data_3BN3
# 
_entry.id   3BN3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3BN3         pdb_00003bn3 10.2210/pdb3bn3/pdb 
RCSB  RCSB045720   ?            ?                   
WWPDB D_1000045720 ?            ?                   
# 
_pdbx_database_status.entry_id                        3BN3 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-12-13 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, H.'      1 
'Springer, T.A.' 2 
'Wang, J.-h.'    3 
# 
_citation.id                        primary 
_citation.title                     
'An unusual allosteric mobility of the C-terminal helix of a high-affinity alpha L integrin I domain variant bound to ICAM-5' 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            31 
_citation.page_first                432 
_citation.page_last                 437 
_citation.year                      2008 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18691975 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2008.06.022 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Zhang, H.'        1 ? 
primary 'Casasnovas, J.M.' 2 ? 
primary 'Jin, M.'          3 ? 
primary 'Liu, J.H.'        4 ? 
primary 'Gahmberg, C.G.'   5 ? 
primary 'Springer, T.A.'   6 ? 
primary 'Wang, J.-h.'      7 ? 
# 
_cell.length_a           61.793 
_cell.length_b           71.507 
_cell.length_c           143.871 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3BN3 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         3BN3 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Integrin alpha-L'                                                                        20532.496 1   ? 
'F265S, F292G' 'I domain'                ? 
2 polymer     man 'Intercellular adhesion molecule 5'                                                       22115.334 1   ? ? 
'N-terminal, two domains' ? 
3 branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   1   ? ? ? ? 
4 non-polymer syn 'MAGNESIUM ION'                                                                           24.305    1   ? ? ? ? 
5 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                  221.208   4   ? ? ? ? 
6 non-polymer syn GLYCEROL                                                                                  92.094    2   ? ? ? ? 
7 water       nat water                                                                                     18.015    226 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Leukocyte adhesion glycoprotein LFA-1 alpha chain; LFA-1A; Leukocyte function-associated molecule 1 alpha chain; CD11a antigen' 
2 'ICAM-5; Telencephalin'                                                                                                          
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MNVDLVFLFDGSMSLQPDEFQKILDFMKDVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKWKDPDALLKHVKHMLLLTN
TFGAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHSQTKESQETLHKFASKPASEFVK
ILDTGEKLKDLFTELQKKIY
;
;MNVDLVFLFDGSMSLQPDEFQKILDFMKDVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKWKDPDALLKHVKHMLLLTN
TFGAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHSQTKESQETLHKFASKPASEFVK
ILDTGEKLKDLFTELQKKIY
;
A ? 
2 'polypeptide(L)' no no 
;EPFWADLQPRVAFVERGGSLWLNCSTNCPRPERGGLETSLRRNGTQRGLRWLARQLVDIREPETQPVCFFRCARRTLQAR
GLIRTFQRPDRVELMPLPPWQPVGENFTLSCRVPGAGPRASLTLTLLRGAQELIRRSFAGEPPRARGAVLTATVLARRED
HGANFSCRAELDLRPHGLGLFENSSAPRELRTFSLS
;
;EPFWADLQPRVAFVERGGSLWLNCSTNCPRPERGGLETSLRRNGTQRGLRWLARQLVDIREPETQPVCFFRCARRTLQAR
GLIRTFQRPDRVELMPLPPWQPVGENFTLSCRVPGAGPRASLTLTLLRGAQELIRRSFAGEPPRARGAVLTATVLARRED
HGANFSCRAELDLRPHGLGLFENSSAPRELRTFSLS
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASN n 
1 3   VAL n 
1 4   ASP n 
1 5   LEU n 
1 6   VAL n 
1 7   PHE n 
1 8   LEU n 
1 9   PHE n 
1 10  ASP n 
1 11  GLY n 
1 12  SER n 
1 13  MET n 
1 14  SER n 
1 15  LEU n 
1 16  GLN n 
1 17  PRO n 
1 18  ASP n 
1 19  GLU n 
1 20  PHE n 
1 21  GLN n 
1 22  LYS n 
1 23  ILE n 
1 24  LEU n 
1 25  ASP n 
1 26  PHE n 
1 27  MET n 
1 28  LYS n 
1 29  ASP n 
1 30  VAL n 
1 31  MET n 
1 32  LYS n 
1 33  LYS n 
1 34  LEU n 
1 35  SER n 
1 36  ASN n 
1 37  THR n 
1 38  SER n 
1 39  TYR n 
1 40  GLN n 
1 41  PHE n 
1 42  ALA n 
1 43  ALA n 
1 44  VAL n 
1 45  GLN n 
1 46  PHE n 
1 47  SER n 
1 48  THR n 
1 49  SER n 
1 50  TYR n 
1 51  LYS n 
1 52  THR n 
1 53  GLU n 
1 54  PHE n 
1 55  ASP n 
1 56  PHE n 
1 57  SER n 
1 58  ASP n 
1 59  TYR n 
1 60  VAL n 
1 61  LYS n 
1 62  TRP n 
1 63  LYS n 
1 64  ASP n 
1 65  PRO n 
1 66  ASP n 
1 67  ALA n 
1 68  LEU n 
1 69  LEU n 
1 70  LYS n 
1 71  HIS n 
1 72  VAL n 
1 73  LYS n 
1 74  HIS n 
1 75  MET n 
1 76  LEU n 
1 77  LEU n 
1 78  LEU n 
1 79  THR n 
1 80  ASN n 
1 81  THR n 
1 82  PHE n 
1 83  GLY n 
1 84  ALA n 
1 85  ILE n 
1 86  ASN n 
1 87  TYR n 
1 88  VAL n 
1 89  ALA n 
1 90  THR n 
1 91  GLU n 
1 92  VAL n 
1 93  PHE n 
1 94  ARG n 
1 95  GLU n 
1 96  GLU n 
1 97  LEU n 
1 98  GLY n 
1 99  ALA n 
1 100 ARG n 
1 101 PRO n 
1 102 ASP n 
1 103 ALA n 
1 104 THR n 
1 105 LYS n 
1 106 VAL n 
1 107 LEU n 
1 108 ILE n 
1 109 ILE n 
1 110 ILE n 
1 111 THR n 
1 112 ASP n 
1 113 GLY n 
1 114 GLU n 
1 115 ALA n 
1 116 THR n 
1 117 ASP n 
1 118 SER n 
1 119 GLY n 
1 120 ASN n 
1 121 ILE n 
1 122 ASP n 
1 123 ALA n 
1 124 ALA n 
1 125 LYS n 
1 126 ASP n 
1 127 ILE n 
1 128 ILE n 
1 129 ARG n 
1 130 TYR n 
1 131 ILE n 
1 132 ILE n 
1 133 GLY n 
1 134 ILE n 
1 135 GLY n 
1 136 LYS n 
1 137 HIS n 
1 138 SER n 
1 139 GLN n 
1 140 THR n 
1 141 LYS n 
1 142 GLU n 
1 143 SER n 
1 144 GLN n 
1 145 GLU n 
1 146 THR n 
1 147 LEU n 
1 148 HIS n 
1 149 LYS n 
1 150 PHE n 
1 151 ALA n 
1 152 SER n 
1 153 LYS n 
1 154 PRO n 
1 155 ALA n 
1 156 SER n 
1 157 GLU n 
1 158 PHE n 
1 159 VAL n 
1 160 LYS n 
1 161 ILE n 
1 162 LEU n 
1 163 ASP n 
1 164 THR n 
1 165 GLY n 
1 166 GLU n 
1 167 LYS n 
1 168 LEU n 
1 169 LYS n 
1 170 ASP n 
1 171 LEU n 
1 172 PHE n 
1 173 THR n 
1 174 GLU n 
1 175 LEU n 
1 176 GLN n 
1 177 LYS n 
1 178 LYS n 
1 179 ILE n 
1 180 TYR n 
2 1   GLU n 
2 2   PRO n 
2 3   PHE n 
2 4   TRP n 
2 5   ALA n 
2 6   ASP n 
2 7   LEU n 
2 8   GLN n 
2 9   PRO n 
2 10  ARG n 
2 11  VAL n 
2 12  ALA n 
2 13  PHE n 
2 14  VAL n 
2 15  GLU n 
2 16  ARG n 
2 17  GLY n 
2 18  GLY n 
2 19  SER n 
2 20  LEU n 
2 21  TRP n 
2 22  LEU n 
2 23  ASN n 
2 24  CYS n 
2 25  SER n 
2 26  THR n 
2 27  ASN n 
2 28  CYS n 
2 29  PRO n 
2 30  ARG n 
2 31  PRO n 
2 32  GLU n 
2 33  ARG n 
2 34  GLY n 
2 35  GLY n 
2 36  LEU n 
2 37  GLU n 
2 38  THR n 
2 39  SER n 
2 40  LEU n 
2 41  ARG n 
2 42  ARG n 
2 43  ASN n 
2 44  GLY n 
2 45  THR n 
2 46  GLN n 
2 47  ARG n 
2 48  GLY n 
2 49  LEU n 
2 50  ARG n 
2 51  TRP n 
2 52  LEU n 
2 53  ALA n 
2 54  ARG n 
2 55  GLN n 
2 56  LEU n 
2 57  VAL n 
2 58  ASP n 
2 59  ILE n 
2 60  ARG n 
2 61  GLU n 
2 62  PRO n 
2 63  GLU n 
2 64  THR n 
2 65  GLN n 
2 66  PRO n 
2 67  VAL n 
2 68  CYS n 
2 69  PHE n 
2 70  PHE n 
2 71  ARG n 
2 72  CYS n 
2 73  ALA n 
2 74  ARG n 
2 75  ARG n 
2 76  THR n 
2 77  LEU n 
2 78  GLN n 
2 79  ALA n 
2 80  ARG n 
2 81  GLY n 
2 82  LEU n 
2 83  ILE n 
2 84  ARG n 
2 85  THR n 
2 86  PHE n 
2 87  GLN n 
2 88  ARG n 
2 89  PRO n 
2 90  ASP n 
2 91  ARG n 
2 92  VAL n 
2 93  GLU n 
2 94  LEU n 
2 95  MET n 
2 96  PRO n 
2 97  LEU n 
2 98  PRO n 
2 99  PRO n 
2 100 TRP n 
2 101 GLN n 
2 102 PRO n 
2 103 VAL n 
2 104 GLY n 
2 105 GLU n 
2 106 ASN n 
2 107 PHE n 
2 108 THR n 
2 109 LEU n 
2 110 SER n 
2 111 CYS n 
2 112 ARG n 
2 113 VAL n 
2 114 PRO n 
2 115 GLY n 
2 116 ALA n 
2 117 GLY n 
2 118 PRO n 
2 119 ARG n 
2 120 ALA n 
2 121 SER n 
2 122 LEU n 
2 123 THR n 
2 124 LEU n 
2 125 THR n 
2 126 LEU n 
2 127 LEU n 
2 128 ARG n 
2 129 GLY n 
2 130 ALA n 
2 131 GLN n 
2 132 GLU n 
2 133 LEU n 
2 134 ILE n 
2 135 ARG n 
2 136 ARG n 
2 137 SER n 
2 138 PHE n 
2 139 ALA n 
2 140 GLY n 
2 141 GLU n 
2 142 PRO n 
2 143 PRO n 
2 144 ARG n 
2 145 ALA n 
2 146 ARG n 
2 147 GLY n 
2 148 ALA n 
2 149 VAL n 
2 150 LEU n 
2 151 THR n 
2 152 ALA n 
2 153 THR n 
2 154 VAL n 
2 155 LEU n 
2 156 ALA n 
2 157 ARG n 
2 158 ARG n 
2 159 GLU n 
2 160 ASP n 
2 161 HIS n 
2 162 GLY n 
2 163 ALA n 
2 164 ASN n 
2 165 PHE n 
2 166 SER n 
2 167 CYS n 
2 168 ARG n 
2 169 ALA n 
2 170 GLU n 
2 171 LEU n 
2 172 ASP n 
2 173 LEU n 
2 174 ARG n 
2 175 PRO n 
2 176 HIS n 
2 177 GLY n 
2 178 LEU n 
2 179 GLY n 
2 180 LEU n 
2 181 PHE n 
2 182 GLU n 
2 183 ASN n 
2 184 SER n 
2 185 SER n 
2 186 ALA n 
2 187 PRO n 
2 188 ARG n 
2 189 GLU n 
2 190 LEU n 
2 191 ARG n 
2 192 THR n 
2 193 PHE n 
2 194 SER n 
2 195 LEU n 
2 196 SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'ITGAL, CD11A'     ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ?                 'Escherichia coli'   
562   ? ? ? ? ?     ? 'BL21(DE3)'   ? ? ? ? ?                      ? ? plasmid ? ? ? pET22b  ? ? 
2 1 sample ? ? ? human ? 'ICAM5, TLCN, TLN' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'Chinese hamster' 'Cricetulus griseus' 
10029 ? ? ? ? ovary ? 'lec 3.2.8.1' ? ? ? ? 'Hampster Ovary cells' ? ? plasmid ? ? ? pBJ5-GS ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.entity_id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 1 UNP ITAL_HUMAN  P20701 154 
;NVDLVFLFDGSMSLQPDEFQKILDFMKDVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKRKDPDALLKHVKHMLLLTNT
FGAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLHKFASKPASEFVKI
LDTFEKLKDLFTELQKKIY
;
? 
2 2 UNP ICAM5_HUMAN Q9UMF0 32  
;EPFWADLQPRVAFVERGGSLWLNCSTNCPRPERGGLETSLRRNGTQRGLRWLARQLVDIREPETQPVCFFRCARRTLQAR
GLIRTFQRPDRVELMPLPPWQPVGENFTLSCRVPGAGPRASLTLTLLRGAQELIRRSFAGEPPRARGAVLTATVLARRED
HGANFSCRAELDLRPHGLGLFENSSAPRELRTFSLS
;
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3BN3 A 2 ? 180 ? P20701 154 ? 332 ? 129 307 
2 2 3BN3 B 1 ? 196 ? Q9UMF0 32  ? 227 ? 1   196 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3BN3 MET A 1   ? UNP P20701 ?   ?   'initiating methionine' 128 1 
1 3BN3 TRP A 62  ? UNP P20701 ARG 214 variant                 189 2 
1 3BN3 SER A 138 ? UNP P20701 PHE 290 'engineered mutation'   265 3 
1 3BN3 GLY A 165 ? UNP P20701 PHE 317 'engineered mutation'   292 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
GOL non-polymer                  . GLYCEROL                                 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       
92.094  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer                  . 'MAGNESIUM ION'                          ? 'Mg 2'           24.305  
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose 
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3BN3 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.73 
_exptl_crystal.density_percent_sol   66.99 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.temp            296 
_exptl_crystal_grow.pdbx_details    
'0.1M HEPES pH7.5, 7.5%PEG8000, 10%glycerol, 5mM magnesium chloride, VAPOR DIFFUSION, HANGING DROP, temperature 296K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97931 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_wavelength_list        0.97931 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
# 
_reflns.entry_id                     3BN3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.099 
_reflns.d_resolution_low             71.980 
_reflns.number_all                   ? 
_reflns.number_obs                   37303 
_reflns.percent_possible_obs         98.6 
_reflns.pdbx_Rmerge_I_obs            0.072 
_reflns.pdbx_Rsym_value              0.054 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        33.3 
_reflns.pdbx_redundancy              8.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.099 
_reflns_shell.d_res_low              2.18 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   95.5 
_reflns_shell.Rmerge_I_obs           0.454 
_reflns_shell.meanI_over_sigI_obs    3.76 
_reflns_shell.pdbx_Rsym_value        0.471 
_reflns_shell.pdbx_redundancy        5.6 
_reflns_shell.number_unique_all      3564 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3BN3 
_refine.ls_d_res_high                            2.099 
_refine.ls_d_res_low                             71.980 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    98.030 
_refine.ls_number_reflns_obs                     37303 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.193 
_refine.ls_R_factor_R_work                       0.191 
_refine.ls_R_factor_R_free                       0.235 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  1863 
_refine.B_iso_mean                               43.703 
_refine.aniso_B[1][1]                            -0.710 
_refine.aniso_B[2][2]                            4.050 
_refine.aniso_B[3][3]                            -3.340 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.964 
_refine.correlation_coeff_Fo_to_Fc_free          0.940 
_refine.pdbx_overall_ESU_R                       0.159 
_refine.pdbx_overall_ESU_R_Free                  0.155 
_refine.overall_SU_ML                            0.134 
_refine.overall_SU_B                             10.384 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     37303 
_refine.ls_R_factor_all                          0.193 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      'PDB IDS 1T0P AND 1IC1' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3000 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         97 
_refine_hist.number_atoms_solvent             226 
_refine_hist.number_atoms_total               3323 
_refine_hist.d_res_high                       2.099 
_refine_hist.d_res_low                        71.980 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         3167 0.009  0.022  ? 'X-RAY DIFFRACTION' ? 
r_bond_other_d           2258 0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      4283 1.320  2.002  ? 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        5420 0.816  3.002  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   374  5.929  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   145  30.189 22.690 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   540  13.285 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   33   13.636 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           480  0.075  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     3415 0.003  0.020  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       661  0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            497  0.201  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbd_other              2292 0.189  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          1492 0.175  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_other            1744 0.100  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    182  0.156  0.200  ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      2    0.068  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   9    0.105  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     51   0.220  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 9    0.218  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              2439 2.855  5.000  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_other           753  0.531  5.000  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             3027 3.484  10.000 ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              1471 2.709  5.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             1256 4.104  10.000 ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.099 
_refine_ls_shell.d_res_low                        2.154 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               95.080 
_refine_ls_shell.number_reflns_R_work             2492 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.261 
_refine_ls_shell.R_factor_R_free                  0.292 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             134 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                2626 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3BN3 
_struct.title                     'crystal structure of ICAM-5 in complex with aL I domain' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3BN3 
_struct_keywords.text            'ICAM-5, I domain, integrin, allosteric mobility, Cell adhesion, immune system' 
_struct_keywords.pdbx_keywords   'Cell adhesion, immune system' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 6 ? 
J N N 6 ? 
K N N 7 ? 
L N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLN A 16  ? LEU A 34  ? GLN A 143 LEU A 161 1 ? 19 
HELX_P HELX_P2  2  ASP A 55  ? LYS A 63  ? ASP A 182 LYS A 190 1 ? 9  
HELX_P HELX_P3  3  ASP A 64  ? LEU A 69  ? ASP A 191 LEU A 196 1 ? 6  
HELX_P HELX_P4  4  ASN A 80  ? VAL A 92  ? ASN A 207 VAL A 219 1 ? 13 
HELX_P HELX_P5  5  ARG A 94  ? GLY A 98  ? ARG A 221 GLY A 225 5 ? 5  
HELX_P HELX_P6  6  ILE A 121 ? LYS A 125 ? ILE A 248 LYS A 252 5 ? 5  
HELX_P HELX_P7  7  GLY A 135 ? GLN A 139 ? GLY A 262 GLN A 266 5 ? 5  
HELX_P HELX_P8  8  THR A 140 ? ALA A 151 ? THR A 267 ALA A 278 1 ? 12 
HELX_P HELX_P9  9  PRO A 154 ? PHE A 158 ? PRO A 281 PHE A 285 1 ? 5  
HELX_P HELX_P10 10 GLU A 166 ? TYR A 180 ? GLU A 293 TYR A 307 1 ? 15 
HELX_P HELX_P11 11 PRO B 118 ? ALA B 120 ? PRO B 118 ALA B 120 5 ? 3  
HELX_P HELX_P12 12 ARG B 157 ? HIS B 161 ? ARG B 157 HIS B 161 5 ? 5  
HELX_P HELX_P13 13 ARG B 174 ? GLY B 177 ? ARG B 174 GLY B 177 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? B CYS 24  SG  ? ? ? 1_555 B CYS 68  SG  ? ? B CYS 24  B CYS 68  1_555 ? ? ? ? ? ? ? 2.047 ? ?               
disulf2 disulf ?    ? B CYS 28  SG  ? ? ? 1_555 B CYS 72  SG  ? ? B CYS 28  B CYS 72  1_555 ? ? ? ? ? ? ? 2.077 ? ?               
disulf3 disulf ?    ? B CYS 111 SG  ? ? ? 1_555 B CYS 167 SG  ? ? B CYS 111 B CYS 167 1_555 ? ? ? ? ? ? ? 2.093 ? ?               
covale1 covale one  ? B ASN 23  ND2 ? ? ? 1_555 C NAG .   C1  ? ? B ASN 23  C NAG 1   1_555 ? ? ? ? ? ? ? 1.458 ? N-Glycosylation 
covale2 covale one  ? B ASN 43  ND2 ? ? ? 1_555 E NAG .   C1  ? ? B ASN 43  B NAG 199 1_555 ? ? ? ? ? ? ? 1.441 ? N-Glycosylation 
covale3 covale one  ? B ASN 106 ND2 ? ? ? 1_555 F NAG .   C1  ? ? B ASN 106 B NAG 200 1_555 ? ? ? ? ? ? ? 1.456 ? N-Glycosylation 
covale4 covale one  ? B ASN 164 ND2 ? ? ? 1_555 G NAG .   C1  ? ? B ASN 164 B NAG 201 1_555 ? ? ? ? ? ? ? 1.454 ? N-Glycosylation 
covale5 covale one  ? B ASN 183 ND2 ? ? ? 1_555 H NAG .   C1  ? ? B ASN 183 B NAG 202 1_555 ? ? ? ? ? ? ? 1.460 ? N-Glycosylation 
covale6 covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1  ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.441 ? ?               
metalc1 metalc ?    ? D MG  .   MG  ? ? ? 1_555 A SER 12  OG  ? ? A MG  1   A SER 139 1_555 ? ? ? ? ? ? ? 2.104 ? ?               
metalc2 metalc ?    ? D MG  .   MG  ? ? ? 1_555 A SER 14  OG  ? ? A MG  1   A SER 141 1_555 ? ? ? ? ? ? ? 2.051 ? ?               
metalc3 metalc ?    ? D MG  .   MG  ? ? ? 1_555 A THR 79  OG1 ? ? A MG  1   A THR 206 1_555 ? ? ? ? ? ? ? 2.205 ? ?               
metalc4 metalc ?    ? D MG  .   MG  ? ? ? 1_555 K HOH .   O   ? ? A MG  1   A HOH 308 1_555 ? ? ? ? ? ? ? 2.095 ? ?               
metalc5 metalc ?    ? D MG  .   MG  ? ? ? 1_555 K HOH .   O   ? ? A MG  1   A HOH 309 1_555 ? ? ? ? ? ? ? 1.962 ? ?               
metalc6 metalc ?    ? D MG  .   MG  ? ? ? 1_555 B GLU 37  OE2 ? ? A MG  1   B GLU 37  1_555 ? ? ? ? ? ? ? 1.897 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 153 A . ? LYS 280 A PRO 154 A ? PRO 281 A 1 3.92  
2 GLN 8   B . ? GLN 8   B PRO 9   B ? PRO 9   B 1 -5.70 
3 GLY 117 B . ? GLY 117 B PRO 118 B ? PRO 118 B 1 9.71  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 4 ? 
C ? 3 ? 
D ? 3 ? 
E ? 3 ? 
F ? 2 ? 
G ? 4 ? 
H ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? parallel      
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 50  ? PHE A 54  ? TYR A 177 PHE A 181 
A 2 TYR A 39  ? PHE A 46  ? TYR A 166 PHE A 173 
A 3 VAL A 3   ? ASP A 10  ? VAL A 130 ASP A 137 
A 4 THR A 104 ? THR A 111 ? THR A 231 THR A 238 
A 5 ILE A 128 ? GLY A 133 ? ILE A 255 GLY A 260 
A 6 VAL A 159 ? ILE A 161 ? VAL A 286 ILE A 288 
B 1 ALA B 5   ? GLN B 8   ? ALA B 5   GLN B 8   
B 2 GLY B 18  ? THR B 26  ? GLY B 18  THR B 26  
B 3 TRP B 51  ? ILE B 59  ? TRP B 51  ILE B 59  
B 4 ARG B 41  ? GLY B 48  ? ARG B 41  GLY B 48  
C 1 VAL B 11  ? GLU B 15  ? VAL B 11  GLU B 15  
C 2 LEU B 82  ? PHE B 86  ? LEU B 82  PHE B 86  
C 3 GLU B 63  ? THR B 64  ? GLU B 63  THR B 64  
D 1 ARG B 33  ? GLU B 37  ? ARG B 33  GLU B 37  
D 2 VAL B 67  ? CYS B 72  ? VAL B 67  CYS B 72  
D 3 ARG B 75  ? ARG B 80  ? ARG B 75  ARG B 80  
E 1 GLU B 93  ? LEU B 94  ? GLU B 93  LEU B 94  
E 2 ASN B 106 ? VAL B 113 ? ASN B 106 VAL B 113 
E 3 ALA B 148 ? LEU B 155 ? ALA B 148 LEU B 155 
F 1 GLN B 101 ? PRO B 102 ? GLN B 101 PRO B 102 
F 2 THR B 192 ? PHE B 193 ? THR B 192 PHE B 193 
G 1 GLN B 131 ? SER B 137 ? GLN B 131 SER B 137 
G 2 LEU B 122 ? ARG B 128 ? LEU B 122 ARG B 128 
G 3 ASN B 164 ? ASP B 172 ? ASN B 164 ASP B 172 
G 4 LEU B 180 ? SER B 184 ? LEU B 180 SER B 184 
H 1 GLN B 131 ? SER B 137 ? GLN B 131 SER B 137 
H 2 LEU B 122 ? ARG B 128 ? LEU B 122 ARG B 128 
H 3 ASN B 164 ? ASP B 172 ? ASN B 164 ASP B 172 
H 4 ARG B 188 ? GLU B 189 ? ARG B 188 GLU B 189 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LYS A 51  ? O LYS A 178 N GLN A 45  ? N GLN A 172 
A 2 3 O VAL A 44  ? O VAL A 171 N PHE A 7   ? N PHE A 134 
A 3 4 N LEU A 8   ? N LEU A 135 O ILE A 108 ? O ILE A 235 
A 4 5 N ILE A 109 ? N ILE A 236 O ILE A 132 ? O ILE A 259 
A 5 6 N GLY A 133 ? N GLY A 260 O LYS A 160 ? O LYS A 287 
B 1 2 N ASP B 6   ? N ASP B 6   O SER B 25  ? O SER B 25  
B 2 3 N CYS B 24  ? N CYS B 24  O LEU B 52  ? O LEU B 52  
B 3 4 O ALA B 53  ? O ALA B 53  N GLN B 46  ? N GLN B 46  
C 1 2 N VAL B 14  ? N VAL B 14  O ARG B 84  ? O ARG B 84  
C 2 3 O ILE B 83  ? O ILE B 83  N THR B 64  ? N THR B 64  
D 1 2 N GLU B 37  ? N GLU B 37  O VAL B 67  ? O VAL B 67  
D 2 3 N CYS B 72  ? N CYS B 72  O ARG B 75  ? O ARG B 75  
E 1 2 N GLU B 93  ? N GLU B 93  O ARG B 112 ? O ARG B 112 
E 2 3 N LEU B 109 ? N LEU B 109 O ALA B 152 ? O ALA B 152 
F 1 2 N GLN B 101 ? N GLN B 101 O PHE B 193 ? O PHE B 193 
G 1 2 O LEU B 133 ? O LEU B 133 N LEU B 126 ? N LEU B 126 
G 2 3 N LEU B 127 ? N LEU B 127 O SER B 166 ? O SER B 166 
G 3 4 N LEU B 171 ? N LEU B 171 O PHE B 181 ? O PHE B 181 
H 1 2 O LEU B 133 ? O LEU B 133 N LEU B 126 ? N LEU B 126 
H 2 3 N LEU B 127 ? N LEU B 127 O SER B 166 ? O SER B 166 
H 3 4 N PHE B 165 ? N PHE B 165 O ARG B 188 ? O ARG B 188 
# 
_atom_sites.entry_id                    3BN3 
_atom_sites.fract_transf_matrix[1][1]   0.016183 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013985 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006951 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 1   ? -3.899  14.269  36.174 1.00 58.12  ? 128 MET A N   1 
ATOM   2    C  CA  . MET A 1 1   ? -4.659  13.746  35.006 1.00 56.28  ? 128 MET A CA  1 
ATOM   3    C  C   . MET A 1 1   ? -5.881  12.990  35.506 1.00 53.96  ? 128 MET A C   1 
ATOM   4    O  O   . MET A 1 1   ? -5.755  12.051  36.288 1.00 53.05  ? 128 MET A O   1 
ATOM   5    C  CB  . MET A 1 1   ? -3.777  12.809  34.179 1.00 56.61  ? 128 MET A CB  1 
ATOM   6    C  CG  . MET A 1 1   ? -4.430  12.271  32.917 1.00 59.02  ? 128 MET A CG  1 
ATOM   7    S  SD  . MET A 1 1   ? -3.176  11.540  31.798 1.00 59.80  ? 128 MET A SD  1 
ATOM   8    C  CE  . MET A 1 1   ? -3.039  12.982  30.570 1.00 61.25  ? 128 MET A CE  1 
ATOM   9    N  N   . ASN A 1 2   ? -7.059  13.403  35.059 1.00 52.40  ? 129 ASN A N   1 
ATOM   10   C  CA  . ASN A 1 2   ? -8.282  12.665  35.371 1.00 54.13  ? 129 ASN A CA  1 
ATOM   11   C  C   . ASN A 1 2   ? -8.330  11.334  34.612 1.00 53.07  ? 129 ASN A C   1 
ATOM   12   O  O   . ASN A 1 2   ? -7.959  11.259  33.433 1.00 51.54  ? 129 ASN A O   1 
ATOM   13   C  CB  . ASN A 1 2   ? -9.530  13.497  35.055 1.00 52.64  ? 129 ASN A CB  1 
ATOM   14   C  CG  . ASN A 1 2   ? -9.751  14.626  36.042 1.00 50.63  ? 129 ASN A CG  1 
ATOM   15   O  OD1 . ASN A 1 2   ? -9.272  14.579  37.192 1.00 50.85  ? 129 ASN A OD1 1 
ATOM   16   N  ND2 . ASN A 1 2   ? -10.499 15.637  35.606 1.00 50.42  ? 129 ASN A ND2 1 
ATOM   17   N  N   . VAL A 1 3   ? -8.780  10.289  35.306 1.00 54.20  ? 130 VAL A N   1 
ATOM   18   C  CA  . VAL A 1 3   ? -8.885  8.958   34.721 1.00 53.11  ? 130 VAL A CA  1 
ATOM   19   C  C   . VAL A 1 3   ? -10.209 8.335   35.050 1.00 56.39  ? 130 VAL A C   1 
ATOM   20   O  O   . VAL A 1 3   ? -10.511 8.110   36.226 1.00 58.62  ? 130 VAL A O   1 
ATOM   21   C  CB  . VAL A 1 3   ? -7.842  7.981   35.263 1.00 53.23  ? 130 VAL A CB  1 
ATOM   22   C  CG1 . VAL A 1 3   ? -8.140  6.484   34.799 1.00 48.55  ? 130 VAL A CG1 1 
ATOM   23   C  CG2 . VAL A 1 3   ? -6.427  8.381   34.844 1.00 44.60  ? 130 VAL A CG2 1 
ATOM   24   N  N   . ASP A 1 4   ? -10.996 8.050   34.017 1.00 54.96  ? 131 ASP A N   1 
ATOM   25   C  CA  . ASP A 1 4   ? -12.201 7.258   34.167 1.00 55.77  ? 131 ASP A CA  1 
ATOM   26   C  C   . ASP A 1 4   ? -11.837 5.793   33.975 1.00 55.29  ? 131 ASP A C   1 
ATOM   27   O  O   . ASP A 1 4   ? -11.337 5.408   32.920 1.00 53.91  ? 131 ASP A O   1 
ATOM   28   C  CB  . ASP A 1 4   ? -13.247 7.672   33.130 1.00 58.18  ? 131 ASP A CB  1 
ATOM   29   C  CG  . ASP A 1 4   ? -13.883 9.014   33.434 1.00 58.95  ? 131 ASP A CG  1 
ATOM   30   O  OD1 . ASP A 1 4   ? -13.714 9.536   34.559 1.00 62.26  ? 131 ASP A OD1 1 
ATOM   31   O  OD2 . ASP A 1 4   ? -14.572 9.546   32.536 1.00 58.00  ? 131 ASP A OD2 1 
ATOM   32   N  N   . LEU A 1 5   ? -12.103 4.974   34.992 1.00 56.65  ? 132 LEU A N   1 
ATOM   33   C  CA  . LEU A 1 5   ? -11.733 3.563   34.955 1.00 51.37  ? 132 LEU A CA  1 
ATOM   34   C  C   . LEU A 1 5   ? -12.954 2.669   35.108 1.00 53.57  ? 132 LEU A C   1 
ATOM   35   O  O   . LEU A 1 5   ? -13.764 2.855   36.020 1.00 51.80  ? 132 LEU A O   1 
ATOM   36   C  CB  . LEU A 1 5   ? -10.708 3.283   36.050 1.00 57.85  ? 132 LEU A CB  1 
ATOM   37   C  CG  . LEU A 1 5   ? -9.960  1.950   35.989 1.00 57.39  ? 132 LEU A CG  1 
ATOM   38   C  CD1 . LEU A 1 5   ? -8.628  2.097   36.694 1.00 51.39  ? 132 LEU A CD1 1 
ATOM   39   C  CD2 . LEU A 1 5   ? -10.802 0.827   36.599 1.00 51.97  ? 132 LEU A CD2 1 
ATOM   40   N  N   . VAL A 1 6   ? -13.097 1.705   34.198 1.00 48.48  ? 133 VAL A N   1 
ATOM   41   C  CA  . VAL A 1 6   ? -14.206 0.762   34.245 1.00 48.22  ? 133 VAL A CA  1 
ATOM   42   C  C   . VAL A 1 6   ? -13.669 -0.646  34.504 1.00 49.12  ? 133 VAL A C   1 
ATOM   43   O  O   . VAL A 1 6   ? -12.725 -1.088  33.834 1.00 47.77  ? 133 VAL A O   1 
ATOM   44   C  CB  . VAL A 1 6   ? -15.003 0.797   32.936 1.00 50.71  ? 133 VAL A CB  1 
ATOM   45   C  CG1 . VAL A 1 6   ? -16.106 -0.275  32.924 1.00 46.65  ? 133 VAL A CG1 1 
ATOM   46   C  CG2 . VAL A 1 6   ? -15.587 2.200   32.732 1.00 48.64  ? 133 VAL A CG2 1 
ATOM   47   N  N   . PHE A 1 7   ? -14.236 -1.317  35.507 1.00 50.74  ? 134 PHE A N   1 
ATOM   48   C  CA  . PHE A 1 7   ? -14.003 -2.747  35.727 1.00 49.21  ? 134 PHE A CA  1 
ATOM   49   C  C   . PHE A 1 7   ? -15.021 -3.517  34.905 1.00 49.02  ? 134 PHE A C   1 
ATOM   50   O  O   . PHE A 1 7   ? -16.220 -3.337  35.081 1.00 49.43  ? 134 PHE A O   1 
ATOM   51   C  CB  . PHE A 1 7   ? -14.204 -3.139  37.193 1.00 50.20  ? 134 PHE A CB  1 
ATOM   52   C  CG  . PHE A 1 7   ? -13.259 -2.469  38.151 1.00 49.49  ? 134 PHE A CG  1 
ATOM   53   C  CD1 . PHE A 1 7   ? -11.982 -2.951  38.332 1.00 48.36  ? 134 PHE A CD1 1 
ATOM   54   C  CD2 . PHE A 1 7   ? -13.669 -1.381  38.905 1.00 51.72  ? 134 PHE A CD2 1 
ATOM   55   C  CE1 . PHE A 1 7   ? -11.111 -2.343  39.230 1.00 51.68  ? 134 PHE A CE1 1 
ATOM   56   C  CE2 . PHE A 1 7   ? -12.799 -0.773  39.806 1.00 50.57  ? 134 PHE A CE2 1 
ATOM   57   C  CZ  . PHE A 1 7   ? -11.528 -1.254  39.963 1.00 50.59  ? 134 PHE A CZ  1 
ATOM   58   N  N   . LEU A 1 8   ? -14.555 -4.379  34.013 1.00 48.40  ? 135 LEU A N   1 
ATOM   59   C  CA  . LEU A 1 8   ? -15.441 -5.211  33.242 1.00 45.37  ? 135 LEU A CA  1 
ATOM   60   C  C   . LEU A 1 8   ? -15.224 -6.629  33.748 1.00 48.78  ? 135 LEU A C   1 
ATOM   61   O  O   . LEU A 1 8   ? -14.199 -7.232  33.442 1.00 45.40  ? 135 LEU A O   1 
ATOM   62   C  CB  . LEU A 1 8   ? -15.126 -5.092  31.749 1.00 43.24  ? 135 LEU A CB  1 
ATOM   63   C  CG  . LEU A 1 8   ? -16.064 -5.938  30.866 1.00 43.42  ? 135 LEU A CG  1 
ATOM   64   C  CD1 . LEU A 1 8   ? -17.538 -5.555  31.120 1.00 38.27  ? 135 LEU A CD1 1 
ATOM   65   C  CD2 . LEU A 1 8   ? -15.717 -5.815  29.385 1.00 40.96  ? 135 LEU A CD2 1 
ATOM   66   N  N   . PHE A 1 9   ? -16.155 -7.147  34.552 1.00 49.05  ? 136 PHE A N   1 
ATOM   67   C  CA  . PHE A 1 9   ? -15.908 -8.419  35.241 1.00 47.61  ? 136 PHE A CA  1 
ATOM   68   C  C   . PHE A 1 9   ? -16.816 -9.570  34.809 1.00 49.73  ? 136 PHE A C   1 
ATOM   69   O  O   . PHE A 1 9   ? -18.011 -9.410  34.629 1.00 51.85  ? 136 PHE A O   1 
ATOM   70   C  CB  . PHE A 1 9   ? -15.860 -8.269  36.784 1.00 46.58  ? 136 PHE A CB  1 
ATOM   71   C  CG  . PHE A 1 9   ? -17.159 -7.876  37.437 1.00 49.16  ? 136 PHE A CG  1 
ATOM   72   C  CD1 . PHE A 1 9   ? -17.583 -6.562  37.438 1.00 46.11  ? 136 PHE A CD1 1 
ATOM   73   C  CD2 . PHE A 1 9   ? -17.934 -8.811  38.111 1.00 45.58  ? 136 PHE A CD2 1 
ATOM   74   C  CE1 . PHE A 1 9   ? -18.775 -6.204  38.040 1.00 45.82  ? 136 PHE A CE1 1 
ATOM   75   C  CE2 . PHE A 1 9   ? -19.111 -8.440  38.730 1.00 46.85  ? 136 PHE A CE2 1 
ATOM   76   C  CZ  . PHE A 1 9   ? -19.526 -7.125  38.700 1.00 44.43  ? 136 PHE A CZ  1 
ATOM   77   N  N   . ASP A 1 10  ? -16.186 -10.737 34.684 1.00 46.18  ? 137 ASP A N   1 
ATOM   78   C  CA  . ASP A 1 10  ? -16.776 -11.956 34.147 1.00 47.07  ? 137 ASP A CA  1 
ATOM   79   C  C   . ASP A 1 10  ? -17.671 -12.611 35.196 1.00 48.04  ? 137 ASP A C   1 
ATOM   80   O  O   . ASP A 1 10  ? -17.192 -13.011 36.255 1.00 53.77  ? 137 ASP A O   1 
ATOM   81   C  CB  . ASP A 1 10  ? -15.621 -12.892 33.770 1.00 46.38  ? 137 ASP A CB  1 
ATOM   82   C  CG  . ASP A 1 10  ? -16.057 -14.119 33.037 1.00 47.62  ? 137 ASP A CG  1 
ATOM   83   O  OD1 . ASP A 1 10  ? -17.218 -14.535 33.186 1.00 47.22  ? 137 ASP A OD1 1 
ATOM   84   O  OD2 . ASP A 1 10  ? -15.205 -14.683 32.313 1.00 48.63  ? 137 ASP A OD2 1 
ATOM   85   N  N   . GLY A 1 11  ? -18.965 -12.699 34.897 1.00 42.97  ? 138 GLY A N   1 
ATOM   86   C  CA  . GLY A 1 11  ? -19.940 -13.309 35.790 1.00 47.25  ? 138 GLY A CA  1 
ATOM   87   C  C   . GLY A 1 11  ? -20.470 -14.590 35.203 1.00 47.60  ? 138 GLY A C   1 
ATOM   88   O  O   . GLY A 1 11  ? -21.588 -15.001 35.507 1.00 52.05  ? 138 GLY A O   1 
ATOM   89   N  N   . SER A 1 12  ? -19.655 -15.242 34.372 1.00 48.75  ? 139 SER A N   1 
ATOM   90   C  CA  . SER A 1 12  ? -20.125 -16.401 33.624 1.00 46.57  ? 139 SER A CA  1 
ATOM   91   C  C   . SER A 1 12  ? -20.052 -17.652 34.502 1.00 48.85  ? 139 SER A C   1 
ATOM   92   O  O   . SER A 1 12  ? -19.395 -17.648 35.529 1.00 48.08  ? 139 SER A O   1 
ATOM   93   C  CB  . SER A 1 12  ? -19.321 -16.568 32.335 1.00 46.94  ? 139 SER A CB  1 
ATOM   94   O  OG  . SER A 1 12  ? -17.985 -16.989 32.573 1.00 43.82  ? 139 SER A OG  1 
ATOM   95   N  N   . MET A 1 13  ? -20.741 -18.704 34.070 1.00 44.55  ? 140 MET A N   1 
ATOM   96   C  CA  . MET A 1 13  ? -20.855 -19.965 34.794 1.00 49.21  ? 140 MET A CA  1 
ATOM   97   C  C   . MET A 1 13  ? -19.509 -20.693 34.907 1.00 48.12  ? 140 MET A C   1 
ATOM   98   O  O   . MET A 1 13  ? -19.343 -21.536 35.785 1.00 52.04  ? 140 MET A O   1 
ATOM   99   C  CB  . MET A 1 13  ? -21.906 -20.838 34.084 1.00 47.22  ? 140 MET A CB  1 
ATOM   100  C  CG  . MET A 1 13  ? -22.072 -22.299 34.534 1.00 48.41  ? 140 MET A CG  1 
ATOM   101  S  SD  . MET A 1 13  ? -22.724 -22.539 36.189 1.00 51.26  ? 140 MET A SD  1 
ATOM   102  C  CE  . MET A 1 13  ? -24.403 -21.939 35.965 1.00 53.82  ? 140 MET A CE  1 
ATOM   103  N  N   . SER A 1 14  ? -18.551 -20.358 34.037 1.00 49.43  ? 141 SER A N   1 
ATOM   104  C  CA  . SER A 1 14  ? -17.207 -20.976 34.076 1.00 49.86  ? 141 SER A CA  1 
ATOM   105  C  C   . SER A 1 14  ? -16.367 -20.553 35.277 1.00 47.89  ? 141 SER A C   1 
ATOM   106  O  O   . SER A 1 14  ? -15.361 -21.188 35.584 1.00 51.96  ? 141 SER A O   1 
ATOM   107  C  CB  . SER A 1 14  ? -16.416 -20.675 32.794 1.00 47.43  ? 141 SER A CB  1 
ATOM   108  O  OG  . SER A 1 14  ? -16.248 -19.279 32.614 1.00 45.95  ? 141 SER A OG  1 
ATOM   109  N  N   . LEU A 1 15  ? -16.758 -19.476 35.942 1.00 48.35  ? 142 LEU A N   1 
ATOM   110  C  CA  . LEU A 1 15  ? -16.083 -19.053 37.169 1.00 52.44  ? 142 LEU A CA  1 
ATOM   111  C  C   . LEU A 1 15  ? -16.808 -19.609 38.389 1.00 48.92  ? 142 LEU A C   1 
ATOM   112  O  O   . LEU A 1 15  ? -18.026 -19.510 38.494 1.00 48.55  ? 142 LEU A O   1 
ATOM   113  C  CB  . LEU A 1 15  ? -16.013 -17.522 37.250 1.00 57.50  ? 142 LEU A CB  1 
ATOM   114  C  CG  . LEU A 1 15  ? -14.915 -16.860 36.409 1.00 60.43  ? 142 LEU A CG  1 
ATOM   115  C  CD1 . LEU A 1 15  ? -15.069 -15.361 36.504 1.00 66.09  ? 142 LEU A CD1 1 
ATOM   116  C  CD2 . LEU A 1 15  ? -13.526 -17.284 36.878 1.00 60.46  ? 142 LEU A CD2 1 
ATOM   117  N  N   . GLN A 1 16  ? -16.054 -20.200 39.307 1.00 52.51  ? 143 GLN A N   1 
ATOM   118  C  CA  . GLN A 1 16  ? -16.616 -20.705 40.553 1.00 52.66  ? 143 GLN A CA  1 
ATOM   119  C  C   . GLN A 1 16  ? -17.103 -19.532 41.407 1.00 51.86  ? 143 GLN A C   1 
ATOM   120  O  O   . GLN A 1 16  ? -16.583 -18.422 41.279 1.00 53.10  ? 143 GLN A O   1 
ATOM   121  C  CB  . GLN A 1 16  ? -15.563 -21.493 41.336 1.00 53.45  ? 143 GLN A CB  1 
ATOM   122  C  CG  . GLN A 1 16  ? -15.102 -22.783 40.672 1.00 54.19  ? 143 GLN A CG  1 
ATOM   123  C  CD  . GLN A 1 16  ? -13.841 -23.366 41.296 1.00 56.11  ? 143 GLN A CD  1 
ATOM   124  O  OE1 . GLN A 1 16  ? -13.383 -24.430 40.890 1.00 60.29  ? 143 GLN A OE1 1 
ATOM   125  N  NE2 . GLN A 1 16  ? -13.275 -22.671 42.282 1.00 54.44  ? 143 GLN A NE2 1 
ATOM   126  N  N   . PRO A 1 17  ? -18.110 -19.775 42.274 1.00 52.82  ? 144 PRO A N   1 
ATOM   127  C  CA  . PRO A 1 17  ? -18.572 -18.792 43.251 1.00 51.78  ? 144 PRO A CA  1 
ATOM   128  C  C   . PRO A 1 17  ? -17.463 -18.179 44.115 1.00 50.40  ? 144 PRO A C   1 
ATOM   129  O  O   . PRO A 1 17  ? -17.508 -16.979 44.399 1.00 51.02  ? 144 PRO A O   1 
ATOM   130  C  CB  . PRO A 1 17  ? -19.540 -19.598 44.122 1.00 52.89  ? 144 PRO A CB  1 
ATOM   131  C  CG  . PRO A 1 17  ? -20.069 -20.619 43.220 1.00 52.70  ? 144 PRO A CG  1 
ATOM   132  C  CD  . PRO A 1 17  ? -18.910 -21.013 42.352 1.00 53.17  ? 144 PRO A CD  1 
ATOM   133  N  N   . ASP A 1 18  ? -16.489 -18.984 44.536 1.00 50.67  ? 145 ASP A N   1 
ATOM   134  C  CA  . ASP A 1 18  ? -15.366 -18.450 45.307 1.00 50.81  ? 145 ASP A CA  1 
ATOM   135  C  C   . ASP A 1 18  ? -14.478 -17.542 44.454 1.00 48.53  ? 145 ASP A C   1 
ATOM   136  O  O   . ASP A 1 18  ? -13.944 -16.558 44.957 1.00 47.46  ? 145 ASP A O   1 
ATOM   137  C  CB  . ASP A 1 18  ? -14.554 -19.564 45.995 1.00 53.48  ? 145 ASP A CB  1 
ATOM   138  C  CG  . ASP A 1 18  ? -13.680 -20.372 45.031 1.00 58.17  ? 145 ASP A CG  1 
ATOM   139  O  OD1 . ASP A 1 18  ? -14.171 -20.799 43.966 1.00 57.69  ? 145 ASP A OD1 1 
ATOM   140  O  OD2 . ASP A 1 18  ? -12.497 -20.618 45.373 1.00 60.72  ? 145 ASP A OD2 1 
ATOM   141  N  N   . GLU A 1 19  ? -14.352 -17.854 43.164 1.00 48.56  ? 146 GLU A N   1 
ATOM   142  C  CA  . GLU A 1 19  ? -13.563 -17.035 42.229 1.00 49.65  ? 146 GLU A CA  1 
ATOM   143  C  C   . GLU A 1 19  ? -14.236 -15.706 41.937 1.00 47.22  ? 146 GLU A C   1 
ATOM   144  O  O   . GLU A 1 19  ? -13.580 -14.676 41.892 1.00 48.61  ? 146 GLU A O   1 
ATOM   145  C  CB  . GLU A 1 19  ? -13.300 -17.791 40.923 1.00 49.25  ? 146 GLU A CB  1 
ATOM   146  C  CG  . GLU A 1 19  ? -12.418 -19.030 41.131 1.00 50.19  ? 146 GLU A CG  1 
ATOM   147  C  CD  . GLU A 1 19  ? -12.273 -19.894 39.893 1.00 51.84  ? 146 GLU A CD  1 
ATOM   148  O  OE1 . GLU A 1 19  ? -13.200 -19.924 39.048 1.00 49.98  ? 146 GLU A OE1 1 
ATOM   149  O  OE2 . GLU A 1 19  ? -11.217 -20.553 39.782 1.00 51.05  ? 146 GLU A OE2 1 
ATOM   150  N  N   . PHE A 1 20  ? -15.547 -15.731 41.747 1.00 49.39  ? 147 PHE A N   1 
ATOM   151  C  CA  . PHE A 1 20  ? -16.320 -14.505 41.551 1.00 49.72  ? 147 PHE A CA  1 
ATOM   152  C  C   . PHE A 1 20  ? -16.186 -13.579 42.762 1.00 48.12  ? 147 PHE A C   1 
ATOM   153  O  O   . PHE A 1 20  ? -16.014 -12.370 42.612 1.00 51.55  ? 147 PHE A O   1 
ATOM   154  C  CB  . PHE A 1 20  ? -17.779 -14.870 41.299 1.00 50.03  ? 147 PHE A CB  1 
ATOM   155  C  CG  . PHE A 1 20  ? -18.673 -13.707 40.986 1.00 50.10  ? 147 PHE A CG  1 
ATOM   156  C  CD1 . PHE A 1 20  ? -18.634 -13.093 39.743 1.00 52.22  ? 147 PHE A CD1 1 
ATOM   157  C  CD2 . PHE A 1 20  ? -19.610 -13.273 41.906 1.00 50.62  ? 147 PHE A CD2 1 
ATOM   158  C  CE1 . PHE A 1 20  ? -19.483 -12.048 39.447 1.00 49.00  ? 147 PHE A CE1 1 
ATOM   159  C  CE2 . PHE A 1 20  ? -20.465 -12.225 41.604 1.00 50.97  ? 147 PHE A CE2 1 
ATOM   160  C  CZ  . PHE A 1 20  ? -20.391 -11.614 40.376 1.00 50.10  ? 147 PHE A CZ  1 
ATOM   161  N  N   . GLN A 1 21  ? -16.256 -14.146 43.961 1.00 50.30  ? 148 GLN A N   1 
ATOM   162  C  CA  . GLN A 1 21  ? -16.033 -13.365 45.187 1.00 51.22  ? 148 GLN A CA  1 
ATOM   163  C  C   . GLN A 1 21  ? -14.634 -12.737 45.204 1.00 50.31  ? 148 GLN A C   1 
ATOM   164  O  O   . GLN A 1 21  ? -14.476 -11.577 45.593 1.00 49.03  ? 148 GLN A O   1 
ATOM   165  C  CB  . GLN A 1 21  ? -16.253 -14.232 46.433 1.00 52.73  ? 148 GLN A CB  1 
ATOM   166  C  CG  . GLN A 1 21  ? -16.178 -13.475 47.752 1.00 54.14  ? 148 GLN A CG  1 
ATOM   167  C  CD  . GLN A 1 21  ? -17.156 -12.321 47.814 1.00 57.00  ? 148 GLN A CD  1 
ATOM   168  O  OE1 . GLN A 1 21  ? -16.764 -11.165 48.006 1.00 59.74  ? 148 GLN A OE1 1 
ATOM   169  N  NE2 . GLN A 1 21  ? -18.436 -12.624 47.632 1.00 53.85  ? 148 GLN A NE2 1 
ATOM   170  N  N   . LYS A 1 22  ? -13.627 -13.499 44.778 1.00 49.52  ? 149 LYS A N   1 
ATOM   171  C  CA  . LYS A 1 22  ? -12.270 -12.964 44.631 1.00 52.32  ? 149 LYS A CA  1 
ATOM   172  C  C   . LYS A 1 22  ? -12.197 -11.845 43.583 1.00 50.94  ? 149 LYS A C   1 
ATOM   173  O  O   . LYS A 1 22  ? -11.401 -10.923 43.718 1.00 50.42  ? 149 LYS A O   1 
ATOM   174  C  CB  . LYS A 1 22  ? -11.273 -14.072 44.279 1.00 55.13  ? 149 LYS A CB  1 
ATOM   175  C  CG  . LYS A 1 22  ? -10.820 -14.907 45.477 1.00 58.05  ? 149 LYS A CG  1 
ATOM   176  C  CD  . LYS A 1 22  ? -9.795  -15.971 45.068 1.00 59.81  ? 149 LYS A CD  1 
ATOM   177  C  CE  . LYS A 1 22  ? -10.323 -17.409 45.195 1.00 62.12  ? 149 LYS A CE  1 
ATOM   178  N  NZ  . LYS A 1 22  ? -10.056 -17.997 46.552 1.00 59.58  ? 149 LYS A NZ  1 
ATOM   179  N  N   . ILE A 1 23  ? -13.010 -11.926 42.536 1.00 50.42  ? 150 ILE A N   1 
ATOM   180  C  CA  . ILE A 1 23  ? -13.043 -10.857 41.542 1.00 51.60  ? 150 ILE A CA  1 
ATOM   181  C  C   . ILE A 1 23  ? -13.609 -9.599  42.194 1.00 50.95  ? 150 ILE A C   1 
ATOM   182  O  O   . ILE A 1 23  ? -13.075 -8.513  42.015 1.00 53.37  ? 150 ILE A O   1 
ATOM   183  C  CB  . ILE A 1 23  ? -13.879 -11.226 40.308 1.00 52.04  ? 150 ILE A CB  1 
ATOM   184  C  CG1 . ILE A 1 23  ? -13.184 -12.307 39.481 1.00 51.03  ? 150 ILE A CG1 1 
ATOM   185  C  CG2 . ILE A 1 23  ? -14.100 -10.003 39.440 1.00 54.57  ? 150 ILE A CG2 1 
ATOM   186  C  CD1 . ILE A 1 23  ? -14.029 -12.779 38.278 1.00 50.72  ? 150 ILE A CD1 1 
ATOM   187  N  N   . LEU A 1 24  ? -14.679 -9.767  42.968 1.00 50.00  ? 151 LEU A N   1 
ATOM   188  C  CA  . LEU A 1 24  ? -15.299 -8.660  43.702 1.00 51.05  ? 151 LEU A CA  1 
ATOM   189  C  C   . LEU A 1 24  ? -14.337 -8.018  44.705 1.00 51.23  ? 151 LEU A C   1 
ATOM   190  O  O   . LEU A 1 24  ? -14.252 -6.793  44.798 1.00 52.80  ? 151 LEU A O   1 
ATOM   191  C  CB  . LEU A 1 24  ? -16.567 -9.139  44.421 1.00 50.49  ? 151 LEU A CB  1 
ATOM   192  C  CG  . LEU A 1 24  ? -17.785 -9.506  43.569 1.00 48.37  ? 151 LEU A CG  1 
ATOM   193  C  CD1 . LEU A 1 24  ? -18.904 -10.023 44.463 1.00 47.57  ? 151 LEU A CD1 1 
ATOM   194  C  CD2 . LEU A 1 24  ? -18.270 -8.313  42.778 1.00 49.50  ? 151 LEU A CD2 1 
ATOM   195  N  N   . ASP A 1 25  ? -13.612 -8.850  45.446 1.00 52.04  ? 152 ASP A N   1 
ATOM   196  C  CA  . ASP A 1 25  ? -12.605 -8.367  46.400 1.00 51.96  ? 152 ASP A CA  1 
ATOM   197  C  C   . ASP A 1 25  ? -11.442 -7.641  45.714 1.00 52.54  ? 152 ASP A C   1 
ATOM   198  O  O   . ASP A 1 25  ? -10.945 -6.645  46.229 1.00 54.70  ? 152 ASP A O   1 
ATOM   199  C  CB  . ASP A 1 25  ? -12.081 -9.530  47.247 1.00 53.45  ? 152 ASP A CB  1 
ATOM   200  C  CG  . ASP A 1 25  ? -13.138 -10.091 48.196 1.00 57.28  ? 152 ASP A CG  1 
ATOM   201  O  OD1 . ASP A 1 25  ? -14.202 -9.450  48.365 1.00 59.28  ? 152 ASP A OD1 1 
ATOM   202  O  OD2 . ASP A 1 25  ? -12.901 -11.172 48.782 1.00 59.72  ? 152 ASP A OD2 1 
ATOM   203  N  N   . PHE A 1 26  ? -11.016 -8.138  44.555 1.00 52.46  ? 153 PHE A N   1 
ATOM   204  C  CA  . PHE A 1 26  ? -9.981  -7.482  43.752 1.00 52.64  ? 153 PHE A CA  1 
ATOM   205  C  C   . PHE A 1 26  ? -10.394 -6.063  43.355 1.00 54.38  ? 153 PHE A C   1 
ATOM   206  O  O   . PHE A 1 26  ? -9.610  -5.123  43.478 1.00 54.62  ? 153 PHE A O   1 
ATOM   207  C  CB  . PHE A 1 26  ? -9.664  -8.310  42.497 1.00 54.47  ? 153 PHE A CB  1 
ATOM   208  C  CG  . PHE A 1 26  ? -8.786  -7.600  41.500 1.00 53.83  ? 153 PHE A CG  1 
ATOM   209  C  CD1 . PHE A 1 26  ? -7.410  -7.714  41.563 1.00 53.30  ? 153 PHE A CD1 1 
ATOM   210  C  CD2 . PHE A 1 26  ? -9.343  -6.832  40.484 1.00 55.21  ? 153 PHE A CD2 1 
ATOM   211  C  CE1 . PHE A 1 26  ? -6.602  -7.055  40.643 1.00 54.66  ? 153 PHE A CE1 1 
ATOM   212  C  CE2 . PHE A 1 26  ? -8.538  -6.168  39.566 1.00 53.88  ? 153 PHE A CE2 1 
ATOM   213  C  CZ  . PHE A 1 26  ? -7.178  -6.280  39.643 1.00 53.53  ? 153 PHE A CZ  1 
ATOM   214  N  N   . MET A 1 27  ? -11.625 -5.914  42.880 1.00 54.26  ? 154 MET A N   1 
ATOM   215  C  CA  . MET A 1 27  ? -12.154 -4.597  42.501 1.00 55.12  ? 154 MET A CA  1 
ATOM   216  C  C   . MET A 1 27  ? -12.183 -3.631  43.697 1.00 56.66  ? 154 MET A C   1 
ATOM   217  O  O   . MET A 1 27  ? -11.761 -2.471  43.588 1.00 55.50  ? 154 MET A O   1 
ATOM   218  C  CB  . MET A 1 27  ? -13.551 -4.748  41.897 1.00 55.31  ? 154 MET A CB  1 
ATOM   219  C  CG  . MET A 1 27  ? -13.569 -5.479  40.547 1.00 55.14  ? 154 MET A CG  1 
ATOM   220  S  SD  . MET A 1 27  ? -15.190 -5.453  39.747 1.00 57.52  ? 154 MET A SD  1 
ATOM   221  C  CE  . MET A 1 27  ? -16.166 -6.468  40.848 1.00 51.31  ? 154 MET A CE  1 
ATOM   222  N  N   . LYS A 1 28  ? -12.657 -4.127  44.839 1.00 57.62  ? 155 LYS A N   1 
ATOM   223  C  CA  . LYS A 1 28  ? -12.677 -3.350  46.089 1.00 56.86  ? 155 LYS A CA  1 
ATOM   224  C  C   . LYS A 1 28  ? -11.281 -2.891  46.521 1.00 55.19  ? 155 LYS A C   1 
ATOM   225  O  O   . LYS A 1 28  ? -11.095 -1.736  46.899 1.00 57.20  ? 155 LYS A O   1 
ATOM   226  C  CB  . LYS A 1 28  ? -13.327 -4.164  47.217 1.00 57.77  ? 155 LYS A CB  1 
ATOM   227  C  CG  . LYS A 1 28  ? -14.821 -4.427  47.021 1.00 60.40  ? 155 LYS A CG  1 
ATOM   228  C  CD  . LYS A 1 28  ? -15.388 -5.381  48.078 1.00 59.74  ? 155 LYS A CD  1 
ATOM   229  C  CE  . LYS A 1 28  ? -16.878 -5.610  47.862 1.00 60.47  ? 155 LYS A CE  1 
ATOM   230  N  NZ  . LYS A 1 28  ? -17.488 -6.507  48.878 1.00 61.40  ? 155 LYS A NZ  1 
ATOM   231  N  N   . ASP A 1 29  ? -10.311 -3.801  46.469 1.00 55.84  ? 156 ASP A N   1 
ATOM   232  C  CA  . ASP A 1 29  ? -8.920  -3.494  46.814 1.00 55.97  ? 156 ASP A CA  1 
ATOM   233  C  C   . ASP A 1 29  ? -8.284  -2.463  45.888 1.00 53.12  ? 156 ASP A C   1 
ATOM   234  O  O   . ASP A 1 29  ? -7.612  -1.558  46.347 1.00 52.81  ? 156 ASP A O   1 
ATOM   235  C  CB  . ASP A 1 29  ? -8.068  -4.767  46.802 1.00 61.43  ? 156 ASP A CB  1 
ATOM   236  C  CG  . ASP A 1 29  ? -8.417  -5.721  47.933 1.00 66.42  ? 156 ASP A CG  1 
ATOM   237  O  OD1 . ASP A 1 29  ? -9.252  -5.369  48.800 1.00 70.06  ? 156 ASP A OD1 1 
ATOM   238  O  OD2 . ASP A 1 29  ? -7.852  -6.835  47.949 1.00 68.96  ? 156 ASP A OD2 1 
ATOM   239  N  N   . VAL A 1 30  ? -8.485  -2.608  44.585 1.00 56.53  ? 157 VAL A N   1 
ATOM   240  C  CA  . VAL A 1 30  ? -7.971  -1.635  43.615 1.00 57.35  ? 157 VAL A CA  1 
ATOM   241  C  C   . VAL A 1 30  ? -8.559  -0.252  43.866 1.00 56.49  ? 157 VAL A C   1 
