data_3BNF
# 
_entry.id   3BNF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3BNF         
RCSB  RCSB045731   
WWPDB D_1000045731 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1FS7 . unspecified 
PDB 3BNG . unspecified 
PDB 3BNH . unspecified 
PDB 3BNJ . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3BNF 
_pdbx_database_status.recvd_initial_deposition_date   2007-12-14 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lukat, P.'  1 
'Einsle, O.' 2 
# 
_citation.id                        primary 
_citation.title                     'Binding and Reduction of Sulfite by Cytochrome c Nitrite Reductase' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            47 
_citation.page_first                2080 
_citation.page_last                 2086 
_citation.year                      2008 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18201106 
_citation.pdbx_database_id_DOI      10.1021/bi7021415 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lukat, P.'         1 
primary 'Rudolf, M.'        2 
primary 'Stach, P.'         3 
primary 'Messerschmidt, A.' 4 
primary 'Kroneck, P.M.H.'   5 
primary 'Simon, J.'         6 
primary 'Einsle, O.'        7 
# 
_cell.entry_id           3BNF 
_cell.length_a           119.500 
_cell.length_b           119.500 
_cell.length_c           186.674 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3BNF 
_symmetry.space_group_name_H-M             'I 41 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                98 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'Cytochrome c-552'                55343.602 1   1.7.2.2 ? ? ? 
2 non-polymer syn 'CALCIUM ION'                     40.078    1   ?       ? ? ? 
3 non-polymer syn 'SULFITE ION'                     80.063    1   ?       ? ? ? 
4 non-polymer syn 'YTTRIUM ION'                     88.906    3   ?       ? ? ? 
5 non-polymer syn 'ACETATE ION'                     59.044    2   ?       ? ? ? 
6 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487   5   ?       ? ? ? 
7 water       nat water                             18.015    639 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Ammonia-forming cytochrome c nitrite reductase, Cytochrome c nitrite reductase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SNINEREKERVALNKTAHSQGIEGKAMSEEWARYYPRQFDSWKKTKESDNITDMLKEKPALVVAWAGYPFSKDYNAPRGH
YYALQDNINTLRTGAPVDGKTGPLPSACWTCKSPDVPRIIEQDGELEYFTGKWAKYGDEIVNTIGCYNCHDDKSAELKSK
VPYLDRGLSAAGFKTFAESTHQEKRSLVCAQCHVEYYFKKTEWKDDKGVDKTAMVVTLPWSKGISTEQMEAYYDEINFAD
WTHGISKTPMLKAQHPDWELYKTGIHGQKGVSCADCHMPYTQEGAVKYSDHKVGNPLDNMDKSCMNCHRESEQKLKDIVK
QKFERKEFLQDIAFDNIGKAHLETGKAMELGATDAELKEIRTHIRHAQWRADMAIAGHGSFFHAPEEVLRLLASGNEEAQ
KARIKLVKVLAKYGAIDYVAPDFETKEKAQKLAKVDMEAFIAEKLKFKQTLEQEWKKQAIAKGRLNPESLKGVDEKSSYY
DKTKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SNINEREKERVALNKTAHSQGIEGKAMSEEWARYYPRQFDSWKKTKESDNITDMLKEKPALVVAWAGYPFSKDYNAPRGH
YYALQDNINTLRTGAPVDGKTGPLPSACWTCKSPDVPRIIEQDGELEYFTGKWAKYGDEIVNTIGCYNCHDDKSAELKSK
VPYLDRGLSAAGFKTFAESTHQEKRSLVCAQCHVEYYFKKTEWKDDKGVDKTAMVVTLPWSKGISTEQMEAYYDEINFAD
WTHGISKTPMLKAQHPDWELYKTGIHGQKGVSCADCHMPYTQEGAVKYSDHKVGNPLDNMDKSCMNCHRESEQKLKDIVK
QKFERKEFLQDIAFDNIGKAHLETGKAMELGATDAELKEIRTHIRHAQWRADMAIAGHGSFFHAPEEVLRLLASGNEEAQ
KARIKLVKVLAKYGAIDYVAPDFETKEKAQKLAKVDMEAFIAEKLKFKQTLEQEWKKQAIAKGRLNPESLKGVDEKSSYY
DKTKK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   ILE n 
1 4   ASN n 
1 5   GLU n 
1 6   ARG n 
1 7   GLU n 
1 8   LYS n 
1 9   GLU n 
1 10  ARG n 
1 11  VAL n 
1 12  ALA n 
1 13  LEU n 
1 14  ASN n 
1 15  LYS n 
1 16  THR n 
1 17  ALA n 
1 18  HIS n 
1 19  SER n 
1 20  GLN n 
1 21  GLY n 
1 22  ILE n 
1 23  GLU n 
1 24  GLY n 
1 25  LYS n 
1 26  ALA n 
1 27  MET n 
1 28  SER n 
1 29  GLU n 
1 30  GLU n 
1 31  TRP n 
1 32  ALA n 
1 33  ARG n 
1 34  TYR n 
1 35  TYR n 
1 36  PRO n 
1 37  ARG n 
1 38  GLN n 
1 39  PHE n 
1 40  ASP n 
1 41  SER n 
1 42  TRP n 
1 43  LYS n 
1 44  LYS n 
1 45  THR n 
1 46  LYS n 
1 47  GLU n 
1 48  SER n 
1 49  ASP n 
1 50  ASN n 
1 51  ILE n 
1 52  THR n 
1 53  ASP n 
1 54  MET n 
1 55  LEU n 
1 56  LYS n 
1 57  GLU n 
1 58  LYS n 
1 59  PRO n 
1 60  ALA n 
1 61  LEU n 
1 62  VAL n 
1 63  VAL n 
1 64  ALA n 
1 65  TRP n 
1 66  ALA n 
1 67  GLY n 
1 68  TYR n 
1 69  PRO n 
1 70  PHE n 
1 71  SER n 
1 72  LYS n 
1 73  ASP n 
1 74  TYR n 
1 75  ASN n 
1 76  ALA n 
1 77  PRO n 
1 78  ARG n 
1 79  GLY n 
1 80  HIS n 
1 81  TYR n 
1 82  TYR n 
1 83  ALA n 
1 84  LEU n 
1 85  GLN n 
1 86  ASP n 
1 87  ASN n 
1 88  ILE n 
1 89  ASN n 
1 90  THR n 
1 91  LEU n 
1 92  ARG n 
1 93  THR n 
1 94  GLY n 
1 95  ALA n 
1 96  PRO n 
1 97  VAL n 
1 98  ASP n 
1 99  GLY n 
1 100 LYS n 
1 101 THR n 
1 102 GLY n 
1 103 PRO n 
1 104 LEU n 
1 105 PRO n 
1 106 SER n 
1 107 ALA n 
1 108 CYS n 
1 109 TRP n 
1 110 THR n 
1 111 CYS n 
1 112 LYS n 
1 113 SER n 
1 114 PRO n 
1 115 ASP n 
1 116 VAL n 
1 117 PRO n 
1 118 ARG n 
1 119 ILE n 
1 120 ILE n 
1 121 GLU n 
1 122 GLN n 
1 123 ASP n 
1 124 GLY n 
1 125 GLU n 
1 126 LEU n 
1 127 GLU n 
1 128 TYR n 
1 129 PHE n 
1 130 THR n 
1 131 GLY n 
1 132 LYS n 
1 133 TRP n 
1 134 ALA n 
1 135 LYS n 
1 136 TYR n 
1 137 GLY n 
1 138 ASP n 
1 139 GLU n 
1 140 ILE n 
1 141 VAL n 
1 142 ASN n 
1 143 THR n 
1 144 ILE n 
1 145 GLY n 
1 146 CYS n 
1 147 TYR n 
1 148 ASN n 
1 149 CYS n 
1 150 HIS n 
1 151 ASP n 
1 152 ASP n 
1 153 LYS n 
1 154 SER n 
1 155 ALA n 
1 156 GLU n 
1 157 LEU n 
1 158 LYS n 
1 159 SER n 
1 160 LYS n 
1 161 VAL n 
1 162 PRO n 
1 163 TYR n 
1 164 LEU n 
1 165 ASP n 
1 166 ARG n 
1 167 GLY n 
1 168 LEU n 
1 169 SER n 
1 170 ALA n 
1 171 ALA n 
1 172 GLY n 
1 173 PHE n 
1 174 LYS n 
1 175 THR n 
1 176 PHE n 
1 177 ALA n 
1 178 GLU n 
1 179 SER n 
1 180 THR n 
1 181 HIS n 
1 182 GLN n 
1 183 GLU n 
1 184 LYS n 
1 185 ARG n 
1 186 SER n 
1 187 LEU n 
1 188 VAL n 
1 189 CYS n 
1 190 ALA n 
1 191 GLN n 
1 192 CYS n 
1 193 HIS n 
1 194 VAL n 
1 195 GLU n 
1 196 TYR n 
1 197 TYR n 
1 198 PHE n 
1 199 LYS n 
1 200 LYS n 
1 201 THR n 
1 202 GLU n 
1 203 TRP n 
1 204 LYS n 
1 205 ASP n 
1 206 ASP n 
1 207 LYS n 
1 208 GLY n 
1 209 VAL n 
1 210 ASP n 
1 211 LYS n 
1 212 THR n 
1 213 ALA n 
1 214 MET n 
1 215 VAL n 
1 216 VAL n 
1 217 THR n 
1 218 LEU n 
1 219 PRO n 
1 220 TRP n 
1 221 SER n 
1 222 LYS n 
1 223 GLY n 
1 224 ILE n 
1 225 SER n 
1 226 THR n 
1 227 GLU n 
1 228 GLN n 
1 229 MET n 
1 230 GLU n 
1 231 ALA n 
1 232 TYR n 
1 233 TYR n 
1 234 ASP n 
1 235 GLU n 
1 236 ILE n 
1 237 ASN n 
1 238 PHE n 
1 239 ALA n 
1 240 ASP n 
1 241 TRP n 
1 242 THR n 
1 243 HIS n 
1 244 GLY n 
1 245 ILE n 
1 246 SER n 
1 247 LYS n 
1 248 THR n 
1 249 PRO n 
1 250 MET n 
1 251 LEU n 
1 252 LYS n 
1 253 ALA n 
1 254 GLN n 
1 255 HIS n 
1 256 PRO n 
1 257 ASP n 
1 258 TRP n 
1 259 GLU n 
1 260 LEU n 
1 261 TYR n 
1 262 LYS n 
1 263 THR n 
1 264 GLY n 
1 265 ILE n 
1 266 HIS n 
1 267 GLY n 
1 268 GLN n 
1 269 LYS n 
1 270 GLY n 
1 271 VAL n 
1 272 SER n 
1 273 CYS n 
1 274 ALA n 
1 275 ASP n 
1 276 CYS n 
1 277 HIS n 
1 278 MET n 
1 279 PRO n 
1 280 TYR n 
1 281 THR n 
1 282 GLN n 
1 283 GLU n 
1 284 GLY n 
1 285 ALA n 
1 286 VAL n 
1 287 LYS n 
1 288 TYR n 
1 289 SER n 
1 290 ASP n 
1 291 HIS n 
1 292 LYS n 
1 293 VAL n 
1 294 GLY n 
1 295 ASN n 
1 296 PRO n 
1 297 LEU n 
1 298 ASP n 
1 299 ASN n 
1 300 MET n 
1 301 ASP n 
1 302 LYS n 
1 303 SER n 
1 304 CYS n 
1 305 MET n 
1 306 ASN n 
1 307 CYS n 
1 308 HIS n 
1 309 ARG n 
1 310 GLU n 
1 311 SER n 
1 312 GLU n 
1 313 GLN n 
1 314 LYS n 
1 315 LEU n 
1 316 LYS n 
1 317 ASP n 
1 318 ILE n 
1 319 VAL n 
1 320 LYS n 
1 321 GLN n 
1 322 LYS n 
1 323 PHE n 
1 324 GLU n 
1 325 ARG n 
1 326 LYS n 
1 327 GLU n 
1 328 PHE n 
1 329 LEU n 
1 330 GLN n 
1 331 ASP n 
1 332 ILE n 
1 333 ALA n 
1 334 PHE n 
1 335 ASP n 
1 336 ASN n 
1 337 ILE n 
1 338 GLY n 
1 339 LYS n 
1 340 ALA n 
1 341 HIS n 
1 342 LEU n 
1 343 GLU n 
1 344 THR n 
1 345 GLY n 
1 346 LYS n 
1 347 ALA n 
1 348 MET n 
1 349 GLU n 
1 350 LEU n 
1 351 GLY n 
1 352 ALA n 
1 353 THR n 
1 354 ASP n 
1 355 ALA n 
1 356 GLU n 
1 357 LEU n 
1 358 LYS n 
1 359 GLU n 
1 360 ILE n 
1 361 ARG n 
1 362 THR n 
1 363 HIS n 
1 364 ILE n 
1 365 ARG n 
1 366 HIS n 
1 367 ALA n 
1 368 GLN n 
1 369 TRP n 
1 370 ARG n 
1 371 ALA n 
1 372 ASP n 
1 373 MET n 
1 374 ALA n 
1 375 ILE n 
1 376 ALA n 
1 377 GLY n 
1 378 HIS n 
1 379 GLY n 
1 380 SER n 
1 381 PHE n 
1 382 PHE n 
1 383 HIS n 
1 384 ALA n 
1 385 PRO n 
1 386 GLU n 
1 387 GLU n 
1 388 VAL n 
1 389 LEU n 
1 390 ARG n 
1 391 LEU n 
1 392 LEU n 
1 393 ALA n 
1 394 SER n 
1 395 GLY n 
1 396 ASN n 
1 397 GLU n 
1 398 GLU n 
1 399 ALA n 
1 400 GLN n 
1 401 LYS n 
1 402 ALA n 
1 403 ARG n 
1 404 ILE n 
1 405 LYS n 
1 406 LEU n 
1 407 VAL n 
1 408 LYS n 
1 409 VAL n 
1 410 LEU n 
1 411 ALA n 
1 412 LYS n 
1 413 TYR n 
1 414 GLY n 
1 415 ALA n 
1 416 ILE n 
1 417 ASP n 
1 418 TYR n 
1 419 VAL n 
1 420 ALA n 
1 421 PRO n 
1 422 ASP n 
1 423 PHE n 
1 424 GLU n 
1 425 THR n 
1 426 LYS n 
1 427 GLU n 
1 428 LYS n 
1 429 ALA n 
1 430 GLN n 
1 431 LYS n 
1 432 LEU n 
1 433 ALA n 
1 434 LYS n 
1 435 VAL n 
1 436 ASP n 
1 437 MET n 
1 438 GLU n 
1 439 ALA n 
1 440 PHE n 
1 441 ILE n 
1 442 ALA n 
1 443 GLU n 
1 444 LYS n 
1 445 LEU n 
1 446 LYS n 
1 447 PHE n 
1 448 LYS n 
1 449 GLN n 
1 450 THR n 
1 451 LEU n 
1 452 GLU n 
1 453 GLN n 
1 454 GLU n 
1 455 TRP n 
1 456 LYS n 
1 457 LYS n 
1 458 GLN n 
1 459 ALA n 
1 460 ILE n 
1 461 ALA n 
1 462 LYS n 
1 463 GLY n 
1 464 ARG n 
1 465 LEU n 
1 466 ASN n 
1 467 PRO n 
1 468 GLU n 
1 469 SER n 
1 470 LEU n 
1 471 LYS n 
1 472 GLY n 
1 473 VAL n 
1 474 ASP n 
1 475 GLU n 
1 476 LYS n 
1 477 SER n 
1 478 SER n 
1 479 TYR n 
1 480 TYR n 
1 481 ASP n 
1 482 LYS n 
1 483 THR n 
1 484 LYS n 
1 485 LYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Wolinella succinogenes' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      844 
_entity_src_nat.genus                      Wolinella 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NRFA_WOLSU 
_struct_ref.pdbx_db_accession          Q9S1E5 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SNINEREKERVALNKTAHSQGIEGKAMSEEWARYYPRQFDSWKKTKESDNITDMLKEKPALVVAWAGYPFSKDYNAPRGH
YYALQDNINTLRTGAPVDGKTGPLPSACWTCKSPDVPRIIEQDGELEYFTGKWAKYGDEIVNTIGCYNCHDDKSAELKSK
VPYLDRGLSAAGFKTFAESTHQEKRSLVCAQCHVEYYFKKTEWKDDKGVDKTAMVVTLPWSKGISTEQMEAYYDEINFAD
WTHGISKTPMLKAQHPDWELYKTGIHGQKGVSCADCHMPYTQEGAVKYSDHKVGNPLDNMDKSCMNCHRESEQKLKDIVK
QKFERKEFLQDIAFDNIGKAHLETGKAMELGATDAELKEIRTHIRHAQWRADMAIAGHGSFFHAPEEVLRLLASGNEEAQ
KARIKLVKVLAKYGAIDYVAPDFETKEKAQKLAKVDMEAFIAEKLKFKQTLEQEWKKQAIAKGRLNPESLKGVDEKSSYY
DKTKK
;
_struct_ref.pdbx_align_begin           23 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3BNF 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 485 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9S1E5 
_struct_ref_seq.db_align_beg                  23 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  507 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       23 
_struct_ref_seq.pdbx_auth_seq_align_end       507 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'                     ?    'C2 H3 O2 -1'      59.044  
ALA 'L-peptide linking' y ALANINE                           ?    'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                          ?    'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ?    'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ?    'C4 H7 N O4'       133.103 
CA  non-polymer         . 'CALCIUM ION'                     ?    'Ca 2'             40.078  
CYS 'L-peptide linking' y CYSTEINE                          ?    'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ?    'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ?    'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                           ?    'C2 H5 N O2'       75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                         ?    'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                             ?    'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ?    'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                           ?    'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                            ?    'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                        ?    'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                     ?    'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                           ?    'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                            ?    'C3 H7 N O3'       105.093 
SO3 non-polymer         . 'SULFITE ION'                     ?    'O3 S -2'          80.063  
THR 'L-peptide linking' y THREONINE                         ?    'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ?    'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                          ?    'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                            ?    'C5 H11 N O2'      117.146 
Y1  non-polymer         . 'YTTRIUM ION'                     ?    'Y 2'              88.906  
# 
_exptl.entry_id          3BNF 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.01 
_exptl_crystal.density_percent_sol   59.14 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.7 
_exptl_crystal_grow.pdbx_details    
'PEG 4000, ammonium sulfate, yttrium chloride, acetate buffer, pH 5.7, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 345 mm plate' 
_diffrn_detector.pdbx_collection_date   2007-09-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    graphite 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0600 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE BW7B' 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, Hamburg' 
_diffrn_source.pdbx_synchrotron_beamline   BW7B 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0600 
# 
_reflns.entry_id                     3BNF 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.d_resolution_high            1.7 
_reflns.d_resolution_low             25.0 
_reflns.number_all                   74335 
_reflns.number_obs                   73146 
_reflns.percent_possible_obs         98.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.069 
_reflns.pdbx_netI_over_sigmaI        16.4 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.79 
_reflns_shell.percent_possible_all   96.9 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.595 
_reflns_shell.meanI_over_sigI_obs    2.0 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3BNF 
_refine.ls_number_reflns_obs                     68471 
_refine.ls_number_reflns_all                     74334 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             22.31 
_refine.ls_d_res_high                            1.70 
_refine.ls_percent_reflns_obs                    97.23 
_refine.ls_R_factor_obs                          0.235 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.23266 
_refine.ls_R_factor_R_free                       0.27954 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  3660 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.939 
_refine.correlation_coeff_Fo_to_Fc_free          0.911 
_refine.B_iso_mean                               30.272 
_refine.aniso_B[1][1]                            0.31 
_refine.aniso_B[2][2]                            0.31 
_refine.aniso_B[3][3]                            -0.62 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1FS7 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.124 
_refine.pdbx_overall_ESU_R_Free                  0.127 
_refine.overall_SU_ML                            0.103 
_refine.overall_SU_B                             3.125 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3815 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         231 
_refine_hist.number_atoms_solvent             639 
_refine_hist.number_atoms_total               4685 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        22.31 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.019  0.022  ? 4157 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.778  2.109  ? 5672 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.903  5.000  ? 480  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.592 25.000 ? 182  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.451 15.000 ? 707  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.732 15.000 ? 14   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.136  0.200  ? 542  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.009  0.020  ? 3193 'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.263  0.200  ? 2567 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.303  0.200  ? 2800 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.206  0.200  ? 571  'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          0.054  0.200  ? 4    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.256  0.200  ? 65   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.194  0.200  ? 29   'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined 0.038  0.200  ? 1    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.068  1.500  ? 2455 'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.556  2.000  ? 3809 'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.550  3.000  ? 2021 'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.546  4.500  ? 1853 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.699 
_refine_ls_shell.d_res_low                        1.743 
_refine_ls_shell.number_reflns_R_work             4875 
_refine_ls_shell.R_factor_R_work                  0.326 
_refine_ls_shell.percent_reflns_obs               95.14 
_refine_ls_shell.R_factor_R_free                  0.359 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             272 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3BNF 
_struct.title                     'W. succinogenes NrfA Sulfite Complex' 
_struct.pdbx_descriptor           'Cytochrome c-552 (E.C.1.7.2.2)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3BNF 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
;c-type cytochrome, nitrite reductase, sulfite complex, Calcium, Electron transport, Heme, Iron, Metal-binding, Oxidoreductase, Periplasm, Transport
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
H N N 5 ? 
I N N 6 ? 
J N N 6 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
N N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  MET A 27  ? ALA A 32  ? MET A 49  ALA A 54  5 ? 6  
HELX_P HELX_P2  2  TYR A 35  ? LYS A 44  ? TYR A 57  LYS A 66  1 ? 10 
HELX_P HELX_P3  3  THR A 45  ? SER A 48  ? THR A 67  SER A 70  5 ? 4  
HELX_P HELX_P4  4  ASP A 53  ? LYS A 58  ? ASP A 75  LYS A 80  1 ? 6  
HELX_P HELX_P5  5  PRO A 59  ? TRP A 65  ? PRO A 81  TRP A 87  1 ? 7  
HELX_P HELX_P6  6  TYR A 68  ? LYS A 72  ? TYR A 90  LYS A 94  5 ? 5  
HELX_P HELX_P7  7  GLY A 79  ? TYR A 81  ? GLY A 101 TYR A 103 5 ? 3  
HELX_P HELX_P8  8  TYR A 82  ? THR A 90  ? TYR A 104 THR A 112 1 ? 9  
HELX_P HELX_P9  9  LEU A 91  ? GLY A 94  ? LEU A 113 GLY A 116 5 ? 4  
HELX_P HELX_P10 10 PRO A 105 ? THR A 110 ? PRO A 127 THR A 132 5 ? 6  
HELX_P HELX_P11 11 PRO A 114 ? GLY A 124 ? PRO A 136 GLY A 146 1 ? 11 
HELX_P HELX_P12 12 GLY A 124 ? PHE A 129 ? GLY A 146 PHE A 151 1 ? 6  
HELX_P HELX_P13 13 LYS A 132 ? GLY A 137 ? LYS A 154 GLY A 159 5 ? 6  
HELX_P HELX_P14 14 GLY A 145 ? CYS A 149 ? GLY A 167 CYS A 171 5 ? 5  
HELX_P HELX_P15 15 VAL A 161 ? ALA A 171 ? VAL A 183 ALA A 193 1 ? 11 
HELX_P HELX_P16 16 THR A 180 ? GLN A 191 ? THR A 202 GLN A 213 1 ? 12 
HELX_P HELX_P17 17 SER A 225 ? ILE A 236 ? SER A 247 ILE A 258 1 ? 12 
HELX_P HELX_P18 18 PRO A 256 ? LYS A 262 ? PRO A 278 LYS A 284 1 ? 7  
HELX_P HELX_P19 19 GLY A 264 ? LYS A 269 ? GLY A 286 LYS A 291 1 ? 6  
HELX_P HELX_P20 20 SER A 272 ? MET A 278 ? SER A 294 MET A 300 1 ? 7  
HELX_P HELX_P21 21 ASN A 295 ? ASP A 298 ? ASN A 317 ASP A 320 5 ? 4  
HELX_P HELX_P22 22 ASN A 299 ? CYS A 304 ? ASN A 321 CYS A 326 1 ? 6  
HELX_P HELX_P23 23 SER A 311 ? GLY A 351 ? SER A 333 GLY A 373 1 ? 41 
HELX_P HELX_P24 24 THR A 353 ? ALA A 376 ? THR A 375 ALA A 398 1 ? 24 
HELX_P HELX_P25 25 GLY A 379 ? ALA A 384 ? GLY A 401 ALA A 406 1 ? 6  
HELX_P HELX_P26 26 ALA A 384 ? TYR A 413 ? ALA A 406 TYR A 435 1 ? 30 
HELX_P HELX_P27 27 THR A 425 ? ALA A 433 ? THR A 447 ALA A 455 1 ? 9  
HELX_P HELX_P28 28 ASP A 436 ? THR A 450 ? ASP A 458 THR A 472 1 ? 15 
HELX_P HELX_P29 29 THR A 450 ? LYS A 462 ? THR A 472 LYS A 484 1 ? 13 
HELX_P HELX_P30 30 ASN A 466 ? LYS A 471 ? ASN A 488 LYS A 493 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A HIS 80  NE2 ? ? ? 1_555 K HEM . FE ? ? A HIS 102 A HEM 510 1_555 ? ? ? ? ? ? ? 2.128 ? 
metalc2  metalc ? ? A LYS 112 NZ  ? ? ? 1_555 I HEM . FE ? ? A LYS 134 A HEM 508 1_555 ? ? ? ? ? ? ? 1.960 ? 
metalc3  metalc ? ? A HIS 150 NE2 ? ? ? 1_555 J HEM . FE ? ? A HIS 172 A HEM 509 1_555 ? ? ? ? ? ? ? 1.901 ? 
metalc4  metalc ? ? A HIS 193 NE2 ? ? ? 1_555 K HEM . FE ? ? A HIS 215 A HEM 510 1_555 ? ? ? ? ? ? ? 1.938 ? 
metalc5  metalc ? ? A GLU 195 OE1 ? ? ? 1_555 B CA  . CA ? ? A GLU 217 A CA  513 1_555 ? ? ? ? ? ? ? 2.434 ? 
metalc6  metalc ? ? A GLU 195 OE2 ? ? ? 1_555 B CA  . CA ? ? A GLU 217 A CA  513 1_555 ? ? ? ? ? ? ? 2.565 ? 
metalc7  metalc ? ? A TYR 196 O   ? ? ? 1_555 B CA  . CA ? ? A TYR 218 A CA  513 1_555 ? ? ? ? ? ? ? 2.489 ? 
metalc8  metalc ? ? A LYS 252 O   ? ? ? 1_555 B CA  . CA ? ? A LYS 274 A CA  513 1_555 ? ? ? ? ? ? ? 2.326 ? 
metalc9  metalc ? ? A GLN 254 OE1 ? ? ? 1_555 B CA  . CA ? ? A GLN 276 A CA  513 1_555 ? ? ? ? ? ? ? 2.435 ? 
metalc10 metalc ? ? A HIS 266 NE2 ? ? ? 1_555 M HEM . FE ? ? A HIS 288 A HEM 512 1_555 ? ? ? ? ? ? ? 1.936 ? 
metalc11 metalc ? ? A HIS 277 NE2 ? ? ? 1_555 L HEM . FE ? ? A HIS 299 A HEM 511 1_555 ? ? ? ? ? ? ? 1.936 ? 
metalc12 metalc ? ? A HIS 291 NE2 ? ? ? 1_555 J HEM . FE ? ? A HIS 313 A HEM 509 1_555 ? ? ? ? ? ? ? 1.917 ? 
metalc13 metalc ? ? A HIS 308 NE2 ? ? ? 1_555 M HEM . FE ? ? A HIS 330 A HEM 512 1_555 ? ? ? ? ? ? ? 2.142 ? 
metalc14 metalc ? ? A HIS 383 NE2 ? ? ? 1_555 L HEM . FE ? ? A HIS 405 A HEM 511 1_555 ? ? ? ? ? ? ? 1.982 ? 
metalc15 metalc ? ? B CA  .   CA  ? ? ? 1_555 N HOH . O  ? ? A CA  513 A HOH 706 1_555 ? ? ? ? ? ? ? 2.473 ? 
metalc16 metalc ? ? B CA  .   CA  ? ? ? 1_555 N HOH . O  ? ? A CA  513 A HOH 590 1_555 ? ? ? ? ? ? ? 2.427 ? 
metalc17 metalc ? ? C SO3 .   S   ? ? ? 1_555 I HEM . FE ? ? A SO3 1   A HEM 508 1_555 ? ? ? ? ? ? ? 2.283 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 197 ? LYS A 204 ? TYR A 219 LYS A 226 
A 2 ASP A 210 ? THR A 217 ? ASP A 232 THR A 239 
B 1 TRP A 241 ? THR A 242 ? TRP A 263 THR A 264 
B 2 PRO A 249 ? MET A 250 ? PRO A 271 MET A 272 
C 1 TYR A 280 ? GLU A 283 ? TYR A 302 GLU A 305 
C 2 VAL A 286 ? SER A 289 ? VAL A 308 SER A 311 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 201 ? N THR A 223 O ALA A 213 ? O ALA A 235 
B 1 2 N TRP A 241 ? N TRP A 263 O MET A 250 ? O MET A 272 
C 1 2 N THR A 281 ? N THR A 303 O TYR A 288 ? O TYR A 310 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 513'  
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO3 A 1'   
AC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE Y1 A 2'    
AC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE Y1 A 3'    
AC5 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE Y1 A 4'    
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ACT A 5'   
AC7 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE ACT A 6'   
AC8 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE HEM A 508' 
AC9 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE HEM A 509' 
BC1 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE HEM A 510' 
BC2 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE HEM A 511' 
BC3 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE HEM A 512' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 6  GLU A 195 ? GLU A 217  . ? 1_555  ? 
2   AC1 6  TYR A 196 ? TYR A 218  . ? 1_555  ? 
3   AC1 6  LYS A 252 ? LYS A 274  . ? 1_555  ? 
4   AC1 6  GLN A 254 ? GLN A 276  . ? 1_555  ? 
5   AC1 6  HOH N .   ? HOH A 590  . ? 1_555  ? 
6   AC1 6  HOH N .   ? HOH A 706  . ? 1_555  ? 
7   AC2 6  PHE A 70  ? PHE A 92   . ? 1_555  ? 
8   AC2 6  ARG A 92  ? ARG A 114  . ? 1_555  ? 
9   AC2 6  TYR A 196 ? TYR A 218  . ? 1_555  ? 
10  AC2 6  HIS A 255 ? HIS A 277  . ? 1_555  ? 
11  AC2 6  HOH N .   ? HOH A 559  . ? 1_555  ? 
12  AC2 6  HOH N .   ? HOH A 1042 . ? 1_555  ? 
13  AC3 7  GLU A 30  ? GLU A 52   . ? 1_555  ? 
14  AC3 7  ASP A 422 ? ASP A 444  . ? 12_555 ? 
15  AC3 7  HOH N .   ? HOH A 659  . ? 1_555  ? 
16  AC3 7  HOH N .   ? HOH A 776  . ? 1_555  ? 
17  AC3 7  HOH N .   ? HOH A 777  . ? 1_555  ? 
18  AC3 7  HOH N .   ? HOH A 778  . ? 1_555  ? 
19  AC3 7  HOH N .   ? HOH A 781  . ? 1_555  ? 
20  AC4 3  PRO A 77  ? PRO A 99   . ? 1_555  ? 
21  AC4 3  HOH N .   ? HOH A 784  . ? 1_555  ? 
22  AC4 3  HOH N .   ? HOH A 1069 . ? 1_555  ? 
23  AC5 1  GLU A 386 ? GLU A 408  . ? 10_565 ? 
24  AC6 5  GLY A 264 ? GLY A 286  . ? 1_555  ? 
25  AC6 5  ILE A 265 ? ILE A 287  . ? 1_555  ? 
26  AC6 5  PRO A 385 ? PRO A 407  . ? 1_555  ? 
27  AC6 5  GLU A 386 ? GLU A 408  . ? 10_565 ? 
28  AC6 5  HOH N .   ? HOH A 827  . ? 1_555  ? 
29  AC7 8  GLY A 21  ? GLY A 43   . ? 1_555  ? 
30  AC7 8  ILE A 22  ? ILE A 44   . ? 1_555  ? 
31  AC7 8  GLU A 23  ? GLU A 45   . ? 1_555  ? 
32  AC7 8  TYR A 34  ? TYR A 56   . ? 1_555  ? 
33  AC7 8  HOH N .   ? HOH A 659  . ? 1_555  ? 
34  AC7 8  HOH N .   ? HOH A 776  . ? 1_555  ? 
35  AC7 8  HOH N .   ? HOH A 781  . ? 1_555  ? 
36  AC7 8  HOH N .   ? HOH A 813  . ? 1_555  ? 
37  AC8 23 TYR A 74  ? TYR A 96   . ? 1_555  ? 
38  AC8 23 ASN A 75  ? ASN A 97   . ? 1_555  ? 
39  AC8 23 ASP A 86  ? ASP A 108  . ? 1_555  ? 
40  AC8 23 ASN A 87  ? ASN A 109  . ? 1_555  ? 
41  AC8 23 THR A 90  ? THR A 112  . ? 1_555  ? 
42  AC8 23 ARG A 92  ? ARG A 114  . ? 1_555  ? 
43  AC8 23 THR A 93  ? THR A 115  . ? 1_555  ? 
44  AC8 23 LEU A 104 ? LEU A 126  . ? 1_555  ? 
45  AC8 23 CYS A 108 ? CYS A 130  . ? 1_555  ? 
46  AC8 23 CYS A 111 ? CYS A 133  . ? 1_555  ? 
47  AC8 23 LYS A 112 ? LYS A 134  . ? 1_555  ? 
48  AC8 23 CYS A 192 ? CYS A 214  . ? 1_555  ? 
49  AC8 23 HIS A 193 ? HIS A 215  . ? 1_555  ? 
50  AC8 23 TYR A 196 ? TYR A 218  . ? 1_555  ? 
51  AC8 23 HIS A 255 ? HIS A 277  . ? 1_555  ? 
52  AC8 23 ALA A 376 ? ALA A 398  . ? 1_555  ? 
53  AC8 23 HIS A 378 ? HIS A 400  . ? 1_555  ? 
54  AC8 23 HOH N .   ? HOH A 538  . ? 1_555  ? 
55  AC8 23 HOH N .   ? HOH A 541  . ? 1_555  ? 
56  AC8 23 HOH N .   ? HOH A 559  . ? 1_555  ? 
57  AC8 23 HOH N .   ? HOH A 561  . ? 1_555  ? 
58  AC8 23 HOH N .   ? HOH A 565  . ? 1_555  ? 
59  AC8 23 HOH N .   ? HOH A 607  . ? 1_555  ? 
60  AC9 17 TYR A 35  ? TYR A 57   . ? 1_555  ? 
61  AC9 17 GLN A 38  ? GLN A 60   . ? 1_555  ? 
62  AC9 17 TRP A 42  ? TRP A 64   . ? 1_555  ? 
63  AC9 17 GLY A 145 ? GLY A 167  . ? 1_555  ? 
64  AC9 17 CYS A 146 ? CYS A 168  . ? 1_555  ? 
65  AC9 17 CYS A 149 ? CYS A 171  . ? 1_555  ? 
66  AC9 17 HIS A 150 ? HIS A 172  . ? 1_555  ? 
67  AC9 17 LEU A 157 ? LEU A 179  . ? 1_555  ? 
68  AC9 17 HIS A 181 ? HIS A 203  . ? 1_555  ? 
69  AC9 17 ARG A 185 ? ARG A 207  . ? 1_555  ? 
70  AC9 17 MET A 278 ? MET A 300  . ? 1_555  ? 
71  AC9 17 TYR A 280 ? TYR A 302  . ? 1_555  ? 
72  AC9 17 TYR A 288 ? TYR A 310  . ? 1_555  ? 
73  AC9 17 SER A 289 ? SER A 311  . ? 1_555  ? 
74  AC9 17 HIS A 291 ? HIS A 313  . ? 1_555  ? 
75  AC9 17 HOH N .   ? HOH A 809  . ? 1_555  ? 
76  AC9 17 HOH N .   ? HOH A 823  . ? 1_555  ? 
77  BC1 18 SER A 48  ? SER A 70   . ? 1_555  ? 
78  BC1 18 PRO A 77  ? PRO A 99   . ? 1_555  ? 
79  BC1 18 ARG A 78  ? ARG A 100  . ? 1_555  ? 
80  BC1 18 GLY A 79  ? GLY A 101  . ? 1_555  ? 
81  BC1 18 HIS A 80  ? HIS A 102  . ? 1_555  ? 
82  BC1 18 TYR A 82  ? TYR A 104  . ? 1_555  ? 
83  BC1 18 ALA A 83  ? ALA A 105  . ? 1_555  ? 
84  BC1 18 ASP A 86  ? ASP A 108  . ? 1_555  ? 
85  BC1 18 CYS A 111 ? CYS A 133  . ? 1_555  ? 
86  BC1 18 LYS A 112 ? LYS A 134  . ? 1_555  ? 
87  BC1 18 ILE A 144 ? ILE A 166  . ? 1_555  ? 
88  BC1 18 CYS A 189 ? CYS A 211  . ? 1_555  ? 
89  BC1 18 CYS A 192 ? CYS A 214  . ? 1_555  ? 
90  BC1 18 HIS A 193 ? HIS A 215  . ? 1_555  ? 
91  BC1 18 HIS A 277 ? HIS A 299  . ? 1_555  ? 
92  BC1 18 GLY A 294 ? GLY A 316  . ? 1_555  ? 
93  BC1 18 HOH N .   ? HOH A 536  . ? 1_555  ? 
94  BC1 18 HOH N .   ? HOH A 537  . ? 1_555  ? 
95  BC2 16 PRO A 77  ? PRO A 99   . ? 1_555  ? 
96  BC2 16 HIS A 193 ? HIS A 215  . ? 1_555  ? 
97  BC2 16 TYR A 261 ? TYR A 283  . ? 1_555  ? 
98  BC2 16 HIS A 266 ? HIS A 288  . ? 1_555  ? 
99  BC2 16 SER A 272 ? SER A 294  . ? 1_555  ? 
100 BC2 16 CYS A 273 ? CYS A 295  . ? 1_555  ? 
101 BC2 16 CYS A 276 ? CYS A 298  . ? 1_555  ? 
102 BC2 16 HIS A 277 ? HIS A 299  . ? 1_555  ? 
103 BC2 16 ASN A 295 ? ASN A 317  . ? 1_555  ? 
104 BC2 16 PRO A 296 ? PRO A 318  . ? 1_555  ? 
105 BC2 16 HIS A 378 ? HIS A 400  . ? 1_555  ? 
106 BC2 16 GLY A 379 ? GLY A 401  . ? 1_555  ? 
107 BC2 16 PHE A 382 ? PHE A 404  . ? 1_555  ? 
108 BC2 16 HIS A 383 ? HIS A 405  . ? 1_555  ? 
109 BC2 16 HOH N .   ? HOH A 1069 . ? 1_555  ? 
110 BC2 16 HOH N .   ? HOH A 1082 . ? 1_555  ? 
111 BC3 13 ILE A 265 ? ILE A 287  . ? 10_565 ? 
112 BC3 13 HIS A 266 ? HIS A 288  . ? 1_555  ? 
113 BC3 13 LYS A 269 ? LYS A 291  . ? 1_555  ? 
114 BC3 13 PRO A 296 ? PRO A 318  . ? 1_555  ? 
115 BC3 13 SER A 303 ? SER A 325  . ? 1_555  ? 
116 BC3 13 CYS A 304 ? CYS A 326  . ? 1_555  ? 
117 BC3 13 CYS A 307 ? CYS A 329  . ? 1_555  ? 
118 BC3 13 HIS A 308 ? HIS A 330  . ? 10_565 ? 
119 BC3 13 LYS A 322 ? LYS A 344  . ? 1_555  ? 
120 BC3 13 PHE A 382 ? PHE A 404  . ? 1_555  ? 
121 BC3 13 GLU A 386 ? GLU A 408  . ? 10_565 ? 
122 BC3 13 HOH N .   ? HOH A 718  . ? 1_555  ? 
123 BC3 13 HOH N .   ? HOH A 894  . ? 1_555  ? 
# 
_database_PDB_matrix.entry_id          3BNF 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3BNF 
_atom_sites.fract_transf_matrix[1][1]   0.008368 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008368 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005357 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
FE 
N  
O  
S  
Y  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LYS A 1 15  ? 33.429 66.867 49.907  1.00 43.12 ? 37   LYS A N   1 
ATOM   2    C  CA  . LYS A 1 15  ? 34.687 66.473 49.213  1.00 42.51 ? 37   LYS A CA  1 
ATOM   3    C  C   . LYS A 1 15  ? 34.857 64.954 49.212  1.00 41.45 ? 37   LYS A C   1 
ATOM   4    O  O   . LYS A 1 15  ? 34.321 64.273 50.092  1.00 41.41 ? 37   LYS A O   1 
ATOM   5    C  CB  . LYS A 1 15  ? 35.901 67.156 49.845  1.00 43.20 ? 37   LYS A CB  1 
ATOM   6    C  CG  . LYS A 1 15  ? 36.772 66.249 50.709  1.00 45.30 ? 37   LYS A CG  1 
ATOM   7    C  CD  . LYS A 1 15  ? 38.263 66.413 50.408  1.00 47.15 ? 37   LYS A CD  1 
ATOM   8    C  CE  . LYS A 1 15  ? 38.669 67.883 50.127  1.00 48.55 ? 37   LYS A CE  1 
ATOM   9    N  NZ  . LYS A 1 15  ? 39.976 68.229 50.815  1.00 49.31 ? 37   LYS A NZ  1 
ATOM   10   N  N   . THR A 1 16  ? 35.608 64.441 48.233  1.00 39.39 ? 38   THR A N   1 
ATOM   11   C  CA  . THR A 1 16  ? 35.683 63.000 47.968  1.00 37.96 ? 38   THR A CA  1 
ATOM   12   C  C   . THR A 1 16  ? 37.007 62.422 48.443  1.00 37.05 ? 38   THR A C   1 
ATOM   13   O  O   . THR A 1 16  ? 37.859 63.156 48.929  1.00 37.13 ? 38   THR A O   1 
ATOM   14   C  CB  . THR A 1 16  ? 35.568 62.680 46.452  1.00 37.97 ? 38   THR A CB  1 
ATOM   15   O  OG1 . THR A 1 16  ? 36.736 63.178 45.769  1.00 36.38 ? 38   THR A OG1 1 
ATOM   16   C  CG2 . THR A 1 16  ? 34.307 63.318 45.872  1.00 39.09 ? 38   THR A CG2 1 
ATOM   17   N  N   . ALA A 1 17  ? 37.155 61.109 48.247  1.00 36.48 ? 39   ALA A N   1 
ATOM   18   C  CA  . ALA A 1 17  ? 38.365 60.357 48.596  1.00 35.92 ? 39   ALA A CA  1 
ATOM   19   C  C   . ALA A 1 17  ? 39.400 60.488 47.478  1.00 35.63 ? 39   ALA A C   1 
ATOM   20   O  O   . ALA A 1 17  ? 40.480 59.895 47.564  1.00 36.59 ? 39   ALA A O   1 
ATOM   21   C  CB  . ALA A 1 17  ? 38.011 58.872 48.822  1.00 35.16 ? 39   ALA A CB  1 
ATOM   22   N  N   . HIS A 1 18  ? 39.066 61.257 46.437  1.00 35.19 ? 40   HIS A N   1 
ATOM   23   C  CA  . HIS A 1 18  ? 39.979 61.526 45.308  1.00 33.20 ? 40   HIS A CA  1 
ATOM   24   C  C   . HIS A 1 18  ? 40.001 63.011 44.966  1.00 33.32 ? 40   HIS A C   1 
ATOM   25   O  O   . HIS A 1 18  ? 40.069 63.393 43.787  1.00 34.21 ? 40   HIS A O   1 
ATOM   26   C  CB  . HIS A 1 18  ? 39.586 60.696 44.074  1.00 33.35 ? 40   HIS A CB  1 
ATOM   27   C  CG  . HIS A 1 18  ? 38.141 60.839 43.700  1.00 30.24 ? 40   HIS A CG  1 
ATOM   28   N  ND1 . HIS A 1 18  ? 37.710 61.742 42.753  1.00 28.78 ? 40   HIS A ND1 1 
ATOM   29   C  CD2 . HIS A 1 18  ? 37.029 60.251 44.198  1.00 32.55 ? 40   HIS A CD2 1 
ATOM   30   C  CE1 . HIS A 1 18  ? 36.396 61.663 42.648  1.00 30.68 ? 40   HIS A CE1 1 
ATOM   31   N  NE2 . HIS A 1 18  ? 35.956 60.775 43.526  1.00 28.28 ? 40   HIS A NE2 1 
ATOM   32   N  N   . SER A 1 19  ? 39.976 63.867 45.984  1.00 32.76 ? 41   SER A N   1 
ATOM   33   C  CA  . SER A 1 19  ? 39.878 65.307 45.750  1.00 33.82 ? 41   SER A CA  1 
ATOM   34   C  C   . SER A 1 19  ? 40.929 65.911 44.794  1.00 33.78 ? 41   SER A C   1 
ATOM   35   O  O   . SER A 1 19  ? 40.734 67.012 44.273  1.00 34.21 ? 41   SER A O   1 
ATOM   36   C  CB  . SER A 1 19  ? 39.917 66.054 47.072  1.00 34.49 ? 41   SER A CB  1 
ATOM   37   O  OG  . SER A 1 19  ? 41.204 65.922 47.625  1.00 37.54 ? 41   SER A OG  1 
ATOM   38   N  N   . GLN A 1 20  ? 42.025 65.200 44.527  1.00 34.00 ? 42   GLN A N   1 
ATOM   39   C  CA  . GLN A 1 20  ? 43.083 65.763 43.684  1.00 34.26 ? 42   GLN A CA  1 
ATOM   40   C  C   . GLN A 1 20  ? 43.078 65.180 42.251  1.00 34.05 ? 42   GLN A C   1 
ATOM   41   O  O   . GLN A 1 20  ? 43.912 65.520 41.409  1.00 32.76 ? 42   GLN A O   1 
ATOM   42   C  CB  . GLN A 1 20  ? 44.442 65.590 44.365  1.00 35.50 ? 42   GLN A CB  1 
ATOM   43   C  CG  . GLN A 1 20  ? 44.497 66.258 45.753  1.00 39.24 ? 42   GLN A CG  1 
ATOM   44   C  CD  . GLN A 1 20  ? 44.020 67.706 45.766  1.00 44.57 ? 42   GLN A CD  1 
ATOM   45   O  OE1 . GLN A 1 20  ? 44.283 68.492 44.837  1.00 47.78 ? 42   GLN A OE1 1 
ATOM   46   N  NE2 . GLN A 1 20  ? 43.317 68.075 46.847  1.00 46.99 ? 42   GLN A NE2 1 
ATOM   47   N  N   . GLY A 1 21  ? 42.099 64.317 41.996  1.00 33.29 ? 43   GLY A N   1 
ATOM   48   C  CA  . GLY A 1 21  ? 41.937 63.768 40.680  1.00 31.67 ? 43   GLY A CA  1 
ATOM   49   C  C   . GLY A 1 21  ? 42.249 62.313 40.728  1.00 31.26 ? 43   GLY A C   1 
ATOM   50   O  O   . GLY A 1 21  ? 42.653 61.777 41.788  1.00 31.81 ? 43   GLY A O   1 
ATOM   51   N  N   . ILE A 1 22  ? 41.991 61.644 39.604  1.00 29.91 ? 44   ILE A N   1 
ATOM   52   C  CA  . ILE A 1 22  ? 42.259 60.231 39.530  1.00 29.08 ? 44   ILE A CA  1 
ATOM   53   C  C   . ILE A 1 22  ? 43.260 59.993 38.393  1.00 29.21 ? 44   ILE A C   1 
ATOM   54   O  O   . ILE A 1 22  ? 42.977 60.294 37.224  1.00 29.02 ? 44   ILE A O   1 
ATOM   55   C  CB  . ILE A 1 22  ? 40.957 59.394 39.288  1.00 28.36 ? 44   ILE A CB  1 
ATOM   56   C  CG1 . ILE A 1 22  ? 39.962 59.630 40.419  1.00 26.21 ? 44   ILE A CG1 1 
ATOM   57   C  CG2 . ILE A 1 22  ? 41.316 57.909 39.100  1.00 28.66 ? 44   ILE A CG2 1 
ATOM   58   C  CD1 . ILE A 1 22  ? 38.624 58.907 40.275  1.00 31.06 ? 44   ILE A CD1 1 
ATOM   59   N  N   . GLU A 1 23  ? 44.424 59.444 38.745  1.00 29.20 ? 45   GLU A N   1 
ATOM   60   C  CA  . GLU A 1 23  ? 45.410 58.996 37.756  1.00 28.85 ? 45   GLU A CA  1 
ATOM   61   C  C   . GLU A 1 23  ? 44.816 57.876 36.911  1.00 27.02 ? 45   GLU A C   1 
ATOM   62   O  O   . GLU A 1 23  ? 44.397 56.857 37.449  1.00 26.38 ? 45   GLU A O   1 
ATOM   63   C  CB  . GLU A 1 23  ? 46.660 58.432 38.478  1.00 29.00 ? 45   GLU A CB  1 
ATOM   64   C  CG  . GLU A 1 23  ? 47.885 58.401 37.605  1.00 32.47 ? 45   GLU A CG  1 
ATOM   65   C  CD  . GLU A 1 23  ? 49.083 57.776 38.313  1.00 31.88 ? 45   GLU A CD  1 
ATOM   66   O  OE1 . GLU A 1 23  ? 49.088 57.715 39.571  1.00 34.29 ? 45   GLU A OE1 1 
ATOM   67   O  OE2 . GLU A 1 23  ? 50.020 57.315 37.614  1.00 39.30 ? 45   GLU A OE2 1 
ATOM   68   N  N   . GLY A 1 24  ? 44.819 58.057 35.591  1.00 26.97 ? 46   GLY A N   1 
ATOM   69   C  CA  . GLY A 1 24  ? 44.288 57.055 34.670  1.00 27.42 ? 46   GLY A CA  1 
ATOM   70   C  C   . GLY A 1 24  ? 42.763 57.118 34.646  1.00 28.31 ? 46   GLY A C   1 
ATOM   71   O  O   . GLY A 1 24  ? 42.097 56.114 34.412  1.00 28.81 ? 46   GLY A O   1 
ATOM   72   N  N   . LYS A 1 25  ? 42.240 58.322 34.866  1.00 28.61 ? 47   LYS A N   1 
ATOM   73   C  CA  . LYS A 1 25  ? 40.776 58.613 34.907  1.00 28.77 ? 47   LYS A CA  1 
ATOM   74   C  C   . LYS A 1 25  ? 39.995 58.042 33.712  1.00 28.58 ? 47   LYS A C   1 
ATOM   75   O  O   . LYS A 1 25  ? 38.869 57.544 33.840  1.00 28.20 ? 47   LYS A O   1 
ATOM   76   C  CB  . LYS A 1 25  ? 40.565 60.131 35.055  1.00 29.42 ? 47   LYS A CB  1 
ATOM   77   C  CG  . LYS A 1 25  ? 41.061 61.003 33.889  1.00 31.18 ? 47   LYS A CG  1 
ATOM   78   C  CD  . LYS A 1 25  ? 41.388 62.453 34.342  1.00 29.86 ? 47   LYS A CD  1 
ATOM   79   C  CE  . LYS A 1 25  ? 41.891 63.251 33.147  1.00 33.11 ? 47   LYS A CE  1 
ATOM   80   N  NZ  . LYS A 1 25  ? 42.541 64.540 33.515  1.00 35.97 ? 47   LYS A NZ  1 
ATOM   81   N  N   . ALA A 1 26  ? 40.614 58.037 32.541  1.00 28.64 ? 48   ALA A N   1 
ATOM   82   C  CA  . ALA A 1 26  ? 39.862 57.561 31.371  1.00 27.63 ? 48   ALA A CA  1 
ATOM   83   C  C   . ALA A 1 26  ? 39.462 56.092 31.508  1.00 28.44 ? 48   ALA A C   1 
ATOM   84   O  O   . ALA A 1 26  ? 38.473 55.666 30.904  1.00 30.11 ? 48   ALA A O   1 
ATOM   85   C  CB  . ALA A 1 26  ? 40.581 57.875 30.063  1.00 25.86 ? 48   ALA A CB  1 
ATOM   86   N  N   . MET A 1 27  ? 40.173 55.332 32.355  1.00 26.34 ? 49   MET A N   1 
ATOM   87   C  CA  . MET A 1 27  ? 39.994 53.862 32.447  1.00 26.36 ? 49   MET A CA  1 
ATOM   88   C  C   . MET A 1 27  ? 39.083 53.719 33.609  1.00 26.36 ? 49   MET A C   1 
ATOM   89   O  O   . MET A 1 27  ? 39.481 53.994 34.760  1.00 26.72 ? 49   MET A O   1 
ATOM   90   C  CB  . MET A 1 27  ? 41.316 53.168 32.742  1.00 26.18 ? 49   MET A CB  1 
ATOM   91   C  CG  . MET A 1 27  ? 42.137 52.975 31.505  1.00 27.14 ? 49   MET A CG  1 
ATOM   92   S  SD  . MET A 1 27  ? 43.833 52.428 31.833  1.00 27.94 ? 49   MET A SD  1 
ATOM   93   C  CE  . MET A 1 27  ? 44.613 53.992 32.240  1.00 29.91 ? 49   MET A CE  1 
ATOM   94   N  N   . SER A 1 28  ? 37.827 53.414 33.295  1.00 24.99 ? 50   SER A N   1 
ATOM   95   C  CA  . SER A 1 28  ? 36.829 53.409 34.371  1.00 25.53 ? 50   SER A CA  1 
ATOM   96   C  C   . SER A 1 28  ? 37.296 52.564 35.576  1.00 24.21 ? 50   SER A C   1 
ATOM   97   O  O   . SER A 1 28  ? 36.953 52.905 36.661  1.00 24.87 ? 50   SER A O   1 
ATOM   98   C  CB  . SER A 1 28  ? 35.505 52.951 33.849  1.00 24.02 ? 50   SER A CB  1 
ATOM   99   O  OG  . SER A 1 28  ? 34.990 53.978 33.032  1.00 23.54 ? 50   SER A OG  1 
ATOM   100  N  N   . GLU A 1 29  ? 38.020 51.460 35.345  1.00 23.75 ? 51   GLU A N   1 
ATOM   101  C  CA  . GLU A 1 29  ? 38.443 50.537 36.432  1.00 24.58 ? 51   GLU A CA  1 
ATOM   102  C  C   . GLU A 1 29  ? 39.207 51.267 37.568  1.00 23.09 ? 51   GLU A C   1 
ATOM   103  O  O   . GLU A 1 29  ? 39.207 50.827 38.730  1.00 23.99 ? 51   GLU A O   1 
ATOM   104  C  CB  . GLU A 1 29  ? 39.305 49.405 35.853  1.00 23.55 ? 51   GLU A CB  1 
ATOM   105  C  CG  . GLU A 1 29  ? 40.350 49.909 34.886  1.00 29.21 ? 51   GLU A CG  1 
ATOM   106  C  CD  . GLU A 1 29  ? 39.925 49.660 33.412  1.00 33.49 ? 51   GLU A CD  1 
ATOM   107  O  OE1 . GLU A 1 29  ? 38.787 50.001 33.039  1.00 31.28 ? 51   GLU A OE1 1 
ATOM   108  O  OE2 . GLU A 1 29  ? 40.745 49.121 32.642  1.00 37.68 ? 51   GLU A OE2 1 
ATOM   109  N  N   . GLU A 1 30  ? 39.849 52.371 37.216  1.00 23.55 ? 52   GLU A N   1 
ATOM   110  C  CA  . GLU A 1 30  ? 40.543 53.275 38.180  1.00 24.34 ? 52   GLU A CA  1 
ATOM   111  C  C   . GLU A 1 30  ? 39.624 53.929 39.236  1.00 26.43 ? 52   GLU A C   1 
ATOM   112  O  O   . GLU A 1 30  ? 40.092 54.522 40.233  1.00 27.99 ? 52   GLU A O   1 
ATOM   113  C  CB  . GLU A 1 30  ? 41.247 54.408 37.402  1.00 24.26 ? 52   GLU A CB  1 
ATOM   114  C  CG  . GLU A 1 30  ? 42.472 53.923 36.628  1.00 24.49 ? 52   GLU A CG  1 
ATOM   115  C  CD  . GLU A 1 30  ? 43.529 53.430 37.596  1.00 26.62 ? 52   GLU A CD  1 
ATOM   116  O  OE1 . GLU A 1 30  ? 43.420 53.853 38.793  1.00 22.14 ? 52   GLU A OE1 1 
ATOM   117  O  OE2 . GLU A 1 30  ? 44.381 52.609 37.190  1.00 26.57 ? 52   GLU A OE2 1 
ATOM   118  N  N   . TRP A 1 31  ? 38.321 53.919 38.944  1.00 26.57 ? 53   TRP A N   1 
ATOM   119  C  CA  . TRP A 1 31  ? 37.347 54.633 39.760  1.00 27.18 ? 53   TRP A CA  1 
ATOM   120  C  C   . TRP A 1 31  ? 36.750 53.612 40.719  1.00 27.66 ? 53   TRP A C   1 
ATOM   121  O  O   . TRP A 1 31  ? 36.115 53.978 41.715  1.00 27.69 ? 53   TRP A O   1 
ATOM   122  C  CB  . TRP A 1 31  ? 36.238 55.182 38.897  1.00 26.56 ? 53   TRP A CB  1 
ATOM   123  C  CG  . TRP A 1 31  ? 36.577 56.331 38.001  1.00 27.57 ? 53   TRP A CG  1 
ATOM   124  C  CD1 . TRP A 1 31  ? 37.455 56.324 36.932  1.00 24.69 ? 53   TRP A CD1 1 
ATOM   125  C  CD2 . TRP A 1 31  ? 36.026 57.646 38.063  1.00 27.44 ? 53   TRP A CD2 1 
ATOM   126  N  NE1 . TRP A 1 31  ? 37.478 57.557 36.339  1.00 25.67 ? 53   TRP A NE1 1 
ATOM   127  C  CE2 . TRP A 1 31  ? 36.604 58.390 37.001  1.00 25.71 ? 53   TRP A CE2 1 
ATOM   128  C  CE3 . TRP A 1 31  ? 35.056 58.269 38.895  1.00 24.29 ? 53   TRP A CE3 1 
ATOM   129  C  CZ2 . TRP A 1 31  ? 36.284 59.743 36.762  1.00 26.85 ? 53   TRP A CZ2 1 
ATOM   130  C  CZ3 . TRP A 1 31  ? 34.720 59.616 38.637  1.00 25.50 ? 53   TRP A CZ3 1 
ATOM   131  C  CH2 . TRP A 1 31  ? 35.350 60.335 37.571  1.00 25.49 ? 53   TRP A CH2 1 
ATOM   132  N  N   . ALA A 1 32  ? 36.985 52.329 40.402  1.00 26.85 ? 54   ALA A N   1 
ATOM   133  C  CA  . ALA A 1 32  ? 36.461 51.213 41.210  1.00 27.18 ? 54   ALA A CA  1 
ATOM   134  C  C   . ALA A 1 32  ? 36.885 51.230 42.680  1.00 27.29 ? 54   ALA A C   1 
ATOM   135  O  O   . ALA A 1 32  ? 36.155 50.722 43.538  1.00 27.51 ? 54   ALA A O   1 
ATOM   136  C  CB  . ALA A 1 32  ? 36.752 49.887 40.576  1.00 27.15 ? 54   ALA A CB  1 
ATOM   137  N  N   . ARG A 1 33  ? 38.045 51.814 42.966  1.00 27.74 ? 55   ARG A N   1 
ATOM   138  C  CA  . ARG A 1 33  ? 38.561 51.792 44.343  1.00 28.65 ? 55   ARG A CA  1 
ATOM   139  C  C   . ARG A 1 33  ? 37.748 52.713 45.239  1.00 28.85 ? 55   ARG A C   1 
ATOM   140  O  O   . ARG A 1 33  ? 37.657 52.489 46.446  1.00 29.11 ? 55   ARG A O   1 
ATOM   141  C  CB  . ARG A 1 33  ? 40.071 52.056 44.415  1.00 28.41 ? 55   ARG A CB  1 
ATOM   142  C  CG  . ARG A 1 33  ? 40.549 53.354 43.899  1.00 28.39 ? 55   ARG A CG  1 
ATOM   143  C  CD  . ARG A 1 33  ? 41.999 53.692 44.375  1.00 29.97 ? 55   ARG A CD  1 
ATOM   144  N  NE  . ARG A 1 33  ? 42.251 53.533 45.805  1.00 29.93 ? 55   ARG A NE  1 
ATOM   145  C  CZ  . ARG A 1 33  ? 43.433 53.142 46.290  1.00 34.31 ? 55   ARG A CZ  1 
ATOM   146  N  NH1 . ARG A 1 33  ? 44.452 52.921 45.469  1.00 26.69 ? 55   ARG A NH1 1 
ATOM   147  N  NH2 . ARG A 1 33  ? 43.617 52.971 47.591  1.00 33.87 ? 55   ARG A NH2 1 
ATOM   148  N  N   . TYR A 1 34  ? 37.077 53.695 44.613  1.00 28.06 ? 56   TYR A N   1 
ATOM   149  C  CA  . TYR A 1 34  ? 36.244 54.593 45.367  1.00 27.54 ? 56   TYR A CA  1 
ATOM   150  C  C   . TYR A 1 34  ? 34.767 54.251 45.329  1.00 27.37 ? 56   TYR A C   1 
ATOM   151  O  O   . TYR A 1 34  ? 34.065 54.506 46.295  1.00 27.60 ? 56   TYR A O   1 
ATOM   152  C  CB  . TYR A 1 34  ? 36.463 56.036 44.926  1.00 27.79 ? 56   TYR A CB  1 
ATOM   153  C  CG  . TYR A 1 34  ? 37.928 56.384 44.823  1.00 28.34 ? 56   TYR A CG  1 
ATOM   154  C  CD1 . TYR A 1 34  ? 38.700 56.469 45.972  1.00 31.05 ? 56   TYR A CD1 1 
ATOM   155  C  CD2 . TYR A 1 34  ? 38.521 56.660 43.600  1.00 31.58 ? 56   TYR A CD2 1 
ATOM   156  C  CE1 . TYR A 1 34  ? 40.028 56.777 45.909  1.00 30.88 ? 56   TYR A CE1 1 
ATOM   157  C  CE2 . TYR A 1 34  ? 39.891 56.970 43.521  1.00 30.70 ? 56   TYR A CE2 1 
ATOM   158  C  CZ  . TYR A 1 34  ? 40.619 57.018 44.703  1.00 32.31 ? 56   TYR A CZ  1 
ATOM   159  O  OH  . TYR A 1 34  ? 41.954 57.308 44.724  1.00 34.29 ? 56   TYR A OH  1 
ATOM   160  N  N   . TYR A 1 35  ? 34.323 53.678 44.200  1.00 27.44 ? 57   TYR A N   1 
ATOM   161  C  CA  . TYR A 1 35  ? 32.914 53.489 43.890  1.00 27.32 ? 57   TYR A CA  1 
ATOM   162  C  C   . TYR A 1 35  ? 32.609 52.088 43.407  1.00 27.27 ? 57   TYR A C   1 
ATOM   163  O  O   . TYR A 1 35  ? 32.179 51.892 42.264  1.00 26.38 ? 57   TYR A O   1 
ATOM   164  C  CB  . TYR A 1 35  ? 32.506 54.519 42.847  1.00 26.85 ? 57   TYR A CB  1 
ATOM   165  C  CG  . TYR A 1 35  ? 32.768 55.902 43.308  1.00 25.44 ? 57   TYR A CG  1 
ATOM   166  C  CD1 . TYR A 1 35  ? 32.253 56.360 44.525  1.00 24.20 ? 57   TYR A CD1 1 
ATOM   167  C  CD2 . TYR A 1 35  ? 33.575 56.759 42.578  1.00 21.35 ? 57   TYR A CD2 1 
ATOM   168  C  CE1 . TYR A 1 35  ? 32.492 57.677 44.980  1.00 23.33 ? 57   TYR A CE1 1 
ATOM   169  C  CE2 . TYR A 1 35  ? 33.825 58.054 43.024  1.00 22.71 ? 57   TYR A CE2 1 
ATOM   170  C  CZ  . TYR A 1 35  ? 33.299 58.505 44.204  1.00 27.23 ? 57   TYR A CZ  1 
ATOM   171  O  OH  . TYR A 1 35  ? 33.576 59.788 44.601  1.00 28.19 ? 57   TYR A OH  1 
ATOM   172  N  N   . PRO A 1 36  ? 32.844 51.087 44.268  1.00 26.26 ? 58   PRO A N   1 
ATOM   173  C  CA  . PRO A 1 36  ? 32.705 49.713 43.802  1.00 27.19 ? 58   PRO A CA  1 
ATOM   174  C  C   . PRO A 1 36  ? 31.277 49.346 43.328  1.00 27.30 ? 58   PRO A C   1 
ATOM   175  O  O   . PRO A 1 36  ? 31.086 48.452 42.492  1.00 27.96 ? 58   PRO A O   1 
ATOM   176  C  CB  . PRO A 1 36  ? 33.060 48.885 45.036  1.00 26.26 ? 58   PRO A CB  1 
ATOM   177  C  CG  . PRO A 1 36  ? 33.015 49.830 46.181  1.00 26.07 ? 58   PRO A CG  1 
ATOM   178  C  CD  . PRO A 1 36  ? 33.305 51.170 45.676  1.00 26.05 ? 58   PRO A CD  1 
ATOM   179  N  N   . ARG A 1 37  ? 30.283 49.990 43.934  1.00 27.44 ? 59   ARG A N   1 
ATOM   180  C  CA  . ARG A 1 37  ? 28.898 49.640 43.740  1.00 28.88 ? 59   ARG A CA  1 
ATOM   181  C  C   . ARG A 1 37  ? 28.516 50.124 42.332  1.00 28.19 ? 59   ARG A C   1 
ATOM   182  O  O   . ARG A 1 37  ? 27.987 49.364 41.512  1.00 28.52 ? 59   ARG A O   1 
ATOM   183  C  CB  . ARG A 1 37  ? 28.114 50.339 44.842  1.00 30.76 ? 59   ARG A CB  1 
ATOM   184  C  CG  . ARG A 1 37  ? 26.674 49.971 45.001  1.00 36.53 ? 59   ARG A CG  1 
ATOM   185  C  CD  . ARG A 1 37  ? 26.444 48.668 45.777  1.00 44.49 ? 59   ARG A CD  1 
ATOM   186  N  NE  . ARG A 1 37  ? 25.022 48.340 45.676  1.00 49.78 ? 59   ARG A NE  1 
ATOM   187  C  CZ  . ARG A 1 37  ? 24.074 48.779 46.507  1.00 52.61 ? 59   ARG A CZ  1 
ATOM   188  N  NH1 . ARG A 1 37  ? 24.375 49.560 47.543  1.00 54.60 ? 59   ARG A NH1 1 
ATOM   189  N  NH2 . ARG A 1 37  ? 22.808 48.435 46.299  1.00 55.36 ? 59   ARG A NH2 1 
ATOM   190  N  N   . GLN A 1 38  ? 28.903 51.353 42.030  1.00 26.66 ? 60   GLN A N   1 
ATOM   191  C  CA  . GLN A 1 38  ? 28.600 51.979 40.731  1.00 26.72 ? 60   GLN A CA  1 
ATOM   192  C  C   . GLN A 1 38  ? 29.444 51.351 39.622  1.00 26.68 ? 60   GLN A C   1 
ATOM   193  O  O   . GLN A 1 38  ? 28.984 51.193 38.490  1.00 25.85 ? 60   GLN A O   1 
ATOM   194  C  CB  . GLN A 1 38  ? 28.826 53.480 40.799  1.00 25.65 ? 60   GLN A CB  1 
ATOM   195  C  CG  . GLN A 1 38  ? 27.780 54.211 41.599  1.00 26.18 ? 60   GLN A CG  1 
ATOM   196  C  CD  . GLN A 1 38  ? 28.156 54.388 43.056  1.00 27.68 ? 60   GLN A CD  1 
ATOM   197  O  OE1 . GLN A 1 38  ? 29.182 53.894 43.496  1.00 27.04 ? 60   GLN A OE1 1 
ATOM   198  N  NE2 . GLN A 1 38  ? 27.315 55.109 43.815  1.00 30.23 ? 60   GLN A NE2 1 
ATOM   199  N  N   . PHE A 1 39  ? 30.676 50.958 39.957  1.00 26.28 ? 61   PHE A N   1 
ATOM   200  C  CA  . PHE A 1 39  ? 31.481 50.242 39.011  1.00 26.42 ? 61   PHE A CA  1 
ATOM   201  C  C   . PHE A 1 39  ? 30.844 48.902 38.655  1.00 27.21 ? 61   PHE A C   1 
ATOM   202  O  O   . PHE A 1 39  ? 30.732 48.546 37.496  1.00 26.98 ? 61   PHE A O   1 
ATOM   203  C  CB  . PHE A 1 39  ? 32.912 50.043 39.537  1.00 27.61 ? 61   PHE A CB  1 
ATOM   204  C  CG  . PHE A 1 39  ? 33.785 49.339 38.565  1.00 28.08 ? 61   PHE A CG  1 
ATOM   205  C  CD1 . PHE A 1 39  ? 34.398 50.047 37.512  1.00 29.93 ? 61   PHE A CD1 1 
ATOM   206  C  CD2 . PHE A 1 39  ? 33.956 47.950 38.644  1.00 31.47 ? 61   PHE A CD2 1 
ATOM   207  C  CE1 . PHE A 1 39  ? 35.184 49.402 36.600  1.00 29.45 ? 61   PHE A CE1 1 
ATOM   208  C  CE2 . PHE A 1 39  ? 34.741 47.291 37.723  1.00 29.27 ? 61   PHE A CE2 1 
ATOM   209  C  CZ  . PHE A 1 39  ? 35.370 48.014 36.707  1.00 31.21 ? 61   PHE A CZ  1 
ATOM   210  N  N   . ASP A 1 40  ? 30.418 48.151 39.655  1.00 26.62 ? 62   ASP A N   1 
ATOM   211  C  CA  . ASP A 1 40  ? 29.829 46.865 39.388  1.00 28.15 ? 62   ASP A CA  1 
ATOM   212  C  C   . ASP A 1 40  ? 28.555 46.898 38.512  1.00 27.35 ? 62   ASP A C   1 
ATOM   213  O  O   . ASP A 1 40  ? 28.410 46.057 37.629  1.00 27.84 ? 62   ASP A O   1 
ATOM   214  C  CB  . ASP A 1 40  ? 29.556 46.132 40.695  1.00 29.29 ? 62   ASP A CB  1 
ATOM   215  C  CG  . ASP A 1 40  ? 29.049 44.731 40.465  1.00 34.90 ? 62   ASP A CG  1 
ATOM   216  O  OD1 . ASP A 1 40  ? 29.871 43.828 40.158  1.00 40.59 ? 62   ASP A OD1 1 
ATOM   217  O  OD2 . ASP A 1 40  ? 27.817 44.530 40.575  1.00 41.37 ? 62   ASP A OD2 1 
ATOM   218  N  N   . SER A 1 41  ? 27.619 47.803 38.793  1.00 27.11 ? 63   SER A N   1 
ATOM   219  C  CA  . SER A 1 41  ? 26.419 47.945 37.944  1.00 26.71 ? 63   SER A CA  1 
ATOM   220  C  C   . SER A 1 41  ? 26.761 48.512 36.559  1.00 26.48 ? 63   SER A C   1 
ATOM   221  O  O   . SER A 1 41  ? 26.208 48.068 35.537  1.00 27.33 ? 63   SER A O   1 
ATOM   222  C  CB  . SER A 1 41  ? 25.289 48.728 38.621  1.00 26.99 ? 63   SER A CB  1 
ATOM   223  O  OG  . SER A 1 41  ? 25.678 50.042 38.990  1.00 27.26 ? 63   SER A OG  1 
ATOM   224  N  N   . TRP A 1 42  ? 27.699 49.447 36.507  1.00 26.94 ? 64   TRP A N   1 
ATOM   225  C  CA  . TRP A 1 42  ? 28.123 50.020 35.194  1.00 26.28 ? 64   TRP A CA  1 
ATOM   226  C  C   . TRP A 1 42  ? 28.638 48.942 34.238  1.00 26.20 ? 64   TRP A C   1 
ATOM   227  O  O   . TRP A 1 42  ? 28.303 48.916 33.043  1.00 24.66 ? 64   TRP A O   1 
ATOM   228  C  CB  . TRP A 1 42  ? 29.173 51.122 35.428  1.00 25.25 ? 64   TRP A CB  1 
ATOM   229  C  CG  . TRP A 1 42  ? 29.987 51.537 34.205  1.00 25.05 ? 64   TRP A CG  1 
ATOM   230  C  CD1 . TRP A 1 42  ? 29.703 52.532 33.315  1.00 25.10 ? 64   TRP A CD1 1 
ATOM   231  C  CD2 . TRP A 1 42  ? 31.252 50.984 33.794  1.00 23.02 ? 64   TRP A CD2 1 
ATOM   232  N  NE1 . TRP A 1 42  ? 30.698 52.616 32.369  1.00 24.53 ? 64   TRP A NE1 1 
ATOM   233  C  CE2 . TRP A 1 42  ? 31.647 51.669 32.627  1.00 22.92 ? 64   TRP A CE2 1 
ATOM   234  C  CE3 . TRP A 1 42  ? 32.081 49.973 34.302  1.00 25.55 ? 64   TRP A CE3 1 
ATOM   235  C  CZ2 . TRP A 1 42  ? 32.836 51.369 31.954  1.00 21.89 ? 64   TRP A CZ2 1 
ATOM   236  C  CZ3 . TRP A 1 42  ? 33.251 49.675 33.626  1.00 26.83 ? 64   TRP A CZ3 1 
ATOM   237  C  CH2 . TRP A 1 42  ? 33.610 50.376 32.464  1.00 22.76 ? 64   TRP A CH2 1 
ATOM   238  N  N   . LYS A 1 43  ? 29.453 48.038 34.764  1.00 26.36 ? 65   LYS A N   1 
ATOM   239  C  CA  . LYS A 1 43  ? 29.961 46.931 33.983  1.00 26.56 ? 65   LYS A CA  1 
ATOM   240  C  C   . LYS A 1 43  ? 28.901 45.960 33.499  1.00 24.96 ? 65   LYS A C   1 
ATOM   241  O  O   . LYS A 1 43  ? 29.115 45.293 32.494  1.00 25.06 ? 65   LYS A O   1 
ATOM   242  C  CB  . LYS A 1 43  ? 30.988 46.141 34.830  1.00 27.60 ? 65   LYS A CB  1 
ATOM   243  C  CG  . LYS A 1 43  ? 32.008 45.341 34.041  1.00 33.59 ? 65   LYS A CG  1 
ATOM   244  C  CD  . LYS A 1 43  ? 33.132 44.900 34.963  1.00 34.20 ? 65   LYS A CD  1 
ATOM   245  C  CE  . LYS A 1 43  ? 33.998 43.798 34.368  1.00 36.85 ? 65   LYS A CE  1 
ATOM   246  N  NZ  . LYS A 1 43  ? 35.192 43.536 35.256  1.00 40.13 ? 65   LYS A NZ  1 
ATOM   247  N  N   . LYS A 1 44  ? 27.777 45.858 34.219  1.00 24.39 ? 66   LYS A N   1 
ATOM   248  C  CA  . LYS A 1 44  ? 26.688 44.951 33.848  1.00 25.01 ? 66   LYS A CA  1 
ATOM   249  C  C   . LYS A 1 44  ? 25.991 45.265 32.524  1.00 25.61 ? 66   LYS A C   1 
ATOM   250  O  O   . LYS A 1 44  ? 25.163 44.455 32.042  1.00 26.99 ? 66   LYS A O   1 
ATOM   251  C  CB  . LYS A 1 44  ? 25.642 44.865 34.941  1.00 24.22 ? 66   LYS A CB  1 
ATOM   252  C  CG  . LYS A 1 44  ? 26.210 44.285 36.146  1.00 27.24 ? 66   LYS A CG  1 
ATOM   253  C  CD  . LYS A 1 44  ? 25.160 44.001 37.203  1.00 31.04 ? 66   LYS A CD  1 
ATOM   254  C  CE  . LYS A 1 44  ? 25.867 43.165 38.277  1.00 35.65 ? 66   LYS A CE  1 
ATOM   255  N  NZ  . LYS A 1 44  ? 25.166 43.238 39.581  1.00 33.00 ? 66   LYS A NZ  1 
ATOM   256  N  N   . THR A 1 45  ? 26.296 46.415 31.915  1.00 24.36 ? 67   THR A N   1 
ATOM   257  C  CA  . THR A 1 45  ? 25.671 46.625 30.597  1.00 23.96 ? 67   THR A CA  1 
ATOM   258  C  C   . THR A 1 45  ? 26.277 45.664 29.562  1.00 23.64 ? 67   THR A C   1 
ATOM   259  O  O   . THR A 1 45  ? 25.775 45.530 28.445  1.00 23.56 ? 67   THR A O   1 
ATOM   260  C  CB  . THR A 1 45  ? 25.830 48.060 30.096  1.00 23.86 ? 67   THR A CB  1 
ATOM   261  O  OG1 . THR A 1 45  ? 27.210 48.301 29.883  1.00 20.32 ? 67   THR A OG1 1 
ATOM   262  C  CG2 . THR A 1 45  ? 25.201 49.104 31.093  1.00 24.54 ? 67   THR A CG2 1 
ATOM   263  N  N   . LYS A 1 46  ? 27.327 44.969 29.979  1.00 23.14 ? 68   LYS A N   1 
ATOM   264  C  CA  . LYS A 1 46  ? 27.855 43.831 29.237  1.00 24.56 ? 68   LYS A CA  1 
ATOM   265  C  C   . LYS A 1 46  ? 26.779 42.779 29.004  1.00 24.39 ? 68   LYS A C   1 
ATOM   266  O  O   . LYS A 1 46  ? 26.904 41.970 28.076  1.00 24.48 ? 68   LYS A O   1 
ATOM   267  C  CB  . LYS A 1 46  ? 28.941 43.142 30.044  1.00 24.48 ? 68   LYS A CB  1 
ATOM   268  C  CG  . LYS A 1 46  ? 29.398 41.874 29.406  1.00 26.98 ? 68   LYS A CG  1 
ATOM   269  C  CD  . LYS A 1 46  ? 30.189 41.006 30.430  1.00 29.48 ? 68   LYS A CD  1 
ATOM   270  C  CE  . LYS A 1 46  ? 31.112 40.051 29.669  1.00 31.28 ? 68   LYS A CE  1 
ATOM   271  N  NZ  . LYS A 1 46  ? 32.013 39.375 30.668  1.00 30.42 ? 68   LYS A NZ  1 
ATOM   272  N  N   . GLU A 1 47  ? 25.765 42.763 29.881  1.00 23.39 ? 69   GLU A N   1 
ATOM   273  C  CA  . GLU A 1 47  ? 24.619 41.865 29.751  1.00 26.01 ? 69   GLU A CA  1 
ATOM   274  C  C   . GLU A 1 47  ? 23.700 42.100 28.522  1.00 26.16 ? 69   GLU A C   1 
ATOM   275  O  O   . GLU A 1 47  ? 23.130 41.151 27.938  1.00 26.89 ? 69   GLU A O   1 
ATOM   276  C  CB  . GLU A 1 47  ? 23.815 41.846 31.052  1.00 25.20 ? 69   GLU A CB  1 
ATOM   277  C  CG  . GLU A 1 47  ? 24.654 41.283 32.229  1.00 26.54 ? 69   GLU A CG  1 
ATOM   278  C  CD  . GLU A 1 47  ? 24.000 41.473 33.629  1.00 27.79 ? 69   GLU A CD  1 
ATOM   279  O  OE1 . GLU A 1 47  ? 22.836 41.843 33.693  1.00 29.41 ? 69   GLU A OE1 1 
ATOM   280  O  OE2 . GLU A 1 47  ? 24.669 41.312 34.686  1.00 30.75 ? 69   GLU A OE2 1 
ATOM   281  N  N   . SER A 1 48  ? 23.592 43.349 28.122  1.00 27.00 ? 70   SER A N   1 
ATOM   282  C  CA  . SER A 1 48  ? 22.812 43.696 26.936  1.00 27.85 ? 70   SER A CA  1 
ATOM   283  C  C   . SER A 1 48  ? 23.734 43.519 25.717  1.00 29.08 ? 70   SER A C   1 
ATOM   284  O  O   . SER A 1 48  ? 24.373 44.483 25.230  1.00 27.06 ? 70   SER A O   1 
ATOM   285  C  CB  . SER A 1 48  ? 22.276 45.101 27.057  1.00 28.15 ? 70   SER A CB  1 
ATOM   286  O  OG  . SER A 1 48  ? 21.653 45.328 28.302  1.00 29.14 ? 70   SER A OG  1 
ATOM   287  N  N   . ASP A 1 49  ? 23.863 42.260 25.280  1.00 28.46 ? 71   ASP A N   1 
ATOM   288  C  CA  . ASP A 1 49  ? 24.801 41.930 24.207  1.00 28.70 ? 71   ASP A CA  1 
ATOM   289  C  C   . ASP A 1 49  ? 24.157 41.584 22.872  1.00 28.64 ? 71   ASP A C   1 
ATOM   290  O  O   . ASP A 1 49  ? 24.865 41.252 21.961  1.00 28.02 ? 71   ASP A O   1 
ATOM   291  C  CB  . ASP A 1 49  ? 25.691 40.768 24.622  1.00 29.28 ? 71   ASP A CB  1 
ATOM   292  C  CG  . ASP A 1 49  ? 24.941 39.447 24.645  1.00 33.15 ? 71   ASP A CG  1 
ATOM   293  O  OD1 . ASP A 1 49  ? 23.787 39.415 25.125  1.00 35.19 ? 71   ASP A OD1 1 
ATOM   294  O  OD2 . ASP A 1 49  ? 25.496 38.433 24.191  1.00 41.94 ? 71   ASP A OD2 1 
ATOM   295  N  N   A ASN A 1 50  ? 22.835 41.689 22.767  0.50 28.36 ? 72   ASN A N   1 
ATOM   296  N  N   B ASN A 1 50  ? 22.829 41.662 22.764  0.50 28.80 ? 72   ASN A N   1 
ATOM   297  C  CA  A ASN A 1 50  ? 22.133 41.294 21.549  0.50 28.62 ? 72   ASN A CA  1 
ATOM   298  C  CA  B ASN A 1 50  ? 22.140 41.262 21.531  0.50 29.42 ? 72   ASN A CA  1 
ATOM   299  C  C   A ASN A 1 50  ? 22.408 42.255 20.392  0.50 28.65 ? 72   ASN A C   1 
ATOM   300  C  C   B ASN A 1 50  ? 22.406 42.242 20.394  0.50 29.13 ? 72   ASN A C   1 
ATOM   301  O  O   A ASN A 1 50  ? 22.433 43.479 20.582  0.50 28.68 ? 72   ASN A O   1 
ATOM   302  O  O   B ASN A 1 50  ? 22.424 43.464 20.600  0.50 29.14 ? 72   ASN A O   1 
ATOM   303  C  CB  A ASN A 1 50  ? 20.620 41.186 21.817  0.50 28.48 ? 72   ASN A CB  1 
ATOM   304  C  CB  B ASN A 1 50  ? 20.623 41.114 21.760  0.50 29.81 ? 72   ASN A CB  1 
ATOM   305  C  CG  A ASN A 1 50  ? 19.837 40.832 20.578  0.50 28.33 ? 72   ASN A CG  1 
ATOM   306  C  CG  B ASN A 1 50  ? 20.274 39.923 22.633  0.50 31.64 ? 72   ASN A CG  1 
ATOM   307  O  OD1 A ASN A 1 50  ? 18.933 41.554 20.179  0.50 29.62 ? 72   ASN A OD1 1 
ATOM   308  O  OD1 B ASN A 1 50  ? 20.553 38.767 22.292  0.50 34.36 ? 72   ASN A OD1 1 
ATOM   309  N  ND2 A ASN A 1 50  ? 20.200 39.724 19.942  0.50 29.05 ? 72   ASN A ND2 1 
ATOM   310  N  ND2 B ASN A 1 50  ? 19.636 40.199 23.766  0.50 34.86 ? 72   ASN A ND2 1 
ATOM   311  N  N   . ILE A 1 51  ? 22.656 41.691 19.211  1.00 29.20 ? 73   ILE A N   1 
ATOM   312  C  CA  . ILE A 1 51  ? 22.791 42.463 17.999  1.00 29.66 ? 73   ILE A CA  1 
ATOM   313  C  C   . ILE A 1 51  ? 21.510 42.250 17.188  1.00 28.79 ? 73   ILE A C   1 
ATOM   314  O  O   . ILE A 1 51  ? 21.140 41.112 16.865  1.00 29.24 ? 73   ILE A O   1 
ATOM   315  C  CB  . ILE A 1 51  ? 24.052 42.089 17.185  1.00 29.98 ? 73   ILE A CB  1 
ATOM   316  C  CG1 . ILE A 1 51  ? 25.319 42.481 17.961  1.00 31.14 ? 73   ILE A CG1 1 
ATOM   317  C  CG2 . ILE A 1 51  ? 23.980 42.728 15.770  1.00 30.92 ? 73   ILE A CG2 1 
ATOM   318  C  CD1 . ILE A 1 51  ? 25.903 43.839 17.569  1.00 32.43 ? 73   ILE A CD1 1 
ATOM   319  N  N   . THR A 1 52  ? 20.798 43.336 16.939  1.00 27.30 ? 74   THR A N   1 
ATOM   320  C  CA  . THR A 1 52  ? 19.602 43.253 16.112  1.00 26.76 ? 74   THR A CA  1 
ATOM   321  C  C   . THR A 1 52  ? 19.978 43.985 14.859  1.00 25.12 ? 74   THR A C   1 
ATOM   322  O  O   . THR A 1 52  ? 20.222 45.189 14.909  1.00 23.97 ? 74   THR A O   1 
ATOM   323  C  CB  . THR A 1 52  ? 18.369 43.888 16.806  1.00 27.09 ? 74   THR A CB  1 
ATOM   324  O  OG1 . THR A 1 52  ? 17.976 43.079 17.927  1.00 31.33 ? 74   THR A OG1 1 
ATOM   325  C  CG2 . THR A 1 52  ? 17.185 44.004 15.855  1.00 28.84 ? 74   THR A CG2 1 
ATOM   326  N  N   . ASP A 1 53  ? 20.072 43.251 13.735  1.00 24.90 ? 75   ASP A N   1 
ATOM   327  C  CA  . ASP A 1 53  ? 20.514 43.864 12.491  1.00 23.63 ? 75   ASP A CA  1 
ATOM   328  C  C   . ASP A 1 53  ? 19.259 44.573 11.931  1.00 24.06 ? 75   ASP A C   1 
ATOM   329  O  O   . ASP A 1 53  ? 18.292 43.918 11.472  1.00 24.82 ? 75   ASP A O   1 
ATOM   330  C  CB  . ASP A 1 53  ? 21.102 42.773 11.549  1.00 22.96 ? 75   ASP A CB  1 
ATOM   331  C  CG  . ASP A 1 53  ? 21.349 43.260 10.132  1.00 26.27 ? 75   ASP A CG  1 
ATOM   332  O  OD1 . ASP A 1 53  ? 20.848 44.372 9.743   1.00 21.72 ? 75   ASP A OD1 1 
ATOM   333  O  OD2 . ASP A 1 53  ? 22.100 42.540 9.388   1.00 22.50 ? 75   ASP A OD2 1 
ATOM   334  N  N   . MET A 1 54  ? 19.258 45.903 12.001  1.00 22.52 ? 76   MET A N   1 
ATOM   335  C  CA  . MET A 1 54  ? 18.047 46.691 11.668  1.00 23.87 ? 76   MET A CA  1 
ATOM   336  C  C   . MET A 1 54  ? 17.836 46.701 10.138  1.00 23.99 ? 76   MET A C   1 
ATOM   337  O  O   . MET A 1 54  ? 16.702 46.916 9.666   1.00 22.49 ? 76   MET A O   1 
ATOM   338  C  CB  . MET A 1 54  ? 18.171 48.128 12.194  1.00 23.74 ? 76   MET A CB  1 
ATOM   339  C  CG  . MET A 1 54  ? 18.095 48.268 13.730  1.00 26.33 ? 76   MET A CG  1 
ATOM   340  S  SD  . MET A 1 54  ? 16.569 47.521 14.325  1.00 32.94 ? 76   MET A SD  1 
ATOM   341  C  CE  . MET A 1 54  ? 15.358 48.513 13.442  1.00 28.02 ? 76   MET A CE  1 
ATOM   342  N  N   . LEU A 1 55  ? 18.919 46.463 9.372   1.00 23.37 ? 77   LEU A N   1 
ATOM   343  C  CA  . LEU A 1 55  ? 18.806 46.355 7.905   1.00 24.14 ? 77   LEU A CA  1 
ATOM   344  C  C   . LEU A 1 55  ? 18.056 45.070 7.497   1.00 25.02 ? 77   LEU A C   1 
ATOM   345  O  O   . LEU A 1 55  ? 17.389 45.023 6.474   1.00 26.36 ? 77   LEU A O   1 
ATOM   346  C  CB  . LEU A 1 55  ? 20.188 46.377 7.283   1.00 22.99 ? 77   LEU A CB  1 
ATOM   347  C  CG  . LEU A 1 55  ? 20.985 47.681 7.492   1.00 21.09 ? 77   LEU A CG  1 
ATOM   348  C  CD1 . LEU A 1 55  ? 22.235 47.703 6.586   1.00 21.06 ? 77   LEU A CD1 1 
ATOM   349  C  CD2 . LEU A 1 55  ? 20.159 48.914 7.204   1.00 19.79 ? 77   LEU A CD2 1 
ATOM   350  N  N   . LYS A 1 56  ? 18.207 44.039 8.305   1.00 26.27 ? 78   LYS A N   1 
ATOM   351  C  CA  . LYS A 1 56  ? 17.515 42.761 8.190   1.00 26.26 ? 78   LYS A CA  1 
ATOM   352  C  C   . LYS A 1 56  ? 16.038 42.877 8.611   1.00 25.94 ? 78   LYS A C   1 
ATOM   353  O  O   . LYS A 1 56  ? 15.172 42.315 7.962   1.00 26.34 ? 78   LYS A O   1 
ATOM   354  C  CB  . LYS A 1 56  ? 18.244 41.749 9.097   1.00 25.75 ? 78   LYS A CB  1 
ATOM   355  C  CG  . LYS A 1 56  ? 17.857 40.289 8.876   1.00 29.06 ? 78   LYS A CG  1 
ATOM   356  C  CD  . LYS A 1 56  ? 18.904 39.300 9.513   1.00 30.15 ? 78   LYS A CD  1 
ATOM   357  C  CE  . LYS A 1 56  ? 20.289 39.515 8.772   1.00 34.57 ? 78   LYS A CE  1 
ATOM   358  N  NZ  . LYS A 1 56  ? 21.320 38.393 8.657   1.00 35.63 ? 78   LYS A NZ  1 
ATOM   359  N  N   . GLU A 1 57  ? 15.748 43.571 9.709   1.00 24.78 ? 79   GLU A N   1 
ATOM   360  C  CA  . GLU A 1 57  ? 14.364 43.720 10.189  1.00 24.94 ? 79   GLU A CA  1 
ATOM   361  C  C   . GLU A 1 57  ? 13.577 44.637 9.260   1.00 24.14 ? 79   GLU A C   1 
ATOM   362  O  O   . GLU A 1 57  ? 12.376 44.437 9.008   1.00 24.10 ? 79   GLU A O   1 
ATOM   363  C  CB  . GLU A 1 57  ? 14.281 44.372 11.600  1.00 24.71 ? 79   GLU A CB  1 
ATOM   364  C  CG  . GLU A 1 57  ? 14.946 43.626 12.759  1.00 33.24 ? 79   GLU A CG  1 
ATOM   365  C  CD  . GLU A 1 57  ? 14.317 42.275 13.035  1.00 40.35 ? 79   GLU A CD  1 
ATOM   366  O  OE1 . GLU A 1 57  ? 13.372 41.891 12.297  1.00 46.94 ? 79   GLU A OE1 1 
ATOM   367  O  OE2 . GLU A 1 57  ? 14.771 41.591 13.986  1.00 43.39 ? 79   GLU A OE2 1 
ATOM   368  N  N   . LYS A 1 58  ? 14.265 45.671 8.819   1.00 23.26 ? 80   LYS A N   1 
ATOM   369  C  CA  . LYS A 1 58  ? 13.682 46.818 8.120   1.00 23.32 ? 80   LYS A CA  1 
