR 47  351 351 THR THR A . n 
A 1 48  ASP 48  352 352 ASP ASP A . n 
A 1 49  LYS 49  353 353 LYS LYS A . n 
A 1 50  ASP 50  354 354 ASP ASP A . n 
A 1 51  THR 51  355 355 THR THR A . n 
A 1 52  TYR 52  356 356 TYR TYR A . n 
A 1 53  ILE 53  357 357 ILE ILE A . n 
A 1 54  ILE 54  358 358 ILE ILE A . n 
A 1 55  PHE 55  359 359 PHE PHE A . n 
A 1 56  HIS 56  360 360 HIS HIS A . n 
A 1 57  ILE 57  361 361 ILE ILE A . n 
A 1 58  ASP 58  362 362 ASP ASP A . n 
A 1 59  PHE 59  363 363 PHE PHE A . n 
A 1 60  ASP 60  364 364 ASP ASP A . n 
A 1 61  CYS 61  365 365 CYS CYS A . n 
A 1 62  PHE 62  366 366 PHE PHE A . n 
A 1 63  PHE 63  367 367 PHE PHE A . n 
A 1 64  ALA 64  368 368 ALA ALA A . n 
A 1 65  THR 65  369 369 THR THR A . n 
A 1 66  VAL 66  370 370 VAL VAL A . n 
A 1 67  ALA 67  371 371 ALA ALA A . n 
A 1 68  TYR 68  372 372 TYR TYR A . n 
A 1 69  LEU 69  373 373 LEU LEU A . n 
A 1 70  CYS 70  374 374 CYS CYS A . n 
A 1 71  ARG 71  375 375 ARG ARG A . n 
A 1 72  SER 72  376 376 SER SER A . n 
A 1 73  SER 73  377 377 SER SER A . n 
A 1 74  SER 74  378 378 SER SER A . n 
A 1 75  PHE 75  379 379 PHE PHE A . n 
A 1 76  SER 76  380 380 SER SER A . n 
A 1 77  ALA 77  381 381 ALA ALA A . n 
A 1 78  CYS 78  382 382 CYS CYS A . n 
A 1 79  ASP 79  383 383 ASP ASP A . n 
A 1 80  PHE 80  384 384 PHE PHE A . n 
A 1 81  LYS 81  385 385 LYS LYS A . n 
A 1 82  ARG 82  386 386 ARG ARG A . n 
A 1 83  ASP 83  387 387 ASP ASP A . n 
A 1 84  PRO 84  388 388 PRO PRO A . n 
A 1 85  ILE 85  389 389 ILE ILE A . n 
A 1 86  VAL 86  390 390 VAL VAL A . n 
A 1 87  VAL 87  391 391 VAL VAL A . n 
A 1 88  CYS 88  392 392 CYS CYS A . n 
A 1 89  HIS 89  393 393 HIS HIS A . n 
A 1 90  GLY 90  394 394 GLY GLY A . n 
A 1 91  THR 91  395 395 THR THR A . n 
A 1 92  LYS 92  396 396 LYS LYS A . n 
A 1 93  ASN 93  397 397 ASN ASN A . n 
A 1 94  SER 94  398 398 SER SER A . n 
A 1 95  ASP 95  399 399 ASP ASP A . n 
A 1 96  ILE 96  400 400 ILE ILE A . n 
A 1 97  ALA 97  401 401 ALA ALA A . n 
A 1 98  SER 98  402 402 SER SER A . n 
A 1 99  CYS 99  403 403 CYS CYS A . n 
A 1 100 ASN 100 404 404 ASN ASN A . n 
A 1 101 TYR 101 405 405 TYR TYR A . n 
A 1 102 VAL 102 406 406 VAL VAL A . n 
A 1 103 ALA 103 407 407 ALA ALA A . n 
A 1 104 ARG 104 408 408 ARG ARG A . n 
A 1 105 SER 105 409 409 SER SER A . n 
A 1 106 TYR 106 410 410 TYR TYR A . n 
A 1 107 GLY 107 411 411 GLY GLY A . n 
A 1 108 ILE 108 412 412 ILE ILE A . n 
A 1 109 LYS 109 413 413 LYS LYS A . n 
A 1 110 ASN 110 414 414 ASN ASN A . n 
A 1 111 GLY 111 415 415 GLY GLY A . n 
A 1 112 MET 112 416 416 MET MET A . n 
A 1 113 TRP 113 417 417 TRP TRP A . n 
A 1 114 VAL 114 418 418 VAL VAL A . n 
A 1 115 SER 115 419 419 SER SER A . n 
A 1 116 GLN 116 420 420 GLN GLN A . n 
A 1 117 ALA 117 421 421 ALA ALA A . n 
A 1 118 GLU 118 422 422 GLU GLU A . n 
A 1 119 LYS 119 423 423 LYS LYS A . n 
A 1 120 MET 120 424 424 MET MET A . n 
A 1 121 LEU 121 425 425 LEU LEU A . n 
A 1 122 PRO 122 426 426 PRO PRO A . n 
A 1 123 ASN 123 427 427 ASN ASN A . n 
A 1 124 GLY 124 428 428 GLY GLY A . n 
A 1 125 ILE 125 429 429 ILE ILE A . n 
A 1 126 LYS 126 430 430 LYS LYS A . n 
A 1 127 LEU 127 431 431 LEU LEU A . n 
A 1 128 ILE 128 432 432 ILE ILE A . n 
A 1 129 SER 129 433 433 SER SER A . n 
A 1 130 LEU 130 434 434 LEU LEU A . n 
A 1 131 PRO 131 435 435 PRO PRO A . n 
A 1 132 TYR 132 436 436 TYR TYR A . n 
A 1 133 THR 133 437 437 THR THR A . n 
A 1 134 PHE 134 438 438 PHE PHE A . n 
A 1 135 GLU 135 439 439 GLU GLU A . n 
A 1 136 GLN 136 440 440 GLN GLN A . n 
A 1 137 PHE 137 441 441 PHE PHE A . n 
A 1 138 GLN 138 442 442 GLN GLN A . n 
A 1 139 LEU 139 443 443 LEU LEU A . n 
A 1 140 LYS 140 444 444 LYS LYS A . n 
A 1 141 SER 141 445 445 SER SER A . n 
A 1 142 GLU 142 446 446 GLU GLU A . n 
A 1 143 ALA 143 447 447 ALA ALA A . n 
A 1 144 PHE 144 448 448 PHE PHE A . n 
A 1 145 TYR 145 449 449 TYR TYR A . n 
A 1 146 SER 146 450 450 SER SER A . n 
A 1 147 THR 147 451 451 THR THR A . n 
A 1 148 LEU 148 452 452 LEU LEU A . n 
A 1 149 LYS 149 453 453 LYS LYS A . n 
A 1 150 ARG 150 454 454 ARG ARG A . n 
A 1 151 LEU 151 455 455 LEU LEU A . n 
A 1 152 ASN 152 456 456 ASN ASN A . n 
