data_3BQM
# 
_entry.id   3BQM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3BQM         
RCSB  RCSB045845   
WWPDB D_1000045845 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3BQN 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3BQM 
_pdbx_database_status.recvd_initial_deposition_date   2007-12-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
_audit_author.name           'Silvian, L.F.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     'Design and synthesis of a series of meta aniline-based LFA-1 ICAM inhibitors' 
_citation.journal_abbrev            Bioorg.Med.Chem.Lett. 
_citation.journal_volume            18 
_citation.page_first                5249 
_citation.page_last                 5251 
_citation.year                      2008 
_citation.journal_id_ASTM           BMCLE8 
_citation.country                   UK 
_citation.journal_id_ISSN           0960-894X 
_citation.journal_id_CSD            1127 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18778938 
_citation.pdbx_database_id_DOI      10.1016/j.bmcl.2008.08.061 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Guckian, K.M.'  1 
primary 'Lin, E.Y.'      2 
primary 'Silvian, L.'    3 
primary 'Friedman, J.E.' 4 
primary 'Chin, D.'       5 
primary 'Scott, D.M.'    6 
# 
_cell.entry_id           3BQM 
_cell.length_a           73.535 
_cell.length_b           70.505 
_cell.length_c           72.558 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3BQM 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Integrin alpha-L'                                                                                  20820.859 2 
? ? 'VWFA domain' ? 
2 non-polymer syn '3-({4-[(1E)-3-morpholin-4-yl-3-oxoprop-1-en-1-yl]-2,3-bis(trifluoromethyl)phenyl}sulfanyl)aniline' 476.435   2 
? ? ?             ? 
3 water       nat water                                                                                               18.015    
333 ? ? ?             ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Leukocyte adhesion glycoprotein LFA-1 alpha chain, LFA-1A, Leukocyte function-associated molecule 1 alpha chain, CD11a antigen' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GNVDLVFLFDGSMSLQPDEFQKILDFMKDVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKWKDPDALLKHVKHMLLLTN
TFGAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLHKFASKPASEFVK
ILDTFEKLKDLFTELQKKIYVI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GNVDLVFLFDGSMSLQPDEFQKILDFMKDVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKWKDPDALLKHVKHMLLLTN
TFGAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLHKFASKPASEFVK
ILDTFEKLKDLFTELQKKIYVI
;
_entity_poly.pdbx_strand_id                 B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ASN n 
1 3   VAL n 
1 4   ASP n 
1 5   LEU n 
1 6   VAL n 
1 7   PHE n 
1 8   LEU n 
1 9   PHE n 
1 10  ASP n 
1 11  GLY n 
1 12  SER n 
1 13  MET n 
1 14  SER n 
1 15  LEU n 
1 16  GLN n 
1 17  PRO n 
1 18  ASP n 
1 19  GLU n 
1 20  PHE n 
1 21  GLN n 
1 22  LYS n 
1 23  ILE n 
1 24  LEU n 
1 25  ASP n 
1 26  PHE n 
1 27  MET n 
1 28  LYS n 
1 29  ASP n 
1 30  VAL n 
1 31  MET n 
1 32  LYS n 
1 33  LYS n 
1 34  LEU n 
1 35  SER n 
1 36  ASN n 
1 37  THR n 
1 38  SER n 
1 39  TYR n 
1 40  GLN n 
1 41  PHE n 
1 42  ALA n 
1 43  ALA n 
1 44  VAL n 
1 45  GLN n 
1 46  PHE n 
1 47  SER n 
1 48  THR n 
1 49  SER n 
1 50  TYR n 
1 51  LYS n 
1 52  THR n 
1 53  GLU n 
1 54  PHE n 
1 55  ASP n 
1 56  PHE n 
1 57  SER n 
1 58  ASP n 
1 59  TYR n 
1 60  VAL n 
1 61  LYS n 
1 62  TRP n 
1 63  LYS n 
1 64  ASP n 
1 65  PRO n 
1 66  ASP n 
1 67  ALA n 
1 68  LEU n 
1 69  LEU n 
1 70  LYS n 
1 71  HIS n 
1 72  VAL n 
1 73  LYS n 
1 74  HIS n 
1 75  MET n 
1 76  LEU n 
1 77  LEU n 
1 78  LEU n 
1 79  THR n 
1 80  ASN n 
1 81  THR n 
1 82  PHE n 
1 83  GLY n 
1 84  ALA n 
1 85  ILE n 
1 86  ASN n 
1 87  TYR n 
1 88  VAL n 
1 89  ALA n 
1 90  THR n 
1 91  GLU n 
1 92  VAL n 
1 93  PHE n 
1 94  ARG n 
1 95  GLU n 
1 96  GLU n 
1 97  LEU n 
1 98  GLY n 
1 99  ALA n 
1 100 ARG n 
1 101 PRO n 
1 102 ASP n 
1 103 ALA n 
1 104 THR n 
1 105 LYS n 
1 106 VAL n 
1 107 LEU n 
1 108 ILE n 
1 109 ILE n 
1 110 ILE n 
1 111 THR n 
1 112 ASP n 
1 113 GLY n 
1 114 GLU n 
1 115 ALA n 
1 116 THR n 
1 117 ASP n 
1 118 SER n 
1 119 GLY n 
1 120 ASN n 
1 121 ILE n 
1 122 ASP n 
1 123 ALA n 
1 124 ALA n 
1 125 LYS n 
1 126 ASP n 
1 127 ILE n 
1 128 ILE n 
1 129 ARG n 
1 130 TYR n 
1 131 ILE n 
1 132 ILE n 
1 133 GLY n 
1 134 ILE n 
1 135 GLY n 
1 136 LYS n 
1 137 HIS n 
1 138 PHE n 
1 139 GLN n 
1 140 THR n 
1 141 LYS n 
1 142 GLU n 
1 143 SER n 
1 144 GLN n 
1 145 GLU n 
1 146 THR n 
1 147 LEU n 
1 148 HIS n 
1 149 LYS n 
1 150 PHE n 
1 151 ALA n 
1 152 SER n 
1 153 LYS n 
1 154 PRO n 
1 155 ALA n 
1 156 SER n 
1 157 GLU n 
1 158 PHE n 
1 159 VAL n 
1 160 LYS n 
1 161 ILE n 
1 162 LEU n 
1 163 ASP n 
1 164 THR n 
1 165 PHE n 
1 166 GLU n 
1 167 LYS n 
1 168 LEU n 
1 169 LYS n 
1 170 ASP n 
1 171 LEU n 
1 172 PHE n 
1 173 THR n 
1 174 GLU n 
1 175 LEU n 
1 176 GLN n 
1 177 LYS n 
1 178 LYS n 
1 179 ILE n 
1 180 TYR n 
1 181 VAL n 
1 182 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ITGAL, CD11A' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     ? 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ITAL_HUMAN 
_struct_ref.pdbx_db_accession          P20701 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GNVDLVFLFDGSMSLQPDEFQKILDFMKDVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKRKDPDALLKHVKHMLLLTN
TFGAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLHKFASKPASEFVK
ILDTFEKLKDLFTELQKKIYVI
;
_struct_ref.pdbx_align_begin           153 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3BQM B 1 ? 182 ? P20701 153 ? 334 ? 128 309 
2 1 3BQM C 1 ? 182 ? P20701 153 ? 334 ? 128 309 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3BQM TRP B 62 ? UNP P20701 ARG 214 VARIANT 189 1 
2 3BQM TRP C 62 ? UNP P20701 ARG 214 VARIANT 189 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                             ? 
'C3 H7 N O2'         89.093  
ARG 'L-peptide linking' y ARGININE                                                                                            ? 
'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                          ? 
'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                     ? 
'C4 H7 N O4'         133.103 
BQM non-polymer         . '3-({4-[(1E)-3-morpholin-4-yl-3-oxoprop-1-en-1-yl]-2,3-bis(trifluoromethyl)phenyl}sulfanyl)aniline' ? 
'C21 H18 F6 N2 O2 S' 476.435 
GLN 'L-peptide linking' y GLUTAMINE                                                                                           ? 
'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                     ? 
'C5 H9 N O4'         147.129 
GLY 'peptide linking'   y GLYCINE                                                                                             ? 
'C2 H5 N O2'         75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                           ? 
'C6 H10 N3 O2 1'     156.162 
HOH non-polymer         . WATER                                                                                               ? 
'H2 O'               18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                          ? 
'C6 H13 N O2'        131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                             ? 
'C6 H13 N O2'        131.173 
LYS 'L-peptide linking' y LYSINE                                                                                              ? 
'C6 H15 N2 O2 1'     147.195 
MET 'L-peptide linking' y METHIONINE                                                                                          ? 
'C5 H11 N O2 S'      149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                                       ? 
'C9 H11 N O2'        165.189 
PRO 'L-peptide linking' y PROLINE                                                                                             ? 
'C5 H9 N O2'         115.130 
SER 'L-peptide linking' y SERINE                                                                                              ? 
'C3 H7 N O3'         105.093 
THR 'L-peptide linking' y THREONINE                                                                                           ? 
'C4 H9 N O3'         119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                          ? 
'C11 H12 N2 O2'      204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                            ? 
'C9 H11 N O3'        181.189 
VAL 'L-peptide linking' y VALINE                                                                                              ? 
'C5 H11 N O2'        117.146 
# 
_exptl.entry_id          3BQM 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.26 
_exptl_crystal.density_percent_sol   45.54 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            273 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.5 
_exptl_crystal_grow.pdbx_details    
'5% Peg400, 20% Peg3350, 50mM K2HPO4 pH 4.5, 10mM MgCl, 1mM inhibitor, VAPOR DIFFUSION, HANGING DROP, temperature 273K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV++' 
_diffrn_detector.pdbx_collection_date   2002-01-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU300' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3BQM 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            1.95 
_reflns.d_resolution_low             35 
_reflns.number_all                   28053 
_reflns.number_obs                   27189 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 3BQM 
_refine.ls_number_reflns_obs                     25805 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             31.71 
_refine.ls_d_res_high                            1.95 
_refine.ls_percent_reflns_obs                    96.60 
_refine.ls_R_factor_obs                          0.23588 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.23334 
_refine.ls_R_factor_R_free                       0.28386 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1352 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.903 
_refine.correlation_coeff_Fo_to_Fc_free          0.865 
_refine.B_iso_mean                               12.411 
_refine.aniso_B[1][1]                            -0.64 
_refine.aniso_B[2][2]                            0.69 
_refine.aniso_B[3][3]                            -0.05 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.241 
_refine.pdbx_overall_ESU_R_Free                  0.205 
_refine.overall_SU_ML                            0.136 
_refine.overall_SU_B                             4.631 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2926 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         64 
_refine_hist.number_atoms_solvent             333 
_refine_hist.number_atoms_total               3323 
_refine_hist.d_res_high                       1.95 
_refine_hist.d_res_low                        31.71 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.011  0.022  ? 3054 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.308  1.985  ? 4128 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.663  5.000  ? 362  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.817 25.294 ? 136  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.734 15.000 ? 550  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       21.579 15.000 ? 6    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.090  0.200  ? 462  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 2264 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.208  0.200  ? 1497 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.309  0.200  ? 2088 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.179  0.200  ? 270  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.211  0.200  ? 86   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.200  0.200  ? 31   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.591  1.500  ? 1870 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.952  2.000  ? 2935 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.666  3.000  ? 1349 'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.680  4.500  ? 1193 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.95 
_refine_ls_shell.d_res_low                        2.002 
_refine_ls_shell.number_reflns_R_work             1817 
_refine_ls_shell.R_factor_R_work                  0.232 
_refine_ls_shell.percent_reflns_obs               94.74 
_refine_ls_shell.R_factor_R_free                  0.348 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             111 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3BQM 
_struct.title                     'LFA-1 I domain bound to inhibitors' 
_struct.pdbx_descriptor           'Integrin alpha-L' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3BQM 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            
;LFA-1 I domain, Leukocyte function associated antigen-1, Alternative splicing, Calcium, Cell adhesion, Glycoprotein, Integrin, Magnesium, Membrane, Polymorphism, Receptor, Transmembrane
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLN A 16  ? LEU A 34  ? GLN B 143 LEU B 161 1 ? 19 
HELX_P HELX_P2  2  ASP A 55  ? LYS A 63  ? ASP B 182 LYS B 190 1 ? 9  
HELX_P HELX_P3  3  ASP A 64  ? LEU A 69  ? ASP B 191 LEU B 196 1 ? 6  
HELX_P HELX_P4  4  ASN A 80  ? VAL A 92  ? ASN B 207 VAL B 219 1 ? 13 
HELX_P HELX_P5  5  ARG A 94  ? GLY A 98  ? ARG B 221 GLY B 225 5 ? 5  
HELX_P HELX_P6  6  ILE A 121 ? LYS A 125 ? ILE B 248 LYS B 252 5 ? 5  
HELX_P HELX_P7  7  LYS A 136 ? GLN A 139 ? LYS B 263 GLN B 266 5 ? 4  
HELX_P HELX_P8  8  THR A 140 ? THR A 146 ? THR B 267 THR B 273 1 ? 7  
HELX_P HELX_P9  9  LEU A 147 ? ALA A 151 ? LEU B 274 ALA B 278 5 ? 5  
HELX_P HELX_P10 10 PRO A 154 ? PHE A 158 ? PRO B 281 PHE B 285 1 ? 5  
HELX_P HELX_P11 11 GLU A 166 ? LYS A 177 ? GLU B 293 LYS B 304 1 ? 12 
HELX_P HELX_P12 12 GLN B 16  ? LEU B 34  ? GLN C 143 LEU C 161 1 ? 19 
HELX_P HELX_P13 13 ASP B 55  ? LYS B 63  ? ASP C 182 LYS C 190 1 ? 9  
HELX_P HELX_P14 14 ASP B 64  ? LEU B 69  ? ASP C 191 LEU C 196 1 ? 6  
HELX_P HELX_P15 15 ASN B 80  ? VAL B 92  ? ASN C 207 VAL C 219 1 ? 13 
HELX_P HELX_P16 16 ARG B 94  ? GLY B 98  ? ARG C 221 GLY C 225 5 ? 5  
HELX_P HELX_P17 17 ILE B 121 ? LYS B 125 ? ILE C 248 LYS C 252 5 ? 5  
HELX_P HELX_P18 18 LYS B 136 ? GLN B 139 ? LYS C 263 GLN C 266 5 ? 4  
HELX_P HELX_P19 19 THR B 140 ? THR B 146 ? THR C 267 THR C 273 1 ? 7  
HELX_P HELX_P20 20 LEU B 147 ? ALA B 151 ? LEU C 274 ALA C 278 5 ? 5  
HELX_P HELX_P21 21 PRO B 154 ? PHE B 158 ? PRO C 281 PHE C 285 1 ? 5  
HELX_P HELX_P22 22 GLU B 166 ? LYS B 177 ? GLU C 293 LYS C 304 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 153 A . ? LYS 280 B PRO 154 A ? PRO 281 B 1 6.92 
2 LYS 153 B . ? LYS 280 C PRO 154 B ? PRO 281 C 1 4.65 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 50  ? PHE A 54  ? TYR B 177 PHE B 181 
A 2 TYR A 39  ? PHE A 46  ? TYR B 166 PHE B 173 
A 3 VAL A 3   ? ASP A 10  ? VAL B 130 ASP B 137 
A 4 THR A 104 ? THR A 111 ? THR B 231 THR B 238 
A 5 ILE A 128 ? ILE A 134 ? ILE B 255 ILE B 261 
A 6 VAL A 159 ? LEU A 162 ? VAL B 286 LEU B 289 
B 1 ILE A 179 ? VAL A 181 ? ILE B 306 VAL B 308 
B 2 ILE B 179 ? VAL B 181 ? ILE C 306 VAL C 308 
C 1 TYR B 50  ? PHE B 54  ? TYR C 177 PHE C 181 
C 2 TYR B 39  ? PHE B 46  ? TYR C 166 PHE C 173 
C 3 VAL B 3   ? ASP B 10  ? VAL C 130 ASP C 137 
C 4 THR B 104 ? THR B 111 ? THR C 231 THR C 238 
C 5 ILE B 128 ? ILE B 134 ? ILE C 255 ILE C 261 
C 6 VAL B 159 ? LEU B 162 ? VAL C 286 LEU C 289 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LYS A 51  ? O LYS B 178 N GLN A 45  ? N GLN B 172 
A 2 3 O VAL A 44  ? O VAL B 171 N PHE A 7   ? N PHE B 134 
A 3 4 N VAL A 6   ? N VAL B 133 O ILE A 108 ? O ILE B 235 
A 4 5 N ILE A 109 ? N ILE B 236 O ILE A 132 ? O ILE B 259 
A 5 6 N GLY A 133 ? N GLY B 260 O LEU A 162 ? O LEU B 289 
B 1 2 N TYR A 180 ? N TYR B 307 O TYR B 180 ? O TYR C 307 
C 1 2 O LYS B 51  ? O LYS C 178 N GLN B 45  ? N GLN C 172 
C 2 3 O GLN B 40  ? O GLN C 167 N LEU B 5   ? N LEU C 132 
C 3 4 N LEU B 8   ? N LEU C 135 O ILE B 108 ? O ILE C 235 
C 4 5 N LEU B 107 ? N LEU C 234 O TYR B 130 ? O TYR C 257 
C 5 6 N ILE B 131 ? N ILE C 258 O LYS B 160 ? O LYS C 287 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE BQM C 1' 
AC2 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE BQM B 1' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 11 LEU B 5   ? LEU C 132 . ? 1_555 ? 