ATOM   370  C  C   . LYS A 1 58  ? 14.463 47.110 6.845   1.00 22.38 ? 80   LYS A C   1 
ATOM   371  O  O   . LYS A 1 58  ? 15.155 48.111 6.737   1.00 22.15 ? 80   LYS A O   1 
ATOM   372  C  CB  . LYS A 1 58  ? 13.660 48.071 9.034   1.00 25.34 ? 80   LYS A CB  1 
ATOM   373  C  CG  . LYS A 1 58  ? 12.747 47.988 10.329  1.00 24.13 ? 80   LYS A CG  1 
ATOM   374  C  CD  . LYS A 1 58  ? 11.315 47.567 10.031  1.00 25.37 ? 80   LYS A CD  1 
ATOM   375  C  CE  . LYS A 1 58  ? 10.445 47.670 11.281  1.00 25.37 ? 80   LYS A CE  1 
ATOM   376  N  NZ  . LYS A 1 58  ? 9.054  47.242 10.890  1.00 27.02 ? 80   LYS A NZ  1 
ATOM   377  N  N   . PRO A 1 59  ? 14.375 46.210 5.855   1.00 21.70 ? 81   PRO A N   1 
ATOM   378  C  CA  . PRO A 1 59  ? 15.287 46.361 4.708   1.00 21.94 ? 81   PRO A CA  1 
ATOM   379  C  C   . PRO A 1 59  ? 14.932 47.614 3.870   1.00 20.48 ? 81   PRO A C   1 
ATOM   380  O  O   . PRO A 1 59  ? 15.733 48.091 3.106   1.00 20.89 ? 81   PRO A O   1 
ATOM   381  C  CB  . PRO A 1 59  ? 15.063 45.115 3.883   1.00 21.20 ? 81   PRO A CB  1 
ATOM   382  C  CG  . PRO A 1 59  ? 13.927 44.364 4.530   1.00 22.27 ? 81   PRO A CG  1 
ATOM   383  C  CD  . PRO A 1 59  ? 13.476 45.035 5.775   1.00 22.70 ? 81   PRO A CD  1 
ATOM   384  N  N   . ALA A 1 60  ? 13.729 48.130 4.041   1.00 19.55 ? 82   ALA A N   1 
ATOM   385  C  CA  . ALA A 1 60  ? 13.371 49.451 3.468   1.00 21.68 ? 82   ALA A CA  1 
ATOM   386  C  C   . ALA A 1 60  ? 14.397 50.580 3.815   1.00 20.10 ? 82   ALA A C   1 
ATOM   387  O  O   . ALA A 1 60  ? 14.654 51.520 3.016   1.00 19.86 ? 82   ALA A O   1 
ATOM   388  C  CB  . ALA A 1 60  ? 11.984 49.858 3.959   1.00 20.34 ? 82   ALA A CB  1 
ATOM   389  N  N   . LEU A 1 61  ? 14.989 50.498 5.006   1.00 20.21 ? 83   LEU A N   1 
ATOM   390  C  CA  . LEU A 1 61  ? 16.048 51.455 5.423   1.00 20.64 ? 83   LEU A CA  1 
ATOM   391  C  C   . LEU A 1 61  ? 17.304 51.421 4.485   1.00 20.98 ? 83   LEU A C   1 
ATOM   392  O  O   . LEU A 1 61  ? 18.072 52.388 4.398   1.00 19.68 ? 83   LEU A O   1 
ATOM   393  C  CB  . LEU A 1 61  ? 16.470 51.092 6.861   1.00 22.33 ? 83   LEU A CB  1 
ATOM   394  C  CG  . LEU A 1 61  ? 15.398 51.352 7.930   1.00 21.12 ? 83   LEU A CG  1 
ATOM   395  C  CD1 . LEU A 1 61  ? 16.108 50.954 9.283   1.00 20.09 ? 83   LEU A CD1 1 
ATOM   396  C  CD2 . LEU A 1 61  ? 14.943 52.825 8.057   1.00 18.94 ? 83   LEU A CD2 1 
ATOM   397  N  N   . VAL A 1 62  ? 17.545 50.277 3.855   1.00 20.72 ? 84   VAL A N   1 
ATOM   398  C  CA  . VAL A 1 62  ? 18.666 50.172 2.907   1.00 21.87 ? 84   VAL A CA  1 
ATOM   399  C  C   . VAL A 1 62  ? 18.372 51.067 1.716   1.00 20.75 ? 84   VAL A C   1 
ATOM   400  O  O   . VAL A 1 62  ? 19.253 51.845 1.249   1.00 24.28 ? 84   VAL A O   1 
ATOM   401  C  CB  . VAL A 1 62  ? 18.849 48.712 2.362   1.00 20.22 ? 84   VAL A CB  1 
ATOM   402  C  CG1 . VAL A 1 62  ? 19.912 48.679 1.273   1.00 20.12 ? 84   VAL A CG1 1 
ATOM   403  C  CG2 . VAL A 1 62  ? 19.202 47.697 3.478   1.00 22.63 ? 84   VAL A CG2 1 
ATOM   404  N  N   . VAL A 1 63  ? 17.148 50.984 1.193   1.00 20.93 ? 85   VAL A N   1 
ATOM   405  C  CA  . VAL A 1 63  ? 16.803 51.858 0.035   1.00 20.34 ? 85   VAL A CA  1 
ATOM   406  C  C   . VAL A 1 63  ? 16.914 53.315 0.504   1.00 20.27 ? 85   VAL A C   1 
ATOM   407  O  O   . VAL A 1 63  ? 17.490 54.163 -0.195  1.00 19.16 ? 85   VAL A O   1 
ATOM   408  C  CB  . VAL A 1 63  ? 15.433 51.505 -0.569  1.00 20.41 ? 85   VAL A CB  1 
ATOM   409  C  CG1 . VAL A 1 63  ? 15.048 52.436 -1.724  1.00 23.61 ? 85   VAL A CG1 1 
ATOM   410  C  CG2 . VAL A 1 63  ? 15.439 50.065 -1.086  1.00 17.63 ? 85   VAL A CG2 1 
ATOM   411  N  N   . ALA A 1 64  ? 16.452 53.566 1.734   1.00 20.35 ? 86   ALA A N   1 
ATOM   412  C  CA  . ALA A 1 64  ? 16.412 54.914 2.264   1.00 20.02 ? 86   ALA A CA  1 
ATOM   413  C  C   . ALA A 1 64  ? 17.839 55.471 2.279   1.00 20.64 ? 86   ALA A C   1 
ATOM   414  O  O   . ALA A 1 64  ? 18.035 56.669 1.959   1.00 19.53 ? 86   ALA A O   1 
ATOM   415  C  CB  . ALA A 1 64  ? 15.797 54.909 3.685   1.00 20.84 ? 86   ALA A CB  1 
ATOM   416  N  N   . TRP A 1 65  ? 18.780 54.618 2.686   1.00 19.14 ? 87   TRP A N   1 
ATOM   417  C  CA  . TRP A 1 65  ? 20.157 55.048 2.923   1.00 20.73 ? 87   TRP A CA  1 
ATOM   418  C  C   . TRP A 1 65  ? 21.133 54.712 1.834   1.00 21.26 ? 87   TRP A C   1 
ATOM   419  O  O   . TRP A 1 65  ? 22.377 54.761 2.056   1.00 20.37 ? 87   TRP A O   1 
ATOM   420  C  CB  . TRP A 1 65  ? 20.647 54.564 4.318   1.00 19.96 ? 87   TRP A CB  1 
ATOM   421  C  CG  . TRP A 1 65  ? 19.831 55.148 5.405   1.00 20.48 ? 87   TRP A CG  1 
ATOM   422  C  CD1 . TRP A 1 65  ? 19.274 56.425 5.465   1.00 22.97 ? 87   TRP A CD1 1 
ATOM   423  C  CD2 . TRP A 1 65  ? 19.430 54.482 6.613   1.00 20.83 ? 87   TRP A CD2 1 
ATOM   424  N  NE1 . TRP A 1 65  ? 18.532 56.556 6.639   1.00 23.21 ? 87   TRP A NE1 1 
ATOM   425  C  CE2 . TRP A 1 65  ? 18.662 55.393 7.371   1.00 20.45 ? 87   TRP A CE2 1 
ATOM   426  C  CE3 . TRP A 1 65  ? 19.688 53.200 7.152   1.00 22.52 ? 87   TRP A CE3 1 
ATOM   427  C  CZ2 . TRP A 1 65  ? 18.147 55.066 8.613   1.00 19.65 ? 87   TRP A CZ2 1 
ATOM   428  C  CZ3 . TRP A 1 65  ? 19.181 52.892 8.382   1.00 21.96 ? 87   TRP A CZ3 1 
ATOM   429  C  CH2 . TRP A 1 65  ? 18.415 53.807 9.106   1.00 22.55 ? 87   TRP A CH2 1 
ATOM   430  N  N   . ALA A 1 66  ? 20.583 54.418 0.653   1.00 19.63 ? 88   ALA A N   1 
ATOM   431  C  CA  . ALA A 1 66  ? 21.355 54.120 -0.522  1.00 20.14 ? 88   ALA A CA  1 
ATOM   432  C  C   . ALA A 1 66  ? 22.357 55.237 -0.795  1.00 19.76 ? 88   ALA A C   1 
ATOM   433  O  O   . ALA A 1 66  ? 21.975 56.415 -0.856  1.00 18.87 ? 88   ALA A O   1 
ATOM   434  C  CB  . ALA A 1 66  ? 20.379 53.897 -1.800  1.00 19.54 ? 88   ALA A CB  1 
ATOM   435  N  N   . GLY A 1 67  ? 23.614 54.854 -1.039  1.00 20.29 ? 89   GLY A N   1 
ATOM   436  C  CA  . GLY A 1 67  ? 24.704 55.847 -1.153  1.00 22.63 ? 89   GLY A CA  1 
ATOM   437  C  C   . GLY A 1 67  ? 25.340 56.401 0.117   1.00 22.81 ? 89   GLY A C   1 
ATOM   438  O  O   . GLY A 1 67  ? 26.176 57.358 0.062   1.00 22.93 ? 89   GLY A O   1 
ATOM   439  N  N   . TYR A 1 68  ? 24.969 55.803 1.249   1.00 21.14 ? 90   TYR A N   1 
ATOM   440  C  CA  . TYR A 1 68  ? 25.350 56.223 2.563   1.00 22.27 ? 90   TYR A CA  1 
ATOM   441  C  C   . TYR A 1 68  ? 25.836 55.001 3.366   1.00 22.61 ? 90   TYR A C   1 
ATOM   442  O  O   . TYR A 1 68  ? 25.330 53.871 3.172   1.00 21.34 ? 90   TYR A O   1 
ATOM   443  C  CB  . TYR A 1 68  ? 24.165 56.858 3.300   1.00 22.37 ? 90   TYR A CB  1 
ATOM   444  C  CG  . TYR A 1 68  ? 24.540 57.782 4.473   1.00 23.94 ? 90   TYR A CG  1 
ATOM   445  C  CD1 . TYR A 1 68  ? 25.380 58.862 4.258   1.00 24.47 ? 90   TYR A CD1 1 
ATOM   446  C  CD2 . TYR A 1 68  ? 24.025 57.585 5.761   1.00 24.89 ? 90   TYR A CD2 1 
ATOM   447  C  CE1 . TYR A 1 68  ? 25.781 59.726 5.289   1.00 25.81 ? 90   TYR A CE1 1 
ATOM   448  C  CE2 . TYR A 1 68  ? 24.400 58.482 6.827   1.00 24.82 ? 90   TYR A CE2 1 
ATOM   449  C  CZ  . TYR A 1 68  ? 25.287 59.532 6.548   1.00 25.17 ? 90   TYR A CZ  1 
ATOM   450  O  OH  . TYR A 1 68  ? 25.658 60.433 7.534   1.00 28.13 ? 90   TYR A OH  1 
ATOM   451  N  N   . PRO A 1 69  ? 26.789 55.231 4.290   1.00 21.47 ? 91   PRO A N   1 
ATOM   452  C  CA  . PRO A 1 69  ? 27.265 54.044 5.056   1.00 22.30 ? 91   PRO A CA  1 
ATOM   453  C  C   . PRO A 1 69  ? 26.256 53.192 5.800   1.00 21.88 ? 91   PRO A C   1 
ATOM   454  O  O   . PRO A 1 69  ? 26.510 51.985 5.954   1.00 24.07 ? 91   PRO A O   1 
ATOM   455  C  CB  . PRO A 1 69  ? 28.278 54.650 6.043   1.00 21.51 ? 91   PRO A CB  1 
ATOM   456  C  CG  . PRO A 1 69  ? 28.891 55.829 5.237   1.00 22.33 ? 91   PRO A CG  1 
ATOM   457  C  CD  . PRO A 1 69  ? 27.574 56.437 4.627   1.00 21.94 ? 91   PRO A CD  1 
ATOM   458  N  N   . PHE A 1 70  ? 25.131 53.781 6.260   1.00 21.78 ? 92   PHE A N   1 
ATOM   459  C  CA  . PHE A 1 70  ? 24.106 53.036 6.974   1.00 22.02 ? 92   PHE A CA  1 
ATOM   460  C  C   . PHE A 1 70  ? 23.423 52.006 6.061   1.00 22.40 ? 92   PHE A C   1 
ATOM   461  O  O   . PHE A 1 70  ? 22.820 51.123 6.553   1.00 22.80 ? 92   PHE A O   1 
ATOM   462  C  CB  . PHE A 1 70  ? 23.031 53.973 7.559   1.00 22.69 ? 92   PHE A CB  1 
ATOM   463  C  CG  . PHE A 1 70  ? 23.414 54.649 8.825   1.00 22.00 ? 92   PHE A CG  1 
ATOM   464  C  CD1 . PHE A 1 70  ? 24.341 55.704 8.812   1.00 23.64 ? 92   PHE A CD1 1 
ATOM   465  C  CD2 . PHE A 1 70  ? 22.804 54.281 10.031  1.00 23.34 ? 92   PHE A CD2 1 
ATOM   466  C  CE1 . PHE A 1 70  ? 24.653 56.386 10.010  1.00 20.13 ? 92   PHE A CE1 1 
ATOM   467  C  CE2 . PHE A 1 70  ? 23.131 54.952 11.211  1.00 23.83 ? 92   PHE A CE2 1 
ATOM   468  C  CZ  . PHE A 1 70  ? 24.105 55.976 11.179  1.00 21.65 ? 92   PHE A CZ  1 
ATOM   469  N  N   . SER A 1 71  ? 23.599 52.096 4.733   1.00 22.28 ? 93   SER A N   1 
ATOM   470  C  CA  . SER A 1 71  ? 23.072 51.038 3.877   1.00 22.63 ? 93   SER A CA  1 
ATOM   471  C  C   . SER A 1 71  ? 23.954 49.758 3.927   1.00 23.49 ? 93   SER A C   1 
ATOM   472  O  O   . SER A 1 71  ? 23.533 48.720 3.423   1.00 24.74 ? 93   SER A O   1 
ATOM   473  C  CB  . SER A 1 71  ? 22.863 51.529 2.450   1.00 23.78 ? 93   SER A CB  1 
ATOM   474  O  OG  . SER A 1 71  ? 24.092 51.848 1.861   1.00 22.38 ? 93   SER A OG  1 
ATOM   475  N  N   . LYS A 1 72  ? 25.171 49.884 4.503   1.00 22.34 ? 94   LYS A N   1 
ATOM   476  C  CA  . LYS A 1 72  ? 26.081 48.736 4.788   1.00 22.91 ? 94   LYS A CA  1 
ATOM   477  C  C   . LYS A 1 72  ? 25.745 47.977 6.071   1.00 22.63 ? 94   LYS A C   1 
ATOM   478  O  O   . LYS A 1 72  ? 25.633 46.775 6.067   1.00 22.28 ? 94   LYS A O   1 
ATOM   479  C  CB  . LYS A 1 72  ? 27.518 49.190 4.959   1.00 22.95 ? 94   LYS A CB  1 
ATOM   480  C  CG  . LYS A 1 72  ? 28.175 49.770 3.716   1.00 23.72 ? 94   LYS A CG  1 
ATOM   481  C  CD  . LYS A 1 72  ? 29.673 49.870 3.999   1.00 28.81 ? 94   LYS A CD  1 
ATOM   482  C  CE  . LYS A 1 72  ? 30.386 50.833 3.078   1.00 30.41 ? 94   LYS A CE  1 
ATOM   483  N  NZ  . LYS A 1 72  ? 31.749 51.167 3.607   1.00 25.01 ? 94   LYS A NZ  1 
ATOM   484  N  N   . ASP A 1 73  ? 25.643 48.708 7.184   1.00 21.59 ? 95   ASP A N   1 
ATOM   485  C  CA  . ASP A 1 73  ? 25.528 48.097 8.465   1.00 21.40 ? 95   ASP A CA  1 
ATOM   486  C  C   . ASP A 1 73  ? 24.809 49.092 9.363   1.00 20.73 ? 95   ASP A C   1 
ATOM   487  O  O   . ASP A 1 73  ? 25.179 50.278 9.436   1.00 20.06 ? 95   ASP A O   1 
ATOM   488  C  CB  . ASP A 1 73  ? 26.953 47.899 9.009   1.00 22.45 ? 95   ASP A CB  1 
ATOM   489  C  CG  . ASP A 1 73  ? 27.038 46.856 10.106  1.00 22.62 ? 95   ASP A CG  1 
ATOM   490  O  OD1 . ASP A 1 73  ? 26.036 46.420 10.661  1.00 22.53 ? 95   ASP A OD1 1 
ATOM   491  O  OD2 . ASP A 1 73  ? 28.164 46.450 10.425  1.00 24.27 ? 95   ASP A OD2 1 
ATOM   492  N  N   . TYR A 1 74  ? 23.804 48.585 10.040  1.00 20.12 ? 96   TYR A N   1 
ATOM   493  C  CA  . TYR A 1 74  ? 23.010 49.404 10.974  1.00 21.25 ? 96   TYR A CA  1 
ATOM   494  C  C   . TYR A 1 74  ? 22.318 48.487 11.924  1.00 20.60 ? 96   TYR A C   1 
ATOM   495  O  O   . TYR A 1 74  ? 21.389 47.737 11.550  1.00 21.64 ? 96   TYR A O   1 
ATOM   496  C  CB  . TYR A 1 74  ? 22.043 50.361 10.283  1.00 20.67 ? 96   TYR A CB  1 
ATOM   497  C  CG  . TYR A 1 74  ? 21.124 51.042 11.277  1.00 23.26 ? 96   TYR A CG  1 
ATOM   498  C  CD1 . TYR A 1 74  ? 21.633 51.900 12.248  1.00 23.97 ? 96   TYR A CD1 1 
ATOM   499  C  CD2 . TYR A 1 74  ? 19.737 50.831 11.242  1.00 20.28 ? 96   TYR A CD2 1 
ATOM   500  C  CE1 . TYR A 1 74  ? 20.752 52.521 13.162  1.00 25.33 ? 96   TYR A CE1 1 
ATOM   501  C  CE2 . TYR A 1 74  ? 18.854 51.439 12.133  1.00 22.85 ? 96   TYR A CE2 1 
ATOM   502  C  CZ  . TYR A 1 74  ? 19.372 52.273 13.091  1.00 20.75 ? 96   TYR A CZ  1 
ATOM   503  O  OH  . TYR A 1 74  ? 18.500 52.877 13.977  1.00 22.69 ? 96   TYR A OH  1 
ATOM   504  N  N   . ASN A 1 75  ? 22.822 48.465 13.152  1.00 20.98 ? 97   ASN A N   1 
ATOM   505  C  CA  . ASN A 1 75  ? 22.183 47.653 14.190  1.00 19.90 ? 97   ASN A CA  1 
ATOM   506  C  C   . ASN A 1 75  ? 21.540 48.537 15.275  1.00 19.96 ? 97   ASN A C   1 
ATOM   507  O  O   . ASN A 1 75  ? 21.913 49.706 15.423  1.00 19.92 ? 97   ASN A O   1 
ATOM   508  C  CB  . ASN A 1 75  ? 23.221 46.717 14.830  1.00 18.39 ? 97   ASN A CB  1 
ATOM   509  C  CG  . ASN A 1 75  ? 24.141 46.095 13.788  1.00 23.52 ? 97   ASN A CG  1 
ATOM   510  O  OD1 . ASN A 1 75  ? 25.392 46.258 13.839  1.00 26.74 ? 97   ASN A OD1 1 
ATOM   511  N  ND2 . ASN A 1 75  ? 23.524 45.491 12.772  1.00 18.69 ? 97   ASN A ND2 1 
ATOM   512  N  N   . ALA A 1 76  ? 20.681 47.917 16.068  1.00 22.95 ? 98   ALA A N   1 
ATOM   513  C  CA  . ALA A 1 76  ? 19.999 48.572 17.183  1.00 22.79 ? 98   ALA A CA  1 
ATOM   514  C  C   . ALA A 1 76  ? 21.038 48.726 18.263  1.00 23.29 ? 98   ALA A C   1 
ATOM   515  O  O   . ALA A 1 76  ? 22.040 48.025 18.227  1.00 21.72 ? 98   ALA A O   1 
ATOM   516  C  CB  . ALA A 1 76  ? 18.843 47.691 17.678  1.00 24.85 ? 98   ALA A CB  1 
ATOM   517  N  N   . PRO A 1 77  ? 20.814 49.653 19.224  1.00 23.54 ? 99   PRO A N   1 
ATOM   518  C  CA  . PRO A 1 77  ? 21.805 49.911 20.289  1.00 24.57 ? 99   PRO A CA  1 
ATOM   519  C  C   . PRO A 1 77  ? 21.888 48.676 21.130  1.00 24.61 ? 99   PRO A C   1 
ATOM   520  O  O   . PRO A 1 77  ? 20.898 47.986 21.238  1.00 24.84 ? 99   PRO A O   1 
ATOM   521  C  CB  . PRO A 1 77  ? 21.169 51.047 21.107  1.00 26.08 ? 99   PRO A CB  1 
ATOM   522  C  CG  . PRO A 1 77  ? 19.998 51.539 20.323  1.00 26.33 ? 99   PRO A CG  1 
ATOM   523  C  CD  . PRO A 1 77  ? 19.607 50.488 19.351  1.00 23.75 ? 99   PRO A CD  1 
ATOM   524  N  N   . ARG A 1 78  ? 23.061 48.372 21.695  1.00 25.01 ? 100  ARG A N   1 
ATOM   525  C  CA  . ARG A 1 78  ? 23.139 47.421 22.814  1.00 22.93 ? 100  ARG A CA  1 
ATOM   526  C  C   . ARG A 1 78  ? 23.840 48.056 23.977  1.00 23.44 ? 100  ARG A C   1 
ATOM   527  O  O   . ARG A 1 78  ? 23.834 49.278 24.040  1.00 20.75 ? 100  ARG A O   1 
ATOM   528  C  CB  . ARG A 1 78  ? 23.668 46.049 22.389  1.00 23.04 ? 100  ARG A CB  1 
ATOM   529  C  CG  . ARG A 1 78  ? 25.068 46.073 21.808  1.00 23.86 ? 100  ARG A CG  1 
ATOM   530  C  CD  . ARG A 1 78  ? 25.525 44.713 21.497  1.00 29.72 ? 100  ARG A CD  1 
ATOM   531  N  NE  . ARG A 1 78  ? 26.862 44.752 20.930  1.00 26.04 ? 100  ARG A NE  1 
ATOM   532  C  CZ  . ARG A 1 78  ? 27.671 43.699 20.884  1.00 27.05 ? 100  ARG A CZ  1 
ATOM   533  N  NH1 . ARG A 1 78  ? 27.225 42.532 21.298  1.00 26.39 ? 100  ARG A NH1 1 
ATOM   534  N  NH2 . ARG A 1 78  ? 28.885 43.808 20.356  1.00 24.28 ? 100  ARG A NH2 1 
ATOM   535  N  N   . GLY A 1 79  ? 24.416 47.271 24.917  1.00 22.32 ? 101  GLY A N   1 
ATOM   536  C  CA  . GLY A 1 79  ? 24.920 47.895 26.166  1.00 22.55 ? 101  GLY A CA  1 
ATOM   537  C  C   . GLY A 1 79  ? 26.128 48.801 25.980  1.00 22.51 ? 101  GLY A C   1 
ATOM   538  O  O   . GLY A 1 79  ? 26.907 48.658 25.026  1.00 22.31 ? 101  GLY A O   1 
ATOM   539  N  N   . HIS A 1 80  ? 26.294 49.750 26.912  1.00 23.55 ? 102  HIS A N   1 
ATOM   540  C  CA  . HIS A 1 80  ? 27.375 50.713 26.810  1.00 23.05 ? 102  HIS A CA  1 
ATOM   541  C  C   . HIS A 1 80  ? 28.728 49.993 26.813  1.00 22.08 ? 102  HIS A C   1 
ATOM   542  O  O   . HIS A 1 80  ? 29.708 50.527 26.288  1.00 22.24 ? 102  HIS A O   1 
ATOM   543  C  CB  . HIS A 1 80  ? 27.326 51.696 27.997  1.00 22.20 ? 102  HIS A CB  1 
ATOM   544  C  CG  . HIS A 1 80  ? 26.310 52.797 27.842  1.00 20.45 ? 102  HIS A CG  1 
ATOM   545  N  ND1 . HIS A 1 80  ? 25.983 53.656 28.880  1.00 23.74 ? 102  HIS A ND1 1 
ATOM   546  C  CD2 . HIS A 1 80  ? 25.581 53.202 26.768  1.00 22.66 ? 102  HIS A CD2 1 
ATOM   547  C  CE1 . HIS A 1 80  ? 25.090 54.533 28.448  1.00 23.69 ? 102  HIS A CE1 1 
ATOM   548  N  NE2 . HIS A 1 80  ? 24.842 54.293 27.171  1.00 19.10 ? 102  HIS A NE2 1 
ATOM   549  N  N   . TYR A 1 81  ? 28.748 48.810 27.434  1.00 20.45 ? 103  TYR A N   1 
ATOM   550  C  CA  . TYR A 1 81  ? 29.933 47.936 27.464  1.00 21.02 ? 103  TYR A CA  1 
ATOM   551  C  C   . TYR A 1 81  ? 30.452 47.708 26.039  1.00 21.02 ? 103  TYR A C   1 
ATOM   552  O  O   . TYR A 1 81  ? 31.639 47.466 25.832  1.00 22.45 ? 103  TYR A O   1 
ATOM   553  C  CB  . TYR A 1 81  ? 29.544 46.570 28.035  1.00 21.24 ? 103  TYR A CB  1 
ATOM   554  C  CG  . TYR A 1 81  ? 30.701 45.629 28.313  1.00 23.61 ? 103  TYR A CG  1 
ATOM   555  C  CD1 . TYR A 1 81  ? 31.455 45.792 29.482  1.00 25.50 ? 103  TYR A CD1 1 
ATOM   556  C  CD2 . TYR A 1 81  ? 31.012 44.576 27.447  1.00 21.50 ? 103  TYR A CD2 1 
ATOM   557  C  CE1 . TYR A 1 81  ? 32.577 44.925 29.768  1.00 21.74 ? 103  TYR A CE1 1 
ATOM   558  C  CE2 . TYR A 1 81  ? 32.111 43.670 27.754  1.00 25.51 ? 103  TYR A CE2 1 
ATOM   559  C  CZ  . TYR A 1 81  ? 32.871 43.892 28.894  1.00 26.63 ? 103  TYR A CZ  1 
ATOM   560  O  OH  . TYR A 1 81  ? 33.935 43.077 29.218  1.00 26.42 ? 103  TYR A OH  1 
ATOM   561  N  N   . TYR A 1 82  ? 29.542 47.744 25.054  1.00 20.79 ? 104  TYR A N   1 
ATOM   562  C  CA  . TYR A 1 82  ? 29.936 47.481 23.649  1.00 22.34 ? 104  TYR A CA  1 
ATOM   563  C  C   . TYR A 1 82  ? 30.180 48.685 22.747  1.00 21.87 ? 104  TYR A C   1 
ATOM   564  O  O   . TYR A 1 82  ? 30.588 48.499 21.600  1.00 21.07 ? 104  TYR A O   1 
ATOM   565  C  CB  . TYR A 1 82  ? 28.923 46.513 22.976  1.00 22.98 ? 104  TYR A CB  1 
ATOM   566  C  CG  . TYR A 1 82  ? 28.792 45.232 23.775  1.00 24.68 ? 104  TYR A CG  1 
ATOM   567  C  CD1 . TYR A 1 82  ? 29.762 44.215 23.690  1.00 21.48 ? 104  TYR A CD1 1 
ATOM   568  C  CD2 . TYR A 1 82  ? 27.745 45.065 24.678  1.00 24.66 ? 104  TYR A CD2 1 
ATOM   569  C  CE1 . TYR A 1 82  ? 29.656 43.051 24.479  1.00 23.50 ? 104  TYR A CE1 1 
ATOM   570  C  CE2 . TYR A 1 82  ? 27.630 43.909 25.472  1.00 23.58 ? 104  TYR A CE2 1 
ATOM   571  C  CZ  . TYR A 1 82  ? 28.599 42.916 25.385  1.00 27.70 ? 104  TYR A CZ  1 
ATOM   572  O  OH  . TYR A 1 82  ? 28.417 41.766 26.198  1.00 26.91 ? 104  TYR A OH  1 
ATOM   573  N  N   . ALA A 1 83  ? 29.892 49.892 23.210  1.00 23.07 ? 105  ALA A N   1 
ATOM   574  C  CA  . ALA A 1 83  ? 29.929 51.061 22.306  1.00 22.20 ? 105  ALA A CA  1 
ATOM   575  C  C   . ALA A 1 83  ? 31.269 51.201 21.521  1.00 22.66 ? 105  ALA A C   1 
ATOM   576  O  O   . ALA A 1 83  ? 31.269 51.370 20.303  1.00 24.62 ? 105  ALA A O   1 
ATOM   577  C  CB  . ALA A 1 83  ? 29.581 52.374 23.071  1.00 23.49 ? 105  ALA A CB  1 
ATOM   578  N  N   . LEU A 1 84  ? 32.402 51.127 22.195  1.00 22.78 ? 106  LEU A N   1 
ATOM   579  C  CA  . LEU A 1 84  ? 33.687 51.286 21.487  1.00 23.80 ? 106  LEU A CA  1 
ATOM   580  C  C   . LEU A 1 84  ? 33.890 50.123 20.444  1.00 23.02 ? 106  LEU A C   1 
ATOM   581  O  O   . LEU A 1 84  ? 34.144 50.326 19.229  1.00 22.26 ? 106  LEU A O   1 
ATOM   582  C  CB  . LEU A 1 84  ? 34.794 51.380 22.509  1.00 23.98 ? 106  LEU A CB  1 
ATOM   583  C  CG  . LEU A 1 84  ? 36.173 51.909 22.092  1.00 25.96 ? 106  LEU A CG  1 
ATOM   584  C  CD1 . LEU A 1 84  ? 36.995 50.820 21.402  1.00 28.85 ? 106  LEU A CD1 1 
ATOM   585  C  CD2 . LEU A 1 84  ? 36.143 53.196 21.295  1.00 26.12 ? 106  LEU A CD2 1 
ATOM   586  N  N   . GLN A 1 85  ? 33.656 48.907 20.886  1.00 24.22 ? 107  GLN A N   1 
ATOM   587  C  CA  . GLN A 1 85  ? 33.843 47.794 19.960  1.00 23.48 ? 107  GLN A CA  1 
ATOM   588  C  C   . GLN A 1 85  ? 32.879 47.827 18.754  1.00 22.59 ? 107  GLN A C   1 
ATOM   589  O  O   . GLN A 1 85  ? 33.249 47.476 17.635  1.00 20.66 ? 107  GLN A O   1 
ATOM   590  C  CB  . GLN A 1 85  ? 33.753 46.463 20.662  1.00 23.87 ? 107  GLN A CB  1 
ATOM   591  C  CG  . GLN A 1 85  ? 34.276 45.341 19.804  1.00 24.34 ? 107  GLN A CG  1 
ATOM   592  C  CD  . GLN A 1 85  ? 35.736 45.503 19.488  1.00 26.06 ? 107  GLN A CD  1 
ATOM   593  O  OE1 . GLN A 1 85  ? 36.540 45.845 20.389  1.00 24.87 ? 107  GLN A OE1 1 
ATOM   594  N  NE2 . GLN A 1 85  ? 36.098 45.334 18.190  1.00 24.19 ? 107  GLN A NE2 1 
ATOM   595  N  N   . ASP A 1 86  ? 31.654 48.269 18.986  1.00 21.03 ? 108  ASP A N   1 
ATOM   596  C  CA  . ASP A 1 86  ? 30.700 48.409 17.904  1.00 21.69 ? 108  ASP A CA  1 
ATOM   597  C  C   . ASP A 1 86  ? 31.081 49.443 16.864  1.00 21.84 ? 108  ASP A C   1 
ATOM   598  O  O   . ASP A 1 86  ? 30.927 49.186 15.667  1.00 21.70 ? 108  ASP A O   1 
ATOM   599  C  CB  . ASP A 1 86  ? 29.291 48.653 18.495  1.00 22.75 ? 108  ASP A CB  1 
ATOM   600  C  CG  . ASP A 1 86  ? 28.724 47.405 19.189  1.00 23.31 ? 108  ASP A CG  1 
ATOM   601  O  OD1 . ASP A 1 86  ? 29.248 46.267 18.947  1.00 23.45 ? 108  ASP A OD1 1 
ATOM   602  O  OD2 . ASP A 1 86  ? 27.746 47.520 19.953  1.00 23.07 ? 108  ASP A OD2 1 
ATOM   603  N  N   . ASN A 1 87  ? 31.594 50.595 17.322  1.00 22.30 ? 109  ASN A N   1 
ATOM   604  C  CA  . ASN A 1 87  ? 32.289 51.610 16.503  1.00 20.23 ? 109  ASN A CA  1 
ATOM   605  C  C   . ASN A 1 87  ? 33.391 50.985 15.608  1.00 21.03 ? 109  ASN A C   1 
ATOM   606  O  O   . ASN A 1 87  ? 33.551 51.308 14.401  1.00 20.52 ? 109  ASN A O   1 
ATOM   607  C  CB  . ASN A 1 87  ? 32.855 52.670 17.453  1.00 21.20 ? 109  ASN A CB  1 
ATOM   608  C  CG  . ASN A 1 87  ? 33.281 53.944 16.773  1.00 23.48 ? 109  ASN A CG  1 
ATOM   609  O  OD1 . ASN A 1 87  ? 34.422 54.356 16.903  1.00 26.69 ? 109  ASN A OD1 1 
ATOM   610  N  ND2 . ASN A 1 87  ? 32.350 54.616 16.076  1.00 25.70 ? 109  ASN A ND2 1 
ATOM   611  N  N   . ILE A 1 88  ? 34.197 50.108 16.205  1.00 20.72 ? 110  ILE A N   1 
ATOM   612  C  CA  . ILE A 1 88  ? 35.265 49.465 15.467  1.00 21.73 ? 110  ILE A CA  1 
ATOM   613  C  C   . ILE A 1 88  ? 34.707 48.436 14.473  1.00 21.40 ? 110  ILE A C   1 
ATOM   614  O  O   . ILE A 1 88  ? 35.168 48.363 13.346  1.00 21.79 ? 110  ILE A O   1 
ATOM   615  C  CB  . ILE A 1 88  ? 36.230 48.756 16.430  1.00 22.22 ? 110  ILE A CB  1 
ATOM   616  C  CG1 . ILE A 1 88  ? 36.924 49.859 17.284  1.00 21.92 ? 110  ILE A CG1 1 
ATOM   617  C  CG2 . ILE A 1 88  ? 37.308 47.882 15.607  1.00 21.44 ? 110  ILE A CG2 1 
ATOM   618  C  CD1 . ILE A 1 88  ? 37.919 49.393 18.366  1.00 25.45 ? 110  ILE A CD1 1 
ATOM   619  N  N   . ASN A 1 89  ? 33.720 47.673 14.916  1.00 21.98 ? 111  ASN A N   1 
ATOM   620  C  CA  . ASN A 1 89  ? 33.134 46.565 14.135  1.00 20.57 ? 111  ASN A CA  1 
ATOM   621  C  C   . ASN A 1 89  ? 32.241 47.003 12.980  1.00 21.06 ? 111  ASN A C   1 
ATOM   622  O  O   . ASN A 1 89  ? 32.163 46.299 11.949  1.00 21.82 ? 111  ASN A O   1 
ATOM   623  C  CB  . ASN A 1 89  ? 32.285 45.656 15.023  1.00 21.43 ? 111  ASN A CB  1 
ATOM   624  C  CG  . ASN A 1 89  ? 33.142 44.751 15.969  1.00 22.16 ? 111  ASN A CG  1 
ATOM   625  O  OD1 . ASN A 1 89  ? 34.352 44.821 15.933  1.00 23.70 ? 111  ASN A OD1 1 
ATOM   626  N  ND2 . ASN A 1 89  ? 32.490 43.958 16.825  1.00 25.91 ? 111  ASN A ND2 1 
ATOM   627  N  N   . THR A 1 90  ? 31.448 48.058 13.187  1.00 20.74 ? 112  THR A N   1 
ATOM   628  C  CA  . THR A 1 90  ? 30.451 48.394 12.135  1.00 20.95 ? 112  THR A CA  1 
ATOM   629  C  C   . THR A 1 90  ? 31.104 48.479 10.758  1.00 20.78 ? 112  THR A C   1 
ATOM   630  O  O   . THR A 1 90  ? 32.186 49.040 10.599  1.00 21.89 ? 112  THR A O   1 
ATOM   631  C  CB  . THR A 1 90  ? 29.619 49.704 12.485  1.00 19.93 ? 112  THR A CB  1 
ATOM   632  O  OG1 . THR A 1 90  ? 28.705 49.951 11.416  1.00 21.83 ? 112  THR A OG1 1 
ATOM   633  C  CG2 . THR A 1 90  ? 30.533 50.926 12.679  1.00 21.31 ? 112  THR A CG2 1 
ATOM   634  N  N   . LEU A 1 91  ? 30.448 47.967 9.717   1.00 22.70 ? 113  LEU A N   1 
ATOM   635  C  CA  . LEU A 1 91  ? 31.011 48.192 8.403   1.00 22.55 ? 113  LEU A CA  1 
ATOM   636  C  C   . LEU A 1 91  ? 31.129 49.665 8.078   1.00 22.66 ? 113  LEU A C   1 
ATOM   637  O  O   . LEU A 1 91  ? 31.870 50.028 7.192   1.00 21.61 ? 113  LEU A O   1 
ATOM   638  C  CB  . LEU A 1 91  ? 30.264 47.449 7.296   1.00 22.31 ? 113  LEU A CB  1 
ATOM   639  C  CG  . LEU A 1 91  ? 30.056 45.953 7.486   1.00 24.06 ? 113  LEU A CG  1 
ATOM   640  C  CD1 . LEU A 1 91  ? 29.230 45.417 6.354   1.00 21.72 ? 113  LEU A CD1 1 
ATOM   641  C  CD2 . LEU A 1 91  ? 31.411 45.178 7.454   1.00 21.33 ? 113  LEU A CD2 1 
ATOM   642  N  N   . ARG A 1 92  ? 30.411 50.538 8.813   1.00 21.39 ? 114  ARG A N   1 
ATOM   643  C  CA  . ARG A 1 92  ? 30.420 51.983 8.448   1.00 22.35 ? 114  ARG A CA  1 
ATOM   644  C  C   . ARG A 1 92  ? 31.781 52.601 8.561   1.00 22.05 ? 114  ARG A C   1 
ATOM   645  O  O   . ARG A 1 92  ? 32.132 53.533 7.773   1.00 23.63 ? 114  ARG A O   1 
ATOM   646  C  CB  . ARG A 1 92  ? 29.409 52.784 9.321   1.00 22.00 ? 114  ARG A CB  1 
ATOM   647  C  CG  . ARG A 1 92  ? 28.029 52.339 9.022   1.00 21.90 ? 114  ARG A CG  1 
ATOM   648  C  CD  . ARG A 1 92  ? 26.893 53.249 9.510   1.00 23.25 ? 114  ARG A CD  1 
ATOM   649  N  NE  . ARG A 1 92  ? 26.957 53.796 10.899  1.00 23.96 ? 114  ARG A NE  1 
ATOM   650  C  CZ  . ARG A 1 92  ? 26.352 53.236 11.943  1.00 22.07 ? 114  ARG A CZ  1 
ATOM   651  N  NH1 . ARG A 1 92  ? 25.730 52.050 11.810  1.00 22.13 ? 114  ARG A NH1 1 
ATOM   652  N  NH2 . ARG A 1 92  ? 26.426 53.794 13.158  1.00 22.84 ? 114  ARG A NH2 1 
ATOM   653  N  N   . THR A 1 93  ? 32.561 52.123 9.556   1.00 22.03 ? 115  THR A N   1 
ATOM   654  C  CA  . THR A 1 93  ? 33.938 52.591 9.688   1.00 22.97 ? 115  THR A CA  1 
ATOM   655  C  C   . THR A 1 93  ? 34.936 51.891 8.734   1.00 23.49 ? 115  THR A C   1 
ATOM   656  O  O   . THR A 1 93  ? 36.101 52.306 8.668   1.00 22.91 ? 115  THR A O   1 
ATOM   657  C  CB  . THR A 1 93  ? 34.455 52.471 11.135  1.00 22.64 ? 115  THR A CB  1 
ATOM   658  O  OG1 . THR A 1 93  ? 34.170 51.167 11.622  1.00 26.59 ? 115  THR A OG1 1 
ATOM   659  C  CG2 . THR A 1 93  ? 33.765 53.527 11.990  1.00 22.95 ? 115  THR A CG2 1 
ATOM   660  N  N   . GLY A 1 94  ? 34.486 50.894 7.984   1.00 23.55 ? 116  GLY A N   1 
ATOM   661  C  CA  . GLY A 1 94  ? 35.381 50.363 6.919   1.00 25.46 ? 116  GLY A CA  1 
ATOM   662  C  C   . GLY A 1 94  ? 36.694 49.767 7.468   1.00 25.84 ? 116  GLY A C   1 
ATOM   663  O  O   . GLY A 1 94  ? 36.755 49.279 8.579   1.00 25.80 ? 116  GLY A O   1 
ATOM   664  N  N   . ALA A 1 95  ? 37.738 49.800 6.646   1.00 27.11 ? 117  ALA A N   1 
ATOM   665  C  CA  . ALA A 1 95  ? 38.930 49.017 6.863   1.00 26.39 ? 117  ALA A CA  1 
ATOM   666  C  C   . ALA A 1 95  ? 40.181 49.872 6.616   1.00 27.53 ? 117  ALA A C   1 
ATOM   667  O  O   . ALA A 1 95  ? 40.839 49.776 5.558   1.00 27.81 ? 117  ALA A O   1 
ATOM   668  C  CB  . ALA A 1 95  ? 38.914 47.818 5.948   1.00 27.01 ? 117  ALA A CB  1 
ATOM   669  N  N   . PRO A 1 96  ? 40.484 50.782 7.548   1.00 27.45 ? 118  PRO A N   1 
ATOM   670  C  CA  . PRO A 1 96  ? 41.661 51.626 7.439   1.00 27.88 ? 118  PRO A CA  1 
ATOM   671  C  C   . PRO A 1 96  ? 42.890 50.736 7.359   1.00 27.25 ? 118  PRO A C   1 
ATOM   672  O  O   . PRO A 1 96  ? 42.899 49.673 7.962   1.00 26.53 ? 118  PRO A O   1 
ATOM   673  C  CB  . PRO A 1 96  ? 41.691 52.374 8.779   1.00 27.30 ? 118  PRO A CB  1 
ATOM   674  C  CG  . PRO A 1 96  ? 40.714 51.635 9.666   1.00 29.20 ? 118  PRO A CG  1 
ATOM   675  C  CD  . PRO A 1 96  ? 39.691 51.062 8.753   1.00 26.86 ? 118  PRO A CD  1 
ATOM   676  N  N   . VAL A 1 97  ? 43.912 51.150 6.629   1.00 28.39 ? 119  VAL A N   1 
ATOM   677  C  CA  . VAL A 1 97  ? 45.173 50.386 6.700   1.00 30.06 ? 119  VAL A CA  1 
ATOM   678  C  C   . VAL A 1 97  ? 46.235 51.062 7.565   1.00 30.52 ? 119  VAL A C   1 
ATOM   679  O  O   . VAL A 1 97  ? 47.285 50.492 7.824   1.00 31.94 ? 119  VAL A O   1 
ATOM   680  C  CB  . VAL A 1 97  ? 45.693 50.023 5.292   1.00 30.88 ? 119  VAL A CB  1 
ATOM   681  C  CG1 . VAL A 1 97  ? 44.607 49.317 4.555   1.00 29.59 ? 119  VAL A CG1 1 
ATOM   682  C  CG2 . VAL A 1 97  ? 46.123 51.304 4.535   1.00 29.07 ? 119  VAL A CG2 1 
ATOM   683  N  N   . ASP A 1 98  ? 45.923 52.265 8.040   1.00 31.52 ? 120  ASP A N   1 
ATOM   684  C  CA  . ASP A 1 98  ? 46.821 53.085 8.844   1.00 32.36 ? 120  ASP A CA  1 
ATOM   685  C  C   . ASP A 1 98  ? 46.026 54.287 9.342   1.00 32.32 ? 120  ASP A C   1 
ATOM   686  O  O   . ASP A 1 98  ? 44.816 54.408 9.087   1.00 31.95 ? 120  ASP A O   1 
ATOM   687  C  CB  . ASP A 1 98  ? 48.055 53.573 8.032   1.00 32.01 ? 120  ASP A CB  1 
ATOM   688  C  CG  . ASP A 1 98  ? 47.693 54.503 6.858   1.00 32.55 ? 120  ASP A CG  1 
ATOM   689  O  OD1 . ASP A 1 98  ? 46.591 55.078 6.735   1.00 30.82 ? 120  ASP A OD1 1 
ATOM   690  O  OD2 . ASP A 1 98  ? 48.556 54.679 5.992   1.00 39.50 ? 120  ASP A OD2 1 
ATOM   691  N  N   . GLY A 1 99  ? 46.706 55.185 10.048  1.00 33.46 ? 121  GLY A N   1 
ATOM   692  C  CA  . GLY A 1 99  ? 46.059 56.362 10.613  1.00 34.04 ? 121  GLY A CA  1 
ATOM   693  C  C   . GLY A 1 99  ? 45.583 57.452 9.669   1.00 34.65 ? 121  GLY A C   1 
ATOM   694  O  O   . GLY A 1 99  ? 45.025 58.456 10.128  1.00 34.43 ? 121  GLY A O   1 
ATOM   695  N  N   . LYS A 1 100 ? 45.815 57.271 8.358   1.00 34.12 ? 122  LYS A N   1 
ATOM   696  C  CA  . LYS A 1 100 ? 45.389 58.237 7.344   1.00 34.46 ? 122  LYS A CA  1 
ATOM   697  C  C   . LYS A 1 100 ? 44.383 57.667 6.338   1.00 33.48 ? 122  LYS A C   1 
ATOM   698  O  O   . LYS A 1 100 ? 44.008 58.339 5.377   1.00 32.79 ? 122  LYS A O   1 
ATOM   699  C  CB  . LYS A 1 100 ? 46.622 58.780 6.585   1.00 35.70 ? 122  LYS A CB  1 
ATOM   700  C  CG  . LYS A 1 100 ? 47.688 59.457 7.465   1.00 38.77 ? 122  LYS A CG  1 
ATOM   701  C  CD  . LYS A 1 100 ? 47.565 60.979 7.473   1.00 42.75 ? 122  LYS A CD  1 
ATOM   702  C  CE  . LYS A 1 100 ? 48.744 61.631 8.203   1.00 42.11 ? 122  LYS A CE  1 
ATOM   703  N  NZ  . LYS A 1 100 ? 48.302 62.914 8.857   1.00 46.40 ? 122  LYS A NZ  1 
ATOM   704  N  N   . THR A 1 101 ? 43.927 56.439 6.560   1.00 31.93 ? 123  THR A N   1 
ATOM   705  C  CA  . THR A 1 101 ? 42.955 55.823 5.639   1.00 31.56 ? 123  THR A CA  1 
ATOM   706  C  C   . THR A 1 101 ? 41.639 55.450 6.329   1.00 30.91 ? 123  THR A C   1 
ATOM   707  O  O   . THR A 1 101 ? 41.499 55.622 7.552   1.00 30.57 ? 123  THR A O   1 
ATOM   708  C  CB  . THR A 1 101 ? 43.587 54.598 4.942   1.00 31.40 ? 123  THR A CB  1 
ATOM   709  O  OG1 . THR A 1 101 ? 44.160 53.731 5.935   1.00 30.62 ? 123  THR A OG1 1 
ATOM   710  C  CG2 . THR A 1 101 ? 44.712 55.070 3.982   1.00 31.32 ? 123  THR A CG2 1 
ATOM   711  N  N   . GLY A 1 102 ? 40.700 54.894 5.553   1.00 29.79 ? 124  GLY A N   1 
ATOM   712  C  CA  . GLY A 1 102 ? 39.384 54.552 6.077   1.00 28.70 ? 124  GLY A CA  1 
ATOM   713  C  C   . GLY A 1 102 ? 38.464 55.677 5.675   1.00 28.43 ? 124  GLY A C   1 
ATOM   714  O  O   . GLY A 1 102 ? 38.934 56.809 5.459   1.00 26.57 ? 124  GLY A O   1 
ATOM   715  N  N   . PRO A 1 103 ? 37.159 55.371 5.557   1.00 28.12 ? 125  PRO A N   1 
ATOM   716  C  CA  . PRO A 1 103 ? 36.147 56.277 5.048   1.00 28.86 ? 125  PRO A CA  1 
ATOM   717  C  C   . PRO A 1 103 ? 35.759 57.443 5.979   1.00 28.41 ? 125  PRO A C   1 
ATOM   718  O  O   . PRO A 1 103 ? 35.495 58.561 5.496   1.00 29.61 ? 125  PRO A O   1 
ATOM   719  C  CB  . PRO A 1 103 ? 34.930 55.360 4.802   1.00 27.77 ? 125  PRO A CB  1 
ATOM   720  C  CG  . PRO A 1 103 ? 35.096 54.198 5.744   1.00 28.43 ? 125  PRO A CG  1 
ATOM   721  C  CD  . PRO A 1 103 ? 36.612 54.052 5.935   1.00 28.67 ? 125  PRO A CD  1 
ATOM   722  N  N   . LEU A 1 104 ? 35.789 57.193 7.289   1.00 27.82 ? 126  LEU A N   1 
ATOM   723  C  CA  . LEU A 1 104 ? 35.196 58.104 8.262   1.00 25.92 ? 126  LEU A CA  1 
ATOM   724  C  C   . LEU A 1 104 ? 36.190 58.951 9.094   1.00 26.37 ? 126  LEU A C   1 
ATOM   725  O  O   . LEU A 1 104 ? 37.372 58.564 9.248   1.00 25.35 ? 126  LEU A O   1 
ATOM   726  C  CB  . LEU A 1 104 ? 34.198 57.323 9.169   1.00 25.33 ? 126  LEU A CB  1 
ATOM   727  C  CG  . LEU A 1 104 ? 33.037 56.560 8.464   1.00 25.05 ? 126  LEU A CG  1 
ATOM   728  C  CD1 . LEU A 1 104 ? 31.935 56.076 9.461   1.00 26.32 ? 126  LEU A CD1 1 
ATOM   729  C  CD2 . LEU A 1 104 ? 32.391 57.327 7.358   1.00 27.90 ? 126  LEU A CD2 1 
ATOM   730  N  N   . PRO A 1 105 ? 35.728 60.126 9.574   1.00 26.54 ? 127  PRO A N   1 
ATOM   731  C  CA  . PRO A 1 105 ? 36.623 61.023 10.307  1.00 26.38 ? 127  PRO A CA  1 
ATOM   732  C  C   . PRO A 1 105 ? 36.698 60.698 11.778  1.00 25.13 ? 127  PRO A C   1 
ATOM   733  O  O   . PRO A 1 105 ? 35.934 59.873 12.248  1.00 24.25 ? 127  PRO A O   1 
ATOM   734  C  CB  . PRO A 1 105 ? 35.960 62.395 10.101  1.00 27.03 ? 127  PRO A CB  1 
ATOM   735  C  CG  . PRO A 1 105 ? 34.543 62.076 10.182  1.00 27.45 ? 127  PRO A CG  1 
ATOM   736  C  CD  . PRO A 1 105 ? 34.412 60.765 9.389   1.00 27.34 ? 127  PRO A CD  1 
ATOM   737  N  N   . SER A 1 106 ? 37.604 61.389 12.454  1.00 26.08 ? 128  SER A N   1 
ATOM   738  C  CA  . SER A 1 106 ? 37.895 61.260 13.880  1.00 26.46 ? 128  SER A CA  1 
ATOM   739  C  C   . SER A 1 106 ? 36.667 61.478 14.744  1.00 25.72 ? 128  SER A C   1 
ATOM   740  O  O   . SER A 1 106 ? 36.595 60.922 15.843  1.00 24.91 ? 128  SER A O   1 
ATOM   741  C  CB  . SER A 1 106 ? 39.031 62.226 14.260  1.00 26.76 ? 128  SER A CB  1 
ATOM   742  O  OG  . SER A 1 106 ? 38.698 63.608 13.989  1.00 28.72 ? 128  SER A OG  1 
ATOM   743  N  N   . ALA A 1 107 ? 35.707 62.272 14.262  1.00 24.27 ? 129  ALA A N   1 
ATOM   744  C  CA  . ALA A 1 107 ? 34.516 62.553 15.061  1.00 24.20 ? 129  ALA A CA  1 
ATOM   745  C  C   . ALA A 1 107 ? 33.719 61.319 15.423  1.00 23.96 ? 129  ALA A C   1 
ATOM   746  O  O   . ALA A 1 107 ? 32.982 61.332 16.394  1.00 24.20 ? 129  ALA A O   1 
ATOM   747  C  CB  . ALA A 1 107 ? 33.606 63.637 14.383  1.00 24.64 ? 129  ALA A CB  1 
ATOM   748  N  N   . CYS A 1 108 ? 33.898 60.217 14.685  1.00 23.05 ? 130  CYS A N   1 
ATOM   749  C  CA  . CYS A 1 108 ? 33.123 58.992 14.991  1.00 22.16 ? 130  CYS A CA  1 
ATOM   750  C  C   . CYS A 1 108 ? 33.476 58.364 16.353  1.00 21.75 ? 130  CYS A C   1 
ATOM   751  O  O   . CYS A 1 108 ? 32.741 57.524 16.850  1.00 23.03 ? 130  CYS A O   1 
ATOM   752  C  CB  . CYS A 1 108 ? 33.288 57.956 13.884  1.00 21.93 ? 130  CYS A CB  1 
ATOM   753  S  SG  . CYS A 1 108 ? 32.392 58.459 12.374  1.00 22.93 ? 130  CYS A SG  1 
ATOM   754  N  N   . TRP A 1 109 ? 34.601 58.800 16.944  1.00 22.41 ? 131  TRP A N   1 
ATOM   755  C  CA  . TRP A 1 109 ? 35.008 58.324 18.267  1.00 23.62 ? 131  TRP A CA  1 
ATOM   756  C  C   . TRP A 1 109 ? 34.242 58.965 19.435  1.00 22.86 ? 131  TRP A C   1 
ATOM   757  O  O   . TRP A 1 109 ? 34.160 58.378 20.515  1.00 24.46 ? 131  TRP A O   1 
ATOM   758  C  CB  . TRP A 1 109 ? 36.475 58.662 18.504  1.00 23.91 ? 131  TRP A CB  1 
ATOM   759  C  CG  . TRP A 1 109 ? 37.430 57.907 17.673  1.00 24.59 ? 131  TRP A CG  1 
ATOM   760  C  CD1 . TRP A 1 109 ? 38.226 58.413 16.712  1.00 25.82 ? 131  TRP A CD1 1 
ATOM   761  C  CD2 . TRP A 1 109 ? 37.723 56.510 17.753  1.00 24.18 ? 131  TRP A CD2 1 
ATOM   762  N  NE1 . TRP A 1 109 ? 39.051 57.428 16.190  1.00 24.95 ? 131  TRP A NE1 1 
ATOM   763  C  CE2 . TRP A 1 109 ? 38.741 56.242 16.788  1.00 25.84 ? 131  TRP A CE2 1 
ATOM   764  C  CE3 . TRP A 1 109 ? 37.213 55.456 18.503  1.00 25.54 ? 131  TRP A CE3 1 
ATOM   765  C  CZ2 . TRP A 1 109 ? 39.262 54.959 16.575  1.00 24.32 ? 131  TRP A CZ2 1 
ATOM   766  C  CZ3 . TRP A 1 109 ? 37.746 54.192 18.306  1.00 26.55 ? 131  TRP A CZ3 1 
ATOM   767  C  CH2 . TRP A 1 109 ? 38.748 53.956 17.322  1.00 23.87 ? 131  TRP A CH2 1 
ATOM   768  N  N   . THR A 1 110 ? 33.651 60.121 19.170  1.00 23.15 ? 132  THR A N   1 
ATOM   769  C  CA  . THR A 1 110 ? 33.328 61.177 20.141  1.00 22.51 ? 132  THR A CA  1 
ATOM   770  C  C   . THR A 1 110 ? 32.402 60.677 21.212  1.00 23.16 ? 132  THR A C   1 
ATOM   771  O  O   . THR A 1 110 ? 32.552 61.068 22.400  1.00 22.84 ? 132  THR A O   1 
ATOM   772  C  CB  . THR A 1 110 ? 32.693 62.428 19.410  1.00 21.75 ? 132  THR A CB  1 
ATOM   773  O  OG1 . THR A 1 110 ? 33.556 62.777 18.311  1.00 22.38 ? 132  THR A OG1 1 
ATOM   774  C  CG2 . THR A 1 110 ? 32.577 63.684 20.366  1.00 22.80 ? 132  THR A CG2 1 
ATOM   775  N  N   . CYS A 1 111 ? 31.437 59.845 20.791  1.00 21.35 ? 133  CYS A N   1 
ATOM   776  C  CA  . CYS A 1 111 ? 30.415 59.429 21.722  1.00 21.71 ? 133  CYS A CA  1 
ATOM   777  C  C   . CYS A 1 111 ? 30.563 57.998 22.137  1.00 20.87 ? 133  CYS A C   1 
ATOM   778  O  O   . CYS A 1 111 ? 29.604 57.405 22.499  1.00 20.82 ? 133  CYS A O   1 
ATOM   779  C  CB  . CYS A 1 111 ? 29.041 59.708 21.128  1.00 22.57 ? 133  CYS A CB  1 
ATOM   780  S  SG  . CYS A 1 111 ? 28.838 61.477 20.752  1.00 24.10 ? 133  CYS A SG  1 
ATOM   781  N  N   . LYS A 1 112 ? 31.789 57.455 22.086  1.00 20.99 ? 134  LYS A N   1 
ATOM   782  C  CA  . LYS A 1 112 ? 31.971 56.042 22.324  1.00 20.43 ? 134  LYS A CA  1 
ATOM   783  C  C   . LYS A 1 112 ? 32.922 55.760 23.484  1.00 21.42 ? 134  LYS A C   1 
ATOM   784  O  O   . LYS A 1 112 ? 33.000 54.619 23.946  1.00 21.53 ? 134  LYS A O   1 
ATOM   785  C  CB  . LYS A 1 112 ? 32.470 55.373 21.042  1.00 21.07 ? 134  LYS A CB  1 
ATOM   786  C  CG  . LYS A 1 112 ? 31.551 55.621 19.788  1.00 22.30 ? 134  LYS A CG  1 
ATOM   787  C  CD  . LYS A 1 112 ? 30.345 54.686 19.731  1.00 21.68 ? 134  LYS A CD  1 
ATOM   788  C  CE  . LYS A 1 112 ? 29.484 55.027 18.439  1.00 19.42 ? 134  LYS A CE  1 
ATOM   789  N  NZ  . LYS A 1 112 ? 28.766 56.354 18.426  1.00 20.56 ? 134  LYS A NZ  1 
ATOM   790  N  N   . SER A 1 113 ? 33.637 56.804 23.945  1.00 23.54 ? 135  SER A N   1 
ATOM   791  C  CA  . SER A 1 113 ? 34.813 56.638 24.822  1.00 23.22 ? 135  SER A CA  1 
ATOM   792  C  C   . SER A 1 113 ? 35.130 57.783 25.800  1.00 24.10 ? 135  SER A C   1 
ATOM   793  O  O   . SER A 1 113 ? 35.148 58.967 25.408  1.00 24.37 ? 135  SER A O   1 
ATOM   794  C  CB  . SER A 1 113 ? 36.048 56.368 23.959  1.00 23.87 ? 135  SER A CB  1 
ATOM   795  O  OG  . SER A 1 113 ? 37.236 56.276 24.735  1.00 23.46 ? 135  SER A OG  1 
ATOM   796  N  N   . PRO A 1 114 ? 35.505 57.417 27.059  1.00 24.54 ? 136  PRO A N   1 
ATOM   797  C  CA  . PRO A 1 114 ? 36.005 58.410 27.989  1.00 23.65 ? 136  PRO A CA  1 
ATOM   798  C  C   . PRO A 1 114 ? 37.415 58.887 27.530  1.00 22.41 ? 136  PRO A C   1 
ATOM   799  O  O   . PRO A 1 114 ? 37.900 59.886 28.036  1.00 25.11 ? 136  PRO A O   1 
ATOM   800  C  CB  . PRO A 1 114 ? 36.044 57.655 29.323  1.00 22.43 ? 136  PRO A CB  1 
ATOM   801  C  CG  . PRO A 1 114 ? 36.257 56.263 28.963  1.00 24.91 ? 136  PRO A CG  1 
ATOM   802  C  CD  . PRO A 1 114 ? 35.444 56.080 27.684  1.00 24.33 ? 136  PRO A CD  1 
ATOM   803  N  N   . ASP A 1 115 ? 38.043 58.215 26.549  1.00 23.74 ? 137  ASP A N   1 
ATOM   804  C  CA  . ASP A 1 115 ? 39.347 58.716 25.956  1.00 23.44 ? 137  ASP A CA  1 
ATOM   805  C  C   . ASP A 1 115 ? 39.164 59.986 25.100  1.00 24.58 ? 137  ASP A C   1 
ATOM   806  O  O   . ASP A 1 115 ? 40.141 60.696 24.787  1.00 24.41 ? 137  ASP A O   1 
ATOM   807  C  CB  . ASP A 1 115 ? 40.156 57.631 25.144  1.00 23.64 ? 137  ASP A CB  1 
ATOM   808  C  CG  . ASP A 1 115 ? 40.727 56.537 26.019  1.00 25.35 ? 137  ASP A CG  1 
ATOM   809  O  OD1 . ASP A 1 115 ? 41.654 56.856 26.783  1.00 23.61 ? 137  ASP A OD1 1 
ATOM   810  O  OD2 . ASP A 1 115 ? 40.264 55.377 25.975  1.00 23.74 ? 137  ASP A OD2 1 
ATOM   811  N  N   . VAL A 1 116 ? 37.925 60.248 24.678  1.00 23.16 ? 138  VAL A N   1 
ATOM   812  C  CA  . VAL A 1 116 ? 37.620 61.434 23.921  1.00 23.34 ? 138  VAL A CA  1 
ATOM   813  C  C   . VAL A 1 116 ? 37.888 62.701 24.766  1.00 25.24 ? 138  VAL A C   1 
ATOM   814  O  O   . VAL A 1 116 ? 38.692 63.512 24.373  1.00 25.62 ? 138  VAL A O   1 
ATOM   815  C  CB  . VAL A 1 116 ? 36.162 61.386 23.383  1.00 23.29 ? 138  VAL A CB  1 
ATOM   816  C  CG1 . VAL A 1 116 ? 35.733 62.714 22.787  1.00 24.76 ? 138  VAL A CG1 1 
ATOM   817  C  CG2 . VAL A 1 116 ? 36.048 60.248 22.378  1.00 22.57 ? 138  VAL A CG2 1 
ATOM   818  N  N   . PRO A 1 117 ? 37.166 62.887 25.893  1.00 25.57 ? 139  PRO A N   1 
ATOM   819  C  CA  . PRO A 1 117 ? 37.532 64.053 26.677  1.00 26.49 ? 139  PRO A CA  1 
ATOM   820  C  C   . PRO A 1 117 ? 38.993 64.098 27.030  1.00 26.57 ? 139  PRO A C   1 
ATOM   821  O  O   . PRO A 1 117 ? 39.567 65.172 26.941  1.00 27.74 ? 139  PRO A O   1 
ATOM   822  C  CB  . PRO A 1 117 ? 36.636 63.970 27.930  1.00 27.38 ? 139  PRO A CB  1 
ATOM   823  C  CG  . PRO A 1 117 ? 35.841 62.761 27.810  1.00 27.02 ? 139  PRO A CG  1 
ATOM   824  C  CD  . PRO A 1 117 ? 35.954 62.228 26.415  1.00 26.74 ? 139  PRO A CD  1 
ATOM   825  N  N   . ARG A 1 118 ? 39.591 62.955 27.398  1.00 25.77 ? 140  ARG A N   1 
ATOM   826  C  CA  . ARG A 1 118 ? 41.034 62.892 27.593  1.00 27.03 ? 140  ARG A CA  1 
ATOM   827  C  C   . ARG A 1 118 ? 41.849 63.546 26.475  1.00 27.85 ? 140  ARG A C   1 
ATOM   828  O  O   . ARG A 1 118 ? 42.728 64.364 26.742  1.00 28.42 ? 140  ARG A O   1 
ATOM   829  C  CB  . ARG A 1 118 ? 41.492 61.459 27.754  1.00 25.92 ? 140  ARG A CB  1 
ATOM   830  C  CG  . ARG A 1 118 ? 42.961 61.424 28.192  1.00 26.26 ? 140  ARG A CG  1 
ATOM   831  C  CD  . ARG A 1 118 ? 43.429 60.059 28.552  1.00 21.78 ? 140  ARG A CD  1 
ATOM   832  N  NE  . ARG A 1 118 ? 43.349 59.134 27.413  1.00 24.46 ? 140  ARG A NE  1 
ATOM   833  C  CZ  . ARG A 1 118 ? 44.207 59.057 26.405  1.00 25.95 ? 140  ARG A CZ  1 
ATOM   834  N  NH1 . ARG A 1 118 ? 45.266 59.876 26.328  1.00 27.47 ? 140  ARG A NH1 1 
ATOM   835  N  NH2 . ARG A 1 118 ? 44.034 58.113 25.471  1.00 28.24 ? 140  ARG A NH2 1 
ATOM   836  N  N   . ILE A 1 119 ? 41.593 63.158 25.225  1.00 29.39 ? 141  ILE A N   1 
ATOM   837  C  CA  . ILE A 1 119 ? 42.340 63.713 24.100  1.00 30.77 ? 141  ILE A CA  1 
ATOM   838  C  C   . ILE A 1 119 ? 41.954 65.180 23.806  1.00 32.41 ? 141  ILE A C   1 
ATOM   839  O  O   . ILE A 1 119 ? 42.810 66.026 23.418  1.00 33.29 ? 141  ILE A O   1 
ATOM   840  C  CB  . ILE A 1 119 ? 42.205 62.827 22.849  1.00 31.03 ? 141  ILE A CB  1 
ATOM   841  C  CG1 . ILE A 1 119 ? 42.958 61.526 23.058  1.00 31.28 ? 141  ILE A CG1 1 
ATOM   842  C  CG2 . ILE A 1 119 ? 42.745 63.522 21.651  1.00 28.53 ? 141  ILE A CG2 1 
ATOM   843  C  CD1 . ILE A 1 119 ? 42.317 60.345 22.439  1.00 35.06 ? 141  ILE A CD1 1 
ATOM   844  N  N   . ILE A 1 120 ? 40.681 65.505 23.946  1.00 32.35 ? 142  ILE A N   1 
ATOM   845  C  CA  . ILE A 1 120 ? 40.294 66.880 23.717  1.00 33.00 ? 142  ILE A CA  1 
ATOM   846  C  C   . ILE A 1 120 ? 41.045 67.803 24.707  1.00 35.74 ? 142  ILE A C   1 
ATOM   847  O  O   . ILE A 1 120 ? 41.569 68.849 24.309  1.00 36.32 ? 142  ILE A O   1 
ATOM   848  C  CB  . ILE A 1 120 ? 38.752 67.071 23.820  1.00 31.68 ? 142  ILE A CB  1 
ATOM   849  C  CG1 . ILE A 1 120 ? 38.066 66.406 22.623  1.00 31.16 ? 142  ILE A CG1 1 
ATOM   850  C  CG2 . ILE A 1 120 ? 38.367 68.549 23.972  1.00 31.56 ? 142  ILE A CG2 1 
ATOM   851  C  CD1 . ILE A 1 120 ? 36.557 66.302 22.812  1.00 28.70 ? 142  ILE A CD1 1 
ATOM   852  N  N   . GLU A 1 121 ? 41.068 67.416 25.982  1.00 37.78 ? 143  GLU A N   1 
ATOM   853  C  CA  . GLU A 1 121 ? 41.659 68.222 27.048  1.00 40.30 ? 143  GLU A CA  1 
ATOM   854  C  C   . GLU A 1 121 ? 43.201 68.320 26.908  1.00 41.86 ? 143  GLU A C   1 
ATOM   855  O  O   . GLU A 1 121 ? 43.818 69.242 27.449  1.00 42.95 ? 143  GLU A O   1 
ATOM   856  C  CB  . GLU A 1 121 ? 41.238 67.680 28.423  1.00 40.15 ? 143  GLU A CB  1 
ATOM   857  C  CG  . GLU A 1 121 ? 39.719 67.733 28.721  1.00 40.75 ? 143  GLU A CG  1 
ATOM   858  C  CD  . GLU A 1 121 ? 39.265 66.673 29.765  1.00 41.93 ? 143  GLU A CD  1 
ATOM   859  O  OE1 . GLU A 1 121 ? 40.111 65.879 30.271  1.00 43.15 ? 143  GLU A OE1 1 
ATOM   860  O  OE2 . GLU A 1 121 ? 38.052 66.641 30.096  1.00 43.07 ? 143  GLU A OE2 1 
ATOM   861  N  N   . GLN A 1 122 ? 43.807 67.401 26.154  1.00 42.55 ? 144  GLN A N   1 
ATOM   862  C  CA  . GLN A 1 122 ? 45.256 67.351 25.922  1.00 43.97 ? 144  GLN A CA  1 
ATOM   863  C  C   . GLN A 1 122 ? 45.658 68.032 24.604  1.00 43.63 ? 144  GLN A C   1 
ATOM   864  O  O   . GLN A 1 122 ? 46.747 68.654 24.508  1.00 44.51 ? 144  GLN A O   1 
ATOM   865  C  CB  . GLN A 1 122 ? 45.729 65.889 25.938  1.00 44.34 ? 144  GLN A CB  1 
ATOM   866  C  CG  . GLN A 1 122 ? 47.145 65.638 25.387  1.00 45.16 ? 144  GLN A CG  1 
ATOM   867  C  CD  . GLN A 1 122 ? 47.462 64.154 25.188  1.00 46.54 ? 144  GLN A CD  1 
ATOM   868  O  OE1 . GLN A 1 122 ? 47.406 63.611 24.060  1.00 48.59 ? 144  GLN A OE1 1 
ATOM   869  N  NE2 . GLN A 1 122 ? 47.810 63.483 26.292  1.00 50.73 ? 144  GLN A NE2 1 
ATOM   870  N  N   . ASP A 1 123 ? 44.807 67.911 23.584  1.00 42.72 ? 145  ASP A N   1 
ATOM   871  C  CA  . ASP A 1 123 ? 45.170 68.392 22.231  1.00 41.59 ? 145  ASP A CA  1 
ATOM   872  C  C   . ASP A 1 123 ? 44.308 69.509 21.637  1.00 40.41 ? 145  ASP A C   1 
ATOM   873  O  O   . ASP A 1 123 ? 44.675 70.098 20.620  1.00 39.50 ? 145  ASP A O   1 
ATOM   874  C  CB  . ASP A 1 123 ? 45.316 67.221 21.258  1.00 41.97 ? 145  ASP A CB  1 
ATOM   875  C  CG  . ASP A 1 123 ? 46.386 66.231 21.718  1.00 43.73 ? 145  ASP A CG  1 
ATOM   876  O  OD1 . ASP A 1 123 ? 46.254 65.018 21.460  1.00 45.12 ? 145  ASP A OD1 1 
ATOM   877  O  OD2 . ASP A 1 123 ? 47.360 66.677 22.378  1.00 47.29 ? 145  ASP A OD2 1 
ATOM   878  N  N   . GLY A 1 124 ? 43.188 69.805 22.289  1.00 38.87 ? 146  GLY A N   1 
ATOM   879  C  CA  . GLY A 1 124 ? 42.263 70.806 21.810  1.00 37.36 ? 146  GLY A CA  1 
ATOM   880  C  C   . GLY A 1 124 ? 41.157 70.182 20.981  1.00 36.12 ? 146  GLY A C   1 
ATOM   881  O  O   . GLY A 1 124 ? 41.376 69.168 20.327  1.00 34.95 ? 146  GLY A O   1 
ATOM   882  N  N   . GLU A 1 125 ? 39.975 70.789 21.021  1.00 35.85 ? 147  GLU A N   1 
ATOM   883  C  CA  . GLU A 1 125 ? 38.812 70.353 20.235  1.00 35.13 ? 147  GLU A CA  1 
ATOM   884  C  C   . GLU A 1 125 ? 39.086 70.252 18.706  1.00 34.35 ? 147  GLU A C   1 
ATOM   885  O  O   . GLU A 1 125 ? 38.830 69.217 18.093  1.00 33.17 ? 147  GLU A O   1 
ATOM   886  C  CB  . GLU A 1 125 ? 37.663 71.326 20.535  1.00 35.90 ? 147  GLU A CB  1 
ATOM   887  C  CG  . GLU A 1 125 ? 36.489 71.307 19.586  1.00 38.42 ? 147  GLU A CG  1 
ATOM   888  C  CD  . GLU A 1 125 ? 35.226 71.799 20.254  1.00 38.77 ? 147  GLU A CD  1 
ATOM   889  O  OE1 . GLU A 1 125 ? 35.282 72.759 21.076  1.00 42.55 ? 147  GLU A OE1 1 
ATOM   890  O  OE2 . GLU A 1 125 ? 34.180 71.193 19.965  1.00 36.42 ? 147  GLU A OE2 1 
ATOM   891  N  N   . LEU A 1 126 ? 39.629 71.315 18.096  1.00 32.59 ? 148  LEU A N   1 
ATOM   892  C  CA  . LEU A 1 126 ? 39.883 71.301 16.637  1.00 32.58 ? 148  LEU A CA  1 
ATOM   893  C  C   . LEU A 1 126 ? 40.837 70.196 16.141  1.00 32.29 ? 148  LEU A C   1 
ATOM   894  O  O   . LEU A 1 126 ? 40.551 69.560 15.125  1.00 32.92 ? 148  LEU A O   1 
ATOM   895  C  CB  . LEU A 1 126 ? 40.315 72.664 16.110  1.00 32.42 ? 148  LEU A CB  1 
ATOM   896  C  CG  . LEU A 1 126 ? 39.210 73.719 16.031  1.00 32.82 ? 148  LEU A CG  1 
ATOM   897  C  CD1 . LEU A 1 126 ? 39.814 75.113 16.142  1.00 34.86 ? 148  LEU A CD1 1 
ATOM   898  C  CD2 . LEU A 1 126 ? 38.420 73.618 14.746  1.00 35.27 ? 148  LEU A CD2 1 
ATOM   899  N  N   . GLU A 1 127 ? 41.949 69.982 16.864  1.00 32.59 ? 149  GLU A N   1 
ATOM   900  C  CA  . GLU A 1 127 ? 42.893 68.899 16.572  1.00 31.94 ? 149  GLU A CA  1 
ATOM   901  C  C   . GLU A 1 127 ? 42.252 67.526 16.742  1.00 31.65 ? 149  GLU A C   1 
ATOM   902  O  O   . GLU A 1 127 ? 42.426 66.658 15.885  1.00 32.17 ? 149  GLU A O   1 
ATOM   903  C  CB  . GLU A 1 127 ? 44.134 68.966 17.462  1.00 32.19 ? 149  GLU A CB  1 
ATOM   904  C  CG  . GLU A 1 127 ? 45.146 67.834 17.124  1.00 32.16 ? 149  GLU A CG  1 
ATOM   905  C  CD  . GLU A 1 127 ? 45.753 67.926 15.722  1.00 35.42 ? 149  GLU A CD  1 
ATOM   906  O  OE1 . GLU A 1 127 ? 46.164 69.020 15.286  1.00 34.49 ? 149  GLU A OE1 1 
ATOM   907  O  OE2 . GLU A 1 127 ? 45.860 66.883 15.050  1.00 33.87 ? 149  GLU A OE2 1 
ATOM   908  N  N   . TYR A 1 128 ? 41.516 67.362 17.838  1.00 30.13 ? 150  TYR A N   1 
ATOM   909  C  CA  . TYR A 1 128 ? 40.713 66.147 18.027  1.00 28.95 ? 150  TYR A CA  1 
ATOM   910  C  C   . TYR A 1 128 ? 39.831 65.873 16.777  1.00 29.22 ? 150  TYR A C   1 
ATOM   911  O  O   . TYR A 1 128 ? 39.749 64.739 16.293  1.00 28.03 ? 150  TYR A O   1 
ATOM   912  C  CB  . TYR A 1 128 ? 39.850 66.200 19.306  1.00 28.13 ? 150  TYR A CB  1 
ATOM   913  C  CG  . TYR A 1 128 ? 38.868 65.037 19.301  1.00 27.93 ? 150  TYR A CG  1 
ATOM   914  C  CD1 . TYR A 1 128 ? 39.321 63.725 19.459  1.00 25.73 ? 150  TYR A CD1 1 
ATOM   915  C  CD2 . TYR A 1 128 ? 37.517 65.243 19.045  1.00 28.21 ? 150  TYR A CD2 1 
ATOM   916  C  CE1 . TYR A 1 128 ? 38.447 62.637 19.394  1.00 25.31 ? 150  TYR A CE1 1 
ATOM   917  C  CE2 . TYR A 1 128 ? 36.626 64.168 18.960  1.00 25.93 ? 150  TYR A CE2 1 
ATOM   918  C  CZ  . TYR A 1 128 ? 37.077 62.880 19.158  1.00 25.59 ? 150  TYR A CZ  1 
ATOM   919  O  OH  . TYR A 1 128 ? 36.179 61.861 19.059  1.00 26.62 ? 150  TYR A OH  1 
ATOM   920  N  N   . PHE A 1 129 ? 39.162 66.921 16.284  1.00 27.66 ? 151  PHE A N   1 
ATOM   921  C  CA  . PHE A 1 129 ? 38.220 66.787 15.165  1.00 27.87 ? 151  PHE A CA  1 
ATOM   922  C  C   . PHE A 1 129 ? 38.884 66.833 13.789  1.00 28.74 ? 151  PHE A C   1 
ATOM   923  O  O   . PHE A 1 129 ? 38.207 66.881 12.757  1.00 29.36 ? 151  PHE A O   1 
ATOM   924  C  CB  . PHE A 1 129 ? 37.193 67.877 15.263  1.00 28.73 ? 151  PHE A CB  1 
ATOM   925  C  CG  . PHE A 1 129 ? 36.093 67.578 16.232  1.00 26.23 ? 151  PHE A CG  1 
ATOM   926  C  CD1 . PHE A 1 129 ? 35.425 66.353 16.169  1.00 26.85 ? 151  PHE A CD1 1 
ATOM   927  C  CD2 . PHE A 1 129 ? 35.751 68.502 17.217  1.00 28.03 ? 151  PHE A CD2 1 
ATOM   928  C  CE1 . PHE A 1 129 ? 34.417 66.058 17.058  1.00 26.39 ? 151  PHE A CE1 1 
ATOM   929  C  CE2 . PHE A 1 129 ? 34.720 68.244 18.133  1.00 26.00 ? 151  PHE A CE2 1 
ATOM   930  C  CZ  . PHE A 1 129 ? 34.037 66.996 18.055  1.00 27.81 ? 151  PHE A CZ  1 
ATOM   931  N  N   . THR A 1 130 ? 40.208 66.771 13.777  1.00 28.81 ? 152  THR A N   1 
ATOM   932  C  CA  . THR A 1 130 ? 40.989 66.865 12.556  1.00 29.18 ? 152  THR A CA  1 
ATOM   933  C  C   . THR A 1 130 ? 41.499 65.458 12.246  1.00 29.18 ? 152  THR A C   1 
ATOM   934  O  O   . THR A 1 130 ? 42.105 64.789 13.097  1.00 30.31 ? 152  THR A O   1 
ATOM   935  C  CB  . THR A 1 130 ? 42.207 67.867 12.752  1.00 29.27 ? 152  THR A CB  1 
ATOM   936  O  OG1 . THR A 1 130 ? 41.692 69.164 13.011  1.00 30.98 ? 152  THR A OG1 1 
ATOM   937  C  CG2 . THR A 1 130 ? 43.157 67.914 11.526  1.00 29.54 ? 152  THR A CG2 1 
ATOM   938  N  N   . GLY A 1 131 ? 41.218 65.008 11.034  1.00 27.51 ? 153  GLY A N   1 
ATOM   939  C  CA  . GLY A 1 131 ? 41.692 63.727 10.541  1.00 27.50 ? 153  GLY A CA  1 
ATOM   940  C  C   . GLY A 1 131 ? 40.746 62.533 10.538  1.00 27.91 ? 153  GLY A C   1 
ATOM   941  O  O   . GLY A 1 131 ? 39.528 62.661 10.776  1.00 26.57 ? 153  GLY A O   1 
ATOM   942  N  N   . LYS A 1 132 ? 41.319 61.364 10.240  1.00 27.88 ? 154  LYS A N   1 
ATOM   943  C  CA  . LYS A 1 132 ? 40.550 60.153 10.036  1.00 26.67 ? 154  LYS A CA  1 
ATOM   944  C  C   . LYS A 1 132 ? 40.226 59.492 11.372  1.00 27.72 ? 154  LYS A C   1 
ATOM   945  O  O   . LYS A 1 132 ? 40.998 59.573 12.336  1.00 26.25 ? 154  LYS A O   1 
ATOM   946  C  CB  . LYS A 1 132 ? 41.356 59.178 9.148   1.00 27.34 ? 154  LYS A CB  1 
ATOM   947  C  CG  . LYS A 1 132 ? 41.507 59.599 7.731   1.00 27.40 ? 154  LYS A CG  1 
ATOM   948  C  CD  . LYS A 1 132 ? 40.159 59.455 7.028   1.00 28.87 ? 154  LYS A CD  1 
ATOM   949  C  CE  . LYS A 1 132 ? 40.180 59.939 5.621   1.00 34.84 ? 154  LYS A CE  1 
ATOM   950  N  NZ  . LYS A 1 132 ? 38.897 59.584 4.955   1.00 37.58 ? 154  LYS A NZ  1 
ATOM   951  N  N   . TRP A 1 133 ? 39.091 58.804 11.432  1.00 27.28 ? 155  TRP A N   1 
ATOM   952  C  CA  . TRP A 1 133 ? 38.831 57.925 12.602  1.00 25.45 ? 155  TRP A CA  1 
ATOM   953  C  C   . TRP A 1 133 ? 40.053 57.050 13.002  1.00 26.97 ? 155  TRP A C   1 
ATOM   954  O  O   . TRP A 1 133 ? 40.405 56.952 14.194  1.00 24.70 ? 155  TRP A O   1 
ATOM   955  C  CB  . TRP A 1 133 ? 37.584 57.063 12.260  1.00 26.39 ? 155  TRP A CB  1 
ATOM   956  C  CG  . TRP A 1 133 ? 37.216 55.984 13.200  1.00 24.70 ? 155  TRP A CG  1 
ATOM   957  C  CD1 . TRP A 1 133 ? 36.469 56.125 14.346  1.00 24.33 ? 155  TRP A CD1 1 
ATOM   958  C  CD2 . TRP A 1 133 ? 37.418 54.580 13.021  1.00 21.43 ? 155  TRP A CD2 1 
ATOM   959  N  NE1 . TRP A 1 133 ? 36.247 54.917 14.907  1.00 23.02 ? 155  TRP A NE1 1 
ATOM   960  C  CE2 . TRP A 1 133 ? 36.859 53.943 14.145  1.00 23.60 ? 155  TRP A CE2 1 
ATOM   961  C  CE3 . TRP A 1 133 ? 38.099 53.798 12.054  1.00 21.76 ? 155  TRP A CE3 1 
ATOM   962  C  CZ2 . TRP A 1 133 ? 36.878 52.538 14.310  1.00 25.00 ? 155  TRP A CZ2 1 
ATOM   963  C  CZ3 . TRP A 1 133 ? 38.146 52.414 12.209  1.00 22.82 ? 155  TRP A CZ3 1 
ATOM   964  C  CH2 . TRP A 1 133 ? 37.524 51.787 13.352  1.00 26.14 ? 155  TRP A CH2 1 
ATOM   965  N  N   . ALA A 1 134 ? 40.713 56.432 12.007  1.00 26.50 ? 156  ALA A N   1 
ATOM   966  C  CA  . ALA A 1 134 ? 41.898 55.598 12.267  1.00 26.83 ? 156  ALA A CA  1 
ATOM   967  C  C   . ALA A 1 134 ? 43.031 56.355 12.961  1.00 27.50 ? 156  ALA A C   1 
ATOM   968  O  O   . ALA A 1 134 ? 43.945 55.713 13.477  1.00 27.67 ? 156  ALA A O   1 
ATOM   969  C  CB  . ALA A 1 134 ? 42.414 54.954 10.948  1.00 26.60 ? 156  ALA A CB  1 
ATOM   970  N  N   . LYS A 1 135 ? 43.030 57.694 12.908  1.00 27.29 ? 157  LYS A N   1 
ATOM   971  C  CA  . LYS A 1 135 ? 44.064 58.533 13.590  1.00 28.14 ? 157  LYS A CA  1 
ATOM   972  C  C   . LYS A 1 135 ? 44.267 58.137 15.050  1.00 28.52 ? 157  LYS A C   1 
ATOM   973  O  O   . LYS A 1 135 ? 45.413 58.001 15.505  1.00 29.47 ? 157  LYS A O   1 
ATOM   974  C  CB  . LYS A 1 135 ? 43.682 60.025 13.505  1.00 28.20 ? 157  LYS A CB  1 
ATOM   975  C  CG  . LYS A 1 135 ? 44.681 61.042 14.065  1.00 27.91 ? 157  LYS A CG  1 
ATOM   976  C  CD  . LYS A 1 135 ? 43.988 62.400 14.064  1.00 28.79 ? 157  LYS A CD  1 
ATOM   977  C  CE  . LYS A 1 135 ? 44.839 63.463 14.731  1.00 30.33 ? 157  LYS A CE  1 
ATOM   978  N  NZ  . LYS A 1 135 ? 44.139 64.712 14.926  1.00 31.29 ? 157  LYS A NZ  1 
ATOM   979  N  N   . TYR A 1 136 ? 43.158 57.894 15.762  1.00 27.64 ? 158  TYR A N   1 
ATOM   980  C  CA  . TYR A 1 136 ? 43.221 57.645 17.216  1.00 27.61 ? 158  TYR A CA  1 
ATOM   981  C  C   . TYR A 1 136 ? 42.998 56.212 17.652  1.00 27.06 ? 158  TYR A C   1 
ATOM   982  O  O   . TYR A 1 136 ? 42.771 55.970 18.827  1.00 27.91 ? 158  TYR A O   1 
ATOM   983  C  CB  . TYR A 1 136 ? 42.179 58.503 17.939  1.00 28.18 ? 158  TYR A CB  1 
ATOM   984  C  CG  . TYR A 1 136 ? 42.504 59.968 17.907  1.00 26.60 ? 158  TYR A CG  1 
ATOM   985  C  CD1 . TYR A 1 136 ? 43.601 60.479 18.608  1.00 28.25 ? 158  TYR A CD1 1 
ATOM   986  C  CD2 . TYR A 1 136 ? 41.734 60.855 17.161  1.00 26.84 ? 158  TYR A CD2 1 
ATOM   987  C  CE1 . TYR A 1 136 ? 43.917 61.839 18.583  1.00 29.06 ? 158  TYR A CE1 1 
ATOM   988  C  CE2 . TYR A 1 136 ? 42.046 62.229 17.135  1.00 29.57 ? 158  TYR A CE2 1 
ATOM   989  C  CZ  . TYR A 1 136 ? 43.143 62.718 17.836  1.00 29.30 ? 158  TYR A CZ  1 
ATOM   990  O  OH  . TYR A 1 136 ? 43.433 64.100 17.784  1.00 28.97 ? 158  TYR A OH  1 
ATOM   991  N  N   . GLY A 1 137 ? 43.101 55.267 16.732  1.00 25.28 ? 159  GLY A N   1 
ATOM   992  C  CA  . GLY A 1 137 ? 42.849 53.892 17.041  1.00 25.32 ? 159  GLY A CA  1 
ATOM   993  C  C   . GLY A 1 137 ? 43.600 53.298 18.216  1.00 26.51 ? 159  GLY A C   1 
ATOM   994  O  O   . GLY A 1 137 ? 43.084 52.387 18.847  1.00 25.73 ? 159  GLY A O   1 
ATOM   995  N  N   . ASP A 1 138 ? 44.821 53.766 18.509  1.00 26.76 ? 160  ASP A N   1 
ATOM   996  C  CA  . ASP A 1 138 ? 45.537 53.153 19.640  1.00 29.04 ? 160  ASP A CA  1 
ATOM   997  C  C   . ASP A 1 138 ? 45.470 54.028 20.878  1.00 28.68 ? 160  ASP A C   1 
ATOM   998  O  O   . ASP A 1 138 ? 46.107 53.741 21.914  1.00 28.63 ? 160  ASP A O   1 
ATOM   999  C  CB  . ASP A 1 138 ? 46.983 52.719 19.295  1.00 30.38 ? 160  ASP A CB  1 
ATOM   1000 C  CG  . ASP A 1 138 ? 47.948 53.896 19.111  1.00 33.42 ? 160  ASP A CG  1 
ATOM   1001 O  OD1 . ASP A 1 138 ? 47.559 55.056 19.294  1.00 37.01 ? 160  ASP A OD1 1 
ATOM   1002 O  OD2 . ASP A 1 138 ? 49.130 53.632 18.753  1.00 41.61 ? 160  ASP A OD2 1 
ATOM   1003 N  N   . GLU A 1 139 ? 44.637 55.069 20.787  1.00 27.88 ? 161  GLU A N   1 
ATOM   1004 C  CA  . GLU A 1 139 ? 44.445 55.994 21.890  1.00 27.45 ? 161  GLU A CA  1 
ATOM   1005 C  C   . GLU A 1 139 ? 43.048 55.929 22.484  1.00 26.96 ? 161  GLU A C   1 
ATOM   1006 O  O   . GLU A 1 139 ? 42.848 56.073 23.737  1.00 25.58 ? 161  GLU A O   1 
ATOM   1007 C  CB  . GLU A 1 139 ? 44.714 57.425 21.426  1.00 27.84 ? 161  GLU A CB  1 
ATOM   1008 C  CG  . GLU A 1 139 ? 46.176 57.758 21.234  1.00 32.49 ? 161  GLU A CG  1 
ATOM   1009 C  CD  . GLU A 1 139 ? 46.933 57.923 22.580  1.00 34.05 ? 161  GLU A CD  1 
ATOM   1010 O  OE1 . GLU A 1 139 ? 46.321 58.068 23.644  1.00 31.96 ? 161  GLU A OE1 1 
ATOM   1011 O  OE2 . GLU A 1 139 ? 48.169 57.896 22.569  1.00 41.55 ? 161  GLU A OE2 1 
ATOM   1012 N  N   . ILE A 1 140 ? 42.079 55.742 21.588  1.00 24.38 ? 162  ILE A N   1 
ATOM   1013 C  CA  . ILE A 1 140 ? 40.665 55.712 21.991  1.00 24.61 ? 162  ILE A CA  1 
ATOM   1014 C  C   . ILE A 1 140 ? 40.238 54.299 22.138  1.00 23.68 ? 162  ILE A C   1 
ATOM   1015 O  O   . ILE A 1 140 ? 39.743 53.649 21.192  1.00 23.87 ? 162  ILE A O   1 
ATOM   1016 C  CB  . ILE A 1 140 ? 39.778 56.595 21.098  1.00 25.04 ? 162  ILE A CB  1 
ATOM   1017 C  CG1 . ILE A 1 140 ? 40.258 58.054 21.260  1.00 21.97 ? 162  ILE A CG1 1 
ATOM   1018 C  CG2 . ILE A 1 140 ? 38.333 56.470 21.526  1.00 23.05 ? 162  ILE A CG2 1 
ATOM   1019 C  CD1 . ILE A 1 140 ? 39.644 59.038 20.261  1.00 23.66 ? 162  ILE A CD1 1 
ATOM   1020 N  N   . VAL A 1 141 ? 40.436 53.813 23.357  1.00 22.20 ? 163  VAL A N   1 
ATOM   1021 C  CA  . VAL A 1 141 ? 40.377 52.398 23.618  1.00 22.10 ? 163  VAL A CA  1 
ATOM   1022 C  C   . VAL A 1 141 ? 39.497 51.932 24.753  1.00 22.41 ? 163  VAL A C   1 
ATOM   1023 O  O   . VAL A 1 141 ? 39.280 50.706 24.917  1.00 22.27 ? 163  VAL A O   1 
ATOM   1024 C  CB  . VAL A 1 141 ? 41.778 51.758 23.734  1.00 22.82 ? 163  VAL A CB  1 
ATOM   1025 C  CG1 . VAL A 1 141 ? 42.441 51.766 22.365  1.00 24.24 ? 163  VAL A CG1 1 
ATOM   1026 C  CG2 . VAL A 1 141 ? 42.597 52.487 24.868  1.00 19.04 ? 163  VAL A CG2 1 
ATOM   1027 N  N   . ASN A 1 142 ? 38.983 52.881 25.527  1.00 21.86 ? 164  ASN A N   1 
ATOM   1028 C  CA  . ASN A 1 142 ? 38.079 52.563 26.636  1.00 22.28 ? 164  ASN A CA  1 
ATOM   1029 C  C   . ASN A 1 142 ? 36.640 52.906 26.215  1.00 22.87 ? 164  ASN A C   1 
ATOM   1030 O  O   . ASN A 1 142 ? 36.423 53.892 25.493  1.00 24.32 ? 164  ASN A O   1 
ATOM   1031 C  CB  . ASN A 1 142 ? 38.439 53.367 27.893  1.00 21.71 ? 164  ASN A CB  1 
ATOM   1032 C  CG  . ASN A 1 142 ? 39.731 52.896 28.502  1.00 20.90 ? 164  ASN A CG  1 
ATOM   1033 O  OD1 . ASN A 1 142 ? 39.737 51.959 29.274  1.00 21.45 ? 164  ASN A OD1 1 
ATOM   1034 N  ND2 . ASN A 1 142 ? 40.843 53.471 28.040  1.00 23.89 ? 164  ASN A ND2 1 
ATOM   1035 N  N   . THR A 1 143 ? 35.681 52.088 26.619  1.00 23.81 ? 165  THR A N   1 
ATOM   1036 C  CA  . THR A 1 143 ? 34.287 52.389 26.293  1.00 22.76 ? 165  THR A CA  1 
ATOM   1037 C  C   . THR A 1 143 ? 33.639 53.319 27.323  1.00 22.51 ? 165  THR A C   1 
ATOM   1038 O  O   . THR A 1 143 ? 34.203 53.491 28.457  1.00 22.48 ? 165  THR A O   1 
ATOM   1039 C  CB  . THR A 1 143 ? 33.413 51.127 26.056  1.00 23.41 ? 165  THR A CB  1 
ATOM   1040 O  OG1 . THR A 1 143 ? 32.262 51.498 25.277  1.00 24.34 ? 165  THR A OG1 1 
ATOM   1041 C  CG2 . THR A 1 143 ? 32.987 50.472 27.384  1.00 22.16 ? 165  THR A CG2 1 
ATOM   1042 N  N   A ILE A 1 144 ? 32.480 53.887 26.945  0.50 21.71 ? 166  ILE A N   1 
ATOM   1043 N  N   B ILE A 1 144 ? 32.511 53.921 26.919  0.50 21.31 ? 166  ILE A N   1 
ATOM   1044 C  CA  A ILE A 1 144 ? 31.590 54.719 27.800  0.50 21.38 ? 166  ILE A CA  1 
ATOM   1045 C  CA  B ILE A 1 144 ? 31.749 54.900 27.714  0.50 20.79 ? 166  ILE A CA  1 
ATOM   1046 C  C   A ILE A 1 144 ? 31.951 54.544 29.259  0.50 21.31 ? 166  ILE A C   1 
ATOM   1047 C  C   B ILE A 1 144 ? 31.953 54.602 29.180  0.50 20.84 ? 166  ILE A C   1 
ATOM   1048 O  O   A ILE A 1 144 ? 31.668 53.504 29.852  0.50 21.94 ? 166  ILE A O   1 
ATOM   1049 O  O   B ILE A 1 144 ? 31.556 53.557 29.685  0.50 21.28 ? 166  ILE A O   1 
ATOM   1050 C  CB  A ILE A 1 144 ? 30.079 54.298 27.705  0.50 21.16 ? 166  ILE A CB  1 
ATOM   1051 C  CB  B ILE A 1 144 ? 30.225 54.871 27.445  0.50 19.67 ? 166  ILE A CB  1 
ATOM   1052 C  CG1 A ILE A 1 144 ? 29.606 54.021 26.258  0.50 20.87 ? 166  ILE A CG1 1 
ATOM   1053 C  CG1 B ILE A 1 144 ? 29.907 55.127 25.973  0.50 20.85 ? 166  ILE A CG1 1 
ATOM   1054 C  CG2 A ILE A 1 144 ? 29.127 55.274 28.444  0.50 21.58 ? 166  ILE A CG2 1 
ATOM   1055 C  CG2 B ILE A 1 144 ? 29.480 55.883 28.331  0.50 22.53 ? 166  ILE A CG2 1 
ATOM   1056 C  CD1 A ILE A 1 144 ? 29.809 55.159 25.293  0.50 26.24 ? 166  ILE A CD1 1 
ATOM   1057 C  CD1 B ILE A 1 144 ? 28.523 54.657 25.535  0.50 20.24 ? 166  ILE A CD1 1 
ATOM   1058 N  N   . GLY A 1 145 ? 32.547 55.563 29.848  1.00 20.51 ? 167  GLY A N   1 
ATOM   1059 C  CA  . GLY A 1 145 ? 33.163 55.373 31.173  1.00 20.93 ? 167  GLY A CA  1 
ATOM   1060 C  C   . GLY A 1 145 ? 32.729 56.411 32.168  1.00 21.04 ? 167  GLY A C   1 
ATOM   1061 O  O   . GLY A 1 145 ? 32.094 57.433 31.822  1.00 21.74 ? 167  GLY A O   1 
ATOM   1062 N  N   . CYS A 1 146 ? 33.099 56.196 33.407  1.00 19.90 ? 168  CYS A N   1 
ATOM   1063 C  CA  . CYS A 1 146 ? 32.781 57.181 34.441  1.00 21.03 ? 168  CYS A CA  1 
ATOM   1064 C  C   . CYS A 1 146 ? 33.224 58.593 34.030  1.00 21.63 ? 168  CYS A C   1 
ATOM   1065 O  O   . CYS A 1 146 ? 32.598 59.569 34.379  1.00 23.01 ? 168  CYS A O   1 
ATOM   1066 C  CB  . CYS A 1 146 ? 33.482 56.827 35.793  1.00 19.74 ? 168  CYS A CB  1 
ATOM   1067 S  SG  . CYS A 1 146 ? 33.726 55.161 36.133  1.00 25.02 ? 168  CYS A SG  1 
ATOM   1068 N  N   . TYR A 1 147 ? 34.373 58.709 33.366  1.00 21.94 ? 169  TYR A N   1 
ATOM   1069 C  CA  . TYR A 1 147 ? 34.901 60.001 32.994  1.00 22.33 ? 169  TYR A CA  1 
ATOM   1070 C  C   . TYR A 1 147 ? 34.108 60.696 31.872  1.00 22.36 ? 169  TYR A C   1 
ATOM   1071 O  O   . TYR A 1 147 ? 34.310 61.923 31.606  1.00 23.72 ? 169  TYR A O   1 
ATOM   1072 C  CB  . TYR A 1 147 ? 36.372 59.833 32.576  1.00 22.58 ? 169  TYR A CB  1 
ATOM   1073 C  CG  . TYR A 1 147 ? 37.147 61.103 32.475  1.00 25.55 ? 169  TYR A CG  1 
ATOM   1074 C  CD1 . TYR A 1 147 ? 37.280 61.968 33.600  1.00 24.20 ? 169  TYR A CD1 1 
ATOM   1075 C  CD2 . TYR A 1 147 ? 37.773 61.451 31.286  1.00 25.15 ? 169  TYR A CD2 1 
ATOM   1076 C  CE1 . TYR A 1 147 ? 38.005 63.117 33.518  1.00 27.46 ? 169  TYR A CE1 1 
ATOM   1077 C  CE2 . TYR A 1 147 ? 38.524 62.608 31.202  1.00 29.83 ? 169  TYR A CE2 1 
ATOM   1078 C  CZ  . TYR A 1 147 ? 38.618 63.440 32.318  1.00 28.87 ? 169  TYR A CZ  1 
ATOM   1079 O  OH  . TYR A 1 147 ? 39.334 64.604 32.242  1.00 31.72 ? 169  TYR A OH  1 