A 1 153 ILE 153 457 457 ILE ILE A . n 
A 1 154 PHE 154 458 458 PHE PHE A . n 
A 1 155 ASN 155 459 459 ASN ASN A . n 
A 1 156 LEU 156 460 460 LEU LEU A . n 
A 1 157 ILE 157 461 461 ILE ILE A . n 
A 1 158 LEU 158 462 462 LEU LEU A . n 
A 1 159 PRO 159 463 463 PRO PRO A . n 
A 1 160 ILE 160 464 464 ILE ILE A . n 
A 1 161 SER 161 465 465 SER SER A . n 
A 1 162 ILE 162 466 466 ILE ILE A . n 
A 1 163 ASP 163 467 467 ASP ASP A . n 
A 1 164 GLU 164 468 468 GLU GLU A . n 
A 1 165 ALA 165 469 469 ALA ALA A . n 
A 1 166 VAL 166 470 470 VAL VAL A . n 
A 1 167 CYS 167 471 471 CYS CYS A . n 
A 1 168 VAL 168 472 472 VAL VAL A . n 
A 1 169 ARG 169 473 473 ARG ARG A . n 
A 1 170 ILE 170 474 474 ILE ILE A . n 
A 1 171 ILE 171 475 475 ILE ILE A . n 
A 1 172 PRO 172 476 476 PRO PRO A . n 
A 1 173 ASP 173 477 477 ASP ASP A . n 
A 1 174 ASN 174 478 ?   ?   ?   A . n 
A 1 175 ILE 175 479 ?   ?   ?   A . n 
A 1 176 HIS 176 480 ?   ?   ?   A . n 
A 1 177 ASN 177 481 ?   ?   ?   A . n 
A 1 178 THR 178 482 ?   ?   ?   A . n 
A 1 179 ASN 179 483 ?   ?   ?   A . n 
A 1 180 THR 180 484 484 THR THR A . n 
A 1 181 LEU 181 485 485 LEU LEU A . n 
A 1 182 ASN 182 486 486 ASN ASN A . n 
A 1 183 ALA 183 487 487 ALA ALA A . n 
A 1 184 ARG 184 488 488 ARG ARG A . n 
A 1 185 LEU 185 489 489 LEU LEU A . n 
A 1 186 CYS 186 490 490 CYS CYS A . n 
A 1 187 GLU 187 491 491 GLU GLU A . n 
A 1 188 GLU 188 492 492 GLU GLU A . n 
A 1 189 ILE 189 493 493 ILE ILE A . n 
A 1 190 ARG 190 494 494 ARG ARG A . n 
A 1 191 GLN 191 495 495 GLN GLN A . n 
A 1 192 GLU 192 496 496 GLU GLU A . n 
A 1 193 ILE 193 497 497 ILE ILE A . n 
A 1 194 PHE 194 498 498 PHE PHE A . n 
A 1 195 GLN 195 499 499 GLN GLN A . n 
A 1 196 GLY 196 500 500 GLY GLY A . n 
A 1 197 THR 197 501 501 THR THR A . n 
A 1 198 ASN 198 502 502 ASN ASN A . n 
A 1 199 GLY 199 503 503 GLY GLY A . n 
A 1 200 CYS 200 504 504 CYS CYS A . n 
A 1 201 THR 201 505 505 THR THR A . n 
A 1 202 VAL 202 506 506 VAL VAL A . n 
A 1 203 SER 203 507 507 SER SER A . n 
A 1 204 ILE 204 508 508 ILE ILE A . n 
A 1 205 GLY 205 509 509 GLY GLY A . n 
A 1 206 CYS 206 510 510 CYS CYS A . n 
A 1 207 SER 207 511 511 SER SER A . n 
A 1 208 ASP 208 512 512 ASP ASP A . n 
A 1 209 SER 209 513 513 SER SER A . n 
A 1 210 LEU 210 514 514 LEU LEU A . n 
A 1 211 VAL 211 515 515 VAL VAL A . n 
A 1 212 LEU 212 516 516 LEU LEU A . n 
A 1 213 ALA 213 517 517 ALA ALA A . n 
A 1 214 ARG 214 518 518 ARG ARG A . n 
A 1 215 LEU 215 519 519 LEU LEU A . n 
A 1 216 ALA 216 520 520 ALA ALA A . n 
A 1 217 LEU 217 521 521 LEU LEU A . n 
A 1 218 LYS 218 522 522 LYS LYS A . n 
A 1 219 MET 219 523 523 MET MET A . n 
A 1 220 ALA 220 524 524 ALA ALA A . n 
A 1 221 LYS 221 525 525 LYS LYS A . n 
A 1 222 PRO 222 526 526 PRO PRO A . n 
A 1 223 ASN 223 527 527 ASN ASN A . n 
A 1 224 GLY 224 528 528 GLY GLY A . n 
A 1 225 TYR 225 529 529 TYR TYR A . n 
A 1 226 ASN 226 530 530 ASN ASN A . n 
A 1 227 ILE 227 531 531 ILE ILE A . n 
A 1 228 THR 228 532 532 THR THR A . n 
A 1 229 PHE 229 533 533 PHE PHE A . n 
A 1 230 LYS 230 534 534 LYS LYS A . n 
A 1 231 SER 231 535 535 SER SER A . n 
A 1 232 ASN 232 536 536 ASN ASN A . n 
A 1 233 LEU 233 537 537 LEU LEU A . n 
A 1 234 SER 234 538 538 SER SER A . n 
A 1 235 GLU 235 539 539 GLU GLU A . n 
A 1 236 GLU 236 540 540 GLU GLU A . n 
A 1 237 PHE 237 541 541 PHE PHE A . n 
A 1 238 TRP 238 542 542 TRP TRP A . n 
A 1 239 SER 239 543 543 SER SER A . n 
A 1 240 SER 240 544 544 SER SER A . n 
A 1 241 PHE 241 545 545 PHE PHE A . n 
A 1 242 LYS 242 546 546 LYS LYS A . n 
A 1 243 LEU 243 547 547 LEU LEU A . n 
A 1 244 ASP 244 548 548 ASP ASP A . n 
A 1 245 ASP 245 549 549 ASP ASP A . n 
A 1 246 LEU 246 550 550 LEU LEU A . n 
A 1 247 PRO 247 551 551 PRO PRO A . n 
A 1 248 GLY 248 552 552 GLY GLY A . n 
A 1 249 VAL 249 553 553 VAL VAL A . n 
A 1 250 GLY 250 554 554 GLY GLY A . n 
A 1 251 HIS 251 555 555 HIS HIS A . n 
A 1 252 SER 252 556 556 SER SER A . n 
A 1 253 THR 253 557 557 THR THR A . n 
A 1 254 LEU 254 558 558 LEU LEU A . n 
A 1 255 SER 255 559 559 SER SER A . n 
A 1 256 ARG 256 560 560 ARG ARG A . n 
A 1 257 LEU 257 561 561 LEU LEU A . n 
A 1 258 GLU 258 562 562 GLU GLU A . n 