ATOM   242  O  O   . VAL A 1 30  ? -7.832  0.745   43.857 1.00 55.25  ? 157 VAL A O   1 
ATOM   243  C  CB  . VAL A 1 30  ? -8.258  -2.067  42.152 1.00 59.40  ? 157 VAL A CB  1 
ATOM   244  C  CG1 . VAL A 1 30  ? -8.007  -0.918  41.182 1.00 59.03  ? 157 VAL A CG1 1 
ATOM   245  C  CG2 . VAL A 1 30  ? -7.408  -3.268  41.787 1.00 56.33  ? 157 VAL A CG2 1 
ATOM   246  N  N   . MET A 1 31  ? -9.865  -0.198  44.114 1.00 56.17  ? 158 MET A N   1 
ATOM   247  C  CA  . MET A 1 31  ? -10.537 1.069   44.407 1.00 57.94  ? 158 MET A CA  1 
ATOM   248  C  C   . MET A 1 31  ? -10.006 1.744   45.682 1.00 59.73  ? 158 MET A C   1 
ATOM   249  O  O   . MET A 1 31  ? -9.806  2.959   45.703 1.00 60.18  ? 158 MET A O   1 
ATOM   250  C  CB  . MET A 1 31  ? -12.050 0.872   44.502 1.00 56.37  ? 158 MET A CB  1 
ATOM   251  C  CG  . MET A 1 31  ? -12.729 0.849   43.145 1.00 59.08  ? 158 MET A CG  1 
ATOM   252  S  SD  . MET A 1 31  ? -14.521 0.643   43.246 1.00 61.37  ? 158 MET A SD  1 
ATOM   253  C  CE  . MET A 1 31  ? -14.642 -1.130  43.424 1.00 66.23  ? 158 MET A CE  1 
ATOM   254  N  N   . LYS A 1 32  ? -9.775  0.959   46.732 1.00 59.90  ? 159 LYS A N   1 
ATOM   255  C  CA  . LYS A 1 32  ? -9.255  1.496   47.991 1.00 58.98  ? 159 LYS A CA  1 
ATOM   256  C  C   . LYS A 1 32  ? -7.853  2.079   47.810 1.00 58.23  ? 159 LYS A C   1 
ATOM   257  O  O   . LYS A 1 32  ? -7.528  3.120   48.383 1.00 56.90  ? 159 LYS A O   1 
ATOM   258  C  CB  . LYS A 1 32  ? -9.237  0.416   49.073 1.00 59.34  ? 159 LYS A CB  1 
ATOM   259  C  CG  . LYS A 1 32  ? -10.605 0.090   49.641 1.00 59.20  ? 159 LYS A CG  1 
ATOM   260  C  CD  . LYS A 1 32  ? -10.583 -1.229  50.399 1.00 61.16  ? 159 LYS A CD  1 
ATOM   261  C  CE  . LYS A 1 32  ? -11.981 -1.668  50.826 1.00 64.32  ? 159 LYS A CE  1 
ATOM   262  N  NZ  . LYS A 1 32  ? -12.147 -3.160  50.735 1.00 68.70  ? 159 LYS A NZ  1 
ATOM   263  N  N   . LYS A 1 33  ? -7.036  1.406   47.006 1.00 58.14  ? 160 LYS A N   1 
ATOM   264  C  CA  . LYS A 1 33  ? -5.677  1.862   46.719 1.00 59.95  ? 160 LYS A CA  1 
ATOM   265  C  C   . LYS A 1 33  ? -5.624  3.111   45.832 1.00 58.49  ? 160 LYS A C   1 
ATOM   266  O  O   . LYS A 1 33  ? -4.630  3.829   45.843 1.00 56.22  ? 160 LYS A O   1 
ATOM   267  C  CB  . LYS A 1 33  ? -4.872  0.738   46.067 1.00 61.53  ? 160 LYS A CB  1 
ATOM   268  C  CG  . LYS A 1 33  ? -4.622  -0.452  46.976 1.00 63.64  ? 160 LYS A CG  1 
ATOM   269  C  CD  . LYS A 1 33  ? -3.869  -1.557  46.245 1.00 64.01  ? 160 LYS A CD  1 
ATOM   270  C  CE  . LYS A 1 33  ? -3.605  -2.751  47.151 1.00 64.84  ? 160 LYS A CE  1 
ATOM   271  N  NZ  . LYS A 1 33  ? -2.651  -3.718  46.538 1.00 66.83  ? 160 LYS A NZ  1 
ATOM   272  N  N   . LEU A 1 34  ? -6.677  3.366   45.063 1.00 57.35  ? 161 LEU A N   1 
ATOM   273  C  CA  . LEU A 1 34  ? -6.723  4.531   44.179 1.00 59.57  ? 161 LEU A CA  1 
ATOM   274  C  C   . LEU A 1 34  ? -7.803  5.514   44.622 1.00 61.87  ? 161 LEU A C   1 
ATOM   275  O  O   . LEU A 1 34  ? -8.341  6.263   43.801 1.00 65.58  ? 161 LEU A O   1 
ATOM   276  C  CB  . LEU A 1 34  ? -6.967  4.088   42.728 1.00 59.15  ? 161 LEU A CB  1 
ATOM   277  C  CG  . LEU A 1 34  ? -5.823  3.355   42.021 1.00 59.35  ? 161 LEU A CG  1 
ATOM   278  C  CD1 . LEU A 1 34  ? -6.300  2.660   40.760 1.00 56.85  ? 161 LEU A CD1 1 
ATOM   279  C  CD2 . LEU A 1 34  ? -4.693  4.325   41.702 1.00 61.27  ? 161 LEU A CD2 1 
ATOM   280  N  N   . SER A 1 35  ? -8.102  5.542   45.921 1.00 61.92  ? 162 SER A N   1 
ATOM   281  C  CA  . SER A 1 35  ? -9.184  6.386   46.441 1.00 63.23  ? 162 SER A CA  1 
ATOM   282  C  C   . SER A 1 35  ? -8.766  7.857   46.581 1.00 66.62  ? 162 SER A C   1 
ATOM   283  O  O   . SER A 1 35  ? -8.876  8.448   47.659 1.00 65.86  ? 162 SER A O   1 
ATOM   284  C  CB  . SER A 1 35  ? -9.718  5.837   47.775 1.00 62.67  ? 162 SER A CB  1 
ATOM   285  O  OG  . SER A 1 35  ? -8.715  5.797   48.773 1.00 61.15  ? 162 SER A OG  1 
ATOM   286  N  N   . ASN A 1 36  ? -8.303  8.434   45.471 1.00 68.75  ? 163 ASN A N   1 
ATOM   287  C  CA  . ASN A 1 36  ? -7.964  9.854   45.383 1.00 67.71  ? 163 ASN A CA  1 
ATOM   288  C  C   . ASN A 1 36  ? -9.036  10.595  44.581 1.00 68.94  ? 163 ASN A C   1 
ATOM   289  O  O   . ASN A 1 36  ? -10.055 10.014  44.222 1.00 73.73  ? 163 ASN A O   1 
ATOM   290  C  CB  . ASN A 1 36  ? -6.598  10.023  44.723 1.00 69.50  ? 163 ASN A CB  1 
ATOM   291  C  CG  . ASN A 1 36  ? -6.630  9.724   43.246 1.00 70.89  ? 163 ASN A CG  1 
ATOM   292  O  OD1 . ASN A 1 36  ? -7.445  8.925   42.782 1.00 73.00  ? 163 ASN A OD1 1 
ATOM   293  N  ND2 . ASN A 1 36  ? -5.747  10.370  42.493 1.00 72.18  ? 163 ASN A ND2 1 
ATOM   294  N  N   . THR A 1 37  ? -8.814  11.874  44.298 1.00 68.78  ? 164 THR A N   1 
ATOM   295  C  CA  . THR A 1 37  ? -9.795  12.675  43.559 1.00 65.82  ? 164 THR A CA  1 
ATOM   296  C  C   . THR A 1 37  ? -9.788  12.365  42.057 1.00 63.81  ? 164 THR A C   1 
ATOM   297  O  O   . THR A 1 37  ? -10.831 12.435  41.395 1.00 65.19  ? 164 THR A O   1 
ATOM   298  C  CB  . THR A 1 37  ? -9.549  14.193  43.760 1.00 66.91  ? 164 THR A CB  1 
ATOM   299  O  OG1 . THR A 1 37  ? -9.415  14.479  45.159 1.00 68.05  ? 164 THR A OG1 1 
ATOM   300  C  CG2 . THR A 1 37  ? -10.701 15.014  43.181 1.00 67.65  ? 164 THR A CG2 1 
ATOM   301  N  N   . SER A 1 38  ? -8.619  11.999  41.535 1.00 58.56  ? 165 SER A N   1 
ATOM   302  C  CA  . SER A 1 38  ? -8.386  11.983  40.094 1.00 57.18  ? 165 SER A CA  1 
ATOM   303  C  C   . SER A 1 38  ? -9.055  10.809  39.394 1.00 56.59  ? 165 SER A C   1 
ATOM   304  O  O   . SER A 1 38  ? -9.521  10.948  38.266 1.00 56.74  ? 165 SER A O   1 
ATOM   305  C  CB  . SER A 1 38  ? -6.884  11.978  39.803 1.00 59.92  ? 165 SER A CB  1 
ATOM   306  O  OG  . SER A 1 38  ? -6.606  12.627  38.575 1.00 62.28  ? 165 SER A OG  1 
ATOM   307  N  N   . TYR A 1 39  ? -9.091  9.662   40.070 1.00 54.66  ? 166 TYR A N   1 
ATOM   308  C  CA  . TYR A 1 39  ? -9.725  8.447   39.556 1.00 50.81  ? 166 TYR A CA  1 
ATOM   309  C  C   . TYR A 1 39  ? -11.200 8.361   39.954 1.00 47.85  ? 166 TYR A C   1 
ATOM   310  O  O   . TYR A 1 39  ? -11.543 8.553   41.120 1.00 42.63  ? 166 TYR A O   1 
ATOM   311  C  CB  . TYR A 1 39  ? -9.029  7.214   40.123 1.00 57.39  ? 166 TYR A CB  1 
ATOM   312  C  CG  . TYR A 1 39  ? -7.667  6.910   39.551 1.00 58.96  ? 166 TYR A CG  1 
ATOM   313  C  CD1 . TYR A 1 39  ? -7.527  5.992   38.522 1.00 60.50  ? 166 TYR A CD1 1 
ATOM   314  C  CD2 . TYR A 1 39  ? -6.518  7.508   40.059 1.00 58.67  ? 166 TYR A CD2 1 
ATOM   315  C  CE1 . TYR A 1 39  ? -6.286  5.686   38.001 1.00 60.55  ? 166 TYR A CE1 1 
ATOM   316  C  CE2 . TYR A 1 39  ? -5.269  7.211   39.540 1.00 58.89  ? 166 TYR A CE2 1 
ATOM   317  C  CZ  . TYR A 1 39  ? -5.164  6.293   38.507 1.00 60.21  ? 166 TYR A CZ  1 
ATOM   318  O  OH  . TYR A 1 39  ? -3.940  5.968   37.968 1.00 62.19  ? 166 TYR A OH  1 
ATOM   319  N  N   . GLN A 1 40  ? -12.062 8.056   38.985 1.00 42.14  ? 167 GLN A N   1 
ATOM   320  C  CA  . GLN A 1 40  ? -13.452 7.720   39.266 1.00 38.29  ? 167 GLN A CA  1 
ATOM   321  C  C   . GLN A 1 40  ? -13.754 6.410   38.554 1.00 37.14  ? 167 GLN A C   1 
ATOM   322  O  O   . GLN A 1 40  ? -13.180 6.111   37.501 1.00 42.89  ? 167 GLN A O   1 
ATOM   323  C  CB  . GLN A 1 40  ? -14.403 8.845   38.847 1.00 30.88  ? 167 GLN A CB  1 
ATOM   324  C  CG  . GLN A 1 40  ? -14.081 10.189  39.595 1.00 34.44  ? 167 GLN A CG  1 
ATOM   325  C  CD  . GLN A 1 40  ? -15.010 11.335  39.230 1.00 36.01  ? 167 GLN A CD  1 
ATOM   326  O  OE1 . GLN A 1 40  ? -15.928 11.162  38.425 1.00 40.37  ? 167 GLN A OE1 1 
ATOM   327  N  NE2 . GLN A 1 40  ? -14.769 12.530  39.819 1.00 31.49  ? 167 GLN A NE2 1 
ATOM   328  N  N   . PHE A 1 41  ? -14.638 5.616   39.137 1.00 39.54  ? 168 PHE A N   1 
ATOM   329  C  CA  . PHE A 1 41  ? -14.803 4.232   38.688 1.00 34.77  ? 168 PHE A CA  1 
ATOM   330  C  C   . PHE A 1 41  ? -16.225 3.900   38.289 1.00 36.90  ? 168 PHE A C   1 
ATOM   331  O  O   . PHE A 1 41  ? -17.187 4.552   38.731 1.00 28.63  ? 168 PHE A O   1 
ATOM   332  C  CB  . PHE A 1 41  ? -14.370 3.279   39.800 1.00 42.31  ? 168 PHE A CB  1 
ATOM   333  C  CG  . PHE A 1 41  ? -12.936 3.441   40.224 1.00 42.06  ? 168 PHE A CG  1 
ATOM   334  C  CD1 . PHE A 1 41  ? -12.607 4.223   41.314 1.00 45.65  ? 168 PHE A CD1 1 
ATOM   335  C  CD2 . PHE A 1 41  ? -11.919 2.786   39.550 1.00 47.27  ? 168 PHE A CD2 1 
ATOM   336  C  CE1 . PHE A 1 41  ? -11.285 4.366   41.717 1.00 45.55  ? 168 PHE A CE1 1 
ATOM   337  C  CE2 . PHE A 1 41  ? -10.589 2.936   39.942 1.00 43.82  ? 168 PHE A CE2 1 
ATOM   338  C  CZ  . PHE A 1 41  ? -10.278 3.714   41.027 1.00 42.06  ? 168 PHE A CZ  1 
ATOM   339  N  N   . ALA A 1 42  ? -16.349 2.834   37.478 1.00 33.45  ? 169 ALA A N   1 
ATOM   340  C  CA  . ALA A 1 42  ? -17.604 2.239   37.146 1.00 32.70  ? 169 ALA A CA  1 
ATOM   341  C  C   . ALA A 1 42  ? -17.294 0.747   37.079 1.00 34.22  ? 169 ALA A C   1 
ATOM   342  O  O   . ALA A 1 42  ? -16.151 0.358   36.891 1.00 39.99  ? 169 ALA A O   1 
ATOM   343  C  CB  . ALA A 1 42  ? -18.129 2.703   35.795 1.00 32.95  ? 169 ALA A CB  1 
ATOM   344  N  N   . ALA A 1 43  ? -18.308 -0.064  37.249 1.00 36.75  ? 170 ALA A N   1 
ATOM   345  C  CA  . ALA A 1 43  ? -18.131 -1.535  37.156 1.00 33.01  ? 170 ALA A CA  1 
ATOM   346  C  C   . ALA A 1 43  ? -19.271 -2.076  36.377 1.00 40.22  ? 170 ALA A C   1 
ATOM   347  O  O   . ALA A 1 43  ? -20.401 -1.615  36.554 1.00 43.06  ? 170 ALA A O   1 
ATOM   348  C  CB  . ALA A 1 43  ? -18.095 -2.156  38.537 1.00 36.82  ? 170 ALA A CB  1 
ATOM   349  N  N   . VAL A 1 44  ? -18.967 -3.044  35.509 1.00 40.71  ? 171 VAL A N   1 
ATOM   350  C  CA  . VAL A 1 44  ? -19.926 -3.659  34.630 1.00 39.27  ? 171 VAL A CA  1 
ATOM   351  C  C   . VAL A 1 44  ? -19.723 -5.167  34.738 1.00 38.72  ? 171 VAL A C   1 
ATOM   352  O  O   . VAL A 1 44  ? -18.604 -5.661  34.566 1.00 43.00  ? 171 VAL A O   1 
ATOM   353  C  CB  . VAL A 1 44  ? -19.714 -3.290  33.132 1.00 42.68  ? 171 VAL A CB  1 
ATOM   354  C  CG1 . VAL A 1 44  ? -20.676 -4.113  32.221 1.00 39.02  ? 171 VAL A CG1 1 
ATOM   355  C  CG2 . VAL A 1 44  ? -19.900 -1.841  32.899 1.00 39.76  ? 171 VAL A CG2 1 
ATOM   356  N  N   . GLN A 1 45  ? -20.784 -5.897  35.053 1.00 36.80  ? 172 GLN A N   1 
ATOM   357  C  CA  . GLN A 1 45  ? -20.695 -7.373  34.996 1.00 37.92  ? 172 GLN A CA  1 
ATOM   358  C  C   . GLN A 1 45  ? -21.082 -7.829  33.605 1.00 44.38  ? 172 GLN A C   1 
ATOM   359  O  O   . GLN A 1 45  ? -21.923 -7.189  32.991 1.00 42.00  ? 172 GLN A O   1 
ATOM   360  C  CB  . GLN A 1 45  ? -21.627 -8.007  36.033 1.00 40.50  ? 172 GLN A CB  1 
ATOM   361  C  CG  . GLN A 1 45  ? -21.359 -9.498  36.226 1.00 37.53  ? 172 GLN A CG  1 
ATOM   362  C  CD  . GLN A 1 45  ? -22.316 -10.206 37.132 1.00 36.58  ? 172 GLN A CD  1 
ATOM   363  O  OE1 . GLN A 1 45  ? -22.337 -11.442 37.157 1.00 39.35  ? 172 GLN A OE1 1 
ATOM   364  N  NE2 . GLN A 1 45  ? -23.138 -9.458  37.870 1.00 35.08  ? 172 GLN A NE2 1 
ATOM   365  N  N   . PHE A 1 46  ? -20.471 -8.918  33.098 1.00 42.65  ? 173 PHE A N   1 
ATOM   366  C  CA  . PHE A 1 46  ? -20.906 -9.494  31.845 1.00 40.54  ? 173 PHE A CA  1 
ATOM   367  C  C   . PHE A 1 46  ? -20.968 -11.019 31.943 1.00 40.01  ? 173 PHE A C   1 
ATOM   368  O  O   . PHE A 1 46  ? -20.171 -11.662 32.623 1.00 37.89  ? 173 PHE A O   1 
ATOM   369  C  CB  . PHE A 1 46  ? -20.009 -9.064  30.662 1.00 43.99  ? 173 PHE A CB  1 
ATOM   370  C  CG  . PHE A 1 46  ? -18.639 -9.710  30.650 1.00 41.98  ? 173 PHE A CG  1 
ATOM   371  C  CD1 . PHE A 1 46  ? -17.602 -9.176  31.409 1.00 44.55  ? 173 PHE A CD1 1 
ATOM   372  C  CD2 . PHE A 1 46  ? -18.392 -10.818 29.885 1.00 43.69  ? 173 PHE A CD2 1 
ATOM   373  C  CE1 . PHE A 1 46  ? -16.353 -9.763  31.417 1.00 43.78  ? 173 PHE A CE1 1 
ATOM   374  C  CE2 . PHE A 1 46  ? -17.147 -11.411 29.887 1.00 45.58  ? 173 PHE A CE2 1 
ATOM   375  C  CZ  . PHE A 1 46  ? -16.123 -10.876 30.662 1.00 42.55  ? 173 PHE A CZ  1 
ATOM   376  N  N   . SER A 1 47  ? -21.932 -11.592 31.261 1.00 44.33  ? 174 SER A N   1 
ATOM   377  C  CA  . SER A 1 47  ? -21.968 -13.049 31.078 1.00 37.23  ? 174 SER A CA  1 
ATOM   378  C  C   . SER A 1 47  ? -22.621 -13.182 29.696 1.00 41.37  ? 174 SER A C   1 
ATOM   379  O  O   . SER A 1 47  ? -21.951 -12.912 28.675 1.00 38.54  ? 174 SER A O   1 
ATOM   380  C  CB  . SER A 1 47  ? -22.716 -13.717 32.246 1.00 38.60  ? 174 SER A CB  1 
ATOM   381  O  OG  . SER A 1 47  ? -22.894 -15.128 32.061 1.00 39.42  ? 174 SER A OG  1 
ATOM   382  N  N   . THR A 1 48  ? -23.906 -13.535 29.633 1.00 44.65  ? 175 THR A N   1 
ATOM   383  C  CA  . THR A 1 48  ? -24.651 -13.462 28.358 1.00 42.55  ? 175 THR A CA  1 
ATOM   384  C  C   . THR A 1 48  ? -24.958 -11.985 28.028 1.00 47.51  ? 175 THR A C   1 
ATOM   385  O  O   . THR A 1 48  ? -24.780 -11.532 26.886 1.00 40.24  ? 175 THR A O   1 
ATOM   386  C  CB  . THR A 1 48  ? -25.916 -14.287 28.410 1.00 44.66  ? 175 THR A CB  1 
ATOM   387  O  OG1 . THR A 1 48  ? -25.565 -15.687 28.435 1.00 40.20  ? 175 THR A OG1 1 
ATOM   388  C  CG2 . THR A 1 48  ? -26.810 -14.021 27.198 1.00 46.53  ? 175 THR A CG2 1 
ATOM   389  N  N   . SER A 1 49  ? -25.403 -11.249 29.042 1.00 41.05  ? 176 SER A N   1 
ATOM   390  C  CA  . SER A 1 49  ? -25.750 -9.854  28.900 1.00 42.26  ? 176 SER A CA  1 
ATOM   391  C  C   . SER A 1 49  ? -24.835 -9.035  29.806 1.00 41.95  ? 176 SER A C   1 
ATOM   392  O  O   . SER A 1 49  ? -23.933 -9.567  30.461 1.00 44.36  ? 176 SER A O   1 
ATOM   393  C  CB  . SER A 1 49  ? -27.232 -9.657  29.225 1.00 44.98  ? 176 SER A CB  1 
ATOM   394  O  OG  . SER A 1 49  ? -27.508 -9.934  30.583 1.00 52.83  ? 176 SER A OG  1 
ATOM   395  N  N   . TYR A 1 50  ? -25.040 -7.729  29.807 1.00 46.52  ? 177 TYR A N   1 
ATOM   396  C  CA  . TYR A 1 50  ? -24.114 -6.802  30.440 1.00 44.16  ? 177 TYR A CA  1 
ATOM   397  C  C   . TYR A 1 50  ? -24.926 -5.992  31.424 1.00 48.70  ? 177 TYR A C   1 
ATOM   398  O  O   . TYR A 1 50  ? -26.090 -5.671  31.152 1.00 45.95  ? 177 TYR A O   1 
ATOM   399  C  CB  . TYR A 1 50  ? -23.449 -5.907  29.380 1.00 47.52  ? 177 TYR A CB  1 
ATOM   400  C  CG  . TYR A 1 50  ? -23.172 -6.661  28.099 1.00 46.73  ? 177 TYR A CG  1 
ATOM   401  C  CD1 . TYR A 1 50  ? -22.417 -7.815  28.123 1.00 49.90  ? 177 TYR A CD1 1 
ATOM   402  C  CD2 . TYR A 1 50  ? -23.700 -6.248  26.881 1.00 49.22  ? 177 TYR A CD2 1 
ATOM   403  C  CE1 . TYR A 1 50  ? -22.178 -8.541  26.977 1.00 51.57  ? 177 TYR A CE1 1 
ATOM   404  C  CE2 . TYR A 1 50  ? -23.465 -6.971  25.718 1.00 47.45  ? 177 TYR A CE2 1 
ATOM   405  C  CZ  . TYR A 1 50  ? -22.704 -8.121  25.780 1.00 51.99  ? 177 TYR A CZ  1 
ATOM   406  O  OH  . TYR A 1 50  ? -22.461 -8.878  24.655 1.00 51.80  ? 177 TYR A OH  1 
ATOM   407  N  N   . LYS A 1 51  ? -24.332 -5.684  32.573 1.00 46.51  ? 178 LYS A N   1 
ATOM   408  C  CA  . LYS A 1 51  ? -25.025 -4.882  33.588 1.00 46.26  ? 178 LYS A CA  1 
ATOM   409  C  C   . LYS A 1 51  ? -24.051 -3.906  34.218 1.00 39.15  ? 178 LYS A C   1 
ATOM   410  O  O   . LYS A 1 51  ? -23.060 -4.323  34.830 1.00 43.01  ? 178 LYS A O   1 
ATOM   411  C  CB  . LYS A 1 51  ? -25.602 -5.827  34.645 1.00 51.60  ? 178 LYS A CB  1 
ATOM   412  C  CG  . LYS A 1 51  ? -26.283 -5.165  35.837 1.00 52.58  ? 178 LYS A CG  1 
ATOM   413  C  CD  . LYS A 1 51  ? -27.521 -4.399  35.456 1.00 57.34  ? 178 LYS A CD  1 
ATOM   414  C  CE  . LYS A 1 51  ? -28.130 -3.730  36.688 1.00 62.41  ? 178 LYS A CE  1 
ATOM   415  N  NZ  . LYS A 1 51  ? -28.371 -4.731  37.772 1.00 69.02  ? 178 LYS A NZ  1 
ATOM   416  N  N   . THR A 1 52  ? -24.288 -2.619  34.036 1.00 45.60  ? 179 THR A N   1 
ATOM   417  C  CA  . THR A 1 52  ? -23.547 -1.606  34.770 1.00 42.36  ? 179 THR A CA  1 
ATOM   418  C  C   . THR A 1 52  ? -23.996 -1.667  36.229 1.00 44.05  ? 179 THR A C   1 
ATOM   419  O  O   . THR A 1 52  ? -25.112 -1.247  36.580 1.00 44.19  ? 179 THR A O   1 
ATOM   420  C  CB  . THR A 1 52  ? -23.779 -0.226  34.190 1.00 45.62  ? 179 THR A CB  1 
ATOM   421  O  OG1 . THR A 1 52  ? -23.390 -0.238  32.810 1.00 48.62  ? 179 THR A OG1 1 
ATOM   422  C  CG2 . THR A 1 52  ? -22.963 0.814   34.951 1.00 44.20  ? 179 THR A CG2 1 
ATOM   423  N  N   . GLU A 1 53  ? -23.136 -2.234  37.066 1.00 40.71  ? 180 GLU A N   1 
ATOM   424  C  CA  . GLU A 1 53  ? -23.476 -2.466  38.466 1.00 40.23  ? 180 GLU A CA  1 
ATOM   425  C  C   . GLU A 1 53  ? -23.366 -1.162  39.251 1.00 39.69  ? 180 GLU A C   1 
ATOM   426  O  O   . GLU A 1 53  ? -24.120 -0.928  40.186 1.00 41.82  ? 180 GLU A O   1 
ATOM   427  C  CB  . GLU A 1 53  ? -22.577 -3.551  39.040 1.00 43.06  ? 180 GLU A CB  1 
ATOM   428  C  CG  . GLU A 1 53  ? -22.690 -4.920  38.258 1.00 36.09  ? 180 GLU A CG  1 
ATOM   429  C  CD  . GLU A 1 53  ? -23.928 -5.701  38.591 1.00 43.38  ? 180 GLU A CD  1 
ATOM   430  O  OE1 . GLU A 1 53  ? -24.768 -5.193  39.369 1.00 42.39  ? 180 GLU A OE1 1 
ATOM   431  O  OE2 . GLU A 1 53  ? -24.050 -6.857  38.088 1.00 42.37  ? 180 GLU A OE2 1 
ATOM   432  N  N   . PHE A 1 54  ? -22.412 -0.319  38.877 1.00 40.65  ? 181 PHE A N   1 
ATOM   433  C  CA  . PHE A 1 54  ? -22.418 1.061   39.314 1.00 38.48  ? 181 PHE A CA  1 
ATOM   434  C  C   . PHE A 1 54  ? -21.686 1.918   38.302 1.00 40.16  ? 181 PHE A C   1 
ATOM   435  O  O   . PHE A 1 54  ? -20.823 1.423   37.586 1.00 42.95  ? 181 PHE A O   1 
ATOM   436  C  CB  . PHE A 1 54  ? -21.829 1.206   40.730 1.00 41.32  ? 181 PHE A CB  1 
ATOM   437  C  CG  . PHE A 1 54  ? -20.336 0.999   40.824 1.00 38.97  ? 181 PHE A CG  1 
ATOM   438  C  CD1 . PHE A 1 54  ? -19.464 2.035   40.589 1.00 37.15  ? 181 PHE A CD1 1 
ATOM   439  C  CD2 . PHE A 1 54  ? -19.813 -0.219  41.227 1.00 42.60  ? 181 PHE A CD2 1 
ATOM   440  C  CE1 . PHE A 1 54  ? -18.085 1.857   40.710 1.00 37.17  ? 181 PHE A CE1 1 
ATOM   441  C  CE2 . PHE A 1 54  ? -18.435 -0.395  41.361 1.00 39.56  ? 181 PHE A CE2 1 
ATOM   442  C  CZ  . PHE A 1 54  ? -17.581 0.638   41.095 1.00 40.60  ? 181 PHE A CZ  1 
ATOM   443  N  N   . ASP A 1 55  ? -22.017 3.206   38.263 1.00 44.24  ? 182 ASP A N   1 
ATOM   444  C  CA  . ASP A 1 55  ? -21.394 4.140   37.318 1.00 41.17  ? 182 ASP A CA  1 
ATOM   445  C  C   . ASP A 1 55  ? -20.600 5.211   38.045 1.00 41.80  ? 182 ASP A C   1 
ATOM   446  O  O   . ASP A 1 55  ? -20.518 5.197   39.272 1.00 41.93  ? 182 ASP A O   1 
ATOM   447  C  CB  . ASP A 1 55  ? -22.443 4.747   36.381 1.00 46.26  ? 182 ASP A CB  1 
ATOM   448  C  CG  . ASP A 1 55  ? -23.458 5.625   37.091 1.00 49.17  ? 182 ASP A CG  1 
ATOM   449  O  OD1 . ASP A 1 55  ? -23.206 6.094   38.221 1.00 49.58  ? 182 ASP A OD1 1 
ATOM   450  O  OD2 . ASP A 1 55  ? -24.527 5.855   36.494 1.00 51.44  ? 182 ASP A OD2 1 
ATOM   451  N  N   . PHE A 1 56  ? -20.008 6.128   37.280 1.00 40.37  ? 183 PHE A N   1 
ATOM   452  C  CA  . PHE A 1 56  ? -19.057 7.082   37.831 1.00 41.21  ? 183 PHE A CA  1 
ATOM   453  C  C   . PHE A 1 56  ? -19.744 7.974   38.846 1.00 43.54  ? 183 PHE A C   1 
ATOM   454  O  O   . PHE A 1 56  ? -19.136 8.380   39.828 1.00 49.49  ? 183 PHE A O   1 
ATOM   455  C  CB  . PHE A 1 56  ? -18.439 7.915   36.715 1.00 41.82  ? 183 PHE A CB  1 
ATOM   456  C  CG  . PHE A 1 56  ? -17.745 7.099   35.678 1.00 37.67  ? 183 PHE A CG  1 
ATOM   457  C  CD1 . PHE A 1 56  ? -16.455 6.625   35.901 1.00 40.50  ? 183 PHE A CD1 1 
ATOM   458  C  CD2 . PHE A 1 56  ? -18.379 6.788   34.483 1.00 38.84  ? 183 PHE A CD2 1 
ATOM   459  C  CE1 . PHE A 1 56  ? -15.808 5.833   34.950 1.00 42.80  ? 183 PHE A CE1 1 
ATOM   460  C  CE2 . PHE A 1 56  ? -17.738 6.009   33.519 1.00 45.41  ? 183 PHE A CE2 1 
ATOM   461  C  CZ  . PHE A 1 56  ? -16.446 5.526   33.755 1.00 43.92  ? 183 PHE A CZ  1 
ATOM   462  N  N   . SER A 1 57  ? -21.012 8.287   38.598 1.00 45.12  ? 184 SER A N   1 
ATOM   463  C  CA  . SER A 1 57  ? -21.796 9.093   39.526 1.00 42.54  ? 184 SER A CA  1 
ATOM   464  C  C   . SER A 1 57  ? -22.094 8.323   40.804 1.00 39.27  ? 184 SER A C   1 
ATOM   465  O  O   . SER A 1 57  ? -22.014 8.869   41.896 1.00 42.02  ? 184 SER A O   1 
ATOM   466  C  CB  . SER A 1 57  ? -23.086 9.531   38.866 1.00 47.58  ? 184 SER A CB  1 
ATOM   467  O  OG  . SER A 1 57  ? -22.789 10.316  37.732 1.00 49.23  ? 184 SER A OG  1 
ATOM   468  N  N   . ASP A 1 58  ? -22.418 7.046   40.680 1.00 44.90  ? 185 ASP A N   1 
ATOM   469  C  CA  . ASP A 1 58  ? -22.552 6.204   41.860 1.00 44.34  ? 185 ASP A CA  1 
ATOM   470  C  C   . ASP A 1 58  ? -21.259 6.237   42.694 1.00 47.13  ? 185 ASP A C   1 
ATOM   471  O  O   . ASP A 1 58  ? -21.297 6.499   43.901 1.00 43.66  ? 185 ASP A O   1 
ATOM   472  C  CB  . ASP A 1 58  ? -22.913 4.776   41.471 1.00 46.63  ? 185 ASP A CB  1 
ATOM   473  C  CG  . ASP A 1 58  ? -24.220 4.685   40.691 1.00 44.62  ? 185 ASP A CG  1 
ATOM   474  O  OD1 . ASP A 1 58  ? -25.106 5.544   40.870 1.00 38.94  ? 185 ASP A OD1 1 
ATOM   475  O  OD2 . ASP A 1 58  ? -24.352 3.753   39.871 1.00 43.65  ? 185 ASP A OD2 1 
ATOM   476  N  N   . TYR A 1 59  ? -20.120 6.013   42.039 1.00 45.95  ? 186 TYR A N   1 
ATOM   477  C  CA  . TYR A 1 59  ? -18.827 6.030   42.721 1.00 43.00  ? 186 TYR A CA  1 
ATOM   478  C  C   . TYR A 1 59  ? -18.670 7.303   43.536 1.00 42.87  ? 186 TYR A C   1 
ATOM   479  O  O   . TYR A 1 59  ? -18.401 7.248   44.737 1.00 43.45  ? 186 TYR A O   1 
ATOM   480  C  CB  . TYR A 1 59  ? -17.642 5.904   41.748 1.00 43.98  ? 186 TYR A CB  1 
ATOM   481  C  CG  . TYR A 1 59  ? -16.319 6.014   42.478 1.00 45.17  ? 186 TYR A CG  1 
ATOM   482  C  CD1 . TYR A 1 59  ? -15.863 4.967   43.280 1.00 46.71  ? 186 TYR A CD1 1 
ATOM   483  C  CD2 . TYR A 1 59  ? -15.551 7.176   42.409 1.00 42.48  ? 186 TYR A CD2 1 
ATOM   484  C  CE1 . TYR A 1 59  ? -14.660 5.065   43.990 1.00 47.02  ? 186 TYR A CE1 1 
ATOM   485  C  CE2 . TYR A 1 59  ? -14.343 7.286   43.115 1.00 45.82  ? 186 TYR A CE2 1 
ATOM   486  C  CZ  . TYR A 1 59  ? -13.905 6.224   43.903 1.00 45.74  ? 186 TYR A CZ  1 
ATOM   487  O  OH  . TYR A 1 59  ? -12.717 6.308   44.603 1.00 46.40  ? 186 TYR A OH  1 
ATOM   488  N  N   . VAL A 1 60  ? -18.840 8.442   42.874 1.00 42.66  ? 187 VAL A N   1 
ATOM   489  C  CA  . VAL A 1 60  ? -18.675 9.745   43.507 1.00 37.98  ? 187 VAL A CA  1 
ATOM   490  C  C   . VAL A 1 60  ? -19.622 9.947   44.701 1.00 41.51  ? 187 VAL A C   1 
ATOM   491  O  O   . VAL A 1 60  ? -19.264 10.590  45.688 1.00 41.80  ? 187 VAL A O   1 
ATOM   492  C  CB  . VAL A 1 60  ? -18.886 10.885  42.475 1.00 37.00  ? 187 VAL A CB  1 
ATOM   493  C  CG1 . VAL A 1 60  ? -18.905 12.270  43.163 1.00 30.22  ? 187 VAL A CG1 1 
ATOM   494  C  CG2 . VAL A 1 60  ? -17.805 10.863  41.409 1.00 34.45  ? 187 VAL A CG2 1 
ATOM   495  N  N   . LYS A 1 61  ? -20.837 9.422   44.608 1.00 41.10  ? 188 LYS A N   1 
ATOM   496  C  CA  . LYS A 1 61  ? -21.814 9.589   45.687 1.00 42.15  ? 188 LYS A CA  1 
ATOM   497  C  C   . LYS A 1 61  ? -21.485 8.712   46.886 1.00 40.69  ? 188 LYS A C   1 
ATOM   498  O  O   . LYS A 1 61  ? -21.500 9.169   48.018 1.00 40.03  ? 188 LYS A O   1 
ATOM   499  C  CB  . LYS A 1 61  ? -23.225 9.241   45.198 1.00 41.38  ? 188 LYS A CB  1 
ATOM   500  C  CG  . LYS A 1 61  ? -24.314 9.619   46.204 1.00 40.69  ? 188 LYS A CG  1 
ATOM   501  C  CD  . LYS A 1 61  ? -25.673 9.063   45.802 1.00 41.39  ? 188 LYS A CD  1 
ATOM   502  C  CE  . LYS A 1 61  ? -26.756 9.469   46.795 1.00 39.80  ? 188 LYS A CE  1 
ATOM   503  N  NZ  . LYS A 1 61  ? -28.129 9.050   46.351 1.00 39.68  ? 188 LYS A NZ  1 
ATOM   504  N  N   . TRP A 1 62  ? -21.206 7.440   46.623 1.00 43.62  ? 189 TRP A N   1 
ATOM   505  C  CA  . TRP A 1 62  ? -21.078 6.444   47.676 1.00 44.73  ? 189 TRP A CA  1 
ATOM   506  C  C   . TRP A 1 62  ? -19.627 6.224   48.132 1.00 46.14  ? 189 TRP A C   1 
ATOM   507  O  O   . TRP A 1 62  ? -19.369 6.100   49.330 1.00 47.12  ? 189 TRP A O   1 
ATOM   508  C  CB  . TRP A 1 62  ? -21.694 5.134   47.193 1.00 46.16  ? 189 TRP A CB  1 
ATOM   509  C  CG  . TRP A 1 62  ? -23.141 5.279   46.805 1.00 45.93  ? 189 TRP A CG  1 
ATOM   510  C  CD1 . TRP A 1 62  ? -23.664 5.297   45.545 1.00 46.11  ? 189 TRP A CD1 1 
ATOM   511  C  CD2 . TRP A 1 62  ? -24.241 5.447   47.695 1.00 44.05  ? 189 TRP A CD2 1 
ATOM   512  N  NE1 . TRP A 1 62  ? -25.030 5.448   45.598 1.00 45.34  ? 189 TRP A NE1 1 
ATOM   513  C  CE2 . TRP A 1 62  ? -25.408 5.542   46.907 1.00 43.53  ? 189 TRP A CE2 1 
ATOM   514  C  CE3 . TRP A 1 62  ? -24.354 5.519   49.083 1.00 46.12  ? 189 TRP A CE3 1 
ATOM   515  C  CZ2 . TRP A 1 62  ? -26.667 5.709   47.460 1.00 45.54  ? 189 TRP A CZ2 1 
ATOM   516  C  CZ3 . TRP A 1 62  ? -25.603 5.693   49.632 1.00 47.61  ? 189 TRP A CZ3 1 
ATOM   517  C  CH2 . TRP A 1 62  ? -26.749 5.789   48.820 1.00 46.90  ? 189 TRP A CH2 1 
ATOM   518  N  N   . LYS A 1 63  ? -18.698 6.169   47.179 1.00 44.77  ? 190 LYS A N   1 
ATOM   519  C  CA  . LYS A 1 63  ? -17.264 5.918   47.436 1.00 49.22  ? 190 LYS A CA  1 
ATOM   520  C  C   . LYS A 1 63  ? -16.930 4.511   47.983 1.00 51.95  ? 190 LYS A C   1 
ATOM   521  O  O   . LYS A 1 63  ? -16.035 3.848   47.470 1.00 56.45  ? 190 LYS A O   1 
ATOM   522  C  CB  . LYS A 1 63  ? -16.670 6.999   48.334 1.00 52.78  ? 190 LYS A CB  1 
ATOM   523  C  CG  . LYS A 1 63  ? -16.758 8.409   47.755 1.00 56.30  ? 190 LYS A CG  1 
ATOM   524  C  CD  . LYS A 1 63  ? -15.764 8.637   46.606 1.00 56.72  ? 190 LYS A CD  1 
ATOM   525  C  CE  . LYS A 1 63  ? -15.477 10.140  46.399 1.00 58.19  ? 190 LYS A CE  1 
ATOM   526  N  NZ  . LYS A 1 63  ? -14.274 10.388  45.531 1.00 59.40  ? 190 LYS A NZ  1 
ATOM   527  N  N   . ASP A 1 64  ? -17.659 4.073   49.006 1.00 52.29  ? 191 ASP A N   1 
ATOM   528  C  CA  . ASP A 1 64  ? -17.477 2.774   49.656 1.00 49.34  ? 191 ASP A CA  1 
ATOM   529  C  C   . ASP A 1 64  ? -17.710 1.607   48.687 1.00 48.07  ? 191 ASP A C   1 
ATOM   530  O  O   . ASP A 1 64  ? -18.845 1.344   48.320 1.00 49.89  ? 191 ASP A O   1 
ATOM   531  C  CB  . ASP A 1 64  ? -18.465 2.689   50.833 1.00 52.68  ? 191 ASP A CB  1 
ATOM   532  C  CG  . ASP A 1 64  ? -18.333 1.410   51.650 1.00 54.95  ? 191 ASP A CG  1 
ATOM   533  O  OD1 . ASP A 1 64  ? -17.462 0.567   51.346 1.00 58.41  ? 191 ASP A OD1 1 
ATOM   534  O  OD2 . ASP A 1 64  ? -19.117 1.260   52.616 1.00 57.74  ? 191 ASP A OD2 1 
ATOM   535  N  N   . PRO A 1 65  ? -16.641 0.891   48.287 1.00 47.15  ? 192 PRO A N   1 
ATOM   536  C  CA  . PRO A 1 65  ? -16.819 -0.206  47.339 1.00 49.73  ? 192 PRO A CA  1 
ATOM   537  C  C   . PRO A 1 65  ? -17.723 -1.334  47.839 1.00 48.56  ? 192 PRO A C   1 
ATOM   538  O  O   . PRO A 1 65  ? -18.310 -2.033  47.025 1.00 49.87  ? 192 PRO A O   1 
ATOM   539  C  CB  . PRO A 1 65  ? -15.390 -0.720  47.131 1.00 51.92  ? 192 PRO A CB  1 
ATOM   540  C  CG  . PRO A 1 65  ? -14.508 0.408   47.534 1.00 49.08  ? 192 PRO A CG  1 
ATOM   541  C  CD  . PRO A 1 65  ? -15.225 1.034   48.675 1.00 50.07  ? 192 PRO A CD  1 
ATOM   542  N  N   . ASP A 1 66  ? -17.825 -1.518  49.157 1.00 47.69  ? 193 ASP A N   1 
ATOM   543  C  CA  . ASP A 1 66  ? -18.758 -2.500  49.718 1.00 48.38  ? 193 ASP A CA  1 
ATOM   544  C  C   . ASP A 1 66  ? -20.202 -2.092  49.432 1.00 47.20  ? 193 ASP A C   1 
ATOM   545  O  O   . ASP A 1 66  ? -21.031 -2.929  49.090 1.00 49.22  ? 193 ASP A O   1 
ATOM   546  C  CB  . ASP A 1 66  ? -18.560 -2.653  51.224 1.00 53.47  ? 193 ASP A CB  1 
ATOM   547  C  CG  . ASP A 1 66  ? -17.174 -3.143  51.590 1.00 56.79  ? 193 ASP A CG  1 
ATOM   548  O  OD1 . ASP A 1 66  ? -16.629 -2.663  52.608 1.00 63.47  ? 193 ASP A OD1 1 
ATOM   549  O  OD2 . ASP A 1 66  ? -16.630 -4.002  50.870 1.00 54.87  ? 193 ASP A OD2 1 
ATOM   550  N  N   . ALA A 1 67  ? -20.483 -0.798  49.583 1.00 45.52  ? 194 ALA A N   1 
ATOM   551  C  CA  . ALA A 1 67  ? -21.768 -0.208  49.229 1.00 45.80  ? 194 ALA A CA  1 
ATOM   552  C  C   . ALA A 1 67  ? -22.079 -0.400  47.744 1.00 48.26  ? 194 ALA A C   1 
ATOM   553  O  O   . ALA A 1 67  ? -23.135 -0.923  47.380 1.00 46.10  ? 194 ALA A O   1 
ATOM   554  C  CB  . ALA A 1 67  ? -21.765 1.278   49.567 1.00 44.19  ? 194 ALA A CB  1 
ATOM   555  N  N   . LEU A 1 68  ? -21.133 0.010   46.901 1.00 47.75  ? 195 LEU A N   1 
ATOM   556  C  CA  . LEU A 1 68  ? -21.317 0.031   45.449 1.00 43.60  ? 195 LEU A CA  1 
ATOM   557  C  C   . LEU A 1 68  ? -21.537 -1.323  44.823 1.00 45.09  ? 195 LEU A C   1 
ATOM   558  O  O   . LEU A 1 68  ? -22.184 -1.423  43.777 1.00 44.18  ? 195 LEU A O   1 
ATOM   559  C  CB  . LEU A 1 68  ? -20.108 0.674   44.782 1.00 43.12  ? 195 LEU A CB  1 
ATOM   560  C  CG  . LEU A 1 68  ? -19.930 2.169   45.073 1.00 34.27  ? 195 LEU A CG  1 
ATOM   561  C  CD1 . LEU A 1 68  ? -18.519 2.613   44.784 1.00 36.90  ? 195 LEU A CD1 1 
ATOM   562  C  CD2 . LEU A 1 68  ? -20.936 2.968   44.264 1.00 36.94  ? 195 LEU A CD2 1 
ATOM   563  N  N   . LEU A 1 69  ? -20.976 -2.363  45.428 1.00 48.76  ? 196 LEU A N   1 
ATOM   564  C  CA  . LEU A 1 69  ? -21.082 -3.718  44.886 1.00 44.97  ? 196 LEU A CA  1 
ATOM   565  C  C   . LEU A 1 69  ? -22.043 -4.629  45.657 1.00 47.74  ? 196 LEU A C   1 
ATOM   566  O  O   . LEU A 1 69  ? -22.103 -5.836  45.384 1.00 44.93  ? 196 LEU A O   1 
ATOM   567  C  CB  . LEU A 1 69  ? -19.688 -4.357  44.828 1.00 46.50  ? 196 LEU A CB  1 
ATOM   568  C  CG  . LEU A 1 69  ? -18.749 -3.788  43.754 1.00 49.03  ? 196 LEU A CG  1 
ATOM   569  C  CD1 . LEU A 1 69  ? -17.296 -4.128  44.067 1.00 47.42  ? 196 LEU A CD1 1 
ATOM   570  C  CD2 . LEU A 1 69  ? -19.144 -4.266  42.343 1.00 45.87  ? 196 LEU A CD2 1 
ATOM   571  N  N   . LYS A 1 70  ? -22.815 -4.078  46.591 1.00 45.87  ? 197 LYS A N   1 
ATOM   572  C  CA  . LYS A 1 70  ? -23.701 -4.914  47.409 1.00 48.84  ? 197 LYS A CA  1 
ATOM   573  C  C   . LYS A 1 70  ? -24.837 -5.596  46.636 1.00 48.93  ? 197 LYS A C   1 
ATOM   574  O  O   . LYS A 1 70  ? -25.318 -6.656  47.051 1.00 50.38  ? 197 LYS A O   1 
ATOM   575  C  CB  . LYS A 1 70  ? -24.285 -4.116  48.577 1.00 51.98  ? 197 LYS A CB  1 
ATOM   576  C  CG  . LYS A 1 70  ? -25.430 -3.187  48.208 1.00 54.47  ? 197 LYS A CG  1 
ATOM   577  C  CD  . LYS A 1 70  ? -25.833 -2.296  49.378 1.00 53.74  ? 197 LYS A CD  1 
ATOM   578  C  CE  . LYS A 1 70  ? -26.404 -3.100  50.543 1.00 56.66  ? 197 LYS A CE  1 
ATOM   579  N  NZ  . LYS A 1 70  ? -27.136 -2.231  51.540 1.00 55.37  ? 197 LYS A NZ  1 
ATOM   580  N  N   . HIS A 1 71  ? -25.278 -4.998  45.531 1.00 48.35  ? 198 HIS A N   1 
ATOM   581  C  CA  . HIS A 1 71  ? -26.431 -5.532  44.791 1.00 46.16  ? 198 HIS A CA  1 
ATOM   582  C  C   . HIS A 1 71  ? -26.041 -6.528  43.721 1.00 45.84  ? 198 HIS A C   1 
ATOM   583  O  O   . HIS A 1 71  ? -26.911 -7.088  43.071 1.00 49.61  ? 198 HIS A O   1 
ATOM   584  C  CB  . HIS A 1 71  ? -27.243 -4.398  44.154 1.00 49.50  ? 198 HIS A CB  1 
ATOM   585  C  CG  . HIS A 1 71  ? -27.743 -3.398  45.145 1.00 46.63  ? 198 HIS A CG  1 
ATOM   586  N  ND1 . HIS A 1 71  ? -27.190 -2.143  45.283 1.00 51.55  ? 198 HIS A ND1 1 
ATOM   587  C  CD2 . HIS A 1 71  ? -28.710 -3.491  46.085 1.00 47.48  ? 198 HIS A CD2 1 
ATOM   588  C  CE1 . HIS A 1 71  ? -27.810 -1.498  46.254 1.00 50.35  ? 198 HIS A CE1 1 
ATOM   589  N  NE2 . HIS A 1 71  ? -28.737 -2.295  46.757 1.00 48.64  ? 198 HIS A NE2 1 
ATOM   590  N  N   . VAL A 1 72  ? -24.745 -6.759  43.534 1.00 48.53  ? 199 VAL A N   1 
ATOM   591  C  CA  . VAL A 1 72  ? -24.279 -7.658  42.481 1.00 42.06  ? 199 VAL A CA  1 
ATOM   592  C  C   . VAL A 1 72  ? -24.724 -9.088  42.761 1.00 43.77  ? 199 VAL A C   1 
ATOM   593  O  O   . VAL A 1 72  ? -24.558 -9.587  43.878 1.00 40.37  ? 199 VAL A O   1 
ATOM   594  C  CB  . VAL A 1 72  ? -22.755 -7.626  42.350 1.00 41.39  ? 199 VAL A CB  1 
ATOM   595  C  CG1 . VAL A 1 72  ? -22.283 -8.676  41.345 1.00 39.61  ? 199 VAL A CG1 1 
ATOM   596  C  CG2 . VAL A 1 72  ? -22.278 -6.219  41.944 1.00 41.28  ? 199 VAL A CG2 1 
ATOM   597  N  N   . LYS A 1 73  ? -25.308 -9.726  41.749 1.00 44.28  ? 200 LYS A N   1 
ATOM   598  C  CA  . LYS A 1 73  ? -25.605 -11.155 41.783 1.00 43.94  ? 200 LYS A CA  1 
ATOM   599  C  C   . LYS A 1 73  ? -24.876 -11.820 40.620 1.00 44.05  ? 200 LYS A C   1 
ATOM   600  O  O   . LYS A 1 73  ? -24.865 -11.307 39.510 1.00 50.97  ? 200 LYS A O   1 
ATOM   601  C  CB  . LYS A 1 73  ? -27.123 -11.416 41.682 1.00 51.44  ? 200 LYS A CB  1 
ATOM   602  C  CG  . LYS A 1 73  ? -27.996 -10.701 42.746 1.00 58.69  ? 200 LYS A CG  1 
ATOM   603  C  CD  . LYS A 1 73  ? -27.635 -11.147 44.178 1.00 62.78  ? 200 LYS A CD  1 
ATOM   604  C  CE  . LYS A 1 73  ? -28.249 -10.243 45.271 1.00 63.75  ? 200 LYS A CE  1 
ATOM   605  N  NZ  . LYS A 1 73  ? -27.244 -9.917  46.354 1.00 64.19  ? 200 LYS A NZ  1 
ATOM   606  N  N   . HIS A 1 74  ? -24.290 -12.984 40.882 1.00 44.13  ? 201 HIS A N   1 
ATOM   607  C  CA  . HIS A 1 74  ? -23.509 -13.702 39.897 1.00 41.85  ? 201 HIS A CA  1 
ATOM   608  C  C   . HIS A 1 74  ? -24.469 -14.159 38.798 1.00 39.43  ? 201 HIS A C   1 
ATOM   609  O  O   . HIS A 1 74  ? -25.428 -14.879 39.075 1.00 46.19  ? 201 HIS A O   1 
ATOM   610  C  CB  . HIS A 1 74  ? -22.805 -14.887 40.593 1.00 43.91  ? 201 HIS A CB  1 
ATOM   611  C  CG  . HIS A 1 74  ? -21.714 -15.518 39.789 1.00 44.44  ? 201 HIS A CG  1 
ATOM   612  N  ND1 . HIS A 1 74  ? -21.006 -16.617 40.234 1.00 43.75  ? 201 HIS A ND1 1 
ATOM   613  C  CD2 . HIS A 1 74  ? -21.239 -15.240 38.553 1.00 45.75  ? 201 HIS A CD2 1 
ATOM   614  C  CE1 . HIS A 1 74  ? -20.128 -16.973 39.312 1.00 46.69  ? 201 HIS A CE1 1 
ATOM   615  N  NE2 . HIS A 1 74  ? -20.249 -16.155 38.281 1.00 46.82  ? 201 HIS A NE2 1 
ATOM   616  N  N   . MET A 1 75  ? -24.203 -13.756 37.552 1.00 41.68  ? 202 MET A N   1 
ATOM   617  C  CA  . MET A 1 75  ? -25.145 -13.989 36.432 1.00 36.74  ? 202 MET A CA  1 
ATOM   618  C  C   . MET A 1 75  ? -25.246 -15.448 36.085 1.00 40.53  ? 202 MET A C   1 
ATOM   619  O  O   . MET A 1 75  ? -26.346 -15.964 35.861 1.00 46.21  ? 202 MET A O   1 
ATOM   620  C  CB  . MET A 1 75  ? -24.724 -13.179 35.202 1.00 39.46  ? 202 MET A CB  1 
ATOM   621  C  CG  . MET A 1 75  ? -25.099 -11.682 35.319 1.00 41.81  ? 202 MET A CG  1 
ATOM   622  S  SD  . MET A 1 75  ? -24.367 -10.736 33.977 1.00 45.20  ? 202 MET A SD  1 
ATOM   623  C  CE  . MET A 1 75  ? -25.079 -9.101  34.213 1.00 40.84  ? 202 MET A CE  1 
ATOM   624  N  N   . LEU A 1 76  ? -24.090 -16.101 36.025 1.00 34.48  ? 203 LEU A N   1 
ATOM   625  C  CA  . LEU A 1 76  ? -24.003 -17.587 35.840 1.00 34.16  ? 203 LEU A CA  1 
ATOM   626  C  C   . LEU A 1 76  ? -24.512 -18.061 34.485 1.00 36.84  ? 203 LEU A C   1 
ATOM   627  O  O   . LEU A 1 76  ? -25.127 -19.133 34.337 1.00 40.24  ? 203 LEU A O   1 
ATOM   628  C  CB  . LEU A 1 76  ? -24.664 -18.311 36.991 1.00 35.27  ? 203 LEU A CB  1 
ATOM   629  C  CG  . LEU A 1 76  ? -23.946 -18.118 38.323 1.00 36.92  ? 203 LEU A CG  1 
ATOM   630  C  CD1 . LEU A 1 76  ? -24.899 -18.401 39.495 1.00 37.76  ? 203 LEU A CD1 1 
ATOM   631  C  CD2 . LEU A 1 76  ? -22.720 -18.984 38.384 1.00 43.87  ? 203 LEU A CD2 1 
ATOM   632  N  N   . LEU A 1 77  ? -24.168 -17.294 33.461 1.00 38.37  ? 204 LEU A N   1 
ATOM   633  C  CA  . LEU A 1 77  ? -24.544 -17.637 32.102 1.00 38.76  ? 204 LEU A CA  1 
ATOM   634  C  C   . LEU A 1 77  ? -23.284 -17.715 31.220 1.00 40.88  ? 204 LEU A C   1 
ATOM   635  O  O   . LEU A 1 77  ? -22.253 -18.197 31.685 1.00 40.39  ? 204 LEU A O   1 
ATOM   636  C  CB  . LEU A 1 77  ? -25.644 -16.677 31.606 1.00 40.74  ? 204 LEU A CB  1 
ATOM   637  C  CG  . LEU A 1 77  ? -26.980 -16.878 32.342 1.00 39.14  ? 204 LEU A CG  1 
ATOM   638  C  CD1 . LEU A 1 77  ? -27.970 -15.811 31.982 1.00 44.69  ? 204 LEU A CD1 1 
ATOM   639  C  CD2 . LEU A 1 77  ? -27.587 -18.258 32.046 1.00 42.67  ? 204 LEU A CD2 1 
ATOM   640  N  N   . LEU A 1 78  ? -23.372 -17.309 29.953 1.00 40.97  ? 205 LEU A N   1 
ATOM   641  C  CA  . LEU A 1 78  ? -22.283 -17.496 28.984 1.00 36.65  ? 205 LEU A CA  1 
ATOM   642  C  C   . LEU A 1 78  ? -21.275 -16.376 29.111 1.00 42.92  ? 205 LEU A C   1 
ATOM   643  O  O   . LEU A 1 78  ? -21.355 -15.609 30.061 1.00 43.61  ? 205 LEU A O   1 
ATOM   644  C  CB  . LEU A 1 78  ? -22.871 -17.555 27.578 1.00 35.64  ? 205 LEU A CB  1 
ATOM   645  C  CG  . LEU A 1 78  ? -23.887 -18.686 27.394 1.00 37.71  ? 205 LEU A CG  1 
ATOM   646  C  CD1 . LEU A 1 78  ? -24.428 -18.717 25.951 1.00 40.55  ? 205 LEU A CD1 1 
ATOM   647  C  CD2 . LEU A 1 78  ? -23.248 -19.998 27.747 1.00 39.98  ? 205 LEU A CD2 1 
ATOM   648  N  N   . THR A 1 79  ? -20.337 -16.275 28.171 1.00 44.97  ? 206 THR A N   1 
ATOM   649  C  CA  . THR A 1 79  ? -19.230 -15.311 28.264 1.00 43.13  ? 206 THR A CA  1 
ATOM   650  C  C   . THR A 1 79  ? -19.051 -14.470 26.982 1.00 44.75  ? 206 THR A C   1 
ATOM   651  O  O   . THR A 1 79  ? -18.091 -14.645 26.228 1.00 43.60  ? 206 THR A O   1 
ATOM   652  C  CB  . THR A 1 79  ? -17.910 -16.039 28.523 1.00 44.44  ? 206 THR A CB  1 
ATOM   653  O  OG1 . THR A 1 79  ? -18.120 -17.109 29.469 1.00 42.44  ? 206 THR A OG1 1 
ATOM   654  C  CG2 . THR A 1 79  ? -16.880 -15.045 29.038 1.00 40.96  ? 206 THR A CG2 1 
ATOM   655  N  N   . ASN A 1 80  ? -19.958 -13.526 26.763 1.00 44.10  ? 207 ASN A N   1 
ATOM   656  C  CA  . ASN A 1 80  ? -19.930 -12.709 25.555 1.00 43.54  ? 207 ASN A CA  1 
ATOM   657  C  C   . ASN A 1 80  ? -19.003 -11.527 25.708 1.00 43.69  ? 207 ASN A C   1 
ATOM   658  O  O   . ASN A 1 80  ? -19.437 -10.382 25.769 1.00 47.48  ? 207 ASN A O   1 
ATOM   659  C  CB  . ASN A 1 80  ? -21.348 -12.285 25.180 1.00 45.98  ? 207 ASN A CB  1 
ATOM   660  C  CG  . ASN A 1 80  ? -22.180 -13.450 24.717 1.00 45.36  ? 207 ASN A CG  1 
ATOM   661  O  OD1 . ASN A 1 80  ? -21.660 -14.397 24.150 1.00 48.26  ? 207 ASN A OD1 1 
ATOM   662  N  ND2 . ASN A 1 80  ? -23.477 -13.399 24.972 1.00 46.14  ? 207 ASN A ND2 1 
ATOM   663  N  N   . THR A 1 81  ? -17.708 -11.812 25.748 1.00 43.97  ? 208 THR A N   1 
ATOM   664  C  CA  . THR A 1 81  ? -16.704 -10.800 26.092 1.00 42.14  ? 208 THR A CA  1 
ATOM   665  C  C   . THR A 1 81  ? -16.490 -9.737  25.019 1.00 45.24  ? 208 THR A C   1 
ATOM   666  O  O   . THR A 1 81  ? -16.248 -8.582  25.348 1.00 47.81  ? 208 THR A O   1 
ATOM   667  C  CB  . THR A 1 81  ? -15.351 -11.454 26.392 1.00 47.03  ? 208 THR A CB  1 
ATOM   668  O  OG1 . THR A 1 81  ? -15.559 -12.671 27.117 1.00 43.92  ? 208 THR A OG1 1 
ATOM   669  C  CG2 . THR A 1 81  ? -14.459 -10.505 27.206 1.00 48.62  ? 208 THR A CG2 1 
ATOM   670  N  N   . PHE A 1 82  ? -16.549 -10.106 23.743 1.00 46.69  ? 209 PHE A N   1 
ATOM   671  C  CA  . PHE A 1 82  ? -16.366 -9.104  22.681 1.00 45.76  ? 209 PHE A CA  1 
ATOM   672  C  C   . PHE A 1 82  ? -17.512 -8.119  22.725 1.00 44.25  ? 209 PHE A C   1 
ATOM   673  O  O   . PHE A 1 82  ? -17.316 -6.902  22.637 1.00 49.15  ? 209 PHE A O   1 
ATOM   674  C  CB  . PHE A 1 82  ? -16.301 -9.749  21.293 1.00 51.07  ? 209 PHE A CB  1 
ATOM   675  C  CG  . PHE A 1 82  ? -14.997 -10.432 21.005 1.00 50.89  ? 209 PHE A CG  1 
ATOM   676  C  CD1 . PHE A 1 82  ? -14.016 -9.792  20.280 1.00 50.22  ? 209 PHE A CD1 1 
ATOM   677  C  CD2 . PHE A 1 82  ? -14.755 -11.714 21.465 1.00 50.93  ? 209 PHE A CD2 1 
ATOM   678  C  CE1 . PHE A 1 82  ? -12.805 -10.422 20.012 1.00 54.19  ? 209 PHE A CE1 1 
ATOM   679  C  CE2 . PHE A 1 82  ? -13.550 -12.354 21.205 1.00 53.29  ? 209 PHE A CE2 1 
ATOM   680  C  CZ  . PHE A 1 82  ? -12.574 -11.716 20.474 1.00 52.23  ? 209 PHE A CZ  1 
ATOM   681  N  N   . GLY A 1 83  ? -18.716 -8.659  22.875 1.00 43.39  ? 210 GLY A N   1 
ATOM   682  C  CA  . GLY A 1 83  ? -19.911 -7.845  23.041 1.00 43.13  ? 210 GLY A CA  1 
ATOM   683  C  C   . GLY A 1 83  ? -19.799 -6.920  24.234 1.00 44.39  ? 210 GLY A C   1 
ATOM   684  O  O   . GLY A 1 83  ? -20.116 -5.736  24.129 1.00 42.88  ? 210 GLY A O   1 
ATOM   685  N  N   . ALA A 1 84  ? -19.343 -7.461  25.364 1.00 45.32  ? 211 ALA A N   1 
ATOM   686  C  CA  . ALA A 1 84  ? -19.182 -6.675  26.604 1.00 44.96  ? 211 ALA A CA  1 
ATOM   687  C  C   . ALA A 1 84  ? -18.238 -5.515  26.414 1.00 42.40  ? 211 ALA A C   1 
ATOM   688  O  O   . ALA A 1 84  ? -18.493 -4.414  26.864 1.00 50.40  ? 211 ALA A O   1 
ATOM   689  C  CB  . ALA A 1 84  ? -18.660 -7.559  27.709 1.00 42.37  ? 211 ALA A CB  1 
ATOM   690  N  N   . ILE A 1 85  ? -17.111 -5.793  25.774 1.00 46.83  ? 212 ILE A N   1 
ATOM   691  C  CA  . ILE A 1 85  ? -16.085 -4.789  25.545 1.00 46.04  ? 212 ILE A CA  1 
ATOM   692  C  C   . ILE A 1 85  ? -16.653 -3.693  24.667 1.00 46.85  ? 212 ILE A C   1 
ATOM   693  O  O   . ILE A 1 85  ? -16.441 -2.511  24.926 1.00 48.59  ? 212 ILE A O   1 
ATOM   694  C  CB  . ILE A 1 85  ? -14.826 -5.401  24.909 1.00 47.07  ? 212 ILE A CB  1 
ATOM   695  C  CG1 . ILE A 1 85  ? -14.116 -6.317  25.922 1.00 45.72  ? 212 ILE A CG1 1 
ATOM   696  C  CG2 . ILE A 1 85  ? -13.881 -4.300  24.468 1.00 45.61  ? 212 ILE A CG2 1 
ATOM   697  C  CD1 . ILE A 1 85  ? -13.048 -7.244  25.323 1.00 47.07  ? 212 ILE A CD1 1 
ATOM   698  N  N   . ASN A 1 86  ? -17.404 -4.085  23.647 1.00 46.05  ? 213 ASN A N   1 
ATOM   699  C  CA  . ASN A 1 86  ? -18.055 -3.111  22.771 1.00 48.57  ? 213 ASN A CA  1 
ATOM   700  C  C   . ASN A 1 86  ? -19.135 -2.309  23.483 1.00 49.23  ? 213 ASN A C   1 
ATOM   701  O  O   . ASN A 1 86  ? -19.300 -1.127  23.227 1.00 47.16  ? 213 ASN A O   1 
ATOM   702  C  CB  . ASN A 1 86  ? -18.609 -3.808  21.531 1.00 46.44  ? 213 ASN A CB  1 
ATOM   703  C  CG  . ASN A 1 86  ? -17.545 -4.036  20.486 1.00 48.73  ? 213 ASN A CG  1 
ATOM   704  O  OD1 . ASN A 1 86  ? -17.207 -3.119  19.747 1.00 54.70  ? 213 ASN A OD1 1 
ATOM   705  N  ND2 . ASN A 1 86  ? -16.992 -5.244  20.432 1.00 49.52  ? 213 ASN A ND2 1 
ATOM   706  N  N   . TYR A 1 87  ? -19.861 -2.959  24.387 1.00 52.57  ? 214 TYR A N   1 
ATOM   707  C  CA  . TYR A 1 87  ? -20.850 -2.275  25.225 1.00 51.61  ? 214 TYR A CA  1 
ATOM   708  C  C   . TYR A 1 87  ? -20.205 -1.196  26.100 1.00 51.73  ? 214 TYR A C   1 
ATOM   709  O  O   . TYR A 1 87  ? -20.721 -0.081  26.211 1.00 49.43  ? 214 TYR A O   1 
ATOM   710  C  CB  . TYR A 1 87  ? -21.592 -3.298  26.097 1.00 57.74  ? 214 TYR A CB  1 
ATOM   711  C  CG  . TYR A 1 87  ? -22.582 -2.695  27.065 1.00 57.64  ? 214 TYR A CG  1 
ATOM   712  C  CD1 . TYR A 1 87  ? -23.847 -2.320  26.646 1.00 59.34  ? 214 TYR A CD1 1 
ATOM   713  C  CD2 . TYR A 1 87  ? -22.257 -2.518  28.408 1.00 59.58  ? 214 TYR A CD2 1 
ATOM   714  C  CE1 . TYR A 1 87  ? -24.767 -1.776  27.534 1.00 61.14  ? 214 TYR A CE1 1 
ATOM   715  C  CE2 . TYR A 1 87  ? -23.169 -1.974  29.307 1.00 60.76  ? 214 TYR A CE2 1 
ATOM   716  C  CZ  . TYR A 1 87  ? -24.429 -1.599  28.862 1.00 61.99  ? 214 TYR A CZ  1 
ATOM   717  O  OH  . TYR A 1 87  ? -25.348 -1.037  29.744 1.00 62.09  ? 214 TYR A OH  1 
ATOM   718  N  N   . VAL A 1 88  ? -19.077 -1.522  26.722 1.00 47.71  ? 215 VAL A N   1 
ATOM   719  C  CA  . VAL A 1 88  ? -18.391 -0.561  27.578 1.00 47.74  ? 215 VAL A CA  1 
ATOM   720  C  C   . VAL A 1 88  ? -17.928 0.639   26.756 1.00 51.08  ? 215 VAL A C   1 
ATOM   721  O  O   . VAL A 1 88  ? -18.190 1.794   27.117 1.00 52.99  ? 215 VAL A O   1 
ATOM   722  C  CB  . VAL A 1 88  ? -17.211 -1.216  28.324 1.00 43.33  ? 215 VAL A CB  1 
ATOM   723  C  CG1 . VAL A 1 88  ? -16.431 -0.199  29.112 1.00 50.52  ? 215 VAL A CG1 1 
ATOM   724  C  CG2 . VAL A 1 88  ? -17.727 -2.335  29.243 1.00 45.37  ? 215 VAL A CG2 1 
ATOM   725  N  N   . ALA A 1 89  ? -17.264 0.363   25.636 1.00 54.36  ? 216 ALA A N   1 
ATOM   726  C  CA  . ALA A 1 89  ? -16.772 1.423   24.746 1.00 54.03  ? 216 ALA A CA  1 
ATOM   727  C  C   . ALA A 1 89  ? -17.857 2.403   24.345 1.00 54.51  ? 216 ALA A C   1 
ATOM   728  O  O   . ALA A 1 89  ? -17.660 3.609   24.398 1.00 59.12  ? 216 ALA A O   1 
ATOM   729  C  CB  . ALA A 1 89  ? -16.163 0.816   23.501 1.00 56.00  ? 216 ALA A CB  1 
ATOM   730  N  N   . THR A 1 90  ? -19.004 1.889   23.927 1.00 55.91  ? 217 THR A N   1 
ATOM   731  C  CA  . THR A 1 90  ? -20.040 2.757   23.373 1.00 57.18  ? 217 THR A CA  1 
ATOM   732  C  C   . THR A 1 90  ? -21.059 3.237   24.410 1.00 56.63  ? 217 THR A C   1 
ATOM   733  O  O   . THR A 1 90  ? -21.578 4.343   24.279 1.00 60.62  ? 217 THR A O   1 
ATOM   734  C  CB  . THR A 1 90  ? -20.752 2.096   22.146 1.00 58.55  ? 217 THR A CB  1 
ATOM   735  O  OG1 . THR A 1 90  ? -21.356 0.850   22.520 1.00 60.57  ? 217 THR A OG1 1 
ATOM   736  C  CG2 . THR A 1 90  ? -19.746 1.845   21.027 1.00 55.56  ? 217 THR A CG2 1 
ATOM   737  N  N   . GLU A 1 91  ? -21.321 2.445   25.450 1.00 55.48  ? 218 GLU A N   1 
ATOM   738  C  CA  . GLU A 1 91  ? -22.448 2.730   26.360 1.00 56.45  ? 218 GLU A CA  1 