ATOM   1080 N  N   . ASN A 1 148 ? 33.213 59.953 31.195  1.00 22.27 ? 170  ASN A N   1 
ATOM   1081 C  CA  . ASN A 1 148 ? 32.313 60.663 30.282  1.00 21.84 ? 170  ASN A CA  1 
ATOM   1082 C  C   . ASN A 1 148 ? 31.243 61.509 31.044  1.00 23.65 ? 170  ASN A C   1 
ATOM   1083 O  O   . ASN A 1 148 ? 30.639 62.405 30.443  1.00 24.98 ? 170  ASN A O   1 
ATOM   1084 C  CB  . ASN A 1 148 ? 31.630 59.697 29.319  1.00 23.71 ? 170  ASN A CB  1 
ATOM   1085 C  CG  . ASN A 1 148 ? 32.598 59.122 28.287  1.00 22.46 ? 170  ASN A CG  1 
ATOM   1086 O  OD1 . ASN A 1 148 ? 32.959 57.950 28.362  1.00 20.74 ? 170  ASN A OD1 1 
ATOM   1087 N  ND2 . ASN A 1 148 ? 33.034 59.980 27.315  1.00 26.42 ? 170  ASN A ND2 1 
ATOM   1088 N  N   . CYS A 1 149 ? 30.981 61.217 32.319  1.00 23.19 ? 171  CYS A N   1 
ATOM   1089 C  CA  . CYS A 1 149 ? 29.846 61.863 32.979  1.00 23.16 ? 171  CYS A CA  1 
ATOM   1090 C  C   . CYS A 1 149 ? 30.208 62.568 34.275  1.00 23.96 ? 171  CYS A C   1 
ATOM   1091 O  O   . CYS A 1 149 ? 29.485 63.425 34.723  1.00 23.49 ? 171  CYS A O   1 
ATOM   1092 C  CB  . CYS A 1 149 ? 28.729 60.876 33.269  1.00 24.15 ? 171  CYS A CB  1 
ATOM   1093 S  SG  . CYS A 1 149 ? 28.088 60.087 31.743  1.00 26.78 ? 171  CYS A SG  1 
ATOM   1094 N  N   . HIS A 1 150 ? 31.307 62.151 34.858  1.00 24.66 ? 172  HIS A N   1 
ATOM   1095 C  CA  . HIS A 1 150 ? 31.682 62.547 36.225  1.00 26.43 ? 172  HIS A CA  1 
ATOM   1096 C  C   . HIS A 1 150 ? 33.025 63.310 36.233  1.00 28.40 ? 172  HIS A C   1 
ATOM   1097 O  O   . HIS A 1 150 ? 33.934 62.931 35.513  1.00 28.51 ? 172  HIS A O   1 
ATOM   1098 C  CB  . HIS A 1 150 ? 31.733 61.309 37.098  1.00 27.23 ? 172  HIS A CB  1 
ATOM   1099 C  CG  . HIS A 1 150 ? 30.380 60.702 37.396  1.00 27.12 ? 172  HIS A CG  1 
ATOM   1100 N  ND1 . HIS A 1 150 ? 29.447 61.308 38.212  1.00 28.95 ? 172  HIS A ND1 1 
ATOM   1101 C  CD2 . HIS A 1 150 ? 29.849 59.512 37.032  1.00 24.33 ? 172  HIS A CD2 1 
ATOM   1102 C  CE1 . HIS A 1 150 ? 28.394 60.511 38.328  1.00 26.11 ? 172  HIS A CE1 1 
ATOM   1103 N  NE2 . HIS A 1 150 ? 28.618 59.394 37.647  1.00 27.61 ? 172  HIS A NE2 1 
ATOM   1104 N  N   . ASP A 1 151 ? 33.103 64.398 37.029  1.00 28.71 ? 173  ASP A N   1 
ATOM   1105 C  CA  . ASP A 1 151 ? 34.359 65.131 37.336  1.00 29.65 ? 173  ASP A CA  1 
ATOM   1106 C  C   . ASP A 1 151 ? 35.206 64.191 38.151  1.00 29.03 ? 173  ASP A C   1 
ATOM   1107 O  O   . ASP A 1 151 ? 34.691 63.534 39.049  1.00 27.74 ? 173  ASP A O   1 
ATOM   1108 C  CB  . ASP A 1 151 ? 34.006 66.360 38.186  1.00 29.93 ? 173  ASP A CB  1 
ATOM   1109 C  CG  . ASP A 1 151 ? 35.170 67.289 38.401  1.00 33.06 ? 173  ASP A CG  1 
ATOM   1110 O  OD1 . ASP A 1 151 ? 36.004 67.041 39.291  1.00 26.88 ? 173  ASP A OD1 1 
ATOM   1111 O  OD2 . ASP A 1 151 ? 35.238 68.328 37.707  1.00 39.92 ? 173  ASP A OD2 1 
ATOM   1112 N  N   . ASP A 1 152 ? 36.492 64.104 37.845  1.00 28.84 ? 174  ASP A N   1 
ATOM   1113 C  CA  . ASP A 1 152 ? 37.352 63.139 38.563  1.00 30.22 ? 174  ASP A CA  1 
ATOM   1114 C  C   . ASP A 1 152 ? 37.870 63.667 39.901  1.00 30.07 ? 174  ASP A C   1 
ATOM   1115 O  O   . ASP A 1 152 ? 38.544 62.936 40.620  1.00 31.31 ? 174  ASP A O   1 
ATOM   1116 C  CB  . ASP A 1 152 ? 38.515 62.593 37.708  1.00 29.87 ? 174  ASP A CB  1 
ATOM   1117 C  CG  . ASP A 1 152 ? 39.595 63.613 37.477  1.00 31.17 ? 174  ASP A CG  1 
ATOM   1118 O  OD1 . ASP A 1 152 ? 39.263 64.745 37.064  1.00 33.33 ? 174  ASP A OD1 1 
ATOM   1119 O  OD2 . ASP A 1 152 ? 40.778 63.271 37.645  1.00 33.70 ? 174  ASP A OD2 1 
ATOM   1120 N  N   . LYS A 1 153 ? 37.541 64.907 40.251  1.00 30.50 ? 175  LYS A N   1 
ATOM   1121 C  CA  . LYS A 1 153 ? 37.785 65.407 41.632  1.00 30.57 ? 175  LYS A CA  1 
ATOM   1122 C  C   . LYS A 1 153 ? 36.567 65.423 42.562  1.00 31.04 ? 175  LYS A C   1 
ATOM   1123 O  O   . LYS A 1 153 ? 36.635 64.997 43.719  1.00 31.20 ? 175  LYS A O   1 
ATOM   1124 C  CB  . LYS A 1 153 ? 38.376 66.811 41.576  1.00 31.56 ? 175  LYS A CB  1 
ATOM   1125 C  CG  . LYS A 1 153 ? 39.707 66.873 40.790  1.00 30.25 ? 175  LYS A CG  1 
ATOM   1126 C  CD  . LYS A 1 153 ? 40.266 68.271 40.761  1.00 34.65 ? 175  LYS A CD  1 
ATOM   1127 C  CE  . LYS A 1 153 ? 41.577 68.281 40.020  1.00 36.35 ? 175  LYS A CE  1 
ATOM   1128 N  NZ  . LYS A 1 153 ? 42.060 69.676 39.758  1.00 41.43 ? 175  LYS A NZ  1 
ATOM   1129 N  N   . SER A 1 154 ? 35.472 65.990 42.069  1.00 30.37 ? 176  SER A N   1 
ATOM   1130 C  CA  . SER A 1 154 ? 34.273 66.148 42.885  1.00 30.55 ? 176  SER A CA  1 
ATOM   1131 C  C   . SER A 1 154 ? 33.298 64.981 42.670  1.00 29.68 ? 176  SER A C   1 
ATOM   1132 O  O   . SER A 1 154 ? 32.358 64.783 43.452  1.00 30.62 ? 176  SER A O   1 
ATOM   1133 C  CB  . SER A 1 154 ? 33.573 67.437 42.506  1.00 31.31 ? 176  SER A CB  1 
ATOM   1134 O  OG  . SER A 1 154 ? 33.047 67.271 41.186  1.00 29.80 ? 176  SER A OG  1 
ATOM   1135 N  N   . ALA A 1 155 ? 33.504 64.223 41.597  1.00 29.82 ? 177  ALA A N   1 
ATOM   1136 C  CA  . ALA A 1 155 ? 32.500 63.216 41.189  1.00 28.28 ? 177  ALA A CA  1 
ATOM   1137 C  C   . ALA A 1 155 ? 31.164 63.827 40.748  1.00 29.29 ? 177  ALA A C   1 
ATOM   1138 O  O   . ALA A 1 155 ? 30.229 63.084 40.482  1.00 29.21 ? 177  ALA A O   1 
ATOM   1139 C  CB  . ALA A 1 155 ? 32.277 62.132 42.253  1.00 28.81 ? 177  ALA A CB  1 
ATOM   1140 N  N   . GLU A 1 156 ? 31.082 65.159 40.629  1.00 29.27 ? 178  GLU A N   1 
ATOM   1141 C  CA  . GLU A 1 156 ? 29.833 65.822 40.204  1.00 30.80 ? 178  GLU A CA  1 
ATOM   1142 C  C   . GLU A 1 156 ? 29.538 65.496 38.740  1.00 30.04 ? 178  GLU A C   1 
ATOM   1143 O  O   . GLU A 1 156 ? 30.462 65.310 37.960  1.00 29.12 ? 178  GLU A O   1 
ATOM   1144 C  CB  . GLU A 1 156 ? 29.913 67.353 40.386  1.00 30.91 ? 178  GLU A CB  1 
ATOM   1145 C  CG  . GLU A 1 156 ? 30.985 68.037 39.528  1.00 34.34 ? 178  GLU A CG  1 
ATOM   1146 C  CD  . GLU A 1 156 ? 31.251 69.527 39.893  1.00 34.95 ? 178  GLU A CD  1 
ATOM   1147 O  OE1 . GLU A 1 156 ? 30.278 70.329 39.962  1.00 40.65 ? 178  GLU A OE1 1 
ATOM   1148 O  OE2 . GLU A 1 156 ? 32.443 69.900 40.092  1.00 40.85 ? 178  GLU A OE2 1 
ATOM   1149 N  N   . LEU A 1 157 ? 28.262 65.437 38.372  1.00 28.91 ? 179  LEU A N   1 
ATOM   1150 C  CA  . LEU A 1 157 ? 27.910 65.304 36.965  1.00 29.77 ? 179  LEU A CA  1 
ATOM   1151 C  C   . LEU A 1 157 ? 28.568 66.444 36.137  1.00 29.40 ? 179  LEU A C   1 
ATOM   1152 O  O   . LEU A 1 157 ? 28.594 67.623 36.558  1.00 28.99 ? 179  LEU A O   1 
ATOM   1153 C  CB  . LEU A 1 157 ? 26.370 65.290 36.788  1.00 29.25 ? 179  LEU A CB  1 
ATOM   1154 C  CG  . LEU A 1 157 ? 25.615 64.055 37.300  1.00 32.30 ? 179  LEU A CG  1 
ATOM   1155 C  CD1 . LEU A 1 157 ? 24.154 64.142 36.978  1.00 35.41 ? 179  LEU A CD1 1 
ATOM   1156 C  CD2 . LEU A 1 157 ? 26.239 62.718 36.751  1.00 31.87 ? 179  LEU A CD2 1 
ATOM   1157 N  N   . LYS A 1 158 ? 29.141 66.101 34.982  1.00 28.62 ? 180  LYS A N   1 
ATOM   1158 C  CA  . LYS A 1 158 ? 29.698 67.112 34.097  1.00 29.42 ? 180  LYS A CA  1 
ATOM   1159 C  C   . LYS A 1 158 ? 29.392 66.726 32.650  1.00 29.44 ? 180  LYS A C   1 
ATOM   1160 O  O   . LYS A 1 158 ? 29.408 65.552 32.339  1.00 30.32 ? 180  LYS A O   1 
ATOM   1161 C  CB  . LYS A 1 158 ? 31.210 67.179 34.271  1.00 30.51 ? 180  LYS A CB  1 
ATOM   1162 C  CG  . LYS A 1 158 ? 31.648 67.756 35.587  1.00 31.08 ? 180  LYS A CG  1 
ATOM   1163 C  CD  . LYS A 1 158 ? 32.221 69.128 35.326  1.00 37.76 ? 180  LYS A CD  1 
ATOM   1164 C  CE  . LYS A 1 158 ? 32.757 69.770 36.595  1.00 38.34 ? 180  LYS A CE  1 
ATOM   1165 N  NZ  . LYS A 1 158 ? 31.798 70.744 37.110  1.00 41.00 ? 180  LYS A NZ  1 
ATOM   1166 N  N   . SER A 1 159 ? 29.151 67.705 31.787  1.00 29.42 ? 181  SER A N   1 
ATOM   1167 C  CA  . SER A 1 159 ? 29.262 67.510 30.347  1.00 29.08 ? 181  SER A CA  1 
ATOM   1168 C  C   . SER A 1 159 ? 30.731 67.663 29.942  1.00 30.49 ? 181  SER A C   1 
ATOM   1169 O  O   . SER A 1 159 ? 31.415 68.639 30.304  1.00 30.01 ? 181  SER A O   1 
ATOM   1170 C  CB  . SER A 1 159 ? 28.396 68.502 29.559  1.00 29.80 ? 181  SER A CB  1 
ATOM   1171 O  OG  . SER A 1 159 ? 28.651 68.388 28.151  1.00 28.27 ? 181  SER A OG  1 
ATOM   1172 N  N   . LYS A 1 160 ? 31.233 66.691 29.200  1.00 30.09 ? 182  LYS A N   1 
ATOM   1173 C  CA  . LYS A 1 160 ? 32.650 66.680 28.906  1.00 29.54 ? 182  LYS A CA  1 
ATOM   1174 C  C   . LYS A 1 160 ? 32.890 67.155 27.466  1.00 31.17 ? 182  LYS A C   1 
ATOM   1175 O  O   . LYS A 1 160 ? 34.030 67.195 26.983  1.00 30.63 ? 182  LYS A O   1 
ATOM   1176 C  CB  . LYS A 1 160 ? 33.186 65.256 29.142  1.00 31.56 ? 182  LYS A CB  1 
ATOM   1177 C  CG  . LYS A 1 160 ? 32.946 64.691 30.544  1.00 29.05 ? 182  LYS A CG  1 
ATOM   1178 C  CD  . LYS A 1 160 ? 33.543 65.628 31.587  1.00 26.80 ? 182  LYS A CD  1 
ATOM   1179 C  CE  . LYS A 1 160 ? 33.762 64.973 32.929  1.00 25.02 ? 182  LYS A CE  1 
ATOM   1180 N  NZ  . LYS A 1 160 ? 35.015 64.243 32.937  1.00 28.12 ? 182  LYS A NZ  1 
ATOM   1181 N  N   . VAL A 1 161 ? 31.815 67.493 26.758  1.00 30.49 ? 183  VAL A N   1 
ATOM   1182 C  CA  . VAL A 1 161 ? 31.946 67.861 25.329  1.00 31.72 ? 183  VAL A CA  1 
ATOM   1183 C  C   . VAL A 1 161 ? 31.419 69.270 25.085  1.00 31.76 ? 183  VAL A C   1 
ATOM   1184 O  O   . VAL A 1 161 ? 30.326 69.585 25.499  1.00 33.71 ? 183  VAL A O   1 
ATOM   1185 C  CB  . VAL A 1 161 ? 31.226 66.851 24.386  1.00 30.97 ? 183  VAL A CB  1 
ATOM   1186 C  CG1 . VAL A 1 161 ? 32.039 65.558 24.256  1.00 32.87 ? 183  VAL A CG1 1 
ATOM   1187 C  CG2 . VAL A 1 161 ? 29.810 66.614 24.872  1.00 33.07 ? 183  VAL A CG2 1 
ATOM   1188 N  N   . PRO A 1 162 ? 32.226 70.160 24.485  1.00 33.38 ? 184  PRO A N   1 
ATOM   1189 C  CA  . PRO A 1 162 ? 31.787 71.543 24.281  1.00 32.26 ? 184  PRO A CA  1 
ATOM   1190 C  C   . PRO A 1 162 ? 30.656 71.745 23.275  1.00 31.41 ? 184  PRO A C   1 
ATOM   1191 O  O   . PRO A 1 162 ? 30.006 72.784 23.306  1.00 31.45 ? 184  PRO A O   1 
ATOM   1192 C  CB  . PRO A 1 162 ? 33.064 72.241 23.810  1.00 33.22 ? 184  PRO A CB  1 
ATOM   1193 C  CG  . PRO A 1 162 ? 34.172 71.384 24.311  1.00 33.80 ? 184  PRO A CG  1 
ATOM   1194 C  CD  . PRO A 1 162 ? 33.624 69.994 24.080  1.00 34.40 ? 184  PRO A CD  1 
ATOM   1195 N  N   . TYR A 1 163 ? 30.386 70.763 22.413  1.00 29.41 ? 185  TYR A N   1 
ATOM   1196 C  CA  . TYR A 1 163 ? 29.332 70.961 21.446  1.00 27.91 ? 185  TYR A CA  1 
ATOM   1197 C  C   . TYR A 1 163 ? 27.961 70.998 22.084  1.00 27.44 ? 185  TYR A C   1 
ATOM   1198 O  O   . TYR A 1 163 ? 27.056 71.624 21.546  1.00 27.97 ? 185  TYR A O   1 
ATOM   1199 C  CB  . TYR A 1 163 ? 29.394 69.963 20.276  1.00 27.63 ? 185  TYR A CB  1 
ATOM   1200 C  CG  . TYR A 1 163 ? 29.369 68.539 20.685  1.00 26.47 ? 185  TYR A CG  1 
ATOM   1201 C  CD1 . TYR A 1 163 ? 28.170 67.925 21.027  1.00 27.70 ? 185  TYR A CD1 1 
ATOM   1202 C  CD2 . TYR A 1 163 ? 30.550 67.775 20.682  1.00 28.75 ? 185  TYR A CD2 1 
ATOM   1203 C  CE1 . TYR A 1 163 ? 28.137 66.605 21.410  1.00 28.19 ? 185  TYR A CE1 1 
ATOM   1204 C  CE2 . TYR A 1 163 ? 30.521 66.446 21.056  1.00 26.38 ? 185  TYR A CE2 1 
ATOM   1205 C  CZ  . TYR A 1 163 ? 29.324 65.875 21.458  1.00 27.01 ? 185  TYR A CZ  1 
ATOM   1206 O  OH  . TYR A 1 163 ? 29.280 64.543 21.774  1.00 28.36 ? 185  TYR A OH  1 
ATOM   1207 N  N   . LEU A 1 164 ? 27.799 70.318 23.225  1.00 27.79 ? 186  LEU A N   1 
ATOM   1208 C  CA  . LEU A 1 164 ? 26.505 70.290 23.885  1.00 27.32 ? 186  LEU A CA  1 
ATOM   1209 C  C   . LEU A 1 164 ? 26.108 71.675 24.400  1.00 28.21 ? 186  LEU A C   1 
ATOM   1210 O  O   . LEU A 1 164 ? 24.988 72.127 24.167  1.00 26.79 ? 186  LEU A O   1 
ATOM   1211 C  CB  . LEU A 1 164 ? 26.434 69.190 24.983  1.00 27.89 ? 186  LEU A CB  1 
ATOM   1212 C  CG  . LEU A 1 164 ? 25.179 69.213 25.884  1.00 27.55 ? 186  LEU A CG  1 
ATOM   1213 C  CD1 . LEU A 1 164 ? 23.841 69.007 25.097  1.00 27.95 ? 186  LEU A CD1 1 
ATOM   1214 C  CD2 . LEU A 1 164 ? 25.273 68.224 27.049  1.00 27.58 ? 186  LEU A CD2 1 
ATOM   1215 N  N   . ASP A 1 165 ? 27.003 72.367 25.100  1.00 28.72 ? 187  ASP A N   1 
ATOM   1216 C  CA  . ASP A 1 165 ? 26.628 73.703 25.607  1.00 29.25 ? 187  ASP A CA  1 
ATOM   1217 C  C   . ASP A 1 165 ? 26.374 74.677 24.460  1.00 28.79 ? 187  ASP A C   1 
ATOM   1218 O  O   . ASP A 1 165 ? 25.434 75.431 24.502  1.00 29.44 ? 187  ASP A O   1 
ATOM   1219 C  CB  . ASP A 1 165 ? 27.691 74.257 26.553  1.00 28.75 ? 187  ASP A CB  1 
ATOM   1220 C  CG  . ASP A 1 165 ? 27.512 73.787 27.977  1.00 29.47 ? 187  ASP A CG  1 
ATOM   1221 O  OD1 . ASP A 1 165 ? 26.478 73.185 28.346  1.00 27.80 ? 187  ASP A OD1 1 
ATOM   1222 O  OD2 . ASP A 1 165 ? 28.435 74.077 28.782  1.00 33.62 ? 187  ASP A OD2 1 
ATOM   1223 N  N   . ARG A 1 166 ? 27.186 74.561 23.411  1.00 29.64 ? 188  ARG A N   1 
ATOM   1224 C  CA  . ARG A 1 166 ? 27.082 75.291 22.137  1.00 30.38 ? 188  ARG A CA  1 
ATOM   1225 C  C   . ARG A 1 166 ? 25.690 75.150 21.546  1.00 30.44 ? 188  ARG A C   1 
ATOM   1226 O  O   . ARG A 1 166 ? 25.070 76.154 21.209  1.00 30.35 ? 188  ARG A O   1 
ATOM   1227 C  CB  . ARG A 1 166 ? 28.111 74.704 21.172  1.00 30.94 ? 188  ARG A CB  1 
ATOM   1228 C  CG  . ARG A 1 166 ? 28.614 75.602 20.105  1.00 35.34 ? 188  ARG A CG  1 
ATOM   1229 C  CD  . ARG A 1 166 ? 29.870 74.983 19.505  1.00 37.35 ? 188  ARG A CD  1 
ATOM   1230 N  NE  . ARG A 1 166 ? 30.991 74.985 20.440  1.00 40.70 ? 188  ARG A NE  1 
ATOM   1231 C  CZ  . ARG A 1 166 ? 32.013 74.131 20.421  1.00 42.51 ? 188  ARG A CZ  1 
ATOM   1232 N  NH1 . ARG A 1 166 ? 32.069 73.143 19.533  1.00 43.74 ? 188  ARG A NH1 1 
ATOM   1233 N  NH2 . ARG A 1 166 ? 32.980 74.247 21.319  1.00 43.55 ? 188  ARG A NH2 1 
ATOM   1234 N  N   . GLY A 1 167 ? 25.194 73.902 21.435  1.00 29.63 ? 189  GLY A N   1 
ATOM   1235 C  CA  . GLY A 1 167 ? 23.845 73.629 20.981  1.00 29.44 ? 189  GLY A CA  1 
ATOM   1236 C  C   . GLY A 1 167 ? 22.787 74.141 21.964  1.00 30.40 ? 189  GLY A C   1 
ATOM   1237 O  O   . GLY A 1 167 ? 21.802 74.769 21.572  1.00 31.35 ? 189  GLY A O   1 
ATOM   1238 N  N   . LEU A 1 168 ? 22.987 73.871 23.249  1.00 29.90 ? 190  LEU A N   1 
ATOM   1239 C  CA  . LEU A 1 168 ? 22.080 74.359 24.288  1.00 29.48 ? 190  LEU A CA  1 
ATOM   1240 C  C   . LEU A 1 168 ? 21.842 75.851 24.228  1.00 30.58 ? 190  LEU A C   1 
ATOM   1241 O  O   . LEU A 1 168 ? 20.685 76.308 24.245  1.00 32.49 ? 190  LEU A O   1 
ATOM   1242 C  CB  . LEU A 1 168 ? 22.583 73.970 25.682  1.00 27.59 ? 190  LEU A CB  1 
ATOM   1243 C  CG  . LEU A 1 168 ? 22.249 72.530 26.072  1.00 26.19 ? 190  LEU A CG  1 
ATOM   1244 C  CD1 . LEU A 1 168 ? 22.917 72.184 27.408  1.00 26.09 ? 190  LEU A CD1 1 
ATOM   1245 C  CD2 . LEU A 1 168 ? 20.721 72.249 26.065  1.00 29.65 ? 190  LEU A CD2 1 
ATOM   1246 N  N   . SER A 1 169 ? 22.935 76.609 24.182  1.00 31.09 ? 191  SER A N   1 
ATOM   1247 C  CA  . SER A 1 169 ? 22.843 78.066 24.097  1.00 31.81 ? 191  SER A CA  1 
ATOM   1248 C  C   . SER A 1 169 ? 22.075 78.448 22.848  1.00 32.59 ? 191  SER A C   1 
ATOM   1249 O  O   . SER A 1 169 ? 21.127 79.256 22.904  1.00 32.78 ? 191  SER A O   1 
ATOM   1250 C  CB  . SER A 1 169 ? 24.237 78.687 24.124  1.00 32.29 ? 191  SER A CB  1 
ATOM   1251 O  OG  . SER A 1 169 ? 24.823 78.484 25.390  1.00 33.50 ? 191  SER A OG  1 
ATOM   1252 N  N   . ALA A 1 170 ? 22.450 77.825 21.731  1.00 31.97 ? 192  ALA A N   1 
ATOM   1253 C  CA  . ALA A 1 170 ? 21.895 78.182 20.408  1.00 32.61 ? 192  ALA A CA  1 
ATOM   1254 C  C   . ALA A 1 170 ? 20.384 78.028 20.393  1.00 32.61 ? 192  ALA A C   1 
ATOM   1255 O  O   . ALA A 1 170 ? 19.670 78.761 19.715  1.00 33.14 ? 192  ALA A O   1 
ATOM   1256 C  CB  . ALA A 1 170 ? 22.539 77.348 19.315  1.00 31.92 ? 192  ALA A CB  1 
ATOM   1257 N  N   . ALA A 1 171 ? 19.889 77.061 21.144  1.00 31.91 ? 193  ALA A N   1 
ATOM   1258 C  CA  . ALA A 1 171 ? 18.465 76.795 21.135  1.00 33.38 ? 193  ALA A CA  1 
ATOM   1259 C  C   . ALA A 1 171 ? 17.782 77.521 22.295  1.00 34.21 ? 193  ALA A C   1 
ATOM   1260 O  O   . ALA A 1 171 ? 16.585 77.336 22.537  1.00 36.51 ? 193  ALA A O   1 
ATOM   1261 C  CB  . ALA A 1 171 ? 18.206 75.299 21.201  1.00 32.74 ? 193  ALA A CB  1 
ATOM   1262 N  N   . GLY A 1 172 ? 18.542 78.344 23.005  1.00 34.42 ? 194  GLY A N   1 
ATOM   1263 C  CA  . GLY A 1 172 ? 18.006 79.140 24.115  1.00 35.37 ? 194  GLY A CA  1 
ATOM   1264 C  C   . GLY A 1 172 ? 17.944 78.512 25.484  1.00 36.25 ? 194  GLY A C   1 
ATOM   1265 O  O   . GLY A 1 172 ? 17.596 79.200 26.428  1.00 36.64 ? 194  GLY A O   1 
ATOM   1266 N  N   . PHE A 1 173 ? 18.294 77.223 25.621  1.00 35.73 ? 195  PHE A N   1 
ATOM   1267 C  CA  . PHE A 1 173 ? 18.354 76.586 26.925  1.00 35.35 ? 195  PHE A CA  1 
ATOM   1268 C  C   . PHE A 1 173 ? 19.527 77.108 27.735  1.00 34.19 ? 195  PHE A C   1 
ATOM   1269 O  O   . PHE A 1 173 ? 20.521 77.577 27.182  1.00 34.03 ? 195  PHE A O   1 
ATOM   1270 C  CB  . PHE A 1 173 ? 18.559 75.064 26.813  1.00 35.82 ? 195  PHE A CB  1 
ATOM   1271 C  CG  . PHE A 1 173 ? 17.455 74.331 26.093  1.00 37.02 ? 195  PHE A CG  1 
ATOM   1272 C  CD1 . PHE A 1 173 ? 16.298 73.951 26.765  1.00 37.46 ? 195  PHE A CD1 1 
ATOM   1273 C  CD2 . PHE A 1 173 ? 17.616 73.965 24.754  1.00 39.00 ? 195  PHE A CD2 1 
ATOM   1274 C  CE1 . PHE A 1 173 ? 15.254 73.272 26.102  1.00 39.62 ? 195  PHE A CE1 1 
ATOM   1275 C  CE2 . PHE A 1 173 ? 16.590 73.272 24.072  1.00 40.98 ? 195  PHE A CE2 1 
ATOM   1276 C  CZ  . PHE A 1 173 ? 15.406 72.930 24.754  1.00 40.94 ? 195  PHE A CZ  1 
ATOM   1277 N  N   . LYS A 1 174 ? 19.434 76.918 29.045  1.00 34.89 ? 196  LYS A N   1 
ATOM   1278 C  CA  . LYS A 1 174 ? 20.592 77.025 29.950  1.00 34.58 ? 196  LYS A CA  1 
ATOM   1279 C  C   . LYS A 1 174 ? 21.716 76.035 29.570  1.00 34.71 ? 196  LYS A C   1 
ATOM   1280 O  O   . LYS A 1 174 ? 21.432 74.910 29.108  1.00 32.93 ? 196  LYS A O   1 
ATOM   1281 C  CB  . LYS A 1 174 ? 20.134 76.818 31.393  1.00 34.80 ? 196  LYS A CB  1 
ATOM   1282 C  CG  . LYS A 1 174 ? 19.170 77.930 31.853  1.00 35.42 ? 196  LYS A CG  1 
ATOM   1283 C  CD  . LYS A 1 174 ? 18.522 77.638 33.203  1.00 36.41 ? 196  LYS A CD  1 
ATOM   1284 C  CE  . LYS A 1 174 ? 17.498 76.490 33.094  1.00 40.11 ? 196  LYS A CE  1 
ATOM   1285 N  NZ  . LYS A 1 174 ? 17.279 75.774 34.426  1.00 41.95 ? 196  LYS A NZ  1 
ATOM   1286 N  N   . THR A 1 175 ? 22.971 76.475 29.737  1.00 33.78 ? 197  THR A N   1 
ATOM   1287 C  CA  . THR A 1 175 ? 24.146 75.579 29.620  1.00 33.80 ? 197  THR A CA  1 
ATOM   1288 C  C   . THR A 1 175 ? 24.079 74.546 30.719  1.00 33.11 ? 197  THR A C   1 
ATOM   1289 O  O   . THR A 1 175 ? 23.346 74.715 31.689  1.00 33.86 ? 197  THR A O   1 
ATOM   1290 C  CB  . THR A 1 175 ? 25.477 76.298 29.734  1.00 33.61 ? 197  THR A CB  1 
ATOM   1291 O  OG1 . THR A 1 175 ? 25.637 76.776 31.082  1.00 34.36 ? 197  THR A OG1 1 
ATOM   1292 C  CG2 . THR A 1 175 ? 25.568 77.459 28.734  1.00 33.66 ? 197  THR A CG2 1 
ATOM   1293 N  N   . PHE A 1 176 ? 24.845 73.473 30.559  1.00 32.32 ? 198  PHE A N   1 
ATOM   1294 C  CA  . PHE A 1 176 ? 24.980 72.481 31.613  1.00 32.08 ? 198  PHE A CA  1 
ATOM   1295 C  C   . PHE A 1 176 ? 25.213 73.042 33.022  1.00 32.45 ? 198  PHE A C   1 
ATOM   1296 O  O   . PHE A 1 176 ? 24.500 72.683 33.934  1.00 31.86 ? 198  PHE A O   1 
ATOM   1297 C  CB  . PHE A 1 176 ? 26.063 71.449 31.281  1.00 31.75 ? 198  PHE A CB  1 
ATOM   1298 C  CG  . PHE A 1 176 ? 26.012 70.235 32.176  1.00 31.41 ? 198  PHE A CG  1 
ATOM   1299 C  CD1 . PHE A 1 176 ? 26.630 70.262 33.431  1.00 32.36 ? 198  PHE A CD1 1 
ATOM   1300 C  CD2 . PHE A 1 176 ? 25.320 69.091 31.784  1.00 30.22 ? 198  PHE A CD2 1 
ATOM   1301 C  CE1 . PHE A 1 176 ? 26.578 69.161 34.256  1.00 31.62 ? 198  PHE A CE1 1 
ATOM   1302 C  CE2 . PHE A 1 176 ? 25.238 67.959 32.617  1.00 32.41 ? 198  PHE A CE2 1 
ATOM   1303 C  CZ  . PHE A 1 176 ? 25.880 67.976 33.855  1.00 31.58 ? 198  PHE A CZ  1 
ATOM   1304 N  N   . ALA A 1 177 ? 26.214 73.906 33.173  1.00 33.21 ? 199  ALA A N   1 
ATOM   1305 C  CA  . ALA A 1 177 ? 26.498 74.586 34.444  1.00 34.44 ? 199  ALA A CA  1 
ATOM   1306 C  C   . ALA A 1 177 ? 25.304 75.392 35.014  1.00 35.48 ? 199  ALA A C   1 
ATOM   1307 O  O   . ALA A 1 177 ? 25.130 75.485 36.238  1.00 35.91 ? 199  ALA A O   1 
ATOM   1308 C  CB  . ALA A 1 177 ? 27.692 75.486 34.255  1.00 34.55 ? 199  ALA A CB  1 
ATOM   1309 N  N   . GLU A 1 178 ? 24.556 76.042 34.118  1.00 35.34 ? 200  GLU A N   1 
ATOM   1310 C  CA  . GLU A 1 178 ? 23.351 76.815 34.450  1.00 35.97 ? 200  GLU A CA  1 
ATOM   1311 C  C   . GLU A 1 178 ? 22.112 75.999 34.852  1.00 35.30 ? 200  GLU A C   1 
ATOM   1312 O  O   . GLU A 1 178 ? 21.154 76.547 35.411  1.00 35.74 ? 200  GLU A O   1 
ATOM   1313 C  CB  . GLU A 1 178 ? 22.989 77.743 33.279  1.00 35.58 ? 200  GLU A CB  1 
ATOM   1314 C  CG  . GLU A 1 178 ? 24.004 78.866 33.023  1.00 38.14 ? 200  GLU A CG  1 
ATOM   1315 C  CD  . GLU A 1 178 ? 23.824 79.610 31.675  1.00 39.78 ? 200  GLU A CD  1 
ATOM   1316 O  OE1 . GLU A 1 178 ? 22.836 79.369 30.904  1.00 40.48 ? 200  GLU A OE1 1 
ATOM   1317 O  OE2 . GLU A 1 178 ? 24.698 80.469 31.383  1.00 44.58 ? 200  GLU A OE2 1 
ATOM   1318 N  N   . SER A 1 179 ? 22.120 74.695 34.587  1.00 34.47 ? 201  SER A N   1 
ATOM   1319 C  CA  . SER A 1 179 ? 20.928 73.868 34.729  1.00 34.23 ? 201  SER A CA  1 
ATOM   1320 C  C   . SER A 1 179 ? 20.795 73.361 36.136  1.00 34.22 ? 201  SER A C   1 
ATOM   1321 O  O   . SER A 1 179 ? 21.757 73.443 36.913  1.00 33.99 ? 201  SER A O   1 
ATOM   1322 C  CB  . SER A 1 179 ? 20.970 72.709 33.708  1.00 33.65 ? 201  SER A CB  1 
ATOM   1323 O  OG  . SER A 1 179 ? 21.075 73.255 32.398  1.00 33.71 ? 201  SER A OG  1 
ATOM   1324 N  N   . THR A 1 180 ? 19.598 72.864 36.460  1.00 33.99 ? 202  THR A N   1 
ATOM   1325 C  CA  . THR A 1 180 ? 19.293 72.239 37.748  1.00 34.27 ? 202  THR A CA  1 
ATOM   1326 C  C   . THR A 1 180 ? 19.938 70.868 37.801  1.00 34.10 ? 202  THR A C   1 
ATOM   1327 O  O   . THR A 1 180 ? 20.299 70.315 36.759  1.00 32.84 ? 202  THR A O   1 
ATOM   1328 C  CB  . THR A 1 180 ? 17.798 71.968 37.956  1.00 34.35 ? 202  THR A CB  1 
ATOM   1329 O  OG1 . THR A 1 180 ? 17.310 71.069 36.950  1.00 35.87 ? 202  THR A OG1 1 
ATOM   1330 C  CG2 . THR A 1 180 ? 16.964 73.283 37.955  1.00 34.86 ? 202  THR A CG2 1 
ATOM   1331 N  N   . HIS A 1 181 ? 20.025 70.295 38.999  1.00 33.37 ? 203  HIS A N   1 
ATOM   1332 C  CA  . HIS A 1 181 ? 20.453 68.905 39.113  1.00 33.75 ? 203  HIS A CA  1 
ATOM   1333 C  C   . HIS A 1 181 ? 19.596 67.900 38.333  1.00 33.13 ? 203  HIS A C   1 
ATOM   1334 O  O   . HIS A 1 181 ? 20.119 66.980 37.693  1.00 33.52 ? 203  HIS A O   1 
ATOM   1335 C  CB  . HIS A 1 181 ? 20.529 68.473 40.553  1.00 34.80 ? 203  HIS A CB  1 
ATOM   1336 C  CG  . HIS A 1 181 ? 21.308 67.219 40.726  1.00 38.20 ? 203  HIS A CG  1 
ATOM   1337 N  ND1 . HIS A 1 181 ? 22.673 67.168 40.524  1.00 39.93 ? 203  HIS A ND1 1 
ATOM   1338 C  CD2 . HIS A 1 181 ? 20.917 65.961 41.025  1.00 38.49 ? 203  HIS A CD2 1 
ATOM   1339 C  CE1 . HIS A 1 181 ? 23.092 65.932 40.727  1.00 41.71 ? 203  HIS A CE1 1 
ATOM   1340 N  NE2 . HIS A 1 181 ? 22.047 65.184 41.037  1.00 40.26 ? 203  HIS A NE2 1 
ATOM   1341 N  N   . GLN A 1 182 ? 18.279 68.058 38.392  1.00 31.81 ? 204  GLN A N   1 
ATOM   1342 C  CA  . GLN A 1 182 ? 17.388 67.183 37.660  1.00 30.14 ? 204  GLN A CA  1 
ATOM   1343 C  C   . GLN A 1 182 ? 17.598 67.388 36.143  1.00 29.25 ? 204  GLN A C   1 
ATOM   1344 O  O   . GLN A 1 182 ? 17.587 66.422 35.366  1.00 28.47 ? 204  GLN A O   1 
ATOM   1345 C  CB  . GLN A 1 182 ? 15.940 67.446 38.075  1.00 31.32 ? 204  GLN A CB  1 
ATOM   1346 C  CG  . GLN A 1 182 ? 14.927 66.623 37.364  1.00 31.34 ? 204  GLN A CG  1 
ATOM   1347 C  CD  . GLN A 1 182 ? 14.944 65.134 37.664  1.00 34.78 ? 204  GLN A CD  1 
ATOM   1348 O  OE1 . GLN A 1 182 ? 14.053 64.414 37.206  1.00 37.40 ? 204  GLN A OE1 1 
ATOM   1349 N  NE2 . GLN A 1 182 ? 15.952 64.652 38.418  1.00 29.34 ? 204  GLN A NE2 1 
ATOM   1350 N  N   . GLU A 1 183 ? 17.803 68.624 35.706  1.00 28.45 ? 205  GLU A N   1 
ATOM   1351 C  CA  . GLU A 1 183 ? 18.212 68.852 34.297  1.00 30.52 ? 205  GLU A CA  1 
ATOM   1352 C  C   . GLU A 1 183 ? 19.502 68.113 33.917  1.00 30.18 ? 205  GLU A C   1 
ATOM   1353 O  O   . GLU A 1 183 ? 19.611 67.447 32.870  1.00 29.58 ? 205  GLU A O   1 
ATOM   1354 C  CB  . GLU A 1 183 ? 18.307 70.347 33.973  1.00 31.40 ? 205  GLU A CB  1 
ATOM   1355 C  CG  . GLU A 1 183 ? 16.983 70.915 33.494  1.00 32.26 ? 205  GLU A CG  1 
ATOM   1356 C  CD  . GLU A 1 183 ? 16.840 72.453 33.537  1.00 34.84 ? 205  GLU A CD  1 
ATOM   1357 O  OE1 . GLU A 1 183 ? 17.711 73.209 34.095  1.00 35.95 ? 205  GLU A OE1 1 
ATOM   1358 O  OE2 . GLU A 1 183 ? 15.790 72.908 32.994  1.00 33.95 ? 205  GLU A OE2 1 
ATOM   1359 N  N   . LYS A 1 184 ? 20.488 68.219 34.783  1.00 29.10 ? 206  LYS A N   1 
ATOM   1360 C  CA  . LYS A 1 184 ? 21.781 67.540 34.559  1.00 28.26 ? 206  LYS A CA  1 
ATOM   1361 C  C   . LYS A 1 184 ? 21.654 66.026 34.424  1.00 28.18 ? 206  LYS A C   1 
ATOM   1362 O  O   . LYS A 1 184 ? 22.424 65.399 33.679  1.00 28.56 ? 206  LYS A O   1 
ATOM   1363 C  CB  . LYS A 1 184 ? 22.760 67.885 35.691  1.00 29.12 ? 206  LYS A CB  1 
ATOM   1364 C  CG  . LYS A 1 184 ? 23.181 69.318 35.714  1.00 29.06 ? 206  LYS A CG  1 
ATOM   1365 C  CD  . LYS A 1 184 ? 24.067 69.673 36.936  1.00 28.59 ? 206  LYS A CD  1 
ATOM   1366 C  CE  . LYS A 1 184 ? 24.747 70.995 36.672  1.00 27.24 ? 206  LYS A CE  1 
ATOM   1367 N  NZ  . LYS A 1 184 ? 25.550 71.352 37.883  1.00 29.63 ? 206  LYS A NZ  1 
ATOM   1368 N  N   . ARG A 1 185 ? 20.714 65.425 35.148  1.00 27.37 ? 207  ARG A N   1 
ATOM   1369 C  CA  . ARG A 1 185 ? 20.541 63.977 35.117  1.00 28.25 ? 207  ARG A CA  1 
ATOM   1370 C  C   . ARG A 1 185 ? 19.989 63.478 33.763  1.00 28.49 ? 207  ARG A C   1 
ATOM   1371 O  O   . ARG A 1 185 ? 19.906 62.283 33.557  1.00 29.21 ? 207  ARG A O   1 
ATOM   1372 C  CB  . ARG A 1 185 ? 19.643 63.503 36.241  1.00 28.75 ? 207  ARG A CB  1 
ATOM   1373 C  CG  . ARG A 1 185 ? 20.287 63.653 37.631  1.00 30.07 ? 207  ARG A CG  1 
ATOM   1374 C  CD  . ARG A 1 185 ? 19.226 63.680 38.712  1.00 30.78 ? 207  ARG A CD  1 
ATOM   1375 N  NE  . ARG A 1 185 ? 18.229 62.622 38.549  1.00 34.01 ? 207  ARG A NE  1 
ATOM   1376 C  CZ  . ARG A 1 185 ? 18.400 61.350 38.876  1.00 34.36 ? 207  ARG A CZ  1 
ATOM   1377 N  NH1 . ARG A 1 185 ? 19.547 60.935 39.357  1.00 36.53 ? 207  ARG A NH1 1 
ATOM   1378 N  NH2 . ARG A 1 185 ? 17.421 60.473 38.705  1.00 32.05 ? 207  ARG A NH2 1 
ATOM   1379 N  N   . SER A 1 186 ? 19.591 64.411 32.896  1.00 27.31 ? 208  SER A N   1 
ATOM   1380 C  CA  . SER A 1 186 ? 19.288 64.127 31.473  1.00 27.10 ? 208  SER A CA  1 
ATOM   1381 C  C   . SER A 1 186 ? 20.388 64.622 30.515  1.00 26.15 ? 208  SER A C   1 
ATOM   1382 O  O   . SER A 1 186 ? 20.708 63.965 29.485  1.00 26.35 ? 208  SER A O   1 
ATOM   1383 C  CB  . SER A 1 186 ? 17.970 64.817 31.089  1.00 26.14 ? 208  SER A CB  1 
ATOM   1384 O  OG  . SER A 1 186 ? 16.886 64.166 31.691  1.00 27.22 ? 208  SER A OG  1 
ATOM   1385 N  N   . LEU A 1 187 ? 20.953 65.780 30.823  1.00 24.63 ? 209  LEU A N   1 
ATOM   1386 C  CA  . LEU A 1 187 ? 21.972 66.385 29.974  1.00 24.16 ? 209  LEU A CA  1 
ATOM   1387 C  C   . LEU A 1 187 ? 23.217 65.545 29.856  1.00 24.05 ? 209  LEU A C   1 
ATOM   1388 O  O   . LEU A 1 187 ? 23.860 65.564 28.809  1.00 24.23 ? 209  LEU A O   1 
ATOM   1389 C  CB  . LEU A 1 187 ? 22.337 67.779 30.445  1.00 24.31 ? 209  LEU A CB  1 
ATOM   1390 C  CG  . LEU A 1 187 ? 21.233 68.876 30.331  1.00 24.51 ? 209  LEU A CG  1 
ATOM   1391 C  CD1 . LEU A 1 187 ? 21.820 70.218 30.727  1.00 28.36 ? 209  LEU A CD1 1 
ATOM   1392 C  CD2 . LEU A 1 187 ? 20.633 68.949 28.930  1.00 28.85 ? 209  LEU A CD2 1 
ATOM   1393 N  N   . VAL A 1 188 ? 23.565 64.797 30.908  1.00 23.15 ? 210  VAL A N   1 
ATOM   1394 C  CA  . VAL A 1 188 ? 24.754 63.890 30.801  1.00 23.05 ? 210  VAL A CA  1 
ATOM   1395 C  C   . VAL A 1 188 ? 24.619 62.879 29.664  1.00 21.48 ? 210  VAL A C   1 
ATOM   1396 O  O   . VAL A 1 188 ? 25.565 62.601 28.929  1.00 21.70 ? 210  VAL A O   1 
ATOM   1397 C  CB  . VAL A 1 188 ? 25.087 63.244 32.119  1.00 23.31 ? 210  VAL A CB  1 
ATOM   1398 C  CG1 . VAL A 1 188 ? 25.557 64.428 33.047  1.00 25.19 ? 210  VAL A CG1 1 
ATOM   1399 C  CG2 . VAL A 1 188 ? 23.879 62.477 32.705  1.00 22.20 ? 210  VAL A CG2 1 
ATOM   1400 N  N   . CYS A 1 189 ? 23.386 62.436 29.469  1.00 21.39 ? 211  CYS A N   1 
ATOM   1401 C  CA  . CYS A 1 189 ? 23.035 61.552 28.386  1.00 21.49 ? 211  CYS A CA  1 
ATOM   1402 C  C   . CYS A 1 189 ? 23.102 62.220 27.015  1.00 22.35 ? 211  CYS A C   1 
ATOM   1403 O  O   . CYS A 1 189 ? 23.415 61.546 25.989  1.00 21.12 ? 211  CYS A O   1 
ATOM   1404 C  CB  . CYS A 1 189 ? 21.623 61.053 28.603  1.00 23.18 ? 211  CYS A CB  1 
ATOM   1405 S  SG  . CYS A 1 189 ? 21.295 60.335 30.257  1.00 22.88 ? 211  CYS A SG  1 
ATOM   1406 N  N   . ALA A 1 190 ? 22.740 63.521 27.030  1.00 24.40 ? 212  ALA A N   1 
ATOM   1407 C  CA  . ALA A 1 190 ? 22.504 64.369 25.842  1.00 23.63 ? 212  ALA A CA  1 
ATOM   1408 C  C   . ALA A 1 190 ? 23.831 64.774 25.231  1.00 22.79 ? 212  ALA A C   1 
ATOM   1409 O  O   . ALA A 1 190 ? 23.863 65.282 24.114  1.00 23.14 ? 212  ALA A O   1 
ATOM   1410 C  CB  . ALA A 1 190 ? 21.715 65.655 26.244  1.00 24.53 ? 212  ALA A CB  1 
ATOM   1411 N  N   . GLN A 1 191 ? 24.927 64.571 25.970  1.00 22.83 ? 213  GLN A N   1 
ATOM   1412 C  CA  . GLN A 1 191 ? 26.277 64.639 25.339  1.00 22.02 ? 213  GLN A CA  1 
ATOM   1413 C  C   . GLN A 1 191 ? 26.354 63.741 24.103  1.00 21.24 ? 213  GLN A C   1 
ATOM   1414 O  O   . GLN A 1 191 ? 27.078 64.061 23.147  1.00 25.01 ? 213  GLN A O   1 
ATOM   1415 C  CB  . GLN A 1 191 ? 27.352 64.107 26.275  1.00 21.33 ? 213  GLN A CB  1 
ATOM   1416 C  CG  . GLN A 1 191 ? 27.633 64.952 27.469  1.00 21.77 ? 213  GLN A CG  1 
ATOM   1417 C  CD  . GLN A 1 191 ? 28.734 64.328 28.352  1.00 21.26 ? 213  GLN A CD  1 
ATOM   1418 O  OE1 . GLN A 1 191 ? 29.909 64.703 28.263  1.00 23.58 ? 213  GLN A OE1 1 
ATOM   1419 N  NE2 . GLN A 1 191 ? 28.337 63.363 29.186  1.00 20.49 ? 213  GLN A NE2 1 
ATOM   1420 N  N   . CYS A 1 192 ? 25.614 62.638 24.116  1.00 21.63 ? 214  CYS A N   1 
ATOM   1421 C  CA  . CYS A 1 192 ? 25.677 61.634 23.011  1.00 22.59 ? 214  CYS A CA  1 
ATOM   1422 C  C   . CYS A 1 192 ? 24.365 61.322 22.311  1.00 22.46 ? 214  CYS A C   1 
ATOM   1423 O  O   . CYS A 1 192 ? 24.350 61.111 21.094  1.00 22.17 ? 214  CYS A O   1 
ATOM   1424 C  CB  . CYS A 1 192 ? 26.255 60.349 23.500  1.00 21.85 ? 214  CYS A CB  1 
ATOM   1425 S  SG  . CYS A 1 192 ? 27.827 60.710 24.359  1.00 22.75 ? 214  CYS A SG  1 
ATOM   1426 N  N   . HIS A 1 193 ? 23.298 61.288 23.090  1.00 23.61 ? 215  HIS A N   1 
ATOM   1427 C  CA  . HIS A 1 193 ? 21.975 60.839 22.663  1.00 21.83 ? 215  HIS A CA  1 
ATOM   1428 C  C   . HIS A 1 193 ? 21.168 61.971 21.989  1.00 21.92 ? 215  HIS A C   1 
ATOM   1429 O  O   . HIS A 1 193 ? 20.085 62.282 22.406  1.00 22.14 ? 215  HIS A O   1 
ATOM   1430 C  CB  . HIS A 1 193 ? 21.252 60.120 23.820  1.00 23.28 ? 215  HIS A CB  1 
ATOM   1431 C  CG  . HIS A 1 193 ? 21.771 58.727 24.091  1.00 21.47 ? 215  HIS A CG  1 
ATOM   1432 N  ND1 . HIS A 1 193 ? 21.319 57.605 23.408  1.00 21.88 ? 215  HIS A ND1 1 
ATOM   1433 C  CD2 . HIS A 1 193 ? 22.690 58.270 24.978  1.00 19.79 ? 215  HIS A CD2 1 
ATOM   1434 C  CE1 . HIS A 1 193 ? 21.924 56.516 23.887  1.00 22.19 ? 215  HIS A CE1 1 
ATOM   1435 N  NE2 . HIS A 1 193 ? 22.799 56.895 24.807  1.00 17.49 ? 215  HIS A NE2 1 
ATOM   1436 N  N   . VAL A 1 194 ? 21.787 62.634 21.010  1.00 20.47 ? 216  VAL A N   1 
ATOM   1437 C  CA  . VAL A 1 194 ? 21.159 63.755 20.317  1.00 21.52 ? 216  VAL A CA  1 
ATOM   1438 C  C   . VAL A 1 194 ? 21.514 63.687 18.845  1.00 22.53 ? 216  VAL A C   1 
ATOM   1439 O  O   . VAL A 1 194 ? 22.421 62.942 18.447  1.00 20.35 ? 216  VAL A O   1 
ATOM   1440 C  CB  . VAL A 1 194 ? 21.705 65.074 20.878  1.00 23.94 ? 216  VAL A CB  1 
ATOM   1441 C  CG1 . VAL A 1 194 ? 21.228 65.332 22.350  1.00 23.25 ? 216  VAL A CG1 1 
ATOM   1442 C  CG2 . VAL A 1 194 ? 23.254 65.078 20.831  1.00 21.63 ? 216  VAL A CG2 1 
ATOM   1443 N  N   . GLU A 1 195 ? 20.801 64.447 18.029  1.00 21.92 ? 217  GLU A N   1 
ATOM   1444 C  CA  . GLU A 1 195 ? 21.127 64.530 16.582  1.00 24.04 ? 217  GLU A CA  1 
ATOM   1445 C  C   . GLU A 1 195 ? 22.310 65.467 16.391  1.00 24.46 ? 217  GLU A C   1 
ATOM   1446 O  O   . GLU A 1 195 ? 22.447 66.450 17.125  1.00 25.74 ? 217  GLU A O   1 
ATOM   1447 C  CB  . GLU A 1 195 ? 19.904 65.016 15.776  1.00 24.17 ? 217  GLU A CB  1 
ATOM   1448 C  CG  . GLU A 1 195 ? 20.243 65.922 14.626  1.00 25.77 ? 217  GLU A CG  1 
ATOM   1449 C  CD  . GLU A 1 195 ? 20.697 65.163 13.361  1.00 29.34 ? 217  GLU A CD  1 
ATOM   1450 O  OE1 . GLU A 1 195 ? 20.995 63.918 13.412  1.00 27.21 ? 217  GLU A OE1 1 
ATOM   1451 O  OE2 . GLU A 1 195 ? 20.734 65.822 12.298  1.00 25.36 ? 217  GLU A OE2 1 
ATOM   1452 N  N   . TYR A 1 196 ? 23.151 65.165 15.397  1.00 23.91 ? 218  TYR A N   1 
ATOM   1453 C  CA  . TYR A 1 196 ? 24.353 65.938 15.146  1.00 23.11 ? 218  TYR A CA  1 
ATOM   1454 C  C   . TYR A 1 196 ? 24.611 65.978 13.655  1.00 24.55 ? 218  TYR A C   1 
ATOM   1455 O  O   . TYR A 1 196 ? 24.025 65.191 12.882  1.00 23.63 ? 218  TYR A O   1 
ATOM   1456 C  CB  . TYR A 1 196 ? 25.560 65.324 15.892  1.00 23.48 ? 218  TYR A CB  1 
ATOM   1457 C  CG  . TYR A 1 196 ? 25.884 63.927 15.386  1.00 21.29 ? 218  TYR A CG  1 
ATOM   1458 C  CD1 . TYR A 1 196 ? 25.155 62.817 15.858  1.00 24.98 ? 218  TYR A CD1 1 
ATOM   1459 C  CD2 . TYR A 1 196 ? 26.840 63.728 14.379  1.00 23.77 ? 218  TYR A CD2 1 
ATOM   1460 C  CE1 . TYR A 1 196 ? 25.380 61.540 15.340  1.00 24.11 ? 218  TYR A CE1 1 
ATOM   1461 C  CE2 . TYR A 1 196 ? 27.094 62.486 13.856  1.00 24.72 ? 218  TYR A CE2 1 
ATOM   1462 C  CZ  . TYR A 1 196 ? 26.378 61.390 14.340  1.00 26.65 ? 218  TYR A CZ  1 
ATOM   1463 O  OH  . TYR A 1 196 ? 26.684 60.129 13.807  1.00 26.29 ? 218  TYR A OH  1 
ATOM   1464 N  N   . TYR A 1 197 ? 25.471 66.899 13.236  1.00 24.24 ? 219  TYR A N   1 
ATOM   1465 C  CA  . TYR A 1 197 ? 25.999 66.865 11.897  1.00 25.67 ? 219  TYR A CA  1 
ATOM   1466 C  C   . TYR A 1 197 ? 27.482 67.213 12.002  1.00 25.20 ? 219  TYR A C   1 
ATOM   1467 O  O   . TYR A 1 197 ? 27.920 67.657 13.053  1.00 26.29 ? 219  TYR A O   1 
ATOM   1468 C  CB  . TYR A 1 197 ? 25.200 67.743 10.895  1.00 27.18 ? 219  TYR A CB  1 
ATOM   1469 C  CG  . TYR A 1 197 ? 25.463 69.239 10.937  1.00 27.34 ? 219  TYR A CG  1 
ATOM   1470 C  CD1 . TYR A 1 197 ? 24.699 70.073 11.746  1.00 28.01 ? 219  TYR A CD1 1 
ATOM   1471 C  CD2 . TYR A 1 197 ? 26.440 69.824 10.116  1.00 27.26 ? 219  TYR A CD2 1 
ATOM   1472 C  CE1 . TYR A 1 197 ? 24.931 71.452 11.772  1.00 30.13 ? 219  TYR A CE1 1 
ATOM   1473 C  CE2 . TYR A 1 197 ? 26.680 71.208 10.147  1.00 26.17 ? 219  TYR A CE2 1 
ATOM   1474 C  CZ  . TYR A 1 197 ? 25.926 72.003 10.968  1.00 28.16 ? 219  TYR A CZ  1 
ATOM   1475 O  OH  . TYR A 1 197 ? 26.125 73.386 10.985  1.00 30.55 ? 219  TYR A OH  1 
ATOM   1476 N  N   . PHE A 1 198 ? 28.272 66.879 10.995  1.00 26.58 ? 220  PHE A N   1 
ATOM   1477 C  CA  . PHE A 1 198 ? 29.667 67.334 11.026  1.00 27.12 ? 220  PHE A CA  1 
ATOM   1478 C  C   . PHE A 1 198 ? 29.784 68.622 10.246  1.00 28.57 ? 220  PHE A C   1 
ATOM   1479 O  O   . PHE A 1 198 ? 29.478 68.660 9.039   1.00 28.98 ? 220  PHE A O   1 
ATOM   1480 C  CB  . PHE A 1 198 ? 30.639 66.275 10.473  1.00 25.72 ? 220  PHE A CB  1 
ATOM   1481 C  CG  . PHE A 1 198 ? 30.612 64.954 11.224  1.00 24.98 ? 220  PHE A CG  1 
ATOM   1482 C  CD1 . PHE A 1 198 ? 30.244 64.900 12.585  1.00 25.30 ? 220  PHE A CD1 1 
ATOM   1483 C  CD2 . PHE A 1 198 ? 30.973 63.777 10.594  1.00 27.10 ? 220  PHE A CD2 1 
ATOM   1484 C  CE1 . PHE A 1 198 ? 30.211 63.699 13.282  1.00 23.75 ? 220  PHE A CE1 1 
ATOM   1485 C  CE2 . PHE A 1 198 ? 30.963 62.541 11.294  1.00 24.18 ? 220  PHE A CE2 1 
ATOM   1486 C  CZ  . PHE A 1 198 ? 30.588 62.504 12.625  1.00 26.46 ? 220  PHE A CZ  1 
ATOM   1487 N  N   A LYS A 1 199 ? 30.236 69.688 10.909  0.50 29.98 ? 221  LYS A N   1 
ATOM   1488 N  N   B LYS A 1 199 ? 30.222 69.674 10.938  0.50 29.77 ? 221  LYS A N   1 
ATOM   1489 C  CA  A LYS A 1 199 ? 30.438 70.990 10.254  0.50 30.68 ? 221  LYS A CA  1 
ATOM   1490 C  CA  B LYS A 1 199 ? 30.532 70.950 10.307  0.50 30.69 ? 221  LYS A CA  1 
ATOM   1491 C  C   A LYS A 1 199 ? 31.907 71.169 9.897   0.50 31.80 ? 221  LYS A C   1 
ATOM   1492 C  C   B LYS A 1 199 ? 31.995 70.950 9.915   0.50 31.70 ? 221  LYS A C   1 
ATOM   1493 O  O   A LYS A 1 199 ? 32.728 71.441 10.780  0.50 31.63 ? 221  LYS A O   1 
ATOM   1494 O  O   B LYS A 1 199 ? 32.897 70.889 10.771  0.50 31.41 ? 221  LYS A O   1 
ATOM   1495 C  CB  A LYS A 1 199 ? 29.954 72.147 11.153  0.50 30.91 ? 221  LYS A CB  1 
ATOM   1496 C  CB  B LYS A 1 199 ? 30.237 72.128 11.245  0.50 30.77 ? 221  LYS A CB  1 
ATOM   1497 C  CG  A LYS A 1 199 ? 30.114 73.575 10.537  0.50 30.73 ? 221  LYS A CG  1 
ATOM   1498 C  CG  B LYS A 1 199 ? 30.418 73.527 10.588  0.50 31.22 ? 221  LYS A CG  1 
ATOM   1499 C  CD  A LYS A 1 199 ? 29.440 74.681 11.398  0.50 31.04 ? 221  LYS A CD  1 
ATOM   1500 C  CD  B LYS A 1 199 ? 30.124 74.680 11.575  0.50 31.19 ? 221  LYS A CD  1 
ATOM   1501 C  CE  A LYS A 1 199 ? 29.906 76.078 10.950  0.50 32.81 ? 221  LYS A CE  1 
ATOM   1502 C  CE  B LYS A 1 199 ? 30.145 76.056 10.884  0.50 31.35 ? 221  LYS A CE  1 
ATOM   1503 N  NZ  A LYS A 1 199 ? 28.927 77.129 11.328  0.50 33.99 ? 221  LYS A NZ  1 
ATOM   1504 N  NZ  B LYS A 1 199 ? 31.349 76.241 10.042  0.50 30.39 ? 221  LYS A NZ  1 
ATOM   1505 N  N   . LYS A 1 200 ? 32.224 71.000 8.610   1.00 32.03 ? 222  LYS A N   1 
ATOM   1506 C  CA  . LYS A 1 200 ? 33.588 71.171 8.079   1.00 34.03 ? 222  LYS A CA  1 
ATOM   1507 C  C   . LYS A 1 200 ? 34.095 72.538 8.545   1.00 33.91 ? 222  LYS A C   1 
ATOM   1508 O  O   . LYS A 1 200 ? 33.446 73.575 8.336   1.00 33.46 ? 222  LYS A O   1 
ATOM   1509 C  CB  . LYS A 1 200 ? 33.589 71.028 6.552   1.00 34.11 ? 222  LYS A CB  1 
ATOM   1510 C  CG  . LYS A 1 200 ? 34.935 71.068 5.879   1.00 35.83 ? 222  LYS A CG  1 
ATOM   1511 C  CD  . LYS A 1 200 ? 34.753 70.979 4.359   1.00 36.20 ? 222  LYS A CD  1 
ATOM   1512 C  CE  . LYS A 1 200 ? 36.056 70.523 3.676   1.00 39.92 ? 222  LYS A CE  1 
ATOM   1513 N  NZ  . LYS A 1 200 ? 36.137 70.822 2.205   1.00 39.87 ? 222  LYS A NZ  1 
ATOM   1514 N  N   . THR A 1 201 ? 35.244 72.525 9.208   1.00 35.02 ? 223  THR A N   1 
ATOM   1515 C  CA  . THR A 1 201 ? 35.771 73.719 9.871   1.00 35.13 ? 223  THR A CA  1 
ATOM   1516 C  C   . THR A 1 201 ? 37.258 73.939 9.561   1.00 36.60 ? 223  THR A C   1 
ATOM   1517 O  O   . THR A 1 201 ? 38.104 73.127 9.963   1.00 35.02 ? 223  THR A O   1 
ATOM   1518 C  CB  . THR A 1 201 ? 35.560 73.583 11.421  1.00 36.19 ? 223  THR A CB  1 
ATOM   1519 O  OG1 . THR A 1 201 ? 34.167 73.349 11.676  1.00 33.07 ? 223  THR A OG1 1 
ATOM   1520 C  CG2 . THR A 1 201 ? 36.039 74.820 12.193  1.00 34.02 ? 223  THR A CG2 1 
ATOM   1521 N  N   . GLU A 1 202 ? 37.577 75.048 8.877   1.00 37.35 ? 224  GLU A N   1 
ATOM   1522 C  CA  . GLU A 1 202 ? 38.980 75.423 8.628   1.00 38.43 ? 224  GLU A CA  1 
ATOM   1523 C  C   . GLU A 1 202 ? 39.620 76.099 9.842   1.00 39.62 ? 224  GLU A C   1 
ATOM   1524 O  O   . GLU A 1 202 ? 39.001 76.951 10.505  1.00 39.62 ? 224  GLU A O   1 
ATOM   1525 C  CB  . GLU A 1 202 ? 39.073 76.369 7.423   1.00 38.71 ? 224  GLU A CB  1 
ATOM   1526 C  CG  . GLU A 1 202 ? 38.179 75.991 6.247   1.00 39.82 ? 224  GLU A CG  1 
ATOM   1527 C  CD  . GLU A 1 202 ? 38.439 74.578 5.740   1.00 43.61 ? 224  GLU A CD  1 
ATOM   1528 O  OE1 . GLU A 1 202 ? 39.605 74.114 5.823   1.00 40.84 ? 224  GLU A OE1 1 
ATOM   1529 O  OE2 . GLU A 1 202 ? 37.465 73.920 5.276   1.00 46.10 ? 224  GLU A OE2 1 
ATOM   1530 N  N   . TRP A 1 203 ? 40.859 75.715 10.143  1.00 41.24 ? 225  TRP A N   1 
ATOM   1531 C  CA  . TRP A 1 203 ? 41.590 76.280 11.281  1.00 42.34 ? 225  TRP A CA  1 
ATOM   1532 C  C   . TRP A 1 203 ? 43.122 76.238 11.125  1.00 43.70 ? 225  TRP A C   1 
ATOM   1533 O  O   . TRP A 1 203 ? 43.653 75.593 10.215  1.00 43.58 ? 225  TRP A O   1 
ATOM   1534 C  CB  . TRP A 1 203 ? 41.140 75.615 12.585  1.00 41.75 ? 225  TRP A CB  1 
ATOM   1535 C  CG  . TRP A 1 203 ? 41.633 74.201 12.736  1.00 41.19 ? 225  TRP A CG  1 
ATOM   1536 C  CD1 . TRP A 1 203 ? 41.189 73.083 12.055  1.00 40.73 ? 225  TRP A CD1 1 
ATOM   1537 C  CD2 . TRP A 1 203 ? 42.652 73.745 13.626  1.00 40.76 ? 225  TRP A CD2 1 
ATOM   1538 N  NE1 . TRP A 1 203 ? 41.874 71.974 12.478  1.00 37.74 ? 225  TRP A NE1 1 
ATOM   1539 C  CE2 . TRP A 1 203 ? 42.772 72.352 13.447  1.00 41.79 ? 225  TRP A CE2 1 
ATOM   1540 C  CE3 . TRP A 1 203 ? 43.469 74.377 14.575  1.00 40.85 ? 225  TRP A CE3 1 
ATOM   1541 C  CZ2 . TRP A 1 203 ? 43.696 71.588 14.168  1.00 42.19 ? 225  TRP A CZ2 1 
ATOM   1542 C  CZ3 . TRP A 1 203 ? 44.373 73.622 15.288  1.00 40.27 ? 225  TRP A CZ3 1 
ATOM   1543 C  CH2 . TRP A 1 203 ? 44.488 72.239 15.079  1.00 41.41 ? 225  TRP A CH2 1 
ATOM   1544 N  N   . LYS A 1 204 ? 43.804 76.954 12.025  1.00 45.39 ? 226  LYS A N   1 
ATOM   1545 C  CA  . LYS A 1 204 ? 45.274 77.064 12.058  1.00 46.20 ? 226  LYS A CA  1 
ATOM   1546 C  C   . LYS A 1 204 ? 45.846 76.570 13.390  1.00 46.82 ? 226  LYS A C   1 
ATOM   1547 O  O   . LYS A 1 204 ? 45.401 76.990 14.460  1.00 47.63 ? 226  LYS A O   1 
ATOM   1548 C  CB  . LYS A 1 204 ? 45.691 78.522 11.817  1.00 45.80 ? 226  LYS A CB  1 
ATOM   1549 C  CG  . LYS A 1 204 ? 46.929 79.064 11.560  0.00 39.17 ? 226  LYS A CG  1 
ATOM   1550 C  CD  . LYS A 1 204 ? 47.424 78.990 10.099  0.00 37.12 ? 226  LYS A CD  1 
ATOM   1551 C  CE  . LYS A 1 204 ? 48.101 80.247 9.567   0.00 35.92 ? 226  LYS A CE  1 
ATOM   1552 N  NZ  . LYS A 1 204 ? 47.446 80.742 8.314   0.00 34.79 ? 226  LYS A NZ  1 
ATOM   1553 N  N   . ASP A 1 205 ? 46.820 75.665 13.340  1.00 47.91 ? 227  ASP A N   1 
ATOM   1554 C  CA  . ASP A 1 205 ? 47.374 75.141 14.580  1.00 49.20 ? 227  ASP A CA  1 
ATOM   1555 C  C   . ASP A 1 205 ? 48.416 76.057 15.209  1.00 49.95 ? 227  ASP A C   1 
ATOM   1556 O  O   . ASP A 1 205 ? 48.627 77.162 14.723  1.00 50.30 ? 227  ASP A O   1 
ATOM   1557 C  CB  . ASP A 1 205 ? 47.895 73.697 14.414  1.00 49.54 ? 227  ASP A CB  1 
ATOM   1558 C  CG  . ASP A 1 205 ? 49.029 73.576 13.417  1.00 48.85 ? 227  ASP A CG  1 
ATOM   1559 O  OD1 . ASP A 1 205 ? 49.827 74.519 13.297  1.00 48.79 ? 227  ASP A OD1 1 
ATOM   1560 O  OD2 . ASP A 1 205 ? 49.135 72.517 12.761  1.00 50.89 ? 227  ASP A OD2 1 
ATOM   1561 N  N   . ASP A 1 206 ? 49.029 75.590 16.299  1.00 51.10 ? 228  ASP A N   1 
ATOM   1562 C  CA  . ASP A 1 206 ? 50.081 76.306 17.040  1.00 52.15 ? 228  ASP A CA  1 
ATOM   1563 C  C   . ASP A 1 206 ? 51.315 76.561 16.181  1.00 52.48 ? 228  ASP A C   1 
ATOM   1564 O  O   . ASP A 1 206 ? 51.945 77.615 16.269  1.00 52.78 ? 228  ASP A O   1 
ATOM   1565 C  CB  . ASP A 1 206 ? 50.473 75.508 18.305  1.00 52.18 ? 228  ASP A CB  1 
ATOM   1566 C  CG  . ASP A 1 206 ? 49.820 76.056 19.578  1.00 52.33 ? 228  ASP A CG  1 
ATOM   1567 O  OD1 . ASP A 1 206 ? 50.416 75.898 20.670  1.00 52.80 ? 228  ASP A OD1 1 
ATOM   1568 O  OD2 . ASP A 1 206 ? 48.727 76.654 19.490  1.00 50.31 ? 228  ASP A OD2 1 
ATOM   1569 N  N   . LYS A 1 207 ? 51.644 75.578 15.352  1.00 53.00 ? 229  LYS A N   1 
ATOM   1570 C  CA  . LYS A 1 207 ? 52.773 75.663 14.431  1.00 53.25 ? 229  LYS A CA  1 
ATOM   1571 C  C   . LYS A 1 207 ? 52.391 76.245 13.054  1.00 53.56 ? 229  LYS A C   1 
ATOM   1572 O  O   . LYS A 1 207 ? 53.192 76.216 12.107  1.00 54.19 ? 229  LYS A O   1 
ATOM   1573 C  CB  . LYS A 1 207 ? 53.447 74.293 14.311  1.00 53.36 ? 229  LYS A CB  1 
ATOM   1574 C  CG  . LYS A 1 207 ? 54.232 73.876 15.559  1.00 53.09 ? 229  LYS A CG  1 
ATOM   1575 C  CD  . LYS A 1 207 ? 53.229 72.257 15.076  0.00 52.55 ? 229  LYS A CD  1 
ATOM   1576 C  CE  . LYS A 1 207 ? 54.130 71.271 15.847  0.00 50.94 ? 229  LYS A CE  1 
ATOM   1577 N  NZ  . LYS A 1 207 ? 54.251 69.917 15.219  0.00 49.29 ? 229  LYS A NZ  1 
ATOM   1578 N  N   . GLY A 1 208 ? 51.163 76.757 12.948  1.00 53.29 ? 230  GLY A N   1 
ATOM   1579 C  CA  . GLY A 1 208 ? 50.746 77.604 11.822  1.00 52.94 ? 230  GLY A CA  1 
ATOM   1580 C  C   . GLY A 1 208 ? 50.204 76.926 10.579  1.00 52.87 ? 230  GLY A C   1 
ATOM   1581 O  O   . GLY A 1 208 ? 49.763 77.607 9.649   1.00 52.99 ? 230  GLY A O   1 
ATOM   1582 N  N   . VAL A 1 209 ? 50.240 75.593 10.563  1.00 52.28 ? 231  VAL A N   1 
ATOM   1583 C  CA  . VAL A 1 209 ? 49.746 74.777 9.437   1.00 51.87 ? 231  VAL A CA  1 
ATOM   1584 C  C   . VAL A 1 209 ? 48.217 74.896 9.210   1.00 51.15 ? 231  VAL A C   1 
ATOM   1585 O  O   . VAL A 1 209 ? 47.425 75.095 10.148  1.00 51.20 ? 231  VAL A O   1 
ATOM   1586 C  CB  . VAL A 1 209 ? 50.109 73.277 9.638   1.00 51.98 ? 231  VAL A CB  1 
ATOM   1587 C  CG1 . VAL A 1 209 ? 49.981 72.491 8.331   1.00 52.87 ? 231  VAL A CG1 1 
ATOM   1588 C  CG2 . VAL A 1 209 ? 51.519 73.121 10.241  1.00 52.76 ? 231  VAL A CG2 1 
ATOM   1589 N  N   . ASP A 1 210 ? 47.809 74.757 7.956   1.00 50.20 ? 232  ASP A N   1 
ATOM   1590 C  CA  . ASP A 1 210 ? 46.398 74.856 7.618   1.00 48.92 ? 232  ASP A CA  1 
ATOM   1591 C  C   . ASP A 1 210 ? 45.762 73.502 7.812   1.00 47.40 ? 232  ASP A C   1 
ATOM   1592 O  O   . ASP A 1 210 ? 46.277 72.496 7.307   1.00 47.69 ? 232  ASP A O   1 
ATOM   1593 C  CB  . ASP A 1 210 ? 46.220 75.331 6.174   1.00 49.22 ? 232  ASP A CB  1 
ATOM   1594 C  CG  . ASP A 1 210 ? 46.727 76.733 5.971   1.00 50.03 ? 232  ASP A CG  1 
ATOM   1595 O  OD1 . ASP A 1 210 ? 46.156 77.650 6.601   1.00 49.77 ? 232  ASP A OD1 1 
ATOM   1596 O  OD2 . ASP A 1 210 ? 47.709 76.907 5.213   1.00 50.65 ? 232  ASP A OD2 1 
ATOM   1597 N  N   . LYS A 1 211 ? 44.658 73.472 8.551   1.00 45.49 ? 233  LYS A N   1 
ATOM   1598 C  CA  . LYS A 1 211 ? 43.965 72.215 8.773   1.00 44.24 ? 233  LYS A CA  1 
ATOM   1599 C  C   . LYS A 1 211 ? 42.464 72.306 8.531   1.00 43.15 ? 233  LYS A C   1 
ATOM   1600 O  O   . LYS A 1 211 ? 41.898 73.391 8.349   1.00 42.94 ? 233  LYS A O   1 
ATOM   1601 C  CB  . LYS A 1 211 ? 44.292 71.649 10.167  1.00 44.09 ? 233  LYS A CB  1 
ATOM   1602 C  CG  . LYS A 1 211 ? 45.702 71.097 10.300  1.00 44.78 ? 233  LYS A CG  1 
ATOM   1603 C  CD  . LYS A 1 211 ? 46.008 70.694 11.748  1.00 44.41 ? 233  LYS A CD  1 
ATOM   1604 C  CE  . LYS A 1 211 ? 47.404 70.125 11.868  1.00 46.29 ? 233  LYS A CE  1 
ATOM   1605 N  NZ  . LYS A 1 211 ? 47.697 69.888 13.309  1.00 45.46 ? 233  LYS A NZ  1 
ATOM   1606 N  N   . THR A 1 212 ? 41.821 71.145 8.487   1.00 41.42 ? 234  THR A N   1 
ATOM   1607 C  CA  . THR A 1 212 ? 40.384 71.116 8.343   1.00 38.88 ? 234  THR A CA  1 
ATOM   1608 C  C   . THR A 1 212 ? 39.857 70.129 9.339   1.00 37.12 ? 234  THR A C   1 
ATOM   1609 O  O   . THR A 1 212 ? 40.224 68.971 9.332   1.00 36.85 ? 234  THR A O   1 
ATOM   1610 C  CB  . THR A 1 212 ? 39.975 70.716 6.930   1.00 39.22 ? 234  THR A CB  1 
ATOM   1611 O  OG1 . THR A 1 212 ? 40.657 71.576 6.008   1.00 38.94 ? 234  THR A OG1 1 
ATOM   1612 C  CG2 . THR A 1 212 ? 38.416 70.796 6.736   1.00 37.51 ? 234  THR A CG2 1 
ATOM   1613 N  N   . ALA A 1 213 ? 39.014 70.623 10.218  1.00 36.45 ? 235  ALA A N   1 
ATOM   1614 C  CA  . ALA A 1 213 ? 38.396 69.777 11.229  1.00 34.85 ? 235  ALA A CA  1 
ATOM   1615 C  C   . ALA A 1 213 ? 36.962 69.468 10.782  1.00 33.85 ? 235  ALA A C   1 
ATOM   1616 O  O   . ALA A 1 213 ? 36.329 70.288 10.134  1.00 35.07 ? 235  ALA A O   1 
ATOM   1617 C  CB  . ALA A 1 213 ? 38.433 70.471 12.577  1.00 34.00 ? 235  ALA A CB  1 
ATOM   1618 N  N   . MET A 1 214 ? 36.474 68.259 11.056  1.00 32.48 ? 236  MET A N   1 
ATOM   1619 C  CA  . MET A 1 214 ? 35.052 67.958 10.830  1.00 31.17 ? 236  MET A CA  1 
ATOM   1620 C  C   . MET A 1 214 ? 34.430 67.838 12.211  1.00 29.53 ? 236  MET A C   1 
ATOM   1621 O  O   . MET A 1 214 ? 34.629 66.823 12.862  1.00 27.04 ? 236  MET A O   1 
ATOM   1622 C  CB  . MET A 1 214 ? 34.906 66.635 10.069  1.00 32.16 ? 236  MET A CB  1 
ATOM   1623 C  CG  . MET A 1 214 ? 35.299 66.697 8.616   1.00 32.57 ? 236  MET A CG  1 
ATOM   1624 S  SD  . MET A 1 214 ? 33.993 67.608 7.816   1.00 40.25 ? 236  MET A SD  1 
ATOM   1625 C  CE  . MET A 1 214 ? 33.077 66.187 7.150   1.00 42.79 ? 236  MET A CE  1 
ATOM   1626 N  N   . VAL A 1 215 ? 33.685 68.869 12.645  1.00 28.10 ? 237  VAL A N   1 
ATOM   1627 C  CA  . VAL A 1 215 ? 33.294 69.077 14.060  1.00 26.77 ? 237  VAL A CA  1 
ATOM   1628 C  C   . VAL A 1 215 ? 31.836 68.814 14.409  1.00 25.98 ? 237  VAL A C   1 
ATOM   1629 O  O   . VAL A 1 215 ? 30.926 69.358 13.767  1.00 24.17 ? 237  VAL A O   1 
ATOM   1630 C  CB  . VAL A 1 215 ? 33.603 70.552 14.488  1.00 26.34 ? 237  VAL A CB  1 
ATOM   1631 C  CG1 . VAL A 1 215 ? 33.102 70.810 15.904  1.00 28.87 ? 237  VAL A CG1 1 
ATOM   1632 C  CG2 . VAL A 1 215 ? 35.149 70.838 14.332  1.00 26.94 ? 237  VAL A CG2 1 
ATOM   1633 N  N   . VAL A 1 216 ? 31.614 68.016 15.460  1.00 25.40 ? 238  VAL A N   1 
ATOM   1634 C  CA  . VAL A 1 216 ? 30.229 67.606 15.834  1.00 25.02 ? 238  VAL A CA  1 
ATOM   1635 C  C   . VAL A 1 216 ? 29.457 68.858 16.167  1.00 25.00 ? 238  VAL A C   1 
ATOM   1636 O  O   . VAL A 1 216 ? 29.930 69.677 16.976  1.00 25.33 ? 238  VAL A O   1 
ATOM   1637 C  CB  . VAL A 1 216 ? 30.247 66.688 17.055  1.00 24.95 ? 238  VAL A CB  1 
ATOM   1638 C  CG1 . VAL A 1 216 ? 28.882 66.518 17.634  1.00 24.15 ? 238  VAL A CG1 1 
ATOM   1639 C  CG2 . VAL A 1 216 ? 30.850 65.359 16.725  1.00 25.48 ? 238  VAL A CG2 1 
ATOM   1640 N  N   . THR A 1 217 ? 28.293 69.043 15.533  1.00 25.16 ? 239  THR A N   1 
ATOM   1641 C  CA  . THR A 1 217 ? 27.519 70.243 15.667  1.00 25.97 ? 239  THR A CA  1 
ATOM   1642 C  C   . THR A 1 217 ? 26.084 69.796 15.892  1.00 26.74 ? 239  THR A C   1 
ATOM   1643 O  O   . THR A 1 217 ? 25.561 68.976 15.118  1.00 28.89 ? 239  THR A O   1 
ATOM   1644 C  CB  . THR A 1 217 ? 27.612 71.106 14.387  1.00 24.71 ? 239  THR A CB  1 
ATOM   1645 O  OG1 . THR A 1 217 ? 28.999 71.444 14.099  1.00 27.06 ? 239  THR A OG1 1 
ATOM   1646 C  CG2 . THR A 1 217 ? 26.774 72.381 14.479  1.00 27.34 ? 239  THR A CG2 1 
ATOM   1647 N  N   . LEU A 1 218 ? 25.457 70.338 16.938  1.00 26.44 ? 240  LEU A N   1 
ATOM   1648 C  CA  . LEU A 1 218 ? 24.035 70.131 17.175  1.00 24.75 ? 240  LEU A CA  1 
ATOM   1649 C  C   . LEU A 1 218 ? 23.219 71.134 16.324  1.00 25.40 ? 240  LEU A C   1 
ATOM   1650 O  O   . LEU A 1 218 ? 23.391 72.354 16.489  1.00 24.14 ? 240  LEU A O   1 
ATOM   1651 C  CB  . LEU A 1 218 ? 23.715 70.224 18.692  1.00 25.42 ? 240  LEU A CB  1 
ATOM   1652 C  CG  . LEU A 1 218 ? 24.568 69.334 19.643  1.00 26.03 ? 240  LEU A CG  1 
ATOM   1653 C  CD1 . LEU A 1 218 ? 24.005 69.315 21.079  1.00 25.72 ? 240  LEU A CD1 1 
ATOM   1654 C  CD2 . LEU A 1 218 ? 24.740 67.907 19.100  1.00 29.17 ? 240  LEU A CD2 1 
ATOM   1655 N  N   . PRO A 1 219 ? 22.300 70.623 15.456  1.00 24.67 ? 241  PRO A N   1 
ATOM   1656 C  CA  . PRO A 1 219 ? 21.534 71.481 14.539  1.00 25.42 ? 241  PRO A CA  1 
ATOM   1657 C  C   . PRO A 1 219 ? 20.391 72.194 15.246  1.00 25.69 ? 241  PRO A C   1 
ATOM   1658 O  O   . PRO A 1 219 ? 19.245 72.140 14.788  1.00 26.83 ? 241  PRO A O   1 
ATOM   1659 C  CB  . PRO A 1 219 ? 21.013 70.493 13.487  1.00 25.35 ? 241  PRO A CB  1 
ATOM   1660 C  CG  . PRO A 1 219 ? 20.809 69.223 14.183  1.00 25.97 ? 241  PRO A CG  1 
ATOM   1661 C  CD  . PRO A 1 219 ? 21.906 69.201 15.309  1.00 25.06 ? 241  PRO A CD  1 
ATOM   1662 N  N   . TRP A 1 220 ? 20.706 72.889 16.325  1.00 24.78 ? 242  TRP A N   1 
ATOM   1663 C  CA  . TRP A 1 220 ? 19.692 73.319 17.297  1.00 27.18 ? 242  TRP A CA  1 
ATOM   1664 C  C   . TRP A 1 220 ? 19.440 74.826 17.296  1.00 28.34 ? 242  TRP A C   1 
ATOM   1665 O  O   . TRP A 1 220 ? 18.665 75.301 18.124  1.00 29.58 ? 242  TRP A O   1 
ATOM   1666 C  CB  . TRP A 1 220 ? 20.165 72.960 18.712  1.00 25.58 ? 242  TRP A CB  1 
ATOM   1667 C  CG  . TRP A 1 220 ? 20.080 71.512 19.061  1.00 26.59 ? 242  TRP A CG  1 
ATOM   1668 C  CD1 . TRP A 1 220 ? 19.822 70.474 18.220  1.00 24.55 ? 242  TRP A CD1 1 
ATOM   1669 C  CD2 . TRP A 1 220 ? 20.313 70.958 20.336  1.00 22.14 ? 242  TRP A CD2 1 
ATOM   1670 N  NE1 . TRP A 1 220 ? 19.849 69.291 18.896  1.00 24.19 ? 242  TRP A NE1 1 
ATOM   1671 C  CE2 . TRP A 1 220 ? 20.190 69.539 20.202  1.00 25.74 ? 242  TRP A CE2 1 
ATOM   1672 C  CE3 . TRP A 1 220 ? 20.691 71.504 21.569  1.00 23.98 ? 242  TRP A CE3 1 
ATOM   1673 C  CZ2 . TRP A 1 220 ? 20.347 68.651 21.291  1.00 24.99 ? 242  TRP A CZ2 1 
ATOM   1674 C  CZ3 . TRP A 1 220 ? 20.864 70.639 22.632  1.00 23.23 ? 242  TRP A CZ3 1 
ATOM   1675 C  CH2 . TRP A 1 220 ? 20.670 69.218 22.492  1.00 25.93 ? 242  TRP A CH2 1 
ATOM   1676 N  N   . SER A 1 221 ? 20.081 75.565 16.391  1.00 29.86 ? 243  SER A N   1 
ATOM   1677 C  CA  . SER A 1 221 ? 20.086 77.041 16.464  1.00 30.05 ? 243  SER A CA  1 
ATOM   1678 C  C   . SER A 1 221 ? 18.747 77.678 16.065  1.00 29.87 ? 243  SER A C   1 
ATOM   1679 O  O   . SER A 1 221 ? 18.474 78.823 16.431  1.00 31.15 ? 243  SER A O   1 
ATOM   1680 C  CB  . SER A 1 221 ? 21.260 77.612 15.677  1.00 30.29 ? 243  SER A CB  1 
ATOM   1681 O  OG  . SER A 1 221 ? 20.984 77.440 14.314  1.00 31.45 ? 243  SER A OG  1 
ATOM   1682 N  N   . LYS A 1 222 ? 17.898 76.938 15.360  1.00 28.49 ? 244  LYS A N   1 
ATOM   1683 C  CA  . LYS A 1 222 ? 16.499 77.363 15.194  1.00 28.91 ? 244  LYS A CA  1 
ATOM   1684 C  C   . LYS A 1 222 ? 15.577 76.692 16.212  1.00 27.26 ? 244  LYS A C   1 
ATOM   1685 O  O   . LYS A 1 222 ? 14.378 76.948 16.234  1.00 27.70 ? 244  LYS A O   1 
ATOM   1686 C  CB  . LYS A 1 222 ? 16.035 77.137 13.743  1.00 28.36 ? 244  LYS A CB  1 
ATOM   1687 C  CG  . LYS A 1 222 ? 16.954 77.812 12.745  1.00 33.18 ? 244  LYS A CG  1 
ATOM   1688 C  CD  . LYS A 1 222 ? 16.420 77.706 11.340  1.00 34.48 ? 244  LYS A CD  1 
ATOM   1689 C  CE  . LYS A 1 222 ? 17.239 78.542 10.408  1.00 34.16 ? 244  LYS A CE  1 
ATOM   1690 N  NZ  . LYS A 1 222 ? 16.822 79.993 10.411  1.00 34.20 ? 244  LYS A NZ  1 
ATOM   1691 N  N   . GLY A 1 223 ? 16.128 75.832 17.089  1.00 26.47 ? 245  GLY A N   1 
ATOM   1692 C  CA  . GLY A 1 223 ? 15.304 75.136 18.092  1.00 25.51 ? 245  GLY A CA  1 
ATOM   1693 C  C   . GLY A 1 223 ? 15.411 73.613 17.915  1.00 24.36 ? 245  GLY A C   1 
ATOM   1694 O  O   . GLY A 1 223 ? 16.091 73.170 17.010  1.00 25.81 ? 245  GLY A O   1 
ATOM   1695 N  N   . ILE A 1 224 ? 14.771 72.821 18.779  1.00 24.68 ? 246  ILE A N   1 
ATOM   1696 C  CA  . ILE A 1 224 ? 15.048 71.355 18.825  1.00 25.47 ? 246  ILE A CA  1 
ATOM   1697 C  C   . ILE A 1 224 ? 13.945 70.495 18.197  1.00 24.85 ? 246  ILE A C   1 
ATOM   1698 O  O   . ILE A 1 224 ? 13.956 69.260 18.261  1.00 26.34 ? 246  ILE A O   1 
ATOM   1699 C  CB  . ILE A 1 224 ? 15.448 70.891 20.277  1.00 24.47 ? 246  ILE A CB  1 
ATOM   1700 C  CG1 . ILE A 1 224 ? 14.352 71.257 21.293  1.00 25.78 ? 246  ILE A CG1 1 
ATOM   1701 C  CG2 . ILE A 1 224 ? 16.799 71.523 20.646  1.00 27.83 ? 246  ILE A CG2 1 
ATOM   1702 C  CD1 . ILE A 1 224 ? 14.376 70.402 22.605  1.00 26.63 ? 246  ILE A CD1 1 
ATOM   1703 N  N   . SER A 1 225 ? 12.970 71.146 17.575  1.00 25.70 ? 247  SER A N   1 
ATOM   1704 C  CA  . SER A 1 225 ? 11.915 70.394 16.938  1.00 23.80 ? 247  SER A CA  1 
ATOM   1705 C  C   . SER A 1 225 ? 12.465 69.884 15.634  1.00 22.16 ? 247  SER A C   1 
ATOM   1706 O  O   . SER A 1 225 ? 13.376 70.448 15.091  1.00 21.60 ? 247  SER A O   1 
ATOM   1707 C  CB  . SER A 1 225 ? 10.672 71.250 16.662  1.00 24.39 ? 247  SER A CB  1 
ATOM   1708 O  OG  . SER A 1 225 ? 10.823 72.027 15.493  1.00 24.44 ? 247  SER A OG  1 
ATOM   1709 N  N   . THR A 1 226 ? 11.877 68.812 15.135  1.00 23.36 ? 248  THR A N   1 
ATOM   1710 C  CA  . THR A 1 226 ? 12.239 68.256 13.828  1.00 23.35 ? 248  THR A CA  1 
ATOM   1711 C  C   . THR A 1 226 ? 12.178 69.311 12.705  1.00 23.57 ? 248  THR A C   1 
ATOM   1712 O  O   . THR A 1 226 ? 13.054 69.427 11.866  1.00 20.87 ? 248  THR A O   1 
ATOM   1713 C  CB  . THR A 1 226 ? 11.285 67.075 13.484  1.00 22.71 ? 248  THR A CB  1 
ATOM   1714 O  OG1 . THR A 1 226 ? 11.549 65.979 14.390  1.00 25.38 ? 248  THR A OG1 1 
ATOM   1715 C  CG2 . THR A 1 226 ? 11.473 66.665 12.015  1.00 21.18 ? 248  THR A CG2 1 
ATOM   1716 N  N   . GLU A 1 227 ? 11.134 70.123 12.755  1.00 24.23 ? 249  GLU A N   1 
ATOM   1717 C  CA  . GLU A 1 227 ? 10.881 71.098 11.708  1.00 24.40 ? 249  GLU A CA  1 
ATOM   1718 C  C   . GLU A 1 227 ? 11.861 72.265 11.780  1.00 23.43 ? 249  GLU A C   1 
ATOM   1719 O  O   . GLU A 1 227 ? 12.213 72.850 10.761  1.00 24.40 ? 249  GLU A O   1 
ATOM   1720 C  CB  . GLU A 1 227 ? 9.443  71.561 11.796  1.00 24.05 ? 249  GLU A CB  1 
ATOM   1721 C  CG  . GLU A 1 227 ? 8.463  70.448 11.288  1.00 27.15 ? 249  GLU A CG  1 
ATOM   1722 C  CD  . GLU A 1 227 ? 8.122  69.403 12.336  1.00 28.82 ? 249  GLU A CD  1 
ATOM   1723 O  OE1 . GLU A 1 227 ? 8.327  69.671 13.524  1.00 29.07 ? 249  GLU A OE1 1 
ATOM   1724 O  OE2 . GLU A 1 227 ? 7.668  68.295 11.946  1.00 31.40 ? 249  GLU A OE2 1 
ATOM   1725 N  N   . GLN A 1 228 ? 12.311 72.557 12.999  1.00 24.54 ? 250  GLN A N   1 
ATOM   1726 C  CA  . GLN A 1 228 ? 13.243 73.625 13.276  1.00 24.32 ? 250  GLN A CA  1 
ATOM   1727 C  C   . GLN A 1 228 ? 14.599 73.180 12.802  1.00 25.34 ? 250  GLN A C   1 
ATOM   1728 O  O   . GLN A 1 228 ? 15.284 73.931 12.150  1.00 26.61 ? 250  GLN A O   1 
ATOM   1729 C  CB  . GLN A 1 228 ? 13.224 73.944 14.760  1.00 26.08 ? 250  GLN A CB  1 
ATOM   1730 C  CG  . GLN A 1 228 ? 12.056 74.908 15.058  1.00 27.90 ? 250  GLN A CG  1 
ATOM   1731 C  CD  . GLN A 1 228 ? 11.638 74.957 16.533  1.00 30.72 ? 250  GLN A CD  1 
ATOM   1732 O  OE1 . GLN A 1 228 ? 10.809 75.791 16.907  1.00 32.86 ? 250  GLN A OE1 1 
ATOM   1733 N  NE2 . GLN A 1 228 ? 12.222 74.107 17.365  1.00 23.73 ? 250  GLN A NE2 1 
ATOM   1734 N  N   . MET A 1 229 ? 14.951 71.916 13.063  1.00 26.05 ? 251  MET A N   1 
ATOM   1735 C  CA  . MET A 1 229 ? 16.221 71.372 12.541  1.00 26.92 ? 251  MET A CA  1 
ATOM   1736 C  C   . MET A 1 229 ? 16.166 71.281 11.044  1.00 26.29 ? 251  MET A C   1 
ATOM   1737 O  O   . MET A 1 229 ? 17.158 71.512 10.370  1.00 27.25 ? 251  MET A O   1 
ATOM   1738 C  CB  . MET A 1 229 ? 16.538 70.007 13.165  1.00 27.61 ? 251  MET A CB  1 
ATOM   1739 C  CG  . MET A 1 229 ? 16.498 69.949 14.646  1.00 27.69 ? 251  MET A CG  1 
ATOM   1740 S  SD  . MET A 1 229 ? 17.203 68.319 15.098  1.00 32.03 ? 251  MET A SD  1 
ATOM   1741 C  CE  . MET A 1 229 ? 17.312 68.499 16.819  1.00 31.13 ? 251  MET A CE  1 
ATOM   1742 N  N   . GLU A 1 230 ? 14.996 70.950 10.508  1.00 26.01 ? 252  GLU A N   1 
ATOM   1743 C  CA  . GLU A 1 230 ? 14.842 70.878 9.047   1.00 26.38 ? 252  GLU A CA  1 
ATOM   1744 C  C   . GLU A 1 230 ? 15.157 72.238 8.391   1.00 25.91 ? 252  GLU A C   1 
ATOM   1745 O  O   . GLU A 1 230 ? 15.821 72.294 7.384   1.00 25.72 ? 252  GLU A O   1 
ATOM   1746 C  CB  . GLU A 1 230 ? 13.446 70.405 8.656   1.00 25.48 ? 252  GLU A CB  1 
ATOM   1747 C  CG  . GLU A 1 230 ? 13.264 69.995 7.207   1.00 23.93 ? 252  GLU A CG  1 
ATOM   1748 C  CD  . GLU A 1 230 ? 11.832 69.546 6.989   1.00 25.93 ? 252  GLU A CD  1 
ATOM   1749 O  OE1 . GLU A 1 230 ? 10.938 70.414 6.798   1.00 34.96 ? 252  GLU A OE1 1 
ATOM   1750 O  OE2 . GLU A 1 230 ? 11.597 68.329 7.029   1.00 29.67 ? 252  GLU A OE2 1 
ATOM   1751 N  N   . ALA A 1 231 ? 14.634 73.311 8.975   1.00 27.29 ? 253  ALA A N   1 
ATOM   1752 C  CA  . ALA A 1 231 ? 14.901 74.679 8.542   1.00 29.16 ? 253  ALA A CA  1 
ATOM   1753 C  C   . ALA A 1 231 ? 16.379 75.062 8.682   1.00 29.80 ? 253  ALA A C   1 
ATOM   1754 O  O   . ALA A 1 231 ? 16.939 75.759 7.822   1.00 31.35 ? 253  ALA A O   1 
ATOM   1755 C  CB  . ALA A 1 231 ? 13.999 75.650 9.334   1.00 29.10 ? 253  ALA A CB  1 
ATOM   1756 N  N   . TYR A 1 232 ? 16.996 74.644 9.788   1.00 30.18 ? 254  TYR A N   1 
ATOM   1757 C  CA  . TYR A 1 232 ? 18.414 74.770 10.006  1.00 30.26 ? 254  TYR A CA  1 
ATOM   1758 C  C   . TYR A 1 232 ? 19.185 74.257 8.796   1.00 28.86 ? 254  TYR A C   1 
ATOM   1759 O  O   . TYR A 1 232 ? 20.044 74.942 8.246   1.00 28.70 ? 254  TYR A O   1 
ATOM   1760 C  CB  . TYR A 1 232 ? 18.799 73.878 11.184  1.00 33.04 ? 254  TYR A CB  1 
ATOM   1761 C  CG  . TYR A 1 232 ? 20.241 73.985 11.584  1.00 35.04 ? 254  TYR A CG  1 
ATOM   1762 C  CD1 . TYR A 1 232 ? 21.251 73.326 10.875  1.00 39.36 ? 254  TYR A CD1 1 
ATOM   1763 C  CD2 . TYR A 1 232 ? 20.583 74.725 12.701  1.00 39.16 ? 254  TYR A CD2 1 
ATOM   1764 C  CE1 . TYR A 1 232 ? 22.593 73.434 11.280  1.00 41.08 ? 254  TYR A CE1 1 
ATOM   1765 C  CE2 . TYR A 1 232 ? 21.878 74.853 13.104  1.00 41.09 ? 254  TYR A CE2 1 
ATOM   1766 C  CZ  . TYR A 1 232 ? 22.888 74.220 12.409  1.00 40.26 ? 254  TYR A CZ  1 
ATOM   1767 O  OH  . TYR A 1 232 ? 24.175 74.424 12.894  1.00 40.89 ? 254  TYR A OH  1 
ATOM   1768 N  N   . TYR A 1 233 ? 18.900 73.015 8.414   1.00 26.26 ? 255  TYR A N   1 
ATOM   1769 C  CA  . TYR A 1 233 ? 19.706 72.320 7.407   1.00 24.93 ? 255  TYR A CA  1 
ATOM   1770 C  C   . TYR A 1 233 ? 19.415 72.872 6.008   1.00 25.19 ? 255  TYR A C   1 
ATOM   1771 O  O   . TYR A 1 233 ? 20.310 72.968 5.169   1.00 26.21 ? 255  TYR A O   1 
ATOM   1772 C  CB  . TYR A 1 233 ? 19.352 70.835 7.455   1.00 25.02 ? 255  TYR A CB  1 
ATOM   1773 C  CG  . TYR A 1 233 ? 20.043 70.056 8.575   1.00 25.25 ? 255  TYR A CG  1 
ATOM   1774 C  CD1 . TYR A 1 233 ? 21.417 70.029 8.638   1.00 26.13 ? 255  TYR A CD1 1 
ATOM   1775 C  CD2 . TYR A 1 233 ? 19.327 69.255 9.459   1.00 24.48 ? 255  TYR A CD2 1 
ATOM   1776 C  CE1 . TYR A 1 233 ? 22.100 69.314 9.613   1.00 25.01 ? 255  TYR A CE1 1 
ATOM   1777 C  CE2 . TYR A 1 233 ? 19.994 68.502 10.468  1.00 25.34 ? 255  TYR A CE2 1 
ATOM   1778 C  CZ  . TYR A 1 233 ? 21.386 68.545 10.526  1.00 26.53 ? 255  TYR A CZ  1 
ATOM   1779 O  OH  . TYR A 1 233 ? 22.116 67.862 11.472  1.00 23.17 ? 255  TYR A OH  1 
ATOM   1780 N  N   . ASP A 1 234 ? 18.143 73.184 5.780   1.00 25.38 ? 256  ASP A N   1 
ATOM   1781 C  CA  . ASP A 1 234 ? 17.710 73.834 4.534   1.00 27.19 ? 256  ASP A CA  1 
ATOM   1782 C  C   . ASP A 1 234 ? 18.329 75.186 4.289   1.00 28.30 ? 256  ASP A C   1 
ATOM   1783 O  O   . ASP A 1 234 ? 18.629 75.530 3.153   1.00 29.05 ? 256  ASP A O   1 
ATOM   1784 C  CB  . ASP A 1 234 ? 16.189 73.900 4.500   1.00 26.53 ? 256  ASP A CB  1 
ATOM   1785 C  CG  . ASP A 1 234 ? 15.583 72.570 4.171   1.00 28.49 ? 256  ASP A CG  1 
ATOM   1786 O  OD1 . ASP A 1 234 ? 16.381 71.604 4.015   1.00 25.72 ? 256  ASP A OD1 1 
ATOM   1787 O  OD2 . ASP A 1 234 ? 14.333 72.498 4.086   1.00 29.16 ? 256  ASP A OD2 1 
ATOM   1788 N  N   . GLU A 1 235 ? 18.519 75.941 5.361   1.00 29.77 ? 257  GLU A N   1 
ATOM   1789 C  CA  . GLU A 1 235 ? 18.971 77.317 5.275   1.00 30.77 ? 257  GLU A CA  1 
ATOM   1790 C  C   . GLU A 1 235 ? 20.411 77.339 4.796   1.00 31.18 ? 257  GLU A C   1 