A 1 259 SER 259 563 563 SER SER A . n 
A 1 260 THR 260 564 564 THR THR A . n 
A 1 261 PHE 261 565 565 PHE PHE A . n 
A 1 262 ASP 262 566 566 ASP ASP A . n 
A 1 263 SER 263 567 567 SER SER A . n 
A 1 264 PRO 264 568 568 PRO PRO A . n 
A 1 265 HIS 265 569 569 HIS HIS A . n 
A 1 266 SER 266 570 570 SER SER A . n 
A 1 267 LEU 267 571 571 LEU LEU A . n 
A 1 268 ASN 268 572 572 ASN ASN A . n 
A 1 269 ASP 269 573 573 ASP ASP A . n 
A 1 270 LEU 270 574 574 LEU LEU A . n 
A 1 271 ARG 271 575 575 ARG ARG A . n 
A 1 272 LYS 272 576 576 LYS LYS A . n 
A 1 273 ARG 273 577 577 ARG ARG A . n 
A 1 274 TYR 274 578 578 TYR TYR A . n 
A 1 275 THR 275 579 579 THR THR A . n 
A 1 276 LEU 276 580 580 LEU LEU A . n 
A 1 277 ASP 277 581 581 ASP ASP A . n 
A 1 278 ALA 278 582 582 ALA ALA A . n 
A 1 279 LEU 279 583 583 LEU LEU A . n 
A 1 280 LYS 280 584 584 LYS LYS A . n 
A 1 281 ALA 281 585 585 ALA ALA A . n 
A 1 282 SER 282 586 586 SER SER A . n 
A 1 283 VAL 283 587 587 VAL VAL A . n 
A 1 284 GLY 284 588 588 GLY GLY A . n 
A 1 285 SER 285 589 589 SER SER A . n 
A 1 286 LYS 286 590 590 LYS LYS A . n 
A 1 287 LEU 287 591 591 LEU LEU A . n 
A 1 288 GLY 288 592 592 GLY GLY A . n 
A 1 289 MET 289 593 593 MET MET A . n 
A 1 290 LYS 290 594 594 LYS LYS A . n 
A 1 291 ILE 291 595 595 ILE ILE A . n 
A 1 292 HIS 292 596 596 HIS HIS A . n 
A 1 293 LEU 293 597 597 LEU LEU A . n 
A 1 294 ALA 294 598 598 ALA ALA A . n 
A 1 295 LEU 295 599 599 LEU LEU A . n 
A 1 296 GLN 296 600 600 GLN GLN A . n 
A 1 297 GLY 297 601 601 GLY GLY A . n 
A 1 298 GLN 298 602 602 GLN GLN A . n 
A 1 299 ASP 299 603 603 ASP ASP A . n 
A 1 300 ASP 300 604 604 ASP ASP A . n 
A 1 301 GLU 301 605 605 GLU GLU A . n 
A 1 302 GLU 302 606 606 GLU GLU A . n 
A 1 303 SER 303 607 607 SER SER A . n 
A 1 304 LEU 304 608 608 LEU LEU A . n 
A 1 305 LYS 305 609 609 LYS LYS A . n 
A 1 306 ILE 306 610 610 ILE ILE A . n 
A 1 307 LEU 307 611 611 LEU LEU A . n 
A 1 308 TYR 308 612 612 TYR TYR A . n 
A 1 309 ASP 309 613 613 ASP ASP A . n 
A 1 310 PRO 310 614 614 PRO PRO A . n 
A 1 311 LYS 311 615 615 LYS LYS A . n 
A 1 312 GLU 312 616 616 GLU GLU A . n 
A 1 313 VAL 313 617 617 VAL VAL A . n 
A 1 314 LEU 314 618 618 LEU LEU A . n 
A 1 315 GLN 315 619 619 GLN GLN A . n 
A 1 316 ARG 316 620 620 ARG ARG A . n 
A 1 317 LYS 317 621 621 LYS LYS A . n 
A 1 318 SER 318 622 622 SER SER A . n 
A 1 319 LEU 319 623 623 LEU LEU A . n 
A 1 320 SER 320 624 624 SER SER A . n 
A 1 321 ILE 321 625 625 ILE ILE A . n 
A 1 322 ASP 322 626 626 ASP ASP A . n 
A 1 323 ILE 323 627 627 ILE ILE A . n 
A 1 324 ASN 324 628 628 ASN ASN A . n 
A 1 325 TRP 325 629 629 TRP TRP A . n 
A 1 326 GLY 326 630 630 GLY GLY A . n 
A 1 327 ILE 327 631 631 ILE ILE A . n 
A 1 328 ARG 328 632 632 ARG ARG A . n 
A 1 329 PHE 329 633 633 PHE PHE A . n 
A 1 330 LYS 330 634 634 LYS LYS A . n 
A 1 331 ASN 331 635 635 ASN ASN A . n 
A 1 332 ILE 332 636 636 ILE ILE A . n 
A 1 333 THR 333 637 637 THR THR A . n 
A 1 334 GLN 334 638 638 GLN GLN A . n 
A 1 335 VAL 335 639 639 VAL VAL A . n 
A 1 336 ASP 336 640 640 ASP ASP A . n 
A 1 337 LEU 337 641 641 LEU LEU A . n 
A 1 338 PHE 338 642 642 PHE PHE A . n 
A 1 339 ILE 339 643 643 ILE ILE A . n 
A 1 340 GLU 340 644 644 GLU GLU A . n 
A 1 341 ARG 341 645 645 ARG ARG A . n 
A 1 342 GLY 342 646 646 GLY GLY A . n 
A 1 343 CYS 343 647 647 CYS CYS A . n 
A 1 344 GLN 344 648 648 GLN GLN A . n 
A 1 345 TYR 345 649 649 TYR TYR A . n 
A 1 346 LEU 346 650 650 LEU LEU A . n 
A 1 347 LEU 347 651 651 LEU LEU A . n 
A 1 348 GLU 348 652 652 GLU GLU A . n 
A 1 349 LYS 349 653 653 LYS LYS A . n 
A 1 350 LEU 350 654 654 LEU LEU A . n 
A 1 351 ASN 351 655 655 ASN ASN A . n 
A 1 352 GLU 352 656 656 GLU GLU A . n 
A 1 353 ILE 353 657 657 ILE ILE A . n 
A 1 354 ASN 354 658 658 ASN ASN A . n 
A 1 355 LYS 355 659 659 LYS LYS A . n 
A 1 356 THR 356 660 660 THR THR A . n 
A 1 357 THR 357 661 661 THR THR A . n 
A 1 358 SER 358 662 662 SER SER A . n 
A 1 359 GLN 359 663 663 GLN GLN A . n 
A 1 360 ILE 360 664 664 ILE ILE A . n 
A 1 361 THR 361 665 665 THR THR A . n 
A 1 362 LEU 362 666 666 LEU LEU A . n 
A 1 363 LYS 363 667 667 LYS LYS A . n 