2  AC1 11 PHE B 26  ? PHE C 153 . ? 1_555 ? 
3  AC1 11 TYR B 39  ? TYR C 166 . ? 1_555 ? 
4  AC1 11 ILE B 108 ? ILE C 235 . ? 1_555 ? 
5  AC1 11 TYR B 130 ? TYR C 257 . ? 1_555 ? 
6  AC1 11 ILE B 131 ? ILE C 258 . ? 1_555 ? 
7  AC1 11 ILE B 132 ? ILE C 259 . ? 1_555 ? 
8  AC1 11 GLU B 157 ? GLU C 284 . ? 1_555 ? 
9  AC1 11 PHE B 158 ? PHE C 285 . ? 1_555 ? 
10 AC1 11 LYS B 160 ? LYS C 287 . ? 1_555 ? 
11 AC1 11 LEU B 175 ? LEU C 302 . ? 1_555 ? 
12 AC2 13 LEU A 5   ? LEU B 132 . ? 1_555 ? 
13 AC2 13 PHE A 26  ? PHE B 153 . ? 1_555 ? 
14 AC2 13 TYR A 39  ? TYR B 166 . ? 1_555 ? 
15 AC2 13 ILE A 108 ? ILE B 235 . ? 1_555 ? 
16 AC2 13 ILE A 128 ? ILE B 255 . ? 1_555 ? 
17 AC2 13 TYR A 130 ? TYR B 257 . ? 1_555 ? 
18 AC2 13 ILE A 131 ? ILE B 258 . ? 1_555 ? 
19 AC2 13 ILE A 132 ? ILE B 259 . ? 1_555 ? 
20 AC2 13 GLU A 157 ? GLU B 284 . ? 1_555 ? 
21 AC2 13 PHE A 158 ? PHE B 285 . ? 1_555 ? 
22 AC2 13 LYS A 160 ? LYS B 287 . ? 1_555 ? 
23 AC2 13 LEU A 175 ? LEU B 302 . ? 1_555 ? 
24 AC2 13 HOH E .   ? HOH B 422 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3BQM 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3BQM 
_atom_sites.fract_transf_matrix[1][1]   0.013599 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014183 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013782 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
F 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 1   ? 29.302 -24.709 -19.481 1.00 14.38  ? 128 GLY B N   1 
ATOM   2    C CA  . GLY A 1 1   ? 28.706 -23.548 -18.729 1.00 13.18  ? 128 GLY B CA  1 
ATOM   3    C C   . GLY A 1 1   ? 28.948 -22.211 -19.415 1.00 12.79  ? 128 GLY B C   1 
ATOM   4    O O   . GLY A 1 1   ? 28.069 -21.338 -19.435 1.00 13.02  ? 128 GLY B O   1 
ATOM   5    N N   . ASN A 1 2   ? 30.146 -22.034 -19.961 1.00 12.01  ? 129 ASN B N   1 
ATOM   6    C CA  . ASN A 1 2   ? 30.459 -20.837 -20.724 1.00 11.06  ? 129 ASN B CA  1 
ATOM   7    C C   . ASN A 1 2   ? 29.905 -20.988 -22.128 1.00 10.21  ? 129 ASN B C   1 
ATOM   8    O O   . ASN A 1 2   ? 29.961 -22.067 -22.701 1.00 9.86   ? 129 ASN B O   1 
ATOM   9    C CB  . ASN A 1 2   ? 31.973 -20.603 -20.780 1.00 11.33  ? 129 ASN B CB  1 
ATOM   10   C CG  . ASN A 1 2   ? 32.567 -20.231 -19.435 1.00 12.90  ? 129 ASN B CG  1 
ATOM   11   O OD1 . ASN A 1 2   ? 31.935 -19.559 -18.622 1.00 15.17  ? 129 ASN B OD1 1 
ATOM   12   N ND2 . ASN A 1 2   ? 33.795 -20.660 -19.202 1.00 12.44  ? 129 ASN B ND2 1 
ATOM   13   N N   . VAL A 1 3   ? 29.347 -19.911 -22.668 1.00 9.67   ? 130 VAL B N   1 
ATOM   14   C CA  . VAL A 1 3   ? 28.811 -19.933 -24.018 1.00 8.80   ? 130 VAL B CA  1 
ATOM   15   C C   . VAL A 1 3   ? 29.554 -18.883 -24.821 1.00 8.43   ? 130 VAL B C   1 
ATOM   16   O O   . VAL A 1 3   ? 29.542 -17.696 -24.468 1.00 8.23   ? 130 VAL B O   1 
ATOM   17   C CB  . VAL A 1 3   ? 27.292 -19.611 -24.073 1.00 9.28   ? 130 VAL B CB  1 
ATOM   18   C CG1 . VAL A 1 3   ? 26.811 -19.487 -25.558 1.00 8.53   ? 130 VAL B CG1 1 
ATOM   19   C CG2 . VAL A 1 3   ? 26.480 -20.652 -23.332 1.00 9.31   ? 130 VAL B CG2 1 
ATOM   20   N N   . ASP A 1 4   ? 30.217 -19.323 -25.888 1.00 7.50   ? 131 ASP B N   1 
ATOM   21   C CA  . ASP A 1 4   ? 30.778 -18.386 -26.846 1.00 6.79   ? 131 ASP B CA  1 
ATOM   22   C C   . ASP A 1 4   ? 29.821 -18.330 -28.016 1.00 6.57   ? 131 ASP B C   1 
ATOM   23   O O   . ASP A 1 4   ? 29.534 -19.359 -28.626 1.00 5.66   ? 131 ASP B O   1 
ATOM   24   C CB  . ASP A 1 4   ? 32.152 -18.828 -27.337 1.00 7.10   ? 131 ASP B CB  1 
ATOM   25   C CG  . ASP A 1 4   ? 33.245 -18.611 -26.321 1.00 6.99   ? 131 ASP B CG  1 
ATOM   26   O OD1 . ASP A 1 4   ? 33.004 -17.987 -25.266 1.00 7.28   ? 131 ASP B OD1 1 
ATOM   27   O OD2 . ASP A 1 4   ? 34.363 -19.092 -26.591 1.00 7.28   ? 131 ASP B OD2 1 
ATOM   28   N N   . LEU A 1 5   ? 29.331 -17.128 -28.320 1.00 6.47   ? 132 LEU B N   1 
ATOM   29   C CA  . LEU A 1 5   ? 28.260 -16.976 -29.298 1.00 5.76   ? 132 LEU B CA  1 
ATOM   30   C C   . LEU A 1 5   ? 28.636 -15.994 -30.407 1.00 5.48   ? 132 LEU B C   1 
ATOM   31   O O   . LEU A 1 5   ? 29.005 -14.858 -30.139 1.00 6.49   ? 132 LEU B O   1 
ATOM   32   C CB  . LEU A 1 5   ? 26.942 -16.575 -28.600 1.00 5.87   ? 132 LEU B CB  1 
ATOM   33   C CG  . LEU A 1 5   ? 25.656 -16.491 -29.441 1.00 5.98   ? 132 LEU B CG  1 
ATOM   34   C CD1 . LEU A 1 5   ? 24.402 -16.839 -28.631 1.00 7.78   ? 132 LEU B CD1 1 
ATOM   35   C CD2 . LEU A 1 5   ? 25.475 -15.112 -30.114 1.00 6.17   ? 132 LEU B CD2 1 
ATOM   36   N N   . VAL A 1 6   ? 28.539 -16.450 -31.652 1.00 5.26   ? 133 VAL B N   1 
ATOM   37   C CA  . VAL A 1 6   ? 28.845 -15.627 -32.820 1.00 4.85   ? 133 VAL B CA  1 
ATOM   38   C C   . VAL A 1 6   ? 27.554 -15.217 -33.516 1.00 5.05   ? 133 VAL B C   1 
ATOM   39   O O   . VAL A 1 6   ? 26.697 -16.058 -33.811 1.00 4.09   ? 133 VAL B O   1 
ATOM   40   C CB  . VAL A 1 6   ? 29.830 -16.367 -33.803 1.00 5.51   ? 133 VAL B CB  1 
ATOM   41   C CG1 . VAL A 1 6   ? 30.034 -15.598 -35.115 1.00 3.79   ? 133 VAL B CG1 1 
ATOM   42   C CG2 . VAL A 1 6   ? 31.178 -16.574 -33.117 1.00 5.61   ? 133 VAL B CG2 1 
ATOM   43   N N   . PHE A 1 7   ? 27.413 -13.919 -33.761 1.00 4.88   ? 134 PHE B N   1 
ATOM   44   C CA  . PHE A 1 7   ? 26.377 -13.456 -34.659 1.00 5.21   ? 134 PHE B CA  1 
ATOM   45   C C   . PHE A 1 7   ? 26.980 -13.400 -36.046 1.00 5.47   ? 134 PHE B C   1 
ATOM   46   O O   . PHE A 1 7   ? 27.929 -12.652 -36.294 1.00 5.04   ? 134 PHE B O   1 
ATOM   47   C CB  . PHE A 1 7   ? 25.901 -12.059 -34.295 1.00 5.09   ? 134 PHE B CB  1 
ATOM   48   C CG  . PHE A 1 7   ? 25.165 -11.977 -32.992 1.00 5.24   ? 134 PHE B CG  1 
ATOM   49   C CD1 . PHE A 1 7   ? 25.792 -11.444 -31.863 1.00 5.62   ? 134 PHE B CD1 1 
ATOM   50   C CD2 . PHE A 1 7   ? 23.840 -12.383 -32.903 1.00 5.45   ? 134 PHE B CD2 1 
ATOM   51   C CE1 . PHE A 1 7   ? 25.111 -11.339 -30.654 1.00 5.75   ? 134 PHE B CE1 1 
ATOM   52   C CE2 . PHE A 1 7   ? 23.149 -12.275 -31.700 1.00 6.04   ? 134 PHE B CE2 1 
ATOM   53   C CZ  . PHE A 1 7   ? 23.790 -11.756 -30.577 1.00 5.86   ? 134 PHE B CZ  1 
ATOM   54   N N   . LEU A 1 8   ? 26.412 -14.177 -36.952 1.00 5.94   ? 135 LEU B N   1 
ATOM   55   C CA  . LEU A 1 8   ? 26.861 -14.159 -38.338 1.00 6.26   ? 135 LEU B CA  1 
ATOM   56   C C   . LEU A 1 8   ? 25.745 -13.543 -39.163 1.00 6.26   ? 135 LEU B C   1 
ATOM   57   O O   . LEU A 1 8   ? 24.713 -14.189 -39.392 1.00 7.05   ? 135 LEU B O   1 
ATOM   58   C CB  . LEU A 1 8   ? 27.193 -15.573 -38.816 1.00 6.28   ? 135 LEU B CB  1 
ATOM   59   C CG  . LEU A 1 8   ? 27.542 -15.709 -40.310 1.00 6.20   ? 135 LEU B CG  1 
ATOM   60   C CD1 . LEU A 1 8   ? 28.796 -14.903 -40.644 1.00 5.27   ? 135 LEU B CD1 1 
ATOM   61   C CD2 . LEU A 1 8   ? 27.702 -17.179 -40.685 1.00 5.97   ? 135 LEU B CD2 1 
ATOM   62   N N   . PHE A 1 9   ? 25.947 -12.291 -39.587 1.00 6.02   ? 136 PHE B N   1 
ATOM   63   C CA  . PHE A 1 9   ? 24.875 -11.487 -40.174 1.00 6.32   ? 136 PHE B CA  1 
ATOM   64   C C   . PHE A 1 9   ? 25.094 -11.033 -41.627 1.00 6.55   ? 136 PHE B C   1 
ATOM   65   O O   . PHE A 1 9   ? 26.185 -10.577 -42.020 1.00 6.32   ? 136 PHE B O   1 
ATOM   66   C CB  . PHE A 1 9   ? 24.480 -10.301 -39.256 1.00 5.87   ? 136 PHE B CB  1 
ATOM   67   C CG  . PHE A 1 9   ? 25.533 -9.210  -39.152 1.00 6.85   ? 136 PHE B CG  1 
ATOM   68   C CD1 . PHE A 1 9   ? 25.408 -8.026  -39.883 1.00 5.93   ? 136 PHE B CD1 1 
ATOM   69   C CD2 . PHE A 1 9   ? 26.644 -9.368  -38.314 1.00 5.94   ? 136 PHE B CD2 1 
ATOM   70   C CE1 . PHE A 1 9   ? 26.375 -7.010  -39.783 1.00 7.27   ? 136 PHE B CE1 1 
ATOM   71   C CE2 . PHE A 1 9   ? 27.621 -8.362  -38.217 1.00 7.89   ? 136 PHE B CE2 1 
ATOM   72   C CZ  . PHE A 1 9   ? 27.482 -7.178  -38.949 1.00 5.96   ? 136 PHE B CZ  1 
ATOM   73   N N   . ASP A 1 10  ? 24.018 -11.179 -42.395 1.00 6.61   ? 137 ASP B N   1 
ATOM   74   C CA  . ASP A 1 10  ? 23.918 -10.862 -43.833 1.00 6.73   ? 137 ASP B CA  1 
ATOM   75   C C   . ASP A 1 10  ? 24.120 -9.360  -44.090 1.00 7.18   ? 137 ASP B C   1 
ATOM   76   O O   . ASP A 1 10  ? 23.495 -8.507  -43.434 1.00 7.36   ? 137 ASP B O   1 
ATOM   77   C CB  . ASP A 1 10  ? 22.518 -11.303 -44.300 1.00 7.34   ? 137 ASP B CB  1 
ATOM   78   C CG  . ASP A 1 10  ? 22.388 -11.438 -45.796 1.00 6.27   ? 137 ASP B CG  1 
ATOM   79   O OD1 . ASP A 1 10  ? 23.067 -10.710 -46.534 1.00 10.20  ? 137 ASP B OD1 1 
ATOM   80   O OD2 . ASP A 1 10  ? 21.573 -12.274 -46.243 1.00 7.57   ? 137 ASP B OD2 1 
ATOM   81   N N   . GLY A 1 11  ? 25.027 -9.050  -45.017 1.00 7.31   ? 138 GLY B N   1 
ATOM   82   C CA  . GLY A 1 11  ? 25.264 -7.685  -45.467 1.00 6.97   ? 138 GLY B CA  1 
ATOM   83   C C   . GLY A 1 11  ? 25.091 -7.557  -46.972 1.00 7.14   ? 138 GLY B C   1 
ATOM   84   O O   . GLY A 1 11  ? 25.673 -6.670  -47.599 1.00 7.24   ? 138 GLY B O   1 
ATOM   85   N N   . SER A 1 12  ? 24.300 -8.451  -47.558 1.00 7.45   ? 139 SER B N   1 
ATOM   86   C CA  . SER A 1 12  ? 24.074 -8.449  -49.004 1.00 7.91   ? 139 SER B CA  1 
ATOM   87   C C   . SER A 1 12  ? 23.395 -7.177  -49.537 1.00 8.39   ? 139 SER B C   1 
ATOM   88   O O   . SER A 1 12  ? 22.774 -6.417  -48.791 1.00 8.14   ? 139 SER B O   1 
ATOM   89   C CB  . SER A 1 12  ? 23.229 -9.658  -49.422 1.00 7.39   ? 139 SER B CB  1 
ATOM   90   O OG  . SER A 1 12  ? 21.962 -9.586  -48.819 1.00 7.74   ? 139 SER B OG  1 
ATOM   91   N N   . MET A 1 13  ? 23.508 -6.993  -50.850 1.00 9.16   ? 140 MET B N   1 
ATOM   92   C CA  . MET A 1 13  ? 22.901 -5.892  -51.605 1.00 11.41  ? 140 MET B CA  1 
ATOM   93   C C   . MET A 1 13  ? 21.379 -5.782  -51.430 1.00 10.06  ? 140 MET B C   1 
ATOM   94   O O   . MET A 1 13  ? 20.805 -4.693  -51.527 1.00 9.84   ? 140 MET B O   1 
ATOM   95   C CB  . MET A 1 13  ? 23.263 -6.086  -53.086 1.00 11.15  ? 140 MET B CB  1 
ATOM   96   C CG  . MET A 1 13  ? 22.623 -5.107  -54.083 1.00 14.18  ? 140 MET B CG  1 
ATOM   97   S SD  . MET A 1 13  ? 22.731 -5.672  -55.815 1.00 17.62  ? 140 MET B SD  1 
ATOM   98   C CE  . MET A 1 13  ? 22.369 -7.420  -55.660 1.00 17.32  ? 140 MET B CE  1 
ATOM   99   N N   . SER A 1 14  ? 20.719 -6.900  -51.158 1.00 9.56   ? 141 SER B N   1 
ATOM   100  C CA  . SER A 1 14  ? 19.253 -6.880  -51.023 1.00 9.59   ? 141 SER B CA  1 
ATOM   101  C C   . SER A 1 14  ? 18.738 -6.086  -49.826 1.00 9.01   ? 141 SER B C   1 
ATOM   102  O O   . SER A 1 14  ? 17.589 -5.623  -49.830 1.00 8.69   ? 141 SER B O   1 
ATOM   103  C CB  . SER A 1 14  ? 18.682 -8.300  -50.994 1.00 9.70   ? 141 SER B CB  1 
ATOM   104  O OG  . SER A 1 14  ? 18.962 -8.915  -49.766 1.00 11.64  ? 141 SER B OG  1 
ATOM   105  N N   . LEU A 1 15  ? 19.572 -5.935  -48.795 1.00 8.67   ? 142 LEU B N   1 
ATOM   106  C CA  . LEU A 1 15  ? 19.144 -5.242  -47.568 1.00 8.45   ? 142 LEU B CA  1 
ATOM   107  C C   . LEU A 1 15  ? 19.093 -3.737  -47.777 1.00 8.77   ? 142 LEU B C   1 
ATOM   108  O O   . LEU A 1 15  ? 20.071 -3.147  -48.218 1.00 9.04   ? 142 LEU B O   1 
ATOM   109  C CB  . LEU A 1 15  ? 20.092 -5.562  -46.408 1.00 7.92   ? 142 LEU B CB  1 
ATOM   110  C CG  . LEU A 1 15  ? 19.994 -7.008  -45.918 1.00 7.57   ? 142 LEU B CG  1 
ATOM   111  C CD1 . LEU A 1 15  ? 21.263 -7.441  -45.227 1.00 8.54   ? 142 LEU B CD1 1 
ATOM   112  C CD2 . LEU A 1 15  ? 18.782 -7.165  -45.010 1.00 8.48   ? 142 LEU B CD2 1 
ATOM   113  N N   . GLN A 1 16  ? 17.949 -3.134  -47.469 1.00 8.64   ? 143 GLN B N   1 
ATOM   114  C CA  . GLN A 1 16  ? 17.812 -1.677  -47.380 1.00 9.52   ? 143 GLN B CA  1 
ATOM   115  C C   . GLN A 1 16  ? 18.555 -1.146  -46.148 1.00 9.42   ? 143 GLN B C   1 
ATOM   116  O O   . GLN A 1 16  ? 18.695 -1.873  -45.175 1.00 9.98   ? 143 GLN B O   1 
ATOM   117  C CB  . GLN A 1 16  ? 16.326 -1.300  -47.269 1.00 9.41   ? 143 GLN B CB  1 
ATOM   118  C CG  . GLN A 1 16  ? 15.473 -1.701  -48.457 1.00 10.91  ? 143 GLN B CG  1 
ATOM   119  C CD  . GLN A 1 16  ? 15.829 -0.941  -49.730 1.00 14.21  ? 143 GLN B CD  1 
ATOM   120  O OE1 . GLN A 1 16  ? 16.367 0.166   -49.679 1.00 15.33  ? 143 GLN B OE1 1 
ATOM   121  N NE2 . GLN A 1 16  ? 15.523 -1.537  -50.881 1.00 14.92  ? 143 GLN B NE2 1 
ATOM   122  N N   . PRO A 1 17  ? 19.050 0.113   -46.182 1.00 9.83   ? 144 PRO B N   1 
ATOM   123  C CA  . PRO A 1 17  ? 19.784 0.601   -45.000 1.00 10.06  ? 144 PRO B CA  1 
ATOM   124  C C   . PRO A 1 17  ? 19.067 0.356   -43.668 1.00 10.04  ? 144 PRO B C   1 
ATOM   125  O O   . PRO A 1 17  ? 19.705 -0.055  -42.708 1.00 10.58  ? 144 PRO B O   1 
ATOM   126  C CB  . PRO A 1 17  ? 19.957 2.103   -45.281 1.00 9.86   ? 144 PRO B CB  1 
ATOM   127  C CG  . PRO A 1 17  ? 20.039 2.163   -46.803 1.00 9.90   ? 144 PRO B CG  1 
ATOM   128  C CD  . PRO A 1 17  ? 19.020 1.125   -47.261 1.00 9.62   ? 144 PRO B CD  1 
ATOM   129  N N   . ASP A 1 18  ? 17.760 0.580   -43.612 1.00 10.47  ? 145 ASP B N   1 
ATOM   130  C CA  . ASP A 1 18  ? 17.020 0.445   -42.349 1.00 11.00  ? 145 ASP B CA  1 
ATOM   131  C C   . ASP A 1 18  ? 16.869 -1.024  -41.923 1.00 10.28  ? 145 ASP B C   1 
ATOM   132  O O   . ASP A 1 18  ? 16.760 -1.326  -40.739 1.00 10.11  ? 145 ASP B O   1 
ATOM   133  C CB  . ASP A 1 18  ? 15.648 1.125   -42.445 1.00 11.38  ? 145 ASP B CB  1 
ATOM   134  C CG  . ASP A 1 18  ? 14.611 0.255   -43.121 1.00 15.61  ? 145 ASP B CG  1 
ATOM   135  O OD1 . ASP A 1 18  ? 14.694 0.038   -44.359 1.00 18.40  ? 145 ASP B OD1 1 
ATOM   136  O OD2 . ASP A 1 18  ? 13.708 -0.232  -42.401 1.00 20.59  ? 145 ASP B OD2 1 
ATOM   137  N N   . GLU A 1 19  ? 16.871 -1.925  -42.900 1.00 9.59   ? 146 GLU B N   1 
ATOM   138  C CA  . GLU A 1 19  ? 16.808 -3.366  -42.627 1.00 9.41   ? 146 GLU B CA  1 
ATOM   139  C C   . GLU A 1 19  ? 18.119 -3.847  -42.015 1.00 8.73   ? 146 GLU B C   1 
ATOM   140  O O   . GLU A 1 19  ? 18.122 -4.538  -40.999 1.00 8.96   ? 146 GLU B O   1 
ATOM   141  C CB  . GLU A 1 19  ? 16.463 -4.132  -43.910 1.00 9.08   ? 146 GLU B CB  1 
ATOM   142  C CG  . GLU A 1 19  ? 15.051 -3.864  -44.426 1.00 9.14   ? 146 GLU B CG  1 
ATOM   143  C CD  . GLU A 1 19  ? 14.796 -4.429  -45.829 1.00 9.85   ? 146 GLU B CD  1 
ATOM   144  O OE1 . GLU A 1 19  ? 15.758 -4.836  -46.518 1.00 9.14   ? 146 GLU B OE1 1 
ATOM   145  O OE2 . GLU A 1 19  ? 13.615 -4.465  -46.245 1.00 10.42  ? 146 GLU B OE2 1 
ATOM   146  N N   . PHE A 1 20  ? 19.233 -3.455  -42.619 1.00 8.86   ? 147 PHE B N   1 
ATOM   147  C CA  . PHE A 1 20  ? 20.567 -3.734  -42.074 1.00 8.74   ? 147 PHE B CA  1 
ATOM   148  C C   . PHE A 1 20  ? 20.691 -3.201  -40.636 1.00 9.07   ? 147 PHE B C   1 
ATOM   149  O O   . PHE A 1 20  ? 21.120 -3.922  -39.732 1.00 9.18   ? 147 PHE B O   1 
ATOM   150  C CB  . PHE A 1 20  ? 21.640 -3.122  -42.988 1.00 8.82   ? 147 PHE B CB  1 
ATOM   151  C CG  . PHE A 1 20  ? 23.053 -3.545  -42.666 1.00 8.48   ? 147 PHE B CG  1 
ATOM   152  C CD1 . PHE A 1 20  ? 23.445 -4.876  -42.788 1.00 7.68   ? 147 PHE B CD1 1 
ATOM   153  C CD2 . PHE A 1 20  ? 23.996 -2.603  -42.277 1.00 9.78   ? 147 PHE B CD2 1 
ATOM   154  C CE1 . PHE A 1 20  ? 24.743 -5.268  -42.502 1.00 7.71   ? 147 PHE B CE1 1 
ATOM   155  C CE2 . PHE A 1 20  ? 25.307 -2.985  -41.988 1.00 8.66   ? 147 PHE B CE2 1 
ATOM   156  C CZ  . PHE A 1 20  ? 25.679 -4.319  -42.109 1.00 7.77   ? 147 PHE B CZ  1 
ATOM   157  N N   . GLN A 1 21  ? 20.282 -1.952  -40.436 1.00 9.30   ? 148 GLN B N   1 
ATOM   158  C CA  . GLN A 1 21  ? 20.264 -1.326  -39.113 1.00 9.13   ? 148 GLN B CA  1 
ATOM   159  C C   . GLN A 1 21  ? 19.445 -2.105  -38.074 1.00 8.62   ? 148 GLN B C   1 
ATOM   160  O O   . GLN A 1 21  ? 19.867 -2.237  -36.922 1.00 8.58   ? 148 GLN B O   1 
ATOM   161  C CB  . GLN A 1 21  ? 19.722 0.103   -39.204 1.00 9.54   ? 148 GLN B CB  1 
ATOM   162  C CG  . GLN A 1 21  ? 19.939 0.888   -37.920 1.00 9.57   ? 148 GLN B CG  1 
ATOM   163  C CD  . GLN A 1 21  ? 21.409 1.077   -37.617 1.00 9.57   ? 148 GLN B CD  1 
ATOM   164  O OE1 . GLN A 1 21  ? 22.161 1.536   -38.463 1.00 10.10  ? 148 GLN B OE1 1 
ATOM   165  N NE2 . GLN A 1 21  ? 21.828 0.705   -36.416 1.00 10.71  ? 148 GLN B NE2 1 
ATOM   166  N N   . LYS A 1 22  ? 18.278 -2.614  -38.481 1.00 7.92   ? 149 LYS B N   1 
ATOM   167  C CA  . LYS A 1 22  ? 17.424 -3.418  -37.585 1.00 7.51   ? 149 LYS B CA  1 
ATOM   168  C C   . LYS A 1 22  ? 18.129 -4.717  -37.139 1.00 6.70   ? 149 LYS B C   1 
ATOM   169  O O   . LYS A 1 22  ? 17.969 -5.172  -35.990 1.00 6.28   ? 149 LYS B O   1 
ATOM   170  C CB  . LYS A 1 22  ? 16.047 -3.667  -38.224 1.00 7.46   ? 149 LYS B CB  1 
ATOM   171  C CG  . LYS A 1 22  ? 15.130 -2.429  -38.156 1.00 8.38   ? 149 LYS B CG  1 
ATOM   172  C CD  . LYS A 1 22  ? 13.898 -2.525  -39.063 1.00 8.94   ? 149 LYS B CD  1 
ATOM   173  C CE  . LYS A 1 22  ? 13.154 -1.197  -39.060 1.00 14.22  ? 149 LYS B CE  1 
ATOM   174  N NZ  . LYS A 1 22  ? 12.488 -0.913  -40.366 1.00 18.62  ? 149 LYS B NZ  1 
ATOM   175  N N   . ILE A 1 23  ? 18.946 -5.285  -38.026 1.00 6.27   ? 150 ILE B N   1 
ATOM   176  C CA  . ILE A 1 23  ? 19.794 -6.427  -37.656 1.00 5.69   ? 150 ILE B CA  1 
ATOM   177  C C   . ILE A 1 23  ? 20.802 -6.020  -36.570 1.00 6.36   ? 150 ILE B C   1 
ATOM   178  O O   . ILE A 1 23  ? 20.880 -6.657  -35.499 1.00 5.90   ? 150 ILE B O   1 