ATOM   1791 O  O   . GLU A 1 235 ? 20.823 78.242 4.036   1.00 31.50 ? 257  GLU A O   1 
ATOM   1792 C  CB  . GLU A 1 235 ? 18.830 77.978 6.636   1.00 29.94 ? 257  GLU A CB  1 
ATOM   1793 C  CG  . GLU A 1 235 ? 19.167 79.445 6.644   1.00 34.04 ? 257  GLU A CG  1 
ATOM   1794 C  CD  . GLU A 1 235 ? 19.237 79.988 8.032   1.00 36.99 ? 257  GLU A CD  1 
ATOM   1795 O  OE1 . GLU A 1 235 ? 20.297 79.802 8.656   1.00 39.10 ? 257  GLU A OE1 1 
ATOM   1796 O  OE2 . GLU A 1 235 ? 18.237 80.593 8.494   1.00 39.22 ? 257  GLU A OE2 1 
ATOM   1797 N  N   . ILE A 1 236 ? 21.165 76.316 5.221   1.00 31.19 ? 258  ILE A N   1 
ATOM   1798 C  CA  . ILE A 1 236 ? 22.581 76.179 4.896   1.00 31.17 ? 258  ILE A CA  1 
ATOM   1799 C  C   . ILE A 1 236 ? 22.781 75.243 3.704   1.00 30.68 ? 258  ILE A C   1 
ATOM   1800 O  O   . ILE A 1 236 ? 23.905 74.941 3.334   1.00 31.24 ? 258  ILE A O   1 
ATOM   1801 C  CB  . ILE A 1 236 ? 23.440 75.762 6.138   1.00 31.41 ? 258  ILE A CB  1 
ATOM   1802 C  CG1 . ILE A 1 236 ? 23.045 74.405 6.693   1.00 30.04 ? 258  ILE A CG1 1 
ATOM   1803 C  CG2 . ILE A 1 236 ? 23.315 76.813 7.331   1.00 32.20 ? 258  ILE A CG2 1 
ATOM   1804 C  CD1 . ILE A 1 236 ? 24.058 73.807 7.785   1.00 31.54 ? 258  ILE A CD1 1 
ATOM   1805 N  N   . ASN A 1 237 ? 21.680 74.788 3.108   1.00 31.12 ? 259  ASN A N   1 
ATOM   1806 C  CA  . ASN A 1 237 ? 21.726 73.889 1.962   1.00 31.47 ? 259  ASN A CA  1 
ATOM   1807 C  C   . ASN A 1 237 ? 22.569 72.647 2.228   1.00 31.07 ? 259  ASN A C   1 
ATOM   1808 O  O   . ASN A 1 237 ? 23.344 72.189 1.362   1.00 31.74 ? 259  ASN A O   1 
ATOM   1809 C  CB  . ASN A 1 237 ? 22.223 74.653 0.724   1.00 33.15 ? 259  ASN A CB  1 
ATOM   1810 C  CG  . ASN A 1 237 ? 21.302 75.821 0.373   1.00 35.45 ? 259  ASN A CG  1 
ATOM   1811 O  OD1 . ASN A 1 237 ? 20.118 75.619 0.127   1.00 36.58 ? 259  ASN A OD1 1 
ATOM   1812 N  ND2 . ASN A 1 237 ? 21.838 77.043 0.391   1.00 37.53 ? 259  ASN A ND2 1 
ATOM   1813 N  N   . PHE A 1 238 ? 22.414 72.096 3.425   1.00 29.43 ? 260  PHE A N   1 
ATOM   1814 C  CA  . PHE A 1 238 ? 23.256 71.002 3.884   1.00 27.96 ? 260  PHE A CA  1 
ATOM   1815 C  C   . PHE A 1 238 ? 22.677 69.680 3.388   1.00 28.10 ? 260  PHE A C   1 
ATOM   1816 O  O   . PHE A 1 238 ? 21.450 69.504 3.432   1.00 28.06 ? 260  PHE A O   1 
ATOM   1817 C  CB  . PHE A 1 238 ? 23.338 70.972 5.418   1.00 27.38 ? 260  PHE A CB  1 
ATOM   1818 C  CG  . PHE A 1 238 ? 24.317 69.965 5.931   1.00 28.61 ? 260  PHE A CG  1 
ATOM   1819 C  CD1 . PHE A 1 238 ? 25.696 70.219 5.885   1.00 26.13 ? 260  PHE A CD1 1 
ATOM   1820 C  CD2 . PHE A 1 238 ? 23.874 68.756 6.456   1.00 25.83 ? 260  PHE A CD2 1 
ATOM   1821 C  CE1 . PHE A 1 238 ? 26.617 69.283 6.317   1.00 27.52 ? 260  PHE A CE1 1 
ATOM   1822 C  CE2 . PHE A 1 238 ? 24.818 67.785 6.938   1.00 24.87 ? 260  PHE A CE2 1 
ATOM   1823 C  CZ  . PHE A 1 238 ? 26.182 68.062 6.846   1.00 28.67 ? 260  PHE A CZ  1 
ATOM   1824 N  N   . ALA A 1 239 ? 23.551 68.779 2.911   1.00 26.53 ? 261  ALA A N   1 
ATOM   1825 C  CA  . ALA A 1 239 ? 23.182 67.353 2.669   1.00 25.94 ? 261  ALA A CA  1 
ATOM   1826 C  C   . ALA A 1 239 ? 24.227 66.428 3.295   1.00 23.99 ? 261  ALA A C   1 
ATOM   1827 O  O   . ALA A 1 239 ? 25.434 66.592 3.057   1.00 23.73 ? 261  ALA A O   1 
ATOM   1828 C  CB  . ALA A 1 239 ? 23.094 67.069 1.181   1.00 27.33 ? 261  ALA A CB  1 
ATOM   1829 N  N   . ASP A 1 240 ? 23.775 65.419 4.047   1.00 23.43 ? 262  ASP A N   1 
ATOM   1830 C  CA  . ASP A 1 240 ? 24.683 64.360 4.518   1.00 22.17 ? 262  ASP A CA  1 
ATOM   1831 C  C   . ASP A 1 240 ? 25.272 63.501 3.400   1.00 22.52 ? 262  ASP A C   1 
ATOM   1832 O  O   . ASP A 1 240 ? 26.432 63.116 3.468   1.00 21.95 ? 262  ASP A O   1 
ATOM   1833 C  CB  . ASP A 1 240 ? 24.018 63.486 5.551   1.00 22.97 ? 262  ASP A CB  1 
ATOM   1834 C  CG  . ASP A 1 240 ? 23.898 64.185 6.875   1.00 24.16 ? 262  ASP A CG  1 
ATOM   1835 O  OD1 . ASP A 1 240 ? 24.965 64.426 7.464   1.00 23.20 ? 262  ASP A OD1 1 
ATOM   1836 O  OD2 . ASP A 1 240 ? 22.771 64.475 7.292   1.00 21.95 ? 262  ASP A OD2 1 
ATOM   1837 N  N   . TRP A 1 241 ? 24.448 63.180 2.401   1.00 23.14 ? 263  TRP A N   1 
ATOM   1838 C  CA  . TRP A 1 241 ? 24.914 62.536 1.194   1.00 21.18 ? 263  TRP A CA  1 
ATOM   1839 C  C   . TRP A 1 241 ? 23.927 62.839 0.053   1.00 22.30 ? 263  TRP A C   1 
ATOM   1840 O  O   . TRP A 1 241 ? 22.799 63.294 0.297   1.00 20.88 ? 263  TRP A O   1 
ATOM   1841 C  CB  . TRP A 1 241 ? 25.043 61.028 1.441   1.00 23.18 ? 263  TRP A CB  1 
ATOM   1842 C  CG  . TRP A 1 241 ? 23.744 60.221 1.413   1.00 21.68 ? 263  TRP A CG  1 
ATOM   1843 C  CD1 . TRP A 1 241 ? 23.416 59.264 0.471   1.00 24.21 ? 263  TRP A CD1 1 
ATOM   1844 C  CD2 . TRP A 1 241 ? 22.692 60.180 2.401   1.00 20.72 ? 263  TRP A CD2 1 
ATOM   1845 N  NE1 . TRP A 1 241 ? 22.168 58.708 0.762   1.00 22.20 ? 263  TRP A NE1 1 
ATOM   1846 C  CE2 . TRP A 1 241 ? 21.736 59.222 1.966   1.00 20.64 ? 263  TRP A CE2 1 
ATOM   1847 C  CE3 . TRP A 1 241 ? 22.465 60.844 3.623   1.00 21.93 ? 263  TRP A CE3 1 
ATOM   1848 C  CZ2 . TRP A 1 241 ? 20.570 58.962 2.672   1.00 20.22 ? 263  TRP A CZ2 1 
ATOM   1849 C  CZ3 . TRP A 1 241 ? 21.279 60.578 4.328   1.00 20.92 ? 263  TRP A CZ3 1 
ATOM   1850 C  CH2 . TRP A 1 241 ? 20.355 59.621 3.840   1.00 19.94 ? 263  TRP A CH2 1 
ATOM   1851 N  N   . THR A 1 242 ? 24.342 62.558 -1.177  1.00 22.08 ? 264  THR A N   1 
ATOM   1852 C  CA  . THR A 1 242 ? 23.430 62.634 -2.313  1.00 23.22 ? 264  THR A CA  1 
ATOM   1853 C  C   . THR A 1 242 ? 22.918 61.224 -2.561  1.00 23.15 ? 264  THR A C   1 
ATOM   1854 O  O   . THR A 1 242 ? 23.710 60.284 -2.662  1.00 23.94 ? 264  THR A O   1 
ATOM   1855 C  CB  . THR A 1 242 ? 24.153 63.207 -3.581  1.00 25.09 ? 264  THR A CB  1 
ATOM   1856 O  OG1 . THR A 1 242 ? 24.710 64.504 -3.286  1.00 27.00 ? 264  THR A OG1 1 
ATOM   1857 C  CG2 . THR A 1 242 ? 23.184 63.278 -4.758  1.00 25.52 ? 264  THR A CG2 1 
ATOM   1858 N  N   . HIS A 1 243 ? 21.587 61.060 -2.578  1.00 23.49 ? 265  HIS A N   1 
ATOM   1859 C  CA  . HIS A 1 243 ? 21.029 59.722 -2.617  1.00 22.42 ? 265  HIS A CA  1 
ATOM   1860 C  C   . HIS A 1 243 ? 21.576 58.897 -3.797  1.00 23.08 ? 265  HIS A C   1 
ATOM   1861 O  O   . HIS A 1 243 ? 21.687 59.394 -4.957  1.00 23.75 ? 265  HIS A O   1 
ATOM   1862 C  CB  . HIS A 1 243 ? 19.503 59.760 -2.664  1.00 23.06 ? 265  HIS A CB  1 
ATOM   1863 C  CG  . HIS A 1 243 ? 18.896 58.479 -2.194  1.00 19.91 ? 265  HIS A CG  1 
ATOM   1864 N  ND1 . HIS A 1 243 ? 18.556 57.462 -3.051  1.00 25.11 ? 265  HIS A ND1 1 
ATOM   1865 C  CD2 . HIS A 1 243 ? 18.643 58.022 -0.939  1.00 19.89 ? 265  HIS A CD2 1 
ATOM   1866 C  CE1 . HIS A 1 243 ? 18.070 56.445 -2.351  1.00 21.80 ? 265  HIS A CE1 1 
ATOM   1867 N  NE2 . HIS A 1 243 ? 18.082 56.778 -1.065  1.00 21.73 ? 265  HIS A NE2 1 
ATOM   1868 N  N   . GLY A 1 244 ? 21.941 57.653 -3.512  1.00 22.76 ? 266  GLY A N   1 
ATOM   1869 C  CA  . GLY A 1 244 ? 22.555 56.778 -4.492  1.00 24.28 ? 266  GLY A CA  1 
ATOM   1870 C  C   . GLY A 1 244 ? 21.611 56.366 -5.589  1.00 25.11 ? 266  GLY A C   1 
ATOM   1871 O  O   . GLY A 1 244 ? 22.051 56.042 -6.697  1.00 26.38 ? 266  GLY A O   1 
ATOM   1872 N  N   . ILE A 1 245 ? 20.300 56.445 -5.329  1.00 24.89 ? 267  ILE A N   1 
ATOM   1873 C  CA  . ILE A 1 245 ? 19.287 56.079 -6.352  1.00 23.87 ? 267  ILE A CA  1 
ATOM   1874 C  C   . ILE A 1 245 ? 18.556 57.283 -6.917  1.00 22.83 ? 267  ILE A C   1 
ATOM   1875 O  O   . ILE A 1 245 ? 18.367 57.372 -8.124  1.00 23.92 ? 267  ILE A O   1 
ATOM   1876 C  CB  . ILE A 1 245 ? 18.258 55.040 -5.834  1.00 24.84 ? 267  ILE A CB  1 
ATOM   1877 C  CG1 . ILE A 1 245 ? 18.937 53.713 -5.532  1.00 24.92 ? 267  ILE A CG1 1 
ATOM   1878 C  CG2 . ILE A 1 245 ? 17.196 54.707 -6.886  1.00 23.67 ? 267  ILE A CG2 1 
ATOM   1879 C  CD1 . ILE A 1 245 ? 18.179 52.854 -4.533  1.00 23.51 ? 267  ILE A CD1 1 
ATOM   1880 N  N   . SER A 1 246 ? 18.125 58.191 -6.046  1.00 21.78 ? 268  SER A N   1 
ATOM   1881 C  CA  . SER A 1 246 ? 17.326 59.291 -6.478  1.00 23.02 ? 268  SER A CA  1 
ATOM   1882 C  C   . SER A 1 246 ? 18.135 60.574 -6.653  1.00 23.26 ? 268  SER A C   1 
ATOM   1883 O  O   . SER A 1 246 ? 17.624 61.530 -7.220  1.00 24.19 ? 268  SER A O   1 
ATOM   1884 C  CB  . SER A 1 246 ? 16.160 59.495 -5.520  1.00 21.71 ? 268  SER A CB  1 
ATOM   1885 O  OG  . SER A 1 246 ? 16.673 59.962 -4.262  1.00 21.60 ? 268  SER A OG  1 
ATOM   1886 N  N   . LYS A 1 247 ? 19.380 60.576 -6.196  1.00 23.13 ? 269  LYS A N   1 
ATOM   1887 C  CA  . LYS A 1 247 ? 20.248 61.736 -6.283  1.00 25.83 ? 269  LYS A CA  1 
ATOM   1888 C  C   . LYS A 1 247 ? 19.635 62.918 -5.547  1.00 25.42 ? 269  LYS A C   1 
ATOM   1889 O  O   . LYS A 1 247 ? 19.935 64.053 -5.836  1.00 26.37 ? 269  LYS A O   1 
ATOM   1890 C  CB  . LYS A 1 247 ? 20.606 62.108 -7.732  1.00 27.39 ? 269  LYS A CB  1 
ATOM   1891 C  CG  . LYS A 1 247 ? 21.264 60.946 -8.534  1.00 32.20 ? 269  LYS A CG  1 
ATOM   1892 C  CD  . LYS A 1 247 ? 22.430 60.211 -7.804  1.00 35.07 ? 269  LYS A CD  1 
ATOM   1893 C  CE  . LYS A 1 247 ? 23.127 59.208 -8.749  1.00 36.97 ? 269  LYS A CE  1 
ATOM   1894 N  NZ  . LYS A 1 247 ? 22.313 57.980 -9.072  1.00 39.03 ? 269  LYS A NZ  1 
ATOM   1895 N  N   . THR A 1 248 ? 18.797 62.623 -4.555  1.00 25.10 ? 270  THR A N   1 
ATOM   1896 C  CA  . THR A 1 248 ? 18.235 63.681 -3.703  1.00 25.28 ? 270  THR A CA  1 
ATOM   1897 C  C   . THR A 1 248 ? 19.298 64.108 -2.714  1.00 24.34 ? 270  THR A C   1 
ATOM   1898 O  O   . THR A 1 248 ? 20.001 63.238 -2.208  1.00 23.46 ? 270  THR A O   1 
ATOM   1899 C  CB  . THR A 1 248 ? 17.010 63.094 -2.959  1.00 25.12 ? 270  THR A CB  1 
ATOM   1900 O  OG1 . THR A 1 248 ? 16.076 62.597 -3.910  1.00 23.94 ? 270  THR A OG1 1 
ATOM   1901 C  CG2 . THR A 1 248 ? 16.256 64.121 -2.037  1.00 26.27 ? 270  THR A CG2 1 
ATOM   1902 N  N   . PRO A 1 249 ? 19.379 65.423 -2.408  1.00 24.24 ? 271  PRO A N   1 
ATOM   1903 C  CA  . PRO A 1 249 ? 20.218 65.883 -1.248  1.00 24.18 ? 271  PRO A CA  1 
ATOM   1904 C  C   . PRO A 1 249 ? 19.596 65.420 0.086   1.00 23.65 ? 271  PRO A C   1 
ATOM   1905 O  O   . PRO A 1 249 ? 18.550 65.936 0.501   1.00 23.46 ? 271  PRO A O   1 
ATOM   1906 C  CB  . PRO A 1 249 ? 20.222 67.410 -1.401  1.00 24.05 ? 271  PRO A CB  1 
ATOM   1907 C  CG  . PRO A 1 249 ? 18.919 67.745 -2.182  1.00 24.96 ? 271  PRO A CG  1 
ATOM   1908 C  CD  . PRO A 1 249 ? 18.695 66.550 -3.101  1.00 24.74 ? 271  PRO A CD  1 
ATOM   1909 N  N   . MET A 1 250 ? 20.229 64.446 0.739   1.00 23.30 ? 272  MET A N   1 
ATOM   1910 C  CA  . MET A 1 250 ? 19.597 63.783 1.884   1.00 23.42 ? 272  MET A CA  1 
ATOM   1911 C  C   . MET A 1 250 ? 20.129 64.301 3.216   1.00 22.80 ? 272  MET A C   1 
ATOM   1912 O  O   . MET A 1 250 ? 21.300 64.671 3.321   1.00 22.78 ? 272  MET A O   1 
ATOM   1913 C  CB  . MET A 1 250 ? 19.777 62.247 1.816   1.00 24.07 ? 272  MET A CB  1 
ATOM   1914 C  CG  . MET A 1 250 ? 19.245 61.591 0.562   1.00 24.89 ? 272  MET A CG  1 
ATOM   1915 S  SD  . MET A 1 250 ? 17.488 61.897 0.358   1.00 23.73 ? 272  MET A SD  1 
ATOM   1916 C  CE  . MET A 1 250 ? 16.697 61.019 1.695   1.00 22.51 ? 272  MET A CE  1 
ATOM   1917 N  N   . LEU A 1 251 ? 19.257 64.238 4.218   1.00 22.72 ? 273  LEU A N   1 
ATOM   1918 C  CA  . LEU A 1 251 ? 19.585 64.447 5.618   1.00 22.13 ? 273  LEU A CA  1 
ATOM   1919 C  C   . LEU A 1 251 ? 19.448 63.143 6.405   1.00 22.27 ? 273  LEU A C   1 
ATOM   1920 O  O   . LEU A 1 251 ? 18.414 62.456 6.268   1.00 22.29 ? 273  LEU A O   1 
ATOM   1921 C  CB  . LEU A 1 251 ? 18.609 65.473 6.238   1.00 23.74 ? 273  LEU A CB  1 
ATOM   1922 C  CG  . LEU A 1 251 ? 18.808 66.899 5.732   1.00 21.98 ? 273  LEU A CG  1 
ATOM   1923 C  CD1 . LEU A 1 251 ? 17.664 67.709 6.320   1.00 20.14 ? 273  LEU A CD1 1 
ATOM   1924 C  CD2 . LEU A 1 251 ? 20.206 67.455 6.032   1.00 27.05 ? 273  LEU A CD2 1 
ATOM   1925 N  N   . LYS A 1 252 ? 20.475 62.817 7.207   1.00 21.44 ? 274  LYS A N   1 
ATOM   1926 C  CA  . LYS A 1 252 ? 20.466 61.660 8.133   1.00 22.37 ? 274  LYS A CA  1 
ATOM   1927 C  C   . LYS A 1 252 ? 20.126 62.083 9.571   1.00 22.58 ? 274  LYS A C   1 
ATOM   1928 O  O   . LYS A 1 252 ? 20.798 62.945 10.105  1.00 23.42 ? 274  LYS A O   1 
ATOM   1929 C  CB  . LYS A 1 252 ? 21.853 60.969 8.185   1.00 20.66 ? 274  LYS A CB  1 
ATOM   1930 C  CG  . LYS A 1 252 ? 21.817 59.671 9.029   1.00 23.39 ? 274  LYS A CG  1 
ATOM   1931 C  CD  . LYS A 1 252 ? 21.144 58.471 8.274   1.00 22.32 ? 274  LYS A CD  1 
ATOM   1932 C  CE  . LYS A 1 252 ? 20.895 57.315 9.264   1.00 23.51 ? 274  LYS A CE  1 
ATOM   1933 N  NZ  . LYS A 1 252 ? 19.767 57.522 10.156  1.00 19.62 ? 274  LYS A NZ  1 
ATOM   1934 N  N   . ALA A 1 253 ? 19.126 61.449 10.170  1.00 22.79 ? 275  ALA A N   1 
ATOM   1935 C  CA  . ALA A 1 253 ? 18.724 61.646 11.573  1.00 23.11 ? 275  ALA A CA  1 
ATOM   1936 C  C   . ALA A 1 253 ? 19.559 60.630 12.332  1.00 23.81 ? 275  ALA A C   1 
ATOM   1937 O  O   . ALA A 1 253 ? 19.656 59.464 11.911  1.00 24.38 ? 275  ALA A O   1 
ATOM   1938 C  CB  . ALA A 1 253 ? 17.289 61.280 11.750  1.00 24.22 ? 275  ALA A CB  1 
ATOM   1939 N  N   . GLN A 1 254 ? 20.174 61.025 13.430  1.00 22.93 ? 276  GLN A N   1 
ATOM   1940 C  CA  . GLN A 1 254 ? 20.784 60.005 14.275  1.00 23.87 ? 276  GLN A CA  1 
ATOM   1941 C  C   . GLN A 1 254 ? 20.292 60.198 15.684  1.00 23.32 ? 276  GLN A C   1 
ATOM   1942 O  O   . GLN A 1 254 ? 20.533 61.212 16.256  1.00 24.67 ? 276  GLN A O   1 
ATOM   1943 C  CB  . GLN A 1 254 ? 22.320 60.095 14.282  1.00 24.54 ? 276  GLN A CB  1 
ATOM   1944 C  CG  . GLN A 1 254 ? 23.024 59.648 12.999  1.00 25.72 ? 276  GLN A CG  1 
ATOM   1945 C  CD  . GLN A 1 254 ? 23.359 60.872 12.173  1.00 30.87 ? 276  GLN A CD  1 
ATOM   1946 O  OE1 . GLN A 1 254 ? 22.946 61.974 12.526  1.00 31.57 ? 276  GLN A OE1 1 
ATOM   1947 N  NE2 . GLN A 1 254 ? 24.139 60.709 11.129  1.00 30.78 ? 276  GLN A NE2 1 
ATOM   1948 N  N   . HIS A 1 255 ? 19.601 59.201 16.226  1.00 25.07 ? 277  HIS A N   1 
ATOM   1949 C  CA  . HIS A 1 255 ? 19.225 59.164 17.615  1.00 21.28 ? 277  HIS A CA  1 
ATOM   1950 C  C   . HIS A 1 255 ? 19.037 60.508 18.287  1.00 20.96 ? 277  HIS A C   1 
ATOM   1951 O  O   . HIS A 1 255 ? 19.811 60.864 19.203  1.00 22.26 ? 277  HIS A O   1 
ATOM   1952 C  CB  . HIS A 1 255 ? 20.213 58.347 18.394  1.00 21.99 ? 277  HIS A CB  1 
ATOM   1953 C  CG  . HIS A 1 255 ? 21.622 58.698 18.087  1.00 19.71 ? 277  HIS A CG  1 
ATOM   1954 N  ND1 . HIS A 1 255 ? 22.175 59.923 18.419  1.00 19.09 ? 277  HIS A ND1 1 
ATOM   1955 C  CD2 . HIS A 1 255 ? 22.598 57.978 17.496  1.00 22.95 ? 277  HIS A CD2 1 
ATOM   1956 C  CE1 . HIS A 1 255 ? 23.437 59.943 17.995  1.00 20.42 ? 277  HIS A CE1 1 
ATOM   1957 N  NE2 . HIS A 1 255 ? 23.729 58.749 17.497  1.00 19.42 ? 277  HIS A NE2 1 
ATOM   1958 N  N   . PRO A 1 256 ? 17.980 61.249 17.868  1.00 21.05 ? 278  PRO A N   1 
ATOM   1959 C  CA  . PRO A 1 256 ? 17.533 62.506 18.508  1.00 21.55 ? 278  PRO A CA  1 
ATOM   1960 C  C   . PRO A 1 256 ? 16.825 62.161 19.842  1.00 22.54 ? 278  PRO A C   1 
ATOM   1961 O  O   . PRO A 1 256 ? 15.682 62.583 20.074  1.00 23.24 ? 278  PRO A O   1 
ATOM   1962 C  CB  . PRO A 1 256 ? 16.494 63.047 17.498  1.00 21.62 ? 278  PRO A CB  1 
ATOM   1963 C  CG  . PRO A 1 256 ? 15.921 61.798 16.849  1.00 18.96 ? 278  PRO A CG  1 
ATOM   1964 C  CD  . PRO A 1 256 ? 17.115 60.873 16.730  1.00 22.28 ? 278  PRO A CD  1 
ATOM   1965 N  N   . ASP A 1 257 ? 17.484 61.381 20.701  1.00 20.54 ? 279  ASP A N   1 
ATOM   1966 C  CA  . ASP A 1 257 ? 16.745 60.807 21.807  1.00 21.26 ? 279  ASP A CA  1 
ATOM   1967 C  C   . ASP A 1 257 ? 16.364 61.908 22.758  1.00 20.93 ? 279  ASP A C   1 
ATOM   1968 O  O   . ASP A 1 257 ? 15.218 61.967 23.207  1.00 19.62 ? 279  ASP A O   1 
ATOM   1969 C  CB  . ASP A 1 257 ? 17.554 59.733 22.559  1.00 19.69 ? 279  ASP A CB  1 
ATOM   1970 C  CG  . ASP A 1 257 ? 18.117 58.626 21.631  1.00 22.42 ? 279  ASP A CG  1 
ATOM   1971 O  OD1 . ASP A 1 257 ? 17.344 58.027 20.915  1.00 24.97 ? 279  ASP A OD1 1 
ATOM   1972 O  OD2 . ASP A 1 257 ? 19.326 58.348 21.666  1.00 25.86 ? 279  ASP A OD2 1 
ATOM   1973 N  N   . TRP A 1 258 ? 17.316 62.757 23.107  1.00 21.38 ? 280  TRP A N   1 
ATOM   1974 C  CA  . TRP A 1 258 ? 17.035 63.859 24.063  1.00 22.35 ? 280  TRP A CA  1 
ATOM   1975 C  C   . TRP A 1 258 ? 16.042 64.875 23.482  1.00 22.93 ? 280  TRP A C   1 
ATOM   1976 O  O   . TRP A 1 258 ? 15.041 65.202 24.111  1.00 22.83 ? 280  TRP A O   1 
ATOM   1977 C  CB  . TRP A 1 258 ? 18.337 64.509 24.575  1.00 25.11 ? 280  TRP A CB  1 
ATOM   1978 C  CG  . TRP A 1 258 ? 18.126 65.678 25.570  1.00 23.19 ? 280  TRP A CG  1 
ATOM   1979 C  CD1 . TRP A 1 258 ? 18.017 65.604 26.932  1.00 27.63 ? 280  TRP A CD1 1 
ATOM   1980 C  CD2 . TRP A 1 258 ? 17.951 67.067 25.234  1.00 28.54 ? 280  TRP A CD2 1 
ATOM   1981 N  NE1 . TRP A 1 258 ? 17.806 66.884 27.475  1.00 25.80 ? 280  TRP A NE1 1 
ATOM   1982 C  CE2 . TRP A 1 258 ? 17.762 67.787 26.448  1.00 26.17 ? 280  TRP A CE2 1 
ATOM   1983 C  CE3 . TRP A 1 258 ? 17.942 67.782 24.023  1.00 26.07 ? 280  TRP A CE3 1 
ATOM   1984 C  CZ2 . TRP A 1 258 ? 17.587 69.182 26.473  1.00 26.89 ? 280  TRP A CZ2 1 
ATOM   1985 C  CZ3 . TRP A 1 258 ? 17.755 69.163 24.052  1.00 25.73 ? 280  TRP A CZ3 1 
ATOM   1986 C  CH2 . TRP A 1 258 ? 17.585 69.847 25.278  1.00 26.42 ? 280  TRP A CH2 1 
ATOM   1987 N  N   . GLU A 1 259 ? 16.260 65.290 22.241  1.00 21.76 ? 281  GLU A N   1 
ATOM   1988 C  CA  . GLU A 1 259 ? 15.391 66.305 21.613  1.00 23.00 ? 281  GLU A CA  1 
ATOM   1989 C  C   . GLU A 1 259 ? 13.921 65.842 21.580  1.00 24.25 ? 281  GLU A C   1 
ATOM   1990 O  O   . GLU A 1 259 ? 12.993 66.619 21.860  1.00 25.23 ? 281  GLU A O   1 
ATOM   1991 C  CB  . GLU A 1 259 ? 15.832 66.589 20.186  1.00 21.92 ? 281  GLU A CB  1 
ATOM   1992 C  CG  . GLU A 1 259 ? 17.181 67.178 20.004  1.00 21.66 ? 281  GLU A CG  1 
ATOM   1993 C  CD  . GLU A 1 259 ? 18.198 66.130 19.634  1.00 24.02 ? 281  GLU A CD  1 
ATOM   1994 O  OE1 . GLU A 1 259 ? 18.151 65.011 20.207  1.00 22.62 ? 281  GLU A OE1 1 
ATOM   1995 O  OE2 . GLU A 1 259 ? 19.054 66.405 18.784  1.00 26.07 ? 281  GLU A OE2 1 
ATOM   1996 N  N   . LEU A 1 260 ? 13.695 64.584 21.233  1.00 23.65 ? 282  LEU A N   1 
ATOM   1997 C  CA  . LEU A 1 260 ? 12.322 64.095 21.231  1.00 24.85 ? 282  LEU A CA  1 
ATOM   1998 C  C   . LEU A 1 260 ? 11.765 63.839 22.635  1.00 25.71 ? 282  LEU A C   1 
ATOM   1999 O  O   . LEU A 1 260 ? 10.585 64.022 22.889  1.00 24.20 ? 282  LEU A O   1 
ATOM   2000 C  CB  . LEU A 1 260 ? 12.185 62.856 20.352  1.00 26.05 ? 282  LEU A CB  1 
ATOM   2001 C  CG  . LEU A 1 260 ? 11.903 63.127 18.875  1.00 26.64 ? 282  LEU A CG  1 
ATOM   2002 C  CD1 . LEU A 1 260 ? 13.054 63.713 18.068  1.00 31.71 ? 282  LEU A CD1 1 
ATOM   2003 C  CD2 . LEU A 1 260 ? 11.472 61.799 18.284  1.00 29.65 ? 282  LEU A CD2 1 
ATOM   2004 N  N   . TYR A 1 261 ? 12.612 63.363 23.537  1.00 24.41 ? 283  TYR A N   1 
ATOM   2005 C  CA  . TYR A 1 261 ? 12.194 63.168 24.914  1.00 26.12 ? 283  TYR A CA  1 
ATOM   2006 C  C   . TYR A 1 261 ? 11.699 64.496 25.449  1.00 25.93 ? 283  TYR A C   1 
ATOM   2007 O  O   . TYR A 1 261 ? 10.835 64.532 26.297  1.00 27.57 ? 283  TYR A O   1 
ATOM   2008 C  CB  . TYR A 1 261 ? 13.384 62.625 25.746  1.00 26.23 ? 283  TYR A CB  1 
ATOM   2009 C  CG  . TYR A 1 261 ? 13.502 63.180 27.157  1.00 27.26 ? 283  TYR A CG  1 
ATOM   2010 C  CD1 . TYR A 1 261 ? 12.871 62.533 28.259  1.00 27.26 ? 283  TYR A CD1 1 
ATOM   2011 C  CD2 . TYR A 1 261 ? 14.265 64.323 27.403  1.00 26.36 ? 283  TYR A CD2 1 
ATOM   2012 C  CE1 . TYR A 1 261 ? 13.006 63.037 29.556  1.00 23.11 ? 283  TYR A CE1 1 
ATOM   2013 C  CE2 . TYR A 1 261 ? 14.416 64.834 28.711  1.00 28.41 ? 283  TYR A CE2 1 
ATOM   2014 C  CZ  . TYR A 1 261 ? 13.769 64.172 29.776  1.00 25.89 ? 283  TYR A CZ  1 
ATOM   2015 O  OH  . TYR A 1 261 ? 13.926 64.686 31.071  1.00 29.00 ? 283  TYR A OH  1 
ATOM   2016 N  N   . LYS A 1 262 ? 12.166 65.599 24.868  1.00 29.48 ? 284  LYS A N   1 
ATOM   2017 C  CA  . LYS A 1 262 ? 11.950 66.914 25.484  1.00 33.74 ? 284  LYS A CA  1 
ATOM   2018 C  C   . LYS A 1 262 ? 10.586 67.575 25.811  1.00 35.27 ? 284  LYS A C   1 
ATOM   2019 O  O   . LYS A 1 262 ? 10.436 67.889 27.008  1.00 35.81 ? 284  LYS A O   1 
ATOM   2020 C  CB  . LYS A 1 262 ? 12.922 67.953 24.936  1.00 33.82 ? 284  LYS A CB  1 
ATOM   2021 C  CG  . LYS A 1 262 ? 14.047 68.216 25.868  1.00 35.11 ? 284  LYS A CG  1 
ATOM   2022 C  CD  . LYS A 1 262 ? 13.535 68.347 27.326  1.00 33.57 ? 284  LYS A CD  1 
ATOM   2023 C  CE  . LYS A 1 262 ? 14.273 69.412 28.101  1.00 37.05 ? 284  LYS A CE  1 
ATOM   2024 N  NZ  . LYS A 1 262 ? 13.868 69.391 29.535  1.00 34.90 ? 284  LYS A NZ  1 
ATOM   2025 N  N   . THR A 1 263 ? 9.588  67.837 24.933  1.00 35.58 ? 285  THR A N   1 
ATOM   2026 C  CA  . THR A 1 263 ? 8.869  67.088 23.808  1.00 36.58 ? 285  THR A CA  1 
ATOM   2027 C  C   . THR A 1 263 ? 7.735  66.216 24.320  1.00 36.18 ? 285  THR A C   1 
ATOM   2028 O  O   . THR A 1 263 ? 6.562  66.600 24.157  1.00 37.72 ? 285  THR A O   1 
ATOM   2029 C  CB  . THR A 1 263 ? 9.608  66.567 22.487  1.00 37.46 ? 285  THR A CB  1 
ATOM   2030 O  OG1 . THR A 1 263 ? 9.838  67.659 21.591  1.00 39.46 ? 285  THR A OG1 1 
ATOM   2031 C  CG2 . THR A 1 263 ? 8.722  65.522 21.659  1.00 34.52 ? 285  THR A CG2 1 
ATOM   2032 N  N   . GLY A 1 264 ? 8.062  65.080 24.941  1.00 33.18 ? 286  GLY A N   1 
ATOM   2033 C  CA  . GLY A 1 264 ? 7.099  64.065 25.378  1.00 31.82 ? 286  GLY A CA  1 
ATOM   2034 C  C   . GLY A 1 264 ? 6.615  64.306 26.793  1.00 30.30 ? 286  GLY A C   1 
ATOM   2035 O  O   . GLY A 1 264 ? 7.195  65.124 27.481  1.00 30.76 ? 286  GLY A O   1 
ATOM   2036 N  N   . ILE A 1 265 ? 5.577  63.600 27.242  1.00 30.25 ? 287  ILE A N   1 
ATOM   2037 C  CA  . ILE A 1 265 ? 4.961  63.964 28.533  1.00 30.61 ? 287  ILE A CA  1 
ATOM   2038 C  C   . ILE A 1 265 ? 5.937  63.858 29.700  1.00 29.44 ? 287  ILE A C   1 
ATOM   2039 O  O   . ILE A 1 265 ? 5.970  64.751 30.542  1.00 30.27 ? 287  ILE A O   1 
ATOM   2040 C  CB  . ILE A 1 265 ? 3.616  63.198 28.843  1.00 31.13 ? 287  ILE A CB  1 
ATOM   2041 C  CG1 . ILE A 1 265 ? 2.981  63.711 30.140  1.00 32.42 ? 287  ILE A CG1 1 
ATOM   2042 C  CG2 . ILE A 1 265 ? 3.806  61.698 28.847  1.00 33.67 ? 287  ILE A CG2 1 
ATOM   2043 C  CD1 . ILE A 1 265 ? 1.445  63.862 30.097  1.00 32.69 ? 287  ILE A CD1 1 
ATOM   2044 N  N   . HIS A 1 266 ? 6.751  62.806 29.719  1.00 28.68 ? 288  HIS A N   1 
ATOM   2045 C  CA  . HIS A 1 266 ? 7.742  62.651 30.801  1.00 28.34 ? 288  HIS A CA  1 
ATOM   2046 C  C   . HIS A 1 266 ? 8.756  63.787 30.824  1.00 28.56 ? 288  HIS A C   1 
ATOM   2047 O  O   . HIS A 1 266 ? 9.014  64.343 31.887  1.00 28.81 ? 288  HIS A O   1 
ATOM   2048 C  CB  . HIS A 1 266 ? 8.422  61.264 30.792  1.00 28.11 ? 288  HIS A CB  1 
ATOM   2049 C  CG  . HIS A 1 266 ? 7.517  60.128 31.181  1.00 26.78 ? 288  HIS A CG  1 
ATOM   2050 N  ND1 . HIS A 1 266 ? 6.945  59.282 30.256  1.00 22.45 ? 288  HIS A ND1 1 
ATOM   2051 C  CD2 . HIS A 1 266 ? 7.062  59.714 32.398  1.00 23.24 ? 288  HIS A CD2 1 
ATOM   2052 C  CE1 . HIS A 1 266 ? 6.222  58.362 30.886  1.00 25.65 ? 288  HIS A CE1 1 
ATOM   2053 N  NE2 . HIS A 1 266 ? 6.254  58.615 32.188  1.00 25.56 ? 288  HIS A NE2 1 
ATOM   2054 N  N   . GLY A 1 267 ? 9.315  64.146 29.655  1.00 28.72 ? 289  GLY A N   1 
ATOM   2055 C  CA  . GLY A 1 267 ? 10.213 65.292 29.541  1.00 28.22 ? 289  GLY A CA  1 
ATOM   2056 C  C   . GLY A 1 267 ? 9.531  66.566 29.993  1.00 30.22 ? 289  GLY A C   1 
ATOM   2057 O  O   . GLY A 1 267 ? 10.129 67.373 30.750  1.00 29.43 ? 289  GLY A O   1 
ATOM   2058 N  N   . GLN A 1 268 ? 8.300  66.789 29.494  1.00 30.12 ? 290  GLN A N   1 
ATOM   2059 C  CA  . GLN A 1 268 ? 7.486  67.939 29.898  1.00 32.85 ? 290  GLN A CA  1 
ATOM   2060 C  C   . GLN A 1 268 ? 7.332  67.992 31.428  1.00 32.46 ? 290  GLN A C   1 
ATOM   2061 O  O   . GLN A 1 268 ? 7.515  69.025 32.035  1.00 33.51 ? 290  GLN A O   1 
ATOM   2062 C  CB  . GLN A 1 268 ? 6.115  67.882 29.208  1.00 32.20 ? 290  GLN A CB  1 
ATOM   2063 C  CG  . GLN A 1 268 ? 6.121  68.596 27.844  1.00 34.62 ? 290  GLN A CG  1 
ATOM   2064 C  CD  . GLN A 1 268 ? 5.086  68.066 26.823  1.00 34.20 ? 290  GLN A CD  1 
ATOM   2065 O  OE1 . GLN A 1 268 ? 4.395  67.059 27.054  1.00 34.80 ? 290  GLN A OE1 1 
ATOM   2066 N  NE2 . GLN A 1 268 ? 5.005  68.743 25.670  1.00 38.48 ? 290  GLN A NE2 1 
ATOM   2067 N  N   . LYS A 1 269 ? 7.026  66.860 32.026  1.00 33.31 ? 291  LYS A N   1 
ATOM   2068 C  CA  . LYS A 1 269 ? 6.794  66.740 33.472  1.00 33.11 ? 291  LYS A CA  1 
ATOM   2069 C  C   . LYS A 1 269 ? 8.090  66.848 34.286  1.00 32.96 ? 291  LYS A C   1 
ATOM   2070 O  O   . LYS A 1 269 ? 8.049  66.914 35.523  1.00 32.18 ? 291  LYS A O   1 
ATOM   2071 C  CB  . LYS A 1 269 ? 6.118  65.383 33.764  1.00 33.72 ? 291  LYS A CB  1 
ATOM   2072 C  CG  . LYS A 1 269 ? 4.683  65.211 33.196  1.00 35.21 ? 291  LYS A CG  1 
ATOM   2073 C  CD  . LYS A 1 269 ? 3.711  66.272 33.711  1.00 38.03 ? 291  LYS A CD  1 
ATOM   2074 C  CE  . LYS A 1 269 ? 2.222  65.931 33.359  1.00 38.81 ? 291  LYS A CE  1 
ATOM   2075 N  NZ  . LYS A 1 269 ? 1.435  65.245 34.471  1.00 36.19 ? 291  LYS A NZ  1 
ATOM   2076 N  N   . GLY A 1 270 ? 9.224  66.910 33.586  1.00 31.69 ? 292  GLY A N   1 
ATOM   2077 C  CA  . GLY A 1 270 ? 10.517 67.010 34.236  1.00 31.93 ? 292  GLY A CA  1 
ATOM   2078 C  C   . GLY A 1 270 ? 11.118 65.698 34.732  1.00 31.55 ? 292  GLY A C   1 
ATOM   2079 O  O   . GLY A 1 270 ? 12.059 65.704 35.529  1.00 32.77 ? 292  GLY A O   1 
ATOM   2080 N  N   . VAL A 1 271 ? 10.584 64.574 34.281  1.00 31.06 ? 293  VAL A N   1 
ATOM   2081 C  CA  . VAL A 1 271 ? 11.179 63.282 34.583  1.00 30.48 ? 293  VAL A CA  1 
ATOM   2082 C  C   . VAL A 1 271 ? 12.473 63.040 33.792  1.00 30.70 ? 293  VAL A C   1 
ATOM   2083 O  O   . VAL A 1 271 ? 12.429 62.970 32.570  1.00 31.26 ? 293  VAL A O   1 
ATOM   2084 C  CB  . VAL A 1 271 ? 10.198 62.163 34.249  1.00 31.14 ? 293  VAL A CB  1 
ATOM   2085 C  CG1 . VAL A 1 271 ? 10.770 60.852 34.606  1.00 30.03 ? 293  VAL A CG1 1 
ATOM   2086 C  CG2 . VAL A 1 271 ? 8.840  62.422 34.923  1.00 29.15 ? 293  VAL A CG2 1 
ATOM   2087 N  N   . SER A 1 272 ? 13.608 62.845 34.465  1.00 29.87 ? 294  SER A N   1 
ATOM   2088 C  CA  . SER A 1 272 ? 14.883 62.733 33.739  1.00 28.85 ? 294  SER A CA  1 
ATOM   2089 C  C   . SER A 1 272 ? 15.127 61.341 33.146  1.00 27.38 ? 294  SER A C   1 
ATOM   2090 O  O   . SER A 1 272 ? 14.476 60.361 33.531  1.00 26.34 ? 294  SER A O   1 
ATOM   2091 C  CB  . SER A 1 272 ? 16.027 63.110 34.671  1.00 30.97 ? 294  SER A CB  1 
ATOM   2092 O  OG  . SER A 1 272 ? 16.326 62.013 35.489  1.00 31.68 ? 294  SER A OG  1 
ATOM   2093 N  N   . CYS A 1 273 ? 16.042 61.262 32.185  1.00 24.92 ? 295  CYS A N   1 
ATOM   2094 C  CA  . CYS A 1 273 ? 16.511 60.002 31.628  1.00 25.19 ? 295  CYS A CA  1 
ATOM   2095 C  C   . CYS A 1 273 ? 16.937 59.119 32.744  1.00 23.63 ? 295  CYS A C   1 
ATOM   2096 O  O   . CYS A 1 273 ? 16.637 57.951 32.738  1.00 22.20 ? 295  CYS A O   1 
ATOM   2097 C  CB  . CYS A 1 273 ? 17.793 60.231 30.789  1.00 25.94 ? 295  CYS A CB  1 
ATOM   2098 S  SG  . CYS A 1 273 ? 17.799 61.547 29.537  1.00 24.92 ? 295  CYS A SG  1 
ATOM   2099 N  N   . ALA A 1 274 ? 17.677 59.682 33.681  1.00 23.98 ? 296  ALA A N   1 
ATOM   2100 C  CA  . ALA A 1 274 ? 18.180 58.898 34.826  1.00 24.95 ? 296  ALA A CA  1 
ATOM   2101 C  C   . ALA A 1 274 ? 17.112 58.304 35.749  1.00 25.25 ? 296  ALA A C   1 
ATOM   2102 O  O   . ALA A 1 274 ? 17.322 57.247 36.398  1.00 25.18 ? 296  ALA A O   1 
ATOM   2103 C  CB  . ALA A 1 274 ? 19.167 59.723 35.613  1.00 24.36 ? 296  ALA A CB  1 
ATOM   2104 N  N   . ASP A 1 275 ? 15.964 58.954 35.842  1.00 25.02 ? 297  ASP A N   1 
ATOM   2105 C  CA  . ASP A 1 275 ? 14.860 58.399 36.628  1.00 26.66 ? 297  ASP A CA  1 
ATOM   2106 C  C   . ASP A 1 275 ? 14.371 57.014 36.176  1.00 25.88 ? 297  ASP A C   1 
ATOM   2107 O  O   . ASP A 1 275 ? 14.084 56.151 37.002  1.00 26.07 ? 297  ASP A O   1 
ATOM   2108 C  CB  . ASP A 1 275 ? 13.681 59.411 36.677  1.00 25.64 ? 297  ASP A CB  1 
ATOM   2109 C  CG  . ASP A 1 275 ? 13.944 60.599 37.569  1.00 28.81 ? 297  ASP A CG  1 
ATOM   2110 O  OD1 . ASP A 1 275 ? 14.514 60.422 38.688  1.00 30.87 ? 297  ASP A OD1 1 
ATOM   2111 O  OD2 . ASP A 1 275 ? 13.572 61.731 37.179  1.00 28.96 ? 297  ASP A OD2 1 
ATOM   2112 N  N   . CYS A 1 276 ? 14.214 56.793 34.875  1.00 25.98 ? 298  CYS A N   1 
ATOM   2113 C  CA  . CYS A 1 276 ? 13.859 55.476 34.377  1.00 26.34 ? 298  CYS A CA  1 
ATOM   2114 C  C   . CYS A 1 276 ? 15.061 54.553 34.103  1.00 26.15 ? 298  CYS A C   1 
ATOM   2115 O  O   . CYS A 1 276 ? 14.951 53.336 34.300  1.00 27.29 ? 298  CYS A O   1 
ATOM   2116 C  CB  . CYS A 1 276 ? 13.029 55.609 33.116  1.00 26.41 ? 298  CYS A CB  1 
ATOM   2117 S  SG  . CYS A 1 276 ? 11.661 56.778 33.416  1.00 27.97 ? 298  CYS A SG  1 
ATOM   2118 N  N   . HIS A 1 277 ? 16.169 55.133 33.629  1.00 26.08 ? 299  HIS A N   1 
ATOM   2119 C  CA  . HIS A 1 277 ? 17.276 54.345 33.111  1.00 24.89 ? 299  HIS A CA  1 
ATOM   2120 C  C   . HIS A 1 277 ? 18.328 54.106 34.196  1.00 25.81 ? 299  HIS A C   1 
ATOM   2121 O  O   . HIS A 1 277 ? 19.131 53.165 34.091  1.00 25.11 ? 299  HIS A O   1 
ATOM   2122 C  CB  . HIS A 1 277 ? 17.881 55.014 31.876  1.00 24.13 ? 299  HIS A CB  1 
ATOM   2123 C  CG  . HIS A 1 277 ? 17.039 54.860 30.635  1.00 24.49 ? 299  HIS A CG  1 
ATOM   2124 N  ND1 . HIS A 1 277 ? 16.935 53.667 29.945  1.00 23.41 ? 299  HIS A ND1 1 
ATOM   2125 C  CD2 . HIS A 1 277 ? 16.269 55.753 29.958  1.00 27.28 ? 299  HIS A CD2 1 
ATOM   2126 C  CE1 . HIS A 1 277 ? 16.141 53.839 28.893  1.00 21.73 ? 299  HIS A CE1 1 
ATOM   2127 N  NE2 . HIS A 1 277 ? 15.706 55.093 28.886  1.00 22.02 ? 299  HIS A NE2 1 
ATOM   2128 N  N   . MET A 1 278 ? 18.326 54.964 35.216  1.00 26.10 ? 300  MET A N   1 
ATOM   2129 C  CA  . MET A 1 278 ? 19.290 54.810 36.344  1.00 28.62 ? 300  MET A CA  1 
ATOM   2130 C  C   . MET A 1 278 ? 18.566 54.978 37.697  1.00 29.26 ? 300  MET A C   1 
ATOM   2131 O  O   . MET A 1 278 ? 18.919 55.840 38.484  1.00 29.71 ? 300  MET A O   1 
ATOM   2132 C  CB  . MET A 1 278 ? 20.475 55.794 36.199  1.00 28.26 ? 300  MET A CB  1 
ATOM   2133 C  CG  . MET A 1 278 ? 21.517 55.389 35.124  1.00 25.76 ? 300  MET A CG  1 
ATOM   2134 S  SD  . MET A 1 278 ? 22.760 56.677 35.068  1.00 30.59 ? 300  MET A SD  1 
ATOM   2135 C  CE  . MET A 1 278 ? 23.495 56.257 36.701  1.00 22.84 ? 300  MET A CE  1 
ATOM   2136 N  N   . PRO A 1 279 ? 17.565 54.128 37.971  1.00 31.29 ? 301  PRO A N   1 
ATOM   2137 C  CA  . PRO A 1 279 ? 16.739 54.407 39.146  1.00 32.54 ? 301  PRO A CA  1 
ATOM   2138 C  C   . PRO A 1 279 ? 17.535 54.205 40.425  1.00 33.52 ? 301  PRO A C   1 
ATOM   2139 O  O   . PRO A 1 279 ? 18.611 53.608 40.377  1.00 34.16 ? 301  PRO A O   1 
ATOM   2140 C  CB  . PRO A 1 279 ? 15.631 53.352 39.049  1.00 32.35 ? 301  PRO A CB  1 
ATOM   2141 C  CG  . PRO A 1 279 ? 16.198 52.267 38.219  1.00 32.44 ? 301  PRO A CG  1 
ATOM   2142 C  CD  . PRO A 1 279 ? 17.183 52.876 37.293  1.00 31.57 ? 301  PRO A CD  1 
ATOM   2143 N  N   . TYR A 1 280 ? 16.975 54.635 41.555  1.00 34.97 ? 302  TYR A N   1 
ATOM   2144 C  CA  . TYR A 1 280 ? 17.651 54.587 42.859  1.00 36.21 ? 302  TYR A CA  1 
ATOM   2145 C  C   . TYR A 1 280 ? 17.317 53.353 43.656  1.00 38.52 ? 302  TYR A C   1 
ATOM   2146 O  O   . TYR A 1 280 ? 16.195 52.854 43.615  1.00 38.86 ? 302  TYR A O   1 
ATOM   2147 C  CB  . TYR A 1 280 ? 17.202 55.740 43.725  1.00 36.09 ? 302  TYR A CB  1 
ATOM   2148 C  CG  . TYR A 1 280 ? 17.542 57.120 43.218  1.00 35.80 ? 302  TYR A CG  1 
ATOM   2149 C  CD1 . TYR A 1 280 ? 18.882 57.522 43.069  1.00 35.31 ? 302  TYR A CD1 1 
ATOM   2150 C  CD2 . TYR A 1 280 ? 16.535 58.037 42.921  1.00 36.44 ? 302  TYR A CD2 1 
ATOM   2151 C  CE1 . TYR A 1 280 ? 19.217 58.797 42.635  1.00 32.84 ? 302  TYR A CE1 1 
ATOM   2152 C  CE2 . TYR A 1 280 ? 16.854 59.321 42.486  1.00 37.28 ? 302  TYR A CE2 1 
ATOM   2153 C  CZ  . TYR A 1 280 ? 18.195 59.700 42.342  1.00 35.88 ? 302  TYR A CZ  1 
ATOM   2154 O  OH  . TYR A 1 280 ? 18.523 60.965 41.916  1.00 36.51 ? 302  TYR A OH  1 
ATOM   2155 N  N   . THR A 1 281 ? 18.285 52.902 44.446  1.00 41.40 ? 303  THR A N   1 
ATOM   2156 C  CA  . THR A 1 281 ? 18.024 51.931 45.487  1.00 43.53 ? 303  THR A CA  1 
ATOM   2157 C  C   . THR A 1 281 ? 18.402 52.575 46.805  1.00 44.90 ? 303  THR A C   1 
ATOM   2158 O  O   . THR A 1 281 ? 19.535 53.021 46.988  1.00 45.01 ? 303  THR A O   1 
ATOM   2159 C  CB  . THR A 1 281 ? 18.797 50.631 45.251  1.00 44.00 ? 303  THR A CB  1 
ATOM   2160 O  OG1 . THR A 1 281 ? 18.195 49.919 44.154  1.00 45.02 ? 303  THR A OG1 1 
ATOM   2161 C  CG2 . THR A 1 281 ? 18.772 49.773 46.507  1.00 44.52 ? 303  THR A CG2 1 
ATOM   2162 N  N   . GLN A 1 282 ? 17.433 52.652 47.711  1.00 46.66 ? 304  GLN A N   1 
ATOM   2163 C  CA  . GLN A 1 282 ? 17.662 53.252 49.018  1.00 48.80 ? 304  GLN A CA  1 
ATOM   2164 C  C   . GLN A 1 282 ? 18.216 52.175 49.948  1.00 49.75 ? 304  GLN A C   1 
ATOM   2165 O  O   . GLN A 1 282 ? 17.723 51.052 49.957  1.00 50.84 ? 304  GLN A O   1 
ATOM   2166 C  CB  . GLN A 1 282 ? 16.356 53.832 49.575  1.00 49.28 ? 304  GLN A CB  1 
ATOM   2167 C  CG  . GLN A 1 282 ? 16.541 54.762 50.772  1.00 49.34 ? 304  GLN A CG  1 
ATOM   2168 C  CD  . GLN A 1 282 ? 17.368 55.981 50.426  1.00 49.76 ? 304  GLN A CD  1 
ATOM   2169 O  OE1 . GLN A 1 282 ? 16.945 56.830 49.634  1.00 50.36 ? 304  GLN A OE1 1 
ATOM   2170 N  NE2 . GLN A 1 282 ? 18.550 56.078 51.017  1.00 49.31 ? 304  GLN A NE2 1 
ATOM   2171 N  N   . GLU A 1 283 ? 19.262 52.513 50.694  1.00 50.54 ? 305  GLU A N   1 
ATOM   2172 C  CA  . GLU A 1 283 ? 19.778 51.646 51.752  1.00 51.44 ? 305  GLU A CA  1 
ATOM   2173 C  C   . GLU A 1 283 ? 20.135 52.505 52.959  1.00 51.78 ? 305  GLU A C   1 
ATOM   2174 O  O   . GLU A 1 283 ? 21.278 52.998 53.093  1.00 51.74 ? 305  GLU A O   1 
ATOM   2175 C  CB  . GLU A 1 283 ? 20.976 50.821 51.275  1.00 51.80 ? 305  GLU A CB  1 
ATOM   2176 C  CG  . GLU A 1 283 ? 20.590 49.709 50.311  1.00 53.32 ? 305  GLU A CG  1 
ATOM   2177 C  CD  . GLU A 1 283 ? 21.783 49.061 49.665  1.00 55.92 ? 305  GLU A CD  1 
ATOM   2178 O  OE1 . GLU A 1 283 ? 22.886 49.148 50.246  1.00 56.79 ? 305  GLU A OE1 1 
ATOM   2179 O  OE2 . GLU A 1 283 ? 21.612 48.451 48.585  1.00 56.85 ? 305  GLU A OE2 1 
ATOM   2180 N  N   . GLY A 1 284 ? 19.130 52.700 53.816  1.00 51.79 ? 306  GLY A N   1 
ATOM   2181 C  CA  . GLY A 1 284 ? 19.244 53.563 54.988  1.00 52.09 ? 306  GLY A CA  1 
ATOM   2182 C  C   . GLY A 1 284 ? 19.555 54.992 54.611  1.00 51.88 ? 306  GLY A C   1 
ATOM   2183 O  O   . GLY A 1 284 ? 18.812 55.628 53.845  1.00 51.89 ? 306  GLY A O   1 
ATOM   2184 N  N   . ALA A 1 285 ? 20.673 55.478 55.148  1.00 51.72 ? 307  ALA A N   1 
ATOM   2185 C  CA  . ALA A 1 285 ? 21.200 56.816 54.861  1.00 51.41 ? 307  ALA A CA  1 
ATOM   2186 C  C   . ALA A 1 285 ? 21.781 56.944 53.445  1.00 51.25 ? 307  ALA A C   1 
ATOM   2187 O  O   . ALA A 1 285 ? 22.014 58.070 52.957  1.00 51.97 ? 307  ALA A O   1 
ATOM   2188 C  CB  . ALA A 1 285 ? 22.267 57.184 55.897  1.00 51.28 ? 307  ALA A CB  1 
ATOM   2189 N  N   . VAL A 1 286 ? 22.016 55.809 52.783  1.00 49.90 ? 308  VAL A N   1 
ATOM   2190 C  CA  . VAL A 1 286 ? 22.738 55.830 51.508  1.00 48.52 ? 308  VAL A CA  1 
ATOM   2191 C  C   . VAL A 1 286 ? 21.805 55.549 50.307  1.00 47.19 ? 308  VAL A C   1 
ATOM   2192 O  O   . VAL A 1 286 ? 21.085 54.539 50.293  1.00 46.69 ? 308  VAL A O   1 
ATOM   2193 C  CB  . VAL A 1 286 ? 23.997 54.877 51.524  1.00 48.99 ? 308  VAL A CB  1 
ATOM   2194 C  CG1 . VAL A 1 286 ? 25.053 55.348 50.514  1.00 49.69 ? 308  VAL A CG1 1 
ATOM   2195 C  CG2 . VAL A 1 286 ? 24.633 54.794 52.939  1.00 48.70 ? 308  VAL A CG2 1 
ATOM   2196 N  N   . LYS A 1 287 ? 21.826 56.451 49.316  1.00 45.00 ? 309  LYS A N   1 
ATOM   2197 C  CA  . LYS A 1 287 ? 21.108 56.255 48.042  1.00 42.96 ? 309  LYS A CA  1 
ATOM   2198 C  C   . LYS A 1 287 ? 22.083 55.876 46.907  1.00 41.08 ? 309  LYS A C   1 
ATOM   2199 O  O   . LYS A 1 287 ? 23.154 56.469 46.785  1.00 41.24 ? 309  LYS A O   1 
ATOM   2200 C  CB  . LYS A 1 287 ? 20.320 57.511 47.672  1.00 43.29 ? 309  LYS A CB  1 
ATOM   2201 C  CG  . LYS A 1 287 ? 19.227 57.285 46.651  1.00 44.89 ? 309  LYS A CG  1 
ATOM   2202 C  CD  . LYS A 1 287 ? 18.314 58.513 46.581  1.00 47.94 ? 309  LYS A CD  1 
ATOM   2203 C  CE  . LYS A 1 287 ? 19.012 59.727 45.963  1.00 47.68 ? 309  LYS A CE  1 
ATOM   2204 N  NZ  . LYS A 1 287 ? 18.043 60.869 45.867  1.00 50.00 ? 309  LYS A NZ  1 
ATOM   2205 N  N   . TYR A 1 288 ? 21.713 54.889 46.092  1.00 38.56 ? 310  TYR A N   1 
ATOM   2206 C  CA  . TYR A 1 288 ? 22.597 54.381 45.045  1.00 36.63 ? 310  TYR A CA  1 
ATOM   2207 C  C   . TYR A 1 288 ? 21.842 54.334 43.723  1.00 35.24 ? 310  TYR A C   1 
ATOM   2208 O  O   . TYR A 1 288 ? 20.726 53.813 43.674  1.00 34.18 ? 310  TYR A O   1 
ATOM   2209 C  CB  . TYR A 1 288 ? 23.020 52.945 45.361  1.00 39.34 ? 310  TYR A CB  1 
ATOM   2210 C  CG  . TYR A 1 288 ? 23.823 52.776 46.631  1.00 41.72 ? 310  TYR A CG  1 
ATOM   2211 C  CD1 . TYR A 1 288 ? 25.207 52.792 46.592  1.00 45.05 ? 310  TYR A CD1 1 
ATOM   2212 C  CD2 . TYR A 1 288 ? 23.191 52.571 47.874  1.00 44.36 ? 310  TYR A CD2 1 
ATOM   2213 C  CE1 . TYR A 1 288 ? 25.968 52.620 47.768  1.00 45.91 ? 310  TYR A CE1 1 
ATOM   2214 C  CE2 . TYR A 1 288 ? 23.929 52.404 49.043  1.00 42.65 ? 310  TYR A CE2 1 
ATOM   2215 C  CZ  . TYR A 1 288 ? 25.321 52.422 48.983  1.00 45.35 ? 310  TYR A CZ  1 
ATOM   2216 O  OH  . TYR A 1 288 ? 26.093 52.258 50.128  1.00 45.27 ? 310  TYR A OH  1 
ATOM   2217 N  N   . SER A 1 289 ? 22.462 54.866 42.669  1.00 32.01 ? 311  SER A N   1 
ATOM   2218 C  CA  . SER A 1 289 ? 21.881 54.857 41.313  1.00 29.78 ? 311  SER A CA  1 
ATOM   2219 C  C   . SER A 1 289 ? 22.331 53.611 40.552  1.00 27.83 ? 311  SER A C   1 
ATOM   2220 O  O   . SER A 1 289 ? 23.514 53.210 40.605  1.00 25.47 ? 311  SER A O   1 
ATOM   2221 C  CB  . SER A 1 289 ? 22.325 56.084 40.539  1.00 29.45 ? 311  SER A CB  1 
ATOM   2222 O  OG  . SER A 1 289 ? 21.917 57.255 41.194  1.00 31.44 ? 311  SER A OG  1 
ATOM   2223 N  N   . ASP A 1 290 ? 21.373 52.961 39.907  1.00 26.52 ? 312  ASP A N   1 
ATOM   2224 C  CA  . ASP A 1 290 ? 21.680 51.789 39.128  1.00 26.96 ? 312  ASP A CA  1 
ATOM   2225 C  C   . ASP A 1 290 ? 22.424 52.237 37.882  1.00 26.91 ? 312  ASP A C   1 
ATOM   2226 O  O   . ASP A 1 290 ? 21.852 52.955 37.020  1.00 26.80 ? 312  ASP A O   1 
ATOM   2227 C  CB  . ASP A 1 290 ? 20.417 50.956 38.781  1.00 27.55 ? 312  ASP A CB  1 
ATOM   2228 C  CG  . ASP A 1 290 ? 20.760 49.595 38.215  1.00 30.97 ? 312  ASP A CG  1 
ATOM   2229 O  OD1 . ASP A 1 290 ? 21.974 49.345 37.897  1.00 29.00 ? 312  ASP A OD1 1 
ATOM   2230 O  OD2 . ASP A 1 290 ? 19.822 48.764 38.041  1.00 35.38 ? 312  ASP A OD2 1 
ATOM   2231 N  N   . HIS A 1 291 ? 23.710 51.864 37.793  1.00 25.72 ? 313  HIS A N   1 
ATOM   2232 C  CA  . HIS A 1 291 ? 24.503 52.199 36.585  1.00 24.42 ? 313  HIS A CA  1 
ATOM   2233 C  C   . HIS A 1 291 ? 24.330 51.210 35.404  1.00 25.50 ? 313  HIS A C   1 
ATOM   2234 O  O   . HIS A 1 291 ? 24.912 51.403 34.338  1.00 25.28 ? 313  HIS A O   1 
ATOM   2235 C  CB  . HIS A 1 291 ? 25.972 52.560 36.926  1.00 24.17 ? 313  HIS A CB  1 
ATOM   2236 C  CG  . HIS A 1 291 ? 26.158 53.968 37.440  1.00 25.35 ? 313  HIS A CG  1 
ATOM   2237 N  ND1 . HIS A 1 291 ? 25.638 54.398 38.649  1.00 25.99 ? 313  HIS A ND1 1 
ATOM   2238 C  CD2 . HIS A 1 291 ? 26.854 55.019 36.940  1.00 22.64 ? 313  HIS A CD2 1 
ATOM   2239 C  CE1 . HIS A 1 291 ? 25.971 55.668 38.843  1.00 22.64 ? 313  HIS A CE1 1 
ATOM   2240 N  NE2 . HIS A 1 291 ? 26.744 56.074 37.840  1.00 24.76 ? 313  HIS A NE2 1 
ATOM   2241 N  N   . LYS A 1 292 ? 23.482 50.202 35.576  1.00 24.37 ? 314  LYS A N   1 
ATOM   2242 C  CA  . LYS A 1 292 ? 23.286 49.275 34.452  1.00 26.47 ? 314  LYS A CA  1 
ATOM   2243 C  C   . LYS A 1 292 ? 22.175 49.902 33.595  1.00 25.63 ? 314  LYS A C   1 
ATOM   2244 O  O   . LYS A 1 292 ? 20.986 49.660 33.806  1.00 26.70 ? 314  LYS A O   1 
ATOM   2245 C  CB  . LYS A 1 292 ? 23.004 47.839 34.889  1.00 26.34 ? 314  LYS A CB  1 
ATOM   2246 C  CG  . LYS A 1 292 ? 22.772 46.878 33.737  1.00 26.88 ? 314  LYS A CG  1 
ATOM   2247 C  CD  . LYS A 1 292 ? 21.986 45.580 34.148  1.00 29.03 ? 314  LYS A CD  1 
ATOM   2248 C  CE  . LYS A 1 292 ? 21.648 44.751 32.924  1.00 31.28 ? 314  LYS A CE  1 
ATOM   2249 N  NZ  . LYS A 1 292 ? 20.723 45.505 31.916  1.00 31.09 ? 314  LYS A NZ  1 
ATOM   2250 N  N   . VAL A 1 293 ? 22.607 50.726 32.659  1.00 25.91 ? 315  VAL A N   1 
ATOM   2251 C  CA  . VAL A 1 293 ? 21.748 51.450 31.724  1.00 24.90 ? 315  VAL A CA  1 
ATOM   2252 C  C   . VAL A 1 293 ? 21.278 50.445 30.696  1.00 25.36 ? 315  VAL A C   1 
ATOM   2253 O  O   . VAL A 1 293 ? 22.095 49.884 29.927  1.00 25.55 ? 315  VAL A O   1 
ATOM   2254 C  CB  . VAL A 1 293 ? 22.503 52.605 30.984  1.00 25.99 ? 315  VAL A CB  1 
ATOM   2255 C  CG1 . VAL A 1 293 ? 21.537 53.362 30.002  1.00 23.74 ? 315  VAL A CG1 1 
ATOM   2256 C  CG2 . VAL A 1 293 ? 23.136 53.545 32.000  1.00 23.91 ? 315  VAL A CG2 1 
ATOM   2257 N  N   . GLY A 1 294 ? 19.977 50.212 30.663  1.00 23.57 ? 316  GLY A N   1 
ATOM   2258 C  CA  . GLY A 1 294 ? 19.464 49.206 29.769  1.00 24.20 ? 316  GLY A CA  1 
ATOM   2259 C  C   . GLY A 1 294 ? 17.999 49.503 29.468  1.00 25.99 ? 316  GLY A C   1 
ATOM   2260 O  O   . GLY A 1 294 ? 17.598 50.647 29.404  1.00 25.57 ? 316  GLY A O   1 
ATOM   2261 N  N   . ASN A 1 295 ? 17.215 48.447 29.302  1.00 26.05 ? 317  ASN A N   1 
ATOM   2262 C  CA  . ASN A 1 295 ? 15.808 48.553 29.030  1.00 27.74 ? 317  ASN A CA  1 
ATOM   2263 C  C   . ASN A 1 295 ? 15.057 48.701 30.353  1.00 27.87 ? 317  ASN A C   1 
ATOM   2264 O  O   . ASN A 1 295 ? 15.014 47.728 31.088  1.00 28.23 ? 317  ASN A O   1 
ATOM   2265 C  CB  . ASN A 1 295 ? 15.379 47.237 28.341  1.00 27.28 ? 317  ASN A CB  1 
ATOM   2266 C  CG  . ASN A 1 295 ? 13.926 47.245 27.929  1.00 29.32 ? 317  ASN A CG  1 
ATOM   2267 O  OD1 . ASN A 1 295 ? 13.121 48.007 28.463  1.00 27.57 ? 317  ASN A OD1 1 
ATOM   2268 N  ND2 . ASN A 1 295 ? 13.580 46.401 26.947  1.00 31.59 ? 317  ASN A ND2 1 
ATOM   2269 N  N   . PRO A 1 296 ? 14.447 49.894 30.646  1.00 28.77 ? 318  PRO A N   1 
ATOM   2270 C  CA  . PRO A 1 296 ? 13.727 50.027 31.969  1.00 29.64 ? 318  PRO A CA  1 
ATOM   2271 C  C   . PRO A 1 296 ? 12.575 49.044 32.288  1.00 29.85 ? 318  PRO A C   1 
ATOM   2272 O  O   . PRO A 1 296 ? 12.224 48.885 33.463  1.00 28.52 ? 318  PRO A O   1 
ATOM   2273 C  CB  . PRO A 1 296 ? 13.230 51.469 31.978  1.00 28.81 ? 318  PRO A CB  1 
ATOM   2274 C  CG  . PRO A 1 296 ? 14.119 52.203 30.944  1.00 29.62 ? 318  PRO A CG  1 
ATOM   2275 C  CD  . PRO A 1 296 ? 14.406 51.165 29.886  1.00 29.17 ? 318  PRO A CD  1 
ATOM   2276 N  N   . LEU A 1 297 ? 12.051 48.363 31.260  1.00 31.54 ? 319  LEU A N   1 
ATOM   2277 C  CA  . LEU A 1 297 ? 10.957 47.402 31.414  1.00 33.36 ? 319  LEU A CA  1 
ATOM   2278 C  C   . LEU A 1 297 ? 11.433 46.099 32.052  1.00 34.64 ? 319  LEU A C   1 
ATOM   2279 O  O   . LEU A 1 297 ? 10.631 45.329 32.564  1.00 35.89 ? 319  LEU A O   1 
ATOM   2280 C  CB  . LEU A 1 297 ? 10.295 47.112 30.049  1.00 32.73 ? 319  LEU A CB  1 
ATOM   2281 C  CG  . LEU A 1 297 ? 9.685  48.349 29.401  1.00 32.68 ? 319  LEU A CG  1 
ATOM   2282 C  CD1 . LEU A 1 297 ? 9.019  47.989 28.117  1.00 33.88 ? 319  LEU A CD1 1 
ATOM   2283 C  CD2 . LEU A 1 297 ? 8.701  48.993 30.376  1.00 33.68 ? 319  LEU A CD2 1 
ATOM   2284 N  N   . ASP A 1 298 ? 12.743 45.870 31.997  1.00 36.65 ? 320  ASP A N   1 
ATOM   2285 C  CA  . ASP A 1 298 ? 13.421 44.764 32.688  1.00 37.70 ? 320  ASP A CA  1 
ATOM   2286 C  C   . ASP A 1 298 ? 13.421 44.961 34.203  1.00 38.21 ? 320  ASP A C   1 
ATOM   2287 O  O   . ASP A 1 298 ? 13.777 44.045 34.947  1.00 38.14 ? 320  ASP A O   1 
ATOM   2288 C  CB  . ASP A 1 298 ? 14.898 44.732 32.253  1.00 38.21 ? 320  ASP A CB  1 
ATOM   2289 C  CG  . ASP A 1 298 ? 15.129 44.109 30.898  1.00 38.54 ? 320  ASP A CG  1 
ATOM   2290 O  OD1 . ASP A 1 298 ? 14.200 43.848 30.095  1.00 42.78 ? 320  ASP A OD1 1 
ATOM   2291 O  OD2 . ASP A 1 298 ? 16.311 43.880 30.629  1.00 41.77 ? 320  ASP A OD2 1 
ATOM   2292 N  N   . ASN A 1 299 ? 13.030 46.155 34.656  1.00 38.91 ? 321  ASN A N   1 
ATOM   2293 C  CA  . ASN A 1 299 ? 13.277 46.607 36.032  1.00 39.21 ? 321  ASN A CA  1 
ATOM   2294 C  C   . ASN A 1 299 ? 12.172 47.545 36.551  1.00 39.60 ? 321  ASN A C   1 
ATOM   2295 O  O   . ASN A 1 299 ? 12.450 48.581 37.173  1.00 38.40 ? 321  ASN A O   1 
ATOM   2296 C  CB  . ASN A 1 299 ? 14.632 47.312 36.053  1.00 39.76 ? 321  ASN A CB  1 
ATOM   2297 C  CG  . ASN A 1 299 ? 15.171 47.501 37.442  1.00 40.34 ? 321  ASN A CG  1 
ATOM   2298 O  OD1 . ASN A 1 299 ? 14.925 46.683 38.341  1.00 44.73 ? 321  ASN A OD1 1 
ATOM   2299 N  ND2 . ASN A 1 299 ? 15.888 48.597 37.643  1.00 40.13 ? 321  ASN A ND2 1 
ATOM   2300 N  N   . MET A 1 300 ? 10.921 47.164 36.295  1.00 39.81 ? 322  MET A N   1 
ATOM   2301 C  CA  . MET A 1 300 ? 9.789  48.097 36.404  1.00 41.17 ? 322  MET A CA  1 
ATOM   2302 C  C   . MET A 1 300 ? 9.466  48.544 37.800  1.00 40.67 ? 322  MET A C   1 
ATOM   2303 O  O   . MET A 1 300 ? 9.092  49.707 37.990  1.00 39.71 ? 322  MET A O   1 
ATOM   2304 C  CB  . MET A 1 300 ? 8.541  47.571 35.692  1.00 40.87 ? 322  MET A CB  1 
ATOM   2305 C  CG  . MET A 1 300 ? 8.600  47.929 34.235  1.00 42.76 ? 322  MET A CG  1 
ATOM   2306 S  SD  . MET A 1 300 ? 7.152  47.453 33.322  1.00 44.82 ? 322  MET A SD  1 
ATOM   2307 C  CE  . MET A 1 300 ? 5.920  48.548 33.984  1.00 43.42 ? 322  MET A CE  1 
ATOM   2308 N  N   . ASP A 1 301 ? 9.683  47.653 38.778  1.00 41.07 ? 323  ASP A N   1 
ATOM   2309 C  CA  . ASP A 1 301 ? 9.439  48.024 40.178  1.00 41.10 ? 323  ASP A CA  1 
ATOM   2310 C  C   . ASP A 1 301 ? 10.228 49.271 40.508  1.00 40.65 ? 323  ASP A C   1 
ATOM   2311 O  O   . ASP A 1 301 ? 9.662  50.218 41.042  1.00 40.59 ? 323  ASP A O   1 
ATOM   2312 C  CB  . ASP A 1 301 ? 9.729  46.870 41.175  1.00 41.80 ? 323  ASP A CB  1 
ATOM   2313 C  CG  . ASP A 1 301 ? 9.044  47.086 42.553  1.00 43.91 ? 323  ASP A CG  1 
ATOM   2314 O  OD1 . ASP A 1 301 ? 9.637  47.762 43.430  1.00 45.30 ? 323  ASP A OD1 1 
ATOM   2315 O  OD2 . ASP A 1 301 ? 7.915  46.561 42.763  1.00 45.65 ? 323  ASP A OD2 1 
ATOM   2316 N  N   . LYS A 1 302 ? 11.516 49.296 40.142  1.00 40.09 ? 324  LYS A N   1 
ATOM   2317 C  CA  . LYS A 1 302 ? 12.392 50.441 40.421  1.00 39.41 ? 324  LYS A CA  1 
ATOM   2318 C  C   . LYS A 1 302 ? 12.240 51.555 39.371  1.00 38.49 ? 324  LYS A C   1 
ATOM   2319 O  O   . LYS A 1 302 ? 12.254 52.729 39.708  1.00 37.90 ? 324  LYS A O   1 
ATOM   2320 C  CB  . LYS A 1 302 ? 13.874 49.999 40.523  1.00 40.09 ? 324  LYS A CB  1 
ATOM   2321 C  CG  . LYS A 1 302 ? 14.124 48.764 41.434  1.00 41.68 ? 324  LYS A CG  1 
ATOM   2322 C  CD  . LYS A 1 302 ? 13.649 49.005 42.872  1.00 45.50 ? 324  LYS A CD  1 
ATOM   2323 C  CE  . LYS A 1 302 ? 14.802 49.265 43.854  1.00 46.67 ? 324  LYS A CE  1 
ATOM   2324 N  NZ  . LYS A 1 302 ? 14.382 50.135 45.016  1.00 46.63 ? 324  LYS A NZ  1 
ATOM   2325 N  N   . SER A 1 303 ? 12.085 51.174 38.102  1.00 37.43 ? 325  SER A N   1 
ATOM   2326 C  CA  . SER A 1 303 ? 12.077 52.179 37.014  1.00 36.37 ? 325  SER A CA  1 
ATOM   2327 C  C   . SER A 1 303 ? 10.739 52.904 36.832  1.00 35.51 ? 325  SER A C   1 
ATOM   2328 O  O   . SER A 1 303 ? 10.737 54.055 36.399  1.00 35.44 ? 325  SER A O   1 
ATOM   2329 C  CB  . SER A 1 303 ? 12.496 51.560 35.680  1.00 35.92 ? 325  SER A CB  1 
ATOM   2330 O  OG  . SER A 1 303 ? 13.830 51.032 35.724  1.00 39.15 ? 325  SER A OG  1 
ATOM   2331 N  N   . CYS A 1 304 ? 9.623  52.232 37.142  1.00 34.99 ? 326  CYS A N   1 
ATOM   2332 C  CA  . CYS A 1 304 ? 8.301  52.796 36.900  1.00 34.62 ? 326  CYS A CA  1 
ATOM   2333 C  C   . CYS A 1 304 ? 7.471  52.995 38.157  1.00 36.23 ? 326  CYS A C   1 
ATOM   2334 O  O   . CYS A 1 304 ? 6.832  54.023 38.321  1.00 36.94 ? 326  CYS A O   1 
ATOM   2335 C  CB  . CYS A 1 304 ? 7.510  51.925 35.923  1.00 34.81 ? 326  CYS A CB  1 
ATOM   2336 S  SG  . CYS A 1 304 ? 8.431  51.617 34.431  1.00 30.53 ? 326  CYS A SG  1 
ATOM   2337 N  N   . MET A 1 305 ? 7.491  52.015 39.045  1.00 38.65 ? 327  MET A N   1 
ATOM   2338 C  CA  . MET A 1 305 ? 6.459  51.946 40.086  1.00 40.56 ? 327  MET A CA  1 
ATOM   2339 C  C   . MET A 1 305 ? 6.605  52.869 41.314  1.00 41.50 ? 327  MET A C   1 
ATOM   2340 O  O   . MET A 1 305 ? 5.900  52.682 42.289  1.00 42.28 ? 327  MET A O   1 
ATOM   2341 C  CB  . MET A 1 305 ? 6.207  50.485 40.452  1.00 41.10 ? 327  MET A CB  1 
ATOM   2342 C  CG  . MET A 1 305 ? 5.949  49.580 39.247  1.00 41.72 ? 327  MET A CG  1 
ATOM   2343 S  SD  . MET A 1 305 ? 4.694  50.260 38.122  1.00 49.29 ? 327  MET A SD  1 
ATOM   2344 C  CE  . MET A 1 305 ? 4.429  48.865 37.096  1.00 43.04 ? 327  MET A CE  1 
ATOM   2345 N  N   . ASN A 1 306 ? 7.473  53.883 41.242  1.00 42.05 ? 328  ASN A N   1 
ATOM   2346 C  CA  . ASN A 1 306 ? 7.499  55.005 42.209  1.00 42.90 ? 328  ASN A CA  1 
ATOM   2347 C  C   . ASN A 1 306 ? 6.442  56.056 41.937  1.00 43.09 ? 328  ASN A C   1 
ATOM   2348 O  O   . ASN A 1 306 ? 6.062  56.835 42.843  1.00 43.14 ? 328  ASN A O   1 
ATOM   2349 C  CB  . ASN A 1 306 ? 8.792  55.795 42.069  1.00 43.92 ? 328  ASN A CB  1 
ATOM   2350 C  CG  . ASN A 1 306 ? 9.895  55.290 42.920  1.00 45.10 ? 328  ASN A CG  1 
ATOM   2351 O  OD1 . ASN A 1 306 ? 10.863 56.019 43.143  1.00 47.44 ? 328  ASN A OD1 1 
ATOM   2352 N  ND2 . ASN A 1 306 ? 9.803  54.037 43.377  1.00 46.29 ? 328  ASN A ND2 1 
ATOM   2353 N  N   . CYS A 1 307 ? 6.047  56.126 40.663  1.00 41.98 ? 329  CYS A N   1 
ATOM   2354 C  CA  . CYS A 1 307 ? 5.177  57.168 40.131  1.00 42.07 ? 329  CYS A CA  1 
ATOM   2355 C  C   . CYS A 1 307 ? 3.933  56.574 39.491  1.00 42.64 ? 329  CYS A C   1 
ATOM   2356 O  O   . CYS A 1 307 ? 3.017  57.309 39.110  1.00 43.40 ? 329  CYS A O   1 
ATOM   2357 C  CB  . CYS A 1 307 ? 5.905  57.966 39.047  1.00 42.19 ? 329  CYS A CB  1 
ATOM   2358 S  SG  . CYS A 1 307 ? 7.569  58.595 39.471  1.00 37.51 ? 329  CYS A SG  1 
ATOM   2359 N  N   . HIS A 1 308 ? 3.918  55.258 39.321  1.00 42.69 ? 330  HIS A N   1 
ATOM   2360 C  CA  . HIS A 1 308 ? 2.760  54.591 38.750  1.00 43.86 ? 330  HIS A CA  1 
ATOM   2361 C  C   . HIS A 1 308 ? 2.207  53.610 39.754  1.00 44.84 ? 330  HIS A C   1 
ATOM   2362 O  O   . HIS A 1 308 ? 2.948  52.797 40.295  1.00 45.41 ? 330  HIS A O   1 
ATOM   2363 C  CB  . HIS A 1 308 ? 3.104  53.876 37.418  1.00 42.92 ? 330  HIS A CB  1 
ATOM   2364 C  CG  . HIS A 1 308 ? 3.429  54.817 36.300  1.00 40.58 ? 330  HIS A CG  1 
ATOM   2365 N  ND1 . HIS A 1 308 ? 2.459  55.485 35.587  1.00 40.38 ? 330  HIS A ND1 1 
ATOM   2366 C  CD2 . HIS A 1 308 ? 4.618  55.224 35.788  1.00 41.48 ? 330  HIS A CD2 1 
ATOM   2367 C  CE1 . HIS A 1 308 ? 3.032  56.256 34.678  1.00 40.06 ? 330  HIS A CE1 1 
ATOM   2368 N  NE2 . HIS A 1 308 ? 4.343  56.121 34.781  1.00 41.18 ? 330  HIS A NE2 1 
ATOM   2369 N  N   . ARG A 1 309 ? 0.908  53.713 40.016  1.00 46.73 ? 331  ARG A N   1 
ATOM   2370 C  CA  . ARG A 1 309 ? 0.177  52.666 40.732  1.00 48.36 ? 331  ARG A CA  1 
ATOM   2371 C  C   . ARG A 1 309 ? -0.287 51.710 39.643  1.00 49.58 ? 331  ARG A C   1 
ATOM   2372 O  O   . ARG A 1 309 ? -0.121 52.007 38.454  1.00 50.67 ? 331  ARG A O   1 
ATOM   2373 C  CB  . ARG A 1 309 ? -0.954 52.831 41.205  0.00 49.90 ? 331  ARG A CB  1 
ATOM   2374 C  CG  . ARG A 1 309 ? -0.721 54.059 42.029  0.00 46.02 ? 331  ARG A CG  1 
ATOM   2375 C  CD  . ARG A 1 309 ? -1.903 54.303 42.969  0.00 40.95 ? 331  ARG A CD  1 
ATOM   2376 N  NE  . ARG A 1 309 ? -1.869 55.602 43.612  0.00 36.66 ? 331  ARG A NE  1 
ATOM   2377 C  CZ  . ARG A 1 309 ? -0.797 56.130 44.173  0.00 34.38 ? 331  ARG A CZ  1 
ATOM   2378 N  NH1 . ARG A 1 309 ? 0.357  55.469 44.175  0.00 32.96 ? 331  ARG A NH1 1 
ATOM   2379 N  NH2 . ARG A 1 309 ? -0.872 57.306 44.758  0.00 32.96 ? 331  ARG A NH2 1 
ATOM   2380 N  N   . GLU A 1 310 ? -0.860 50.579 40.037  1.00 50.04 ? 332  GLU A N   1 
ATOM   2381 C  CA  . GLU A 1 310 ? -1.371 49.550 39.107  1.00 50.77 ? 332  GLU A CA  1 
ATOM   2382 C  C   . GLU A 1 310 ? -0.292 48.693 38.483  1.00 49.60 ? 332  GLU A C   1 
ATOM   2383 O  O   . GLU A 1 310 ? 0.894  49.003 38.579  1.00 50.37 ? 332  GLU A O   1 
ATOM   2384 C  CB  . GLU A 1 310 ? -2.328 50.103 38.007  1.00 51.70 ? 332  GLU A CB  1 
ATOM   2385 C  CG  . GLU A 1 310 ? -1.735 51.127 36.990  1.00 53.74 ? 332  GLU A CG  1 
ATOM   2386 C  CD  . GLU A 1 310 ? -0.786 50.536 35.940  1.00 55.58 ? 332  GLU A CD  1 
ATOM   2387 O  OE1 . GLU A 1 310 ? 0.105  51.265 35.485  1.00 57.58 ? 332  GLU A OE1 1 
ATOM   2388 O  OE2 . GLU A 1 310 ? -0.923 49.366 35.548  1.00 58.19 ? 332  GLU A OE2 1 
ATOM   2389 N  N   . SER A 1 311 ? -0.731 47.642 37.797  1.00 48.16 ? 333  SER A N   1 
ATOM   2390 C  CA  . SER A 1 311 ? 0.156  46.555 37.419  1.00 46.22 ? 333  SER A CA  1 
ATOM   2391 C  C   . SER A 1 311 ? 1.314  46.927 36.513  1.00 45.20 ? 333  SER A C   1 
ATOM   2392 O  O   . SER A 1 311 ? 1.236  47.845 35.683  1.00 43.82 ? 333  SER A O   1 
ATOM   2393 C  CB  . SER A 1 311 ? -0.613 45.362 36.816  1.00 46.27 ? 333  SER A CB  1 
ATOM   2394 O  OG  . SER A 1 311 ? -1.389 45.733 35.706  1.00 45.52 ? 333  SER A OG  1 
ATOM   2395 N  N   . GLU A 1 312 ? 2.390  46.169 36.704  1.00 44.47 ? 334  GLU A N   1 
ATOM   2396 C  CA  . GLU A 1 312 ? 3.494  46.152 35.789  1.00 43.53 ? 334  GLU A CA  1 
ATOM   2397 C  C   . GLU A 1 312 ? 2.987  45.736 34.427  1.00 43.41 ? 334  GLU A C   1 
ATOM   2398 O  O   . GLU A 1 312 ? 3.298  46.382 33.414  1.00 42.65 ? 334  GLU A O   1 
ATOM   2399 C  CB  . GLU A 1 312 ? 4.530  45.155 36.269  1.00 43.85 ? 334  GLU A CB  1 
ATOM   2400 C  CG  . GLU A 1 312 ? 5.285  45.592 37.541  1.00 44.62 ? 334  GLU A CG  1 
ATOM   2401 C  CD  . GLU A 1 312 ? 6.530  44.734 37.773  1.00 43.56 ? 334  GLU A CD  1 
ATOM   2402 O  OE1 . GLU A 1 312 ? 6.791  43.859 36.921  1.00 44.79 ? 334  GLU A OE1 1 
ATOM   2403 O  OE2 . GLU A 1 312 ? 7.236  44.930 38.785  1.00 43.76 ? 334  GLU A OE2 1 
ATOM   2404 N  N   . GLN A 1 313 ? 2.173  44.677 34.435  1.00 42.51 ? 335  GLN A N   1 
ATOM   2405 C  CA  . GLN A 1 313 ? 1.719  44.021 33.224  1.00 42.42 ? 335  GLN A CA  1 
ATOM   2406 C  C   . GLN A 1 313 ? 0.887  44.932 32.334  1.00 41.23 ? 335  GLN A C   1 
ATOM   2407 O  O   . GLN A 1 313 ? 1.166  45.053 31.126  1.00 41.80 ? 335  GLN A O   1 
ATOM   2408 C  CB  . GLN A 1 313 ? 0.986  42.710 33.541  1.00 42.81 ? 335  GLN A CB  1 
ATOM   2409 C  CG  . GLN A 1 313 ? 0.945  41.730 32.354  1.00 45.15 ? 335  GLN A CG  1 
ATOM   2410 C  CD  . GLN A 1 313 ? 2.189  41.809 31.507  1.00 47.46 ? 335  GLN A CD  1 
ATOM   2411 O  OE1 . GLN A 1 313 ? 3.235  41.308 31.893  1.00 50.66 ? 335  GLN A OE1 1 
ATOM   2412 N  NE2 . GLN A 1 313 ? 2.091  42.479 30.358  1.00 48.54 ? 335  GLN A NE2 1 
ATOM   2413 N  N   . LYS A 1 314 ? -0.103 45.602 32.911  1.00 39.53 ? 336  LYS A N   1 
ATOM   2414 C  CA  . LYS A 1 314 ? -0.887 46.553 32.143  1.00 38.70 ? 336  LYS A CA  1 
ATOM   2415 C  C   . LYS A 1 314 ? 0.033  47.604 31.529  1.00 38.35 ? 336  LYS A C   1 
ATOM   2416 O  O   . LYS A 1 314 ? -0.081 47.927 30.348  1.00 37.77 ? 336  LYS A O   1 
ATOM   2417 C  CB  . LYS A 1 314 ? -1.959 47.214 33.006  1.00 38.96 ? 336  LYS A CB  1 
ATOM   2418 C  CG  . LYS A 1 314 ? -2.593 45.865 33.337  0.00 35.22 ? 336  LYS A CG  1 
ATOM   2419 C  CD  . LYS A 1 314 ? -3.638 46.450 34.272  0.00 34.59 ? 336  LYS A CD  1 
ATOM   2420 C  CE  . LYS A 1 314 ? -4.734 45.444 34.568  0.00 34.14 ? 336  LYS A CE  1 
ATOM   2421 N  NZ  . LYS A 1 314 ? -4.201 44.213 35.209  0.00 33.68 ? 336  LYS A NZ  1 
ATOM   2422 N  N   . LEU A 1 315 ? 0.957  48.126 32.329  1.00 37.74 ? 337  LEU A N   1 
ATOM   2423 C  CA  . LEU A 1 315 ? 1.923  49.115 31.839  1.00 37.14 ? 337  LEU A CA  1 
ATOM   2424 C  C   . LEU A 1 315 ? 2.885  48.608 30.731  1.00 37.28 ? 337  LEU A C   1 
ATOM   2425 O  O   . LEU A 1 315 ? 3.165  49.335 29.750  1.00 36.54 ? 337  LEU A O   1 
ATOM   2426 C  CB  . LEU A 1 315 ? 2.684  49.685 33.030  1.00 37.67 ? 337  LEU A CB  1 
ATOM   2427 C  CG  . LEU A 1 315 ? 3.112  51.149 33.017  1.00 38.59 ? 337  LEU A CG  1 
ATOM   2428 C  CD1 . LEU A 1 315 ? 1.954  52.113 32.841  1.00 41.24 ? 337  LEU A CD1 1 
ATOM   2429 C  CD2 . LEU A 1 315 ? 3.921  51.487 34.277  1.00 36.98 ? 337  LEU A CD2 1 
ATOM   2430 N  N   . LYS A 1 316 ? 3.392  47.383 30.864  1.00 36.43 ? 338  LYS A N   1 
ATOM   2431 C  CA  . LYS A 1 316 ? 4.156  46.766 29.781  1.00 36.77 ? 338  LYS A CA  1 
ATOM   2432 C  C   . LYS A 1 316 ? 3.302  46.621 28.512  1.00 37.00 ? 338  LYS A C   1 
ATOM   2433 O  O   . LYS A 1 316 ? 3.778  46.891 27.401  1.00 38.02 ? 338  LYS A O   1 
ATOM   2434 C  CB  . LYS A 1 316 ? 4.642  45.396 30.192  1.00 37.39 ? 338  LYS A CB  1 
ATOM   2435 C  CG  . LYS A 1 316 ? 6.103  45.314 30.619  1.00 39.21 ? 338  LYS A CG  1 
ATOM   2436 C  CD  . LYS A 1 316 ? 6.382  44.002 31.314  1.00 41.71 ? 338  LYS A CD  1 
ATOM   2437 C  CE  . LYS A 1 316 ? 7.876  43.633 31.195  1.00 44.30 ? 338  LYS A CE  1 
ATOM   2438 N  NZ  . LYS A 1 316 ? 8.130  42.389 31.996  1.00 45.78 ? 338  LYS A NZ  1 
ATOM   2439 N  N   . ASP A 1 317 ? 2.050  46.196 28.671  1.00 36.26 ? 339  ASP A N   1 
ATOM   2440 C  CA  . ASP A 1 317 ? 1.116  46.059 27.522  1.00 35.67 ? 339  ASP A CA  1 
ATOM   2441 C  C   . ASP A 1 317 ? 0.822  47.401 26.824  1.00 35.11 ? 339  ASP A C   1 
ATOM   2442 O  O   . ASP A 1 317 ? 0.666  47.447 25.607  1.00 33.00 ? 339  ASP A O   1 
ATOM   2443 C  CB  . ASP A 1 317 ? -0.208 45.398 27.964  1.00 36.43 ? 339  ASP A CB  1 
ATOM   2444 C  CG  . ASP A 1 317 ? -0.046 43.947 28.401  1.00 37.90 ? 339  ASP A CG  1 
ATOM   2445 O  OD1 . ASP A 1 317 ? 0.939  43.270 28.039  1.00 39.66 ? 339  ASP A OD1 1 
ATOM   2446 O  OD2 . ASP A 1 317 ? -0.946 43.462 29.119  1.00 43.38 ? 339  ASP A OD2 1 
ATOM   2447 N  N   . ILE A 1 318 ? 0.720  48.482 27.592  1.00 34.64 ? 340  ILE A N   1 
ATOM   2448 C  CA  . ILE A 1 318 ? 0.498  49.823 27.044  1.00 35.59 ? 340  ILE A CA  1 
ATOM   2449 C  C   . ILE A 1 318 ? 1.705  50.272 26.170  1.00 34.44 ? 340  ILE A C   1 
ATOM   2450 O  O   . ILE A 1 318 ? 1.548  50.948 25.151  1.00 34.11 ? 340  ILE A O   1 
ATOM   2451 C  CB  . ILE A 1 318 ? 0.163  50.848 28.175  1.00 35.79 ? 340  ILE A CB  1 
ATOM   2452 C  CG1 . ILE A 1 318 ? -1.250 50.581 28.733  1.00 36.69 ? 340  ILE A CG1 1 
ATOM   2453 C  CG2 . ILE A 1 318 ? 0.186  52.287 27.651  1.00 36.20 ? 340  ILE A CG2 1 
ATOM   2454 C  CD1 . ILE A 1 318 ? -1.479 51.011 30.237  1.00 37.30 ? 340  ILE A CD1 1 
ATOM   2455 N  N   . VAL A 1 319 ? 2.900  49.853 26.548  1.00 33.40 ? 341  VAL A N   1 
ATOM   2456 C  CA  . VAL A 1 319 ? 4.107  50.219 25.808  1.00 32.55 ? 341  VAL A CA  1 
ATOM   2457 C  C   . VAL A 1 319 ? 4.222  49.411 24.526  1.00 32.58 ? 341  VAL A C   1 
ATOM   2458 O  O   . VAL A 1 319 ? 4.607  49.950 23.457  1.00 30.72 ? 341  VAL A O   1 
ATOM   2459 C  CB  . VAL A 1 319 ? 5.390  50.159 26.697  1.00 32.47 ? 341  VAL A CB  1 
ATOM   2460 C  CG1 . VAL A 1 319 ? 6.661  50.462 25.864  1.00 33.67 ? 341  VAL A CG1 1 
ATOM   2461 C  CG2 . VAL A 1 319 ? 5.224  51.145 27.904  1.00 33.44 ? 341  VAL A CG2 1 
ATOM   2462 N  N   . LYS A 1 320 ? 3.860  48.124 24.623  1.00 32.42 ? 342  LYS A N   1 
ATOM   2463 C  CA  . LYS A 1 320 ? 3.792  47.269 23.482  1.00 32.90 ? 342  LYS A CA  1 
ATOM   2464 C  C   . LYS A 1 320 ? 2.858  47.871 22.437  1.00 32.10 ? 342  LYS A C   1 
ATOM   2465 O  O   . LYS A 1 320 ? 3.143  47.831 21.234  1.00 31.85 ? 342  LYS A O   1 
ATOM   2466 C  CB  . LYS A 1 320 ? 3.298  45.868 23.902  1.00 33.33 ? 342  LYS A CB  1 
ATOM   2467 C  CG  . LYS A 1 320 ? 3.032  44.914 22.716  1.00 34.27 ? 342  LYS A CG  1 
ATOM   2468 C  CD  . LYS A 1 320 ? 2.504  43.568 23.197  1.00 34.31 ? 342  LYS A CD  1 
ATOM   2469 C  CE  . LYS A 1 320 ? 2.908  42.681 22.001  0.00 39.58 ? 342  LYS A CE  1 
ATOM   2470 N  NZ  . LYS A 1 320 ? 2.035  43.125 20.878  0.00 40.78 ? 342  LYS A NZ  1 
ATOM   2471 N  N   . GLN A 1 321 ? 1.730  48.406 22.895  1.00 30.30 ? 343  GLN A N   1 
ATOM   2472 C  CA  . GLN A 1 321 ? 0.737  48.969 21.969  1.00 29.67 ? 343  GLN A CA  1 
ATOM   2473 C  C   . GLN A 1 321 ? 1.316  50.190 21.258  1.00 26.61 ? 343  GLN A C   1 
ATOM   2474 O  O   . GLN A 1 321 ? 1.146  50.356 20.045  1.00 24.78 ? 343  GLN A O   1 
ATOM   2475 C  CB  . GLN A 1 321 ? -0.549 49.326 22.717  1.00 29.45 ? 343  GLN A CB  1 
ATOM   2476 C  CG  . GLN A 1 321 ? -1.331 48.100 23.200  1.00 32.08 ? 343  GLN A CG  1 
ATOM   2477 C  CD  . GLN A 1 321 ? -2.509 48.449 24.135  1.00 33.81 ? 343  GLN A CD  1 
ATOM   2478 O  OE1 . GLN A 1 321 ? -3.470 49.112 23.731  1.00 40.20 ? 343  GLN A OE1 1 
ATOM   2479 N  NE2 . GLN A 1 321 ? -2.416 48.008 25.395  1.00 39.80 ? 343  GLN A NE2 1 
ATOM   2480 N  N   . LYS A 1 322 ? 2.013  51.042 22.004  1.00 25.59 ? 344  LYS A N   1 
ATOM   2481 C  CA  . LYS A 1 322 ? 2.729  52.176 21.396  1.00 23.92 ? 344  LYS A CA  1 
ATOM   2482 C  C   . LYS A 1 322 ? 3.729  51.700 20.356  1.00 23.45 ? 344  LYS A C   1 
ATOM   2483 O  O   . LYS A 1 322 ? 3.825  52.280 19.264  1.00 24.01 ? 344  LYS A O   1 
ATOM   2484 C  CB  . LYS A 1 322 ? 3.459  53.014 22.457  1.00 23.33 ? 344  LYS A CB  1 
ATOM   2485 C  CG  . LYS A 1 322 ? 2.535  53.524 23.562  1.00 21.65 ? 344  LYS A CG  1 
ATOM   2486 C  CD  . LYS A 1 322 ? 3.374  54.499 24.433  1.00 21.80 ? 344  LYS A CD  1 
ATOM   2487 C  CE  . LYS A 1 322 ? 2.549  55.120 25.565  1.00 21.55 ? 344  LYS A CE  1 
ATOM   2488 N  NZ  . LYS A 1 322 ? 1.319  55.894 25.145  1.00 24.50 ? 344  LYS A NZ  1 
ATOM   2489 N  N   . PHE A 1 323 ? 4.490  50.660 20.697  1.00 22.39 ? 345  PHE A N   1 
ATOM   2490 C  CA  . PHE A 1 323 ? 5.470  50.150 19.766  1.00 22.92 ? 345  PHE A CA  1 
ATOM   2491 C  C   . PHE A 1 323 ? 4.785  49.720 18.457  1.00 23.61 ? 345  PHE A C   1 
ATOM   2492 O  O   . PHE A 1 323 ? 5.259  50.051 17.333  1.00 22.86 ? 345  PHE A O   1 
ATOM   2493 C  CB  . PHE A 1 323 ? 6.266  48.979 20.360  1.00 23.99 ? 345  PHE A CB  1 
ATOM   2494 C  CG  . PHE A 1 323 ? 7.394  48.554 19.461  1.00 23.72 ? 345  PHE A CG  1 
ATOM   2495 C  CD1 . PHE A 1 323 ? 8.582  49.301 19.414  1.00 26.43 ? 345  PHE A CD1 1 
ATOM   2496 C  CD2 . PHE A 1 323 ? 7.258  47.474 18.625  1.00 26.93 ? 345  PHE A CD2 1 
ATOM   2497 C  CE1 . PHE A 1 323 ? 9.636  48.939 18.564  1.00 26.44 ? 345  PHE A CE1 1 
ATOM   2498 C  CE2 . PHE A 1 323 ? 8.344  47.080 17.795  1.00 22.60 ? 345  PHE A CE2 1 
ATOM   2499 C  CZ  . PHE A 1 323 ? 9.487  47.842 17.726  1.00 25.00 ? 345  PHE A CZ  1 
ATOM   2500 N  N   A GLU A 1 324 ? 3.681  49.003 18.575  0.50 23.09 ? 346  GLU A N   1 