A 1 364 LEU 364 668 668 LEU LEU A . n 
A 1 365 MET 365 669 669 MET MET A . n 
A 1 366 ARG 366 670 670 ARG ARG A . n 
A 1 367 ARG 367 671 671 ARG ARG A . n 
A 1 368 CYS 368 672 672 CYS CYS A . n 
A 1 369 LYS 369 673 673 LYS LYS A . n 
A 1 370 ASP 370 674 674 ASP ASP A . n 
A 1 371 ALA 371 675 675 ALA ALA A . n 
A 1 372 PRO 372 676 676 PRO PRO A . n 
A 1 373 ILE 373 677 677 ILE ILE A . n 
A 1 374 GLU 374 678 678 GLU GLU A . n 
A 1 375 PRO 375 679 679 PRO PRO A . n 
A 1 376 PRO 376 680 680 PRO PRO A . n 
A 1 377 LYS 377 681 681 LYS LYS A . n 
A 1 378 TYR 378 682 682 TYR TYR A . n 
A 1 379 MET 379 683 683 MET MET A . n 
A 1 380 GLY 380 684 684 GLY GLY A . n 
A 1 381 MET 381 685 685 MET MET A . n 
A 1 382 GLY 382 686 686 GLY GLY A . n 
A 1 383 ARG 383 687 687 ARG ARG A . n 
A 1 384 CYS 384 688 688 CYS CYS A . n 
A 1 385 ASP 385 689 689 ASP ASP A . n 
A 1 386 SER 386 690 690 SER SER A . n 
A 1 387 PHE 387 691 691 PHE PHE A . n 
A 1 388 SER 388 692 692 SER SER A . n 
A 1 389 ARG 389 693 693 ARG ARG A . n 
A 1 390 SER 390 694 694 SER SER A . n 
A 1 391 SER 391 695 695 SER SER A . n 
A 1 392 ARG 392 696 696 ARG ARG A . n 
A 1 393 LEU 393 697 697 LEU LEU A . n 
A 1 394 GLY 394 698 698 GLY GLY A . n 
A 1 395 ILE 395 699 699 ILE ILE A . n 
A 1 396 PRO 396 700 700 PRO PRO A . n 
A 1 397 THR 397 701 701 THR THR A . n 
A 1 398 ASN 398 702 702 ASN ASN A . n 
A 1 399 GLU 399 703 703 GLU GLU A . n 
A 1 400 PHE 400 704 704 PHE PHE A . n 
A 1 401 GLY 401 705 705 GLY GLY A . n 
A 1 402 ILE 402 706 706 ILE ILE A . n 
A 1 403 ILE 403 707 707 ILE ILE A . n 
A 1 404 ALA 404 708 708 ALA ALA A . n 
A 1 405 THR 405 709 709 THR THR A . n 
A 1 406 GLU 406 710 710 GLU GLU A . n 
A 1 407 MET 407 711 711 MET MET A . n 
A 1 408 LYS 408 712 712 LYS LYS A . n 
A 1 409 SER 409 713 713 SER SER A . n 
A 1 410 LEU 410 714 714 LEU LEU A . n 
A 1 411 TYR 411 715 715 TYR TYR A . n 
A 1 412 ARG 412 716 716 ARG ARG A . n 
A 1 413 THR 413 717 717 THR THR A . n 
A 1 414 LEU 414 718 718 LEU LEU A . n 
A 1 415 GLY 415 719 719 GLY GLY A . n 
A 1 416 CYS 416 720 720 CYS CYS A . n 
A 1 417 PRO 417 721 721 PRO PRO A . n 
A 1 418 PRO 418 722 722 PRO PRO A . n 
A 1 419 MET 419 723 723 MET MET A . n 
A 1 420 GLU 420 724 724 GLU GLU A . n 
A 1 421 LEU 421 725 725 LEU LEU A . n 
A 1 422 ARG 422 726 726 ARG ARG A . n 
A 1 423 GLY 423 727 727 GLY GLY A . n 
A 1 424 LEU 424 728 728 LEU LEU A . n 
A 1 425 ALA 425 729 729 ALA ALA A . n 
A 1 426 LEU 426 730 730 LEU LEU A . n 
A 1 427 GLN 427 731 731 GLN GLN A . n 
A 1 428 PHE 428 732 732 PHE PHE A . n 
A 1 429 ASN 429 733 733 ASN ASN A . n 
A 1 430 LYS 430 734 734 LYS LYS A . n 
A 1 431 LEU 431 735 735 LEU LEU A . n 
A 1 432 VAL 432 736 736 VAL VAL A . n 
A 1 433 ASP 433 737 737 ASP ASP A . n 
A 1 434 VAL 434 738 738 VAL VAL A . n 
B 2 1   DT  1   1   1   DT  DT  T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DA  3   3   3   DA  DA  T . n 
B 2 4   P   4   4   4   P   P   T . n 
B 2 5   DG  5   5   5   DG  DG  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DA  7   7   7   DA  DA  T . n 
B 2 8   DG  8   8   8   DG  DG  T . n 
B 2 9   DG  9   9   9   DG  DG  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
B 2 11  DG  11  11  11  DG  DG  T . n 
B 2 12  DA  12  12  12  DA  DA  T . n 
B 2 13  DG  13  13  13  DG  DG  T . n 
B 2 14  DG  14  14  14  DG  DG  T . n 
B 2 15  DA  15  15  15  DA  DA  T . n 
B 2 16  DT  16  16  16  DT  DT  T . n 
C 3 1   DA  1   1   1   DA  DA  P . n 
C 3 2   DT  2   2   2   DT  DT  P . n 
C 3 3   DC  3   3   3   DC  DC  P . n 
C 3 4   DC  4   4   4   DC  DC  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DC  6   6   6   DC  DC  P . n 
C 3 7   DC  7   7   7   DC  DC  P . n 
C 3 8   DC  8   8   8   DC  DC  P . n 
C 3 9   DC  9   9   9   DC  DC  P . n 
C 3 10  DT  10  10  10  DT  DT  P . n 
C 3 11  DA  11  11  11  DA  DA  P . n 
C 3 12  DOC 12  12  12  DOC DOC P . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 B P   4  T P   4  ? DG ?                                        
2 C DOC 12 P DOC 12 ? DC "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE" 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6910  ? 