ATOM   179  C CB  . ILE A 1 23  ? 20.531 -7.075  -38.877 1.00 6.16   ? 150 ILE B CB  1 
ATOM   180  C CG1 . ILE A 1 23  ? 19.514 -7.566  -39.927 1.00 5.91   ? 150 ILE B CG1 1 
ATOM   181  C CG2 . ILE A 1 23  ? 21.421 -8.223  -38.385 1.00 5.04   ? 150 ILE B CG2 1 
ATOM   182  C CD1 . ILE A 1 23  ? 20.117 -8.078  -41.257 1.00 5.43   ? 150 ILE B CD1 1 
ATOM   183  N N   . LEU A 1 24  ? 21.564 -4.958  -36.851 1.00 6.44   ? 151 LEU B N   1 
ATOM   184  C CA  . LEU A 1 24  ? 22.495 -4.385  -35.890 1.00 6.68   ? 151 LEU B CA  1 
ATOM   185  C C   . LEU A 1 24  ? 21.833 -4.134  -34.543 1.00 7.13   ? 151 LEU B C   1 
ATOM   186  O O   . LEU A 1 24  ? 22.386 -4.474  -33.510 1.00 7.36   ? 151 LEU B O   1 
ATOM   187  C CB  . LEU A 1 24  ? 23.100 -3.076  -36.439 1.00 7.27   ? 151 LEU B CB  1 
ATOM   188  C CG  . LEU A 1 24  ? 23.866 -3.158  -37.772 1.00 7.31   ? 151 LEU B CG  1 
ATOM   189  C CD1 . LEU A 1 24  ? 24.533 -1.805  -38.134 1.00 9.09   ? 151 LEU B CD1 1 
ATOM   190  C CD2 . LEU A 1 24  ? 24.909 -4.243  -37.710 1.00 9.76   ? 151 LEU B CD2 1 
ATOM   191  N N   . ASP A 1 25  ? 20.645 -3.541  -34.550 1.00 7.47   ? 152 ASP B N   1 
ATOM   192  C CA  . ASP A 1 25  ? 19.991 -3.197  -33.293 1.00 7.93   ? 152 ASP B CA  1 
ATOM   193  C C   . ASP A 1 25  ? 19.507 -4.445  -32.567 1.00 7.58   ? 152 ASP B C   1 
ATOM   194  O O   . ASP A 1 25  ? 19.606 -4.519  -31.347 1.00 7.96   ? 152 ASP B O   1 
ATOM   195  C CB  . ASP A 1 25  ? 18.879 -2.172  -33.502 1.00 8.05   ? 152 ASP B CB  1 
ATOM   196  C CG  . ASP A 1 25  ? 19.415 -0.779  -33.849 1.00 10.81  ? 152 ASP B CG  1 
ATOM   197  O OD1 . ASP A 1 25  ? 20.585 -0.457  -33.564 1.00 13.57  ? 152 ASP B OD1 1 
ATOM   198  O OD2 . ASP A 1 25  ? 18.647 0.016   -34.418 1.00 16.05  ? 152 ASP B OD2 1 
ATOM   199  N N   . PHE A 1 26  ? 19.048 -5.444  -33.318 1.00 7.27   ? 153 PHE B N   1 
ATOM   200  C CA  . PHE A 1 26  ? 18.694 -6.745  -32.730 1.00 8.00   ? 153 PHE B CA  1 
ATOM   201  C C   . PHE A 1 26  ? 19.877 -7.376  -31.977 1.00 8.34   ? 153 PHE B C   1 
ATOM   202  O O   . PHE A 1 26  ? 19.722 -7.877  -30.850 1.00 9.18   ? 153 PHE B O   1 
ATOM   203  C CB  . PHE A 1 26  ? 18.138 -7.717  -33.789 1.00 7.42   ? 153 PHE B CB  1 
ATOM   204  C CG  . PHE A 1 26  ? 17.787 -9.085  -33.240 1.00 7.65   ? 153 PHE B CG  1 
ATOM   205  C CD1 . PHE A 1 26  ? 16.609 -9.279  -32.521 1.00 7.01   ? 153 PHE B CD1 1 
ATOM   206  C CD2 . PHE A 1 26  ? 18.632 -10.175 -33.448 1.00 7.43   ? 153 PHE B CD2 1 
ATOM   207  C CE1 . PHE A 1 26  ? 16.285 -10.540 -32.002 1.00 7.69   ? 153 PHE B CE1 1 
ATOM   208  C CE2 . PHE A 1 26  ? 18.319 -11.438 -32.944 1.00 7.78   ? 153 PHE B CE2 1 
ATOM   209  C CZ  . PHE A 1 26  ? 17.133 -11.615 -32.212 1.00 7.23   ? 153 PHE B CZ  1 
ATOM   210  N N   . MET A 1 27  ? 21.057 -7.348  -32.589 1.00 8.16   ? 154 MET B N   1 
ATOM   211  C CA  . MET A 1 27  ? 22.229 -7.949  -31.969 1.00 8.96   ? 154 MET B CA  1 
ATOM   212  C C   . MET A 1 27  ? 22.572 -7.248  -30.654 1.00 8.78   ? 154 MET B C   1 
ATOM   213  O O   . MET A 1 27  ? 22.882 -7.898  -29.669 1.00 8.20   ? 154 MET B O   1 
ATOM   214  C CB  . MET A 1 27  ? 23.407 -7.946  -32.936 1.00 8.85   ? 154 MET B CB  1 
ATOM   215  C CG  . MET A 1 27  ? 23.145 -8.845  -34.148 1.00 9.41   ? 154 MET B CG  1 
ATOM   216  S SD  . MET A 1 27  ? 24.543 -8.989  -35.272 1.00 11.36  ? 154 MET B SD  1 
ATOM   217  C CE  . MET A 1 27  ? 24.770 -7.330  -35.873 1.00 11.26  ? 154 MET B CE  1 
ATOM   218  N N   . LYS A 1 28  ? 22.448 -5.923  -30.644 1.00 8.69   ? 155 LYS B N   1 
ATOM   219  C CA  . LYS A 1 28  ? 22.766 -5.126  -29.475 1.00 9.04   ? 155 LYS B CA  1 
ATOM   220  C C   . LYS A 1 28  ? 21.771 -5.359  -28.358 1.00 9.29   ? 155 LYS B C   1 
ATOM   221  O O   . LYS A 1 28  ? 22.181 -5.515  -27.217 1.00 9.68   ? 155 LYS B O   1 
ATOM   222  C CB  . LYS A 1 28  ? 22.846 -3.644  -29.834 1.00 9.56   ? 155 LYS B CB  1 
ATOM   223  C CG  . LYS A 1 28  ? 23.901 -3.349  -30.879 1.00 9.84   ? 155 LYS B CG  1 
ATOM   224  C CD  . LYS A 1 28  ? 24.203 -1.867  -30.959 1.00 14.94  ? 155 LYS B CD  1 
ATOM   225  C CE  . LYS A 1 28  ? 23.031 -1.100  -31.508 1.00 16.46  ? 155 LYS B CE  1 
ATOM   226  N NZ  . LYS A 1 28  ? 23.437 0.261   -31.964 1.00 20.24  ? 155 LYS B NZ  1 
ATOM   227  N N   . ASP A 1 29  ? 20.479 -5.404  -28.693 1.00 9.39   ? 156 ASP B N   1 
ATOM   228  C CA  . ASP A 1 29  ? 19.428 -5.735  -27.725 1.00 9.58   ? 156 ASP B CA  1 
ATOM   229  C C   . ASP A 1 29  ? 19.732 -7.054  -26.999 1.00 8.78   ? 156 ASP B C   1 
ATOM   230  O O   . ASP A 1 29  ? 19.665 -7.120  -25.776 1.00 9.06   ? 156 ASP B O   1 
ATOM   231  C CB  . ASP A 1 29  ? 18.054 -5.819  -28.401 1.00 9.67   ? 156 ASP B CB  1 
ATOM   232  C CG  . ASP A 1 29  ? 17.533 -4.476  -28.861 1.00 12.40  ? 156 ASP B CG  1 
ATOM   233  O OD1 . ASP A 1 29  ? 16.547 -4.476  -29.633 1.00 14.91  ? 156 ASP B OD1 1 
ATOM   234  O OD2 . ASP A 1 29  ? 18.105 -3.433  -28.478 1.00 12.50  ? 156 ASP B OD2 1 
ATOM   235  N N   . VAL A 1 30  ? 20.078 -8.090  -27.762 1.00 8.16   ? 157 VAL B N   1 
ATOM   236  C CA  . VAL A 1 30  ? 20.455 -9.390  -27.183 1.00 7.44   ? 157 VAL B CA  1 
ATOM   237  C C   . VAL A 1 30  ? 21.667 -9.300  -26.245 1.00 7.64   ? 157 VAL B C   1 
ATOM   238  O O   . VAL A 1 30  ? 21.628 -9.816  -25.127 1.00 6.86   ? 157 VAL B O   1 
ATOM   239  C CB  . VAL A 1 30  ? 20.685 -10.464 -28.274 1.00 7.44   ? 157 VAL B CB  1 
ATOM   240  C CG1 . VAL A 1 30  ? 21.279 -11.767 -27.676 1.00 7.27   ? 157 VAL B CG1 1 
ATOM   241  C CG2 . VAL A 1 30  ? 19.391 -10.756 -28.980 1.00 5.91   ? 157 VAL B CG2 1 
ATOM   242  N N   . MET A 1 31  ? 22.735 -8.639  -26.696 1.00 7.33   ? 158 MET B N   1 
ATOM   243  C CA  . MET A 1 31  ? 23.968 -8.583  -25.919 1.00 7.97   ? 158 MET B CA  1 
ATOM   244  C C   . MET A 1 31  ? 23.795 -7.772  -24.638 1.00 7.39   ? 158 MET B C   1 
ATOM   245  O O   . MET A 1 31  ? 24.327 -8.132  -23.589 1.00 7.27   ? 158 MET B O   1 
ATOM   246  C CB  . MET A 1 31  ? 25.122 -8.042  -26.763 1.00 7.50   ? 158 MET B CB  1 
ATOM   247  C CG  . MET A 1 31  ? 25.536 -9.006  -27.890 1.00 8.63   ? 158 MET B CG  1 
ATOM   248  S SD  . MET A 1 31  ? 26.995 -8.425  -28.759 1.00 10.84  ? 158 MET B SD  1 
ATOM   249  C CE  . MET A 1 31  ? 26.279 -7.339  -29.987 1.00 10.97  ? 158 MET B CE  1 
ATOM   250  N N   . LYS A 1 32  ? 23.043 -6.683  -24.724 1.00 7.18   ? 159 LYS B N   1 
ATOM   251  C CA  . LYS A 1 32  ? 22.748 -5.872  -23.542 1.00 7.30   ? 159 LYS B CA  1 
ATOM   252  C C   . LYS A 1 32  ? 22.002 -6.676  -22.469 1.00 7.24   ? 159 LYS B C   1 
ATOM   253  O O   . LYS A 1 32  ? 22.303 -6.557  -21.273 1.00 7.02   ? 159 LYS B O   1 
ATOM   254  C CB  . LYS A 1 32  ? 21.947 -4.642  -23.936 1.00 7.39   ? 159 LYS B CB  1 
ATOM   255  C CG  . LYS A 1 32  ? 22.784 -3.608  -24.655 1.00 9.52   ? 159 LYS B CG  1 
ATOM   256  C CD  . LYS A 1 32  ? 21.922 -2.471  -25.151 1.00 13.79  ? 159 LYS B CD  1 
ATOM   257  C CE  . LYS A 1 32  ? 22.695 -1.610  -26.136 1.00 17.04  ? 159 LYS B CE  1 
ATOM   258  N NZ  . LYS A 1 32  ? 21.816 -0.545  -26.687 1.00 19.39  ? 159 LYS B NZ  1 
ATOM   259  N N   . LYS A 1 33  ? 21.047 -7.496  -22.905 1.00 7.09   ? 160 LYS B N   1 
ATOM   260  C CA  . LYS A 1 33  ? 20.224 -8.285  -21.986 1.00 7.62   ? 160 LYS B CA  1 
ATOM   261  C C   . LYS A 1 33  ? 21.068 -9.353  -21.297 1.00 7.41   ? 160 LYS B C   1 
ATOM   262  O O   . LYS A 1 33  ? 20.843 -9.667  -20.130 1.00 7.67   ? 160 LYS B O   1 
ATOM   263  C CB  . LYS A 1 33  ? 19.032 -8.915  -22.730 1.00 7.67   ? 160 LYS B CB  1 
ATOM   264  C CG  . LYS A 1 33  ? 17.966 -9.559  -21.837 1.00 7.82   ? 160 LYS B CG  1 
ATOM   265  C CD  . LYS A 1 33  ? 17.346 -8.549  -20.897 1.00 9.67   ? 160 LYS B CD  1 
ATOM   266  C CE  . LYS A 1 33  ? 16.292 -9.176  -19.999 1.00 8.72   ? 160 LYS B CE  1 
ATOM   267  N NZ  . LYS A 1 33  ? 15.774 -8.145  -19.052 1.00 8.81   ? 160 LYS B NZ  1 
ATOM   268  N N   . LEU A 1 34  ? 22.041 -9.895  -22.031 1.00 7.70   ? 161 LEU B N   1 
ATOM   269  C CA  . LEU A 1 34  ? 22.929 -10.938 -21.521 1.00 7.81   ? 161 LEU B CA  1 
ATOM   270  C C   . LEU A 1 34  ? 24.293 -10.408 -21.037 1.00 8.03   ? 161 LEU B C   1 
ATOM   271  O O   . LEU A 1 34  ? 25.302 -11.143 -21.031 1.00 8.53   ? 161 LEU B O   1 
ATOM   272  C CB  . LEU A 1 34  ? 23.098 -12.043 -22.573 1.00 7.91   ? 161 LEU B CB  1 
ATOM   273  C CG  . LEU A 1 34  ? 21.829 -12.812 -22.943 1.00 8.34   ? 161 LEU B CG  1 
ATOM   274  C CD1 . LEU A 1 34  ? 22.019 -13.646 -24.217 1.00 9.74   ? 161 LEU B CD1 1 
ATOM   275  C CD2 . LEU A 1 34  ? 21.324 -13.661 -21.785 1.00 8.75   ? 161 LEU B CD2 1 
ATOM   276  N N   . SER A 1 35  ? 24.315 -9.140  -20.627 1.00 7.67   ? 162 SER B N   1 
ATOM   277  C CA  . SER A 1 35  ? 25.521 -8.549  -20.064 1.00 7.74   ? 162 SER B CA  1 
ATOM   278  C C   . SER A 1 35  ? 25.842 -9.244  -18.753 1.00 7.89   ? 162 SER B C   1 
ATOM   279  O O   . SER A 1 35  ? 24.941 -9.731  -18.067 1.00 8.08   ? 162 SER B O   1 
ATOM   280  C CB  . SER A 1 35  ? 25.359 -7.040  -19.844 1.00 7.33   ? 162 SER B CB  1 
ATOM   281  O OG  . SER A 1 35  ? 24.441 -6.756  -18.797 1.00 7.05   ? 162 SER B OG  1 
ATOM   282  N N   . ASN A 1 36  ? 27.132 -9.331  -18.432 1.00 8.20   ? 163 ASN B N   1 
ATOM   283  C CA  . ASN A 1 36  ? 27.586 -9.859  -17.131 1.00 8.26   ? 163 ASN B CA  1 
ATOM   284  C C   . ASN A 1 36  ? 27.181 -11.307 -16.852 1.00 7.84   ? 163 ASN B C   1 
ATOM   285  O O   . ASN A 1 36  ? 27.014 -11.721 -15.694 1.00 7.38   ? 163 ASN B O   1 
ATOM   286  C CB  . ASN A 1 36  ? 27.122 -8.920  -15.995 1.00 8.76   ? 163 ASN B CB  1 
ATOM   287  C CG  . ASN A 1 36  ? 27.539 -7.483  -16.233 1.00 9.53   ? 163 ASN B CG  1 
ATOM   288  O OD1 . ASN A 1 36  ? 28.676 -7.218  -16.625 1.00 10.85  ? 163 ASN B OD1 1 
ATOM   289  N ND2 . ASN A 1 36  ? 26.621 -6.547  -16.004 1.00 11.26  ? 163 ASN B ND2 1 
ATOM   290  N N   . THR A 1 37  ? 27.042 -12.085 -17.918 1.00 7.18   ? 164 THR B N   1 
ATOM   291  C CA  . THR A 1 37  ? 26.687 -13.492 -17.790 1.00 7.01   ? 164 THR B CA  1 
ATOM   292  C C   . THR A 1 37  ? 27.844 -14.392 -18.236 1.00 7.22   ? 164 THR B C   1 
ATOM   293  O O   . THR A 1 37  ? 28.987 -13.924 -18.367 1.00 7.57   ? 164 THR B O   1 
ATOM   294  C CB  . THR A 1 37  ? 25.397 -13.823 -18.561 1.00 7.03   ? 164 THR B CB  1 
ATOM   295  O OG1 . THR A 1 37  ? 25.638 -13.723 -19.970 1.00 7.49   ? 164 THR B OG1 1 
ATOM   296  C CG2 . THR A 1 37  ? 24.255 -12.875 -18.162 1.00 5.64   ? 164 THR B CG2 1 
ATOM   297  N N   . SER A 1 38  ? 27.565 -15.671 -18.468 1.00 7.38   ? 165 SER B N   1 
ATOM   298  C CA  . SER A 1 38  ? 28.609 -16.582 -18.980 1.00 8.51   ? 165 SER B CA  1 
ATOM   299  C C   . SER A 1 38  ? 28.754 -16.540 -20.503 1.00 7.77   ? 165 SER B C   1 
ATOM   300  O O   . SER A 1 38  ? 29.572 -17.262 -21.067 1.00 7.36   ? 165 SER B O   1 
ATOM   301  C CB  . SER A 1 38  ? 28.385 -18.024 -18.513 1.00 8.51   ? 165 SER B CB  1 
ATOM   302  O OG  . SER A 1 38  ? 28.350 -18.053 -17.102 1.00 11.21  ? 165 SER B OG  1 
ATOM   303  N N   . TYR A 1 39  ? 27.946 -15.697 -21.139 1.00 7.54   ? 166 TYR B N   1 
ATOM   304  C CA  . TYR A 1 39  ? 28.033 -15.416 -22.571 1.00 7.73   ? 166 TYR B CA  1 
ATOM   305  C C   . TYR A 1 39  ? 29.151 -14.428 -22.888 1.00 8.00   ? 166 TYR B C   1 
ATOM   306  O O   . TYR A 1 39  ? 29.333 -13.415 -22.191 1.00 7.84   ? 166 TYR B O   1 
ATOM   307  C CB  . TYR A 1 39  ? 26.717 -14.829 -23.085 1.00 7.27   ? 166 TYR B CB  1 
ATOM   308  C CG  . TYR A 1 39  ? 25.580 -15.816 -23.152 1.00 7.32   ? 166 TYR B CG  1 
ATOM   309  C CD1 . TYR A 1 39  ? 24.870 -16.160 -22.007 1.00 5.62   ? 166 TYR B CD1 1 
ATOM   310  C CD2 . TYR A 1 39  ? 25.219 -16.414 -24.358 1.00 6.64   ? 166 TYR B CD2 1 
ATOM   311  C CE1 . TYR A 1 39  ? 23.822 -17.048 -22.051 1.00 7.27   ? 166 TYR B CE1 1 
ATOM   312  C CE2 . TYR A 1 39  ? 24.152 -17.315 -24.415 1.00 8.06   ? 166 TYR B CE2 1 
ATOM   313  C CZ  . TYR A 1 39  ? 23.472 -17.637 -23.242 1.00 7.45   ? 166 TYR B CZ  1 
ATOM   314  O OH  . TYR A 1 39  ? 22.424 -18.525 -23.259 1.00 6.91   ? 166 TYR B OH  1 
ATOM   315  N N   . GLN A 1 40  ? 29.893 -14.737 -23.948 1.00 8.23   ? 167 GLN B N   1 
ATOM   316  C CA  . GLN A 1 40  ? 30.795 -13.785 -24.572 1.00 8.58   ? 167 GLN B CA  1 
ATOM   317  C C   . GLN A 1 40  ? 30.559 -13.842 -26.082 1.00 8.36   ? 167 GLN B C   1 
ATOM   318  O O   . GLN A 1 40  ? 30.223 -14.894 -26.626 1.00 8.55   ? 167 GLN B O   1 
ATOM   319  C CB  . GLN A 1 40  ? 32.244 -14.051 -24.152 1.00 8.79   ? 167 GLN B CB  1 
ATOM   320  C CG  . GLN A 1 40  ? 32.442 -13.748 -22.642 1.00 8.66   ? 167 GLN B CG  1 
ATOM   321  C CD  . GLN A 1 40  ? 33.818 -14.053 -22.091 1.00 10.15  ? 167 GLN B CD  1 
ATOM   322  O OE1 . GLN A 1 40  ? 34.696 -14.589 -22.776 1.00 13.28  ? 167 GLN B OE1 1 
ATOM   323  N NE2 . GLN A 1 40  ? 34.022 -13.690 -20.835 1.00 10.69  ? 167 GLN B NE2 1 
ATOM   324  N N   . PHE A 1 41  ? 30.669 -12.690 -26.732 1.00 8.61   ? 168 PHE B N   1 
ATOM   325  C CA  . PHE A 1 41  ? 30.139 -12.512 -28.088 1.00 8.88   ? 168 PHE B CA  1 
ATOM   326  C C   . PHE A 1 41  ? 31.187 -12.083 -29.099 1.00 8.46   ? 168 PHE B C   1 
ATOM   327  O O   . PHE A 1 41  ? 32.197 -11.486 -28.747 1.00 8.91   ? 168 PHE B O   1 
ATOM   328  C CB  . PHE A 1 41  ? 29.023 -11.460 -28.083 1.00 8.80   ? 168 PHE B CB  1 
ATOM   329  C CG  . PHE A 1 41  ? 27.891 -11.766 -27.134 1.00 9.42   ? 168 PHE B CG  1 
ATOM   330  C CD1 . PHE A 1 41  ? 27.877 -11.225 -25.849 1.00 9.17   ? 168 PHE B CD1 1 
ATOM   331  C CD2 . PHE A 1 41  ? 26.842 -12.585 -27.522 1.00 11.28  ? 168 PHE B CD2 1 
ATOM   332  C CE1 . PHE A 1 41  ? 26.833 -11.500 -24.972 1.00 9.26   ? 168 PHE B CE1 1 
ATOM   333  C CE2 . PHE A 1 41  ? 25.787 -12.865 -26.639 1.00 11.90  ? 168 PHE B CE2 1 
ATOM   334  C CZ  . PHE A 1 41  ? 25.792 -12.319 -25.368 1.00 8.63   ? 168 PHE B CZ  1 
ATOM   335  N N   . ALA A 1 42  ? 30.914 -12.390 -30.362 1.00 8.38   ? 169 ALA B N   1 
ATOM   336  C CA  . ALA A 1 42  ? 31.660 -11.874 -31.508 1.00 8.13   ? 169 ALA B CA  1 
ATOM   337  C C   . ALA A 1 42  ? 30.662 -11.721 -32.642 1.00 7.73   ? 169 ALA B C   1 
ATOM   338  O O   . ALA A 1 42  ? 29.615 -12.359 -32.638 1.00 7.23   ? 169 ALA B O   1 
ATOM   339  C CB  . ALA A 1 42  ? 32.783 -12.836 -31.914 1.00 8.45   ? 169 ALA B CB  1 
ATOM   340  N N   . ALA A 1 43  ? 30.969 -10.854 -33.597 1.00 7.39   ? 170 ALA B N   1 
ATOM   341  C CA  . ALA A 1 43  ? 30.030 -10.568 -34.682 1.00 7.64   ? 170 ALA B CA  1 
ATOM   342  C C   . ALA A 1 43  ? 30.765 -10.493 -35.997 1.00 7.50   ? 170 ALA B C   1 
ATOM   343  O O   . ALA A 1 43  ? 31.797 -9.805  -36.107 1.00 7.55   ? 170 ALA B O   1 
ATOM   344  C CB  . ALA A 1 43  ? 29.275 -9.261  -34.429 1.00 7.25   ? 170 ALA B CB  1 
ATOM   345  N N   . VAL A 1 44  ? 30.216 -11.199 -36.987 1.00 7.02   ? 171 VAL B N   1 
ATOM   346  C CA  . VAL A 1 44  ? 30.840 -11.365 -38.291 1.00 6.99   ? 171 VAL B CA  1 
ATOM   347  C C   . VAL A 1 44  ? 29.831 -10.957 -39.347 1.00 7.39   ? 171 VAL B C   1 
ATOM   348  O O   . VAL A 1 44  ? 28.729 -11.535 -39.417 1.00 7.67   ? 171 VAL B O   1 
ATOM   349  C CB  . VAL A 1 44  ? 31.276 -12.854 -38.509 1.00 7.28   ? 171 VAL B CB  1 
ATOM   350  C CG1 . VAL A 1 44  ? 31.971 -13.062 -39.865 1.00 7.32   ? 171 VAL B CG1 1 
ATOM   351  C CG2 . VAL A 1 44  ? 32.181 -13.338 -37.366 1.00 6.18   ? 171 VAL B CG2 1 
ATOM   352  N N   . GLN A 1 45  ? 30.183 -9.955  -40.155 1.00 6.85   ? 172 GLN B N   1 
ATOM   353  C CA  . GLN A 1 45  ? 29.354 -9.613  -41.305 1.00 6.55   ? 172 GLN B CA  1 
ATOM   354  C C   . GLN A 1 45  ? 29.750 -10.513 -42.468 1.00 6.81   ? 172 GLN B C   1 
ATOM   355  O O   . GLN A 1 45  ? 30.948 -10.724 -42.740 1.00 6.52   ? 172 GLN B O   1 
ATOM   356  C CB  . GLN A 1 45  ? 29.489 -8.140  -41.706 1.00 6.58   ? 172 GLN B CB  1 
ATOM   357  C CG  . GLN A 1 45  ? 28.403 -7.665  -42.700 1.00 5.70   ? 172 GLN B CG  1 
ATOM   358  C CD  . GLN A 1 45  ? 28.678 -6.281  -43.303 1.00 6.20   ? 172 GLN B CD  1 
ATOM   359  O OE1 . GLN A 1 45  ? 29.492 -5.509  -42.800 1.00 8.71   ? 172 GLN B OE1 1 
ATOM   360  N NE2 . GLN A 1 45  ? 27.970 -5.959  -44.369 1.00 3.88   ? 172 GLN B NE2 1 
ATOM   361  N N   . PHE A 1 46  ? 28.760 -11.058 -43.163 1.00 6.42   ? 173 PHE B N   1 
ATOM   362  C CA  . PHE A 1 46  ? 29.091 -11.771 -44.396 1.00 6.42   ? 173 PHE B CA  1 
ATOM   363  C C   . PHE A 1 46  ? 28.307 -11.259 -45.576 1.00 6.57   ? 173 PHE B C   1 
ATOM   364  O O   . PHE A 1 46  ? 27.146 -10.890 -45.451 1.00 6.65   ? 173 PHE B O   1 
ATOM   365  C CB  . PHE A 1 46  ? 28.935 -13.286 -44.254 1.00 6.30   ? 173 PHE B CB  1 
ATOM   366  C CG  . PHE A 1 46  ? 27.504 -13.770 -44.246 1.00 7.21   ? 173 PHE B CG  1 
ATOM   367  C CD1 . PHE A 1 46  ? 26.744 -13.719 -43.086 1.00 4.82   ? 173 PHE B CD1 1 
ATOM   368  C CD2 . PHE A 1 46  ? 26.930 -14.309 -45.405 1.00 6.96   ? 173 PHE B CD2 1 
ATOM   369  C CE1 . PHE A 1 46  ? 25.426 -14.190 -43.062 1.00 8.79   ? 173 PHE B CE1 1 
ATOM   370  C CE2 . PHE A 1 46  ? 25.599 -14.791 -45.394 1.00 9.27   ? 173 PHE B CE2 1 
ATOM   371  C CZ  . PHE A 1 46  ? 24.846 -14.727 -44.228 1.00 7.57   ? 173 PHE B CZ  1 
ATOM   372  N N   . SER A 1 47  ? 28.958 -11.262 -46.726 1.00 7.06   ? 174 SER B N   1 