ATOM   2501 N  N   B GLU A 1 324 ? 3.685  48.977 18.606  0.50 23.22 ? 346  GLU A N   1 
ATOM   2502 C  CA  A GLU A 1 324 ? 3.006  48.506 17.380  0.50 24.65 ? 346  GLU A CA  1 
ATOM   2503 C  CA  B GLU A 1 324 ? 2.861  48.483 17.482  0.50 25.09 ? 346  GLU A CA  1 
ATOM   2504 C  C   A GLU A 1 324 ? 2.365  49.625 16.540  0.50 24.48 ? 346  GLU A C   1 
ATOM   2505 C  C   B GLU A 1 324 ? 2.413  49.633 16.578  0.50 24.63 ? 346  GLU A C   1 
ATOM   2506 O  O   A GLU A 1 324 ? 2.381  49.544 15.332  0.50 25.22 ? 346  GLU A O   1 
ATOM   2507 O  O   B GLU A 1 324 ? 2.593  49.577 15.382  0.50 25.22 ? 346  GLU A O   1 
ATOM   2508 C  CB  A GLU A 1 324 ? 2.058  47.352 17.710  0.50 24.40 ? 346  GLU A CB  1 
ATOM   2509 C  CB  B GLU A 1 324 ? 1.638  47.681 17.979  0.50 24.32 ? 346  GLU A CB  1 
ATOM   2510 C  CG  A GLU A 1 324 ? 2.815  46.101 18.284  0.50 26.26 ? 346  GLU A CG  1 
ATOM   2511 C  CG  B GLU A 1 324 ? 1.977  46.293 18.580  0.50 26.51 ? 346  GLU A CG  1 
ATOM   2512 C  CD  A GLU A 1 324 ? 3.825  45.497 17.287  0.50 29.69 ? 346  GLU A CD  1 
ATOM   2513 C  CD  B GLU A 1 324 ? 0.802  45.599 19.289  0.50 26.92 ? 346  GLU A CD  1 
ATOM   2514 O  OE1 A GLU A 1 324 ? 3.441  45.248 16.125  0.50 34.87 ? 346  GLU A OE1 1 
ATOM   2515 O  OE1 B GLU A 1 324 ? -0.361 46.072 19.210  0.50 30.58 ? 346  GLU A OE1 1 
ATOM   2516 O  OE2 A GLU A 1 324 ? 5.013  45.299 17.651  0.50 31.36 ? 346  GLU A OE2 1 
ATOM   2517 O  OE2 B GLU A 1 324 ? 1.059  44.564 19.942  0.50 29.23 ? 346  GLU A OE2 1 
ATOM   2518 N  N   . ARG A 1 325 ? 1.868  50.688 17.165  1.00 25.62 ? 347  ARG A N   1 
ATOM   2519 C  CA  . ARG A 1 325 ? 1.403  51.860 16.393  1.00 26.55 ? 347  ARG A CA  1 
ATOM   2520 C  C   . ARG A 1 325 ? 2.560  52.498 15.639  1.00 25.00 ? 347  ARG A C   1 
ATOM   2521 O  O   . ARG A 1 325 ? 2.436  52.852 14.455  1.00 26.20 ? 347  ARG A O   1 
ATOM   2522 C  CB  . ARG A 1 325 ? 0.722  52.889 17.289  1.00 27.99 ? 347  ARG A CB  1 
ATOM   2523 C  CG  . ARG A 1 325 ? -0.645 52.403 17.850  1.00 27.01 ? 347  ARG A CG  1 
ATOM   2524 C  CD  . ARG A 1 325 ? -1.463 53.551 18.516  1.00 30.40 ? 347  ARG A CD  1 
ATOM   2525 N  NE  . ARG A 1 325 ? -0.836 53.946 19.757  1.00 38.82 ? 347  ARG A NE  1 
ATOM   2526 C  CZ  . ARG A 1 325 ? -1.205 53.546 20.965  1.00 36.15 ? 347  ARG A CZ  1 
ATOM   2527 N  NH1 . ARG A 1 325 ? -2.241 52.741 21.149  1.00 37.74 ? 347  ARG A NH1 1 
ATOM   2528 N  NH2 . ARG A 1 325 ? -0.515 53.967 21.999  1.00 38.52 ? 347  ARG A NH2 1 
ATOM   2529 N  N   . LYS A 1 326 ? 3.708  52.624 16.303  1.00 24.16 ? 348  LYS A N   1 
ATOM   2530 C  CA  . LYS A 1 326 ? 4.881  53.156 15.655  1.00 22.88 ? 348  LYS A CA  1 
ATOM   2531 C  C   . LYS A 1 326 ? 5.325  52.288 14.461  1.00 23.13 ? 348  LYS A C   1 
ATOM   2532 O  O   . LYS A 1 326 ? 5.603  52.832 13.410  1.00 21.27 ? 348  LYS A O   1 
ATOM   2533 C  CB  . LYS A 1 326 ? 6.017  53.319 16.652  1.00 23.04 ? 348  LYS A CB  1 
ATOM   2534 C  CG  . LYS A 1 326 ? 7.251  54.005 16.066  1.00 26.98 ? 348  LYS A CG  1 
ATOM   2535 C  CD  . LYS A 1 326 ? 8.116  52.991 15.334  1.00 28.70 ? 348  LYS A CD  1 
ATOM   2536 C  CE  . LYS A 1 326 ? 8.968  52.237 16.324  1.00 28.78 ? 348  LYS A CE  1 
ATOM   2537 N  NZ  . LYS A 1 326 ? 9.776  51.196 15.639  1.00 27.74 ? 348  LYS A NZ  1 
ATOM   2538 N  N   . GLU A 1 327 ? 5.398  50.961 14.635  1.00 23.66 ? 349  GLU A N   1 
ATOM   2539 C  CA  . GLU A 1 327 ? 5.715  50.065 13.537  1.00 24.36 ? 349  GLU A CA  1 
ATOM   2540 C  C   . GLU A 1 327 ? 4.811  50.247 12.342  1.00 25.07 ? 349  GLU A C   1 
ATOM   2541 O  O   . GLU A 1 327 ? 5.274  50.361 11.228  1.00 25.39 ? 349  GLU A O   1 
ATOM   2542 C  CB  . GLU A 1 327 ? 5.669  48.616 14.008  1.00 24.89 ? 349  GLU A CB  1 
ATOM   2543 C  CG  . GLU A 1 327 ? 6.759  48.284 14.951  1.00 26.14 ? 349  GLU A CG  1 
ATOM   2544 C  CD  . GLU A 1 327 ? 8.050  47.945 14.274  1.00 26.68 ? 349  GLU A CD  1 
ATOM   2545 O  OE1 . GLU A 1 327 ? 8.143  46.840 13.720  1.00 29.93 ? 349  GLU A OE1 1 
ATOM   2546 O  OE2 . GLU A 1 327 ? 8.993  48.748 14.315  1.00 28.81 ? 349  GLU A OE2 1 
ATOM   2547 N  N   . PHE A 1 328 ? 3.506  50.288 12.600  1.00 24.71 ? 350  PHE A N   1 
ATOM   2548 C  CA  . PHE A 1 328 ? 2.496  50.462 11.583  1.00 24.84 ? 350  PHE A CA  1 
ATOM   2549 C  C   . PHE A 1 328 ? 2.779  51.691 10.700  1.00 22.24 ? 350  PHE A C   1 
ATOM   2550 O  O   . PHE A 1 328 ? 2.894  51.556 9.488   1.00 22.69 ? 350  PHE A O   1 
ATOM   2551 C  CB  . PHE A 1 328 ? 1.119  50.579 12.262  1.00 24.95 ? 350  PHE A CB  1 
ATOM   2552 C  CG  . PHE A 1 328 ? 0.003  50.838 11.313  1.00 25.62 ? 350  PHE A CG  1 
ATOM   2553 C  CD1 . PHE A 1 328 ? -0.432 49.847 10.438  1.00 25.37 ? 350  PHE A CD1 1 
ATOM   2554 C  CD2 . PHE A 1 328 ? -0.622 52.097 11.290  1.00 25.74 ? 350  PHE A CD2 1 
ATOM   2555 C  CE1 . PHE A 1 328 ? -1.499 50.119 9.564   1.00 27.03 ? 350  PHE A CE1 1 
ATOM   2556 C  CE2 . PHE A 1 328 ? -1.642 52.367 10.426  1.00 28.32 ? 350  PHE A CE2 1 
ATOM   2557 C  CZ  . PHE A 1 328 ? -2.094 51.371 9.558   1.00 28.15 ? 350  PHE A CZ  1 
ATOM   2558 N  N   . LEU A 1 329 ? 2.965  52.860 11.290  1.00 21.69 ? 351  LEU A N   1 
ATOM   2559 C  CA  . LEU A 1 329 ? 3.176  54.078 10.506  1.00 22.10 ? 351  LEU A CA  1 
ATOM   2560 C  C   . LEU A 1 329 ? 4.596  54.104 9.885   1.00 21.63 ? 351  LEU A C   1 
ATOM   2561 O  O   . LEU A 1 329 ? 4.834  54.706 8.826   1.00 22.58 ? 351  LEU A O   1 
ATOM   2562 C  CB  . LEU A 1 329 ? 2.958  55.279 11.415  1.00 22.68 ? 351  LEU A CB  1 
ATOM   2563 C  CG  . LEU A 1 329 ? 1.485  55.482 11.825  1.00 23.15 ? 351  LEU A CG  1 
ATOM   2564 C  CD1 . LEU A 1 329 ? 1.359  56.881 12.421  1.00 26.30 ? 351  LEU A CD1 1 
ATOM   2565 C  CD2 . LEU A 1 329 ? 0.463  55.303 10.600  1.00 25.11 ? 351  LEU A CD2 1 
ATOM   2566 N  N   . GLN A 1 330 ? 5.527  53.458 10.572  1.00 20.67 ? 352  GLN A N   1 
ATOM   2567 C  CA  . GLN A 1 330 ? 6.919  53.378 10.125  1.00 20.88 ? 352  GLN A CA  1 
ATOM   2568 C  C   . GLN A 1 330 ? 7.028  52.631 8.808   1.00 21.43 ? 352  GLN A C   1 
ATOM   2569 O  O   . GLN A 1 330 ? 7.729  53.079 7.873   1.00 22.08 ? 352  GLN A O   1 
ATOM   2570 C  CB  . GLN A 1 330 ? 7.794  52.702 11.149  1.00 20.04 ? 352  GLN A CB  1 
ATOM   2571 C  CG  . GLN A 1 330 ? 9.189  52.338 10.570  1.00 21.17 ? 352  GLN A CG  1 
ATOM   2572 C  CD  . GLN A 1 330 ? 10.216 51.882 11.607  1.00 22.87 ? 352  GLN A CD  1 
ATOM   2573 O  OE1 . GLN A 1 330 ? 11.319 51.425 11.262  1.00 24.29 ? 352  GLN A OE1 1 
ATOM   2574 N  NE2 . GLN A 1 330 ? 9.857  52.020 12.878  1.00 21.83 ? 352  GLN A NE2 1 
ATOM   2575 N  N   . ASP A 1 331 ? 6.348  51.489 8.756   1.00 21.51 ? 353  ASP A N   1 
ATOM   2576 C  CA  . ASP A 1 331 ? 6.387  50.629 7.621   1.00 21.57 ? 353  ASP A CA  1 
ATOM   2577 C  C   . ASP A 1 331 ? 5.727  51.284 6.443   1.00 22.43 ? 353  ASP A C   1 
ATOM   2578 O  O   . ASP A 1 331 ? 6.262  51.246 5.310   1.00 24.18 ? 353  ASP A O   1 
ATOM   2579 C  CB  . ASP A 1 331 ? 5.761  49.283 8.024   1.00 20.93 ? 353  ASP A CB  1 
ATOM   2580 C  CG  . ASP A 1 331 ? 6.721  48.435 8.870   1.00 22.37 ? 353  ASP A CG  1 
ATOM   2581 O  OD1 . ASP A 1 331 ? 7.926  48.743 8.933   1.00 25.64 ? 353  ASP A OD1 1 
ATOM   2582 O  OD2 . ASP A 1 331 ? 6.279  47.446 9.463   1.00 27.09 ? 353  ASP A OD2 1 
ATOM   2583 N  N   . ILE A 1 332 ? 4.589  51.930 6.677   1.00 22.27 ? 354  ILE A N   1 
ATOM   2584 C  CA  . ILE A 1 332 ? 3.969  52.751 5.617   1.00 23.33 ? 354  ILE A CA  1 
ATOM   2585 C  C   . ILE A 1 332 ? 4.895  53.817 5.099   1.00 21.09 ? 354  ILE A C   1 
ATOM   2586 O  O   . ILE A 1 332 ? 5.146  53.859 3.883   1.00 22.76 ? 354  ILE A O   1 
ATOM   2587 C  CB  . ILE A 1 332 ? 2.612  53.385 6.066   1.00 22.05 ? 354  ILE A CB  1 
ATOM   2588 C  CG1 . ILE A 1 332 ? 1.586  52.273 6.314   1.00 25.33 ? 354  ILE A CG1 1 
ATOM   2589 C  CG2 . ILE A 1 332 ? 2.107  54.358 5.015   1.00 24.92 ? 354  ILE A CG2 1 
ATOM   2590 C  CD1 . ILE A 1 332 ? 0.303  52.743 7.110   1.00 25.40 ? 354  ILE A CD1 1 
ATOM   2591 N  N   . ALA A 1 333 ? 5.451  54.672 6.000   1.00 20.24 ? 355  ALA A N   1 
ATOM   2592 C  CA  . ALA A 1 333 ? 6.292  55.768 5.546   1.00 19.92 ? 355  ALA A CA  1 
ATOM   2593 C  C   . ALA A 1 333 ? 7.491  55.281 4.748   1.00 19.35 ? 355  ALA A C   1 
ATOM   2594 O  O   . ALA A 1 333 ? 7.794  55.859 3.705   1.00 21.06 ? 355  ALA A O   1 
ATOM   2595 C  CB  . ALA A 1 333 ? 6.785  56.672 6.715   1.00 20.32 ? 355  ALA A CB  1 
ATOM   2596 N  N   . PHE A 1 334 ? 8.211  54.292 5.273   1.00 19.70 ? 356  PHE A N   1 
ATOM   2597 C  CA  . PHE A 1 334 ? 9.400  53.847 4.573   1.00 20.04 ? 356  PHE A CA  1 
ATOM   2598 C  C   . PHE A 1 334 ? 9.122  53.073 3.314   1.00 19.56 ? 356  PHE A C   1 
ATOM   2599 O  O   . PHE A 1 334 ? 9.957  53.063 2.391   1.00 21.69 ? 356  PHE A O   1 
ATOM   2600 C  CB  . PHE A 1 334 ? 10.388 53.194 5.507   1.00 21.77 ? 356  PHE A CB  1 
ATOM   2601 C  CG  . PHE A 1 334 ? 11.162 54.190 6.303   1.00 21.92 ? 356  PHE A CG  1 
ATOM   2602 C  CD1 . PHE A 1 334 ? 12.335 54.709 5.781   1.00 22.79 ? 356  PHE A CD1 1 
ATOM   2603 C  CD2 . PHE A 1 334 ? 10.713 54.629 7.572   1.00 22.76 ? 356  PHE A CD2 1 
ATOM   2604 C  CE1 . PHE A 1 334 ? 13.097 55.655 6.503   1.00 24.72 ? 356  PHE A CE1 1 
ATOM   2605 C  CE2 . PHE A 1 334 ? 11.480 55.520 8.334   1.00 24.42 ? 356  PHE A CE2 1 
ATOM   2606 C  CZ  . PHE A 1 334 ? 12.678 56.067 7.790   1.00 22.66 ? 356  PHE A CZ  1 
ATOM   2607 N  N   . ASP A 1 335 ? 7.952  52.476 3.228   1.00 19.75 ? 357  ASP A N   1 
ATOM   2608 C  CA  . ASP A 1 335 ? 7.551  51.893 1.941   1.00 21.44 ? 357  ASP A CA  1 
ATOM   2609 C  C   . ASP A 1 335 ? 7.373  52.981 0.845   1.00 21.71 ? 357  ASP A C   1 
ATOM   2610 O  O   . ASP A 1 335 ? 7.929  52.872 -0.252  1.00 23.28 ? 357  ASP A O   1 
ATOM   2611 C  CB  . ASP A 1 335 ? 6.290  51.006 2.112   1.00 21.67 ? 357  ASP A CB  1 
ATOM   2612 C  CG  . ASP A 1 335 ? 6.056  50.076 0.936   1.00 25.40 ? 357  ASP A CG  1 
ATOM   2613 O  OD1 . ASP A 1 335 ? 6.991  49.316 0.511   1.00 27.56 ? 357  ASP A OD1 1 
ATOM   2614 O  OD2 . ASP A 1 335 ? 4.908  50.101 0.435   1.00 30.27 ? 357  ASP A OD2 1 
ATOM   2615 N  N   . ASN A 1 336 ? 6.619  54.044 1.138   1.00 24.00 ? 358  ASN A N   1 
ATOM   2616 C  CA  . ASN A 1 336 ? 6.460  55.136 0.161   1.00 23.38 ? 358  ASN A CA  1 
ATOM   2617 C  C   . ASN A 1 336 ? 7.739  55.928 -0.094  1.00 22.67 ? 358  ASN A C   1 
ATOM   2618 O  O   . ASN A 1 336 ? 8.005  56.252 -1.236  1.00 22.96 ? 358  ASN A O   1 
ATOM   2619 C  CB  . ASN A 1 336 ? 5.281  56.006 0.525   1.00 24.83 ? 358  ASN A CB  1 
ATOM   2620 C  CG  . ASN A 1 336 ? 4.003  55.247 0.480   1.00 25.23 ? 358  ASN A CG  1 
ATOM   2621 O  OD1 . ASN A 1 336 ? 3.723  54.518 -0.498  1.00 26.97 ? 358  ASN A OD1 1 
ATOM   2622 N  ND2 . ASN A 1 336 ? 3.183  55.394 1.534   1.00 27.94 ? 358  ASN A ND2 1 
ATOM   2623 N  N   . ILE A 1 337 ? 8.541  56.191 0.942   1.00 20.80 ? 359  ILE A N   1 
ATOM   2624 C  CA  . ILE A 1 337 ? 9.916  56.731 0.768   1.00 19.66 ? 359  ILE A CA  1 
ATOM   2625 C  C   . ILE A 1 337 ? 10.762 55.885 -0.213  1.00 20.96 ? 359  ILE A C   1 
ATOM   2626 O  O   . ILE A 1 337 ? 11.334 56.419 -1.172  1.00 20.03 ? 359  ILE A O   1 
ATOM   2627 C  CB  . ILE A 1 337 ? 10.646 56.910 2.124   1.00 18.62 ? 359  ILE A CB  1 
ATOM   2628 C  CG1 . ILE A 1 337 ? 9.865  57.958 2.948   1.00 20.84 ? 359  ILE A CG1 1 
ATOM   2629 C  CG2 . ILE A 1 337 ? 12.097 57.339 1.848   1.00 18.25 ? 359  ILE A CG2 1 
ATOM   2630 C  CD1 . ILE A 1 337 ? 10.310 58.130 4.448   1.00 16.04 ? 359  ILE A CD1 1 
ATOM   2631 N  N   . GLY A 1 338 ? 10.806 54.560 0.031   1.00 20.38 ? 360  GLY A N   1 
ATOM   2632 C  CA  . GLY A 1 338 ? 11.561 53.632 -0.826  1.00 19.58 ? 360  GLY A CA  1 
ATOM   2633 C  C   . GLY A 1 338 ? 11.066 53.720 -2.244  1.00 20.27 ? 360  GLY A C   1 
ATOM   2634 O  O   . GLY A 1 338 ? 11.867 53.831 -3.215  1.00 21.88 ? 360  GLY A O   1 
ATOM   2635 N  N   . LYS A 1 339 ? 9.747  53.623 -2.393  1.00 20.70 ? 361  LYS A N   1 
ATOM   2636 C  CA  . LYS A 1 339 ? 9.133  53.680 -3.749  1.00 19.70 ? 361  LYS A CA  1 
ATOM   2637 C  C   . LYS A 1 339 ? 9.505  54.998 -4.397  1.00 19.91 ? 361  LYS A C   1 
ATOM   2638 O  O   . LYS A 1 339 ? 9.812  55.053 -5.571  1.00 21.36 ? 361  LYS A O   1 
ATOM   2639 C  CB  . LYS A 1 339 ? 7.621  53.558 -3.664  1.00 20.97 ? 361  LYS A CB  1 
ATOM   2640 C  CG  . LYS A 1 339 ? 7.153  52.112 -3.417  1.00 20.21 ? 361  LYS A CG  1 
ATOM   2641 C  CD  . LYS A 1 339 ? 5.633  52.092 -3.180  1.00 20.27 ? 361  LYS A CD  1 
ATOM   2642 C  CE  . LYS A 1 339 ? 5.243  50.636 -2.983  1.00 23.89 ? 361  LYS A CE  1 
ATOM   2643 N  NZ  . LYS A 1 339 ? 3.791  50.419 -2.775  1.00 26.10 ? 361  LYS A NZ  1 
ATOM   2644 N  N   . ALA A 1 340 ? 9.473  56.058 -3.623  1.00 19.51 ? 362  ALA A N   1 
ATOM   2645 C  CA  . ALA A 1 340 ? 9.770  57.372 -4.224  1.00 19.43 ? 362  ALA A CA  1 
ATOM   2646 C  C   . ALA A 1 340 ? 11.201 57.488 -4.702  1.00 18.98 ? 362  ALA A C   1 
ATOM   2647 O  O   . ALA A 1 340 ? 11.479 58.017 -5.797  1.00 18.03 ? 362  ALA A O   1 
ATOM   2648 C  CB  . ALA A 1 340 ? 9.426  58.525 -3.246  1.00 21.14 ? 362  ALA A CB  1 
ATOM   2649 N  N   . HIS A 1 341 ? 12.149 57.015 -3.905  1.00 18.93 ? 363  HIS A N   1 
ATOM   2650 C  CA  . HIS A 1 341 ? 13.506 57.008 -4.411  1.00 19.62 ? 363  HIS A CA  1 
ATOM   2651 C  C   . HIS A 1 341 ? 13.597 56.236 -5.731  1.00 21.31 ? 363  HIS A C   1 
ATOM   2652 O  O   . HIS A 1 341 ? 14.136 56.768 -6.699  1.00 21.36 ? 363  HIS A O   1 
ATOM   2653 C  CB  . HIS A 1 341 ? 14.478 56.402 -3.415  1.00 20.00 ? 363  HIS A CB  1 
ATOM   2654 C  CG  . HIS A 1 341 ? 14.758 57.247 -2.206  1.00 20.05 ? 363  HIS A CG  1 
ATOM   2655 N  ND1 . HIS A 1 341 ? 15.482 58.433 -2.256  1.00 22.59 ? 363  HIS A ND1 1 
ATOM   2656 C  CD2 . HIS A 1 341 ? 14.542 57.006 -0.892  1.00 19.12 ? 363  HIS A CD2 1 
ATOM   2657 C  CE1 . HIS A 1 341 ? 15.628 58.903 -1.025  1.00 18.98 ? 363  HIS A CE1 1 
ATOM   2658 N  NE2 . HIS A 1 341 ? 15.136 58.017 -0.183  1.00 18.93 ? 363  HIS A NE2 1 
ATOM   2659 N  N   . LEU A 1 342 ? 12.986 55.043 -5.771  1.00 20.32 ? 364  LEU A N   1 
ATOM   2660 C  CA  . LEU A 1 342 ? 13.113 54.103 -6.942  1.00 20.25 ? 364  LEU A CA  1 
ATOM   2661 C  C   . LEU A 1 342 ? 12.460 54.680 -8.201  1.00 21.63 ? 364  LEU A C   1 
ATOM   2662 O  O   . LEU A 1 342 ? 13.059 54.713 -9.296  1.00 22.55 ? 364  LEU A O   1 
ATOM   2663 C  CB  . LEU A 1 342 ? 12.554 52.725 -6.578  1.00 20.19 ? 364  LEU A CB  1 
ATOM   2664 C  CG  . LEU A 1 342 ? 13.367 51.933 -5.541  1.00 20.17 ? 364  LEU A CG  1 
ATOM   2665 C  CD1 . LEU A 1 342 ? 12.486 50.876 -4.848  1.00 20.33 ? 364  LEU A CD1 1 
ATOM   2666 C  CD2 . LEU A 1 342 ? 14.640 51.287 -6.230  1.00 24.54 ? 364  LEU A CD2 1 
ATOM   2667 N  N   . GLU A 1 343 ? 11.288 55.248 -8.017  1.00 19.90 ? 365  GLU A N   1 
ATOM   2668 C  CA  . GLU A 1 343 ? 10.560 55.928 -9.096  1.00 21.49 ? 365  GLU A CA  1 
ATOM   2669 C  C   . GLU A 1 343 ? 11.338 57.110 -9.631  1.00 20.22 ? 365  GLU A C   1 
ATOM   2670 O  O   . GLU A 1 343 ? 11.334 57.374 -10.822 1.00 21.36 ? 365  GLU A O   1 
ATOM   2671 C  CB  . GLU A 1 343 ? 9.188  56.341 -8.569  1.00 20.18 ? 365  GLU A CB  1 
ATOM   2672 C  CG  . GLU A 1 343 ? 8.296  55.117 -8.350  1.00 20.51 ? 365  GLU A CG  1 
ATOM   2673 C  CD  . GLU A 1 343 ? 7.065  55.322 -7.452  1.00 24.09 ? 365  GLU A CD  1 
ATOM   2674 O  OE1 . GLU A 1 343 ? 6.830  56.408 -6.880  1.00 26.12 ? 365  GLU A OE1 1 
ATOM   2675 O  OE2 . GLU A 1 343 ? 6.311  54.317 -7.352  1.00 29.23 ? 365  GLU A OE2 1 
ATOM   2676 N  N   . THR A 1 344 ? 12.064 57.781 -8.746  1.00 21.14 ? 366  THR A N   1 
ATOM   2677 C  CA  . THR A 1 344 ? 12.894 58.914 -9.126  1.00 21.97 ? 366  THR A CA  1 
ATOM   2678 C  C   . THR A 1 344 ? 14.115 58.432 -9.977  1.00 21.29 ? 366  THR A C   1 
ATOM   2679 O  O   . THR A 1 344 ? 14.416 59.046 -11.037 1.00 23.25 ? 366  THR A O   1 
ATOM   2680 C  CB  . THR A 1 344 ? 13.305 59.763 -7.880  1.00 22.72 ? 366  THR A CB  1 
ATOM   2681 O  OG1 . THR A 1 344 ? 12.122 60.313 -7.222  1.00 22.72 ? 366  THR A OG1 1 
ATOM   2682 C  CG2 . THR A 1 344 ? 14.169 60.926 -8.345  1.00 22.95 ? 366  THR A CG2 1 
ATOM   2683 N  N   . GLY A 1 345 ? 14.797 57.370 -9.527  1.00 22.45 ? 367  GLY A N   1 
ATOM   2684 C  CA  . GLY A 1 345 ? 15.924 56.739 -10.281 1.00 21.67 ? 367  GLY A CA  1 
ATOM   2685 C  C   . GLY A 1 345 ? 15.415 56.340 -11.676 1.00 21.24 ? 367  GLY A C   1 
ATOM   2686 O  O   . GLY A 1 345 ? 16.110 56.601 -12.707 1.00 23.31 ? 367  GLY A O   1 
ATOM   2687 N  N   . LYS A 1 346 ? 14.208 55.771 -11.730 1.00 22.29 ? 368  LYS A N   1 
ATOM   2688 C  CA  . LYS A 1 346 ? 13.583 55.334 -12.990 1.00 21.94 ? 368  LYS A CA  1 
ATOM   2689 C  C   . LYS A 1 346 ? 13.395 56.578 -13.837 1.00 23.74 ? 368  LYS A C   1 
ATOM   2690 O  O   . LYS A 1 346 ? 13.782 56.562 -15.028 1.00 23.39 ? 368  LYS A O   1 
ATOM   2691 C  CB  . LYS A 1 346 ? 12.225 54.612 -12.796 1.00 23.07 ? 368  LYS A CB  1 
ATOM   2692 C  CG  . LYS A 1 346 ? 11.521 54.111 -14.106 1.00 22.55 ? 368  LYS A CG  1 
ATOM   2693 C  CD  . LYS A 1 346 ? 12.388 53.164 -14.956 1.00 24.12 ? 368  LYS A CD  1 
ATOM   2694 C  CE  . LYS A 1 346 ? 11.572 52.714 -16.207 1.00 24.84 ? 368  LYS A CE  1 
ATOM   2695 N  NZ  . LYS A 1 346 ? 12.250 51.646 -17.027 1.00 27.70 ? 368  LYS A NZ  1 
ATOM   2696 N  N   . ALA A 1 347 ? 12.772 57.634 -13.267 1.00 22.24 ? 369  ALA A N   1 
ATOM   2697 C  CA  . ALA A 1 347 ? 12.591 58.873 -14.074 1.00 24.18 ? 369  ALA A CA  1 
ATOM   2698 C  C   . ALA A 1 347 ? 13.924 59.396 -14.609 1.00 24.39 ? 369  ALA A C   1 
ATOM   2699 O  O   . ALA A 1 347 ? 14.001 59.900 -15.734 1.00 23.21 ? 369  ALA A O   1 
ATOM   2700 C  CB  . ALA A 1 347 ? 11.817 59.957 -13.295 1.00 25.49 ? 369  ALA A CB  1 
ATOM   2701 N  N   . MET A 1 348 ? 14.984 59.245 -13.802 1.00 24.21 ? 370  MET A N   1 
ATOM   2702 C  CA  . MET A 1 348 ? 16.328 59.679 -14.223 1.00 24.84 ? 370  MET A CA  1 
ATOM   2703 C  C   . MET A 1 348 ? 16.786 58.863 -15.429 1.00 25.63 ? 370  MET A C   1 
ATOM   2704 O  O   . MET A 1 348 ? 17.269 59.406 -16.449 1.00 25.93 ? 370  MET A O   1 
ATOM   2705 C  CB  . MET A 1 348 ? 17.282 59.516 -13.084 1.00 23.71 ? 370  MET A CB  1 
ATOM   2706 C  CG  . MET A 1 348 ? 17.051 60.609 -11.998 1.00 25.44 ? 370  MET A CG  1 
ATOM   2707 S  SD  . MET A 1 348 ? 17.746 60.030 -10.466 1.00 26.72 ? 370  MET A SD  1 
ATOM   2708 C  CE  . MET A 1 348 ? 19.462 59.870 -10.998 1.00 28.93 ? 370  MET A CE  1 
ATOM   2709 N  N   . GLU A 1 349 ? 16.619 57.552 -15.334 1.00 27.44 ? 371  GLU A N   1 
ATOM   2710 C  CA  . GLU A 1 349 ? 17.024 56.698 -16.450 1.00 28.49 ? 371  GLU A CA  1 
ATOM   2711 C  C   . GLU A 1 349 ? 16.301 57.098 -17.740 1.00 28.56 ? 371  GLU A C   1 
ATOM   2712 O  O   . GLU A 1 349 ? 16.846 56.974 -18.832 1.00 30.15 ? 371  GLU A O   1 
ATOM   2713 C  CB  . GLU A 1 349 ? 16.750 55.230 -16.136 1.00 30.24 ? 371  GLU A CB  1 
ATOM   2714 C  CG  . GLU A 1 349 ? 17.671 54.710 -15.077 1.00 34.85 ? 371  GLU A CG  1 
ATOM   2715 C  CD  . GLU A 1 349 ? 17.340 53.296 -14.625 1.00 43.98 ? 371  GLU A CD  1 
ATOM   2716 O  OE1 . GLU A 1 349 ? 16.476 52.628 -15.257 1.00 45.50 ? 371  GLU A OE1 1 
ATOM   2717 O  OE2 . GLU A 1 349 ? 17.940 52.866 -13.607 1.00 46.35 ? 371  GLU A OE2 1 
ATOM   2718 N  N   . LEU A 1 350 ? 15.065 57.543 -17.619 1.00 27.38 ? 372  LEU A N   1 
ATOM   2719 C  CA  . LEU A 1 350 ? 14.268 57.827 -18.812 1.00 26.48 ? 372  LEU A CA  1 
ATOM   2720 C  C   . LEU A 1 350 ? 14.662 59.191 -19.371 1.00 26.84 ? 372  LEU A C   1 
ATOM   2721 O  O   . LEU A 1 350 ? 14.287 59.528 -20.485 1.00 27.27 ? 372  LEU A O   1 
ATOM   2722 C  CB  . LEU A 1 350 ? 12.786 57.773 -18.496 1.00 26.60 ? 372  LEU A CB  1 
ATOM   2723 C  CG  . LEU A 1 350 ? 12.263 56.389 -18.085 1.00 22.94 ? 372  LEU A CG  1 
ATOM   2724 C  CD1 . LEU A 1 350 ? 10.893 56.543 -17.477 1.00 25.38 ? 372  LEU A CD1 1 
ATOM   2725 C  CD2 . LEU A 1 350 ? 12.269 55.488 -19.341 1.00 23.46 ? 372  LEU A CD2 1 
ATOM   2726 N  N   . GLY A 1 351 ? 15.392 59.961 -18.573 1.00 26.82 ? 373  GLY A N   1 
ATOM   2727 C  CA  . GLY A 1 351 ? 15.994 61.220 -19.040 1.00 27.74 ? 373  GLY A CA  1 
ATOM   2728 C  C   . GLY A 1 351 ? 15.343 62.441 -18.398 1.00 28.60 ? 373  GLY A C   1 
ATOM   2729 O  O   . GLY A 1 351 ? 15.470 63.559 -18.890 1.00 28.11 ? 373  GLY A O   1 
ATOM   2730 N  N   . ALA A 1 352 ? 14.648 62.242 -17.283 1.00 27.96 ? 374  ALA A N   1 
ATOM   2731 C  CA  . ALA A 1 352 ? 13.986 63.382 -16.699 1.00 28.37 ? 374  ALA A CA  1 
ATOM   2732 C  C   . ALA A 1 352 ? 15.106 64.295 -16.126 1.00 28.03 ? 374  ALA A C   1 
ATOM   2733 O  O   . ALA A 1 352 ? 16.165 63.817 -15.679 1.00 26.11 ? 374  ALA A O   1 
ATOM   2734 C  CB  . ALA A 1 352 ? 12.996 62.948 -15.623 1.00 29.06 ? 374  ALA A CB  1 
ATOM   2735 N  N   . THR A 1 353 ? 14.866 65.606 -16.158 1.00 28.68 ? 375  THR A N   1 
ATOM   2736 C  CA  . THR A 1 353 ? 15.860 66.617 -15.794 1.00 29.91 ? 375  THR A CA  1 
ATOM   2737 C  C   . THR A 1 353 ? 15.857 66.944 -14.297 1.00 30.50 ? 375  THR A C   1 
ATOM   2738 O  O   . THR A 1 353 ? 14.874 66.672 -13.578 1.00 29.89 ? 375  THR A O   1 
ATOM   2739 C  CB  . THR A 1 353 ? 15.641 67.920 -16.621 1.00 29.97 ? 375  THR A CB  1 
ATOM   2740 O  OG1 . THR A 1 353 ? 14.440 68.563 -16.173 1.00 30.89 ? 375  THR A OG1 1 
ATOM   2741 C  CG2 . THR A 1 353 ? 15.450 67.567 -18.140 1.00 30.16 ? 375  THR A CG2 1 
ATOM   2742 N  N   . ASP A 1 354 ? 16.946 67.549 -13.831 1.00 30.14 ? 376  ASP A N   1 
ATOM   2743 C  CA  . ASP A 1 354 ? 16.997 68.080 -12.465 1.00 30.36 ? 376  ASP A CA  1 
ATOM   2744 C  C   . ASP A 1 354 ? 15.848 69.083 -12.199 1.00 30.59 ? 376  ASP A C   1 
ATOM   2745 O  O   . ASP A 1 354 ? 15.161 69.043 -11.155 1.00 29.28 ? 376  ASP A O   1 
ATOM   2746 C  CB  . ASP A 1 354 ? 18.371 68.692 -12.187 1.00 30.50 ? 376  ASP A CB  1 
ATOM   2747 C  CG  . ASP A 1 354 ? 19.474 67.657 -12.059 1.00 32.26 ? 376  ASP A CG  1 
ATOM   2748 O  OD1 . ASP A 1 354 ? 19.199 66.448 -11.853 1.00 27.00 ? 376  ASP A OD1 1 
ATOM   2749 O  OD2 . ASP A 1 354 ? 20.672 68.059 -12.122 1.00 36.31 ? 376  ASP A OD2 1 
ATOM   2750 N  N   . ALA A 1 355 ? 15.589 69.970 -13.155 1.00 30.32 ? 377  ALA A N   1 
ATOM   2751 C  CA  . ALA A 1 355 ? 14.536 70.928 -12.932 1.00 28.99 ? 377  ALA A CA  1 
ATOM   2752 C  C   . ALA A 1 355 ? 13.212 70.201 -12.759 1.00 28.52 ? 377  ALA A C   1 
ATOM   2753 O  O   . ALA A 1 355 ? 12.439 70.566 -11.884 1.00 27.92 ? 377  ALA A O   1 
ATOM   2754 C  CB  . ALA A 1 355 ? 14.484 71.960 -14.063 1.00 28.65 ? 377  ALA A CB  1 
ATOM   2755 N  N   . GLU A 1 356 ? 12.965 69.156 -13.560 1.00 28.36 ? 378  GLU A N   1 
ATOM   2756 C  CA  . GLU A 1 356 ? 11.725 68.360 -13.505 1.00 29.16 ? 378  GLU A CA  1 
ATOM   2757 C  C   . GLU A 1 356 ? 11.584 67.582 -12.208 1.00 29.41 ? 378  GLU A C   1 
ATOM   2758 O  O   . GLU A 1 356 ? 10.471 67.156 -11.866 1.00 29.22 ? 378  GLU A O   1 
ATOM   2759 C  CB  . GLU A 1 356 ? 11.690 67.319 -14.615 1.00 29.01 ? 378  GLU A CB  1 
ATOM   2760 C  CG  . GLU A 1 356 ? 11.072 67.785 -15.965 1.00 30.11 ? 378  GLU A CG  1 
ATOM   2761 C  CD  . GLU A 1 356 ? 11.173 66.696 -16.993 1.00 31.47 ? 378  GLU A CD  1 
ATOM   2762 O  OE1 . GLU A 1 356 ? 12.273 66.102 -17.138 1.00 29.19 ? 378  GLU A OE1 1 
ATOM   2763 O  OE2 . GLU A 1 356 ? 10.145 66.406 -17.637 1.00 39.80 ? 378  GLU A OE2 1 
ATOM   2764 N  N   . LEU A 1 357 ? 12.712 67.374 -11.520 1.00 27.70 ? 379  LEU A N   1 
ATOM   2765 C  CA  . LEU A 1 357 ? 12.723 66.533 -10.302 1.00 26.64 ? 379  LEU A CA  1 
ATOM   2766 C  C   . LEU A 1 357 ? 12.967 67.290 -9.017  1.00 25.31 ? 379  LEU A C   1 
ATOM   2767 O  O   . LEU A 1 357 ? 12.871 66.723 -7.911  1.00 23.46 ? 379  LEU A O   1 
ATOM   2768 C  CB  . LEU A 1 357 ? 13.778 65.437 -10.424 1.00 26.67 ? 379  LEU A CB  1 
ATOM   2769 C  CG  . LEU A 1 357 ? 13.528 64.430 -11.523 1.00 25.64 ? 379  LEU A CG  1 
ATOM   2770 C  CD1 . LEU A 1 357 ? 14.735 63.485 -11.723 1.00 27.29 ? 379  LEU A CD1 1 
ATOM   2771 C  CD2 . LEU A 1 357 ? 12.261 63.677 -11.214 1.00 26.47 ? 379  LEU A CD2 1 
ATOM   2772 N  N   . LYS A 1 358 ? 13.360 68.552 -9.149  1.00 27.52 ? 380  LYS A N   1 
ATOM   2773 C  CA  . LYS A 1 358 ? 13.711 69.343 -7.972  1.00 28.31 ? 380  LYS A CA  1 
ATOM   2774 C  C   . LYS A 1 358 ? 12.648 69.290 -6.855  1.00 27.32 ? 380  LYS A C   1 
ATOM   2775 O  O   . LYS A 1 358 ? 13.018 69.097 -5.662  1.00 27.27 ? 380  LYS A O   1 
ATOM   2776 C  CB  . LYS A 1 358 ? 14.117 70.784 -8.357  1.00 29.47 ? 380  LYS A CB  1 
ATOM   2777 C  CG  . LYS A 1 358 ? 14.616 71.569 -7.162  1.00 29.57 ? 380  LYS A CG  1 
ATOM   2778 C  CD  . LYS A 1 358 ? 15.251 72.919 -7.530  1.00 31.98 ? 380  LYS A CD  1 
ATOM   2779 C  CE  . LYS A 1 358 ? 15.054 73.919 -6.382  1.00 38.06 ? 380  LYS A CE  1 
ATOM   2780 N  NZ  . LYS A 1 358 ? 15.833 75.198 -6.548  1.00 40.31 ? 380  LYS A NZ  1 
ATOM   2781 N  N   . GLU A 1 359 ? 11.370 69.502 -7.200  1.00 26.44 ? 381  GLU A N   1 
ATOM   2782 C  CA  . GLU A 1 359 ? 10.292 69.585 -6.185  1.00 25.83 ? 381  GLU A CA  1 
ATOM   2783 C  C   . GLU A 1 359 ? 10.040 68.215 -5.568  1.00 24.39 ? 381  GLU A C   1 
ATOM   2784 O  O   . GLU A 1 359 ? 9.883  68.069 -4.340  1.00 23.75 ? 381  GLU A O   1 
ATOM   2785 C  CB  . GLU A 1 359 ? 8.965  70.046 -6.754  1.00 26.20 ? 381  GLU A CB  1 
ATOM   2786 C  CG  . GLU A 1 359 ? 8.794  71.517 -7.077  1.00 28.69 ? 381  GLU A CG  1 
ATOM   2787 C  CD  . GLU A 1 359 ? 7.338  71.810 -7.528  1.00 29.63 ? 381  GLU A CD  1 
ATOM   2788 O  OE1 . GLU A 1 359 ? 6.536  70.842 -7.648  1.00 35.36 ? 381  GLU A OE1 1 
ATOM   2789 O  OE2 . GLU A 1 359 ? 6.968  72.992 -7.741  1.00 35.98 ? 381  GLU A OE2 1 
ATOM   2790 N  N   . ILE A 1 360 ? 10.048 67.218 -6.430  1.00 22.01 ? 382  ILE A N   1 
ATOM   2791 C  CA  . ILE A 1 360 ? 9.981  65.806 -5.965  1.00 22.03 ? 382  ILE A CA  1 
ATOM   2792 C  C   . ILE A 1 360 ? 11.062 65.519 -4.924  1.00 22.16 ? 382  ILE A C   1 
ATOM   2793 O  O   . ILE A 1 360 ? 10.765 65.051 -3.806  1.00 22.74 ? 382  ILE A O   1 
ATOM   2794 C  CB  . ILE A 1 360 ? 10.002 64.833 -7.159  1.00 20.56 ? 382  ILE A CB  1 
ATOM   2795 C  CG1 . ILE A 1 360 ? 8.636  64.873 -7.845  1.00 22.59 ? 382  ILE A CG1 1 
ATOM   2796 C  CG2 . ILE A 1 360 ? 10.508 63.343 -6.787  1.00 22.10 ? 382  ILE A CG2 1 
ATOM   2797 C  CD1 . ILE A 1 360 ? 8.634  64.411 -9.324  1.00 20.07 ? 382  ILE A CD1 1 
ATOM   2798 N  N   . ARG A 1 361 ? 12.305 65.757 -5.317  1.00 23.70 ? 383  ARG A N   1 
ATOM   2799 C  CA  . ARG A 1 361 ? 13.471 65.559 -4.415  1.00 24.75 ? 383  ARG A CA  1 
ATOM   2800 C  C   . ARG A 1 361 ? 13.333 66.313 -3.069  1.00 24.82 ? 383  ARG A C   1 
ATOM   2801 O  O   . ARG A 1 361 ? 13.626 65.762 -1.980  1.00 22.64 ? 383  ARG A O   1 
ATOM   2802 C  CB  . ARG A 1 361 ? 14.789 65.861 -5.132  1.00 25.56 ? 383  ARG A CB  1 
ATOM   2803 C  CG  . ARG A 1 361 ? 15.241 64.788 -6.091  1.00 25.47 ? 383  ARG A CG  1 
ATOM   2804 C  CD  . ARG A 1 361 ? 16.372 65.257 -7.040  1.00 24.23 ? 383  ARG A CD  1 
ATOM   2805 N  NE  . ARG A 1 361 ? 16.883 64.154 -7.871  1.00 26.66 ? 383  ARG A NE  1 
ATOM   2806 C  CZ  . ARG A 1 361 ? 17.417 64.302 -9.083  1.00 24.72 ? 383  ARG A CZ  1 
ATOM   2807 N  NH1 . ARG A 1 361 ? 17.508 65.536 -9.648  1.00 23.72 ? 383  ARG A NH1 1 
ATOM   2808 N  NH2 . ARG A 1 361 ? 17.849 63.217 -9.732  1.00 23.98 ? 383  ARG A NH2 1 
ATOM   2809 N  N   . THR A 1 362 ? 12.901 67.574 -3.139  1.00 24.76 ? 384  THR A N   1 
ATOM   2810 C  CA  . THR A 1 362 ? 12.634 68.315 -1.893  1.00 24.89 ? 384  THR A CA  1 
ATOM   2811 C  C   . THR A 1 362 ? 11.603 67.578 -1.010  1.00 24.35 ? 384  THR A C   1 
ATOM   2812 O  O   . THR A 1 362 ? 11.781 67.479 0.212   1.00 25.80 ? 384  THR A O   1 
ATOM   2813 C  CB  . THR A 1 362 ? 12.183 69.743 -2.178  1.00 25.32 ? 384  THR A CB  1 
ATOM   2814 O  OG1 . THR A 1 362 ? 13.232 70.466 -2.858  1.00 27.13 ? 384  THR A OG1 1 
ATOM   2815 C  CG2 . THR A 1 362 ? 11.820 70.429 -0.863  1.00 26.79 ? 384  THR A CG2 1 
ATOM   2816 N  N   . HIS A 1 363 ? 10.529 67.048 -1.614  1.00 22.00 ? 385  HIS A N   1 
ATOM   2817 C  CA  . HIS A 1 363 ? 9.559  66.259 -0.867  1.00 20.77 ? 385  HIS A CA  1 
ATOM   2818 C  C   . HIS A 1 363 ? 10.201 65.033 -0.249  1.00 21.62 ? 385  HIS A C   1 
ATOM   2819 O  O   . HIS A 1 363 ? 9.925  64.729 0.868   1.00 21.15 ? 385  HIS A O   1 
ATOM   2820 C  CB  . HIS A 1 363 ? 8.377  65.818 -1.712  1.00 23.70 ? 385  HIS A CB  1 
ATOM   2821 C  CG  . HIS A 1 363 ? 7.434  66.930 -2.065  1.00 22.73 ? 385  HIS A CG  1 
ATOM   2822 N  ND1 . HIS A 1 363 ? 6.748  67.640 -1.120  1.00 26.70 ? 385  HIS A ND1 1 
ATOM   2823 C  CD2 . HIS A 1 363 ? 7.047  67.424 -3.264  1.00 28.72 ? 385  HIS A CD2 1 
ATOM   2824 C  CE1 . HIS A 1 363 ? 5.987  68.549 -1.715  1.00 29.94 ? 385  HIS A CE1 1 
ATOM   2825 N  NE2 . HIS A 1 363 ? 6.156  68.438 -3.016  1.00 29.70 ? 385  HIS A NE2 1 
ATOM   2826 N  N   . ILE A 1 364 ? 11.046 64.335 -1.009  1.00 19.80 ? 386  ILE A N   1 
ATOM   2827 C  CA  . ILE A 1 364 ? 11.655 63.077 -0.518  1.00 20.07 ? 386  ILE A CA  1 
ATOM   2828 C  C   . ILE A 1 364 ? 12.613 63.428 0.651   1.00 19.42 ? 386  ILE A C   1 
ATOM   2829 O  O   . ILE A 1 364 ? 12.619 62.785 1.674   1.00 21.04 ? 386  ILE A O   1 
ATOM   2830 C  CB  . ILE A 1 364 ? 12.453 62.357 -1.640  1.00 19.02 ? 386  ILE A CB  1 
ATOM   2831 C  CG1 . ILE A 1 364 ? 11.520 61.770 -2.698  1.00 20.63 ? 386  ILE A CG1 1 
ATOM   2832 C  CG2 . ILE A 1 364 ? 13.276 61.171 -1.063  1.00 21.55 ? 386  ILE A CG2 1 
ATOM   2833 C  CD1 . ILE A 1 364 ? 12.313 61.258 -3.985  1.00 21.87 ? 386  ILE A CD1 1 
ATOM   2834 N  N   . ARG A 1 365 ? 13.411 64.460 0.475   1.00 18.62 ? 387  ARG A N   1 
ATOM   2835 C  CA  . ARG A 1 365 ? 14.345 64.945 1.517   1.00 19.81 ? 387  ARG A CA  1 
ATOM   2836 C  C   . ARG A 1 365 ? 13.602 65.211 2.800   1.00 19.49 ? 387  ARG A C   1 
ATOM   2837 O  O   . ARG A 1 365 ? 13.997 64.758 3.846   1.00 19.40 ? 387  ARG A O   1 
ATOM   2838 C  CB  . ARG A 1 365 ? 15.013 66.220 1.033   1.00 19.82 ? 387  ARG A CB  1 
ATOM   2839 C  CG  . ARG A 1 365 ? 15.897 66.999 2.088   1.00 19.73 ? 387  ARG A CG  1 
ATOM   2840 C  CD  . ARG A 1 365 ? 16.303 68.352 1.482   1.00 22.19 ? 387  ARG A CD  1 
ATOM   2841 N  NE  . ARG A 1 365 ? 16.952 69.293 2.434   1.00 26.97 ? 387  ARG A NE  1 
ATOM   2842 C  CZ  . ARG A 1 365 ? 18.246 69.289 2.741   1.00 26.10 ? 387  ARG A CZ  1 
ATOM   2843 N  NH1 . ARG A 1 365 ? 19.050 68.369 2.202   1.00 24.86 ? 387  ARG A NH1 1 
ATOM   2844 N  NH2 . ARG A 1 365 ? 18.741 70.223 3.562   1.00 23.55 ? 387  ARG A NH2 1 
ATOM   2845 N  N   . HIS A 1 366 ? 12.494 65.930 2.712   1.00 18.59 ? 388  HIS A N   1 
ATOM   2846 C  CA  . HIS A 1 366 ? 11.699 66.237 3.918   1.00 20.29 ? 388  HIS A CA  1 
ATOM   2847 C  C   . HIS A 1 366 ? 10.954 65.040 4.487   1.00 19.61 ? 388  HIS A C   1 
ATOM   2848 O  O   . HIS A 1 366 ? 10.921 64.841 5.695   1.00 20.39 ? 388  HIS A O   1 
ATOM   2849 C  CB  . HIS A 1 366 ? 10.716 67.367 3.609   1.00 21.15 ? 388  HIS A CB  1 
ATOM   2850 C  CG  . HIS A 1 366 ? 11.368 68.700 3.369   1.00 24.68 ? 388  HIS A CG  1 
ATOM   2851 N  ND1 . HIS A 1 366 ? 10.733 69.709 2.677   1.00 26.65 ? 388  HIS A ND1 1 
ATOM   2852 C  CD2 . HIS A 1 366 ? 12.594 69.180 3.697   1.00 28.09 ? 388  HIS A CD2 1 
ATOM   2853 C  CE1 . HIS A 1 366 ? 11.541 70.754 2.583   1.00 28.65 ? 388  HIS A CE1 1 
ATOM   2854 N  NE2 . HIS A 1 366 ? 12.680 70.461 3.189   1.00 29.88 ? 388  HIS A NE2 1 
ATOM   2855 N  N   . ALA A 1 367 ? 10.409 64.208 3.617   1.00 19.88 ? 389  ALA A N   1 
ATOM   2856 C  CA  . ALA A 1 367 ? 9.726  62.984 4.036   1.00 19.43 ? 389  ALA A CA  1 
ATOM   2857 C  C   . ALA A 1 367 ? 10.663 62.136 4.873   1.00 19.31 ? 389  ALA A C   1 
ATOM   2858 O  O   . ALA A 1 367 ? 10.328 61.710 6.008   1.00 22.50 ? 389  ALA A O   1 
ATOM   2859 C  CB  . ALA A 1 367 ? 9.275  62.186 2.792   1.00 20.09 ? 389  ALA A CB  1 
ATOM   2860 N  N   . GLN A 1 368 ? 11.868 61.913 4.337   1.00 18.91 ? 390  GLN A N   1 
ATOM   2861 C  CA  . GLN A 1 368 ? 12.759 60.994 4.996   1.00 19.79 ? 390  GLN A CA  1 
ATOM   2862 C  C   . GLN A 1 368 ? 13.363 61.639 6.224   1.00 20.10 ? 390  GLN A C   1 
ATOM   2863 O  O   . GLN A 1 368 ? 13.571 60.954 7.206   1.00 20.37 ? 390  GLN A O   1 
ATOM   2864 C  CB  . GLN A 1 368 ? 13.857 60.501 4.029   1.00 20.14 ? 390  GLN A CB  1 
ATOM   2865 C  CG  . GLN A 1 368 ? 14.699 59.401 4.647   1.00 18.99 ? 390  GLN A CG  1 
ATOM   2866 C  CD  . GLN A 1 368 ? 15.579 58.698 3.644   1.00 20.42 ? 390  GLN A CD  1 
ATOM   2867 O  OE1 . GLN A 1 368 ? 15.073 58.247 2.586   1.00 18.18 ? 390  GLN A OE1 1 
ATOM   2868 N  NE2 . GLN A 1 368 ? 16.904 58.529 3.988   1.00 20.61 ? 390  GLN A NE2 1 
ATOM   2869 N  N   . TRP A 1 369 ? 13.717 62.923 6.154   1.00 21.05 ? 391  TRP A N   1 
ATOM   2870 C  CA  . TRP A 1 369 ? 14.143 63.636 7.358   1.00 21.65 ? 391  TRP A CA  1 
ATOM   2871 C  C   . TRP A 1 369 ? 13.170 63.436 8.527   1.00 22.30 ? 391  TRP A C   1 
ATOM   2872 O  O   . TRP A 1 369 ? 13.564 63.155 9.655   1.00 21.69 ? 391  TRP A O   1 
ATOM   2873 C  CB  . TRP A 1 369 ? 14.282 65.133 7.115   1.00 23.07 ? 391  TRP A CB  1 
ATOM   2874 C  CG  . TRP A 1 369 ? 14.587 65.892 8.429   1.00 20.49 ? 391  TRP A CG  1 
ATOM   2875 C  CD1 . TRP A 1 369 ? 13.842 66.890 9.008   1.00 25.04 ? 391  TRP A CD1 1 
ATOM   2876 C  CD2 . TRP A 1 369 ? 15.719 65.693 9.277   1.00 22.90 ? 391  TRP A CD2 1 
ATOM   2877 N  NE1 . TRP A 1 369 ? 14.469 67.331 10.182  1.00 24.60 ? 391  TRP A NE1 1 
ATOM   2878 C  CE2 . TRP A 1 369 ? 15.647 66.646 10.326  1.00 19.08 ? 391  TRP A CE2 1 
ATOM   2879 C  CE3 . TRP A 1 369 ? 16.845 64.870 9.201   1.00 19.46 ? 391  TRP A CE3 1 
ATOM   2880 C  CZ2 . TRP A 1 369 ? 16.607 66.707 11.337  1.00 23.40 ? 391  TRP A CZ2 1 
ATOM   2881 C  CZ3 . TRP A 1 369 ? 17.837 64.965 10.198  1.00 23.50 ? 391  TRP A CZ3 1 
ATOM   2882 C  CH2 . TRP A 1 369 ? 17.701 65.874 11.246  1.00 23.07 ? 391  TRP A CH2 1 
ATOM   2883 N  N   . ARG A 1 370 ? 11.900 63.666 8.276   1.00 21.25 ? 392  ARG A N   1 
ATOM   2884 C  CA  . ARG A 1 370 ? 10.910 63.530 9.324   1.00 20.79 ? 392  ARG A CA  1 
ATOM   2885 C  C   . ARG A 1 370 ? 10.722 62.049 9.776   1.00 21.39 ? 392  ARG A C   1 
ATOM   2886 O  O   . ARG A 1 370 ? 10.698 61.781 10.945  1.00 21.65 ? 392  ARG A O   1 
ATOM   2887 C  CB  . ARG A 1 370 ? 9.566  64.107 8.868   1.00 22.32 ? 392  ARG A CB  1 
ATOM   2888 C  CG  . ARG A 1 370 ? 9.669  65.512 8.475   1.00 21.44 ? 392  ARG A CG  1 
ATOM   2889 C  CD  . ARG A 1 370 ? 8.463  66.007 7.719   1.00 23.72 ? 392  ARG A CD  1 
ATOM   2890 N  NE  . ARG A 1 370 ? 8.791  67.322 7.202   1.00 23.50 ? 392  ARG A NE  1 
ATOM   2891 C  CZ  . ARG A 1 370 ? 7.958  68.125 6.548   1.00 26.86 ? 392  ARG A CZ  1 
ATOM   2892 N  NH1 . ARG A 1 370 ? 6.680  67.796 6.358   1.00 24.51 ? 392  ARG A NH1 1 
ATOM   2893 N  NH2 . ARG A 1 370 ? 8.403  69.270 6.087   1.00 23.32 ? 392  ARG A NH2 1 
ATOM   2894 N  N   . ALA A 1 371 ? 10.550 61.120 8.853   1.00 22.07 ? 393  ALA A N   1 
ATOM   2895 C  CA  . ALA A 1 371 ? 10.380 59.727 9.244   1.00 21.09 ? 393  ALA A CA  1 
ATOM   2896 C  C   . ALA A 1 371 ? 11.645 59.193 9.975   1.00 21.15 ? 393  ALA A C   1 
ATOM   2897 O  O   . ALA A 1 371 ? 11.486 58.437 10.923  1.00 19.63 ? 393  ALA A O   1 
ATOM   2898 C  CB  . ALA A 1 371 ? 10.018 58.876 8.053   1.00 22.37 ? 393  ALA A CB  1 
ATOM   2899 N  N   . ASP A 1 372 ? 12.858 59.564 9.520   1.00 20.67 ? 394  ASP A N   1 
ATOM   2900 C  CA  . ASP A 1 372 ? 14.118 59.087 10.152  1.00 22.60 ? 394  ASP A CA  1 
ATOM   2901 C  C   . ASP A 1 372 ? 14.194 59.690 11.551  1.00 22.78 ? 394  ASP A C   1 
ATOM   2902 O  O   . ASP A 1 372 ? 14.425 58.985 12.542  1.00 22.76 ? 394  ASP A O   1 
ATOM   2903 C  CB  . ASP A 1 372 ? 15.359 59.509 9.337   1.00 23.02 ? 394  ASP A CB  1 
ATOM   2904 C  CG  . ASP A 1 372 ? 16.578 58.646 9.601   1.00 22.63 ? 394  ASP A CG  1 
ATOM   2905 O  OD1 . ASP A 1 372 ? 16.434 57.672 10.386  1.00 23.78 ? 394  ASP A OD1 1 
ATOM   2906 O  OD2 . ASP A 1 372 ? 17.667 58.955 8.993   1.00 21.30 ? 394  ASP A OD2 1 
ATOM   2907 N  N   . MET A 1 373 ? 13.878 60.972 11.655  1.00 21.24 ? 395  MET A N   1 
ATOM   2908 C  CA  . MET A 1 373 ? 13.858 61.632 12.995  1.00 23.02 ? 395  MET A CA  1 
ATOM   2909 C  C   . MET A 1 373 ? 12.887 60.938 13.969  1.00 22.55 ? 395  MET A C   1 
ATOM   2910 O  O   . MET A 1 373 ? 13.122 60.892 15.192  1.00 24.71 ? 395  MET A O   1 
ATOM   2911 C  CB  . MET A 1 373 ? 13.485 63.097 12.849  1.00 21.29 ? 395  MET A CB  1 
ATOM   2912 C  CG  . MET A 1 373 ? 14.673 63.998 12.569  1.00 23.21 ? 395  MET A CG  1 
ATOM   2913 S  SD  . MET A 1 373 ? 15.815 64.161 13.985  1.00 25.66 ? 395  MET A SD  1 
ATOM   2914 C  CE  . MET A 1 373 ? 14.906 65.139 15.177  1.00 30.35 ? 395  MET A CE  1 
ATOM   2915 N  N   . ALA A 1 374 ? 11.791 60.410 13.448  1.00 22.79 ? 396  ALA A N   1 
ATOM   2916 C  CA  . ALA A 1 374 ? 10.856 59.622 14.267  1.00 22.26 ? 396  ALA A CA  1 
ATOM   2917 C  C   . ALA A 1 374 ? 11.396 58.289 14.760  1.00 21.93 ? 396  ALA A C   1 
ATOM   2918 O  O   . ALA A 1 374 ? 11.028 57.857 15.856  1.00 22.37 ? 396  ALA A O   1 
ATOM   2919 C  CB  . ALA A 1 374 ? 9.577  59.323 13.492  1.00 22.86 ? 396  ALA A CB  1 
ATOM   2920 N  N   . ILE A 1 375 ? 12.176 57.604 13.914  1.00 20.52 ? 397  ILE A N   1 
ATOM   2921 C  CA  . ILE A 1 375 ? 12.526 56.195 14.201  1.00 21.16 ? 397  ILE A CA  1 
ATOM   2922 C  C   . ILE A 1 375 ? 13.983 56.057 14.634  1.00 21.55 ? 397  ILE A C   1 
ATOM   2923 O  O   . ILE A 1 375 ? 14.410 54.964 15.091  1.00 20.91 ? 397  ILE A O   1 
ATOM   2924 C  CB  . ILE A 1 375 ? 12.274 55.272 12.952  1.00 21.34 ? 397  ILE A CB  1 
ATOM   2925 C  CG1 . ILE A 1 375 ? 13.151 55.708 11.764  1.00 21.99 ? 397  ILE A CG1 1 
ATOM   2926 C  CG2 . ILE A 1 375 ? 10.777 55.251 12.627  1.00 22.22 ? 397  ILE A CG2 1 
ATOM   2927 C  CD1 . ILE A 1 375 ? 13.629 54.565 10.872  1.00 23.73 ? 397  ILE A CD1 1 
ATOM   2928 N  N   . ALA A 1 376 ? 14.758 57.126 14.432  1.00 20.72 ? 398  ALA A N   1 
ATOM   2929 C  CA  . ALA A 1 376 ? 16.208 57.046 14.736  1.00 21.35 ? 398  ALA A CA  1 
ATOM   2930 C  C   . ALA A 1 376 ? 16.469 56.920 16.243  1.00 21.65 ? 398  ALA A C   1 
ATOM   2931 O  O   . ALA A 1 376 ? 17.473 56.362 16.658  1.00 22.35 ? 398  ALA A O   1 
ATOM   2932 C  CB  . ALA A 1 376 ? 16.998 58.212 14.137  1.00 21.34 ? 398  ALA A CB  1 
ATOM   2933 N  N   . GLY A 1 377 ? 15.560 57.445 17.063  1.00 20.89 ? 399  GLY A N   1 
ATOM   2934 C  CA  . GLY A 1 377 ? 15.734 57.252 18.499  1.00 21.63 ? 399  GLY A CA  1 
ATOM   2935 C  C   . GLY A 1 377 ? 14.867 56.063 18.834  1.00 22.38 ? 399  GLY A C   1 
ATOM   2936 O  O   . GLY A 1 377 ? 13.644 56.126 18.632  1.00 21.69 ? 399  GLY A O   1 
ATOM   2937 N  N   . HIS A 1 378 ? 15.492 54.977 19.274  1.00 21.04 ? 400  HIS A N   1 
ATOM   2938 C  CA  . HIS A 1 378 ? 14.814 53.738 19.498  1.00 23.21 ? 400  HIS A CA  1 
ATOM   2939 C  C   . HIS A 1 378 ? 13.818 53.681 20.653  1.00 24.17 ? 400  HIS A C   1 
ATOM   2940 O  O   . HIS A 1 378 ? 13.002 52.730 20.732  1.00 26.71 ? 400  HIS A O   1 
ATOM   2941 C  CB  . HIS A 1 378 ? 15.816 52.626 19.675  1.00 23.08 ? 400  HIS A CB  1 
ATOM   2942 C  CG  . HIS A 1 378 ? 16.562 52.329 18.421  1.00 23.01 ? 400  HIS A CG  1 
ATOM   2943 N  ND1 . HIS A 1 378 ? 16.111 51.433 17.465  1.00 23.70 ? 400  HIS A ND1 1 
ATOM   2944 C  CD2 . HIS A 1 378 ? 17.701 52.863 17.940  1.00 23.65 ? 400  HIS A CD2 1 
ATOM   2945 C  CE1 . HIS A 1 378 ? 16.995 51.385 16.477  1.00 26.14 ? 400  HIS A CE1 1 
ATOM   2946 N  NE2 . HIS A 1 378 ? 17.961 52.254 16.739  1.00 24.47 ? 400  HIS A NE2 1 
ATOM   2947 N  N   . GLY A 1 379 ? 13.914 54.635 21.571  1.00 24.73 ? 401  GLY A N   1 
ATOM   2948 C  CA  . GLY A 1 379 ? 12.929 54.728 22.643  1.00 24.79 ? 401  GLY A CA  1 
ATOM   2949 C  C   . GLY A 1 379 ? 11.886 55.794 22.374  1.00 24.81 ? 401  GLY A C   1 
ATOM   2950 O  O   . GLY A 1 379 ? 10.950 55.931 23.157  1.00 26.33 ? 401  GLY A O   1 
ATOM   2951 N  N   . SER A 1 380 ? 12.041 56.567 21.287  1.00 23.47 ? 402  SER A N   1 
ATOM   2952 C  CA  . SER A 1 380 ? 11.134 57.697 21.101  1.00 23.52 ? 402  SER A CA  1 
ATOM   2953 C  C   . SER A 1 380 ? 9.670  57.284 21.013  1.00 22.93 ? 402  SER A C   1 
ATOM   2954 O  O   . SER A 1 380 ? 8.806  58.101 21.359  1.00 23.33 ? 402  SER A O   1 
ATOM   2955 C  CB  . SER A 1 380 ? 11.465 58.481 19.843  1.00 23.47 ? 402  SER A CB  1 
ATOM   2956 O  OG  . SER A 1 380 ? 12.764 59.007 19.901  1.00 21.98 ? 402  SER A OG  1 
ATOM   2957 N  N   . PHE A 1 381 ? 9.412  56.090 20.466  1.00 24.19 ? 403  PHE A N   1 
ATOM   2958 C  CA  . PHE A 1 381 ? 8.025  55.568 20.346  1.00 24.66 ? 403  PHE A CA  1 
ATOM   2959 C  C   . PHE A 1 381 ? 7.342  55.576 21.727  1.00 25.84 ? 403  PHE A C   1 
ATOM   2960 O  O   . PHE A 1 381 ? 6.102  55.637 21.808  1.00 27.09 ? 403  PHE A O   1 
ATOM   2961 C  CB  . PHE A 1 381 ? 8.061  54.148 19.789  1.00 25.50 ? 403  PHE A CB  1 
ATOM   2962 C  CG  . PHE A 1 381 ? 8.467  53.100 20.813  1.00 23.82 ? 403  PHE A CG  1 
ATOM   2963 C  CD1 . PHE A 1 381 ? 9.808  52.782 21.025  1.00 26.92 ? 403  PHE A CD1 1 
ATOM   2964 C  CD2 . PHE A 1 381 ? 7.501  52.472 21.593  1.00 26.59 ? 403  PHE A CD2 1 
ATOM   2965 C  CE1 . PHE A 1 381 ? 10.168 51.820 21.973  1.00 27.19 ? 403  PHE A CE1 1 
ATOM   2966 C  CE2 . PHE A 1 381 ? 7.852  51.518 22.556  1.00 27.00 ? 403  PHE A CE2 1 
ATOM   2967 C  CZ  . PHE A 1 381 ? 9.175  51.162 22.716  1.00 26.84 ? 403  PHE A CZ  1 
ATOM   2968 N  N   . PHE A 1 382 ? 8.177  55.518 22.795  1.00 24.48 ? 404  PHE A N   1 
ATOM   2969 C  CA  . PHE A 1 382 ? 7.746  55.611 24.216  1.00 24.29 ? 404  PHE A CA  1 
ATOM   2970 C  C   . PHE A 1 382 ? 7.978  56.987 24.844  1.00 24.59 ? 404  PHE A C   1 
ATOM   2971 O  O   . PHE A 1 382 ? 7.100  57.507 25.560  1.00 23.91 ? 404  PHE A O   1 
ATOM   2972 C  CB  . PHE A 1 382 ? 8.433  54.550 25.107  1.00 25.14 ? 404  PHE A CB  1 
ATOM   2973 C  CG  . PHE A 1 382 ? 8.149  54.736 26.591  1.00 26.29 ? 404  PHE A CG  1 
ATOM   2974 C  CD1 . PHE A 1 382 ? 6.929  54.340 27.137  1.00 29.02 ? 404  PHE A CD1 1 
ATOM   2975 C  CD2 . PHE A 1 382 ? 9.057  55.402 27.414  1.00 26.43 ? 404  PHE A CD2 1 
ATOM   2976 C  CE1 . PHE A 1 382 ? 6.650  54.533 28.501  1.00 26.09 ? 404  PHE A CE1 1 
ATOM   2977 C  CE2 . PHE A 1 382 ? 8.778  55.620 28.772  1.00 23.04 ? 404  PHE A CE2 1 
ATOM   2978 C  CZ  . PHE A 1 382 ? 7.545  55.184 29.303  1.00 23.96 ? 404  PHE A CZ  1 
ATOM   2979 N  N   . HIS A 1 383 ? 9.160  57.550 24.605  1.00 22.92 ? 405  HIS A N   1 
ATOM   2980 C  CA  . HIS A 1 383 ? 9.550  58.849 25.161  1.00 24.35 ? 405  HIS A CA  1 
ATOM   2981 C  C   . HIS A 1 383 ? 8.590  59.924 24.698  1.00 24.55 ? 405  HIS A C   1 
ATOM   2982 O  O   . HIS A 1 383 ? 8.252  60.798 25.472  1.00 23.70 ? 405  HIS A O   1 
ATOM   2983 C  CB  . HIS A 1 383 ? 10.986 59.276 24.798  1.00 25.60 ? 405  HIS A CB  1 
ATOM   2984 C  CG  . HIS A 1 383 ? 12.078 58.321 25.237  1.00 24.89 ? 405  HIS A CG  1 
ATOM   2985 N  ND1 . HIS A 1 383 ? 13.235 58.160 24.499  1.00 23.79 ? 405  HIS A ND1 1 
ATOM   2986 C  CD2 . HIS A 1 383 ? 12.212 57.500 26.322  1.00 27.70 ? 405  HIS A CD2 1 
ATOM   2987 C  CE1 . HIS A 1 383 ? 14.046 57.297 25.118  1.00 26.14 ? 405  HIS A CE1 1 
ATOM   2988 N  NE2 . HIS A 1 383 ? 13.449 56.865 26.226  1.00 23.48 ? 405  HIS A NE2 1 
ATOM   2989 N  N   . ALA A 1 384 ? 8.168  59.858 23.428  1.00 23.77 ? 406  ALA A N   1 
ATOM   2990 C  CA  . ALA A 1 384 ? 7.296  60.895 22.837  1.00 24.32 ? 406  ALA A CA  1 
ATOM   2991 C  C   . ALA A 1 384 ? 6.405  60.324 21.749  1.00 24.32 ? 406  ALA A C   1 
ATOM   2992 O  O   . ALA A 1 384 ? 6.575  60.650 20.544  1.00 25.11 ? 406  ALA A O   1 
ATOM   2993 C  CB  . ALA A 1 384 ? 8.130  62.044 22.288  1.00 22.81 ? 406  ALA A CB  1 
ATOM   2994 N  N   . PRO A 1 385 ? 5.470  59.459 22.153  1.00 24.46 ? 407  PRO A N   1 
ATOM   2995 C  CA  . PRO A 1 385 ? 4.678  58.658 21.227  1.00 23.62 ? 407  PRO A CA  1 
ATOM   2996 C  C   . PRO A 1 385 ? 3.882  59.501 20.264  1.00 23.60 ? 407  PRO A C   1 
ATOM   2997 O  O   . PRO A 1 385 ? 3.824  59.222 19.096  1.00 22.89 ? 407  PRO A O   1 
ATOM   2998 C  CB  . PRO A 1 385 ? 3.705  57.938 22.178  1.00 23.79 ? 407  PRO A CB  1 
ATOM   2999 C  CG  . PRO A 1 385 ? 4.490  57.857 23.465  1.00 26.80 ? 407  PRO A CG  1 
ATOM   3000 C  CD  . PRO A 1 385 ? 5.106  59.161 23.566  1.00 25.53 ? 407  PRO A CD  1 
ATOM   3001 N  N   . GLU A 1 386 ? 3.257  60.557 20.768  1.00 22.74 ? 408  GLU A N   1 
ATOM   3002 C  CA  . GLU A 1 386 ? 2.442  61.396 19.878  1.00 22.55 ? 408  GLU A CA  1 
ATOM   3003 C  C   . GLU A 1 386 ? 3.258  62.150 18.849  1.00 22.66 ? 408  GLU A C   1 
ATOM   3004 O  O   . GLU A 1 386 ? 2.836  62.237 17.696  1.00 24.10 ? 408  GLU A O   1 
ATOM   3005 C  CB  . GLU A 1 386 ? 1.468  62.263 20.698  1.00 23.08 ? 408  GLU A CB  1 
ATOM   3006 C  CG  . GLU A 1 386 ? 0.492  61.381 21.357  1.00 20.32 ? 408  GLU A CG  1 
ATOM   3007 C  CD  . GLU A 1 386 ? -0.276 62.016 22.489  1.00 24.05 ? 408  GLU A CD  1 
ATOM   3008 O  OE1 . GLU A 1 386 ? -0.754 63.169 22.413  1.00 23.09 ? 408  GLU A OE1 1 
ATOM   3009 O  OE2 . GLU A 1 386 ? -0.459 61.318 23.476  1.00 20.87 ? 408  GLU A OE2 1 
ATOM   3010 N  N   . GLU A 1 387 ? 4.421  62.689 19.239  1.00 24.16 ? 409  GLU A N   1 
ATOM   3011 C  CA  . GLU A 1 387 ? 5.285  63.364 18.278  1.00 23.51 ? 409  GLU A CA  1 
ATOM   3012 C  C   . GLU A 1 387 ? 5.778  62.386 17.237  1.00 24.53 ? 409  GLU A C   1 
ATOM   3013 O  O   . GLU A 1 387 ? 5.794  62.741 16.032  1.00 23.50 ? 409  GLU A O   1 
ATOM   3014 C  CB  . GLU A 1 387 ? 6.460  64.100 18.930  1.00 24.84 ? 409  GLU A CB  1 
ATOM   3015 C  CG  . GLU A 1 387 ? 7.354  64.814 17.933  1.00 26.82 ? 409  GLU A CG  1 
ATOM   3016 C  CD  . GLU A 1 387 ? 6.683  65.976 17.160  1.00 33.22 ? 409  GLU A CD  1 
ATOM   3017 O  OE1 . GLU A 1 387 ? 5.502  66.307 17.383  1.00 33.47 ? 409  GLU A OE1 1 
ATOM   3018 O  OE2 . GLU A 1 387 ? 7.385  66.599 16.333  1.00 37.28 ? 409  GLU A OE2 1 
ATOM   3019 N  N   . VAL A 1 388 ? 6.113  61.160 17.687  1.00 24.47 ? 410  VAL A N   1 
ATOM   3020 C  CA  . VAL A 1 388 ? 6.591  60.087 16.796  1.00 24.60 ? 410  VAL A CA  1 
ATOM   3021 C  C   . VAL A 1 388 ? 5.566  59.798 15.709  1.00 22.92 ? 410  VAL A C   1 
ATOM   3022 O  O   . VAL A 1 388 ? 5.884  59.841 14.534  1.00 23.07 ? 410  VAL A O   1 
ATOM   3023 C  CB  . VAL A 1 388 ? 7.050  58.784 17.538  1.00 24.40 ? 410  VAL A CB  1 
ATOM   3024 C  CG1 . VAL A 1 388 ? 7.155  57.575 16.592  1.00 28.07 ? 410  VAL A CG1 1 
ATOM   3025 C  CG2 . VAL A 1 388 ? 8.427  59.049 18.140  1.00 24.55 ? 410  VAL A CG2 1 
ATOM   3026 N  N   . LEU A 1 389 ? 4.347  59.481 16.100  1.00 23.36 ? 411  LEU A N   1 
ATOM   3027 C  CA  . LEU A 1 389 ? 3.262  59.239 15.106  1.00 23.06 ? 411  LEU A CA  1 
ATOM   3028 C  C   . LEU A 1 389 ? 3.037  60.455 14.221  1.00 22.54 ? 411  LEU A C   1 
ATOM   3029 O  O   . LEU A 1 389 ? 2.897  60.334 13.008  1.00 22.60 ? 411  LEU A O   1 
ATOM   3030 C  CB  . LEU A 1 389 ? 1.967  58.845 15.796  1.00 22.29 ? 411  LEU A CB  1 
ATOM   3031 C  CG  . LEU A 1 389 ? 2.063  57.627 16.756  1.00 19.90 ? 411  LEU A CG  1 
ATOM   3032 C  CD1 . LEU A 1 389 ? 0.752  57.536 17.548  1.00 20.30 ? 411  LEU A CD1 1 
ATOM   3033 C  CD2 . LEU A 1 389 ? 2.422  56.316 16.033  1.00 21.30 ? 411  LEU A CD2 1 
ATOM   3034 N  N   . ARG A 1 390 ? 3.005  61.643 14.803  1.00 24.43 ? 412  ARG A N   1 
ATOM   3035 C  CA  . ARG A 1 390 ? 2.761  62.847 13.973  1.00 23.93 ? 412  ARG A CA  1 
ATOM   3036 C  C   . ARG A 1 390 ? 3.859  62.998 12.891  1.00 23.92 ? 412  ARG A C   1 
ATOM   3037 O  O   . ARG A 1 390 ? 3.568  63.309 11.682  1.00 21.82 ? 412  ARG A O   1 
ATOM   3038 C  CB  . ARG A 1 390 ? 2.554  64.116 14.851  1.00 25.65 ? 412  ARG A CB  1 
ATOM   3039 C  CG  . ARG A 1 390 ? 2.143  65.401 14.075  1.00 25.30 ? 412  ARG A CG  1 
ATOM   3040 C  CD  . ARG A 1 390 ? 2.593  66.699 14.775  1.00 27.04 ? 412  ARG A CD  1 
ATOM   3041 N  NE  . ARG A 1 390 ? 4.045  66.785 14.720  1.00 32.21 ? 412  ARG A NE  1 
ATOM   3042 C  CZ  . ARG A 1 390 ? 4.761  67.168 13.657  1.00 33.37 ? 412  ARG A CZ  1 
ATOM   3043 N  NH1 . ARG A 1 390 ? 4.180  67.585 12.515  1.00 33.27 ? 412  ARG A NH1 1 
ATOM   3044 N  NH2 . ARG A 1 390 ? 6.081  67.156 13.753  1.00 31.15 ? 412  ARG A NH2 1 
ATOM   3045 N  N   . LEU A 1 391 ? 5.113  62.727 13.283  1.00 22.69 ? 413  LEU A N   1 
ATOM   3046 C  CA  . LEU A 1 391 ? 6.260  62.826 12.353  1.00 22.56 ? 413  LEU A CA  1 
ATOM   3047 C  C   . LEU A 1 391 ? 6.200  61.814 11.211  1.00 22.79 ? 413  LEU A C   1 
ATOM   3048 O  O   . LEU A 1 391 ? 6.481  62.126 10.059  1.00 22.08 ? 413  LEU A O   1 
ATOM   3049 C  CB  . LEU A 1 391 ? 7.608  62.675 13.103  1.00 21.74 ? 413  LEU A CB  1 
ATOM   3050 C  CG  . LEU A 1 391 ? 8.032  63.845 13.982  1.00 23.56 ? 413  LEU A CG  1 
ATOM   3051 C  CD1 . LEU A 1 391 ? 9.299  63.460 14.863  1.00 26.23 ? 413  LEU A CD1 1 
ATOM   3052 C  CD2 . LEU A 1 391 ? 8.295  65.089 13.082  1.00 24.96 ? 413  LEU A CD2 1 
ATOM   3053 N  N   . LEU A 1 392 ? 5.822  60.592 11.545  1.00 22.30 ? 414  LEU A N   1 
ATOM   3054 C  CA  . LEU A 1 392 ? 5.808  59.499 10.578  1.00 22.33 ? 414  LEU A CA  1 
ATOM   3055 C  C   . LEU A 1 392 ? 4.651  59.762 9.598   1.00 22.76 ? 414  LEU A C   1 
ATOM   3056 O  O   . LEU A 1 392 ? 4.759  59.559 8.369   1.00 23.13 ? 414  LEU A O   1 
ATOM   3057 C  CB  . LEU A 1 392 ? 5.579  58.191 11.318  1.00 22.16 ? 414  LEU A CB  1 
ATOM   3058 C  CG  . LEU A 1 392 ? 6.823  57.605 11.959  1.00 25.01 ? 414  LEU A CG  1 
ATOM   3059 C  CD1 . LEU A 1 392 ? 6.357  56.499 12.912  1.00 21.69 ? 414  LEU A CD1 1 
ATOM   3060 C  CD2 . LEU A 1 392 ? 7.897  57.180 10.847  1.00 21.40 ? 414  LEU A CD2 1 
ATOM   3061 N  N   . ALA A 1 393 ? 3.548  60.223 10.151  1.00 22.13 ? 415  ALA A N   1 
ATOM   3062 C  CA  . ALA A 1 393 ? 2.391  60.618 9.317   1.00 21.45 ? 415  ALA A CA  1 
ATOM   3063 C  C   . ALA A 1 393 ? 2.796  61.804 8.429   1.00 21.03 ? 415  ALA A C   1 
ATOM   3064 O  O   . ALA A 1 393 ? 2.437  61.862 7.241   1.00 22.11 ? 415  ALA A O   1 
ATOM   3065 C  CB  . ALA A 1 393 ? 1.183  60.983 10.215  1.00 20.70 ? 415  ALA A CB  1 
ATOM   3066 N  N   . SER A 1 394 ? 3.535  62.773 8.956   1.00 21.03 ? 416  SER A N   1 
ATOM   3067 C  CA  . SER A 1 394 ? 4.018  63.947 8.169   1.00 20.76 ? 416  SER A CA  1 
ATOM   3068 C  C   . SER A 1 394 ? 5.006  63.545 7.068   1.00 21.41 ? 416  SER A C   1 
ATOM   3069 O  O   . SER A 1 394 ? 4.908  63.980 5.914   1.00 22.79 ? 416  SER A O   1 
ATOM   3070 C  CB  . SER A 1 394 ? 4.608  65.044 9.072   1.00 21.20 ? 416  SER A CB  1 
ATOM   3071 O  OG  . SER A 1 394 ? 5.062  66.152 8.283   1.00 23.31 ? 416  SER A OG  1 
ATOM   3072 N  N   . GLY A 1 395 ? 5.936  62.693 7.416   1.00 21.64 ? 417  GLY A N   1 
ATOM   3073 C  CA  . GLY A 1 395 ? 6.887  62.076 6.468   1.00 21.70 ? 417  GLY A CA  1 
ATOM   3074 C  C   . GLY A 1 395 ? 6.216  61.375 5.291   1.00 23.28 ? 417  GLY A C   1 
ATOM   3075 O  O   . GLY A 1 395 ? 6.482  61.673 4.109   1.00 21.10 ? 417  GLY A O   1 
ATOM   3076 N  N   . ASN A 1 396 ? 5.281  60.508 5.627   1.00 21.93 ? 418  ASN A N   1 
ATOM   3077 C  CA  . ASN A 1 396 ? 4.598  59.733 4.635   1.00 23.01 ? 418  ASN A CA  1 
ATOM   3078 C  C   . ASN A 1 396 ? 3.858  60.686 3.687   1.00 23.18 ? 418  ASN A C   1 
ATOM   3079 O  O   . ASN A 1 396 ? 3.981  60.554 2.467   1.00 23.46 ? 418  ASN A O   1 
ATOM   3080 C  CB  . ASN A 1 396 ? 3.626  58.770 5.288   1.00 22.53 ? 418  ASN A CB  1 
ATOM   3081 C  CG  . ASN A 1 396 ? 2.974  57.867 4.259   1.00 24.34 ? 418  ASN A CG  1 
ATOM   3082 O  OD1 . ASN A 1 396 ? 3.654  57.161 3.531   1.00 21.65 ? 418  ASN A OD1 1 
ATOM   3083 N  ND2 . ASN A 1 396 ? 1.664  57.933 4.165   1.00 20.67 ? 418  ASN A ND2 1 
ATOM   3084 N  N   . GLU A 1 397 ? 3.199  61.696 4.251   1.00 23.44 ? 419  GLU A N   1 
ATOM   3085 C  CA  . GLU A 1 397 ? 2.524  62.708 3.425   1.00 23.44 ? 419  GLU A CA  1 
ATOM   3086 C  C   . GLU A 1 397 ? 3.473  63.407 2.451   1.00 22.58 ? 419  GLU A C   1 
ATOM   3087 O  O   . GLU A 1 397 ? 3.109  63.621 1.309   1.00 22.02 ? 419  GLU A O   1 
ATOM   3088 C  CB  . GLU A 1 397 ? 1.741  63.718 4.273   1.00 25.40 ? 419  GLU A CB  1 
ATOM   3089 C  CG  . GLU A 1 397 ? 1.132  64.921 3.461   1.00 23.24 ? 419  GLU A CG  1 
ATOM   3090 C  CD  . GLU A 1 397 ? 0.074  64.492 2.412   1.00 26.24 ? 419  GLU A CD  1 
ATOM   3091 O  OE1 . GLU A 1 397 ? -0.147 63.293 2.311   1.00 25.12 ? 419  GLU A OE1 1 
ATOM   3092 O  OE2 . GLU A 1 397 ? -0.520 65.362 1.670   1.00 28.38 ? 419  GLU A OE2 1 
ATOM   3093 N  N   . GLU A 1 398 ? 4.692  63.741 2.880   1.00 21.68 ? 420  GLU A N   1 
ATOM   3094 C  CA  . GLU A 1 398 ? 5.663  64.327 1.945   1.00 22.85 ? 420  GLU A CA  1 
ATOM   3095 C  C   . GLU A 1 398 ? 5.999  63.297 0.871   1.00 22.46 ? 420  GLU A C   1 
ATOM   3096 O  O   . GLU A 1 398 ? 6.164  63.668 -0.277  1.00 23.22 ? 420  GLU A O   1 
ATOM   3097 C  CB  . GLU A 1 398 ? 6.914  64.848 2.629   1.00 22.90 ? 420  GLU A CB  1 
ATOM   3098 C  CG  . GLU A 1 398 ? 6.647  66.145 3.385   1.00 24.46 ? 420  GLU A CG  1 
ATOM   3099 C  CD  . GLU A 1 398 ? 6.457  67.306 2.411   1.00 27.27 ? 420  GLU A CD  1 
ATOM   3100 O  OE1 . GLU A 1 398 ? 7.304  67.506 1.536   1.00 29.88 ? 420  GLU A OE1 1 
ATOM   3101 O  OE2 . GLU A 1 398 ? 5.447  67.995 2.502   1.00 29.26 ? 420  GLU A OE2 1 
ATOM   3102 N  N   . ALA A 1 399 ? 6.057  62.026 1.253   1.00 24.45 ? 421  ALA A N   1 
ATOM   3103 C  CA  . ALA A 1 399 ? 6.550  60.945 0.354   1.00 23.56 ? 421  ALA A CA  1 
ATOM   3104 C  C   . ALA A 1 399 ? 5.467  60.709 -0.666  1.00 23.31 ? 421  ALA A C   1 
ATOM   3105 O  O   . ALA A 1 399 ? 5.743  60.657 -1.872  1.00 24.06 ? 421  ALA A O   1 
ATOM   3106 C  CB  . ALA A 1 399 ? 6.850  59.641 1.127   1.00 25.14 ? 421  ALA A CB  1 
ATOM   3107 N  N   . GLN A 1 400 ? 4.222  60.692 -0.210  1.00 24.52 ? 422  GLN A N   1 
ATOM   3108 C  CA  . GLN A 1 400 ? 3.073  60.580 -1.114  1.00 23.86 ? 422  GLN A CA  1 
ATOM   3109 C  C   . GLN A 1 400 ? 2.919  61.751 -2.077  1.00 24.35 ? 422  GLN A C   1 
ATOM   3110 O  O   . GLN A 1 400 ? 2.714  61.536 -3.289  1.00 23.17 ? 422  GLN A O   1 
ATOM   3111 C  CB  . GLN A 1 400 ? 1.808  60.323 -0.307  1.00 25.21 ? 422  GLN A CB  1 
ATOM   3112 C  CG  . GLN A 1 400 ? 1.810  58.932 0.360   1.00 23.84 ? 422  GLN A CG  1 
ATOM   3113 C  CD  . GLN A 1 400 ? 1.706  57.778 -0.659  1.00 26.75 ? 422  GLN A CD  1 
ATOM   3114 O  OE1 . GLN A 1 400 ? 0.781  56.949 -0.581  1.00 29.68 ? 422  GLN A OE1 1 
ATOM   3115 N  NE2 . GLN A 1 400 ? 2.684  57.675 -1.553  1.00 27.51 ? 422  GLN A NE2 1 
ATOM   3116 N  N   . LYS A 1 401 ? 3.146  62.975 -1.594  1.00 22.84 ? 423  LYS A N   1 
ATOM   3117 C  CA  . LYS A 1 401 ? 3.148  64.100 -2.514  1.00 22.37 ? 423  LYS A CA  1 
ATOM   3118 C  C   . LYS A 1 401 ? 4.217  63.938 -3.575  1.00 21.82 ? 423  LYS A C   1 
ATOM   3119 O  O   . LYS A 1 401 ? 3.997  64.295 -4.733  1.00 22.87 ? 423  LYS A O   1 
ATOM   3120 C  CB  . LYS A 1 401 ? 3.458  65.376 -1.765  1.00 24.32 ? 423  LYS A CB  1 
ATOM   3121 C  CG  . LYS A 1 401 ? 2.317  65.887 -0.955  1.00 23.71 ? 423  LYS A CG  1 
ATOM   3122 C  CD  . LYS A 1 401 ? 2.814  67.038 -0.122  1.00 28.40 ? 423  LYS A CD  1 
ATOM   3123 C  CE  . LYS A 1 401 ? 1.909  68.241 -0.264  1.00 37.96 ? 423  LYS A CE  1 
ATOM   3124 N  NZ  . LYS A 1 401 ? 2.314  69.310 0.721   1.00 39.76 ? 423  LYS A NZ  1 
ATOM   3125 N  N   . ALA A 1 402 ? 5.386  63.420 -3.168  1.00 21.46 ? 424  ALA A N   1 
ATOM   3126 C  CA  . ALA A 1 402 ? 6.469  63.091 -4.110  1.00 21.04 ? 424  ALA A CA  1 
ATOM   3127 C  C   . ALA A 1 402 ? 5.976  62.097 -5.172  1.00 20.93 ? 424  ALA A C   1 
ATOM   3128 O  O   . ALA A 1 402 ? 6.166  62.306 -6.363  1.00 20.89 ? 424  ALA A O   1 
ATOM   3129 C  CB  . ALA A 1 402 ? 7.673  62.535 -3.366  1.00 20.63 ? 424  ALA A CB  1 
ATOM   3130 N  N   . ARG A 1 403 ? 5.324  61.034 -4.736  1.00 20.08 ? 425  ARG A N   1 
ATOM   3131 C  CA  . ARG A 1 403 ? 4.891  59.984 -5.652  1.00 21.00 ? 425  ARG A CA  1 
ATOM   3132 C  C   . ARG A 1 403 ? 3.819  60.390 -6.608  1.00 20.79 ? 425  ARG A C   1 
ATOM   3133 O  O   . ARG A 1 403 ? 3.834  59.903 -7.734  1.00 20.95 ? 425  ARG A O   1 
ATOM   3134 C  CB  . ARG A 1 403 ? 4.422  58.737 -4.882  1.00 20.67 ? 425  ARG A CB  1 
ATOM   3135 C  CG  . ARG A 1 403 ? 5.560  58.180 -3.907  1.00 22.11 ? 425  ARG A CG  1 
ATOM   3136 C  CD  . ARG A 1 403 ? 5.303  56.793 -3.436  1.00 21.82 ? 425  ARG A CD  1 
ATOM   3137 N  NE  . ARG A 1 403 ? 5.142  55.881 -4.574  1.00 20.43 ? 425  ARG A NE  1 
ATOM   3138 C  CZ  . ARG A 1 403 ? 4.192  54.945 -4.622  1.00 26.83 ? 425  ARG A CZ  1 
ATOM   3139 N  NH1 . ARG A 1 403 ? 3.305  54.812 -3.621  1.00 25.57 ? 425  ARG A NH1 1 
ATOM   3140 N  NH2 . ARG A 1 403 ? 4.095  54.150 -5.679  1.00 25.66 ? 425  ARG A NH2 1 
ATOM   3141 N  N   . ILE A 1 404 ? 2.880  61.236 -6.175  1.00 22.07 ? 426  ILE A N   1 
ATOM   3142 C  CA  . ILE A 1 404 ? 1.856  61.716 -7.097  1.00 21.92 ? 426  ILE A CA  1 
ATOM   3143 C  C   . ILE A 1 404 ? 2.525  62.522 -8.244  1.00 21.47 ? 426  ILE A C   1 
ATOM   3144 O  O   . ILE A 1 404 ? 2.243  62.284 -9.418  1.00 21.41 ? 426  ILE A O   1 
ATOM   3145 C  CB  . ILE A 1 404 ? 0.777  62.500 -6.380  1.00 23.60 ? 426  ILE A CB  1 
ATOM   3146 C  CG1 . ILE A 1 404 ? -0.007 61.551 -5.450  1.00 23.95 ? 426  ILE A CG1 1 
ATOM   3147 C  CG2 . ILE A 1 404 ? -0.175 63.214 -7.422  1.00 22.23 ? 426  ILE A CG2 1 
ATOM   3148 C  CD1 . ILE A 1 404 ? -0.848 62.192 -4.363  1.00 26.15 ? 426  ILE A CD1 1 
ATOM   3149 N  N   . LYS A 1 405 ? 3.424  63.443 -7.896  1.00 21.07 ? 427  LYS A N   1 
ATOM   3150 C  CA  . LYS A 1 405 ? 4.236  64.211 -8.862  1.00 21.74 ? 427  LYS A CA  1 
ATOM   3151 C  C   . LYS A 1 405 ? 5.083  63.307 -9.730  1.00 21.20 ? 427  LYS A C   1 
ATOM   3152 O  O   . LYS A 1 405 ? 5.308  63.596 -10.918 1.00 23.33 ? 427  LYS A O   1 
ATOM   3153 C  CB  . LYS A 1 405 ? 5.162  65.207 -8.136  1.00 21.78 ? 427  LYS A CB  1 
ATOM   3154 C  CG  . LYS A 1 405 ? 4.345  66.264 -7.402  1.00 23.88 ? 427  LYS A CG  1 
ATOM   3155 C  CD  . LYS A 1 405 ? 5.148  67.423 -6.954  1.00 26.40 ? 427  LYS A CD  1 
ATOM   3156 C  CE  . LYS A 1 405 ? 4.228  68.322 -6.158  1.00 32.15 ? 427  LYS A CE  1 
ATOM   3157 N  NZ  . LYS A 1 405 ? 4.935  69.401 -5.389  1.00 34.52 ? 427  LYS A NZ  1 
ATOM   3158 N  N   . LEU A 1 406 ? 5.546  62.202 -9.179  1.00 22.26 ? 428  LEU A N   1 
ATOM   3159 C  CA  . LEU A 1 406 ? 6.423  61.266 -9.926  1.00 23.11 ? 428  LEU A CA  1 
ATOM   3160 C  C   . LEU A 1 406 ? 5.645  60.564 -10.982 1.00 24.30 ? 428  LEU A C   1 
ATOM   3161 O  O   . LEU A 1 406 ? 6.181  60.302 -12.071 1.00 24.16 ? 428  LEU A O   1 
ATOM   3162 C  CB  . LEU A 1 406 ? 7.092  60.242 -8.973  1.00 22.61 ? 428  LEU A CB  1 
ATOM   3163 C  CG  . LEU A 1 406 ? 8.435  60.798 -8.438  1.00 21.15 ? 428  LEU A CG  1 
ATOM   3164 C  CD1 . LEU A 1 406 ? 8.811  60.002 -7.219  1.00 18.25 ? 428  LEU A CD1 1 
ATOM   3165 C  CD2 . LEU A 1 406 ? 9.634  60.849 -9.494  1.00 22.23 ? 428  LEU A CD2 1 
ATOM   3166 N  N   . VAL A 1 407 ? 4.358  60.281 -10.701 1.00 23.09 ? 429  VAL A N   1 
ATOM   3167 C  CA  . VAL A 1 407 ? 3.528  59.513 -11.650 1.00 25.92 ? 429  VAL A CA  1 
ATOM   3168 C  C   . VAL A 1 407 ? 3.482  60.283 -12.957 1.00 26.53 ? 429  VAL A C   1 
ATOM   3169 O  O   . VAL A 1 407 ? 3.659  59.729 -14.050 1.00 26.09 ? 429  VAL A O   1 
ATOM   3170 C  CB  . VAL A 1 407 ? 2.076  59.259 -11.119 1.00 26.28 ? 429  VAL A CB  1 
ATOM   3171 C  CG1 . VAL A 1 407 ? 1.184  58.606 -12.223 1.00 27.55 ? 429  VAL A CG1 1 
ATOM   3172 C  CG2 . VAL A 1 407 ? 2.096  58.420 -9.878  1.00 27.08 ? 429  VAL A CG2 1 
ATOM   3173 N  N   . LYS A 1 408 ? 3.296  61.577 -12.807 1.00 25.63 ? 430  LYS A N   1 
ATOM   3174 C  CA  . LYS A 1 408 ? 3.259  62.497 -13.931 1.00 26.25 ? 430  LYS A CA  1 
ATOM   3175 C  C   . LYS A 1 408 ? 4.576  62.548 -14.692 1.00 24.36 ? 430  LYS A C   1 
ATOM   3176 O  O   . LYS A 1 408 ? 4.565  62.614 -15.920 1.00 23.63 ? 430  LYS A O   1 
ATOM   3177 C  CB  . LYS A 1 408 ? 2.911  63.894 -13.427 1.00 26.77 ? 430  LYS A CB  1 
ATOM   3178 C  CG  . LYS A 1 408 ? 1.498  64.005 -12.892 1.00 32.57 ? 430  LYS A CG  1 
ATOM   3179 C  CD  . LYS A 1 408 ? 1.262  65.464 -12.521 1.00 36.64 ? 430  LYS A CD  1 
ATOM   3180 C  CE  . LYS A 1 408 ? 0.000  66.033 -13.129 1.00 38.73 ? 430  LYS A CE  1 
ATOM   3181 N  NZ  . LYS A 1 408 ? 0.030  67.558 -13.303 1.00 38.48 ? 430  LYS A NZ  1 
ATOM   3182 N  N   . VAL A 1 409 ? 5.700  62.587 -13.974 1.00 22.87 ? 431  VAL A N   1 
ATOM   3183 C  CA  . VAL A 1 409 ? 7.011  62.664 -14.631 1.00 23.54 ? 431  VAL A CA  1 
ATOM   3184 C  C   . VAL A 1 409 ? 7.246  61.348 -15.397 1.00 23.88 ? 431  VAL A C   1 
ATOM   3185 O  O   . VAL A 1 409 ? 7.676  61.345 -16.569 1.00 25.22 ? 431  VAL A O   1 
ATOM   3186 C  CB  . VAL A 1 409 ? 8.183  62.946 -13.650 1.00 22.88 ? 431  VAL A CB  1 
ATOM   3187 C  CG1 . VAL A 1 409 ? 9.544  62.788 -14.373 1.00 21.98 ? 431  VAL A CG1 1 
ATOM   3188 C  CG2 . VAL A 1 409 ? 8.065  64.377 -13.038 1.00 23.13 ? 431  VAL A CG2 1 
ATOM   3189 N  N   . LEU A 1 410 ? 6.971  60.243 -14.737 1.00 24.24 ? 432  LEU A N   1 
ATOM   3190 C  CA  . LEU A 1 410 ? 7.042  58.935 -15.406 1.00 24.66 ? 432  LEU A CA  1 
ATOM   3191 C  C   . LEU A 1 410 ? 6.112  58.920 -16.633 1.00 24.16 ? 432  LEU A C   1 
ATOM   3192 O  O   . LEU A 1 410 ? 6.525  58.465 -17.714 1.00 24.46 ? 432  LEU A O   1 
ATOM   3193 C  CB  . LEU A 1 410 ? 6.644  57.855 -14.434 1.00 24.93 ? 432  LEU A CB  1 
ATOM   3194 C  CG  . LEU A 1 410 ? 7.686  57.609 -13.322 1.00 24.51 ? 432  LEU A CG  1 
ATOM   3195 C  CD1 . LEU A 1 410 ? 7.059  56.698 -12.273 1.00 26.61 ? 432  LEU A CD1 1 
ATOM   3196 C  CD2 . LEU A 1 410 ? 8.962  56.973 -13.865 1.00 27.26 ? 432  LEU A CD2 1 
ATOM   3197 N  N   . ALA A 1 411 ? 4.887  59.426 -16.480 1.00 24.88 ? 433  ALA A N   1 
ATOM   3198 C  CA  . ALA A 1 411 ? 3.968  59.496 -17.638 1.00 23.42 ? 433  ALA A CA  1 
ATOM   3199 C  C   . ALA A 1 411 ? 4.621  60.259 -18.780 1.00 25.68 ? 433  ALA A C   1 
ATOM   3200 O  O   . ALA A 1 411 ? 4.613  59.818 -19.955 1.00 25.08 ? 433  ALA A O   1 
ATOM   3201 C  CB  . ALA A 1 411 ? 2.624  60.097 -17.263 1.00 23.87 ? 433  ALA A CB  1 
ATOM   3202 N  N   . LYS A 1 412 ? 5.222  61.393 -18.448 1.00 23.88 ? 434  LYS A N   1 
ATOM   3203 C  CA  . LYS A 1 412 ? 5.806  62.209 -19.485 1.00 25.78 ? 434  LYS A CA  1 
ATOM   3204 C  C   . LYS A 1 412 ? 6.839  61.450 -20.309 1.00 25.58 ? 434  LYS A C   1 
ATOM   3205 O  O   . LYS A 1 412 ? 6.933  61.652 -21.520 1.00 26.25 ? 434  LYS A O   1 
ATOM   3206 C  CB  . LYS A 1 412 ? 6.401  63.483 -18.910 1.00 25.02 ? 434  LYS A CB  1 
ATOM   3207 C  CG  . LYS A 1 412 ? 7.075  64.223 -19.999 1.00 26.41 ? 434  LYS A CG  1 
ATOM   3208 C  CD  . LYS A 1 412 ? 7.782  65.451 -19.537 1.00 30.83 ? 434  LYS A CD  1 
ATOM   3209 C  CE  . LYS A 1 412 ? 8.902  65.786 -20.533 1.00 35.27 ? 434  LYS A CE  1 
ATOM   3210 N  NZ  . LYS A 1 412 ? 9.485  67.106 -20.252 1.00 36.45 ? 434  LYS A NZ  1 