ATOM   739  C  C   . GLU A 1 91  ? -22.090 3.135   27.793 1.00 57.43  ? 218 GLU A C   1 
ATOM   740  O  O   . GLU A 1 91  ? -22.948 3.654   28.511 1.00 54.09  ? 218 GLU A O   1 
ATOM   741  C  CB  . GLU A 1 91  ? -23.393 1.527   26.429 1.00 57.43  ? 218 GLU A CB  1 
ATOM   742  C  CG  . GLU A 1 91  ? -23.782 0.923   25.076 1.00 63.02  ? 218 GLU A CG  1 
ATOM   743  C  CD  . GLU A 1 91  ? -24.357 1.947   24.103 1.00 67.17  ? 218 GLU A CD  1 
ATOM   744  O  OE1 . GLU A 1 91  ? -25.086 2.860   24.548 1.00 69.53  ? 218 GLU A OE1 1 
ATOM   745  O  OE2 . GLU A 1 91  ? -24.070 1.844   22.889 1.00 70.70  ? 218 GLU A OE2 1 
ATOM   746  N  N   . VAL A 1 92  ? -20.856 2.891   28.227 1.00 54.97  ? 219 VAL A N   1 
ATOM   747  C  CA  . VAL A 1 92  ? -20.501 3.125   29.627 1.00 53.37  ? 219 VAL A CA  1 
ATOM   748  C  C   . VAL A 1 92  ? -19.652 4.379   29.782 1.00 53.39  ? 219 VAL A C   1 
ATOM   749  O  O   . VAL A 1 92  ? -19.851 5.145   30.733 1.00 53.60  ? 219 VAL A O   1 
ATOM   750  C  CB  . VAL A 1 92  ? -19.801 1.895   30.276 1.00 49.28  ? 219 VAL A CB  1 
ATOM   751  C  CG1 . VAL A 1 92  ? -19.348 2.208   31.688 1.00 45.06  ? 219 VAL A CG1 1 
ATOM   752  C  CG2 . VAL A 1 92  ? -20.733 0.676   30.284 1.00 44.87  ? 219 VAL A CG2 1 
ATOM   753  N  N   . PHE A 1 93  ? -18.714 4.604   28.863 1.00 55.18  ? 220 PHE A N   1 
ATOM   754  C  CA  . PHE A 1 93  ? -17.972 5.875   28.842 1.00 55.25  ? 220 PHE A CA  1 
ATOM   755  C  C   . PHE A 1 93  ? -18.841 6.974   28.227 1.00 59.20  ? 220 PHE A C   1 
ATOM   756  O  O   . PHE A 1 93  ? -18.644 7.363   27.074 1.00 61.16  ? 220 PHE A O   1 
ATOM   757  C  CB  . PHE A 1 93  ? -16.650 5.755   28.072 1.00 48.77  ? 220 PHE A CB  1 
ATOM   758  C  CG  . PHE A 1 93  ? -15.594 4.958   28.786 1.00 46.07  ? 220 PHE A CG  1 
ATOM   759  C  CD1 . PHE A 1 93  ? -14.859 5.521   29.815 1.00 46.43  ? 220 PHE A CD1 1 
ATOM   760  C  CD2 . PHE A 1 93  ? -15.324 3.655   28.419 1.00 44.80  ? 220 PHE A CD2 1 
ATOM   761  C  CE1 . PHE A 1 93  ? -13.872 4.803   30.471 1.00 45.39  ? 220 PHE A CE1 1 
ATOM   762  C  CE2 . PHE A 1 93  ? -14.330 2.927   29.068 1.00 44.33  ? 220 PHE A CE2 1 
ATOM   763  C  CZ  . PHE A 1 93  ? -13.615 3.503   30.102 1.00 47.39  ? 220 PHE A CZ  1 
ATOM   764  N  N   . ARG A 1 94  ? -19.802 7.464   29.009 1.00 60.32  ? 221 ARG A N   1 
ATOM   765  C  CA  . ARG A 1 94  ? -20.713 8.525   28.574 1.00 59.80  ? 221 ARG A CA  1 
ATOM   766  C  C   . ARG A 1 94  ? -20.965 9.508   29.709 1.00 56.85  ? 221 ARG A C   1 
ATOM   767  O  O   . ARG A 1 94  ? -20.987 9.118   30.881 1.00 49.89  ? 221 ARG A O   1 
ATOM   768  C  CB  . ARG A 1 94  ? -22.048 7.933   28.111 1.00 63.03  ? 221 ARG A CB  1 
ATOM   769  C  CG  . ARG A 1 94  ? -21.969 7.129   26.821 1.00 66.46  ? 221 ARG A CG  1 
ATOM   770  C  CD  . ARG A 1 94  ? -23.333 6.536   26.435 1.00 69.41  ? 221 ARG A CD  1 
ATOM   771  N  NE  . ARG A 1 94  ? -24.279 7.538   25.938 1.00 72.25  ? 221 ARG A NE  1 
ATOM   772  C  CZ  . ARG A 1 94  ? -24.221 8.120   24.737 1.00 73.66  ? 221 ARG A CZ  1 
ATOM   773  N  NH1 . ARG A 1 94  ? -23.248 7.822   23.876 1.00 74.77  ? 221 ARG A NH1 1 
ATOM   774  N  NH2 . ARG A 1 94  ? -25.142 9.016   24.395 1.00 72.73  ? 221 ARG A NH2 1 
ATOM   775  N  N   . GLU A 1 95  ? -21.166 10.779  29.351 1.00 55.58  ? 222 GLU A N   1 
ATOM   776  C  CA  . GLU A 1 95  ? -21.419 11.835  30.325 1.00 57.94  ? 222 GLU A CA  1 
ATOM   777  C  C   . GLU A 1 95  ? -22.688 11.557  31.121 1.00 57.41  ? 222 GLU A C   1 
ATOM   778  O  O   . GLU A 1 95  ? -22.810 11.964  32.276 1.00 54.93  ? 222 GLU A O   1 
ATOM   779  C  CB  . GLU A 1 95  ? -21.546 13.194  29.633 1.00 57.79  ? 222 GLU A CB  1 
ATOM   780  C  CG  . GLU A 1 95  ? -20.281 13.673  28.933 1.00 59.15  ? 222 GLU A CG  1 
ATOM   781  C  CD  . GLU A 1 95  ? -20.333 15.165  28.589 1.00 61.64  ? 222 GLU A CD  1 
ATOM   782  O  OE1 . GLU A 1 95  ? -20.399 15.993  29.523 1.00 61.94  ? 222 GLU A OE1 1 
ATOM   783  O  OE2 . GLU A 1 95  ? -20.297 15.510  27.388 1.00 63.34  ? 222 GLU A OE2 1 
ATOM   784  N  N   . GLU A 1 96  ? -23.622 10.849  30.496 1.00 57.18  ? 223 GLU A N   1 
ATOM   785  C  CA  . GLU A 1 96  ? -24.887 10.496  31.125 1.00 58.34  ? 223 GLU A CA  1 
ATOM   786  C  C   . GLU A 1 96  ? -24.647 9.636   32.379 1.00 55.88  ? 223 GLU A C   1 
ATOM   787  O  O   . GLU A 1 96  ? -25.362 9.773   33.368 1.00 53.11  ? 223 GLU A O   1 
ATOM   788  C  CB  . GLU A 1 96  ? -25.792 9.763   30.121 1.00 61.46  ? 223 GLU A CB  1 
ATOM   789  C  CG  . GLU A 1 96  ? -26.357 10.645  28.995 1.00 64.06  ? 223 GLU A CG  1 
ATOM   790  C  CD  . GLU A 1 96  ? -25.306 11.142  27.998 1.00 65.44  ? 223 GLU A CD  1 
ATOM   791  O  OE1 . GLU A 1 96  ? -24.584 10.311  27.416 1.00 63.85  ? 223 GLU A OE1 1 
ATOM   792  O  OE2 . GLU A 1 96  ? -25.203 12.373  27.792 1.00 66.88  ? 223 GLU A OE2 1 
ATOM   793  N  N   . LEU A 1 97  ? -23.632 8.772   32.328 1.00 54.02  ? 224 LEU A N   1 
ATOM   794  C  CA  . LEU A 1 97  ? -23.208 7.976   33.487 1.00 54.50  ? 224 LEU A CA  1 
ATOM   795  C  C   . LEU A 1 97  ? -22.152 8.666   34.377 1.00 52.18  ? 224 LEU A C   1 
ATOM   796  O  O   . LEU A 1 97  ? -21.620 8.040   35.300 1.00 52.96  ? 224 LEU A O   1 
ATOM   797  C  CB  . LEU A 1 97  ? -22.657 6.630   33.019 1.00 58.09  ? 224 LEU A CB  1 
ATOM   798  C  CG  . LEU A 1 97  ? -23.615 5.679   32.316 1.00 58.54  ? 224 LEU A CG  1 
ATOM   799  C  CD1 . LEU A 1 97  ? -22.932 4.358   32.187 1.00 57.80  ? 224 LEU A CD1 1 
ATOM   800  C  CD2 . LEU A 1 97  ? -24.915 5.521   33.088 1.00 64.51  ? 224 LEU A CD2 1 
ATOM   801  N  N   . GLY A 1 98  ? -21.851 9.932   34.100 1.00 47.82  ? 225 GLY A N   1 
ATOM   802  C  CA  . GLY A 1 98  ? -20.902 10.709  34.901 1.00 51.22  ? 225 GLY A CA  1 
ATOM   803  C  C   . GLY A 1 98  ? -19.457 10.688  34.419 1.00 51.19  ? 225 GLY A C   1 
ATOM   804  O  O   . GLY A 1 98  ? -18.570 11.207  35.102 1.00 49.54  ? 225 GLY A O   1 
ATOM   805  N  N   . ALA A 1 99  ? -19.218 10.093  33.249 1.00 52.17  ? 226 ALA A N   1 
ATOM   806  C  CA  . ALA A 1 99  ? -17.895 10.100  32.634 1.00 50.13  ? 226 ALA A CA  1 
ATOM   807  C  C   . ALA A 1 99  ? -17.467 11.524  32.323 1.00 50.84  ? 226 ALA A C   1 
ATOM   808  O  O   . ALA A 1 99  ? -18.283 12.360  31.930 1.00 51.84  ? 226 ALA A O   1 
ATOM   809  C  CB  . ALA A 1 99  ? -17.876 9.256   31.361 1.00 48.84  ? 226 ALA A CB  1 
ATOM   810  N  N   . ARG A 1 100 ? -16.179 11.787  32.517 1.00 51.62  ? 227 ARG A N   1 
ATOM   811  C  CA  . ARG A 1 100 ? -15.591 13.094  32.270 1.00 50.23  ? 227 ARG A CA  1 
ATOM   812  C  C   . ARG A 1 100 ? -14.934 13.068  30.888 1.00 51.67  ? 227 ARG A C   1 
ATOM   813  O  O   . ARG A 1 100 ? -14.141 12.168  30.612 1.00 50.38  ? 227 ARG A O   1 
ATOM   814  C  CB  . ARG A 1 100 ? -14.547 13.403  33.342 1.00 49.58  ? 227 ARG A CB  1 
ATOM   815  C  CG  . ARG A 1 100 ? -15.101 13.483  34.768 1.00 48.00  ? 227 ARG A CG  1 
ATOM   816  C  CD  . ARG A 1 100 ? -13.994 13.529  35.825 1.00 49.28  ? 227 ARG A CD  1 
ATOM   817  N  NE  . ARG A 1 100 ? -13.269 12.257  35.885 1.00 47.59  ? 227 ARG A NE  1 
ATOM   818  C  CZ  . ARG A 1 100 ? -12.467 11.865  36.877 1.00 49.00  ? 227 ARG A CZ  1 
ATOM   819  N  NH1 . ARG A 1 100 ? -12.239 12.637  37.934 1.00 50.62  ? 227 ARG A NH1 1 
ATOM   820  N  NH2 . ARG A 1 100 ? -11.884 10.672  36.803 1.00 48.56  ? 227 ARG A NH2 1 
ATOM   821  N  N   . PRO A 1 101 ? -15.253 14.045  30.014 1.00 51.83  ? 228 PRO A N   1 
ATOM   822  C  CA  . PRO A 1 101 ? -14.708 13.985  28.646 1.00 54.86  ? 228 PRO A CA  1 
ATOM   823  C  C   . PRO A 1 101 ? -13.195 14.249  28.589 1.00 56.30  ? 228 PRO A C   1 
ATOM   824  O  O   . PRO A 1 101 ? -12.517 13.821  27.652 1.00 55.95  ? 228 PRO A O   1 
ATOM   825  C  CB  . PRO A 1 101 ? -15.473 15.094  27.900 1.00 55.17  ? 228 PRO A CB  1 
ATOM   826  C  CG  . PRO A 1 101 ? -16.518 15.598  28.843 1.00 54.85  ? 228 PRO A CG  1 
ATOM   827  C  CD  . PRO A 1 101 ? -16.075 15.250  30.220 1.00 55.30  ? 228 PRO A CD  1 
ATOM   828  N  N   . ASP A 1 102 ? -12.698 14.957  29.599 1.00 56.99  ? 229 ASP A N   1 
ATOM   829  C  CA  . ASP A 1 102 ? -11.282 15.278  29.755 1.00 56.29  ? 229 ASP A CA  1 
ATOM   830  C  C   . ASP A 1 102 ? -10.427 14.110  30.266 1.00 54.45  ? 229 ASP A C   1 
ATOM   831  O  O   . ASP A 1 102 ? -9.195  14.205  30.270 1.00 53.52  ? 229 ASP A O   1 
ATOM   832  C  CB  . ASP A 1 102 ? -11.149 16.459  30.732 1.00 61.50  ? 229 ASP A CB  1 
ATOM   833  C  CG  . ASP A 1 102 ? -11.916 16.226  32.039 1.00 64.53  ? 229 ASP A CG  1 
ATOM   834  O  OD1 . ASP A 1 102 ? -13.081 16.687  32.140 1.00 64.70  ? 229 ASP A OD1 1 
ATOM   835  O  OD2 . ASP A 1 102 ? -11.369 15.554  32.945 1.00 65.63  ? 229 ASP A OD2 1 
ATOM   836  N  N   . ALA A 1 103 ? -11.074 13.021  30.687 1.00 50.16  ? 230 ALA A N   1 
ATOM   837  C  CA  . ALA A 1 103 ? -10.409 11.945  31.425 1.00 49.57  ? 230 ALA A CA  1 
ATOM   838  C  C   . ALA A 1 103 ? -9.832  10.850  30.527 1.00 48.13  ? 230 ALA A C   1 
ATOM   839  O  O   . ALA A 1 103 ? -10.404 10.516  29.489 1.00 44.79  ? 230 ALA A O   1 
ATOM   840  C  CB  . ALA A 1 103 ? -11.385 11.317  32.422 1.00 50.62  ? 230 ALA A CB  1 
ATOM   841  N  N   . THR A 1 104 ? -8.709  10.285  30.960 1.00 44.84  ? 231 THR A N   1 
ATOM   842  C  CA  . THR A 1 104 ? -8.098  9.154   30.292 1.00 45.10  ? 231 THR A CA  1 
ATOM   843  C  C   . THR A 1 104 ? -8.908  7.896   30.610 1.00 46.84  ? 231 THR A C   1 
ATOM   844  O  O   . THR A 1 104 ? -9.132  7.563   31.776 1.00 45.59  ? 231 THR A O   1 
ATOM   845  C  CB  . THR A 1 104 ? -6.619  8.967   30.728 1.00 45.85  ? 231 THR A CB  1 
ATOM   846  O  OG1 . THR A 1 104 ? -5.819  10.046  30.213 1.00 43.69  ? 231 THR A OG1 1 
ATOM   847  C  CG2 . THR A 1 104 ? -6.053  7.636   30.225 1.00 45.38  ? 231 THR A CG2 1 
ATOM   848  N  N   . LYS A 1 105 ? -9.337  7.201   29.564 1.00 45.72  ? 232 LYS A N   1 
ATOM   849  C  CA  . LYS A 1 105 ? -10.188 6.034   29.715 1.00 44.78  ? 232 LYS A CA  1 
ATOM   850  C  C   . LYS A 1 105 ? -9.363  4.771   29.934 1.00 47.10  ? 232 LYS A C   1 
ATOM   851  O  O   . LYS A 1 105 ? -8.439  4.483   29.168 1.00 45.19  ? 232 LYS A O   1 
ATOM   852  C  CB  . LYS A 1 105 ? -11.044 5.848   28.472 1.00 45.83  ? 232 LYS A CB  1 
ATOM   853  C  CG  . LYS A 1 105 ? -11.898 7.018   28.104 1.00 46.71  ? 232 LYS A CG  1 
ATOM   854  C  CD  . LYS A 1 105 ? -12.729 6.668   26.906 1.00 47.89  ? 232 LYS A CD  1 
ATOM   855  C  CE  . LYS A 1 105 ? -13.538 7.842   26.411 1.00 52.44  ? 232 LYS A CE  1 
ATOM   856  N  NZ  . LYS A 1 105 ? -14.690 7.337   25.603 1.00 55.23  ? 232 LYS A NZ  1 
ATOM   857  N  N   . VAL A 1 106 ? -9.722  4.004   30.962 1.00 48.41  ? 233 VAL A N   1 
ATOM   858  C  CA  . VAL A 1 106 ? -9.075  2.729   31.241 1.00 46.14  ? 233 VAL A CA  1 
ATOM   859  C  C   . VAL A 1 106 ? -10.125 1.673   31.507 1.00 48.81  ? 233 VAL A C   1 
ATOM   860  O  O   . VAL A 1 106 ? -11.147 1.952   32.125 1.00 48.91  ? 233 VAL A O   1 
ATOM   861  C  CB  . VAL A 1 106 ? -8.154  2.813   32.464 1.00 48.32  ? 233 VAL A CB  1 
ATOM   862  C  CG1 . VAL A 1 106 ? -7.520  1.452   32.746 1.00 46.44  ? 233 VAL A CG1 1 
ATOM   863  C  CG2 . VAL A 1 106 ? -7.098  3.870   32.254 1.00 41.93  ? 233 VAL A CG2 1 
ATOM   864  N  N   . LEU A 1 107 ? -9.847  0.466   31.023 1.00 45.62  ? 234 LEU A N   1 
ATOM   865  C  CA  . LEU A 1 107 ? -10.705 -0.684  31.176 1.00 49.55  ? 234 LEU A CA  1 
ATOM   866  C  C   . LEU A 1 107 ? -9.864  -1.759  31.844 1.00 50.83  ? 234 LEU A C   1 
ATOM   867  O  O   . LEU A 1 107 ? -8.760  -2.064  31.392 1.00 54.81  ? 234 LEU A O   1 
ATOM   868  C  CB  . LEU A 1 107 ? -11.184 -1.126  29.791 1.00 48.11  ? 234 LEU A CB  1 
ATOM   869  C  CG  . LEU A 1 107 ? -12.421 -1.976  29.511 1.00 52.48  ? 234 LEU A CG  1 
ATOM   870  C  CD1 . LEU A 1 107 ? -13.511 -1.985  30.609 1.00 50.86  ? 234 LEU A CD1 1 
ATOM   871  C  CD2 . LEU A 1 107 ? -12.987 -1.541  28.151 1.00 52.19  ? 234 LEU A CD2 1 
ATOM   872  N  N   . ILE A 1 108 ? -10.361 -2.288  32.955 1.00 48.03  ? 235 ILE A N   1 
ATOM   873  C  CA  . ILE A 1 108 ? -9.748  -3.432  33.602 1.00 47.94  ? 235 ILE A CA  1 
ATOM   874  C  C   . ILE A 1 108 ? -10.698 -4.593  33.389 1.00 46.41  ? 235 ILE A C   1 
ATOM   875  O  O   . ILE A 1 108 ? -11.784 -4.624  33.953 1.00 49.41  ? 235 ILE A O   1 
ATOM   876  C  CB  . ILE A 1 108 ? -9.469  -3.174  35.088 1.00 48.09  ? 235 ILE A CB  1 
ATOM   877  C  CG1 . ILE A 1 108 ? -8.426  -2.060  35.219 1.00 49.16  ? 235 ILE A CG1 1 
ATOM   878  C  CG2 . ILE A 1 108 ? -8.955  -4.446  35.760 1.00 48.03  ? 235 ILE A CG2 1 
ATOM   879  C  CD1 . ILE A 1 108 ? -8.266  -1.498  36.622 1.00 51.50  ? 235 ILE A CD1 1 
ATOM   880  N  N   . ILE A 1 109 ? -10.304 -5.511  32.520 1.00 44.76  ? 236 ILE A N   1 
ATOM   881  C  CA  . ILE A 1 109 ? -11.144 -6.657  32.152 1.00 45.52  ? 236 ILE A CA  1 
ATOM   882  C  C   . ILE A 1 109 ? -10.699 -7.879  32.945 1.00 46.59  ? 236 ILE A C   1 
ATOM   883  O  O   . ILE A 1 109 ? -9.547  -8.289  32.843 1.00 47.64  ? 236 ILE A O   1 
ATOM   884  C  CB  . ILE A 1 109 ? -11.061 -6.940  30.636 1.00 44.02  ? 236 ILE A CB  1 
ATOM   885  C  CG1 . ILE A 1 109 ? -11.438 -5.670  29.859 1.00 44.92  ? 236 ILE A CG1 1 
ATOM   886  C  CG2 . ILE A 1 109 ? -11.967 -8.131  30.247 1.00 43.07  ? 236 ILE A CG2 1 
ATOM   887  C  CD1 . ILE A 1 109 ? -10.975 -5.652  28.409 1.00 48.56  ? 236 ILE A CD1 1 
ATOM   888  N  N   . ILE A 1 110 ? -11.615 -8.457  33.731 1.00 47.56  ? 237 ILE A N   1 
ATOM   889  C  CA  . ILE A 1 110 ? -11.292 -9.579  34.610 1.00 46.53  ? 237 ILE A CA  1 
ATOM   890  C  C   . ILE A 1 110 ? -12.048 -10.820 34.152 1.00 47.43  ? 237 ILE A C   1 
ATOM   891  O  O   . ILE A 1 110 ? -13.264 -10.885 34.273 1.00 49.98  ? 237 ILE A O   1 
ATOM   892  C  CB  . ILE A 1 110 ? -11.658 -9.287  36.082 1.00 46.15  ? 237 ILE A CB  1 
ATOM   893  C  CG1 . ILE A 1 110 ? -11.092 -7.945  36.538 1.00 43.77  ? 237 ILE A CG1 1 
ATOM   894  C  CG2 . ILE A 1 110 ? -11.173 -10.429 36.968 1.00 47.47  ? 237 ILE A CG2 1 
ATOM   895  C  CD1 . ILE A 1 110 ? -12.033 -7.128  37.366 1.00 44.35  ? 237 ILE A CD1 1 
ATOM   896  N  N   . THR A 1 111 ? -11.330 -11.805 33.624 1.00 45.78  ? 238 THR A N   1 
ATOM   897  C  CA  . THR A 1 111 ? -11.975 -12.928 32.963 1.00 48.80  ? 238 THR A CA  1 
ATOM   898  C  C   . THR A 1 111 ? -11.035 -14.132 32.860 1.00 50.76  ? 238 THR A C   1 
ATOM   899  O  O   . THR A 1 111 ? -9.827  -13.979 32.971 1.00 54.24  ? 238 THR A O   1 
ATOM   900  C  CB  . THR A 1 111 ? -12.430 -12.482 31.559 1.00 50.76  ? 238 THR A CB  1 
ATOM   901  O  OG1 . THR A 1 111 ? -13.094 -13.560 30.883 1.00 49.81  ? 238 THR A OG1 1 
ATOM   902  C  CG2 . THR A 1 111 ? -11.226 -11.993 30.740 1.00 47.52  ? 238 THR A CG2 1 
ATOM   903  N  N   . ASP A 1 112 ? -11.591 -15.325 32.669 1.00 49.51  ? 239 ASP A N   1 
ATOM   904  C  CA  . ASP A 1 112 ? -10.774 -16.511 32.409 1.00 49.21  ? 239 ASP A CA  1 
ATOM   905  C  C   . ASP A 1 112 ? -10.383 -16.641 30.938 1.00 46.51  ? 239 ASP A C   1 
ATOM   906  O  O   . ASP A 1 112 ? -9.685  -17.567 30.565 1.00 49.13  ? 239 ASP A O   1 
ATOM   907  C  CB  . ASP A 1 112 ? -11.424 -17.803 32.954 1.00 49.92  ? 239 ASP A CB  1 
ATOM   908  C  CG  . ASP A 1 112 ? -12.727 -18.186 32.258 1.00 51.71  ? 239 ASP A CG  1 
ATOM   909  O  OD1 . ASP A 1 112 ? -13.004 -17.708 31.128 1.00 46.55  ? 239 ASP A OD1 1 
ATOM   910  O  OD2 . ASP A 1 112 ? -13.464 -19.009 32.863 1.00 46.21  ? 239 ASP A OD2 1 
ATOM   911  N  N   . GLY A 1 113 ? -10.833 -15.706 30.111 1.00 49.45  ? 240 GLY A N   1 
ATOM   912  C  CA  . GLY A 1 113 ? -10.403 -15.628 28.723 1.00 50.83  ? 240 GLY A CA  1 
ATOM   913  C  C   . GLY A 1 113 ? -11.103 -16.591 27.791 1.00 52.91  ? 240 GLY A C   1 
ATOM   914  O  O   . GLY A 1 113 ? -10.779 -16.628 26.604 1.00 54.17  ? 240 GLY A O   1 
ATOM   915  N  N   . GLU A 1 114 ? -12.066 -17.359 28.314 1.00 54.89  ? 241 GLU A N   1 
ATOM   916  C  CA  . GLU A 1 114 ? -12.818 -18.334 27.518 1.00 52.26  ? 241 GLU A CA  1 
ATOM   917  C  C   . GLU A 1 114 ? -14.116 -17.697 26.977 1.00 53.62  ? 241 GLU A C   1 
ATOM   918  O  O   . GLU A 1 114 ? -15.231 -18.010 27.417 1.00 48.68  ? 241 GLU A O   1 
ATOM   919  C  CB  . GLU A 1 114 ? -13.116 -19.567 28.368 1.00 54.76  ? 241 GLU A CB  1 
ATOM   920  C  CG  . GLU A 1 114 ? -13.712 -20.727 27.602 1.00 57.60  ? 241 GLU A CG  1 
ATOM   921  C  CD  . GLU A 1 114 ? -14.098 -21.886 28.511 1.00 60.49  ? 241 GLU A CD  1 
ATOM   922  O  OE1 . GLU A 1 114 ? -14.976 -21.722 29.411 1.00 55.07  ? 241 GLU A OE1 1 
ATOM   923  O  OE2 . GLU A 1 114 ? -13.520 -22.971 28.305 1.00 61.37  ? 241 GLU A OE2 1 
ATOM   924  N  N   . ALA A 1 115 ? -13.948 -16.809 26.000 1.00 50.03  ? 242 ALA A N   1 
ATOM   925  C  CA  . ALA A 1 115 ? -15.060 -16.069 25.399 1.00 48.77  ? 242 ALA A CA  1 
ATOM   926  C  C   . ALA A 1 115 ? -15.947 -17.006 24.595 1.00 48.37  ? 242 ALA A C   1 
ATOM   927  O  O   . ALA A 1 115 ? -15.443 -17.873 23.900 1.00 46.38  ? 242 ALA A O   1 
ATOM   928  C  CB  . ALA A 1 115 ? -14.516 -14.979 24.496 1.00 44.80  ? 242 ALA A CB  1 
ATOM   929  N  N   . THR A 1 116 ? -17.264 -16.846 24.687 1.00 44.34  ? 243 THR A N   1 
ATOM   930  C  CA  . THR A 1 116 ? -18.166 -17.668 23.876 1.00 48.52  ? 243 THR A CA  1 
ATOM   931  C  C   . THR A 1 116 ? -18.677 -16.925 22.640 1.00 48.96  ? 243 THR A C   1 
ATOM   932  O  O   . THR A 1 116 ? -19.442 -17.477 21.858 1.00 49.80  ? 243 THR A O   1 
ATOM   933  C  CB  . THR A 1 116 ? -19.354 -18.190 24.698 1.00 45.07  ? 243 THR A CB  1 
ATOM   934  O  OG1 . THR A 1 116 ? -20.075 -17.087 25.230 1.00 45.06  ? 243 THR A OG1 1 
ATOM   935  C  CG2 . THR A 1 116 ? -18.863 -19.078 25.845 1.00 41.13  ? 243 THR A CG2 1 
ATOM   936  N  N   . ASP A 1 117 ? -18.255 -15.674 22.456 1.00 50.91  ? 244 ASP A N   1 
ATOM   937  C  CA  . ASP A 1 117 ? -18.581 -14.942 21.233 1.00 50.12  ? 244 ASP A CA  1 
ATOM   938  C  C   . ASP A 1 117 ? -17.299 -14.607 20.456 1.00 53.25  ? 244 ASP A C   1 
ATOM   939  O  O   . ASP A 1 117 ? -16.216 -15.070 20.797 1.00 54.39  ? 244 ASP A O   1 
ATOM   940  C  CB  . ASP A 1 117 ? -19.422 -13.694 21.537 1.00 48.92  ? 244 ASP A CB  1 
ATOM   941  C  CG  . ASP A 1 117 ? -18.693 -12.670 22.385 1.00 50.51  ? 244 ASP A CG  1 
ATOM   942  O  OD1 . ASP A 1 117 ? -17.589 -12.984 22.893 1.00 48.02  ? 244 ASP A OD1 1 
ATOM   943  O  OD2 . ASP A 1 117 ? -19.245 -11.548 22.561 1.00 48.78  ? 244 ASP A OD2 1 
ATOM   944  N  N   . SER A 1 118 ? -17.435 -13.823 19.397 1.00 54.87  ? 245 SER A N   1 
ATOM   945  C  CA  . SER A 1 118 ? -16.299 -13.453 18.571 1.00 56.37  ? 245 SER A CA  1 
ATOM   946  C  C   . SER A 1 118 ? -16.526 -12.078 17.972 1.00 56.01  ? 245 SER A C   1 
ATOM   947  O  O   . SER A 1 118 ? -17.568 -11.459 18.172 1.00 55.76  ? 245 SER A O   1 
ATOM   948  C  CB  . SER A 1 118 ? -16.087 -14.499 17.469 1.00 60.15  ? 245 SER A CB  1 
ATOM   949  O  OG  . SER A 1 118 ? -17.304 -14.795 16.806 1.00 61.81  ? 245 SER A OG  1 
ATOM   950  N  N   . GLY A 1 119 ? -15.526 -11.590 17.256 1.00 58.38  ? 246 GLY A N   1 
ATOM   951  C  CA  . GLY A 1 119 ? -15.647 -10.332 16.551 1.00 58.75  ? 246 GLY A CA  1 
ATOM   952  C  C   . GLY A 1 119 ? -14.404 -9.506  16.758 1.00 59.37  ? 246 GLY A C   1 
ATOM   953  O  O   . GLY A 1 119 ? -13.288 -10.031 16.784 1.00 57.57  ? 246 GLY A O   1 
ATOM   954  N  N   . ASN A 1 120 ? -14.604 -8.205  16.903 1.00 58.76  ? 247 ASN A N   1 
ATOM   955  C  CA  . ASN A 1 120 ? -13.502 -7.285  17.093 1.00 59.19  ? 247 ASN A CA  1 
ATOM   956  C  C   . ASN A 1 120 ? -13.879 -6.296  18.173 1.00 56.07  ? 247 ASN A C   1 
ATOM   957  O  O   . ASN A 1 120 ? -15.059 -6.126  18.487 1.00 55.36  ? 247 ASN A O   1 
ATOM   958  C  CB  . ASN A 1 120 ? -13.161 -6.565  15.779 1.00 58.15  ? 247 ASN A CB  1 
ATOM   959  C  CG  . ASN A 1 120 ? -14.259 -5.610  15.328 1.00 60.15  ? 247 ASN A CG  1 
ATOM   960  O  OD1 . ASN A 1 120 ? -14.335 -4.468  15.790 1.00 60.77  ? 247 ASN A OD1 1 
ATOM   961  N  ND2 . ASN A 1 120 ? -15.107 -6.069  14.413 1.00 57.98  ? 247 ASN A ND2 1 
ATOM   962  N  N   . ILE A 1 121 ? -12.862 -5.664  18.741 1.00 55.72  ? 248 ILE A N   1 
ATOM   963  C  CA  . ILE A 1 121 ? -13.046 -4.657  19.764 1.00 56.95  ? 248 ILE A CA  1 
ATOM   964  C  C   . ILE A 1 121 ? -12.500 -3.325  19.264 1.00 55.87  ? 248 ILE A C   1 
ATOM   965  O  O   . ILE A 1 121 ? -11.994 -2.531  20.047 1.00 58.43  ? 248 ILE A O   1 
ATOM   966  C  CB  . ILE A 1 121 ? -12.375 -5.086  21.103 1.00 59.50  ? 248 ILE A CB  1 
ATOM   967  C  CG1 . ILE A 1 121 ? -10.863 -5.290  20.949 1.00 59.54  ? 248 ILE A CG1 1 
ATOM   968  C  CG2 . ILE A 1 121 ? -12.999 -6.378  21.620 1.00 57.01  ? 248 ILE A CG2 1 
ATOM   969  C  CD1 . ILE A 1 121 ? -10.127 -5.329  22.268 1.00 59.16  ? 248 ILE A CD1 1 
ATOM   970  N  N   . ASP A 1 122 ? -12.619 -3.079  17.957 1.00 56.39  ? 249 ASP A N   1 
ATOM   971  C  CA  . ASP A 1 122 ? -12.089 -1.850  17.343 1.00 56.30  ? 249 ASP A CA  1 
ATOM   972  C  C   . ASP A 1 122 ? -12.654 -0.600  18.003 1.00 55.07  ? 249 ASP A C   1 
ATOM   973  O  O   . ASP A 1 122 ? -11.943 0.380   18.159 1.00 55.78  ? 249 ASP A O   1 
ATOM   974  C  CB  . ASP A 1 122 ? -12.405 -1.787  15.843 1.00 59.13  ? 249 ASP A CB  1 
ATOM   975  C  CG  . ASP A 1 122 ? -11.644 -2.816  15.030 1.00 61.31  ? 249 ASP A CG  1 
ATOM   976  O  OD1 . ASP A 1 122 ? -10.663 -3.402  15.542 1.00 60.06  ? 249 ASP A OD1 1 
ATOM   977  O  OD2 . ASP A 1 122 ? -12.038 -3.032  13.862 1.00 64.29  ? 249 ASP A OD2 1 
ATOM   978  N  N   . ALA A 1 123 ? -13.929 -0.641  18.387 1.00 55.08  ? 250 ALA A N   1 
ATOM   979  C  CA  . ALA A 1 123 ? -14.576 0.471   19.100 1.00 54.73  ? 250 ALA A CA  1 
ATOM   980  C  C   . ALA A 1 123 ? -13.864 0.829   20.404 1.00 51.77  ? 250 ALA A C   1 
ATOM   981  O  O   . ALA A 1 123 ? -14.014 1.930   20.898 1.00 49.65  ? 250 ALA A O   1 
ATOM   982  C  CB  . ALA A 1 123 ? -16.041 0.141   19.387 1.00 53.69  ? 250 ALA A CB  1 
ATOM   983  N  N   . ALA A 1 124 ? -13.109 -0.109  20.963 1.00 52.35  ? 251 ALA A N   1 
ATOM   984  C  CA  . ALA A 1 124 ? -12.367 0.120   22.193 1.00 54.74  ? 251 ALA A CA  1 
ATOM   985  C  C   . ALA A 1 124 ? -10.903 0.470   21.952 1.00 56.94  ? 251 ALA A C   1 
ATOM   986  O  O   . ALA A 1 124 ? -10.143 0.576   22.908 1.00 54.87  ? 251 ALA A O   1 
ATOM   987  C  CB  . ALA A 1 124 ? -12.453 -1.108  23.070 1.00 55.07  ? 251 ALA A CB  1 
ATOM   988  N  N   . LYS A 1 125 ? -10.510 0.669   20.693 1.00 60.08  ? 252 LYS A N   1 
ATOM   989  C  CA  . LYS A 1 125 ? -9.096  0.890   20.344 1.00 62.75  ? 252 LYS A CA  1 
ATOM   990  C  C   . LYS A 1 125 ? -8.406  1.973   21.192 1.00 63.46  ? 252 LYS A C   1 
ATOM   991  O  O   . LYS A 1 125 ? -7.270  1.782   21.630 1.00 63.11  ? 252 LYS A O   1 
ATOM   992  C  CB  . LYS A 1 125 ? -8.920  1.171   18.832 1.00 66.44  ? 252 LYS A CB  1 
ATOM   993  C  CG  . LYS A 1 125 ? -9.240  2.610   18.338 1.00 69.49  ? 252 LYS A CG  1 
ATOM   994  C  CD  . LYS A 1 125 ? -10.735 2.951   18.342 1.00 69.89  ? 252 LYS A CD  1 
ATOM   995  C  CE  . LYS A 1 125 ? -11.005 4.414   18.024 1.00 69.95  ? 252 LYS A CE  1 
ATOM   996  N  NZ  . LYS A 1 125 ? -12.469 4.677   17.898 1.00 69.99  ? 252 LYS A NZ  1 
ATOM   997  N  N   . ASP A 1 126 ? -9.104  3.081   21.445 1.00 64.35  ? 253 ASP A N   1 
ATOM   998  C  CA  . ASP A 1 126 ? -8.522  4.230   22.153 1.00 63.80  ? 253 ASP A CA  1 
ATOM   999  C  C   . ASP A 1 126 ? -8.755  4.214   23.678 1.00 63.07  ? 253 ASP A C   1 
ATOM   1000 O  O   . ASP A 1 126 ? -8.573  5.237   24.349 1.00 63.00  ? 253 ASP A O   1 
ATOM   1001 C  CB  . ASP A 1 126 ? -9.044  5.543   21.541 1.00 68.85  ? 253 ASP A CB  1 
ATOM   1002 C  CG  . ASP A 1 126 ? -8.409  5.864   20.180 1.00 71.14  ? 253 ASP A CG  1 
ATOM   1003 O  OD1 . ASP A 1 126 ? -7.519  5.119   19.709 1.00 71.94  ? 253 ASP A OD1 1 
ATOM   1004 O  OD2 . ASP A 1 126 ? -8.804  6.883   19.576 1.00 73.99  ? 253 ASP A OD2 1 
ATOM   1005 N  N   . ILE A 1 127 ? -9.146  3.054   24.210 1.00 60.01  ? 254 ILE A N   1 
ATOM   1006 C  CA  . ILE A 1 127 ? -9.230  2.812   25.654 1.00 58.97  ? 254 ILE A CA  1 
ATOM   1007 C  C   . ILE A 1 127 ? -8.043  1.938   26.072 1.00 61.77  ? 254 ILE A C   1 
ATOM   1008 O  O   . ILE A 1 127 ? -7.794  0.914   25.448 1.00 61.34  ? 254 ILE A O   1 
ATOM   1009 C  CB  . ILE A 1 127 ? -10.530 2.068   26.024 1.00 57.59  ? 254 ILE A CB  1 
ATOM   1010 C  CG1 . ILE A 1 127 ? -11.760 2.873   25.590 1.00 58.04  ? 254 ILE A CG1 1 
ATOM   1011 C  CG2 . ILE A 1 127 ? -10.591 1.779   27.517 1.00 57.20  ? 254 ILE A CG2 1 
ATOM   1012 C  CD1 . ILE A 1 127 ? -13.071 2.163   25.810 1.00 54.42  ? 254 ILE A CD1 1 
ATOM   1013 N  N   . ILE A 1 128 ? -7.310  2.347   27.111 1.00 62.36  ? 255 ILE A N   1 
ATOM   1014 C  CA  . ILE A 1 128 ? -6.242  1.520   27.685 1.00 62.04  ? 255 ILE A CA  1 
ATOM   1015 C  C   . ILE A 1 128 ? -6.869  0.297   28.338 1.00 61.16  ? 255 ILE A C   1 
ATOM   1016 O  O   . ILE A 1 128 ? -7.696  0.438   29.227 1.00 60.28  ? 255 ILE A O   1 
ATOM   1017 C  CB  . ILE A 1 128 ? -5.427  2.285   28.759 1.00 65.01  ? 255 ILE A CB  1 
ATOM   1018 C  CG1 . ILE A 1 128 ? -4.688  3.471   28.140 1.00 63.17  ? 255 ILE A CG1 1 
ATOM   1019 C  CG2 . ILE A 1 128 ? -4.400  1.368   29.434 1.00 64.36  ? 255 ILE A CG2 1 
ATOM   1020 C  CD1 . ILE A 1 128 ? -4.249  4.502   29.168 1.00 65.67  ? 255 ILE A CD1 1 
ATOM   1021 N  N   . ARG A 1 129 ? -6.476  -0.897  27.895 1.00 61.63  ? 256 ARG A N   1 
ATOM   1022 C  CA  . ARG A 1 129 ? -7.066  -2.146  28.379 1.00 62.73  ? 256 ARG A CA  1 
ATOM   1023 C  C   . ARG A 1 129 ? -6.054  -2.998  29.133 1.00 60.47  ? 256 ARG A C   1 
ATOM   1024 O  O   . ARG A 1 129 ? -5.082  -3.491  28.546 1.00 58.69  ? 256 ARG A O   1 
ATOM   1025 C  CB  . ARG A 1 129 ? -7.643  -2.933  27.207 1.00 62.16  ? 256 ARG A CB  1 
ATOM   1026 C  CG  . ARG A 1 129 ? -8.706  -2.157  26.441 1.00 64.94  ? 256 ARG A CG  1 
ATOM   1027 C  CD  . ARG A 1 129 ? -9.083  -2.803  25.124 1.00 67.95  ? 256 ARG A CD  1 
ATOM   1028 N  NE  . ARG A 1 129 ? -7.937  -3.080  24.255 1.00 69.66  ? 256 ARG A NE  1 
ATOM   1029 C  CZ  . ARG A 1 129 ? -7.432  -2.255  23.349 1.00 69.13  ? 256 ARG A CZ  1 
ATOM   1030 N  NH1 . ARG A 1 129 ? -7.931  -1.045  23.167 1.00 72.44  ? 256 ARG A NH1 1 
ATOM   1031 N  NH2 . ARG A 1 129 ? -6.397  -2.649  22.627 1.00 70.99  ? 256 ARG A NH2 1 
ATOM   1032 N  N   . TYR A 1 130 ? -6.272  -3.128  30.440 1.00 60.80  ? 257 TYR A N   1 
ATOM   1033 C  CA  . TYR A 1 130 ? -5.531  -4.069  31.281 1.00 63.20  ? 257 TYR A CA  1 
ATOM   1034 C  C   . TYR A 1 130 ? -6.353  -5.338  31.444 1.00 61.84  ? 257 TYR A C   1 
ATOM   1035 O  O   . TYR A 1 130 ? -7.528  -5.260  31.762 1.00 63.73  ? 257 TYR A O   1 
ATOM   1036 C  CB  . TYR A 1 130 ? -5.277  -3.484  32.671 1.00 61.83  ? 257 TYR A CB  1 
ATOM   1037 C  CG  . TYR A 1 130 ? -4.143  -2.503  32.727 1.00 62.51  ? 257 TYR A CG  1 
ATOM   1038 C  CD1 . TYR A 1 130 ? -4.372  -1.147  32.536 1.00 62.26  ? 257 TYR A CD1 1 
ATOM   1039 C  CD2 . TYR A 1 130 ? -2.840  -2.924  32.980 1.00 60.92  ? 257 TYR A CD2 1 
ATOM   1040 C  CE1 . TYR A 1 130 ? -3.338  -0.237  32.581 1.00 62.96  ? 257 TYR A CE1 1 
ATOM   1041 C  CE2 . TYR A 1 130 ? -1.793  -2.009  33.033 1.00 60.30  ? 257 TYR A CE2 1 
ATOM   1042 C  CZ  . TYR A 1 130 ? -2.054  -0.666  32.835 1.00 60.23  ? 257 TYR A CZ  1 
ATOM   1043 O  OH  . TYR A 1 130 ? -1.047  0.267   32.881 1.00 62.81  ? 257 TYR A OH  1 
ATOM   1044 N  N   . ILE A 1 131 ? -5.733  -6.501  31.253 1.00 64.32  ? 258 ILE A N   1 
ATOM   1045 C  CA  . ILE A 1 131 ? -6.431  -7.776  31.387 1.00 61.90  ? 258 ILE A CA  1 
ATOM   1046 C  C   . ILE A 1 131 ? -5.990  -8.538  32.627 1.00 58.70  ? 258 ILE A C   1 
ATOM   1047 O  O   . ILE A 1 131 ? -4.797  -8.722  32.855 1.00 58.08  ? 258 ILE A O   1 
ATOM   1048 C  CB  . ILE A 1 131 ? -6.213  -8.663  30.165 1.00 64.72  ? 258 ILE A CB  1 
ATOM   1049 C  CG1 . ILE A 1 131 ? -6.494  -7.874  28.885 1.00 66.96  ? 258 ILE A CG1 1 
ATOM   1050 C  CG2 . ILE A 1 131 ? -7.110  -9.878  30.239 1.00 66.86  ? 258 ILE A CG2 1 
ATOM   1051 C  CD1 . ILE A 1 131 ? -7.835  -7.207  28.853 1.00 64.69  ? 258 ILE A CD1 1 
ATOM   1052 N  N   . ILE A 1 132 ? -6.964  -8.972  33.426 1.00 58.35  ? 259 ILE A N   1 
ATOM   1053 C  CA  . ILE A 1 132 ? -6.695  -9.752  34.635 1.00 58.76  ? 259 ILE A CA  1 
ATOM   1054 C  C   . ILE A 1 132 ? -7.255  -11.159 34.453 1.00 59.14  ? 259 ILE A C   1 
ATOM   1055 O  O   . ILE A 1 132 ? -8.463  -11.349 34.461 1.00 59.61  ? 259 ILE A O   1 
ATOM   1056 C  CB  . ILE A 1 132 ? -7.309  -9.109  35.893 1.00 58.68  ? 259 ILE A CB  1 
ATOM   1057 C  CG1 . ILE A 1 132 ? -6.819  -7.669  36.063 1.00 58.07  ? 259 ILE A CG1 1 
ATOM   1058 C  CG2 . ILE A 1 132 ? -6.947  -9.911  37.128 1.00 58.77  ? 259 ILE A CG2 1 
ATOM   1059 C  CD1 . ILE A 1 132 ? -5.350  -7.542  36.322 1.00 57.32  ? 259 ILE A CD1 1 
ATOM   1060 N  N   . GLY A 1 133 ? -6.365  -12.134 34.277 1.00 57.08  ? 260 GLY A N   1 
ATOM   1061 C  CA  . GLY A 1 133 ? -6.760  -13.524 34.092 1.00 56.67  ? 260 GLY A CA  1 
ATOM   1062 C  C   . GLY A 1 133 ? -6.985  -14.237 35.412 1.00 56.65  ? 260 GLY A C   1 
ATOM   1063 O  O   . GLY A 1 133 ? -6.263  -14.016 36.370 1.00 57.41  ? 260 GLY A O   1 
ATOM   1064 N  N   . ILE A 1 134 ? -7.992  -15.100 35.454 1.00 57.01  ? 261 ILE A N   1 
ATOM   1065 C  CA  . ILE A 1 134 ? -8.349  -15.846 36.657 1.00 57.66  ? 261 ILE A CA  1 
ATOM   1066 C  C   . ILE A 1 134 ? -9.069  -17.123 36.208 1.00 59.61  ? 261 ILE A C   1 
ATOM   1067 O  O   . ILE A 1 134 ? -9.672  -17.139 35.141 1.00 60.98  ? 261 ILE A O   1 
ATOM   1068 C  CB  . ILE A 1 134 ? -9.251  -14.986 37.603 1.00 59.47  ? 261 ILE A CB  1 
ATOM   1069 C  CG1 . ILE A 1 134 ? -9.626  -15.748 38.878 1.00 59.88  ? 261 ILE A CG1 1 
ATOM   1070 C  CG2 . ILE A 1 134 ? -10.521 -14.539 36.895 1.00 59.80  ? 261 ILE A CG2 1 
ATOM   1071 C  CD1 . ILE A 1 134 ? -10.213 -14.867 39.961 1.00 57.04  ? 261 ILE A CD1 1 
ATOM   1072 N  N   . GLY A 1 135 ? -8.982  -18.189 36.997 1.00 55.88  ? 262 GLY A N   1 
ATOM   1073 C  CA  . GLY A 1 135 ? -9.742  -19.408 36.726 1.00 55.81  ? 262 GLY A CA  1 
ATOM   1074 C  C   . GLY A 1 135 ? -8.958  -20.478 35.994 1.00 55.75  ? 262 GLY A C   1 
ATOM   1075 O  O   . GLY A 1 135 ? -8.042  -20.184 35.223 1.00 55.88  ? 262 GLY A O   1 
ATOM   1076 N  N   . LYS A 1 136 ? -9.320  -21.735 36.241 1.00 55.42  ? 263 LYS A N   1 
ATOM   1077 C  CA  . LYS A 1 136 ? -8.659  -22.867 35.590 1.00 53.79  ? 263 LYS A CA  1 
ATOM   1078 C  C   . LYS A 1 136 ? -8.682  -22.762 34.063 1.00 54.29  ? 263 LYS A C   1 
ATOM   1079 O  O   . LYS A 1 136 ? -7.768  -23.238 33.404 1.00 57.18  ? 263 LYS A O   1 
ATOM   1080 C  CB  . LYS A 1 136 ? -9.276  -24.204 36.035 1.00 51.54  ? 263 LYS A CB  1 
ATOM   1081 C  CG  . LYS A 1 136 ? -10.751 -24.371 35.694 1.00 50.54  ? 263 LYS A CG  1 
ATOM   1082 C  CD  . LYS A 1 136 ? -11.328 -25.640 36.279 1.00 50.45  ? 263 LYS A CD  1 
ATOM   1083 C  CE  . LYS A 1 136 ? -11.689 -25.499 37.759 1.00 49.95  ? 263 LYS A CE  1 
ATOM   1084 N  NZ  . LYS A 1 136 ? -12.671 -24.408 38.016 1.00 48.79  ? 263 LYS A NZ  1 
ATOM   1085 N  N   . HIS A 1 137 ? -9.708  -22.126 33.501 1.00 54.18  ? 264 HIS A N   1 
ATOM   1086 C  CA  . HIS A 1 137 ? -9.855  -22.068 32.044 1.00 57.35  ? 264 HIS A CA  1 
ATOM   1087 C  C   . HIS A 1 137 ? -8.976  -21.009 31.360 1.00 60.92  ? 264 HIS A C   1 
ATOM   1088 O  O   . HIS A 1 137 ? -8.925  -20.939 30.135 1.00 66.76  ? 264 HIS A O   1 
ATOM   1089 C  CB  . HIS A 1 137 ? -11.323 -21.905 31.665 1.00 55.88  ? 264 HIS A CB  1 
ATOM   1090 C  CG  . HIS A 1 137 ? -12.191 -23.032 32.133 1.00 54.33  ? 264 HIS A CG  1 
ATOM   1091 N  ND1 . HIS A 1 137 ? -11.885 -24.355 31.898 1.00 57.28  ? 264 HIS A ND1 1 
ATOM   1092 C  CD2 . HIS A 1 137 ? -13.349 -23.035 32.833 1.00 56.77  ? 264 HIS A CD2 1 
ATOM   1093 C  CE1 . HIS A 1 137 ? -12.820 -25.125 32.427 1.00 56.67  ? 264 HIS A CE1 1 
ATOM   1094 N  NE2 . HIS A 1 137 ? -13.721 -24.349 33.002 1.00 54.59  ? 264 HIS A NE2 1 
ATOM   1095 N  N   . SER A 1 138 ? -8.259  -20.212 32.146 1.00 59.19  ? 265 SER A N   1 
ATOM   1096 C  CA  . SER A 1 138 ? -7.324  -19.236 31.597 1.00 60.11  ? 265 SER A CA  1 
ATOM   1097 C  C   . SER A 1 138 ? -6.015  -19.883 31.133 1.00 63.72  ? 265 SER A C   1 
ATOM   1098 O  O   . SER A 1 138 ? -5.205  -19.239 30.467 1.00 63.70  ? 265 SER A O   1 
ATOM   1099 C  CB  . SER A 1 138 ? -7.031  -18.156 32.641 1.00 58.86  ? 265 SER A CB  1 
ATOM   1100 O  OG  . SER A 1 138 ? -6.354  -18.697 33.761 1.00 58.82  ? 265 SER A OG  1 
ATOM   1101 N  N   . GLN A 1 139 ? -5.826  -21.157 31.475 1.00 66.46  ? 266 GLN A N   1 
ATOM   1102 C  CA  . GLN A 1 139 ? -4.561  -21.850 31.275 1.00 66.89  ? 266 GLN A CA  1 
ATOM   1103 C  C   . GLN A 1 139 ? -4.399  -22.471 29.894 1.00 66.84  ? 266 GLN A C   1 
ATOM   1104 O  O   . GLN A 1 139 ? -3.325  -22.955 29.572 1.00 69.44  ? 266 GLN A O   1 
ATOM   1105 C  CB  . GLN A 1 139 ? -4.392  -22.946 32.334 1.00 70.28  ? 266 GLN A CB  1 
ATOM   1106 C  CG  . GLN A 1 139 ? -4.529  -22.462 33.774 1.00 72.91  ? 266 GLN A CG  1 
ATOM   1107 C  CD  . GLN A 1 139 ? -3.601  -21.306 34.100 1.00 75.04  ? 266 GLN A CD  1 
ATOM   1108 O  OE1 . GLN A 1 139 ? -2.403  -21.366 33.828 1.00 78.02  ? 266 GLN A OE1 1 
ATOM   1109 N  NE2 . GLN A 1 139 ? -4.151  -20.247 34.690 1.00 76.42  ? 266 GLN A NE2 1 
ATOM   1110 N  N   . THR A 1 140 ? -5.445  -22.465 29.079 1.00 66.66  ? 267 THR A N   1 
ATOM   1111 C  CA  . THR A 1 140 ? -5.349  -23.038 27.741 1.00 67.10  ? 267 THR A CA  1 
ATOM   1112 C  C   . THR A 1 140 ? -4.665  -22.049 26.804 1.00 67.72  ? 267 THR A C   1 
ATOM   1113 O  O   . THR A 1 140 ? -4.624  -20.850 27.085 1.00 67.84  ? 267 THR A O   1 
ATOM   1114 C  CB  . THR A 1 140 ? -6.729  -23.394 27.174 1.00 66.09  ? 267 THR A CB  1 
ATOM   1115 O  OG1 . THR A 1 140 ? -7.506  -22.203 27.033 1.00 67.18  ? 267 THR A OG1 1 
ATOM   1116 C  CG2 . THR A 1 140 ? -7.456  -24.373 28.092 1.00 64.99  ? 267 THR A CG2 1 
ATOM   1117 N  N   . LYS A 1 141 ? -4.133  -22.559 25.694 1.00 65.26  ? 268 LYS A N   1 
ATOM   1118 C  CA  . LYS A 1 141 ? -3.503  -21.716 24.679 1.00 67.63  ? 268 LYS A CA  1 
ATOM   1119 C  C   . LYS A 1 141 ? -4.496  -20.714 24.106 1.00 67.39  ? 268 LYS A C   1 
ATOM   1120 O  O   . LYS A 1 141 ? -4.161  -19.541 23.933 1.00 69.37  ? 268 LYS A O   1 
ATOM   1121 C  CB  . LYS A 1 141 ? -2.918  -22.558 23.537 1.00 68.47  ? 268 LYS A CB  1 
ATOM   1122 C  CG  . LYS A 1 141 ? -1.687  -23.364 23.906 1.00 69.37  ? 268 LYS A CG  1 
ATOM   1123 C  CD  . LYS A 1 141 ? -1.412  -24.443 22.855 1.00 70.09  ? 268 LYS A CD  1 
ATOM   1124 C  CE  . LYS A 1 141 ? -0.251  -25.352 23.228 1.00 69.96  ? 268 LYS A CE  1 
ATOM   1125 N  NZ  . LYS A 1 141 ? 1.058   -24.809 22.775 1.00 71.22  ? 268 LYS A NZ  1 
ATOM   1126 N  N   . GLU A 1 142 ? -5.713  -21.176 23.823 1.00 67.43  ? 269 GLU A N   1 
ATOM   1127 C  CA  . GLU A 1 142 ? -6.724  -20.337 23.191 1.00 67.62  ? 269 GLU A CA  1 
ATOM   1128 C  C   . GLU A 1 142 ? -7.142  -19.204 24.115 1.00 64.48  ? 269 GLU A C   1 
ATOM   1129 O  O   . GLU A 1 142 ? -7.339  -18.077 23.656 1.00 65.01  ? 269 GLU A O   1 
ATOM   1130 C  CB  . GLU A 1 142 ? -7.953  -21.155 22.769 1.00 71.01  ? 269 GLU A CB  1 
ATOM   1131 C  CG  . GLU A 1 142 ? -8.844  -20.422 21.755 1.00 73.60  ? 269 GLU A CG  1 
ATOM   1132 C  CD  . GLU A 1 142 ? -10.272 -20.962 21.695 1.00 76.99  ? 269 GLU A CD  1 
ATOM   1133 O  OE1 . GLU A 1 142 ? -10.446 -22.188 21.503 1.00 81.17  ? 269 GLU A OE1 1 
ATOM   1134 O  OE2 . GLU A 1 142 ? -11.223 -20.154 21.829 1.00 81.36  ? 269 GLU A OE2 1 
ATOM   1135 N  N   . SER A 1 143 ? -7.278  -19.505 25.407 1.00 60.98  ? 270 SER A N   1 
ATOM   1136 C  CA  . SER A 1 143 ? -7.608  -18.484 26.405 1.00 63.39  ? 270 SER A CA  1 
ATOM   1137 C  C   . SER A 1 143 ? -6.484  -17.464 26.548 1.00 62.25  ? 270 SER A C   1 
ATOM   1138 O  O   . SER A 1 143 ? -6.736  -16.269 26.589 1.00 63.02  ? 270 SER A O   1 
ATOM   1139 C  CB  . SER A 1 143 ? -7.922  -19.117 27.761 1.00 63.37  ? 270 SER A CB  1 
ATOM   1140 O  OG  . SER A 1 143 ? -9.184  -19.762 27.725 1.00 63.96  ? 270 SER A OG  1 
ATOM   1141 N  N   . GLN A 1 144 ? -5.244  -17.936 26.595 1.00 63.81  ? 271 GLN A N   1 
ATOM   1142 C  CA  . GLN A 1 144 ? -4.100  -17.038 26.688 1.00 63.92  ? 271 GLN A CA  1 
ATOM   1143 C  C   . GLN A 1 144 ? -4.025  -16.110 25.475 1.00 63.70  ? 271 GLN A C   1 
ATOM   1144 O  O   . GLN A 1 144 ? -3.796  -14.908 25.623 1.00 63.53  ? 271 GLN A O   1 
ATOM   1145 C  CB  . GLN A 1 144 ? -2.805  -17.833 26.863 1.00 68.65  ? 271 GLN A CB  1 
ATOM   1146 C  CG  . GLN A 1 144 ? -2.684  -18.500 28.235 1.00 72.55  ? 271 GLN A CG  1 
ATOM   1147 C  CD  . GLN A 1 144 ? -2.456  -17.506 29.368 1.00 75.80  ? 271 GLN A CD  1 
ATOM   1148 O  OE1 . GLN A 1 144 ? -1.597  -16.629 29.276 1.00 80.87  ? 271 GLN A OE1 1 
ATOM   1149 N  NE2 . GLN A 1 144 ? -3.214  -17.650 30.447 1.00 73.48  ? 271 GLN A NE2 1 
ATOM   1150 N  N   . GLU A 1 145 ? -4.244  -16.667 24.287 1.00 60.65  ? 272 GLU A N   1 
ATOM   1151 C  CA  . GLU A 1 145 ? -4.316  -15.873 23.063 1.00 61.49  ? 272 GLU A CA  1 
ATOM   1152 C  C   . GLU A 1 145 ? -5.478  -14.888 23.084 1.00 60.54  ? 272 GLU A C   1 
ATOM   1153 O  O   . GLU A 1 145 ? -5.331  -13.756 22.627 1.00 59.38  ? 272 GLU A O   1 
ATOM   1154 C  CB  . GLU A 1 145 ? -4.441  -16.779 21.841 1.00 62.64  ? 272 GLU A CB  1 
ATOM   1155 C  CG  . GLU A 1 145 ? -3.164  -17.524 21.513 1.00 64.99  ? 272 GLU A CG  1 
ATOM   1156 C  CD  . GLU A 1 145 ? -3.302  -18.422 20.300 1.00 67.02  ? 272 GLU A CD  1 
ATOM   1157 O  OE1 . GLU A 1 145 ? -4.408  -18.463 19.717 1.00 71.47  ? 272 GLU A OE1 1 
ATOM   1158 O  OE2 . GLU A 1 145 ? -2.304  -19.081 19.930 1.00 65.59  ? 272 GLU A OE2 1 
ATOM   1159 N  N   . THR A 1 146 ? -6.629  -15.304 23.614 1.00 59.14  ? 273 THR A N   1 
ATOM   1160 C  CA  . THR A 1 146 ? -7.768  -14.393 23.727 1.00 60.06  ? 273 THR A CA  1 
ATOM   1161 C  C   . THR A 1 146 ? -7.449  -13.220 24.656 1.00 61.62  ? 273 THR A C   1 
ATOM   1162 O  O   . THR A 1 146 ? -7.694  -12.069 24.304 1.00 64.85  ? 273 THR A O   1 
ATOM   1163 C  CB  . THR A 1 146 ? -9.057  -15.100 24.196 1.00 60.47  ? 273 THR A CB  1 
ATOM   1164 O  OG1 . THR A 1 146 ? -9.347  -16.194 23.318 1.00 59.10  ? 273 THR A OG1 1 
ATOM   1165 C  CG2 . THR A 1 146 ? -10.232 -14.131 24.180 1.00 58.47  ? 273 THR A CG2 1 
ATOM   1166 N  N   . LEU A 1 147 ? -6.889  -13.506 25.825 1.00 61.87  ? 274 LEU A N   1 
ATOM   1167 C  CA  . LEU A 1 147 ? -6.537  -12.446 26.777 1.00 62.06  ? 274 LEU A CA  1 
ATOM   1168 C  C   . LEU A 1 147 ? -5.596  -11.424 26.134 1.00 63.05  ? 274 LEU A C   1 
ATOM   1169 O  O   . LEU A 1 147 ? -5.774  -10.218 26.295 1.00 64.34  ? 274 LEU A O   1 
ATOM   1170 C  CB  . LEU A 1 147 ? -5.879  -13.029 28.037 1.00 60.94  ? 274 LEU A CB  1 
ATOM   1171 C  CG  . LEU A 1 147 ? -6.741  -13.944 28.921 1.00 59.70  ? 274 LEU A CG  1 
ATOM   1172 C  CD1 . LEU A 1 147 ? -5.888  -14.540 30.040 1.00 59.06  ? 274 LEU A CD1 1 
ATOM   1173 C  CD2 . LEU A 1 147 ? -7.941  -13.221 29.480 1.00 54.90  ? 274 LEU A CD2 1 
ATOM   1174 N  N   . HIS A 1 148 ? -4.602  -11.910 25.406 1.00 61.27  ? 275 HIS A N   1 
ATOM   1175 C  CA  . HIS A 1 148 ? -3.669  -11.029 24.712 1.00 65.62  ? 275 HIS A CA  1 
ATOM   1176 C  C   . HIS A 1 148 ? -4.319  -10.226 23.574 1.00 66.56  ? 275 HIS A C   1 
ATOM   1177 O  O   . HIS A 1 148 ? -3.926  -9.088  23.317 1.00 66.46  ? 275 HIS A O   1 
ATOM   1178 C  CB  . HIS A 1 148 ? -2.461  -11.826 24.204 1.00 68.52  ? 275 HIS A CB  1 
ATOM   1179 C  CG  . HIS A 1 148 ? -1.508  -12.219 25.292 1.00 70.70  ? 275 HIS A CG  1 
ATOM   1180 N  ND1 . HIS A 1 148 ? -1.898  -12.945 26.398 1.00 73.06  ? 275 HIS A ND1 1 
ATOM   1181 C  CD2 . HIS A 1 148 ? -0.187  -11.974 25.452 1.00 72.66  ? 275 HIS A CD2 1 
ATOM   1182 C  CE1 . HIS A 1 148 ? -0.857  -13.136 27.188 1.00 71.72  ? 275 HIS A CE1 1 
ATOM   1183 N  NE2 . HIS A 1 148 ? 0.193   -12.557 26.637 1.00 73.77  ? 275 HIS A NE2 1 
ATOM   1184 N  N   . LYS A 1 149 ? -5.299  -10.817 22.898 1.00 67.50  ? 276 LYS A N   1 
ATOM   1185 C  CA  . LYS A 1 149 ? -6.081  -10.102 21.884 1.00 67.30  ? 276 LYS A CA  1 
ATOM   1186 C  C   . LYS A 1 149 ? -6.762  -8.872  22.504 1.00 69.00  ? 276 LYS A C   1 
ATOM   1187 O  O   . LYS A 1 149 ? -6.770  -7.798  21.902 1.00 69.69  ? 276 LYS A O   1 
ATOM   1188 C  CB  . LYS A 1 149 ? -7.106  -11.052 21.228 1.00 70.83  ? 276 LYS A CB  1 
ATOM   1189 C  CG  . LYS A 1 149 ? -8.266  -10.400 20.451 1.00 71.70  ? 276 LYS A CG  1 
ATOM   1190 C  CD  . LYS A 1 149 ? -7.921  -10.119 18.994 1.00 75.36  ? 276 LYS A CD  1 
ATOM   1191 C  CE  . LYS A 1 149 ? -9.087  -9.448  18.240 1.00 76.21  ? 276 LYS A CE  1 
ATOM   1192 N  NZ  . LYS A 1 149 ? -9.246  -7.973  18.519 1.00 75.93  ? 276 LYS A NZ  1 
ATOM   1193 N  N   . PHE A 1 150 ? -7.313  -9.025  23.708 1.00 67.61  ? 277 PHE A N   1 
ATOM   1194 C  CA  . PHE A 1 150 ? -8.034  -7.933  24.376 1.00 65.59  ? 277 PHE A CA  1 
ATOM   1195 C  C   . PHE A 1 150 ? -7.128  -6.844  24.926 1.00 67.61  ? 277 PHE A C   1 
ATOM   1196 O  O   . PHE A 1 150 ? -7.547  -5.706  25.029 1.00 67.72  ? 277 PHE A O   1 
ATOM   1197 C  CB  . PHE A 1 150 ? -8.892  -8.452  25.537 1.00 63.61  ? 277 PHE A CB  1 
ATOM   1198 C  CG  . PHE A 1 150 ? -10.001 -9.384  25.129 1.00 62.83  ? 277 PHE A CG  1 
ATOM   1199 C  CD1 . PHE A 1 150 ? -10.671 -9.234  23.921 1.00 62.39  ? 277 PHE A CD1 1 
ATOM   1200 C  CD2 . PHE A 1 150 ? -10.400 -10.400 25.984 1.00 64.09  ? 277 PHE A CD2 1 
ATOM   1201 C  CE1 . PHE A 1 150 ? -11.694 -10.096 23.570 1.00 62.27  ? 277 PHE A CE1 1 
ATOM   1202 C  CE2 . PHE A 1 150 ? -11.420 -11.259 25.633 1.00 62.93  ? 277 PHE A CE2 1 
ATOM   1203 C  CZ  . PHE A 1 150 ? -12.062 -11.108 24.422 1.00 62.01  ? 277 PHE A CZ  1 
ATOM   1204 N  N   . ALA A 1 151 ? -5.903  -7.198  25.290 1.00 68.96  ? 278 ALA A N   1 
ATOM   1205 C  CA  . ALA A 1 151 ? -5.006  -6.279  25.979 1.00 68.92  ? 278 ALA A CA  1 
ATOM   1206 C  C   . ALA A 1 151 ? -4.505  -5.159  25.072 1.00 70.61  ? 278 ALA A C   1 
ATOM   1207 O  O   . ALA A 1 151 ? -4.447  -5.311  23.853 1.00 69.79  ? 278 ALA A O   1 
ATOM   1208 C  CB  . ALA A 1 151 ? -3.806  -7.053  26.554 1.00 71.19  ? 278 ALA A CB  1 
ATOM   1209 N  N   . SER A 1 152 ? -4.148  -4.031  25.683 1.00 69.48  ? 279 SER A N   1 
ATOM   1210 C  CA  . SER A 1 152 ? -3.376  -3.006  25.000 1.00 67.28  ? 279 SER A CA  1 
ATOM   1211 C  C   . SER A 1 152 ? -1.974  -3.557  24.810 1.00 67.93  ? 279 SER A C   1 
ATOM   1212 O  O   . SER A 1 152 ? -1.560  -4.472  25.528 1.00 65.39  ? 279 SER A O   1 
ATOM   1213 C  CB  . SER A 1 152 ? -3.316  -1.718  25.818 1.00 65.60  ? 279 SER A CB  1 
ATOM   1214 O  OG  . SER A 1 152 ? -4.608  -1.205  26.060 1.00 64.12  ? 279 SER A OG  1 
ATOM   1215 N  N   . LYS A 1 153 ? -1.246  -2.996  23.850 1.00 67.47  ? 280 LYS A N   1 
ATOM   1216 C  CA  . LYS A 1 153 ? 0.063   -3.517  23.480 1.00 69.52  ? 280 LYS A CA  1 
ATOM   1217 C  C   . LYS A 1 153 ? 1.168   -2.589  23.987 1.00 69.93  ? 280 LYS A C   1 
ATOM   1218 O  O   . LYS A 1 153 ? 1.008   -1.370  23.944 1.00 67.92  ? 280 LYS A O   1 
ATOM   1219 C  CB  . LYS A 1 153 ? 0.139   -3.700  21.963 1.00 71.70  ? 280 LYS A CB  1 
ATOM   1220 C  CG  . LYS A 1 153 ? -0.952  -4.620  21.391 1.00 74.17  ? 280 LYS A CG  1 
ATOM   1221 C  CD  . LYS A 1 153 ? -0.834  -6.058  21.922 1.00 75.61  ? 280 LYS A CD  1 
ATOM   1222 C  CE  . LYS A 1 153 ? -1.983  -6.963  21.457 1.00 73.77  ? 280 LYS A CE  1 
ATOM   1223 N  NZ  . LYS A 1 153 ? -3.210  -6.834  22.277 1.00 68.60  ? 280 LYS A NZ  1 
ATOM   1224 N  N   . PRO A 1 154 ? 2.293   -3.157  24.470 1.00 70.57  ? 281 PRO A N   1 
ATOM   1225 C  CA  . PRO A 1 154 ? 2.646   -4.582  24.508 1.00 70.11  ? 281 PRO A CA  1 
ATOM   1226 C  C   . PRO A 1 154 ? 1.893   -5.379  25.572 1.00 67.65  ? 281 PRO A C   1 
ATOM   1227 O  O   . PRO A 1 154 ? 1.969   -5.044  26.756 1.00 64.05  ? 281 PRO A O   1 
ATOM   1228 C  CB  . PRO A 1 154 ? 4.142   -4.558  24.837 1.00 70.70  ? 281 PRO A CB  1 
ATOM   1229 C  CG  . PRO A 1 154 ? 4.333   -3.316  25.608 1.00 71.06  ? 281 PRO A CG  1 
ATOM   1230 C  CD  . PRO A 1 154 ? 3.361   -2.320  25.047 1.00 71.41  ? 281 PRO A CD  1 
ATOM   1231 N  N   . ALA A 1 155 ? 1.215   -6.446  25.138 1.00 68.16  ? 282 ALA A N   1 
ATOM   1232 C  CA  . ALA A 1 155 ? 0.354   -7.260  26.005 1.00 68.60  ? 282 ALA A CA  1 
ATOM   1233 C  C   . ALA A 1 155 ? 1.084   -7.809  27.230 1.00 69.15  ? 282 ALA A C   1 
ATOM   1234 O  O   . ALA A 1 155 ? 0.477   -8.006  28.281 1.00 72.24  ? 282 ALA A O   1 
ATOM   1235 C  CB  . ALA A 1 155 ? -0.269  -8.399  25.209 1.00 68.00  ? 282 ALA A CB  1 