ATOM   373  C CA  . SER A 1 47  ? 28.293 -10.976 -47.975 1.00 7.75   ? 174 SER B CA  1 
ATOM   374  C C   . SER A 1 47  ? 28.984 -11.822 -49.054 1.00 8.42   ? 174 SER B C   1 
ATOM   375  O O   . SER A 1 47  ? 28.797 -13.046 -49.094 1.00 8.25   ? 174 SER B O   1 
ATOM   376  C CB  . SER A 1 47  ? 28.326 -9.475  -48.236 1.00 7.77   ? 174 SER B CB  1 
ATOM   377  O OG  . SER A 1 47  ? 27.477 -9.116  -49.293 1.00 8.91   ? 174 SER B OG  1 
ATOM   378  N N   . THR A 1 48  ? 29.786 -11.200 -49.908 1.00 8.71   ? 175 THR B N   1 
ATOM   379  C CA  . THR A 1 48  ? 30.684 -11.958 -50.784 1.00 9.72   ? 175 THR B CA  1 
ATOM   380  C C   . THR A 1 48  ? 31.884 -12.429 -49.949 1.00 9.94   ? 175 THR B C   1 
ATOM   381  O O   . THR A 1 48  ? 32.276 -13.593 -50.005 1.00 9.93   ? 175 THR B O   1 
ATOM   382  C CB  . THR A 1 48  ? 31.126 -11.107 -51.994 1.00 9.65   ? 175 THR B CB  1 
ATOM   383  O OG1 . THR A 1 48  ? 30.005 -10.943 -52.873 1.00 10.48  ? 175 THR B OG1 1 
ATOM   384  C CG2 . THR A 1 48  ? 32.279 -11.762 -52.766 1.00 9.26   ? 175 THR B CG2 1 
ATOM   385  N N   . SER A 1 49  ? 32.405 -11.505 -49.149 1.00 10.24  ? 176 SER B N   1 
ATOM   386  C CA  . SER A 1 49  ? 33.514 -11.720 -48.230 1.00 11.27  ? 176 SER B CA  1 
ATOM   387  C C   . SER A 1 49  ? 33.015 -11.676 -46.777 1.00 10.96  ? 176 SER B C   1 
ATOM   388  O O   . SER A 1 49  ? 31.836 -11.415 -46.511 1.00 9.98   ? 176 SER B O   1 
ATOM   389  C CB  . SER A 1 49  ? 34.580 -10.636 -48.478 1.00 11.69  ? 176 SER B CB  1 
ATOM   390  O OG  . SER A 1 49  ? 35.636 -10.687 -47.531 1.00 15.39  ? 176 SER B OG  1 
ATOM   391  N N   . TYR A 1 50  ? 33.931 -11.928 -45.846 1.00 11.10  ? 177 TYR B N   1 
ATOM   392  C CA  . TYR A 1 50  ? 33.623 -12.085 -44.426 1.00 11.83  ? 177 TYR B CA  1 
ATOM   393  C C   . TYR A 1 50  ? 34.470 -11.123 -43.602 1.00 12.01  ? 177 TYR B C   1 
ATOM   394  O O   . TYR A 1 50  ? 35.660 -10.938 -43.890 1.00 12.46  ? 177 TYR B O   1 
ATOM   395  C CB  . TYR A 1 50  ? 33.883 -13.536 -44.014 1.00 12.34  ? 177 TYR B CB  1 
ATOM   396  C CG  . TYR A 1 50  ? 33.557 -14.499 -45.133 1.00 13.01  ? 177 TYR B CG  1 
ATOM   397  C CD1 . TYR A 1 50  ? 34.567 -15.165 -45.831 1.00 13.74  ? 177 TYR B CD1 1 
ATOM   398  C CD2 . TYR A 1 50  ? 32.236 -14.701 -45.533 1.00 12.79  ? 177 TYR B CD2 1 
ATOM   399  C CE1 . TYR A 1 50  ? 34.256 -16.036 -46.877 1.00 13.01  ? 177 TYR B CE1 1 
ATOM   400  C CE2 . TYR A 1 50  ? 31.924 -15.555 -46.576 1.00 14.07  ? 177 TYR B CE2 1 
ATOM   401  C CZ  . TYR A 1 50  ? 32.930 -16.221 -47.240 1.00 13.20  ? 177 TYR B CZ  1 
ATOM   402  O OH  . TYR A 1 50  ? 32.590 -17.072 -48.270 1.00 13.61  ? 177 TYR B OH  1 
ATOM   403  N N   . LYS A 1 51  ? 33.852 -10.493 -42.605 1.00 11.47  ? 178 LYS B N   1 
ATOM   404  C CA  . LYS A 1 51  ? 34.544 -9.550  -41.738 1.00 11.64  ? 178 LYS B CA  1 
ATOM   405  C C   . LYS A 1 51  ? 34.151 -9.771  -40.277 1.00 11.26  ? 178 LYS B C   1 
ATOM   406  O O   . LYS A 1 51  ? 32.984 -9.628  -39.920 1.00 11.39  ? 178 LYS B O   1 
ATOM   407  C CB  . LYS A 1 51  ? 34.224 -8.107  -42.142 1.00 11.72  ? 178 LYS B CB  1 
ATOM   408  C CG  . LYS A 1 51  ? 35.076 -7.027  -41.471 1.00 12.64  ? 178 LYS B CG  1 
ATOM   409  C CD  . LYS A 1 51  ? 34.871 -5.658  -42.152 1.00 12.22  ? 178 LYS B CD  1 
ATOM   410  C CE  . LYS A 1 51  ? 35.786 -4.582  -41.559 1.00 14.95  ? 178 LYS B CE  1 
ATOM   411  N NZ  . LYS A 1 51  ? 35.238 -3.907  -40.312 1.00 16.03  ? 178 LYS B NZ  1 
ATOM   412  N N   . THR A 1 52  ? 35.131 -10.105 -39.441 1.00 10.63  ? 179 THR B N   1 
ATOM   413  C CA  . THR A 1 52  ? 34.917 -10.113 -37.997 1.00 10.05  ? 179 THR B CA  1 
ATOM   414  C C   . THR A 1 52  ? 34.911 -8.659  -37.552 1.00 9.97   ? 179 THR B C   1 
ATOM   415  O O   . THR A 1 52  ? 35.965 -8.006  -37.511 1.00 9.62   ? 179 THR B O   1 
ATOM   416  C CB  . THR A 1 52  ? 36.019 -10.884 -37.259 1.00 10.35  ? 179 THR B CB  1 
ATOM   417  O OG1 . THR A 1 52  ? 35.979 -12.253 -37.653 1.00 9.49   ? 179 THR B OG1 1 
ATOM   418  C CG2 . THR A 1 52  ? 35.851 -10.786 -35.723 1.00 9.40   ? 179 THR B CG2 1 
ATOM   419  N N   . GLU A 1 53  ? 33.718 -8.163  -37.234 1.00 9.20   ? 180 GLU B N   1 
ATOM   420  C CA  . GLU A 1 53  ? 33.520 -6.772  -36.825 1.00 9.08   ? 180 GLU B CA  1 
ATOM   421  C C   . GLU A 1 53  ? 34.018 -6.518  -35.397 1.00 9.04   ? 180 GLU B C   1 
ATOM   422  O O   . GLU A 1 53  ? 34.621 -5.470  -35.114 1.00 9.18   ? 180 GLU B O   1 
ATOM   423  C CB  . GLU A 1 53  ? 32.046 -6.376  -36.965 1.00 9.02   ? 180 GLU B CB  1 
ATOM   424  C CG  . GLU A 1 53  ? 31.439 -6.582  -38.382 1.00 8.89   ? 180 GLU B CG  1 
ATOM   425  C CD  . GLU A 1 53  ? 31.859 -5.540  -39.404 1.00 9.55   ? 180 GLU B CD  1 
ATOM   426  O OE1 . GLU A 1 53  ? 31.289 -5.543  -40.513 1.00 12.14  ? 180 GLU B OE1 1 
ATOM   427  O OE2 . GLU A 1 53  ? 32.746 -4.714  -39.124 1.00 10.34  ? 180 GLU B OE2 1 
ATOM   428  N N   . PHE A 1 54  ? 33.747 -7.463  -34.500 1.00 8.34   ? 181 PHE B N   1 
ATOM   429  C CA  . PHE A 1 54  ? 34.435 -7.504  -33.206 1.00 8.38   ? 181 PHE B CA  1 
ATOM   430  C C   . PHE A 1 54  ? 34.571 -8.944  -32.747 1.00 8.39   ? 181 PHE B C   1 
ATOM   431  O O   . PHE A 1 54  ? 33.769 -9.799  -33.137 1.00 8.76   ? 181 PHE B O   1 
ATOM   432  C CB  . PHE A 1 54  ? 33.751 -6.632  -32.132 1.00 7.46   ? 181 PHE B CB  1 
ATOM   433  C CG  . PHE A 1 54  ? 32.405 -7.135  -31.676 1.00 7.84   ? 181 PHE B CG  1 
ATOM   434  C CD1 . PHE A 1 54  ? 31.236 -6.710  -32.311 1.00 7.04   ? 181 PHE B CD1 1 
ATOM   435  C CD2 . PHE A 1 54  ? 32.305 -8.004  -30.577 1.00 7.10   ? 181 PHE B CD2 1 
ATOM   436  C CE1 . PHE A 1 54  ? 29.984 -7.154  -31.881 1.00 6.63   ? 181 PHE B CE1 1 
ATOM   437  C CE2 . PHE A 1 54  ? 31.070 -8.469  -30.145 1.00 8.08   ? 181 PHE B CE2 1 
ATOM   438  C CZ  . PHE A 1 54  ? 29.896 -8.036  -30.795 1.00 7.41   ? 181 PHE B CZ  1 
ATOM   439  N N   . ASP A 1 55  ? 35.568 -9.210  -31.907 1.00 8.56   ? 182 ASP B N   1 
ATOM   440  C CA  . ASP A 1 55  ? 35.747 -10.555 -31.396 1.00 8.64   ? 182 ASP B CA  1 
ATOM   441  C C   . ASP A 1 55  ? 35.428 -10.675 -29.905 1.00 8.68   ? 182 ASP B C   1 
ATOM   442  O O   . ASP A 1 55  ? 35.037 -9.690  -29.263 1.00 8.23   ? 182 ASP B O   1 
ATOM   443  C CB  . ASP A 1 55  ? 37.136 -11.113 -31.756 1.00 9.40   ? 182 ASP B CB  1 
ATOM   444  C CG  . ASP A 1 55  ? 38.288 -10.346 -31.119 1.00 9.62   ? 182 ASP B CG  1 
ATOM   445  O OD1 . ASP A 1 55  ? 38.103 -9.666  -30.079 1.00 10.52  ? 182 ASP B OD1 1 
ATOM   446  O OD2 . ASP A 1 55  ? 39.405 -10.448 -31.670 1.00 9.88   ? 182 ASP B OD2 1 
ATOM   447  N N   . PHE A 1 56  ? 35.581 -11.885 -29.370 1.00 8.57   ? 183 PHE B N   1 
ATOM   448  C CA  . PHE A 1 56  ? 35.297 -12.151 -27.965 1.00 8.96   ? 183 PHE B CA  1 
ATOM   449  C C   . PHE A 1 56  ? 36.168 -11.272 -27.048 1.00 9.27   ? 183 PHE B C   1 
ATOM   450  O O   . PHE A 1 56  ? 35.685 -10.755 -26.038 1.00 9.27   ? 183 PHE B O   1 
ATOM   451  C CB  . PHE A 1 56  ? 35.489 -13.639 -27.643 1.00 8.80   ? 183 PHE B CB  1 
ATOM   452  C CG  . PHE A 1 56  ? 34.726 -14.582 -28.561 1.00 9.49   ? 183 PHE B CG  1 
ATOM   453  C CD1 . PHE A 1 56  ? 35.399 -15.356 -29.504 1.00 9.10   ? 183 PHE B CD1 1 
ATOM   454  C CD2 . PHE A 1 56  ? 33.340 -14.705 -28.463 1.00 8.29   ? 183 PHE B CD2 1 
ATOM   455  C CE1 . PHE A 1 56  ? 34.699 -16.239 -30.344 1.00 9.58   ? 183 PHE B CE1 1 
ATOM   456  C CE2 . PHE A 1 56  ? 32.633 -15.571 -29.290 1.00 7.48   ? 183 PHE B CE2 1 
ATOM   457  C CZ  . PHE A 1 56  ? 33.301 -16.330 -30.240 1.00 8.78   ? 183 PHE B CZ  1 
ATOM   458  N N   . SER A 1 57  ? 37.436 -11.079 -27.419 1.00 8.92   ? 184 SER B N   1 
ATOM   459  C CA  . SER A 1 57  ? 38.329 -10.259 -26.610 1.00 9.34   ? 184 SER B CA  1 
ATOM   460  C C   . SER A 1 57  ? 37.877 -8.798  -26.561 1.00 9.43   ? 184 SER B C   1 
ATOM   461  O O   . SER A 1 57  ? 37.909 -8.145  -25.492 1.00 8.83   ? 184 SER B O   1 
ATOM   462  C CB  . SER A 1 57  ? 39.767 -10.405 -27.094 1.00 9.74   ? 184 SER B CB  1 
ATOM   463  O OG  . SER A 1 57  ? 40.226 -11.707 -26.765 1.00 9.95   ? 184 SER B OG  1 
ATOM   464  N N   . ASP A 1 58  ? 37.421 -8.305  -27.705 1.00 9.19   ? 185 ASP B N   1 
ATOM   465  C CA  . ASP A 1 58  ? 36.829 -6.985  -27.800 1.00 10.25  ? 185 ASP B CA  1 
ATOM   466  C C   . ASP A 1 58  ? 35.613 -6.858  -26.906 1.00 10.58  ? 185 ASP B C   1 
ATOM   467  O O   . ASP A 1 58  ? 35.468 -5.849  -26.201 1.00 10.74  ? 185 ASP B O   1 
ATOM   468  C CB  . ASP A 1 58  ? 36.415 -6.685  -29.237 1.00 9.82   ? 185 ASP B CB  1 
ATOM   469  C CG  . ASP A 1 58  ? 37.589 -6.638  -30.188 1.00 10.94  ? 185 ASP B CG  1 
ATOM   470  O OD1 . ASP A 1 58  ? 37.385 -6.998  -31.372 1.00 9.60   ? 185 ASP B OD1 1 
ATOM   471  O OD2 . ASP A 1 58  ? 38.708 -6.240  -29.768 1.00 10.51  ? 185 ASP B OD2 1 
ATOM   472  N N   . TYR A 1 59  ? 34.732 -7.866  -26.961 1.00 10.94  ? 186 TYR B N   1 
ATOM   473  C CA  . TYR A 1 59  ? 33.565 -7.907  -26.082 1.00 11.70  ? 186 TYR B CA  1 
ATOM   474  C C   . TYR A 1 59  ? 33.951 -7.916  -24.589 1.00 12.21  ? 186 TYR B C   1 
ATOM   475  O O   . TYR A 1 59  ? 33.388 -7.165  -23.806 1.00 12.22  ? 186 TYR B O   1 
ATOM   476  C CB  . TYR A 1 59  ? 32.597 -9.063  -26.409 1.00 11.20  ? 186 TYR B CB  1 
ATOM   477  C CG  . TYR A 1 59  ? 31.412 -9.008  -25.469 1.00 12.35  ? 186 TYR B CG  1 
ATOM   478  C CD1 . TYR A 1 59  ? 30.338 -8.142  -25.720 1.00 11.18  ? 186 TYR B CD1 1 
ATOM   479  C CD2 . TYR A 1 59  ? 31.405 -9.746  -24.275 1.00 11.80  ? 186 TYR B CD2 1 
ATOM   480  C CE1 . TYR A 1 59  ? 29.275 -8.050  -24.838 1.00 12.28  ? 186 TYR B CE1 1 
ATOM   481  C CE2 . TYR A 1 59  ? 30.346 -9.654  -23.387 1.00 13.13  ? 186 TYR B CE2 1 
ATOM   482  C CZ  . TYR A 1 59  ? 29.288 -8.797  -23.670 1.00 11.91  ? 186 TYR B CZ  1 
ATOM   483  O OH  . TYR A 1 59  ? 28.237 -8.703  -22.786 1.00 12.27  ? 186 TYR B OH  1 
ATOM   484  N N   . VAL A 1 60  ? 34.904 -8.765  -24.209 1.00 13.31  ? 187 VAL B N   1 
ATOM   485  C CA  . VAL A 1 60  ? 35.355 -8.880  -22.814 1.00 13.90  ? 187 VAL B CA  1 
ATOM   486  C C   . VAL A 1 60  ? 35.943 -7.574  -22.295 1.00 14.63  ? 187 VAL B C   1 
ATOM   487  O O   . VAL A 1 60  ? 35.652 -7.144  -21.168 1.00 14.50  ? 187 VAL B O   1 
ATOM   488  C CB  . VAL A 1 60  ? 36.382 -10.023 -22.643 1.00 14.26  ? 187 VAL B CB  1 
ATOM   489  C CG1 . VAL A 1 60  ? 37.115 -9.926  -21.290 1.00 13.84  ? 187 VAL B CG1 1 
ATOM   490  C CG2 . VAL A 1 60  ? 35.689 -11.373 -22.780 1.00 14.01  ? 187 VAL B CG2 1 
ATOM   491  N N   . LYS A 1 61  ? 36.762 -6.935  -23.122 1.00 15.28  ? 188 LYS B N   1 
ATOM   492  C CA  . LYS A 1 61  ? 37.458 -5.735  -22.691 1.00 15.98  ? 188 LYS B CA  1 
ATOM   493  C C   . LYS A 1 61  ? 36.502 -4.538  -22.554 1.00 16.01  ? 188 LYS B C   1 
ATOM   494  O O   . LYS A 1 61  ? 36.555 -3.820  -21.549 1.00 16.15  ? 188 LYS B O   1 
ATOM   495  C CB  . LYS A 1 61  ? 38.616 -5.416  -23.637 1.00 16.26  ? 188 LYS B CB  1 
ATOM   496  C CG  . LYS A 1 61  ? 39.754 -4.670  -22.963 1.00 18.29  ? 188 LYS B CG  1 
ATOM   497  C CD  . LYS A 1 61  ? 40.698 -4.031  -23.973 1.00 20.65  ? 188 LYS B CD  1 
ATOM   498  C CE  . LYS A 1 61  ? 41.751 -4.996  -24.471 1.00 22.71  ? 188 LYS B CE  1 
ATOM   499  N NZ  . LYS A 1 61  ? 42.726 -4.287  -25.360 1.00 23.61  ? 188 LYS B NZ  1 
ATOM   500  N N   . TRP A 1 62  ? 35.617 -4.348  -23.537 1.00 15.49  ? 189 TRP B N   1 
ATOM   501  C CA  . TRP A 1 62  ? 34.738 -3.166  -23.577 1.00 15.51  ? 189 TRP B CA  1 
ATOM   502  C C   . TRP A 1 62  ? 33.294 -3.351  -23.086 1.00 14.54  ? 189 TRP B C   1 
ATOM   503  O O   . TRP A 1 62  ? 32.736 -2.435  -22.481 1.00 14.21  ? 189 TRP B O   1 
ATOM   504  C CB  . TRP A 1 62  ? 34.759 -2.517  -24.963 1.00 16.45  ? 189 TRP B CB  1 
ATOM   505  C CG  . TRP A 1 62  ? 36.160 -2.183  -25.477 1.00 17.73  ? 189 TRP B CG  1 
ATOM   506  C CD1 . TRP A 1 62  ? 36.605 -2.314  -26.759 1.00 20.03  ? 189 TRP B CD1 1 
ATOM   507  C CD2 . TRP A 1 62  ? 37.279 -1.669  -24.719 1.00 19.31  ? 189 TRP B CD2 1 
ATOM   508  N NE1 . TRP A 1 62  ? 37.918 -1.910  -26.856 1.00 19.93  ? 189 TRP B NE1 1 
ATOM   509  C CE2 . TRP A 1 62  ? 38.355 -1.509  -25.621 1.00 19.07  ? 189 TRP B CE2 1 
ATOM   510  C CE3 . TRP A 1 62  ? 37.478 -1.335  -23.365 1.00 20.31  ? 189 TRP B CE3 1 
ATOM   511  C CZ2 . TRP A 1 62  ? 39.611 -1.022  -25.219 1.00 18.72  ? 189 TRP B CZ2 1 
ATOM   512  C CZ3 . TRP A 1 62  ? 38.733 -0.840  -22.965 1.00 19.45  ? 189 TRP B CZ3 1 
ATOM   513  C CH2 . TRP A 1 62  ? 39.779 -0.697  -23.893 1.00 19.11  ? 189 TRP B CH2 1 
ATOM   514  N N   . LYS A 1 63  ? 32.697 -4.513  -23.355 1.00 13.42  ? 190 LYS B N   1 
ATOM   515  C CA  . LYS A 1 63  ? 31.334 -4.850  -22.876 1.00 13.21  ? 190 LYS B CA  1 
ATOM   516  C C   . LYS A 1 63  ? 30.283 -3.798  -23.262 1.00 12.47  ? 190 LYS B C   1 
ATOM   517  O O   . LYS A 1 63  ? 29.412 -3.422  -22.460 1.00 12.45  ? 190 LYS B O   1 
ATOM   518  C CB  . LYS A 1 63  ? 31.351 -5.106  -21.356 1.00 13.24  ? 190 LYS B CB  1 
ATOM   519  C CG  . LYS A 1 63  ? 32.266 -6.259  -20.923 1.00 13.46  ? 190 LYS B CG  1 
ATOM   520  C CD  . LYS A 1 63  ? 32.223 -6.488  -19.407 1.00 13.88  ? 190 LYS B CD  1 
ATOM   521  C CE  . LYS A 1 63  ? 33.236 -7.557  -18.968 1.00 15.05  ? 190 LYS B CE  1 
ATOM   522  N NZ  . LYS A 1 63  ? 33.372 -7.593  -17.472 1.00 18.07  ? 190 LYS B NZ  1 
ATOM   523  N N   . ASP A 1 64  ? 30.380 -3.326  -24.500 1.00 12.05  ? 191 ASP B N   1 
ATOM   524  C CA  . ASP A 1 64  ? 29.631 -2.168  -24.965 1.00 12.00  ? 191 ASP B CA  1 
ATOM   525  C C   . ASP A 1 64  ? 29.225 -2.427  -26.412 1.00 12.05  ? 191 ASP B C   1 
ATOM   526  O O   . ASP A 1 64  ? 29.945 -2.048  -27.344 1.00 11.02  ? 191 ASP B O   1 
ATOM   527  C CB  . ASP A 1 64  ? 30.508 -0.915  -24.845 1.00 12.20  ? 191 ASP B CB  1 
ATOM   528  C CG  . ASP A 1 64  ? 29.797 0.372   -25.250 1.00 12.69  ? 191 ASP B CG  1 
ATOM   529  O OD1 . ASP A 1 64  ? 28.711 0.333   -25.862 1.00 13.44  ? 191 ASP B OD1 1 
ATOM   530  O OD2 . ASP A 1 64  ? 30.358 1.455   -24.967 1.00 13.91  ? 191 ASP B OD2 1 
ATOM   531  N N   . PRO A 1 65  ? 28.081 -3.112  -26.604 1.00 12.70  ? 192 PRO B N   1 
ATOM   532  C CA  . PRO A 1 65  ? 27.600 -3.453  -27.952 1.00 13.03  ? 192 PRO B CA  1 
ATOM   533  C C   . PRO A 1 65  ? 27.531 -2.256  -28.897 1.00 13.70  ? 192 PRO B C   1 
ATOM   534  O O   . PRO A 1 65  ? 27.940 -2.375  -30.060 1.00 14.16  ? 192 PRO B O   1 
ATOM   535  C CB  . PRO A 1 65  ? 26.195 -4.008  -27.685 1.00 13.16  ? 192 PRO B CB  1 
ATOM   536  C CG  . PRO A 1 65  ? 26.296 -4.604  -26.343 1.00 12.61  ? 192 PRO B CG  1 
ATOM   537  C CD  . PRO A 1 65  ? 27.184 -3.649  -25.560 1.00 12.15  ? 192 PRO B CD  1 
ATOM   538  N N   . ASP A 1 66  ? 27.044 -1.113  -28.405 1.00 14.17  ? 193 ASP B N   1 
ATOM   539  C CA  . ASP A 1 66  ? 26.919 0.104   -29.235 1.00 14.79  ? 193 ASP B CA  1 
ATOM   540  C C   . ASP A 1 66  ? 28.270 0.517   -29.824 1.00 14.47  ? 193 ASP B C   1 
ATOM   541  O O   . ASP A 1 66  ? 28.370 0.830   -31.006 1.00 14.53  ? 193 ASP B O   1 
ATOM   542  C CB  . ASP A 1 66  ? 26.318 1.284   -28.440 1.00 15.30  ? 193 ASP B CB  1 
ATOM   543  C CG  . ASP A 1 66  ? 24.833 1.088   -28.066 1.00 17.02  ? 193 ASP B CG  1 
ATOM   544  O OD1 . ASP A 1 66  ? 24.170 0.139   -28.521 1.00 18.00  ? 193 ASP B OD1 1 
ATOM   545  O OD2 . ASP A 1 66  ? 24.318 1.911   -27.282 1.00 19.95  ? 193 ASP B OD2 1 
ATOM   546  N N   . ALA A 1 67  ? 29.306 0.514   -28.990 1.00 14.46  ? 194 ALA B N   1 
ATOM   547  C CA  . ALA A 1 67  ? 30.666 0.874   -29.419 1.00 14.43  ? 194 ALA B CA  1 
ATOM   548  C C   . ALA A 1 67  ? 31.263 -0.148  -30.376 1.00 14.54  ? 194 ALA B C   1 
ATOM   549  O O   . ALA A 1 67  ? 31.930 0.214   -31.355 1.00 14.04  ? 194 ALA B O   1 
ATOM   550  C CB  . ALA A 1 67  ? 31.577 1.031   -28.213 1.00 14.49  ? 194 ALA B CB  1 
ATOM   551  N N   . LEU A 1 68  ? 31.032 -1.423  -30.064 1.00 14.44  ? 195 LEU B N   1 
ATOM   552  C CA  . LEU A 1 68  ? 31.620 -2.540  -30.793 1.00 14.85  ? 195 LEU B CA  1 
ATOM   553  C C   . LEU A 1 68  ? 31.123 -2.624  -32.235 1.00 14.84  ? 195 LEU B C   1 
ATOM   554  O O   . LEU A 1 68  ? 31.844 -3.113  -33.099 1.00 15.42  ? 195 LEU B O   1 
ATOM   555  C CB  . LEU A 1 68  ? 31.380 -3.864  -30.051 1.00 14.63  ? 195 LEU B CB  1 
ATOM   556  C CG  . LEU A 1 68  ? 32.104 -3.984  -28.699 1.00 14.43  ? 195 LEU B CG  1 
ATOM   557  C CD1 . LEU A 1 68  ? 31.579 -5.155  -27.867 1.00 14.21  ? 195 LEU B CD1 1 
ATOM   558  C CD2 . LEU A 1 68  ? 33.612 -4.080  -28.902 1.00 15.68  ? 195 LEU B CD2 1 
ATOM   559  N N   . LEU A 1 69  ? 29.917 -2.116  -32.482 1.00 14.81  ? 196 LEU B N   1 
ATOM   560  C CA  . LEU A 1 69  ? 29.270 -2.212  -33.800 1.00 14.74  ? 196 LEU B CA  1 
ATOM   561  C C   . LEU A 1 69  ? 29.175 -0.863  -34.528 1.00 15.64  ? 196 LEU B C   1 
ATOM   562  O O   . LEU A 1 69  ? 28.654 -0.772  -35.637 1.00 16.21  ? 196 LEU B O   1 
ATOM   563  C CB  . LEU A 1 69  ? 27.890 -2.853  -33.651 1.00 13.94  ? 196 LEU B CB  1 
ATOM   564  C CG  . LEU A 1 69  ? 27.872 -4.356  -33.346 1.00 13.20  ? 196 LEU B CG  1 
ATOM   565  C CD1 . LEU A 1 69  ? 26.484 -4.823  -32.989 1.00 12.57  ? 196 LEU B CD1 1 