ATOM   3211 N  N   . TYR A 1 413 ? 7.554  60.536 -19.658 1.00 26.35 ? 435  TYR A N   1 
ATOM   3212 C  CA  . TYR A 1 413 ? 8.581  59.724 -20.351 1.00 27.10 ? 435  TYR A CA  1 
ATOM   3213 C  C   . TYR A 1 413 ? 8.153  58.299 -20.776 1.00 26.89 ? 435  TYR A C   1 
ATOM   3214 O  O   . TYR A 1 413 ? 9.007  57.468 -21.033 1.00 27.29 ? 435  TYR A O   1 
ATOM   3215 C  CB  . TYR A 1 413 ? 9.842  59.683 -19.500 1.00 27.37 ? 435  TYR A CB  1 
ATOM   3216 C  CG  . TYR A 1 413 ? 10.491 61.025 -19.443 1.00 28.45 ? 435  TYR A CG  1 
ATOM   3217 C  CD1 . TYR A 1 413 ? 11.301 61.463 -20.508 1.00 29.88 ? 435  TYR A CD1 1 
ATOM   3218 C  CD2 . TYR A 1 413 ? 10.213 61.904 -18.410 1.00 28.54 ? 435  TYR A CD2 1 
ATOM   3219 C  CE1 . TYR A 1 413 ? 11.892 62.711 -20.483 1.00 31.38 ? 435  TYR A CE1 1 
ATOM   3220 C  CE2 . TYR A 1 413 ? 10.787 63.191 -18.387 1.00 29.64 ? 435  TYR A CE2 1 
ATOM   3221 C  CZ  . TYR A 1 413 ? 11.623 63.575 -19.424 1.00 28.35 ? 435  TYR A CZ  1 
ATOM   3222 O  OH  . TYR A 1 413 ? 12.182 64.824 -19.467 1.00 29.46 ? 435  TYR A OH  1 
ATOM   3223 N  N   . GLY A 1 414 ? 6.852  58.044 -20.873 1.00 28.58 ? 436  GLY A N   1 
ATOM   3224 C  CA  . GLY A 1 414 ? 6.313  56.784 -21.396 1.00 28.25 ? 436  GLY A CA  1 
ATOM   3225 C  C   . GLY A 1 414 ? 6.211  55.637 -20.399 1.00 28.91 ? 436  GLY A C   1 
ATOM   3226 O  O   . GLY A 1 414 ? 6.010  54.459 -20.781 1.00 31.49 ? 436  GLY A O   1 
ATOM   3227 N  N   . ALA A 1 415 ? 6.318  55.953 -19.113 1.00 25.31 ? 437  ALA A N   1 
ATOM   3228 C  CA  . ALA A 1 415 ? 6.467  54.868 -18.161 1.00 25.43 ? 437  ALA A CA  1 
ATOM   3229 C  C   . ALA A 1 415 ? 5.478  54.930 -17.024 1.00 24.15 ? 437  ALA A C   1 
ATOM   3230 O  O   . ALA A 1 415 ? 5.831  54.649 -15.896 1.00 24.93 ? 437  ALA A O   1 
ATOM   3231 C  CB  . ALA A 1 415 ? 7.870  54.775 -17.644 1.00 24.72 ? 437  ALA A CB  1 
ATOM   3232 N  N   . ILE A 1 416 ? 4.244  55.291 -17.341 1.00 25.27 ? 438  ILE A N   1 
ATOM   3233 C  CA  . ILE A 1 416 ? 3.252  55.537 -16.281 1.00 27.06 ? 438  ILE A CA  1 
ATOM   3234 C  C   . ILE A 1 416 ? 2.967  54.233 -15.508 1.00 27.41 ? 438  ILE A C   1 
ATOM   3235 O  O   . ILE A 1 416 ? 2.625  54.271 -14.315 1.00 29.34 ? 438  ILE A O   1 
ATOM   3236 C  CB  . ILE A 1 416 ? 1.898  56.126 -16.819 1.00 26.79 ? 438  ILE A CB  1 
ATOM   3237 C  CG1 . ILE A 1 416 ? 1.083  56.759 -15.656 1.00 27.59 ? 438  ILE A CG1 1 
ATOM   3238 C  CG2 . ILE A 1 416 ? 1.004  54.998 -17.465 1.00 29.06 ? 438  ILE A CG2 1 
ATOM   3239 C  CD1 . ILE A 1 416 ? 0.028  57.724 -16.096 1.00 28.77 ? 438  ILE A CD1 1 
ATOM   3240 N  N   . ASP A 1 417 ? 3.105  53.093 -16.177 1.00 27.24 ? 439  ASP A N   1 
ATOM   3241 C  CA  . ASP A 1 417 ? 2.790  51.802 -15.547 1.00 28.95 ? 439  ASP A CA  1 
ATOM   3242 C  C   . ASP A 1 417 ? 3.964  51.149 -14.806 1.00 29.02 ? 439  ASP A C   1 
ATOM   3243 O  O   . ASP A 1 417 ? 3.840  50.012 -14.316 1.00 30.17 ? 439  ASP A O   1 
ATOM   3244 C  CB  . ASP A 1 417 ? 2.238  50.851 -16.582 1.00 29.95 ? 439  ASP A CB  1 
ATOM   3245 C  CG  . ASP A 1 417 ? 0.917  51.330 -17.127 1.00 30.75 ? 439  ASP A CG  1 
ATOM   3246 O  OD1 . ASP A 1 417 ? 0.078  51.753 -16.298 1.00 33.20 ? 439  ASP A OD1 1 
ATOM   3247 O  OD2 . ASP A 1 417 ? 0.735  51.300 -18.363 1.00 37.36 ? 439  ASP A OD2 1 
ATOM   3248 N  N   . TYR A 1 418 ? 5.074  51.883 -14.706 1.00 28.24 ? 440  TYR A N   1 
ATOM   3249 C  CA  . TYR A 1 418 ? 6.245  51.435 -13.948 1.00 26.94 ? 440  TYR A CA  1 
ATOM   3250 C  C   . TYR A 1 418 ? 5.895  51.038 -12.526 1.00 25.89 ? 440  TYR A C   1 
ATOM   3251 O  O   . TYR A 1 418 ? 5.214  51.780 -11.843 1.00 25.68 ? 440  TYR A O   1 
ATOM   3252 C  CB  . TYR A 1 418 ? 7.320  52.519 -13.915 1.00 26.94 ? 440  TYR A CB  1 
ATOM   3253 C  CG  . TYR A 1 418 ? 8.520  52.190 -13.037 1.00 25.11 ? 440  TYR A CG  1 
ATOM   3254 C  CD1 . TYR A 1 418 ? 9.507  51.305 -13.474 1.00 27.48 ? 440  TYR A CD1 1 
ATOM   3255 C  CD2 . TYR A 1 418 ? 8.710  52.837 -11.836 1.00 23.80 ? 440  TYR A CD2 1 
ATOM   3256 C  CE1 . TYR A 1 418 ? 10.643 51.022 -12.664 1.00 27.04 ? 440  TYR A CE1 1 
ATOM   3257 C  CE2 . TYR A 1 418 ? 9.822  52.583 -11.022 1.00 25.26 ? 440  TYR A CE2 1 
ATOM   3258 C  CZ  . TYR A 1 418 ? 10.782 51.675 -11.435 1.00 26.55 ? 440  TYR A CZ  1 
ATOM   3259 O  OH  . TYR A 1 418 ? 11.893 51.432 -10.655 1.00 28.22 ? 440  TYR A OH  1 
ATOM   3260 N  N   . VAL A 1 419 ? 6.402  49.888 -12.108 1.00 25.43 ? 441  VAL A N   1 
ATOM   3261 C  CA  . VAL A 1 419 ? 6.231  49.401 -10.750 1.00 24.01 ? 441  VAL A CA  1 
ATOM   3262 C  C   . VAL A 1 419 ? 7.595  49.306 -10.072 1.00 24.61 ? 441  VAL A C   1 
ATOM   3263 O  O   . VAL A 1 419 ? 8.499  48.587 -10.549 1.00 24.02 ? 441  VAL A O   1 
ATOM   3264 C  CB  . VAL A 1 419 ? 5.528  48.000 -10.688 1.00 26.02 ? 441  VAL A CB  1 
ATOM   3265 C  CG1 . VAL A 1 419 ? 5.290  47.641 -9.234  1.00 24.82 ? 441  VAL A CG1 1 
ATOM   3266 C  CG2 . VAL A 1 419 ? 4.226  48.000 -11.446 1.00 23.56 ? 441  VAL A CG2 1 
ATOM   3267 N  N   . ALA A 1 420 ? 7.762  50.056 -8.983  1.00 23.56 ? 442  ALA A N   1 
ATOM   3268 C  CA  . ALA A 1 420 ? 9.067  50.165 -8.341  1.00 24.90 ? 442  ALA A CA  1 
ATOM   3269 C  C   . ALA A 1 420 ? 9.459  48.760 -7.890  1.00 22.82 ? 442  ALA A C   1 
ATOM   3270 O  O   . ALA A 1 420 ? 8.587  48.008 -7.402  1.00 21.24 ? 442  ALA A O   1 
ATOM   3271 C  CB  . ALA A 1 420 ? 8.981  51.107 -7.120  1.00 25.08 ? 442  ALA A CB  1 
ATOM   3272 N  N   . PRO A 1 421 ? 10.749 48.380 -8.032  1.00 24.18 ? 443  PRO A N   1 
ATOM   3273 C  CA  . PRO A 1 421 ? 11.012 47.014 -7.523  1.00 23.18 ? 443  PRO A CA  1 
ATOM   3274 C  C   . PRO A 1 421 ? 10.722 46.835 -6.044  1.00 25.74 ? 443  PRO A C   1 
ATOM   3275 O  O   . PRO A 1 421 ? 10.730 47.842 -5.270  1.00 24.00 ? 443  PRO A O   1 
ATOM   3276 C  CB  . PRO A 1 421 ? 12.508 46.837 -7.766  1.00 26.03 ? 443  PRO A CB  1 
ATOM   3277 C  CG  . PRO A 1 421 ? 13.037 48.202 -7.832  1.00 25.77 ? 443  PRO A CG  1 
ATOM   3278 C  CD  . PRO A 1 421 ? 11.971 48.974 -8.594  1.00 23.38 ? 443  PRO A CD  1 
ATOM   3279 N  N   . ASP A 1 422 ? 10.543 45.578 -5.632  1.00 26.26 ? 444  ASP A N   1 
ATOM   3280 C  CA  . ASP A 1 422 ? 10.384 45.256 -4.189  1.00 26.11 ? 444  ASP A CA  1 
ATOM   3281 C  C   . ASP A 1 422 ? 11.704 45.173 -3.444  1.00 26.34 ? 444  ASP A C   1 
ATOM   3282 O  O   . ASP A 1 422 ? 12.778 44.911 -4.030  1.00 26.64 ? 444  ASP A O   1 
ATOM   3283 C  CB  . ASP A 1 422 ? 9.632  43.930 -4.006  1.00 27.65 ? 444  ASP A CB  1 
ATOM   3284 C  CG  . ASP A 1 422 ? 8.238  43.982 -4.556  1.00 28.29 ? 444  ASP A CG  1 
ATOM   3285 O  OD1 . ASP A 1 422 ? 7.547  44.986 -4.298  1.00 25.17 ? 444  ASP A OD1 1 
ATOM   3286 O  OD2 . ASP A 1 422 ? 7.846  43.032 -5.283  1.00 25.52 ? 444  ASP A OD2 1 
ATOM   3287 N  N   . PHE A 1 423 ? 11.638 45.386 -2.131  1.00 24.04 ? 445  PHE A N   1 
ATOM   3288 C  CA  . PHE A 1 423 ? 12.838 45.485 -1.325  1.00 24.36 ? 445  PHE A CA  1 
ATOM   3289 C  C   . PHE A 1 423 ? 12.535 44.931 0.052   1.00 25.56 ? 445  PHE A C   1 
ATOM   3290 O  O   . PHE A 1 423 ? 12.857 45.535 1.076   1.00 25.27 ? 445  PHE A O   1 
ATOM   3291 C  CB  . PHE A 1 423 ? 13.406 46.946 -1.319  1.00 25.02 ? 445  PHE A CB  1 
ATOM   3292 C  CG  . PHE A 1 423 ? 12.338 48.047 -1.101  1.00 22.05 ? 445  PHE A CG  1 
ATOM   3293 C  CD1 . PHE A 1 423 ? 11.687 48.639 -2.195  1.00 22.06 ? 445  PHE A CD1 1 
ATOM   3294 C  CD2 . PHE A 1 423 ? 11.997 48.470 0.192   1.00 24.67 ? 445  PHE A CD2 1 
ATOM   3295 C  CE1 . PHE A 1 423 ? 10.732 49.633 -2.039  1.00 22.52 ? 445  PHE A CE1 1 
ATOM   3296 C  CE2 . PHE A 1 423 ? 11.031 49.470 0.372   1.00 26.45 ? 445  PHE A CE2 1 
ATOM   3297 C  CZ  . PHE A 1 423 ? 10.393 50.043 -0.724  1.00 24.40 ? 445  PHE A CZ  1 
ATOM   3298 N  N   . GLU A 1 424 ? 11.892 43.753 0.062   1.00 24.75 ? 446  GLU A N   1 
ATOM   3299 C  CA  . GLU A 1 424 ? 11.359 43.165 1.254   1.00 24.98 ? 446  GLU A CA  1 
ATOM   3300 C  C   . GLU A 1 424 ? 12.360 42.282 1.998   1.00 24.93 ? 446  GLU A C   1 
ATOM   3301 O  O   . GLU A 1 424 ? 12.006 41.717 3.053   1.00 25.03 ? 446  GLU A O   1 
ATOM   3302 C  CB  . GLU A 1 424 ? 10.064 42.393 0.924   1.00 26.10 ? 446  GLU A CB  1 
ATOM   3303 C  CG  . GLU A 1 424 ? 10.291 41.024 0.469   1.00 23.77 ? 446  GLU A CG  1 
ATOM   3304 C  CD  . GLU A 1 424 ? 10.811 40.842 -0.975  1.00 28.85 ? 446  GLU A CD  1 
ATOM   3305 O  OE1 . GLU A 1 424 ? 10.996 41.804 -1.751  1.00 29.27 ? 446  GLU A OE1 1 
ATOM   3306 O  OE2 . GLU A 1 424 ? 11.014 39.666 -1.333  1.00 33.24 ? 446  GLU A OE2 1 
ATOM   3307 N  N   . THR A 1 425 ? 13.551 42.094 1.414   1.00 23.83 ? 447  THR A N   1 
ATOM   3308 C  CA  . THR A 1 425 ? 14.648 41.447 2.111   1.00 24.85 ? 447  THR A CA  1 
ATOM   3309 C  C   . THR A 1 425 ? 15.871 42.373 2.097   1.00 24.64 ? 447  THR A C   1 
ATOM   3310 O  O   . THR A 1 425 ? 16.083 43.122 1.117   1.00 24.33 ? 447  THR A O   1 
ATOM   3311 C  CB  . THR A 1 425 ? 15.026 40.036 1.522   1.00 25.37 ? 447  THR A CB  1 
ATOM   3312 O  OG1 . THR A 1 425 ? 15.590 40.203 0.204   1.00 25.31 ? 447  THR A OG1 1 
ATOM   3313 C  CG2 . THR A 1 425 ? 13.820 39.068 1.516   1.00 26.46 ? 447  THR A CG2 1 
ATOM   3314 N  N   . LYS A 1 426 ? 16.702 42.320 3.144   1.00 24.39 ? 448  LYS A N   1 
ATOM   3315 C  CA  . LYS A 1 426 ? 18.007 43.045 3.082   1.00 24.67 ? 448  LYS A CA  1 
ATOM   3316 C  C   . LYS A 1 426 ? 18.840 42.780 1.814   1.00 24.88 ? 448  LYS A C   1 
ATOM   3317 O  O   . LYS A 1 426 ? 19.465 43.686 1.234   1.00 25.79 ? 448  LYS A O   1 
ATOM   3318 C  CB  . LYS A 1 426 ? 18.823 42.764 4.330   1.00 23.89 ? 448  LYS A CB  1 
ATOM   3319 C  CG  . LYS A 1 426 ? 20.186 43.380 4.402   1.00 22.67 ? 448  LYS A CG  1 
ATOM   3320 C  CD  . LYS A 1 426 ? 20.914 42.805 5.606   1.00 26.75 ? 448  LYS A CD  1 
ATOM   3321 C  CE  . LYS A 1 426 ? 22.310 43.397 5.818   1.00 26.78 ? 448  LYS A CE  1 
ATOM   3322 N  NZ  . LYS A 1 426 ? 22.928 42.834 7.057   1.00 26.74 ? 448  LYS A NZ  1 
ATOM   3323 N  N   . GLU A 1 427 ? 18.802 41.546 1.331   1.00 24.63 ? 449  GLU A N   1 
ATOM   3324 C  CA  . GLU A 1 427 ? 19.596 41.160 0.173   1.00 25.44 ? 449  GLU A CA  1 
ATOM   3325 C  C   . GLU A 1 427 ? 19.111 41.905 -1.055  1.00 24.82 ? 449  GLU A C   1 
ATOM   3326 O  O   . GLU A 1 427 ? 19.917 42.500 -1.833  1.00 23.52 ? 449  GLU A O   1 
ATOM   3327 C  CB  . GLU A 1 427 ? 19.485 39.632 -0.005  1.00 24.75 ? 449  GLU A CB  1 
ATOM   3328 C  CG  . GLU A 1 427 ? 20.187 38.875 1.180   1.00 28.90 ? 449  GLU A CG  1 
ATOM   3329 C  CD  . GLU A 1 427 ? 19.468 38.941 2.574   1.00 33.29 ? 449  GLU A CD  1 
ATOM   3330 O  OE1 . GLU A 1 427 ? 18.227 39.052 2.674   1.00 32.15 ? 449  GLU A OE1 1 
ATOM   3331 O  OE2 . GLU A 1 427 ? 20.170 38.871 3.626   1.00 39.93 ? 449  GLU A OE2 1 
ATOM   3332 N  N   . LYS A 1 428 ? 17.784 41.912 -1.202  1.00 24.86 ? 450  LYS A N   1 
ATOM   3333 C  CA  . LYS A 1 428 ? 17.156 42.503 -2.392  1.00 24.18 ? 450  LYS A CA  1 
ATOM   3334 C  C   . LYS A 1 428 ? 17.377 43.998 -2.342  1.00 25.25 ? 450  LYS A C   1 
ATOM   3335 O  O   . LYS A 1 428 ? 17.755 44.622 -3.356  1.00 25.20 ? 450  LYS A O   1 
ATOM   3336 C  CB  . LYS A 1 428 ? 15.695 42.115 -2.432  1.00 24.83 ? 450  LYS A CB  1 
ATOM   3337 C  CG  . LYS A 1 428 ? 15.460 40.724 -3.086  1.00 25.00 ? 450  LYS A CG  1 
ATOM   3338 C  CD  . LYS A 1 428 ? 13.967 40.306 -2.967  1.00 24.86 ? 450  LYS A CD  1 
ATOM   3339 C  CE  . LYS A 1 428 ? 12.975 41.106 -3.883  1.00 30.89 ? 450  LYS A CE  1 
ATOM   3340 N  NZ  . LYS A 1 428 ? 11.512 40.536 -4.177  1.00 27.87 ? 450  LYS A NZ  1 
ATOM   3341 N  N   . ALA A 1 429 ? 17.243 44.535 -1.128  1.00 23.68 ? 451  ALA A N   1 
ATOM   3342 C  CA  . ALA A 1 429 ? 17.448 45.954 -0.894  1.00 24.14 ? 451  ALA A CA  1 
ATOM   3343 C  C   . ALA A 1 429 ? 18.878 46.376 -1.145  1.00 23.65 ? 451  ALA A C   1 
ATOM   3344 O  O   . ALA A 1 429 ? 19.104 47.344 -1.869  1.00 24.72 ? 451  ALA A O   1 
ATOM   3345 C  CB  . ALA A 1 429 ? 16.878 46.388 0.505   1.00 24.11 ? 451  ALA A CB  1 
ATOM   3346 N  N   . GLN A 1 430 ? 19.868 45.611 -0.658  1.00 22.47 ? 452  GLN A N   1 
ATOM   3347 C  CA  . GLN A 1 430 ? 21.277 45.981 -0.900  1.00 24.85 ? 452  GLN A CA  1 
ATOM   3348 C  C   . GLN A 1 430 ? 21.656 45.847 -2.389  1.00 24.55 ? 452  GLN A C   1 
ATOM   3349 O  O   . GLN A 1 430 ? 22.491 46.571 -2.899  1.00 25.12 ? 452  GLN A O   1 
ATOM   3350 C  CB  . GLN A 1 430 ? 22.209 45.210 0.057   1.00 25.73 ? 452  GLN A CB  1 
ATOM   3351 C  CG  . GLN A 1 430 ? 21.974 45.561 1.554   1.00 24.88 ? 452  GLN A CG  1 
ATOM   3352 C  CD  . GLN A 1 430 ? 23.059 44.995 2.485   1.00 26.00 ? 452  GLN A CD  1 
ATOM   3353 O  OE1 . GLN A 1 430 ? 23.650 45.710 3.320   1.00 29.49 ? 452  GLN A OE1 1 
ATOM   3354 N  NE2 . GLN A 1 430 ? 23.347 43.725 2.325   1.00 22.48 ? 452  GLN A NE2 1 
ATOM   3355 N  N   . LYS A 1 431 ? 21.041 44.922 -3.105  1.00 25.96 ? 453  LYS A N   1 
ATOM   3356 C  CA  . LYS A 1 431 ? 21.251 44.843 -4.575  1.00 27.76 ? 453  LYS A CA  1 
ATOM   3357 C  C   . LYS A 1 431 ? 20.824 46.160 -5.250  1.00 27.27 ? 453  LYS A C   1 
ATOM   3358 O  O   . LYS A 1 431 ? 21.562 46.708 -6.065  1.00 28.93 ? 453  LYS A O   1 
ATOM   3359 C  CB  . LYS A 1 431 ? 20.446 43.711 -5.167  1.00 28.31 ? 453  LYS A CB  1 
ATOM   3360 C  CG  . LYS A 1 431 ? 20.872 43.224 -6.560  1.00 31.44 ? 453  LYS A CG  1 
ATOM   3361 C  CD  . LYS A 1 431 ? 19.896 42.119 -6.961  1.00 36.49 ? 453  LYS A CD  1 
ATOM   3362 C  CE  . LYS A 1 431 ? 20.550 41.018 -7.821  1.00 41.74 ? 453  LYS A CE  1 
ATOM   3363 N  NZ  . LYS A 1 431 ? 21.001 41.490 -9.165  1.00 41.80 ? 453  LYS A NZ  1 
ATOM   3364 N  N   . LEU A 1 432 ? 19.647 46.669 -4.877  1.00 27.38 ? 454  LEU A N   1 
ATOM   3365 C  CA  . LEU A 1 432 ? 19.134 47.923 -5.444  1.00 26.98 ? 454  LEU A CA  1 
ATOM   3366 C  C   . LEU A 1 432 ? 19.989 49.118 -5.102  1.00 26.59 ? 454  LEU A C   1 
ATOM   3367 O  O   . LEU A 1 432 ? 20.130 50.036 -5.909  1.00 28.15 ? 454  LEU A O   1 
ATOM   3368 C  CB  . LEU A 1 432 ? 17.704 48.197 -4.916  1.00 27.05 ? 454  LEU A CB  1 
ATOM   3369 C  CG  . LEU A 1 432 ? 16.590 47.241 -5.341  1.00 26.90 ? 454  LEU A CG  1 
ATOM   3370 C  CD1 . LEU A 1 432 ? 15.288 47.521 -4.582  1.00 23.37 ? 454  LEU A CD1 1 
ATOM   3371 C  CD2 . LEU A 1 432 ? 16.414 47.331 -6.842  1.00 29.62 ? 454  LEU A CD2 1 
ATOM   3372 N  N   . ALA A 1 433 ? 20.508 49.105 -3.879  1.00 27.33 ? 455  ALA A N   1 
ATOM   3373 C  CA  . ALA A 1 433 ? 21.385 50.141 -3.345  1.00 27.58 ? 455  ALA A CA  1 
ATOM   3374 C  C   . ALA A 1 433 ? 22.852 49.960 -3.792  1.00 28.35 ? 455  ALA A C   1 
ATOM   3375 O  O   . ALA A 1 433 ? 23.730 50.781 -3.473  1.00 28.46 ? 455  ALA A O   1 
ATOM   3376 C  CB  . ALA A 1 433 ? 21.246 50.164 -1.773  1.00 27.19 ? 455  ALA A CB  1 
ATOM   3377 N  N   . LYS A 1 434 ? 23.110 48.877 -4.534  1.00 28.33 ? 456  LYS A N   1 
ATOM   3378 C  CA  . LYS A 1 434 ? 24.437 48.576 -5.046  1.00 27.95 ? 456  LYS A CA  1 
ATOM   3379 C  C   . LYS A 1 434 ? 25.510 48.486 -3.943  1.00 27.57 ? 456  LYS A C   1 
ATOM   3380 O  O   . LYS A 1 434 ? 26.632 49.053 -4.059  1.00 27.10 ? 456  LYS A O   1 
ATOM   3381 C  CB  . LYS A 1 434 ? 24.813 49.579 -6.133  1.00 29.34 ? 456  LYS A CB  1 
ATOM   3382 C  CG  . LYS A 1 434 ? 23.806 49.566 -7.268  1.00 31.35 ? 456  LYS A CG  1 
ATOM   3383 C  CD  . LYS A 1 434 ? 23.968 50.782 -8.162  1.00 35.43 ? 456  LYS A CD  1 
ATOM   3384 C  CE  . LYS A 1 434 ? 23.041 50.686 -9.336  1.00 38.89 ? 456  LYS A CE  1 
ATOM   3385 N  NZ  . LYS A 1 434 ? 22.734 52.061 -9.754  1.00 44.80 ? 456  LYS A NZ  1 
ATOM   3386 N  N   . VAL A 1 435 ? 25.160 47.756 -2.894  1.00 26.96 ? 457  VAL A N   1 
ATOM   3387 C  CA  . VAL A 1 435 ? 26.084 47.504 -1.771  1.00 27.67 ? 457  VAL A CA  1 
ATOM   3388 C  C   . VAL A 1 435 ? 26.705 46.107 -1.874  1.00 28.68 ? 457  VAL A C   1 
ATOM   3389 O  O   . VAL A 1 435 ? 26.013 45.117 -1.717  1.00 28.31 ? 457  VAL A O   1 
ATOM   3390 C  CB  . VAL A 1 435 ? 25.380 47.594 -0.402  1.00 27.02 ? 457  VAL A CB  1 
ATOM   3391 C  CG1 . VAL A 1 435 ? 26.357 47.272 0.744   1.00 25.32 ? 457  VAL A CG1 1 
ATOM   3392 C  CG2 . VAL A 1 435 ? 24.799 48.968 -0.193  1.00 28.54 ? 457  VAL A CG2 1 
ATOM   3393 N  N   . ASP A 1 436 ? 28.006 46.063 -2.103  1.00 30.24 ? 458  ASP A N   1 
ATOM   3394 C  CA  . ASP A 1 436 ? 28.706 44.798 -2.200  1.00 31.60 ? 458  ASP A CA  1 
ATOM   3395 C  C   . ASP A 1 436 ? 29.132 44.380 -0.803  1.00 31.50 ? 458  ASP A C   1 
ATOM   3396 O  O   . ASP A 1 436 ? 30.305 44.476 -0.448  1.00 30.80 ? 458  ASP A O   1 
ATOM   3397 C  CB  . ASP A 1 436 ? 29.898 44.966 -3.142  1.00 32.60 ? 458  ASP A CB  1 
ATOM   3398 C  CG  . ASP A 1 436 ? 30.610 43.644 -3.435  1.00 35.01 ? 458  ASP A CG  1 
ATOM   3399 O  OD1 . ASP A 1 436 ? 30.178 42.573 -2.924  1.00 34.27 ? 458  ASP A OD1 1 
ATOM   3400 O  OD2 . ASP A 1 436 ? 31.614 43.711 -4.173  1.00 38.55 ? 458  ASP A OD2 1 
ATOM   3401 N  N   . MET A 1 437 ? 28.160 43.974 0.004   1.00 31.42 ? 459  MET A N   1 
ATOM   3402 C  CA  . MET A 1 437 ? 28.396 43.744 1.428   1.00 32.94 ? 459  MET A CA  1 
ATOM   3403 C  C   . MET A 1 437 ? 29.523 42.718 1.650   1.00 34.04 ? 459  MET A C   1 
ATOM   3404 O  O   . MET A 1 437 ? 30.430 42.945 2.458   1.00 34.14 ? 459  MET A O   1 
ATOM   3405 C  CB  . MET A 1 437 ? 27.091 43.397 2.157   1.00 33.03 ? 459  MET A CB  1 
ATOM   3406 C  CG  . MET A 1 437 ? 26.746 44.241 3.427   1.00 31.26 ? 459  MET A CG  1 
ATOM   3407 S  SD  . MET A 1 437 ? 26.038 43.200 4.764   1.00 34.07 ? 459  MET A SD  1 
ATOM   3408 C  CE  . MET A 1 437 ? 25.329 41.824 3.857   1.00 34.69 ? 459  MET A CE  1 
ATOM   3409 N  N   . GLU A 1 438 ? 29.480 41.614 0.913   1.00 35.72 ? 460  GLU A N   1 
ATOM   3410 C  CA  . GLU A 1 438 ? 30.537 40.589 0.920   1.00 37.64 ? 460  GLU A CA  1 
ATOM   3411 C  C   . GLU A 1 438 ? 31.951 41.150 0.818   1.00 35.88 ? 460  GLU A C   1 
ATOM   3412 O  O   . GLU A 1 438 ? 32.812 40.791 1.628   1.00 36.57 ? 460  GLU A O   1 
ATOM   3413 C  CB  . GLU A 1 438 ? 30.318 39.573 -0.201  1.00 38.12 ? 460  GLU A CB  1 
ATOM   3414 C  CG  . GLU A 1 438 ? 29.315 38.447 0.114   1.00 42.31 ? 460  GLU A CG  1 
ATOM   3415 C  CD  . GLU A 1 438 ? 29.208 37.444 -1.049  1.00 41.83 ? 460  GLU A CD  1 
ATOM   3416 O  OE1 . GLU A 1 438 ? 29.322 37.874 -2.225  1.00 48.56 ? 460  GLU A OE1 1 
ATOM   3417 O  OE2 . GLU A 1 438 ? 29.023 36.232 -0.796  1.00 48.38 ? 460  GLU A OE2 1 
ATOM   3418 N  N   . ALA A 1 439 ? 32.184 42.018 -0.172  1.00 34.21 ? 461  ALA A N   1 
ATOM   3419 C  CA  . ALA A 1 439 ? 33.460 42.740 -0.338  1.00 31.68 ? 461  ALA A CA  1 
ATOM   3420 C  C   . ALA A 1 439 ? 33.778 43.532 0.918   1.00 30.95 ? 461  ALA A C   1 
ATOM   3421 O  O   . ALA A 1 439 ? 34.898 43.525 1.416   1.00 30.30 ? 461  ALA A O   1 
ATOM   3422 C  CB  . ALA A 1 439 ? 33.393 43.674 -1.510  1.00 33.24 ? 461  ALA A CB  1 
ATOM   3423 N  N   . PHE A 1 440 ? 32.777 44.237 1.425   1.00 28.73 ? 462  PHE A N   1 
ATOM   3424 C  CA  . PHE A 1 440 ? 32.983 45.075 2.609   1.00 27.34 ? 462  PHE A CA  1 
ATOM   3425 C  C   . PHE A 1 440 ? 33.320 44.274 3.845   1.00 26.78 ? 462  PHE A C   1 
ATOM   3426 O  O   . PHE A 1 440 ? 34.186 44.654 4.641   1.00 26.60 ? 462  PHE A O   1 
ATOM   3427 C  CB  . PHE A 1 440 ? 31.726 45.937 2.858   1.00 26.74 ? 462  PHE A CB  1 
ATOM   3428 C  CG  . PHE A 1 440 ? 31.540 47.039 1.851   1.00 26.55 ? 462  PHE A CG  1 
ATOM   3429 C  CD1 . PHE A 1 440 ? 32.563 47.962 1.587   1.00 26.96 ? 462  PHE A CD1 1 
ATOM   3430 C  CD2 . PHE A 1 440 ? 30.303 47.184 1.183   1.00 26.38 ? 462  PHE A CD2 1 
ATOM   3431 C  CE1 . PHE A 1 440 ? 32.382 48.988 0.629   1.00 28.92 ? 462  PHE A CE1 1 
ATOM   3432 C  CE2 . PHE A 1 440 ? 30.106 48.235 0.224   1.00 25.02 ? 462  PHE A CE2 1 
ATOM   3433 C  CZ  . PHE A 1 440 ? 31.149 49.129 -0.046  1.00 24.83 ? 462  PHE A CZ  1 
ATOM   3434 N  N   . ILE A 1 441 ? 32.632 43.167 4.026   1.00 26.68 ? 463  ILE A N   1 
ATOM   3435 C  CA  . ILE A 1 441 ? 32.896 42.281 5.172   1.00 27.21 ? 463  ILE A CA  1 
ATOM   3436 C  C   . ILE A 1 441 ? 34.318 41.696 5.087   1.00 27.86 ? 463  ILE A C   1 
ATOM   3437 O  O   . ILE A 1 441 ? 35.056 41.657 6.106   1.00 26.86 ? 463  ILE A O   1 
ATOM   3438 C  CB  . ILE A 1 441 ? 31.863 41.142 5.253   1.00 27.90 ? 463  ILE A CB  1 
ATOM   3439 C  CG1 . ILE A 1 441 ? 30.512 41.694 5.695   1.00 27.10 ? 463  ILE A CG1 1 
ATOM   3440 C  CG2 . ILE A 1 441 ? 32.315 40.071 6.254   1.00 29.50 ? 463  ILE A CG2 1 
ATOM   3441 C  CD1 . ILE A 1 441 ? 29.356 40.692 5.598   1.00 26.71 ? 463  ILE A CD1 1 
ATOM   3442 N  N   . ALA A 1 442 ? 34.725 41.315 3.876   1.00 28.51 ? 464  ALA A N   1 
ATOM   3443 C  CA  . ALA A 1 442 ? 36.053 40.678 3.700   1.00 29.04 ? 464  ALA A CA  1 
ATOM   3444 C  C   . ALA A 1 442 ? 37.164 41.645 4.121   1.00 29.38 ? 464  ALA A C   1 
ATOM   3445 O  O   . ALA A 1 442 ? 38.039 41.306 4.915   1.00 29.50 ? 464  ALA A O   1 
ATOM   3446 C  CB  . ALA A 1 442 ? 36.215 40.211 2.257   1.00 29.74 ? 464  ALA A CB  1 
ATOM   3447 N  N   . GLU A 1 443 ? 37.094 42.864 3.587   1.00 29.42 ? 465  GLU A N   1 
ATOM   3448 C  CA  . GLU A 1 443 ? 37.977 43.992 3.812   1.00 29.84 ? 465  GLU A CA  1 
ATOM   3449 C  C   . GLU A 1 443 ? 37.978 44.332 5.308   1.00 28.34 ? 465  GLU A C   1 
ATOM   3450 O  O   . GLU A 1 443 ? 39.009 44.629 5.877   1.00 26.53 ? 465  GLU A O   1 
ATOM   3451 C  CB  . GLU A 1 443 ? 37.429 45.174 2.975   1.00 30.24 ? 465  GLU A CB  1 
ATOM   3452 C  CG  . GLU A 1 443 ? 38.208 46.498 2.999   1.00 33.27 ? 465  GLU A CG  1 
ATOM   3453 C  CD  . GLU A 1 443 ? 37.504 47.694 2.255   1.00 35.41 ? 465  GLU A CD  1 
ATOM   3454 O  OE1 . GLU A 1 443 ? 36.464 48.285 2.717   1.00 32.41 ? 465  GLU A OE1 1 
ATOM   3455 O  OE2 . GLU A 1 443 ? 38.074 48.087 1.218   1.00 40.60 ? 465  GLU A OE2 1 
ATOM   3456 N  N   . LYS A 1 444 ? 36.802 44.243 5.938   1.00 26.69 ? 466  LYS A N   1 
ATOM   3457 C  CA  . LYS A 1 444 ? 36.650 44.562 7.350   1.00 26.98 ? 466  LYS A CA  1 
ATOM   3458 C  C   . LYS A 1 444 ? 37.415 43.572 8.213   1.00 26.93 ? 466  LYS A C   1 
ATOM   3459 O  O   . LYS A 1 444 ? 38.169 43.968 9.079   1.00 25.95 ? 466  LYS A O   1 
ATOM   3460 C  CB  . LYS A 1 444 ? 35.160 44.495 7.739   1.00 25.79 ? 466  LYS A CB  1 
ATOM   3461 C  CG  . LYS A 1 444 ? 34.908 45.077 9.096   1.00 27.41 ? 466  LYS A CG  1 
ATOM   3462 C  CD  . LYS A 1 444 ? 35.309 46.517 9.159   1.00 31.52 ? 466  LYS A CD  1 
ATOM   3463 C  CE  . LYS A 1 444 ? 34.931 47.128 10.508  1.00 32.38 ? 466  LYS A CE  1 
ATOM   3464 N  NZ  . LYS A 1 444 ? 35.124 48.572 10.550  1.00 27.83 ? 466  LYS A NZ  1 
ATOM   3465 N  N   . LEU A 1 445 ? 37.213 42.276 7.943   1.00 26.77 ? 467  LEU A N   1 
ATOM   3466 C  CA  . LEU A 1 445 ? 37.844 41.199 8.731   1.00 28.27 ? 467  LEU A CA  1 
ATOM   3467 C  C   . LEU A 1 445 ? 39.351 41.292 8.726   1.00 28.75 ? 467  LEU A C   1 
ATOM   3468 O  O   . LEU A 1 445 ? 39.993 41.034 9.754   1.00 29.15 ? 467  LEU A O   1 
ATOM   3469 C  CB  . LEU A 1 445 ? 37.437 39.837 8.199   1.00 28.64 ? 467  LEU A CB  1 
ATOM   3470 C  CG  . LEU A 1 445 ? 35.972 39.450 8.371   1.00 27.63 ? 467  LEU A CG  1 
ATOM   3471 C  CD1 . LEU A 1 445 ? 35.730 38.057 7.715   1.00 29.49 ? 467  LEU A CD1 1 
ATOM   3472 C  CD2 . LEU A 1 445 ? 35.583 39.460 9.822   1.00 28.95 ? 467  LEU A CD2 1 
ATOM   3473 N  N   A LYS A 1 446 ? 39.894 41.615 7.548   0.50 29.33 ? 468  LYS A N   1 
ATOM   3474 N  N   B LYS A 1 446 ? 39.912 41.662 7.572   0.50 29.06 ? 468  LYS A N   1 
ATOM   3475 C  CA  A LYS A 1 446 ? 41.324 41.822 7.328   0.50 29.38 ? 468  LYS A CA  1 
ATOM   3476 C  CA  B LYS A 1 446 ? 41.359 41.827 7.378   0.50 28.78 ? 468  LYS A CA  1 
ATOM   3477 C  C   A LYS A 1 446 ? 41.819 42.909 8.275   0.50 29.35 ? 468  LYS A C   1 
ATOM   3478 C  C   B LYS A 1 446 ? 41.885 42.968 8.227   0.50 29.06 ? 468  LYS A C   1 
ATOM   3479 O  O   A LYS A 1 446 ? 42.822 42.729 8.966   0.50 28.63 ? 468  LYS A O   1 
ATOM   3480 O  O   B LYS A 1 446 ? 42.983 42.905 8.774   0.50 28.57 ? 468  LYS A O   1 
ATOM   3481 C  CB  A LYS A 1 446 ? 41.596 42.222 5.869   0.50 29.87 ? 468  LYS A CB  1 
ATOM   3482 C  CB  B LYS A 1 446 ? 41.673 42.126 5.910   0.50 29.25 ? 468  LYS A CB  1 
ATOM   3483 C  CG  A LYS A 1 446 ? 43.072 42.154 5.451   0.50 30.40 ? 468  LYS A CG  1 
ATOM   3484 C  CG  B LYS A 1 446 ? 41.808 40.909 5.026   0.50 28.54 ? 468  LYS A CG  1 
ATOM   3485 C  CD  A LYS A 1 446 ? 43.283 42.331 3.951   0.50 30.32 ? 468  LYS A CD  1 
ATOM   3486 C  CD  B LYS A 1 446 ? 40.821 39.862 5.409   0.50 27.90 ? 468  LYS A CD  1 
ATOM   3487 C  CE  A LYS A 1 446 ? 42.606 41.247 3.125   0.50 31.77 ? 468  LYS A CE  1 
ATOM   3488 C  CE  B LYS A 1 446 ? 39.993 39.396 4.269   0.50 27.37 ? 468  LYS A CE  1 
ATOM   3489 N  NZ  A LYS A 1 446 ? 42.983 41.294 1.667   0.50 33.60 ? 468  LYS A NZ  1 
ATOM   3490 N  NZ  B LYS A 1 446 ? 38.843 38.650 4.849   0.50 23.62 ? 468  LYS A NZ  1 
ATOM   3491 N  N   . PHE A 1 447 ? 41.082 44.023 8.312   1.00 28.47 ? 469  PHE A N   1 
ATOM   3492 C  CA  . PHE A 1 447 ? 41.383 45.139 9.229   1.00 28.10 ? 469  PHE A CA  1 
ATOM   3493 C  C   . PHE A 1 447 ? 41.371 44.677 10.697  1.00 28.28 ? 469  PHE A C   1 
ATOM   3494 O  O   . PHE A 1 447 ? 42.282 45.046 11.472  1.00 27.28 ? 469  PHE A O   1 
ATOM   3495 C  CB  . PHE A 1 447 ? 40.408 46.310 8.992   1.00 27.29 ? 469  PHE A CB  1 
ATOM   3496 C  CG  . PHE A 1 447 ? 40.184 47.182 10.201  1.00 25.29 ? 469  PHE A CG  1 
ATOM   3497 C  CD1 . PHE A 1 447 ? 41.101 48.203 10.563  1.00 23.74 ? 469  PHE A CD1 1 
ATOM   3498 C  CD2 . PHE A 1 447 ? 39.024 46.997 10.970  1.00 24.23 ? 469  PHE A CD2 1 
ATOM   3499 C  CE1 . PHE A 1 447 ? 40.863 49.018 11.715  1.00 23.10 ? 469  PHE A CE1 1 
ATOM   3500 C  CE2 . PHE A 1 447 ? 38.792 47.751 12.133  1.00 24.26 ? 469  PHE A CE2 1 
ATOM   3501 C  CZ  . PHE A 1 447 ? 39.701 48.768 12.492  1.00 25.84 ? 469  PHE A CZ  1 
ATOM   3502 N  N   . LYS A 1 448 ? 40.345 43.912 11.081  1.00 28.51 ? 470  LYS A N   1 
ATOM   3503 C  CA  . LYS A 1 448 ? 40.193 43.443 12.479  1.00 28.72 ? 470  LYS A CA  1 
ATOM   3504 C  C   . LYS A 1 448 ? 41.329 42.504 12.820  1.00 29.84 ? 470  LYS A C   1 
ATOM   3505 O  O   . LYS A 1 448 ? 41.808 42.461 13.972  1.00 29.35 ? 470  LYS A O   1 
ATOM   3506 C  CB  . LYS A 1 448 ? 38.880 42.711 12.711  1.00 28.57 ? 470  LYS A CB  1 
ATOM   3507 C  CG  . LYS A 1 448 ? 37.658 43.654 12.555  1.00 27.74 ? 470  LYS A CG  1 
ATOM   3508 C  CD  . LYS A 1 448 ? 36.316 42.987 12.886  1.00 27.35 ? 470  LYS A CD  1 
ATOM   3509 C  CE  . LYS A 1 448 ? 36.331 42.166 14.182  1.00 27.43 ? 470  LYS A CE  1 
ATOM   3510 N  NZ  . LYS A 1 448 ? 36.568 43.107 15.367  1.00 24.24 ? 470  LYS A NZ  1 
ATOM   3511 N  N   . GLN A 1 449 ? 41.709 41.725 11.811  1.00 29.53 ? 471  GLN A N   1 
ATOM   3512 C  CA  . GLN A 1 449 ? 42.741 40.707 12.006  1.00 31.58 ? 471  GLN A CA  1 
ATOM   3513 C  C   . GLN A 1 449 ? 44.144 41.305 12.062  1.00 32.12 ? 471  GLN A C   1 
ATOM   3514 O  O   . GLN A 1 449 ? 45.059 40.642 12.569  1.00 33.58 ? 471  GLN A O   1 
ATOM   3515 C  CB  . GLN A 1 449 ? 42.623 39.614 10.936  1.00 30.68 ? 471  GLN A CB  1 
ATOM   3516 C  CG  . GLN A 1 449 ? 41.380 38.740 11.166  1.00 33.07 ? 471  GLN A CG  1 
ATOM   3517 C  CD  . GLN A 1 449 ? 40.882 38.023 9.925   1.00 34.36 ? 471  GLN A CD  1 
ATOM   3518 O  OE1 . GLN A 1 449 ? 41.474 38.112 8.859   1.00 39.70 ? 471  GLN A OE1 1 
ATOM   3519 N  NE2 . GLN A 1 449 ? 39.808 37.288 10.073  1.00 34.89 ? 471  GLN A NE2 1 
ATOM   3520 N  N   . THR A 1 450 ? 44.325 42.530 11.564  1.00 33.11 ? 472  THR A N   1 
ATOM   3521 C  CA  . THR A 1 450 ? 45.672 43.107 11.484  1.00 33.36 ? 472  THR A CA  1 
ATOM   3522 C  C   . THR A 1 450 ? 45.735 44.409 12.256  1.00 32.75 ? 472  THR A C   1 
ATOM   3523 O  O   . THR A 1 450 ? 46.095 44.396 13.431  1.00 31.91 ? 472  THR A O   1 
ATOM   3524 C  CB  . THR A 1 450 ? 46.165 43.296 10.047  1.00 34.17 ? 472  THR A CB  1 
ATOM   3525 O  OG1 . THR A 1 450 ? 45.345 44.262 9.369   1.00 34.89 ? 472  THR A OG1 1 
ATOM   3526 C  CG2 . THR A 1 450 ? 46.154 41.973 9.285   1.00 35.00 ? 472  THR A CG2 1 
ATOM   3527 N  N   . LEU A 1 451 ? 45.304 45.511 11.637  1.00 31.57 ? 473  LEU A N   1 
ATOM   3528 C  CA  . LEU A 1 451 ? 45.467 46.813 12.257  1.00 31.50 ? 473  LEU A CA  1 
ATOM   3529 C  C   . LEU A 1 451 ? 44.715 46.934 13.615  1.00 30.73 ? 473  LEU A C   1 
ATOM   3530 O  O   . LEU A 1 451 ? 45.282 47.455 14.606  1.00 30.75 ? 473  LEU A O   1 
ATOM   3531 C  CB  . LEU A 1 451 ? 45.126 47.967 11.292  1.00 31.16 ? 473  LEU A CB  1 
ATOM   3532 C  CG  . LEU A 1 451 ? 45.400 49.336 11.942  1.00 32.96 ? 473  LEU A CG  1 
ATOM   3533 C  CD1 . LEU A 1 451 ? 46.904 49.557 12.034  1.00 29.53 ? 473  LEU A CD1 1 
ATOM   3534 C  CD2 . LEU A 1 451 ? 44.729 50.538 11.226  1.00 32.75 ? 473  LEU A CD2 1 
ATOM   3535 N  N   . GLU A 1 452 ? 43.476 46.450 13.682  1.00 29.09 ? 474  GLU A N   1 
ATOM   3536 C  CA  . GLU A 1 452 ? 42.759 46.455 14.964  1.00 29.13 ? 474  GLU A CA  1 
ATOM   3537 C  C   . GLU A 1 452 ? 43.533 45.822 16.106  1.00 29.15 ? 474  GLU A C   1 
ATOM   3538 O  O   . GLU A 1 452 ? 43.621 46.398 17.176  1.00 28.17 ? 474  GLU A O   1 
ATOM   3539 C  CB  . GLU A 1 452 ? 41.364 45.838 14.901  1.00 28.90 ? 474  GLU A CB  1 
ATOM   3540 C  CG  . GLU A 1 452 ? 40.628 46.022 16.239  1.00 24.06 ? 474  GLU A CG  1 
ATOM   3541 C  CD  . GLU A 1 452 ? 39.425 45.123 16.461  1.00 24.99 ? 474  GLU A CD  1 
ATOM   3542 O  OE1 . GLU A 1 452 ? 39.006 44.357 15.581  1.00 26.28 ? 474  GLU A OE1 1 
ATOM   3543 O  OE2 . GLU A 1 452 ? 38.928 45.128 17.595  1.00 25.36 ? 474  GLU A OE2 1 
ATOM   3544 N  N   . GLN A 1 453 ? 44.114 44.651 15.865  1.00 30.41 ? 475  GLN A N   1 
ATOM   3545 C  CA  . GLN A 1 453 ? 44.897 43.976 16.904  1.00 31.09 ? 475  GLN A CA  1 
ATOM   3546 C  C   . GLN A 1 453 ? 46.183 44.742 17.271  1.00 30.41 ? 475  GLN A C   1 
ATOM   3547 O  O   . GLN A 1 453 ? 46.601 44.761 18.432  1.00 30.38 ? 475  GLN A O   1 
ATOM   3548 C  CB  . GLN A 1 453 ? 45.169 42.517 16.499  1.00 32.73 ? 475  GLN A CB  1 
ATOM   3549 C  CG  . GLN A 1 453 ? 43.898 41.623 16.275  1.00 33.72 ? 475  GLN A CG  1 
ATOM   3550 C  CD  . GLN A 1 453 ? 42.770 41.726 17.335  1.00 37.05 ? 475  GLN A CD  1 
ATOM   3551 O  OE1 . GLN A 1 453 ? 43.014 41.654 18.562  1.00 35.97 ? 475  GLN A OE1 1 
ATOM   3552 N  NE2 . GLN A 1 453 ? 41.501 41.871 16.847  1.00 38.72 ? 475  GLN A NE2 1 
ATOM   3553 N  N   . GLU A 1 454 ? 46.805 45.388 16.288  1.00 29.30 ? 476  GLU A N   1 
ATOM   3554 C  CA  . GLU A 1 454 ? 47.923 46.266 16.553  1.00 28.83 ? 476  GLU A CA  1 
ATOM   3555 C  C   . GLU A 1 454 ? 47.531 47.440 17.448  1.00 28.80 ? 476  GLU A C   1 
ATOM   3556 O  O   . GLU A 1 454 ? 48.240 47.736 18.397  1.00 26.43 ? 476  GLU A O   1 
ATOM   3557 C  CB  . GLU A 1 454 ? 48.559 46.742 15.247  1.00 30.34 ? 476  GLU A CB  1 
ATOM   3558 C  CG  . GLU A 1 454 ? 49.135 45.564 14.421  1.00 34.82 ? 476  GLU A CG  1 
ATOM   3559 C  CD  . GLU A 1 454 ? 49.974 44.590 15.272  1.00 41.84 ? 476  GLU A CD  1 
ATOM   3560 O  OE1 . GLU A 1 454 ? 50.881 45.058 15.999  1.00 45.68 ? 476  GLU A OE1 1 
ATOM   3561 O  OE2 . GLU A 1 454 ? 49.716 43.362 15.226  1.00 45.64 ? 476  GLU A OE2 1 
ATOM   3562 N  N   . TRP A 1 455 ? 46.385 48.072 17.179  1.00 27.62 ? 477  TRP A N   1 
ATOM   3563 C  CA  . TRP A 1 455 ? 45.812 49.067 18.099  1.00 28.07 ? 477  TRP A CA  1 
ATOM   3564 C  C   . TRP A 1 455 ? 45.721 48.600 19.535  1.00 26.14 ? 477  TRP A C   1 
ATOM   3565 O  O   . TRP A 1 455 ? 46.193 49.292 20.434  1.00 26.34 ? 477  TRP A O   1 
ATOM   3566 C  CB  . TRP A 1 455 ? 44.395 49.467 17.638  1.00 28.07 ? 477  TRP A CB  1 
ATOM   3567 C  CG  . TRP A 1 455 ? 44.372 50.225 16.365  1.00 28.24 ? 477  TRP A CG  1 
ATOM   3568 C  CD1 . TRP A 1 455 ? 45.440 50.613 15.622  1.00 27.42 ? 477  TRP A CD1 1 
ATOM   3569 C  CD2 . TRP A 1 455 ? 43.208 50.722 15.694  1.00 29.76 ? 477  TRP A CD2 1 
ATOM   3570 N  NE1 . TRP A 1 455 ? 45.025 51.310 14.522  1.00 29.67 ? 477  TRP A NE1 1 
ATOM   3571 C  CE2 . TRP A 1 455 ? 43.654 51.400 14.542  1.00 30.69 ? 477  TRP A CE2 1 
ATOM   3572 C  CE3 . TRP A 1 455 ? 41.830 50.688 15.977  1.00 30.53 ? 477  TRP A CE3 1 
ATOM   3573 C  CZ2 . TRP A 1 455 ? 42.769 52.044 13.654  1.00 29.57 ? 477  TRP A CZ2 1 
ATOM   3574 C  CZ3 . TRP A 1 455 ? 40.954 51.326 15.090  1.00 28.47 ? 477  TRP A CZ3 1 
ATOM   3575 C  CH2 . TRP A 1 455 ? 41.428 51.991 13.953  1.00 27.35 ? 477  TRP A CH2 1 
ATOM   3576 N  N   . LYS A 1 456 ? 45.070 47.457 19.747  1.00 26.27 ? 478  LYS A N   1 
ATOM   3577 C  CA  . LYS A 1 456 ? 44.761 46.950 21.072  1.00 25.96 ? 478  LYS A CA  1 
ATOM   3578 C  C   . LYS A 1 456 ? 46.079 46.514 21.735  1.00 27.35 ? 478  LYS A C   1 
ATOM   3579 O  O   . LYS A 1 456 ? 46.312 46.850 22.880  1.00 27.36 ? 478  LYS A O   1 
ATOM   3580 C  CB  . LYS A 1 456 ? 43.770 45.776 21.029  1.00 27.15 ? 478  LYS A CB  1 
ATOM   3581 C  CG  . LYS A 1 456 ? 42.328 46.220 20.755  1.00 25.62 ? 478  LYS A CG  1 
ATOM   3582 C  CD  . LYS A 1 456 ? 41.322 45.096 20.801  1.00 27.14 ? 478  LYS A CD  1 
ATOM   3583 C  CE  . LYS A 1 456 ? 39.901 45.612 21.017  1.00 26.86 ? 478  LYS A CE  1 
ATOM   3584 N  NZ  . LYS A 1 456 ? 39.402 46.564 19.976  1.00 23.14 ? 478  LYS A NZ  1 
ATOM   3585 N  N   . LYS A 1 457 ? 46.936 45.817 21.003  1.00 27.11 ? 479  LYS A N   1 
ATOM   3586 C  CA  . LYS A 1 457 ? 48.287 45.488 21.543  1.00 28.61 ? 479  LYS A CA  1 
ATOM   3587 C  C   . LYS A 1 457 ? 49.035 46.762 22.022  1.00 28.39 ? 479  LYS A C   1 
ATOM   3588 O  O   . LYS A 1 457 ? 49.522 46.798 23.175  1.00 27.54 ? 479  LYS A O   1 
ATOM   3589 C  CB  . LYS A 1 457 ? 49.113 44.744 20.486  1.00 28.86 ? 479  LYS A CB  1 
ATOM   3590 C  CG  . LYS A 1 457 ? 48.612 43.345 20.158  1.00 32.33 ? 479  LYS A CG  1 
ATOM   3591 C  CD  . LYS A 1 457 ? 49.291 42.869 18.885  1.00 33.93 ? 479  LYS A CD  1 
ATOM   3592 C  CE  . LYS A 1 457 ? 48.419 41.926 18.073  1.00 38.73 ? 479  LYS A CE  1 
ATOM   3593 N  NZ  . LYS A 1 457 ? 48.580 40.571 18.608  1.00 42.86 ? 479  LYS A NZ  1 
ATOM   3594 N  N   . GLN A 1 458 ? 49.106 47.809 21.177  1.00 28.27 ? 480  GLN A N   1 
ATOM   3595 C  CA  . GLN A 1 458 ? 49.875 49.019 21.485  1.00 29.05 ? 480  GLN A CA  1 
ATOM   3596 C  C   . GLN A 1 458 ? 49.287 49.776 22.682  1.00 28.99 ? 480  GLN A C   1 
ATOM   3597 O  O   . GLN A 1 458 ? 49.998 50.177 23.606  1.00 26.55 ? 480  GLN A O   1 
ATOM   3598 C  CB  . GLN A 1 458 ? 49.960 49.966 20.255  1.00 30.48 ? 480  GLN A CB  1 
ATOM   3599 C  CG  . GLN A 1 458 ? 51.002 49.525 19.166  1.00 32.02 ? 480  GLN A CG  1 
ATOM   3600 C  CD  . GLN A 1 458 ? 50.603 49.817 17.704  1.00 34.09 ? 480  GLN A CD  1 
ATOM   3601 O  OE1 . GLN A 1 458 ? 51.279 49.335 16.770  1.00 42.01 ? 480  GLN A OE1 1 
ATOM   3602 N  NE2 . GLN A 1 458 ? 49.517 50.591 17.486  1.00 35.96 ? 480  GLN A NE2 1 
ATOM   3603 N  N   . ALA A 1 459 ? 47.973 49.994 22.645  1.00 28.35 ? 481  ALA A N   1 
ATOM   3604 C  CA  . ALA A 1 459 ? 47.251 50.590 23.784  1.00 28.58 ? 481  ALA A CA  1 
ATOM   3605 C  C   . ALA A 1 459 ? 47.496 49.824 25.115  1.00 27.39 ? 481  ALA A C   1 
ATOM   3606 O  O   . ALA A 1 459 ? 47.598 50.451 26.182  1.00 29.34 ? 481  ALA A O   1 
ATOM   3607 C  CB  . ALA A 1 459 ? 45.770 50.610 23.481  1.00 28.79 ? 481  ALA A CB  1 
ATOM   3608 N  N   . ILE A 1 460 ? 47.517 48.497 25.060  1.00 26.58 ? 482  ILE A N   1 
ATOM   3609 C  CA  . ILE A 1 460 ? 47.747 47.682 26.269  1.00 26.83 ? 482  ILE A CA  1 
ATOM   3610 C  C   . ILE A 1 460 ? 49.204 47.851 26.728  1.00 27.67 ? 482  ILE A C   1 
ATOM   3611 O  O   . ILE A 1 460 ? 49.478 47.951 27.929  1.00 28.56 ? 482  ILE A O   1 
ATOM   3612 C  CB  . ILE A 1 460 ? 47.441 46.192 26.064  1.00 26.98 ? 482  ILE A CB  1 
ATOM   3613 C  CG1 . ILE A 1 460 ? 45.932 45.927 25.973  1.00 22.74 ? 482  ILE A CG1 1 
ATOM   3614 C  CG2 . ILE A 1 460 ? 48.015 45.297 27.204  1.00 27.21 ? 482  ILE A CG2 1 
ATOM   3615 C  CD1 . ILE A 1 460 ? 45.663 44.548 25.470  1.00 26.84 ? 482  ILE A CD1 1 
ATOM   3616 N  N   . ALA A 1 461 ? 50.124 47.902 25.768  1.00 28.05 ? 483  ALA A N   1 
ATOM   3617 C  CA  . ALA A 1 461 ? 51.536 48.192 26.094  1.00 28.79 ? 483  ALA A CA  1 
ATOM   3618 C  C   . ALA A 1 461 ? 51.725 49.566 26.725  1.00 28.60 ? 483  ALA A C   1 
ATOM   3619 O  O   . ALA A 1 461 ? 52.427 49.721 27.728  1.00 28.93 ? 483  ALA A O   1 
ATOM   3620 C  CB  . ALA A 1 461 ? 52.403 48.071 24.840  1.00 28.70 ? 483  ALA A CB  1 
ATOM   3621 N  N   . LYS A 1 462 ? 51.116 50.587 26.118  1.00 28.34 ? 484  LYS A N   1 
ATOM   3622 C  CA  . LYS A 1 462 ? 51.250 51.937 26.632  1.00 28.54 ? 484  LYS A CA  1 
ATOM   3623 C  C   . LYS A 1 462 ? 50.561 52.120 27.963  1.00 28.24 ? 484  LYS A C   1 
ATOM   3624 O  O   . LYS A 1 462 ? 50.769 53.136 28.601  1.00 28.59 ? 484  LYS A O   1 
ATOM   3625 C  CB  . LYS A 1 462 ? 50.662 52.960 25.641  1.00 29.46 ? 484  LYS A CB  1 
ATOM   3626 C  CG  . LYS A 1 462 ? 51.510 53.272 24.448  1.00 29.86 ? 484  LYS A CG  1 
ATOM   3627 C  CD  . LYS A 1 462 ? 50.824 54.349 23.555  1.00 30.51 ? 484  LYS A CD  1 
ATOM   3628 C  CE  . LYS A 1 462 ? 49.408 53.982 23.034  1.00 35.03 ? 484  LYS A CE  1 
ATOM   3629 N  NZ  . LYS A 1 462 ? 49.027 54.936 21.954  1.00 34.69 ? 484  LYS A NZ  1 
ATOM   3630 N  N   . GLY A 1 463 ? 49.695 51.186 28.352  1.00 27.39 ? 485  GLY A N   1 
ATOM   3631 C  CA  . GLY A 1 463 ? 48.930 51.322 29.597  1.00 27.52 ? 485  GLY A CA  1 
ATOM   3632 C  C   . GLY A 1 463 ? 47.657 52.156 29.480  1.00 27.50 ? 485  GLY A C   1 
ATOM   3633 O  O   . GLY A 1 463 ? 47.182 52.702 30.469  1.00 27.59 ? 485  GLY A O   1 
ATOM   3634 N  N   . ARG A 1 464 ? 47.115 52.259 28.263  1.00 27.10 ? 486  ARG A N   1 
ATOM   3635 C  CA  . ARG A 1 464 ? 45.876 53.023 28.010  1.00 26.60 ? 486  ARG A CA  1 
ATOM   3636 C  C   . ARG A 1 464 ? 44.676 52.114 28.086  1.00 26.03 ? 486  ARG A C   1 
ATOM   3637 O  O   . ARG A 1 464 ? 43.558 52.574 28.231  1.00 26.75 ? 486  ARG A O   1 
ATOM   3638 C  CB  . ARG A 1 464 ? 45.890 53.684 26.642  1.00 26.29 ? 486  ARG A CB  1 
ATOM   3639 C  CG  . ARG A 1 464 ? 47.006 54.712 26.475  1.00 29.29 ? 486  ARG A CG  1 
ATOM   3640 C  CD  . ARG A 1 464 ? 46.786 55.799 27.499  1.00 36.63 ? 486  ARG A CD  1 
ATOM   3641 N  NE  . ARG A 1 464 ? 47.570 56.983 27.204  1.00 40.56 ? 486  ARG A NE  1 
ATOM   3642 C  CZ  . ARG A 1 464 ? 47.727 58.020 28.018  1.00 43.28 ? 486  ARG A CZ  1 
ATOM   3643 N  NH1 . ARG A 1 464 ? 47.165 58.047 29.240  1.00 41.11 ? 486  ARG A NH1 1 
ATOM   3644 N  NH2 . ARG A 1 464 ? 48.455 59.043 27.591  1.00 41.55 ? 486  ARG A NH2 1 
ATOM   3645 N  N   . LEU A 1 465 ? 44.927 50.833 27.915  1.00 26.24 ? 487  LEU A N   1 
ATOM   3646 C  CA  . LEU A 1 465 ? 43.891 49.797 27.878  1.00 25.27 ? 487  LEU A CA  1 
ATOM   3647 C  C   . LEU A 1 465 ? 44.268 48.621 28.780  1.00 27.25 ? 487  LEU A C   1 
ATOM   3648 O  O   . LEU A 1 465 ? 45.390 48.095 28.708  1.00 27.35 ? 487  LEU A O   1 
ATOM   3649 C  CB  . LEU A 1 465 ? 43.726 49.293 26.415  1.00 24.09 ? 487  LEU A CB  1 
ATOM   3650 C  CG  . LEU A 1 465 ? 42.818 48.088 26.147  1.00 22.15 ? 487  LEU A CG  1 
ATOM   3651 C  CD1 . LEU A 1 465 ? 41.378 48.346 26.521  1.00 22.55 ? 487  LEU A CD1 1 
ATOM   3652 C  CD2 . LEU A 1 465 ? 42.906 47.659 24.667  1.00 22.87 ? 487  LEU A CD2 1 
ATOM   3653 N  N   . ASN A 1 466 ? 43.321 48.222 29.611  1.00 28.38 ? 488  ASN A N   1 
ATOM   3654 C  CA  . ASN A 1 466 ? 43.413 47.017 30.433  1.00 30.01 ? 488  ASN A CA  1 
ATOM   3655 C  C   . ASN A 1 466 ? 42.610 45.906 29.763  1.00 29.36 ? 488  ASN A C   1 
ATOM   3656 O  O   . ASN A 1 466 ? 41.402 46.080 29.482  1.00 28.09 ? 488  ASN A O   1 
ATOM   3657 C  CB  . ASN A 1 466 ? 42.970 47.342 31.880  1.00 31.41 ? 488  ASN A CB  1 
ATOM   3658 C  CG  . ASN A 1 466 ? 42.486 46.115 32.686  1.00 34.76 ? 488  ASN A CG  1 
ATOM   3659 O  OD1 . ASN A 1 466 ? 42.878 44.968 32.435  1.00 38.34 ? 488  ASN A OD1 1 
ATOM   3660 N  ND2 . ASN A 1 466 ? 41.619 46.383 33.698  1.00 41.58 ? 488  ASN A ND2 1 
ATOM   3661 N  N   . PRO A 1 467 ? 43.270 44.770 29.451  1.00 29.11 ? 489  PRO A N   1 
ATOM   3662 C  CA  . PRO A 1 467 ? 42.624 43.715 28.673  1.00 30.11 ? 489  PRO A CA  1 
ATOM   3663 C  C   . PRO A 1 467 ? 41.409 43.096 29.406  1.00 30.15 ? 489  PRO A C   1 
ATOM   3664 O  O   . PRO A 1 467 ? 40.587 42.386 28.800  1.00 30.63 ? 489  PRO A O   1 
ATOM   3665 C  CB  . PRO A 1 467 ? 43.755 42.682 28.500  1.00 31.77 ? 489  PRO A CB  1 
ATOM   3666 C  CG  . PRO A 1 467 ? 44.579 42.877 29.672  1.00 31.28 ? 489  PRO A CG  1 
ATOM   3667 C  CD  . PRO A 1 467 ? 44.650 44.373 29.821  1.00 29.19 ? 489  PRO A CD  1 
ATOM   3668 N  N   . GLU A 1 468 ? 41.293 43.369 30.712  1.00 30.68 ? 490  GLU A N   1 
ATOM   3669 C  CA  . GLU A 1 468 ? 40.123 42.951 31.484  1.00 32.53 ? 490  GLU A CA  1 
ATOM   3670 C  C   . GLU A 1 468 ? 38.833 43.486 30.817  1.00 30.70 ? 490  GLU A C   1 
ATOM   3671 O  O   . GLU A 1 468 ? 37.800 42.808 30.805  1.00 31.78 ? 490  GLU A O   1 
ATOM   3672 C  CB  . GLU A 1 468 ? 40.268 43.448 32.955  1.00 33.30 ? 490  GLU A CB  1 
ATOM   3673 C  CG  . GLU A 1 468 ? 39.132 43.120 33.915  1.00 39.44 ? 490  GLU A CG  1 
ATOM   3674 C  CD  . GLU A 1 468 ? 38.996 41.626 34.191  1.00 45.28 ? 490  GLU A CD  1 
ATOM   3675 O  OE1 . GLU A 1 468 ? 40.046 40.935 34.250  1.00 49.75 ? 490  GLU A OE1 1 
ATOM   3676 O  OE2 . GLU A 1 468 ? 37.840 41.143 34.344  1.00 48.63 ? 490  GLU A OE2 1 
ATOM   3677 N  N   . SER A 1 469 ? 38.933 44.671 30.213  1.00 29.85 ? 491  SER A N   1 
ATOM   3678 C  CA  . SER A 1 469 ? 37.757 45.372 29.654  1.00 29.59 ? 491  SER A CA  1 
ATOM   3679 C  C   . SER A 1 469 ? 37.281 44.792 28.307  1.00 29.27 ? 491  SER A C   1 
ATOM   3680 O  O   . SER A 1 469 ? 36.182 45.122 27.820  1.00 29.31 ? 491  SER A O   1 
ATOM   3681 C  CB  . SER A 1 469 ? 38.048 46.855 29.526  1.00 29.77 ? 491  SER A CB  1 
ATOM   3682 O  OG  . SER A 1 469 ? 39.089 47.097 28.620  1.00 27.96 ? 491  SER A OG  1 
ATOM   3683 N  N   . LEU A 1 470 ? 38.110 43.924 27.735  1.00 28.88 ? 492  LEU A N   1 
ATOM   3684 C  CA  . LEU A 1 470 ? 37.877 43.278 26.449  1.00 29.36 ? 492  LEU A CA  1 
ATOM   3685 C  C   . LEU A 1 470 ? 37.120 41.941 26.601  1.00 29.26 ? 492  LEU A C   1 
ATOM   3686 O  O   . LEU A 1 470 ? 36.726 41.340 25.623  1.00 30.38 ? 492  LEU A O   1 
ATOM   3687 C  CB  . LEU A 1 470 ? 39.211 43.075 25.712  1.00 29.07 ? 492  LEU A CB  1 
ATOM   3688 C  CG  . LEU A 1 470 ? 39.983 44.371 25.478  1.00 28.69 ? 492  LEU A CG  1 
ATOM   3689 C  CD1 . LEU A 1 470 ? 41.337 44.146 24.812  1.00 30.56 ? 492  LEU A CD1 1 
ATOM   3690 C  CD2 . LEU A 1 470 ? 39.125 45.386 24.632  1.00 30.85 ? 492  LEU A CD2 1 
ATOM   3691 N  N   . LYS A 1 471 ? 36.897 41.493 27.824  1.00 29.12 ? 493  LYS A N   1 
ATOM   3692 C  CA  . LYS A 1 471 ? 36.171 40.220 28.037  1.00 30.28 ? 493  LYS A CA  1 
ATOM   3693 C  C   . LYS A 1 471 ? 34.814 40.126 27.303  1.00 29.30 ? 493  LYS A C   1 
ATOM   3694 O  O   . LYS A 1 471 ? 33.879 40.859 27.595  1.00 28.82 ? 493  LYS A O   1 
ATOM   3695 C  CB  . LYS A 1 471 ? 36.046 39.931 29.537  1.00 31.21 ? 493  LYS A CB  1 
ATOM   3696 C  CG  . LYS A 1 471 ? 37.135 39.043 30.079  1.00 32.38 ? 493  LYS A CG  1 
ATOM   3697 C  CD  . LYS A 1 471 ? 37.672 39.505 31.475  1.00 33.81 ? 493  LYS A CD  1 
ATOM   3698 C  CE  . LYS A 1 471 ? 38.584 38.472 32.153  1.00 36.39 ? 493  LYS A CE  1 
ATOM   3699 N  NZ  . LYS A 1 471 ? 39.365 37.561 31.211  1.00 38.26 ? 493  LYS A NZ  1 
ATOM   3700 N  N   . GLY A 1 472 ? 34.738 39.256 26.303  1.00 29.14 ? 494  GLY A N   1 
ATOM   3701 C  CA  . GLY A 1 472 ? 33.497 39.042 25.572  1.00 28.94 ? 494  GLY A CA  1 
ATOM   3702 C  C   . GLY A 1 472 ? 32.970 40.247 24.791  1.00 28.62 ? 494  GLY A C   1 
ATOM   3703 O  O   . GLY A 1 472 ? 31.815 40.257 24.422  1.00 30.10 ? 494  GLY A O   1 
ATOM   3704 N  N   . VAL A 1 473 ? 33.808 41.244 24.529  1.00 28.01 ? 495  VAL A N   1 
ATOM   3705 C  CA  . VAL A 1 473 ? 33.360 42.503 23.905  1.00 27.07 ? 495  VAL A CA  1 
ATOM   3706 C  C   . VAL A 1 473 ? 33.345 42.327 22.384  1.00 27.43 ? 495  VAL A C   1 
ATOM   3707 O  O   . VAL A 1 473 ? 32.626 43.052 21.657  1.00 27.68 ? 495  VAL A O   1 
ATOM   3708 C  CB  . VAL A 1 473 ? 34.292 43.720 24.275  1.00 26.63 ? 495  VAL A CB  1 
ATOM   3709 C  CG1 . VAL A 1 473 ? 35.529 43.774 23.383  1.00 26.17 ? 495  VAL A CG1 1 
ATOM   3710 C  CG2 . VAL A 1 473 ? 33.485 45.045 24.185  1.00 27.82 ? 495  VAL A CG2 1 
ATOM   3711 N  N   . ASP A 1 474 ? 34.156 41.377 21.894  1.00 27.17 ? 496  ASP A N   1 
ATOM   3712 C  CA  . ASP A 1 474 ? 34.266 41.166 20.449  1.00 28.06 ? 496  ASP A CA  1 
ATOM   3713 C  C   . ASP A 1 474 ? 33.786 39.806 19.914  1.00 28.85 ? 496  ASP A C   1 
ATOM   3714 O  O   . ASP A 1 474 ? 34.357 39.236 18.963  1.00 29.60 ? 496  ASP A O   1 
ATOM   3715 C  CB  . ASP A 1 474 ? 35.637 41.543 19.888  1.00 27.81 ? 496  ASP A CB  1 
ATOM   3716 C  CG  . ASP A 1 474 ? 35.579 41.744 18.401  1.00 29.24 ? 496  ASP A CG  1 
ATOM   3717 O  OD1 . ASP A 1 474 ? 34.495 42.175 17.948  1.00 29.09 ? 496  ASP A OD1 1 
ATOM   3718 O  OD2 . ASP A 1 474 ? 36.573 41.496 17.662  1.00 30.31 ? 496  ASP A OD2 1 
ATOM   3719 N  N   . GLU A 1 475 ? 32.700 39.331 20.488  1.00 28.77 ? 497  GLU A N   1 
ATOM   3720 C  CA  . GLU A 1 475 ? 32.089 38.082 20.095  1.00 30.09 ? 497  GLU A CA  1 
ATOM   3721 C  C   . GLU A 1 475 ? 31.016 38.197 19.003  1.00 29.29 ? 497  GLU A C   1 
ATOM   3722 O  O   . GLU A 1 475 ? 30.697 37.201 18.369  1.00 29.08 ? 497  GLU A O   1 
ATOM   3723 C  CB  . GLU A 1 475 ? 31.526 37.377 21.301  1.00 30.41 ? 497  GLU A CB  1 
ATOM   3724 C  CG  . GLU A 1 475 ? 32.655 36.624 22.005  1.00 36.42 ? 497  GLU A CG  1 
ATOM   3725 C  CD  . GLU A 1 475 ? 32.240 36.100 23.310  1.00 43.33 ? 497  GLU A CD  1 
ATOM   3726 O  OE1 . GLU A 1 475 ? 31.026 36.160 23.556  1.00 46.24 ? 497  GLU A OE1 1 
ATOM   3727 O  OE2 . GLU A 1 475 ? 33.100 35.652 24.090  1.00 45.99 ? 497  GLU A OE2 1 
ATOM   3728 N  N   . LYS A 1 476 ? 30.467 39.396 18.789  1.00 28.03 ? 498  LYS A N   1 
ATOM   3729 C  CA  . LYS A 1 476 ? 29.385 39.514 17.815  1.00 29.72 ? 498  LYS A CA  1 
ATOM   3730 C  C   . LYS A 1 476 ? 29.396 40.799 17.036  1.00 29.95 ? 498  LYS A C   1 
ATOM   3731 O  O   . LYS A 1 476 ? 29.812 41.838 17.532  1.00 30.62 ? 498  LYS A O   1 
ATOM   3732 C  CB  . LYS A 1 476 ? 28.035 39.532 18.518  1.00 30.18 ? 498  LYS A CB  1 
ATOM   3733 C  CG  . LYS A 1 476 ? 27.540 38.306 19.157  1.00 33.28 ? 498  LYS A CG  1 
ATOM   3734 C  CD  . LYS A 1 476 ? 26.293 38.754 19.828  1.00 31.83 ? 498  LYS A CD  1 
ATOM   3735 C  CE  . LYS A 1 476 ? 25.954 37.922 21.008  1.00 34.02 ? 498  LYS A CE  1 
ATOM   3736 N  NZ  . LYS A 1 476 ? 24.573 38.258 21.356  1.00 34.59 ? 498  LYS A NZ  1 
ATOM   3737 N  N   . SER A 1 477 ? 28.804 40.746 15.852  1.00 28.07 ? 499  SER A N   1 
ATOM   3738 C  CA  . SER A 1 477 ? 28.582 41.929 15.027  1.00 27.21 ? 499  SER A CA  1 
ATOM   3739 C  C   . SER A 1 477 ? 27.434 41.533 14.133  1.00 27.61 ? 499  SER A C   1 
ATOM   3740 O  O   . SER A 1 477 ? 26.877 40.448 14.305  1.00 26.82 ? 499  SER A O   1 
ATOM   3741 C  CB  . SER A 1 477 ? 29.797 42.230 14.192  1.00 27.55 ? 499  SER A CB  1 
ATOM   3742 O  OG  . SER A 1 477 ? 29.964 41.275 13.141  1.00 26.59 ? 499  SER A OG  1 
ATOM   3743 N  N   . SER A 1 478 ? 27.093 42.380 13.157  1.00 26.14 ? 500  SER A N   1 
ATOM   3744 C  CA  . SER A 1 478 ? 26.049 41.984 12.214  1.00 27.06 ? 500  SER A CA  1 
ATOM   3745 C  C   . SER A 1 478 ? 26.545 40.893 11.264  1.00 27.65 ? 500  SER A C   1 
ATOM   3746 O  O   . SER A 1 478 ? 25.728 40.270 10.576  1.00 27.56 ? 500  SER A O   1 
ATOM   3747 C  CB  . SER A 1 478 ? 25.558 43.172 11.395  1.00 26.42 ? 500  SER A CB  1 
ATOM   3748 O  OG  . SER A 1 478 ? 26.604 43.766 10.631  1.00 24.38 ? 500  SER A OG  1 
ATOM   3749 N  N   . TYR A 1 479 ? 27.872 40.678 11.216  1.00 25.86 ? 501  TYR A N   1 
ATOM   3750 C  CA  . TYR A 1 479 ? 28.433 39.791 10.183  1.00 26.40 ? 501  TYR A CA  1 
ATOM   3751 C  C   . TYR A 1 479 ? 29.185 38.594 10.686  1.00 27.00 ? 501  TYR A C   1 
ATOM   3752 O  O   . TYR A 1 479 ? 29.536 37.718 9.891   1.00 29.66 ? 501  TYR A O   1 
ATOM   3753 C  CB  . TYR A 1 479 ? 29.297 40.570 9.173   1.00 26.14 ? 501  TYR A CB  1 
ATOM   3754 C  CG  . TYR A 1 479 ? 30.301 41.461 9.827   1.00 25.04 ? 501  TYR A CG  1 
ATOM   3755 C  CD1 . TYR A 1 479 ? 29.944 42.767 10.239  1.00 24.27 ? 501  TYR A CD1 1 
ATOM   3756 C  CD2 . TYR A 1 479 ? 31.629 41.027 10.021  1.00 28.52 ? 501  TYR A CD2 1 
ATOM   3757 C  CE1 . TYR A 1 479 ? 30.879 43.619 10.832  1.00 23.62 ? 501  TYR A CE1 1 
ATOM   3758 C  CE2 . TYR A 1 479 ? 32.560 41.850 10.630  1.00 26.71 ? 501  TYR A CE2 1 
ATOM   3759 C  CZ  . TYR A 1 479 ? 32.180 43.120 11.076  1.00 26.33 ? 501  TYR A CZ  1 
ATOM   3760 O  OH  . TYR A 1 479 ? 33.134 43.934 11.662  1.00 24.72 ? 501  TYR A OH  1 
ATOM   3761 N  N   . TYR A 1 480 ? 29.447 38.540 11.982  1.00 27.36 ? 502  TYR A N   1 
ATOM   3762 C  CA  . TYR A 1 480 ? 29.757 37.272 12.643  1.00 27.67 ? 502  TYR A CA  1 
ATOM   3763 C  C   . TYR A 1 480 ? 29.152 37.165 14.027  1.00 28.25 ? 502  TYR A C   1 
ATOM   3764 O  O   . TYR A 1 480 ? 28.676 38.120 14.626  1.00 26.16 ? 502  TYR A O   1 
ATOM   3765 C  CB  . TYR A 1 480 ? 31.272 37.031 12.760  1.00 28.71 ? 502  TYR A CB  1 
ATOM   3766 C  CG  . TYR A 1 480 ? 31.919 38.134 13.503  1.00 27.40 ? 502  TYR A CG  1 
ATOM   3767 C  CD1 . TYR A 1 480 ? 32.028 38.111 14.911  1.00 31.00 ? 502  TYR A CD1 1 
ATOM   3768 C  CD2 . TYR A 1 480 ? 32.349 39.281 12.810  1.00 27.48 ? 502  TYR A CD2 1 
ATOM   3769 C  CE1 . TYR A 1 480 ? 32.612 39.200 15.609  1.00 26.89 ? 502  TYR A CE1 1 
ATOM   3770 C  CE2 . TYR A 1 480 ? 32.931 40.340 13.497  1.00 28.01 ? 502  TYR A CE2 1 
ATOM   3771 C  CZ  . TYR A 1 480 ? 33.066 40.276 14.885  1.00 28.40 ? 502  TYR A CZ  1 
ATOM   3772 O  OH  . TYR A 1 480 ? 33.601 41.391 15.491  1.00 30.09 ? 502  TYR A OH  1 
ATOM   3773 N  N   . ASP A 1 481 ? 29.217 35.961 14.557  1.00 29.44 ? 503  ASP A N   1 
ATOM   3774 C  CA  . ASP A 1 481 ? 28.722 35.693 15.882  1.00 32.25 ? 503  ASP A CA  1 
ATOM   3775 C  C   . ASP A 1 481 ? 29.430 34.435 16.406  1.00 34.33 ? 503  ASP A C   1 
ATOM   3776 O  O   . ASP A 1 481 ? 29.079 33.309 16.038  1.00 35.24 ? 503  ASP A O   1 
ATOM   3777 C  CB  . ASP A 1 481 ? 27.193 35.546 15.877  1.00 32.22 ? 503  ASP A CB  1 
ATOM   3778 C  CG  . ASP A 1 481 ? 26.631 35.148 17.234  1.00 34.08 ? 503  ASP A CG  1 
ATOM   3779 O  OD1 . ASP A 1 481 ? 27.396 34.769 18.140  1.00 34.97 ? 503  ASP A OD1 1 
ATOM   3780 O  OD2 . ASP A 1 481 ? 25.403 35.212 17.411  1.00 35.99 ? 503  ASP A OD2 1 
ATOM   3781 N  N   . LYS A 1 482 ? 30.437 34.650 17.245  1.00 35.78 ? 504  LYS A N   1 
ATOM   3782 C  CA  . LYS A 1 482 ? 31.172 33.556 17.938  1.00 38.61 ? 504  LYS A CA  1 
ATOM   3783 C  C   . LYS A 1 482 ? 30.288 32.789 18.954  1.00 41.23 ? 504  LYS A C   1 
ATOM   3784 O  O   . LYS A 1 482 ? 30.603 31.653 19.330  1.00 42.25 ? 504  LYS A O   1 
ATOM   3785 C  CB  . LYS A 1 482 ? 32.423 34.141 18.602  1.00 36.95 ? 504  LYS A CB  1 
ATOM   3786 C  CG  . LYS A 1 482 ? 33.374 34.770 17.583  1.00 37.32 ? 504  LYS A CG  1 
ATOM   3787 C  CD  . LYS A 1 482 ? 34.566 35.470 18.228  1.00 37.69 ? 504  LYS A CD  1 
ATOM   3788 C  CE  . LYS A 1 482 ? 35.223 36.433 17.250  1.00 36.59 ? 504  LYS A CE  1 
ATOM   3789 N  NZ  . LYS A 1 482 ? 36.153 37.322 17.936  1.00 34.85 ? 504  LYS A NZ  1 
ATOM   3790 N  N   . THR A 1 483 ? 29.218 33.463 19.406  1.00 44.55 ? 505  THR A N   1 
ATOM   3791 C  CA  . THR A 1 483 ? 28.036 32.925 20.144  1.00 47.14 ? 505  THR A CA  1 
ATOM   3792 C  C   . THR A 1 483 ? 27.820 33.362 21.636  1.00 49.01 ? 505  THR A C   1 
ATOM   3793 O  O   . THR A 1 483 ? 26.748 33.100 22.193  1.00 50.34 ? 505  THR A O   1 
ATOM   3794 C  CB  . THR A 1 483 ? 27.755 31.364 19.891  1.00 47.54 ? 505  THR A CB  1 
ATOM   3795 O  OG1 . THR A 1 483 ? 27.750 31.070 18.479  1.00 46.39 ? 505  THR A OG1 1 
ATOM   3796 C  CG2 . THR A 1 483 ? 26.383 30.924 20.475  1.00 45.43 ? 505  THR A CG2 1 
ATOM   3797 N  N   . LYS A 1 484 ? 28.776 34.070 22.253  1.00 50.63 ? 506  LYS A N   1 
ATOM   3798 C  CA  . LYS A 1 484 ? 28.879 34.119 23.754  1.00 51.38 ? 506  LYS A CA  1 
ATOM   3799 C  C   . LYS A 1 484 ? 28.690 35.466 24.513  1.00 51.81 ? 506  LYS A C   1 
ATOM   3800 O  O   . LYS A 1 484 ? 28.156 35.484 25.638  1.00 52.15 ? 506  LYS A O   1 
ATOM   3801 C  CB  . LYS A 1 484 ? 30.215 33.476 24.186  1.00 52.01 ? 506  LYS A CB  1 
ATOM   3802 C  CG  . LYS A 1 484 ? 30.136 32.385 25.273  1.00 51.97 ? 506  LYS A CG  1 
ATOM   3803 C  CD  . LYS A 1 484 ? 29.514 31.092 24.740  1.00 52.24 ? 506  LYS A CD  1 
ATOM   3804 C  CE  . LYS A 1 484 ? 27.992 31.230 24.574  1.00 51.82 ? 506  LYS A CE  1 
ATOM   3805 N  NZ  . LYS A 1 484 ? 27.460 30.308 23.534  0.50 50.74 ? 506  LYS A NZ  1 
ATOM   3806 N  N   . LYS A 1 485 ? 29.093 36.564 23.856  1.00 51.83 ? 507  LYS A N   1 
ATOM   3807 C  CA  . LYS A 1 485 ? 29.338 37.949 24.384  1.00 51.32 ? 507  LYS A CA  1 
ATOM   3808 C  C   . LYS A 1 485 ? 29.348 38.382 25.871  1.00 51.63 ? 507  LYS A C   1 
ATOM   3809 O  O   . LYS A 1 485 ? 29.902 39.459 26.148  1.00 50.36 ? 507  LYS A O   1 
ATOM   3810 C  CB  . LYS A 1 485 ? 28.583 38.992 23.553  1.00 50.76 ? 507  LYS A CB  1 
ATOM   3811 C  CG  . LYS A 1 485 ? 29.204 39.177 22.217  1.00 48.22 ? 507  LYS A CG  1 
ATOM   3812 C  CD  . LYS A 1 485 ? 29.164 40.574 21.783  1.00 38.84 ? 507  LYS A CD  1 
ATOM   3813 C  CE  . LYS A 1 485 ? 30.549 41.038 21.467  1.00 37.74 ? 507  LYS A CE  1 
ATOM   3814 N  NZ  . LYS A 1 485 ? 30.642 41.897 20.279  1.00 33.54 ? 507  LYS A NZ  1 
ATOM   3815 O  OXT . LYS A 1 485 ? 28.825 37.747 26.798  1.00 51.85 ? 507  LYS A OXT 1 
HETATM 3816 CA CA  . CA  B 2 .   ? 22.370 64.059 11.408  1.00 29.61 ? 513  CA  A CA  1 
HETATM 3817 S  S   . SO3 C 3 .   ? 25.845 56.967 15.414  1.00 26.33 ? 1    SO3 A S   1 
HETATM 3818 O  O1  . SO3 C 3 .   ? 26.219 56.601 14.043  1.00 28.72 ? 1    SO3 A O1  1 
HETATM 3819 O  O2  . SO3 C 3 .   ? 25.560 58.419 15.410  1.00 29.75 ? 1    SO3 A O2  1 
HETATM 3820 O  O3  . SO3 C 3 .   ? 24.581 56.328 15.737  1.00 23.69 ? 1    SO3 A O3  1 
HETATM 3821 Y  Y   . Y1  D 4 .   ? 44.516 53.902 40.790  1.00 29.26 ? 2    Y1  A Y   1 
HETATM 3822 Y  Y   . Y1  E 4 .   ? 19.066 47.284 23.021  0.50 54.19 ? 3    Y1  A Y   1 
HETATM 3823 Y  Y   . Y1  F 4 .   ? -0.008 59.736 25.083  0.50 32.67 ? 4    Y1  A Y   1 
HETATM 3824 C  C   . ACT G 5 .   ? 2.862  61.742 24.576  1.00 46.29 ? 5    ACT A C   1 
HETATM 3825 O  O   . ACT G 5 .   ? 2.254  61.642 25.675  1.00 46.78 ? 5    ACT A O   1 
HETATM 3826 O  OXT . ACT G 5 .   ? 2.584  60.841 23.749  1.00 46.82 ? 5    ACT A OXT 1 
HETATM 3827 C  CH3 . ACT G 5 .   ? 3.843  62.835 24.250  1.00 45.65 ? 5    ACT A CH3 1 
HETATM 3828 C  C   . ACT H 5 .   ? 44.119 58.157 42.345  1.00 40.90 ? 6    ACT A C   1 
HETATM 3829 O  O   . ACT H 5 .   ? 43.701 56.949 42.385  1.00 40.26 ? 6    ACT A O   1 
HETATM 3830 O  OXT . ACT H 5 .   ? 44.907 58.526 41.409  1.00 40.71 ? 6    ACT A OXT 1 
HETATM 3831 C  CH3 . ACT H 5 .   ? 43.705 59.127 43.412  1.00 40.94 ? 6    ACT A CH3 1 
HETATM 3832 C  CHA . HEM I 6 .   ? 25.241 54.136 18.131  1.00 22.18 ? 508  HEM A CHA 1 
HETATM 3833 C  CHB . HEM I 6 .   ? 29.080 54.355 15.075  1.00 20.55 ? 508  HEM A CHB 1 
HETATM 3834 C  CHC . HEM I 6 .   ? 29.074 59.196 15.565  1.00 20.13 ? 508  HEM A CHC 1 
HETATM 3835 C  CHD . HEM I 6 .   ? 26.296 58.637 19.407  1.00 19.99 ? 508  HEM A CHD 1 
HETATM 3836 C  C1A . HEM I 6 .   ? 26.277 53.769 17.269  1.00 20.59 ? 508  HEM A C1A 1 
HETATM 3837 C  C2A . HEM I 6 .   ? 26.523 52.416 16.800  1.00 18.72 ? 508  HEM A C2A 1 
HETATM 3838 C  C3A . HEM I 6 .   ? 27.569 52.501 15.944  1.00 18.70 ? 508  HEM A C3A 1 
HETATM 3839 C  C4A . HEM I 6 .   ? 28.010 53.859 15.828  1.00 16.90 ? 508  HEM A C4A 1 
HETATM 3840 C  CMA . HEM I 6 .   ? 28.240 51.359 15.213  1.00 19.42 ? 508  HEM A CMA 1 
HETATM 3841 C  CAA . HEM I 6 .   ? 25.785 51.130 17.257  1.00 24.96 ? 508  HEM A CAA 1 
HETATM 3842 C  CBA . HEM I 6 .   ? 24.465 50.892 16.539  1.00 20.30 ? 508  HEM A CBA 1 
HETATM 3843 C  CGA . HEM I 6 .   ? 24.679 50.783 15.059  1.00 22.76 ? 508  HEM A CGA 1 
HETATM 3844 O  O1A . HEM I 6 .   ? 25.152 49.709 14.602  1.00 23.81 ? 508  HEM A O1A 1 
HETATM 3845 O  O2A . HEM I 6 .   ? 24.393 51.812 14.373  1.00 25.03 ? 508  HEM A O2A 1 
HETATM 3846 C  C1B . HEM I 6 .   ? 29.383 55.702 14.860  1.00 19.89 ? 508  HEM A C1B 1 
HETATM 3847 C  C2B . HEM I 6 .   ? 30.144 56.286 13.737  1.00 21.96 ? 508  HEM A C2B 1 
HETATM 3848 C  C3B . HEM I 6 .   ? 30.123 57.629 13.878  1.00 21.06 ? 508  HEM A C3B 1 
HETATM 3849 C  C4B . HEM I 6 .   ? 29.306 57.939 15.049  1.00 20.92 ? 508  HEM A C4B 1 
HETATM 3850 C  CMB . HEM I 6 .   ? 30.833 55.447 12.654  1.00 21.49 ? 508  HEM A CMB 1 
HETATM 3851 C  CAB . HEM I 6 .   ? 30.675 58.726 12.964  1.00 23.14 ? 508  HEM A CAB 1 
HETATM 3852 C  CBB . HEM I 6 .   ? 30.041 58.909 11.746  1.00 20.45 ? 508  HEM A CBB 1 
HETATM 3853 C  C1C . HEM I 6 .   ? 28.378 59.477 16.729  1.00 18.52 ? 508  HEM A C1C 1 
HETATM 3854 C  C2C . HEM I 6 .   ? 28.338 60.764 17.418  1.00 20.40 ? 508  HEM A C2C 1 
HETATM 3855 C  C3C . HEM I 6 .   ? 27.532 60.632 18.481  1.00 18.34 ? 508  HEM A C3C 1 
HETATM 3856 C  C4C . HEM I 6 .   ? 27.131 59.231 18.516  1.00 19.23 ? 508  HEM A C4C 1 
HETATM 3857 C  CMC . HEM I 6 .   ? 29.051 62.058 16.970  1.00 21.23 ? 508  HEM A CMC 1 
HETATM 3858 C  CAC . HEM I 6 .   ? 27.151 61.687 19.529  1.00 22.92 ? 508  HEM A CAC 1 
HETATM 3859 C  CBC . HEM I 6 .   ? 26.963 63.012 19.288  1.00 25.44 ? 508  HEM A CBC 1 
HETATM 3860 C  C1D . HEM I 6 .   ? 25.691 57.449 19.376  1.00 23.71 ? 508  HEM A C1D 1 
HETATM 3861 C  C2D . HEM I 6 .   ? 24.621 57.048 20.267  1.00 21.61 ? 508  HEM A C2D 1 
HETATM 3862 C  C3D . HEM I 6 .   ? 24.234 55.660 19.817  1.00 22.20 ? 508  HEM A C3D 1 
HETATM 3863 C  C4D . HEM I 6 .   ? 25.166 55.354 18.756  1.00 21.65 ? 508  HEM A C4D 1 
HETATM 3864 C  CMD . HEM I 6 .   ? 23.922 57.850 21.389  1.00 23.93 ? 508  HEM A CMD 1 
HETATM 3865 C  CAD . HEM I 6 .   ? 23.185 54.723 20.440  1.00 22.65 ? 508  HEM A CAD 1 
HETATM 3866 C  CBD . HEM I 6 .   ? 21.758 55.142 20.073  1.00 21.76 ? 508  HEM A CBD 1 
HETATM 3867 C  CGD . HEM I 6 .   ? 21.374 54.599 18.739  1.00 22.20 ? 508  HEM A CGD 1 
HETATM 3868 O  O1D . HEM I 6 .   ? 22.176 53.867 18.121  1.00 24.92 ? 508  HEM A O1D 1 
HETATM 3869 O  O2D . HEM I 6 .   ? 20.256 54.921 18.243  1.00 20.08 ? 508  HEM A O2D 1 
HETATM 3870 N  NA  . HEM I 6 .   ? 27.172 54.635 16.660  1.00 20.73 ? 508  HEM A NA  1 
HETATM 3871 N  NB  . HEM I 6 .   ? 28.911 56.753 15.613  1.00 21.83 ? 508  HEM A NB  1 
HETATM 3872 N  NC  . HEM I 6 .   ? 27.682 58.556 17.459  1.00 20.58 ? 508  HEM A NC  1 
HETATM 3873 N  ND  . HEM I 6 .   ? 25.997 56.421 18.498  1.00 21.61 ? 508  HEM A ND  1 
HETATM 3874 FE FE  . HEM I 6 .   ? 27.431 56.562 17.006  1.00 22.37 ? 508  HEM A FE  1 
HETATM 3875 C  CHA . HEM J 6 .   ? 25.542 58.846 40.107  1.00 27.35 ? 509  HEM A CHA 1 
HETATM 3876 C  CHB . HEM J 6 .   ? 30.001 56.971 40.067  1.00 25.42 ? 509  HEM A CHB 1 
HETATM 3877 C  CHC . HEM J 6 .   ? 29.407 56.012 35.370  1.00 24.83 ? 509  HEM A CHC 1 
HETATM 3878 C  CHD . HEM J 6 .   ? 25.814 59.201 35.246  1.00 27.59 ? 509  HEM A CHD 1 
HETATM 3879 C  C1A . HEM J 6 .   ? 26.800 58.459 40.561  1.00 28.48 ? 509  HEM A C1A 1 
HETATM 3880 C  C2A . HEM J 6 .   ? 27.323 58.503 41.944  1.00 26.37 ? 509  HEM A C2A 1 
HETATM 3881 C  C3A . HEM J 6 .   ? 28.566 58.002 41.910  1.00 24.87 ? 509  HEM A C3A 1 
HETATM 3882 C  C4A . HEM J 6 .   ? 28.852 57.549 40.557  1.00 26.52 ? 509  HEM A C4A 1 
HETATM 3883 C  CMA . HEM J 6 .   ? 29.511 57.859 43.119  1.00 27.16 ? 509  HEM A CMA 1 
HETATM 3884 C  CAA . HEM J 6 .   ? 26.609 59.116 43.177  1.00 27.05 ? 509  HEM A CAA 1 
HETATM 3885 C  CBA . HEM J 6 .   ? 25.875 58.076 44.004  1.00 26.69 ? 509  HEM A CBA 1 
HETATM 3886 C  CGA . HEM J 6 .   ? 24.826 57.332 43.234  1.00 27.90 ? 509  HEM A CGA 1 
HETATM 3887 O  O1A . HEM J 6 .   ? 25.018 56.114 43.062  1.00 28.66 ? 509  HEM A O1A 1 
HETATM 3888 O  O2A . HEM J 6 .   ? 23.791 57.923 42.836  1.00 29.92 ? 509  HEM A O2A 1 
HETATM 3889 C  C1B . HEM J 6 .   ? 30.199 56.459 38.812  1.00 25.41 ? 509  HEM A C1B 1 
HETATM 3890 C  C2B . HEM J 6 .   ? 31.278 55.547 38.417  1.00 23.92 ? 509  HEM A C2B 1 
HETATM 3891 C  C3B . HEM J 6 .   ? 31.108 55.248 37.107  1.00 23.95 ? 509  HEM A C3B 1 
HETATM 3892 C  C4B . HEM J 6 .   ? 29.917 55.994 36.635  1.00 21.66 ? 509  HEM A C4B 1 
HETATM 3893 C  CMB . HEM J 6 .   ? 32.359 54.999 39.366  1.00 25.18 ? 509  HEM A CMB 1 
HETATM 3894 C  CAB . HEM J 6 .   ? 32.000 54.304 36.258  1.00 27.14 ? 509  HEM A CAB 1 
HETATM 3895 C  CBB . HEM J 6 .   ? 32.133 53.026 36.631  1.00 25.41 ? 509  HEM A CBB 1 
HETATM 3896 C  C1C . HEM J 6 .   ? 28.496 56.880 34.882  1.00 24.70 ? 509  HEM A C1C 1 
HETATM 3897 C  C2C . HEM J 6 .   ? 28.265 57.291 33.484  1.00 23.04 ? 509  HEM A C2C 1 
HETATM 3898 C  C3C . HEM J 6 .   ? 27.244 58.164 33.508  1.00 24.95 ? 509  HEM A C3C 1 
HETATM 3899 C  C4C . HEM J 6 .   ? 26.828 58.361 34.864  1.00 27.66 ? 509  HEM A C4C 1 
HETATM 3900 C  CMC . HEM J 6 .   ? 28.990 56.798 32.205  1.00 22.73 ? 509  HEM A CMC 1 
HETATM 3901 C  CAC . HEM J 6 .   ? 26.622 58.912 32.294  1.00 26.19 ? 509  HEM A CAC 1 
HETATM 3902 C  CBC . HEM J 6 .   ? 26.167 58.271 31.195  1.00 25.86 ? 509  HEM A CBC 1 
HETATM 3903 C  C1D . HEM J 6 .   ? 25.343 59.300 36.522  1.00 29.52 ? 509  HEM A C1D 1 
HETATM 3904 C  C2D . HEM J 6 .   ? 24.046 59.874 36.858  1.00 27.37 ? 509  HEM A C2D 1 
HETATM 3905 C  C3D . HEM J 6 .   ? 23.948 59.764 38.375  1.00 26.70 ? 509  HEM A C3D 1 
HETATM 3906 C  C4D . HEM J 6 .   ? 25.174 59.119 38.810  1.00 26.05 ? 509  HEM A C4D 1 
HETATM 3907 C  CMD . HEM J 6 .   ? 23.024 60.491 35.875  1.00 25.67 ? 509  HEM A CMD 1 
HETATM 3908 C  CAD . HEM J 6 .   ? 22.761 60.263 39.192  1.00 29.55 ? 509  HEM A CAD 1 
HETATM 3909 C  CBD . HEM J 6 .   ? 23.292 61.282 40.164  1.00 33.88 ? 509  HEM A CBD 1 
HETATM 3910 C  CGD . HEM J 6 .   ? 22.134 62.031 40.789  1.00 37.38 ? 509  HEM A CGD 1 
HETATM 3911 O  O1D . HEM J 6 .   ? 21.061 61.468 41.127  1.00 36.65 ? 509  HEM A O1D 1 
HETATM 3912 O  O2D . HEM J 6 .   ? 22.341 63.231 40.964  1.00 43.51 ? 509  HEM A O2D 1 
HETATM 3913 N  NA  . HEM J 6 .   ? 27.771 57.872 39.805  1.00 22.30 ? 509  HEM A NA  1 
HETATM 3914 N  NB  . HEM J 6 .   ? 29.433 56.703 37.676  1.00 24.07 ? 509  HEM A NB  1 
HETATM 3915 N  NC  . HEM J 6 .   ? 27.595 57.557 35.700  1.00 24.38 ? 509  HEM A NC  1 
HETATM 3916 N  ND  . HEM J 6 .   ? 25.970 58.862 37.678  1.00 25.60 ? 509  HEM A ND  1 
HETATM 3917 FE FE  . HEM J 6 .   ? 27.718 57.723 37.750  1.00 27.26 ? 509  HEM A FE  1 
HETATM 3918 C  CHA . HEM K 6 .   ? 23.265 52.728 24.223  1.00 21.02 ? 510  HEM A CHA 1 
HETATM 3919 C  CHB . HEM K 6 .   ? 20.701 55.274 27.458  1.00 21.70 ? 510  HEM A CHB 1 
HETATM 3920 C  CHC . HEM K 6 .   ? 24.577 58.040 28.238  1.00 21.15 ? 510  HEM A CHC 1 
HETATM 3921 C  CHD . HEM K 6 .   ? 26.352 56.474 24.068  1.00 20.73 ? 510  HEM A CHD 1 