ATOM   1236 N  N   . SER A 1 156 ? 2.382   -8.053  27.084 1.00 68.36  ? 283 SER A N   1 
ATOM   1237 C  CA  . SER A 1 156 ? 3.252   -8.432  28.199 1.00 68.71  ? 283 SER A CA  1 
ATOM   1238 C  C   . SER A 1 156 ? 3.119   -7.513  29.417 1.00 67.45  ? 283 SER A C   1 
ATOM   1239 O  O   . SER A 1 156 ? 3.222   -7.968  30.554 1.00 66.03  ? 283 SER A O   1 
ATOM   1240 C  CB  . SER A 1 156 ? 4.717   -8.457  27.728 1.00 67.81  ? 283 SER A CB  1 
ATOM   1241 O  OG  . SER A 1 156 ? 5.609   -8.114  28.776 1.00 68.10  ? 283 SER A OG  1 
ATOM   1242 N  N   . GLU A 1 157 ? 2.907   -6.223  29.172 1.00 66.18  ? 284 GLU A N   1 
ATOM   1243 C  CA  . GLU A 1 157 ? 2.792   -5.241  30.245 1.00 64.81  ? 284 GLU A CA  1 
ATOM   1244 C  C   . GLU A 1 157 ? 1.345   -5.086  30.743 1.00 64.53  ? 284 GLU A C   1 
ATOM   1245 O  O   . GLU A 1 157 ? 1.118   -4.731  31.898 1.00 63.15  ? 284 GLU A O   1 
ATOM   1246 C  CB  . GLU A 1 157 ? 3.341   -3.887  29.780 1.00 67.31  ? 284 GLU A CB  1 
ATOM   1247 C  CG  . GLU A 1 157 ? 4.790   -3.921  29.246 1.00 70.02  ? 284 GLU A CG  1 
ATOM   1248 C  CD  . GLU A 1 157 ? 5.852   -3.970  30.340 1.00 70.90  ? 284 GLU A CD  1 
ATOM   1249 O  OE1 . GLU A 1 157 ? 6.879   -3.277  30.193 1.00 74.28  ? 284 GLU A OE1 1 
ATOM   1250 O  OE2 . GLU A 1 157 ? 5.677   -4.694  31.342 1.00 70.13  ? 284 GLU A OE2 1 
ATOM   1251 N  N   . PHE A 1 158 ? 0.374   -5.370  29.877 1.00 63.14  ? 285 PHE A N   1 
ATOM   1252 C  CA  . PHE A 1 158 ? -1.051  -5.153  30.192 1.00 63.88  ? 285 PHE A CA  1 
ATOM   1253 C  C   . PHE A 1 158 ? -1.837  -6.398  30.589 1.00 61.88  ? 285 PHE A C   1 
ATOM   1254 O  O   . PHE A 1 158 ? -3.004  -6.283  30.966 1.00 66.92  ? 285 PHE A O   1 
ATOM   1255 C  CB  . PHE A 1 158 ? -1.738  -4.469  29.013 1.00 62.52  ? 285 PHE A CB  1 
ATOM   1256 C  CG  . PHE A 1 158 ? -1.286  -3.058  28.808 1.00 63.75  ? 285 PHE A CG  1 
ATOM   1257 C  CD1 . PHE A 1 158 ? -0.188  -2.774  28.013 1.00 61.62  ? 285 PHE A CD1 1 
ATOM   1258 C  CD2 . PHE A 1 158 ? -1.934  -2.015  29.444 1.00 63.65  ? 285 PHE A CD2 1 
ATOM   1259 C  CE1 . PHE A 1 158 ? 0.241   -1.469  27.834 1.00 63.34  ? 285 PHE A CE1 1 
ATOM   1260 C  CE2 . PHE A 1 158 ? -1.514  -0.710  29.269 1.00 63.34  ? 285 PHE A CE2 1 
ATOM   1261 C  CZ  . PHE A 1 158 ? -0.420  -0.437  28.463 1.00 63.21  ? 285 PHE A CZ  1 
ATOM   1262 N  N   . VAL A 1 159 ? -1.219  -7.574  30.511 1.00 59.42  ? 286 VAL A N   1 
ATOM   1263 C  CA  . VAL A 1 159 ? -1.856  -8.820  30.936 1.00 62.40  ? 286 VAL A CA  1 
ATOM   1264 C  C   . VAL A 1 159 ? -1.255  -9.319  32.247 1.00 62.58  ? 286 VAL A C   1 
ATOM   1265 O  O   . VAL A 1 159 ? -0.046  -9.403  32.383 1.00 64.17  ? 286 VAL A O   1 
ATOM   1266 C  CB  . VAL A 1 159 ? -1.738  -9.929  29.859 1.00 59.38  ? 286 VAL A CB  1 
ATOM   1267 C  CG1 . VAL A 1 159 ? -2.383  -11.225 30.359 1.00 59.90  ? 286 VAL A CG1 1 
ATOM   1268 C  CG2 . VAL A 1 159 ? -2.374  -9.474  28.528 1.00 60.88  ? 286 VAL A CG2 1 
ATOM   1269 N  N   . LYS A 1 160 ? -2.117  -9.645  33.206 1.00 66.49  ? 287 LYS A N   1 
ATOM   1270 C  CA  . LYS A 1 160 ? -1.702  -10.142 34.512 1.00 66.71  ? 287 LYS A CA  1 
ATOM   1271 C  C   . LYS A 1 160 ? -2.580  -11.337 34.845 1.00 67.64  ? 287 LYS A C   1 
ATOM   1272 O  O   . LYS A 1 160 ? -3.755  -11.342 34.509 1.00 69.59  ? 287 LYS A O   1 
ATOM   1273 C  CB  . LYS A 1 160 ? -1.857  -9.036  35.562 1.00 71.29  ? 287 LYS A CB  1 
ATOM   1274 C  CG  . LYS A 1 160 ? -1.860  -9.488  37.035 1.00 72.15  ? 287 LYS A CG  1 
ATOM   1275 C  CD  . LYS A 1 160 ? -0.454  -9.728  37.591 1.00 75.13  ? 287 LYS A CD  1 
ATOM   1276 C  CE  . LYS A 1 160 ? -0.494  -10.310 39.016 1.00 75.82  ? 287 LYS A CE  1 
ATOM   1277 N  NZ  . LYS A 1 160 ? -1.519  -9.661  39.912 1.00 76.90  ? 287 LYS A NZ  1 
ATOM   1278 N  N   . ILE A 1 161 ? -2.017  -12.345 35.503 1.00 67.41  ? 288 ILE A N   1 
ATOM   1279 C  CA  . ILE A 1 161 ? -2.775  -13.545 35.846 1.00 67.41  ? 288 ILE A CA  1 
ATOM   1280 C  C   . ILE A 1 161 ? -2.859  -13.698 37.360 1.00 65.55  ? 288 ILE A C   1 
ATOM   1281 O  O   . ILE A 1 161 ? -1.862  -13.975 38.006 1.00 63.04  ? 288 ILE A O   1 
ATOM   1282 C  CB  . ILE A 1 161 ? -2.144  -14.815 35.219 1.00 69.85  ? 288 ILE A CB  1 
ATOM   1283 C  CG1 . ILE A 1 161 ? -2.266  -14.783 33.688 1.00 69.31  ? 288 ILE A CG1 1 
ATOM   1284 C  CG2 . ILE A 1 161 ? -2.820  -16.077 35.755 1.00 70.75  ? 288 ILE A CG2 1 
ATOM   1285 C  CD1 . ILE A 1 161 ? -3.622  -15.186 33.160 1.00 68.02  ? 288 ILE A CD1 1 
ATOM   1286 N  N   . LEU A 1 162 ? -4.057  -13.516 37.913 1.00 65.38  ? 289 LEU A N   1 
ATOM   1287 C  CA  . LEU A 1 162 ? -4.293  -13.694 39.348 1.00 64.98  ? 289 LEU A CA  1 
ATOM   1288 C  C   . LEU A 1 162 ? -4.064  -15.128 39.797 1.00 64.79  ? 289 LEU A C   1 
ATOM   1289 O  O   . LEU A 1 162 ? -4.574  -16.068 39.187 1.00 67.07  ? 289 LEU A O   1 
ATOM   1290 C  CB  . LEU A 1 162 ? -5.721  -13.282 39.722 1.00 66.29  ? 289 LEU A CB  1 
ATOM   1291 C  CG  . LEU A 1 162 ? -5.892  -11.896 40.337 1.00 68.66  ? 289 LEU A CG  1 
ATOM   1292 C  CD1 . LEU A 1 162 ? -5.054  -10.855 39.589 1.00 71.48  ? 289 LEU A CD1 1 
ATOM   1293 C  CD2 . LEU A 1 162 ? -7.367  -11.514 40.372 1.00 66.40  ? 289 LEU A CD2 1 
ATOM   1294 N  N   . ASP A 1 163 ? -3.301  -15.276 40.877 1.00 63.44  ? 290 ASP A N   1 
ATOM   1295 C  CA  . ASP A 1 163 ? -3.042  -16.571 41.493 1.00 63.54  ? 290 ASP A CA  1 
ATOM   1296 C  C   . ASP A 1 163 ? -4.106  -16.829 42.562 1.00 63.12  ? 290 ASP A C   1 
ATOM   1297 O  O   . ASP A 1 163 ? -4.085  -16.213 43.629 1.00 64.24  ? 290 ASP A O   1 
ATOM   1298 C  CB  . ASP A 1 163 ? -1.635  -16.591 42.114 1.00 63.99  ? 290 ASP A CB  1 
ATOM   1299 C  CG  . ASP A 1 163 ? -1.312  -17.903 42.814 1.00 64.20  ? 290 ASP A CG  1 
ATOM   1300 O  OD1 . ASP A 1 163 ? -1.890  -18.949 42.443 1.00 64.48  ? 290 ASP A OD1 1 
ATOM   1301 O  OD2 . ASP A 1 163 ? -0.466  -17.884 43.734 1.00 66.48  ? 290 ASP A OD2 1 
ATOM   1302 N  N   . THR A 1 164 ? -5.028  -17.744 42.269 1.00 61.53  ? 291 THR A N   1 
ATOM   1303 C  CA  . THR A 1 164 ? -6.120  -18.070 43.184 1.00 60.83  ? 291 THR A CA  1 
ATOM   1304 C  C   . THR A 1 164 ? -5.853  -19.349 43.999 1.00 58.81  ? 291 THR A C   1 
ATOM   1305 O  O   . THR A 1 164 ? -6.754  -19.876 44.651 1.00 57.88  ? 291 THR A O   1 
ATOM   1306 C  CB  . THR A 1 164 ? -7.466  -18.156 42.419 1.00 64.00  ? 291 THR A CB  1 
ATOM   1307 O  OG1 . THR A 1 164 ? -7.327  -19.004 41.271 1.00 66.57  ? 291 THR A OG1 1 
ATOM   1308 C  CG2 . THR A 1 164 ? -7.899  -16.766 41.957 1.00 62.50  ? 291 THR A CG2 1 
ATOM   1309 N  N   . GLY A 1 165 ? -4.609  -19.828 43.968 1.00 57.44  ? 292 GLY A N   1 
ATOM   1310 C  CA  . GLY A 1 165 ? -4.156  -20.909 44.847 1.00 54.73  ? 292 GLY A CA  1 
ATOM   1311 C  C   . GLY A 1 165 ? -4.356  -22.319 44.314 1.00 53.08  ? 292 GLY A C   1 
ATOM   1312 O  O   . GLY A 1 165 ? -4.382  -23.277 45.095 1.00 53.39  ? 292 GLY A O   1 
ATOM   1313 N  N   . GLU A 1 166 ? -4.463  -22.455 42.992 1.00 49.14  ? 293 GLU A N   1 
ATOM   1314 C  CA  . GLU A 1 166 ? -4.752  -23.744 42.358 1.00 46.13  ? 293 GLU A CA  1 
ATOM   1315 C  C   . GLU A 1 166 ? -3.704  -24.170 41.330 1.00 41.68  ? 293 GLU A C   1 
ATOM   1316 O  O   . GLU A 1 166 ? -3.982  -25.022 40.487 1.00 38.67  ? 293 GLU A O   1 
ATOM   1317 C  CB  . GLU A 1 166 ? -6.115  -23.686 41.665 1.00 46.72  ? 293 GLU A CB  1 
ATOM   1318 C  CG  . GLU A 1 166 ? -7.295  -23.466 42.597 1.00 46.78  ? 293 GLU A CG  1 
ATOM   1319 C  CD  . GLU A 1 166 ? -8.629  -23.676 41.897 1.00 46.06  ? 293 GLU A CD  1 
ATOM   1320 O  OE1 . GLU A 1 166 ? -8.696  -23.481 40.661 1.00 44.04  ? 293 GLU A OE1 1 
ATOM   1321 O  OE2 . GLU A 1 166 ? -9.607  -24.038 42.585 1.00 45.86  ? 293 GLU A OE2 1 
ATOM   1322 N  N   . LYS A 1 167 ? -2.505  -23.595 41.396 1.00 40.53  ? 294 LYS A N   1 
ATOM   1323 C  CA  . LYS A 1 167 ? -1.460  -23.895 40.410 1.00 40.60  ? 294 LYS A CA  1 
ATOM   1324 C  C   . LYS A 1 167 ? -0.985  -25.354 40.476 1.00 39.85  ? 294 LYS A C   1 
ATOM   1325 O  O   . LYS A 1 167 ? -0.716  -25.966 39.440 1.00 39.66  ? 294 LYS A O   1 
ATOM   1326 C  CB  . LYS A 1 167 ? -0.266  -22.949 40.573 1.00 40.39  ? 294 LYS A CB  1 
ATOM   1327 C  CG  . LYS A 1 167 ? -0.618  -21.478 40.411 1.00 39.88  ? 294 LYS A CG  1 
ATOM   1328 C  CD  . LYS A 1 167 ? 0.521   -20.674 39.789 1.00 40.33  ? 294 LYS A CD  1 
ATOM   1329 C  CE  . LYS A 1 167 ? 0.542   -20.804 38.268 1.00 39.80  ? 294 LYS A CE  1 
ATOM   1330 N  NZ  . LYS A 1 167 ? 1.517   -19.866 37.639 1.00 38.55  ? 294 LYS A NZ  1 
ATOM   1331 N  N   . LEU A 1 168 ? -0.891  -25.907 41.684 1.00 37.48  ? 295 LEU A N   1 
ATOM   1332 C  CA  . LEU A 1 168 ? -0.503  -27.310 41.853 1.00 38.28  ? 295 LEU A CA  1 
ATOM   1333 C  C   . LEU A 1 168 ? -1.527  -28.278 41.248 1.00 39.90  ? 295 LEU A C   1 
ATOM   1334 O  O   . LEU A 1 168 ? -1.142  -29.326 40.724 1.00 38.14  ? 295 LEU A O   1 
ATOM   1335 C  CB  . LEU A 1 168 ? -0.260  -27.653 43.330 1.00 35.56  ? 295 LEU A CB  1 
ATOM   1336 C  CG  . LEU A 1 168 ? 1.067   -27.165 43.919 1.00 34.33  ? 295 LEU A CG  1 
ATOM   1337 C  CD1 . LEU A 1 168 ? 1.092   -27.341 45.431 1.00 33.74  ? 295 LEU A CD1 1 
ATOM   1338 C  CD2 . LEU A 1 168 ? 2.239   -27.890 43.275 1.00 32.81  ? 295 LEU A CD2 1 
ATOM   1339 N  N   . LYS A 1 169 ? -2.818  -27.934 41.319 1.00 40.72  ? 296 LYS A N   1 
ATOM   1340 C  CA  . LYS A 1 169 ? -3.872  -28.744 40.680 1.00 40.89  ? 296 LYS A CA  1 
ATOM   1341 C  C   . LYS A 1 169 ? -3.718  -28.760 39.158 1.00 40.65  ? 296 LYS A C   1 
ATOM   1342 O  O   . LYS A 1 169 ? -3.897  -29.802 38.523 1.00 39.39  ? 296 LYS A O   1 
ATOM   1343 C  CB  . LYS A 1 169 ? -5.281  -28.257 41.065 1.00 41.26  ? 296 LYS A CB  1 
ATOM   1344 C  CG  . LYS A 1 169 ? -5.778  -28.810 42.393 1.00 41.22  ? 296 LYS A CG  1 
ATOM   1345 C  CD  . LYS A 1 169 ? -7.225  -28.429 42.684 1.00 41.13  ? 296 LYS A CD  1 
ATOM   1346 C  CE  . LYS A 1 169 ? -7.368  -26.957 43.012 1.00 40.85  ? 296 LYS A CE  1 
ATOM   1347 N  NZ  . LYS A 1 169 ? -8.689  -26.657 43.625 1.00 41.50  ? 296 LYS A NZ  1 
ATOM   1348 N  N   . ASP A 1 170 ? -3.385  -27.604 38.586 1.00 40.52  ? 297 ASP A N   1 
ATOM   1349 C  CA  . ASP A 1 170 ? -3.125  -27.491 37.153 1.00 43.34  ? 297 ASP A CA  1 
ATOM   1350 C  C   . ASP A 1 170 ? -1.903  -28.329 36.741 1.00 45.93  ? 297 ASP A C   1 
ATOM   1351 O  O   . ASP A 1 170 ? -1.887  -28.922 35.659 1.00 47.23  ? 297 ASP A O   1 
ATOM   1352 C  CB  . ASP A 1 170 ? -2.919  -26.018 36.752 1.00 43.50  ? 297 ASP A CB  1 
ATOM   1353 C  CG  . ASP A 1 170 ? -4.171  -25.146 36.975 1.00 43.91  ? 297 ASP A CG  1 
ATOM   1354 O  OD1 . ASP A 1 170 ? -5.252  -25.673 37.316 1.00 41.55  ? 297 ASP A OD1 1 
ATOM   1355 O  OD2 . ASP A 1 170 ? -4.068  -23.913 36.802 1.00 45.85  ? 297 ASP A OD2 1 
ATOM   1356 N  N   . LEU A 1 171 ? -0.893  -28.383 37.611 1.00 46.07  ? 298 LEU A N   1 
ATOM   1357 C  CA  . LEU A 1 171 ? 0.320   -29.181 37.364 1.00 45.94  ? 298 LEU A CA  1 
ATOM   1358 C  C   . LEU A 1 171 ? 0.022   -30.683 37.393 1.00 45.62  ? 298 LEU A C   1 
ATOM   1359 O  O   . LEU A 1 171 ? 0.386   -31.403 36.462 1.00 42.08  ? 298 LEU A O   1 
ATOM   1360 C  CB  . LEU A 1 171 ? 1.410   -28.841 38.393 1.00 45.29  ? 298 LEU A CB  1 
ATOM   1361 C  CG  . LEU A 1 171 ? 2.763   -29.556 38.265 1.00 45.47  ? 298 LEU A CG  1 
ATOM   1362 C  CD1 . LEU A 1 171 ? 3.403   -29.248 36.926 1.00 42.62  ? 298 LEU A CD1 1 
ATOM   1363 C  CD2 . LEU A 1 171 ? 3.693   -29.162 39.402 1.00 44.39  ? 298 LEU A CD2 1 
ATOM   1364 N  N   . PHE A 1 172 ? -0.645  -31.149 38.453 1.00 47.26  ? 299 PHE A N   1 
ATOM   1365 C  CA  . PHE A 1 172 ? -1.005  -32.567 38.568 1.00 49.26  ? 299 PHE A CA  1 
ATOM   1366 C  C   . PHE A 1 172 ? -1.782  -33.000 37.334 1.00 51.35  ? 299 PHE A C   1 
ATOM   1367 O  O   . PHE A 1 172 ? -1.452  -33.999 36.708 1.00 55.21  ? 299 PHE A O   1 
ATOM   1368 C  CB  . PHE A 1 172 ? -1.847  -32.859 39.820 1.00 49.88  ? 299 PHE A CB  1 
ATOM   1369 C  CG  . PHE A 1 172 ? -1.158  -32.534 41.120 1.00 49.52  ? 299 PHE A CG  1 
ATOM   1370 C  CD1 . PHE A 1 172 ? 0.144   -32.949 41.365 1.00 49.88  ? 299 PHE A CD1 1 
ATOM   1371 C  CD2 . PHE A 1 172 ? -1.829  -31.830 42.113 1.00 50.13  ? 299 PHE A CD2 1 
ATOM   1372 C  CE1 . PHE A 1 172 ? 0.772   -32.652 42.571 1.00 50.30  ? 299 PHE A CE1 1 
ATOM   1373 C  CE2 . PHE A 1 172 ? -1.207  -31.524 43.317 1.00 50.58  ? 299 PHE A CE2 1 
ATOM   1374 C  CZ  . PHE A 1 172 ? 0.097   -31.940 43.548 1.00 50.66  ? 299 PHE A CZ  1 
ATOM   1375 N  N   . THR A 1 173 ? -2.796  -32.223 36.978 1.00 51.29  ? 300 THR A N   1 
ATOM   1376 C  CA  . THR A 1 173 ? -3.627  -32.509 35.811 1.00 53.48  ? 300 THR A CA  1 
ATOM   1377 C  C   . THR A 1 173 ? -2.786  -32.703 34.549 1.00 55.99  ? 300 THR A C   1 
ATOM   1378 O  O   . THR A 1 173 ? -2.945  -33.704 33.849 1.00 55.70  ? 300 THR A O   1 
ATOM   1379 C  CB  . THR A 1 173 ? -4.651  -31.374 35.567 1.00 51.51  ? 300 THR A CB  1 
ATOM   1380 O  OG1 . THR A 1 173 ? -5.347  -31.090 36.785 1.00 49.27  ? 300 THR A OG1 1 
ATOM   1381 C  CG2 . THR A 1 173 ? -5.651  -31.769 34.495 1.00 51.71  ? 300 THR A CG2 1 
ATOM   1382 N  N   . GLU A 1 174 ? -1.899  -31.746 34.272 1.00 58.11  ? 301 GLU A N   1 
ATOM   1383 C  CA  . GLU A 1 174 ? -1.046  -31.786 33.082 1.00 58.74  ? 301 GLU A CA  1 
ATOM   1384 C  C   . GLU A 1 174 ? -0.090  -32.982 33.123 1.00 60.74  ? 301 GLU A C   1 
ATOM   1385 O  O   . GLU A 1 174 ? 0.032   -33.716 32.141 1.00 62.89  ? 301 GLU A O   1 
ATOM   1386 C  CB  . GLU A 1 174 ? -0.248  -30.481 32.949 1.00 60.01  ? 301 GLU A CB  1 
ATOM   1387 C  CG  . GLU A 1 174 ? 0.431   -30.287 31.586 1.00 61.52  ? 301 GLU A CG  1 
ATOM   1388 C  CD  . GLU A 1 174 ? 1.430   -29.122 31.553 1.00 62.42  ? 301 GLU A CD  1 
ATOM   1389 O  OE1 . GLU A 1 174 ? 1.939   -28.711 32.621 1.00 63.75  ? 301 GLU A OE1 1 
ATOM   1390 O  OE2 . GLU A 1 174 ? 1.715   -28.622 30.442 1.00 63.93  ? 301 GLU A OE2 1 
ATOM   1391 N  N   . LEU A 1 175 ? 0.579   -33.177 34.257 1.00 60.44  ? 302 LEU A N   1 
ATOM   1392 C  CA  . LEU A 1 175 ? 1.532   -34.284 34.404 1.00 60.87  ? 302 LEU A CA  1 
ATOM   1393 C  C   . LEU A 1 175 ? 0.837   -35.634 34.275 1.00 62.32  ? 302 LEU A C   1 
ATOM   1394 O  O   . LEU A 1 175 ? 1.338   -36.525 33.597 1.00 64.87  ? 302 LEU A O   1 
ATOM   1395 C  CB  . LEU A 1 175 ? 2.286   -34.205 35.738 1.00 56.78  ? 302 LEU A CB  1 
ATOM   1396 C  CG  . LEU A 1 175 ? 3.330   -33.093 35.878 1.00 55.10  ? 302 LEU A CG  1 
ATOM   1397 C  CD1 . LEU A 1 175 ? 3.988   -33.145 37.250 1.00 50.95  ? 302 LEU A CD1 1 
ATOM   1398 C  CD2 . LEU A 1 175 ? 4.384   -33.168 34.778 1.00 54.19  ? 302 LEU A CD2 1 
ATOM   1399 N  N   . GLN A 1 176 ? -0.324  -35.775 34.906 1.00 63.71  ? 303 GLN A N   1 
ATOM   1400 C  CA  . GLN A 1 176 ? -1.100  -37.010 34.808 1.00 65.85  ? 303 GLN A CA  1 
ATOM   1401 C  C   . GLN A 1 176 ? -1.363  -37.373 33.346 1.00 68.09  ? 303 GLN A C   1 
ATOM   1402 O  O   . GLN A 1 176 ? -1.387  -38.552 33.000 1.00 69.03  ? 303 GLN A O   1 
ATOM   1403 C  CB  . GLN A 1 176 ? -2.432  -36.893 35.561 1.00 66.88  ? 303 GLN A CB  1 
ATOM   1404 C  CG  . GLN A 1 176 ? -2.303  -36.704 37.077 1.00 67.89  ? 303 GLN A CG  1 
ATOM   1405 C  CD  . GLN A 1 176 ? -2.065  -37.985 37.841 1.00 67.80  ? 303 GLN A CD  1 
ATOM   1406 O  OE1 . GLN A 1 176 ? -1.710  -39.014 37.268 1.00 68.71  ? 303 GLN A OE1 1 
ATOM   1407 N  NE2 . GLN A 1 176 ? -2.252  -37.925 39.155 1.00 67.20  ? 303 GLN A NE2 1 
ATOM   1408 N  N   . LYS A 1 177 ? -1.547  -36.361 32.495 1.00 69.49  ? 304 LYS A N   1 
ATOM   1409 C  CA  . LYS A 1 177 ? -1.837  -36.574 31.071 1.00 69.97  ? 304 LYS A CA  1 
ATOM   1410 C  C   . LYS A 1 177 ? -0.613  -36.950 30.226 1.00 71.10  ? 304 LYS A C   1 
ATOM   1411 O  O   . LYS A 1 177 ? -0.740  -37.718 29.273 1.00 71.66  ? 304 LYS A O   1 
ATOM   1412 C  CB  . LYS A 1 177 ? -2.513  -35.337 30.467 1.00 71.23  ? 304 LYS A CB  1 
ATOM   1413 C  CG  . LYS A 1 177 ? -3.955  -35.153 30.903 1.00 71.98  ? 304 LYS A CG  1 
ATOM   1414 C  CD  . LYS A 1 177 ? -4.591  -33.940 30.241 1.00 71.94  ? 304 LYS A CD  1 
ATOM   1415 C  CE  . LYS A 1 177 ? -6.100  -34.015 30.302 1.00 71.72  ? 304 LYS A CE  1 
ATOM   1416 N  NZ  . LYS A 1 177 ? -6.755  -32.967 29.476 1.00 73.91  ? 304 LYS A NZ  1 
ATOM   1417 N  N   . LYS A 1 178 ? 0.558   -36.410 30.565 1.00 71.28  ? 305 LYS A N   1 
ATOM   1418 C  CA  . LYS A 1 178 ? 1.770   -36.633 29.768 1.00 71.83  ? 305 LYS A CA  1 
ATOM   1419 C  C   . LYS A 1 178 ? 2.593   -37.816 30.273 1.00 74.36  ? 305 LYS A C   1 
ATOM   1420 O  O   . LYS A 1 178 ? 3.161   -38.577 29.480 1.00 75.60  ? 305 LYS A O   1 
ATOM   1421 C  CB  . LYS A 1 178 ? 2.646   -35.375 29.750 1.00 73.79  ? 305 LYS A CB  1 
ATOM   1422 C  CG  . LYS A 1 178 ? 2.334   -34.380 28.627 1.00 73.96  ? 305 LYS A CG  1 
ATOM   1423 C  CD  . LYS A 1 178 ? 1.271   -33.366 29.008 1.00 73.52  ? 305 LYS A CD  1 
ATOM   1424 C  CE  . LYS A 1 178 ? 1.384   -32.097 28.164 1.00 74.71  ? 305 LYS A CE  1 
ATOM   1425 N  NZ  . LYS A 1 178 ? 1.489   -32.370 26.700 1.00 75.25  ? 305 LYS A NZ  1 
ATOM   1426 N  N   . ILE A 1 179 ? 2.674   -37.947 31.595 1.00 74.43  ? 306 ILE A N   1 
ATOM   1427 C  CA  . ILE A 1 179 ? 3.385   -39.047 32.241 1.00 72.87  ? 306 ILE A CA  1 
ATOM   1428 C  C   . ILE A 1 179 ? 2.512   -40.297 32.245 1.00 72.11  ? 306 ILE A C   1 
ATOM   1429 O  O   . ILE A 1 179 ? 3.013   -41.412 32.081 1.00 68.69  ? 306 ILE A O   1 
ATOM   1430 C  CB  . ILE A 1 179 ? 3.734   -38.709 33.711 1.00 72.42  ? 306 ILE A CB  1 
ATOM   1431 C  CG1 . ILE A 1 179 ? 4.542   -37.413 33.810 1.00 71.82  ? 306 ILE A CG1 1 
ATOM   1432 C  CG2 . ILE A 1 179 ? 4.513   -39.838 34.351 1.00 73.07  ? 306 ILE A CG2 1 
ATOM   1433 C  CD1 . ILE A 1 179 ? 4.818   -36.995 35.241 1.00 72.01  ? 306 ILE A CD1 1 
ATOM   1434 N  N   . TYR A 1 180 ? 1.206   -40.076 32.417 1.00 74.88  ? 307 TYR A N   1 
ATOM   1435 C  CA  . TYR A 1 180 ? 0.193   -41.111 32.670 1.00 76.52  ? 307 TYR A CA  1 
ATOM   1436 C  C   . TYR A 1 180 ? 0.148   -41.380 34.175 1.00 78.02  ? 307 TYR A C   1 
ATOM   1437 O  O   . TYR A 1 180 ? -0.729  -40.867 34.872 1.00 77.51  ? 307 TYR A O   1 
ATOM   1438 C  CB  . TYR A 1 180 ? 0.422   -42.405 31.867 1.00 78.97  ? 307 TYR A CB  1 
ATOM   1439 C  CG  . TYR A 1 180 ? 0.170   -42.303 30.368 1.00 79.13  ? 307 TYR A CG  1 
ATOM   1440 C  CD1 . TYR A 1 180 ? 0.183   -41.073 29.702 1.00 79.34  ? 307 TYR A CD1 1 
ATOM   1441 C  CD2 . TYR A 1 180 ? -0.060  -43.450 29.612 1.00 79.09  ? 307 TYR A CD2 1 
ATOM   1442 C  CE1 . TYR A 1 180 ? -0.039  -40.993 28.333 1.00 79.23  ? 307 TYR A CE1 1 
ATOM   1443 C  CE2 . TYR A 1 180 ? -0.280  -43.379 28.242 1.00 79.28  ? 307 TYR A CE2 1 
ATOM   1444 C  CZ  . TYR A 1 180 ? -0.268  -42.148 27.609 1.00 79.76  ? 307 TYR A CZ  1 
ATOM   1445 O  OH  . TYR A 1 180 ? -0.489  -42.068 26.253 1.00 80.16  ? 307 TYR A OH  1 
ATOM   1446 O  OXT . TYR A 1 180 ? 0.987   -42.085 34.739 1.00 78.66  ? 307 TYR A OXT 1 
ATOM   1447 N  N   . GLU B 2 1   ? -39.709 -22.233 19.193 1.00 63.85  ? 1   GLU B N   1 
ATOM   1448 C  CA  . GLU B 2 1   ? -39.396 -23.642 19.583 1.00 59.61  ? 1   GLU B CA  1 
ATOM   1449 C  C   . GLU B 2 1   ? -38.963 -24.569 18.425 1.00 59.97  ? 1   GLU B C   1 
ATOM   1450 O  O   . GLU B 2 1   ? -38.708 -25.756 18.671 1.00 62.19  ? 1   GLU B O   1 
ATOM   1451 C  CB  . GLU B 2 1   ? -40.589 -24.269 20.354 1.00 59.61  ? 1   GLU B CB  1 
ATOM   1452 C  CG  . GLU B 2 1   ? -41.879 -24.565 19.540 1.00 57.59  ? 1   GLU B CG  1 
ATOM   1453 C  CD  . GLU B 2 1   ? -42.839 -25.522 20.265 1.00 57.24  ? 1   GLU B CD  1 
ATOM   1454 O  OE1 . GLU B 2 1   ? -44.072 -25.386 20.116 1.00 56.79  ? 1   GLU B OE1 1 
ATOM   1455 O  OE2 . GLU B 2 1   ? -42.363 -26.418 20.985 1.00 51.87  ? 1   GLU B OE2 1 
ATOM   1456 N  N   . PRO B 2 2   ? -38.858 -24.046 17.176 1.00 57.12  ? 2   PRO B N   1 
ATOM   1457 C  CA  . PRO B 2 2   ? -38.539 -24.981 16.089 1.00 53.45  ? 2   PRO B CA  1 
ATOM   1458 C  C   . PRO B 2 2   ? -37.120 -25.546 16.190 1.00 50.63  ? 2   PRO B C   1 
ATOM   1459 O  O   . PRO B 2 2   ? -36.932 -26.754 15.992 1.00 49.01  ? 2   PRO B O   1 
ATOM   1460 C  CB  . PRO B 2 2   ? -38.729 -24.140 14.817 1.00 55.96  ? 2   PRO B CB  1 
ATOM   1461 C  CG  . PRO B 2 2   ? -38.536 -22.741 15.246 1.00 56.21  ? 2   PRO B CG  1 
ATOM   1462 C  CD  . PRO B 2 2   ? -38.995 -22.662 16.680 1.00 57.27  ? 2   PRO B CD  1 
ATOM   1463 N  N   . PHE B 2 3   ? -36.141 -24.698 16.515 1.00 45.28  ? 3   PHE B N   1 
ATOM   1464 C  CA  . PHE B 2 3   ? -34.780 -25.183 16.768 1.00 43.13  ? 3   PHE B CA  1 
ATOM   1465 C  C   . PHE B 2 3   ? -34.428 -25.121 18.255 1.00 37.28  ? 3   PHE B C   1 
ATOM   1466 O  O   . PHE B 2 3   ? -34.862 -24.230 18.979 1.00 34.04  ? 3   PHE B O   1 
ATOM   1467 C  CB  . PHE B 2 3   ? -33.755 -24.425 15.926 1.00 44.85  ? 3   PHE B CB  1 
ATOM   1468 C  CG  . PHE B 2 3   ? -34.029 -24.481 14.441 1.00 44.34  ? 3   PHE B CG  1 
ATOM   1469 C  CD1 . PHE B 2 3   ? -34.117 -23.317 13.694 1.00 47.52  ? 3   PHE B CD1 1 
ATOM   1470 C  CD2 . PHE B 2 3   ? -34.201 -25.696 13.796 1.00 44.16  ? 3   PHE B CD2 1 
ATOM   1471 C  CE1 . PHE B 2 3   ? -34.380 -23.365 12.321 1.00 47.31  ? 3   PHE B CE1 1 
ATOM   1472 C  CE2 . PHE B 2 3   ? -34.458 -25.753 12.435 1.00 44.02  ? 3   PHE B CE2 1 
ATOM   1473 C  CZ  . PHE B 2 3   ? -34.545 -24.589 11.696 1.00 44.85  ? 3   PHE B CZ  1 
ATOM   1474 N  N   . TRP B 2 4   ? -33.641 -26.091 18.700 1.00 35.43  ? 4   TRP B N   1 
ATOM   1475 C  CA  . TRP B 2 4   ? -33.343 -26.253 20.113 1.00 37.16  ? 4   TRP B CA  1 
ATOM   1476 C  C   . TRP B 2 4   ? -31.939 -26.795 20.346 1.00 37.69  ? 4   TRP B C   1 
ATOM   1477 O  O   . TRP B 2 4   ? -31.284 -27.293 19.421 1.00 38.36  ? 4   TRP B O   1 
ATOM   1478 C  CB  . TRP B 2 4   ? -34.360 -27.206 20.735 1.00 39.25  ? 4   TRP B CB  1 
ATOM   1479 C  CG  . TRP B 2 4   ? -34.601 -28.423 19.910 1.00 40.29  ? 4   TRP B CG  1 
ATOM   1480 C  CD1 . TRP B 2 4   ? -35.642 -28.633 19.058 1.00 40.93  ? 4   TRP B CD1 1 
ATOM   1481 C  CD2 . TRP B 2 4   ? -33.788 -29.606 19.850 1.00 40.10  ? 4   TRP B CD2 1 
ATOM   1482 N  NE1 . TRP B 2 4   ? -35.534 -29.873 18.475 1.00 41.75  ? 4   TRP B NE1 1 
ATOM   1483 C  CE2 . TRP B 2 4   ? -34.408 -30.492 18.948 1.00 40.87  ? 4   TRP B CE2 1 
ATOM   1484 C  CE3 . TRP B 2 4   ? -32.604 -30.003 20.474 1.00 40.98  ? 4   TRP B CE3 1 
ATOM   1485 C  CZ2 . TRP B 2 4   ? -33.875 -31.741 18.643 1.00 39.16  ? 4   TRP B CZ2 1 
ATOM   1486 C  CZ3 . TRP B 2 4   ? -32.086 -31.247 20.184 1.00 41.01  ? 4   TRP B CZ3 1 
ATOM   1487 C  CH2 . TRP B 2 4   ? -32.717 -32.100 19.272 1.00 40.66  ? 4   TRP B CH2 1 
ATOM   1488 N  N   . ALA B 2 5   ? -31.491 -26.674 21.596 1.00 35.50  ? 5   ALA B N   1 
ATOM   1489 C  CA  . ALA B 2 5   ? -30.331 -27.378 22.099 1.00 35.49  ? 5   ALA B CA  1 
ATOM   1490 C  C   . ALA B 2 5   ? -30.818 -28.276 23.233 1.00 35.62  ? 5   ALA B C   1 
ATOM   1491 O  O   . ALA B 2 5   ? -31.854 -28.013 23.844 1.00 33.50  ? 5   ALA B O   1 
ATOM   1492 C  CB  . ALA B 2 5   ? -29.268 -26.406 22.591 1.00 40.47  ? 5   ALA B CB  1 
ATOM   1493 N  N   . ASP B 2 6   ? -30.092 -29.358 23.482 1.00 36.77  ? 6   ASP B N   1 
ATOM   1494 C  CA  . ASP B 2 6   ? -30.429 -30.271 24.563 1.00 37.85  ? 6   ASP B CA  1 
ATOM   1495 C  C   . ASP B 2 6   ? -29.154 -30.815 25.172 1.00 37.53  ? 6   ASP B C   1 
ATOM   1496 O  O   . ASP B 2 6   ? -28.198 -31.124 24.465 1.00 41.26  ? 6   ASP B O   1 
ATOM   1497 C  CB  . ASP B 2 6   ? -31.312 -31.413 24.045 1.00 39.99  ? 6   ASP B CB  1 
ATOM   1498 C  CG  . ASP B 2 6   ? -31.886 -32.276 25.158 1.00 43.02  ? 6   ASP B CG  1 
ATOM   1499 O  OD1 . ASP B 2 6   ? -31.965 -31.822 26.323 1.00 49.13  ? 6   ASP B OD1 1 
ATOM   1500 O  OD2 . ASP B 2 6   ? -32.273 -33.419 24.858 1.00 46.02  ? 6   ASP B OD2 1 
ATOM   1501 N  N   . LEU B 2 7   ? -29.153 -30.930 26.491 1.00 36.47  ? 7   LEU B N   1 
ATOM   1502 C  CA  . LEU B 2 7   ? -28.007 -31.425 27.225 1.00 39.03  ? 7   LEU B CA  1 
ATOM   1503 C  C   . LEU B 2 7   ? -28.453 -32.695 27.914 1.00 39.93  ? 7   LEU B C   1 
ATOM   1504 O  O   . LEU B 2 7   ? -29.484 -32.703 28.574 1.00 38.27  ? 7   LEU B O   1 
ATOM   1505 C  CB  . LEU B 2 7   ? -27.552 -30.382 28.250 1.00 44.19  ? 7   LEU B CB  1 
ATOM   1506 C  CG  . LEU B 2 7   ? -26.296 -30.657 29.077 1.00 42.52  ? 7   LEU B CG  1 
ATOM   1507 C  CD1 . LEU B 2 7   ? -25.081 -30.878 28.183 1.00 41.44  ? 7   LEU B CD1 1 
ATOM   1508 C  CD2 . LEU B 2 7   ? -26.065 -29.482 30.007 1.00 43.84  ? 7   LEU B CD2 1 
ATOM   1509 N  N   . GLN B 2 8   ? -27.701 -33.776 27.713 1.00 39.01  ? 8   GLN B N   1 
ATOM   1510 C  CA  . GLN B 2 8   ? -28.022 -35.064 28.301 1.00 37.08  ? 8   GLN B CA  1 
ATOM   1511 C  C   . GLN B 2 8   ? -26.783 -35.655 28.963 1.00 39.82  ? 8   GLN B C   1 
ATOM   1512 O  O   . GLN B 2 8   ? -25.696 -35.605 28.387 1.00 40.12  ? 8   GLN B O   1 
ATOM   1513 C  CB  . GLN B 2 8   ? -28.545 -36.023 27.229 1.00 37.65  ? 8   GLN B CB  1 
ATOM   1514 C  CG  . GLN B 2 8   ? -29.895 -35.634 26.639 1.00 38.16  ? 8   GLN B CG  1 
ATOM   1515 C  CD  . GLN B 2 8   ? -31.044 -35.710 27.647 1.00 42.65  ? 8   GLN B CD  1 
ATOM   1516 O  OE1 . GLN B 2 8   ? -30.986 -36.444 28.633 1.00 41.70  ? 8   GLN B OE1 1 
ATOM   1517 N  NE2 . GLN B 2 8   ? -32.098 -34.947 27.391 1.00 42.12  ? 8   GLN B NE2 1 
ATOM   1518 N  N   . PRO B 2 9   ? -26.933 -36.197 30.184 1.00 40.88  ? 9   PRO B N   1 
ATOM   1519 C  CA  . PRO B 2 9   ? -28.150 -36.178 31.005 1.00 41.82  ? 9   PRO B CA  1 
ATOM   1520 C  C   . PRO B 2 9   ? -28.401 -34.758 31.547 1.00 43.27  ? 9   PRO B C   1 
ATOM   1521 O  O   . PRO B 2 9   ? -27.444 -34.022 31.816 1.00 46.92  ? 9   PRO B O   1 
ATOM   1522 C  CB  . PRO B 2 9   ? -27.824 -37.159 32.132 1.00 37.29  ? 9   PRO B CB  1 
ATOM   1523 C  CG  . PRO B 2 9   ? -26.375 -37.083 32.266 1.00 38.76  ? 9   PRO B CG  1 
ATOM   1524 C  CD  . PRO B 2 9   ? -25.832 -36.887 30.874 1.00 39.33  ? 9   PRO B CD  1 
ATOM   1525 N  N   . ARG B 2 10  ? -29.665 -34.359 31.659 1.00 42.07  ? 10  ARG B N   1 
ATOM   1526 C  CA  . ARG B 2 10  ? -29.973 -32.998 32.086 0.50 42.83  ? 10  ARG B CA  1 
ATOM   1527 C  C   . ARG B 2 10  ? -29.813 -32.862 33.601 1.00 44.68  ? 10  ARG B C   1 
ATOM   1528 O  O   . ARG B 2 10  ? -29.443 -31.798 34.082 1.00 46.55  ? 10  ARG B O   1 
ATOM   1529 C  CB  . ARG B 2 10  ? -31.362 -32.535 31.628 0.50 41.28  ? 10  ARG B CB  1 
ATOM   1530 C  CG  . ARG B 2 10  ? -31.375 -31.037 31.326 0.50 41.41  ? 10  ARG B CG  1 
ATOM   1531 C  CD  . ARG B 2 10  ? -32.767 -30.406 31.286 0.50 42.93  ? 10  ARG B CD  1 
ATOM   1532 N  NE  . ARG B 2 10  ? -33.485 -30.511 32.553 0.50 43.00  ? 10  ARG B NE  1 
ATOM   1533 C  CZ  . ARG B 2 10  ? -33.164 -29.865 33.674 0.50 43.59  ? 10  ARG B CZ  1 
ATOM   1534 N  NH1 . ARG B 2 10  ? -32.136 -29.025 33.721 0.50 45.29  ? 10  ARG B NH1 1 
ATOM   1535 N  NH2 . ARG B 2 10  ? -33.893 -30.053 34.767 0.50 43.62  ? 10  ARG B NH2 1 
ATOM   1536 N  N   . VAL B 2 11  ? -30.055 -33.939 34.344 1.00 41.70  ? 11  VAL B N   1 
ATOM   1537 C  CA  . VAL B 2 11  ? -29.756 -33.968 35.784 1.00 42.89  ? 11  VAL B CA  1 
ATOM   1538 C  C   . VAL B 2 11  ? -28.926 -35.204 36.119 1.00 44.67  ? 11  VAL B C   1 
ATOM   1539 O  O   . VAL B 2 11  ? -29.297 -36.313 35.754 1.00 46.82  ? 11  VAL B O   1 
ATOM   1540 C  CB  . VAL B 2 11  ? -31.045 -33.949 36.652 1.00 45.02  ? 11  VAL B CB  1 
ATOM   1541 C  CG1 . VAL B 2 11  ? -30.703 -34.099 38.123 1.00 46.57  ? 11  VAL B CG1 1 
ATOM   1542 C  CG2 . VAL B 2 11  ? -31.809 -32.664 36.432 1.00 47.44  ? 11  VAL B CG2 1 
ATOM   1543 N  N   . ALA B 2 12  ? -27.802 -35.007 36.810 1.00 42.78  ? 12  ALA B N   1 
ATOM   1544 C  CA  . ALA B 2 12  ? -26.912 -36.108 37.180 1.00 41.08  ? 12  ALA B CA  1 
ATOM   1545 C  C   . ALA B 2 12  ? -26.443 -36.013 38.628 1.00 42.55  ? 12  ALA B C   1 
ATOM   1546 O  O   . ALA B 2 12  ? -26.308 -34.934 39.178 1.00 42.53  ? 12  ALA B O   1 
ATOM   1547 C  CB  . ALA B 2 12  ? -25.741 -36.150 36.273 1.00 37.93  ? 12  ALA B CB  1 
ATOM   1548 N  N   . PHE B 2 13  ? -26.214 -37.168 39.238 1.00 44.89  ? 13  PHE B N   1 
ATOM   1549 C  CA  . PHE B 2 13  ? -25.717 -37.256 40.594 1.00 43.08  ? 13  PHE B CA  1 
ATOM   1550 C  C   . PHE B 2 13  ? -24.373 -37.944 40.507 1.00 45.18  ? 13  PHE B C   1 
ATOM   1551 O  O   . PHE B 2 13  ? -24.297 -39.048 39.984 1.00 47.79  ? 13  PHE B O   1 
ATOM   1552 C  CB  . PHE B 2 13  ? -26.663 -38.112 41.416 1.00 48.32  ? 13  PHE B CB  1 
ATOM   1553 C  CG  . PHE B 2 13  ? -27.166 -37.457 42.660 1.00 44.89  ? 13  PHE B CG  1 
ATOM   1554 C  CD1 . PHE B 2 13  ? -26.292 -37.089 43.667 1.00 44.90  ? 13  PHE B CD1 1 
ATOM   1555 C  CD2 . PHE B 2 13  ? -28.523 -37.238 42.836 1.00 47.65  ? 13  PHE B CD2 1 
ATOM   1556 C  CE1 . PHE B 2 13  ? -26.758 -36.500 44.836 1.00 47.74  ? 13  PHE B CE1 1 
ATOM   1557 C  CE2 . PHE B 2 13  ? -29.008 -36.651 44.007 1.00 50.54  ? 13  PHE B CE2 1 
ATOM   1558 C  CZ  . PHE B 2 13  ? -28.119 -36.285 45.010 1.00 50.08  ? 13  PHE B CZ  1 
ATOM   1559 N  N   . VAL B 2 14  ? -23.320 -37.301 41.011 1.00 42.91  ? 14  VAL B N   1 
ATOM   1560 C  CA  . VAL B 2 14  ? -21.947 -37.826 40.933 1.00 43.41  ? 14  VAL B CA  1 
ATOM   1561 C  C   . VAL B 2 14  ? -21.309 -37.879 42.315 1.00 40.73  ? 14  VAL B C   1 
ATOM   1562 O  O   . VAL B 2 14  ? -21.554 -37.003 43.128 1.00 41.42  ? 14  VAL B O   1 
ATOM   1563 C  CB  . VAL B 2 14  ? -21.088 -36.930 40.009 1.00 44.71  ? 14  VAL B CB  1 
ATOM   1564 C  CG1 . VAL B 2 14  ? -19.657 -37.379 39.995 1.00 49.87  ? 14  VAL B CG1 1 
ATOM   1565 C  CG2 . VAL B 2 14  ? -21.654 -36.949 38.596 1.00 43.98  ? 14  VAL B CG2 1 
ATOM   1566 N  N   . GLU B 2 15  ? -20.499 -38.901 42.592 1.00 38.88  ? 15  GLU B N   1 
ATOM   1567 C  CA  . GLU B 2 15  ? -19.774 -38.942 43.862 1.00 39.64  ? 15  GLU B CA  1 
ATOM   1568 C  C   . GLU B 2 15  ? -18.729 -37.845 43.886 1.00 40.71  ? 15  GLU B C   1 
ATOM   1569 O  O   . GLU B 2 15  ? -18.063 -37.587 42.882 1.00 43.83  ? 15  GLU B O   1 
ATOM   1570 C  CB  . GLU B 2 15  ? -19.100 -40.284 44.107 1.00 38.34  ? 15  GLU B CB  1 
ATOM   1571 C  CG  . GLU B 2 15  ? -18.536 -40.368 45.515 1.00 38.21  ? 15  GLU B CG  1 
ATOM   1572 C  CD  . GLU B 2 15  ? -18.246 -41.777 45.980 1.00 42.13  ? 15  GLU B CD  1 
ATOM   1573 O  OE1 . GLU B 2 15  ? -18.274 -42.692 45.139 1.00 45.59  ? 15  GLU B OE1 1 
ATOM   1574 O  OE2 . GLU B 2 15  ? -17.995 -41.965 47.192 1.00 43.38  ? 15  GLU B OE2 1 
ATOM   1575 N  N   . ARG B 2 16  ? -18.587 -37.184 45.024 1.00 42.28  ? 16  ARG B N   1 
ATOM   1576 C  CA  . ARG B 2 16  ? -17.724 -36.018 45.091 1.00 43.07  ? 16  ARG B CA  1 
ATOM   1577 C  C   . ARG B 2 16  ? -16.320 -36.409 44.636 1.00 41.52  ? 16  ARG B C   1 
ATOM   1578 O  O   . ARG B 2 16  ? -15.774 -37.391 45.106 1.00 41.03  ? 16  ARG B O   1 
ATOM   1579 C  CB  . ARG B 2 16  ? -17.699 -35.458 46.511 1.00 46.75  ? 16  ARG B CB  1 
ATOM   1580 C  CG  . ARG B 2 16  ? -17.050 -34.120 46.578 1.00 49.03  ? 16  ARG B CG  1 
ATOM   1581 C  CD  . ARG B 2 16  ? -17.230 -33.443 47.914 1.00 53.69  ? 16  ARG B CD  1 
ATOM   1582 N  NE  . ARG B 2 16  ? -16.205 -32.409 48.043 1.00 57.73  ? 16  ARG B NE  1 
ATOM   1583 C  CZ  . ARG B 2 16  ? -15.083 -32.523 48.753 1.00 60.88  ? 16  ARG B CZ  1 
ATOM   1584 N  NH1 . ARG B 2 16  ? -14.219 -31.510 48.763 1.00 60.47  ? 16  ARG B NH1 1 
ATOM   1585 N  NH2 . ARG B 2 16  ? -14.815 -33.625 49.462 1.00 61.22  ? 16  ARG B NH2 1 
ATOM   1586 N  N   . GLY B 2 17  ? -15.755 -35.648 43.705 1.00 40.73  ? 17  GLY B N   1 
ATOM   1587 C  CA  . GLY B 2 17  ? -14.463 -35.976 43.104 1.00 41.64  ? 17  GLY B CA  1 
ATOM   1588 C  C   . GLY B 2 17  ? -14.544 -36.805 41.824 1.00 42.41  ? 17  GLY B C   1 
ATOM   1589 O  O   . GLY B 2 17  ? -13.527 -37.058 41.184 1.00 40.70  ? 17  GLY B O   1 
ATOM   1590 N  N   . GLY B 2 18  ? -15.750 -37.219 41.445 1.00 39.91  ? 18  GLY B N   1 
ATOM   1591 C  CA  . GLY B 2 18  ? -15.947 -38.082 40.293 1.00 38.75  ? 18  GLY B CA  1 
ATOM   1592 C  C   . GLY B 2 18  ? -16.042 -37.322 38.988 1.00 40.16  ? 18  GLY B C   1 
ATOM   1593 O  O   . GLY B 2 18  ? -15.782 -36.117 38.920 1.00 38.43  ? 18  GLY B O   1 
ATOM   1594 N  N   . SER B 2 19  ? -16.425 -38.037 37.941 1.00 40.67  ? 19  SER B N   1 
ATOM   1595 C  CA  . SER B 2 19  ? -16.485 -37.466 36.609 1.00 44.51  ? 19  SER B CA  1 
ATOM   1596 C  C   . SER B 2 19  ? -17.797 -37.840 35.936 1.00 44.85  ? 19  SER B C   1 
ATOM   1597 O  O   . SER B 2 19  ? -18.525 -38.711 36.414 1.00 42.31  ? 19  SER B O   1 
ATOM   1598 C  CB  . SER B 2 19  ? -15.305 -37.976 35.788 1.00 47.30  ? 19  SER B CB  1 
ATOM   1599 O  OG  . SER B 2 19  ? -15.402 -39.372 35.641 1.00 52.25  ? 19  SER B OG  1 
ATOM   1600 N  N   . LEU B 2 20  ? -18.085 -37.181 34.821 1.00 44.67  ? 20  LEU B N   1 
ATOM   1601 C  CA  . LEU B 2 20  ? -19.327 -37.385 34.102 1.00 46.35  ? 20  LEU B CA  1 
ATOM   1602 C  C   . LEU B 2 20  ? -19.181 -36.965 32.644 1.00 45.97  ? 20  LEU B C   1 
ATOM   1603 O  O   . LEU B 2 20  ? -18.644 -35.907 32.369 1.00 41.41  ? 20  LEU B O   1 
ATOM   1604 C  CB  . LEU B 2 20  ? -20.420 -36.534 34.760 1.00 48.05  ? 20  LEU B CB  1 
ATOM   1605 C  CG  . LEU B 2 20  ? -21.800 -36.520 34.112 1.00 48.09  ? 20  LEU B CG  1 
ATOM   1606 C  CD1 . LEU B 2 20  ? -22.459 -37.862 34.264 1.00 45.51  ? 20  LEU B CD1 1 
ATOM   1607 C  CD2 . LEU B 2 20  ? -22.662 -35.423 34.704 1.00 49.53  ? 20  LEU B CD2 1 
ATOM   1608 N  N   . TRP B 2 21  ? -19.679 -37.793 31.728 1.00 44.78  ? 21  TRP B N   1 
ATOM   1609 C  CA  . TRP B 2 21  ? -19.857 -37.397 30.331 1.00 45.54  ? 21  TRP B CA  1 
ATOM   1610 C  C   . TRP B 2 21  ? -21.186 -36.670 30.124 1.00 44.71  ? 21  TRP B C   1 
ATOM   1611 O  O   . TRP B 2 21  ? -22.238 -37.137 30.553 1.00 39.87  ? 21  TRP B O   1 
ATOM   1612 C  CB  . TRP B 2 21  ? -19.797 -38.616 29.403 1.00 45.50  ? 21  TRP B CB  1 
ATOM   1613 C  CG  . TRP B 2 21  ? -18.395 -39.052 29.097 1.00 45.42  ? 21  TRP B CG  1 
ATOM   1614 C  CD1 . TRP B 2 21  ? -17.673 -39.988 29.765 1.00 45.60  ? 21  TRP B CD1 1 
ATOM   1615 C  CD2 . TRP B 2 21  ? -17.543 -38.556 28.056 1.00 44.26  ? 21  TRP B CD2 1 
ATOM   1616 N  NE1 . TRP B 2 21  ? -16.430 -40.118 29.204 1.00 46.30  ? 21  TRP B NE1 1 
ATOM   1617 C  CE2 . TRP B 2 21  ? -16.319 -39.247 28.156 1.00 47.01  ? 21  TRP B CE2 1 
ATOM   1618 C  CE3 . TRP B 2 21  ? -17.697 -37.601 27.049 1.00 46.17  ? 21  TRP B CE3 1 
ATOM   1619 C  CZ2 . TRP B 2 21  ? -15.248 -39.009 27.289 1.00 46.25  ? 21  TRP B CZ2 1 
ATOM   1620 C  CZ3 . TRP B 2 21  ? -16.633 -37.363 26.181 1.00 45.43  ? 21  TRP B CZ3 1 
ATOM   1621 C  CH2 . TRP B 2 21  ? -15.427 -38.055 26.311 1.00 46.79  ? 21  TRP B CH2 1 
ATOM   1622 N  N   . LEU B 2 22  ? -21.133 -35.515 29.471 1.00 44.01  ? 22  LEU B N   1 
ATOM   1623 C  CA  . LEU B 2 22  ? -22.346 -34.809 29.068 1.00 48.51  ? 22  LEU B CA  1 
ATOM   1624 C  C   . LEU B 2 22  ? -22.320 -34.710 27.557 1.00 47.06  ? 22  LEU B C   1 
ATOM   1625 O  O   . LEU B 2 22  ? -21.250 -34.614 26.972 1.00 45.89  ? 22  LEU B O   1 
ATOM   1626 C  CB  . LEU B 2 22  ? -22.419 -33.403 29.671 1.00 51.53  ? 22  LEU B CB  1 
ATOM   1627 C  CG  . LEU B 2 22  ? -22.614 -33.204 31.182 1.00 49.52  ? 22  LEU B CG  1 
ATOM   1628 C  CD1 . LEU B 2 22  ? -22.821 -31.734 31.456 1.00 51.84  ? 22  LEU B CD1 1 
ATOM   1629 C  CD2 . LEU B 2 22  ? -23.776 -33.966 31.736 1.00 48.40  ? 22  LEU B CD2 1 
ATOM   1630 N  N   . ASN B 2 23  ? -23.500 -34.757 26.940 1.00 45.93  ? 23  ASN B N   1 
ATOM   1631 C  CA  . ASN B 2 23  ? -23.649 -34.644 25.492 1.00 47.25  ? 23  ASN B CA  1 
ATOM   1632 C  C   . ASN B 2 23  ? -24.581 -33.476 25.190 1.00 47.87  ? 23  ASN B C   1 
ATOM   1633 O  O   . ASN B 2 23  ? -25.749 -33.495 25.553 1.00 48.69  ? 23  ASN B O   1 
ATOM   1634 C  CB  . ASN B 2 23  ? -24.196 -35.956 24.895 1.00 43.60  ? 23  ASN B CB  1 
ATOM   1635 C  CG  . ASN B 2 23  ? -24.113 -36.002 23.363 1.00 45.64  ? 23  ASN B CG  1 
ATOM   1636 O  OD1 . ASN B 2 23  ? -23.865 -34.993 22.707 1.00 51.25  ? 23  ASN B OD1 1 
ATOM   1637 N  ND2 . ASN B 2 23  ? -24.330 -37.205 22.793 1.00 50.03  ? 23  ASN B ND2 1 
ATOM   1638 N  N   . CYS B 2 24  ? -24.047 -32.451 24.540 1.00 52.71  ? 24  CYS B N   1 
ATOM   1639 C  CA  . CYS B 2 24  ? -24.813 -31.261 24.176 1.00 49.77  ? 24  CYS B CA  1 
ATOM   1640 C  C   . CYS B 2 24  ? -25.160 -31.358 22.670 1.00 47.31  ? 24  CYS B C   1 
ATOM   1641 O  O   . CYS B 2 24  ? -24.281 -31.541 21.849 1.00 51.25  ? 24  CYS B O   1 
ATOM   1642 C  CB  . CYS B 2 24  ? -23.976 -30.018 24.555 1.00 57.06  ? 24  CYS B CB  1 
ATOM   1643 S  SG  . CYS B 2 24  ? -24.485 -28.414 23.871 1.00 67.94  ? 24  CYS B SG  1 
ATOM   1644 N  N   . SER B 2 25  ? -26.444 -31.292 22.312 1.00 45.03  ? 25  SER B N   1 
ATOM   1645 C  CA  . SER B 2 25  ? -26.851 -31.439 20.909 1.00 45.07  ? 25  SER B CA  1 
ATOM   1646 C  C   . SER B 2 25  ? -27.904 -30.435 20.451 1.00 40.77  ? 25  SER B C   1 
ATOM   1647 O  O   . SER B 2 25  ? -28.568 -29.803 21.277 1.00 40.34  ? 25  SER B O   1 
ATOM   1648 C  CB  . SER B 2 25  ? -27.398 -32.847 20.672 1.00 45.01  ? 25  SER B CB  1 
ATOM   1649 O  OG  . SER B 2 25  ? -28.593 -33.034 21.405 1.00 45.23  ? 25  SER B OG  1 
ATOM   1650 N  N   . THR B 2 26  ? -28.067 -30.333 19.127 1.00 38.38  ? 26  THR B N   1 
ATOM   1651 C  CA  . THR B 2 26  ? -29.045 -29.416 18.509 1.00 38.72  ? 26  THR B CA  1 
ATOM   1652 C  C   . THR B 2 26  ? -29.623 -30.001 17.227 1.00 38.38  ? 26  THR B C   1 
ATOM   1653 O  O   . THR B 2 26  ? -29.021 -30.888 16.624 1.00 39.09  ? 26  THR B O   1 
ATOM   1654 C  CB  . THR B 2 26  ? -28.393 -28.059 18.186 1.00 41.04  ? 26  THR B CB  1 
ATOM   1655 O  OG1 . THR B 2 26  ? -29.365 -27.160 17.624 1.00 38.22  ? 26  THR B OG1 1 
ATOM   1656 C  CG2 . THR B 2 26  ? -27.220 -28.239 17.222 1.00 38.30  ? 26  THR B CG2 1 
ATOM   1657 N  N   . ASN B 2 27  ? -30.804 -29.525 16.829 1.00 36.89  ? 27  ASN B N   1 
ATOM   1658 C  CA  . ASN B 2 27  ? -31.349 -29.829 15.507 1.00 38.85  ? 27  ASN B CA  1 
ATOM   1659 C  C   . ASN B 2 27  ? -31.157 -28.658 14.548 1.00 42.26  ? 27  ASN B C   1 
ATOM   1660 O  O   . ASN B 2 27  ? -31.691 -28.665 13.443 1.00 42.92  ? 27  ASN B O   1 
ATOM   1661 C  CB  . ASN B 2 27  ? -32.829 -30.212 15.579 1.00 37.34  ? 27  ASN B CB  1 
ATOM   1662 C  CG  . ASN B 2 27  ? -33.711 -29.049 15.935 1.00 38.28  ? 27  ASN B CG  1 
ATOM   1663 O  OD1 . ASN B 2 27  ? -33.276 -28.123 16.610 1.00 37.65  ? 27  ASN B OD1 1 
ATOM   1664 N  ND2 . ASN B 2 27  ? -34.956 -29.082 15.479 1.00 34.06  ? 27  ASN B ND2 1 
ATOM   1665 N  N   . CYS B 2 28  ? -30.392 -27.654 14.964 1.00 42.49  ? 28  CYS B N   1 
ATOM   1666 C  CA  . CYS B 2 28  ? -30.036 -26.568 14.071 1.00 45.92  ? 28  CYS B CA  1 
ATOM   1667 C  C   . CYS B 2 28  ? -29.416 -27.165 12.808 1.00 47.18  ? 28  CYS B C   1 
ATOM   1668 O  O   . CYS B 2 28  ? -28.515 -27.978 12.915 1.00 48.30  ? 28  CYS B O   1 
ATOM   1669 C  CB  . CYS B 2 28  ? -29.030 -25.645 14.748 1.00 49.11  ? 28  CYS B CB  1 
ATOM   1670 S  SG  . CYS B 2 28  ? -28.577 -24.244 13.741 1.00 53.07  ? 28  CYS B SG  1 
ATOM   1671 N  N   . PRO B 2 29  ? -29.907 -26.783 11.614 1.00 52.37  ? 29  PRO B N   1 
ATOM   1672 C  CA  . PRO B 2 29  ? -29.356 -27.334 10.364 1.00 55.46  ? 29  PRO B CA  1 
ATOM   1673 C  C   . PRO B 2 29  ? -27.847 -27.119 10.198 1.00 59.44  ? 29  PRO B C   1 
ATOM   1674 O  O   . PRO B 2 29  ? -27.116 -28.071 9.915  1.00 59.95  ? 29  PRO B O   1 
ATOM   1675 C  CB  . PRO B 2 29  ? -30.118 -26.578 9.278  1.00 54.97  ? 29  PRO B CB  1 
ATOM   1676 C  CG  . PRO B 2 29  ? -31.354 -26.098 9.936  1.00 55.12  ? 29  PRO B CG  1 
ATOM   1677 C  CD  . PRO B 2 29  ? -31.009 -25.841 11.357 1.00 52.41  ? 29  PRO B CD  1 
ATOM   1678 N  N   . ARG B 2 30  ? -27.398 -25.878 10.379 1.00 60.82  ? 30  ARG B N   1 
ATOM   1679 C  CA  . ARG B 2 30  ? -25.975 -25.534 10.299 1.00 62.12  ? 30  ARG B CA  1 
ATOM   1680 C  C   . ARG B 2 30  ? -25.534 -24.668 11.487 1.00 57.72  ? 30  ARG B C   1 
ATOM   1681 O  O   . ARG B 2 30  ? -25.473 -23.443 11.388 1.00 53.91  ? 30  ARG B O   1 
ATOM   1682 C  CB  . ARG B 2 30  ? -25.650 -24.856 8.955  1.00 67.54  ? 30  ARG B CB  1 
ATOM   1683 C  CG  . ARG B 2 30  ? -26.771 -24.010 8.330  1.00 70.05  ? 30  ARG B CG  1 
ATOM   1684 C  CD  . ARG B 2 30  ? -26.331 -23.465 6.964  1.00 71.01  ? 30  ARG B CD  1 
ATOM   1685 N  NE  . ARG B 2 30  ? -27.443 -23.018 6.115  1.00 73.50  ? 30  ARG B NE  1 
ATOM   1686 C  CZ  . ARG B 2 30  ? -27.931 -21.772 6.059  1.00 76.25  ? 30  ARG B CZ  1 
ATOM   1687 N  NH1 . ARG B 2 30  ? -27.434 -20.795 6.822  1.00 76.57  ? 30  ARG B NH1 1 
ATOM   1688 N  NH2 . ARG B 2 30  ? -28.938 -21.499 5.229  1.00 74.66  ? 30  ARG B NH2 1 
ATOM   1689 N  N   . PRO B 2 31  ? -25.232 -25.306 12.627 1.00 57.16  ? 31  PRO B N   1 
ATOM   1690 C  CA  . PRO B 2 31  ? -24.817 -24.522 13.792 1.00 60.05  ? 31  PRO B CA  1 
ATOM   1691 C  C   . PRO B 2 31  ? -23.445 -23.890 13.574 1.00 61.33  ? 31  PRO B C   1 
ATOM   1692 O  O   . PRO B 2 31  ? -22.549 -24.527 13.020 1.00 60.59  ? 31  PRO B O   1 
ATOM   1693 C  CB  . PRO B 2 31  ? -24.790 -25.547 14.925 1.00 56.32  ? 31  PRO B CB  1 
ATOM   1694 C  CG  . PRO B 2 31  ? -24.655 -26.864 14.256 1.00 56.55  ? 31  PRO B CG  1 
ATOM   1695 C  CD  . PRO B 2 31  ? -25.249 -26.753 12.898 1.00 55.89  ? 31  PRO B CD  1 
ATOM   1696 N  N   . GLU B 2 32  ? -23.301 -22.643 14.012 1.00 63.71  ? 32  GLU B N   1 
ATOM   1697 C  CA  . GLU B 2 32  ? -22.151 -21.802 13.667 1.00 67.13  ? 32  GLU B CA  1 
ATOM   1698 C  C   . GLU B 2 32  ? -21.046 -21.870 14.724 1.00 67.32  ? 32  GLU B C   1 
ATOM   1699 O  O   . GLU B 2 32  ? -19.863 -21.674 14.424 1.00 67.87  ? 32  GLU B O   1 
ATOM   1700 C  CB  . GLU B 2 32  ? -22.625 -20.351 13.482 1.00 70.02  ? 32  GLU B CB  1 
ATOM   1701 C  CG  . GLU B 2 32  ? -23.864 -20.242 12.566 1.00 73.93  ? 32  GLU B CG  1 
ATOM   1702 C  CD  . GLU B 2 32  ? -24.406 -18.826 12.402 1.00 75.00  ? 32  GLU B CD  1 
ATOM   1703 O  OE1 . GLU B 2 32  ? -24.569 -18.113 13.416 1.00 77.82  ? 32  GLU B OE1 1 
ATOM   1704 O  OE2 . GLU B 2 32  ? -24.700 -18.436 11.246 1.00 79.85  ? 32  GLU B OE2 1 
ATOM   1705 N  N   . ARG B 2 33  ? -21.447 -22.180 15.951 1.00 65.49  ? 33  ARG B N   1 
ATOM   1706 C  CA  . ARG B 2 33  ? -20.614 -22.025 17.137 1.00 66.52  ? 33  ARG B CA  1 
ATOM   1707 C  C   . ARG B 2 33  ? -21.313 -22.909 18.160 1.00 65.00  ? 33  ARG B C   1 
ATOM   1708 O  O   . ARG B 2 33  ? -22.539 -22.869 18.232 1.00 66.12  ? 33  ARG B O   1 
ATOM   1709 C  CB  . ARG B 2 33  ? -20.629 -20.548 17.581 1.00 70.52  ? 33  ARG B CB  1 
ATOM   1710 C  CG  . ARG B 2 33  ? -19.478 -20.074 18.474 1.00 71.25  ? 33  ARG B CG  1 
ATOM   1711 C  CD  . ARG B 2 33  ? -18.943 -18.668 18.048 1.00 74.60  ? 33  ARG B CD  1 
ATOM   1712 N  NE  . ARG B 2 33  ? -19.781 -17.532 18.469 1.00 77.51  ? 33  ARG B NE  1 
ATOM   1713 C  CZ  . ARG B 2 33  ? -20.632 -16.840 17.697 1.00 76.98  ? 33  ARG B CZ  1 
ATOM   1714 N  NH1 . ARG B 2 33  ? -20.822 -17.144 16.417 1.00 78.67  ? 33  ARG B NH1 1 
ATOM   1715 N  NH2 . ARG B 2 33  ? -21.324 -15.830 18.222 1.00 75.05  ? 33  ARG B NH2 1 
ATOM   1716 N  N   . GLY B 2 34  ? -20.568 -23.723 18.908 1.00 56.75  ? 34  GLY B N   1 
ATOM   1717 C  CA  . GLY B 2 34  ? -21.168 -24.616 19.902 1.00 56.81  ? 34  GLY B CA  1 
ATOM   1718 C  C   . GLY B 2 34  ? -20.272 -24.772 21.114 1.00 55.52  ? 34  GLY B C   1 
ATOM   1719 O  O   . GLY B 2 34  ? -19.057 -24.639 21.003 1.00 56.84  ? 34  GLY B O   1 
ATOM   1720 N  N   . GLY B 2 35  ? -20.848 -25.050 22.277 1.00 50.08  ? 35  GLY B N   1 
ATOM   1721 C  CA  . GLY B 2 35  ? -20.026 -25.172 23.472 1.00 47.28  ? 35  GLY B CA  1 
ATOM   1722 C  C   . GLY B 2 35  ? -20.760 -25.541 24.719 1.00 43.06  ? 35  GLY B C   1 
ATOM   1723 O  O   . GLY B 2 35  ? -21.977 -25.677 24.714 1.00 49.39  ? 35  GLY B O   1 
ATOM   1724 N  N   . LEU B 2 36  ? -19.995 -25.698 25.797 1.00 47.17  ? 36  LEU B N   1 
ATOM   1725 C  CA  . LEU B 2 36  ? -20.507 -26.065 27.110 1.00 48.78  ? 36  LEU B CA  1 
ATOM   1726 C  C   . LEU B 2 36  ? -19.805 -25.209 28.161 1.00 50.17  ? 36  LEU B C   1 
ATOM   1727 O  O   . LEU B 2 36  ? -18.620 -25.387 28.420 1.00 54.64  ? 36  LEU B O   1 
ATOM   1728 C  CB  . LEU B 2 36  ? -20.272 -27.561 27.385 1.00 50.19  ? 36  LEU B CB  1 
ATOM   1729 C  CG  . LEU B 2 36  ? -20.868 -28.121 28.684 1.00 51.47  ? 36  LEU B CG  1 
ATOM   1730 C  CD1 . LEU B 2 36  ? -22.385 -28.219 28.575 1.00 48.89  ? 36  LEU B CD1 1 
ATOM   1731 C  CD2 . LEU B 2 36  ? -20.269 -29.473 29.018 1.00 53.22  ? 36  LEU B CD2 1 
ATOM   1732 N  N   . GLU B 2 37  ? -20.542 -24.278 28.756 1.00 45.93  ? 37  GLU B N   1 