1 MORE         -48   ? 
1 'SSA (A^2)'  22530 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-10-28 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC     'data collection' Quantum ? 1 
AMoRE    phasing           .       ? 2 
CNS      refinement        1.1     ? 3 
HKL-2000 'data reduction'  .       ? 4 
HKL-2000 'data scaling'    .       ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 ND2 A ASN 459 ? ? O   A HOH 809 ? ? 2.03 
2 1 OP2 P DOC 12  ? ? O   P HOH 144 ? ? 2.11 
3 1 OE1 A GLN 495 ? ? NE2 A GLN 499 ? ? 2.14 
4 1 O   A CYS 510 ? ? O   A ILE 531 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB    A PHE 367 ? ? CG    A PHE 367 ? ? CD2   A PHE 367 ? ? 115.45 120.80 -5.35  0.70 N 
2  1 CB    A PHE 367 ? ? CG    A PHE 367 ? ? CD1   A PHE 367 ? ? 125.79 120.80 4.99   0.70 N 
3  1 CA    A LEU 460 ? ? CB    A LEU 460 ? ? CG    A LEU 460 ? ? 130.22 115.30 14.92  2.30 N 
4  1 CA    A PRO 526 ? ? N     A PRO 526 ? ? CD    A PRO 526 ? ? 103.24 111.70 -8.46  1.40 N 
5  1 C     A GLU 678 ? ? N     A PRO 679 ? ? CA    A PRO 679 ? ? 128.54 119.30 9.24   1.50 Y 
6  1 C     A GLU 678 ? ? N     A PRO 679 ? ? CD    A PRO 679 ? ? 113.64 128.40 -14.76 2.10 Y 
7  1 N9    T DG  5   ? ? "C1'" T DG  5   ? ? "C2'" T DG  5   ? ? 123.89 114.30 9.59   1.40 N 
8  1 "C5'" T DT  6   ? ? "C4'" T DT  6   ? ? "C3'" T DT  6   ? ? 98.10  114.10 -16.00 1.80 N 
9  1 "O4'" T DT  6   ? ? "C1'" T DT  6   ? ? N1    T DT  6   ? ? 111.81 108.30 3.51   0.30 N 
10 1 "C3'" T DG  8   ? ? "C2'" T DG  8   ? ? "C1'" T DG  8   ? ? 96.84  102.40 -5.56  0.80 N 
11 1 N9    T DG  8   ? ? "C1'" T DG  8   ? ? "C2'" T DG  8   ? ? 126.25 114.30 11.95  1.40 N 
12 1 "O4'" T DG  8   ? ? "C1'" T DG  8   ? ? N9    T DG  8   ? ? 113.71 108.30 5.41   0.30 N 
13 1 "O4'" T DG  9   ? ? "C1'" T DG  9   ? ? N9    T DG  9   ? ? 111.05 108.30 2.75   0.30 N 
14 1 C4    T DG  9   ? ? N9    T DG  9   ? ? "C1'" T DG  9   ? ? 134.60 126.50 8.10   1.30 N 
15 1 "O4'" T DG  10  ? ? "C1'" T DG  10  ? ? N9    T DG  10  ? ? 111.96 108.30 3.66   0.30 N 
16 1 N9    T DG  11  ? ? "C1'" T DG  11  ? ? "C2'" T DG  11  ? ? 123.45 114.30 9.15   1.40 N 
17 1 "O4'" T DG  11  ? ? "C1'" T DG  11  ? ? N9    T DG  11  ? ? 110.59 108.30 2.29   0.30 N 
18 1 N9    T DG  13  ? ? "C1'" T DG  13  ? ? "C2'" T DG  13  ? ? 124.65 114.30 10.35  1.40 N 
19 1 "O4'" T DG  13  ? ? "C1'" T DG  13  ? ? N9    T DG  13  ? ? 112.47 108.30 4.17   0.30 N 
20 1 N9    T DG  14  ? ? "C1'" T DG  14  ? ? "C2'" T DG  14  ? ? 125.17 114.30 10.87  1.40 N 
21 1 "O4'" T DG  14  ? ? "C1'" T DG  14  ? ? N9    T DG  14  ? ? 110.97 108.30 2.67   0.30 N 
22 1 "O4'" T DA  15  ? ? "C1'" T DA  15  ? ? N9    T DA  15  ? ? 110.53 108.30 2.23   0.30 N 
23 1 "O4'" P DC  3   ? ? "C1'" P DC  3   ? ? N1    P DC  3   ? ? 110.19 108.30 1.89   0.30 N 
24 1 "O4'" P DC  4   ? ? "C1'" P DC  4   ? ? N1    P DC  4   ? ? 110.24 108.30 1.94   0.30 N 
25 1 "O4'" P DC  6   ? ? "C1'" P DC  6   ? ? N1    P DC  6   ? ? 110.38 108.30 2.08   0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 306 ? ? 71.82   104.72  
2  1 CYS A 365 ? ? 24.69   65.37   
3  1 LYS A 396 ? ? -127.60 -88.41  
4  1 ASN A 397 ? ? -96.52  50.52   
5  1 ASN A 456 ? ? -113.18 68.55   
6  1 ASN A 502 ? ? 81.33   -136.91 
7  1 LYS A 525 ? ? -15.70  -65.64  
8  1 PRO A 526 ? ? -58.03  85.04   
9  1 ILE A 531 ? ? -93.08  -72.85  
10 1 THR A 532 ? ? 52.53   93.35   
11 1 SER A 567 ? ? 37.40   72.30   
12 1 ASP A 613 ? ? -172.85 86.76   
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DA T 3  ? ? 0.076 'SIDE CHAIN' 
2 1 DG T 5  ? ? 0.088 'SIDE CHAIN' 
3 1 DG T 10 ? ? 0.054 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 305 ? CG  ? A LYS 1   CG  
2  1 Y 1 A LYS 305 ? CD  ? A LYS 1   CD  
3  1 Y 1 A LYS 305 ? CE  ? A LYS 1   CE  
4  1 Y 1 A LYS 305 ? NZ  ? A LYS 1   NZ  