HETATM 3922 C  C1A . HEM K 6 .   ? 22.276 53.125 25.131  1.00 21.95 ? 510  HEM A C1A 1 
HETATM 3923 C  C2A . HEM K 6 .   ? 21.098 52.336 25.455  1.00 20.89 ? 510  HEM A C2A 1 
HETATM 3924 C  C3A . HEM K 6 .   ? 20.379 53.033 26.385  1.00 22.18 ? 510  HEM A C3A 1 
HETATM 3925 C  C4A . HEM K 6 .   ? 21.121 54.260 26.636  1.00 23.38 ? 510  HEM A C4A 1 
HETATM 3926 C  CMA . HEM K 6 .   ? 19.056 52.707 27.105  1.00 22.23 ? 510  HEM A CMA 1 
HETATM 3927 C  CAA . HEM K 6 .   ? 20.802 50.914 24.907  1.00 21.79 ? 510  HEM A CAA 1 
HETATM 3928 C  CBA . HEM K 6 .   ? 21.185 49.925 26.053  1.00 20.69 ? 510  HEM A CBA 1 
HETATM 3929 C  CGA . HEM K 6 .   ? 20.621 48.549 25.813  1.00 28.18 ? 510  HEM A CGA 1 
HETATM 3930 O  O1A . HEM K 6 .   ? 20.646 48.044 24.651  1.00 30.65 ? 510  HEM A O1A 1 
HETATM 3931 O  O2A . HEM K 6 .   ? 20.075 47.960 26.770  1.00 31.06 ? 510  HEM A O2A 1 
HETATM 3932 C  C1B . HEM K 6 .   ? 21.514 56.236 27.998  1.00 21.11 ? 510  HEM A C1B 1 
HETATM 3933 C  C2B . HEM K 6 .   ? 21.215 57.117 29.072  1.00 21.09 ? 510  HEM A C2B 1 
HETATM 3934 C  C3B . HEM K 6 .   ? 22.307 57.880 29.348  1.00 18.67 ? 510  HEM A C3B 1 
HETATM 3935 C  C4B . HEM K 6 .   ? 23.311 57.526 28.369  1.00 21.41 ? 510  HEM A C4B 1 
HETATM 3936 C  CMB . HEM K 6 .   ? 19.875 57.115 29.835  1.00 23.16 ? 510  HEM A CMB 1 
HETATM 3937 C  CAB . HEM K 6 .   ? 22.439 58.951 30.488  1.00 23.88 ? 510  HEM A CAB 1 
HETATM 3938 C  CBB . HEM K 6 .   ? 22.399 58.445 31.788  1.00 20.57 ? 510  HEM A CBB 1 
HETATM 3939 C  C1C . HEM K 6 .   ? 25.404 57.898 27.174  1.00 19.82 ? 510  HEM A C1C 1 
HETATM 3940 C  C2C . HEM K 6 .   ? 26.622 58.678 26.893  1.00 20.96 ? 510  HEM A C2C 1 
HETATM 3941 C  C3C . HEM K 6 .   ? 27.099 58.248 25.714  1.00 21.45 ? 510  HEM A C3C 1 
HETATM 3942 C  C4C . HEM K 6 .   ? 26.213 57.195 25.242  1.00 19.48 ? 510  HEM A C4C 1 
HETATM 3943 C  CMC . HEM K 6 .   ? 27.197 59.829 27.740  1.00 23.26 ? 510  HEM A CMC 1 
HETATM 3944 C  CAC . HEM K 6 .   ? 28.354 58.725 24.953  1.00 24.71 ? 510  HEM A CAC 1 
HETATM 3945 C  CBC . HEM K 6 .   ? 29.579 58.751 25.528  1.00 21.08 ? 510  HEM A CBC 1 
HETATM 3946 C  C1D . HEM K 6 .   ? 25.718 55.317 23.723  1.00 21.75 ? 510  HEM A C1D 1 
HETATM 3947 C  C2D . HEM K 6 .   ? 26.124 54.481 22.582  1.00 20.37 ? 510  HEM A C2D 1 
HETATM 3948 C  C3D . HEM K 6 .   ? 25.143 53.317 22.627  1.00 22.36 ? 510  HEM A C3D 1 
HETATM 3949 C  C4D . HEM K 6 .   ? 24.273 53.526 23.771  1.00 19.92 ? 510  HEM A C4D 1 
HETATM 3950 C  CMD . HEM K 6 .   ? 27.279 54.802 21.579  1.00 16.89 ? 510  HEM A CMD 1 
HETATM 3951 C  CAD . HEM K 6 .   ? 25.130 52.142 21.687  1.00 22.07 ? 510  HEM A CAD 1 
HETATM 3952 C  CBD . HEM K 6 .   ? 26.180 51.165 22.208  1.00 24.14 ? 510  HEM A CBD 1 
HETATM 3953 C  CGD . HEM K 6 .   ? 26.347 49.923 21.372  1.00 26.15 ? 510  HEM A CGD 1 
HETATM 3954 O  O1D . HEM K 6 .   ? 25.425 49.546 20.602  1.00 25.17 ? 510  HEM A O1D 1 
HETATM 3955 O  O2D . HEM K 6 .   ? 27.455 49.305 21.505  1.00 24.65 ? 510  HEM A O2D 1 
HETATM 3956 N  NA  . HEM K 6 .   ? 22.296 54.276 25.880  1.00 20.64 ? 510  HEM A NA  1 
HETATM 3957 N  NB  . HEM K 6 .   ? 22.808 56.512 27.610  1.00 20.42 ? 510  HEM A NB  1 
HETATM 3958 N  NC  . HEM K 6 .   ? 25.182 57.017 26.138  1.00 21.81 ? 510  HEM A NC  1 
HETATM 3959 N  ND  . HEM K 6 .   ? 24.634 54.737 24.352  1.00 21.26 ? 510  HEM A ND  1 
HETATM 3960 FE FE  . HEM K 6 .   ? 23.777 55.683 25.961  1.00 22.81 ? 510  HEM A FE  1 
HETATM 3961 C  CHA . HEM L 6 .   ? 14.175 53.257 25.485  1.00 21.46 ? 511  HEM A CHA 1 
HETATM 3962 C  CHB . HEM L 6 .   ? 17.531 56.643 26.077  1.00 21.48 ? 511  HEM A CHB 1 
HETATM 3963 C  CHC . HEM L 6 .   ? 14.419 58.900 28.989  1.00 19.55 ? 511  HEM A CHC 1 
HETATM 3964 C  CHD . HEM L 6 .   ? 12.076 54.803 29.474  1.00 20.73 ? 511  HEM A CHD 1 
HETATM 3965 C  C1A . HEM L 6 .   ? 15.324 53.994 25.306  1.00 23.82 ? 511  HEM A C1A 1 
HETATM 3966 C  C2A . HEM L 6 .   ? 16.394 53.723 24.335  1.00 25.55 ? 511  HEM A C2A 1 
HETATM 3967 C  C3A . HEM L 6 .   ? 17.330 54.677 24.501  1.00 19.84 ? 511  HEM A C3A 1 
HETATM 3968 C  C4A . HEM L 6 .   ? 16.865 55.584 25.522  1.00 23.58 ? 511  HEM A C4A 1 
HETATM 3969 C  CMA . HEM L 6 .   ? 18.646 54.854 23.702  1.00 23.99 ? 511  HEM A CMA 1 
HETATM 3970 C  CAA . HEM L 6 .   ? 16.394 52.543 23.324  1.00 27.32 ? 511  HEM A CAA 1 
HETATM 3971 C  CBA . HEM L 6 .   ? 16.682 51.219 24.067  1.00 31.24 ? 511  HEM A CBA 1 
HETATM 3972 C  CGA . HEM L 6 .   ? 17.050 50.235 23.014  1.00 38.31 ? 511  HEM A CGA 1 
HETATM 3973 O  O1A . HEM L 6 .   ? 18.267 50.044 22.789  1.00 40.72 ? 511  HEM A O1A 1 
HETATM 3974 O  O2A . HEM L 6 .   ? 16.122 49.671 22.390  1.00 41.01 ? 511  HEM A O2A 1 
HETATM 3975 C  C1B . HEM L 6 .   ? 16.940 57.568 26.891  1.00 22.53 ? 511  HEM A C1B 1 
HETATM 3976 C  C2B . HEM L 6 .   ? 17.459 58.912 27.079  1.00 21.90 ? 511  HEM A C2B 1 
HETATM 3977 C  C3B . HEM L 6 .   ? 16.566 59.547 27.873  1.00 21.64 ? 511  HEM A C3B 1 
HETATM 3978 C  C4B . HEM L 6 .   ? 15.525 58.637 28.199  1.00 22.29 ? 511  HEM A C4B 1 
HETATM 3979 C  CMB . HEM L 6 .   ? 18.766 59.470 26.468  1.00 21.24 ? 511  HEM A CMB 1 
HETATM 3980 C  CAB . HEM L 6 .   ? 16.633 60.993 28.302  1.00 24.03 ? 511  HEM A CAB 1 
HETATM 3981 C  CBB . HEM L 6 .   ? 16.562 61.927 27.313  1.00 27.46 ? 511  HEM A CBB 1 
HETATM 3982 C  C1C . HEM L 6 .   ? 13.520 58.016 29.447  1.00 22.21 ? 511  HEM A C1C 1 
HETATM 3983 C  C2C . HEM L 6 .   ? 12.518 58.225 30.481  1.00 19.97 ? 511  HEM A C2C 1 
HETATM 3984 C  C3C . HEM L 6 .   ? 11.859 57.073 30.591  1.00 24.27 ? 511  HEM A C3C 1 
HETATM 3985 C  C4C . HEM L 6 .   ? 12.430 56.113 29.665  1.00 24.38 ? 511  HEM A C4C 1 
HETATM 3986 C  CMC . HEM L 6 .   ? 12.304 59.574 31.215  1.00 22.76 ? 511  HEM A CMC 1 
HETATM 3987 C  CAC . HEM L 6 .   ? 10.655 56.712 31.503  1.00 23.66 ? 511  HEM A CAC 1 
HETATM 3988 C  CBC . HEM L 6 .   ? 9.803  57.729 31.812  1.00 22.67 ? 511  HEM A CBC 1 
HETATM 3989 C  C1D . HEM L 6 .   ? 12.317 53.995 28.378  1.00 22.19 ? 511  HEM A C1D 1 
HETATM 3990 C  C2D . HEM L 6 .   ? 11.515 52.876 27.947  1.00 23.74 ? 511  HEM A C2D 1 
HETATM 3991 C  C3D . HEM L 6 .   ? 12.150 52.414 26.663  1.00 22.32 ? 511  HEM A C3D 1 
HETATM 3992 C  C4D . HEM L 6 .   ? 13.289 53.282 26.506  1.00 22.14 ? 511  HEM A C4D 1 
HETATM 3993 C  CMD . HEM L 6 .   ? 10.248 52.304 28.623  1.00 22.23 ? 511  HEM A CMD 1 
HETATM 3994 C  CAD . HEM L 6 .   ? 11.715 51.249 25.786  1.00 25.97 ? 511  HEM A CAD 1 
HETATM 3995 C  CBD . HEM L 6 .   ? 12.357 49.999 26.328  1.00 31.80 ? 511  HEM A CBD 1 
HETATM 3996 C  CGD . HEM L 6 .   ? 13.669 49.813 25.604  1.00 35.74 ? 511  HEM A CGD 1 
HETATM 3997 O  O1D . HEM L 6 .   ? 13.677 49.667 24.354  1.00 36.64 ? 511  HEM A O1D 1 
HETATM 3998 O  O2D . HEM L 6 .   ? 14.726 49.805 26.292  1.00 37.95 ? 511  HEM A O2D 1 
HETATM 3999 N  NA  . HEM L 6 .   ? 15.669 55.106 26.010  1.00 22.55 ? 511  HEM A NA  1 
HETATM 4000 N  NB  . HEM L 6 .   ? 15.764 57.434 27.589  1.00 21.72 ? 511  HEM A NB  1 
HETATM 4001 N  NC  . HEM L 6 .   ? 13.432 56.754 29.022  1.00 22.98 ? 511  HEM A NC  1 
HETATM 4002 N  ND  . HEM L 6 .   ? 13.345 54.222 27.481  1.00 23.50 ? 511  HEM A ND  1 
HETATM 4003 FE FE  . HEM L 6 .   ? 14.551 55.880 27.547  1.00 24.72 ? 511  HEM A FE  1 
HETATM 4004 C  CHA . HEM M 6 .   ? 2.676  59.138 32.166  1.00 30.26 ? 512  HEM A CHA 1 
HETATM 4005 C  CHB . HEM M 6 .   ? 4.569  54.738 31.522  1.00 28.91 ? 512  HEM A CHB 1 
HETATM 4006 C  CHC . HEM M 6 .   ? 8.212  55.973 34.518  1.00 31.78 ? 512  HEM A CHC 1 
HETATM 4007 C  CHD . HEM M 6 .   ? 5.711  59.848 35.926  1.00 33.41 ? 512  HEM A CHD 1 
HETATM 4008 C  C1A . HEM M 6 .   ? 2.911  57.888 31.652  1.00 29.54 ? 512  HEM A C1A 1 
HETATM 4009 C  C2A . HEM M 6 .   ? 2.223  57.260 30.548  1.00 26.59 ? 512  HEM A C2A 1 
HETATM 4010 C  C3A . HEM M 6 .   ? 2.724  56.042 30.381  1.00 25.87 ? 512  HEM A C3A 1 
HETATM 4011 C  C4A . HEM M 6 .   ? 3.779  55.843 31.376  1.00 25.79 ? 512  HEM A C4A 1 
HETATM 4012 C  CMA . HEM M 6 .   ? 2.299  55.018 29.313  1.00 29.74 ? 512  HEM A CMA 1 
HETATM 4013 C  CAA . HEM M 6 .   ? 1.074  57.829 29.693  1.00 28.18 ? 512  HEM A CAA 1 
HETATM 4014 C  CBA . HEM M 6 .   ? 1.720  58.899 28.842  1.00 30.11 ? 512  HEM A CBA 1 
HETATM 4015 C  CGA . HEM M 6 .   ? 1.898  58.515 27.388  1.00 36.76 ? 512  HEM A CGA 1 
HETATM 4016 O  O1A . HEM M 6 .   ? 0.883  58.278 26.679  1.00 30.06 ? 512  HEM A O1A 1 
HETATM 4017 O  O2A . HEM M 6 .   ? 3.076  58.471 26.924  1.00 40.92 ? 512  HEM A O2A 1 
HETATM 4018 C  C1B . HEM M 6 .   ? 5.754  54.699 32.229  1.00 29.30 ? 512  HEM A C1B 1 
HETATM 4019 C  C2B . HEM M 6 .   ? 6.699  53.600 32.220  1.00 31.84 ? 512  HEM A C2B 1 
HETATM 4020 C  C3B . HEM M 6 .   ? 7.715  53.946 33.033  1.00 31.56 ? 512  HEM A C3B 1 
HETATM 4021 C  C4B . HEM M 6 .   ? 7.434  55.250 33.608  1.00 29.28 ? 512  HEM A C4B 1 
HETATM 4022 C  CMB . HEM M 6 .   ? 6.544  52.306 31.383  1.00 33.56 ? 512  HEM A CMB 1 
HETATM 4023 C  CAB . HEM M 6 .   ? 9.000  53.093 33.301  1.00 31.07 ? 512  HEM A CAB 1 
HETATM 4024 C  CBB . HEM M 6 .   ? 9.832  52.754 32.274  1.00 29.58 ? 512  HEM A CBB 1 
HETATM 4025 C  C1C . HEM M 6 .   ? 7.869  57.120 35.218  1.00 29.54 ? 512  HEM A C1C 1 
HETATM 4026 C  C2C . HEM M 6 .   ? 8.592  57.824 36.299  1.00 30.30 ? 512  HEM A C2C 1 
HETATM 4027 C  C3C . HEM M 6 .   ? 7.892  58.918 36.646  1.00 31.39 ? 512  HEM A C3C 1 
HETATM 4028 C  C4C . HEM M 6 .   ? 6.688  58.912 35.830  1.00 30.58 ? 512  HEM A C4C 1 
HETATM 4029 C  CMC . HEM M 6 .   ? 9.982  57.435 36.879  1.00 29.80 ? 512  HEM A CMC 1 
HETATM 4030 C  CAC . HEM M 6 .   ? 8.140  60.033 37.720  1.00 33.08 ? 512  HEM A CAC 1 
HETATM 4031 C  CBC . HEM M 6 .   ? 9.270  60.724 37.935  1.00 35.11 ? 512  HEM A CBC 1 
HETATM 4032 C  C1D . HEM M 6 .   ? 4.718  60.032 35.012  1.00 31.86 ? 512  HEM A C1D 1 
HETATM 4033 C  C2D . HEM M 6 .   ? 3.935  61.229 34.994  1.00 33.32 ? 512  HEM A C2D 1 
HETATM 4034 C  C3D . HEM M 6 .   ? 2.964  60.995 33.828  1.00 35.03 ? 512  HEM A C3D 1 
HETATM 4035 C  C4D . HEM M 6 .   ? 3.303  59.699 33.260  1.00 32.48 ? 512  HEM A C4D 1 
HETATM 4036 C  CMD . HEM M 6 .   ? 4.030  62.392 36.000  1.00 32.98 ? 512  HEM A CMD 1 
HETATM 4037 C  CAD . HEM M 6 .   ? 1.881  61.984 33.360  1.00 39.50 ? 512  HEM A CAD 1 
HETATM 4038 C  CBD . HEM M 6 .   ? 0.511  61.532 33.813  1.00 44.87 ? 512  HEM A CBD 1 
HETATM 4039 C  CGD . HEM M 6 .   ? 0.396  61.991 35.238  1.00 45.49 ? 512  HEM A CGD 1 
HETATM 4040 O  O1D . HEM M 6 .   ? 0.361  63.225 35.440  1.00 47.90 ? 512  HEM A O1D 1 
HETATM 4041 O  O2D . HEM M 6 .   ? 0.366  61.129 36.145  1.00 45.98 ? 512  HEM A O2D 1 
HETATM 4042 N  NA  . HEM M 6 .   ? 3.869  56.996 32.124  1.00 28.53 ? 512  HEM A NA  1 
HETATM 4043 N  NB  . HEM M 6 .   ? 6.231  55.686 33.073  1.00 29.26 ? 512  HEM A NB  1 
HETATM 4044 N  NC  . HEM M 6 .   ? 6.727  57.848 34.983  1.00 29.54 ? 512  HEM A NC  1 
HETATM 4045 N  ND  . HEM M 6 .   ? 4.368  59.153 33.986  1.00 30.17 ? 512  HEM A ND  1 
HETATM 4046 FE FE  . HEM M 6 .   ? 5.328  57.499 33.470  1.00 29.20 ? 512  HEM A FE  1 
HETATM 4047 O  O   . HOH N 7 .   ? 27.075 62.724 7.429   1.00 36.18 ? 514  HOH A O   1 
HETATM 4048 O  O   . HOH N 7 .   ? 27.026 63.220 10.622  1.00 38.98 ? 515  HOH A O   1 
HETATM 4049 O  O   . HOH N 7 .   ? 36.202 56.537 32.739  1.00 23.75 ? 516  HOH A O   1 
HETATM 4050 O  O   . HOH N 7 .   ? 44.863 56.869 30.153  1.00 29.60 ? 517  HOH A O   1 
HETATM 4051 O  O   . HOH N 7 .   ? 43.390 58.688 31.865  1.00 25.82 ? 518  HOH A O   1 
HETATM 4052 O  O   . HOH N 7 .   ? 44.849 60.683 31.795  1.00 43.68 ? 519  HOH A O   1 
HETATM 4053 O  O   . HOH N 7 .   ? 46.556 61.813 27.834  1.00 40.02 ? 520  HOH A O   1 
HETATM 4054 O  O   . HOH N 7 .   ? 43.336 55.423 28.356  1.00 27.60 ? 521  HOH A O   1 
HETATM 4055 O  O   . HOH N 7 .   ? 35.737 52.963 30.403  1.00 27.07 ? 522  HOH A O   1 
HETATM 4056 O  O   . HOH N 7 .   ? 37.768 51.294 30.756  1.00 23.35 ? 523  HOH A O   1 
HETATM 4057 O  O   . HOH N 7 .   ? 37.962 48.860 26.473  1.00 26.99 ? 524  HOH A O   1 
HETATM 4058 O  O   . HOH N 7 .   ? 40.387 51.348 41.205  1.00 30.08 ? 525  HOH A O   1 
HETATM 4059 O  O   . HOH N 7 .   ? 30.213 52.457 45.751  1.00 31.57 ? 526  HOH A O   1 
HETATM 4060 O  O   . HOH N 7 .   ? 28.004 55.821 46.881  1.00 42.90 ? 527  HOH A O   1 
HETATM 4061 O  O   . HOH N 7 .   ? 26.249 47.367 42.622  1.00 35.43 ? 528  HOH A O   1 
HETATM 4062 O  O   . HOH N 7 .   ? 26.410 53.631 33.621  1.00 26.60 ? 529  HOH A O   1 
HETATM 4063 O  O   . HOH N 7 .   ? 27.388 53.263 31.171  1.00 25.62 ? 530  HOH A O   1 
HETATM 4064 O  O   . HOH N 7 .   ? 28.198 50.663 31.117  1.00 22.98 ? 531  HOH A O   1 
HETATM 4065 O  O   . HOH N 7 .   ? 30.239 51.001 29.386  1.00 22.60 ? 532  HOH A O   1 
HETATM 4066 O  O   . HOH N 7 .   ? 31.893 48.922 30.423  1.00 24.74 ? 533  HOH A O   1 
HETATM 4067 O  O   . HOH N 7 .   ? 34.268 46.677 27.108  1.00 23.75 ? 534  HOH A O   1 
HETATM 4068 O  O   . HOH N 7 .   ? 21.472 45.346 18.795  1.00 34.67 ? 535  HOH A O   1 
HETATM 4069 O  O   . HOH N 7 .   ? 18.350 45.497 26.615  1.00 49.29 ? 536  HOH A O   1 
HETATM 4070 O  O   . HOH N 7 .   ? 25.003 47.756 18.427  1.00 25.03 ? 537  HOH A O   1 
HETATM 4071 O  O   . HOH N 7 .   ? 26.329 47.826 15.988  1.00 22.36 ? 538  HOH A O   1 
HETATM 4072 O  O   . HOH N 7 .   ? 29.629 44.560 16.828  1.00 27.62 ? 539  HOH A O   1 
HETATM 4073 O  O   . HOH N 7 .   ? 28.107 44.976 12.863  1.00 21.26 ? 540  HOH A O   1 
HETATM 4074 O  O   . HOH N 7 .   ? 26.271 48.810 12.283  1.00 24.28 ? 541  HOH A O   1 
HETATM 4075 O  O   . HOH N 7 .   ? 23.272 45.801 9.932   1.00 28.67 ? 542  HOH A O   1 
HETATM 4076 O  O   . HOH N 7 .   ? 24.786 44.674 7.822   1.00 24.40 ? 543  HOH A O   1 
HETATM 4077 O  O   . HOH N 7 .   ? 26.702 42.633 8.244   1.00 24.99 ? 544  HOH A O   1 
HETATM 4078 O  O   . HOH N 7 .   ? 13.477 51.524 13.630  1.00 36.59 ? 545  HOH A O   1 
HETATM 4079 O  O   . HOH N 7 .   ? 11.576 51.252 8.213   1.00 24.26 ? 546  HOH A O   1 
HETATM 4080 O  O   . HOH N 7 .   ? 9.810  49.400 7.034   1.00 25.26 ? 547  HOH A O   1 
HETATM 4081 O  O   . HOH N 7 .   ? 11.421 47.421 5.892   1.00 20.45 ? 548  HOH A O   1 
HETATM 4082 O  O   . HOH N 7 .   ? 11.607 47.533 14.493  1.00 34.83 ? 549  HOH A O   1 
HETATM 4083 O  O   . HOH N 7 .   ? 12.715 53.426 2.175   1.00 23.36 ? 550  HOH A O   1 
HETATM 4084 O  O   . HOH N 7 .   ? 17.783 59.707 6.355   1.00 20.78 ? 551  HOH A O   1 
HETATM 4085 O  O   . HOH N 7 .   ? 18.821 50.192 -8.309  1.00 40.74 ? 552  HOH A O   1 
HETATM 4086 O  O   . HOH N 7 .   ? 19.828 56.160 -9.920  1.00 28.13 ? 553  HOH A O   1 
HETATM 4087 O  O   . HOH N 7 .   ? 22.992 53.326 -4.493  1.00 31.93 ? 554  HOH A O   1 
HETATM 4088 O  O   . HOH N 7 .   ? 25.543 58.888 -4.216  1.00 38.81 ? 555  HOH A O   1 
HETATM 4089 O  O   . HOH N 7 .   ? 27.130 58.787 -1.859  1.00 35.29 ? 556  HOH A O   1 
HETATM 4090 O  O   . HOH N 7 .   ? 28.025 58.819 2.093   1.00 36.40 ? 557  HOH A O   1 
HETATM 4091 O  O   . HOH N 7 .   ? 32.753 48.950 4.853   1.00 30.76 ? 558  HOH A O   1 
HETATM 4092 O  O   . HOH N 7 .   ? 23.145 54.137 15.431  1.00 26.13 ? 559  HOH A O   1 
HETATM 4093 O  O   . HOH N 7 .   ? 20.200 56.703 14.256  1.00 42.54 ? 560  HOH A O   1 
HETATM 4094 O  O   . HOH N 7 .   ? 19.336 54.822 15.731  1.00 23.66 ? 561  HOH A O   1 
HETATM 4095 O  O   . HOH N 7 .   ? 19.789 55.437 11.949  1.00 25.55 ? 562  HOH A O   1 
HETATM 4096 O  O   . HOH N 7 .   ? 16.991 55.404 11.759  1.00 25.44 ? 563  HOH A O   1 
HETATM 4097 O  O   . HOH N 7 .   ? 15.718 53.286 13.315  1.00 25.54 ? 564  HOH A O   1 
HETATM 4098 O  O   . HOH N 7 .   ? 20.759 52.210 16.263  1.00 22.72 ? 565  HOH A O   1 
HETATM 4099 O  O   . HOH N 7 .   ? 33.559 48.412 23.674  1.00 24.57 ? 566  HOH A O   1 
HETATM 4100 O  O   . HOH N 7 .   ? 37.111 47.280 22.703  1.00 22.66 ? 567  HOH A O   1 
HETATM 4101 O  O   . HOH N 7 .   ? 39.637 48.773 23.058  1.00 25.22 ? 568  HOH A O   1 
HETATM 4102 O  O   . HOH N 7 .   ? 40.509 48.893 20.447  1.00 25.81 ? 569  HOH A O   1 
HETATM 4103 O  O   . HOH N 7 .   ? 40.454 51.569 19.338  1.00 22.79 ? 570  HOH A O   1 
HETATM 4104 O  O   . HOH N 7 .   ? 30.917 58.490 18.317  1.00 23.69 ? 571  HOH A O   1 
HETATM 4105 O  O   . HOH N 7 .   ? 37.567 50.848 3.946   1.00 35.93 ? 572  HOH A O   1 
HETATM 4106 O  O   . HOH N 7 .   ? 41.274 47.906 3.445   1.00 31.53 ? 573  HOH A O   1 
HETATM 4107 O  O   . HOH N 7 .   ? 39.335 55.957 9.184   1.00 27.00 ? 574  HOH A O   1 
HETATM 4108 O  O   . HOH N 7 .   ? 40.780 54.825 2.542   1.00 35.06 ? 575  HOH A O   1 
HETATM 4109 O  O   . HOH N 7 .   ? 43.876 46.968 7.707   1.00 42.68 ? 576  HOH A O   1 
HETATM 4110 O  O   . HOH N 7 .   ? 44.112 60.961 9.729   1.00 36.36 ? 577  HOH A O   1 
HETATM 4111 O  O   . HOH N 7 .   ? 43.822 62.525 7.523   1.00 45.74 ? 578  HOH A O   1 
HETATM 4112 O  O   . HOH N 7 .   ? 36.076 64.611 12.449  1.00 28.13 ? 579  HOH A O   1 
HETATM 4113 O  O   . HOH N 7 .   ? 36.487 60.905 6.312   1.00 49.49 ? 580  HOH A O   1 
HETATM 4114 O  O   . HOH N 7 .   ? 30.733 62.257 24.382  1.00 25.86 ? 581  HOH A O   1 
HETATM 4115 O  O   . HOH N 7 .   ? 31.634 62.529 27.025  1.00 24.44 ? 582  HOH A O   1 
HETATM 4116 O  O   . HOH N 7 .   ? 29.249 72.096 34.996  1.00 45.45 ? 583  HOH A O   1 
HETATM 4117 O  O   . HOH N 7 .   ? 28.848 70.975 27.046  1.00 36.49 ? 584  HOH A O   1 
HETATM 4118 O  O   . HOH N 7 .   ? 27.080 72.072 18.658  1.00 25.09 ? 585  HOH A O   1 
HETATM 4119 O  O   . HOH N 7 .   ? 25.126 74.050 17.878  1.00 33.67 ? 586  HOH A O   1 
HETATM 4120 O  O   . HOH N 7 .   ? 29.992 71.985 17.662  1.00 33.62 ? 587  HOH A O   1 
HETATM 4121 O  O   . HOH N 7 .   ? 17.974 71.642 28.715  1.00 39.57 ? 588  HOH A O   1 
HETATM 4122 O  O   . HOH N 7 .   ? 12.056 67.855 19.599  1.00 36.38 ? 589  HOH A O   1 
HETATM 4123 O  O   . HOH N 7 .   ? 22.511 65.693 9.619   1.00 24.66 ? 590  HOH A O   1 
HETATM 4124 O  O   . HOH N 7 .   ? 28.078 73.545 7.159   1.00 44.87 ? 591  HOH A O   1 
HETATM 4125 O  O   . HOH N 7 .   ? 32.744 74.441 13.665  1.00 35.84 ? 592  HOH A O   1 
HETATM 4126 O  O   . HOH N 7 .   ? 30.186 70.285 7.058   1.00 36.51 ? 593  HOH A O   1 
HETATM 4127 O  O   . HOH N 7 .   ? 28.955 65.606 6.744   1.00 34.20 ? 594  HOH A O   1 
HETATM 4128 O  O   . HOH N 7 .   ? 43.910 69.171 8.003   1.00 36.27 ? 595  HOH A O   1 
HETATM 4129 O  O   . HOH N 7 .   ? 45.759 66.777 10.370  1.00 53.24 ? 596  HOH A O   1 
HETATM 4130 O  O   . HOH N 7 .   ? 25.827 78.533 20.601  1.00 40.14 ? 597  HOH A O   1 
HETATM 4131 O  O   . HOH N 7 .   ? 7.565  69.021 15.925  1.00 42.67 ? 598  HOH A O   1 
HETATM 4132 O  O   . HOH N 7 .   ? 5.705  68.146 10.011  1.00 26.63 ? 599  HOH A O   1 
HETATM 4133 O  O   . HOH N 7 .   ? 21.225 76.803 9.833   1.00 37.18 ? 600  HOH A O   1 
HETATM 4134 O  O   . HOH N 7 .   ? 8.473  69.583 1.446   1.00 37.43 ? 601  HOH A O   1 
HETATM 4135 O  O   . HOH N 7 .   ? 26.210 69.667 2.224   1.00 29.12 ? 602  HOH A O   1 
HETATM 4136 O  O   . HOH N 7 .   ? 16.273 63.330 4.262   1.00 24.18 ? 603  HOH A O   1 
HETATM 4137 O  O   . HOH N 7 .   ? 26.931 61.555 -1.314  1.00 31.16 ? 604  HOH A O   1 
HETATM 4138 O  O   . HOH N 7 .   ? 24.465 52.218 -0.913  1.00 25.40 ? 605  HOH A O   1 
HETATM 4139 O  O   . HOH N 7 .   ? 15.824 69.426 -3.829  1.00 35.34 ? 606  HOH A O   1 
HETATM 4140 O  O   . HOH N 7 .   ? 18.269 55.566 20.049  1.00 21.71 ? 607  HOH A O   1 
HETATM 4141 O  O   . HOH N 7 .   ? 15.113 57.405 21.768  1.00 25.05 ? 608  HOH A O   1 
HETATM 4142 O  O   . HOH N 7 .   ? 13.224 59.772 22.305  1.00 21.13 ? 609  HOH A O   1 
HETATM 4143 O  O   . HOH N 7 .   ? 9.465  62.436 27.358  1.00 24.97 ? 610  HOH A O   1 
HETATM 4144 O  O   . HOH N 7 .   ? 13.276 59.185 17.349  1.00 24.14 ? 611  HOH A O   1 
HETATM 4145 O  O   . HOH N 7 .   ? 6.728  60.584 27.686  1.00 24.64 ? 612  HOH A O   1 
HETATM 4146 O  O   . HOH N 7 .   ? 16.052 66.253 33.169  1.00 28.91 ? 613  HOH A O   1 
HETATM 4147 O  O   . HOH N 7 .   ? 13.602 69.594 35.316  1.00 42.94 ? 614  HOH A O   1 
HETATM 4148 O  O   . HOH N 7 .   ? 16.811 69.624 40.448  1.00 37.39 ? 615  HOH A O   1 
HETATM 4149 O  O   . HOH N 7 .   ? 18.076 51.203 32.175  1.00 30.19 ? 616  HOH A O   1 
HETATM 4150 O  O   . HOH N 7 .   ? 16.453 50.502 35.090  1.00 47.00 ? 617  HOH A O   1 
HETATM 4151 O  O   . HOH N 7 .   ? 17.575 48.907 39.750  1.00 29.98 ? 618  HOH A O   1 
HETATM 4152 O  O   . HOH N 7 .   ? 24.010 50.852 28.233  1.00 22.07 ? 619  HOH A O   1 
HETATM 4153 O  O   . HOH N 7 .   ? 22.189 47.026 30.170  1.00 30.53 ? 620  HOH A O   1 
HETATM 4154 O  O   . HOH N 7 .   ? 11.388 54.636 18.768  1.00 36.97 ? 621  HOH A O   1 
HETATM 4155 O  O   . HOH N 7 .   ? 12.313 53.548 16.164  1.00 35.58 ? 622  HOH A O   1 
HETATM 4156 O  O   . HOH N 7 .   ? 11.771 51.664 18.078  1.00 34.20 ? 623  HOH A O   1 
HETATM 4157 O  O   . HOH N 7 .   ? 2.187  49.090 8.035   1.00 23.90 ? 624  HOH A O   1 
HETATM 4158 O  O   . HOH N 7 .   ? 10.548 46.578 2.265   1.00 37.06 ? 625  HOH A O   1 
HETATM 4159 O  O   . HOH N 7 .   ? 7.493  47.774 -1.449  1.00 25.49 ? 626  HOH A O   1 
HETATM 4160 O  O   . HOH N 7 .   ? 1.219  53.520 -0.910  1.00 28.87 ? 627  HOH A O   1 
HETATM 4161 O  O   . HOH N 7 .   ? 0.636  53.448 -3.640  1.00 40.52 ? 628  HOH A O   1 
HETATM 4162 O  O   . HOH N 7 .   ? 5.862  52.145 -8.489  1.00 35.42 ? 629  HOH A O   1 
HETATM 4163 O  O   . HOH N 7 .   ? 12.418 49.521 -15.272 1.00 40.26 ? 630  HOH A O   1 
HETATM 4164 O  O   . HOH N 7 .   ? 9.638  67.661 -9.178  1.00 23.73 ? 631  HOH A O   1 
HETATM 4165 O  O   . HOH N 7 .   ? 5.218  66.164 -11.574 1.00 27.74 ? 632  HOH A O   1 
HETATM 4166 O  O   . HOH N 7 .   ? 8.175  67.648 -13.302 1.00 41.84 ? 633  HOH A O   1 
HETATM 4167 O  O   . HOH N 7 .   ? -0.678 52.413 -7.156  1.00 25.79 ? 634  HOH A O   1 
HETATM 4168 O  O   . HOH N 7 .   ? 3.392  66.778 5.595   1.00 32.04 ? 635  HOH A O   1 
HETATM 4169 O  O   . HOH N 7 .   ? 1.369  69.158 4.291   1.00 39.39 ? 636  HOH A O   1 
HETATM 4170 O  O   . HOH N 7 .   ? 5.002  70.517 8.987   1.00 36.99 ? 637  HOH A O   1 
HETATM 4171 O  O   . HOH N 7 .   ? 1.542  55.103 20.208  1.00 25.37 ? 638  HOH A O   1 
HETATM 4172 O  O   . HOH N 7 .   ? 16.423 68.249 -8.912  1.00 25.19 ? 639  HOH A O   1 
HETATM 4173 O  O   . HOH N 7 .   ? 1.891  62.671 -19.873 1.00 32.01 ? 640  HOH A O   1 
HETATM 4174 O  O   . HOH N 7 .   ? 3.161  56.392 -19.931 1.00 35.65 ? 641  HOH A O   1 
HETATM 4175 O  O   . HOH N 7 .   ? 4.567  52.201 -18.589 1.00 36.21 ? 642  HOH A O   1 
HETATM 4176 O  O   . HOH N 7 .   ? 10.568 43.642 -7.577  1.00 41.07 ? 643  HOH A O   1 
HETATM 4177 O  O   . HOH N 7 .   ? 16.202 37.783 -0.699  1.00 28.99 ? 644  HOH A O   1 
HETATM 4178 O  O   . HOH N 7 .   ? 17.842 37.643 -2.939  1.00 43.43 ? 645  HOH A O   1 
HETATM 4179 O  O   . HOH N 7 .   ? 29.442 48.168 -3.171  1.00 31.19 ? 646  HOH A O   1 
HETATM 4180 O  O   . HOH N 7 .   ? 32.438 37.296 9.202   1.00 37.39 ? 647  HOH A O   1 
HETATM 4181 O  O   . HOH N 7 .   ? 39.279 39.833 14.723  1.00 46.37 ? 648  HOH A O   1 
HETATM 4182 O  O   . HOH N 7 .   ? 44.051 42.417 22.897  1.00 37.01 ? 649  HOH A O   1 
HETATM 4183 O  O   . HOH N 7 .   ? 39.262 42.117 21.451  1.00 26.26 ? 650  HOH A O   1 
HETATM 4184 O  O   . HOH N 7 .   ? 38.025 40.717 23.530  1.00 39.01 ? 651  HOH A O   1 
HETATM 4185 O  O   . HOH N 7 .   ? 35.606 39.071 22.711  1.00 32.52 ? 652  HOH A O   1 
HETATM 4186 O  O   . HOH N 7 .   ? 50.734 44.813 24.113  1.00 32.28 ? 653  HOH A O   1 
HETATM 4187 O  O   . HOH N 7 .   ? 27.031 39.024 28.016  1.00 46.30 ? 654  HOH A O   1 
HETATM 4188 O  O   . HOH N 7 .   ? 36.407 50.066 28.628  1.00 31.28 ? 655  HOH A O   1 
HETATM 4189 O  O   . HOH N 7 .   ? 34.392 48.100 29.582  1.00 24.66 ? 656  HOH A O   1 
HETATM 4190 O  O   . HOH N 7 .   ? 35.169 46.671 31.864  1.00 32.32 ? 657  HOH A O   1 
HETATM 4191 O  O   . HOH N 7 .   ? 40.757 49.396 29.941  1.00 27.47 ? 658  HOH A O   1 
HETATM 4192 O  O   . HOH N 7 .   ? 42.415 54.838 41.412  1.00 25.14 ? 659  HOH A O   1 
HETATM 4193 O  O   . HOH N 7 .   ? 35.160 59.295 46.986  1.00 41.13 ? 660  HOH A O   1 
HETATM 4194 O  O   . HOH N 7 .   ? 36.149 46.092 45.368  1.00 40.29 ? 661  HOH A O   1 
HETATM 4195 O  O   . HOH N 7 .   ? 37.736 49.460 47.298  1.00 38.29 ? 662  HOH A O   1 
HETATM 4196 O  O   . HOH N 7 .   ? 23.898 45.606 40.158  1.00 51.01 ? 663  HOH A O   1 
HETATM 4197 O  O   . HOH N 7 .   ? 22.621 46.365 38.106  1.00 38.24 ? 664  HOH A O   1 
HETATM 4198 O  O   . HOH N 7 .   ? 20.119 58.176 39.011  1.00 30.76 ? 665  HOH A O   1 
HETATM 4199 O  O   . HOH N 7 .   ? 16.619 46.105 24.905  1.00 51.34 ? 666  HOH A O   1 
HETATM 4200 O  O   . HOH N 7 .   ? 22.677 38.830 18.994  1.00 33.42 ? 667  HOH A O   1 
HETATM 4201 O  O   . HOH N 7 .   ? 19.451 40.509 13.907  1.00 34.24 ? 668  HOH A O   1 
HETATM 4202 O  O   . HOH N 7 .   ? 21.525 39.460 12.657  1.00 33.13 ? 669  HOH A O   1 
HETATM 4203 O  O   . HOH N 7 .   ? 13.938 49.480 17.632  1.00 36.22 ? 670  HOH A O   1 
HETATM 4204 O  O   . HOH N 7 .   ? 23.023 40.162 10.412  1.00 27.71 ? 671  HOH A O   1 
HETATM 4205 O  O   . HOH N 7 .   ? 23.330 40.125 6.555   1.00 35.06 ? 672  HOH A O   1 
HETATM 4206 O  O   . HOH N 7 .   ? 15.688 41.037 5.325   1.00 30.61 ? 673  HOH A O   1 
HETATM 4207 O  O   . HOH N 7 .   ? 8.374  49.729 4.938   1.00 29.38 ? 674  HOH A O   1 
HETATM 4208 O  O   . HOH N 7 .   ? 6.494  45.152 14.133  1.00 48.45 ? 675  HOH A O   1 
HETATM 4209 O  O   . HOH N 7 .   ? 8.694  48.750 2.501   1.00 29.24 ? 676  HOH A O   1 
HETATM 4210 O  O   . HOH N 7 .   ? 10.003 42.795 4.886   1.00 30.11 ? 677  HOH A O   1 
HETATM 4211 O  O   . HOH N 7 .   ? 3.560  48.851 5.208   1.00 42.87 ? 678  HOH A O   1 
HETATM 4212 O  O   . HOH N 7 .   ? 9.481  46.020 -0.798  1.00 31.39 ? 679  HOH A O   1 
HETATM 4213 O  O   . HOH N 7 .   ? 8.330  48.414 -4.130  1.00 28.65 ? 680  HOH A O   1 
HETATM 4214 O  O   . HOH N 7 .   ? 31.408 53.406 5.085   1.00 26.55 ? 681  HOH A O   1 
HETATM 4215 O  O   . HOH N 7 .   ? 28.810 46.619 15.188  1.00 27.67 ? 682  HOH A O   1 
HETATM 4216 O  O   . HOH N 7 .   ? 35.886 47.743 25.134  1.00 21.60 ? 683  HOH A O   1 
HETATM 4217 O  O   . HOH N 7 .   ? 38.982 42.726 18.663  1.00 28.32 ? 684  HOH A O   1 
HETATM 4218 O  O   . HOH N 7 .   ? 36.867 55.024 8.945   1.00 28.56 ? 685  HOH A O   1 
HETATM 4219 O  O   . HOH N 7 .   ? 34.874 47.287 5.043   1.00 29.23 ? 686  HOH A O   1 
HETATM 4220 O  O   . HOH N 7 .   ? 39.777 53.004 2.920   1.00 34.96 ? 687  HOH A O   1 
HETATM 4221 O  O   . HOH N 7 .   ? 34.958 51.440 3.406   1.00 37.89 ? 688  HOH A O   1 
HETATM 4222 O  O   . HOH N 7 .   ? 41.910 51.801 3.931   1.00 33.63 ? 689  HOH A O   1 
HETATM 4223 O  O   . HOH N 7 .   ? 41.173 45.491 4.637   1.00 35.56 ? 690  HOH A O   1 
HETATM 4224 O  O   . HOH N 7 .   ? 45.466 64.611 19.402  1.00 32.50 ? 691  HOH A O   1 
HETATM 4225 O  O   . HOH N 7 .   ? 36.867 66.243 32.672  1.00 41.53 ? 692  HOH A O   1 
HETATM 4226 O  O   . HOH N 7 .   ? 43.273 72.094 18.762  1.00 31.37 ? 693  HOH A O   1 
HETATM 4227 O  O   . HOH N 7 .   ? 47.348 71.077 16.562  1.00 41.11 ? 694  HOH A O   1 
HETATM 4228 O  O   . HOH N 7 .   ? 36.975 65.874 35.266  1.00 35.77 ? 695  HOH A O   1 
HETATM 4229 O  O   . HOH N 7 .   ? 36.296 66.504 46.249  1.00 34.65 ? 696  HOH A O   1 
HETATM 4230 O  O   . HOH N 7 .   ? 26.452 66.179 40.427  1.00 32.18 ? 697  HOH A O   1 
HETATM 4231 O  O   . HOH N 7 .   ? 23.661 71.022 40.545  1.00 53.98 ? 698  HOH A O   1 
HETATM 4232 O  O   . HOH N 7 .   ? 19.615 73.433 30.060  1.00 38.89 ? 699  HOH A O   1 
HETATM 4233 O  O   . HOH N 7 .   ? 30.404 73.585 15.159  1.00 33.54 ? 700  HOH A O   1 
HETATM 4234 O  O   . HOH N 7 .   ? 22.616 79.169 27.703  1.00 39.51 ? 701  HOH A O   1 
HETATM 4235 O  O   . HOH N 7 .   ? 17.468 74.159 14.926  1.00 30.08 ? 702  HOH A O   1 
HETATM 4236 O  O   . HOH N 7 .   ? 19.640 72.006 41.291  1.00 40.99 ? 703  HOH A O   1 
HETATM 4237 O  O   . HOH N 7 .   ? 17.840 68.275 30.347  1.00 35.47 ? 704  HOH A O   1 
HETATM 4238 O  O   . HOH N 7 .   ? 9.857  70.093 27.731  1.00 39.75 ? 705  HOH A O   1 
HETATM 4239 O  O   . HOH N 7 .   ? 24.428 63.663 10.096  1.00 29.94 ? 706  HOH A O   1 
HETATM 4240 O  O   . HOH N 7 .   ? 13.168 78.665 14.780  1.00 51.07 ? 707  HOH A O   1 
HETATM 4241 O  O   . HOH N 7 .   ? 12.585 73.977 20.178  1.00 32.15 ? 708  HOH A O   1 
HETATM 4242 O  O   . HOH N 7 .   ? 8.746  73.339 15.488  1.00 33.36 ? 709  HOH A O   1 
HETATM 4243 O  O   . HOH N 7 .   ? 10.340 66.839 16.679  1.00 25.75 ? 710  HOH A O   1 
HETATM 4244 O  O   . HOH N 7 .   ? 8.048  69.480 18.643  1.00 47.79 ? 711  HOH A O   1 
HETATM 4245 O  O   . HOH N 7 .   ? 15.177 77.278 6.507   1.00 38.11 ? 712  HOH A O   1 
HETATM 4246 O  O   . HOH N 7 .   ? 22.281 63.307 -10.182 1.00 45.95 ? 713  HOH A O   1 
HETATM 4247 O  O   . HOH N 7 .   ? 18.897 56.162 -12.523 1.00 30.57 ? 714  HOH A O   1 
HETATM 4248 O  O   . HOH N 7 .   ? 8.780  70.377 -2.970  1.00 26.52 ? 715  HOH A O   1 
HETATM 4249 O  O   . HOH N 7 .   ? 4.467  55.352 19.808  1.00 24.90 ? 716  HOH A O   1 
HETATM 4250 O  O   . HOH N 7 .   ? 7.879  47.545 23.702  1.00 46.45 ? 717  HOH A O   1 
HETATM 4251 O  O   . HOH N 7 .   ? 5.254  58.644 27.360  1.00 38.31 ? 718  HOH A O   1 
HETATM 4252 O  O   . HOH N 7 .   ? 20.343 43.296 30.385  1.00 43.72 ? 719  HOH A O   1 
HETATM 4253 O  O   . HOH N 7 .   ? 1.947  47.128 14.180  1.00 31.44 ? 720  HOH A O   1 
HETATM 4254 O  O   . HOH N 7 .   ? 3.626  47.138 9.292   1.00 30.58 ? 721  HOH A O   1 
HETATM 4255 O  O   . HOH N 7 .   ? 6.426  49.108 -6.051  1.00 23.32 ? 722  HOH A O   1 
HETATM 4256 O  O   . HOH N 7 .   ? 4.336  50.597 -7.178  1.00 41.91 ? 723  HOH A O   1 
HETATM 4257 O  O   . HOH N 7 .   ? 4.588  57.356 -8.170  1.00 25.33 ? 724  HOH A O   1 
HETATM 4258 O  O   . HOH N 7 .   ? 3.146  55.065 -9.281  1.00 38.28 ? 725  HOH A O   1 
HETATM 4259 O  O   . HOH N 7 .   ? 1.823  53.145 -7.924  1.00 36.48 ? 726  HOH A O   1 
HETATM 4260 O  O   . HOH N 7 .   ? 2.468  51.597 -5.059  1.00 33.89 ? 727  HOH A O   1 
HETATM 4261 O  O   . HOH N 7 .   ? 3.644  53.975 -11.923 1.00 39.96 ? 728  HOH A O   1 
HETATM 4262 O  O   . HOH N 7 .   ? 17.913 62.054 -16.588 1.00 31.16 ? 729  HOH A O   1 
HETATM 4263 O  O   . HOH N 7 .   ? 14.697 53.067 -17.593 1.00 38.61 ? 730  HOH A O   1 
HETATM 4264 O  O   . HOH N 7 .   ? 7.706  48.136 -13.897 1.00 33.84 ? 731  HOH A O   1 
HETATM 4265 O  O   . HOH N 7 .   ? 19.178 67.232 -15.617 1.00 36.21 ? 732  HOH A O   1 
HETATM 4266 O  O   . HOH N 7 .   ? 17.415 70.655 -15.388 1.00 30.95 ? 733  HOH A O   1 
HETATM 4267 O  O   . HOH N 7 .   ? 13.062 73.362 -11.098 1.00 40.98 ? 734  HOH A O   1 
HETATM 4268 O  O   . HOH N 7 .   ? 8.059  71.178 -0.524  1.00 26.05 ? 735  HOH A O   1 
HETATM 4269 O  O   . HOH N 7 .   ? 5.042  70.359 1.415   1.00 57.12 ? 736  HOH A O   1 
HETATM 4270 O  O   . HOH N 7 .   ? -1.693 53.479 -4.910  1.00 29.86 ? 737  HOH A O   1 
HETATM 4271 O  O   . HOH N 7 .   ? 3.070  64.149 -17.508 1.00 44.07 ? 738  HOH A O   1 
HETATM 4272 O  O   . HOH N 7 .   ? 1.372  49.403 -13.125 1.00 44.31 ? 739  HOH A O   1 
HETATM 4273 O  O   . HOH N 7 .   ? 22.474 41.671 -2.004  1.00 34.68 ? 740  HOH A O   1 
HETATM 4274 O  O   . HOH N 7 .   ? 17.225 40.844 -5.974  1.00 40.00 ? 741  HOH A O   1 
HETATM 4275 O  O   . HOH N 7 .   ? 24.454 43.625 -3.134  1.00 33.61 ? 742  HOH A O   1 
HETATM 4276 O  O   . HOH N 7 .   ? 34.982 56.982 47.834  1.00 45.24 ? 743  HOH A O   1 
HETATM 4277 O  O   . HOH N 7 .   ? 29.804 42.807 33.648  1.00 42.90 ? 744  HOH A O   1 
HETATM 4278 O  O   . HOH N 7 .   ? 35.214 43.728 31.534  1.00 33.55 ? 745  HOH A O   1 
HETATM 4279 O  O   . HOH N 7 .   ? 32.744 36.943 29.087  1.00 43.29 ? 746  HOH A O   1 
HETATM 4280 O  O   . HOH N 7 .   ? 31.817 55.316 3.247   1.00 45.66 ? 747  HOH A O   1 
HETATM 4281 O  O   . HOH N 7 .   ? 28.102 62.355 5.151   1.00 40.43 ? 748  HOH A O   1 
HETATM 4282 O  O   . HOH N 7 .   ? 32.307 61.559 6.717   1.00 41.50 ? 749  HOH A O   1 
HETATM 4283 O  O   . HOH N 7 .   ? 29.764 59.288 4.499   1.00 45.48 ? 750  HOH A O   1 
HETATM 4284 O  O   . HOH N 7 .   ? 49.544 55.915 10.299  1.00 57.57 ? 751  HOH A O   1 
HETATM 4285 O  O   . HOH N 7 .   ? 47.325 69.916 19.302  1.00 52.34 ? 752  HOH A O   1 
HETATM 4286 O  O   . HOH N 7 .   ? 33.971 75.100 16.535  1.00 51.84 ? 753  HOH A O   1 
HETATM 4287 O  O   . HOH N 7 .   ? 28.723 75.690 15.258  1.00 48.03 ? 754  HOH A O   1 
HETATM 4288 O  O   . HOH N 7 .   ? 28.394 74.447 31.296  1.00 33.73 ? 755  HOH A O   1 
HETATM 4289 O  O   . HOH N 7 .   ? 16.717 67.524 42.467  1.00 36.91 ? 756  HOH A O   1 
HETATM 4290 O  O   . HOH N 7 .   ? 6.920  72.025 7.601   1.00 51.17 ? 757  HOH A O   1 
HETATM 4291 O  O   . HOH N 7 .   ? 9.912  73.281 1.069   1.00 39.68 ? 758  HOH A O   1 
HETATM 4292 O  O   . HOH N 7 .   ? 26.298 65.792 -0.414  1.00 62.37 ? 759  HOH A O   1 
HETATM 4293 O  O   . HOH N 7 .   ? 19.860 52.975 -9.212  1.00 34.71 ? 760  HOH A O   1 
HETATM 4294 O  O   . HOH N 7 .   ? 9.945  45.702 4.531   1.00 35.35 ? 761  HOH A O   1 
HETATM 4295 O  O   . HOH N 7 .   ? 17.184 68.459 -5.871  1.00 33.27 ? 762  HOH A O   1 
HETATM 4296 O  O   . HOH N 7 .   ? 3.667  51.819 -0.295  1.00 37.70 ? 763  HOH A O   1 
HETATM 4297 O  O   . HOH N 7 .   ? 6.811  68.081 -9.965  1.00 36.19 ? 764  HOH A O   1 
HETATM 4298 O  O   . HOH N 7 .   ? 12.594 42.803 -10.007 1.00 38.78 ? 765  HOH A O   1 
HETATM 4299 O  O   . HOH N 7 .   ? 14.070 43.862 -6.003  1.00 30.96 ? 766  HOH A O   1 
HETATM 4300 O  O   . HOH N 7 .   ? 25.849 40.071 7.888   1.00 36.40 ? 767  HOH A O   1 
HETATM 4301 O  O   . HOH N 7 .   ? 32.539 36.883 6.516   1.00 58.66 ? 768  HOH A O   1 
HETATM 4302 O  O   . HOH N 7 .   ? 36.620 37.345 25.671  1.00 54.74 ? 769  HOH A O   1 
HETATM 4303 O  O   . HOH N 7 .   ? 22.820 38.844 3.956   1.00 57.69 ? 770  HOH A O   1 
HETATM 4304 O  O   . HOH N 7 .   ? 6.583  71.594 -4.321  1.00 30.53 ? 771  HOH A O   1 
HETATM 4305 O  O   . HOH N 7 .   ? 13.416 70.601 -17.366 1.00 43.83 ? 772  HOH A O   1 
HETATM 4306 O  O   . HOH N 7 .   ? 37.067 69.249 39.777  1.00 42.18 ? 773  HOH A O   1 
HETATM 4307 O  O   . HOH N 7 .   ? 29.860 70.390 32.016  1.00 56.05 ? 774  HOH A O   1 
HETATM 4308 O  O   . HOH N 7 .   ? 24.423 38.003 17.128  1.00 49.56 ? 775  HOH A O   1 
HETATM 4309 O  O   . HOH N 7 .   ? 44.983 55.987 39.803  1.00 29.60 ? 776  HOH A O   1 
HETATM 4310 O  O   . HOH N 7 .   ? 45.559 52.343 39.468  1.00 26.79 ? 777  HOH A O   1 
HETATM 4311 O  O   . HOH N 7 .   ? 46.947 54.147 41.003  1.00 33.10 ? 778  HOH A O   1 
HETATM 4312 O  O   . HOH N 7 .   ? 37.433 47.177 33.082  1.00 53.43 ? 779  HOH A O   1 
HETATM 4313 O  O   . HOH N 7 .   ? 33.376 46.925 42.169  1.00 39.72 ? 780  HOH A O   1 
HETATM 4314 O  O   . HOH N 7 .   ? 44.733 54.834 42.912  1.00 28.70 ? 781  HOH A O   1 
HETATM 4315 O  O   . HOH N 7 .   ? 21.391 39.312 25.553  1.00 37.52 ? 782  HOH A O   1 
HETATM 4316 O  O   . HOH N 7 .   ? 21.007 43.576 24.029  1.00 34.69 ? 783  HOH A O   1 
HETATM 4317 O  O   . HOH N 7 .   ? 20.616 44.989 21.915  1.00 38.67 ? 784  HOH A O   1 
HETATM 4318 O  O   . HOH N 7 .   ? 28.431 61.504 2.117   1.00 51.64 ? 785  HOH A O   1 
HETATM 4319 O  O   . HOH N 7 .   ? 21.759 52.333 -6.539  1.00 46.19 ? 786  HOH A O   1 
HETATM 4320 O  O   . HOH N 7 .   ? 41.036 71.410 25.540  1.00 35.43 ? 787  HOH A O   1 
HETATM 4321 O  O   . HOH N 7 .   ? 47.400 58.750 31.719  1.00 54.79 ? 788  HOH A O   1 
HETATM 4322 O  O   . HOH N 7 .   ? 40.002 66.656 8.723   1.00 38.91 ? 789  HOH A O   1 
HETATM 4323 O  O   . HOH N 7 .   ? 26.195 64.430 42.119  1.00 42.45 ? 790  HOH A O   1 
HETATM 4324 O  O   . HOH N 7 .   ? 13.421 56.165 39.492  1.00 43.15 ? 791  HOH A O   1 
HETATM 4325 O  O   . HOH N 7 .   ? 14.153 55.453 41.917  1.00 53.51 ? 792  HOH A O   1 
HETATM 4326 O  O   . HOH N 7 .   ? 18.508 51.118 41.690  1.00 39.95 ? 793  HOH A O   1 
HETATM 4327 O  O   . HOH N 7 .   ? 25.309 50.911 41.475  1.00 30.06 ? 794  HOH A O   1 
HETATM 4328 O  O   . HOH N 7 .   ? -1.522 49.223 19.097  1.00 39.60 ? 795  HOH A O   1 
HETATM 4329 O  O   . HOH N 7 .   ? 3.144  56.674 8.294   1.00 37.08 ? 796  HOH A O   1 
HETATM 4330 O  O   . HOH N 7 .   ? -2.148 53.268 -16.224 1.00 31.39 ? 797  HOH A O   1 
HETATM 4331 O  O   . HOH N 7 .   ? 17.101 43.504 -5.727  1.00 27.20 ? 798  HOH A O   1 
HETATM 4332 O  O   . HOH N 7 .   ? 18.087 44.163 -8.296  1.00 33.74 ? 799  HOH A O   1 
HETATM 4333 O  O   . HOH N 7 .   ? 30.131 37.253 3.411   1.00 38.15 ? 800  HOH A O   1 
HETATM 4334 O  O   . HOH N 7 .   ? 32.344 38.062 2.713   1.00 31.39 ? 801  HOH A O   1 
HETATM 4335 O  O   . HOH N 7 .   ? 49.582 50.920 9.623   1.00 48.35 ? 802  HOH A O   1 
HETATM 4336 O  O   . HOH N 7 .   ? 52.339 44.400 26.307  1.00 36.69 ? 803  HOH A O   1 
HETATM 4337 O  O   . HOH N 7 .   ? 28.499 37.325 7.800   1.00 43.70 ? 804  HOH A O   1 
HETATM 4338 O  O   . HOH N 7 .   ? 30.117 33.835 12.750  1.00 34.12 ? 805  HOH A O   1 
HETATM 4339 O  O   . HOH N 7 .   ? 25.296 36.459 12.383  1.00 44.34 ? 806  HOH A O   1 
HETATM 4340 O  O   . HOH N 7 .   ? 24.910 38.694 14.430  1.00 35.54 ? 807  HOH A O   1 
HETATM 4341 O  O   . HOH N 7 .   ? 16.882 48.748 32.968  1.00 36.79 ? 808  HOH A O   1 
HETATM 4342 O  O   . HOH N 7 .   ? 23.201 60.214 44.103  1.00 28.30 ? 809  HOH A O   1 
HETATM 4343 O  O   . HOH N 7 .   ? 23.774 49.152 42.535  1.00 38.05 ? 810  HOH A O   1 
HETATM 4344 O  O   . HOH N 7 .   ? 49.499 56.495 25.220  1.00 57.87 ? 811  HOH A O   1 
HETATM 4345 O  O   . HOH N 7 .   ? 42.420 66.456 30.852  1.00 41.92 ? 812  HOH A O   1 
HETATM 4346 O  O   . HOH N 7 .   ? 47.285 57.280 41.797  1.00 35.46 ? 813  HOH A O   1 
HETATM 4347 O  O   . HOH N 7 .   ? 46.953 55.125 44.163  1.00 37.06 ? 814  HOH A O   1 
HETATM 4348 O  O   . HOH N 7 .   ? 46.958 55.174 46.881  1.00 54.47 ? 815  HOH A O   1 
HETATM 4349 O  O   . HOH N 7 .   ? 45.810 61.947 41.018  1.00 45.94 ? 816  HOH A O   1 
HETATM 4350 O  O   . HOH N 7 .   ? 42.019 56.914 49.464  1.00 63.65 ? 817  HOH A O   1 
HETATM 4351 O  O   . HOH N 7 .   ? 10.599 70.612 -10.064 1.00 34.50 ? 818  HOH A O   1 
HETATM 4352 O  O   . HOH N 7 .   ? 5.538  72.232 -0.515  1.00 50.32 ? 819  HOH A O   1 
HETATM 4353 O  O   . HOH N 7 .   ? -1.963 51.106 -3.857  1.00 45.67 ? 820  HOH A O   1 
HETATM 4354 O  O   . HOH N 7 .   ? 40.697 59.908 2.116   1.00 44.36 ? 821  HOH A O   1 
HETATM 4355 O  O   . HOH N 7 .   ? 29.163 54.300 1.897   1.00 49.76 ? 822  HOH A O   1 
HETATM 4356 O  O   . HOH N 7 .   ? 25.134 55.993 33.610  1.00 36.35 ? 823  HOH A O   1 
HETATM 4357 O  O   . HOH N 7 .   ? 27.376 74.674 8.952   1.00 45.22 ? 824  HOH A O   1 
HETATM 4358 O  O   . HOH N 7 .   ? 48.648 42.447 24.262  1.00 37.26 ? 825  HOH A O   1 
HETATM 4359 O  O   . HOH N 7 .   ? 15.784 45.358 -10.234 1.00 46.16 ? 826  HOH A O   1 
HETATM 4360 O  O   . HOH N 7 .   ? 4.785  63.068 22.221  1.00 25.25 ? 827  HOH A O   1 
HETATM 4361 O  O   . HOH N 7 .   ? 27.886 50.437 -6.236  1.00 42.69 ? 828  HOH A O   1 
HETATM 4362 O  O   . HOH N 7 .   ? 38.135 65.013 10.352  1.00 49.28 ? 829  HOH A O   1 
HETATM 4363 O  O   . HOH N 7 .   ? 31.431 73.953 7.019   1.00 54.41 ? 830  HOH A O   1 
HETATM 4364 O  O   . HOH N 7 .   ? 22.038 70.167 -0.449  1.00 35.69 ? 831  HOH A O   1 
HETATM 4365 O  O   . HOH N 7 .   ? 11.120 42.038 32.181  1.00 57.11 ? 832  HOH A O   1 
HETATM 4366 O  O   . HOH N 7 .   ? 14.221 65.670 -21.136 1.00 40.82 ? 833  HOH A O   1 
HETATM 4367 O  O   . HOH N 7 .   ? 24.907 37.006 10.050  1.00 60.25 ? 834  HOH A O   1 
HETATM 4368 O  O   . HOH N 7 .   ? 35.884 46.604 42.233  1.00 37.13 ? 835  HOH A O   1 
HETATM 4369 O  O   . HOH N 7 .   ? 5.924  70.979 5.401   1.00 47.15 ? 836  HOH A O   1 
HETATM 4370 O  O   . HOH N 7 .   ? 8.936  73.234 4.858   1.00 52.86 ? 837  HOH A O   1 
HETATM 4371 O  O   . HOH N 7 .   ? 20.021 57.714 -14.361 1.00 37.46 ? 838  HOH A O   1 
HETATM 4372 O  O   . HOH N 7 .   ? 4.321  71.525 -2.317  1.00 37.82 ? 839  HOH A O   1 
HETATM 4373 O  O   . HOH N 7 .   ? 11.865 72.493 -4.077  1.00 43.41 ? 840  HOH A O   1 
HETATM 4374 O  O   . HOH N 7 .   ? 34.655 70.962 44.470  1.00 49.37 ? 841  HOH A O   1 
HETATM 4375 O  O   . HOH N 7 .   ? 26.014 54.409 -3.714  1.00 46.36 ? 842  HOH A O   1 
HETATM 4376 O  O   . HOH N 7 .   ? 22.924 66.283 -3.212  1.00 34.18 ? 843  HOH A O   1 
HETATM 4377 O  O   . HOH N 7 .   ? 17.933 63.629 42.859  1.00 44.95 ? 844  HOH A O   1 
HETATM 4378 O  O   . HOH N 7 .   ? 9.618  47.088 -12.347 1.00 38.65 ? 845  HOH A O   1 
HETATM 4379 O  O   . HOH N 7 .   ? 12.244 47.212 -12.159 1.00 59.25 ? 846  HOH A O   1 
HETATM 4380 O  O   . HOH N 7 .   ? 10.418 70.296 19.934  1.00 27.34 ? 847  HOH A O   1 
HETATM 4381 O  O   . HOH N 7 .   ? 14.003 67.746 33.977  1.00 35.78 ? 848  HOH A O   1 
HETATM 4382 O  O   . HOH N 7 .   ? 11.807 48.263 21.062  1.00 38.16 ? 849  HOH A O   1 
HETATM 4383 O  O   . HOH N 7 .   ? 1.768  66.987 -8.979  1.00 59.04 ? 850  HOH A O   1 
HETATM 4384 O  O   . HOH N 7 .   ? 17.198 38.702 5.427   1.00 38.09 ? 851  HOH A O   1 
HETATM 4385 O  O   . HOH N 7 .   ? 41.738 44.169 1.845   1.00 43.94 ? 852  HOH A O   1 
HETATM 4386 O  O   . HOH N 7 .   ? 18.173 64.182 -13.873 1.00 45.06 ? 853  HOH A O   1 
HETATM 4387 O  O   . HOH N 7 .   ? 36.853 55.634 49.619  1.00 46.40 ? 854  HOH A O   1 
HETATM 4388 O  O   . HOH N 7 .   ? 42.588 64.893 36.584  1.00 51.27 ? 855  HOH A O   1 
HETATM 4389 O  O   . HOH N 7 .   ? 45.720 60.716 34.317  1.00 43.64 ? 856  HOH A O   1 
HETATM 4390 O  O   . HOH N 7 .   ? 32.560 45.044 40.190  1.00 39.36 ? 857  HOH A O   1 
HETATM 4391 O  O   . HOH N 7 .   ? 9.772  44.759 10.504  1.00 44.44 ? 858  HOH A O   1 
HETATM 4392 O  O   . HOH N 7 .   ? 31.857 52.267 1.032   1.00 44.92 ? 859  HOH A O   1 
HETATM 4393 O  O   . HOH N 7 .   ? 47.223 48.063 8.244   1.00 38.76 ? 860  HOH A O   1 
HETATM 4394 O  O   . HOH N 7 .   ? 43.851 51.489 1.832   1.00 39.12 ? 861  HOH A O   1 
HETATM 4395 O  O   . HOH N 7 .   ? 48.362 46.479 10.797  1.00 53.59 ? 862  HOH A O   1 
HETATM 4396 O  O   . HOH N 7 .   ? 49.046 53.048 11.520  1.00 46.29 ? 863  HOH A O   1 
HETATM 4397 O  O   . HOH N 7 .   ? 44.017 61.014 5.096   1.00 49.04 ? 864  HOH A O   1 
HETATM 4398 O  O   . HOH N 7 .   ? 47.171 61.006 3.357   1.00 49.34 ? 865  HOH A O   1 
HETATM 4399 O  O   . HOH N 7 .   ? 38.835 68.301 33.161  1.00 57.83 ? 866  HOH A O   1 
HETATM 4400 O  O   . HOH N 7 .   ? 27.844 69.799 37.758  1.00 44.33 ? 867  HOH A O   1 
HETATM 4401 O  O   . HOH N 7 .   ? 31.027 74.808 25.033  1.00 32.71 ? 868  HOH A O   1 
HETATM 4402 O  O   . HOH N 7 .   ? 17.875 81.751 20.584  1.00 54.44 ? 869  HOH A O   1 
HETATM 4403 O  O   . HOH N 7 .   ? 16.326 79.510 19.241  1.00 43.23 ? 870  HOH A O   1 
HETATM 4404 O  O   . HOH N 7 .   ? 31.168 69.584 4.632   1.00 42.16 ? 871  HOH A O   1 
HETATM 4405 O  O   . HOH N 7 .   ? 32.157 67.523 4.343   1.00 56.73 ? 872  HOH A O   1 
HETATM 4406 O  O   . HOH N 7 .   ? 39.016 72.087 3.581   1.00 39.35 ? 873  HOH A O   1 
HETATM 4407 O  O   . HOH N 7 .   ? 14.477 81.001 14.751  1.00 47.05 ? 874  HOH A O   1 
HETATM 4408 O  O   . HOH N 7 .   ? 13.800 79.114 9.731   1.00 44.32 ? 875  HOH A O   1 
HETATM 4409 O  O   . HOH N 7 .   ? 10.752 73.264 8.727   1.00 38.73 ? 876  HOH A O   1 
HETATM 4410 O  O   . HOH N 7 .   ? 15.534 77.452 3.442   1.00 51.32 ? 877  HOH A O   1 
HETATM 4411 O  O   . HOH N 7 .   ? -0.285 44.981 24.016  1.00 36.40 ? 878  HOH A O   1 
HETATM 4412 O  O   . HOH N 7 .   ? 29.613 43.515 37.216  1.00 40.53 ? 879  HOH A O   1 
HETATM 4413 O  O   . HOH N 7 .   ? 21.327 42.795 35.833  1.00 45.98 ? 880  HOH A O   1 
HETATM 4414 O  O   . HOH N 7 .   ? 11.701 37.976 4.195   1.00 50.36 ? 881  HOH A O   1 
HETATM 4415 O  O   . HOH N 7 .   ? 7.502  46.325 5.560   1.00 47.21 ? 882  HOH A O   1 
HETATM 4416 O  O   . HOH N 7 .   ? 42.485 54.495 0.611   1.00 40.85 ? 883  HOH A O   1 
HETATM 4417 O  O   . HOH N 7 .   ? 44.073 65.033 28.775  1.00 43.91 ? 884  HOH A O   1 
HETATM 4418 O  O   . HOH N 7 .   ? 37.007 73.794 22.707  1.00 44.16 ? 885  HOH A O   1 
HETATM 4419 O  O   . HOH N 7 .   ? 42.600 78.745 13.352  1.00 54.50 ? 886  HOH A O   1 
HETATM 4420 O  O   . HOH N 7 .   ? 49.089 56.973 18.724  1.00 56.57 ? 887  HOH A O   1 
HETATM 4421 O  O   . HOH N 7 .   ? 51.858 57.836 26.488  1.00 39.77 ? 888  HOH A O   1 
HETATM 4422 O  O   . HOH N 7 .   ? 26.463 73.878 38.024  1.00 38.98 ? 889  HOH A O   1 
HETATM 4423 O  O   . HOH N 7 .   ? 26.046 74.050 4.438   1.00 46.33 ? 890  HOH A O   1 
HETATM 4424 O  O   . HOH N 7 .   ? 11.060 72.838 21.702  1.00 49.37 ? 891  HOH A O   1 
HETATM 4425 O  O   . HOH N 7 .   ? 10.180 67.044 19.101  1.00 40.40 ? 892  HOH A O   1 
HETATM 4426 O  O   . HOH N 7 .   ? 20.534 54.079 -13.738 1.00 50.90 ? 893  HOH A O   1 
HETATM 4427 O  O   . HOH N 7 .   ? -0.202 65.839 36.283  1.00 42.30 ? 894  HOH A O   1 
HETATM 4428 O  O   . HOH N 7 .   ? 11.005 44.869 26.458  1.00 45.10 ? 895  HOH A O   1 
HETATM 4429 O  O   . HOH N 7 .   ? 6.012  45.495 40.831  1.00 43.48 ? 896  HOH A O   1 
HETATM 4430 O  O   . HOH N 7 .   ? 2.886  50.877 42.230  1.00 36.90 ? 897  HOH A O   1 
HETATM 4431 O  O   . HOH N 7 .   ? 2.653  46.576 11.724  1.00 52.89 ? 898  HOH A O   1 
HETATM 4432 O  O   . HOH N 7 .   ? 1.441  69.927 14.639  1.00 45.52 ? 899  HOH A O   1 
HETATM 4433 O  O   . HOH N 7 .   ? 3.286  70.129 12.653  1.00 40.60 ? 900  HOH A O   1 
HETATM 4434 O  O   . HOH N 7 .   ? -0.002 59.748 5.915   0.50 33.17 ? 901  HOH A O   1 
HETATM 4435 O  O   . HOH N 7 .   ? 15.608 51.994 -12.892 1.00 45.70 ? 902  HOH A O   1 
HETATM 4436 O  O   . HOH N 7 .   ? 19.420 68.948 -16.807 1.00 48.11 ? 903  HOH A O   1 
HETATM 4437 O  O   . HOH N 7 .   ? 17.204 72.339 -11.196 1.00 36.01 ? 904  HOH A O   1 
HETATM 4438 O  O   . HOH N 7 .   ? 10.485 73.546 -9.400  1.00 52.51 ? 905  HOH A O   1 
HETATM 4439 O  O   . HOH N 7 .   ? 4.902  68.978 5.073   1.00 45.32 ? 906  HOH A O   1 
HETATM 4440 O  O   . HOH N 7 .   ? 3.288  58.326 -24.212 1.00 51.92 ? 907  HOH A O   1 
HETATM 4441 O  O   . HOH N 7 .   ? 17.463 36.788 1.173   1.00 39.07 ? 908  HOH A O   1 
HETATM 4442 O  O   . HOH N 7 .   ? 23.190 41.749 0.605   1.00 37.51 ? 909  HOH A O   1 
HETATM 4443 O  O   . HOH N 7 .   ? 24.083 45.793 -7.314  1.00 48.79 ? 910  HOH A O   1 
HETATM 4444 O  O   . HOH N 7 .   ? 28.018 40.742 -1.896  1.00 50.15 ? 911  HOH A O   1 
HETATM 4445 O  O   . HOH N 7 .   ? 32.690 45.488 -5.305  1.00 49.97 ? 912  HOH A O   1 
HETATM 4446 O  O   . HOH N 7 .   ? 34.467 37.480 4.795   1.00 36.33 ? 913  HOH A O   1 
HETATM 4447 O  O   . HOH N 7 .   ? 35.988 42.293 -4.471  1.00 45.77 ? 914  HOH A O   1 
HETATM 4448 O  O   . HOH N 7 .   ? 26.672 38.353 6.223   1.00 37.16 ? 915  HOH A O   1 
HETATM 4449 O  O   . HOH N 7 .   ? 43.199 37.977 14.702  1.00 43.72 ? 916  HOH A O   1 
HETATM 4450 O  O   . HOH N 7 .   ? 44.061 43.482 33.466  1.00 45.17 ? 917  HOH A O   1 
HETATM 4451 O  O   . HOH N 7 .   ? 40.685 39.988 27.331  1.00 37.64 ? 918  HOH A O   1 
HETATM 4452 O  O   . HOH N 7 .   ? 38.162 34.569 17.098  1.00 59.25 ? 919  HOH A O   1 
HETATM 4453 O  O   . HOH N 7 .   ? 31.201 61.272 45.520  1.00 39.42 ? 920  HOH A O   1 
HETATM 4454 O  O   . HOH N 7 .   ? 40.321 66.028 34.130  1.00 47.41 ? 921  HOH A O   1 
HETATM 4455 O  O   . HOH N 7 .   ? 35.468 72.801 38.074  1.00 42.64 ? 922  HOH A O   1 
HETATM 4456 O  O   . HOH N 7 .   ? 42.786 49.639 34.453  1.00 47.21 ? 923  HOH A O   1 
HETATM 4457 O  O   . HOH N 7 .   ? 38.979 47.468 39.393  1.00 44.07 ? 924  HOH A O   1 
HETATM 4458 O  O   . HOH N 7 .   ? 25.656 56.849 47.324  1.00 38.16 ? 925  HOH A O   1 
HETATM 4459 O  O   . HOH N 7 .   ? 18.934 50.794 35.388  1.00 35.50 ? 926  HOH A O   1 
HETATM 4460 O  O   . HOH N 7 .   ? 19.406 47.015 36.176  1.00 38.39 ? 927  HOH A O   1 
HETATM 4461 O  O   . HOH N 7 .   ? 21.313 44.552 37.730  1.00 45.77 ? 928  HOH A O   1 
HETATM 4462 O  O   . HOH N 7 .   ? 33.731 41.239 31.886  1.00 42.88 ? 929  HOH A O   1 
HETATM 4463 O  O   . HOH N 7 .   ? 27.612 41.134 33.438  1.00 40.19 ? 930  HOH A O   1 
HETATM 4464 O  O   . HOH N 7 .   ? 18.490 45.853 30.105  1.00 33.02 ? 931  HOH A O   1 
HETATM 4465 O  O   . HOH N 7 .   ? 27.849 39.235 31.842  1.00 42.17 ? 932  HOH A O   1 
HETATM 4466 O  O   . HOH N 7 .   ? 22.805 38.472 28.611  1.00 36.27 ? 933  HOH A O   1 
HETATM 4467 O  O   . HOH N 7 .   ? 20.717 38.901 29.616  1.00 59.54 ? 934  HOH A O   1 
HETATM 4468 O  O   . HOH N 7 .   ? 22.676 39.857 14.655  1.00 44.63 ? 935  HOH A O   1 
HETATM 4469 O  O   . HOH N 7 .   ? 22.027 37.715 24.093  1.00 36.20 ? 936  HOH A O   1 
HETATM 4470 O  O   . HOH N 7 .   ? 18.155 43.942 20.385  1.00 31.94 ? 937  HOH A O   1 
HETATM 4471 O  O   . HOH N 7 .   ? 23.631 34.421 19.538  1.00 47.51 ? 938  HOH A O   1 
HETATM 4472 O  O   . HOH N 7 .   ? 17.460 41.539 12.482  1.00 48.13 ? 939  HOH A O   1 
HETATM 4473 O  O   . HOH N 7 .   ? 11.731 42.172 6.884   1.00 50.74 ? 940  HOH A O   1 
HETATM 4474 O  O   . HOH N 7 .   ? 6.605  46.606 2.213   1.00 41.44 ? 941  HOH A O   1 
HETATM 4475 O  O   . HOH N 7 .   ? 8.170  45.164 7.716   1.00 43.79 ? 942  HOH A O   1 
HETATM 4476 O  O   . HOH N 7 .   ? 26.295 51.555 -2.568  1.00 33.30 ? 943  HOH A O   1 
HETATM 4477 O  O   . HOH N 7 .   ? 28.619 50.557 -2.217  1.00 41.06 ? 944  HOH A O   1 
HETATM 4478 O  O   . HOH N 7 .   ? 26.706 56.884 -4.181  1.00 58.43 ? 945  HOH A O   1 
HETATM 4479 O  O   . HOH N 7 .   ? 38.100 54.670 2.559   1.00 42.96 ? 946  HOH A O   1 
HETATM 4480 O  O   . HOH N 7 .   ? 38.298 57.214 1.848   1.00 51.09 ? 947  HOH A O   1 
HETATM 4481 O  O   . HOH N 7 .   ? 46.968 61.892 21.718  1.00 49.56 ? 948  HOH A O   1 
HETATM 4482 O  O   . HOH N 7 .   ? 41.052 73.495 19.444  1.00 58.29 ? 949  HOH A O   1 
HETATM 4483 O  O   . HOH N 7 .   ? 45.020 64.357 10.935  1.00 39.50 ? 950  HOH A O   1 
HETATM 4484 O  O   . HOH N 7 .   ? 24.138 80.704 21.147  1.00 46.98 ? 951  HOH A O   1 
HETATM 4485 O  O   . HOH N 7 .   ? 17.206 74.134 30.849  1.00 52.21 ? 952  HOH A O   1 
HETATM 4486 O  O   . HOH N 7 .   ? 26.669 78.674 17.786  1.00 58.83 ? 953  HOH A O   1 
HETATM 4487 O  O   . HOH N 7 .   ? 17.220 81.082 15.221  1.00 43.33 ? 954  HOH A O   1 
HETATM 4488 O  O   . HOH N 7 .   ? 27.998 78.775 33.564  1.00 39.09 ? 955  HOH A O   1 
HETATM 4489 O  O   . HOH N 7 .   ? 20.313 79.880 35.090  1.00 47.75 ? 956  HOH A O   1 
HETATM 4490 O  O   . HOH N 7 .   ? 14.569 71.254 36.873  1.00 46.89 ? 957  HOH A O   1 
HETATM 4491 O  O   . HOH N 7 .   ? 14.511 70.622 39.793  1.00 42.02 ? 958  HOH A O   1 
HETATM 4492 O  O   . HOH N 7 .   ? 27.187 65.462 8.622   1.00 34.81 ? 959  HOH A O   1 
HETATM 4493 O  O   . HOH N 7 .   ? 27.816 66.035 4.091   1.00 38.75 ? 960  HOH A O   1 
HETATM 4494 O  O   . HOH N 7 .   ? 27.019 72.179 3.089   1.00 50.60 ? 961  HOH A O   1 
HETATM 4495 O  O   . HOH N 7 .   ? 42.904 76.976 7.445   1.00 49.16 ? 962  HOH A O   1 
HETATM 4496 O  O   . HOH N 7 .   ? 12.342 77.557 12.120  1.00 45.24 ? 963  HOH A O   1 
HETATM 4497 O  O   . HOH N 7 .   ? 9.628  77.510 15.189  1.00 40.96 ? 964  HOH A O   1 
HETATM 4498 O  O   . HOH N 7 .   ? 8.793  75.370 13.242  1.00 43.58 ? 965  HOH A O   1 
HETATM 4499 O  O   . HOH N 7 .   ? 7.634  73.153 18.165  1.00 44.04 ? 966  HOH A O   1 
HETATM 4500 O  O   . HOH N 7 .   ? 17.835 75.120 0.722   1.00 53.95 ? 967  HOH A O   1 
HETATM 4501 O  O   . HOH N 7 .   ? 14.682 73.193 0.323   1.00 60.87 ? 968  HOH A O   1 
HETATM 4502 O  O   . HOH N 7 .   ? 24.566 67.977 -1.452  1.00 52.24 ? 969  HOH A O   1 
HETATM 4503 O  O   . HOH N 7 .   ? 17.019 52.818 -11.071 1.00 42.07 ? 970  HOH A O   1 
HETATM 4504 O  O   . HOH N 7 .   ? 15.087 52.606 -9.777  1.00 38.06 ? 971  HOH A O   1 
HETATM 4505 O  O   . HOH N 7 .   ? 19.883 63.569 -11.905 1.00 39.13 ? 972  HOH A O   1 
HETATM 4506 O  O   . HOH N 7 .   ? 21.175 60.105 -14.326 1.00 50.64 ? 973  HOH A O   1 
HETATM 4507 O  O   . HOH N 7 .   ? 20.083 62.447 -14.446 1.00 37.43 ? 974  HOH A O   1 
HETATM 4508 O  O   . HOH N 7 .   ? 9.198  54.909 39.440  1.00 38.58 ? 975  HOH A O   1 
HETATM 4509 O  O   . HOH N 7 .   ? 11.224 57.484 40.373  1.00 37.74 ? 976  HOH A O   1 
HETATM 4510 O  O   . HOH N 7 .   ? 8.812  50.939 46.668  0.50 57.25 ? 977  HOH A O   1 
HETATM 4511 O  O   . HOH N 7 .   ? 6.254  46.394 26.975  1.00 44.98 ? 978  HOH A O   1 
HETATM 4512 O  O   . HOH N 7 .   ? 0.538  57.691 7.407   1.00 43.81 ? 979  HOH A O   1 
HETATM 4513 O  O   . HOH N 7 .   ? 0.132  51.599 2.231   1.00 47.98 ? 980  HOH A O   1 
HETATM 4514 O  O   . HOH N 7 .   ? 2.856  50.191 2.731   1.00 44.69 ? 981  HOH A O   1 
HETATM 4515 O  O   . HOH N 7 .   ? 13.511 49.726 -11.842 1.00 49.09 ? 982  HOH A O   1 
HETATM 4516 O  O   . HOH N 7 .   ? 14.979 47.621 -15.426 1.00 51.87 ? 983  HOH A O   1 
HETATM 4517 O  O   . HOH N 7 .   ? 52.255 41.191 26.710  1.00 43.92 ? 984  HOH A O   1 
HETATM 4518 O  O   . HOH N 7 .   ? 13.024 55.891 -23.567 1.00 39.41 ? 985  HOH A O   1 
HETATM 4519 O  O   . HOH N 7 .   ? 51.129 40.715 21.505  1.00 54.68 ? 986  HOH A O   1 
HETATM 4520 O  O   . HOH N 7 .   ? 15.633 71.775 -17.543 1.00 41.08 ? 987  HOH A O   1 
HETATM 4521 O  O   . HOH N 7 .   ? 16.896 71.740 -4.719  1.00 51.38 ? 988  HOH A O   1 
HETATM 4522 O  O   . HOH N 7 .   ? 2.681  68.032 -11.083 1.00 67.64 ? 989  HOH A O   1 
HETATM 4523 O  O   . HOH N 7 .   ? 2.238  58.647 -21.092 1.00 45.32 ? 990  HOH A O   1 
HETATM 4524 O  O   . HOH N 7 .   ? -0.081 58.608 -19.946 1.00 46.19 ? 991  HOH A O   1 
HETATM 4525 O  O   . HOH N 7 .   ? 7.563  52.326 -25.705 1.00 60.20 ? 992  HOH A O   1 
HETATM 4526 O  O   . HOH N 7 .   ? 18.684 39.791 -4.128  1.00 34.07 ? 993  HOH A O   1 
HETATM 4527 O  O   . HOH N 7 .   ? 26.125 42.210 -1.310  1.00 49.78 ? 994  HOH A O   1 
HETATM 4528 O  O   . HOH N 7 .   ? 28.039 38.453 3.674   1.00 46.23 ? 995  HOH A O   1 
HETATM 4529 O  O   . HOH N 7 .   ? 32.994 41.430 -4.320  1.00 59.70 ? 996  HOH A O   1 
HETATM 4530 O  O   . HOH N 7 .   ? 33.653 37.169 0.630   1.00 48.61 ? 997  HOH A O   1 
HETATM 4531 O  O   . HOH N 7 .   ? 35.954 40.515 -1.877  1.00 50.68 ? 998  HOH A O   1 
HETATM 4532 O  O   . HOH N 7 .   ? 33.104 39.461 -1.523  1.00 38.08 ? 999  HOH A O   1 
HETATM 4533 O  O   . HOH N 7 .   ? 36.939 37.080 3.605   1.00 38.30 ? 1000 HOH A O   1 
HETATM 4534 O  O   . HOH N 7 .   ? 39.293 42.435 1.332   1.00 44.02 ? 1001 HOH A O   1 
HETATM 4535 O  O   . HOH N 7 .   ? 37.634 39.620 16.600  1.00 45.18 ? 1002 HOH A O   1 
HETATM 4536 O  O   . HOH N 7 .   ? 38.936 35.768 8.239   1.00 40.84 ? 1003 HOH A O   1 
HETATM 4537 O  O   . HOH N 7 .   ? 41.832 41.081 21.121  1.00 42.24 ? 1004 HOH A O   1 
HETATM 4538 O  O   . HOH N 7 .   ? 30.145 36.045 5.719   1.00 43.51 ? 1005 HOH A O   1 
HETATM 4539 O  O   . HOH N 7 .   ? 17.071 57.466 39.641  1.00 35.04 ? 1006 HOH A O   1 
HETATM 4540 O  O   . HOH N 7 .   ? 14.675 38.564 7.942   1.00 48.54 ? 1007 HOH A O   1 
HETATM 4541 O  O   . HOH N 7 .   ? -0.325 49.144 6.490   1.00 46.71 ? 1008 HOH A O   1 
HETATM 4542 O  O   . HOH N 7 .   ? 35.211 68.812 34.539  1.00 61.91 ? 1009 HOH A O   1 
HETATM 4543 O  O   . HOH N 7 .   ? 24.654 69.031 41.937  1.00 61.28 ? 1010 HOH A O   1 
HETATM 4544 O  O   . HOH N 7 .   ? 32.232 77.222 13.014  1.00 40.06 ? 1011 HOH A O   1 
HETATM 4545 O  O   . HOH N 7 .   ? 32.557 76.413 5.479   1.00 45.56 ? 1012 HOH A O   1 
HETATM 4546 O  O   . HOH N 7 .   ? 21.045 52.266 -12.080 1.00 46.10 ? 1013 HOH A O   1 
HETATM 4547 O  O   . HOH N 7 .   ? 18.416 72.568 -13.661 1.00 51.06 ? 1014 HOH A O   1 
HETATM 4548 O  O   . HOH N 7 .   ? 18.394 69.140 -19.182 1.00 46.09 ? 1015 HOH A O   1 
HETATM 4549 O  O   . HOH N 7 .   ? 3.313  70.951 4.043   1.00 54.32 ? 1016 HOH A O   1 
HETATM 4550 O  O   . HOH N 7 .   ? 45.791 53.948 12.537  1.00 48.84 ? 1017 HOH A O   1 
HETATM 4551 O  O   . HOH N 7 .   ? 47.887 58.205 14.072  1.00 45.86 ? 1018 HOH A O   1 
HETATM 4552 O  O   . HOH N 7 .   ? 24.419 80.311 35.638  1.00 62.30 ? 1019 HOH A O   1 
HETATM 4553 O  O   . HOH N 7 .   ? 17.882 72.064 0.884   1.00 50.22 ? 1020 HOH A O   1 
HETATM 4554 O  O   . HOH N 7 .   ? 27.649 61.153 -4.634  1.00 48.86 ? 1021 HOH A O   1 
HETATM 4555 O  O   . HOH N 7 .   ? 19.551 68.604 -6.293  1.00 48.57 ? 1022 HOH A O   1 
HETATM 4556 O  O   . HOH N 7 .   ? 12.189 41.646 -6.443  1.00 30.83 ? 1023 HOH A O   1 
HETATM 4557 O  O   . HOH N 7 .   ? 12.293 53.437 42.672  1.00 40.23 ? 1024 HOH A O   1 
HETATM 4558 O  O   . HOH N 7 .   ? 19.621 46.767 -9.029  1.00 51.42 ? 1025 HOH A O   1 
HETATM 4559 O  O   . HOH N 7 .   ? 47.598 48.199 29.972  1.00 39.92 ? 1026 HOH A O   1 
HETATM 4560 O  O   . HOH N 7 .   ? 15.816 49.740 -17.863 1.00 43.56 ? 1027 HOH A O   1 
HETATM 4561 O  O   . HOH N 7 .   ? 17.472 48.155 -18.090 1.00 41.27 ? 1028 HOH A O   1 
HETATM 4562 O  O   . HOH N 7 .   ? 44.404 63.037 35.541  1.00 57.52 ? 1029 HOH A O   1 
HETATM 4563 O  O   . HOH N 7 .   ? 19.416 80.241 12.466  1.00 55.88 ? 1030 HOH A O   1 
HETATM 4564 O  O   . HOH N 7 .   ? 10.697 75.524 11.331  1.00 49.09 ? 1031 HOH A O   1 
HETATM 4565 O  O   . HOH N 7 .   ? 37.617 38.776 -1.670  1.00 39.39 ? 1032 HOH A O   1 
HETATM 4566 O  O   . HOH N 7 .   ? 40.350 40.351 0.002   0.50 65.67 ? 1033 HOH A O   1 
HETATM 4567 O  O   . HOH N 7 .   ? 41.753 38.593 29.589  1.00 62.14 ? 1034 HOH A O   1 
HETATM 4568 O  O   . HOH N 7 .   ? 42.558 66.489 7.971   1.00 57.06 ? 1035 HOH A O   1 
HETATM 4569 O  O   . HOH N 7 .   ? 18.441 76.813 36.371  1.00 55.88 ? 1036 HOH A O   1 
HETATM 4570 O  O   . HOH N 7 .   ? 10.176 51.070 43.187  1.00 41.93 ? 1037 HOH A O   1 
HETATM 4571 O  O   . HOH N 7 .   ? 35.838 62.064 51.456  1.00 56.16 ? 1038 HOH A O   1 
HETATM 4572 O  O   . HOH N 7 .   ? 41.072 63.086 6.973   1.00 50.35 ? 1039 HOH A O   1 
HETATM 4573 O  O   . HOH N 7 .   ? 40.120 63.012 2.820   1.00 56.22 ? 1040 HOH A O   1 
HETATM 4574 O  O   . HOH N 7 .   ? 2.145  42.704 36.584  1.00 48.76 ? 1041 HOH A O   1 
HETATM 4575 O  O   . HOH N 7 .   ? 27.814 56.247 11.543  1.00 27.61 ? 1042 HOH A O   1 
HETATM 4576 O  O   . HOH N 7 .   ? 28.099 57.111 8.570   1.00 42.67 ? 1043 HOH A O   1 
HETATM 4577 O  O   . HOH N 7 .   ? 28.636 59.450 7.358   1.00 40.71 ? 1044 HOH A O   1 
HETATM 4578 O  O   . HOH N 7 .   ? 51.653 57.320 34.798  1.00 47.12 ? 1045 HOH A O   1 
HETATM 4579 O  O   . HOH N 7 .   ? 47.477 55.322 30.809  1.00 35.96 ? 1046 HOH A O   1 
HETATM 4580 O  O   . HOH N 7 .   ? 12.785 67.210 31.339  1.00 39.20 ? 1047 HOH A O   1 
HETATM 4581 O  O   . HOH N 7 .   ? 25.957 81.347 33.590  1.00 45.87 ? 1048 HOH A O   1 
HETATM 4582 O  O   . HOH N 7 .   ? 22.899 80.745 7.548   1.00 57.58 ? 1049 HOH A O   1 
HETATM 4583 O  O   . HOH N 7 .   ? 47.991 42.507 13.755  1.00 40.54 ? 1050 HOH A O   1 
HETATM 4584 O  O   . HOH N 7 .   ? 25.106 72.704 -0.590  1.00 46.60 ? 1051 HOH A O   1 
HETATM 4585 O  O   . HOH N 7 .   ? 5.251  41.658 28.732  1.00 55.67 ? 1052 HOH A O   1 
HETATM 4586 O  O   . HOH N 7 .   ? 13.064 57.948 -22.518 1.00 47.90 ? 1053 HOH A O   1 
HETATM 4587 O  O   . HOH N 7 .   ? 36.873 37.481 20.275  1.00 48.00 ? 1054 HOH A O   1 
HETATM 4588 O  O   . HOH N 7 .   ? 19.892 39.148 16.810  1.00 44.93 ? 1055 HOH A O   1 
HETATM 4589 O  O   . HOH N 7 .   ? 11.980 68.298 37.741  1.00 45.34 ? 1056 HOH A O   1 
HETATM 4590 O  O   . HOH N 7 .   ? 17.161 40.451 17.743  1.00 48.72 ? 1057 HOH A O   1 
HETATM 4591 O  O   . HOH N 7 .   ? 27.846 61.630 41.416  1.00 34.05 ? 1058 HOH A O   1 
HETATM 4592 O  O   . HOH N 7 .   ? 23.253 52.029 54.186  1.00 44.53 ? 1059 HOH A O   1 
HETATM 4593 O  O   . HOH N 7 .   ? 22.176 65.961 -14.766 1.00 51.57 ? 1060 HOH A O   1 
HETATM 4594 O  O   . HOH N 7 .   ? 33.186 72.504 28.268  1.00 60.06 ? 1061 HOH A O   1 
HETATM 4595 O  O   . HOH N 7 .   ? 14.773 46.605 22.546  1.00 54.44 ? 1062 HOH A O   1 
HETATM 4596 O  O   . HOH N 7 .   ? 45.021 40.045 18.682  1.00 45.28 ? 1063 HOH A O   1 
HETATM 4597 O  O   . HOH N 7 .   ? 38.569 37.140 12.808  1.00 65.78 ? 1064 HOH A O   1 
HETATM 4598 O  O   . HOH N 7 .   ? 5.295  63.137 -22.892 1.00 46.71 ? 1065 HOH A O   1 
HETATM 4599 O  O   . HOH N 7 .   ? 25.402 49.679 -11.453 1.00 58.96 ? 1066 HOH A O   1 
HETATM 4600 O  O   . HOH N 7 .   ? 24.398 55.896 -7.635  1.00 39.50 ? 1067 HOH A O   1 
HETATM 4601 O  O   . HOH N 7 .   ? 11.808 72.800 5.397   1.00 43.77 ? 1068 HOH A O   1 
HETATM 4602 O  O   . HOH N 7 .   ? 17.980 47.888 20.898  1.00 39.63 ? 1069 HOH A O   1 
HETATM 4603 O  O   . HOH N 7 .   ? 14.134 60.887 -22.533 1.00 51.10 ? 1070 HOH A O   1 
HETATM 4604 O  O   . HOH N 7 .   ? 51.033 52.838 5.412   1.00 49.78 ? 1071 HOH A O   1 
HETATM 4605 O  O   . HOH N 7 .   ? 23.802 59.057 47.592  1.00 56.35 ? 1072 HOH A O   1 
HETATM 4606 O  O   . HOH N 7 .   ? 18.629 49.742 -14.526 1.00 51.00 ? 1073 HOH A O   1 
HETATM 4607 O  O   . HOH N 7 .   ? -0.967 53.808 24.278  1.00 36.15 ? 1074 HOH A O   1 
HETATM 4608 O  O   . HOH N 7 .   ? 28.849 79.112 9.848   1.00 40.81 ? 1075 HOH A O   1 
HETATM 4609 O  O   . HOH N 7 .   ? 19.778 57.546 -18.208 1.00 55.96 ? 1076 HOH A O   1 
HETATM 4610 O  O   . HOH N 7 .   ? 25.097 77.417 1.306   1.00 46.85 ? 1077 HOH A O   1 
HETATM 4611 O  O   . HOH N 7 .   ? 21.240 55.791 -16.290 1.00 56.41 ? 1078 HOH A O   1 
HETATM 4612 O  O   . HOH N 7 .   ? 20.081 59.120 51.591  1.00 45.50 ? 1079 HOH A O   1 
HETATM 4613 O  O   . HOH N 7 .   ? 29.123 61.621 44.335  1.00 37.58 ? 1080 HOH A O   1 
HETATM 4614 O  O   . HOH N 7 .   ? 20.303 65.343 -16.144 1.00 51.87 ? 1081 HOH A O   1 
HETATM 4615 O  O   . HOH N 7 .   ? 15.794 48.577 19.983  1.00 43.25 ? 1082 HOH A O   1 
HETATM 4616 O  O   . HOH N 7 .   ? 14.845 77.907 20.245  1.00 33.68 ? 1083 HOH A O   1 
HETATM 4617 O  O   . HOH N 7 .   ? 23.952 79.389 16.765  1.00 59.01 ? 1084 HOH A O   1 
HETATM 4618 O  O   . HOH N 7 .   ? 26.904 75.984 17.051  1.00 51.52 ? 1085 HOH A O   1 
HETATM 4619 O  O   . HOH N 7 .   ? 26.321 78.342 9.427   1.00 59.11 ? 1086 HOH A O   1 
HETATM 4620 O  O   . HOH N 7 .   ? 20.252 71.564 -1.939  1.00 53.93 ? 1087 HOH A O   1 
HETATM 4621 O  O   . HOH N 7 .   ? 32.404 66.065 45.732  1.00 46.72 ? 1088 HOH A O   1 
HETATM 4622 O  O   . HOH N 7 .   ? 36.325 69.295 43.205  1.00 52.88 ? 1089 HOH A O   1 
HETATM 4623 O  O   . HOH N 7 .   ? 4.426  66.705 37.218  1.00 72.23 ? 1090 HOH A O   1 
HETATM 4624 O  O   . HOH N 7 .   ? 15.074 58.257 46.627  1.00 60.86 ? 1091 HOH A O   1 
HETATM 4625 O  O   . HOH N 7 .   ? 29.781 51.166 48.409  1.00 53.85 ? 1092 HOH A O   1 
HETATM 4626 O  O   . HOH N 7 .   ? 34.820 52.054 49.978  1.00 64.08 ? 1093 HOH A O   1 
HETATM 4627 O  O   . HOH N 7 .   ? 25.845 63.321 -7.274  1.00 45.17 ? 1094 HOH A O   1 
HETATM 4628 O  O   . HOH N 7 .   ? 7.420  42.409 3.317   1.00 52.35 ? 1095 HOH A O   1 
HETATM 4629 O  O   . HOH N 7 .   ? 19.299 75.682 39.013  1.00 51.80 ? 1096 HOH A O   1 
HETATM 4630 O  O   . HOH N 7 .   ? 30.398 39.874 -3.780  1.00 46.40 ? 1097 HOH A O   1 
HETATM 4631 O  O   . HOH N 7 .   ? 21.919 56.318 13.879  1.00 33.43 ? 1098 HOH A O   1 