ATOM   1733 C  CA  . GLU B 2 37  ? -19.996 -23.362 29.750 1.00 46.28  ? 37  GLU B CA  1 
ATOM   1734 C  C   . GLU B 2 37  ? -20.197 -23.983 31.137 1.00 47.22  ? 37  GLU B C   1 
ATOM   1735 O  O   . GLU B 2 37  ? -21.324 -24.132 31.607 1.00 48.57  ? 37  GLU B O   1 
ATOM   1736 C  CB  . GLU B 2 37  ? -20.697 -21.995 29.613 1.00 45.15  ? 37  GLU B CB  1 
ATOM   1737 C  CG  . GLU B 2 37  ? -20.396 -20.961 30.676 1.00 45.76  ? 37  GLU B CG  1 
ATOM   1738 C  CD  . GLU B 2 37  ? -19.401 -19.898 30.261 1.00 40.20  ? 37  GLU B CD  1 
ATOM   1739 O  OE1 . GLU B 2 37  ? -19.423 -19.438 29.101 1.00 37.43  ? 37  GLU B OE1 1 
ATOM   1740 O  OE2 . GLU B 2 37  ? -18.614 -19.475 31.137 1.00 41.60  ? 37  GLU B OE2 1 
ATOM   1741 N  N   . THR B 2 38  ? -19.089 -24.367 31.768 1.00 46.20  ? 38  THR B N   1 
ATOM   1742 C  CA  . THR B 2 38  ? -19.092 -24.866 33.140 1.00 46.57  ? 38  THR B CA  1 
ATOM   1743 C  C   . THR B 2 38  ? -17.760 -24.554 33.813 1.00 44.06  ? 38  THR B C   1 
ATOM   1744 O  O   . THR B 2 38  ? -16.743 -24.400 33.140 1.00 41.11  ? 38  THR B O   1 
ATOM   1745 C  CB  . THR B 2 38  ? -19.343 -26.391 33.189 1.00 46.11  ? 38  THR B CB  1 
ATOM   1746 O  OG1 . THR B 2 38  ? -19.311 -26.828 34.546 1.00 51.97  ? 38  THR B OG1 1 
ATOM   1747 C  CG2 . THR B 2 38  ? -18.301 -27.154 32.385 1.00 46.64  ? 38  THR B CG2 1 
ATOM   1748 N  N   . SER B 2 39  ? -17.769 -24.450 35.142 1.00 47.32  ? 39  SER B N   1 
ATOM   1749 C  CA  . SER B 2 39  ? -16.543 -24.223 35.907 1.00 47.52  ? 39  SER B CA  1 
ATOM   1750 C  C   . SER B 2 39  ? -15.768 -25.513 36.076 1.00 46.79  ? 39  SER B C   1 
ATOM   1751 O  O   . SER B 2 39  ? -14.601 -25.489 36.452 1.00 47.12  ? 39  SER B O   1 
ATOM   1752 C  CB  . SER B 2 39  ? -16.846 -23.646 37.290 1.00 48.90  ? 39  SER B CB  1 
ATOM   1753 O  OG  . SER B 2 39  ? -17.808 -24.427 37.966 1.00 51.58  ? 39  SER B OG  1 
ATOM   1754 N  N   . LEU B 2 40  ? -16.423 -26.638 35.825 1.00 49.71  ? 40  LEU B N   1 
ATOM   1755 C  CA  . LEU B 2 40  ? -15.775 -27.934 35.959 1.00 47.30  ? 40  LEU B CA  1 
ATOM   1756 C  C   . LEU B 2 40  ? -14.662 -28.119 34.933 1.00 50.80  ? 40  LEU B C   1 
ATOM   1757 O  O   . LEU B 2 40  ? -14.754 -27.679 33.776 1.00 55.65  ? 40  LEU B O   1 
ATOM   1758 C  CB  . LEU B 2 40  ? -16.791 -29.054 35.806 1.00 45.90  ? 40  LEU B CB  1 
ATOM   1759 C  CG  . LEU B 2 40  ? -17.888 -29.080 36.849 1.00 42.85  ? 40  LEU B CG  1 
ATOM   1760 C  CD1 . LEU B 2 40  ? -18.929 -30.119 36.451 1.00 42.98  ? 40  LEU B CD1 1 
ATOM   1761 C  CD2 . LEU B 2 40  ? -17.287 -29.355 38.209 1.00 39.53  ? 40  LEU B CD2 1 
ATOM   1762 N  N   . ARG B 2 41  ? -13.602 -28.767 35.388 1.00 52.13  ? 41  ARG B N   1 
ATOM   1763 C  CA  . ARG B 2 41  ? -12.500 -29.170 34.549 1.00 53.83  ? 41  ARG B CA  1 
ATOM   1764 C  C   . ARG B 2 41  ? -12.994 -30.211 33.553 1.00 52.47  ? 41  ARG B C   1 
ATOM   1765 O  O   . ARG B 2 41  ? -13.811 -31.056 33.897 1.00 52.24  ? 41  ARG B O   1 
ATOM   1766 C  CB  . ARG B 2 41  ? -11.417 -29.785 35.439 1.00 57.12  ? 41  ARG B CB  1 
ATOM   1767 C  CG  . ARG B 2 41  ? -10.022 -29.764 34.868 1.00 59.11  ? 41  ARG B CG  1 
ATOM   1768 C  CD  . ARG B 2 41  ? -9.031  -30.268 35.899 1.00 58.56  ? 41  ARG B CD  1 
ATOM   1769 N  NE  . ARG B 2 41  ? -9.002  -29.428 37.103 1.00 59.96  ? 41  ARG B NE  1 
ATOM   1770 C  CZ  . ARG B 2 41  ? -8.268  -28.323 37.250 1.00 58.90  ? 41  ARG B CZ  1 
ATOM   1771 N  NH1 . ARG B 2 41  ? -8.319  -27.643 38.394 1.00 58.50  ? 41  ARG B NH1 1 
ATOM   1772 N  NH2 . ARG B 2 41  ? -7.487  -27.885 36.264 1.00 58.37  ? 41  ARG B NH2 1 
ATOM   1773 N  N   . ARG B 2 42  ? -12.492 -30.146 32.326 1.00 54.29  ? 42  ARG B N   1 
ATOM   1774 C  CA  . ARG B 2 42  ? -12.814 -31.132 31.298 1.00 57.09  ? 42  ARG B CA  1 
ATOM   1775 C  C   . ARG B 2 42  ? -11.610 -32.013 31.019 1.00 55.58  ? 42  ARG B C   1 
ATOM   1776 O  O   . ARG B 2 42  ? -10.476 -31.619 31.263 1.00 53.41  ? 42  ARG B O   1 
ATOM   1777 C  CB  . ARG B 2 42  ? -13.307 -30.463 30.011 1.00 61.91  ? 42  ARG B CB  1 
ATOM   1778 C  CG  . ARG B 2 42  ? -12.444 -29.334 29.482 1.00 64.20  ? 42  ARG B CG  1 
ATOM   1779 C  CD  . ARG B 2 42  ? -13.042 -28.787 28.203 1.00 65.98  ? 42  ARG B CD  1 
ATOM   1780 N  NE  . ARG B 2 42  ? -12.339 -27.603 27.719 1.00 68.08  ? 42  ARG B NE  1 
ATOM   1781 C  CZ  . ARG B 2 42  ? -12.646 -26.340 28.019 1.00 71.08  ? 42  ARG B CZ  1 
ATOM   1782 N  NH1 . ARG B 2 42  ? -13.666 -26.049 28.828 1.00 70.63  ? 42  ARG B NH1 1 
ATOM   1783 N  NH2 . ARG B 2 42  ? -11.911 -25.358 27.503 1.00 71.31  ? 42  ARG B NH2 1 
ATOM   1784 N  N   . ASN B 2 43  ? -11.869 -33.211 30.513 1.00 57.88  ? 43  ASN B N   1 
ATOM   1785 C  CA  . ASN B 2 43  ? -10.826 -34.212 30.322 1.00 56.25  ? 43  ASN B CA  1 
ATOM   1786 C  C   . ASN B 2 43  ? -11.072 -35.098 29.107 1.00 57.37  ? 43  ASN B C   1 
ATOM   1787 O  O   . ASN B 2 43  ? -10.659 -36.258 29.074 1.00 64.35  ? 43  ASN B O   1 
ATOM   1788 C  CB  . ASN B 2 43  ? -10.744 -35.087 31.566 1.00 60.07  ? 43  ASN B CB  1 
ATOM   1789 C  CG  . ASN B 2 43  ? -9.635  -36.107 31.487 1.00 62.73  ? 43  ASN B CG  1 
ATOM   1790 O  OD1 . ASN B 2 43  ? -8.480  -35.761 31.262 1.00 62.68  ? 43  ASN B OD1 1 
ATOM   1791 N  ND2 . ASN B 2 43  ? -9.991  -37.379 31.668 1.00 70.63  ? 43  ASN B ND2 1 
ATOM   1792 N  N   . GLY B 2 44  ? -11.731 -34.555 28.101 1.00 51.29  ? 44  GLY B N   1 
ATOM   1793 C  CA  . GLY B 2 44  ? -12.128 -35.351 26.961 1.00 49.97  ? 44  GLY B CA  1 
ATOM   1794 C  C   . GLY B 2 44  ? -13.228 -34.628 26.236 1.00 46.60  ? 44  GLY B C   1 
ATOM   1795 O  O   . GLY B 2 44  ? -14.154 -34.136 26.869 1.00 42.86  ? 44  GLY B O   1 
ATOM   1796 N  N   . THR B 2 45  ? -13.090 -34.531 24.916 1.00 48.80  ? 45  THR B N   1 
ATOM   1797 C  CA  . THR B 2 45  ? -14.105 -33.957 24.047 1.00 49.36  ? 45  THR B CA  1 
ATOM   1798 C  C   . THR B 2 45  ? -14.295 -34.826 22.807 1.00 46.19  ? 45  THR B C   1 
ATOM   1799 O  O   . THR B 2 45  ? -13.351 -35.417 22.297 1.00 41.20  ? 45  THR B O   1 
ATOM   1800 C  CB  . THR B 2 45  ? -13.731 -32.532 23.587 1.00 52.69  ? 45  THR B CB  1 
ATOM   1801 O  OG1 . THR B 2 45  ? -13.484 -31.708 24.730 1.00 53.31  ? 45  THR B OG1 1 
ATOM   1802 C  CG2 . THR B 2 45  ? -14.860 -31.913 22.768 1.00 50.85  ? 45  THR B CG2 1 
ATOM   1803 N  N   . GLN B 2 46  ? -15.540 -34.908 22.360 1.00 45.90  ? 46  GLN B N   1 
ATOM   1804 C  CA  . GLN B 2 46  ? -15.898 -35.480 21.079 1.00 49.04  ? 46  GLN B CA  1 
ATOM   1805 C  C   . GLN B 2 46  ? -16.909 -34.541 20.449 1.00 47.14  ? 46  GLN B C   1 
ATOM   1806 O  O   . GLN B 2 46  ? -17.678 -33.897 21.159 1.00 41.50  ? 46  GLN B O   1 
ATOM   1807 C  CB  . GLN B 2 46  ? -16.529 -36.854 21.259 1.00 51.26  ? 46  GLN B CB  1 
ATOM   1808 C  CG  . GLN B 2 46  ? -15.618 -37.869 21.905 1.00 55.72  ? 46  GLN B CG  1 
ATOM   1809 C  CD  . GLN B 2 46  ? -16.268 -39.233 22.003 1.00 58.55  ? 46  GLN B CD  1 
ATOM   1810 O  OE1 . GLN B 2 46  ? -16.783 -39.756 21.012 1.00 64.32  ? 46  GLN B OE1 1 
ATOM   1811 N  NE2 . GLN B 2 46  ? -16.248 -39.818 23.197 1.00 61.11  ? 46  GLN B NE2 1 
ATOM   1812 N  N   . ARG B 2 47  ? -16.906 -34.464 19.125 1.00 46.69  ? 47  ARG B N   1 
ATOM   1813 C  CA  . ARG B 2 47  ? -17.795 -33.561 18.418 1.00 51.50  ? 47  ARG B CA  1 
ATOM   1814 C  C   . ARG B 2 47  ? -18.322 -34.186 17.150 1.00 49.60  ? 47  ARG B C   1 
ATOM   1815 O  O   . ARG B 2 47  ? -17.631 -34.953 16.506 1.00 47.00  ? 47  ARG B O   1 
ATOM   1816 C  CB  . ARG B 2 47  ? -17.051 -32.297 18.039 1.00 52.71  ? 47  ARG B CB  1 
ATOM   1817 C  CG  . ARG B 2 47  ? -16.871 -31.307 19.155 1.00 54.28  ? 47  ARG B CG  1 
ATOM   1818 C  CD  . ARG B 2 47  ? -15.971 -30.222 18.646 1.00 59.81  ? 47  ARG B CD  1 
ATOM   1819 N  NE  . ARG B 2 47  ? -15.972 -28.989 19.423 1.00 64.23  ? 47  ARG B NE  1 
ATOM   1820 C  CZ  . ARG B 2 47  ? -16.931 -28.070 19.399 1.00 65.49  ? 47  ARG B CZ  1 
ATOM   1821 N  NH1 . ARG B 2 47  ? -18.037 -28.246 18.680 1.00 64.41  ? 47  ARG B NH1 1 
ATOM   1822 N  NH2 . ARG B 2 47  ? -16.784 -26.976 20.130 1.00 67.17  ? 47  ARG B NH2 1 
ATOM   1823 N  N   . GLY B 2 48  ? -19.558 -33.840 16.811 1.00 51.90  ? 48  GLY B N   1 
ATOM   1824 C  CA  . GLY B 2 48  ? -20.123 -34.096 15.488 1.00 52.30  ? 48  GLY B CA  1 
ATOM   1825 C  C   . GLY B 2 48  ? -20.742 -32.798 15.022 1.00 52.10  ? 48  GLY B C   1 
ATOM   1826 O  O   . GLY B 2 48  ? -20.651 -31.789 15.720 1.00 54.29  ? 48  GLY B O   1 
ATOM   1827 N  N   . LEU B 2 49  ? -21.377 -32.820 13.858 1.00 51.71  ? 49  LEU B N   1 
ATOM   1828 C  CA  . LEU B 2 49  ? -21.904 -31.596 13.250 1.00 52.72  ? 49  LEU B CA  1 
ATOM   1829 C  C   . LEU B 2 49  ? -22.860 -30.874 14.196 1.00 51.64  ? 49  LEU B C   1 
ATOM   1830 O  O   . LEU B 2 49  ? -22.784 -29.642 14.347 1.00 54.83  ? 49  LEU B O   1 
ATOM   1831 C  CB  . LEU B 2 49  ? -22.582 -31.903 11.894 1.00 55.38  ? 49  LEU B CB  1 
ATOM   1832 C  CG  . LEU B 2 49  ? -23.441 -30.813 11.237 1.00 56.31  ? 49  LEU B CG  1 
ATOM   1833 C  CD1 . LEU B 2 49  ? -22.652 -29.545 10.995 1.00 58.36  ? 49  LEU B CD1 1 
ATOM   1834 C  CD2 . LEU B 2 49  ? -24.031 -31.330 9.935  1.00 56.88  ? 49  LEU B CD2 1 
ATOM   1835 N  N   . ARG B 2 50  ? -23.726 -31.638 14.857 1.00 42.60  ? 50  ARG B N   1 
ATOM   1836 C  CA  . ARG B 2 50  ? -24.734 -31.053 15.732 1.00 44.30  ? 50  ARG B CA  1 
ATOM   1837 C  C   . ARG B 2 50  ? -24.627 -31.516 17.184 1.00 42.51  ? 50  ARG B C   1 
ATOM   1838 O  O   . ARG B 2 50  ? -25.598 -31.433 17.924 1.00 44.02  ? 50  ARG B O   1 
ATOM   1839 C  CB  . ARG B 2 50  ? -26.136 -31.356 15.195 1.00 43.36  ? 50  ARG B CB  1 
ATOM   1840 C  CG  . ARG B 2 50  ? -26.333 -30.938 13.762 1.00 42.61  ? 50  ARG B CG  1 
ATOM   1841 C  CD  . ARG B 2 50  ? -27.764 -31.075 13.304 1.00 43.80  ? 50  ARG B CD  1 
ATOM   1842 N  NE  . ARG B 2 50  ? -27.897 -30.587 11.932 1.00 44.47  ? 50  ARG B NE  1 
ATOM   1843 C  CZ  . ARG B 2 50  ? -27.857 -31.346 10.838 1.00 47.39  ? 50  ARG B CZ  1 
ATOM   1844 N  NH1 . ARG B 2 50  ? -27.694 -32.659 10.910 1.00 47.50  ? 50  ARG B NH1 1 
ATOM   1845 N  NH2 . ARG B 2 50  ? -27.989 -30.779 9.647  1.00 49.00  ? 50  ARG B NH2 1 
ATOM   1846 N  N   . TRP B 2 51  ? -23.456 -31.986 17.604 1.00 43.13  ? 51  TRP B N   1 
ATOM   1847 C  CA  . TRP B 2 51  ? -23.268 -32.362 18.996 1.00 42.89  ? 51  TRP B CA  1 
ATOM   1848 C  C   . TRP B 2 51  ? -21.839 -32.177 19.495 1.00 42.46  ? 51  TRP B C   1 
ATOM   1849 O  O   . TRP B 2 51  ? -20.893 -32.117 18.712 1.00 39.63  ? 51  TRP B O   1 
ATOM   1850 C  CB  . TRP B 2 51  ? -23.741 -33.795 19.244 1.00 45.58  ? 51  TRP B CB  1 
ATOM   1851 C  CG  . TRP B 2 51  ? -23.008 -34.833 18.460 1.00 43.97  ? 51  TRP B CG  1 
ATOM   1852 C  CD1 . TRP B 2 51  ? -23.335 -35.308 17.233 1.00 44.51  ? 51  TRP B CD1 1 
ATOM   1853 C  CD2 . TRP B 2 51  ? -21.823 -35.523 18.859 1.00 45.24  ? 51  TRP B CD2 1 
ATOM   1854 N  NE1 . TRP B 2 51  ? -22.426 -36.254 16.834 1.00 44.20  ? 51  TRP B NE1 1 
ATOM   1855 C  CE2 . TRP B 2 51  ? -21.480 -36.402 17.813 1.00 45.60  ? 51  TRP B CE2 1 
ATOM   1856 C  CE3 . TRP B 2 51  ? -21.009 -35.474 19.994 1.00 46.05  ? 51  TRP B CE3 1 
ATOM   1857 C  CZ2 . TRP B 2 51  ? -20.364 -37.245 17.874 1.00 46.69  ? 51  TRP B CZ2 1 
ATOM   1858 C  CZ3 . TRP B 2 51  ? -19.891 -36.304 20.054 1.00 44.87  ? 51  TRP B CZ3 1 
ATOM   1859 C  CH2 . TRP B 2 51  ? -19.584 -37.182 19.001 1.00 45.77  ? 51  TRP B CH2 1 
ATOM   1860 N  N   . LEU B 2 52  ? -21.736 -32.034 20.816 1.00 44.96  ? 52  LEU B N   1 
ATOM   1861 C  CA  . LEU B 2 52  ? -20.487 -31.867 21.537 1.00 47.20  ? 52  LEU B CA  1 
ATOM   1862 C  C   . LEU B 2 52  ? -20.626 -32.667 22.816 1.00 49.17  ? 52  LEU B C   1 
ATOM   1863 O  O   . LEU B 2 52  ? -21.539 -32.413 23.598 1.00 44.50  ? 52  LEU B O   1 
ATOM   1864 C  CB  . LEU B 2 52  ? -20.263 -30.400 21.921 1.00 52.68  ? 52  LEU B CB  1 
ATOM   1865 C  CG  . LEU B 2 52  ? -19.124 -30.158 22.924 1.00 54.19  ? 52  LEU B CG  1 
ATOM   1866 C  CD1 . LEU B 2 52  ? -17.804 -30.660 22.328 1.00 53.01  ? 52  LEU B CD1 1 
ATOM   1867 C  CD2 . LEU B 2 52  ? -19.014 -28.690 23.299 1.00 53.40  ? 52  LEU B CD2 1 
ATOM   1868 N  N   . ALA B 2 53  ? -19.731 -33.629 23.020 1.00 47.36  ? 53  ALA B N   1 
ATOM   1869 C  CA  . ALA B 2 53  ? -19.688 -34.413 24.247 1.00 47.18  ? 53  ALA B CA  1 
ATOM   1870 C  C   . ALA B 2 53  ? -18.392 -34.075 24.971 1.00 46.73  ? 53  ALA B C   1 
ATOM   1871 O  O   . ALA B 2 53  ? -17.327 -34.047 24.357 1.00 47.77  ? 53  ALA B O   1 
ATOM   1872 C  CB  . ALA B 2 53  ? -19.754 -35.907 23.935 1.00 44.30  ? 53  ALA B CB  1 
ATOM   1873 N  N   . ARG B 2 54  ? -18.500 -33.820 26.267 1.00 47.72  ? 54  ARG B N   1 
ATOM   1874 C  CA  . ARG B 2 54  ? -17.372 -33.448 27.123 1.00 49.22  ? 54  ARG B CA  1 
ATOM   1875 C  C   . ARG B 2 54  ? -17.389 -34.304 28.375 1.00 46.56  ? 54  ARG B C   1 
ATOM   1876 O  O   . ARG B 2 54  ? -18.443 -34.448 28.987 1.00 45.11  ? 54  ARG B O   1 
ATOM   1877 C  CB  . ARG B 2 54  ? -17.543 -32.015 27.609 1.00 52.26  ? 54  ARG B CB  1 
ATOM   1878 C  CG  . ARG B 2 54  ? -17.111 -30.962 26.649 1.00 58.23  ? 54  ARG B CG  1 
ATOM   1879 C  CD  . ARG B 2 54  ? -15.774 -30.399 27.029 1.00 57.40  ? 54  ARG B CD  1 
ATOM   1880 N  NE  . ARG B 2 54  ? -15.168 -29.744 25.878 1.00 59.33  ? 54  ARG B NE  1 
ATOM   1881 C  CZ  . ARG B 2 54  ? -15.387 -28.483 25.523 1.00 59.99  ? 54  ARG B CZ  1 
ATOM   1882 N  NH1 . ARG B 2 54  ? -16.229 -27.722 26.209 1.00 60.64  ? 54  ARG B NH1 1 
ATOM   1883 N  NH2 . ARG B 2 54  ? -14.765 -27.995 24.459 1.00 58.52  ? 54  ARG B NH2 1 
ATOM   1884 N  N   . GLN B 2 55  ? -16.231 -34.816 28.782 1.00 41.78  ? 55  GLN B N   1 
ATOM   1885 C  CA  . GLN B 2 55  ? -16.082 -35.424 30.102 1.00 42.46  ? 55  GLN B CA  1 
ATOM   1886 C  C   . GLN B 2 55  ? -15.609 -34.361 31.098 1.00 40.86  ? 55  GLN B C   1 
ATOM   1887 O  O   . GLN B 2 55  ? -14.557 -33.752 30.918 1.00 40.15  ? 55  GLN B O   1 
ATOM   1888 C  CB  . GLN B 2 55  ? -15.074 -36.572 30.085 1.00 39.17  ? 55  GLN B CB  1 
ATOM   1889 C  CG  . GLN B 2 55  ? -15.097 -37.364 31.384 1.00 41.63  ? 55  GLN B CG  1 
ATOM   1890 C  CD  . GLN B 2 55  ? -13.990 -38.407 31.504 1.00 42.78  ? 55  GLN B CD  1 
ATOM   1891 O  OE1 . GLN B 2 55  ? -12.908 -38.264 30.936 1.00 45.22  ? 55  GLN B OE1 1 
ATOM   1892 N  NE2 . GLN B 2 55  ? -14.266 -39.459 32.265 1.00 48.10  ? 55  GLN B NE2 1 
ATOM   1893 N  N   . LEU B 2 56  ? -16.376 -34.178 32.158 1.00 42.17  ? 56  LEU B N   1 
ATOM   1894 C  CA  . LEU B 2 56  ? -16.053 -33.225 33.207 1.00 42.16  ? 56  LEU B CA  1 
ATOM   1895 C  C   . LEU B 2 56  ? -15.548 -34.044 34.368 1.00 41.39  ? 56  LEU B C   1 
ATOM   1896 O  O   . LEU B 2 56  ? -16.061 -35.123 34.624 1.00 39.64  ? 56  LEU B O   1 
ATOM   1897 C  CB  . LEU B 2 56  ? -17.298 -32.421 33.600 1.00 42.78  ? 56  LEU B CB  1 
ATOM   1898 C  CG  . LEU B 2 56  ? -17.998 -31.785 32.396 1.00 43.30  ? 56  LEU B CG  1 
ATOM   1899 C  CD1 . LEU B 2 56  ? -19.300 -31.104 32.790 1.00 45.38  ? 56  LEU B CD1 1 
ATOM   1900 C  CD2 . LEU B 2 56  ? -17.048 -30.827 31.707 1.00 37.72  ? 56  LEU B CD2 1 
ATOM   1901 N  N   . VAL B 2 57  ? -14.523 -33.542 35.048 1.00 40.79  ? 57  VAL B N   1 
ATOM   1902 C  CA  . VAL B 2 57  ? -13.799 -34.333 36.035 1.00 39.86  ? 57  VAL B CA  1 
ATOM   1903 C  C   . VAL B 2 57  ? -13.597 -33.544 37.321 1.00 42.38  ? 57  VAL B C   1 
ATOM   1904 O  O   . VAL B 2 57  ? -13.772 -32.312 37.351 1.00 36.95  ? 57  VAL B O   1 
ATOM   1905 C  CB  . VAL B 2 57  ? -12.432 -34.810 35.492 1.00 38.12  ? 57  VAL B CB  1 
ATOM   1906 C  CG1 . VAL B 2 57  ? -12.628 -35.759 34.323 1.00 37.15  ? 57  VAL B CG1 1 
ATOM   1907 C  CG2 . VAL B 2 57  ? -11.561 -33.625 35.078 1.00 38.06  ? 57  VAL B CG2 1 
ATOM   1908 N  N   . ASP B 2 58  ? -13.236 -34.274 38.376 1.00 40.88  ? 58  ASP B N   1 
ATOM   1909 C  CA  . ASP B 2 58  ? -12.944 -33.699 39.684 1.00 39.23  ? 58  ASP B CA  1 
ATOM   1910 C  C   . ASP B 2 58  ? -14.106 -32.827 40.159 1.00 36.84  ? 58  ASP B C   1 
ATOM   1911 O  O   . ASP B 2 58  ? -13.926 -31.688 40.574 1.00 40.37  ? 58  ASP B O   1 
ATOM   1912 C  CB  . ASP B 2 58  ? -11.641 -32.906 39.618 1.00 42.72  ? 58  ASP B CB  1 
ATOM   1913 C  CG  . ASP B 2 58  ? -11.130 -32.517 40.986 1.00 48.58  ? 58  ASP B CG  1 
ATOM   1914 O  OD1 . ASP B 2 58  ? -11.251 -33.340 41.938 1.00 51.77  ? 58  ASP B OD1 1 
ATOM   1915 O  OD2 . ASP B 2 58  ? -10.607 -31.384 41.101 1.00 53.12  ? 58  ASP B OD2 1 
ATOM   1916 N  N   . ILE B 2 59  ? -15.306 -33.383 40.075 1.00 36.43  ? 59  ILE B N   1 
ATOM   1917 C  CA  . ILE B 2 59  ? -16.534 -32.645 40.345 1.00 38.91  ? 59  ILE B CA  1 
ATOM   1918 C  C   . ILE B 2 59  ? -16.761 -32.586 41.858 1.00 40.78  ? 59  ILE B C   1 
ATOM   1919 O  O   . ILE B 2 59  ? -17.066 -33.606 42.483 1.00 41.67  ? 59  ILE B O   1 
ATOM   1920 C  CB  . ILE B 2 59  ? -17.732 -33.311 39.642 1.00 38.10  ? 59  ILE B CB  1 
ATOM   1921 C  CG1 . ILE B 2 59  ? -17.491 -33.399 38.134 1.00 40.74  ? 59  ILE B CG1 1 
ATOM   1922 C  CG2 . ILE B 2 59  ? -19.019 -32.537 39.928 1.00 40.16  ? 59  ILE B CG2 1 
ATOM   1923 C  CD1 . ILE B 2 59  ? -18.564 -34.137 37.360 1.00 36.91  ? 59  ILE B CD1 1 
ATOM   1924 N  N   . ARG B 2 60  ? -16.610 -31.401 42.444 1.00 41.62  ? 60  ARG B N   1 
ATOM   1925 C  CA  . ARG B 2 60  ? -16.578 -31.281 43.900 1.00 46.46  ? 60  ARG B CA  1 
ATOM   1926 C  C   . ARG B 2 60  ? -17.644 -30.394 44.540 1.00 45.91  ? 60  ARG B C   1 
ATOM   1927 O  O   . ARG B 2 60  ? -17.918 -30.541 45.733 1.00 45.15  ? 60  ARG B O   1 
ATOM   1928 C  CB  . ARG B 2 60  ? -15.177 -30.863 44.345 1.00 48.32  ? 60  ARG B CB  1 
ATOM   1929 C  CG  . ARG B 2 60  ? -14.161 -31.955 44.078 1.00 51.09  ? 60  ARG B CG  1 
ATOM   1930 C  CD  . ARG B 2 60  ? -12.873 -31.767 44.826 1.00 53.90  ? 60  ARG B CD  1 
ATOM   1931 N  NE  . ARG B 2 60  ? -11.940 -32.856 44.528 1.00 56.60  ? 60  ARG B NE  1 
ATOM   1932 C  CZ  . ARG B 2 60  ? -11.922 -34.047 45.138 1.00 61.04  ? 60  ARG B CZ  1 
ATOM   1933 N  NH1 . ARG B 2 60  ? -11.026 -34.958 44.764 1.00 59.08  ? 60  ARG B NH1 1 
ATOM   1934 N  NH2 . ARG B 2 60  ? -12.772 -34.343 46.127 1.00 62.79  ? 60  ARG B NH2 1 
ATOM   1935 N  N   . GLU B 2 61  ? -18.250 -29.493 43.770 1.00 49.00  ? 61  GLU B N   1 
ATOM   1936 C  CA  . GLU B 2 61  ? -19.261 -28.582 44.314 1.00 49.13  ? 61  GLU B CA  1 
ATOM   1937 C  C   . GLU B 2 61  ? -20.549 -29.345 44.609 1.00 43.52  ? 61  GLU B C   1 
ATOM   1938 O  O   . GLU B 2 61  ? -20.899 -30.270 43.878 1.00 43.71  ? 61  GLU B O   1 
ATOM   1939 C  CB  . GLU B 2 61  ? -19.572 -27.454 43.326 1.00 55.51  ? 61  GLU B CB  1 
ATOM   1940 C  CG  . GLU B 2 61  ? -18.465 -26.405 43.170 1.00 58.65  ? 61  GLU B CG  1 
ATOM   1941 C  CD  . GLU B 2 61  ? -18.990 -25.066 42.643 1.00 60.92  ? 61  GLU B CD  1 
ATOM   1942 O  OE1 . GLU B 2 61  ? -19.365 -24.194 43.470 1.00 63.38  ? 61  GLU B OE1 1 
ATOM   1943 O  OE2 . GLU B 2 61  ? -19.015 -24.883 41.404 1.00 65.03  ? 61  GLU B OE2 1 
ATOM   1944 N  N   . PRO B 2 62  ? -21.272 -28.950 45.666 1.00 40.59  ? 62  PRO B N   1 
ATOM   1945 C  CA  . PRO B 2 62  ? -22.574 -29.546 45.929 1.00 42.21  ? 62  PRO B CA  1 
ATOM   1946 C  C   . PRO B 2 62  ? -23.471 -29.536 44.691 1.00 42.23  ? 62  PRO B C   1 
ATOM   1947 O  O   . PRO B 2 62  ? -24.099 -30.539 44.383 1.00 40.61  ? 62  PRO B O   1 
ATOM   1948 C  CB  . PRO B 2 62  ? -23.154 -28.639 47.010 1.00 41.00  ? 62  PRO B CB  1 
ATOM   1949 C  CG  . PRO B 2 62  ? -21.981 -28.145 47.727 1.00 41.99  ? 62  PRO B CG  1 
ATOM   1950 C  CD  . PRO B 2 62  ? -20.936 -27.934 46.674 1.00 41.65  ? 62  PRO B CD  1 
ATOM   1951 N  N   . GLU B 2 63  ? -23.507 -28.409 43.987 1.00 43.45  ? 63  GLU B N   1 
ATOM   1952 C  CA  . GLU B 2 63  ? -24.350 -28.265 42.822 1.00 43.86  ? 63  GLU B CA  1 
ATOM   1953 C  C   . GLU B 2 63  ? -23.663 -27.422 41.766 1.00 37.95  ? 63  GLU B C   1 
ATOM   1954 O  O   . GLU B 2 63  ? -23.042 -26.418 42.086 1.00 35.44  ? 63  GLU B O   1 
ATOM   1955 C  CB  . GLU B 2 63  ? -25.655 -27.577 43.229 1.00 48.55  ? 63  GLU B CB  1 
ATOM   1956 C  CG  . GLU B 2 63  ? -26.633 -27.342 42.073 1.00 52.20  ? 63  GLU B CG  1 
ATOM   1957 C  CD  . GLU B 2 63  ? -27.777 -26.401 42.431 1.00 55.06  ? 63  GLU B CD  1 
ATOM   1958 O  OE1 . GLU B 2 63  ? -28.378 -26.585 43.521 1.00 54.67  ? 63  GLU B OE1 1 
ATOM   1959 O  OE2 . GLU B 2 63  ? -28.069 -25.490 41.611 1.00 57.85  ? 63  GLU B OE2 1 
ATOM   1960 N  N   . THR B 2 64  ? -23.785 -27.826 40.511 1.00 36.99  ? 64  THR B N   1 
ATOM   1961 C  CA  . THR B 2 64  ? -23.390 -26.962 39.403 1.00 40.20  ? 64  THR B CA  1 
ATOM   1962 C  C   . THR B 2 64  ? -24.287 -27.193 38.203 1.00 38.24  ? 64  THR B C   1 
ATOM   1963 O  O   . THR B 2 64  ? -24.811 -28.284 38.025 1.00 41.71  ? 64  THR B O   1 
ATOM   1964 C  CB  . THR B 2 64  ? -21.898 -27.124 39.030 1.00 45.32  ? 64  THR B CB  1 
ATOM   1965 O  OG1 . THR B 2 64  ? -21.475 -25.981 38.269 1.00 41.52  ? 64  THR B OG1 1 
ATOM   1966 C  CG2 . THR B 2 64  ? -21.669 -28.373 38.222 1.00 43.19  ? 64  THR B CG2 1 
ATOM   1967 N  N   . GLN B 2 65  ? -24.485 -26.145 37.405 1.00 43.89  ? 65  GLN B N   1 
ATOM   1968 C  CA  . GLN B 2 65  ? -25.415 -26.179 36.283 1.00 44.20  ? 65  GLN B CA  1 
ATOM   1969 C  C   . GLN B 2 65  ? -24.717 -25.782 35.000 1.00 45.34  ? 65  GLN B C   1 
ATOM   1970 O  O   . GLN B 2 65  ? -24.660 -24.610 34.667 1.00 39.74  ? 65  GLN B O   1 
ATOM   1971 C  CB  . GLN B 2 65  ? -26.575 -25.226 36.535 1.00 43.83  ? 65  GLN B CB  1 
ATOM   1972 C  CG  . GLN B 2 65  ? -27.299 -25.489 37.830 1.00 46.76  ? 65  GLN B CG  1 
ATOM   1973 C  CD  . GLN B 2 65  ? -28.602 -24.717 37.934 1.00 48.80  ? 65  GLN B CD  1 
ATOM   1974 O  OE1 . GLN B 2 65  ? -29.372 -24.649 36.977 1.00 52.95  ? 65  GLN B OE1 1 
ATOM   1975 N  NE2 . GLN B 2 65  ? -28.858 -24.144 39.102 1.00 47.00  ? 65  GLN B NE2 1 
ATOM   1976 N  N   . PRO B 2 66  ? -24.170 -26.759 34.273 1.00 44.83  ? 66  PRO B N   1 
ATOM   1977 C  CA  . PRO B 2 66  ? -23.530 -26.454 32.992 1.00 45.23  ? 66  PRO B CA  1 
ATOM   1978 C  C   . PRO B 2 66  ? -24.501 -25.868 31.981 1.00 44.01  ? 66  PRO B C   1 
ATOM   1979 O  O   . PRO B 2 66  ? -25.663 -26.272 31.961 1.00 39.77  ? 66  PRO B O   1 
ATOM   1980 C  CB  . PRO B 2 66  ? -23.065 -27.829 32.505 1.00 48.31  ? 66  PRO B CB  1 
ATOM   1981 C  CG  . PRO B 2 66  ? -23.010 -28.673 33.720 1.00 49.69  ? 66  PRO B CG  1 
ATOM   1982 C  CD  . PRO B 2 66  ? -24.097 -28.195 34.596 1.00 49.87  ? 66  PRO B CD  1 
ATOM   1983 N  N   . VAL B 2 67  ? -24.033 -24.918 31.167 1.00 39.18  ? 67  VAL B N   1 
ATOM   1984 C  CA  . VAL B 2 67  ? -24.859 -24.341 30.105 1.00 39.89  ? 67  VAL B CA  1 
ATOM   1985 C  C   . VAL B 2 67  ? -24.355 -24.787 28.738 1.00 39.23  ? 67  VAL B C   1 
ATOM   1986 O  O   . VAL B 2 67  ? -23.262 -24.440 28.315 1.00 35.06  ? 67  VAL B O   1 
ATOM   1987 C  CB  . VAL B 2 67  ? -24.906 -22.812 30.108 1.00 41.54  ? 67  VAL B CB  1 
ATOM   1988 C  CG1 . VAL B 2 67  ? -26.014 -22.357 29.163 1.00 36.60  ? 67  VAL B CG1 1 
ATOM   1989 C  CG2 . VAL B 2 67  ? -25.114 -22.255 31.517 1.00 36.35  ? 67  VAL B CG2 1 
ATOM   1990 N  N   . CYS B 2 68  ? -25.156 -25.601 28.077 1.00 39.98  ? 68  CYS B N   1 
ATOM   1991 C  CA  . CYS B 2 68  ? -24.878 -26.033 26.717 1.00 43.64  ? 68  CYS B CA  1 
ATOM   1992 C  C   . CYS B 2 68  ? -25.453 -24.993 25.748 1.00 43.46  ? 68  CYS B C   1 
ATOM   1993 O  O   . CYS B 2 68  ? -26.545 -24.473 25.970 1.00 40.26  ? 68  CYS B O   1 
ATOM   1994 C  CB  . CYS B 2 68  ? -25.498 -27.425 26.527 1.00 50.66  ? 68  CYS B CB  1 
ATOM   1995 S  SG  . CYS B 2 68  ? -26.125 -27.815 24.940 1.00 56.72  ? 68  CYS B SG  1 
ATOM   1996 N  N   . PHE B 2 69  ? -24.720 -24.672 24.689 1.00 43.62  ? 69  PHE B N   1 
ATOM   1997 C  CA  . PHE B 2 69  ? -25.215 -23.713 23.705 1.00 42.33  ? 69  PHE B CA  1 
ATOM   1998 C  C   . PHE B 2 69  ? -24.759 -24.022 22.286 1.00 40.97  ? 69  PHE B C   1 
ATOM   1999 O  O   . PHE B 2 69  ? -23.701 -24.605 22.083 1.00 38.45  ? 69  PHE B O   1 
ATOM   2000 C  CB  . PHE B 2 69  ? -24.831 -22.275 24.087 1.00 40.97  ? 69  PHE B CB  1 
ATOM   2001 C  CG  . PHE B 2 69  ? -23.359 -21.969 23.977 1.00 42.02  ? 69  PHE B CG  1 
ATOM   2002 C  CD1 . PHE B 2 69  ? -22.487 -22.285 25.017 1.00 45.61  ? 69  PHE B CD1 1 
ATOM   2003 C  CD2 . PHE B 2 69  ? -22.849 -21.331 22.851 1.00 38.91  ? 69  PHE B CD2 1 
ATOM   2004 C  CE1 . PHE B 2 69  ? -21.136 -22.006 24.916 1.00 41.28  ? 69  PHE B CE1 1 
ATOM   2005 C  CE2 . PHE B 2 69  ? -21.508 -21.068 22.735 1.00 36.49  ? 69  PHE B CE2 1 
ATOM   2006 C  CZ  . PHE B 2 69  ? -20.647 -21.399 23.771 1.00 40.90  ? 69  PHE B CZ  1 
ATOM   2007 N  N   . PHE B 2 70  ? -25.607 -23.668 21.324 1.00 39.57  ? 70  PHE B N   1 
ATOM   2008 C  CA  . PHE B 2 70  ? -25.227 -23.545 19.905 1.00 38.19  ? 70  PHE B CA  1 
ATOM   2009 C  C   . PHE B 2 70  ? -25.794 -22.251 19.341 1.00 38.52  ? 70  PHE B C   1 
ATOM   2010 O  O   . PHE B 2 70  ? -26.937 -21.902 19.620 1.00 40.22  ? 70  PHE B O   1 
ATOM   2011 C  CB  . PHE B 2 70  ? -25.812 -24.675 19.084 1.00 40.15  ? 70  PHE B CB  1 
ATOM   2012 C  CG  . PHE B 2 70  ? -25.184 -26.005 19.356 1.00 39.17  ? 70  PHE B CG  1 
ATOM   2013 C  CD1 . PHE B 2 70  ? -24.091 -26.433 18.620 1.00 41.03  ? 70  PHE B CD1 1 
ATOM   2014 C  CD2 . PHE B 2 70  ? -25.652 -26.792 20.356 1.00 39.66  ? 70  PHE B CD2 1 
ATOM   2015 C  CE1 . PHE B 2 70  ? -23.506 -27.643 18.883 1.00 42.48  ? 70  PHE B CE1 1 
ATOM   2016 C  CE2 . PHE B 2 70  ? -25.066 -28.008 20.608 1.00 43.90  ? 70  PHE B CE2 1 
ATOM   2017 C  CZ  . PHE B 2 70  ? -23.991 -28.419 19.869 1.00 38.85  ? 70  PHE B CZ  1 
ATOM   2018 N  N   . ARG B 2 71  ? -25.007 -21.573 18.526 1.00 36.77  ? 71  ARG B N   1 
ATOM   2019 C  CA  . ARG B 2 71  ? -25.475 -20.405 17.793 1.00 44.93  ? 71  ARG B CA  1 
ATOM   2020 C  C   . ARG B 2 71  ? -26.159 -20.920 16.525 1.00 44.56  ? 71  ARG B C   1 
ATOM   2021 O  O   . ARG B 2 71  ? -25.590 -21.735 15.804 1.00 43.08  ? 71  ARG B O   1 
ATOM   2022 C  CB  . ARG B 2 71  ? -24.299 -19.490 17.465 1.00 43.76  ? 71  ARG B CB  1 
ATOM   2023 C  CG  . ARG B 2 71  ? -24.666 -18.147 16.802 1.00 47.53  ? 71  ARG B CG  1 
ATOM   2024 C  CD  . ARG B 2 71  ? -25.357 -17.190 17.756 1.00 50.25  ? 71  ARG B CD  1 
ATOM   2025 N  NE  . ARG B 2 71  ? -25.471 -15.845 17.184 1.00 50.18  ? 71  ARG B NE  1 
ATOM   2026 C  CZ  . ARG B 2 71  ? -26.034 -14.802 17.799 1.00 50.74  ? 71  ARG B CZ  1 
ATOM   2027 N  NH1 . ARG B 2 71  ? -26.562 -14.930 19.018 1.00 49.15  ? 71  ARG B NH1 1 
ATOM   2028 N  NH2 . ARG B 2 71  ? -26.073 -13.623 17.191 1.00 54.35  ? 71  ARG B NH2 1 
ATOM   2029 N  N   . CYS B 2 72  ? -27.392 -20.483 16.289 1.00 46.35  ? 72  CYS B N   1 
ATOM   2030 C  CA  . CYS B 2 72  ? -28.164 -20.937 15.134 1.00 48.38  ? 72  CYS B CA  1 
ATOM   2031 C  C   . CYS B 2 72  ? -28.736 -19.729 14.416 1.00 45.87  ? 72  CYS B C   1 
ATOM   2032 O  O   . CYS B 2 72  ? -29.653 -19.086 14.916 1.00 46.39  ? 72  CYS B O   1 
ATOM   2033 C  CB  . CYS B 2 72  ? -29.284 -21.884 15.573 1.00 52.63  ? 72  CYS B CB  1 
ATOM   2034 S  SG  . CYS B 2 72  ? -30.012 -22.812 14.195 1.00 58.45  ? 72  CYS B SG  1 
ATOM   2035 N  N   . ALA B 2 73  ? -28.185 -19.421 13.246 1.00 43.75  ? 73  ALA B N   1 
ATOM   2036 C  CA  . ALA B 2 73  ? -28.491 -18.176 12.561 1.00 45.42  ? 73  ALA B CA  1 
ATOM   2037 C  C   . ALA B 2 73  ? -28.253 -17.033 13.550 1.00 44.42  ? 73  ALA B C   1 
ATOM   2038 O  O   . ALA B 2 73  ? -27.147 -16.904 14.084 1.00 45.55  ? 73  ALA B O   1 
ATOM   2039 C  CB  . ALA B 2 73  ? -29.925 -18.183 12.023 1.00 44.43  ? 73  ALA B CB  1 
ATOM   2040 N  N   . ARG B 2 74  ? -29.283 -16.241 13.838 1.00 42.60  ? 74  ARG B N   1 
ATOM   2041 C  CA  . ARG B 2 74  ? -29.121 -15.089 14.719 1.00 43.41  ? 74  ARG B CA  1 
ATOM   2042 C  C   . ARG B 2 74  ? -29.392 -15.382 16.204 1.00 40.68  ? 74  ARG B C   1 
ATOM   2043 O  O   . ARG B 2 74  ? -29.324 -14.476 17.020 1.00 39.97  ? 74  ARG B O   1 
ATOM   2044 C  CB  . ARG B 2 74  ? -30.025 -13.955 14.239 1.00 47.51  ? 74  ARG B CB  1 
ATOM   2045 C  CG  . ARG B 2 74  ? -29.614 -13.388 12.895 1.00 49.71  ? 74  ARG B CG  1 
ATOM   2046 C  CD  . ARG B 2 74  ? -30.571 -12.318 12.428 1.00 51.54  ? 74  ARG B CD  1 
ATOM   2047 N  NE  . ARG B 2 74  ? -31.939 -12.812 12.296 1.00 52.92  ? 74  ARG B NE  1 
ATOM   2048 C  CZ  . ARG B 2 74  ? -32.388 -13.544 11.281 1.00 54.20  ? 74  ARG B CZ  1 
ATOM   2049 N  NH1 . ARG B 2 74  ? -31.581 -13.901 10.286 1.00 56.38  ? 74  ARG B NH1 1 
ATOM   2050 N  NH2 . ARG B 2 74  ? -33.660 -13.929 11.265 1.00 53.42  ? 74  ARG B NH2 1 
ATOM   2051 N  N   . ARG B 2 75  ? -29.678 -16.639 16.546 1.00 37.52  ? 75  ARG B N   1 
ATOM   2052 C  CA  . ARG B 2 75  ? -30.091 -17.021 17.897 1.00 34.85  ? 75  ARG B CA  1 
ATOM   2053 C  C   . ARG B 2 75  ? -29.066 -17.932 18.533 1.00 33.11  ? 75  ARG B C   1 
ATOM   2054 O  O   . ARG B 2 75  ? -28.430 -18.723 17.847 1.00 34.45  ? 75  ARG B O   1 
ATOM   2055 C  CB  . ARG B 2 75  ? -31.412 -17.792 17.854 1.00 33.51  ? 75  ARG B CB  1 
ATOM   2056 C  CG  . ARG B 2 75  ? -32.554 -17.082 17.149 1.00 37.99  ? 75  ARG B CG  1 
ATOM   2057 C  CD  . ARG B 2 75  ? -33.408 -16.337 18.123 1.00 36.08  ? 75  ARG B CD  1 
ATOM   2058 N  NE  . ARG B 2 75  ? -34.476 -15.594 17.468 1.00 36.22  ? 75  ARG B NE  1 
ATOM   2059 C  CZ  . ARG B 2 75  ? -35.309 -14.782 18.103 1.00 35.19  ? 75  ARG B CZ  1 
ATOM   2060 N  NH1 . ARG B 2 75  ? -35.195 -14.609 19.410 1.00 35.52  ? 75  ARG B NH1 1 
ATOM   2061 N  NH2 . ARG B 2 75  ? -36.255 -14.141 17.432 1.00 37.30  ? 75  ARG B NH2 1 
ATOM   2062 N  N   . THR B 2 76  ? -28.935 -17.822 19.853 1.00 29.23  ? 76  THR B N   1 
ATOM   2063 C  CA  . THR B 2 76  ? -28.211 -18.788 20.659 1.00 33.03  ? 76  THR B CA  1 
ATOM   2064 C  C   . THR B 2 76  ? -29.234 -19.710 21.273 1.00 33.82  ? 76  THR B C   1 
ATOM   2065 O  O   . THR B 2 76  ? -30.140 -19.266 21.982 1.00 36.01  ? 76  THR B O   1 
ATOM   2066 C  CB  . THR B 2 76  ? -27.437 -18.122 21.785 1.00 34.99  ? 76  THR B CB  1 
ATOM   2067 O  OG1 . THR B 2 76  ? -26.487 -17.214 21.219 1.00 32.20  ? 76  THR B OG1 1 
ATOM   2068 C  CG2 . THR B 2 76  ? -26.698 -19.155 22.621 1.00 26.08  ? 76  THR B CG2 1 
ATOM   2069 N  N   . LEU B 2 77  ? -29.091 -20.991 20.974 1.00 32.49  ? 77  LEU B N   1 
ATOM   2070 C  CA  . LEU B 2 77  ? -29.970 -22.015 21.487 1.00 34.74  ? 77  LEU B CA  1 
ATOM   2071 C  C   . LEU B 2 77  ? -29.240 -22.588 22.674 1.00 34.72  ? 77  LEU B C   1 
ATOM   2072 O  O   . LEU B 2 77  ? -28.068 -22.893 22.571 1.00 39.87  ? 77  LEU B O   1 
ATOM   2073 C  CB  . LEU B 2 77  ? -30.162 -23.103 20.434 1.00 36.61  ? 77  LEU B CB  1 
ATOM   2074 C  CG  . LEU B 2 77  ? -30.606 -22.641 19.055 1.00 35.72  ? 77  LEU B CG  1 
ATOM   2075 C  CD1 . LEU B 2 77  ? -30.613 -23.847 18.144 1.00 34.81  ? 77  LEU B CD1 1 
ATOM   2076 C  CD2 . LEU B 2 77  ? -31.990 -21.983 19.139 1.00 34.04  ? 77  LEU B CD2 1 
ATOM   2077 N  N   . GLN B 2 78  ? -29.895 -22.733 23.810 1.00 36.94  ? 78  GLN B N   1 
ATOM   2078 C  CA  . GLN B 2 78  ? -29.181 -23.283 24.952 1.00 40.14  ? 78  GLN B CA  1 
ATOM   2079 C  C   . GLN B 2 78  ? -30.007 -24.245 25.755 1.00 38.03  ? 78  GLN B C   1 
ATOM   2080 O  O   . GLN B 2 78  ? -31.239 -24.258 25.660 1.00 34.86  ? 78  GLN B O   1 
ATOM   2081 C  CB  . GLN B 2 78  ? -28.609 -22.176 25.842 1.00 44.49  ? 78  GLN B CB  1 
ATOM   2082 C  CG  . GLN B 2 78  ? -29.585 -21.263 26.511 1.00 46.65  ? 78  GLN B CG  1 
ATOM   2083 C  CD  . GLN B 2 78  ? -28.866 -20.264 27.451 1.00 49.65  ? 78  GLN B CD  1 
ATOM   2084 O  OE1 . GLN B 2 78  ? -27.972 -19.543 27.024 1.00 53.62  ? 78  GLN B OE1 1 
ATOM   2085 N  NE2 . GLN B 2 78  ? -29.258 -20.238 28.723 1.00 45.41  ? 78  GLN B NE2 1 
ATOM   2086 N  N   . ALA B 2 79  ? -29.301 -25.085 26.507 1.00 37.09  ? 79  ALA B N   1 
ATOM   2087 C  CA  . ALA B 2 79  ? -29.909 -26.002 27.470 1.00 41.01  ? 79  ALA B CA  1 
ATOM   2088 C  C   . ALA B 2 79  ? -29.011 -26.058 28.719 1.00 41.91  ? 79  ALA B C   1 
ATOM   2089 O  O   . ALA B 2 79  ? -27.793 -25.964 28.628 1.00 46.99  ? 79  ALA B O   1 
ATOM   2090 C  CB  . ALA B 2 79  ? -30.090 -27.386 26.859 1.00 41.81  ? 79  ALA B CB  1 
ATOM   2091 N  N   . ARG B 2 80  ? -29.625 -26.199 29.881 1.00 46.50  ? 80  ARG B N   1 
ATOM   2092 C  CA  . ARG B 2 80  ? -28.938 -26.028 31.162 1.00 50.08  ? 80  ARG B CA  1 
ATOM   2093 C  C   . ARG B 2 80  ? -29.107 -27.348 31.896 1.00 48.63  ? 80  ARG B C   1 
ATOM   2094 O  O   . ARG B 2 80  ? -30.190 -27.914 31.878 1.00 50.79  ? 80  ARG B O   1 
ATOM   2095 C  CB  . ARG B 2 80  ? -29.603 -24.877 31.925 1.00 53.88  ? 80  ARG B CB  1 
ATOM   2096 C  CG  . ARG B 2 80  ? -28.758 -24.129 32.931 1.00 54.92  ? 80  ARG B CG  1 
ATOM   2097 C  CD  . ARG B 2 80  ? -29.589 -22.982 33.521 1.00 59.75  ? 80  ARG B CD  1 
ATOM   2098 N  NE  . ARG B 2 80  ? -28.953 -22.305 34.652 1.00 62.63  ? 80  ARG B NE  1 
ATOM   2099 C  CZ  . ARG B 2 80  ? -27.976 -21.402 34.554 1.00 66.13  ? 80  ARG B CZ  1 
ATOM   2100 N  NH1 . ARG B 2 80  ? -27.491 -21.064 33.366 1.00 68.83  ? 80  ARG B NH1 1 
ATOM   2101 N  NH2 . ARG B 2 80  ? -27.471 -20.837 35.652 1.00 62.07  ? 80  ARG B NH2 1 
ATOM   2102 N  N   . GLY B 2 81  ? -28.040 -27.857 32.505 1.00 45.79  ? 81  GLY B N   1 
ATOM   2103 C  CA  . GLY B 2 81  ? -28.109 -29.110 33.256 1.00 47.11  ? 81  GLY B CA  1 
ATOM   2104 C  C   . GLY B 2 81  ? -27.950 -28.873 34.746 1.00 45.74  ? 81  GLY B C   1 
ATOM   2105 O  O   . GLY B 2 81  ? -27.817 -27.738 35.191 1.00 47.33  ? 81  GLY B O   1 
ATOM   2106 N  N   . LEU B 2 82  ? -28.002 -29.950 35.513 1.00 45.96  ? 82  LEU B N   1 
ATOM   2107 C  CA  . LEU B 2 82  ? -27.731 -29.910 36.950 1.00 46.57  ? 82  LEU B CA  1 
ATOM   2108 C  C   . LEU B 2 82  ? -26.861 -31.098 37.312 1.00 44.17  ? 82  LEU B C   1 
ATOM   2109 O  O   . LEU B 2 82  ? -27.261 -32.241 37.103 1.00 45.29  ? 82  LEU B O   1 
ATOM   2110 C  CB  . LEU B 2 82  ? -29.032 -29.979 37.754 1.00 45.44  ? 82  LEU B CB  1 
ATOM   2111 C  CG  . LEU B 2 82  ? -28.885 -29.934 39.286 1.00 46.30  ? 82  LEU B CG  1 
ATOM   2112 C  CD1 . LEU B 2 82  ? -28.372 -28.588 39.703 1.00 43.33  ? 82  LEU B CD1 1 
ATOM   2113 C  CD2 . LEU B 2 82  ? -30.202 -30.228 39.980 1.00 46.46  ? 82  LEU B CD2 1 
ATOM   2114 N  N   . ILE B 2 83  ? -25.681 -30.830 37.859 1.00 41.54  ? 83  ILE B N   1 
ATOM   2115 C  CA  . ILE B 2 83  ? -24.844 -31.885 38.409 1.00 40.73  ? 83  ILE B CA  1 
ATOM   2116 C  C   . ILE B 2 83  ? -24.777 -31.704 39.917 1.00 40.84  ? 83  ILE B C   1 
ATOM   2117 O  O   . ILE B 2 83  ? -24.288 -30.684 40.408 1.00 39.95  ? 83  ILE B O   1 
ATOM   2118 C  CB  . ILE B 2 83  ? -23.436 -31.867 37.814 1.00 41.07  ? 83  ILE B CB  1 
ATOM   2119 C  CG1 . ILE B 2 83  ? -23.479 -32.045 36.294 1.00 40.89  ? 83  ILE B CG1 1 
ATOM   2120 C  CG2 . ILE B 2 83  ? -22.591 -32.995 38.396 1.00 42.06  ? 83  ILE B CG2 1 
ATOM   2121 C  CD1 . ILE B 2 83  ? -22.139 -31.700 35.646 1.00 38.89  ? 83  ILE B CD1 1 
ATOM   2122 N  N   . ARG B 2 84  ? -25.308 -32.683 40.642 1.00 43.30  ? 84  ARG B N   1 
ATOM   2123 C  CA  . ARG B 2 84  ? -25.239 -32.718 42.095 1.00 42.11  ? 84  ARG B CA  1 
ATOM   2124 C  C   . ARG B 2 84  ? -24.152 -33.696 42.505 1.00 43.06  ? 84  ARG B C   1 
ATOM   2125 O  O   . ARG B 2 84  ? -23.946 -34.686 41.819 1.00 43.09  ? 84  ARG B O   1 
ATOM   2126 C  CB  . ARG B 2 84  ? -26.572 -33.177 42.684 1.00 42.03  ? 84  ARG B CB  1 
ATOM   2127 C  CG  . ARG B 2 84  ? -27.734 -32.250 42.402 1.00 42.46  ? 84  ARG B CG  1 
ATOM   2128 C  CD  . ARG B 2 84  ? -28.958 -32.654 43.194 1.00 43.09  ? 84  ARG B CD  1 
ATOM   2129 N  NE  . ARG B 2 84  ? -28.842 -32.248 44.592 1.00 44.08  ? 84  ARG B NE  1 
ATOM   2130 C  CZ  . ARG B 2 84  ? -29.689 -32.617 45.548 1.00 44.92  ? 84  ARG B CZ  1 
ATOM   2131 N  NH1 . ARG B 2 84  ? -30.716 -33.413 45.278 1.00 48.33  ? 84  ARG B NH1 1 
ATOM   2132 N  NH2 . ARG B 2 84  ? -29.507 -32.188 46.784 1.00 43.54  ? 84  ARG B NH2 1 
ATOM   2133 N  N   . THR B 2 85  ? -23.442 -33.407 43.603 1.00 43.16  ? 85  THR B N   1 
ATOM   2134 C  CA  . THR B 2 85  ? -22.479 -34.363 44.161 1.00 40.88  ? 85  THR B CA  1 
ATOM   2135 C  C   . THR B 2 85  ? -22.993 -34.928 45.458 1.00 38.64  ? 85  THR B C   1 
ATOM   2136 O  O   . THR B 2 85  ? -23.805 -34.294 46.143 1.00 35.49  ? 85  THR B O   1 
ATOM   2137 C  CB  . THR B 2 85  ? -21.066 -33.772 44.398 1.00 40.16  ? 85  THR B CB  1 
ATOM   2138 O  OG1 . THR B 2 85  ? -21.137 -32.608 45.230 1.00 36.99  ? 85  THR B OG1 1 
ATOM   2139 C  CG2 . THR B 2 85  ? -20.426 -33.424 43.091 1.00 39.81  ? 85  THR B CG2 1 
ATOM   2140 N  N   . PHE B 2 86  ? -22.563 -36.151 45.775 1.00 40.18  ? 86  PHE B N   1 
ATOM   2141 C  CA  . PHE B 2 86  ? -22.751 -36.678 47.117 1.00 41.57  ? 86  PHE B CA  1 
ATOM   2142 C  C   . PHE B 2 86  ? -21.410 -37.025 47.724 1.00 41.86  ? 86  PHE B C   1 
ATOM   2143 O  O   . PHE B 2 86  ? -20.439 -37.269 47.013 1.00 41.09  ? 86  PHE B O   1 
ATOM   2144 C  CB  . PHE B 2 86  ? -23.698 -37.887 47.134 1.00 45.95  ? 86  PHE B CB  1 
ATOM   2145 C  CG  . PHE B 2 86  ? -23.147 -39.122 46.470 1.00 43.21  ? 86  PHE B CG  1 
ATOM   2146 C  CD1 . PHE B 2 86  ? -23.389 -39.369 45.128 1.00 44.42  ? 86  PHE B CD1 1 
ATOM   2147 C  CD2 . PHE B 2 86  ? -22.427 -40.054 47.199 1.00 46.44  ? 86  PHE B CD2 1 
ATOM   2148 C  CE1 . PHE B 2 86  ? -22.898 -40.517 44.518 1.00 43.91  ? 86  PHE B CE1 1 
ATOM   2149 C  CE2 . PHE B 2 86  ? -21.932 -41.200 46.598 1.00 46.75  ? 86  PHE B CE2 1 
ATOM   2150 C  CZ  . PHE B 2 86  ? -22.171 -41.433 45.261 1.00 44.15  ? 86  PHE B CZ  1 
ATOM   2151 N  N   . GLN B 2 87  ? -21.379 -37.026 49.052 1.00 45.39  ? 87  GLN B N   1 
ATOM   2152 C  CA  . GLN B 2 87  ? -20.193 -37.320 49.830 1.00 45.74  ? 87  GLN B CA  1 
ATOM   2153 C  C   . GLN B 2 87  ? -20.599 -38.313 50.918 1.00 43.97  ? 87  GLN B C   1 
ATOM   2154 O  O   . GLN B 2 87  ? -21.463 -38.014 51.735 1.00 44.41  ? 87  GLN B O   1 
ATOM   2155 C  CB  . GLN B 2 87  ? -19.664 -36.022 50.444 1.00 48.99  ? 87  GLN B CB  1 
ATOM   2156 C  CG  . GLN B 2 87  ? -18.572 -36.179 51.483 1.00 48.97  ? 87  GLN B CG  1 
ATOM   2157 C  CD  . GLN B 2 87  ? -17.373 -36.904 50.949 1.00 51.22  ? 87  GLN B CD  1 
ATOM   2158 O  OE1 . GLN B 2 87  ? -16.879 -36.591 49.871 1.00 53.18  ? 87  GLN B OE1 1 
ATOM   2159 N  NE2 . GLN B 2 87  ? -16.891 -37.884 51.702 1.00 53.07  ? 87  GLN B NE2 1 
ATOM   2160 N  N   . ARG B 2 88  ? -20.005 -39.501 50.895 1.00 43.65  ? 88  ARG B N   1 
ATOM   2161 C  CA  . ARG B 2 88  ? -20.233 -40.524 51.917 1.00 48.71  ? 88  ARG B CA  1 
ATOM   2162 C  C   . ARG B 2 88  ? -19.865 -39.994 53.300 1.00 47.24  ? 88  ARG B C   1 
ATOM   2163 O  O   . ARG B 2 88  ? -19.023 -39.104 53.399 1.00 47.36  ? 88  ARG B O   1 
ATOM   2164 C  CB  . ARG B 2 88  ? -19.326 -41.724 51.666 1.00 49.82  ? 88  ARG B CB  1 
ATOM   2165 C  CG  . ARG B 2 88  ? -19.591 -42.495 50.407 1.00 55.90  ? 88  ARG B CG  1 
ATOM   2166 C  CD  . ARG B 2 88  ? -18.335 -43.269 50.026 1.00 59.24  ? 88  ARG B CD  1 
ATOM   2167 N  NE  . ARG B 2 88  ? -18.597 -44.256 48.980 1.00 60.70  ? 88  ARG B NE  1 
ATOM   2168 C  CZ  . ARG B 2 88  ? -18.537 -45.578 49.147 1.00 66.21  ? 88  ARG B CZ  1 
ATOM   2169 N  NH1 . ARG B 2 88  ? -18.220 -46.115 50.328 1.00 68.22  ? 88  ARG B NH1 1 
ATOM   2170 N  NH2 . ARG B 2 88  ? -18.796 -46.378 48.115 1.00 66.42  ? 88  ARG B NH2 1 
ATOM   2171 N  N   . PRO B 2 89  ? -20.433 -40.593 54.372 1.00 47.52  ? 89  PRO B N   1 
ATOM   2172 C  CA  . PRO B 2 89  ? -20.009 -40.307 55.743 1.00 47.88  ? 89  PRO B CA  1 
ATOM   2173 C  C   . PRO B 2 89  ? -18.681 -40.993 56.117 1.00 48.43  ? 89  PRO B C   1 
ATOM   2174 O  O   . PRO B 2 89  ? -18.651 -41.930 56.921 1.00 47.17  ? 89  PRO B O   1 
ATOM   2175 C  CB  . PRO B 2 89  ? -21.167 -40.861 56.583 1.00 47.95  ? 89  PRO B CB  1 
ATOM   2176 C  CG  . PRO B 2 89  ? -21.705 -41.972 55.791 1.00 43.37  ? 89  PRO B CG  1 
ATOM   2177 C  CD  . PRO B 2 89  ? -21.527 -41.587 54.337 1.00 46.25  ? 89  PRO B CD  1 
ATOM   2178 N  N   . ASP B 2 90  ? -17.589 -40.526 55.527 1.00 48.34  ? 90  ASP B N   1 
ATOM   2179 C  CA  . ASP B 2 90  ? -16.265 -41.063 55.821 1.00 50.20  ? 90  ASP B CA  1 
ATOM   2180 C  C   . ASP B 2 90  ? -15.780 -40.674 57.220 1.00 50.63  ? 90  ASP B C   1 
ATOM   2181 O  O   . ASP B 2 90  ? -14.923 -41.347 57.789 1.00 52.24  ? 90  ASP B O   1 
ATOM   2182 C  CB  . ASP B 2 90  ? -15.255 -40.618 54.750 1.00 56.11  ? 90  ASP B CB  1 
ATOM   2183 C  CG  . ASP B 2 90  ? -15.128 -39.106 54.644 1.00 61.73  ? 90  ASP B CG  1 
ATOM   2184 O  OD1 . ASP B 2 90  ? -16.099 -38.384 54.954 1.00 65.28  ? 90  ASP B OD1 1 
ATOM   2185 O  OD2 . ASP B 2 90  ? -14.047 -38.635 54.241 1.00 68.99  ? 90  ASP B OD2 1 
ATOM   2186 N  N   . ARG B 2 91  ? -16.327 -39.591 57.766 1.00 51.35  ? 91  ARG B N   1 
ATOM   2187 C  CA  . ARG B 2 91  ? -15.994 -39.133 59.113 1.00 50.70  ? 91  ARG B CA  1 
ATOM   2188 C  C   . ARG B 2 91  ? -17.248 -39.036 59.961 1.00 48.14  ? 91  ARG B C   1 
ATOM   2189 O  O   . ARG B 2 91  ? -18.126 -38.222 59.692 1.00 49.05  ? 91  ARG B O   1 
ATOM   2190 C  CB  . ARG B 2 91  ? -15.313 -37.770 59.043 1.00 57.61  ? 91  ARG B CB  1 
ATOM   2191 C  CG  . ARG B 2 91  ? -13.922 -37.828 58.439 1.00 64.98  ? 91  ARG B CG  1 
ATOM   2192 C  CD  . ARG B 2 91  ? -13.661 -36.647 57.532 1.00 72.75  ? 91  ARG B CD  1 
ATOM   2193 N  NE  . ARG B 2 91  ? -13.501 -35.398 58.276 1.00 76.98  ? 91  ARG B NE  1 
ATOM   2194 C  CZ  . ARG B 2 91  ? -13.525 -34.180 57.726 1.00 79.96  ? 91  ARG B CZ  1 
ATOM   2195 N  NH1 . ARG B 2 91  ? -13.362 -33.105 58.497 1.00 78.19  ? 91  ARG B NH1 1 
ATOM   2196 N  NH2 . ARG B 2 91  ? -13.722 -34.025 56.413 1.00 79.93  ? 91  ARG B NH2 1 
ATOM   2197 N  N   . VAL B 2 92  ? -17.338 -39.899 60.966 1.00 47.52  ? 92  VAL B N   1 
ATOM   2198 C  CA  . VAL B 2 92  ? -18.411 -39.857 61.957 1.00 50.16  ? 92  VAL B CA  1 
ATOM   2199 C  C   . VAL B 2 92  ? -17.728 -39.844 63.324 1.00 51.32  ? 92  VAL B C   1 
ATOM   2200 O  O   . VAL B 2 92  ? -17.028 -40.786 63.689 1.00 53.78  ? 92  VAL B O   1 
ATOM   2201 C  CB  . VAL B 2 92  ? -19.384 -41.063 61.822 1.00 48.29  ? 92  VAL B CB  1 
ATOM   2202 C  CG1 . VAL B 2 92  ? -20.551 -40.910 62.773 1.00 45.65  ? 92  VAL B CG1 1 
ATOM   2203 C  CG2 . VAL B 2 92  ? -19.885 -41.192 60.379 1.00 45.07  ? 92  VAL B CG2 1 
ATOM   2204 N  N   . GLU B 2 93  ? -17.912 -38.752 64.054 1.00 52.77  ? 93  GLU B N   1 
ATOM   2205 C  CA  . GLU B 2 93  ? -17.151 -38.489 65.255 1.00 55.49  ? 93  GLU B CA  1 
ATOM   2206 C  C   . GLU B 2 93  ? -18.081 -38.130 66.397 1.00 52.98  ? 93  GLU B C   1 
ATOM   2207 O  O   . GLU B 2 93  ? -18.868 -37.192 66.293 1.00 50.86  ? 93  GLU B O   1 
ATOM   2208 C  CB  . GLU B 2 93  ? -16.177 -37.341 64.991 1.00 59.66  ? 93  GLU B CB  1 
ATOM   2209 C  CG  . GLU B 2 93  ? -14.990 -37.735 64.096 1.00 63.56  ? 93  GLU B CG  1 
ATOM   2210 C  CD  . GLU B 2 93  ? -14.404 -36.576 63.287 1.00 65.39  ? 93  GLU B CD  1 
ATOM   2211 O  OE1 . GLU B 2 93  ? -14.959 -35.451 63.316 1.00 69.28  ? 93  GLU B OE1 1 
ATOM   2212 O  OE2 . GLU B 2 93  ? -13.383 -36.806 62.598 1.00 70.66  ? 93  GLU B OE2 1 
ATOM   2213 N  N   . LEU B 2 94  ? -17.986 -38.896 67.478 1.00 53.21  ? 94  LEU B N   1 
ATOM   2214 C  CA  . LEU B 2 94  ? -18.667 -38.581 68.726 1.00 53.10  ? 94  LEU B CA  1 
ATOM   2215 C  C   . LEU B 2 94  ? -17.704 -37.785 69.598 1.00 51.71  ? 94  LEU B C   1 
ATOM   2216 O  O   . LEU B 2 94  ? -16.577 -38.217 69.828 1.00 50.35  ? 94  LEU B O   1 
ATOM   2217 C  CB  . LEU B 2 94  ? -19.073 -39.866 69.436 1.00 51.42  ? 94  LEU B CB  1 
ATOM   2218 C  CG  . LEU B 2 94  ? -19.980 -39.740 70.654 1.00 49.37  ? 94  LEU B CG  1 
ATOM   2219 C  CD1 . LEU B 2 94  ? -21.349 -39.265 70.231 1.00 49.97  ? 94  LEU B CD1 1 
ATOM   2220 C  CD2 . LEU B 2 94  ? -20.058 -41.086 71.351 1.00 51.67  ? 94  LEU B CD2 1 
ATOM   2221 N  N   . MET B 2 95  ? -18.133 -36.625 70.079 1.00 52.02  ? 95  MET B N   1 
ATOM   2222 C  CA  . MET B 2 95  ? -17.269 -35.793 70.921 1.00 54.33  ? 95  MET B CA  1 
ATOM   2223 C  C   . MET B 2 95  ? -16.931 -36.526 72.219 1.00 50.39  ? 95  MET B C   1 
ATOM   2224 O  O   . MET B 2 95  ? -17.722 -37.344 72.685 1.00 47.25  ? 95  MET B O   1 
ATOM   2225 C  CB  . MET B 2 95  ? -17.941 -34.457 71.241 1.00 61.97  ? 95  MET B CB  1 
ATOM   2226 C  CG  . MET B 2 95  ? -18.113 -33.545 70.037 1.00 69.47  ? 95  MET B CG  1 
ATOM   2227 S  SD  . MET B 2 95  ? -16.547 -32.875 69.448 1.00 78.68  ? 95  MET B SD  1 
ATOM   2228 C  CE  . MET B 2 95  ? -16.130 -31.748 70.786 1.00 77.64  ? 95  MET B CE  1 
ATOM   2229 N  N   . PRO B 2 96  ? -15.744 -36.253 72.796 1.00 50.24  ? 96  PRO B N   1 