ATOM   566  C CD2 . LEU A 1 69  ? 28.418 -5.189  -34.505 1.00 10.19  ? 196 LEU B CD2 1 
ATOM   567  N N   . LYS A 1 70  ? 29.717 0.176   -33.910 1.00 16.37  ? 197 LYS B N   1 
ATOM   568  C CA  . LYS A 1 70  ? 29.610 1.538   -34.418 1.00 17.18  ? 197 LYS B CA  1 
ATOM   569  C C   . LYS A 1 70  ? 30.222 1.717   -35.814 1.00 16.75  ? 197 LYS B C   1 
ATOM   570  O O   . LYS A 1 70  ? 29.764 2.545   -36.594 1.00 17.53  ? 197 LYS B O   1 
ATOM   571  C CB  . LYS A 1 70  ? 30.279 2.490   -33.429 1.00 17.48  ? 197 LYS B CB  1 
ATOM   572  C CG  . LYS A 1 70  ? 29.874 3.941   -33.555 1.00 19.16  ? 197 LYS B CG  1 
ATOM   573  C CD  . LYS A 1 70  ? 30.423 4.744   -32.376 1.00 21.55  ? 197 LYS B CD  1 
ATOM   574  C CE  . LYS A 1 70  ? 31.939 4.894   -32.454 1.00 22.11  ? 197 LYS B CE  1 
ATOM   575  N NZ  . LYS A 1 70  ? 32.366 6.194   -31.852 1.00 24.82  ? 197 LYS B NZ  1 
ATOM   576  N N   . HIS A 1 71  ? 31.235 0.918   -36.119 1.00 16.39  ? 198 HIS B N   1 
ATOM   577  C CA  . HIS A 1 71  ? 32.024 1.082   -37.326 1.00 15.92  ? 198 HIS B CA  1 
ATOM   578  C C   . HIS A 1 71  ? 31.714 0.082   -38.439 1.00 14.76  ? 198 HIS B C   1 
ATOM   579  O O   . HIS A 1 71  ? 32.520 -0.082  -39.361 1.00 14.86  ? 198 HIS B O   1 
ATOM   580  C CB  . HIS A 1 71  ? 33.515 1.031   -36.985 1.00 16.55  ? 198 HIS B CB  1 
ATOM   581  C CG  . HIS A 1 71  ? 34.005 2.216   -36.205 1.00 19.19  ? 198 HIS B CG  1 
ATOM   582  N ND1 . HIS A 1 71  ? 33.288 3.389   -36.089 1.00 21.56  ? 198 HIS B ND1 1 
ATOM   583  C CD2 . HIS A 1 71  ? 35.162 2.415   -35.531 1.00 21.75  ? 198 HIS B CD2 1 
ATOM   584  C CE1 . HIS A 1 71  ? 33.971 4.250   -35.358 1.00 23.63  ? 198 HIS B CE1 1 
ATOM   585  N NE2 . HIS A 1 71  ? 35.117 3.687   -35.014 1.00 23.49  ? 198 HIS B NE2 1 
ATOM   586  N N   . VAL A 1 72  ? 30.552 -0.567  -38.366 1.00 13.15  ? 199 VAL B N   1 
ATOM   587  C CA  . VAL A 1 72  ? 30.149 -1.543  -39.378 1.00 11.64  ? 199 VAL B CA  1 
ATOM   588  C C   . VAL A 1 72  ? 29.799 -0.815  -40.682 1.00 11.81  ? 199 VAL B C   1 
ATOM   589  O O   . VAL A 1 72  ? 29.011 0.138   -40.671 1.00 11.73  ? 199 VAL B O   1 
ATOM   590  C CB  . VAL A 1 72  ? 28.927 -2.398  -38.918 1.00 11.52  ? 199 VAL B CB  1 
ATOM   591  C CG1 . VAL A 1 72  ? 28.411 -3.263  -40.054 1.00 10.88  ? 199 VAL B CG1 1 
ATOM   592  C CG2 . VAL A 1 72  ? 29.299 -3.285  -37.725 1.00 10.35  ? 199 VAL B CG2 1 
ATOM   593  N N   . LYS A 1 73  ? 30.381 -1.275  -41.785 1.00 11.51  ? 200 LYS B N   1 
ATOM   594  C CA  . LYS A 1 73  ? 30.037 -0.785  -43.118 1.00 11.94  ? 200 LYS B CA  1 
ATOM   595  C C   . LYS A 1 73  ? 29.346 -1.896  -43.915 1.00 11.50  ? 200 LYS B C   1 
ATOM   596  O O   . LYS A 1 73  ? 29.926 -2.971  -44.129 1.00 11.35  ? 200 LYS B O   1 
ATOM   597  C CB  . LYS A 1 73  ? 31.295 -0.330  -43.863 1.00 12.62  ? 200 LYS B CB  1 
ATOM   598  C CG  . LYS A 1 73  ? 32.025 0.863   -43.248 1.00 15.24  ? 200 LYS B CG  1 
ATOM   599  C CD  . LYS A 1 73  ? 31.224 2.168   -43.381 1.00 17.92  ? 200 LYS B CD  1 
ATOM   600  C CE  . LYS A 1 73  ? 32.102 3.385   -43.119 1.00 19.68  ? 200 LYS B CE  1 
ATOM   601  N NZ  . LYS A 1 73  ? 32.514 3.461   -41.695 1.00 22.61  ? 200 LYS B NZ  1 
ATOM   602  N N   . HIS A 1 74  ? 28.116 -1.621  -44.350 1.00 10.82  ? 201 HIS B N   1 
ATOM   603  C CA  . HIS A 1 74  ? 27.282 -2.560  -45.113 1.00 10.75  ? 201 HIS B CA  1 
ATOM   604  C C   . HIS A 1 74  ? 27.973 -2.920  -46.430 1.00 10.66  ? 201 HIS B C   1 
ATOM   605  O O   . HIS A 1 74  ? 28.235 -2.043  -47.252 1.00 10.99  ? 201 HIS B O   1 
ATOM   606  C CB  . HIS A 1 74  ? 25.912 -1.913  -45.379 1.00 10.25  ? 201 HIS B CB  1 
ATOM   607  C CG  . HIS A 1 74  ? 24.905 -2.829  -46.004 1.00 10.78  ? 201 HIS B CG  1 
ATOM   608  N ND1 . HIS A 1 74  ? 23.687 -2.380  -46.475 1.00 9.62   ? 201 HIS B ND1 1 
ATOM   609  C CD2 . HIS A 1 74  ? 24.933 -4.162  -46.246 1.00 9.60   ? 201 HIS B CD2 1 
ATOM   610  C CE1 . HIS A 1 74  ? 23.008 -3.396  -46.976 1.00 8.45   ? 201 HIS B CE1 1 
ATOM   611  N NE2 . HIS A 1 74  ? 23.744 -4.486  -46.856 1.00 9.37   ? 201 HIS B NE2 1 
ATOM   612  N N   . MET A 1 75  ? 28.275 -4.208  -46.601 1.00 10.16  ? 202 MET B N   1 
ATOM   613  C CA  . MET A 1 75  ? 29.073 -4.699  -47.732 1.00 10.23  ? 202 MET B CA  1 
ATOM   614  C C   . MET A 1 75  ? 28.355 -4.531  -49.070 1.00 10.29  ? 202 MET B C   1 
ATOM   615  O O   . MET A 1 75  ? 28.969 -4.122  -50.044 1.00 10.51  ? 202 MET B O   1 
ATOM   616  C CB  . MET A 1 75  ? 29.487 -6.164  -47.510 1.00 10.21  ? 202 MET B CB  1 
ATOM   617  C CG  . MET A 1 75  ? 30.601 -6.353  -46.484 1.00 9.10   ? 202 MET B CG  1 
ATOM   618  S SD  . MET A 1 75  ? 30.684 -8.050  -45.906 1.00 10.46  ? 202 MET B SD  1 
ATOM   619  C CE  . MET A 1 75  ? 32.160 -8.010  -44.887 1.00 10.14  ? 202 MET B CE  1 
ATOM   620  N N   . LEU A 1 76  ? 27.056 -4.836  -49.092 1.00 9.91   ? 203 LEU B N   1 
ATOM   621  C CA  . LEU A 1 76  ? 26.186 -4.666  -50.264 1.00 10.31  ? 203 LEU B CA  1 
ATOM   622  C C   . LEU A 1 76  ? 26.530 -5.585  -51.444 1.00 10.02  ? 203 LEU B C   1 
ATOM   623  O O   . LEU A 1 76  ? 26.419 -5.175  -52.601 1.00 10.10  ? 203 LEU B O   1 
ATOM   624  C CB  . LEU A 1 76  ? 26.155 -3.201  -50.719 1.00 10.26  ? 203 LEU B CB  1 
ATOM   625  C CG  . LEU A 1 76  ? 25.463 -2.235  -49.764 1.00 11.37  ? 203 LEU B CG  1 
ATOM   626  C CD1 . LEU A 1 76  ? 25.966 -0.833  -50.011 1.00 13.47  ? 203 LEU B CD1 1 
ATOM   627  C CD2 . LEU A 1 76  ? 23.950 -2.315  -49.922 1.00 11.77  ? 203 LEU B CD2 1 
ATOM   628  N N   . LEU A 1 77  ? 26.942 -6.818  -51.152 1.00 9.41   ? 204 LEU B N   1 
ATOM   629  C CA  . LEU A 1 77  ? 27.300 -7.757  -52.205 1.00 8.94   ? 204 LEU B CA  1 
ATOM   630  C C   . LEU A 1 77  ? 26.445 -9.034  -52.157 1.00 8.69   ? 204 LEU B C   1 
ATOM   631  O O   . LEU A 1 77  ? 25.231 -8.955  -51.959 1.00 8.26   ? 204 LEU B O   1 
ATOM   632  C CB  . LEU A 1 77  ? 28.812 -8.028  -52.184 1.00 9.42   ? 204 LEU B CB  1 
ATOM   633  C CG  . LEU A 1 77  ? 29.694 -6.788  -52.435 1.00 9.92   ? 204 LEU B CG  1 
ATOM   634  C CD1 . LEU A 1 77  ? 31.176 -7.046  -52.111 1.00 10.48  ? 204 LEU B CD1 1 
ATOM   635  C CD2 . LEU A 1 77  ? 29.518 -6.241  -53.868 1.00 11.27  ? 204 LEU B CD2 1 
ATOM   636  N N   . LEU A 1 78  ? 27.069 -10.202 -52.320 1.00 8.36   ? 205 LEU B N   1 
ATOM   637  C CA  . LEU A 1 78  ? 26.316 -11.457 -52.415 1.00 7.78   ? 205 LEU B CA  1 
ATOM   638  C C   . LEU A 1 78  ? 25.990 -12.067 -51.036 1.00 7.35   ? 205 LEU B C   1 
ATOM   639  O O   . LEU A 1 78  ? 25.961 -11.360 -50.031 1.00 6.51   ? 205 LEU B O   1 
ATOM   640  C CB  . LEU A 1 78  ? 27.039 -12.451 -53.330 1.00 8.30   ? 205 LEU B CB  1 
ATOM   641  C CG  . LEU A 1 78  ? 27.297 -12.040 -54.796 1.00 9.15   ? 205 LEU B CG  1 
ATOM   642  C CD1 . LEU A 1 78  ? 28.331 -12.939 -55.452 1.00 10.35  ? 205 LEU B CD1 1 
ATOM   643  C CD2 . LEU A 1 78  ? 26.024 -12.052 -55.588 1.00 10.10  ? 205 LEU B CD2 1 
ATOM   644  N N   . THR A 1 79  ? 25.712 -13.367 -51.009 1.00 6.79   ? 206 THR B N   1 
ATOM   645  C CA  . THR A 1 79  ? 25.269 -14.051 -49.803 1.00 7.32   ? 206 THR B CA  1 
ATOM   646  C C   . THR A 1 79  ? 25.968 -15.415 -49.706 1.00 6.90   ? 206 THR B C   1 
ATOM   647  O O   . THR A 1 79  ? 25.357 -16.469 -49.894 1.00 7.07   ? 206 THR B O   1 
ATOM   648  C CB  . THR A 1 79  ? 23.728 -14.227 -49.801 1.00 6.92   ? 206 THR B CB  1 
ATOM   649  O OG1 . THR A 1 79  ? 23.106 -12.987 -50.179 1.00 7.86   ? 206 THR B OG1 1 
ATOM   650  C CG2 . THR A 1 79  ? 23.223 -14.670 -48.420 1.00 7.13   ? 206 THR B CG2 1 
ATOM   651  N N   . ASN A 1 80  ? 27.261 -15.377 -49.422 1.00 7.16   ? 207 ASN B N   1 
ATOM   652  C CA  . ASN A 1 80  ? 28.073 -16.568 -49.406 1.00 7.53   ? 207 ASN B CA  1 
ATOM   653  C C   . ASN A 1 80  ? 28.001 -17.277 -48.070 1.00 7.15   ? 207 ASN B C   1 
ATOM   654  O O   . ASN A 1 80  ? 28.948 -17.257 -47.284 1.00 7.95   ? 207 ASN B O   1 
ATOM   655  C CB  . ASN A 1 80  ? 29.523 -16.233 -49.787 1.00 7.65   ? 207 ASN B CB  1 
ATOM   656  C CG  . ASN A 1 80  ? 29.694 -16.013 -51.277 1.00 7.81   ? 207 ASN B CG  1 
ATOM   657  O OD1 . ASN A 1 80  ? 28.926 -16.527 -52.088 1.00 8.56   ? 207 ASN B OD1 1 
ATOM   658  N ND2 . ASN A 1 80  ? 30.708 -15.249 -51.642 1.00 8.21   ? 207 ASN B ND2 1 
ATOM   659  N N   . THR A 1 81  ? 26.866 -17.910 -47.821 1.00 7.35   ? 208 THR B N   1 
ATOM   660  C CA  . THR A 1 81  ? 26.583 -18.472 -46.502 1.00 7.35   ? 208 THR B CA  1 
ATOM   661  C C   . THR A 1 81  ? 27.470 -19.669 -46.119 1.00 7.27   ? 208 THR B C   1 
ATOM   662  O O   . THR A 1 81  ? 27.869 -19.780 -44.964 1.00 7.85   ? 208 THR B O   1 
ATOM   663  C CB  . THR A 1 81  ? 25.081 -18.828 -46.342 1.00 7.92   ? 208 THR B CB  1 
ATOM   664  O OG1 . THR A 1 81  ? 24.270 -17.772 -46.886 1.00 7.85   ? 208 THR B OG1 1 
ATOM   665  C CG2 . THR A 1 81  ? 24.729 -19.012 -44.866 1.00 8.41   ? 208 THR B CG2 1 
ATOM   666  N N   . PHE A 1 82  ? 27.755 -20.561 -47.069 1.00 7.15   ? 209 PHE B N   1 
ATOM   667  C CA  . PHE A 1 82  ? 28.623 -21.730 -46.816 1.00 7.20   ? 209 PHE B CA  1 
ATOM   668  C C   . PHE A 1 82  ? 30.019 -21.277 -46.393 1.00 7.41   ? 209 PHE B C   1 
ATOM   669  O O   . PHE A 1 82  ? 30.530 -21.707 -45.368 1.00 7.68   ? 209 PHE B O   1 
ATOM   670  C CB  . PHE A 1 82  ? 28.734 -22.638 -48.053 1.00 6.83   ? 209 PHE B CB  1 
ATOM   671  C CG  . PHE A 1 82  ? 27.583 -23.580 -48.226 1.00 7.02   ? 209 PHE B CG  1 
ATOM   672  C CD1 . PHE A 1 82  ? 26.519 -23.254 -49.054 1.00 5.30   ? 209 PHE B CD1 1 
ATOM   673  C CD2 . PHE A 1 82  ? 27.577 -24.814 -47.570 1.00 7.36   ? 209 PHE B CD2 1 
ATOM   674  C CE1 . PHE A 1 82  ? 25.449 -24.122 -49.219 1.00 4.46   ? 209 PHE B CE1 1 
ATOM   675  C CE2 . PHE A 1 82  ? 26.502 -25.706 -47.728 1.00 8.50   ? 209 PHE B CE2 1 
ATOM   676  C CZ  . PHE A 1 82  ? 25.436 -25.350 -48.554 1.00 7.11   ? 209 PHE B CZ  1 
ATOM   677  N N   . GLY A 1 83  ? 30.619 -20.397 -47.190 1.00 7.50   ? 210 GLY B N   1 
ATOM   678  C CA  . GLY A 1 83  ? 31.927 -19.822 -46.876 1.00 7.38   ? 210 GLY B CA  1 
ATOM   679  C C   . GLY A 1 83  ? 31.959 -19.066 -45.551 1.00 7.17   ? 210 GLY B C   1 
ATOM   680  O O   . GLY A 1 83  ? 32.921 -19.176 -44.802 1.00 7.58   ? 210 GLY B O   1 
ATOM   681  N N   . ALA A 1 84  ? 30.906 -18.300 -45.276 1.00 6.46   ? 211 ALA B N   1 
ATOM   682  C CA  . ALA A 1 84  ? 30.765 -17.516 -44.038 1.00 5.71   ? 211 ALA B CA  1 
ATOM   683  C C   . ALA A 1 84  ? 30.775 -18.392 -42.797 1.00 5.54   ? 211 ALA B C   1 
ATOM   684  O O   . ALA A 1 84  ? 31.476 -18.111 -41.828 1.00 4.88   ? 211 ALA B O   1 
ATOM   685  C CB  . ALA A 1 84  ? 29.473 -16.716 -44.083 1.00 5.74   ? 211 ALA B CB  1 
ATOM   686  N N   . ILE A 1 85  ? 29.960 -19.439 -42.823 1.00 5.92   ? 212 ILE B N   1 
ATOM   687  C CA  . ILE A 1 85  ? 29.885 -20.389 -41.716 1.00 6.95   ? 212 ILE B CA  1 
ATOM   688  C C   . ILE A 1 85  ? 31.218 -21.118 -41.531 1.00 7.69   ? 212 ILE B C   1 
ATOM   689  O O   . ILE A 1 85  ? 31.650 -21.365 -40.401 1.00 8.20   ? 212 ILE B O   1 
ATOM   690  C CB  . ILE A 1 85  ? 28.750 -21.421 -41.925 1.00 6.95   ? 212 ILE B CB  1 
ATOM   691  C CG1 . ILE A 1 85  ? 27.382 -20.775 -41.719 1.00 7.14   ? 212 ILE B CG1 1 
ATOM   692  C CG2 . ILE A 1 85  ? 28.913 -22.622 -40.955 1.00 8.19   ? 212 ILE B CG2 1 
ATOM   693  C CD1 . ILE A 1 85  ? 26.195 -21.607 -42.254 1.00 7.29   ? 212 ILE B CD1 1 
ATOM   694  N N   . ASN A 1 86  ? 31.850 -21.484 -42.639 1.00 7.91   ? 213 ASN B N   1 
ATOM   695  C CA  . ASN A 1 86  ? 33.177 -22.081 -42.594 1.00 9.34   ? 213 ASN B CA  1 
ATOM   696  C C   . ASN A 1 86  ? 34.236 -21.127 -42.045 1.00 9.28   ? 213 ASN B C   1 
ATOM   697  O O   . ASN A 1 86  ? 35.141 -21.542 -41.320 1.00 9.77   ? 213 ASN B O   1 
ATOM   698  C CB  . ASN A 1 86  ? 33.561 -22.624 -43.974 1.00 9.19   ? 213 ASN B CB  1 
ATOM   699  C CG  . ASN A 1 86  ? 32.975 -23.989 -44.232 1.00 12.11  ? 213 ASN B CG  1 
ATOM   700  O OD1 . ASN A 1 86  ? 33.266 -24.951 -43.509 1.00 15.17  ? 213 ASN B OD1 1 
ATOM   701  N ND2 . ASN A 1 86  ? 32.140 -24.092 -45.256 1.00 13.43  ? 213 ASN B ND2 1 
ATOM   702  N N   . TYR A 1 87  ? 34.100 -19.847 -42.378 1.00 9.67   ? 214 TYR B N   1 
ATOM   703  C CA  . TYR A 1 87  ? 34.980 -18.800 -41.877 1.00 9.98   ? 214 TYR B CA  1 
ATOM   704  C C   . TYR A 1 87  ? 34.865 -18.647 -40.362 1.00 10.27  ? 214 TYR B C   1 
ATOM   705  O O   . TYR A 1 87  ? 35.867 -18.418 -39.680 1.00 9.93   ? 214 TYR B O   1 
ATOM   706  C CB  . TYR A 1 87  ? 34.657 -17.474 -42.566 1.00 10.42  ? 214 TYR B CB  1 
ATOM   707  C CG  . TYR A 1 87  ? 35.363 -16.270 -41.987 1.00 10.79  ? 214 TYR B CG  1 
ATOM   708  C CD1 . TYR A 1 87  ? 36.667 -15.945 -42.374 1.00 11.50  ? 214 TYR B CD1 1 
ATOM   709  C CD2 . TYR A 1 87  ? 34.724 -15.451 -41.046 1.00 10.62  ? 214 TYR B CD2 1 
ATOM   710  C CE1 . TYR A 1 87  ? 37.319 -14.826 -41.843 1.00 12.63  ? 214 TYR B CE1 1 
ATOM   711  C CE2 . TYR A 1 87  ? 35.359 -14.336 -40.515 1.00 12.16  ? 214 TYR B CE2 1 
ATOM   712  C CZ  . TYR A 1 87  ? 36.651 -14.026 -40.913 1.00 13.03  ? 214 TYR B CZ  1 
ATOM   713  O OH  . TYR A 1 87  ? 37.267 -12.918 -40.379 1.00 12.25  ? 214 TYR B OH  1 
ATOM   714  N N   . VAL A 1 88  ? 33.641 -18.769 -39.847 1.00 10.12  ? 215 VAL B N   1 
ATOM   715  C CA  . VAL A 1 88  ? 33.399 -18.651 -38.414 1.00 10.44  ? 215 VAL B CA  1 
ATOM   716  C C   . VAL A 1 88  ? 34.048 -19.823 -37.675 1.00 10.86  ? 215 VAL B C   1 
ATOM   717  O O   . VAL A 1 88  ? 34.701 -19.644 -36.644 1.00 10.21  ? 215 VAL B O   1 
ATOM   718  C CB  . VAL A 1 88  ? 31.886 -18.600 -38.098 1.00 9.77   ? 215 VAL B CB  1 
ATOM   719  C CG1 . VAL A 1 88  ? 31.636 -18.773 -36.605 1.00 10.13  ? 215 VAL B CG1 1 
ATOM   720  C CG2 . VAL A 1 88  ? 31.284 -17.262 -38.574 1.00 9.83   ? 215 VAL B CG2 1 
ATOM   721  N N   . ALA A 1 89  ? 33.844 -21.018 -38.220 1.00 11.35  ? 216 ALA B N   1 
ATOM   722  C CA  . ALA A 1 89  ? 34.312 -22.256 -37.605 1.00 12.47  ? 216 ALA B CA  1 
ATOM   723  C C   . ALA A 1 89  ? 35.821 -22.269 -37.465 1.00 12.62  ? 216 ALA B C   1 
ATOM   724  O O   . ALA A 1 89  ? 36.347 -22.646 -36.409 1.00 13.07  ? 216 ALA B O   1 
ATOM   725  C CB  . ALA A 1 89  ? 33.835 -23.473 -38.420 1.00 12.23  ? 216 ALA B CB  1 
ATOM   726  N N   . THR A 1 90  ? 36.512 -21.843 -38.523 1.00 12.75  ? 217 THR B N   1 
ATOM   727  C CA  . THR A 1 90  ? 37.967 -21.965 -38.599 1.00 12.66  ? 217 THR B CA  1 
ATOM   728  C C   . THR A 1 90  ? 38.698 -20.694 -38.171 1.00 12.57  ? 217 THR B C   1 
ATOM   729  O O   . THR A 1 90  ? 39.763 -20.771 -37.548 1.00 12.20  ? 217 THR B O   1 
ATOM   730  C CB  . THR A 1 90  ? 38.442 -22.396 -40.003 1.00 12.95  ? 217 THR B CB  1 
ATOM   731  O OG1 . THR A 1 90  ? 38.154 -21.361 -40.956 1.00 14.63  ? 217 THR B OG1 1 
ATOM   732  C CG2 . THR A 1 90  ? 37.751 -23.682 -40.439 1.00 12.89  ? 217 THR B CG2 1 
ATOM   733  N N   . GLU A 1 91  ? 38.120 -19.533 -38.477 1.00 11.51  ? 218 GLU B N   1 
ATOM   734  C CA  . GLU A 1 91  ? 38.808 -18.273 -38.221 1.00 11.62  ? 218 GLU B CA  1 
ATOM   735  C C   . GLU A 1 91  ? 38.266 -17.446 -37.043 1.00 11.11  ? 218 GLU B C   1 
ATOM   736  O O   . GLU A 1 91  ? 38.881 -16.456 -36.675 1.00 11.67  ? 218 GLU B O   1 
ATOM   737  C CB  . GLU A 1 91  ? 38.901 -17.414 -39.500 1.00 11.94  ? 218 GLU B CB  1 
ATOM   738  C CG  . GLU A 1 91  ? 39.695 -18.068 -40.664 1.00 14.75  ? 218 GLU B CG  1 
ATOM   739  C CD  . GLU A 1 91  ? 41.139 -18.440 -40.293 1.00 19.00  ? 218 GLU B CD  1 
ATOM   740  O OE1 . GLU A 1 91  ? 41.611 -19.522 -40.720 1.00 20.73  ? 218 GLU B OE1 1 
ATOM   741  O OE2 . GLU A 1 91  ? 41.799 -17.662 -39.567 1.00 20.87  ? 218 GLU B OE2 1 
ATOM   742  N N   . VAL A 1 92  ? 37.133 -17.831 -36.455 1.00 9.77   ? 219 VAL B N   1 
ATOM   743  C CA  . VAL A 1 92  ? 36.565 -17.029 -35.365 1.00 8.58   ? 219 VAL B CA  1 
ATOM   744  C C   . VAL A 1 92  ? 36.636 -17.742 -34.013 1.00 8.57   ? 219 VAL B C   1 
ATOM   745  O O   . VAL A 1 92  ? 36.945 -17.118 -32.985 1.00 8.79   ? 219 VAL B O   1 
ATOM   746  C CB  . VAL A 1 92  ? 35.126 -16.537 -35.697 1.00 8.44   ? 219 VAL B CB  1 
ATOM   747  C CG1 . VAL A 1 92  ? 34.544 -15.718 -34.548 1.00 9.37   ? 219 VAL B CG1 1 
ATOM   748  C CG2 . VAL A 1 92  ? 35.141 -15.699 -36.991 1.00 8.16   ? 219 VAL B CG2 1 
ATOM   749  N N   . PHE A 1 93  ? 36.354 -19.042 -34.016 1.00 7.98   ? 220 PHE B N   1 
ATOM   750  C CA  . PHE A 1 93  ? 36.411 -19.842 -32.792 1.00 8.30   ? 220 PHE B CA  1 
ATOM   751  C C   . PHE A 1 93  ? 37.848 -20.279 -32.517 1.00 8.68   ? 220 PHE B C   1 
ATOM   752  O O   . PHE A 1 93  ? 38.201 -21.444 -32.716 1.00 8.70   ? 220 PHE B O   1 
ATOM   753  C CB  . PHE A 1 93  ? 35.443 -21.038 -32.869 1.00 8.30   ? 220 PHE B CB  1 
ATOM   754  C CG  . PHE A 1 93  ? 33.995 -20.674 -32.606 1.00 8.19   ? 220 PHE B CG  1 
ATOM   755  C CD1 . PHE A 1 93  ? 33.036 -20.766 -33.620 1.00 9.17   ? 220 PHE B CD1 1 
ATOM   756  C CD2 . PHE A 1 93  ? 33.587 -20.246 -31.348 1.00 9.33   ? 220 PHE B CD2 1 
ATOM   757  C CE1 . PHE A 1 93  ? 31.696 -20.445 -33.379 1.00 6.86   ? 220 PHE B CE1 1 
ATOM   758  C CE2 . PHE A 1 93  ? 32.240 -19.920 -31.095 1.00 8.16   ? 220 PHE B CE2 1 
ATOM   759  C CZ  . PHE A 1 93  ? 31.297 -20.018 -32.116 1.00 6.70   ? 220 PHE B CZ  1 