5  1 Y 1 A TYR 347 ? CG  ? A TYR 43  CG  
6  1 Y 1 A TYR 347 ? CD1 ? A TYR 43  CD1 
7  1 Y 1 A TYR 347 ? CD2 ? A TYR 43  CD2 
8  1 Y 1 A TYR 347 ? CE1 ? A TYR 43  CE1 
9  1 Y 1 A TYR 347 ? CE2 ? A TYR 43  CE2 
10 1 Y 1 A TYR 347 ? CZ  ? A TYR 43  CZ  
11 1 Y 1 A TYR 347 ? OH  ? A TYR 43  OH  
12 1 Y 1 A LYS 353 ? CG  ? A LYS 49  CG  
13 1 Y 1 A LYS 353 ? CD  ? A LYS 49  CD  
14 1 Y 1 A LYS 353 ? CE  ? A LYS 49  CE  
15 1 Y 1 A LYS 353 ? NZ  ? A LYS 49  NZ  
16 1 Y 1 A ARG 386 ? CG  ? A ARG 82  CG  
17 1 Y 1 A ARG 386 ? CD  ? A ARG 82  CD  
18 1 Y 1 A ARG 386 ? NE  ? A ARG 82  NE  
19 1 Y 1 A ARG 386 ? CZ  ? A ARG 82  CZ  
20 1 Y 1 A ARG 386 ? NH1 ? A ARG 82  NH1 
21 1 Y 1 A ARG 386 ? NH2 ? A ARG 82  NH2 
22 1 Y 1 A LYS 430 ? CG  ? A LYS 126 CG  
23 1 Y 1 A LYS 430 ? CD  ? A LYS 126 CD  
24 1 Y 1 A LYS 430 ? CE  ? A LYS 126 CE  
25 1 Y 1 A LYS 430 ? NZ  ? A LYS 126 NZ  
26 1 Y 1 A GLU 439 ? CG  ? A GLU 135 CG  
27 1 Y 1 A GLU 439 ? CD  ? A GLU 135 CD  
28 1 Y 1 A GLU 439 ? OE1 ? A GLU 135 OE1 
29 1 Y 1 A GLU 439 ? OE2 ? A GLU 135 OE2 
30 1 Y 1 A LYS 453 ? CG  ? A LYS 149 CG  
31 1 Y 1 A LYS 453 ? CD  ? A LYS 149 CD  
32 1 Y 1 A LYS 453 ? CE  ? A LYS 149 CE  
33 1 Y 1 A LYS 453 ? NZ  ? A LYS 149 NZ  
34 1 Y 1 A GLU 540 ? CG  ? A GLU 236 CG  
35 1 Y 1 A GLU 540 ? CD  ? A GLU 236 CD  
36 1 Y 1 A GLU 540 ? OE1 ? A GLU 236 OE1 
37 1 Y 1 A GLU 540 ? OE2 ? A GLU 236 OE2 
38 1 Y 1 A GLU 616 ? CG  ? A GLU 312 CG  
39 1 Y 1 A GLU 616 ? CD  ? A GLU 312 CD  
40 1 Y 1 A GLU 616 ? OE1 ? A GLU 312 OE1 
41 1 Y 1 A GLU 616 ? OE2 ? A GLU 312 OE2 
42 1 Y 1 A LYS 653 ? CG  ? A LYS 349 CG  
43 1 Y 1 A LYS 653 ? CD  ? A LYS 349 CD  
44 1 Y 1 A LYS 653 ? CE  ? A LYS 349 CE  
45 1 Y 1 A LYS 653 ? NZ  ? A LYS 349 NZ  
46 1 Y 1 A LYS 673 ? CG  ? A LYS 369 CG  
47 1 Y 1 A LYS 673 ? CD  ? A LYS 369 CD  
48 1 Y 1 A LYS 673 ? CE  ? A LYS 369 CE  
49 1 Y 1 A LYS 673 ? NZ  ? A LYS 369 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASN 478 ? A ASN 174 
2 1 Y 1 A ILE 479 ? A ILE 175 
3 1 Y 1 A HIS 480 ? A HIS 176 
4 1 Y 1 A ASN 481 ? A ASN 177 
5 1 Y 1 A THR 482 ? A THR 178 
6 1 Y 1 A ASN 483 ? A ASN 179 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
3BJY 'double helix'        
3BJY 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 5  1_555 C DOC 12 1_555 -0.174 -0.166 -0.679 -25.235 -9.033  -5.359 1  T_DG5:DOC12_P T 5  ? P 12 ? 19 1 
1 B DT 6  1_555 C DA  11 1_555 -0.032 -0.152 -0.099 -7.982  -10.171 5.772  2  T_DT6:DA11_P  T 6  ? P 11 ? 20 1 
1 B DA 7  1_555 C DT  10 1_555 0.314  -0.051 -0.189 -5.472  -7.178  2.704  3  T_DA7:DT10_P  T 7  ? P 10 ? 20 1 
1 B DG 8  1_555 C DC  9  1_555 0.072  -0.183 0.210  8.470   -6.445  -4.645 4  T_DG8:DC9_P   T 8  ? P 9  ? 19 1 
1 B DG 9  1_555 C DC  8  1_555 -0.016 -0.152 0.098  -3.596  -5.402  -0.317 5  T_DG9:DC8_P   T 9  ? P 8  ? 19 1 
1 B DG 10 1_555 C DC  7  1_555 -0.172 -0.099 0.240  -11.213 -15.468 3.003  6  T_DG10:DC7_P  T 10 ? P 7  ? 19 1 
1 B DG 11 1_555 C DC  6  1_555 -0.057 -0.042 -0.287 -1.001  -6.552  -1.255 7  T_DG11:DC6_P  T 11 ? P 6  ? 19 1 
1 B DA 12 1_555 C DT  5  1_555 0.182  0.064  0.140  8.017   -9.832  -0.963 8  T_DA12:DT5_P  T 12 ? P 5  ? 20 1 
1 B DG 13 1_555 C DC  4  1_555 0.177  -0.160 0.366  12.150  -12.146 -4.138 9  T_DG13:DC4_P  T 13 ? P 4  ? 19 1 
1 B DG 14 1_555 C DC  3  1_555 -0.066 -0.219 -0.287 -0.545  -13.164 -4.448 10 T_DG14:DC3_P  T 14 ? P 3  ? 19 1 
1 B DA 15 1_555 C DT  2  1_555 0.190  -0.078 -0.345 -9.495  -5.993  -1.969 11 T_DA15:DT2_P  T 15 ? P 2  ? 20 1 
1 B DT 16 1_555 C DA  1  1_555 0.203  -0.220 -0.166 7.799   -3.897  -6.920 12 T_DT16:DA1_P  T 16 ? P 1  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 5  1_555 C DOC 12 1_555 B DT 6  1_555 C DA 11 1_555 0.566  0.788  2.905 -8.798 10.539 17.640 -1.580 -4.480 2.450 29.277 
24.440 22.319 1  TT_DG5DT6:DA11DOC12_PP T 5  ? P 12 ? T 6  ? P 11 ? 