ATOM   2230 C  CA  . PRO B 2 96  ? -15.357 -36.944 74.021 1.00 52.79  ? 96  PRO B CA  1 
ATOM   2231 C  C   . PRO B 2 96  ? -16.357 -36.765 75.156 1.00 54.07  ? 96  PRO B C   1 
ATOM   2232 O  O   . PRO B 2 96  ? -16.969 -35.707 75.282 1.00 57.48  ? 96  PRO B O   1 
ATOM   2233 C  CB  . PRO B 2 96  ? -14.016 -36.298 74.378 1.00 51.14  ? 96  PRO B CB  1 
ATOM   2234 C  CG  . PRO B 2 96  ? -13.491 -35.798 73.101 1.00 50.79  ? 96  PRO B CG  1 
ATOM   2235 C  CD  . PRO B 2 96  ? -14.687 -35.337 72.339 1.00 49.38  ? 96  PRO B CD  1 
ATOM   2236 N  N   . LEU B 2 97  ? -16.515 -37.805 75.967 1.00 56.13  ? 97  LEU B N   1 
ATOM   2237 C  CA  . LEU B 2 97  ? -17.381 -37.758 77.141 1.00 55.60  ? 97  LEU B CA  1 
ATOM   2238 C  C   . LEU B 2 97  ? -16.550 -37.261 78.319 1.00 56.09  ? 97  LEU B C   1 
ATOM   2239 O  O   . LEU B 2 97  ? -15.324 -37.265 78.249 1.00 57.09  ? 97  LEU B O   1 
ATOM   2240 C  CB  . LEU B 2 97  ? -17.954 -39.150 77.435 1.00 56.90  ? 97  LEU B CB  1 
ATOM   2241 C  CG  . LEU B 2 97  ? -18.766 -39.787 76.303 1.00 56.37  ? 97  LEU B CG  1 
ATOM   2242 C  CD1 . LEU B 2 97  ? -19.266 -41.170 76.689 1.00 55.44  ? 97  LEU B CD1 1 
ATOM   2243 C  CD2 . LEU B 2 97  ? -19.928 -38.880 75.921 1.00 58.46  ? 97  LEU B CD2 1 
ATOM   2244 N  N   . PRO B 2 98  ? -17.205 -36.822 79.408 1.00 58.33  ? 98  PRO B N   1 
ATOM   2245 C  CA  . PRO B 2 98  ? -16.407 -36.428 80.565 1.00 57.53  ? 98  PRO B CA  1 
ATOM   2246 C  C   . PRO B 2 98  ? -15.642 -37.628 81.124 1.00 56.35  ? 98  PRO B C   1 
ATOM   2247 O  O   . PRO B 2 98  ? -16.157 -38.745 81.101 1.00 57.95  ? 98  PRO B O   1 
ATOM   2248 C  CB  . PRO B 2 98  ? -17.452 -35.924 81.567 1.00 58.52  ? 98  PRO B CB  1 
ATOM   2249 C  CG  . PRO B 2 98  ? -18.668 -35.640 80.756 1.00 59.83  ? 98  PRO B CG  1 
ATOM   2250 C  CD  . PRO B 2 98  ? -18.646 -36.651 79.654 1.00 60.11  ? 98  PRO B CD  1 
ATOM   2251 N  N   . PRO B 2 99  ? -14.405 -37.411 81.582 1.00 55.70  ? 99  PRO B N   1 
ATOM   2252 C  CA  . PRO B 2 99  ? -13.628 -38.493 82.195 1.00 56.10  ? 99  PRO B CA  1 
ATOM   2253 C  C   . PRO B 2 99  ? -14.441 -39.276 83.218 1.00 53.35  ? 99  PRO B C   1 
ATOM   2254 O  O   . PRO B 2 99  ? -14.458 -40.500 83.180 1.00 52.87  ? 99  PRO B O   1 
ATOM   2255 C  CB  . PRO B 2 99  ? -12.478 -37.752 82.876 1.00 58.00  ? 99  PRO B CB  1 
ATOM   2256 C  CG  . PRO B 2 99  ? -12.294 -36.525 82.040 1.00 58.78  ? 99  PRO B CG  1 
ATOM   2257 C  CD  . PRO B 2 99  ? -13.655 -36.144 81.540 1.00 57.26  ? 99  PRO B CD  1 
ATOM   2258 N  N   . TRP B 2 100 ? -15.113 -38.550 84.107 1.00 54.44  ? 100 TRP B N   1 
ATOM   2259 C  CA  . TRP B 2 100 ? -16.051 -39.123 85.065 1.00 53.11  ? 100 TRP B CA  1 
ATOM   2260 C  C   . TRP B 2 100 ? -17.311 -38.272 85.114 1.00 52.13  ? 100 TRP B C   1 
ATOM   2261 O  O   . TRP B 2 100 ? -17.231 -37.049 85.252 1.00 55.91  ? 100 TRP B O   1 
ATOM   2262 C  CB  . TRP B 2 100 ? -15.412 -39.201 86.450 1.00 50.21  ? 100 TRP B CB  1 
ATOM   2263 C  CG  . TRP B 2 100 ? -14.475 -40.346 86.579 1.00 49.08  ? 100 TRP B CG  1 
ATOM   2264 C  CD1 . TRP B 2 100 ? -13.130 -40.336 86.368 1.00 48.75  ? 100 TRP B CD1 1 
ATOM   2265 C  CD2 . TRP B 2 100 ? -14.820 -41.685 86.926 1.00 48.34  ? 100 TRP B CD2 1 
ATOM   2266 N  NE1 . TRP B 2 100 ? -12.610 -41.589 86.572 1.00 48.67  ? 100 TRP B NE1 1 
ATOM   2267 C  CE2 . TRP B 2 100 ? -13.629 -42.438 86.912 1.00 48.78  ? 100 TRP B CE2 1 
ATOM   2268 C  CE3 . TRP B 2 100 ? -16.020 -42.322 87.259 1.00 49.57  ? 100 TRP B CE3 1 
ATOM   2269 C  CZ2 . TRP B 2 100 ? -13.603 -43.801 87.214 1.00 49.52  ? 100 TRP B CZ2 1 
ATOM   2270 C  CZ3 . TRP B 2 100 ? -15.989 -43.680 87.567 1.00 49.49  ? 100 TRP B CZ3 1 
ATOM   2271 C  CH2 . TRP B 2 100 ? -14.791 -44.401 87.538 1.00 48.58  ? 100 TRP B CH2 1 
ATOM   2272 N  N   . GLN B 2 101 ? -18.467 -38.922 85.006 1.00 51.34  ? 101 GLN B N   1 
ATOM   2273 C  CA  . GLN B 2 101 ? -19.752 -38.235 84.984 1.00 53.02  ? 101 GLN B CA  1 
ATOM   2274 C  C   . GLN B 2 101 ? -20.549 -38.531 86.259 1.00 53.63  ? 101 GLN B C   1 
ATOM   2275 O  O   . GLN B 2 101 ? -20.808 -39.689 86.556 1.00 52.67  ? 101 GLN B O   1 
ATOM   2276 C  CB  . GLN B 2 101 ? -20.553 -38.681 83.753 1.00 51.93  ? 101 GLN B CB  1 
ATOM   2277 C  CG  . GLN B 2 101 ? -21.978 -38.133 83.669 1.00 51.53  ? 101 GLN B CG  1 
ATOM   2278 C  CD  . GLN B 2 101 ? -22.034 -36.613 83.629 1.00 53.85  ? 101 GLN B CD  1 
ATOM   2279 O  OE1 . GLN B 2 101 ? -21.063 -35.940 83.260 1.00 54.31  ? 101 GLN B OE1 1 
ATOM   2280 N  NE2 . GLN B 2 101 ? -23.182 -36.063 84.013 1.00 55.77  ? 101 GLN B NE2 1 
ATOM   2281 N  N   . PRO B 2 102 ? -20.948 -37.485 87.012 1.00 56.85  ? 102 PRO B N   1 
ATOM   2282 C  CA  . PRO B 2 102 ? -21.833 -37.688 88.163 1.00 56.66  ? 102 PRO B CA  1 
ATOM   2283 C  C   . PRO B 2 102 ? -23.168 -38.339 87.812 1.00 56.55  ? 102 PRO B C   1 
ATOM   2284 O  O   . PRO B 2 102 ? -23.828 -37.912 86.862 1.00 54.15  ? 102 PRO B O   1 
ATOM   2285 C  CB  . PRO B 2 102 ? -22.078 -36.264 88.668 1.00 58.15  ? 102 PRO B CB  1 
ATOM   2286 C  CG  . PRO B 2 102 ? -20.899 -35.492 88.214 1.00 58.16  ? 102 PRO B CG  1 
ATOM   2287 C  CD  . PRO B 2 102 ? -20.576 -36.065 86.869 1.00 58.39  ? 102 PRO B CD  1 
ATOM   2288 N  N   . VAL B 2 103 ? -23.556 -39.366 88.566 1.00 56.18  ? 103 VAL B N   1 
ATOM   2289 C  CA  . VAL B 2 103 ? -24.864 -39.997 88.384 1.00 56.97  ? 103 VAL B CA  1 
ATOM   2290 C  C   . VAL B 2 103 ? -25.935 -38.958 88.708 1.00 59.14  ? 103 VAL B C   1 
ATOM   2291 O  O   . VAL B 2 103 ? -25.755 -38.150 89.614 1.00 58.74  ? 103 VAL B O   1 
ATOM   2292 C  CB  . VAL B 2 103 ? -25.051 -41.248 89.283 1.00 55.53  ? 103 VAL B CB  1 
ATOM   2293 C  CG1 . VAL B 2 103 ? -26.464 -41.787 89.159 1.00 58.17  ? 103 VAL B CG1 1 
ATOM   2294 C  CG2 . VAL B 2 103 ? -24.048 -42.335 88.921 1.00 52.62  ? 103 VAL B CG2 1 
ATOM   2295 N  N   . GLY B 2 104 ? -27.025 -38.949 87.943 1.00 59.70  ? 104 GLY B N   1 
ATOM   2296 C  CA  . GLY B 2 104 ? -28.116 -38.003 88.173 1.00 60.37  ? 104 GLY B CA  1 
ATOM   2297 C  C   . GLY B 2 104 ? -27.926 -36.613 87.582 1.00 63.16  ? 104 GLY B C   1 
ATOM   2298 O  O   . GLY B 2 104 ? -28.814 -35.768 87.706 1.00 66.40  ? 104 GLY B O   1 
ATOM   2299 N  N   . GLU B 2 105 ? -26.779 -36.361 86.951 1.00 63.04  ? 105 GLU B N   1 
ATOM   2300 C  CA  . GLU B 2 105 ? -26.559 -35.120 86.206 1.00 61.64  ? 105 GLU B CA  1 
ATOM   2301 C  C   . GLU B 2 105 ? -26.547 -35.405 84.708 1.00 58.75  ? 105 GLU B C   1 
ATOM   2302 O  O   . GLU B 2 105 ? -26.319 -36.536 84.275 1.00 54.17  ? 105 GLU B O   1 
ATOM   2303 C  CB  . GLU B 2 105 ? -25.249 -34.447 86.631 1.00 63.08  ? 105 GLU B CB  1 
ATOM   2304 C  CG  . GLU B 2 105 ? -25.301 -33.822 88.031 1.00 64.40  ? 105 GLU B CG  1 
ATOM   2305 C  CD  . GLU B 2 105 ? -24.081 -32.962 88.367 1.00 66.53  ? 105 GLU B CD  1 
ATOM   2306 O  OE1 . GLU B 2 105 ? -23.264 -32.684 87.462 1.00 69.50  ? 105 GLU B OE1 1 
ATOM   2307 O  OE2 . GLU B 2 105 ? -23.940 -32.556 89.544 1.00 68.83  ? 105 GLU B OE2 1 
ATOM   2308 N  N   . ASN B 2 106 ? -26.811 -34.367 83.926 1.00 59.81  ? 106 ASN B N   1 
ATOM   2309 C  CA  . ASN B 2 106 ? -26.802 -34.471 82.476 1.00 60.45  ? 106 ASN B CA  1 
ATOM   2310 C  C   . ASN B 2 106 ? -25.394 -34.339 81.920 1.00 58.50  ? 106 ASN B C   1 
ATOM   2311 O  O   . ASN B 2 106 ? -24.531 -33.706 82.526 1.00 58.96  ? 106 ASN B O   1 
ATOM   2312 C  CB  . ASN B 2 106 ? -27.664 -33.376 81.847 1.00 65.91  ? 106 ASN B CB  1 
ATOM   2313 C  CG  . ASN B 2 106 ? -29.145 -33.570 82.099 1.00 71.72  ? 106 ASN B CG  1 
ATOM   2314 O  OD1 . ASN B 2 106 ? -29.675 -34.675 81.967 1.00 71.82  ? 106 ASN B OD1 1 
ATOM   2315 N  ND2 . ASN B 2 106 ? -29.829 -32.469 82.460 1.00 78.83  ? 106 ASN B ND2 1 
ATOM   2316 N  N   . PHE B 2 107 ? -25.173 -34.959 80.767 1.00 56.66  ? 107 PHE B N   1 
ATOM   2317 C  CA  . PHE B 2 107 ? -24.001 -34.690 79.940 1.00 55.87  ? 107 PHE B CA  1 
ATOM   2318 C  C   . PHE B 2 107 ? -24.452 -34.588 78.477 1.00 55.29  ? 107 PHE B C   1 
ATOM   2319 O  O   . PHE B 2 107 ? -25.585 -34.950 78.139 1.00 51.64  ? 107 PHE B O   1 
ATOM   2320 C  CB  . PHE B 2 107 ? -22.923 -35.770 80.125 1.00 55.36  ? 107 PHE B CB  1 
ATOM   2321 C  CG  . PHE B 2 107 ? -23.344 -37.147 79.676 1.00 55.61  ? 107 PHE B CG  1 
ATOM   2322 C  CD1 . PHE B 2 107 ? -24.111 -37.961 80.504 1.00 53.91  ? 107 PHE B CD1 1 
ATOM   2323 C  CD2 . PHE B 2 107 ? -22.975 -37.628 78.420 1.00 55.34  ? 107 PHE B CD2 1 
ATOM   2324 C  CE1 . PHE B 2 107 ? -24.508 -39.232 80.083 1.00 55.20  ? 107 PHE B CE1 1 
ATOM   2325 C  CE2 . PHE B 2 107 ? -23.366 -38.897 77.994 1.00 54.52  ? 107 PHE B CE2 1 
ATOM   2326 C  CZ  . PHE B 2 107 ? -24.134 -39.700 78.823 1.00 55.30  ? 107 PHE B CZ  1 
ATOM   2327 N  N   . THR B 2 108 ? -23.562 -34.091 77.626 1.00 54.27  ? 108 THR B N   1 
ATOM   2328 C  CA  . THR B 2 108 ? -23.874 -33.871 76.226 1.00 54.16  ? 108 THR B CA  1 
ATOM   2329 C  C   . THR B 2 108 ? -23.225 -34.931 75.356 1.00 53.92  ? 108 THR B C   1 
ATOM   2330 O  O   . THR B 2 108 ? -22.037 -35.215 75.491 1.00 55.83  ? 108 THR B O   1 
ATOM   2331 C  CB  . THR B 2 108 ? -23.383 -32.499 75.756 1.00 55.21  ? 108 THR B CB  1 
ATOM   2332 O  OG1 . THR B 2 108 ? -23.938 -31.482 76.594 1.00 55.85  ? 108 THR B OG1 1 
ATOM   2333 C  CG2 . THR B 2 108 ? -23.805 -32.240 74.315 1.00 53.80  ? 108 THR B CG2 1 
ATOM   2334 N  N   . LEU B 2 109 ? -24.032 -35.528 74.487 1.00 51.83  ? 109 LEU B N   1 
ATOM   2335 C  CA  . LEU B 2 109 ? -23.543 -36.343 73.391 1.00 53.46  ? 109 LEU B CA  1 
ATOM   2336 C  C   . LEU B 2 109 ? -23.631 -35.498 72.142 1.00 52.55  ? 109 LEU B C   1 
ATOM   2337 O  O   . LEU B 2 109 ? -24.697 -34.976 71.846 1.00 52.29  ? 109 LEU B O   1 
ATOM   2338 C  CB  . LEU B 2 109 ? -24.423 -37.573 73.182 1.00 55.54  ? 109 LEU B CB  1 
ATOM   2339 C  CG  . LEU B 2 109 ? -24.272 -38.803 74.062 1.00 56.11  ? 109 LEU B CG  1 
ATOM   2340 C  CD1 . LEU B 2 109 ? -25.292 -39.822 73.595 1.00 54.37  ? 109 LEU B CD1 1 
ATOM   2341 C  CD2 . LEU B 2 109 ? -22.867 -39.368 73.988 1.00 56.63  ? 109 LEU B CD2 1 
ATOM   2342 N  N   . SER B 2 110 ? -22.528 -35.360 71.413 1.00 52.63  ? 110 SER B N   1 
ATOM   2343 C  CA  . SER B 2 110 ? -22.548 -34.682 70.125 1.00 54.33  ? 110 SER B CA  1 
ATOM   2344 C  C   . SER B 2 110 ? -21.872 -35.534 69.066 1.00 55.00  ? 110 SER B C   1 
ATOM   2345 O  O   . SER B 2 110 ? -20.710 -35.907 69.211 1.00 55.99  ? 110 SER B O   1 
ATOM   2346 C  CB  . SER B 2 110 ? -21.876 -33.307 70.205 1.00 55.99  ? 110 SER B CB  1 
ATOM   2347 O  OG  . SER B 2 110 ? -22.070 -32.588 68.988 1.00 58.06  ? 110 SER B OG  1 
ATOM   2348 N  N   . CYS B 2 111 ? -22.630 -35.850 68.019 1.00 57.16  ? 111 CYS B N   1 
ATOM   2349 C  CA  . CYS B 2 111 ? -22.145 -36.568 66.848 1.00 57.88  ? 111 CYS B CA  1 
ATOM   2350 C  C   . CYS B 2 111 ? -21.908 -35.536 65.758 1.00 56.06  ? 111 CYS B C   1 
ATOM   2351 O  O   . CYS B 2 111 ? -22.819 -34.787 65.422 1.00 54.35  ? 111 CYS B O   1 
ATOM   2352 C  CB  . CYS B 2 111 ? -23.204 -37.572 66.368 1.00 61.54  ? 111 CYS B CB  1 
ATOM   2353 S  SG  . CYS B 2 111 ? -22.684 -38.725 65.044 1.00 67.16  ? 111 CYS B SG  1 
ATOM   2354 N  N   . ARG B 2 112 ? -20.694 -35.495 65.216 1.00 55.44  ? 112 ARG B N   1 
ATOM   2355 C  CA  . ARG B 2 112 ? -20.381 -34.625 64.092 1.00 57.60  ? 112 ARG B CA  1 
ATOM   2356 C  C   . ARG B 2 112 ? -20.025 -35.460 62.867 1.00 53.61  ? 112 ARG B C   1 
ATOM   2357 O  O   . ARG B 2 112 ? -19.257 -36.425 62.950 1.00 47.63  ? 112 ARG B O   1 
ATOM   2358 C  CB  . ARG B 2 112 ? -19.242 -33.674 64.458 1.00 64.66  ? 112 ARG B CB  1 
ATOM   2359 C  CG  . ARG B 2 112 ? -19.562 -32.782 65.657 1.00 67.22  ? 112 ARG B CG  1 
ATOM   2360 C  CD  . ARG B 2 112 ? -18.472 -31.747 65.910 1.00 69.31  ? 112 ARG B CD  1 
ATOM   2361 N  NE  . ARG B 2 112 ? -18.593 -31.131 67.236 1.00 71.11  ? 112 ARG B NE  1 
ATOM   2362 C  CZ  . ARG B 2 112 ? -17.695 -30.299 67.774 1.00 73.65  ? 112 ARG B CZ  1 
ATOM   2363 N  NH1 . ARG B 2 112 ? -16.586 -29.968 67.109 1.00 74.24  ? 112 ARG B NH1 1 
ATOM   2364 N  NH2 . ARG B 2 112 ? -17.900 -29.799 68.992 1.00 72.50  ? 112 ARG B NH2 1 
ATOM   2365 N  N   . VAL B 2 113 ? -20.610 -35.083 61.735 1.00 54.56  ? 113 VAL B N   1 
ATOM   2366 C  CA  . VAL B 2 113 ? -20.450 -35.806 60.476 1.00 54.18  ? 113 VAL B CA  1 
ATOM   2367 C  C   . VAL B 2 113 ? -20.117 -34.806 59.363 1.00 52.41  ? 113 VAL B C   1 
ATOM   2368 O  O   . VAL B 2 113 ? -20.978 -34.450 58.561 1.00 56.06  ? 113 VAL B O   1 
ATOM   2369 C  CB  . VAL B 2 113 ? -21.731 -36.618 60.140 1.00 51.50  ? 113 VAL B CB  1 
ATOM   2370 C  CG1 . VAL B 2 113 ? -21.593 -37.306 58.819 1.00 48.81  ? 113 VAL B CG1 1 
ATOM   2371 C  CG2 . VAL B 2 113 ? -22.033 -37.627 61.255 1.00 51.75  ? 113 VAL B CG2 1 
ATOM   2372 N  N   . PRO B 2 114 ? -18.862 -34.338 59.318 1.00 53.61  ? 114 PRO B N   1 
ATOM   2373 C  CA  . PRO B 2 114 ? -18.520 -33.263 58.391 1.00 55.87  ? 114 PRO B CA  1 
ATOM   2374 C  C   . PRO B 2 114 ? -18.553 -33.650 56.920 1.00 55.61  ? 114 PRO B C   1 
ATOM   2375 O  O   . PRO B 2 114 ? -18.139 -34.744 56.547 1.00 59.53  ? 114 PRO B O   1 
ATOM   2376 C  CB  . PRO B 2 114 ? -17.099 -32.872 58.811 1.00 57.48  ? 114 PRO B CB  1 
ATOM   2377 C  CG  . PRO B 2 114 ? -16.559 -34.054 59.507 1.00 56.95  ? 114 PRO B CG  1 
ATOM   2378 C  CD  . PRO B 2 114 ? -17.712 -34.750 60.140 1.00 56.73  ? 114 PRO B CD  1 
ATOM   2379 N  N   . GLY B 2 115 ? -19.076 -32.751 56.097 1.00 57.73  ? 115 GLY B N   1 
ATOM   2380 C  CA  . GLY B 2 115 ? -18.969 -32.869 54.646 1.00 54.82  ? 115 GLY B CA  1 
ATOM   2381 C  C   . GLY B 2 115 ? -19.954 -33.788 53.957 1.00 54.33  ? 115 GLY B C   1 
ATOM   2382 O  O   . GLY B 2 115 ? -20.213 -33.631 52.767 1.00 55.68  ? 115 GLY B O   1 
ATOM   2383 N  N   . ALA B 2 116 ? -20.500 -34.756 54.685 1.00 53.27  ? 116 ALA B N   1 
ATOM   2384 C  CA  . ALA B 2 116 ? -21.356 -35.768 54.084 1.00 53.82  ? 116 ALA B CA  1 
ATOM   2385 C  C   . ALA B 2 116 ? -22.665 -35.150 53.611 1.00 54.89  ? 116 ALA B C   1 
ATOM   2386 O  O   . ALA B 2 116 ? -23.151 -34.173 54.178 1.00 54.31  ? 116 ALA B O   1 
ATOM   2387 C  CB  . ALA B 2 116 ? -21.622 -36.901 55.079 1.00 50.60  ? 116 ALA B CB  1 
ATOM   2388 N  N   . GLY B 2 117 ? -23.250 -35.717 52.571 1.00 54.64  ? 117 GLY B N   1 
ATOM   2389 C  CA  . GLY B 2 117 ? -24.514 -35.183 52.078 1.00 57.16  ? 117 GLY B CA  1 
ATOM   2390 C  C   . GLY B 2 117 ? -24.833 -35.588 50.657 1.00 55.81  ? 117 GLY B C   1 
ATOM   2391 O  O   . GLY B 2 117 ? -24.089 -36.372 50.065 1.00 50.51  ? 117 GLY B O   1 
ATOM   2392 N  N   . PRO B 2 118 ? -25.916 -35.025 50.087 1.00 54.66  ? 118 PRO B N   1 
ATOM   2393 C  CA  . PRO B 2 118 ? -26.739 -33.897 50.608 1.00 55.77  ? 118 PRO B CA  1 
ATOM   2394 C  C   . PRO B 2 118 ? -27.305 -34.077 52.024 1.00 57.35  ? 118 PRO B C   1 
ATOM   2395 O  O   . PRO B 2 118 ? -27.712 -35.179 52.385 1.00 57.98  ? 118 PRO B O   1 
ATOM   2396 C  CB  . PRO B 2 118 ? -27.877 -33.769 49.591 1.00 55.22  ? 118 PRO B CB  1 
ATOM   2397 C  CG  . PRO B 2 118 ? -27.751 -34.911 48.667 1.00 54.93  ? 118 PRO B CG  1 
ATOM   2398 C  CD  . PRO B 2 118 ? -26.388 -35.491 48.779 1.00 53.88  ? 118 PRO B CD  1 
ATOM   2399 N  N   . ARG B 2 119 ? -27.323 -32.994 52.805 1.00 56.11  ? 119 ARG B N   1 
ATOM   2400 C  CA  . ARG B 2 119 ? -27.736 -33.063 54.203 1.00 53.84  ? 119 ARG B CA  1 
ATOM   2401 C  C   . ARG B 2 119 ? -29.159 -33.599 54.353 1.00 54.36  ? 119 ARG B C   1 
ATOM   2402 O  O   . ARG B 2 119 ? -29.416 -34.395 55.238 1.00 55.84  ? 119 ARG B O   1 
ATOM   2403 C  CB  . ARG B 2 119 ? -27.605 -31.690 54.868 1.00 54.82  ? 119 ARG B CB  1 
ATOM   2404 C  CG  . ARG B 2 119 ? -27.934 -31.684 56.369 1.00 54.86  ? 119 ARG B CG  1 
ATOM   2405 C  CD  . ARG B 2 119 ? -28.014 -30.274 56.899 1.00 53.51  ? 119 ARG B CD  1 
ATOM   2406 N  NE  . ARG B 2 119 ? -26.694 -29.654 56.952 1.00 52.64  ? 119 ARG B NE  1 
ATOM   2407 C  CZ  . ARG B 2 119 ? -26.468 -28.348 57.003 1.00 55.97  ? 119 ARG B CZ  1 
ATOM   2408 N  NH1 . ARG B 2 119 ? -27.468 -27.475 56.980 1.00 56.82  ? 119 ARG B NH1 1 
ATOM   2409 N  NH2 . ARG B 2 119 ? -25.218 -27.912 57.051 1.00 55.62  ? 119 ARG B NH2 1 
ATOM   2410 N  N   . ALA B 2 120 ? -30.074 -33.191 53.473 1.00 53.24  ? 120 ALA B N   1 
ATOM   2411 C  CA  . ALA B 2 120 ? -31.457 -33.701 53.495 1.00 51.83  ? 120 ALA B CA  1 
ATOM   2412 C  C   . ALA B 2 120 ? -31.587 -35.237 53.406 1.00 50.58  ? 120 ALA B C   1 
ATOM   2413 O  O   . ALA B 2 120 ? -32.620 -35.795 53.776 1.00 55.03  ? 120 ALA B O   1 
ATOM   2414 C  CB  . ALA B 2 120 ? -32.259 -33.061 52.389 1.00 53.53  ? 120 ALA B CB  1 
ATOM   2415 N  N   . SER B 2 121 ? -30.558 -35.907 52.905 1.00 48.02  ? 121 SER B N   1 
ATOM   2416 C  CA  . SER B 2 121 ? -30.550 -37.377 52.798 1.00 51.73  ? 121 SER B CA  1 
ATOM   2417 C  C   . SER B 2 121 ? -29.879 -38.091 53.968 1.00 52.11  ? 121 SER B C   1 
ATOM   2418 O  O   . SER B 2 121 ? -29.789 -39.326 53.978 1.00 53.10  ? 121 SER B O   1 
ATOM   2419 C  CB  . SER B 2 121 ? -29.847 -37.775 51.511 1.00 55.19  ? 121 SER B CB  1 
ATOM   2420 O  OG  . SER B 2 121 ? -30.543 -37.265 50.401 1.00 59.27  ? 121 SER B OG  1 
ATOM   2421 N  N   . LEU B 2 122 ? -29.404 -37.316 54.947 1.00 55.21  ? 122 LEU B N   1 
ATOM   2422 C  CA  . LEU B 2 122 ? -28.716 -37.865 56.125 1.00 52.99  ? 122 LEU B CA  1 
ATOM   2423 C  C   . LEU B 2 122 ? -29.667 -38.128 57.272 1.00 53.10  ? 122 LEU B C   1 
ATOM   2424 O  O   . LEU B 2 122 ? -30.576 -37.330 57.522 1.00 46.44  ? 122 LEU B O   1 
ATOM   2425 C  CB  . LEU B 2 122 ? -27.666 -36.891 56.647 1.00 55.05  ? 122 LEU B CB  1 
ATOM   2426 C  CG  . LEU B 2 122 ? -26.361 -36.795 55.882 1.00 53.63  ? 122 LEU B CG  1 
ATOM   2427 C  CD1 . LEU B 2 122 ? -25.599 -35.614 56.444 1.00 49.41  ? 122 LEU B CD1 1 
ATOM   2428 C  CD2 . LEU B 2 122 ? -25.571 -38.086 56.017 1.00 50.76  ? 122 LEU B CD2 1 
ATOM   2429 N  N   . THR B 2 123 ? -29.438 -39.245 57.962 1.00 48.74  ? 123 THR B N   1 
ATOM   2430 C  CA  . THR B 2 123 ? -30.054 -39.530 59.249 1.00 51.51  ? 123 THR B CA  1 
ATOM   2431 C  C   . THR B 2 123 ? -28.937 -39.870 60.222 1.00 51.63  ? 123 THR B C   1 
ATOM   2432 O  O   . THR B 2 123 ? -28.112 -40.726 59.923 1.00 48.42  ? 123 THR B O   1 
ATOM   2433 C  CB  . THR B 2 123 ? -31.048 -40.715 59.173 1.00 51.18  ? 123 THR B CB  1 
ATOM   2434 O  OG1 . THR B 2 123 ? -32.138 -40.361 58.316 1.00 53.76  ? 123 THR B OG1 1 
ATOM   2435 C  CG2 . THR B 2 123 ? -31.591 -41.064 60.562 1.00 45.97  ? 123 THR B CG2 1 
ATOM   2436 N  N   . LEU B 2 124 ? -28.905 -39.165 61.358 1.00 51.39  ? 124 LEU B N   1 
ATOM   2437 C  CA  . LEU B 2 124 ? -27.933 -39.412 62.426 1.00 50.44  ? 124 LEU B CA  1 
ATOM   2438 C  C   . LEU B 2 124 ? -28.635 -39.998 63.634 1.00 50.35  ? 124 LEU B C   1 
ATOM   2439 O  O   . LEU B 2 124 ? -29.734 -39.579 63.980 1.00 50.19  ? 124 LEU B O   1 
ATOM   2440 C  CB  . LEU B 2 124 ? -27.224 -38.122 62.845 1.00 49.46  ? 124 LEU B CB  1 
ATOM   2441 C  CG  . LEU B 2 124 ? -25.993 -37.642 62.074 1.00 49.86  ? 124 LEU B CG  1 
ATOM   2442 C  CD1 . LEU B 2 124 ? -26.267 -37.575 60.582 1.00 48.48  ? 124 LEU B CD1 1 
ATOM   2443 C  CD2 . LEU B 2 124 ? -25.518 -36.286 62.610 1.00 47.19  ? 124 LEU B CD2 1 
ATOM   2444 N  N   . THR B 2 125 ? -27.969 -40.946 64.285 1.00 49.43  ? 125 THR B N   1 
ATOM   2445 C  CA  . THR B 2 125 ? -28.516 -41.648 65.435 1.00 49.59  ? 125 THR B CA  1 
ATOM   2446 C  C   . THR B 2 125 ? -27.471 -41.694 66.526 1.00 46.97  ? 125 THR B C   1 
ATOM   2447 O  O   . THR B 2 125 ? -26.304 -41.966 66.260 1.00 45.85  ? 125 THR B O   1 
ATOM   2448 C  CB  . THR B 2 125 ? -28.912 -43.092 65.049 1.00 49.24  ? 125 THR B CB  1 
ATOM   2449 O  OG1 . THR B 2 125 ? -29.760 -43.042 63.903 1.00 50.62  ? 125 THR B OG1 1 
ATOM   2450 C  CG2 . THR B 2 125 ? -29.654 -43.786 66.158 1.00 49.88  ? 125 THR B CG2 1 
ATOM   2451 N  N   . LEU B 2 126 ? -27.898 -41.442 67.753 1.00 47.05  ? 126 LEU B N   1 
ATOM   2452 C  CA  . LEU B 2 126 ? -27.039 -41.608 68.923 1.00 49.26  ? 126 LEU B CA  1 
ATOM   2453 C  C   . LEU B 2 126 ? -27.436 -42.891 69.624 1.00 47.13  ? 126 LEU B C   1 
ATOM   2454 O  O   . LEU B 2 126 ? -28.618 -43.118 69.863 1.00 46.60  ? 126 LEU B O   1 
ATOM   2455 C  CB  . LEU B 2 126 ? -27.190 -40.416 69.874 1.00 50.12  ? 126 LEU B CB  1 
ATOM   2456 C  CG  . LEU B 2 126 ? -26.646 -39.081 69.363 1.00 50.93  ? 126 LEU B CG  1 
ATOM   2457 C  CD1 . LEU B 2 126 ? -27.034 -37.955 70.324 1.00 48.59  ? 126 LEU B CD1 1 
ATOM   2458 C  CD2 . LEU B 2 126 ? -25.138 -39.176 69.210 1.00 51.47  ? 126 LEU B CD2 1 
ATOM   2459 N  N   . LEU B 2 127 ? -26.450 -43.727 69.944 1.00 49.92  ? 127 LEU B N   1 
ATOM   2460 C  CA  . LEU B 2 127 ? -26.696 -45.033 70.535 1.00 52.26  ? 127 LEU B CA  1 
ATOM   2461 C  C   . LEU B 2 127 ? -26.002 -45.194 71.896 1.00 50.98  ? 127 LEU B C   1 
ATOM   2462 O  O   . LEU B 2 127 ? -24.917 -44.666 72.122 1.00 49.87  ? 127 LEU B O   1 
ATOM   2463 C  CB  . LEU B 2 127 ? -26.199 -46.119 69.588 1.00 53.50  ? 127 LEU B CB  1 
ATOM   2464 C  CG  . LEU B 2 127 ? -26.859 -46.174 68.204 1.00 54.60  ? 127 LEU B CG  1 
ATOM   2465 C  CD1 . LEU B 2 127 ? -25.821 -46.022 67.126 1.00 51.36  ? 127 LEU B CD1 1 
ATOM   2466 C  CD2 . LEU B 2 127 ? -27.653 -47.467 68.024 1.00 54.07  ? 127 LEU B CD2 1 
ATOM   2467 N  N   . ARG B 2 128 ? -26.657 -45.917 72.792 1.00 53.47  ? 128 ARG B N   1 
ATOM   2468 C  CA  . ARG B 2 128 ? -26.028 -46.462 73.993 1.00 55.79  ? 128 ARG B CA  1 
ATOM   2469 C  C   . ARG B 2 128 ? -26.114 -47.978 73.836 1.00 56.34  ? 128 ARG B C   1 
ATOM   2470 O  O   . ARG B 2 128 ? -27.211 -48.536 73.797 1.00 55.78  ? 128 ARG B O   1 
ATOM   2471 C  CB  . ARG B 2 128 ? -26.779 -46.003 75.242 1.00 55.99  ? 128 ARG B CB  1 
ATOM   2472 C  CG  . ARG B 2 128 ? -26.209 -46.517 76.565 1.00 56.92  ? 128 ARG B CG  1 
ATOM   2473 C  CD  . ARG B 2 128 ? -27.007 -45.976 77.739 1.00 60.47  ? 128 ARG B CD  1 
ATOM   2474 N  NE  . ARG B 2 128 ? -28.425 -46.339 77.652 1.00 63.50  ? 128 ARG B NE  1 
ATOM   2475 C  CZ  . ARG B 2 128 ? -29.448 -45.566 78.029 1.00 65.50  ? 128 ARG B CZ  1 
ATOM   2476 N  NH1 . ARG B 2 128 ? -29.252 -44.346 78.536 1.00 66.10  ? 128 ARG B NH1 1 
ATOM   2477 N  NH2 . ARG B 2 128 ? -30.691 -46.015 77.889 1.00 64.53  ? 128 ARG B NH2 1 
ATOM   2478 N  N   . GLY B 2 129 ? -24.971 -48.644 73.719 1.00 57.39  ? 129 GLY B N   1 
ATOM   2479 C  CA  . GLY B 2 129 ? -24.963 -50.037 73.289 1.00 58.07  ? 129 GLY B CA  1 
ATOM   2480 C  C   . GLY B 2 129 ? -25.630 -50.136 71.926 1.00 59.62  ? 129 GLY B C   1 
ATOM   2481 O  O   . GLY B 2 129 ? -25.366 -49.316 71.039 1.00 58.19  ? 129 GLY B O   1 
ATOM   2482 N  N   . ALA B 2 130 ? -26.515 -51.118 71.756 1.00 60.27  ? 130 ALA B N   1 
ATOM   2483 C  CA  . ALA B 2 130 ? -27.273 -51.250 70.506 1.00 60.78  ? 130 ALA B CA  1 
ATOM   2484 C  C   . ALA B 2 130 ? -28.599 -50.488 70.546 1.00 60.24  ? 130 ALA B C   1 
ATOM   2485 O  O   . ALA B 2 130 ? -29.360 -50.540 69.585 1.00 62.63  ? 130 ALA B O   1 
ATOM   2486 C  CB  . ALA B 2 130 ? -27.526 -52.723 70.183 1.00 62.59  ? 130 ALA B CB  1 
ATOM   2487 N  N   . GLN B 2 131 ? -28.873 -49.789 71.647 1.00 59.64  ? 131 GLN B N   1 
ATOM   2488 C  CA  . GLN B 2 131 ? -30.122 -49.051 71.806 1.00 59.48  ? 131 GLN B CA  1 
ATOM   2489 C  C   . GLN B 2 131 ? -30.005 -47.655 71.213 1.00 59.83  ? 131 GLN B C   1 
ATOM   2490 O  O   . GLN B 2 131 ? -29.103 -46.894 71.576 1.00 57.89  ? 131 GLN B O   1 
ATOM   2491 C  CB  . GLN B 2 131 ? -30.479 -48.932 73.280 1.00 61.68  ? 131 GLN B CB  1 
ATOM   2492 C  CG  . GLN B 2 131 ? -31.864 -48.363 73.540 1.00 63.61  ? 131 GLN B CG  1 
ATOM   2493 C  CD  . GLN B 2 131 ? -32.011 -47.817 74.945 1.00 66.57  ? 131 GLN B CD  1 
ATOM   2494 O  OE1 . GLN B 2 131 ? -31.347 -48.275 75.881 1.00 70.49  ? 131 GLN B OE1 1 
ATOM   2495 N  NE2 . GLN B 2 131 ? -32.886 -46.830 75.102 1.00 69.83  ? 131 GLN B NE2 1 
ATOM   2496 N  N   . GLU B 2 132 ? -30.928 -47.320 70.316 1.00 58.90  ? 132 GLU B N   1 
ATOM   2497 C  CA  . GLU B 2 132 ? -30.975 -46.000 69.708 1.00 58.80  ? 132 GLU B CA  1 
ATOM   2498 C  C   . GLU B 2 132 ? -31.646 -45.022 70.668 1.00 58.24  ? 132 GLU B C   1 
ATOM   2499 O  O   . GLU B 2 132 ? -32.803 -45.205 71.030 1.00 59.73  ? 132 GLU B O   1 
ATOM   2500 C  CB  . GLU B 2 132 ? -31.732 -46.062 68.380 1.00 61.44  ? 132 GLU B CB  1 
ATOM   2501 C  CG  . GLU B 2 132 ? -31.085 -47.013 67.365 1.00 63.06  ? 132 GLU B CG  1 
ATOM   2502 C  CD  . GLU B 2 132 ? -31.743 -46.987 65.996 1.00 63.28  ? 132 GLU B CD  1 
ATOM   2503 O  OE1 . GLU B 2 132 ? -32.712 -46.215 65.787 1.00 64.05  ? 132 GLU B OE1 1 
ATOM   2504 O  OE2 . GLU B 2 132 ? -31.276 -47.749 65.126 1.00 62.80  ? 132 GLU B OE2 1 
ATOM   2505 N  N   . LEU B 2 133 ? -30.908 -43.999 71.093 1.00 55.32  ? 133 LEU B N   1 
ATOM   2506 C  CA  . LEU B 2 133 ? -31.413 -43.016 72.048 1.00 53.88  ? 133 LEU B CA  1 
ATOM   2507 C  C   . LEU B 2 133 ? -32.143 -41.886 71.345 1.00 55.80  ? 133 LEU B C   1 
ATOM   2508 O  O   . LEU B 2 133 ? -33.205 -41.452 71.794 1.00 54.97  ? 133 LEU B O   1 
ATOM   2509 C  CB  . LEU B 2 133 ? -30.266 -42.419 72.864 1.00 53.84  ? 133 LEU B CB  1 
ATOM   2510 C  CG  . LEU B 2 133 ? -29.444 -43.373 73.730 1.00 53.10  ? 133 LEU B CG  1 
ATOM   2511 C  CD1 . LEU B 2 133 ? -28.440 -42.590 74.553 1.00 51.95  ? 133 LEU B CD1 1 
ATOM   2512 C  CD2 . LEU B 2 133 ? -30.348 -44.191 74.620 1.00 51.60  ? 133 LEU B CD2 1 
ATOM   2513 N  N   . ILE B 2 134 ? -31.543 -41.390 70.263 1.00 55.96  ? 134 ILE B N   1 
ATOM   2514 C  CA  . ILE B 2 134 ? -32.090 -40.277 69.491 1.00 56.80  ? 134 ILE B CA  1 
ATOM   2515 C  C   . ILE B 2 134 ? -31.779 -40.514 68.028 1.00 52.35  ? 134 ILE B C   1 
ATOM   2516 O  O   . ILE B 2 134 ? -30.662 -40.862 67.681 1.00 52.31  ? 134 ILE B O   1 
ATOM   2517 C  CB  . ILE B 2 134 ? -31.479 -38.905 69.896 1.00 59.94  ? 134 ILE B CB  1 
ATOM   2518 C  CG1 . ILE B 2 134 ? -31.900 -38.511 71.309 1.00 66.11  ? 134 ILE B CG1 1 
ATOM   2519 C  CG2 . ILE B 2 134 ? -31.951 -37.807 68.949 1.00 59.68  ? 134 ILE B CG2 1 
ATOM   2520 C  CD1 . ILE B 2 134 ? -33.396 -38.232 71.439 1.00 70.40  ? 134 ILE B CD1 1 
ATOM   2521 N  N   . ARG B 2 135 ? -32.781 -40.330 67.186 1.00 56.05  ? 135 ARG B N   1 
ATOM   2522 C  CA  . ARG B 2 135 ? -32.653 -40.504 65.752 1.00 58.06  ? 135 ARG B CA  1 
ATOM   2523 C  C   . ARG B 2 135 ? -33.181 -39.237 65.114 1.00 58.32  ? 135 ARG B C   1 
ATOM   2524 O  O   . ARG B 2 135 ? -34.278 -38.786 65.444 1.00 60.06  ? 135 ARG B O   1 
ATOM   2525 C  CB  . ARG B 2 135 ? -33.474 -41.710 65.308 1.00 59.00  ? 135 ARG B CB  1 
ATOM   2526 C  CG  . ARG B 2 135 ? -33.269 -42.123 63.875 1.00 59.54  ? 135 ARG B CG  1 
ATOM   2527 C  CD  . ARG B 2 135 ? -33.966 -43.446 63.599 1.00 62.40  ? 135 ARG B CD  1 
ATOM   2528 N  NE  . ARG B 2 135 ? -33.804 -43.881 62.211 1.00 63.57  ? 135 ARG B NE  1 
ATOM   2529 C  CZ  . ARG B 2 135 ? -32.709 -44.454 61.710 1.00 63.56  ? 135 ARG B CZ  1 
ATOM   2530 N  NH1 . ARG B 2 135 ? -32.672 -44.804 60.432 1.00 64.14  ? 135 ARG B NH1 1 
ATOM   2531 N  NH2 . ARG B 2 135 ? -31.649 -44.673 62.471 1.00 64.41  ? 135 ARG B NH2 1 
ATOM   2532 N  N   . ARG B 2 136 ? -32.395 -38.643 64.227 1.00 58.71  ? 136 ARG B N   1 
ATOM   2533 C  CA  . ARG B 2 136 ? -32.800 -37.409 63.572 1.00 58.44  ? 136 ARG B CA  1 
ATOM   2534 C  C   . ARG B 2 136 ? -32.532 -37.451 62.076 1.00 54.89  ? 136 ARG B C   1 
ATOM   2535 O  O   . ARG B 2 136 ? -31.388 -37.518 61.644 1.00 53.28  ? 136 ARG B O   1 
ATOM   2536 C  CB  . ARG B 2 136 ? -32.066 -36.225 64.176 1.00 61.10  ? 136 ARG B CB  1 
ATOM   2537 C  CG  . ARG B 2 136 ? -32.593 -34.887 63.694 1.00 63.81  ? 136 ARG B CG  1 
ATOM   2538 C  CD  . ARG B 2 136 ? -31.736 -33.750 64.194 1.00 68.43  ? 136 ARG B CD  1 
ATOM   2539 N  NE  . ARG B 2 136 ? -31.998 -32.496 63.487 1.00 70.06  ? 136 ARG B NE  1 
ATOM   2540 C  CZ  . ARG B 2 136 ? -31.318 -31.366 63.691 1.00 74.89  ? 136 ARG B CZ  1 
ATOM   2541 N  NH1 . ARG B 2 136 ? -31.624 -30.277 62.989 1.00 73.92  ? 136 ARG B NH1 1 
ATOM   2542 N  NH2 . ARG B 2 136 ? -30.325 -31.319 64.591 1.00 75.43  ? 136 ARG B NH2 1 
ATOM   2543 N  N   . SER B 2 137 ? -33.609 -37.409 61.302 1.00 55.04  ? 137 SER B N   1 
ATOM   2544 C  CA  . SER B 2 137 ? -33.543 -37.198 59.872 1.00 56.14  ? 137 SER B CA  1 
ATOM   2545 C  C   . SER B 2 137 ? -33.404 -35.705 59.624 1.00 56.43  ? 137 SER B C   1 
ATOM   2546 O  O   . SER B 2 137 ? -34.036 -34.907 60.307 1.00 60.05  ? 137 SER B O   1 
ATOM   2547 C  CB  . SER B 2 137 ? -34.829 -37.703 59.219 1.00 56.14  ? 137 SER B CB  1 
ATOM   2548 O  OG  . SER B 2 137 ? -34.816 -37.461 57.827 1.00 60.19  ? 137 SER B OG  1 
ATOM   2549 N  N   . PHE B 2 138 ? -32.591 -35.334 58.640 1.00 58.51  ? 138 PHE B N   1 
ATOM   2550 C  CA  . PHE B 2 138 ? -32.416 -33.932 58.254 1.00 57.80  ? 138 PHE B CA  1 
ATOM   2551 C  C   . PHE B 2 138 ? -33.230 -33.562 57.014 1.00 59.19  ? 138 PHE B C   1 
ATOM   2552 O  O   . PHE B 2 138 ? -32.983 -32.534 56.382 1.00 56.64  ? 138 PHE B O   1 
ATOM   2553 C  CB  . PHE B 2 138 ? -30.933 -33.642 58.057 1.00 56.67  ? 138 PHE B CB  1 
ATOM   2554 C  CG  . PHE B 2 138 ? -30.157 -33.660 59.336 1.00 55.56  ? 138 PHE B CG  1 
ATOM   2555 C  CD1 . PHE B 2 138 ? -29.722 -34.856 59.879 1.00 54.74  ? 138 PHE B CD1 1 
ATOM   2556 C  CD2 . PHE B 2 138 ? -29.894 -32.482 60.020 1.00 56.55  ? 138 PHE B CD2 1 
ATOM   2557 C  CE1 . PHE B 2 138 ? -29.025 -34.883 61.075 1.00 57.06  ? 138 PHE B CE1 1 
ATOM   2558 C  CE2 . PHE B 2 138 ? -29.188 -32.500 61.220 1.00 56.03  ? 138 PHE B CE2 1 
ATOM   2559 C  CZ  . PHE B 2 138 ? -28.752 -33.707 61.744 1.00 55.26  ? 138 PHE B CZ  1 
ATOM   2560 N  N   . ALA B 2 139 ? -34.225 -34.388 56.693 1.00 61.35  ? 139 ALA B N   1 
ATOM   2561 C  CA  . ALA B 2 139 ? -35.185 -34.087 55.632 1.00 63.39  ? 139 ALA B CA  1 
ATOM   2562 C  C   . ALA B 2 139 ? -35.619 -32.634 55.703 1.00 63.08  ? 139 ALA B C   1 
ATOM   2563 O  O   . ALA B 2 139 ? -35.908 -32.129 56.775 1.00 64.97  ? 139 ALA B O   1 
ATOM   2564 C  CB  . ALA B 2 139 ? -36.406 -34.998 55.745 1.00 64.92  ? 139 ALA B CB  1 
ATOM   2565 N  N   . GLY B 2 140 ? -35.650 -31.965 54.557 1.00 63.84  ? 140 GLY B N   1 
ATOM   2566 C  CA  . GLY B 2 140 ? -36.089 -30.577 54.491 1.00 63.25  ? 140 GLY B CA  1 
ATOM   2567 C  C   . GLY B 2 140 ? -34.991 -29.528 54.588 1.00 64.11  ? 140 GLY B C   1 
ATOM   2568 O  O   . GLY B 2 140 ? -35.275 -28.339 54.479 1.00 66.62  ? 140 GLY B O   1 
ATOM   2569 N  N   . GLU B 2 141 ? -33.742 -29.948 54.788 1.00 61.82  ? 141 GLU B N   1 
ATOM   2570 C  CA  . GLU B 2 141 ? -32.612 -29.023 54.716 1.00 59.00  ? 141 GLU B CA  1 
ATOM   2571 C  C   . GLU B 2 141 ? -32.415 -28.591 53.261 1.00 56.77  ? 141 GLU B C   1 
ATOM   2572 O  O   . GLU B 2 141 ? -32.908 -29.261 52.343 1.00 50.89  ? 141 GLU B O   1 
ATOM   2573 C  CB  . GLU B 2 141 ? -31.342 -29.670 55.258 1.00 58.55  ? 141 GLU B CB  1 
ATOM   2574 C  CG  . GLU B 2 141 ? -31.386 -29.945 56.746 1.00 61.91  ? 141 GLU B CG  1 
ATOM   2575 C  CD  . GLU B 2 141 ? -31.116 -28.724 57.595 1.00 65.11  ? 141 GLU B CD  1 
ATOM   2576 O  OE1 . GLU B 2 141 ? -30.774 -27.665 57.039 1.00 67.22  ? 141 GLU B OE1 1 
ATOM   2577 O  OE2 . GLU B 2 141 ? -31.245 -28.828 58.832 1.00 72.77  ? 141 GLU B OE2 1 
ATOM   2578 N  N   . PRO B 2 142 ? -31.712 -27.462 53.037 1.00 58.48  ? 142 PRO B N   1 
ATOM   2579 C  CA  . PRO B 2 142 ? -31.522 -26.994 51.660 1.00 58.39  ? 142 PRO B CA  1 
ATOM   2580 C  C   . PRO B 2 142 ? -30.719 -27.999 50.839 1.00 57.07  ? 142 PRO B C   1 
ATOM   2581 O  O   . PRO B 2 142 ? -29.837 -28.656 51.394 1.00 59.55  ? 142 PRO B O   1 
ATOM   2582 C  CB  . PRO B 2 142 ? -30.738 -25.685 51.825 1.00 58.70  ? 142 PRO B CB  1 
ATOM   2583 C  CG  . PRO B 2 142 ? -30.912 -25.292 53.257 1.00 59.77  ? 142 PRO B CG  1 
ATOM   2584 C  CD  . PRO B 2 142 ? -31.059 -26.571 54.014 1.00 60.62  ? 142 PRO B CD  1 
ATOM   2585 N  N   . PRO B 2 143 ? -31.017 -28.116 49.530 1.00 58.52  ? 143 PRO B N   1 
ATOM   2586 C  CA  . PRO B 2 143 ? -30.390 -29.123 48.674 1.00 57.83  ? 143 PRO B CA  1 
ATOM   2587 C  C   . PRO B 2 143 ? -28.858 -29.072 48.613 1.00 55.94  ? 143 PRO B C   1 
ATOM   2588 O  O   . PRO B 2 143 ? -28.230 -30.122 48.457 1.00 56.27  ? 143 PRO B O   1 
ATOM   2589 C  CB  . PRO B 2 143 ? -31.007 -28.859 47.291 1.00 58.41  ? 143 PRO B CB  1 
ATOM   2590 C  CG  . PRO B 2 143 ? -31.606 -27.536 47.362 1.00 60.94  ? 143 PRO B CG  1 
ATOM   2591 C  CD  . PRO B 2 143 ? -31.978 -27.294 48.776 1.00 61.03  ? 143 PRO B CD  1 
ATOM   2592 N  N   . ARG B 2 144 ? -28.268 -27.887 48.764 1.00 53.86  ? 144 ARG B N   1 
ATOM   2593 C  CA  . ARG B 2 144 ? -26.810 -27.729 48.702 1.00 57.73  ? 144 ARG B CA  1 
ATOM   2594 C  C   . ARG B 2 144 ? -26.097 -27.856 50.055 1.00 56.65  ? 144 ARG B C   1 
ATOM   2595 O  O   . ARG B 2 144 ? -24.870 -27.722 50.123 1.00 57.83  ? 144 ARG B O   1 
ATOM   2596 C  CB  . ARG B 2 144 ? -26.470 -26.376 48.081 1.00 60.82  ? 144 ARG B CB  1 
ATOM   2597 C  CG  . ARG B 2 144 ? -27.043 -26.218 46.685 1.00 65.85  ? 144 ARG B CG  1 
ATOM   2598 C  CD  . ARG B 2 144 ? -26.530 -24.979 45.985 1.00 69.02  ? 144 ARG B CD  1 
ATOM   2599 N  NE  . ARG B 2 144 ? -27.244 -23.761 46.372 1.00 75.38  ? 144 ARG B NE  1 
ATOM   2600 C  CZ  . ARG B 2 144 ? -28.475 -23.430 45.973 1.00 78.06  ? 144 ARG B CZ  1 
ATOM   2601 N  NH1 . ARG B 2 144 ? -29.182 -24.241 45.185 1.00 79.75  ? 144 ARG B NH1 1 
ATOM   2602 N  NH2 . ARG B 2 144 ? -29.016 -22.282 46.379 1.00 76.42  ? 144 ARG B NH2 1 
ATOM   2603 N  N   . ALA B 2 145 ? -26.859 -28.089 51.125 1.00 52.55  ? 145 ALA B N   1 
ATOM   2604 C  CA  . ALA B 2 145 ? -26.301 -28.156 52.475 1.00 51.90  ? 145 ALA B CA  1 
ATOM   2605 C  C   . ALA B 2 145 ? -25.545 -29.466 52.653 1.00 49.38  ? 145 ALA B C   1 
ATOM   2606 O  O   . ALA B 2 145 ? -26.010 -30.502 52.199 1.00 51.29  ? 145 ALA B O   1 
ATOM   2607 C  CB  . ALA B 2 145 ? -27.406 -28.058 53.500 1.00 50.91  ? 145 ALA B CB  1 
ATOM   2608 N  N   . ARG B 2 146 ? -24.388 -29.411 53.312 1.00 48.51  ? 146 ARG B N   1 
ATOM   2609 C  CA  . ARG B 2 146 ? -23.562 -30.595 53.542 1.00 49.82  ? 146 ARG B CA  1 
ATOM   2610 C  C   . ARG B 2 146 ? -23.135 -30.652 54.998 1.00 51.07  ? 146 ARG B C   1 
ATOM   2611 O  O   . ARG B 2 146 ? -23.033 -29.627 55.656 1.00 49.89  ? 146 ARG B O   1 
ATOM   2612 C  CB  . ARG B 2 146 ? -22.331 -30.585 52.636 1.00 50.76  ? 146 ARG B CB  1 
ATOM   2613 C  CG  . ARG B 2 146 ? -22.642 -30.694 51.134 1.00 52.63  ? 146 ARG B CG  1 
ATOM   2614 C  CD  . ARG B 2 146 ? -23.334 -32.017 50.780 1.00 54.66  ? 146 ARG B CD  1 
ATOM   2615 N  NE  . ARG B 2 146 ? -23.563 -32.202 49.333 1.00 53.66  ? 146 ARG B NE  1 
ATOM   2616 C  CZ  . ARG B 2 146 ? -24.580 -31.678 48.652 1.00 54.65  ? 146 ARG B CZ  1 
ATOM   2617 N  NH1 . ARG B 2 146 ? -25.496 -30.930 49.249 1.00 49.58  ? 146 ARG B NH1 1 
ATOM   2618 N  NH2 . ARG B 2 146 ? -24.689 -31.913 47.346 1.00 58.85  ? 146 ARG B NH2 1 
ATOM   2619 N  N   . GLY B 2 147 ? -22.908 -31.860 55.498 1.00 48.13  ? 147 GLY B N   1 
ATOM   2620 C  CA  . GLY B 2 147 ? -22.481 -32.054 56.878 1.00 52.24  ? 147 GLY B CA  1 
ATOM   2621 C  C   . GLY B 2 147 ? -23.658 -32.040 57.830 1.00 53.66  ? 147 GLY B C   1 
ATOM   2622 O  O   . GLY B 2 147 ? -24.730 -31.547 57.498 1.00 51.85  ? 147 GLY B O   1 
ATOM   2623 N  N   . ALA B 2 148 ? -23.474 -32.594 59.019 1.00 50.21  ? 148 ALA B N   1 
ATOM   2624 C  CA  . ALA B 2 148 ? -24.536 -32.570 60.009 1.00 49.10  ? 148 ALA B CA  1 
ATOM   2625 C  C   . ALA B 2 148 ? -23.968 -32.752 61.409 1.00 48.16  ? 148 ALA B C   1 
ATOM   2626 O  O   . ALA B 2 148 ? -22.877 -33.291 61.583 1.00 47.77  ? 148 ALA B O   1 
ATOM   2627 C  CB  . ALA B 2 148 ? -25.597 -33.629 59.692 1.00 48.69  ? 148 ALA B CB  1 
ATOM   2628 N  N   . VAL B 2 149 ? -24.696 -32.228 62.392 1.00 50.88  ? 149 VAL B N   1 
ATOM   2629 C  CA  . VAL B 2 149 ? -24.377 -32.406 63.798 1.00 51.08  ? 149 VAL B CA  1 
ATOM   2630 C  C   . VAL B 2 149 ? -25.664 -32.805 64.509 1.00 51.50  ? 149 VAL B C   1 
ATOM   2631 O  O   . VAL B 2 149 ? -26.734 -32.289 64.188 1.00 53.32  ? 149 VAL B O   1 
ATOM   2632 C  CB  . VAL B 2 149 ? -23.817 -31.113 64.436 1.00 53.79  ? 149 VAL B CB  1 
ATOM   2633 C  CG1 . VAL B 2 149 ? -23.733 -31.260 65.946 1.00 52.56  ? 149 VAL B CG1 1 
ATOM   2634 C  CG2 . VAL B 2 149 ? -22.444 -30.767 63.861 1.00 54.94  ? 149 VAL B CG2 1 
ATOM   2635 N  N   . LEU B 2 150 ? -25.555 -33.731 65.455 1.00 50.09  ? 150 LEU B N   1 
ATOM   2636 C  CA  . LEU B 2 150 ? -26.679 -34.128 66.303 1.00 51.33  ? 150 LEU B CA  1 
ATOM   2637 C  C   . LEU B 2 150 ? -26.204 -34.124 67.749 1.00 49.95  ? 150 LEU B C   1 
ATOM   2638 O  O   . LEU B 2 150 ? -25.323 -34.896 68.110 1.00 47.02  ? 150 LEU B O   1 
ATOM   2639 C  CB  . LEU B 2 150 ? -27.176 -35.525 65.939 1.00 51.96  ? 150 LEU B CB  1 
ATOM   2640 C  CG  . LEU B 2 150 ? -28.234 -36.151 66.852 1.00 51.05  ? 150 LEU B CG  1 
ATOM   2641 C  CD1 . LEU B 2 150 ? -29.432 -35.219 67.021 1.00 51.14  ? 150 LEU B CD1 1 
ATOM   2642 C  CD2 . LEU B 2 150 ? -28.664 -37.485 66.297 1.00 50.63  ? 150 LEU B CD2 1 
ATOM   2643 N  N   . THR B 2 151 ? -26.783 -33.242 68.555 1.00 49.72  ? 151 THR B N   1 
ATOM   2644 C  CA  . THR B 2 151 ? -26.411 -33.087 69.958 1.00 51.82  ? 151 THR B CA  1 
ATOM   2645 C  C   . THR B 2 151 ? -27.619 -33.384 70.828 1.00 51.98  ? 151 THR B C   1 
ATOM   2646 O  O   . THR B 2 151 ? -28.738 -33.012 70.497 1.00 53.09  ? 151 THR B O   1 
ATOM   2647 C  CB  . THR B 2 151 ? -25.922 -31.659 70.240 1.00 53.90  ? 151 THR B CB  1 
ATOM   2648 O  OG1 . THR B 2 151 ? -24.825 -31.359 69.370 1.00 58.57  ? 151 THR B OG1 1 
ATOM   2649 C  CG2 . THR B 2 151 ? -25.462 -31.520 71.670 1.00 50.64  ? 151 THR B CG2 1 
ATOM   2650 N  N   . ALA B 2 152 ? -27.392 -34.066 71.939 1.00 52.74  ? 152 ALA B N   1 
ATOM   2651 C  CA  . ALA B 2 152 ? -28.471 -34.417 72.849 1.00 52.22  ? 152 ALA B CA  1 
ATOM   2652 C  C   . ALA B 2 152 ? -27.960 -34.408 74.274 1.00 51.31  ? 152 ALA B C   1 
ATOM   2653 O  O   . ALA B 2 152 ? -26.790 -34.685 74.521 1.00 51.12  ? 152 ALA B O   1 
ATOM   2654 C  CB  . ALA B 2 152 ? -29.034 -35.779 72.498 1.00 50.16  ? 152 ALA B CB  1 
ATOM   2655 N  N   . THR B 2 153 ? -28.843 -34.062 75.200 1.00 53.62  ? 153 THR B N   1 
ATOM   2656 C  CA  . THR B 2 153 ? -28.545 -34.111 76.624 1.00 55.14  ? 153 THR B CA  1 
ATOM   2657 C  C   . THR B 2 153 ? -29.025 -35.455 77.151 1.00 57.19  ? 153 THR B C   1 
ATOM   2658 O  O   . THR B 2 153 ? -30.121 -35.905 76.809 1.00 58.81  ? 153 THR B O   1 
ATOM   2659 C  CB  . THR B 2 153 ? -29.240 -32.974 77.371 1.00 55.28  ? 153 THR B CB  1 
ATOM   2660 O  OG1 . THR B 2 153 ? -28.843 -31.725 76.794 1.00 56.77  ? 153 THR B OG1 1 
ATOM   2661 C  CG2 . THR B 2 153 ? -28.863 -32.989 78.829 1.00 54.27  ? 153 THR B CG2 1 
ATOM   2662 N  N   . VAL B 2 154 ? -28.196 -36.104 77.961 1.00 55.90  ? 154 VAL B N   1 
ATOM   2663 C  CA  . VAL B 2 154 ? -28.505 -37.436 78.466 1.00 55.93  ? 154 VAL B CA  1 
ATOM   2664 C  C   . VAL B 2 154 ? -28.242 -37.475 79.962 1.00 55.84  ? 154 VAL B C   1 
ATOM   2665 O  O   . VAL B 2 154 ? -27.190 -37.033 80.416 1.00 54.04  ? 154 VAL B O   1 
ATOM   2666 C  CB  . VAL B 2 154 ? -27.654 -38.507 77.759 1.00 56.41  ? 154 VAL B CB  1 
ATOM   2667 C  CG1 . VAL B 2 154 ? -27.949 -39.888 78.329 1.00 59.84  ? 154 VAL B CG1 1 
ATOM   2668 C  CG2 . VAL B 2 154 ? -27.906 -38.477 76.260 1.00 58.13  ? 154 VAL B CG2 1 
ATOM   2669 N  N   . LEU B 2 155 ? -29.210 -37.988 80.716 1.00 57.02  ? 155 LEU B N   1 
ATOM   2670 C  CA  . LEU B 2 155 ? -29.100 -38.099 82.163 1.00 59.01  ? 155 LEU B CA  1 
ATOM   2671 C  C   . LEU B 2 155 ? -28.276 -39.334 82.515 1.00 60.61  ? 155 LEU B C   1 
ATOM   2672 O  O   . LEU B 2 155 ? -28.603 -40.441 82.090 1.00 60.92  ? 155 LEU B O   1 
ATOM   2673 C  CB  . LEU B 2 155 ? -30.491 -38.203 82.790 1.00 60.09  ? 155 LEU B CB  1 
ATOM   2674 C  CG  . LEU B 2 155 ? -30.574 -38.164 84.316 1.00 59.95  ? 155 LEU B CG  1 
ATOM   2675 C  CD1 . LEU B 2 155 ? -30.204 -36.789 84.835 1.00 63.14  ? 155 LEU B CD1 1 
ATOM   2676 C  CD2 . LEU B 2 155 ? -31.967 -38.544 84.770 1.00 60.39  ? 155 LEU B CD2 1 
ATOM   2677 N  N   . ALA B 2 156 ? -27.210 -39.137 83.288 1.00 60.83  ? 156 ALA B N   1 
ATOM   2678 C  CA  . ALA B 2 156 ? -26.324 -40.229 83.676 1.00 59.59  ? 156 ALA B CA  1 
ATOM   2679 C  C   . ALA B 2 156 ? -26.987 -41.110 84.736 1.00 60.09  ? 156 ALA B C   1 
ATOM   2680 O  O   . ALA B 2 156 ? -27.539 -40.598 85.709 1.00 59.18  ? 156 ALA B O   1 
ATOM   2681 C  CB  . ALA B 2 156 ? -25.008 -39.672 84.195 1.00 55.55  ? 156 ALA B CB  1 
ATOM   2682 N  N   . ARG B 2 157 ? -26.932 -42.428 84.535 1.00 61.39  ? 157 ARG B N   1 
ATOM   2683 C  CA  . ARG B 2 157 ? -27.447 -43.408 85.501 1.00 62.51  ? 157 ARG B CA  1 
ATOM   2684 C  C   . ARG B 2 157 ? -26.326 -44.324 86.005 1.00 62.71  ? 157 ARG B C   1 
ATOM   2685 O  O   . ARG B 2 157 ? -25.295 -44.473 85.341 1.00 61.14  ? 157 ARG B O   1 
ATOM   2686 C  CB  . ARG B 2 157 ? -28.529 -44.278 84.855 1.00 64.03  ? 157 ARG B CB  1 
ATOM   2687 C  CG  . ARG B 2 157 ? -29.683 -43.513 84.219 1.00 66.21  ? 157 ARG B CG  1 
ATOM   2688 C  CD  . ARG B 2 157 ? -30.657 -44.456 83.509 1.00 65.80  ? 157 ARG B CD  1 
ATOM   2689 N  NE  . ARG B 2 157 ? -29.999 -45.260 82.477 1.00 65.93  ? 157 ARG B NE  1 
ATOM   2690 C  CZ  . ARG B 2 157 ? -30.573 -46.265 81.816 1.00 67.11  ? 157 ARG B CZ  1 
ATOM   2691 N  NH1 . ARG B 2 157 ? -29.881 -46.937 80.906 1.00 67.53  ? 157 ARG B NH1 1 
ATOM   2692 N  NH2 . ARG B 2 157 ? -31.833 -46.609 82.054 1.00 67.94  ? 157 ARG B NH2 1 
ATOM   2693 N  N   . ARG B 2 158 ? -26.539 -44.938 87.173 1.00 63.15  ? 158 ARG B N   1 
ATOM   2694 C  CA  . ARG B 2 158 ? -25.634 -45.970 87.706 1.00 63.78  ? 158 ARG B CA  1 
ATOM   2695 C  C   . ARG B 2 158 ? -25.404 -47.079 86.695 1.00 60.38  ? 158 ARG B C   1 
ATOM   2696 O  O   . ARG B 2 158 ? -24.281 -47.529 86.499 1.00 58.22  ? 158 ARG B O   1 
ATOM   2697 C  CB  . ARG B 2 158 ? -26.216 -46.610 88.969 1.00 65.22  ? 158 ARG B CB  1 
ATOM   2698 C  CG  . ARG B 2 158 ? -26.166 -45.737 90.203 1.00 68.31  ? 158 ARG B CG  1 
ATOM   2699 C  CD  . ARG B 2 158 ? -26.549 -46.505 91.478 1.00 69.19  ? 158 ARG B CD  1 
ATOM   2700 N  NE  . ARG B 2 158 ? -25.772 -47.740 91.649 1.00 70.68  ? 158 ARG B NE  1 
ATOM   2701 C  CZ  . ARG B 2 158 ? -26.240 -48.984 91.501 1.00 70.20  ? 158 ARG B CZ  1 
ATOM   2702 N  NH1 . ARG B 2 158 ? -27.511 -49.222 91.186 1.00 68.57  ? 158 ARG B NH1 1 
ATOM   2703 N  NH2 . ARG B 2 158 ? -25.418 -50.011 91.682 1.00 70.49  ? 158 ARG B NH2 1 
ATOM   2704 N  N   . GLU B 2 159 ? -26.498 -47.508 86.072 1.00 61.73  ? 159 GLU B N   1 
ATOM   2705 C  CA  . GLU B 2 159 ? -26.505 -48.554 85.046 1.00 65.23  ? 159 GLU B CA  1 
ATOM   2706 C  C   . GLU B 2 159 ? -25.567 -48.253 83.867 1.00 64.29  ? 159 GLU B C   1 
ATOM   2707 O  O   . GLU B 2 159 ? -25.043 -49.167 83.228 1.00 63.97  ? 159 GLU B O   1 
ATOM   2708 C  CB  . GLU B 2 159 ? -27.923 -48.717 84.485 1.00 67.05  ? 159 GLU B CB  1 
ATOM   2709 C  CG  . GLU B 2 159 ? -29.025 -48.929 85.523 1.00 70.69  ? 159 GLU B CG  1 
ATOM   2710 C  CD  . GLU B 2 159 ? -30.417 -48.777 84.931 1.00 72.45  ? 159 GLU B CD  1 
ATOM   2711 O  OE1 . GLU B 2 159 ? -30.544 -48.782 83.687 1.00 75.42  ? 159 GLU B OE1 1 
ATOM   2712 O  OE2 . GLU B 2 159 ? -31.389 -48.658 85.710 1.00 76.14  ? 159 GLU B OE2 1 
ATOM   2713 N  N   . ASP B 2 160 ? -25.372 -46.972 83.571 1.00 64.26  ? 160 ASP B N   1 
ATOM   2714 C  CA  . ASP B 2 160 ? -24.604 -46.557 82.397 1.00 61.35  ? 160 ASP B CA  1 
ATOM   2715 C  C   . ASP B 2 160 ? -23.093 -46.584 82.620 1.00 59.10  ? 160 ASP B C   1 
ATOM   2716 O  O   . ASP B 2 160 ? -22.326 -46.252 81.714 1.00 58.41  ? 160 ASP B O   1 
ATOM   2717 C  CB  . ASP B 2 160 ? -25.030 -45.153 81.972 1.00 64.35  ? 160 ASP B CB  1 
ATOM   2718 C  CG  . ASP B 2 160 ? -26.482 -45.088 81.539 1.00 66.98  ? 160 ASP B CG  1 
ATOM   2719 O  OD1 . ASP B 2 160 ? -27.062 -46.147 81.206 1.00 63.82  ? 160 ASP B OD1 1 
ATOM   2720 O  OD2 . ASP B 2 160 ? -27.033 -43.965 81.519 1.00 70.84  ? 160 ASP B OD2 1 
ATOM   2721 N  N   . HIS B 2 161 ? -22.655 -46.962 83.817 1.00 55.52  ? 161 HIS B N   1 
ATOM   2722 C  CA  . HIS B 2 161 ? -21.232 -47.107 84.056 1.00 55.84  ? 161 HIS B CA  1 
ATOM   2723 C  C   . HIS B 2 161 ? -20.672 -48.181 83.135 1.00 55.27  ? 161 HIS B C   1 
ATOM   2724 O  O   . HIS B 2 161 ? -21.154 -49.310 83.135 1.00 55.91  ? 161 HIS B O   1 
ATOM   2725 C  CB  . HIS B 2 161 ? -20.929 -47.475 85.504 1.00 54.20  ? 161 HIS B CB  1 
ATOM   2726 C  CG  . HIS B 2 161 ? -19.466 -47.542 85.787 1.00 53.83  ? 161 HIS B CG  1 