HETATM 4632 O  O   . HOH N 7 .   ? 37.527 60.216 51.954  1.00 59.41 ? 1099 HOH A O   1 
HETATM 4633 O  O   . HOH N 7 .   ? 39.386 55.808 50.370  1.00 50.19 ? 1100 HOH A O   1 
HETATM 4634 O  O   . HOH N 7 .   ? 44.701 65.851 36.740  1.00 38.97 ? 1101 HOH A O   1 
HETATM 4635 O  O   . HOH N 7 .   ? 32.791 43.935 38.195  1.00 43.94 ? 1102 HOH A O   1 
HETATM 4636 O  O   . HOH N 7 .   ? 30.484 38.500 35.278  1.00 45.19 ? 1103 HOH A O   1 
HETATM 4637 O  O   . HOH N 7 .   ? 21.013 40.767 32.281  1.00 36.14 ? 1104 HOH A O   1 
HETATM 4638 O  O   . HOH N 7 .   ? 19.005 38.212 25.183  1.00 52.58 ? 1105 HOH A O   1 
HETATM 4639 O  O   . HOH N 7 .   ? 24.688 39.399 2.253   1.00 47.81 ? 1106 HOH A O   1 
HETATM 4640 O  O   . HOH N 7 .   ? 28.138 53.386 0.064   1.00 51.22 ? 1107 HOH A O   1 
HETATM 4641 O  O   . HOH N 7 .   ? 34.048 51.804 1.514   1.00 47.23 ? 1108 HOH A O   1 
HETATM 4642 O  O   . HOH N 7 .   ? 48.065 59.601 24.697  1.00 37.75 ? 1109 HOH A O   1 
HETATM 4643 O  O   . HOH N 7 .   ? 50.548 61.061 24.561  1.00 50.01 ? 1110 HOH A O   1 
HETATM 4644 O  O   . HOH N 7 .   ? 48.968 68.666 21.734  1.00 42.07 ? 1111 HOH A O   1 
HETATM 4645 O  O   . HOH N 7 .   ? 47.938 65.526 18.879  1.00 50.26 ? 1112 HOH A O   1 
HETATM 4646 O  O   . HOH N 7 .   ? 49.572 67.958 14.911  1.00 51.36 ? 1113 HOH A O   1 
HETATM 4647 O  O   . HOH N 7 .   ? 35.447 74.990 26.524  1.00 49.72 ? 1114 HOH A O   1 
HETATM 4648 O  O   . HOH N 7 .   ? 16.384 78.871 28.777  1.00 45.48 ? 1115 HOH A O   1 
HETATM 4649 O  O   . HOH N 7 .   ? 11.355 63.787 38.509  1.00 34.41 ? 1116 HOH A O   1 
HETATM 4650 O  O   . HOH N 7 .   ? 11.018 70.119 32.559  1.00 50.93 ? 1117 HOH A O   1 
HETATM 4651 O  O   . HOH N 7 .   ? 49.981 72.228 17.077  1.00 48.09 ? 1118 HOH A O   1 
HETATM 4652 O  O   . HOH N 7 .   ? 27.942 61.680 9.314   1.00 40.29 ? 1119 HOH A O   1 
HETATM 4653 O  O   . HOH N 7 .   ? 6.085  65.598 22.291  1.00 37.63 ? 1120 HOH A O   1 
HETATM 4654 O  O   . HOH N 7 .   ? 23.026 46.475 48.860  1.00 52.22 ? 1121 HOH A O   1 
HETATM 4655 O  O   . HOH N 7 .   ? 24.346 45.250 45.923  1.00 49.10 ? 1122 HOH A O   1 
HETATM 4656 O  O   . HOH N 7 .   ? 31.385 54.750 47.674  1.00 39.57 ? 1123 HOH A O   1 
HETATM 4657 O  O   . HOH N 7 .   ? 17.949 44.306 32.788  1.00 46.30 ? 1124 HOH A O   1 
HETATM 4658 O  O   . HOH N 7 .   ? -0.631 55.543 38.659  1.00 34.49 ? 1125 HOH A O   1 
HETATM 4659 O  O   . HOH N 7 .   ? 1.536  50.614 -0.135  1.00 46.72 ? 1126 HOH A O   1 
HETATM 4660 O  O   . HOH N 7 .   ? 17.934 64.951 -18.617 1.00 50.37 ? 1127 HOH A O   1 
HETATM 4661 O  O   . HOH N 7 .   ? 15.267 74.289 -10.541 1.00 49.79 ? 1128 HOH A O   1 
HETATM 4662 O  O   . HOH N 7 .   ? 15.247 75.490 -14.284 1.00 47.65 ? 1129 HOH A O   1 
HETATM 4663 O  O   . HOH N 7 .   ? 19.694 73.859 -17.420 1.00 41.67 ? 1130 HOH A O   1 
HETATM 4664 O  O   . HOH N 7 .   ? 9.759  72.830 -4.071  1.00 46.15 ? 1131 HOH A O   1 
HETATM 4665 O  O   . HOH N 7 .   ? 10.174 55.243 16.720  1.00 35.58 ? 1132 HOH A O   1 
HETATM 4666 O  O   . HOH N 7 .   ? 2.498  61.690 -22.189 1.00 43.43 ? 1133 HOH A O   1 
HETATM 4667 O  O   . HOH N 7 .   ? 4.465  66.147 -19.233 1.00 52.04 ? 1134 HOH A O   1 
HETATM 4668 O  O   . HOH N 7 .   ? 19.443 35.203 4.106   1.00 48.04 ? 1135 HOH A O   1 
HETATM 4669 O  O   . HOH N 7 .   ? 17.103 34.216 3.872   1.00 40.30 ? 1136 HOH A O   1 
HETATM 4670 O  O   . HOH N 7 .   ? 32.443 40.951 -6.844  1.00 41.18 ? 1137 HOH A O   1 
HETATM 4671 O  O   . HOH N 7 .   ? 30.378 35.536 1.489   1.00 55.18 ? 1138 HOH A O   1 
HETATM 4672 O  O   . HOH N 7 .   ? 40.895 34.063 11.590  1.00 44.56 ? 1139 HOH A O   1 
HETATM 4673 O  O   . HOH N 7 .   ? 46.002 41.037 22.731  1.00 46.01 ? 1140 HOH A O   1 
HETATM 4674 O  O   . HOH N 7 .   ? 43.574 36.694 23.527  1.00 45.39 ? 1141 HOH A O   1 
HETATM 4675 O  O   . HOH N 7 .   ? 38.907 39.321 36.537  1.00 44.60 ? 1142 HOH A O   1 
HETATM 4676 O  O   . HOH N 7 .   ? 36.147 35.289 33.080  1.00 45.72 ? 1143 HOH A O   1 
HETATM 4677 O  O   . HOH N 7 .   ? 38.112 36.291 28.488  1.00 50.10 ? 1144 HOH A O   1 
HETATM 4678 O  O   . HOH N 7 .   ? 27.547 34.014 10.665  1.00 50.34 ? 1145 HOH A O   1 
HETATM 4679 O  O   . HOH N 7 .   ? 12.159 49.519 15.586  1.00 35.16 ? 1146 HOH A O   1 
HETATM 4680 O  O   . HOH N 7 .   ? 10.179 70.358 23.292  1.00 46.87 ? 1147 HOH A O   1 
HETATM 4681 O  O   . HOH N 7 .   ? 29.611 72.182 7.142   1.00 36.33 ? 1148 HOH A O   1 
HETATM 4682 O  O   . HOH N 7 .   ? 46.335 68.726 4.742   1.00 45.01 ? 1149 HOH A O   1 
HETATM 4683 O  O   . HOH N 7 .   ? 31.892 48.578 -3.998  1.00 48.38 ? 1150 HOH A O   1 
HETATM 4684 O  O   . HOH N 7 .   ? 25.954 69.470 -0.316  1.00 50.37 ? 1151 HOH A O   1 
HETATM 4685 O  O   . HOH N 7 .   ? 26.697 80.122 13.376  1.00 52.68 ? 1152 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   23  ?   ?   ?   A . n 
A 1 2   ASN 2   24  ?   ?   ?   A . n 
A 1 3   ILE 3   25  ?   ?   ?   A . n 
A 1 4   ASN 4   26  ?   ?   ?   A . n 
A 1 5   GLU 5   27  ?   ?   ?   A . n 
A 1 6   ARG 6   28  ?   ?   ?   A . n 
A 1 7   GLU 7   29  ?   ?   ?   A . n 
A 1 8   LYS 8   30  ?   ?   ?   A . n 
A 1 9   GLU 9   31  ?   ?   ?   A . n 
A 1 10  ARG 10  32  ?   ?   ?   A . n 
A 1 11  VAL 11  33  ?   ?   ?   A . n 
A 1 12  ALA 12  34  ?   ?   ?   A . n 
A 1 13  LEU 13  35  ?   ?   ?   A . n 
A 1 14  ASN 14  36  ?   ?   ?   A . n 
A 1 15  LYS 15  37  37  LYS LYS A . n 
A 1 16  THR 16  38  38  THR THR A . n 
A 1 17  ALA 17  39  39  ALA ALA A . n 
A 1 18  HIS 18  40  40  HIS HIS A . n 
A 1 19  SER 19  41  41  SER SER A . n 
A 1 20  GLN 20  42  42  GLN GLN A . n 
A 1 21  GLY 21  43  43  GLY GLY A . n 
A 1 22  ILE 22  44  44  ILE ILE A . n 
A 1 23  GLU 23  45  45  GLU GLU A . n 
A 1 24  GLY 24  46  46  GLY GLY A . n 
A 1 25  LYS 25  47  47  LYS LYS A . n 
A 1 26  ALA 26  48  48  ALA ALA A . n 
A 1 27  MET 27  49  49  MET MET A . n 
A 1 28  SER 28  50  50  SER SER A . n 
A 1 29  GLU 29  51  51  GLU GLU A . n 
A 1 30  GLU 30  52  52  GLU GLU A . n 
A 1 31  TRP 31  53  53  TRP TRP A . n 
A 1 32  ALA 32  54  54  ALA ALA A . n 
A 1 33  ARG 33  55  55  ARG ARG A . n 
A 1 34  TYR 34  56  56  TYR TYR A . n 
A 1 35  TYR 35  57  57  TYR TYR A . n 
A 1 36  PRO 36  58  58  PRO PRO A . n 
A 1 37  ARG 37  59  59  ARG ARG A . n 
A 1 38  GLN 38  60  60  GLN GLN A . n 
A 1 39  PHE 39  61  61  PHE PHE A . n 
A 1 40  ASP 40  62  62  ASP ASP A . n 
A 1 41  SER 41  63  63  SER SER A . n 
A 1 42  TRP 42  64  64  TRP TRP A . n 
A 1 43  LYS 43  65  65  LYS LYS A . n 
A 1 44  LYS 44  66  66  LYS LYS A . n 
A 1 45  THR 45  67  67  THR THR A . n 
A 1 46  LYS 46  68  68  LYS LYS A . n 
A 1 47  GLU 47  69  69  GLU GLU A . n 
A 1 48  SER 48  70  70  SER SER A . n 
A 1 49  ASP 49  71  71  ASP ASP A . n 
A 1 50  ASN 50  72  72  ASN ASN A . n 
A 1 51  ILE 51  73  73  ILE ILE A . n 
A 1 52  THR 52  74  74  THR THR A . n 
A 1 53  ASP 53  75  75  ASP ASP A . n 
A 1 54  MET 54  76  76  MET MET A . n 
A 1 55  LEU 55  77  77  LEU LEU A . n 
A 1 56  LYS 56  78  78  LYS LYS A . n 
A 1 57  GLU 57  79  79  GLU GLU A . n 
A 1 58  LYS 58  80  80  LYS LYS A . n 
A 1 59  PRO 59  81  81  PRO PRO A . n 
A 1 60  ALA 60  82  82  ALA ALA A . n 
A 1 61  LEU 61  83  83  LEU LEU A . n 
A 1 62  VAL 62  84  84  VAL VAL A . n 
A 1 63  VAL 63  85  85  VAL VAL A . n 
A 1 64  ALA 64  86  86  ALA ALA A . n 
A 1 65  TRP 65  87  87  TRP TRP A . n 
A 1 66  ALA 66  88  88  ALA ALA A . n 
A 1 67  GLY 67  89  89  GLY GLY A . n 
A 1 68  TYR 68  90  90  TYR TYR A . n 
A 1 69  PRO 69  91  91  PRO PRO A . n 
A 1 70  PHE 70  92  92  PHE PHE A . n 
A 1 71  SER 71  93  93  SER SER A . n 
A 1 72  LYS 72  94  94  LYS LYS A . n 
A 1 73  ASP 73  95  95  ASP ASP A . n 
A 1 74  TYR 74  96  96  TYR TYR A . n 
A 1 75  ASN 75  97  97  ASN ASN A . n 
A 1 76  ALA 76  98  98  ALA ALA A . n 
A 1 77  PRO 77  99  99  PRO PRO A . n 
A 1 78  ARG 78  100 100 ARG ARG A . n 
A 1 79  GLY 79  101 101 GLY GLY A . n 
A 1 80  HIS 80  102 102 HIS HIS A . n 
A 1 81  TYR 81  103 103 TYR TYR A . n 
A 1 82  TYR 82  104 104 TYR TYR A . n 
A 1 83  ALA 83  105 105 ALA ALA A . n 
A 1 84  LEU 84  106 106 LEU LEU A . n 
A 1 85  GLN 85  107 107 GLN GLN A . n 
A 1 86  ASP 86  108 108 ASP ASP A . n 
A 1 87  ASN 87  109 109 ASN ASN A . n 
A 1 88  ILE 88  110 110 ILE ILE A . n 
A 1 89  ASN 89  111 111 ASN ASN A . n 
A 1 90  THR 90  112 112 THR THR A . n 
A 1 91  LEU 91  113 113 LEU LEU A . n 
A 1 92  ARG 92  114 114 ARG ARG A . n 
A 1 93  THR 93  115 115 THR THR A . n 
A 1 94  GLY 94  116 116 GLY GLY A . n 
A 1 95  ALA 95  117 117 ALA ALA A . n 
A 1 96  PRO 96  118 118 PRO PRO A . n 
A 1 97  VAL 97  119 119 VAL VAL A . n 
A 1 98  ASP 98  120 120 ASP ASP A . n 
A 1 99  GLY 99  121 121 GLY GLY A . n 
A 1 100 LYS 100 122 122 LYS LYS A . n 
A 1 101 THR 101 123 123 THR THR A . n 
A 1 102 GLY 102 124 124 GLY GLY A . n 
A 1 103 PRO 103 125 125 PRO PRO A . n 
A 1 104 LEU 104 126 126 LEU LEU A . n 
A 1 105 PRO 105 127 127 PRO PRO A . n 
A 1 106 SER 106 128 128 SER SER A . n 
A 1 107 ALA 107 129 129 ALA ALA A . n 
A 1 108 CYS 108 130 130 CYS CYS A . n 
A 1 109 TRP 109 131 131 TRP TRP A . n 
A 1 110 THR 110 132 132 THR THR A . n 
A 1 111 CYS 111 133 133 CYS CYS A . n 
A 1 112 LYS 112 134 134 LYS LYS A . n 
A 1 113 SER 113 135 135 SER SER A . n 
A 1 114 PRO 114 136 136 PRO PRO A . n 
A 1 115 ASP 115 137 137 ASP ASP A . n 
A 1 116 VAL 116 138 138 VAL VAL A . n 
A 1 117 PRO 117 139 139 PRO PRO A . n 
A 1 118 ARG 118 140 140 ARG ARG A . n 
A 1 119 ILE 119 141 141 ILE ILE A . n 
A 1 120 ILE 120 142 142 ILE ILE A . n 
A 1 121 GLU 121 143 143 GLU GLU A . n 
A 1 122 GLN 122 144 144 GLN GLN A . n 
A 1 123 ASP 123 145 145 ASP ASP A . n 
A 1 124 GLY 124 146 146 GLY GLY A . n 
A 1 125 GLU 125 147 147 GLU GLU A . n 
A 1 126 LEU 126 148 148 LEU LEU A . n 
A 1 127 GLU 127 149 149 GLU GLU A . n 
A 1 128 TYR 128 150 150 TYR TYR A . n 
A 1 129 PHE 129 151 151 PHE PHE A . n 
A 1 130 THR 130 152 152 THR THR A . n 
A 1 131 GLY 131 153 153 GLY GLY A . n 
A 1 132 LYS 132 154 154 LYS LYS A . n 
A 1 133 TRP 133 155 155 TRP TRP A . n 
A 1 134 ALA 134 156 156 ALA ALA A . n 
A 1 135 LYS 135 157 157 LYS LYS A . n 
A 1 136 TYR 136 158 158 TYR TYR A . n 
A 1 137 GLY 137 159 159 GLY GLY A . n 
A 1 138 ASP 138 160 160 ASP ASP A . n 
A 1 139 GLU 139 161 161 GLU GLU A . n 
A 1 140 ILE 140 162 162 ILE ILE A . n 
A 1 141 VAL 141 163 163 VAL VAL A . n 
A 1 142 ASN 142 164 164 ASN ASN A . n 
A 1 143 THR 143 165 165 THR THR A . n 
A 1 144 ILE 144 166 166 ILE ILE A . n 
A 1 145 GLY 145 167 167 GLY GLY A . n 
A 1 146 CYS 146 168 168 CYS CYS A . n 
A 1 147 TYR 147 169 169 TYR TYR A . n 
A 1 148 ASN 148 170 170 ASN ASN A . n 
A 1 149 CYS 149 171 171 CYS CYS A . n 
A 1 150 HIS 150 172 172 HIS HIS A . n 
A 1 151 ASP 151 173 173 ASP ASP A . n 
A 1 152 ASP 152 174 174 ASP ASP A . n 
A 1 153 LYS 153 175 175 LYS LYS A . n 
A 1 154 SER 154 176 176 SER SER A . n 
A 1 155 ALA 155 177 177 ALA ALA A . n 
A 1 156 GLU 156 178 178 GLU GLU A . n 
A 1 157 LEU 157 179 179 LEU LEU A . n 
A 1 158 LYS 158 180 180 LYS LYS A . n 
A 1 159 SER 159 181 181 SER SER A . n 
A 1 160 LYS 160 182 182 LYS LYS A . n 
A 1 161 VAL 161 183 183 VAL VAL A . n 
A 1 162 PRO 162 184 184 PRO PRO A . n 
A 1 163 TYR 163 185 185 TYR TYR A . n 
A 1 164 LEU 164 186 186 LEU LEU A . n 
A 1 165 ASP 165 187 187 ASP ASP A . n 
A 1 166 ARG 166 188 188 ARG ARG A . n 
A 1 167 GLY 167 189 189 GLY GLY A . n 
A 1 168 LEU 168 190 190 LEU LEU A . n 
A 1 169 SER 169 191 191 SER SER A . n 
A 1 170 ALA 170 192 192 ALA ALA A . n 
A 1 171 ALA 171 193 193 ALA ALA A . n 
A 1 172 GLY 172 194 194 GLY GLY A . n 
A 1 173 PHE 173 195 195 PHE PHE A . n 
A 1 174 LYS 174 196 196 LYS LYS A . n 
A 1 175 THR 175 197 197 THR THR A . n 
A 1 176 PHE 176 198 198 PHE PHE A . n 
A 1 177 ALA 177 199 199 ALA ALA A . n 
A 1 178 GLU 178 200 200 GLU GLU A . n 
A 1 179 SER 179 201 201 SER SER A . n 
A 1 180 THR 180 202 202 THR THR A . n 
A 1 181 HIS 181 203 203 HIS HIS A . n 
A 1 182 GLN 182 204 204 GLN GLN A . n 
A 1 183 GLU 183 205 205 GLU GLU A . n 
A 1 184 LYS 184 206 206 LYS LYS A . n 
A 1 185 ARG 185 207 207 ARG ARG A . n 
A 1 186 SER 186 208 208 SER SER A . n 
A 1 187 LEU 187 209 209 LEU LEU A . n 
A 1 188 VAL 188 210 210 VAL VAL A . n 
A 1 189 CYS 189 211 211 CYS CYS A . n 
A 1 190 ALA 190 212 212 ALA ALA A . n 
A 1 191 GLN 191 213 213 GLN GLN A . n 
A 1 192 CYS 192 214 214 CYS CYS A . n 
A 1 193 HIS 193 215 215 HIS HIS A . n 
A 1 194 VAL 194 216 216 VAL VAL A . n 
A 1 195 GLU 195 217 217 GLU GLU A . n 
A 1 196 TYR 196 218 218 TYR TYR A . n 
A 1 197 TYR 197 219 219 TYR TYR A . n 
A 1 198 PHE 198 220 220 PHE PHE A . n 
A 1 199 LYS 199 221 221 LYS LYS A . n 
A 1 200 LYS 200 222 222 LYS LYS A . n 
A 1 201 THR 201 223 223 THR THR A . n 
A 1 202 GLU 202 224 224 GLU GLU A . n 
A 1 203 TRP 203 225 225 TRP TRP A . n 
A 1 204 LYS 204 226 226 LYS LYS A . n 
A 1 205 ASP 205 227 227 ASP ASP A . n 
A 1 206 ASP 206 228 228 ASP ASP A . n 
A 1 207 LYS 207 229 229 LYS LYS A . n 
A 1 208 GLY 208 230 230 GLY GLY A . n 
A 1 209 VAL 209 231 231 VAL VAL A . n 
A 1 210 ASP 210 232 232 ASP ASP A . n 
A 1 211 LYS 211 233 233 LYS LYS A . n 
A 1 212 THR 212 234 234 THR THR A . n 
A 1 213 ALA 213 235 235 ALA ALA A . n 
A 1 214 MET 214 236 236 MET MET A . n 
A 1 215 VAL 215 237 237 VAL VAL A . n 
A 1 216 VAL 216 238 238 VAL VAL A . n 
A 1 217 THR 217 239 239 THR THR A . n 
A 1 218 LEU 218 240 240 LEU LEU A . n 
A 1 219 PRO 219 241 241 PRO PRO A . n 
A 1 220 TRP 220 242 242 TRP TRP A . n 
A 1 221 SER 221 243 243 SER SER A . n 
A 1 222 LYS 222 244 244 LYS LYS A . n 
A 1 223 GLY 223 245 245 GLY GLY A . n 
A 1 224 ILE 224 246 246 ILE ILE A . n 
A 1 225 SER 225 247 247 SER SER A . n 
A 1 226 THR 226 248 248 THR THR A . n 
A 1 227 GLU 227 249 249 GLU GLU A . n 
A 1 228 GLN 228 250 250 GLN GLN A . n 
A 1 229 MET 229 251 251 MET MET A . n 
A 1 230 GLU 230 252 252 GLU GLU A . n 
A 1 231 ALA 231 253 253 ALA ALA A . n 
A 1 232 TYR 232 254 254 TYR TYR A . n 
A 1 233 TYR 233 255 255 TYR TYR A . n 
A 1 234 ASP 234 256 256 ASP ASP A . n 
A 1 235 GLU 235 257 257 GLU GLU A . n 
A 1 236 ILE 236 258 258 ILE ILE A . n 
A 1 237 ASN 237 259 259 ASN ASN A . n 
A 1 238 PHE 238 260 260 PHE PHE A . n 
A 1 239 ALA 239 261 261 ALA ALA A . n 
A 1 240 ASP 240 262 262 ASP ASP A . n 
A 1 241 TRP 241 263 263 TRP TRP A . n 
A 1 242 THR 242 264 264 THR THR A . n 
A 1 243 HIS 243 265 265 HIS HIS A . n 
A 1 244 GLY 244 266 266 GLY GLY A . n 
A 1 245 ILE 245 267 267 ILE ILE A . n 
A 1 246 SER 246 268 268 SER SER A . n 
A 1 247 LYS 247 269 269 LYS LYS A . n 
A 1 248 THR 248 270 270 THR THR A . n 
A 1 249 PRO 249 271 271 PRO PRO A . n 
A 1 250 MET 250 272 272 MET MET A . n 
A 1 251 LEU 251 273 273 LEU LEU A . n 
A 1 252 LYS 252 274 274 LYS LYS A . n 
A 1 253 ALA 253 275 275 ALA ALA A . n 
A 1 254 GLN 254 276 276 GLN GLN A . n 
A 1 255 HIS 255 277 277 HIS HIS A . n 
A 1 256 PRO 256 278 278 PRO PRO A . n 
A 1 257 ASP 257 279 279 ASP ASP A . n 
A 1 258 TRP 258 280 280 TRP TRP A . n 
A 1 259 GLU 259 281 281 GLU GLU A . n 
A 1 260 LEU 260 282 282 LEU LEU A . n 
A 1 261 TYR 261 283 283 TYR TYR A . n 
A 1 262 LYS 262 284 284 LYS LYS A . n 
A 1 263 THR 263 285 285 THR THR A . n 
A 1 264 GLY 264 286 286 GLY GLY A . n 
A 1 265 ILE 265 287 287 ILE ILE A . n 
A 1 266 HIS 266 288 288 HIS HIS A . n 
A 1 267 GLY 267 289 289 GLY GLY A . n 
A 1 268 GLN 268 290 290 GLN GLN A . n 
A 1 269 LYS 269 291 291 LYS LYS A . n 
A 1 270 GLY 270 292 292 GLY GLY A . n 
A 1 271 VAL 271 293 293 VAL VAL A . n 
A 1 272 SER 272 294 294 SER SER A . n 
A 1 273 CYS 273 295 295 CYS CYS A . n 
A 1 274 ALA 274 296 296 ALA ALA A . n 
A 1 275 ASP 275 297 297 ASP ASP A . n 
A 1 276 CYS 276 298 298 CYS CYS A . n 
A 1 277 HIS 277 299 299 HIS HIS A . n 
A 1 278 MET 278 300 300 MET MET A . n 
A 1 279 PRO 279 301 301 PRO PRO A . n 
A 1 280 TYR 280 302 302 TYR TYR A . n 
A 1 281 THR 281 303 303 THR THR A . n 
A 1 282 GLN 282 304 304 GLN GLN A . n 
A 1 283 GLU 283 305 305 GLU GLU A . n 
A 1 284 GLY 284 306 306 GLY GLY A . n 
A 1 285 ALA 285 307 307 ALA ALA A . n 
A 1 286 VAL 286 308 308 VAL VAL A . n 
A 1 287 LYS 287 309 309 LYS LYS A . n 
A 1 288 TYR 288 310 310 TYR TYR A . n 
A 1 289 SER 289 311 311 SER SER A . n 
A 1 290 ASP 290 312 312 ASP ASP A . n 
A 1 291 HIS 291 313 313 HIS HIS A . n 
A 1 292 LYS 292 314 314 LYS LYS A . n 
A 1 293 VAL 293 315 315 VAL VAL A . n 
A 1 294 GLY 294 316 316 GLY GLY A . n 
A 1 295 ASN 295 317 317 ASN ASN A . n 
A 1 296 PRO 296 318 318 PRO PRO A . n 
A 1 297 LEU 297 319 319 LEU LEU A . n 
A 1 298 ASP 298 320 320 ASP ASP A . n 
A 1 299 ASN 299 321 321 ASN ASN A . n 
A 1 300 MET 300 322 322 MET MET A . n 
A 1 301 ASP 301 323 323 ASP ASP A . n 
A 1 302 LYS 302 324 324 LYS LYS A . n 
A 1 303 SER 303 325 325 SER SER A . n 
A 1 304 CYS 304 326 326 CYS CYS A . n 
A 1 305 MET 305 327 327 MET MET A . n 
A 1 306 ASN 306 328 328 ASN ASN A . n 
A 1 307 CYS 307 329 329 CYS CYS A . n 
A 1 308 HIS 308 330 330 HIS HIS A . n 
A 1 309 ARG 309 331 331 ARG ARG A . n 
A 1 310 GLU 310 332 332 GLU GLU A . n 
A 1 311 SER 311 333 333 SER SER A . n 
A 1 312 GLU 312 334 334 GLU GLU A . n 
A 1 313 GLN 313 335 335 GLN GLN A . n 
A 1 314 LYS 314 336 336 LYS LYS A . n 
A 1 315 LEU 315 337 337 LEU LEU A . n 
A 1 316 LYS 316 338 338 LYS LYS A . n 
A 1 317 ASP 317 339 339 ASP ASP A . n 
A 1 318 ILE 318 340 340 ILE ILE A . n 
A 1 319 VAL 319 341 341 VAL VAL A . n 
A 1 320 LYS 320 342 342 LYS LYS A . n 
A 1 321 GLN 321 343 343 GLN GLN A . n 
A 1 322 LYS 322 344 344 LYS LYS A . n 
A 1 323 PHE 323 345 345 PHE PHE A . n 
A 1 324 GLU 324 346 346 GLU GLU A . n 
A 1 325 ARG 325 347 347 ARG ARG A . n 
A 1 326 LYS 326 348 348 LYS LYS A . n 
A 1 327 GLU 327 349 349 GLU GLU A . n 
A 1 328 PHE 328 350 350 PHE PHE A . n 
A 1 329 LEU 329 351 351 LEU LEU A . n 
A 1 330 GLN 330 352 352 GLN GLN A . n 
A 1 331 ASP 331 353 353 ASP ASP A . n 
A 1 332 ILE 332 354 354 ILE ILE A . n 
A 1 333 ALA 333 355 355 ALA ALA A . n 
A 1 334 PHE 334 356 356 PHE PHE A . n 
A 1 335 ASP 335 357 357 ASP ASP A . n 
A 1 336 ASN 336 358 358 ASN ASN A . n 
A 1 337 ILE 337 359 359 ILE ILE A . n 
A 1 338 GLY 338 360 360 GLY GLY A . n 
A 1 339 LYS 339 361 361 LYS LYS A . n 
A 1 340 ALA 340 362 362 ALA ALA A . n 
A 1 341 HIS 341 363 363 HIS HIS A . n 
A 1 342 LEU 342 364 364 LEU LEU A . n 
A 1 343 GLU 343 365 365 GLU GLU A . n 
A 1 344 THR 344 366 366 THR THR A . n 
A 1 345 GLY 345 367 367 GLY GLY A . n 
A 1 346 LYS 346 368 368 LYS LYS A . n 
A 1 347 ALA 347 369 369 ALA ALA A . n 
A 1 348 MET 348 370 370 MET MET A . n 
A 1 349 GLU 349 371 371 GLU GLU A . n 
A 1 350 LEU 350 372 372 LEU LEU A . n 
A 1 351 GLY 351 373 373 GLY GLY A . n 
A 1 352 ALA 352 374 374 ALA ALA A . n 
A 1 353 THR 353 375 375 THR THR A . n 
A 1 354 ASP 354 376 376 ASP ASP A . n 
A 1 355 ALA 355 377 377 ALA ALA A . n 
A 1 356 GLU 356 378 378 GLU GLU A . n 
A 1 357 LEU 357 379 379 LEU LEU A . n 
A 1 358 LYS 358 380 380 LYS LYS A . n 
A 1 359 GLU 359 381 381 GLU GLU A . n 
A 1 360 ILE 360 382 382 ILE ILE A . n 
A 1 361 ARG 361 383 383 ARG ARG A . n 
A 1 362 THR 362 384 384 THR THR A . n 
A 1 363 HIS 363 385 385 HIS HIS A . n 
A 1 364 ILE 364 386 386 ILE ILE A . n 
A 1 365 ARG 365 387 387 ARG ARG A . n 
A 1 366 HIS 366 388 388 HIS HIS A . n 
A 1 367 ALA 367 389 389 ALA ALA A . n 
A 1 368 GLN 368 390 390 GLN GLN A . n 
A 1 369 TRP 369 391 391 TRP TRP A . n 
A 1 370 ARG 370 392 392 ARG ARG A . n 
A 1 371 ALA 371 393 393 ALA ALA A . n 
A 1 372 ASP 372 394 394 ASP ASP A . n 
A 1 373 MET 373 395 395 MET MET A . n 
A 1 374 ALA 374 396 396 ALA ALA A . n 
A 1 375 ILE 375 397 397 ILE ILE A . n 
A 1 376 ALA 376 398 398 ALA ALA A . n 
A 1 377 GLY 377 399 399 GLY GLY A . n 
A 1 378 HIS 378 400 400 HIS HIS A . n 
A 1 379 GLY 379 401 401 GLY GLY A . n 
A 1 380 SER 380 402 402 SER SER A . n 
A 1 381 PHE 381 403 403 PHE PHE A . n 
A 1 382 PHE 382 404 404 PHE PHE A . n 
A 1 383 HIS 383 405 405 HIS HIS A . n 
A 1 384 ALA 384 406 406 ALA ALA A . n 
A 1 385 PRO 385 407 407 PRO PRO A . n 
A 1 386 GLU 386 408 408 GLU GLU A . n 
A 1 387 GLU 387 409 409 GLU GLU A . n 
A 1 388 VAL 388 410 410 VAL VAL A . n 
A 1 389 LEU 389 411 411 LEU LEU A . n 
A 1 390 ARG 390 412 412 ARG ARG A . n 
A 1 391 LEU 391 413 413 LEU LEU A . n 
A 1 392 LEU 392 414 414 LEU LEU A . n 
A 1 393 ALA 393 415 415 ALA ALA A . n 
A 1 394 SER 394 416 416 SER SER A . n 
A 1 395 GLY 395 417 417 GLY GLY A . n 
A 1 396 ASN 396 418 418 ASN ASN A . n 
A 1 397 GLU 397 419 419 GLU GLU A . n 
A 1 398 GLU 398 420 420 GLU GLU A . n 
A 1 399 ALA 399 421 421 ALA ALA A . n 
A 1 400 GLN 400 422 422 GLN GLN A . n 
A 1 401 LYS 401 423 423 LYS LYS A . n 
A 1 402 ALA 402 424 424 ALA ALA A . n 
A 1 403 ARG 403 425 425 ARG ARG A . n 
A 1 404 ILE 404 426 426 ILE ILE A . n 
A 1 405 LYS 405 427 427 LYS LYS A . n 
A 1 406 LEU 406 428 428 LEU LEU A . n 
A 1 407 VAL 407 429 429 VAL VAL A . n 
A 1 408 LYS 408 430 430 LYS LYS A . n 
A 1 409 VAL 409 431 431 VAL VAL A . n 
A 1 410 LEU 410 432 432 LEU LEU A . n 
A 1 411 ALA 411 433 433 ALA ALA A . n 
A 1 412 LYS 412 434 434 LYS LYS A . n 
A 1 413 TYR 413 435 435 TYR TYR A . n 
A 1 414 GLY 414 436 436 GLY GLY A . n 
A 1 415 ALA 415 437 437 ALA ALA A . n 
A 1 416 ILE 416 438 438 ILE ILE A . n 
A 1 417 ASP 417 439 439 ASP ASP A . n 
A 1 418 TYR 418 440 440 TYR TYR A . n 
A 1 419 VAL 419 441 441 VAL VAL A . n 
A 1 420 ALA 420 442 442 ALA ALA A . n 
A 1 421 PRO 421 443 443 PRO PRO A . n 
A 1 422 ASP 422 444 444 ASP ASP A . n 
A 1 423 PHE 423 445 445 PHE PHE A . n 
A 1 424 GLU 424 446 446 GLU GLU A . n 
A 1 425 THR 425 447 447 THR THR A . n 
A 1 426 LYS 426 448 448 LYS LYS A . n 
A 1 427 GLU 427 449 449 GLU GLU A . n 
A 1 428 LYS 428 450 450 LYS LYS A . n 
A 1 429 ALA 429 451 451 ALA ALA A . n 
A 1 430 GLN 430 452 452 GLN GLN A . n 
A 1 431 LYS 431 453 453 LYS LYS A . n 
A 1 432 LEU 432 454 454 LEU LEU A . n 
A 1 433 ALA 433 455 455 ALA ALA A . n 
A 1 434 LYS 434 456 456 LYS LYS A . n 
A 1 435 VAL 435 457 457 VAL VAL A . n 
A 1 436 ASP 436 458 458 ASP ASP A . n 
A 1 437 MET 437 459 459 MET MET A . n 
A 1 438 GLU 438 460 460 GLU GLU A . n 
A 1 439 ALA 439 461 461 ALA ALA A . n 
A 1 440 PHE 440 462 462 PHE PHE A . n 
A 1 441 ILE 441 463 463 ILE ILE A . n 
A 1 442 ALA 442 464 464 ALA ALA A . n 
A 1 443 GLU 443 465 465 GLU GLU A . n 
A 1 444 LYS 444 466 466 LYS LYS A . n 
A 1 445 LEU 445 467 467 LEU LEU A . n 
A 1 446 LYS 446 468 468 LYS LYS A . n 
A 1 447 PHE 447 469 469 PHE PHE A . n 
A 1 448 LYS 448 470 470 LYS LYS A . n 
A 1 449 GLN 449 471 471 GLN GLN A . n 
A 1 450 THR 450 472 472 THR THR A . n 
A 1 451 LEU 451 473 473 LEU LEU A . n 
A 1 452 GLU 452 474 474 GLU GLU A . n 
A 1 453 GLN 453 475 475 GLN GLN A . n 
A 1 454 GLU 454 476 476 GLU GLU A . n 
A 1 455 TRP 455 477 477 TRP TRP A . n 
A 1 456 LYS 456 478 478 LYS LYS A . n 
A 1 457 LYS 457 479 479 LYS LYS A . n 
A 1 458 GLN 458 480 480 GLN GLN A . n 
A 1 459 ALA 459 481 481 ALA ALA A . n 
A 1 460 ILE 460 482 482 ILE ILE A . n 
A 1 461 ALA 461 483 483 ALA ALA A . n 
A 1 462 LYS 462 484 484 LYS LYS A . n 
A 1 463 GLY 463 485 485 GLY GLY A . n 
A 1 464 ARG 464 486 486 ARG ARG A . n 
A 1 465 LEU 465 487 487 LEU LEU A . n 
A 1 466 ASN 466 488 488 ASN ASN A . n 
A 1 467 PRO 467 489 489 PRO PRO A . n 
A 1 468 GLU 468 490 490 GLU GLU A . n 
A 1 469 SER 469 491 491 SER SER A . n 
A 1 470 LEU 470 492 492 LEU LEU A . n 
A 1 471 LYS 471 493 493 LYS LYS A . n 
A 1 472 GLY 472 494 494 GLY GLY A . n 
A 1 473 VAL 473 495 495 VAL VAL A . n 
A 1 474 ASP 474 496 496 ASP ASP A . n 
A 1 475 GLU 475 497 497 GLU GLU A . n 
A 1 476 LYS 476 498 498 LYS LYS A . n 
A 1 477 SER 477 499 499 SER SER A . n 
A 1 478 SER 478 500 500 SER SER A . n 
A 1 479 TYR 479 501 501 TYR TYR A . n 
A 1 480 TYR 480 502 502 TYR TYR A . n 
A 1 481 ASP 481 503 503 ASP ASP A . n 
A 1 482 LYS 482 504 504 LYS LYS A . n 
A 1 483 THR 483 505 505 THR THR A . n 
A 1 484 LYS 484 506 506 LYS LYS A . n 
A 1 485 LYS 485 507 507 LYS LYS A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CA  1   513  513 CA  CA  A . 
C 3 SO3 1   1    1   SO3 SO3 A . 
D 4 Y1  1   2    2   Y1  Y1  A . 
E 4 Y1  1   3    3   Y1  Y1  A . 
F 4 Y1  1   4    4   Y1  Y1  A . 
G 5 ACT 1   5    5   ACT ACT A . 
H 5 ACT 1   6    6   ACT ACT A . 
I 6 HEM 1   508  508 HEM HEM A . 
J 6 HEM 1   509  509 HEM HEM A . 
K 6 HEM 1   510  510 HEM HEM A . 
L 6 HEM 1   511  511 HEM HEM A . 
M 6 HEM 1   512  512 HEM HEM A . 
N 7 HOH 1   514  1   HOH HOH A . 
N 7 HOH 2   515  2   HOH HOH A . 
N 7 HOH 3   516  3   HOH HOH A . 
N 7 HOH 4   517  4   HOH HOH A . 
N 7 HOH 5   518  5   HOH HOH A . 
N 7 HOH 6   519  6   HOH HOH A . 
N 7 HOH 7   520  7   HOH HOH A . 
N 7 HOH 8   521  8   HOH HOH A . 
N 7 HOH 9   522  9   HOH HOH A . 
N 7 HOH 10  523  10  HOH HOH A . 
N 7 HOH 11  524  11  HOH HOH A . 
N 7 HOH 12  525  12  HOH HOH A . 
N 7 HOH 13  526  13  HOH HOH A . 
N 7 HOH 14  527  14  HOH HOH A . 
N 7 HOH 15  528  15  HOH HOH A . 
N 7 HOH 16  529  16  HOH HOH A . 
N 7 HOH 17  530  17  HOH HOH A . 
N 7 HOH 18  531  18  HOH HOH A . 
N 7 HOH 19  532  19  HOH HOH A . 
N 7 HOH 20  533  20  HOH HOH A . 
N 7 HOH 21  534  21  HOH HOH A . 
N 7 HOH 22  535  22  HOH HOH A . 
N 7 HOH 23  536  23  HOH HOH A . 
N 7 HOH 24  537  24  HOH HOH A . 
N 7 HOH 25  538  25  HOH HOH A . 
N 7 HOH 26  539  26  HOH HOH A . 
N 7 HOH 27  540  27  HOH HOH A . 
N 7 HOH 28  541  28  HOH HOH A . 
N 7 HOH 29  542  29  HOH HOH A . 
N 7 HOH 30  543  30  HOH HOH A . 
N 7 HOH 31  544  31  HOH HOH A . 
N 7 HOH 32  545  32  HOH HOH A . 
N 7 HOH 33  546  33  HOH HOH A . 
N 7 HOH 34  547  34  HOH HOH A . 
N 7 HOH 35  548  35  HOH HOH A . 
N 7 HOH 36  549  36  HOH HOH A . 
N 7 HOH 37  550  37  HOH HOH A . 
N 7 HOH 38  551  38  HOH HOH A . 
N 7 HOH 39  552  39  HOH HOH A . 
N 7 HOH 40  553  40  HOH HOH A . 
N 7 HOH 41  554  41  HOH HOH A . 
N 7 HOH 42  555  42  HOH HOH A . 
N 7 HOH 43  556  43  HOH HOH A . 
N 7 HOH 44  557  44  HOH HOH A . 
N 7 HOH 45  558  45  HOH HOH A . 
N 7 HOH 46  559  46  HOH HOH A . 
N 7 HOH 47  560  47  HOH HOH A . 
N 7 HOH 48  561  48  HOH HOH A . 
N 7 HOH 49  562  49  HOH HOH A . 
N 7 HOH 50  563  50  HOH HOH A . 
N 7 HOH 51  564  51  HOH HOH A . 
N 7 HOH 52  565  52  HOH HOH A . 
N 7 HOH 53  566  53  HOH HOH A . 
N 7 HOH 54  567  54  HOH HOH A . 
N 7 HOH 55  568  55  HOH HOH A . 
N 7 HOH 56  569  56  HOH HOH A . 
N 7 HOH 57  570  57  HOH HOH A . 
N 7 HOH 58  571  58  HOH HOH A . 
N 7 HOH 59  572  59  HOH HOH A . 
N 7 HOH 60  573  60  HOH HOH A . 
N 7 HOH 61  574  61  HOH HOH A . 
N 7 HOH 62  575  62  HOH HOH A . 
N 7 HOH 63  576  63  HOH HOH A . 
N 7 HOH 64  577  64  HOH HOH A . 
N 7 HOH 65  578  65  HOH HOH A . 
N 7 HOH 66  579  66  HOH HOH A . 
N 7 HOH 67  580  67  HOH HOH A . 
N 7 HOH 68  581  68  HOH HOH A . 
N 7 HOH 69  582  69  HOH HOH A . 
N 7 HOH 70  583  70  HOH HOH A . 
N 7 HOH 71  584  71  HOH HOH A . 
N 7 HOH 72  585  72  HOH HOH A . 
N 7 HOH 73  586  73  HOH HOH A . 
N 7 HOH 74  587  74  HOH HOH A . 
N 7 HOH 75  588  75  HOH HOH A . 
N 7 HOH 76  589  76  HOH HOH A . 
N 7 HOH 77  590  77  HOH HOH A . 
N 7 HOH 78  591  78  HOH HOH A . 
N 7 HOH 79  592  79  HOH HOH A . 
N 7 HOH 80  593  80  HOH HOH A . 
N 7 HOH 81  594  81  HOH HOH A . 
N 7 HOH 82  595  82  HOH HOH A . 
N 7 HOH 83  596  83  HOH HOH A . 
N 7 HOH 84  597  84  HOH HOH A . 
N 7 HOH 85  598  85  HOH HOH A . 
N 7 HOH 86  599  86  HOH HOH A . 
N 7 HOH 87  600  87  HOH HOH A . 
N 7 HOH 88  601  88  HOH HOH A . 
N 7 HOH 89  602  89  HOH HOH A . 
N 7 HOH 90  603  90  HOH HOH A . 
N 7 HOH 91  604  91  HOH HOH A . 
N 7 HOH 92  605  92  HOH HOH A . 
N 7 HOH 93  606  93  HOH HOH A . 
N 7 HOH 94  607  94  HOH HOH A . 
N 7 HOH 95  608  95  HOH HOH A . 
N 7 HOH 96  609  96  HOH HOH A . 
N 7 HOH 97  610  97  HOH HOH A . 
N 7 HOH 98  611  98  HOH HOH A . 
N 7 HOH 99  612  99  HOH HOH A . 
N 7 HOH 100 613  100 HOH HOH A . 
N 7 HOH 101 614  101 HOH HOH A . 
N 7 HOH 102 615  102 HOH HOH A . 
N 7 HOH 103 616  103 HOH HOH A . 
N 7 HOH 104 617  104 HOH HOH A . 
N 7 HOH 105 618  105 HOH HOH A . 
N 7 HOH 106 619  106 HOH HOH A . 
N 7 HOH 107 620  107 HOH HOH A . 
N 7 HOH 108 621  108 HOH HOH A . 
N 7 HOH 109 622  109 HOH HOH A . 
N 7 HOH 110 623  110 HOH HOH A . 
N 7 HOH 111 624  111 HOH HOH A . 
N 7 HOH 112 625  112 HOH HOH A . 
N 7 HOH 113 626  113 HOH HOH A . 
N 7 HOH 114 627  114 HOH HOH A . 
N 7 HOH 115 628  115 HOH HOH A . 
N 7 HOH 116 629  116 HOH HOH A . 
N 7 HOH 117 630  117 HOH HOH A . 
N 7 HOH 118 631  118 HOH HOH A . 
N 7 HOH 119 632  119 HOH HOH A . 
N 7 HOH 120 633  120 HOH HOH A . 
N 7 HOH 121 634  121 HOH HOH A . 
N 7 HOH 122 635  122 HOH HOH A . 
N 7 HOH 123 636  123 HOH HOH A . 
N 7 HOH 124 637  124 HOH HOH A . 
N 7 HOH 125 638  125 HOH HOH A . 
N 7 HOH 126 639  126 HOH HOH A . 
N 7 HOH 127 640  127 HOH HOH A . 
N 7 HOH 128 641  128 HOH HOH A . 
N 7 HOH 129 642  129 HOH HOH A . 
N 7 HOH 130 643  130 HOH HOH A . 
N 7 HOH 131 644  131 HOH HOH A . 
N 7 HOH 132 645  132 HOH HOH A . 
N 7 HOH 133 646  133 HOH HOH A . 
N 7 HOH 134 647  134 HOH HOH A . 
N 7 HOH 135 648  135 HOH HOH A . 
N 7 HOH 136 649  136 HOH HOH A . 
N 7 HOH 137 650  137 HOH HOH A . 
N 7 HOH 138 651  138 HOH HOH A . 
N 7 HOH 139 652  139 HOH HOH A . 
N 7 HOH 140 653  140 HOH HOH A . 
N 7 HOH 141 654  141 HOH HOH A . 
N 7 HOH 142 655  142 HOH HOH A . 
N 7 HOH 143 656  143 HOH HOH A . 
N 7 HOH 144 657  144 HOH HOH A . 
N 7 HOH 145 658  145 HOH HOH A . 
N 7 HOH 146 659  146 HOH HOH A . 
N 7 HOH 147 660  147 HOH HOH A . 
N 7 HOH 148 661  148 HOH HOH A . 
N 7 HOH 149 662  149 HOH HOH A . 
N 7 HOH 150 663  150 HOH HOH A . 
N 7 HOH 151 664  151 HOH HOH A . 
N 7 HOH 152 665  152 HOH HOH A . 
N 7 HOH 153 666  153 HOH HOH A . 
N 7 HOH 154 667  154 HOH HOH A . 
N 7 HOH 155 668  155 HOH HOH A . 
N 7 HOH 156 669  156 HOH HOH A . 
N 7 HOH 157 670  157 HOH HOH A . 
N 7 HOH 158 671  158 HOH HOH A . 
N 7 HOH 159 672  159 HOH HOH A . 
N 7 HOH 160 673  160 HOH HOH A . 
N 7 HOH 161 674  161 HOH HOH A . 
N 7 HOH 162 675  162 HOH HOH A . 
N 7 HOH 163 676  163 HOH HOH A . 
N 7 HOH 164 677  164 HOH HOH A . 
N 7 HOH 165 678  165 HOH HOH A . 
N 7 HOH 166 679  166 HOH HOH A . 
N 7 HOH 167 680  167 HOH HOH A . 
N 7 HOH 168 681  168 HOH HOH A . 
N 7 HOH 169 682  169 HOH HOH A . 
N 7 HOH 170 683  170 HOH HOH A . 
N 7 HOH 171 684  171 HOH HOH A . 
N 7 HOH 172 685  172 HOH HOH A . 
N 7 HOH 173 686  173 HOH HOH A . 
N 7 HOH 174 687  174 HOH HOH A . 
N 7 HOH 175 688  175 HOH HOH A . 
N 7 HOH 176 689  176 HOH HOH A . 
N 7 HOH 177 690  177 HOH HOH A . 
N 7 HOH 178 691  178 HOH HOH A . 
N 7 HOH 179 692  179 HOH HOH A . 
N 7 HOH 180 693  180 HOH HOH A . 
N 7 HOH 181 694  181 HOH HOH A . 
N 7 HOH 182 695  182 HOH HOH A . 
N 7 HOH 183 696  183 HOH HOH A . 
N 7 HOH 184 697  184 HOH HOH A . 
N 7 HOH 185 698  185 HOH HOH A . 
N 7 HOH 186 699  186 HOH HOH A . 
N 7 HOH 187 700  187 HOH HOH A . 
N 7 HOH 188 701  188 HOH HOH A . 
N 7 HOH 189 702  189 HOH HOH A . 
N 7 HOH 190 703  190 HOH HOH A . 
N 7 HOH 191 704  191 HOH HOH A . 
N 7 HOH 192 705  192 HOH HOH A . 
N 7 HOH 193 706  193 HOH HOH A . 
N 7 HOH 194 707  194 HOH HOH A . 
N 7 HOH 195 708  195 HOH HOH A . 
N 7 HOH 196 709  196 HOH HOH A . 
N 7 HOH 197 710  197 HOH HOH A . 
N 7 HOH 198 711  198 HOH HOH A . 
N 7 HOH 199 712  199 HOH HOH A . 
N 7 HOH 200 713  200 HOH HOH A . 
N 7 HOH 201 714  201 HOH HOH A . 
N 7 HOH 202 715  202 HOH HOH A . 
N 7 HOH 203 716  203 HOH HOH A . 
N 7 HOH 204 717  204 HOH HOH A . 
N 7 HOH 205 718  205 HOH HOH A . 
N 7 HOH 206 719  206 HOH HOH A . 
N 7 HOH 207 720  207 HOH HOH A . 
N 7 HOH 208 721  208 HOH HOH A . 
N 7 HOH 209 722  209 HOH HOH A . 
N 7 HOH 210 723  210 HOH HOH A . 
N 7 HOH 211 724  211 HOH HOH A . 
N 7 HOH 212 725  212 HOH HOH A . 
N 7 HOH 213 726  213 HOH HOH A . 
N 7 HOH 214 727  214 HOH HOH A . 
N 7 HOH 215 728  215 HOH HOH A . 
N 7 HOH 216 729  216 HOH HOH A . 
N 7 HOH 217 730  217 HOH HOH A . 
N 7 HOH 218 731  218 HOH HOH A . 
N 7 HOH 219 732  219 HOH HOH A . 
N 7 HOH 220 733  220 HOH HOH A . 
N 7 HOH 221 734  221 HOH HOH A . 
N 7 HOH 222 735  222 HOH HOH A . 
N 7 HOH 223 736  223 HOH HOH A . 
N 7 HOH 224 737  224 HOH HOH A . 
N 7 HOH 225 738  225 HOH HOH A . 
N 7 HOH 226 739  226 HOH HOH A . 
N 7 HOH 227 740  227 HOH HOH A . 
N 7 HOH 228 741  228 HOH HOH A . 
N 7 HOH 229 742  229 HOH HOH A . 
N 7 HOH 230 743  230 HOH HOH A . 
N 7 HOH 231 744  231 HOH HOH A . 
N 7 HOH 232 745  232 HOH HOH A . 
N 7 HOH 233 746  233 HOH HOH A . 
N 7 HOH 234 747  234 HOH HOH A . 
N 7 HOH 235 748  235 HOH HOH A . 
N 7 HOH 236 749  236 HOH HOH A . 
N 7 HOH 237 750  237 HOH HOH A . 
N 7 HOH 238 751  238 HOH HOH A . 
N 7 HOH 239 752  239 HOH HOH A . 
N 7 HOH 240 753  240 HOH HOH A . 
N 7 HOH 241 754  241 HOH HOH A . 
N 7 HOH 242 755  242 HOH HOH A . 
N 7 HOH 243 756  243 HOH HOH A . 
N 7 HOH 244 757  244 HOH HOH A . 
N 7 HOH 245 758  245 HOH HOH A . 
N 7 HOH 246 759  246 HOH HOH A . 
N 7 HOH 247 760  247 HOH HOH A . 
N 7 HOH 248 761  248 HOH HOH A . 
N 7 HOH 249 762  249 HOH HOH A . 
N 7 HOH 250 763  250 HOH HOH A . 
N 7 HOH 251 764  251 HOH HOH A . 
N 7 HOH 252 765  252 HOH HOH A . 
N 7 HOH 253 766  253 HOH HOH A . 
N 7 HOH 254 767  254 HOH HOH A . 
N 7 HOH 255 768  255 HOH HOH A . 
N 7 HOH 256 769  256 HOH HOH A . 
N 7 HOH 257 770  257 HOH HOH A . 
N 7 HOH 258 771  258 HOH HOH A . 
N 7 HOH 259 772  259 HOH HOH A . 
N 7 HOH 260 773  260 HOH HOH A . 
N 7 HOH 261 774  261 HOH HOH A . 
N 7 HOH 262 775  262 HOH HOH A . 
N 7 HOH 263 776  263 HOH HOH A . 
N 7 HOH 264 777  264 HOH HOH A . 
N 7 HOH 265 778  265 HOH HOH A . 
N 7 HOH 266 779  266 HOH HOH A . 
N 7 HOH 267 780  267 HOH HOH A . 
N 7 HOH 268 781  268 HOH HOH A . 
N 7 HOH 269 782  269 HOH HOH A . 
N 7 HOH 270 783  270 HOH HOH A . 
N 7 HOH 271 784  271 HOH HOH A . 
N 7 HOH 272 785  272 HOH HOH A . 
N 7 HOH 273 786  273 HOH HOH A . 
N 7 HOH 274 787  274 HOH HOH A . 
N 7 HOH 275 788  275 HOH HOH A . 
N 7 HOH 276 789  276 HOH HOH A . 
N 7 HOH 277 790  277 HOH HOH A . 
N 7 HOH 278 791  278 HOH HOH A . 
N 7 HOH 279 792  279 HOH HOH A . 
N 7 HOH 280 793  280 HOH HOH A . 
N 7 HOH 281 794  281 HOH HOH A . 
N 7 HOH 282 795  282 HOH HOH A . 
N 7 HOH 283 796  283 HOH HOH A . 
N 7 HOH 284 797  284 HOH HOH A . 
N 7 HOH 285 798  285 HOH HOH A . 
N 7 HOH 286 799  286 HOH HOH A . 
N 7 HOH 287 800  287 HOH HOH A . 
N 7 HOH 288 801  288 HOH HOH A . 
N 7 HOH 289 802  289 HOH HOH A . 
N 7 HOH 290 803  290 HOH HOH A . 
N 7 HOH 291 804  291 HOH HOH A . 
N 7 HOH 292 805  292 HOH HOH A . 
N 7 HOH 293 806  293 HOH HOH A . 
N 7 HOH 294 807  294 HOH HOH A . 
N 7 HOH 295 808  295 HOH HOH A . 
N 7 HOH 296 809  296 HOH HOH A . 
N 7 HOH 297 810  297 HOH HOH A . 
N 7 HOH 298 811  298 HOH HOH A . 
N 7 HOH 299 812  299 HOH HOH A . 
N 7 HOH 300 813  300 HOH HOH A . 
N 7 HOH 301 814  301 HOH HOH A . 
N 7 HOH 302 815  302 HOH HOH A . 
N 7 HOH 303 816  303 HOH HOH A . 
N 7 HOH 304 817  304 HOH HOH A . 
N 7 HOH 305 818  305 HOH HOH A . 
N 7 HOH 306 819  306 HOH HOH A . 
N 7 HOH 307 820  307 HOH HOH A . 
N 7 HOH 308 821  308 HOH HOH A . 
N 7 HOH 309 822  309 HOH HOH A . 
N 7 HOH 310 823  310 HOH HOH A . 
N 7 HOH 311 824  311 HOH HOH A . 
N 7 HOH 312 825  312 HOH HOH A . 
N 7 HOH 313 826  313 HOH HOH A . 
N 7 HOH 314 827  314 HOH HOH A . 
N 7 HOH 315 828  315 HOH HOH A . 
N 7 HOH 316 829  316 HOH HOH A . 
N 7 HOH 317 830  317 HOH HOH A . 
N 7 HOH 318 831  318 HOH HOH A . 
N 7 HOH 319 832  319 HOH HOH A . 
N 7 HOH 320 833  320 HOH HOH A . 
N 7 HOH 321 834  321 HOH HOH A . 
N 7 HOH 322 835  322 HOH HOH A . 
N 7 HOH 323 836  323 HOH HOH A . 
N 7 HOH 324 837  324 HOH HOH A . 
N 7 HOH 325 838  325 HOH HOH A . 
N 7 HOH 326 839  326 HOH HOH A . 
N 7 HOH 327 840  327 HOH HOH A . 
N 7 HOH 328 841  328 HOH HOH A . 
N 7 HOH 329 842  329 HOH HOH A . 
N 7 HOH 330 843  330 HOH HOH A . 
N 7 HOH 331 844  331 HOH HOH A . 
N 7 HOH 332 845  332 HOH HOH A . 
N 7 HOH 333 846  333 HOH HOH A . 
N 7 HOH 334 847  334 HOH HOH A . 
N 7 HOH 335 848  335 HOH HOH A . 
N 7 HOH 336 849  336 HOH HOH A . 
N 7 HOH 337 850  337 HOH HOH A . 
N 7 HOH 338 851  338 HOH HOH A . 
N 7 HOH 339 852  339 HOH HOH A . 
N 7 HOH 340 853  340 HOH HOH A . 
N 7 HOH 341 854  341 HOH HOH A . 
N 7 HOH 342 855  342 HOH HOH A . 
N 7 HOH 343 856  343 HOH HOH A . 
N 7 HOH 344 857  344 HOH HOH A . 
N 7 HOH 345 858  345 HOH HOH A . 
N 7 HOH 346 859  346 HOH HOH A . 
N 7 HOH 347 860  347 HOH HOH A . 
N 7 HOH 348 861  348 HOH HOH A . 
N 7 HOH 349 862  349 HOH HOH A . 
N 7 HOH 350 863  350 HOH HOH A . 
N 7 HOH 351 864  351 HOH HOH A . 
N 7 HOH 352 865  352 HOH HOH A . 
N 7 HOH 353 866  353 HOH HOH A . 
N 7 HOH 354 867  354 HOH HOH A . 
N 7 HOH 355 868  355 HOH HOH A . 
N 7 HOH 356 869  356 HOH HOH A . 
N 7 HOH 357 870  357 HOH HOH A . 
N 7 HOH 358 871  358 HOH HOH A . 
N 7 HOH 359 872  359 HOH HOH A . 
N 7 HOH 360 873  360 HOH HOH A . 
N 7 HOH 361 874  361 HOH HOH A . 
N 7 HOH 362 875  362 HOH HOH A . 
N 7 HOH 363 876  363 HOH HOH A . 
N 7 HOH 364 877  364 HOH HOH A . 
N 7 HOH 365 878  365 HOH HOH A . 
N 7 HOH 366 879  366 HOH HOH A . 
N 7 HOH 367 880  367 HOH HOH A . 
N 7 HOH 368 881  368 HOH HOH A . 
N 7 HOH 369 882  369 HOH HOH A . 
N 7 HOH 370 883  370 HOH HOH A . 
N 7 HOH 371 884  371 HOH HOH A . 
N 7 HOH 372 885  372 HOH HOH A . 
N 7 HOH 373 886  373 HOH HOH A . 
N 7 HOH 374 887  374 HOH HOH A . 
N 7 HOH 375 888  375 HOH HOH A . 
N 7 HOH 376 889  376 HOH HOH A . 
N 7 HOH 377 890  377 HOH HOH A . 
N 7 HOH 378 891  378 HOH HOH A . 
N 7 HOH 379 892  379 HOH HOH A . 
N 7 HOH 380 893  380 HOH HOH A . 
N 7 HOH 381 894  381 HOH HOH A . 
N 7 HOH 382 895  382 HOH HOH A . 
N 7 HOH 383 896  383 HOH HOH A . 
N 7 HOH 384 897  384 HOH HOH A . 
N 7 HOH 385 898  385 HOH HOH A . 
N 7 HOH 386 899  386 HOH HOH A . 
N 7 HOH 387 900  387 HOH HOH A . 
N 7 HOH 388 901  388 HOH HOH A . 
N 7 HOH 389 902  389 HOH HOH A . 
N 7 HOH 390 903  390 HOH HOH A . 
N 7 HOH 391 904  391 HOH HOH A . 
N 7 HOH 392 905  392 HOH HOH A . 
N 7 HOH 393 906  393 HOH HOH A . 
N 7 HOH 394 907  394 HOH HOH A . 
N 7 HOH 395 908  395 HOH HOH A . 
N 7 HOH 396 909  396 HOH HOH A . 
N 7 HOH 397 910  397 HOH HOH A . 
N 7 HOH 398 911  398 HOH HOH A . 
N 7 HOH 399 912  399 HOH HOH A . 
N 7 HOH 400 913  400 HOH HOH A . 
N 7 HOH 401 914  401 HOH HOH A . 
N 7 HOH 402 915  402 HOH HOH A . 
N 7 HOH 403 916  403 HOH HOH A . 
N 7 HOH 404 917  404 HOH HOH A . 
N 7 HOH 405 918  405 HOH HOH A . 
N 7 HOH 406 919  406 HOH HOH A . 
N 7 HOH 407 920  407 HOH HOH A . 
N 7 HOH 408 921  408 HOH HOH A . 
N 7 HOH 409 922  409 HOH HOH A . 
N 7 HOH 410 923  410 HOH HOH A . 
N 7 HOH 411 924  411 HOH HOH A . 
N 7 HOH 412 925  412 HOH HOH A . 
N 7 HOH 413 926  413 HOH HOH A . 
N 7 HOH 414 927  414 HOH HOH A . 
N 7 HOH 415 928  415 HOH HOH A . 
N 7 HOH 416 929  416 HOH HOH A . 
N 7 HOH 417 930  417 HOH HOH A . 
N 7 HOH 418 931  418 HOH HOH A . 
N 7 HOH 419 932  419 HOH HOH A . 
N 7 HOH 420 933  420 HOH HOH A . 
N 7 HOH 421 934  421 HOH HOH A . 
N 7 HOH 422 935  422 HOH HOH A . 
N 7 HOH 423 936  423 HOH HOH A . 
N 7 HOH 424 937  424 HOH HOH A . 
N 7 HOH 425 938  425 HOH HOH A . 
N 7 HOH 426 939  426 HOH HOH A . 
N 7 HOH 427 940  427 HOH HOH A . 
N 7 HOH 428 941  428 HOH HOH A . 
N 7 HOH 429 942  429 HOH HOH A . 
N 7 HOH 430 943  430 HOH HOH A . 
N 7 HOH 431 944  431 HOH HOH A . 
N 7 HOH 432 945  432 HOH HOH A . 
N 7 HOH 433 946  433 HOH HOH A . 
N 7 HOH 434 947  434 HOH HOH A . 
N 7 HOH 435 948  435 HOH HOH A . 
N 7 HOH 436 949  436 HOH HOH A . 
N 7 HOH 437 950  437 HOH HOH A . 
N 7 HOH 438 951  438 HOH HOH A . 
N 7 HOH 439 952  439 HOH HOH A . 
N 7 HOH 440 953  440 HOH HOH A . 
N 7 HOH 441 954  441 HOH HOH A . 
N 7 HOH 442 955  442 HOH HOH A . 
N 7 HOH 443 956  443 HOH HOH A . 
N 7 HOH 444 957  444 HOH HOH A . 
N 7 HOH 445 958  445 HOH HOH A . 
N 7 HOH 446 959  446 HOH HOH A . 
N 7 HOH 447 960  447 HOH HOH A . 
N 7 HOH 448 961  448 HOH HOH A . 
N 7 HOH 449 962  449 HOH HOH A . 
N 7 HOH 450 963  450 HOH HOH A . 
N 7 HOH 451 964  451 HOH HOH A . 
N 7 HOH 452 965  452 HOH HOH A . 
N 7 HOH 453 966  453 HOH HOH A . 
N 7 HOH 454 967  454 HOH HOH A . 
N 7 HOH 455 968  455 HOH HOH A . 
N 7 HOH 456 969  456 HOH HOH A . 
N 7 HOH 457 970  457 HOH HOH A . 
N 7 HOH 458 971  458 HOH HOH A . 
N 7 HOH 459 972  459 HOH HOH A . 
N 7 HOH 460 973  460 HOH HOH A . 
N 7 HOH 461 974  461 HOH HOH A . 
N 7 HOH 462 975  462 HOH HOH A . 
N 7 HOH 463 976  463 HOH HOH A . 
N 7 HOH 464 977  464 HOH HOH A . 
N 7 HOH 465 978  465 HOH HOH A . 
N 7 HOH 466 979  466 HOH HOH A . 
N 7 HOH 467 980  467 HOH HOH A . 
N 7 HOH 468 981  468 HOH HOH A . 
N 7 HOH 469 982  469 HOH HOH A . 
N 7 HOH 470 983  470 HOH HOH A . 
N 7 HOH 471 984  471 HOH HOH A . 
N 7 HOH 472 985  472 HOH HOH A . 
N 7 HOH 473 986  473 HOH HOH A . 
N 7 HOH 474 987  474 HOH HOH A . 
N 7 HOH 475 988  475 HOH HOH A . 
N 7 HOH 476 989  476 HOH HOH A . 
N 7 HOH 477 990  477 HOH HOH A . 
N 7 HOH 478 991  478 HOH HOH A . 
N 7 HOH 479 992  479 HOH HOH A . 
N 7 HOH 480 993  480 HOH HOH A . 
N 7 HOH 481 994  481 HOH HOH A . 
N 7 HOH 482 995  482 HOH HOH A . 
N 7 HOH 483 996  483 HOH HOH A . 
N 7 HOH 484 997  484 HOH HOH A . 
N 7 HOH 485 998  485 HOH HOH A . 
N 7 HOH 486 999  486 HOH HOH A . 
N 7 HOH 487 1000 487 HOH HOH A . 
N 7 HOH 488 1001 488 HOH HOH A . 
N 7 HOH 489 1002 489 HOH HOH A . 
N 7 HOH 490 1003 490 HOH HOH A . 
N 7 HOH 491 1004 491 HOH HOH A . 
N 7 HOH 492 1005 492 HOH HOH A . 
N 7 HOH 493 1006 493 HOH HOH A . 
N 7 HOH 494 1007 494 HOH HOH A . 
N 7 HOH 495 1008 495 HOH HOH A . 
N 7 HOH 496 1009 496 HOH HOH A . 
N 7 HOH 497 1010 497 HOH HOH A . 
N 7 HOH 498 1011 498 HOH HOH A . 
N 7 HOH 499 1012 499 HOH HOH A . 
N 7 HOH 500 1013 500 HOH HOH A . 
N 7 HOH 501 1014 501 HOH HOH A . 
N 7 HOH 502 1015 502 HOH HOH A . 
N 7 HOH 503 1016 503 HOH HOH A . 
N 7 HOH 504 1017 504 HOH HOH A . 
N 7 HOH 505 1018 505 HOH HOH A . 
N 7 HOH 506 1019 506 HOH HOH A . 
N 7 HOH 507 1020 507 HOH HOH A . 
N 7 HOH 508 1021 508 HOH HOH A . 
N 7 HOH 509 1022 509 HOH HOH A . 
N 7 HOH 510 1023 510 HOH HOH A . 
N 7 HOH 511 1024 511 HOH HOH A . 
N 7 HOH 512 1025 512 HOH HOH A . 
N 7 HOH 513 1026 513 HOH HOH A . 
N 7 HOH 514 1027 514 HOH HOH A . 
N 7 HOH 515 1028 515 HOH HOH A . 
N 7 HOH 516 1029 516 HOH HOH A . 
N 7 HOH 517 1030 517 HOH HOH A . 
N 7 HOH 518 1031 518 HOH HOH A . 
N 7 HOH 519 1032 519 HOH HOH A . 
N 7 HOH 520 1033 520 HOH HOH A . 
N 7 HOH 521 1034 521 HOH HOH A . 
N 7 HOH 522 1035 522 HOH HOH A . 
N 7 HOH 523 1036 523 HOH HOH A . 
N 7 HOH 524 1037 524 HOH HOH A . 
N 7 HOH 525 1038 525 HOH HOH A . 
N 7 HOH 526 1039 526 HOH HOH A . 
N 7 HOH 527 1040 527 HOH HOH A . 
N 7 HOH 528 1041 528 HOH HOH A . 
N 7 HOH 529 1042 529 HOH HOH A . 
N 7 HOH 530 1043 530 HOH HOH A . 
N 7 HOH 531 1044 531 HOH HOH A . 
N 7 HOH 532 1045 532 HOH HOH A . 
N 7 HOH 533 1046 533 HOH HOH A . 
N 7 HOH 534 1047 534 HOH HOH A . 
N 7 HOH 535 1048 535 HOH HOH A . 
N 7 HOH 536 1049 536 HOH HOH A . 
N 7 HOH 537 1050 537 HOH HOH A . 
N 7 HOH 538 1051 538 HOH HOH A . 
N 7 HOH 539 1052 539 HOH HOH A . 
N 7 HOH 540 1053 540 HOH HOH A . 
N 7 HOH 541 1054 541 HOH HOH A . 
N 7 HOH 542 1055 542 HOH HOH A . 
N 7 HOH 543 1056 543 HOH HOH A . 
N 7 HOH 544 1057 544 HOH HOH A . 
N 7 HOH 545 1058 545 HOH HOH A . 
N 7 HOH 546 1059 546 HOH HOH A . 
N 7 HOH 547 1060 547 HOH HOH A . 
N 7 HOH 548 1061 548 HOH HOH A . 
N 7 HOH 549 1062 549 HOH HOH A . 
N 7 HOH 550 1063 550 HOH HOH A . 
N 7 HOH 551 1064 551 HOH HOH A . 
N 7 HOH 552 1065 552 HOH HOH A . 
N 7 HOH 553 1066 553 HOH HOH A . 
N 7 HOH 554 1067 554 HOH HOH A . 
N 7 HOH 555 1068 555 HOH HOH A . 
N 7 HOH 556 1069 556 HOH HOH A . 
N 7 HOH 557 1070 557 HOH HOH A . 
N 7 HOH 558 1071 558 HOH HOH A . 
N 7 HOH 559 1072 559 HOH HOH A . 
N 7 HOH 560 1073 560 HOH HOH A . 
N 7 HOH 561 1074 561 HOH HOH A . 
N 7 HOH 562 1075 562 HOH HOH A . 
N 7 HOH 563 1076 563 HOH HOH A . 
N 7 HOH 564 1077 564 HOH HOH A . 
N 7 HOH 565 1078 565 HOH HOH A . 
N 7 HOH 566 1079 566 HOH HOH A . 
N 7 HOH 567 1080 567 HOH HOH A . 
N 7 HOH 568 1081 568 HOH HOH A . 
N 7 HOH 569 1082 569 HOH HOH A . 
N 7 HOH 570 1083 570 HOH HOH A . 
N 7 HOH 571 1084 571 HOH HOH A . 
N 7 HOH 572 1085 572 HOH HOH A . 
N 7 HOH 573 1086 573 HOH HOH A . 
N 7 HOH 574 1087 574 HOH HOH A . 
N 7 HOH 575 1088 575 HOH HOH A . 
N 7 HOH 576 1089 576 HOH HOH A . 
N 7 HOH 577 1090 577 HOH HOH A . 
N 7 HOH 578 1091 578 HOH HOH A . 
N 7 HOH 579 1092 579 HOH HOH A . 
N 7 HOH 580 1093 580 HOH HOH A . 
N 7 HOH 581 1094 581 HOH HOH A . 
N 7 HOH 582 1095 582 HOH HOH A . 
N 7 HOH 583 1096 583 HOH HOH A . 
N 7 HOH 584 1097 584 HOH HOH A . 
N 7 HOH 585 1098 585 HOH HOH A . 
N 7 HOH 586 1099 586 HOH HOH A . 
N 7 HOH 587 1100 587 HOH HOH A . 
N 7 HOH 588 1101 588 HOH HOH A . 
N 7 HOH 589 1102 589 HOH HOH A . 
N 7 HOH 590 1103 590 HOH HOH A . 
N 7 HOH 591 1104 591 HOH HOH A . 
N 7 HOH 592 1105 592 HOH HOH A . 
N 7 HOH 593 1106 593 HOH HOH A . 
N 7 HOH 594 1107 594 HOH HOH A . 
N 7 HOH 595 1108 595 HOH HOH A . 
N 7 HOH 596 1109 596 HOH HOH A . 
N 7 HOH 597 1110 597 HOH HOH A . 
N 7 HOH 598 1111 598 HOH HOH A . 
N 7 HOH 599 1112 599 HOH HOH A . 
N 7 HOH 600 1113 600 HOH HOH A . 
N 7 HOH 601 1114 601 HOH HOH A . 
N 7 HOH 602 1115 602 HOH HOH A . 
N 7 HOH 603 1116 603 HOH HOH A . 
N 7 HOH 604 1117 604 HOH HOH A . 
N 7 HOH 605 1118 605 HOH HOH A . 
N 7 HOH 606 1119 606 HOH HOH A . 
N 7 HOH 607 1120 607 HOH HOH A . 
N 7 HOH 608 1121 608 HOH HOH A . 
N 7 HOH 609 1122 609 HOH HOH A . 
N 7 HOH 610 1123 610 HOH HOH A . 
N 7 HOH 611 1124 611 HOH HOH A . 
N 7 HOH 612 1125 612 HOH HOH A . 
N 7 HOH 613 1126 613 HOH HOH A . 
N 7 HOH 614 1127 614 HOH HOH A . 
N 7 HOH 615 1128 615 HOH HOH A . 
N 7 HOH 616 1129 616 HOH HOH A . 
N 7 HOH 617 1130 617 HOH HOH A . 
N 7 HOH 618 1131 618 HOH HOH A . 
N 7 HOH 619 1132 619 HOH HOH A . 
N 7 HOH 620 1133 620 HOH HOH A . 
N 7 HOH 621 1134 621 HOH HOH A . 
N 7 HOH 622 1135 622 HOH HOH A . 
N 7 HOH 623 1136 623 HOH HOH A . 
N 7 HOH 624 1137 624 HOH HOH A . 
N 7 HOH 625 1138 625 HOH HOH A . 
N 7 HOH 626 1139 626 HOH HOH A . 
N 7 HOH 627 1140 627 HOH HOH A . 
N 7 HOH 628 1141 628 HOH HOH A . 
N 7 HOH 629 1142 629 HOH HOH A . 
N 7 HOH 630 1143 630 HOH HOH A . 
N 7 HOH 631 1144 631 HOH HOH A . 
N 7 HOH 632 1145 632 HOH HOH A . 
N 7 HOH 633 1146 633 HOH HOH A . 
N 7 HOH 634 1147 634 HOH HOH A . 
N 7 HOH 635 1148 635 HOH HOH A . 
N 7 HOH 636 1149 636 HOH HOH A . 
N 7 HOH 637 1150 637 HOH HOH A . 
N 7 HOH 638 1151 638 HOH HOH A . 
N 7 HOH 639 1152 639 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
_pdbx_struct_assembly_prop.biol_id   1 
_pdbx_struct_assembly_prop.type      'ABSA (A^2)' 
_pdbx_struct_assembly_prop.value     17990 
_pdbx_struct_assembly_prop.details   ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 10_565 -x,-y+1,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 119.5000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A Y1  4    ? F Y1  . 
2 1 A HOH 901  ? N HOH . 
3 1 A HOH 977  ? N HOH . 
4 1 A HOH 1033 ? N HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 80  ? A HIS 102 ? 1_555 FE ? K HEM . ? A HEM 510 ? 1_555 NA  ? K HEM .   ? A HEM 510 ? 1_555 86.3  ? 
2  NE2 ? A HIS 80  ? A HIS 102 ? 1_555 FE ? K HEM . ? A HEM 510 ? 1_555 NB  ? K HEM .   ? A HEM 510 ? 1_555 92.4  ? 
3  NA  ? K HEM .   ? A HEM 510 ? 1_555 FE ? K HEM . ? A HEM 510 ? 1_555 NB  ? K HEM .   ? A HEM 510 ? 1_555 88.2  ? 
4  NE2 ? A HIS 80  ? A HIS 102 ? 1_555 FE ? K HEM . ? A HEM 510 ? 1_555 NC  ? K HEM .   ? A HEM 510 ? 1_555 92.0  ? 
5  NA  ? K HEM .   ? A HEM 510 ? 1_555 FE ? K HEM . ? A HEM 510 ? 1_555 NC  ? K HEM .   ? A HEM 510 ? 1_555 177.1 ? 
6  NB  ? K HEM .   ? A HEM 510 ? 1_555 FE ? K HEM . ? A HEM 510 ? 1_555 NC  ? K HEM .   ? A HEM 510 ? 1_555 89.5  ? 
7  NE2 ? A HIS 80  ? A HIS 102 ? 1_555 FE ? K HEM . ? A HEM 510 ? 1_555 ND  ? K HEM .   ? A HEM 510 ? 1_555 86.3  ? 
8  NA  ? K HEM .   ? A HEM 510 ? 1_555 FE ? K HEM . ? A HEM 510 ? 1_555 ND  ? K HEM .   ? A HEM 510 ? 1_555 87.4  ? 
9  NB  ? K HEM .   ? A HEM 510 ? 1_555 FE ? K HEM . ? A HEM 510 ? 1_555 ND  ? K HEM .   ? A HEM 510 ? 1_555 175.5 ? 
10 NC  ? K HEM .   ? A HEM 510 ? 1_555 FE ? K HEM . ? A HEM 510 ? 1_555 ND  ? K HEM .   ? A HEM 510 ? 1_555 94.9  ? 
11 NE2 ? A HIS 80  ? A HIS 102 ? 1_555 FE ? K HEM . ? A HEM 510 ? 1_555 NE2 ? A HIS 193 ? A HIS 215 ? 1_555 177.8 ? 
12 NA  ? K HEM .   ? A HEM 510 ? 1_555 FE ? K HEM . ? A HEM 510 ? 1_555 NE2 ? A HIS 193 ? A HIS 215 ? 1_555 92.4  ? 
13 NB  ? K HEM .   ? A HEM 510 ? 1_555 FE ? K HEM . ? A HEM 510 ? 1_555 NE2 ? A HIS 193 ? A HIS 215 ? 1_555 89.3  ? 
14 NC  ? K HEM .   ? A HEM 510 ? 1_555 FE ? K HEM . ? A HEM 510 ? 1_555 NE2 ? A HIS 193 ? A HIS 215 ? 1_555 89.4  ? 
15 ND  ? K HEM .   ? A HEM 510 ? 1_555 FE ? K HEM . ? A HEM 510 ? 1_555 NE2 ? A HIS 193 ? A HIS 215 ? 1_555 91.8  ? 
16 NZ  ? A LYS 112 ? A LYS 134 ? 1_555 FE ? I HEM . ? A HEM 508 ? 1_555 NA  ? I HEM .   ? A HEM 508 ? 1_555 96.5  ? 
17 NZ  ? A LYS 112 ? A LYS 134 ? 1_555 FE ? I HEM . ? A HEM 508 ? 1_555 NB  ? I HEM .   ? A HEM 508 ? 1_555 90.6  ? 
18 NA  ? I HEM .   ? A HEM 508 ? 1_555 FE ? I HEM . ? A HEM 508 ? 1_555 NB  ? I HEM .   ? A HEM 508 ? 1_555 93.8  ? 
19 NZ  ? A LYS 112 ? A LYS 134 ? 1_555 FE ? I HEM . ? A HEM 508 ? 1_555 NC  ? I HEM .   ? A HEM 508 ? 1_555 82.0  ? 
20 NA  ? I HEM .   ? A HEM 508 ? 1_555 FE ? I HEM . ? A HEM 508 ? 1_555 NC  ? I HEM .   ? A HEM 508 ? 1_555 177.3 ? 
21 NB  ? I HEM .   ? A HEM 508 ? 1_555 FE ? I HEM . ? A HEM 508 ? 1_555 NC  ? I HEM .   ? A HEM 508 ? 1_555 88.3  ? 
22 NZ  ? A LYS 112 ? A LYS 134 ? 1_555 FE ? I HEM . ? A HEM 508 ? 1_555 ND  ? I HEM .   ? A HEM 508 ? 1_555 86.7  ? 
23 NA  ? I HEM .   ? A HEM 508 ? 1_555 FE ? I HEM . ? A HEM 508 ? 1_555 ND  ? I HEM .   ? A HEM 508 ? 1_555 88.2  ? 
24 NB  ? I HEM .   ? A HEM 508 ? 1_555 FE ? I HEM . ? A HEM 508 ? 1_555 ND  ? I HEM .   ? A HEM 508 ? 1_555 176.8 ? 
25 NC  ? I HEM .   ? A HEM 508 ? 1_555 FE ? I HEM . ? A HEM 508 ? 1_555 ND  ? I HEM .   ? A HEM 508 ? 1_555 89.5  ? 
26 NZ  ? A LYS 112 ? A LYS 134 ? 1_555 FE ? I HEM . ? A HEM 508 ? 1_555 S   ? C SO3 .   ? A SO3 1   ? 1_555 175.6 ? 
27 NA  ? I HEM .   ? A HEM 508 ? 1_555 FE ? I HEM . ? A HEM 508 ? 1_555 S   ? C SO3 .   ? A SO3 1   ? 1_555 87.7  ? 
28 NB  ? I HEM .   ? A HEM 508 ? 1_555 FE ? I HEM . ? A HEM 508 ? 1_555 S   ? C SO3 .   ? A SO3 1   ? 1_555 90.6  ? 
29 NC  ? I HEM .   ? A HEM 508 ? 1_555 FE ? I HEM . ? A HEM 508 ? 1_555 S   ? C SO3 .   ? A SO3 1   ? 1_555 93.8  ? 
30 ND  ? I HEM .   ? A HEM 508 ? 1_555 FE ? I HEM . ? A HEM 508 ? 1_555 S   ? C SO3 .   ? A SO3 1   ? 1_555 91.9  ? 
31 NE2 ? A HIS 150 ? A HIS 172 ? 1_555 FE ? J HEM . ? A HEM 509 ? 1_555 NA  ? J HEM .   ? A HEM 509 ? 1_555 88.8  ? 
32 NE2 ? A HIS 150 ? A HIS 172 ? 1_555 FE ? J HEM . ? A HEM 509 ? 1_555 NB  ? J HEM .   ? A HEM 509 ? 1_555 92.3  ? 
33 NA  ? J HEM .   ? A HEM 509 ? 1_555 FE ? J HEM . ? A HEM 509 ? 1_555 NB  ? J HEM .   ? A HEM 509 ? 1_555 93.0  ? 
34 NE2 ? A HIS 150 ? A HIS 172 ? 1_555 FE ? J HEM . ? A HEM 509 ? 1_555 NC  ? J HEM .   ? A HEM 509 ? 1_555 92.6  ? 
35 NA  ? J HEM .   ? A HEM 509 ? 1_555 FE ? J HEM . ? A HEM 509 ? 1_555 NC  ? J HEM .   ? A HEM 509 ? 1_555 178.0 ? 
36 NB  ? J HEM .   ? A HEM 509 ? 1_555 FE ? J HEM . ? A HEM 509 ? 1_555 NC  ? J HEM .   ? A HEM 509 ? 1_555 88.5  ? 
37 NE2 ? A HIS 150 ? A HIS 172 ? 1_555 FE ? J HEM . ? A HEM 509 ? 1_555 ND  ? J HEM .   ? A HEM 509 ? 1_555 85.1  ? 
38 NA  ? J HEM .   ? A HEM 509 ? 1_555 FE ? J HEM . ? A HEM 509 ? 1_555 ND  ? J HEM .   ? A HEM 509 ? 1_555 90.9  ? 
39 NB  ? J HEM .   ? A HEM 509 ? 1_555 FE ? J HEM . ? A HEM 509 ? 1_555 ND  ? J HEM .   ? A HEM 509 ? 1_555 175.3 ? 
40 NC  ? J HEM .   ? A HEM 509 ? 1_555 FE ? J HEM . ? A HEM 509 ? 1_555 ND  ? J HEM .   ? A HEM 509 ? 1_555 87.7  ? 
41 NE2 ? A HIS 150 ? A HIS 172 ? 1_555 FE ? J HEM . ? A HEM 509 ? 1_555 NE2 ? A HIS 291 ? A HIS 313 ? 1_555 177.7 ? 
42 NA  ? J HEM .   ? A HEM 509 ? 1_555 FE ? J HEM . ? A HEM 509 ? 1_555 NE2 ? A HIS 291 ? A HIS 313 ? 1_555 91.6  ? 
43 NB  ? J HEM .   ? A HEM 509 ? 1_555 FE ? J HEM . ? A HEM 509 ? 1_555 NE2 ? A HIS 291 ? A HIS 313 ? 1_555 89.9  ? 
44 NC  ? J HEM .   ? A HEM 509 ? 1_555 FE ? J HEM . ? A HEM 509 ? 1_555 NE2 ? A HIS 291 ? A HIS 313 ? 1_555 87.0  ? 
45 ND  ? J HEM .   ? A HEM 509 ? 1_555 FE ? J HEM . ? A HEM 509 ? 1_555 NE2 ? A HIS 291 ? A HIS 313 ? 1_555 92.6  ? 
46 OE1 ? A GLU 195 ? A GLU 217 ? 1_555 CA ? B CA  . ? A CA  513 ? 1_555 OE2 ? A GLU 195 ? A GLU 217 ? 1_555 52.7  ? 
47 OE1 ? A GLU 195 ? A GLU 217 ? 1_555 CA ? B CA  . ? A CA  513 ? 1_555 O   ? A TYR 196 ? A TYR 218 ? 1_555 85.1  ? 
48 OE2 ? A GLU 195 ? A GLU 217 ? 1_555 CA ? B CA  . ? A CA  513 ? 1_555 O   ? A TYR 196 ? A TYR 218 ? 1_555 84.6  ? 
49 OE1 ? A GLU 195 ? A GLU 217 ? 1_555 CA ? B CA  . ? A CA  513 ? 1_555 O   ? A LYS 252 ? A LYS 274 ? 1_555 93.0  ? 
50 OE2 ? A GLU 195 ? A GLU 217 ? 1_555 CA ? B CA  . ? A CA  513 ? 1_555 O   ? A LYS 252 ? A LYS 274 ? 1_555 95.3  ? 
51 O   ? A TYR 196 ? A TYR 218 ? 1_555 CA ? B CA  . ? A CA  513 ? 1_555 O   ? A LYS 252 ? A LYS 274 ? 1_555 177.6 ? 
52 OE1 ? A GLU 195 ? A GLU 217 ? 1_555 CA ? B CA  . ? A CA  513 ? 1_555 OE1 ? A GLN 254 ? A GLN 276 ? 1_555 72.9  ? 
53 OE2 ? A GLU 195 ? A GLU 217 ? 1_555 CA ? B CA  . ? A CA  513 ? 1_555 OE1 ? A GLN 254 ? A GLN 276 ? 1_555 125.5 ? 
54 O   ? A TYR 196 ? A TYR 218 ? 1_555 CA ? B CA  . ? A CA  513 ? 1_555 OE1 ? A GLN 254 ? A GLN 276 ? 1_555 87.7  ? 
55 O   ? A LYS 252 ? A LYS 274 ? 1_555 CA ? B CA  . ? A CA  513 ? 1_555 OE1 ? A GLN 254 ? A GLN 276 ? 1_555 90.4  ? 
56 OE1 ? A GLU 195 ? A GLU 217 ? 1_555 CA ? B CA  . ? A CA  513 ? 1_555 O   ? N HOH .   ? A HOH 706 ? 1_555 153.8 ? 
57 OE2 ? A GLU 195 ? A GLU 217 ? 1_555 CA ? B CA  . ? A CA  513 ? 1_555 O   ? N HOH .   ? A HOH 706 ? 1_555 145.6 ? 
58 O   ? A TYR 196 ? A TYR 218 ? 1_555 CA ? B CA  . ? A CA  513 ? 1_555 O   ? N HOH .   ? A HOH 706 ? 1_555 80.4  ? 
59 O   ? A LYS 252 ? A LYS 274 ? 1_555 CA ? B CA  . ? A CA  513 ? 1_555 O   ? N HOH .   ? A HOH 706 ? 1_555 100.9 ? 
60 OE1 ? A GLN 254 ? A GLN 276 ? 1_555 CA ? B CA  . ? A CA  513 ? 1_555 O   ? N HOH .   ? A HOH 706 ? 1_555 84.8  ? 
61 OE1 ? A GLU 195 ? A GLU 217 ? 1_555 CA ? B CA  . ? A CA  513 ? 1_555 O   ? N HOH .   ? A HOH 590 ? 1_555 132.7 ? 
62 OE2 ? A GLU 195 ? A GLU 217 ? 1_555 CA ? B CA  . ? A CA  513 ? 1_555 O   ? N HOH .   ? A HOH 590 ? 1_555 80.2  ? 
63 O   ? A TYR 196 ? A TYR 218 ? 1_555 CA ? B CA  . ? A CA  513 ? 1_555 O   ? N HOH .   ? A HOH 590 ? 1_555 95.3  ? 
64 O   ? A LYS 252 ? A LYS 274 ? 1_555 CA ? B CA  . ? A CA  513 ? 1_555 O   ? N HOH .   ? A HOH 590 ? 1_555 87.1  ? 
65 OE1 ? A GLN 254 ? A GLN 276 ? 1_555 CA ? B CA  . ? A CA  513 ? 1_555 O   ? N HOH .   ? A HOH 590 ? 1_555 154.3 ? 
66 O   ? N HOH .   ? A HOH 706 ? 1_555 CA ? B CA  . ? A CA  513 ? 1_555 O   ? N HOH .   ? A HOH 590 ? 1_555 70.6  ? 
67 NE2 ? A HIS 266 ? A HIS 288 ? 1_555 FE ? M HEM . ? A HEM 512 ? 1_555 NA  ? M HEM .   ? A HEM 512 ? 1_555 92.7  ? 
68 NE2 ? A HIS 266 ? A HIS 288 ? 1_555 FE ? M HEM . ? A HEM 512 ? 1_555 NB  ? M HEM .   ? A HEM 512 ? 1_555 99.8  ? 
69 NA  ? M HEM .   ? A HEM 512 ? 1_555 FE ? M HEM . ? A HEM 512 ? 1_555 NB  ? M HEM .   ? A HEM 512 ? 1_555 88.3  ? 
70 NE2 ? A HIS 266 ? A HIS 288 ? 1_555 FE ? M HEM . ? A HEM 512 ? 1_555 NC  ? M HEM .   ? A HEM 512 ? 1_555 93.6  ? 
71 NA  ? M HEM .   ? A HEM 512 ? 1_555 FE ? M HEM . ? A HEM 512 ? 1_555 NC  ? M HEM .   ? A HEM 512 ? 1_555 173.6 ? 
72 NB  ? M HEM .   ? A HEM 512 ? 1_555 FE ? M HEM . ? A HEM 512 ? 1_555 NC  ? M HEM .   ? A HEM 512 ? 1_555 89.6  ? 
73 NE2 ? A HIS 266 ? A HIS 288 ? 1_555 FE ? M HEM . ? A HEM 512 ? 1_555 ND  ? M HEM .   ? A HEM 512 ? 1_555 85.6  ? 
74 NA  ? M HEM .   ? A HEM 512 ? 1_555 FE ? M HEM . ? A HEM 512 ? 1_555 ND  ? M HEM .   ? A HEM 512 ? 1_555 91.8  ? 
75 NB  ? M HEM .   ? A HEM 512 ? 1_555 FE ? M HEM . ? A HEM 512 ? 1_555 ND  ? M HEM .   ? A HEM 512 ? 1_555 174.6 ? 
76 NC  ? M HEM .   ? A HEM 512 ? 1_555 FE ? M HEM . ? A HEM 512 ? 1_555 ND  ? M HEM .   ? A HEM 512 ? 1_555 89.8  ? 
77 NE2 ? A HIS 266 ? A HIS 288 ? 1_555 FE ? M HEM . ? A HEM 512 ? 1_555 NE2 ? A HIS 308 ? A HIS 330 ? 1_555 175.1 ? 
78 NA  ? M HEM .   ? A HEM 512 ? 1_555 FE ? M HEM . ? A HEM 512 ? 1_555 NE2 ? A HIS 308 ? A HIS 330 ? 1_555 85.2  ? 
79 NB  ? M HEM .   ? A HEM 512 ? 1_555 FE ? M HEM . ? A HEM 512 ? 1_555 NE2 ? A HIS 308 ? A HIS 330 ? 1_555 75.7  ? 
80 NC  ? M HEM .   ? A HEM 512 ? 1_555 FE ? M HEM . ? A HEM 512 ? 1_555 NE2 ? A HIS 308 ? A HIS 330 ? 1_555 88.4  ? 
81 ND  ? M HEM .   ? A HEM 512 ? 1_555 FE ? M HEM . ? A HEM 512 ? 1_555 NE2 ? A HIS 308 ? A HIS 330 ? 1_555 98.9  ? 
82 NE2 ? A HIS 277 ? A HIS 299 ? 1_555 FE ? L HEM . ? A HEM 511 ? 1_555 NA  ? L HEM .   ? A HEM 511 ? 1_555 92.3  ? 
83 NE2 ? A HIS 277 ? A HIS 299 ? 1_555 FE ? L HEM . ? A HEM 511 ? 1_555 NB  ? L HEM .   ? A HEM 511 ? 1_555 86.5  ? 
84 NA  ? L HEM .   ? A HEM 511 ? 1_555 FE ? L HEM . ? A HEM 511 ? 1_555 NB  ? L HEM .   ? A HEM 511 ? 1_555 88.7  ? 
85 NE2 ? A HIS 277 ? A HIS 299 ? 1_555 FE ? L HEM . ? A HEM 511 ? 1_555 NC  ? L HEM .   ? A HEM 511 ? 1_555 90.1  ? 
86 NA  ? L HEM .   ? A HEM 511 ? 1_555 FE ? L HEM . ? A HEM 511 ? 1_555 NC  ? L HEM .   ? A HEM 511 ? 1_555 176.7 ? 
87 NB  ? L HEM .   ? A HEM 511 ? 1_555 FE ? L HEM . ? A HEM 511 ? 1_555 NC  ? L HEM .   ? A HEM 511 ? 1_555 89.1  ? 
88 NE2 ? A HIS 277 ? A HIS 299 ? 1_555 FE ? L HEM . ? A HEM 511 ? 1_555 ND  ? L HEM .   ? A HEM 511 ? 1_555 92.5  ? 
89 NA  ? L HEM .   ? A HEM 511 ? 1_555 FE ? L HEM . ? A HEM 511 ? 1_555 ND  ? L HEM .   ? A HEM 511 ? 1_555 89.5  ? 
90 NB  ? L HEM .   ? A HEM 511 ? 1_555 FE ? L HEM . ? A HEM 511 ? 1_555 ND  ? L HEM .   ? A HEM 511 ? 1_555 178.0 ? 
91 NC  ? L HEM .   ? A HEM 511 ? 1_555 FE ? L HEM . ? A HEM 511 ? 1_555 ND  ? L HEM .   ? A HEM 511 ? 1_555 92.7  ? 
92 NE2 ? A HIS 277 ? A HIS 299 ? 1_555 FE ? L HEM . ? A HEM 511 ? 1_555 NE2 ? A HIS 383 ? A HIS 405 ? 1_555 174.1 ? 
93 NA  ? L HEM .   ? A HEM 511 ? 1_555 FE ? L HEM . ? A HEM 511 ? 1_555 NE2 ? A HIS 383 ? A HIS 405 ? 1_555 89.5  ? 
94 NB  ? L HEM .   ? A HEM 511 ? 1_555 FE ? L HEM . ? A HEM 511 ? 1_555 NE2 ? A HIS 383 ? A HIS 405 ? 1_555 88.0  ? 
95 NC  ? L HEM .   ? A HEM 511 ? 1_555 FE ? L HEM . ? A HEM 511 ? 1_555 NE2 ? A HIS 383 ? A HIS 405 ? 1_555 87.9  ? 
96 ND  ? L HEM .   ? A HEM 511 ? 1_555 FE ? L HEM . ? A HEM 511 ? 1_555 NE2 ? A HIS 383 ? A HIS 405 ? 1_555 93.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-02-26 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement        5.2.0019 ? 1 
MAR345dtb 'data collection' .        ? 2 
DENZO     'data reduction'  .        ? 3 
SCALEPACK 'data scaling'    .        ? 4 
MOLREP    phasing           .        ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 SG  A CYS 295 ? ? CAB A HEM 511  ? ? 1.79 
2  1 O   A HOH 560 ? ? O   A HOH 1098 ? ? 1.80 
3  1 SG  A CYS 211 ? ? CAB A HEM 510  ? ? 1.81 
4  1 SG  A CYS 130 ? ? CAB A HEM 508  ? ? 1.84 
5  1 SG  A CYS 168 ? ? CAB A HEM 509  ? ? 1.93 
6  1 SG  A CYS 326 ? ? CAB A HEM 512  ? ? 1.94 
7  1 SG  A CYS 171 ? ? CAC A HEM 509  ? ? 1.96 
8  1 NE2 A HIS 203 ? ? O2D A HEM 509  ? ? 1.98 
9  1 O   A HOH 593 ? ? O   A HOH 1148 ? ? 1.98 
10 1 OE1 A GLU 497 ? ? N   A LYS 507  ? ? 2.00 
11 1 O   A HOH 591 ? ? O   A HOH 1148 ? ? 2.05 
12 1 SG  A CYS 133 ? ? CAC A HEM 508  ? ? 2.09 
13 1 O   A HOH 732 ? ? O   A HOH 903  ? ? 2.10 
14 1 O   A HOH 589 ? ? O   A HOH 892  ? ? 2.10 
15 1 O   A HOH 575 ? ? O   A HOH 687  ? ? 2.11 
16 1 O   A HOH 688 ? ? O   A HOH 1108 ? ? 2.13 
17 1 O   A HOH 840 ? ? O   A HOH 1131 ? ? 2.13 
18 1 SG  A CYS 214 ? ? CAC A HEM 510  ? ? 2.14 
19 1 OD1 A ASN 488 ? ? O   A HOH 917  ? ? 2.16 
20 1 SG  A CYS 298 ? ? CAC A HEM 511  ? ? 2.16 
21 1 O   A THR 285 ? ? O   A HOH 1120 ? ? 2.17 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     634 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     850 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   10_565 
_pdbx_validate_symm_contact.dist              2.13 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CG A LYS 229 ? ? CD A LYS 229 ? ? 1.965 1.520 0.445  0.034 N 
2 1 CA A ARG 331 ? ? CB A ARG 331 ? ? 1.237 1.535 -0.298 0.022 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 120 ? ? CG A ASP 120 ? ? OD1 A ASP 120 ? ? 124.07 118.30 5.77   0.90 N 
2 1 CA A LYS 226 ? ? CB A LYS 226 ? ? CG  A LYS 226 ? ? 130.38 113.40 16.98  2.20 N 
3 1 CB A LYS 229 ? ? CG A LYS 229 ? ? CD  A LYS 229 ? ? 76.26  111.60 -35.34 2.60 N 
4 1 N  A THR 285 ? ? CA A THR 285 ? ? CB  A THR 285 ? ? 123.29 110.30 12.99  1.90 N 
5 1 CB A ARG 331 ? ? CA A ARG 331 ? ? C   A ARG 331 ? ? 94.51  110.40 -15.89 2.00 N 
6 1 N  A ARG 331 ? ? CA A ARG 331 ? ? CB  A ARG 331 ? ? 123.24 110.60 12.64  1.80 N 
7 1 CA A LYS 336 ? ? CB A LYS 336 ? ? CG  A LYS 336 ? ? 91.81  113.40 -21.59 2.20 N 
8 1 CB A LYS 336 ? ? CG A LYS 336 ? ? CD  A LYS 336 ? ? 94.52  111.60 -17.08 2.60 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 100 ? ? -125.34 -157.92 
2  1 ASP A 120 ? ? -172.35 -176.99 
3  1 ILE A 166 ? A -15.49  108.25  
4  1 ILE A 166 ? B -29.09  117.20  
5  1 HIS A 277 ? ? 28.48   67.90   
6  1 THR A 285 ? ? 84.68   -74.57  
7  1 ASN A 321 ? ? -148.50 44.64   
8  1 GLU A 332 ? ? 76.76   170.73  
9  1 ALA A 406 ? ? -150.70 67.21   
10 1 PHE A 445 ? ? -147.47 47.03   
11 1 THR A 472 ? ? -121.97 -82.64  
12 1 THR A 505 ? ? 113.40  -7.88   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   LYS 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    284 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   THR 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    285 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            46.15 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 0 A LYS 226 ? CG  ? A LYS 204 CG  
2  1 Y 0 A LYS 226 ? CD  ? A LYS 204 CD  
3  1 Y 0 A LYS 226 ? CE  ? A LYS 204 CE  
4  1 Y 0 A LYS 226 ? NZ  ? A LYS 204 NZ  
5  1 Y 0 A LYS 229 ? CD  ? A LYS 207 CD  
6  1 Y 0 A LYS 229 ? CE  ? A LYS 207 CE  
7  1 Y 0 A LYS 229 ? NZ  ? A LYS 207 NZ  
8  1 Y 0 A ARG 331 ? CB  ? A ARG 309 CB  
9  1 Y 0 A ARG 331 ? CG  ? A ARG 309 CG  
10 1 Y 0 A ARG 331 ? CD  ? A ARG 309 CD  
11 1 Y 0 A ARG 331 ? NE  ? A ARG 309 NE  
12 1 Y 0 A ARG 331 ? CZ  ? A ARG 309 CZ  
13 1 Y 0 A ARG 331 ? NH1 ? A ARG 309 NH1 
14 1 Y 0 A ARG 331 ? NH2 ? A ARG 309 NH2 
15 1 Y 0 A LYS 336 ? CG  ? A LYS 314 CG  
16 1 Y 0 A LYS 336 ? CD  ? A LYS 314 CD  
17 1 Y 0 A LYS 336 ? CE  ? A LYS 314 CE  
18 1 Y 0 A LYS 336 ? NZ  ? A LYS 314 NZ  
19 1 Y 0 A LYS 342 ? CE  ? A LYS 320 CE  
20 1 Y 0 A LYS 342 ? NZ  ? A LYS 320 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 23 ? A SER 1  
2  1 Y 1 A ASN 24 ? A ASN 2  
3  1 Y 1 A ILE 25 ? A ILE 3  
4  1 Y 1 A ASN 26 ? A ASN 4  
5  1 Y 1 A GLU 27 ? A GLU 5  
6  1 Y 1 A ARG 28 ? A ARG 6  
7  1 Y 1 A GLU 29 ? A GLU 7  
8  1 Y 1 A LYS 30 ? A LYS 8  
9  1 Y 1 A GLU 31 ? A GLU 9  
10 1 Y 1 A ARG 32 ? A ARG 10 
11 1 Y 1 A VAL 33 ? A VAL 11 
12 1 Y 1 A ALA 34 ? A ALA 12 
13 1 Y 1 A LEU 35 ? A LEU 13 
14 1 Y 1 A ASN 36 ? A ASN 14 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION'                     CA  
3 'SULFITE ION'                     SO3 
4 'YTTRIUM ION'                     Y1  
5 'ACETATE ION'                     ACT 
6 'PROTOPORPHYRIN IX CONTAINING FE' HEM 
7 water                             HOH 
#