ATOM   760  N N   . ARG A 1 94  ? 38.656 -19.318 -32.062 1.00 8.65   ? 221 ARG B N   1 
ATOM   761  C CA  . ARG A 1 94  ? 40.101 -19.477 -31.798 1.00 9.93   ? 221 ARG B CA  1 
ATOM   762  C C   . ARG A 1 94  ? 40.497 -18.650 -30.573 1.00 9.25   ? 221 ARG B C   1 
ATOM   763  O O   . ARG A 1 94  ? 39.957 -17.555 -30.384 1.00 9.06   ? 221 ARG B O   1 
ATOM   764  C CB  . ARG A 1 94  ? 40.911 -18.897 -32.960 1.00 10.50  ? 221 ARG B CB  1 
ATOM   765  C CG  . ARG A 1 94  ? 40.776 -19.550 -34.305 1.00 13.07  ? 221 ARG B CG  1 
ATOM   766  C CD  . ARG A 1 94  ? 40.944 -18.490 -35.408 1.00 17.73  ? 221 ARG B CD  1 
ATOM   767  N NE  . ARG A 1 94  ? 42.257 -17.853 -35.479 1.00 19.80  ? 221 ARG B NE  1 
ATOM   768  C CZ  . ARG A 1 94  ? 42.493 -16.679 -36.067 1.00 22.61  ? 221 ARG B CZ  1 
ATOM   769  N NH1 . ARG A 1 94  ? 41.512 -15.996 -36.649 1.00 25.90  ? 221 ARG B NH1 1 
ATOM   770  N NH2 . ARG A 1 94  ? 43.717 -16.182 -36.091 1.00 22.65  ? 221 ARG B NH2 1 
ATOM   771  N N   . GLU A 1 95  ? 41.458 -19.154 -29.780 1.00 9.17   ? 222 GLU B N   1 
ATOM   772  C CA  . GLU A 1 95  ? 42.102 -18.429 -28.649 1.00 9.02   ? 222 GLU B CA  1 
ATOM   773  C C   . GLU A 1 95  ? 42.491 -17.018 -29.026 1.00 8.96   ? 222 GLU B C   1 
ATOM   774  O O   . GLU A 1 95  ? 42.330 -16.083 -28.237 1.00 9.01   ? 222 GLU B O   1 
ATOM   775  C CB  . GLU A 1 95  ? 43.445 -19.083 -28.237 1.00 9.26   ? 222 GLU B CB  1 
ATOM   776  C CG  . GLU A 1 95  ? 43.375 -20.421 -27.604 1.00 10.91  ? 222 GLU B CG  1 
ATOM   777  C CD  . GLU A 1 95  ? 44.697 -20.865 -27.038 1.00 8.37   ? 222 GLU B CD  1 
ATOM   778  O OE1 . GLU A 1 95  ? 45.776 -20.607 -27.627 1.00 7.98   ? 222 GLU B OE1 1 
ATOM   779  O OE2 . GLU A 1 95  ? 44.643 -21.513 -25.999 1.00 12.49  ? 222 GLU B OE2 1 
ATOM   780  N N   . GLU A 1 96  ? 43.066 -16.891 -30.221 1.00 9.01   ? 223 GLU B N   1 
ATOM   781  C CA  . GLU A 1 96  ? 43.628 -15.628 -30.684 1.00 9.45   ? 223 GLU B CA  1 
ATOM   782  C C   . GLU A 1 96  ? 42.586 -14.518 -30.684 1.00 9.65   ? 223 GLU B C   1 
ATOM   783  O O   . GLU A 1 96  ? 42.925 -13.357 -30.480 1.00 9.71   ? 223 GLU B O   1 
ATOM   784  C CB  . GLU A 1 96  ? 44.251 -15.766 -32.075 1.00 9.02   ? 223 GLU B CB  1 
ATOM   785  C CG  . GLU A 1 96  ? 45.156 -14.568 -32.423 1.00 10.02  ? 223 GLU B CG  1 
ATOM   786  C CD  . GLU A 1 96  ? 45.765 -14.630 -33.809 1.00 10.02  ? 223 GLU B CD  1 
ATOM   787  O OE1 . GLU A 1 96  ? 46.243 -15.696 -34.211 1.00 9.63   ? 223 GLU B OE1 1 
ATOM   788  O OE2 . GLU A 1 96  ? 45.791 -13.587 -34.497 1.00 13.26  ? 223 GLU B OE2 1 
ATOM   789  N N   . LEU A 1 97  ? 41.325 -14.882 -30.905 1.00 10.13  ? 224 LEU B N   1 
ATOM   790  C CA  . LEU A 1 97  ? 40.233 -13.898 -30.875 1.00 10.23  ? 224 LEU B CA  1 
ATOM   791  C C   . LEU A 1 97  ? 39.453 -13.901 -29.571 1.00 9.79   ? 224 LEU B C   1 
ATOM   792  O O   . LEU A 1 97  ? 38.424 -13.262 -29.479 1.00 10.23  ? 224 LEU B O   1 
ATOM   793  C CB  . LEU A 1 97  ? 39.261 -14.088 -32.046 1.00 10.49  ? 224 LEU B CB  1 
ATOM   794  C CG  . LEU A 1 97  ? 39.743 -14.101 -33.497 1.00 11.15  ? 224 LEU B CG  1 
ATOM   795  C CD1 . LEU A 1 97  ? 38.683 -13.487 -34.394 1.00 10.83  ? 224 LEU B CD1 1 
ATOM   796  C CD2 . LEU A 1 97  ? 41.082 -13.427 -33.704 1.00 13.53  ? 224 LEU B CD2 1 
ATOM   797  N N   . GLY A 1 98  ? 39.950 -14.610 -28.562 1.00 9.78   ? 225 GLY B N   1 
ATOM   798  C CA  . GLY A 1 98  ? 39.321 -14.601 -27.238 1.00 9.08   ? 225 GLY B CA  1 
ATOM   799  C C   . GLY A 1 98  ? 38.357 -15.731 -26.954 1.00 9.08   ? 225 GLY B C   1 
ATOM   800  O O   . GLY A 1 98  ? 37.709 -15.735 -25.909 1.00 8.54   ? 225 GLY B O   1 
ATOM   801  N N   . ALA A 1 99  ? 38.245 -16.685 -27.882 1.00 9.08   ? 226 ALA B N   1 
ATOM   802  C CA  . ALA A 1 99  ? 37.399 -17.872 -27.667 1.00 9.31   ? 226 ALA B CA  1 
ATOM   803  C C   . ALA A 1 99  ? 37.919 -18.741 -26.510 1.00 9.93   ? 226 ALA B C   1 
ATOM   804  O O   . ALA A 1 99  ? 39.137 -18.902 -26.323 1.00 9.31   ? 226 ALA B O   1 
ATOM   805  C CB  . ALA A 1 99  ? 37.278 -18.692 -28.947 1.00 9.47   ? 226 ALA B CB  1 
ATOM   806  N N   . ARG A 1 100 ? 36.993 -19.261 -25.713 1.00 10.46  ? 227 ARG B N   1 
ATOM   807  C CA  . ARG A 1 100 ? 37.342 -20.172 -24.631 1.00 12.04  ? 227 ARG B CA  1 
ATOM   808  C C   . ARG A 1 100 ? 37.190 -21.608 -25.152 1.00 13.33  ? 227 ARG B C   1 
ATOM   809  O O   . ARG A 1 100 ? 36.118 -21.992 -25.577 1.00 12.91  ? 227 ARG B O   1 
ATOM   810  C CB  . ARG A 1 100 ? 36.476 -19.899 -23.398 1.00 11.27  ? 227 ARG B CB  1 
ATOM   811  C CG  . ARG A 1 100 ? 36.576 -18.454 -22.868 1.00 11.58  ? 227 ARG B CG  1 
ATOM   812  C CD  . ARG A 1 100 ? 35.452 -18.082 -21.858 1.00 12.02  ? 227 ARG B CD  1 
ATOM   813  N NE  . ARG A 1 100 ? 34.145 -17.875 -22.502 1.00 9.34   ? 227 ARG B NE  1 
ATOM   814  C CZ  . ARG A 1 100 ? 33.053 -17.378 -21.912 1.00 11.13  ? 227 ARG B CZ  1 
ATOM   815  N NH1 . ARG A 1 100 ? 33.045 -17.004 -20.633 1.00 8.72   ? 227 ARG B NH1 1 
ATOM   816  N NH2 . ARG A 1 100 ? 31.944 -17.236 -22.619 1.00 11.92  ? 227 ARG B NH2 1 
ATOM   817  N N   . PRO A 1 101 ? 38.287 -22.394 -25.149 1.00 15.46  ? 228 PRO B N   1 
ATOM   818  C CA  . PRO A 1 101 ? 38.367 -23.711 -25.823 1.00 16.74  ? 228 PRO B CA  1 
ATOM   819  C C   . PRO A 1 101 ? 37.297 -24.747 -25.437 1.00 18.00  ? 228 PRO B C   1 
ATOM   820  O O   . PRO A 1 101 ? 36.895 -25.575 -26.276 1.00 18.64  ? 228 PRO B O   1 
ATOM   821  C CB  . PRO A 1 101 ? 39.781 -24.206 -25.452 1.00 16.80  ? 228 PRO B CB  1 
ATOM   822  C CG  . PRO A 1 101 ? 40.560 -22.939 -25.240 1.00 17.08  ? 228 PRO B CG  1 
ATOM   823  C CD  . PRO A 1 101 ? 39.574 -22.032 -24.524 1.00 16.23  ? 228 PRO B CD  1 
ATOM   824  N N   . ASP A 1 102 ? 36.854 -24.687 -24.186 1.00 18.36  ? 229 ASP B N   1 
ATOM   825  C CA  . ASP A 1 102 ? 35.902 -25.635 -23.614 1.00 18.94  ? 229 ASP B CA  1 
ATOM   826  C C   . ASP A 1 102 ? 34.468 -25.097 -23.528 1.00 18.23  ? 229 ASP B C   1 
ATOM   827  O O   . ASP A 1 102 ? 33.561 -25.802 -23.067 1.00 18.53  ? 229 ASP B O   1 
ATOM   828  C CB  . ASP A 1 102 ? 36.375 -25.972 -22.210 1.00 20.36  ? 229 ASP B CB  1 
ATOM   829  C CG  . ASP A 1 102 ? 36.999 -24.773 -21.518 1.00 22.52  ? 229 ASP B CG  1 
ATOM   830  O OD1 . ASP A 1 102 ? 37.356 -24.882 -20.317 1.00 27.79  ? 229 ASP B OD1 1 
ATOM   831  O OD2 . ASP A 1 102 ? 37.132 -23.716 -22.183 1.00 24.34  ? 229 ASP B OD2 1 
ATOM   832  N N   . ALA A 1 103 ? 34.265 -23.857 -23.966 1.00 16.65  ? 230 ALA B N   1 
ATOM   833  C CA  . ALA A 1 103 ? 32.937 -23.248 -23.956 1.00 15.24  ? 230 ALA B CA  1 
ATOM   834  C C   . ALA A 1 103 ? 32.005 -23.966 -24.920 1.00 14.10  ? 230 ALA B C   1 
ATOM   835  O O   . ALA A 1 103 ? 32.454 -24.637 -25.858 1.00 13.89  ? 230 ALA B O   1 
ATOM   836  C CB  . ALA A 1 103 ? 33.019 -21.768 -24.300 1.00 14.89  ? 230 ALA B CB  1 
ATOM   837  N N   . THR A 1 104 ? 30.707 -23.835 -24.670 1.00 12.79  ? 231 THR B N   1 
ATOM   838  C CA  . THR A 1 104 ? 29.697 -24.257 -25.623 1.00 11.91  ? 231 THR B CA  1 
ATOM   839  C C   . THR A 1 104 ? 29.650 -23.225 -26.760 1.00 11.72  ? 231 THR B C   1 
ATOM   840  O O   . THR A 1 104 ? 29.522 -22.033 -26.515 1.00 11.45  ? 231 THR B O   1 
ATOM   841  C CB  . THR A 1 104 ? 28.322 -24.414 -24.933 1.00 11.72  ? 231 THR B CB  1 
ATOM   842  O OG1 . THR A 1 104 ? 28.396 -25.480 -23.976 1.00 11.45  ? 231 THR B OG1 1 
ATOM   843  C CG2 . THR A 1 104 ? 27.227 -24.732 -25.943 1.00 12.17  ? 231 THR B CG2 1 
ATOM   844  N N   . LYS A 1 105 ? 29.778 -23.687 -27.999 1.00 11.49  ? 232 LYS B N   1 
ATOM   845  C CA  . LYS A 1 105 ? 29.807 -22.776 -29.157 1.00 11.30  ? 232 LYS B CA  1 
ATOM   846  C C   . LYS A 1 105 ? 28.420 -22.626 -29.782 1.00 10.49  ? 232 LYS B C   1 
ATOM   847  O O   . LYS A 1 105 ? 27.729 -23.615 -30.031 1.00 10.43  ? 232 LYS B O   1 
ATOM   848  C CB  . LYS A 1 105 ? 30.825 -23.243 -30.198 1.00 11.07  ? 232 LYS B CB  1 
ATOM   849  C CG  . LYS A 1 105 ? 32.271 -23.279 -29.672 1.00 12.03  ? 232 LYS B CG  1 
ATOM   850  C CD  . LYS A 1 105 ? 33.266 -23.754 -30.739 1.00 12.61  ? 232 LYS B CD  1 
ATOM   851  C CE  . LYS A 1 105 ? 32.945 -25.168 -31.243 1.00 16.66  ? 232 LYS B CE  1 
ATOM   852  N NZ  . LYS A 1 105 ? 33.101 -26.218 -30.187 1.00 19.24  ? 232 LYS B NZ  1 
ATOM   853  N N   . VAL A 1 106 ? 28.002 -21.379 -29.992 1.00 9.91   ? 233 VAL B N   1 
ATOM   854  C CA  . VAL A 1 106 ? 26.685 -21.097 -30.565 1.00 8.98   ? 233 VAL B CA  1 
ATOM   855  C C   . VAL A 1 106 ? 26.830 -20.102 -31.710 1.00 8.50   ? 233 VAL B C   1 
ATOM   856  O O   . VAL A 1 106 ? 27.578 -19.137 -31.609 1.00 8.07   ? 233 VAL B O   1 
ATOM   857  C CB  . VAL A 1 106 ? 25.663 -20.593 -29.512 1.00 9.10   ? 233 VAL B CB  1 
ATOM   858  C CG1 . VAL A 1 106 ? 24.322 -20.280 -30.164 1.00 8.86   ? 233 VAL B CG1 1 
ATOM   859  C CG2 . VAL A 1 106 ? 25.472 -21.627 -28.372 1.00 9.79   ? 233 VAL B CG2 1 
ATOM   860  N N   . LEU A 1 107 ? 26.153 -20.394 -32.817 1.00 8.01   ? 234 LEU B N   1 
ATOM   861  C CA  . LEU A 1 107 ? 26.110 -19.498 -33.972 1.00 7.99   ? 234 LEU B CA  1 
ATOM   862  C C   . LEU A 1 107 ? 24.665 -19.036 -34.209 1.00 7.66   ? 234 LEU B C   1 
ATOM   863  O O   . LEU A 1 107 ? 23.722 -19.836 -34.184 1.00 7.38   ? 234 LEU B O   1 
ATOM   864  C CB  . LEU A 1 107 ? 26.702 -20.219 -35.186 1.00 8.26   ? 234 LEU B CB  1 
ATOM   865  C CG  . LEU A 1 107 ? 27.090 -19.668 -36.563 1.00 8.47   ? 234 LEU B CG  1 
ATOM   866  C CD1 . LEU A 1 107 ? 27.643 -18.267 -36.550 1.00 5.60   ? 234 LEU B CD1 1 
ATOM   867  C CD2 . LEU A 1 107 ? 28.124 -20.624 -37.157 1.00 8.37   ? 234 LEU B CD2 1 
ATOM   868  N N   . ILE A 1 108 ? 24.497 -17.735 -34.403 1.00 7.24   ? 235 ILE B N   1 
ATOM   869  C CA  . ILE A 1 108 ? 23.185 -17.159 -34.731 1.00 6.61   ? 235 ILE B CA  1 
ATOM   870  C C   . ILE A 1 108 ? 23.346 -16.533 -36.110 1.00 6.82   ? 235 ILE B C   1 
ATOM   871  O O   . ILE A 1 108 ? 23.961 -15.472 -36.248 1.00 6.78   ? 235 ILE B O   1 
ATOM   872  C CB  . ILE A 1 108 ? 22.741 -16.087 -33.679 1.00 7.16   ? 235 ILE B CB  1 
ATOM   873  C CG1 . ILE A 1 108 ? 22.788 -16.644 -32.235 1.00 6.99   ? 235 ILE B CG1 1 
ATOM   874  C CG2 . ILE A 1 108 ? 21.366 -15.441 -34.036 1.00 5.39   ? 235 ILE B CG2 1 
ATOM   875  C CD1 . ILE A 1 108 ? 21.789 -17.786 -31.931 1.00 6.31   ? 235 ILE B CD1 1 
ATOM   876  N N   . ILE A 1 109 ? 22.842 -17.223 -37.131 1.00 6.28   ? 236 ILE B N   1 
ATOM   877  C CA  . ILE A 1 109 ? 22.928 -16.736 -38.513 1.00 6.28   ? 236 ILE B CA  1 
ATOM   878  C C   . ILE A 1 109 ? 21.680 -15.929 -38.833 1.00 5.79   ? 236 ILE B C   1 
ATOM   879  O O   . ILE A 1 109 ? 20.561 -16.401 -38.648 1.00 7.35   ? 236 ILE B O   1 
ATOM   880  C CB  . ILE A 1 109 ? 23.047 -17.897 -39.530 1.00 5.95   ? 236 ILE B CB  1 
ATOM   881  C CG1 . ILE A 1 109 ? 24.170 -18.870 -39.129 1.00 7.18   ? 236 ILE B CG1 1 
ATOM   882  C CG2 . ILE A 1 109 ? 23.273 -17.355 -40.956 1.00 6.87   ? 236 ILE B CG2 1 
ATOM   883  C CD1 . ILE A 1 109 ? 23.952 -20.301 -39.633 1.00 8.68   ? 236 ILE B CD1 1 
ATOM   884  N N   . ILE A 1 110 ? 21.870 -14.716 -39.322 1.00 5.85   ? 237 ILE B N   1 
ATOM   885  C CA  . ILE A 1 110 ? 20.748 -13.866 -39.710 1.00 5.18   ? 237 ILE B CA  1 
ATOM   886  C C   . ILE A 1 110 ? 20.857 -13.512 -41.197 1.00 5.00   ? 237 ILE B C   1 
ATOM   887  O O   . ILE A 1 110 ? 21.857 -12.926 -41.633 1.00 5.27   ? 237 ILE B O   1 
ATOM   888  C CB  . ILE A 1 110 ? 20.685 -12.585 -38.841 1.00 5.41   ? 237 ILE B CB  1 
ATOM   889  C CG1 . ILE A 1 110 ? 20.626 -12.956 -37.347 1.00 5.66   ? 237 ILE B CG1 1 
ATOM   890  C CG2 . ILE A 1 110 ? 19.462 -11.731 -39.242 1.00 3.90   ? 237 ILE B CG2 1 
ATOM   891  C CD1 . ILE A 1 110 ? 20.884 -11.787 -36.384 1.00 5.47   ? 237 ILE B CD1 1 
ATOM   892  N N   . THR A 1 111 ? 19.833 -13.869 -41.969 1.00 4.96   ? 238 THR B N   1 
ATOM   893  C CA  . THR A 1 111 ? 19.898 -13.764 -43.429 1.00 5.42   ? 238 THR B CA  1 
ATOM   894  C C   . THR A 1 111 ? 18.579 -13.299 -44.083 1.00 6.02   ? 238 THR B C   1 
ATOM   895  O O   . THR A 1 111 ? 17.489 -13.530 -43.555 1.00 5.45   ? 238 THR B O   1 
ATOM   896  C CB  . THR A 1 111 ? 20.455 -15.082 -44.079 1.00 5.27   ? 238 THR B CB  1 
ATOM   897  O OG1 . THR A 1 111 ? 20.816 -14.841 -45.457 1.00 6.70   ? 238 THR B OG1 1 
ATOM   898  C CG2 . THR A 1 111 ? 19.438 -16.235 -44.003 1.00 4.04   ? 238 THR B CG2 1 
ATOM   899  N N   . ASP A 1 112 ? 18.692 -12.628 -45.228 1.00 6.52   ? 239 ASP B N   1 
ATOM   900  C CA  . ASP A 1 112 ? 17.502 -12.224 -45.973 1.00 7.19   ? 239 ASP B CA  1 
ATOM   901  C C   . ASP A 1 112 ? 17.449 -12.855 -47.370 1.00 7.64   ? 239 ASP B C   1 
ATOM   902  O O   . ASP A 1 112 ? 16.689 -12.409 -48.227 1.00 7.26   ? 239 ASP B O   1 
ATOM   903  C CB  . ASP A 1 112 ? 17.355 -10.688 -46.033 1.00 7.30   ? 239 ASP B CB  1 
ATOM   904  C CG  . ASP A 1 112 ? 18.128 -10.061 -47.179 1.00 8.08   ? 239 ASP B CG  1 
ATOM   905  O OD1 . ASP A 1 112 ? 19.210 -10.580 -47.521 1.00 7.86   ? 239 ASP B OD1 1 
ATOM   906  O OD2 . ASP A 1 112 ? 17.650 -9.037  -47.727 1.00 7.30   ? 239 ASP B OD2 1 
ATOM   907  N N   . GLY A 1 113 ? 18.243 -13.898 -47.584 1.00 7.69   ? 240 GLY B N   1 
ATOM   908  C CA  . GLY A 1 113 ? 18.239 -14.586 -48.879 1.00 9.11   ? 240 GLY B CA  1 
ATOM   909  C C   . GLY A 1 113 ? 18.938 -15.926 -48.883 1.00 9.44   ? 240 GLY B C   1 
ATOM   910  O O   . GLY A 1 113 ? 19.670 -16.263 -47.941 1.00 9.95   ? 240 GLY B O   1 
ATOM   911  N N   . GLU A 1 114 ? 18.705 -16.695 -49.947 1.00 9.89   ? 241 GLU B N   1 
ATOM   912  C CA  . GLU A 1 114 ? 19.355 -17.986 -50.121 1.00 10.26  ? 241 GLU B CA  1 
ATOM   913  C C   . GLU A 1 114 ? 20.844 -17.800 -50.430 1.00 10.36  ? 241 GLU B C   1 
ATOM   914  O O   . GLU A 1 114 ? 21.253 -16.764 -50.980 1.00 9.70   ? 241 GLU B O   1 
ATOM   915  C CB  . GLU A 1 114 ? 18.667 -18.798 -51.232 1.00 10.25  ? 241 GLU B CB  1 
ATOM   916  C CG  . GLU A 1 114 ? 17.177 -19.090 -50.998 1.00 10.16  ? 241 GLU B CG  1 
ATOM   917  C CD  . GLU A 1 114 ? 16.585 -20.033 -52.044 1.00 11.03  ? 241 GLU B CD  1 
ATOM   918  O OE1 . GLU A 1 114 ? 15.342 -20.074 -52.197 1.00 13.03  ? 241 GLU B OE1 1 
ATOM   919  O OE2 . GLU A 1 114 ? 17.365 -20.724 -52.727 1.00 12.09  ? 241 GLU B OE2 1 
ATOM   920  N N   . ALA A 1 115 ? 21.643 -18.811 -50.081 1.00 10.00  ? 242 ALA B N   1 
ATOM   921  C CA  . ALA A 1 115 ? 23.085 -18.799 -50.333 1.00 9.86   ? 242 ALA B CA  1 
ATOM   922  C C   . ALA A 1 115 ? 23.432 -18.637 -51.816 1.00 10.20  ? 242 ALA B C   1 
ATOM   923  O O   . ALA A 1 115 ? 22.750 -19.193 -52.692 1.00 9.36   ? 242 ALA B O   1 
ATOM   924  C CB  . ALA A 1 115 ? 23.723 -20.070 -49.792 1.00 9.77   ? 242 ALA B CB  1 
ATOM   925  N N   . THR A 1 116 ? 24.491 -17.871 -52.080 1.00 10.14  ? 243 THR B N   1 
ATOM   926  C CA  . THR A 1 116 ? 25.017 -17.705 -53.441 1.00 11.11  ? 243 THR B CA  1 
ATOM   927  C C   . THR A 1 116 ? 26.208 -18.643 -53.732 1.00 11.83  ? 243 THR B C   1 
ATOM   928  O O   . THR A 1 116 ? 26.702 -18.713 -54.868 1.00 12.77  ? 243 THR B O   1 
ATOM   929  C CB  . THR A 1 116 ? 25.388 -16.224 -53.746 1.00 10.89  ? 243 THR B CB  1 
ATOM   930  O OG1 . THR A 1 116 ? 26.156 -15.667 -52.672 1.00 10.80  ? 243 THR B OG1 1 
ATOM   931  C CG2 . THR A 1 116 ? 24.125 -15.371 -53.954 1.00 11.21  ? 243 THR B CG2 1 
ATOM   932  N N   . ASP A 1 117 ? 26.672 -19.350 -52.710 1.00 11.97  ? 244 ASP B N   1 
ATOM   933  C CA  . ASP A 1 117 ? 27.740 -20.334 -52.882 1.00 12.30  ? 244 ASP B CA  1 
ATOM   934  C C   . ASP A 1 117 ? 27.274 -21.761 -52.581 1.00 13.14  ? 244 ASP B C   1 
ATOM   935  O O   . ASP A 1 117 ? 26.076 -22.018 -52.406 1.00 13.65  ? 244 ASP B O   1 
ATOM   936  C CB  . ASP A 1 117 ? 28.997 -19.951 -52.078 1.00 11.76  ? 244 ASP B CB  1 
ATOM   937  C CG  . ASP A 1 117 ? 28.758 -19.898 -50.574 1.00 10.18  ? 244 ASP B CG  1 
ATOM   938  O OD1 . ASP A 1 117 ? 27.614 -20.063 -50.118 1.00 8.73   ? 244 ASP B OD1 1 
ATOM   939  O OD2 . ASP A 1 117 ? 29.739 -19.704 -49.842 1.00 7.47   ? 244 ASP B OD2 1 
ATOM   940  N N   . SER A 1 118 ? 28.223 -22.685 -52.534 1.00 13.73  ? 245 SER B N   1 
ATOM   941  C CA  . SER A 1 118 ? 27.926 -24.088 -52.306 1.00 14.58  ? 245 SER B CA  1 
ATOM   942  C C   . SER A 1 118 ? 29.037 -24.758 -51.500 1.00 14.39  ? 245 SER B C   1 
ATOM   943  O O   . SER A 1 118 ? 30.043 -24.129 -51.198 1.00 14.29  ? 245 SER B O   1 
ATOM   944  C CB  . SER A 1 118 ? 27.751 -24.783 -53.654 1.00 15.09  ? 245 SER B CB  1 
ATOM   945  O OG  . SER A 1 118 ? 28.883 -24.539 -54.476 1.00 17.09  ? 245 SER B OG  1 
ATOM   946  N N   . GLY A 1 119 ? 28.834 -26.028 -51.146 1.00 14.79  ? 246 GLY B N   1 
ATOM   947  C CA  . GLY A 1 119 ? 29.834 -26.823 -50.438 1.00 14.84  ? 246 GLY B CA  1 
ATOM   948  C C   . GLY A 1 119 ? 29.248 -27.572 -49.260 1.00 14.92  ? 246 GLY B C   1 
ATOM   949  O O   . GLY A 1 119 ? 28.185 -28.192 -49.363 1.00 15.41  ? 246 GLY B O   1 
ATOM   950  N N   . ASN A 1 120 ? 29.943 -27.521 -48.130 1.00 15.13  ? 247 ASN B N   1 
ATOM   951  C CA  . ASN A 1 120 ? 29.465 -28.165 -46.912 1.00 15.22  ? 247 ASN B CA  1 
ATOM   952  C C   . ASN A 1 120 ? 29.896 -27.372 -45.678 1.00 14.92  ? 247 ASN B C   1 
ATOM   953  O O   . ASN A 1 120 ? 30.731 -26.465 -45.776 1.00 14.87  ? 247 ASN B O   1 