ATOM   2727 N  ND1 . HIS B 2 161 ? -18.644 -46.442 85.681 1.00 53.63  ? 161 HIS B ND1 1 
ATOM   2728 C  CD2 . HIS B 2 161 ? -18.666 -48.581 86.115 1.00 53.56  ? 161 HIS B CD2 1 
ATOM   2729 C  CE1 . HIS B 2 161 ? -17.403 -46.795 85.955 1.00 54.19  ? 161 HIS B CE1 1 
ATOM   2730 N  NE2 . HIS B 2 161 ? -17.390 -48.088 86.224 1.00 53.46  ? 161 HIS B NE2 1 
ATOM   2731 N  N   . GLY B 2 162 ? -19.668 -47.819 82.341 1.00 53.74  ? 162 GLY B N   1 
ATOM   2732 C  CA  . GLY B 2 162 ? -19.034 -48.761 81.428 1.00 54.99  ? 162 GLY B CA  1 
ATOM   2733 C  C   . GLY B 2 162 ? -19.783 -49.002 80.127 1.00 56.72  ? 162 GLY B C   1 
ATOM   2734 O  O   . GLY B 2 162 ? -19.321 -49.781 79.294 1.00 60.54  ? 162 GLY B O   1 
ATOM   2735 N  N   . ALA B 2 163 ? -20.930 -48.341 79.941 1.00 56.78  ? 163 ALA B N   1 
ATOM   2736 C  CA  . ALA B 2 163 ? -21.706 -48.457 78.700 1.00 55.39  ? 163 ALA B CA  1 
ATOM   2737 C  C   . ALA B 2 163 ? -21.020 -47.681 77.586 1.00 54.19  ? 163 ALA B C   1 
ATOM   2738 O  O   . ALA B 2 163 ? -20.377 -46.653 77.839 1.00 53.88  ? 163 ALA B O   1 
ATOM   2739 C  CB  . ALA B 2 163 ? -23.139 -47.948 78.896 1.00 54.39  ? 163 ALA B CB  1 
ATOM   2740 N  N   . ASN B 2 164 ? -21.154 -48.186 76.360 1.00 53.65  ? 164 ASN B N   1 
ATOM   2741 C  CA  . ASN B 2 164 ? -20.536 -47.574 75.188 1.00 54.48  ? 164 ASN B CA  1 
ATOM   2742 C  C   . ASN B 2 164 ? -21.534 -46.740 74.419 1.00 53.84  ? 164 ASN B C   1 
ATOM   2743 O  O   . ASN B 2 164 ? -22.576 -47.244 73.999 1.00 56.60  ? 164 ASN B O   1 
ATOM   2744 C  CB  . ASN B 2 164 ? -19.979 -48.635 74.250 1.00 60.54  ? 164 ASN B CB  1 
ATOM   2745 C  CG  . ASN B 2 164 ? -18.913 -49.471 74.895 1.00 68.33  ? 164 ASN B CG  1 
ATOM   2746 O  OD1 . ASN B 2 164 ? -17.830 -48.976 75.222 1.00 68.40  ? 164 ASN B OD1 1 
ATOM   2747 N  ND2 . ASN B 2 164 ? -19.221 -50.769 75.087 1.00 79.72  ? 164 ASN B ND2 1 
ATOM   2748 N  N   . PHE B 2 165 ? -21.203 -45.468 74.232 1.00 50.87  ? 165 PHE B N   1 
ATOM   2749 C  CA  . PHE B 2 165 ? -21.980 -44.576 73.395 1.00 49.75  ? 165 PHE B CA  1 
ATOM   2750 C  C   . PHE B 2 165 ? -21.291 -44.400 72.053 1.00 51.51  ? 165 PHE B C   1 
ATOM   2751 O  O   . PHE B 2 165 ? -20.061 -44.369 71.951 1.00 50.75  ? 165 PHE B O   1 
ATOM   2752 C  CB  . PHE B 2 165 ? -22.186 -43.222 74.063 1.00 49.15  ? 165 PHE B CB  1 
ATOM   2753 C  CG  . PHE B 2 165 ? -23.013 -43.296 75.313 1.00 49.67  ? 165 PHE B CG  1 
ATOM   2754 C  CD1 . PHE B 2 165 ? -22.461 -43.762 76.493 1.00 49.79  ? 165 PHE B CD1 1 
ATOM   2755 C  CD2 . PHE B 2 165 ? -24.342 -42.910 75.305 1.00 48.90  ? 165 PHE B CD2 1 
ATOM   2756 C  CE1 . PHE B 2 165 ? -23.219 -43.851 77.650 1.00 49.68  ? 165 PHE B CE1 1 
ATOM   2757 C  CE2 . PHE B 2 165 ? -25.102 -42.981 76.455 1.00 49.10  ? 165 PHE B CE2 1 
ATOM   2758 C  CZ  . PHE B 2 165 ? -24.538 -43.456 77.632 1.00 49.65  ? 165 PHE B CZ  1 
ATOM   2759 N  N   . SER B 2 166 ? -22.106 -44.295 71.017 1.00 49.24  ? 166 SER B N   1 
ATOM   2760 C  CA  . SER B 2 166 ? -21.601 -44.163 69.672 1.00 50.02  ? 166 SER B CA  1 
ATOM   2761 C  C   . SER B 2 166 ? -22.654 -43.451 68.865 1.00 48.89  ? 166 SER B C   1 
ATOM   2762 O  O   . SER B 2 166 ? -23.757 -43.200 69.338 1.00 46.06  ? 166 SER B O   1 
ATOM   2763 C  CB  . SER B 2 166 ? -21.319 -45.541 69.065 1.00 50.83  ? 166 SER B CB  1 
ATOM   2764 O  OG  . SER B 2 166 ? -22.518 -46.279 68.889 1.00 53.89  ? 166 SER B OG  1 
ATOM   2765 N  N   . CYS B 2 167 ? -22.319 -43.119 67.638 1.00 51.61  ? 167 CYS B N   1 
ATOM   2766 C  CA  . CYS B 2 167 ? -23.323 -42.585 66.764 1.00 52.92  ? 167 CYS B CA  1 
ATOM   2767 C  C   . CYS B 2 167 ? -23.148 -43.145 65.371 1.00 52.77  ? 167 CYS B C   1 
ATOM   2768 O  O   . CYS B 2 167 ? -22.104 -43.708 65.046 1.00 47.70  ? 167 CYS B O   1 
ATOM   2769 C  CB  . CYS B 2 167 ? -23.284 -41.077 66.797 1.00 60.45  ? 167 CYS B CB  1 
ATOM   2770 S  SG  . CYS B 2 167 ? -21.841 -40.309 66.121 1.00 67.96  ? 167 CYS B SG  1 
ATOM   2771 N  N   . ARG B 2 168 ? -24.208 -43.036 64.581 1.00 52.19  ? 168 ARG B N   1 
ATOM   2772 C  CA  . ARG B 2 168 ? -24.237 -43.591 63.248 1.00 50.97  ? 168 ARG B CA  1 
ATOM   2773 C  C   . ARG B 2 168 ? -24.755 -42.546 62.294 1.00 50.26  ? 168 ARG B C   1 
ATOM   2774 O  O   . ARG B 2 168 ? -25.684 -41.825 62.618 1.00 53.56  ? 168 ARG B O   1 
ATOM   2775 C  CB  . ARG B 2 168 ? -25.137 -44.826 63.200 1.00 50.49  ? 168 ARG B CB  1 
ATOM   2776 C  CG  . ARG B 2 168 ? -25.065 -45.564 61.866 1.00 52.85  ? 168 ARG B CG  1 
ATOM   2777 C  CD  . ARG B 2 168 ? -25.766 -46.897 61.918 1.00 52.28  ? 168 ARG B CD  1 
ATOM   2778 N  NE  . ARG B 2 168 ? -27.204 -46.720 62.092 1.00 52.46  ? 168 ARG B NE  1 
ATOM   2779 C  CZ  . ARG B 2 168 ? -27.926 -47.154 63.123 1.00 50.78  ? 168 ARG B CZ  1 
ATOM   2780 N  NH1 . ARG B 2 168 ? -27.387 -47.846 64.117 1.00 52.68  ? 168 ARG B NH1 1 
ATOM   2781 N  NH2 . ARG B 2 168 ? -29.225 -46.903 63.148 1.00 51.57  ? 168 ARG B NH2 1 
ATOM   2782 N  N   . ALA B 2 169 ? -24.142 -42.473 61.121 1.00 49.17  ? 169 ALA B N   1 
ATOM   2783 C  CA  . ALA B 2 169 ? -24.591 -41.592 60.056 1.00 49.86  ? 169 ALA B CA  1 
ATOM   2784 C  C   . ALA B 2 169 ? -25.060 -42.458 58.891 1.00 51.10  ? 169 ALA B C   1 
ATOM   2785 O  O   . ALA B 2 169 ? -24.399 -43.429 58.546 1.00 48.34  ? 169 ALA B O   1 
ATOM   2786 C  CB  . ALA B 2 169 ? -23.466 -40.694 59.637 1.00 50.25  ? 169 ALA B CB  1 
ATOM   2787 N  N   . GLU B 2 170 ? -26.216 -42.136 58.320 1.00 52.83  ? 170 GLU B N   1 
ATOM   2788 C  CA  . GLU B 2 170 ? -26.703 -42.826 57.121 1.00 53.66  ? 170 GLU B CA  1 
ATOM   2789 C  C   . GLU B 2 170 ? -26.990 -41.803 56.049 1.00 56.59  ? 170 GLU B C   1 
ATOM   2790 O  O   . GLU B 2 170 ? -27.731 -40.847 56.297 1.00 52.97  ? 170 GLU B O   1 
ATOM   2791 C  CB  . GLU B 2 170 ? -27.992 -43.584 57.403 1.00 55.89  ? 170 GLU B CB  1 
ATOM   2792 C  CG  . GLU B 2 170 ? -27.895 -44.579 58.540 1.00 58.01  ? 170 GLU B CG  1 
ATOM   2793 C  CD  . GLU B 2 170 ? -29.242 -44.869 59.169 1.00 59.47  ? 170 GLU B CD  1 
ATOM   2794 O  OE1 . GLU B 2 170 ? -30.276 -44.717 58.481 1.00 60.81  ? 170 GLU B OE1 1 
ATOM   2795 O  OE2 . GLU B 2 170 ? -29.264 -45.238 60.360 1.00 58.76  ? 170 GLU B OE2 1 
ATOM   2796 N  N   . LEU B 2 171 ? -26.399 -42.003 54.873 1.00 53.68  ? 171 LEU B N   1 
ATOM   2797 C  CA  . LEU B 2 171 ? -26.715 -41.211 53.693 1.00 51.18  ? 171 LEU B CA  1 
ATOM   2798 C  C   . LEU B 2 171 ? -27.519 -42.129 52.795 1.00 48.75  ? 171 LEU B C   1 
ATOM   2799 O  O   . LEU B 2 171 ? -26.974 -43.076 52.240 1.00 46.28  ? 171 LEU B O   1 
ATOM   2800 C  CB  . LEU B 2 171 ? -25.442 -40.756 52.989 1.00 51.17  ? 171 LEU B CB  1 
ATOM   2801 C  CG  . LEU B 2 171 ? -25.611 -39.892 51.739 1.00 52.29  ? 171 LEU B CG  1 
ATOM   2802 C  CD1 . LEU B 2 171 ? -26.333 -38.590 52.070 1.00 49.54  ? 171 LEU B CD1 1 
ATOM   2803 C  CD2 . LEU B 2 171 ? -24.254 -39.618 51.100 1.00 49.45  ? 171 LEU B CD2 1 
ATOM   2804 N  N   . ASP B 2 172 ? -28.822 -41.866 52.713 1.00 46.47  ? 172 ASP B N   1 
ATOM   2805 C  CA  . ASP B 2 172 ? -29.751 -42.683 51.955 1.00 47.54  ? 172 ASP B CA  1 
ATOM   2806 C  C   . ASP B 2 172 ? -30.017 -42.078 50.579 1.00 47.92  ? 172 ASP B C   1 
ATOM   2807 O  O   . ASP B 2 172 ? -30.874 -41.203 50.419 1.00 49.65  ? 172 ASP B O   1 
ATOM   2808 C  CB  . ASP B 2 172 ? -31.065 -42.825 52.716 1.00 48.86  ? 172 ASP B CB  1 
ATOM   2809 C  CG  . ASP B 2 172 ? -31.960 -43.888 52.127 1.00 50.26  ? 172 ASP B CG  1 
ATOM   2810 O  OD1 . ASP B 2 172 ? -31.633 -44.405 51.038 1.00 50.77  ? 172 ASP B OD1 1 
ATOM   2811 O  OD2 . ASP B 2 172 ? -32.981 -44.222 52.762 1.00 52.43  ? 172 ASP B OD2 1 
ATOM   2812 N  N   . LEU B 2 173 ? -29.272 -42.545 49.590 1.00 50.35  ? 173 LEU B N   1 
ATOM   2813 C  CA  . LEU B 2 173 ? -29.452 -42.095 48.217 1.00 46.38  ? 173 LEU B CA  1 
ATOM   2814 C  C   . LEU B 2 173 ? -30.238 -43.087 47.388 1.00 46.04  ? 173 LEU B C   1 
ATOM   2815 O  O   . LEU B 2 173 ? -30.244 -43.025 46.157 1.00 45.59  ? 173 LEU B O   1 
ATOM   2816 C  CB  . LEU B 2 173 ? -28.088 -41.824 47.593 1.00 47.38  ? 173 LEU B CB  1 
ATOM   2817 C  CG  . LEU B 2 173 ? -27.266 -40.737 48.305 1.00 48.36  ? 173 LEU B CG  1 
ATOM   2818 C  CD1 . LEU B 2 173 ? -26.001 -40.420 47.519 1.00 53.50  ? 173 LEU B CD1 1 
ATOM   2819 C  CD2 . LEU B 2 173 ? -28.086 -39.505 48.488 1.00 48.29  ? 173 LEU B CD2 1 
ATOM   2820 N  N   . ARG B 2 174 ? -30.961 -43.976 48.054 1.00 44.05  ? 174 ARG B N   1 
ATOM   2821 C  CA  . ARG B 2 174 ? -31.700 -45.006 47.333 1.00 45.05  ? 174 ARG B CA  1 
ATOM   2822 C  C   . ARG B 2 174 ? -32.864 -44.451 46.528 1.00 44.52  ? 174 ARG B C   1 
ATOM   2823 O  O   . ARG B 2 174 ? -33.149 -44.977 45.457 1.00 47.69  ? 174 ARG B O   1 
ATOM   2824 C  CB  . ARG B 2 174 ? -32.178 -46.094 48.284 1.00 46.44  ? 174 ARG B CB  1 
ATOM   2825 C  CG  . ARG B 2 174 ? -31.049 -46.838 48.918 1.00 46.42  ? 174 ARG B CG  1 
ATOM   2826 C  CD  . ARG B 2 174 ? -31.526 -47.827 49.950 1.00 48.24  ? 174 ARG B CD  1 
ATOM   2827 N  NE  . ARG B 2 174 ? -32.051 -47.166 51.145 1.00 48.93  ? 174 ARG B NE  1 
ATOM   2828 C  CZ  . ARG B 2 174 ? -32.376 -47.808 52.259 1.00 51.77  ? 174 ARG B CZ  1 
ATOM   2829 N  NH1 . ARG B 2 174 ? -32.237 -49.119 52.348 1.00 50.55  ? 174 ARG B NH1 1 
ATOM   2830 N  NH2 . ARG B 2 174 ? -32.844 -47.133 53.290 1.00 51.59  ? 174 ARG B NH2 1 
ATOM   2831 N  N   . PRO B 2 175 ? -33.534 -43.379 47.006 1.00 43.75  ? 175 PRO B N   1 
ATOM   2832 C  CA  . PRO B 2 175 ? -34.529 -42.743 46.121 1.00 44.62  ? 175 PRO B CA  1 
ATOM   2833 C  C   . PRO B 2 175 ? -33.967 -42.325 44.756 1.00 47.20  ? 175 PRO B C   1 
ATOM   2834 O  O   . PRO B 2 175 ? -34.718 -42.236 43.780 1.00 49.59  ? 175 PRO B O   1 
ATOM   2835 C  CB  . PRO B 2 175 ? -34.966 -41.501 46.922 1.00 48.58  ? 175 PRO B CB  1 
ATOM   2836 C  CG  . PRO B 2 175 ? -34.746 -41.865 48.333 1.00 45.49  ? 175 PRO B CG  1 
ATOM   2837 C  CD  . PRO B 2 175 ? -33.465 -42.682 48.309 1.00 48.27  ? 175 PRO B CD  1 
ATOM   2838 N  N   . HIS B 2 176 ? -32.652 -42.095 44.687 1.00 50.48  ? 176 HIS B N   1 
ATOM   2839 C  CA  . HIS B 2 176 ? -31.979 -41.693 43.452 1.00 48.75  ? 176 HIS B CA  1 
ATOM   2840 C  C   . HIS B 2 176 ? -31.240 -42.830 42.798 1.00 50.68  ? 176 HIS B C   1 
ATOM   2841 O  O   . HIS B 2 176 ? -30.491 -42.622 41.861 1.00 52.58  ? 176 HIS B O   1 
ATOM   2842 C  CB  . HIS B 2 176 ? -31.016 -40.560 43.749 1.00 53.85  ? 176 HIS B CB  1 
ATOM   2843 C  CG  . HIS B 2 176 ? -31.679 -39.380 44.372 1.00 54.77  ? 176 HIS B CG  1 
ATOM   2844 N  ND1 . HIS B 2 176 ? -31.538 -39.067 45.707 1.00 58.73  ? 176 HIS B ND1 1 
ATOM   2845 C  CD2 . HIS B 2 176 ? -32.524 -38.458 43.853 1.00 56.56  ? 176 HIS B CD2 1 
ATOM   2846 C  CE1 . HIS B 2 176 ? -32.257 -37.992 45.980 1.00 59.59  ? 176 HIS B CE1 1 
ATOM   2847 N  NE2 . HIS B 2 176 ? -32.865 -37.603 44.873 1.00 58.71  ? 176 HIS B NE2 1 
ATOM   2848 N  N   . GLY B 2 177 ? -31.450 -44.039 43.292 1.00 50.93  ? 177 GLY B N   1 
ATOM   2849 C  CA  . GLY B 2 177 ? -30.839 -45.215 42.704 1.00 51.19  ? 177 GLY B CA  1 
ATOM   2850 C  C   . GLY B 2 177 ? -29.376 -45.419 43.036 1.00 52.95  ? 177 GLY B C   1 
ATOM   2851 O  O   . GLY B 2 177 ? -28.719 -46.236 42.393 1.00 45.96  ? 177 GLY B O   1 
ATOM   2852 N  N   . LEU B 2 178 ? -28.873 -44.725 44.062 1.00 50.24  ? 178 LEU B N   1 
ATOM   2853 C  CA  . LEU B 2 178 ? -27.435 -44.705 44.354 1.00 52.23  ? 178 LEU B CA  1 
ATOM   2854 C  C   . LEU B 2 178 ? -27.010 -45.436 45.632 1.00 58.80  ? 178 LEU B C   1 
ATOM   2855 O  O   . LEU B 2 178 ? -25.821 -45.423 45.960 1.00 68.15  ? 178 LEU B O   1 
ATOM   2856 C  CB  . LEU B 2 178 ? -26.939 -43.256 44.462 1.00 54.01  ? 178 LEU B CB  1 
ATOM   2857 C  CG  . LEU B 2 178 ? -26.986 -42.414 43.193 1.00 54.65  ? 178 LEU B CG  1 
ATOM   2858 C  CD1 . LEU B 2 178 ? -26.733 -40.954 43.525 1.00 60.60  ? 178 LEU B CD1 1 
ATOM   2859 C  CD2 . LEU B 2 178 ? -26.003 -42.950 42.178 1.00 55.93  ? 178 LEU B CD2 1 
ATOM   2860 N  N   . GLY B 2 179 ? -27.935 -46.045 46.367 1.00 49.66  ? 179 GLY B N   1 
ATOM   2861 C  CA  . GLY B 2 179 ? -27.537 -46.790 47.583 1.00 50.01  ? 179 GLY B CA  1 
ATOM   2862 C  C   . GLY B 2 179 ? -27.550 -46.068 48.928 1.00 49.07  ? 179 GLY B C   1 
ATOM   2863 O  O   . GLY B 2 179 ? -27.690 -44.841 49.012 1.00 49.68  ? 179 GLY B O   1 
ATOM   2864 N  N   . LEU B 2 180 ? -27.414 -46.858 49.991 1.00 47.50  ? 180 LEU B N   1 
ATOM   2865 C  CA  . LEU B 2 180 ? -27.406 -46.376 51.371 1.00 49.25  ? 180 LEU B CA  1 
ATOM   2866 C  C   . LEU B 2 180 ? -25.981 -46.472 51.907 1.00 49.71  ? 180 LEU B C   1 
ATOM   2867 O  O   . LEU B 2 180 ? -25.414 -47.553 51.944 1.00 47.93  ? 180 LEU B O   1 
ATOM   2868 C  CB  . LEU B 2 180 ? -28.357 -47.224 52.230 1.00 47.53  ? 180 LEU B CB  1 
ATOM   2869 C  CG  . LEU B 2 180 ? -28.357 -47.005 53.755 1.00 46.37  ? 180 LEU B CG  1 
ATOM   2870 C  CD1 . LEU B 2 180 ? -28.772 -45.614 54.141 1.00 49.07  ? 180 LEU B CD1 1 
ATOM   2871 C  CD2 . LEU B 2 180 ? -29.264 -48.042 54.409 1.00 51.84  ? 180 LEU B CD2 1 
ATOM   2872 N  N   . PHE B 2 181 ? -25.395 -45.344 52.306 1.00 45.27  ? 181 PHE B N   1 
ATOM   2873 C  CA  . PHE B 2 181 ? -24.015 -45.334 52.785 1.00 48.81  ? 181 PHE B CA  1 
ATOM   2874 C  C   . PHE B 2 181 ? -24.025 -45.038 54.280 1.00 48.57  ? 181 PHE B C   1 
ATOM   2875 O  O   . PHE B 2 181 ? -24.503 -43.982 54.690 1.00 49.53  ? 181 PHE B O   1 
ATOM   2876 C  CB  . PHE B 2 181 ? -23.199 -44.266 52.043 1.00 49.46  ? 181 PHE B CB  1 
ATOM   2877 C  CG  . PHE B 2 181 ? -23.208 -44.416 50.545 1.00 48.48  ? 181 PHE B CG  1 
ATOM   2878 C  CD1 . PHE B 2 181 ? -24.191 -43.819 49.782 1.00 48.86  ? 181 PHE B CD1 1 
ATOM   2879 C  CD2 . PHE B 2 181 ? -22.233 -45.159 49.906 1.00 50.44  ? 181 PHE B CD2 1 
ATOM   2880 C  CE1 . PHE B 2 181 ? -24.209 -43.957 48.399 1.00 47.80  ? 181 PHE B CE1 1 
ATOM   2881 C  CE2 . PHE B 2 181 ? -22.234 -45.290 48.530 1.00 51.76  ? 181 PHE B CE2 1 
ATOM   2882 C  CZ  . PHE B 2 181 ? -23.235 -44.682 47.777 1.00 49.28  ? 181 PHE B CZ  1 
ATOM   2883 N  N   . GLU B 2 182 ? -23.506 -45.965 55.083 1.00 49.61  ? 182 GLU B N   1 
ATOM   2884 C  CA  . GLU B 2 182 ? -23.501 -45.832 56.542 1.00 49.48  ? 182 GLU B CA  1 
ATOM   2885 C  C   . GLU B 2 182 ? -22.101 -45.863 57.112 1.00 50.86  ? 182 GLU B C   1 
ATOM   2886 O  O   . GLU B 2 182 ? -21.195 -46.475 56.552 1.00 41.85  ? 182 GLU B O   1 
ATOM   2887 C  CB  . GLU B 2 182 ? -24.220 -47.000 57.210 1.00 51.54  ? 182 GLU B CB  1 
ATOM   2888 C  CG  . GLU B 2 182 ? -25.654 -47.179 56.839 1.00 55.84  ? 182 GLU B CG  1 
ATOM   2889 C  CD  . GLU B 2 182 ? -26.364 -48.174 57.746 1.00 57.05  ? 182 GLU B CD  1 
ATOM   2890 O  OE1 . GLU B 2 182 ? -25.682 -48.937 58.475 1.00 57.22  ? 182 GLU B OE1 1 
ATOM   2891 O  OE2 . GLU B 2 182 ? -27.610 -48.187 57.720 1.00 60.64  ? 182 GLU B OE2 1 
ATOM   2892 N  N   . ASN B 2 183 ? -21.957 -45.246 58.272 1.00 50.03  ? 183 ASN B N   1 
ATOM   2893 C  CA  . ASN B 2 183 ? -20.745 -45.359 59.064 1.00 49.16  ? 183 ASN B CA  1 
ATOM   2894 C  C   . ASN B 2 183 ? -21.069 -45.002 60.508 1.00 44.83  ? 183 ASN B C   1 
ATOM   2895 O  O   . ASN B 2 183 ? -21.993 -44.237 60.767 1.00 45.34  ? 183 ASN B O   1 
ATOM   2896 C  CB  . ASN B 2 183 ? -19.660 -44.430 58.525 1.00 50.00  ? 183 ASN B CB  1 
ATOM   2897 C  CG  . ASN B 2 183 ? -18.446 -45.177 58.008 1.00 55.66  ? 183 ASN B CG  1 
ATOM   2898 O  OD1 . ASN B 2 183 ? -17.914 -46.057 58.683 1.00 57.38  ? 183 ASN B OD1 1 
ATOM   2899 N  ND2 . ASN B 2 183 ? -17.985 -44.794 56.793 1.00 61.21  ? 183 ASN B ND2 1 
ATOM   2900 N  N   . SER B 2 184 ? -20.306 -45.561 61.431 1.00 48.26  ? 184 SER B N   1 
ATOM   2901 C  CA  . SER B 2 184 ? -20.503 -45.336 62.853 1.00 50.46  ? 184 SER B CA  1 
ATOM   2902 C  C   . SER B 2 184 ? -19.204 -44.830 63.468 1.00 51.33  ? 184 SER B C   1 
ATOM   2903 O  O   . SER B 2 184 ? -18.128 -45.126 62.974 1.00 47.42  ? 184 SER B O   1 
ATOM   2904 C  CB  . SER B 2 184 ? -20.928 -46.645 63.538 1.00 52.75  ? 184 SER B CB  1 
ATOM   2905 O  OG  . SER B 2 184 ? -22.211 -47.075 63.086 1.00 56.08  ? 184 SER B OG  1 
ATOM   2906 N  N   . SER B 2 185 ? -19.310 -44.072 64.553 1.00 51.82  ? 185 SER B N   1 
ATOM   2907 C  CA  . SER B 2 185 ? -18.135 -43.621 65.288 1.00 51.73  ? 185 SER B CA  1 
ATOM   2908 C  C   . SER B 2 185 ? -17.545 -44.784 66.044 1.00 51.99  ? 185 SER B C   1 
ATOM   2909 O  O   . SER B 2 185 ? -18.211 -45.792 66.254 1.00 54.65  ? 185 SER B O   1 
ATOM   2910 C  CB  . SER B 2 185 ? -18.529 -42.547 66.298 1.00 53.42  ? 185 SER B CB  1 
ATOM   2911 O  OG  . SER B 2 185 ? -19.525 -43.041 67.179 1.00 55.95  ? 185 SER B OG  1 
ATOM   2912 N  N   . ALA B 2 186 ? -16.288 -44.642 66.448 1.00 52.21  ? 186 ALA B N   1 
ATOM   2913 C  CA  . ALA B 2 186 ? -15.715 -45.509 67.468 1.00 53.02  ? 186 ALA B CA  1 
ATOM   2914 C  C   . ALA B 2 186 ? -16.497 -45.291 68.773 1.00 52.81  ? 186 ALA B C   1 
ATOM   2915 O  O   . ALA B 2 186 ? -16.930 -44.176 69.059 1.00 55.53  ? 186 ALA B O   1 
ATOM   2916 C  CB  . ALA B 2 186 ? -14.232 -45.192 67.677 1.00 50.81  ? 186 ALA B CB  1 
ATOM   2917 N  N   . PRO B 2 187 ? -16.695 -46.359 69.561 1.00 52.38  ? 187 PRO B N   1 
ATOM   2918 C  CA  . PRO B 2 187 ? -17.454 -46.206 70.796 1.00 54.10  ? 187 PRO B CA  1 
ATOM   2919 C  C   . PRO B 2 187 ? -16.702 -45.398 71.845 1.00 53.05  ? 187 PRO B C   1 
ATOM   2920 O  O   . PRO B 2 187 ? -15.471 -45.387 71.847 1.00 54.92  ? 187 PRO B O   1 
ATOM   2921 C  CB  . PRO B 2 187 ? -17.632 -47.649 71.275 1.00 54.35  ? 187 PRO B CB  1 
ATOM   2922 C  CG  . PRO B 2 187 ? -16.470 -48.374 70.703 1.00 53.39  ? 187 PRO B CG  1 
ATOM   2923 C  CD  . PRO B 2 187 ? -16.232 -47.744 69.367 1.00 50.87  ? 187 PRO B CD  1 
ATOM   2924 N  N   . ARG B 2 188 ? -17.451 -44.734 72.721 1.00 55.17  ? 188 ARG B N   1 
ATOM   2925 C  CA  . ARG B 2 188 ? -16.890 -44.034 73.881 1.00 57.00  ? 188 ARG B CA  1 
ATOM   2926 C  C   . ARG B 2 188 ? -17.530 -44.564 75.151 1.00 55.26  ? 188 ARG B C   1 
ATOM   2927 O  O   . ARG B 2 188 ? -18.753 -44.621 75.252 1.00 50.97  ? 188 ARG B O   1 
ATOM   2928 C  CB  . ARG B 2 188 ? -17.120 -42.526 73.771 1.00 57.60  ? 188 ARG B CB  1 
ATOM   2929 C  CG  . ARG B 2 188 ? -16.251 -41.882 72.705 1.00 59.19  ? 188 ARG B CG  1 
ATOM   2930 C  CD  . ARG B 2 188 ? -16.222 -40.381 72.804 1.00 57.29  ? 188 ARG B CD  1 
ATOM   2931 N  NE  . ARG B 2 188 ? -15.406 -39.821 71.738 1.00 54.58  ? 188 ARG B NE  1 
ATOM   2932 C  CZ  . ARG B 2 188 ? -14.091 -39.649 71.788 1.00 53.78  ? 188 ARG B CZ  1 
ATOM   2933 N  NH1 . ARG B 2 188 ? -13.383 -40.000 72.850 1.00 58.00  ? 188 ARG B NH1 1 
ATOM   2934 N  NH2 . ARG B 2 188 ? -13.473 -39.116 70.751 1.00 56.59  ? 188 ARG B NH2 1 
ATOM   2935 N  N   . GLU B 2 189 ? -16.697 -44.945 76.114 1.00 57.18  ? 189 GLU B N   1 
ATOM   2936 C  CA  . GLU B 2 189 ? -17.178 -45.510 77.372 1.00 58.21  ? 189 GLU B CA  1 
ATOM   2937 C  C   . GLU B 2 189 ? -17.524 -44.418 78.377 1.00 57.19  ? 189 GLU B C   1 
ATOM   2938 O  O   . GLU B 2 189 ? -16.727 -43.511 78.618 1.00 57.89  ? 189 GLU B O   1 
ATOM   2939 C  CB  . GLU B 2 189 ? -16.128 -46.432 77.984 1.00 58.84  ? 189 GLU B CB  1 
ATOM   2940 C  CG  . GLU B 2 189 ? -16.703 -47.366 79.023 1.00 61.05  ? 189 GLU B CG  1 
ATOM   2941 C  CD  . GLU B 2 189 ? -15.640 -48.150 79.765 1.00 63.07  ? 189 GLU B CD  1 
ATOM   2942 O  OE1 . GLU B 2 189 ? -14.896 -47.536 80.559 1.00 61.76  ? 189 GLU B OE1 1 
ATOM   2943 O  OE2 . GLU B 2 189 ? -15.563 -49.382 79.562 1.00 67.46  ? 189 GLU B OE2 1 
ATOM   2944 N  N   . LEU B 2 190 ? -18.712 -44.517 78.965 1.00 54.65  ? 190 LEU B N   1 
ATOM   2945 C  CA  . LEU B 2 190 ? -19.101 -43.620 80.039 1.00 53.59  ? 190 LEU B CA  1 
ATOM   2946 C  C   . LEU B 2 190 ? -18.630 -44.215 81.364 1.00 52.97  ? 190 LEU B C   1 
ATOM   2947 O  O   . LEU B 2 190 ? -18.716 -45.420 81.582 1.00 49.53  ? 190 LEU B O   1 
ATOM   2948 C  CB  . LEU B 2 190 ? -20.616 -43.415 80.058 1.00 52.74  ? 190 LEU B CB  1 
ATOM   2949 C  CG  . LEU B 2 190 ? -21.157 -42.388 81.060 1.00 52.87  ? 190 LEU B CG  1 
ATOM   2950 C  CD1 . LEU B 2 190 ? -20.755 -40.981 80.667 1.00 51.10  ? 190 LEU B CD1 1 
ATOM   2951 C  CD2 . LEU B 2 190 ? -22.664 -42.508 81.195 1.00 51.39  ? 190 LEU B CD2 1 
ATOM   2952 N  N   . ARG B 2 191 ? -18.114 -43.353 82.228 1.00 52.69  ? 191 ARG B N   1 
ATOM   2953 C  CA  . ARG B 2 191 ? -17.743 -43.724 83.581 1.00 52.62  ? 191 ARG B CA  1 
ATOM   2954 C  C   . ARG B 2 191 ? -18.530 -42.830 84.512 1.00 49.77  ? 191 ARG B C   1 
ATOM   2955 O  O   . ARG B 2 191 ? -18.387 -41.609 84.462 1.00 51.01  ? 191 ARG B O   1 
ATOM   2956 C  CB  . ARG B 2 191 ? -16.248 -43.520 83.783 1.00 54.31  ? 191 ARG B CB  1 
ATOM   2957 C  CG  . ARG B 2 191 ? -15.416 -44.542 83.041 1.00 57.96  ? 191 ARG B CG  1 
ATOM   2958 C  CD  . ARG B 2 191 ? -14.118 -43.968 82.531 1.00 61.07  ? 191 ARG B CD  1 
ATOM   2959 N  NE  . ARG B 2 191 ? -13.018 -44.145 83.462 1.00 64.03  ? 191 ARG B NE  1 
ATOM   2960 C  CZ  . ARG B 2 191 ? -11.777 -43.715 83.240 1.00 68.61  ? 191 ARG B CZ  1 
ATOM   2961 N  NH1 . ARG B 2 191 ? -11.483 -43.069 82.111 1.00 71.12  ? 191 ARG B NH1 1 
ATOM   2962 N  NH2 . ARG B 2 191 ? -10.825 -43.927 84.150 1.00 66.65  ? 191 ARG B NH2 1 
ATOM   2963 N  N   . THR B 2 192 ? -19.383 -43.440 85.333 1.00 49.04  ? 192 THR B N   1 
ATOM   2964 C  CA  . THR B 2 192 ? -20.232 -42.707 86.259 1.00 47.25  ? 192 THR B CA  1 
ATOM   2965 C  C   . THR B 2 192 ? -19.926 -43.066 87.708 1.00 46.12  ? 192 THR B C   1 
ATOM   2966 O  O   . THR B 2 192 ? -19.401 -44.134 88.000 1.00 44.47  ? 192 THR B O   1 
ATOM   2967 C  CB  . THR B 2 192 ? -21.740 -42.949 85.973 1.00 47.05  ? 192 THR B CB  1 
ATOM   2968 O  OG1 . THR B 2 192 ? -22.091 -44.307 86.274 1.00 47.40  ? 192 THR B OG1 1 
ATOM   2969 C  CG2 . THR B 2 192 ? -22.064 -42.661 84.516 1.00 45.45  ? 192 THR B CG2 1 
ATOM   2970 N  N   . PHE B 2 193 ? -20.271 -42.146 88.602 1.00 46.78  ? 193 PHE B N   1 
ATOM   2971 C  CA  . PHE B 2 193 ? -20.062 -42.290 90.037 1.00 45.41  ? 193 PHE B CA  1 
ATOM   2972 C  C   . PHE B 2 193 ? -21.047 -41.375 90.742 1.00 46.17  ? 193 PHE B C   1 
ATOM   2973 O  O   . PHE B 2 193 ? -21.565 -40.438 90.133 1.00 48.12  ? 193 PHE B O   1 
ATOM   2974 C  CB  . PHE B 2 193 ? -18.637 -41.878 90.412 1.00 42.67  ? 193 PHE B CB  1 
ATOM   2975 C  CG  . PHE B 2 193 ? -18.401 -40.388 90.373 1.00 41.30  ? 193 PHE B CG  1 
ATOM   2976 C  CD1 . PHE B 2 193 ? -18.189 -39.739 89.171 1.00 42.53  ? 193 PHE B CD1 1 
ATOM   2977 C  CD2 . PHE B 2 193 ? -18.368 -39.642 91.543 1.00 41.49  ? 193 PHE B CD2 1 
ATOM   2978 C  CE1 . PHE B 2 193 ? -17.970 -38.372 89.131 1.00 41.77  ? 193 PHE B CE1 1 
ATOM   2979 C  CE2 . PHE B 2 193 ? -18.147 -38.275 91.507 1.00 41.68  ? 193 PHE B CE2 1 
ATOM   2980 C  CZ  . PHE B 2 193 ? -17.949 -37.644 90.292 1.00 40.98  ? 193 PHE B CZ  1 
ATOM   2981 N  N   . SER B 2 194 ? -21.296 -41.624 92.022 1.00 46.70  ? 194 SER B N   1 
ATOM   2982 C  CA  . SER B 2 194 ? -22.173 -40.755 92.781 1.00 47.90  ? 194 SER B CA  1 
ATOM   2983 C  C   . SER B 2 194 ? -21.358 -39.728 93.570 1.00 49.36  ? 194 SER B C   1 
ATOM   2984 O  O   . SER B 2 194 ? -20.444 -40.082 94.320 1.00 49.05  ? 194 SER B O   1 
ATOM   2985 C  CB  . SER B 2 194 ? -23.070 -41.570 93.706 1.00 50.26  ? 194 SER B CB  1 
ATOM   2986 O  OG  . SER B 2 194 ? -22.305 -42.231 94.687 1.00 52.53  ? 194 SER B OG  1 
ATOM   2987 N  N   . LEU B 2 195 ? -21.698 -38.454 93.374 1.00 49.27  ? 195 LEU B N   1 
ATOM   2988 C  CA  . LEU B 2 195 ? -21.133 -37.354 94.150 1.00 49.47  ? 195 LEU B CA  1 
ATOM   2989 C  C   . LEU B 2 195 ? -21.515 -37.442 95.625 1.00 49.08  ? 195 LEU B C   1 
ATOM   2990 O  O   . LEU B 2 195 ? -20.758 -37.004 96.474 1.00 44.95  ? 195 LEU B O   1 
ATOM   2991 C  CB  . LEU B 2 195 ? -21.632 -36.006 93.609 1.00 49.61  ? 195 LEU B CB  1 
ATOM   2992 C  CG  . LEU B 2 195 ? -21.134 -35.519 92.247 1.00 50.45  ? 195 LEU B CG  1 
ATOM   2993 C  CD1 . LEU B 2 195 ? -22.159 -34.575 91.624 1.00 50.64  ? 195 LEU B CD1 1 
ATOM   2994 C  CD2 . LEU B 2 195 ? -19.772 -34.837 92.367 1.00 50.39  ? 195 LEU B CD2 1 
ATOM   2995 N  N   . SER B 2 196 ? -22.695 -38.002 95.904 1.00 52.65  ? 196 SER B N   1 
ATOM   2996 C  CA  . SER B 2 196 ? -23.358 -37.936 97.219 1.00 52.33  ? 196 SER B CA  1 
ATOM   2997 C  C   . SER B 2 196 ? -23.003 -36.680 98.014 1.00 52.70  ? 196 SER B C   1 
ATOM   2998 O  O   . SER B 2 196 ? -22.981 -36.694 99.243 1.00 55.15  ? 196 SER B O   1 
ATOM   2999 C  CB  . SER B 2 196 ? -23.067 -39.197 98.045 1.00 53.41  ? 196 SER B CB  1 
ATOM   3000 O  OG  . SER B 2 196 ? -23.237 -40.369 97.263 1.00 51.95  ? 196 SER B OG  1 
HETATM 3001 C  C1  . NAG C 3 .   ? -24.409 -37.237 21.337 1.00 50.05  ? 1   NAG C C1  1 
HETATM 3002 C  C2  . NAG C 3 .   ? -23.714 -38.504 20.811 1.00 51.21  ? 1   NAG C C2  1 
HETATM 3003 C  C3  . NAG C 3 .   ? -23.958 -38.680 19.322 1.00 55.51  ? 1   NAG C C3  1 
HETATM 3004 C  C4  . NAG C 3 .   ? -25.462 -38.743 19.150 1.00 60.57  ? 1   NAG C C4  1 
HETATM 3005 C  C5  . NAG C 3 .   ? -26.001 -37.357 19.461 1.00 54.39  ? 1   NAG C C5  1 
HETATM 3006 C  C6  . NAG C 3 .   ? -27.497 -37.258 19.195 1.00 51.27  ? 1   NAG C C6  1 
HETATM 3007 C  C7  . NAG C 3 .   ? -21.718 -39.224 22.049 1.00 51.43  ? 1   NAG C C7  1 
HETATM 3008 C  C8  . NAG C 3 .   ? -20.228 -39.127 22.196 1.00 46.08  ? 1   NAG C C8  1 
HETATM 3009 N  N2  . NAG C 3 .   ? -22.278 -38.535 21.051 1.00 51.24  ? 1   NAG C N2  1 
HETATM 3010 O  O3  . NAG C 3 .   ? -23.357 -39.877 18.905 1.00 58.20  ? 1   NAG C O3  1 
HETATM 3011 O  O4  . NAG C 3 .   ? -25.900 -39.428 17.978 1.00 75.50  ? 1   NAG C O4  1 
HETATM 3012 O  O5  . NAG C 3 .   ? -25.744 -37.116 20.842 1.00 51.67  ? 1   NAG C O5  1 
HETATM 3013 O  O6  . NAG C 3 .   ? -28.270 -37.516 20.340 1.00 54.09  ? 1   NAG C O6  1 
HETATM 3014 O  O7  . NAG C 3 .   ? -22.358 -39.913 22.834 1.00 52.10  ? 1   NAG C O7  1 
HETATM 3015 C  C1  . NAG C 3 .   ? -25.867 -38.873 16.649 1.00 86.90  ? 2   NAG C C1  1 
HETATM 3016 C  C2  . NAG C 3 .   ? -26.364 -40.070 15.827 1.00 92.12  ? 2   NAG C C2  1 
HETATM 3017 C  C3  . NAG C 3 .   ? -26.955 -39.761 14.447 1.00 95.39  ? 2   NAG C C3  1 
HETATM 3018 C  C4  . NAG C 3 .   ? -27.608 -38.381 14.356 1.00 97.47  ? 2   NAG C C4  1 
HETATM 3019 C  C5  . NAG C 3 .   ? -26.790 -37.339 15.113 1.00 93.21  ? 2   NAG C C5  1 
HETATM 3020 C  C6  . NAG C 3 .   ? -27.463 -35.973 15.087 1.00 92.57  ? 2   NAG C C6  1 
HETATM 3021 C  C7  . NAG C 3 .   ? -25.259 -42.200 16.380 1.00 95.34  ? 2   NAG C C7  1 
HETATM 3022 C  C8  . NAG C 3 .   ? -24.039 -43.050 16.164 1.00 93.23  ? 2   NAG C C8  1 
HETATM 3023 N  N2  . NAG C 3 .   ? -25.297 -41.056 15.689 1.00 94.66  ? 2   NAG C N2  1 
HETATM 3024 O  O3  . NAG C 3 .   ? -27.895 -40.766 14.118 1.00 94.59  ? 2   NAG C O3  1 
HETATM 3025 O  O4  . NAG C 3 .   ? -27.724 -38.009 12.992 1.00 101.55 ? 2   NAG C O4  1 
HETATM 3026 O  O5  . NAG C 3 .   ? -26.695 -37.754 16.452 1.00 90.69  ? 2   NAG C O5  1 
HETATM 3027 O  O6  . NAG C 3 .   ? -26.681 -35.072 15.831 1.00 91.82  ? 2   NAG C O6  1 
HETATM 3028 O  O7  . NAG C 3 .   ? -26.144 -42.577 17.154 1.00 96.73  ? 2   NAG C O7  1 
HETATM 3029 MG MG  . MG  D 4 .   ? -17.168 -18.248 31.099 1.00 23.05  ? 1   MG  A MG  1 
HETATM 3030 C  C1  . NAG E 5 .   ? -8.898  -38.311 31.550 1.00 77.21  ? 199 NAG B C1  1 
HETATM 3031 C  C2  . NAG E 5 .   ? -9.675  -39.317 32.404 1.00 79.50  ? 199 NAG B C2  1 
HETATM 3032 C  C3  . NAG E 5 .   ? -9.064  -40.713 32.297 1.00 82.74  ? 199 NAG B C3  1 
HETATM 3033 C  C4  . NAG E 5 .   ? -8.811  -41.097 30.843 1.00 83.66  ? 199 NAG B C4  1 
HETATM 3034 C  C5  . NAG E 5 .   ? -8.099  -39.985 30.075 1.00 81.94  ? 199 NAG B C5  1 
HETATM 3035 C  C6  . NAG E 5 .   ? -8.001  -40.344 28.592 1.00 81.96  ? 199 NAG B C6  1 
HETATM 3036 C  C7  . NAG E 5 .   ? -10.720 -39.258 34.629 1.00 77.89  ? 199 NAG B C7  1 
HETATM 3037 C  C8  . NAG E 5 .   ? -10.729 -38.616 35.989 1.00 77.76  ? 199 NAG B C8  1 
HETATM 3038 N  N2  . NAG E 5 .   ? -9.737  -38.887 33.797 1.00 78.13  ? 199 NAG B N2  1 
HETATM 3039 O  O3  . NAG E 5 .   ? -9.938  -41.664 32.865 1.00 83.96  ? 199 NAG B O3  1 
HETATM 3040 O  O4  . NAG E 5 .   ? -8.044  -42.284 30.795 1.00 85.38  ? 199 NAG B O4  1 
HETATM 3041 O  O5  . NAG E 5 .   ? -8.808  -38.772 30.218 1.00 79.44  ? 199 NAG B O5  1 
HETATM 3042 O  O6  . NAG E 5 .   ? -7.737  -39.196 27.818 1.00 81.26  ? 199 NAG B O6  1 
HETATM 3043 O  O7  . NAG E 5 .   ? -11.590 -40.083 34.337 1.00 75.31  ? 199 NAG B O7  1 
HETATM 3044 C  C1  . NAG F 5 .   ? -31.277 -32.602 82.380 1.00 88.09  ? 200 NAG B C1  1 
HETATM 3045 C  C2  . NAG F 5 .   ? -31.927 -31.886 83.581 1.00 91.07  ? 200 NAG B C2  1 
HETATM 3046 C  C3  . NAG F 5 .   ? -33.444 -31.700 83.471 1.00 93.57  ? 200 NAG B C3  1 
HETATM 3047 C  C4  . NAG F 5 .   ? -33.870 -31.294 82.061 1.00 95.15  ? 200 NAG B C4  1 
HETATM 3048 C  C5  . NAG F 5 .   ? -33.233 -32.228 81.028 1.00 94.57  ? 200 NAG B C5  1 
HETATM 3049 C  C6  . NAG F 5 .   ? -33.606 -31.816 79.606 1.00 96.03  ? 200 NAG B C6  1 
HETATM 3050 C  C7  . NAG F 5 .   ? -30.651 -32.165 85.677 1.00 85.52  ? 200 NAG B C7  1 
HETATM 3051 C  C8  . NAG F 5 .   ? -30.286 -33.138 86.759 1.00 84.64  ? 200 NAG B C8  1 
HETATM 3052 N  N2  . NAG F 5 .   ? -31.614 -32.566 84.838 1.00 88.45  ? 200 NAG B N2  1 
HETATM 3053 O  O3  . NAG F 5 .   ? -33.848 -30.711 84.396 1.00 93.71  ? 200 NAG B O3  1 
HETATM 3054 O  O4  . NAG F 5 .   ? -35.284 -31.317 81.952 1.00 95.46  ? 200 NAG B O4  1 
HETATM 3055 O  O5  . NAG F 5 .   ? -31.823 -32.198 81.136 1.00 90.66  ? 200 NAG B O5  1 
HETATM 3056 O  O6  . NAG F 5 .   ? -33.115 -30.517 79.339 1.00 97.38  ? 200 NAG B O6  1 
HETATM 3057 O  O7  . NAG F 5 .   ? -30.075 -31.076 85.607 1.00 82.38  ? 200 NAG B O7  1 
HETATM 3058 C  C1  . NAG G 5 .   ? -18.202 -51.621 75.679 1.00 88.25  ? 201 NAG B C1  1 
HETATM 3059 C  C2  . NAG G 5 .   ? -18.691 -52.913 76.355 1.00 91.04  ? 201 NAG B C2  1 
HETATM 3060 C  C3  . NAG G 5 .   ? -17.571 -53.891 76.711 1.00 94.61  ? 201 NAG B C3  1 
HETATM 3061 C  C4  . NAG G 5 .   ? -16.537 -53.993 75.600 1.00 95.07  ? 201 NAG B C4  1 
HETATM 3062 C  C5  . NAG G 5 .   ? -16.042 -52.606 75.227 1.00 94.51  ? 201 NAG B C5  1 
HETATM 3063 C  C6  . NAG G 5 .   ? -14.965 -52.703 74.142 1.00 95.47  ? 201 NAG B C6  1 
HETATM 3064 C  C7  . NAG G 5 .   ? -20.601 -53.242 77.852 1.00 90.48  ? 201 NAG B C7  1 
HETATM 3065 C  C8  . NAG G 5 .   ? -20.533 -54.720 78.128 1.00 90.38  ? 201 NAG B C8  1 
HETATM 3066 N  N2  . NAG G 5 .   ? -19.461 -52.609 77.554 1.00 89.52  ? 201 NAG B N2  1 
HETATM 3067 O  O3  . NAG G 5 .   ? -18.114 -55.175 76.935 1.00 96.98  ? 201 NAG B O3  1 
HETATM 3068 O  O4  . NAG G 5 .   ? -15.454 -54.786 76.033 1.00 97.60  ? 201 NAG B O4  1 
HETATM 3069 O  O5  . NAG G 5 .   ? -17.146 -51.860 74.760 1.00 91.68  ? 201 NAG B O5  1 
HETATM 3070 O  O6  . NAG G 5 .   ? -15.112 -51.689 73.168 1.00 97.32  ? 201 NAG B O6  1 
HETATM 3071 O  O7  . NAG G 5 .   ? -21.688 -52.669 77.922 1.00 89.19  ? 201 NAG B O7  1 
HETATM 3072 C  C1  . NAG H 5 .   ? -16.769 -45.397 56.254 1.00 62.83  ? 202 NAG B C1  1 
HETATM 3073 C  C2  . NAG H 5 .   ? -16.948 -45.228 54.738 1.00 65.36  ? 202 NAG B C2  1 
HETATM 3074 C  C3  . NAG H 5 .   ? -15.672 -45.533 53.956 1.00 68.74  ? 202 NAG B C3  1 
HETATM 3075 C  C4  . NAG H 5 .   ? -14.516 -44.722 54.535 1.00 70.80  ? 202 NAG B C4  1 
HETATM 3076 C  C5  . NAG H 5 .   ? -14.379 -44.978 56.036 1.00 68.17  ? 202 NAG B C5  1 
HETATM 3077 C  C6  . NAG H 5 .   ? -13.320 -44.038 56.614 1.00 69.88  ? 202 NAG B C6  1 
HETATM 3078 C  C7  . NAG H 5 .   ? -19.242 -45.501 53.795 1.00 59.32  ? 202 NAG B C7  1 
HETATM 3079 C  C8  . NAG H 5 .   ? -20.210 -46.448 53.141 1.00 57.43  ? 202 NAG B C8  1 
HETATM 3080 N  N2  . NAG H 5 .   ? -18.080 -46.016 54.239 1.00 64.64  ? 202 NAG B N2  1 
HETATM 3081 O  O3  . NAG H 5 .   ? -15.861 -45.171 52.600 1.00 68.71  ? 202 NAG B O3  1 
HETATM 3082 O  O4  . NAG H 5 .   ? -13.296 -44.997 53.854 1.00 73.48  ? 202 NAG B O4  1 
HETATM 3083 O  O5  . NAG H 5 .   ? -15.596 -44.736 56.707 1.00 62.27  ? 202 NAG B O5  1 
HETATM 3084 O  O6  . NAG H 5 .   ? -13.299 -44.127 58.023 1.00 71.62  ? 202 NAG B O6  1 
HETATM 3085 O  O7  . NAG H 5 .   ? -19.551 -44.322 53.899 1.00 53.56  ? 202 NAG B O7  1 
HETATM 3086 C  C1  . GOL I 6 .   ? -34.769 -34.797 33.466 1.00 55.03  ? 203 GOL B C1  1 
HETATM 3087 O  O1  . GOL I 6 .   ? -34.583 -34.498 32.103 1.00 53.59  ? 203 GOL B O1  1 
HETATM 3088 C  C2  . GOL I 6 .   ? -35.657 -33.745 34.128 1.00 56.01  ? 203 GOL B C2  1 
HETATM 3089 O  O2  . GOL I 6 .   ? -35.396 -32.471 33.592 1.00 54.68  ? 203 GOL B O2  1 
HETATM 3090 C  C3  . GOL I 6 .   ? -35.411 -33.705 35.628 1.00 59.95  ? 203 GOL B C3  1 
HETATM 3091 O  O3  . GOL I 6 .   ? -35.888 -32.490 36.165 1.00 62.58  ? 203 GOL B O3  1 
HETATM 3092 C  C1  . GOL J 6 .   ? -27.672 -28.108 60.866 1.00 77.38  ? 204 GOL B C1  1 
HETATM 3093 O  O1  . GOL J 6 .   ? -28.840 -28.848 61.162 1.00 78.20  ? 204 GOL B O1  1 
HETATM 3094 C  C2  . GOL J 6 .   ? -26.425 -28.999 60.858 1.00 74.36  ? 204 GOL B C2  1 
HETATM 3095 O  O2  . GOL J 6 .   ? -26.605 -30.095 61.721 1.00 69.73  ? 204 GOL B O2  1 
HETATM 3096 C  C3  . GOL J 6 .   ? -25.192 -28.205 61.293 1.00 74.35  ? 204 GOL B C3  1 
HETATM 3097 O  O3  . GOL J 6 .   ? -24.042 -28.683 60.631 1.00 74.86  ? 204 GOL B O3  1 
HETATM 3098 O  O   . HOH K 7 .   ? -16.287 -19.295 29.512 1.00 32.05  ? 308 HOH A O   1 
HETATM 3099 O  O   . HOH K 7 .   ? -15.583 -17.095 31.184 1.00 33.17  ? 309 HOH A O   1 
HETATM 3100 O  O   . HOH K 7 .   ? -26.077 -7.984  39.215 1.00 38.88  ? 310 HOH A O   1 
HETATM 3101 O  O   . HOH K 7 .   ? -25.949 -12.472 31.739 1.00 28.98  ? 311 HOH A O   1 
HETATM 3102 O  O   . HOH K 7 .   ? -22.280 -16.893 23.282 1.00 49.01  ? 312 HOH A O   1 
HETATM 3103 O  O   . HOH K 7 .   ? -25.525 -15.246 23.716 1.00 36.46  ? 313 HOH A O   1 
HETATM 3104 O  O   . HOH K 7 .   ? -24.113 -3.123  43.465 1.00 34.79  ? 314 HOH A O   1 
HETATM 3105 O  O   . HOH K 7 .   ? -24.245 -13.810 43.808 1.00 46.08  ? 315 HOH A O   1 
HETATM 3106 O  O   . HOH K 7 .   ? -28.797 10.862  48.674 1.00 39.94  ? 316 HOH A O   1 
HETATM 3107 O  O   . HOH K 7 .   ? -20.178 -21.289 38.509 1.00 36.60  ? 317 HOH A O   1 
HETATM 3108 O  O   . HOH K 7 .   ? 3.139   -25.632 33.592 1.00 63.79  ? 318 HOH A O   1 
HETATM 3109 O  O   . HOH K 7 .   ? -28.205 -7.594  31.652 1.00 38.18  ? 319 HOH A O   1 
HETATM 3110 O  O   . HOH K 7 .   ? -13.421 -14.119 28.136 1.00 37.54  ? 320 HOH A O   1 
HETATM 3111 O  O   . HOH K 7 .   ? -25.871 -10.285 24.462 1.00 51.01  ? 321 HOH A O   1 
HETATM 3112 O  O   . HOH K 7 .   ? -28.515 -14.430 35.423 1.00 44.84  ? 322 HOH A O   1 
HETATM 3113 O  O   . HOH K 7 .   ? -25.431 -3.299  41.216 1.00 43.24  ? 323 HOH A O   1 
HETATM 3114 O  O   . HOH K 7 .   ? -16.418 -23.802 30.347 1.00 37.90  ? 324 HOH A O   1 
HETATM 3115 O  O   . HOH K 7 .   ? -19.322 -8.455  48.155 1.00 60.68  ? 325 HOH A O   1 
HETATM 3116 O  O   . HOH K 7 .   ? -12.899 15.433  38.443 1.00 65.07  ? 326 HOH A O   1 
HETATM 3117 O  O   . HOH K 7 .   ? -27.298 -9.867  37.908 1.00 43.44  ? 327 HOH A O   1 
HETATM 3118 O  O   . HOH K 7 .   ? -10.561 15.921  39.597 1.00 73.78  ? 328 HOH A O   1 
HETATM 3119 O  O   . HOH K 7 .   ? -21.700 -8.527  46.571 1.00 59.17  ? 329 HOH A O   1 
HETATM 3120 O  O   . HOH K 7 .   ? -26.668 -15.672 41.200 1.00 50.43  ? 330 HOH A O   1 
HETATM 3121 O  O   . HOH K 7 .   ? -11.871 -6.295  50.150 1.00 69.04  ? 331 HOH A O   1 
HETATM 3122 O  O   . HOH K 7 .   ? -2.850  -1.048  22.014 1.00 67.35  ? 332 HOH A O   1 
HETATM 3123 O  O   . HOH K 7 .   ? -21.717 -10.901 21.367 1.00 55.70  ? 333 HOH A O   1 
HETATM 3124 O  O   . HOH K 7 .   ? -11.964 -20.530 34.684 1.00 42.81  ? 334 HOH A O   1 
HETATM 3125 O  O   . HOH K 7 .   ? -28.456 7.093   44.368 1.00 54.09  ? 335 HOH A O   1 
HETATM 3126 O  O   . HOH K 7 .   ? -13.106 -21.741 37.103 1.00 44.90  ? 336 HOH A O   1 
HETATM 3127 O  O   . HOH K 7 .   ? -17.548 -7.006  17.115 1.00 62.33  ? 337 HOH A O   1 
HETATM 3128 O  O   . HOH K 7 .   ? -28.278 -2.956  40.555 1.00 49.42  ? 338 HOH A O   1 
HETATM 3129 O  O   . HOH K 7 .   ? -25.931 3.837   28.483 1.00 61.21  ? 339 HOH A O   1 
HETATM 3130 O  O   . HOH K 7 .   ? -7.172  -8.634  46.060 1.00 61.19  ? 340 HOH A O   1 
HETATM 3131 O  O   . HOH K 7 .   ? -6.595  -18.152 38.976 1.00 60.35  ? 341 HOH A O   1 
HETATM 3132 O  O   . HOH K 7 .   ? -8.902  7.908   26.404 1.00 55.76  ? 342 HOH A O   1 
HETATM 3133 O  O   . HOH K 7 .   ? 1.860   -7.721  33.601 1.00 64.50  ? 343 HOH A O   1 
HETATM 3134 O  O   . HOH K 7 .   ? -10.992 8.156   43.545 1.00 55.63  ? 344 HOH A O   1 
HETATM 3135 O  O   . HOH K 7 .   ? -10.521 -5.534  13.080 1.00 73.20  ? 345 HOH A O   1 
HETATM 3136 O  O   . HOH K 7 .   ? -19.089 -7.939  19.347 1.00 57.18  ? 346 HOH A O   1 
HETATM 3137 O  O   . HOH K 7 .   ? -27.172 1.203   28.209 1.00 57.04  ? 347 HOH A O   1 
HETATM 3138 O  O   . HOH K 7 .   ? -22.751 -17.446 21.091 1.00 57.20  ? 348 HOH A O   1 
HETATM 3139 O  O   . HOH K 7 .   ? -21.992 -4.832  22.244 1.00 53.64  ? 349 HOH A O   1 
HETATM 3140 O  O   . HOH K 7 .   ? -24.805 1.283   31.184 1.00 49.40  ? 350 HOH A O   1 
HETATM 3141 O  O   . HOH K 7 .   ? -21.209 5.243   51.646 1.00 60.46  ? 351 HOH A O   1 
HETATM 3142 O  O   . HOH K 7 .   ? -26.897 5.147   24.539 1.00 66.46  ? 352 HOH A O   1 
HETATM 3143 O  O   . HOH K 7 .   ? -15.443 -20.878 23.720 1.00 59.87  ? 353 HOH A O   1 
HETATM 3144 O  O   . HOH K 7 .   ? -17.722 -20.815 21.041 1.00 65.17  ? 354 HOH A O   1 
HETATM 3145 O  O   . HOH K 7 .   ? -5.137  4.056   18.142 1.00 72.97  ? 355 HOH A O   1 
HETATM 3146 O  O   . HOH K 7 .   ? -20.299 -5.719  48.678 1.00 55.43  ? 356 HOH A O   1 
HETATM 3147 O  O   . HOH K 7 .   ? -22.325 -1.973  21.552 1.00 65.60  ? 357 HOH A O   1 
HETATM 3148 O  O   . HOH K 7 .   ? -22.549 11.315  42.214 1.00 53.07  ? 358 HOH A O   1 
HETATM 3149 O  O   . HOH K 7 .   ? -19.867 -13.333 45.815 1.00 66.78  ? 359 HOH A O   1 
HETATM 3150 O  O   . HOH K 7 .   ? 3.730   -8.801  24.507 1.00 61.83  ? 360 HOH A O   1 
HETATM 3151 O  O   . HOH K 7 .   ? -20.773 -6.110  19.770 1.00 53.63  ? 361 HOH A O   1 
HETATM 3152 O  O   . HOH K 7 .   ? -22.371 -6.361  50.454 1.00 68.40  ? 362 HOH A O   1 
HETATM 3153 O  O   . HOH K 7 .   ? -27.910 4.986   22.095 1.00 61.45  ? 363 HOH A O   1 
HETATM 3154 O  O   . HOH K 7 .   ? -26.397 2.576   33.113 1.00 55.52  ? 364 HOH A O   1 
HETATM 3155 O  O   . HOH K 7 .   ? -24.117 -7.972  49.329 1.00 63.99  ? 365 HOH A O   1 
HETATM 3156 O  O   . HOH K 7 .   ? -13.992 -16.318 20.273 1.00 62.64  ? 366 HOH A O   1 
HETATM 3157 O  O   . HOH K 7 .   ? -14.028 17.361  34.586 1.00 73.12  ? 367 HOH A O   1 
HETATM 3158 O  O   . HOH K 7 .   ? -15.969 10.021  36.139 1.00 58.17  ? 368 HOH A O   1 
HETATM 3159 O  O   . HOH K 7 .   ? -10.735 -22.747 38.617 1.00 45.71  ? 369 HOH A O   1 
HETATM 3160 O  O   . HOH K 7 .   ? -28.298 11.594  44.790 1.00 52.78  ? 370 HOH A O   1 
HETATM 3161 O  O   . HOH K 7 .   ? -9.382  -20.552 41.790 1.00 64.32  ? 371 HOH A O   1 
HETATM 3162 O  O   . HOH K 7 .   ? -7.262  5.996   27.286 1.00 63.40  ? 372 HOH A O   1 
HETATM 3163 O  O   . HOH K 7 .   ? -27.747 -3.634  30.771 1.00 47.48  ? 373 HOH A O   1 
HETATM 3164 O  O   . HOH K 7 .   ? -29.155 0.601   24.887 1.00 60.74  ? 374 HOH A O   1 
HETATM 3165 O  O   . HOH K 7 .   ? -15.539 -2.999  17.585 1.00 63.94  ? 375 HOH A O   1 
HETATM 3166 O  O   . HOH K 7 .   ? -10.025 -25.263 29.886 1.00 59.52  ? 376 HOH A O   1 
HETATM 3167 O  O   . HOH K 7 .   ? -21.229 11.372  26.467 1.00 59.26  ? 377 HOH A O   1 
HETATM 3168 O  O   . HOH K 7 .   ? -6.841  -16.565 46.511 1.00 68.98  ? 378 HOH A O   1 
HETATM 3169 O  O   . HOH K 7 .   ? -11.626 -17.688 23.772 1.00 57.56  ? 379 HOH A O   1 
HETATM 3170 O  O   . HOH K 7 .   ? -6.149  -23.995 23.389 1.00 65.89  ? 380 HOH A O   1 
HETATM 3171 O  O   . HOH K 7 .   ? -16.349 -18.615 20.209 1.00 70.67  ? 381 HOH A O   1 
HETATM 3172 O  O   . HOH K 7 .   ? -10.716 -20.116 24.947 1.00 56.61  ? 382 HOH A O   1 
HETATM 3173 O  O   . HOH K 7 .   ? -20.257 -16.227 44.428 1.00 54.70  ? 383 HOH A O   1 
HETATM 3174 O  O   . HOH K 7 .   ? -13.251 11.887  42.209 1.00 66.82  ? 384 HOH A O   1 
HETATM 3175 O  O   . HOH K 7 .   ? -16.035 4.208   20.962 1.00 61.98  ? 385 HOH A O   1 
HETATM 3176 O  O   . HOH K 7 .   ? -0.467  -5.373  34.258 1.00 70.29  ? 386 HOH A O   1 
HETATM 3177 O  O   . HOH K 7 .   ? -23.631 -8.504  22.572 1.00 64.76  ? 387 HOH A O   1 
HETATM 3178 O  O   . HOH K 7 .   ? -4.314  -20.152 40.662 1.00 61.13  ? 388 HOH A O   1 
HETATM 3179 O  O   . HOH K 7 .   ? 0.213   -24.604 37.297 1.00 72.97  ? 389 HOH A O   1 
HETATM 3180 O  O   . HOH K 7 .   ? -12.360 -13.791 48.544 1.00 67.48  ? 390 HOH A O   1 
HETATM 3181 O  O   . HOH K 7 .   ? -3.609  -26.632 44.029 1.00 69.54  ? 391 HOH A O   1 
HETATM 3182 O  O   . HOH K 7 .   ? -27.901 -0.731  35.701 1.00 54.78  ? 392 HOH A O   1 
HETATM 3183 O  O   . HOH K 7 .   ? -29.223 -4.577  49.348 1.00 81.66  ? 393 HOH A O   1 
HETATM 3184 O  O   . HOH K 7 .   ? -27.755 -6.236  39.801 1.00 60.68  ? 394 HOH A O   1 
HETATM 3185 O  O   . HOH K 7 .   ? -30.043 -0.976  38.353 1.00 62.20  ? 395 HOH A O   1 
HETATM 3186 O  O   . HOH K 7 .   ? -14.495 9.309   29.753 1.00 58.49  ? 396 HOH A O   1 
HETATM 3187 O  O   . HOH K 7 .   ? -25.017 9.759   35.941 1.00 59.59  ? 397 HOH A O   1 
HETATM 3188 O  O   . HOH K 7 .   ? -0.927  -26.962 30.292 1.00 72.18  ? 398 HOH A O   1 
HETATM 3189 O  O   . HOH K 7 .   ? -23.174 -2.383  52.584 1.00 73.46  ? 399 HOH A O   1 
HETATM 3190 O  O   . HOH K 7 .   ? -16.571 10.339  28.014 1.00 60.29  ? 400 HOH A O   1 
HETATM 3191 O  O   . HOH K 7 .   ? -28.730 -6.987  48.168 1.00 71.60  ? 401 HOH A O   1 
HETATM 3192 O  O   . HOH K 7 .   ? -9.969  -27.192 31.802 1.00 65.88  ? 402 HOH A O   1 
HETATM 3193 O  O   . HOH K 7 .   ? -26.872 1.265   25.842 1.00 70.09  ? 403 HOH A O   1 
HETATM 3194 O  O   . HOH K 7 .   ? -23.309 11.315  25.300 1.00 79.14  ? 404 HOH A O   1 
HETATM 3195 O  O   . HOH K 7 .   ? -29.351 -7.866  33.732 1.00 57.46  ? 405 HOH A O   1 
HETATM 3196 O  O   . HOH K 7 .   ? -29.834 12.994  42.641 1.00 48.22  ? 406 HOH A O   1 
HETATM 3197 O  O   . HOH K 7 .   ? -28.603 -12.189 31.291 1.00 46.99  ? 407 HOH A O   1 
HETATM 3198 O  O   . HOH K 7 .   ? -29.458 -13.238 29.352 1.00 44.16  ? 408 HOH A O   1 
HETATM 3199 O  O   . HOH K 7 .   ? -28.622 -12.593 37.962 1.00 63.65  ? 409 HOH A O   1 
HETATM 3200 O  O   . HOH L 7 .   ? -23.514 -48.977 49.722 1.00 57.33  ? 205 HOH B O   1 
HETATM 3201 O  O   . HOH L 7 .   ? -28.076 -34.112 23.762 1.00 39.15  ? 206 HOH B O   1 
HETATM 3202 O  O   . HOH L 7 .   ? -28.300 -42.974 61.600 1.00 33.94  ? 207 HOH B O   1 
HETATM 3203 O  O   . HOH L 7 .   ? -19.443 -29.956 57.076 1.00 55.70  ? 208 HOH B O   1 
HETATM 3204 O  O   . HOH L 7 .   ? -20.334 -40.550 32.350 1.00 54.33  ? 209 HOH B O   1 
HETATM 3205 O  O   . HOH L 7 .   ? -23.975 -34.173 14.004 1.00 51.45  ? 210 HOH B O   1 
HETATM 3206 O  O   . HOH L 7 .   ? -16.056 -56.875 78.288 1.00 64.04  ? 211 HOH B O   1 
HETATM 3207 O  O   . HOH L 7 .   ? -21.472 -30.351 41.266 1.00 39.93  ? 212 HOH B O   1 
HETATM 3208 O  O   . HOH L 7 .   ? -17.930 -39.993 48.917 1.00 42.78  ? 213 HOH B O   1 
HETATM 3209 O  O   . HOH L 7 .   ? -20.086 -29.692 17.667 1.00 47.18  ? 214 HOH B O   1 
HETATM 3210 O  O   . HOH L 7 .   ? -35.850 -28.210 35.163 1.00 45.46  ? 215 HOH B O   1 
HETATM 3211 O  O   . HOH L 7 .   ? -27.565 -17.332 28.139 1.00 34.97  ? 216 HOH B O   1 
HETATM 3212 O  O   . HOH L 7 .   ? -28.736 -31.183 67.415 1.00 52.09  ? 217 HOH B O   1 
HETATM 3213 O  O   . HOH L 7 .   ? -20.218 -36.539 72.958 1.00 43.76  ? 218 HOH B O   1 
HETATM 3214 O  O   . HOH L 7 .   ? -22.866 -48.405 53.942 1.00 42.32  ? 219 HOH B O   1 
HETATM 3215 O  O   . HOH L 7 .   ? -17.173 -40.705 33.254 1.00 49.86  ? 220 HOH B O   1 
HETATM 3216 O  O   . HOH L 7 .   ? -18.407 -37.373 57.111 1.00 40.72  ? 221 HOH B O   1 
HETATM 3217 O  O   . HOH L 7 .   ? -32.660 -21.692 24.053 1.00 47.84  ? 222 HOH B O   1 
HETATM 3218 O  O   . HOH L 7 .   ? -19.951 -41.030 40.847 1.00 43.64  ? 223 HOH B O   1 
HETATM 3219 O  O   . HOH L 7 .   ? -32.373 -16.684 13.280 1.00 54.38  ? 224 HOH B O   1 
HETATM 3220 O  O   . HOH L 7 .   ? -23.369 -26.771 53.976 1.00 49.54  ? 225 HOH B O   1 
HETATM 3221 O  O   . HOH L 7 .   ? -22.644 -38.177 14.605 1.00 55.78  ? 226 HOH B O   1 
HETATM 3222 O  O   . HOH L 7 .   ? -28.673 -12.253 9.507  1.00 66.74  ? 227 HOH B O   1 