1 B DT 6  1_555 C DA  11 1_555 B DA 7  1_555 C DT 10 1_555 -0.795 0.909  3.375 -0.819 6.273  40.096 0.574  1.050  3.488 9.081  
1.185  40.572 2  TT_DT6DA7:DT10DA11_PP  T 6  ? P 11 ? T 7  ? P 10 ? 
1 B DA 7  1_555 C DT  10 1_555 B DG 8  1_555 C DC 9  1_555 0.239  -0.116 3.058 -2.820 3.582  24.950 -1.225 -1.302 2.968 8.204  
6.457  25.357 3  TT_DA7DG8:DC9DT10_PP   T 7  ? P 10 ? T 8  ? P 9  ? 
1 B DG 8  1_555 C DC  9  1_555 B DG 9  1_555 C DC 8  1_555 -0.595 -0.488 3.528 -3.200 4.594  40.253 -1.253 0.473  3.489 6.637  
4.623  40.625 4  TT_DG8DG9:DC8DC9_PP    T 8  ? P 9  ? T 9  ? P 8  ? 
1 B DG 9  1_555 C DC  8  1_555 B DG 10 1_555 C DC 7  1_555 0.838  -0.951 3.417 -1.812 6.421  32.627 -2.743 -1.768 3.129 11.283 
3.183  33.284 5  TT_DG9DG10:DC7DC8_PP   T 9  ? P 8  ? T 10 ? P 7  ? 
1 B DG 10 1_555 C DC  7  1_555 B DG 11 1_555 C DC 6  1_555 -1.321 -0.248 3.048 3.292  2.583  30.678 -0.918 3.053  2.864 4.854  
-6.186 30.955 6  TT_DG10DG11:DC6DC7_PP  T 10 ? P 7  ? T 11 ? P 6  ? 
1 B DG 11 1_555 C DC  6  1_555 B DA 12 1_555 C DT 5  1_555 -0.644 0.537  3.122 -5.666 2.444  37.408 0.522  0.284  3.209 3.779  
8.760  37.896 7  TT_DG11DA12:DT5DC6_PP  T 11 ? P 6  ? T 12 ? P 5  ? 
1 B DA 12 1_555 C DT  5  1_555 B DG 13 1_555 C DC 4  1_555 0.360  0.252  3.219 -0.819 4.090  31.102 -0.294 -0.819 3.215 7.586  
1.519  31.374 8  TT_DA12DG13:DC4DT5_PP  T 12 ? P 5  ? T 13 ? P 4  ? 
1 B DG 13 1_555 C DC  4  1_555 B DG 14 1_555 C DC 3  1_555 -0.148 -0.026 3.658 4.442  8.404  37.590 -1.190 0.831  3.532 12.793 
-6.762 38.731 9  TT_DG13DG14:DC3DC4_PP  T 13 ? P 4  ? T 14 ? P 3  ? 
1 B DG 14 1_555 C DC  3  1_555 B DA 15 1_555 C DT 2  1_555 0.015  -0.330 3.439 0.002  0.519  37.022 -0.593 -0.023 3.434 0.818  
-0.004 37.026 10 TT_DG14DA15:DT2DC3_PP  T 14 ? P 3  ? T 15 ? P 2  ? 
1 B DA 15 1_555 C DT  2  1_555 B DT 16 1_555 C DA 1  1_555 0.614  -0.913 3.068 0.085  0.906  30.553 -1.900 -1.150 3.042 1.719  
-0.161 30.567 11 TT_DA15DT16:DA1DT2_PP  T 15 ? P 2  ? T 16 ? P 1  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE" DCP 
5 'MAGNESIUM ION'                    MG  
6 water                              HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 DCP 1   739 739 DCP DCP A . 
E 5 MG  1   297 297 MG  MG  A . 
F 5 MG  1   298 298 MG  MG  A . 
G 6 HOH 1   740 740 HOH HOH A . 
G 6 HOH 2   741 741 HOH HOH A . 
G 6 HOH 3   742 742 HOH HOH A . 
G 6 HOH 4   743 743 HOH HOH A . 
G 6 HOH 5   744 744 HOH HOH A . 
G 6 HOH 6   745 745 HOH HOH A . 
G 6 HOH 7   746 746 HOH HOH A . 
G 6 HOH 8   747 747 HOH HOH A . 
G 6 HOH 9   748 748 HOH HOH A . 
G 6 HOH 10  749 749 HOH HOH A . 
G 6 HOH 11  750 750 HOH HOH A . 
G 6 HOH 12  751 751 HOH HOH A . 
G 6 HOH 13  752 752 HOH HOH A . 
G 6 HOH 14  753 753 HOH HOH A . 
G 6 HOH 15  754 754 HOH HOH A . 
G 6 HOH 16  755 755 HOH HOH A . 
G 6 HOH 17  756 756 HOH HOH A . 
G 6 HOH 18  757 757 HOH HOH A . 
G 6 HOH 19  758 758 HOH HOH A . 
G 6 HOH 20  759 759 HOH HOH A . 
G 6 HOH 21  760 760 HOH HOH A . 
G 6 HOH 22  761 761 HOH HOH A . 
G 6 HOH 23  762 762 HOH HOH A . 
G 6 HOH 24  763 763 HOH HOH A . 
G 6 HOH 25  764 764 HOH HOH A . 
G 6 HOH 26  765 765 HOH HOH A . 
G 6 HOH 27  766 766 HOH HOH A . 
G 6 HOH 28  767 767 HOH HOH A . 
G 6 HOH 29  768 768 HOH HOH A . 
G 6 HOH 30  769 769 HOH HOH A . 
G 6 HOH 31  770 770 HOH HOH A . 
G 6 HOH 32  771 771 HOH HOH A . 
G 6 HOH 33  772 772 HOH HOH A . 
G 6 HOH 34  773 773 HOH HOH A . 
G 6 HOH 35  774 774 HOH HOH A . 
G 6 HOH 36  775 775 HOH HOH A . 
G 6 HOH 37  776 776 HOH HOH A . 
G 6 HOH 38  777 777 HOH HOH A . 
G 6 HOH 39  778 778 HOH HOH A . 
G 6 HOH 40  779 779 HOH HOH A . 
G 6 HOH 41  780 780 HOH HOH A . 
G 6 HOH 42  781 781 HOH HOH A . 
G 6 HOH 43  782 782 HOH HOH A . 
G 6 HOH 44  783 783 HOH HOH A . 
G 6 HOH 45  784 784 HOH HOH A . 
G 6 HOH 46  785 785 HOH HOH A . 