ATOM   954  C CB  . ASN A 1 120 ? 29.973 -29.615 -46.833 1.00 15.85  ? 247 ASN B CB  1 
ATOM   955  C CG  . ASN A 1 120 ? 31.472 -29.698 -46.593 1.00 16.19  ? 247 ASN B CG  1 
ATOM   956  O OD1 . ASN A 1 120 ? 31.953 -29.436 -45.488 1.00 19.17  ? 247 ASN B OD1 1 
ATOM   957  N ND2 . ASN A 1 120 ? 32.214 -30.061 -47.620 1.00 16.99  ? 247 ASN B ND2 1 
ATOM   958  N N   . ILE A 1 121 ? 29.335 -27.722 -44.525 1.00 14.84  ? 248 ILE B N   1 
ATOM   959  C CA  . ILE A 1 121 ? 29.713 -27.069 -43.264 1.00 14.90  ? 248 ILE B CA  1 
ATOM   960  C C   . ILE A 1 121 ? 30.205 -28.089 -42.235 1.00 15.01  ? 248 ILE B C   1 
ATOM   961  O O   . ILE A 1 121 ? 29.963 -27.965 -41.032 1.00 14.71  ? 248 ILE B O   1 
ATOM   962  C CB  . ILE A 1 121 ? 28.596 -26.110 -42.691 1.00 14.85  ? 248 ILE B CB  1 
ATOM   963  C CG1 . ILE A 1 121 ? 27.275 -26.840 -42.461 1.00 14.53  ? 248 ILE B CG1 1 
ATOM   964  C CG2 . ILE A 1 121 ? 28.389 -24.896 -43.616 1.00 14.95  ? 248 ILE B CG2 1 
ATOM   965  C CD1 . ILE A 1 121 ? 26.341 -26.119 -41.500 1.00 14.85  ? 248 ILE B CD1 1 
ATOM   966  N N   . ASP A 1 122 ? 30.913 -29.103 -42.732 1.00 15.30  ? 249 ASP B N   1 
ATOM   967  C CA  . ASP A 1 122 ? 31.497 -30.137 -41.882 1.00 15.55  ? 249 ASP B CA  1 
ATOM   968  C C   . ASP A 1 122 ? 32.329 -29.529 -40.742 1.00 15.61  ? 249 ASP B C   1 
ATOM   969  O O   . ASP A 1 122 ? 32.302 -30.025 -39.616 1.00 16.18  ? 249 ASP B O   1 
ATOM   970  C CB  . ASP A 1 122 ? 32.326 -31.111 -42.729 1.00 15.62  ? 249 ASP B CB  1 
ATOM   971  C CG  . ASP A 1 122 ? 31.460 -31.999 -43.628 1.00 16.36  ? 249 ASP B CG  1 
ATOM   972  O OD1 . ASP A 1 122 ? 30.213 -31.991 -43.497 1.00 18.16  ? 249 ASP B OD1 1 
ATOM   973  O OD2 . ASP A 1 122 ? 32.025 -32.724 -44.470 1.00 18.63  ? 249 ASP B OD2 1 
ATOM   974  N N   . ALA A 1 123 ? 33.014 -28.424 -41.028 1.00 15.43  ? 250 ALA B N   1 
ATOM   975  C CA  . ALA A 1 123 ? 33.913 -27.791 -40.075 1.00 15.76  ? 250 ALA B CA  1 
ATOM   976  C C   . ALA A 1 123 ? 33.191 -27.113 -38.913 1.00 15.86  ? 250 ALA B C   1 
ATOM   977  O O   . ALA A 1 123 ? 33.825 -26.755 -37.929 1.00 15.54  ? 250 ALA B O   1 
ATOM   978  C CB  . ALA A 1 123 ? 34.832 -26.794 -40.790 1.00 15.77  ? 250 ALA B CB  1 
ATOM   979  N N   . ALA A 1 124 ? 31.869 -26.968 -39.039 1.00 16.17  ? 251 ALA B N   1 
ATOM   980  C CA  . ALA A 1 124 ? 31.031 -26.295 -38.046 1.00 16.40  ? 251 ALA B CA  1 
ATOM   981  C C   . ALA A 1 124 ? 30.112 -27.249 -37.259 1.00 16.87  ? 251 ALA B C   1 
ATOM   982  O O   . ALA A 1 124 ? 29.165 -26.804 -36.600 1.00 16.56  ? 251 ALA B O   1 
ATOM   983  C CB  . ALA A 1 124 ? 30.221 -25.189 -38.721 1.00 15.89  ? 251 ALA B CB  1 
ATOM   984  N N   . LYS A 1 125 ? 30.417 -28.552 -37.302 1.00 17.37  ? 252 LYS B N   1 
ATOM   985  C CA  . LYS A 1 125 ? 29.578 -29.587 -36.683 1.00 18.05  ? 252 LYS B CA  1 
ATOM   986  C C   . LYS A 1 125 ? 29.485 -29.545 -35.147 1.00 18.39  ? 252 LYS B C   1 
ATOM   987  O O   . LYS A 1 125 ? 28.509 -30.031 -34.549 1.00 18.73  ? 252 LYS B O   1 
ATOM   988  C CB  . LYS A 1 125 ? 30.041 -30.978 -37.124 1.00 18.46  ? 252 LYS B CB  1 
ATOM   989  N N   . ASP A 1 126 ? 30.496 -28.958 -34.521 1.00 18.36  ? 253 ASP B N   1 
ATOM   990  C CA  . ASP A 1 126 ? 30.582 -28.887 -33.072 1.00 18.39  ? 253 ASP B CA  1 
ATOM   991  C C   . ASP A 1 126 ? 29.896 -27.620 -32.545 1.00 17.33  ? 253 ASP B C   1 
ATOM   992  O O   . ASP A 1 126 ? 29.876 -27.374 -31.336 1.00 17.83  ? 253 ASP B O   1 
ATOM   993  C CB  . ASP A 1 126 ? 32.047 -28.872 -32.654 1.00 19.12  ? 253 ASP B CB  1 
ATOM   994  C CG  . ASP A 1 126 ? 32.284 -29.605 -31.365 1.00 21.66  ? 253 ASP B CG  1 
ATOM   995  O OD1 . ASP A 1 126 ? 32.293 -30.861 -31.404 1.00 25.67  ? 253 ASP B OD1 1 
ATOM   996  O OD2 . ASP A 1 126 ? 32.483 -28.936 -30.325 1.00 23.23  ? 253 ASP B OD2 1 
ATOM   997  N N   . ILE A 1 127 ? 29.357 -26.821 -33.461 1.00 15.54  ? 254 ILE B N   1 
ATOM   998  C CA  . ILE A 1 127 ? 28.646 -25.592 -33.109 1.00 13.91  ? 254 ILE B CA  1 
ATOM   999  C C   . ILE A 1 127 ? 27.130 -25.841 -33.149 1.00 13.28  ? 254 ILE B C   1 
ATOM   1000 O O   . ILE A 1 127 ? 26.630 -26.488 -34.070 1.00 12.90  ? 254 ILE B O   1 
ATOM   1001 C CB  . ILE A 1 127 ? 29.050 -24.419 -34.051 1.00 13.82  ? 254 ILE B CB  1 
ATOM   1002 C CG1 . ILE A 1 127 ? 30.583 -24.254 -34.063 1.00 13.94  ? 254 ILE B CG1 1 
ATOM   1003 C CG2 . ILE A 1 127 ? 28.365 -23.104 -33.628 1.00 12.89  ? 254 ILE B CG2 1 
ATOM   1004 C CD1 . ILE A 1 127 ? 31.144 -23.576 -35.345 1.00 13.12  ? 254 ILE B CD1 1 
ATOM   1005 N N   . ILE A 1 128 ? 26.422 -25.359 -32.125 1.00 12.12  ? 255 ILE B N   1 
ATOM   1006 C CA  . ILE A 1 128 ? 24.962 -25.294 -32.134 1.00 11.44  ? 255 ILE B CA  1 
ATOM   1007 C C   . ILE A 1 128 ? 24.566 -24.109 -33.017 1.00 10.82  ? 255 ILE B C   1 
ATOM   1008 O O   . ILE A 1 128 ? 24.849 -22.964 -32.675 1.00 10.87  ? 255 ILE B O   1 
ATOM   1009 C CB  . ILE A 1 128 ? 24.393 -25.086 -30.715 1.00 11.34  ? 255 ILE B CB  1 
ATOM   1010 C CG1 . ILE A 1 128 ? 24.970 -26.113 -29.733 1.00 12.32  ? 255 ILE B CG1 1 
ATOM   1011 C CG2 . ILE A 1 128 ? 22.853 -25.109 -30.727 1.00 11.90  ? 255 ILE B CG2 1 
ATOM   1012 C CD1 . ILE A 1 128 ? 24.580 -25.869 -28.265 1.00 11.56  ? 255 ILE B CD1 1 
ATOM   1013 N N   . ARG A 1 129 ? 23.929 -24.388 -34.153 1.00 10.05  ? 256 ARG B N   1 
ATOM   1014 C CA  . ARG A 1 129 ? 23.617 -23.351 -35.146 1.00 9.33   ? 256 ARG B CA  1 
ATOM   1015 C C   . ARG A 1 129 ? 22.116 -23.017 -35.244 1.00 8.44   ? 256 ARG B C   1 
ATOM   1016 O O   . ARG A 1 129 ? 21.285 -23.897 -35.507 1.00 8.74   ? 256 ARG B O   1 
ATOM   1017 C CB  . ARG A 1 129 ? 24.144 -23.771 -36.522 1.00 9.05   ? 256 ARG B CB  1 
ATOM   1018 C CG  . ARG A 1 129 ? 25.673 -23.870 -36.622 1.00 11.18  ? 256 ARG B CG  1 
ATOM   1019 C CD  . ARG A 1 129 ? 26.096 -24.992 -37.549 1.00 13.24  ? 256 ARG B CD  1 
ATOM   1020 N NE  . ARG A 1 129 ? 26.141 -26.273 -36.835 1.00 18.38  ? 256 ARG B NE  1 
ATOM   1021 C CZ  . ARG A 1 129 ? 25.516 -27.382 -37.212 1.00 19.32  ? 256 ARG B CZ  1 
ATOM   1022 N NH1 . ARG A 1 129 ? 24.783 -27.415 -38.321 1.00 20.20  ? 256 ARG B NH1 1 
ATOM   1023 N NH2 . ARG A 1 129 ? 25.639 -28.474 -36.475 1.00 22.36  ? 256 ARG B NH2 1 
ATOM   1024 N N   . TYR A 1 130 ? 21.789 -21.745 -35.037 1.00 7.43   ? 257 TYR B N   1 
ATOM   1025 C CA  . TYR A 1 130 ? 20.446 -21.207 -35.277 1.00 6.64   ? 257 TYR B CA  1 
ATOM   1026 C C   . TYR A 1 130 ? 20.485 -20.314 -36.514 1.00 6.68   ? 257 TYR B C   1 
ATOM   1027 O O   . TYR A 1 130 ? 21.509 -19.660 -36.799 1.00 5.89   ? 257 TYR B O   1 
ATOM   1028 C CB  . TYR A 1 130 ? 19.971 -20.346 -34.098 1.00 7.45   ? 257 TYR B CB  1 
ATOM   1029 C CG  . TYR A 1 130 ? 19.743 -21.088 -32.798 1.00 7.69   ? 257 TYR B CG  1 
ATOM   1030 C CD1 . TYR A 1 130 ? 20.820 -21.419 -31.974 1.00 6.31   ? 257 TYR B CD1 1 
ATOM   1031 C CD2 . TYR A 1 130 ? 18.453 -21.436 -32.382 1.00 7.03   ? 257 TYR B CD2 1 
ATOM   1032 C CE1 . TYR A 1 130 ? 20.634 -22.102 -30.775 1.00 6.80   ? 257 TYR B CE1 1 
ATOM   1033 C CE2 . TYR A 1 130 ? 18.248 -22.123 -31.172 1.00 8.16   ? 257 TYR B CE2 1 
ATOM   1034 C CZ  . TYR A 1 130 ? 19.355 -22.455 -30.374 1.00 8.04   ? 257 TYR B CZ  1 
ATOM   1035 O OH  . TYR A 1 130 ? 19.191 -23.131 -29.168 1.00 8.43   ? 257 TYR B OH  1 
ATOM   1036 N N   . ILE A 1 131 ? 19.371 -20.249 -37.231 1.00 6.38   ? 258 ILE B N   1 
ATOM   1037 C CA  . ILE A 1 131 ? 19.299 -19.400 -38.429 1.00 6.33   ? 258 ILE B CA  1 
ATOM   1038 C C   . ILE A 1 131 ? 17.966 -18.678 -38.471 1.00 6.26   ? 258 ILE B C   1 
ATOM   1039 O O   . ILE A 1 131 ? 16.915 -19.296 -38.321 1.00 6.19   ? 258 ILE B O   1 
ATOM   1040 C CB  . ILE A 1 131 ? 19.589 -20.173 -39.770 1.00 6.38   ? 258 ILE B CB  1 
ATOM   1041 C CG1 . ILE A 1 131 ? 19.676 -19.189 -40.959 1.00 6.34   ? 258 ILE B CG1 1 
ATOM   1042 C CG2 . ILE A 1 131 ? 18.526 -21.246 -40.042 1.00 5.82   ? 258 ILE B CG2 1 
ATOM   1043 C CD1 . ILE A 1 131 ? 20.403 -19.758 -42.219 1.00 6.08   ? 258 ILE B CD1 1 
ATOM   1044 N N   . ILE A 1 132 ? 18.040 -17.355 -38.622 1.00 6.02   ? 259 ILE B N   1 
ATOM   1045 C CA  . ILE A 1 132 ? 16.866 -16.508 -38.783 1.00 6.08   ? 259 ILE B CA  1 
ATOM   1046 C C   . ILE A 1 132 ? 16.847 -16.038 -40.218 1.00 6.09   ? 259 ILE B C   1 
ATOM   1047 O O   . ILE A 1 132 ? 17.767 -15.346 -40.648 1.00 6.06   ? 259 ILE B O   1 
ATOM   1048 C CB  . ILE A 1 132 ? 16.924 -15.276 -37.867 1.00 5.89   ? 259 ILE B CB  1 
ATOM   1049 C CG1 . ILE A 1 132 ? 17.235 -15.713 -36.424 1.00 6.30   ? 259 ILE B CG1 1 
ATOM   1050 C CG2 . ILE A 1 132 ? 15.632 -14.411 -38.024 1.00 5.49   ? 259 ILE B CG2 1 
ATOM   1051 C CD1 . ILE A 1 132 ? 17.500 -14.575 -35.468 1.00 7.50   ? 259 ILE B CD1 1 
ATOM   1052 N N   . GLY A 1 133 ? 15.825 -16.442 -40.965 1.00 6.28   ? 260 GLY B N   1 
ATOM   1053 C CA  . GLY A 1 133 ? 15.628 -15.943 -42.335 1.00 6.33   ? 260 GLY B CA  1 
ATOM   1054 C C   . GLY A 1 133 ? 14.572 -14.852 -42.314 1.00 6.33   ? 260 GLY B C   1 
ATOM   1055 O O   . GLY A 1 133 ? 13.532 -15.039 -41.723 1.00 6.92   ? 260 GLY B O   1 
ATOM   1056 N N   . ILE A 1 134 ? 14.826 -13.719 -42.963 1.00 6.06   ? 261 ILE B N   1 
ATOM   1057 C CA  . ILE A 1 134 ? 13.911 -12.560 -42.875 1.00 6.52   ? 261 ILE B CA  1 
ATOM   1058 C C   . ILE A 1 134 ? 13.460 -12.025 -44.235 1.00 6.91   ? 261 ILE B C   1 
ATOM   1059 O O   . ILE A 1 134 ? 14.284 -11.836 -45.140 1.00 6.52   ? 261 ILE B O   1 
ATOM   1060 C CB  . ILE A 1 134 ? 14.548 -11.380 -42.078 1.00 6.25   ? 261 ILE B CB  1 
ATOM   1061 C CG1 . ILE A 1 134 ? 15.206 -11.870 -40.775 1.00 5.60   ? 261 ILE B CG1 1 
ATOM   1062 C CG2 . ILE A 1 134 ? 13.508 -10.274 -41.800 1.00 7.94   ? 261 ILE B CG2 1 
ATOM   1063 C CD1 . ILE A 1 134 ? 16.006 -10.776 -40.051 1.00 5.96   ? 261 ILE B CD1 1 
ATOM   1064 N N   . GLY A 1 135 ? 12.149 -11.802 -44.367 1.00 7.80   ? 262 GLY B N   1 
ATOM   1065 C CA  . GLY A 1 135 ? 11.582 -11.038 -45.476 1.00 8.27   ? 262 GLY B CA  1 
ATOM   1066 C C   . GLY A 1 135 ? 10.936 -11.807 -46.613 1.00 9.00   ? 262 GLY B C   1 
ATOM   1067 O O   . GLY A 1 135 ? 10.768 -13.026 -46.553 1.00 9.19   ? 262 GLY B O   1 
ATOM   1068 N N   . LYS A 1 136 ? 10.595 -11.079 -47.674 1.00 9.06   ? 263 LYS B N   1 
ATOM   1069 C CA  . LYS A 1 136 ? 9.844  -11.644 -48.798 1.00 9.64   ? 263 LYS B CA  1 
ATOM   1070 C C   . LYS A 1 136 ? 10.603 -12.713 -49.582 1.00 9.22   ? 263 LYS B C   1 
ATOM   1071 O O   . LYS A 1 136 ? 9.983  -13.463 -50.336 1.00 9.27   ? 263 LYS B O   1 
ATOM   1072 C CB  . LYS A 1 136 ? 9.362  -10.542 -49.753 1.00 10.23  ? 263 LYS B CB  1 
ATOM   1073 C CG  . LYS A 1 136 ? 8.333  -9.591  -49.137 1.00 12.40  ? 263 LYS B CG  1 
ATOM   1074 C CD  . LYS A 1 136 ? 7.835  -8.590  -50.155 1.00 13.60  ? 263 LYS B CD  1 
ATOM   1075 C CE  . LYS A 1 136 ? 8.066  -7.145  -49.701 1.00 15.67  ? 263 LYS B CE  1 
ATOM   1076 N NZ  . LYS A 1 136 ? 7.375  -6.799  -48.439 1.00 17.31  ? 263 LYS B NZ  1 
ATOM   1077 N N   . HIS A 1 137 ? 11.927 -12.781 -49.413 1.00 8.50   ? 264 HIS B N   1 
ATOM   1078 C CA  . HIS A 1 137 ? 12.725 -13.829 -50.076 1.00 8.58   ? 264 HIS B CA  1 
ATOM   1079 C C   . HIS A 1 137 ? 12.395 -15.226 -49.546 1.00 8.54   ? 264 HIS B C   1 
ATOM   1080 O O   . HIS A 1 137 ? 12.713 -16.222 -50.197 1.00 8.69   ? 264 HIS B O   1 
ATOM   1081 C CB  . HIS A 1 137 ? 14.235 -13.565 -49.974 1.00 7.81   ? 264 HIS B CB  1 
ATOM   1082 C CG  . HIS A 1 137 ? 14.706 -12.426 -50.826 1.00 8.27   ? 264 HIS B CG  1 
ATOM   1083 N ND1 . HIS A 1 137 ? 15.442 -12.610 -51.975 1.00 8.39   ? 264 HIS B ND1 1 
ATOM   1084 C CD2 . HIS A 1 137 ? 14.529 -11.089 -50.702 1.00 7.92   ? 264 HIS B CD2 1 
ATOM   1085 C CE1 . HIS A 1 137 ? 15.699 -11.435 -52.523 1.00 8.84   ? 264 HIS B CE1 1 
ATOM   1086 N NE2 . HIS A 1 137 ? 15.155 -10.495 -51.771 1.00 6.53   ? 264 HIS B NE2 1 
ATOM   1087 N N   . PHE A 1 138 ? 11.741 -15.283 -48.385 1.00 8.67   ? 265 PHE B N   1 
ATOM   1088 C CA  . PHE A 1 138 ? 11.369 -16.553 -47.741 1.00 9.40   ? 265 PHE B CA  1 
ATOM   1089 C C   . PHE A 1 138 ? 9.866  -16.779 -47.624 1.00 9.84   ? 265 PHE B C   1 
ATOM   1090 O O   . PHE A 1 138 ? 9.387  -17.342 -46.636 1.00 10.55  ? 265 PHE B O   1 
ATOM   1091 C CB  . PHE A 1 138 ? 12.039 -16.703 -46.376 1.00 8.61   ? 265 PHE B CB  1 
ATOM   1092 C CG  . PHE A 1 138 ? 13.526 -16.737 -46.452 1.00 8.70   ? 265 PHE B CG  1 
ATOM   1093 C CD1 . PHE A 1 138 ? 14.270 -15.661 -45.996 1.00 6.94   ? 265 PHE B CD1 1 
ATOM   1094 C CD2 . PHE A 1 138 ? 14.183 -17.826 -47.018 1.00 7.96   ? 265 PHE B CD2 1 
ATOM   1095 C CE1 . PHE A 1 138 ? 15.664 -15.671 -46.076 1.00 7.81   ? 265 PHE B CE1 1 
ATOM   1096 C CE2 . PHE A 1 138 ? 15.573 -17.840 -47.116 1.00 6.92   ? 265 PHE B CE2 1 
ATOM   1097 C CZ  . PHE A 1 138 ? 16.310 -16.758 -46.630 1.00 7.26   ? 265 PHE B CZ  1 
ATOM   1098 N N   . GLN A 1 139 ? 9.140  -16.353 -48.647 1.00 10.58  ? 266 GLN B N   1 
ATOM   1099 C CA  . GLN A 1 139 ? 7.702  -16.566 -48.744 1.00 11.49  ? 266 GLN B CA  1 
ATOM   1100 C C   . GLN A 1 139 ? 7.335  -18.029 -48.925 1.00 10.72  ? 266 GLN B C   1 
ATOM   1101 O O   . GLN A 1 139 ? 6.343  -18.483 -48.367 1.00 10.79  ? 266 GLN B O   1 
ATOM   1102 C CB  . GLN A 1 139 ? 7.102  -15.746 -49.901 1.00 11.28  ? 266 GLN B CB  1 
ATOM   1103 C CG  . GLN A 1 139 ? 6.562  -14.396 -49.473 1.00 13.51  ? 266 GLN B CG  1 
ATOM   1104 C CD  . GLN A 1 139 ? 6.186  -13.488 -50.646 1.00 13.79  ? 266 GLN B CD  1 
ATOM   1105 O OE1 . GLN A 1 139 ? 6.835  -12.466 -50.881 1.00 17.54  ? 266 GLN B OE1 1 
ATOM   1106 N NE2 . GLN A 1 139 ? 5.145  -13.862 -51.385 1.00 15.03  ? 266 GLN B NE2 1 
ATOM   1107 N N   . THR A 1 140 ? 8.112  -18.755 -49.725 1.00 10.24  ? 267 THR B N   1 
ATOM   1108 C CA  . THR A 1 140 ? 7.736  -20.123 -50.069 1.00 9.73   ? 267 THR B CA  1 
ATOM   1109 C C   . THR A 1 140 ? 8.331  -21.105 -49.056 1.00 9.56   ? 267 THR B C   1 
ATOM   1110 O O   . THR A 1 140 ? 9.377  -20.837 -48.444 1.00 9.16   ? 267 THR B O   1 
ATOM   1111 C CB  . THR A 1 140 ? 8.146  -20.524 -51.515 1.00 9.62   ? 267 THR B CB  1 
ATOM   1112 O OG1 . THR A 1 140 ? 9.569  -20.644 -51.615 1.00 8.66   ? 267 THR B OG1 1 
ATOM   1113 C CG2 . THR A 1 140 ? 7.638  -19.506 -52.570 1.00 9.50   ? 267 THR B CG2 1 
ATOM   1114 N N   . LYS A 1 141 ? 7.653  -22.235 -48.892 1.00 9.00   ? 268 LYS B N   1 
ATOM   1115 C CA  . LYS A 1 141 ? 8.138  -23.342 -48.076 1.00 9.41   ? 268 LYS B CA  1 
ATOM   1116 C C   . LYS A 1 141 ? 9.509  -23.821 -48.596 1.00 8.97   ? 268 LYS B C   1 
ATOM   1117 O O   . LYS A 1 141 ? 10.440 -24.063 -47.813 1.00 8.90   ? 268 LYS B O   1 
ATOM   1118 C CB  . LYS A 1 141 ? 7.096  -24.471 -48.088 1.00 9.38   ? 268 LYS B CB  1 
ATOM   1119 C CG  . LYS A 1 141 ? 7.524  -25.801 -47.463 1.00 11.04  ? 268 LYS B CG  1 
ATOM   1120 C CD  . LYS A 1 141 ? 7.381  -25.819 -45.954 1.00 12.96  ? 268 LYS B CD  1 
ATOM   1121 C CE  . LYS A 1 141 ? 7.971  -27.119 -45.380 1.00 11.68  ? 268 LYS B CE  1 
ATOM   1122 N NZ  . LYS A 1 141 ? 8.172  -27.027 -43.909 1.00 15.90  ? 268 LYS B NZ  1 
ATOM   1123 N N   . GLU A 1 142 ? 9.635  -23.920 -49.917 1.00 8.56   ? 269 GLU B N   1 
ATOM   1124 C CA  . GLU A 1 142 ? 10.888 -24.339 -50.549 1.00 8.68   ? 269 GLU B CA  1 
ATOM   1125 C C   . GLU A 1 142 ? 12.075 -23.445 -50.165 1.00 8.42   ? 269 GLU B C   1 
ATOM   1126 O O   . GLU A 1 142 ? 13.149 -23.955 -49.839 1.00 8.27   ? 269 GLU B O   1 
ATOM   1127 C CB  . GLU A 1 142 ? 10.744 -24.417 -52.077 1.00 8.80   ? 269 GLU B CB  1 
ATOM   1128 C CG  . GLU A 1 142 ? 9.827  -25.523 -52.577 1.00 11.45  ? 269 GLU B CG  1 
ATOM   1129 C CD  . GLU A 1 142 ? 8.335  -25.240 -52.368 1.00 17.62  ? 269 GLU B CD  1 
ATOM   1130 O OE1 . GLU A 1 142 ? 7.947  -24.068 -52.159 1.00 17.90  ? 269 GLU B OE1 1 
ATOM   1131 O OE2 . GLU A 1 142 ? 7.534  -26.207 -52.414 1.00 21.24  ? 269 GLU B OE2 1 
ATOM   1132 N N   . SER A 1 143 ? 11.879 -22.126 -50.174 1.00 8.06   ? 270 SER B N   1 
ATOM   1133 C CA  . SER A 1 143 ? 12.941 -21.188 -49.772 1.00 8.22   ? 270 SER B CA  1 
ATOM   1134 C C   . SER A 1 143 ? 13.312 -21.294 -48.291 1.00 8.90   ? 270 SER B C   1 
ATOM   1135 O O   . SER A 1 143 ? 14.483 -21.152 -47.910 1.00 9.91   ? 270 SER B O   1 
ATOM   1136 C CB  . SER A 1 143 ? 12.544 -19.752 -50.088 1.00 7.69   ? 270 SER B CB  1 
ATOM   1137 O OG  . SER A 1 143 ? 11.552 -19.303 -49.188 1.00 6.33   ? 270 SER B OG  1 
ATOM   1138 N N   . GLN A 1 144 ? 12.320 -21.512 -47.445 1.00 8.99   ? 271 GLN B N   1 
ATOM   1139 C CA  . GLN A 1 144 ? 12.592 -21.743 -46.028 1.00 9.30   ? 271 GLN B CA  1 
ATOM   1140 C C   . GLN A 1 144 ? 13.406 -23.032 -45.836 1.00 9.86   ? 271 GLN B C   1 
ATOM   1141 O O   . GLN A 1 144 ? 14.373 -23.061 -45.082 1.00 9.79   ? 271 GLN B O   1 
ATOM   1142 C CB  . GLN A 1 144 ? 11.280 -21.776 -45.245 1.00 9.08   ? 271 GLN B CB  1 
ATOM   1143 C CG  . GLN A 1 144 ? 10.503 -20.438 -45.341 1.00 9.33   ? 271 GLN B CG  1 
ATOM   1144 C CD  . GLN A 1 144 ? 9.031  -20.563 -45.022 1.00 7.59   ? 271 GLN B CD  1 
ATOM   1145 O OE1 . GLN A 1 144 ? 8.608  -21.513 -44.376 1.00 10.40  ? 271 GLN B OE1 1 
ATOM   1146 N NE2 . GLN A 1 144 ? 8.242  -19.586 -45.460 1.00 6.08   ? 271 GLN B NE2 1 
ATOM   1147 N N   . GLU A 1 145 ? 13.017 -24.085 -46.549 1.00 10.36  ? 272 GLU B N   1 