HETATM 3223 O  O   . HOH L 7 .   ? -16.549 -24.931 22.318 1.00 48.04  ? 228 HOH B O   1 
HETATM 3224 O  O   . HOH L 7 .   ? -14.978 -42.041 65.378 1.00 46.24  ? 229 HOH B O   1 
HETATM 3225 O  O   . HOH L 7 .   ? -31.063 -40.948 55.875 1.00 43.54  ? 230 HOH B O   1 
HETATM 3226 O  O   . HOH L 7 .   ? -16.996 -24.995 25.188 1.00 49.50  ? 231 HOH B O   1 
HETATM 3227 O  O   . HOH L 7 .   ? -16.957 -27.583 29.075 1.00 45.45  ? 232 HOH B O   1 
HETATM 3228 O  O   . HOH L 7 .   ? -16.777 -41.004 38.333 1.00 55.06  ? 233 HOH B O   1 
HETATM 3229 O  O   . HOH L 7 .   ? -16.588 -29.278 48.199 1.00 61.56  ? 234 HOH B O   1 
HETATM 3230 O  O   . HOH L 7 .   ? -12.713 -36.888 38.556 1.00 43.78  ? 235 HOH B O   1 
HETATM 3231 O  O   . HOH L 7 .   ? -21.000 -29.521 59.425 1.00 61.94  ? 236 HOH B O   1 
HETATM 3232 O  O   . HOH L 7 .   ? -31.431 -43.742 56.527 1.00 44.37  ? 237 HOH B O   1 
HETATM 3233 O  O   . HOH L 7 .   ? -36.403 -36.691 62.613 1.00 56.47  ? 238 HOH B O   1 
HETATM 3234 O  O   . HOH L 7 .   ? -38.231 -26.237 21.491 1.00 63.55  ? 239 HOH B O   1 
HETATM 3235 O  O   . HOH L 7 .   ? -13.170 -28.439 21.795 1.00 56.71  ? 240 HOH B O   1 
HETATM 3236 O  O   . HOH L 7 .   ? -13.479 -29.583 38.099 1.00 45.82  ? 241 HOH B O   1 
HETATM 3237 O  O   . HOH L 7 .   ? -26.787 -21.115 11.552 1.00 59.92  ? 242 HOH B O   1 
HETATM 3238 O  O   . HOH L 7 .   ? -21.086 -25.308 35.796 1.00 48.97  ? 243 HOH B O   1 
HETATM 3239 O  O   . HOH L 7 .   ? -29.760 -31.535 51.374 1.00 45.85  ? 244 HOH B O   1 
HETATM 3240 O  O   . HOH L 7 .   ? -24.825 -38.483 27.664 1.00 60.92  ? 245 HOH B O   1 
HETATM 3241 O  O   . HOH L 7 .   ? -28.639 -28.738 44.398 1.00 49.44  ? 246 HOH B O   1 
HETATM 3242 O  O   . HOH L 7 .   ? -22.263 -48.324 60.544 1.00 48.61  ? 247 HOH B O   1 
HETATM 3243 O  O   . HOH L 7 .   ? -21.188 -32.950 48.021 1.00 54.61  ? 248 HOH B O   1 
HETATM 3244 O  O   . HOH L 7 .   ? -17.555 -24.380 17.960 1.00 56.33  ? 249 HOH B O   1 
HETATM 3245 O  O   . HOH L 7 .   ? -19.639 -48.755 60.138 1.00 57.16  ? 250 HOH B O   1 
HETATM 3246 O  O   . HOH L 7 .   ? -21.639 -35.107 12.601 1.00 57.22  ? 251 HOH B O   1 
HETATM 3247 O  O   . HOH L 7 .   ? -28.196 -38.982 35.588 1.00 54.37  ? 252 HOH B O   1 
HETATM 3248 O  O   . HOH L 7 .   ? -30.835 -26.606 35.857 1.00 58.59  ? 253 HOH B O   1 
HETATM 3249 O  O   . HOH L 7 .   ? -14.727 -40.183 75.979 1.00 53.20  ? 254 HOH B O   1 
HETATM 3250 O  O   . HOH L 7 .   ? -17.865 -21.515 27.781 1.00 48.77  ? 255 HOH B O   1 
HETATM 3251 O  O   . HOH L 7 .   ? -23.618 -12.961 20.075 1.00 59.52  ? 256 HOH B O   1 
HETATM 3252 O  O   . HOH L 7 .   ? -29.148 -44.136 88.636 1.00 58.71  ? 257 HOH B O   1 
HETATM 3253 O  O   . HOH L 7 .   ? -31.393 -32.632 49.145 1.00 48.96  ? 258 HOH B O   1 
HETATM 3254 O  O   . HOH L 7 .   ? -13.398 -37.135 48.096 1.00 75.41  ? 259 HOH B O   1 
HETATM 3255 O  O   . HOH L 7 .   ? -22.885 -25.534 45.072 1.00 61.15  ? 260 HOH B O   1 
HETATM 3256 O  O   . HOH L 7 .   ? -28.297 -18.303 36.128 1.00 52.78  ? 261 HOH B O   1 
HETATM 3257 O  O   . HOH L 7 .   ? -11.930 -30.488 47.568 1.00 75.74  ? 262 HOH B O   1 
HETATM 3258 O  O   . HOH L 7 .   ? -20.456 -40.598 36.382 1.00 51.79  ? 263 HOH B O   1 
HETATM 3259 O  O   . HOH L 7 .   ? -14.715 -42.756 29.717 1.00 62.55  ? 264 HOH B O   1 
HETATM 3260 O  O   . HOH L 7 .   ? -11.389 -43.042 59.664 1.00 71.39  ? 265 HOH B O   1 
HETATM 3261 O  O   . HOH L 7 .   ? -24.013 -49.976 59.835 1.00 61.38  ? 266 HOH B O   1 
HETATM 3262 O  O   . HOH L 7 .   ? -16.706 -41.239 80.895 1.00 59.88  ? 267 HOH B O   1 
HETATM 3263 O  O   . HOH L 7 .   ? -31.825 -33.953 74.362 1.00 65.91  ? 268 HOH B O   1 
HETATM 3264 O  O   . HOH L 7 .   ? -27.180 -39.925 38.282 1.00 51.90  ? 269 HOH B O   1 
HETATM 3265 O  O   . HOH L 7 .   ? -15.354 -40.734 67.661 1.00 59.73  ? 270 HOH B O   1 
HETATM 3266 O  O   . HOH L 7 .   ? -13.336 -38.554 67.289 1.00 69.91  ? 271 HOH B O   1 
HETATM 3267 O  O   . HOH L 7 .   ? -23.813 -45.627 44.269 1.00 57.56  ? 272 HOH B O   1 
HETATM 3268 O  O   . HOH L 7 .   ? -24.184 -48.068 64.806 1.00 54.43  ? 273 HOH B O   1 
HETATM 3269 O  O   . HOH L 7 .   ? -26.827 -30.424 45.691 1.00 49.16  ? 274 HOH B O   1 
HETATM 3270 O  O   . HOH L 7 .   ? -15.978 -38.527 47.770 1.00 58.44  ? 275 HOH B O   1 
HETATM 3271 O  O   . HOH L 7 .   ? -13.776 -44.833 75.387 1.00 59.55  ? 276 HOH B O   1 
HETATM 3272 O  O   . HOH L 7 .   ? -23.126 -47.856 71.060 1.00 48.32  ? 277 HOH B O   1 
HETATM 3273 O  O   . HOH L 7 .   ? -26.352 -24.347 56.137 1.00 70.13  ? 278 HOH B O   1 
HETATM 3274 O  O   . HOH L 7 .   ? -6.891  -44.101 29.087 1.00 73.30  ? 279 HOH B O   1 
HETATM 3275 O  O   . HOH L 7 .   ? -22.862 -50.201 76.106 1.00 58.68  ? 280 HOH B O   1 
HETATM 3276 O  O   . HOH L 7 .   ? -11.559 -38.898 55.819 1.00 64.43  ? 281 HOH B O   1 
HETATM 3277 O  O   . HOH L 7 .   ? -22.654 -40.151 16.374 1.00 62.72  ? 282 HOH B O   1 
HETATM 3278 O  O   . HOH L 7 .   ? -30.575 -24.914 57.307 1.00 71.20  ? 283 HOH B O   1 
HETATM 3279 O  O   . HOH L 7 .   ? -29.537 -25.159 48.639 1.00 65.35  ? 284 HOH B O   1 
HETATM 3280 O  O   . HOH L 7 .   ? -35.486 -28.044 32.550 1.00 68.81  ? 285 HOH B O   1 
HETATM 3281 O  O   . HOH L 7 .   ? -15.267 -26.866 31.103 1.00 53.30  ? 286 HOH B O   1 
HETATM 3282 O  O   . HOH L 7 .   ? -20.030 -34.663 77.094 1.00 58.51  ? 287 HOH B O   1 
HETATM 3283 O  O   . HOH L 7 .   ? -19.301 -30.601 48.905 1.00 68.59  ? 288 HOH B O   1 
HETATM 3284 O  O   . HOH L 7 .   ? -27.474 -36.440 23.383 1.00 53.63  ? 289 HOH B O   1 
HETATM 3285 O  O   . HOH L 7 .   ? -31.963 -34.429 42.243 1.00 57.86  ? 290 HOH B O   1 
HETATM 3286 O  O   . HOH L 7 .   ? -25.999 -12.342 20.842 1.00 59.45  ? 291 HOH B O   1 
HETATM 3287 O  O   . HOH L 7 .   ? -8.988  -31.063 43.157 1.00 76.30  ? 292 HOH B O   1 
HETATM 3288 O  O   . HOH L 7 .   ? -27.028 -21.959 38.488 1.00 54.97  ? 293 HOH B O   1 
HETATM 3289 O  O   . HOH L 7 .   ? -26.738 -9.465  20.567 1.00 49.38  ? 294 HOH B O   1 
HETATM 3290 O  O   . HOH L 7 .   ? -24.684 -22.870 39.371 1.00 57.22  ? 295 HOH B O   1 
HETATM 3291 O  O   . HOH L 7 .   ? -16.904 -22.491 44.777 1.00 66.75  ? 296 HOH B O   1 
HETATM 3292 O  O   . HOH L 7 .   ? -31.745 -35.142 49.344 1.00 52.86  ? 297 HOH B O   1 
HETATM 3293 O  O   . HOH L 7 .   ? -20.076 -13.327 17.988 1.00 63.96  ? 298 HOH B O   1 
HETATM 3294 O  O   . HOH L 7 .   ? -21.808 -52.270 74.246 1.00 63.54  ? 299 HOH B O   1 
HETATM 3295 O  O   . HOH L 7 .   ? -23.232 -39.519 31.091 1.00 50.38  ? 300 HOH B O   1 
HETATM 3296 O  O   . HOH L 7 .   ? -11.586 -28.961 41.562 1.00 72.32  ? 301 HOH B O   1 
HETATM 3297 O  O   . HOH L 7 .   ? -33.417 -28.606 37.768 1.00 70.93  ? 302 HOH B O   1 
HETATM 3298 O  O   . HOH L 7 .   ? -29.872 -33.588 15.852 1.00 64.58  ? 303 HOH B O   1 
HETATM 3299 O  O   . HOH L 7 .   ? -13.580 -37.094 52.079 1.00 69.42  ? 304 HOH B O   1 
HETATM 3300 O  O   . HOH L 7 .   ? -31.624 -23.709 48.002 1.00 65.99  ? 305 HOH B O   1 
HETATM 3301 O  O   . HOH L 7 .   ? -13.639 -24.662 24.935 1.00 71.15  ? 306 HOH B O   1 
HETATM 3302 O  O   . HOH L 7 .   ? -15.572 -29.100 41.169 1.00 58.49  ? 307 HOH B O   1 
HETATM 3303 O  O   . HOH L 7 .   ? -26.217 -38.570 24.939 1.00 63.09  ? 308 HOH B O   1 
HETATM 3304 O  O   . HOH L 7 .   ? -33.316 -30.374 60.028 1.00 70.29  ? 309 HOH B O   1 
HETATM 3305 O  O   . HOH L 7 .   ? -25.629 -24.314 41.390 1.00 68.71  ? 310 HOH B O   1 
HETATM 3306 O  O   . HOH L 7 .   ? -15.175 -40.205 51.305 1.00 71.86  ? 311 HOH B O   1 
HETATM 3307 O  O   . HOH L 7 .   ? -29.916 -18.150 24.361 1.00 63.22  ? 312 HOH B O   1 
HETATM 3308 O  O   . HOH L 7 .   ? -29.206 -15.225 23.832 1.00 53.64  ? 313 HOH B O   1 
HETATM 3309 O  O   . HOH L 7 .   ? -26.992 -13.895 23.191 1.00 48.87  ? 314 HOH B O   1 
HETATM 3310 O  O   . HOH L 7 .   ? -10.851 -45.963 54.257 1.00 61.69  ? 315 HOH B O   1 
HETATM 3311 O  O   . HOH L 7 .   ? -10.956 -31.508 25.775 1.00 59.16  ? 316 HOH B O   1 
HETATM 3312 O  O   . HOH L 7 .   ? -19.877 -31.100 60.965 1.00 68.58  ? 317 HOH B O   1 
HETATM 3313 O  O   . HOH L 7 .   ? -31.268 -51.451 50.699 1.00 39.11  ? 318 HOH B O   1 
HETATM 3314 O  O   . HOH L 7 .   ? -31.779 -36.711 30.925 1.00 61.84  ? 319 HOH B O   1 
HETATM 3315 O  O   . HOH L 7 .   ? -17.215 -22.623 25.706 1.00 53.54  ? 320 HOH B O   1 
HETATM 3316 O  O   . HOH L 7 .   ? -20.498 -37.185 13.329 1.00 60.90  ? 321 HOH B O   1 
HETATM 3317 O  O   . HOH L 7 .   ? -11.145 -35.973 42.101 1.00 65.54  ? 322 HOH B O   1 
HETATM 3318 O  O   . HOH L 7 .   ? -29.983 -15.996 28.663 1.00 46.95  ? 323 HOH B O   1 
HETATM 3319 O  O   . HOH L 7 .   ? -30.394 -17.479 35.048 1.00 63.36  ? 324 HOH B O   1 
HETATM 3320 O  O   . HOH L 7 .   ? -33.372 -37.438 55.639 1.00 52.20  ? 325 HOH B O   1 
HETATM 3321 O  O   . HOH L 7 .   ? -33.207 -39.978 54.706 1.00 49.49  ? 326 HOH B O   1 
HETATM 3322 O  O   . HOH L 7 .   ? -33.608 -43.967 55.386 1.00 59.60  ? 327 HOH B O   1 
HETATM 3323 O  O   . HOH L 7 .   ? -29.636 -49.786 65.252 1.00 62.51  ? 328 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   128 128 MET MET A . n 
A 1 2   ASN 2   129 129 ASN ASN A . n 
A 1 3   VAL 3   130 130 VAL VAL A . n 
A 1 4   ASP 4   131 131 ASP ASP A . n 
A 1 5   LEU 5   132 132 LEU LEU A . n 
A 1 6   VAL 6   133 133 VAL VAL A . n 
A 1 7   PHE 7   134 134 PHE PHE A . n 
A 1 8   LEU 8   135 135 LEU LEU A . n 
A 1 9   PHE 9   136 136 PHE PHE A . n 
A 1 10  ASP 10  137 137 ASP ASP A . n 
A 1 11  GLY 11  138 138 GLY GLY A . n 
A 1 12  SER 12  139 139 SER SER A . n 
A 1 13  MET 13  140 140 MET MET A . n 
A 1 14  SER 14  141 141 SER SER A . n 
A 1 15  LEU 15  142 142 LEU LEU A . n 
A 1 16  GLN 16  143 143 GLN GLN A . n 
A 1 17  PRO 17  144 144 PRO PRO A . n 
A 1 18  ASP 18  145 145 ASP ASP A . n 
A 1 19  GLU 19  146 146 GLU GLU A . n 
A 1 20  PHE 20  147 147 PHE PHE A . n 
A 1 21  GLN 21  148 148 GLN GLN A . n 
A 1 22  LYS 22  149 149 LYS LYS A . n 
A 1 23  ILE 23  150 150 ILE ILE A . n 
A 1 24  LEU 24  151 151 LEU LEU A . n 
A 1 25  ASP 25  152 152 ASP ASP A . n 
A 1 26  PHE 26  153 153 PHE PHE A . n 
A 1 27  MET 27  154 154 MET MET A . n 
A 1 28  LYS 28  155 155 LYS LYS A . n 
A 1 29  ASP 29  156 156 ASP ASP A . n 
A 1 30  VAL 30  157 157 VAL VAL A . n 
A 1 31  MET 31  158 158 MET MET A . n 
A 1 32  LYS 32  159 159 LYS LYS A . n 
A 1 33  LYS 33  160 160 LYS LYS A . n 
A 1 34  LEU 34  161 161 LEU LEU A . n 
A 1 35  SER 35  162 162 SER SER A . n 
A 1 36  ASN 36  163 163 ASN ASN A . n 
A 1 37  THR 37  164 164 THR THR A . n 
A 1 38  SER 38  165 165 SER SER A . n 
A 1 39  TYR 39  166 166 TYR TYR A . n 
A 1 40  GLN 40  167 167 GLN GLN A . n 
A 1 41  PHE 41  168 168 PHE PHE A . n 
A 1 42  ALA 42  169 169 ALA ALA A . n 
A 1 43  ALA 43  170 170 ALA ALA A . n 
A 1 44  VAL 44  171 171 VAL VAL A . n 
A 1 45  GLN 45  172 172 GLN GLN A . n 
A 1 46  PHE 46  173 173 PHE PHE A . n 
A 1 47  SER 47  174 174 SER SER A . n 
A 1 48  THR 48  175 175 THR THR A . n 
A 1 49  SER 49  176 176 SER SER A . n 
A 1 50  TYR 50  177 177 TYR TYR A . n 
A 1 51  LYS 51  178 178 LYS LYS A . n 
A 1 52  THR 52  179 179 THR THR A . n 
A 1 53  GLU 53  180 180 GLU GLU A . n 
A 1 54  PHE 54  181 181 PHE PHE A . n 
A 1 55  ASP 55  182 182 ASP ASP A . n 
A 1 56  PHE 56  183 183 PHE PHE A . n 
A 1 57  SER 57  184 184 SER SER A . n 
A 1 58  ASP 58  185 185 ASP ASP A . n 
A 1 59  TYR 59  186 186 TYR TYR A . n 
A 1 60  VAL 60  187 187 VAL VAL A . n 
A 1 61  LYS 61  188 188 LYS LYS A . n 
A 1 62  TRP 62  189 189 TRP TRP A . n 
A 1 63  LYS 63  190 190 LYS LYS A . n 
A 1 64  ASP 64  191 191 ASP ASP A . n 
A 1 65  PRO 65  192 192 PRO PRO A . n 
A 1 66  ASP 66  193 193 ASP ASP A . n 
A 1 67  ALA 67  194 194 ALA ALA A . n 
A 1 68  LEU 68  195 195 LEU LEU A . n 
A 1 69  LEU 69  196 196 LEU LEU A . n 
A 1 70  LYS 70  197 197 LYS LYS A . n 
A 1 71  HIS 71  198 198 HIS HIS A . n 
A 1 72  VAL 72  199 199 VAL VAL A . n 
A 1 73  LYS 73  200 200 LYS LYS A . n 
A 1 74  HIS 74  201 201 HIS HIS A . n 
A 1 75  MET 75  202 202 MET MET A . n 
A 1 76  LEU 76  203 203 LEU LEU A . n 
A 1 77  LEU 77  204 204 LEU LEU A . n 
A 1 78  LEU 78  205 205 LEU LEU A . n 
A 1 79  THR 79  206 206 THR THR A . n 
A 1 80  ASN 80  207 207 ASN ASN A . n 
A 1 81  THR 81  208 208 THR THR A . n 
A 1 82  PHE 82  209 209 PHE PHE A . n 
A 1 83  GLY 83  210 210 GLY GLY A . n 
A 1 84  ALA 84  211 211 ALA ALA A . n 
A 1 85  ILE 85  212 212 ILE ILE A . n 
A 1 86  ASN 86  213 213 ASN ASN A . n 
A 1 87  TYR 87  214 214 TYR TYR A . n 
A 1 88  VAL 88  215 215 VAL VAL A . n 
A 1 89  ALA 89  216 216 ALA ALA A . n 
A 1 90  THR 90  217 217 THR THR A . n 
A 1 91  GLU 91  218 218 GLU GLU A . n 
A 1 92  VAL 92  219 219 VAL VAL A . n 
A 1 93  PHE 93  220 220 PHE PHE A . n 
A 1 94  ARG 94  221 221 ARG ARG A . n 
A 1 95  GLU 95  222 222 GLU GLU A . n 
A 1 96  GLU 96  223 223 GLU GLU A . n 
A 1 97  LEU 97  224 224 LEU LEU A . n 
A 1 98  GLY 98  225 225 GLY GLY A . n 
A 1 99  ALA 99  226 226 ALA ALA A . n 
A 1 100 ARG 100 227 227 ARG ARG A . n 
A 1 101 PRO 101 228 228 PRO PRO A . n 
A 1 102 ASP 102 229 229 ASP ASP A . n 
A 1 103 ALA 103 230 230 ALA ALA A . n 
A 1 104 THR 104 231 231 THR THR A . n 
A 1 105 LYS 105 232 232 LYS LYS A . n 
A 1 106 VAL 106 233 233 VAL VAL A . n 
A 1 107 LEU 107 234 234 LEU LEU A . n 
A 1 108 ILE 108 235 235 ILE ILE A . n 
A 1 109 ILE 109 236 236 ILE ILE A . n 
A 1 110 ILE 110 237 237 ILE ILE A . n 
A 1 111 THR 111 238 238 THR THR A . n 
A 1 112 ASP 112 239 239 ASP ASP A . n 
A 1 113 GLY 113 240 240 GLY GLY A . n 
A 1 114 GLU 114 241 241 GLU GLU A . n 
A 1 115 ALA 115 242 242 ALA ALA A . n 
A 1 116 THR 116 243 243 THR THR A . n 
A 1 117 ASP 117 244 244 ASP ASP A . n 
A 1 118 SER 118 245 245 SER SER A . n 
A 1 119 GLY 119 246 246 GLY GLY A . n 
A 1 120 ASN 120 247 247 ASN ASN A . n 
A 1 121 ILE 121 248 248 ILE ILE A . n 
A 1 122 ASP 122 249 249 ASP ASP A . n 
A 1 123 ALA 123 250 250 ALA ALA A . n 
A 1 124 ALA 124 251 251 ALA ALA A . n 
A 1 125 LYS 125 252 252 LYS LYS A . n 
A 1 126 ASP 126 253 253 ASP ASP A . n 
A 1 127 ILE 127 254 254 ILE ILE A . n 
A 1 128 ILE 128 255 255 ILE ILE A . n 
A 1 129 ARG 129 256 256 ARG ARG A . n 
A 1 130 TYR 130 257 257 TYR TYR A . n 
A 1 131 ILE 131 258 258 ILE ILE A . n 
A 1 132 ILE 132 259 259 ILE ILE A . n 
A 1 133 GLY 133 260 260 GLY GLY A . n 
A 1 134 ILE 134 261 261 ILE ILE A . n 
A 1 135 GLY 135 262 262 GLY GLY A . n 
A 1 136 LYS 136 263 263 LYS LYS A . n 
A 1 137 HIS 137 264 264 HIS HIS A . n 
A 1 138 SER 138 265 265 SER SER A . n 
A 1 139 GLN 139 266 266 GLN GLN A . n 
A 1 140 THR 140 267 267 THR THR A . n 
A 1 141 LYS 141 268 268 LYS LYS A . n 
A 1 142 GLU 142 269 269 GLU GLU A . n 
A 1 143 SER 143 270 270 SER SER A . n 
A 1 144 GLN 144 271 271 GLN GLN A . n 
A 1 145 GLU 145 272 272 GLU GLU A . n 
A 1 146 THR 146 273 273 THR THR A . n 
A 1 147 LEU 147 274 274 LEU LEU A . n 
A 1 148 HIS 148 275 275 HIS HIS A . n 
A 1 149 LYS 149 276 276 LYS LYS A . n 
A 1 150 PHE 150 277 277 PHE PHE A . n 
A 1 151 ALA 151 278 278 ALA ALA A . n 
A 1 152 SER 152 279 279 SER SER A . n 
A 1 153 LYS 153 280 280 LYS LYS A . n 
A 1 154 PRO 154 281 281 PRO PRO A . n 
A 1 155 ALA 155 282 282 ALA ALA A . n 
A 1 156 SER 156 283 283 SER SER A . n 
A 1 157 GLU 157 284 284 GLU GLU A . n 
A 1 158 PHE 158 285 285 PHE PHE A . n 
A 1 159 VAL 159 286 286 VAL VAL A . n 
A 1 160 LYS 160 287 287 LYS LYS A . n 
A 1 161 ILE 161 288 288 ILE ILE A . n 
A 1 162 LEU 162 289 289 LEU LEU A . n 
A 1 163 ASP 163 290 290 ASP ASP A . n 
A 1 164 THR 164 291 291 THR THR A . n 
A 1 165 GLY 165 292 292 GLY GLY A . n 
A 1 166 GLU 166 293 293 GLU GLU A . n 
A 1 167 LYS 167 294 294 LYS LYS A . n 
A 1 168 LEU 168 295 295 LEU LEU A . n 
A 1 169 LYS 169 296 296 LYS LYS A . n 
A 1 170 ASP 170 297 297 ASP ASP A . n 
A 1 171 LEU 171 298 298 LEU LEU A . n 
A 1 172 PHE 172 299 299 PHE PHE A . n 
A 1 173 THR 173 300 300 THR THR A . n 
A 1 174 GLU 174 301 301 GLU GLU A . n 
A 1 175 LEU 175 302 302 LEU LEU A . n 
A 1 176 GLN 176 303 303 GLN GLN A . n 
A 1 177 LYS 177 304 304 LYS LYS A . n 
A 1 178 LYS 178 305 305 LYS LYS A . n 
A 1 179 ILE 179 306 306 ILE ILE A . n 
A 1 180 TYR 180 307 307 TYR TYR A . n 
B 2 1   GLU 1   1   1   GLU GLU B . n 
B 2 2   PRO 2   2   2   PRO PRO B . n 
B 2 3   PHE 3   3   3   PHE PHE B . n 
B 2 4   TRP 4   4   4   TRP TRP B . n 
B 2 5   ALA 5   5   5   ALA ALA B . n 
B 2 6   ASP 6   6   6   ASP ASP B . n 
B 2 7   LEU 7   7   7   LEU LEU B . n 
B 2 8   GLN 8   8   8   GLN GLN B . n 
B 2 9   PRO 9   9   9   PRO PRO B . n 
B 2 10  ARG 10  10  10  ARG ARG B . n 
B 2 11  VAL 11  11  11  VAL VAL B . n 
B 2 12  ALA 12  12  12  ALA ALA B . n 
B 2 13  PHE 13  13  13  PHE PHE B . n 
B 2 14  VAL 14  14  14  VAL VAL B . n 
B 2 15  GLU 15  15  15  GLU GLU B . n 
B 2 16  ARG 16  16  16  ARG ARG B . n 
B 2 17  GLY 17  17  17  GLY GLY B . n 
B 2 18  GLY 18  18  18  GLY GLY B . n 
B 2 19  SER 19  19  19  SER SER B . n 
B 2 20  LEU 20  20  20  LEU LEU B . n 
B 2 21  TRP 21  21  21  TRP TRP B . n 
B 2 22  LEU 22  22  22  LEU LEU B . n 
B 2 23  ASN 23  23  23  ASN ASN B . n 
B 2 24  CYS 24  24  24  CYS CYS B . n 
B 2 25  SER 25  25  25  SER SER B . n 
B 2 26  THR 26  26  26  THR THR B . n 
B 2 27  ASN 27  27  27  ASN ASN B . n 
B 2 28  CYS 28  28  28  CYS CYS B . n 
B 2 29  PRO 29  29  29  PRO PRO B . n 
B 2 30  ARG 30  30  30  ARG ARG B . n 
B 2 31  PRO 31  31  31  PRO PRO B . n 
B 2 32  GLU 32  32  32  GLU GLU B . n 
B 2 33  ARG 33  33  33  ARG ARG B . n 
B 2 34  GLY 34  34  34  GLY GLY B . n 
B 2 35  GLY 35  35  35  GLY GLY B . n 
B 2 36  LEU 36  36  36  LEU LEU B . n 
B 2 37  GLU 37  37  37  GLU GLU B . n 
B 2 38  THR 38  38  38  THR THR B . n 
B 2 39  SER 39  39  39  SER SER B . n 
B 2 40  LEU 40  40  40  LEU LEU B . n 
B 2 41  ARG 41  41  41  ARG ARG B . n 
B 2 42  ARG 42  42  42  ARG ARG B . n 
B 2 43  ASN 43  43  43  ASN ASN B . n 
B 2 44  GLY 44  44  44  GLY GLY B . n 
B 2 45  THR 45  45  45  THR THR B . n 
B 2 46  GLN 46  46  46  GLN GLN B . n 
B 2 47  ARG 47  47  47  ARG ARG B . n 
B 2 48  GLY 48  48  48  GLY GLY B . n 
B 2 49  LEU 49  49  49  LEU LEU B . n 
B 2 50  ARG 50  50  50  ARG ARG B . n 
B 2 51  TRP 51  51  51  TRP TRP B . n 
B 2 52  LEU 52  52  52  LEU LEU B . n 
B 2 53  ALA 53  53  53  ALA ALA B . n 
B 2 54  ARG 54  54  54  ARG ARG B . n 
B 2 55  GLN 55  55  55  GLN GLN B . n 
B 2 56  LEU 56  56  56  LEU LEU B . n 
B 2 57  VAL 57  57  57  VAL VAL B . n 
B 2 58  ASP 58  58  58  ASP ASP B . n 
B 2 59  ILE 59  59  59  ILE ILE B . n 
B 2 60  ARG 60  60  60  ARG ARG B . n 
B 2 61  GLU 61  61  61  GLU GLU B . n 
B 2 62  PRO 62  62  62  PRO PRO B . n 
B 2 63  GLU 63  63  63  GLU GLU B . n 
B 2 64  THR 64  64  64  THR THR B . n 
B 2 65  GLN 65  65  65  GLN GLN B . n 
B 2 66  PRO 66  66  66  PRO PRO B . n 
B 2 67  VAL 67  67  67  VAL VAL B . n 
B 2 68  CYS 68  68  68  CYS CYS B . n 
B 2 69  PHE 69  69  69  PHE PHE B . n 
B 2 70  PHE 70  70  70  PHE PHE B . n 
B 2 71  ARG 71  71  71  ARG ARG B . n 
B 2 72  CYS 72  72  72  CYS CYS B . n 
B 2 73  ALA 73  73  73  ALA ALA B . n 
B 2 74  ARG 74  74  74  ARG ARG B . n 
B 2 75  ARG 75  75  75  ARG ARG B . n 
B 2 76  THR 76  76  76  THR THR B . n 
B 2 77  LEU 77  77  77  LEU LEU B . n 
B 2 78  GLN 78  78  78  GLN GLN B . n 
B 2 79  ALA 79  79  79  ALA ALA B . n 
B 2 80  ARG 80  80  80  ARG ARG B . n 
B 2 81  GLY 81  81  81  GLY GLY B . n 
B 2 82  LEU 82  82  82  LEU LEU B . n 
B 2 83  ILE 83  83  83  ILE ILE B . n 
B 2 84  ARG 84  84  84  ARG ARG B . n 
B 2 85  THR 85  85  85  THR THR B . n 
B 2 86  PHE 86  86  86  PHE PHE B . n 
B 2 87  GLN 87  87  87  GLN GLN B . n 
B 2 88  ARG 88  88  88  ARG ARG B . n 
B 2 89  PRO 89  89  89  PRO PRO B . n 
B 2 90  ASP 90  90  90  ASP ASP B . n 
B 2 91  ARG 91  91  91  ARG ARG B . n 
B 2 92  VAL 92  92  92  VAL VAL B . n 
B 2 93  GLU 93  93  93  GLU GLU B . n 
B 2 94  LEU 94  94  94  LEU LEU B . n 
B 2 95  MET 95  95  95  MET MET B . n 
B 2 96  PRO 96  96  96  PRO PRO B . n 
B 2 97  LEU 97  97  97  LEU LEU B . n 
B 2 98  PRO 98  98  98  PRO PRO B . n 
B 2 99  PRO 99  99  99  PRO PRO B . n 
B 2 100 TRP 100 100 100 TRP TRP B . n 
B 2 101 GLN 101 101 101 GLN GLN B . n 
B 2 102 PRO 102 102 102 PRO PRO B . n 
B 2 103 VAL 103 103 103 VAL VAL B . n 
B 2 104 GLY 104 104 104 GLY GLY B . n 
B 2 105 GLU 105 105 105 GLU GLU B . n 
B 2 106 ASN 106 106 106 ASN ASN B . n 
B 2 107 PHE 107 107 107 PHE PHE B . n 
B 2 108 THR 108 108 108 THR THR B . n 
B 2 109 LEU 109 109 109 LEU LEU B . n 
B 2 110 SER 110 110 110 SER SER B . n 
B 2 111 CYS 111 111 111 CYS CYS B . n 
B 2 112 ARG 112 112 112 ARG ARG B . n 
B 2 113 VAL 113 113 113 VAL VAL B . n 
B 2 114 PRO 114 114 114 PRO PRO B . n 
B 2 115 GLY 115 115 115 GLY GLY B . n 
B 2 116 ALA 116 116 116 ALA ALA B . n 
B 2 117 GLY 117 117 117 GLY GLY B . n 
B 2 118 PRO 118 118 118 PRO PRO B . n 
B 2 119 ARG 119 119 119 ARG ARG B . n 
B 2 120 ALA 120 120 120 ALA ALA B . n 
B 2 121 SER 121 121 121 SER SER B . n 
B 2 122 LEU 122 122 122 LEU LEU B . n 
B 2 123 THR 123 123 123 THR THR B . n 
B 2 124 LEU 124 124 124 LEU LEU B . n 
B 2 125 THR 125 125 125 THR THR B . n 
B 2 126 LEU 126 126 126 LEU LEU B . n 
B 2 127 LEU 127 127 127 LEU LEU B . n 
B 2 128 ARG 128 128 128 ARG ARG B . n 
B 2 129 GLY 129 129 129 GLY GLY B . n 
B 2 130 ALA 130 130 130 ALA ALA B . n 
B 2 131 GLN 131 131 131 GLN GLN B . n 
B 2 132 GLU 132 132 132 GLU GLU B . n 
B 2 133 LEU 133 133 133 LEU LEU B . n 
B 2 134 ILE 134 134 134 ILE ILE B . n 
B 2 135 ARG 135 135 135 ARG ARG B . n 
B 2 136 ARG 136 136 136 ARG ARG B . n 
B 2 137 SER 137 137 137 SER SER B . n 
B 2 138 PHE 138 138 138 PHE PHE B . n 
B 2 139 ALA 139 139 139 ALA ALA B . n 
B 2 140 GLY 140 140 140 GLY GLY B . n 
B 2 141 GLU 141 141 141 GLU GLU B . n 
B 2 142 PRO 142 142 142 PRO PRO B . n 
B 2 143 PRO 143 143 143 PRO PRO B . n 
B 2 144 ARG 144 144 144 ARG ARG B . n 
B 2 145 ALA 145 145 145 ALA ALA B . n 
B 2 146 ARG 146 146 146 ARG ARG B . n 
B 2 147 GLY 147 147 147 GLY GLY B . n 
B 2 148 ALA 148 148 148 ALA ALA B . n 
B 2 149 VAL 149 149 149 VAL VAL B . n 
B 2 150 LEU 150 150 150 LEU LEU B . n 
B 2 151 THR 151 151 151 THR THR B . n 
B 2 152 ALA 152 152 152 ALA ALA B . n 
B 2 153 THR 153 153 153 THR THR B . n 
B 2 154 VAL 154 154 154 VAL VAL B . n 
B 2 155 LEU 155 155 155 LEU LEU B . n 
B 2 156 ALA 156 156 156 ALA ALA B . n 
B 2 157 ARG 157 157 157 ARG ARG B . n 
B 2 158 ARG 158 158 158 ARG ARG B . n 
B 2 159 GLU 159 159 159 GLU GLU B . n 
B 2 160 ASP 160 160 160 ASP ASP B . n 
B 2 161 HIS 161 161 161 HIS HIS B . n 
B 2 162 GLY 162 162 162 GLY GLY B . n 
B 2 163 ALA 163 163 163 ALA ALA B . n 
B 2 164 ASN 164 164 164 ASN ASN B . n 
B 2 165 PHE 165 165 165 PHE PHE B . n 
B 2 166 SER 166 166 166 SER SER B . n 
B 2 167 CYS 167 167 167 CYS CYS B . n 
B 2 168 ARG 168 168 168 ARG ARG B . n 
B 2 169 ALA 169 169 169 ALA ALA B . n 
B 2 170 GLU 170 170 170 GLU GLU B . n 
B 2 171 LEU 171 171 171 LEU LEU B . n 
B 2 172 ASP 172 172 172 ASP ASP B . n 
B 2 173 LEU 173 173 173 LEU LEU B . n 
B 2 174 ARG 174 174 174 ARG ARG B . n 
B 2 175 PRO 175 175 175 PRO PRO B . n 
B 2 176 HIS 176 176 176 HIS HIS B . n 
B 2 177 GLY 177 177 177 GLY GLY B . n 
B 2 178 LEU 178 178 178 LEU LEU B . n 
B 2 179 GLY 179 179 179 GLY GLY B . n 
B 2 180 LEU 180 180 180 LEU LEU B . n 
B 2 181 PHE 181 181 181 PHE PHE B . n 
B 2 182 GLU 182 182 182 GLU GLU B . n 
B 2 183 ASN 183 183 183 ASN ASN B . n 
B 2 184 SER 184 184 184 SER SER B . n 
B 2 185 SER 185 185 185 SER SER B . n 
B 2 186 ALA 186 186 186 ALA ALA B . n 
B 2 187 PRO 187 187 187 PRO PRO B . n 
B 2 188 ARG 188 188 188 ARG ARG B . n 
B 2 189 GLU 189 189 189 GLU GLU B . n 
B 2 190 LEU 190 190 190 LEU LEU B . n 
B 2 191 ARG 191 191 191 ARG ARG B . n 
B 2 192 THR 192 192 192 THR THR B . n 
B 2 193 PHE 193 193 193 PHE PHE B . n 
B 2 194 SER 194 194 194 SER SER B . n 
B 2 195 LEU 195 195 195 LEU LEU B . n 
B 2 196 SER 196 196 196 SER SER B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 MG  1   1   1   MG  MG  A . 
E 5 NAG 1   199 2   NAG NAG B . 
F 5 NAG 1   200 3   NAG NAG B . 
G 5 NAG 1   201 4   NAG NAG B . 
H 5 NAG 1   202 5   NAG NAG B . 
I 6 GOL 1   203 1   GOL GOL B . 
J 6 GOL 1   204 2   GOL GOL B . 
K 7 HOH 1   308 1   HOH HOH A . 
K 7 HOH 2   309 2   HOH HOH A . 
K 7 HOH 3   310 3   HOH HOH A . 
K 7 HOH 4   311 5   HOH HOH A . 
K 7 HOH 5   312 6   HOH HOH A . 
K 7 HOH 6   313 7   HOH HOH A . 
K 7 HOH 7   314 8   HOH HOH A . 
K 7 HOH 8   315 10  HOH HOH A . 
K 7 HOH 9   316 14  HOH HOH A . 
K 7 HOH 10  317 16  HOH HOH A . 
K 7 HOH 11  318 18  HOH HOH A . 
K 7 HOH 12  319 25  HOH HOH A . 
K 7 HOH 13  320 26  HOH HOH A . 
K 7 HOH 14  321 35  HOH HOH A . 
K 7 HOH 15  322 39  HOH HOH A . 
K 7 HOH 16  323 41  HOH HOH A . 
K 7 HOH 17  324 47  HOH HOH A . 
K 7 HOH 18  325 49  HOH HOH A . 
K 7 HOH 19  326 50  HOH HOH A . 
K 7 HOH 20  327 52  HOH HOH A . 
K 7 HOH 21  328 58  HOH HOH A . 
K 7 HOH 22  329 59  HOH HOH A . 
K 7 HOH 23  330 63  HOH HOH A . 
K 7 HOH 24  331 65  HOH HOH A . 
K 7 HOH 25  332 66  HOH HOH A . 
K 7 HOH 26  333 69  HOH HOH A . 
K 7 HOH 27  334 71  HOH HOH A . 
K 7 HOH 28  335 73  HOH HOH A . 
K 7 HOH 29  336 75  HOH HOH A . 
K 7 HOH 30  337 78  HOH HOH A . 
K 7 HOH 31  338 80  HOH HOH A . 
K 7 HOH 32  339 82  HOH HOH A . 
K 7 HOH 33  340 83  HOH HOH A . 
K 7 HOH 34  341 84  HOH HOH A . 
K 7 HOH 35  342 90  HOH HOH A . 
K 7 HOH 36  343 91  HOH HOH A . 
K 7 HOH 37  344 94  HOH HOH A . 
K 7 HOH 38  345 99  HOH HOH A . 
K 7 HOH 39  346 104 HOH HOH A . 
K 7 HOH 40  347 105 HOH HOH A . 
K 7 HOH 41  348 106 HOH HOH A . 
K 7 HOH 42  349 110 HOH HOH A . 
K 7 HOH 43  350 111 HOH HOH A . 
K 7 HOH 44  351 112 HOH HOH A . 
K 7 HOH 45  352 114 HOH HOH A . 
K 7 HOH 46  353 115 HOH HOH A . 
K 7 HOH 47  354 116 HOH HOH A . 
K 7 HOH 48  355 117 HOH HOH A . 
K 7 HOH 49  356 118 HOH HOH A . 
K 7 HOH 50  357 119 HOH HOH A . 
K 7 HOH 51  358 122 HOH HOH A . 
K 7 HOH 52  359 123 HOH HOH A . 
K 7 HOH 53  360 124 HOH HOH A . 
K 7 HOH 54  361 125 HOH HOH A . 
K 7 HOH 55  362 128 HOH HOH A . 
K 7 HOH 56  363 129 HOH HOH A . 
K 7 HOH 57  364 130 HOH HOH A . 
K 7 HOH 58  365 133 HOH HOH A . 
K 7 HOH 59  366 135 HOH HOH A . 
K 7 HOH 60  367 138 HOH HOH A . 
K 7 HOH 61  368 141 HOH HOH A . 
K 7 HOH 62  369 143 HOH HOH A . 
K 7 HOH 63  370 145 HOH HOH A . 
K 7 HOH 64  371 146 HOH HOH A . 
K 7 HOH 65  372 147 HOH HOH A . 
K 7 HOH 66  373 148 HOH HOH A . 
K 7 HOH 67  374 150 HOH HOH A . 
K 7 HOH 68  375 152 HOH HOH A . 
K 7 HOH 69  376 156 HOH HOH A . 
K 7 HOH 70  377 158 HOH HOH A . 
K 7 HOH 71  378 159 HOH HOH A . 
K 7 HOH 72  379 160 HOH HOH A . 
K 7 HOH 73  380 161 HOH HOH A . 
K 7 HOH 74  381 162 HOH HOH A . 
K 7 HOH 75  382 167 HOH HOH A . 
K 7 HOH 76  383 171 HOH HOH A . 
K 7 HOH 77  384 172 HOH HOH A . 
K 7 HOH 78  385 173 HOH HOH A . 
K 7 HOH 79  386 177 HOH HOH A . 
K 7 HOH 80  387 181 HOH HOH A . 
K 7 HOH 81  388 182 HOH HOH A . 
K 7 HOH 82  389 184 HOH HOH A . 
K 7 HOH 83  390 185 HOH HOH A . 
K 7 HOH 84  391 188 HOH HOH A . 
K 7 HOH 85  392 190 HOH HOH A . 
K 7 HOH 86  393 191 HOH HOH A . 
K 7 HOH 87  394 192 HOH HOH A . 
K 7 HOH 88  395 194 HOH HOH A . 
K 7 HOH 89  396 196 HOH HOH A . 
K 7 HOH 90  397 199 HOH HOH A . 
K 7 HOH 91  398 200 HOH HOH A . 
K 7 HOH 92  399 201 HOH HOH A . 
K 7 HOH 93  400 202 HOH HOH A . 
K 7 HOH 94  401 203 HOH HOH A . 
K 7 HOH 95  402 205 HOH HOH A . 
K 7 HOH 96  403 208 HOH HOH A . 
K 7 HOH 97  404 210 HOH HOH A . 
K 7 HOH 98  405 214 HOH HOH A . 
K 7 HOH 99  406 215 HOH HOH A . 
K 7 HOH 100 407 216 HOH HOH A . 
K 7 HOH 101 408 220 HOH HOH A . 
K 7 HOH 102 409 222 HOH HOH A . 
L 7 HOH 1   205 4   HOH HOH B . 
L 7 HOH 2   206 9   HOH HOH B . 
L 7 HOH 3   207 11  HOH HOH B . 
L 7 HOH 4   208 12  HOH HOH B . 
L 7 HOH 5   209 13  HOH HOH B . 
L 7 HOH 6   210 15  HOH HOH B . 
L 7 HOH 7   211 17  HOH HOH B . 
L 7 HOH 8   212 19  HOH HOH B . 
L 7 HOH 9   213 20  HOH HOH B . 
L 7 HOH 10  214 21  HOH HOH B . 
L 7 HOH 11  215 22  HOH HOH B . 
L 7 HOH 12  216 23  HOH HOH B . 
L 7 HOH 13  217 24  HOH HOH B . 
L 7 HOH 14  218 27  HOH HOH B . 
L 7 HOH 15  219 28  HOH HOH B . 
L 7 HOH 16  220 29  HOH HOH B . 
L 7 HOH 17  221 30  HOH HOH B . 
L 7 HOH 18  222 31  HOH HOH B . 
L 7 HOH 19  223 32  HOH HOH B . 
L 7 HOH 20  224 33  HOH HOH B . 
L 7 HOH 21  225 34  HOH HOH B . 
L 7 HOH 22  226 36  HOH HOH B . 
L 7 HOH 23  227 37  HOH HOH B . 
L 7 HOH 24  228 38  HOH HOH B . 
L 7 HOH 25  229 40  HOH HOH B . 
L 7 HOH 26  230 42  HOH HOH B . 
L 7 HOH 27  231 43  HOH HOH B . 
L 7 HOH 28  232 44  HOH HOH B . 
L 7 HOH 29  233 45  HOH HOH B . 
L 7 HOH 30  234 46  HOH HOH B . 
L 7 HOH 31  235 48  HOH HOH B . 
L 7 HOH 32  236 51  HOH HOH B . 
L 7 HOH 33  237 53  HOH HOH B . 
L 7 HOH 34  238 54  HOH HOH B . 
L 7 HOH 35  239 55  HOH HOH B . 
L 7 HOH 36  240 56  HOH HOH B . 
L 7 HOH 37  241 57  HOH HOH B . 
L 7 HOH 38  242 60  HOH HOH B . 
L 7 HOH 39  243 61  HOH HOH B . 
L 7 HOH 40  244 62  HOH HOH B . 
L 7 HOH 41  245 64  HOH HOH B . 
L 7 HOH 42  246 67  HOH HOH B . 
L 7 HOH 43  247 68  HOH HOH B . 
L 7 HOH 44  248 70  HOH HOH B . 
L 7 HOH 45  249 72  HOH HOH B . 
L 7 HOH 46  250 74  HOH HOH B . 
L 7 HOH 47  251 76  HOH HOH B . 
L 7 HOH 48  252 77  HOH HOH B . 
L 7 HOH 49  253 79  HOH HOH B . 
L 7 HOH 50  254 81  HOH HOH B . 
L 7 HOH 51  255 85  HOH HOH B . 
L 7 HOH 52  256 86  HOH HOH B . 
L 7 HOH 53  257 87  HOH HOH B . 
L 7 HOH 54  258 88  HOH HOH B . 
L 7 HOH 55  259 89  HOH HOH B . 
L 7 HOH 56  260 92  HOH HOH B . 
L 7 HOH 57  261 93  HOH HOH B . 
L 7 HOH 58  262 95  HOH HOH B . 
L 7 HOH 59  263 96  HOH HOH B . 
L 7 HOH 60  264 97  HOH HOH B . 
L 7 HOH 61  265 98  HOH HOH B . 
L 7 HOH 62  266 100 HOH HOH B . 
L 7 HOH 63  267 101 HOH HOH B . 
L 7 HOH 64  268 102 HOH HOH B . 
L 7 HOH 65  269 103 HOH HOH B . 
L 7 HOH 66  270 107 HOH HOH B . 
L 7 HOH 67  271 108 HOH HOH B . 
L 7 HOH 68  272 109 HOH HOH B . 
L 7 HOH 69  273 113 HOH HOH B . 
L 7 HOH 70  274 120 HOH HOH B . 
L 7 HOH 71  275 121 HOH HOH B . 
L 7 HOH 72  276 126 HOH HOH B . 
L 7 HOH 73  277 127 HOH HOH B . 
L 7 HOH 74  278 131 HOH HOH B . 
L 7 HOH 75  279 132 HOH HOH B . 
L 7 HOH 76  280 134 HOH HOH B . 
L 7 HOH 77  281 136 HOH HOH B . 
L 7 HOH 78  282 137 HOH HOH B . 
L 7 HOH 79  283 139 HOH HOH B . 
L 7 HOH 80  284 140 HOH HOH B . 
L 7 HOH 81  285 142 HOH HOH B . 
L 7 HOH 82  286 144 HOH HOH B . 
L 7 HOH 83  287 149 HOH HOH B . 
L 7 HOH 84  288 151 HOH HOH B . 
L 7 HOH 85  289 153 HOH HOH B . 
L 7 HOH 86  290 154 HOH HOH B . 
L 7 HOH 87  291 155 HOH HOH B . 
L 7 HOH 88  292 157 HOH HOH B . 
L 7 HOH 89  293 163 HOH HOH B . 
L 7 HOH 90  294 164 HOH HOH B . 
L 7 HOH 91  295 165 HOH HOH B . 
L 7 HOH 92  296 166 HOH HOH B . 
L 7 HOH 93  297 168 HOH HOH B . 
L 7 HOH 94  298 169 HOH HOH B . 
L 7 HOH 95  299 170 HOH HOH B . 
L 7 HOH 96  300 174 HOH HOH B . 
L 7 HOH 97  301 175 HOH HOH B . 
L 7 HOH 98  302 176 HOH HOH B . 
L 7 HOH 99  303 178 HOH HOH B . 
L 7 HOH 100 304 179 HOH HOH B . 
L 7 HOH 101 305 180 HOH HOH B . 
L 7 HOH 102 306 183 HOH HOH B . 
L 7 HOH 103 307 186 HOH HOH B . 
L 7 HOH 104 308 187 HOH HOH B . 
L 7 HOH 105 309 189 HOH HOH B . 
L 7 HOH 106 310 193 HOH HOH B . 
L 7 HOH 107 311 195 HOH HOH B . 
L 7 HOH 108 312 197 HOH HOH B . 
L 7 HOH 109 313 198 HOH HOH B . 
L 7 HOH 110 314 204 HOH HOH B . 
L 7 HOH 111 315 206 HOH HOH B . 
L 7 HOH 112 316 207 HOH HOH B . 
L 7 HOH 113 317 209 HOH HOH B . 
L 7 HOH 114 318 211 HOH HOH B . 
L 7 HOH 115 319 212 HOH HOH B . 
L 7 HOH 116 320 213 HOH HOH B . 
L 7 HOH 117 321 217 HOH HOH B . 
L 7 HOH 118 322 218 HOH HOH B . 
L 7 HOH 119 323 219 HOH HOH B . 
L 7 HOH 120 324 221 HOH HOH B . 
L 7 HOH 121 325 223 HOH HOH B . 
L 7 HOH 122 326 224 HOH HOH B . 
L 7 HOH 123 327 225 HOH HOH B . 
L 7 HOH 124 328 226 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 B ASN 23  B ASN 23  ? ASN 'GLYCOSYLATION SITE' 
2 B ASN 43  B ASN 43  ? ASN 'GLYCOSYLATION SITE' 
3 B ASN 106 B ASN 106 ? ASN 'GLYCOSYLATION SITE' 
4 B ASN 164 B ASN 164 ? ASN 'GLYCOSYLATION SITE' 
5 B ASN 183 B ASN 183 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3580  ? 
1 MORE         10    ? 
1 'SSA (A^2)'  19790 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OG  ? A SER 12 ? A SER 139 ? 1_555 MG ? D MG . ? A MG 1 ? 1_555 OG  ? A SER 14 ? A SER 141 ? 1_555 87.6  ? 
2  OG  ? A SER 12 ? A SER 139 ? 1_555 MG ? D MG . ? A MG 1 ? 1_555 OG1 ? A THR 79 ? A THR 206 ? 1_555 92.4  ? 
3  OG  ? A SER 14 ? A SER 141 ? 1_555 MG ? D MG . ? A MG 1 ? 1_555 OG1 ? A THR 79 ? A THR 206 ? 1_555 178.8 ? 
4  OG  ? A SER 12 ? A SER 139 ? 1_555 MG ? D MG . ? A MG 1 ? 1_555 O   ? K HOH .  ? A HOH 308 ? 1_555 173.2 ? 
5  OG  ? A SER 14 ? A SER 141 ? 1_555 MG ? D MG . ? A MG 1 ? 1_555 O   ? K HOH .  ? A HOH 308 ? 1_555 96.9  ? 
6  OG1 ? A THR 79 ? A THR 206 ? 1_555 MG ? D MG . ? A MG 1 ? 1_555 O   ? K HOH .  ? A HOH 308 ? 1_555 83.1  ? 
7  OG  ? A SER 12 ? A SER 139 ? 1_555 MG ? D MG . ? A MG 1 ? 1_555 O   ? K HOH .  ? A HOH 309 ? 1_555 86.1  ? 
8  OG  ? A SER 14 ? A SER 141 ? 1_555 MG ? D MG . ? A MG 1 ? 1_555 O   ? K HOH .  ? A HOH 309 ? 1_555 84.3  ? 
9  OG1 ? A THR 79 ? A THR 206 ? 1_555 MG ? D MG . ? A MG 1 ? 1_555 O   ? K HOH .  ? A HOH 309 ? 1_555 94.4  ? 
10 O   ? K HOH .  ? A HOH 308 ? 1_555 MG ? D MG . ? A MG 1 ? 1_555 O   ? K HOH .  ? A HOH 309 ? 1_555 89.2  ? 
11 OG  ? A SER 12 ? A SER 139 ? 1_555 MG ? D MG . ? A MG 1 ? 1_555 OE2 ? B GLU 37 ? B GLU 37  ? 1_555 94.4  ? 
12 OG  ? A SER 14 ? A SER 141 ? 1_555 MG ? D MG . ? A MG 1 ? 1_555 OE2 ? B GLU 37 ? B GLU 37  ? 1_555 90.1  ? 
13 OG1 ? A THR 79 ? A THR 206 ? 1_555 MG ? D MG . ? A MG 1 ? 1_555 OE2 ? B GLU 37 ? B GLU 37  ? 1_555 91.1  ? 
14 O   ? K HOH .  ? A HOH 308 ? 1_555 MG ? D MG . ? A MG 1 ? 1_555 OE2 ? B GLU 37 ? B GLU 37  ? 1_555 90.7  ? 
15 O   ? K HOH .  ? A HOH 309 ? 1_555 MG ? D MG . ? A MG 1 ? 1_555 OE2 ? B GLU 37 ? B GLU 37  ? 1_555 174.4 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-08-19 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 2 0 2020-07-29 
4 'Structure model' 2 1 2021-10-20 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 3 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Atomic model'              
4 3 'Structure model' 'Data collection'           
5 3 'Structure model' 'Database references'       
6 3 'Structure model' 'Derived calculations'      
7 3 'Structure model' 'Structure summary'         
8 4 'Structure model' 'Database references'       
9 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' atom_site                     
2  3 'Structure model' chem_comp                     
3  3 'Structure model' entity                        
4  3 'Structure model' pdbx_branch_scheme            
5  3 'Structure model' pdbx_chem_comp_identifier     
6  3 'Structure model' pdbx_entity_branch            
7  3 'Structure model' pdbx_entity_branch_descriptor 
8  3 'Structure model' pdbx_entity_branch_link       
9  3 'Structure model' pdbx_entity_branch_list       
10 3 'Structure model' pdbx_entity_nonpoly           
11 3 'Structure model' pdbx_nonpoly_scheme           
12 3 'Structure model' pdbx_struct_assembly_gen      
13 3 'Structure model' pdbx_struct_conn_angle        
14 3 'Structure model' struct_asym                   
15 3 'Structure model' struct_conn                   
16 3 'Structure model' struct_conn_type              
17 3 'Structure model' struct_ref_seq_dif            
18 3 'Structure model' struct_site                   
19 3 'Structure model' struct_site_gen               
20 4 'Structure model' chem_comp                     
21 4 'Structure model' database_2                    
22 4 'Structure model' struct_ref_seq_dif            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_atom_site.B_iso_or_equiv'                   
2  3 'Structure model' '_atom_site.Cartn_x'                          
3  3 'Structure model' '_atom_site.Cartn_y'                          
4  3 'Structure model' '_atom_site.Cartn_z'                          
5  3 'Structure model' '_atom_site.auth_asym_id'                     
6  3 'Structure model' '_atom_site.auth_atom_id'                     
7  3 'Structure model' '_atom_site.auth_comp_id'                     
8  3 'Structure model' '_atom_site.auth_seq_id'                      
9  3 'Structure model' '_atom_site.label_asym_id'                    
10 3 'Structure model' '_atom_site.label_atom_id'                    
11 3 'Structure model' '_atom_site.label_comp_id'                    
12 3 'Structure model' '_atom_site.label_entity_id'                  
13 3 'Structure model' '_atom_site.type_symbol'                      
14 3 'Structure model' '_chem_comp.name'                             
15 3 'Structure model' '_chem_comp.type'                             
16 3 'Structure model' '_pdbx_entity_nonpoly.entity_id'              
17 3 'Structure model' '_pdbx_entity_nonpoly.name'                   
18 3 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
19 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id'  
20 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
21 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
22 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
23 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
24 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
25 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
26 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
27 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id'  
28 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
29 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
30 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
31 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
32 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
33 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
34 3 'Structure model' '_pdbx_struct_conn_angle.value'               
35 3 'Structure model' '_struct_conn.conn_type_id'                   
36 3 'Structure model' '_struct_conn.id'                             
37 3 'Structure model' '_struct_conn.pdbx_dist_value'                
38 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
39 3 'Structure model' '_struct_conn.pdbx_role'                      
40 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
41 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
42 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
43 3 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
44 3 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
45 3 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
46 3 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
47 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
48 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
49 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
50 3 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
51 3 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
52 3 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
53 3 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
54 3 'Structure model' '_struct_conn_type.id'                        
55 3 'Structure model' '_struct_ref_seq_dif.details'                 
56 4 'Structure model' '_chem_comp.pdbx_synonyms'                    
57 4 'Structure model' '_database_2.pdbx_DOI'                        
58 4 'Structure model' '_database_2.pdbx_database_accession'         
59 4 'Structure model' '_struct_ref_seq_dif.details'                 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1  ? refined -13.3740 -7.4467  40.5065 -0.3063 0.0185  -0.0761 0.0208  -0.0790 -0.1223 2.2786  9.3261  3.2681  -0.4126 0.2897  
2.5947  -0.0511 0.3843  -0.3332 -0.4607 0.2087  -0.8824 0.6153  0.3911  0.7099  'X-RAY DIFFRACTION' 
2  ? refined -18.0757 -1.2018  34.1248 -0.1865 -0.2055 0.0047  -0.0521 0.0067  -0.0738 3.0865  4.0224  3.6903  -0.8144 -1.0273 
1.8414  0.0717  0.1168  -0.1885 -0.2335 0.6265  -0.3636 -0.0977 -0.3380 0.1890  'X-RAY DIFFRACTION' 
3  ? refined -5.0674  -10.9471 29.0331 -0.4889 -0.0097 0.0715  -0.0405 0.1434  -0.1603 6.0553  17.5310 3.8565  2.5312  -0.2833 
0.5706  0.0872  0.3590  -0.4462 -0.1905 -0.2262 -1.6492 -0.5632 -0.0029 0.9762  'X-RAY DIFFRACTION' 
4  ? refined -1.1366  -31.8040 36.2154 0.0172  0.4127  0.5090  0.1295  0.0197  0.4244  14.8948 3.4198  25.9190 -5.5531 3.4641  
4.5300  0.4120  0.1277  -0.5396 0.2949  0.5984  0.2900  1.5243  -0.7854 -0.2675 'X-RAY DIFFRACTION' 
5  ? refined -26.5476 -33.1425 31.1120 -0.0975 -0.0329 -0.0356 0.0112  0.0136  0.0796  0.1215  6.1054  5.3963  -0.0689 -0.5347 
-3.9938 0.3135  0.3097  -0.6231 -0.2247 -0.4246 0.7324  -0.3021 0.4806  -0.5948 'X-RAY DIFFRACTION' 
6  ? refined -20.5993 -29.0049 21.9585 -0.1436 -0.0994 -0.2035 0.0435  0.1020  0.0385  2.9984  7.5962  8.5632  -0.6686 3.5653  
-0.4680 0.0655  -0.1892 0.1237  0.3243  -0.0852 -0.0660 -0.7275 0.2427  0.3512  'X-RAY DIFFRACTION' 
7  ? refined -24.3973 -25.9849 30.8679 -0.1249 -0.1086 -0.0585 -0.0708 0.0363  0.0362  0.1521  5.2831  10.6552 -0.8875 0.7125  
-3.2831 -0.1498 -0.0242 0.1739  -0.1624 0.1929  -0.1151 0.1642  -0.6559 -0.3464 'X-RAY DIFFRACTION' 
8  ? refined -19.7186 -37.5402 70.4138 -0.0139 -0.0491 -0.1769 0.0027  -0.0789 0.0003  1.2084  0.0873  19.6866 0.0130  2.3638  
0.3335  -0.0555 0.0034  0.0521  -0.1672 0.1089  -0.3068 0.0273  -0.4506 0.3978  'X-RAY DIFFRACTION' 
9  ? refined -27.5334 -39.8295 63.2714 -0.0679 -0.1502 -0.2441 0.0581  -0.0417 -0.0066 2.4615  0.0840  8.8516  0.4127  2.5088  
0.4459  0.0399  -0.0585 0.0186  -0.4655 -0.0521 -0.0923 0.1646  -0.1218 -0.5812 'X-RAY DIFFRACTION' 
10 ? refined -18.8366 -43.1234 77.5868 -0.1296 0.0578  -0.1684 -0.0015 -0.0898 0.0256  3.1709  4.8114  37.3759 0.1416  7.2532  
3.6632  0.1935  -0.0408 -0.1528 -0.5291 0.0340  -0.0617 0.6629  1.4154  0.6150  'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1  1  A 1   A 33  ? A 128 A 160 'X-RAY DIFFRACTION' ? 
2  2  A 34  A 124 ? A 161 A 251 'X-RAY DIFFRACTION' ? 
3  3  A 125 A 165 ? A 252 A 292 'X-RAY DIFFRACTION' ? 
4  4  A 166 A 180 ? A 293 A 307 'X-RAY DIFFRACTION' ? 
5  5  B 1   B 21  ? B 1   B 21  'X-RAY DIFFRACTION' ? 
6  6  B 22  B 54  ? B 22  B 54  'X-RAY DIFFRACTION' ? 
7  7  B 55  B 85  ? B 55  B 85  'X-RAY DIFFRACTION' ? 
8  8  B 86  B 112 ? B 86  B 112 'X-RAY DIFFRACTION' ? 
9  9  B 113 B 181 ? B 113 B 181 'X-RAY DIFFRACTION' ? 
10 10 B 182 B 196 ? B 182 B 196 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC      5.3.0026 ?                    program 'Murshudov, G.N.' ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html  Fortran_77 ? 1 
PDB_EXTRACT 3.004    'September 10, 2007' package PDB               sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/ C++        ? 2 
HKL-2000    .        ?                    ?       ?                 ?                        'data reduction'  ? ?          ? 3 
HKL-2000    .        ?                    ?       ?                 ?                        'data scaling'    ? ?          ? 4 
PHASER      .        ?                    ?       ?                 ?                        phasing           ? ?          ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 313 ? ? O  B HOH 314 ? ? 2.06 
2 1 ND2 B ASN 43  ? ? C2 B NAG 199 ? ? 2.10 
3 1 O   A ASN 163 ? ? O  A HOH 344 ? ? 2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 174 ? ? -148.04 -102.95 
2 1 LYS A 190 ? ? 66.19   -48.46  
3 1 LEU A 204 ? ? -124.09 -144.57 
4 1 ASN B 43  ? ? -147.01 29.84   
5 1 ALA B 73  ? ? 52.78   -120.64 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 3 NAG 1 C NAG 1 G NAG 1 n 
C 3 NAG 2 C NAG 2 G NAG 6 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   3 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 3 DGlcpNAcb1-4DGlcpNAcb1-                               'Glycam Condensed Sequence' GMML       1.0   
2 3 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS                       PDB2Glycan 1.1.0 
3 3 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}}'    LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  3 
_pdbx_entity_branch_link.entity_branch_list_num_1   2 
_pdbx_entity_branch_link.comp_id_1                  NAG 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   1 
_pdbx_entity_branch_link.comp_id_2                  NAG 
_pdbx_entity_branch_link.atom_id_2                  O4 
_pdbx_entity_branch_link.leaving_atom_id_2          HO4 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
3 NAG 1 n 
3 NAG 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MAGNESIUM ION'                          MG  
5 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
6 GLYCEROL                                 GOL 
7 water                                    HOH 
#