G 6 HOH 47  786 786 HOH HOH A . 
G 6 HOH 48  787 787 HOH HOH A . 
G 6 HOH 49  788 788 HOH HOH A . 
G 6 HOH 50  789 789 HOH HOH A . 
G 6 HOH 51  790 790 HOH HOH A . 
G 6 HOH 52  791 791 HOH HOH A . 
G 6 HOH 53  792 792 HOH HOH A . 
G 6 HOH 54  793 793 HOH HOH A . 
G 6 HOH 55  794 794 HOH HOH A . 
G 6 HOH 56  795 795 HOH HOH A . 
G 6 HOH 57  796 796 HOH HOH A . 
G 6 HOH 58  797 797 HOH HOH A . 
G 6 HOH 59  798 798 HOH HOH A . 
G 6 HOH 60  799 799 HOH HOH A . 
G 6 HOH 61  800 800 HOH HOH A . 
G 6 HOH 62  801 801 HOH HOH A . 
G 6 HOH 63  802 802 HOH HOH A . 
G 6 HOH 64  803 803 HOH HOH A . 
G 6 HOH 65  804 804 HOH HOH A . 
G 6 HOH 66  805 805 HOH HOH A . 
G 6 HOH 67  806 806 HOH HOH A . 
G 6 HOH 68  807 807 HOH HOH A . 
G 6 HOH 69  808 808 HOH HOH A . 
G 6 HOH 70  809 809 HOH HOH A . 
G 6 HOH 71  810 810 HOH HOH A . 
G 6 HOH 72  811 811 HOH HOH A . 
G 6 HOH 73  812 812 HOH HOH A . 
G 6 HOH 74  813 813 HOH HOH A . 
G 6 HOH 75  814 814 HOH HOH A . 
G 6 HOH 76  815 815 HOH HOH A . 
G 6 HOH 77  816 816 HOH HOH A . 
G 6 HOH 78  817 817 HOH HOH A . 
G 6 HOH 79  818 818 HOH HOH A . 
G 6 HOH 80  819 819 HOH HOH A . 
G 6 HOH 81  820 820 HOH HOH A . 
G 6 HOH 82  821 821 HOH HOH A . 
G 6 HOH 83  822 822 HOH HOH A . 
G 6 HOH 84  823 823 HOH HOH A . 
G 6 HOH 85  824 824 HOH HOH A . 
G 6 HOH 86  825 825 HOH HOH A . 
G 6 HOH 87  826 826 HOH HOH A . 
G 6 HOH 88  827 827 HOH HOH A . 
G 6 HOH 89  828 828 HOH HOH A . 
G 6 HOH 90  829 829 HOH HOH A . 
G 6 HOH 91  830 830 HOH HOH A . 
G 6 HOH 92  831 831 HOH HOH A . 
G 6 HOH 93  832 832 HOH HOH A . 
G 6 HOH 94  833 833 HOH HOH A . 
G 6 HOH 95  834 834 HOH HOH A . 
G 6 HOH 96  835 835 HOH HOH A . 
G 6 HOH 97  836 836 HOH HOH A . 
G 6 HOH 98  837 837 HOH HOH A . 
G 6 HOH 99  838 838 HOH HOH A . 
G 6 HOH 100 839 839 HOH HOH A . 
G 6 HOH 101 840 840 HOH HOH A . 
G 6 HOH 102 841 841 HOH HOH A . 
G 6 HOH 103 842 842 HOH HOH A . 
G 6 HOH 104 843 843 HOH HOH A . 
G 6 HOH 105 844 844 HOH HOH A . 
G 6 HOH 106 845 845 HOH HOH A . 
G 6 HOH 107 846 846 HOH HOH A . 
G 6 HOH 108 847 847 HOH HOH A . 
G 6 HOH 109 848 848 HOH HOH A . 
G 6 HOH 110 849 849 HOH HOH A . 
G 6 HOH 111 850 850 HOH HOH A . 
G 6 HOH 112 851 851 HOH HOH A . 
G 6 HOH 113 852 852 HOH HOH A . 
G 6 HOH 114 853 853 HOH HOH A . 
G 6 HOH 115 854 854 HOH HOH A . 
G 6 HOH 116 855 855 HOH HOH A . 
G 6 HOH 117 856 856 HOH HOH A . 
G 6 HOH 118 857 857 HOH HOH A . 
G 6 HOH 119 858 858 HOH HOH A . 
G 6 HOH 120 859 859 HOH HOH A . 
G 6 HOH 121 860 860 HOH HOH A . 
G 6 HOH 122 861 861 HOH HOH A . 
G 6 HOH 123 862 862 HOH HOH A . 
G 6 HOH 124 863 863 HOH HOH A . 
G 6 HOH 125 864 864 HOH HOH A . 
G 6 HOH 126 865 865 HOH HOH A . 
G 6 HOH 127 866 866 HOH HOH A . 
G 6 HOH 128 867 867 HOH HOH A . 
G 6 HOH 129 868 868 HOH HOH A . 
G 6 HOH 130 869 869 HOH HOH A . 
G 6 HOH 131 870 870 HOH HOH A . 
G 6 HOH 132 871 871 HOH HOH A . 
G 6 HOH 133 872 872 HOH HOH A . 
G 6 HOH 134 873 873 HOH HOH A . 
G 6 HOH 135 874 874 HOH HOH A . 
G 6 HOH 136 875 875 HOH HOH A . 
G 6 HOH 137 876 876 HOH HOH A . 
G 6 HOH 138 877 877 HOH HOH A . 
G 6 HOH 139 878 878 HOH HOH A . 
G 6 HOH 140 879 879 HOH HOH A . 
G 6 HOH 141 880 880 HOH HOH A . 
G 6 HOH 142 881 881 HOH HOH A . 
G 6 HOH 143 882 882 HOH HOH A . 
G 6 HOH 144 883 883 HOH HOH A . 
H 6 HOH 1   17  17  HOH HOH T . 
H 6 HOH 2   18  18  HOH HOH T . 
H 6 HOH 3   19  19  HOH HOH T . 
H 6 HOH 4   20  20  HOH HOH T . 
H 6 HOH 5   21  21  HOH HOH T . 
H 6 HOH 6   22  22  HOH HOH T . 
H 6 HOH 7   23  23  HOH HOH T . 
H 6 HOH 8   24  24  HOH HOH T . 
I 6 HOH 1   31  31  HOH HOH P . 
I 6 HOH 2   83  83  HOH HOH P . 
I 6 HOH 3   98  98  HOH HOH P . 
I 6 HOH 4   133 133 HOH HOH P . 
I 6 HOH 5   144 144 HOH HOH P . 
I 6 HOH 6   155 155 HOH HOH P . 
#