ATOM   1148 C CA  . GLU A 1 145 ? 13.685 -25.382 -46.459 1.00 11.38  ? 272 GLU B CA  1 
ATOM   1149 C C   . GLU A 1 145 ? 15.179 -25.347 -46.787 1.00 10.90  ? 272 GLU B C   1 
ATOM   1150 O O   . GLU A 1 145 ? 15.940 -26.126 -46.227 1.00 10.25  ? 272 GLU B O   1 
ATOM   1151 C CB  . GLU A 1 145 ? 12.986 -26.413 -47.346 1.00 11.61  ? 272 GLU B CB  1 
ATOM   1152 C CG  . GLU A 1 145 ? 12.035 -27.306 -46.603 1.00 16.05  ? 272 GLU B CG  1 
ATOM   1153 C CD  . GLU A 1 145 ? 12.749 -28.367 -45.786 1.00 20.32  ? 272 GLU B CD  1 
ATOM   1154 O OE1 . GLU A 1 145 ? 13.894 -28.732 -46.133 1.00 23.37  ? 272 GLU B OE1 1 
ATOM   1155 O OE2 . GLU A 1 145 ? 12.155 -28.848 -44.801 1.00 23.17  ? 272 GLU B OE2 1 
ATOM   1156 N N   . THR A 1 146 ? 15.584 -24.450 -47.687 1.00 10.98  ? 273 THR B N   1 
ATOM   1157 C CA  . THR A 1 146 ? 16.994 -24.314 -48.083 1.00 11.33  ? 273 THR B CA  1 
ATOM   1158 C C   . THR A 1 146 ? 17.882 -23.892 -46.920 1.00 10.65  ? 273 THR B C   1 
ATOM   1159 O O   . THR A 1 146 ? 19.083 -24.158 -46.922 1.00 10.58  ? 273 THR B O   1 
ATOM   1160 C CB  . THR A 1 146 ? 17.201 -23.298 -49.235 1.00 11.46  ? 273 THR B CB  1 
ATOM   1161 O OG1 . THR A 1 146 ? 17.104 -21.955 -48.723 1.00 12.50  ? 273 THR B OG1 1 
ATOM   1162 C CG2 . THR A 1 146 ? 16.185 -23.517 -50.336 1.00 11.76  ? 273 THR B CG2 1 
ATOM   1163 N N   . LEU A 1 147 ? 17.286 -23.211 -45.950 1.00 10.62  ? 274 LEU B N   1 
ATOM   1164 C CA  . LEU A 1 147 ? 17.988 -22.776 -44.736 1.00 10.69  ? 274 LEU B CA  1 
ATOM   1165 C C   . LEU A 1 147 ? 18.300 -23.913 -43.758 1.00 10.90  ? 274 LEU B C   1 
ATOM   1166 O O   . LEU A 1 147 ? 19.109 -23.751 -42.845 1.00 11.11  ? 274 LEU B O   1 
ATOM   1167 C CB  . LEU A 1 147 ? 17.169 -21.692 -44.020 1.00 10.35  ? 274 LEU B CB  1 
ATOM   1168 C CG  . LEU A 1 147 ? 16.930 -20.404 -44.812 1.00 9.13   ? 274 LEU B CG  1 
ATOM   1169 C CD1 . LEU A 1 147 ? 16.420 -19.305 -43.880 1.00 9.41   ? 274 LEU B CD1 1 
ATOM   1170 C CD2 . LEU A 1 147 ? 18.218 -19.979 -45.512 1.00 9.07   ? 274 LEU B CD2 1 
ATOM   1171 N N   . HIS A 1 148 ? 17.637 -25.052 -43.939 1.00 11.25  ? 275 HIS B N   1 
ATOM   1172 C CA  . HIS A 1 148 ? 17.686 -26.143 -42.962 1.00 11.41  ? 275 HIS B CA  1 
ATOM   1173 C C   . HIS A 1 148 ? 19.069 -26.770 -42.819 1.00 11.44  ? 275 HIS B C   1 
ATOM   1174 O O   . HIS A 1 148 ? 19.464 -27.130 -41.706 1.00 11.73  ? 275 HIS B O   1 
ATOM   1175 C CB  . HIS A 1 148 ? 16.651 -27.222 -43.305 1.00 11.67  ? 275 HIS B CB  1 
ATOM   1176 C CG  . HIS A 1 148 ? 15.237 -26.846 -42.969 1.00 12.07  ? 275 HIS B CG  1 
ATOM   1177 N ND1 . HIS A 1 148 ? 14.816 -25.541 -42.832 1.00 10.84  ? 275 HIS B ND1 1 
ATOM   1178 C CD2 . HIS A 1 148 ? 14.138 -27.614 -42.783 1.00 12.63  ? 275 HIS B CD2 1 
ATOM   1179 C CE1 . HIS A 1 148 ? 13.529 -25.519 -42.543 1.00 11.38  ? 275 HIS B CE1 1 
ATOM   1180 N NE2 . HIS A 1 148 ? 13.091 -26.765 -42.513 1.00 14.62  ? 275 HIS B NE2 1 
ATOM   1181 N N   . LYS A 1 149 ? 19.782 -26.901 -43.943 1.00 11.57  ? 276 LYS B N   1 
ATOM   1182 C CA  . LYS A 1 149 ? 21.135 -27.487 -44.012 1.00 11.65  ? 276 LYS B CA  1 
ATOM   1183 C C   . LYS A 1 149 ? 22.197 -26.683 -43.265 1.00 11.54  ? 276 LYS B C   1 
ATOM   1184 O O   . LYS A 1 149 ? 23.329 -27.141 -43.107 1.00 11.21  ? 276 LYS B O   1 
ATOM   1185 C CB  . LYS A 1 149 ? 21.578 -27.635 -45.478 1.00 11.98  ? 276 LYS B CB  1 
ATOM   1186 C CG  . LYS A 1 149 ? 21.827 -26.305 -46.219 1.00 11.78  ? 276 LYS B CG  1 
ATOM   1187 C CD  . LYS A 1 149 ? 22.115 -26.508 -47.712 1.00 12.38  ? 276 LYS B CD  1 
ATOM   1188 C CE  . LYS A 1 149 ? 20.853 -26.361 -48.576 1.00 15.49  ? 276 LYS B CE  1 
ATOM   1189 N NZ  . LYS A 1 149 ? 20.712 -25.018 -49.228 1.00 11.67  ? 276 LYS B NZ  1 
ATOM   1190 N N   . PHE A 1 150 ? 21.835 -25.474 -42.842 1.00 11.21  ? 277 PHE B N   1 
ATOM   1191 C CA  . PHE A 1 150 ? 22.769 -24.558 -42.196 1.00 11.28  ? 277 PHE B CA  1 
ATOM   1192 C C   . PHE A 1 150 ? 22.655 -24.623 -40.680 1.00 11.31  ? 277 PHE B C   1 
ATOM   1193 O O   . PHE A 1 150 ? 23.616 -24.311 -39.960 1.00 11.46  ? 277 PHE B O   1 
ATOM   1194 C CB  . PHE A 1 150 ? 22.508 -23.122 -42.660 1.00 11.58  ? 277 PHE B CB  1 
ATOM   1195 C CG  . PHE A 1 150 ? 22.873 -22.871 -44.104 1.00 11.91  ? 277 PHE B CG  1 
ATOM   1196 C CD1 . PHE A 1 150 ? 24.114 -23.268 -44.608 1.00 13.26  ? 277 PHE B CD1 1 
ATOM   1197 C CD2 . PHE A 1 150 ? 21.983 -22.231 -44.954 1.00 13.15  ? 277 PHE B CD2 1 
ATOM   1198 C CE1 . PHE A 1 150 ? 24.455 -23.035 -45.948 1.00 13.24  ? 277 PHE B CE1 1 
ATOM   1199 C CE2 . PHE A 1 150 ? 22.315 -21.992 -46.296 1.00 12.80  ? 277 PHE B CE2 1 
ATOM   1200 C CZ  . PHE A 1 150 ? 23.555 -22.402 -46.785 1.00 12.91  ? 277 PHE B CZ  1 
ATOM   1201 N N   . ALA A 1 151 ? 21.477 -25.027 -40.211 1.00 10.51  ? 278 ALA B N   1 
ATOM   1202 C CA  . ALA A 1 151 ? 21.136 -24.995 -38.789 1.00 11.02  ? 278 ALA B CA  1 
ATOM   1203 C C   . ALA A 1 151 ? 21.188 -26.385 -38.171 1.00 11.20  ? 278 ALA B C   1 
ATOM   1204 O O   . ALA A 1 151 ? 21.192 -27.394 -38.884 1.00 11.23  ? 278 ALA B O   1 
ATOM   1205 C CB  . ALA A 1 151 ? 19.748 -24.385 -38.600 1.00 10.48  ? 278 ALA B CB  1 
ATOM   1206 N N   . SER A 1 152 ? 21.222 -26.430 -36.845 1.00 11.85  ? 279 SER B N   1 
ATOM   1207 C CA  . SER A 1 152 ? 21.161 -27.683 -36.120 1.00 11.71  ? 279 SER B CA  1 
ATOM   1208 C C   . SER A 1 152 ? 19.769 -28.282 -36.285 1.00 13.12  ? 279 SER B C   1 
ATOM   1209 O O   . SER A 1 152 ? 18.815 -27.578 -36.670 1.00 13.09  ? 279 SER B O   1 
ATOM   1210 C CB  . SER A 1 152 ? 21.519 -27.464 -34.641 1.00 11.70  ? 279 SER B CB  1 
ATOM   1211 O OG  . SER A 1 152 ? 22.882 -27.078 -34.506 1.00 8.54   ? 279 SER B OG  1 
ATOM   1212 N N   . LYS A 1 153 ? 19.655 -29.580 -36.013 1.00 14.20  ? 280 LYS B N   1 
ATOM   1213 C CA  . LYS A 1 153 ? 18.385 -30.295 -36.167 1.00 15.44  ? 280 LYS B CA  1 
ATOM   1214 C C   . LYS A 1 153 ? 17.696 -30.486 -34.814 1.00 15.51  ? 280 LYS B C   1 
ATOM   1215 O O   . LYS A 1 153 ? 18.362 -30.766 -33.819 1.00 15.66  ? 280 LYS B O   1 
ATOM   1216 C CB  . LYS A 1 153 ? 18.615 -31.633 -36.877 1.00 15.48  ? 280 LYS B CB  1 
ATOM   1217 C CG  . LYS A 1 153 ? 19.391 -31.489 -38.204 1.00 16.68  ? 280 LYS B CG  1 
ATOM   1218 C CD  . LYS A 1 153 ? 19.619 -32.821 -38.890 1.00 17.46  ? 280 LYS B CD  1 
ATOM   1219 C CE  . LYS A 1 153 ? 19.841 -32.646 -40.394 1.00 20.46  ? 280 LYS B CE  1 
ATOM   1220 N NZ  . LYS A 1 153 ? 20.073 -33.962 -41.073 1.00 22.88  ? 280 LYS B NZ  1 
ATOM   1221 N N   . PRO A 1 154 ? 16.358 -30.343 -34.765 1.00 15.31  ? 281 PRO B N   1 
ATOM   1222 C CA  . PRO A 1 154 ? 15.429 -30.158 -35.868 1.00 15.16  ? 281 PRO B CA  1 
ATOM   1223 C C   . PRO A 1 154 ? 15.273 -28.696 -36.280 1.00 14.87  ? 281 PRO B C   1 
ATOM   1224 O O   . PRO A 1 154 ? 15.523 -27.802 -35.484 1.00 14.09  ? 281 PRO B O   1 
ATOM   1225 C CB  . PRO A 1 154 ? 14.107 -30.659 -35.281 1.00 15.68  ? 281 PRO B CB  1 
ATOM   1226 C CG  . PRO A 1 154 ? 14.200 -30.314 -33.829 1.00 15.37  ? 281 PRO B CG  1 
ATOM   1227 C CD  . PRO A 1 154 ? 15.662 -30.355 -33.464 1.00 15.62  ? 281 PRO B CD  1 
ATOM   1228 N N   . ALA A 1 155 ? 14.836 -28.472 -37.515 1.00 14.63  ? 282 ALA B N   1 
ATOM   1229 C CA  . ALA A 1 155 ? 14.554 -27.124 -38.002 1.00 14.73  ? 282 ALA B CA  1 
ATOM   1230 C C   . ALA A 1 155 ? 13.528 -26.418 -37.124 1.00 14.74  ? 282 ALA B C   1 
ATOM   1231 O O   . ALA A 1 155 ? 13.627 -25.212 -36.887 1.00 14.63  ? 282 ALA B O   1 
ATOM   1232 C CB  . ALA A 1 155 ? 14.066 -27.182 -39.434 1.00 14.75  ? 282 ALA B CB  1 
ATOM   1233 N N   . SER A 1 156 ? 12.543 -27.171 -36.634 1.00 14.42  ? 283 SER B N   1 
ATOM   1234 C CA  . SER A 1 156 ? 11.487 -26.601 -35.794 1.00 14.22  ? 283 SER B CA  1 
ATOM   1235 C C   . SER A 1 156 ? 12.069 -25.872 -34.575 1.00 13.66  ? 283 SER B C   1 
ATOM   1236 O O   . SER A 1 156 ? 11.490 -24.897 -34.075 1.00 12.86  ? 283 SER B O   1 
ATOM   1237 C CB  . SER A 1 156 ? 10.499 -27.691 -35.363 1.00 14.45  ? 283 SER B CB  1 
ATOM   1238 O OG  . SER A 1 156 ? 11.169 -28.724 -34.659 1.00 15.49  ? 283 SER B OG  1 
ATOM   1239 N N   . GLU A 1 157 ? 13.232 -26.331 -34.119 1.00 12.99  ? 284 GLU B N   1 
ATOM   1240 C CA  . GLU A 1 157 ? 13.886 -25.718 -32.978 1.00 13.34  ? 284 GLU B CA  1 
ATOM   1241 C C   . GLU A 1 157 ? 14.910 -24.659 -33.380 1.00 12.63  ? 284 GLU B C   1 
ATOM   1242 O O   . GLU A 1 157 ? 15.039 -23.635 -32.707 1.00 12.87  ? 284 GLU B O   1 
ATOM   1243 C CB  . GLU A 1 157 ? 14.567 -26.778 -32.102 1.00 13.21  ? 284 GLU B CB  1 
ATOM   1244 C CG  . GLU A 1 157 ? 15.502 -26.167 -31.042 1.00 14.32  ? 284 GLU B CG  1 
ATOM   1245 C CD  . GLU A 1 157 ? 16.052 -27.179 -30.066 1.00 14.57  ? 284 GLU B CD  1 
ATOM   1246 O OE1 . GLU A 1 157 ? 15.955 -28.399 -30.340 1.00 14.39  ? 284 GLU B OE1 1 
ATOM   1247 O OE2 . GLU A 1 157 ? 16.584 -26.735 -29.022 1.00 16.69  ? 284 GLU B OE2 1 
ATOM   1248 N N   . PHE A 1 158 ? 15.637 -24.914 -34.464 1.00 12.40  ? 285 PHE B N   1 
ATOM   1249 C CA  . PHE A 1 158 ? 16.804 -24.092 -34.825 1.00 11.63  ? 285 PHE B CA  1 
ATOM   1250 C C   . PHE A 1 158 ? 16.621 -23.156 -36.014 1.00 11.16  ? 285 PHE B C   1 
ATOM   1251 O O   . PHE A 1 158 ? 17.542 -22.387 -36.356 1.00 10.25  ? 285 PHE B O   1 
ATOM   1252 C CB  . PHE A 1 158 ? 18.041 -24.978 -35.018 1.00 11.80  ? 285 PHE B CB  1 
ATOM   1253 C CG  . PHE A 1 158 ? 18.448 -25.726 -33.776 1.00 12.48  ? 285 PHE B CG  1 
ATOM   1254 C CD1 . PHE A 1 158 ? 18.125 -27.067 -33.615 1.00 12.26  ? 285 PHE B CD1 1 
ATOM   1255 C CD2 . PHE A 1 158 ? 19.148 -25.084 -32.765 1.00 11.15  ? 285 PHE B CD2 1 
ATOM   1256 C CE1 . PHE A 1 158 ? 18.497 -27.750 -32.458 1.00 12.42  ? 285 PHE B CE1 1 
ATOM   1257 C CE2 . PHE A 1 158 ? 19.513 -25.753 -31.613 1.00 12.15  ? 285 PHE B CE2 1 
ATOM   1258 C CZ  . PHE A 1 158 ? 19.190 -27.094 -31.462 1.00 12.29  ? 285 PHE B CZ  1 
ATOM   1259 N N   . VAL A 1 159 ? 15.444 -23.201 -36.638 1.00 10.40  ? 286 VAL B N   1 
ATOM   1260 C CA  . VAL A 1 159 ? 15.165 -22.302 -37.770 1.00 9.77   ? 286 VAL B CA  1 
ATOM   1261 C C   . VAL A 1 159 ? 13.952 -21.418 -37.480 1.00 9.37   ? 286 VAL B C   1 
ATOM   1262 O O   . VAL A 1 159 ? 12.917 -21.910 -37.058 1.00 8.53   ? 286 VAL B O   1 
ATOM   1263 C CB  . VAL A 1 159 ? 14.967 -23.063 -39.124 1.00 9.50   ? 286 VAL B CB  1 
ATOM   1264 C CG1 . VAL A 1 159 ? 14.856 -22.078 -40.287 1.00 8.80   ? 286 VAL B CG1 1 
ATOM   1265 C CG2 . VAL A 1 159 ? 16.113 -24.033 -39.381 1.00 9.97   ? 286 VAL B CG2 1 
ATOM   1266 N N   . LYS A 1 160 ? 14.105 -20.113 -37.721 1.00 9.27   ? 287 LYS B N   1 
ATOM   1267 C CA  . LYS A 1 160 ? 13.033 -19.138 -37.550 1.00 9.51   ? 287 LYS B CA  1 
ATOM   1268 C C   . LYS A 1 160 ? 12.898 -18.305 -38.813 1.00 9.19   ? 287 LYS B C   1 
ATOM   1269 O O   . LYS A 1 160 ? 13.892 -17.838 -39.333 1.00 9.56   ? 287 LYS B O   1 
ATOM   1270 C CB  . LYS A 1 160 ? 13.337 -18.221 -36.360 1.00 10.54  ? 287 LYS B CB  1 
ATOM   1271 C CG  . LYS A 1 160 ? 12.188 -17.319 -35.923 1.00 12.72  ? 287 LYS B CG  1 
ATOM   1272 C CD  . LYS A 1 160 ? 10.993 -18.140 -35.553 1.00 17.29  ? 287 LYS B CD  1 
ATOM   1273 C CE  . LYS A 1 160 ? 10.252 -17.571 -34.368 1.00 19.09  ? 287 LYS B CE  1 
ATOM   1274 N NZ  . LYS A 1 160 ? 9.136  -18.500 -34.030 1.00 20.81  ? 287 LYS B NZ  1 
ATOM   1275 N N   . ILE A 1 161 ? 11.675 -18.126 -39.308 1.00 8.44   ? 288 ILE B N   1 
ATOM   1276 C CA  . ILE A 1 161 ? 11.459 -17.258 -40.477 1.00 8.85   ? 288 ILE B CA  1 
ATOM   1277 C C   . ILE A 1 161 ? 10.582 -16.091 -40.069 1.00 8.70   ? 288 ILE B C   1 
ATOM   1278 O O   . ILE A 1 161 ? 9.542  -16.282 -39.431 1.00 9.54   ? 288 ILE B O   1 
ATOM   1279 C CB  . ILE A 1 161 ? 10.808 -18.004 -41.697 1.00 8.75   ? 288 ILE B CB  1 
ATOM   1280 C CG1 . ILE A 1 161 ? 11.537 -19.322 -42.032 1.00 8.01   ? 288 ILE B CG1 1 
ATOM   1281 C CG2 . ILE A 1 161 ? 10.703 -17.069 -42.934 1.00 7.15   ? 288 ILE B CG2 1 
ATOM   1282 C CD1 . ILE A 1 161 ? 13.000 -19.184 -42.500 1.00 8.18   ? 288 ILE B CD1 1 
ATOM   1283 N N   . LEU A 1 162 ? 11.010 -14.891 -40.444 1.00 8.47   ? 289 LEU B N   1 
ATOM   1284 C CA  . LEU A 1 162 ? 10.305 -13.661 -40.089 1.00 8.07   ? 289 LEU B CA  1 
ATOM   1285 C C   . LEU A 1 162 ? 9.771  -12.973 -41.338 1.00 7.49   ? 289 LEU B C   1 
ATOM   1286 O O   . LEU A 1 162 ? 10.507 -12.798 -42.304 1.00 7.09   ? 289 LEU B O   1 
ATOM   1287 C CB  . LEU A 1 162 ? 11.266 -12.715 -39.358 1.00 7.89   ? 289 LEU B CB  1 
ATOM   1288 C CG  . LEU A 1 162 ? 11.897 -13.158 -38.031 1.00 8.69   ? 289 LEU B CG  1 
ATOM   1289 C CD1 . LEU A 1 162 ? 12.586 -11.967 -37.395 1.00 7.66   ? 289 LEU B CD1 1 
ATOM   1290 C CD2 . LEU A 1 162 ? 10.891 -13.762 -37.043 1.00 9.86   ? 289 LEU B CD2 1 
ATOM   1291 N N   . ASP A 1 163 ? 8.507  -12.555 -41.305 1.00 7.73   ? 290 ASP B N   1 
ATOM   1292 C CA  . ASP A 1 163 ? 7.883  -11.852 -42.434 1.00 7.91   ? 290 ASP B CA  1 
ATOM   1293 C C   . ASP A 1 163 ? 8.607  -10.566 -42.784 1.00 7.72   ? 290 ASP B C   1 
ATOM   1294 O O   . ASP A 1 163 ? 8.750  -10.246 -43.953 1.00 7.52   ? 290 ASP B O   1 
ATOM   1295 C CB  . ASP A 1 163 ? 6.405  -11.538 -42.159 1.00 7.65   ? 290 ASP B CB  1 
ATOM   1296 C CG  . ASP A 1 163 ? 5.514  -12.766 -42.251 1.00 9.37   ? 290 ASP B CG  1 
ATOM   1297 O OD1 . ASP A 1 163 ? 6.023  -13.910 -42.219 1.00 5.55   ? 290 ASP B OD1 1 
ATOM   1298 O OD2 . ASP A 1 163 ? 4.287  -12.581 -42.367 1.00 14.07  ? 290 ASP B OD2 1 
ATOM   1299 N N   . THR A 1 164 ? 9.050  -9.826  -41.767 1.00 8.07   ? 291 THR B N   1 
ATOM   1300 C CA  . THR A 1 164 ? 9.672  -8.522  -41.985 1.00 7.91   ? 291 THR B CA  1 
ATOM   1301 C C   . THR A 1 164 ? 10.734 -8.232  -40.919 1.00 7.98   ? 291 THR B C   1 
ATOM   1302 O O   . THR A 1 164 ? 10.775 -8.883  -39.877 1.00 7.22   ? 291 THR B O   1 
ATOM   1303 C CB  . THR A 1 164 ? 8.642  -7.364  -41.848 1.00 8.28   ? 291 THR B CB  1 
ATOM   1304 O OG1 . THR A 1 164 ? 8.279  -7.247  -40.475 1.00 7.61   ? 291 THR B OG1 1 
ATOM   1305 C CG2 . THR A 1 164 ? 7.367  -7.558  -42.726 1.00 8.75   ? 291 THR B CG2 1 
ATOM   1306 N N   . PHE A 1 165 ? 11.542 -7.198  -41.161 1.00 8.12   ? 292 PHE B N   1 
ATOM   1307 C CA  . PHE A 1 165 ? 12.574 -6.779  -40.216 1.00 8.86   ? 292 PHE B CA  1 
ATOM   1308 C C   . PHE A 1 165 ? 12.046 -6.179  -38.913 1.00 9.28   ? 292 PHE B C   1 
ATOM   1309 O O   . PHE A 1 165 ? 12.730 -6.236  -37.881 1.00 8.77   ? 292 PHE B O   1 
ATOM   1310 C CB  . PHE A 1 165 ? 13.603 -5.875  -40.911 1.00 9.07   ? 292 PHE B CB  1 
ATOM   1311 C CG  . PHE A 1 165 ? 14.465 -6.629  -41.886 1.00 10.34  ? 292 PHE B CG  1 
ATOM   1312 C CD1 . PHE A 1 165 ? 14.001 -6.903  -43.176 1.00 10.08  ? 292 PHE B CD1 1 
ATOM   1313 C CD2 . PHE A 1 165 ? 15.712 -7.120  -41.497 1.00 11.23  ? 292 PHE B CD2 1 
ATOM   1314 C CE1 . PHE A 1 165 ? 14.773 -7.628  -44.072 1.00 10.89  ? 292 PHE B CE1 1 
ATOM   1315 C CE2 . PHE A 1 165 ? 16.494 -7.858  -42.386 1.00 10.88  ? 292 PHE B CE2 1 
ATOM   1316 C CZ  . PHE A 1 165 ? 16.021 -8.112  -43.676 1.00 9.91   ? 292 PHE B CZ  1 
ATOM   1317 N N   . GLU A 1 166 ? 10.831 -5.635  -38.955 1.00 9.68   ? 293 GLU B N   1 
ATOM   1318 C CA  . GLU A 1 166 ? 10.153 -5.166  -37.739 1.00 10.70  ? 293 GLU B CA  1 
ATOM   1319 C C   . GLU A 1 166 ? 9.891  -6.321  -36.788 1.00 10.18  ? 293 GLU B C   1 
ATOM   1320 O O   . GLU A 1 166 ? 9.951  -6.134  -35.586 1.00 10.55  ? 293 GLU B O   1 
ATOM   1321 C CB  . GLU A 1 166 ? 8.839  -4.422  -38.045 1.00 11.66  ? 293 GLU B CB  1 
ATOM   1322 C CG  . GLU A 1 166 ? 9.004  -3.030  -38.665 1.00 14.87  ? 293 GLU B CG  1 
ATOM   1323 C CD  . GLU A 1 166 ? 9.500  -3.071  -40.108 1.00 20.58  ? 293 GLU B CD  1 
ATOM   1324 O OE1 . GLU A 1 166 ? 9.073  -3.970  -40.866 1.00 20.75  ? 293 GLU B OE1 1 
ATOM   1325 O OE2 . GLU A 1 166 ? 10.322 -2.197  -40.483 1.00 22.23  ? 293 GLU B OE2 1 
ATOM   1326 N N   . LYS A 1 167 ? 9.634  -7.520  -37.315 1.00 10.24  ? 294 LYS B N   1 
ATOM   1327 C CA  . LYS A 1 167 ? 9.402  -8.699  -36.449 1.00 10.30  ? 294 LYS B CA  1 
ATOM   1328 C C   . LYS A 1 167 ? 10.614 -9.124  -35.592 1.00 10.20  ? 294 LYS B C   1 
ATOM   1329 O O   . LYS A 1 167 ? 10.483 -10.006 -34.740 1.00 9.21   ? 294 LYS B O   1 
ATOM   1330 C CB  . LYS A 1 167 ? 8.920  -9.908  -37.251 1.00 10.31  ? 294 LYS B CB  1 
ATOM   1331 C CG  . LYS A 1 167 ? 7.699  -9.672  -38.117 1.00 11.05  ? 294 LYS B CG  1 
ATOM   1332 C CD  . LYS A 1 167 ? 6.425  -9.387  -37.329 1.00 13.23  ? 294 LYS B CD  1 
ATOM   1333 C CE  . LYS A 1 167 ? 5.962  -10.588 -36.535 1.00 16.21  ? 294 LYS B CE  1 
ATOM   1334 N NZ  . LYS A 1 167 ? 4.461  -10.597 -36.367 1.00 17.31  ? 294 LYS B NZ  1 
ATOM   1335 N N   . LEU A 1 168 ? 11.790 -8.533  -35.841 1.00 9.87   ? 295 LEU B N   1 
ATOM   1336 C CA  . LEU A 1 168 ? 12.953 -8.763  -34.969 1.00 10.34  ? 295 LEU B CA  1 
ATOM   1337 C C   . LEU A 1 168 ? 12.697 -8.214  -33.562 1.00 10.81  ? 295 LEU B C   1 
ATOM   1338 O O   . LEU A 1 168 ? 13.156 -8.789  -32.573 1.00 10.73  ? 295 LEU B O   1 
ATOM   1339 C CB  . LEU A 1 168 ? 14.236 -8.157  -35.553 1.00 10.07  ? 295 LEU B CB  1 
ATOM   1340 C CG  . LEU A 1 168 ? 14.962 -8.912  -36.669 1.00 10.13  ? 295 LEU B CG  1 
ATOM   1341 C CD1 . LEU A 1 168 ? 15.979 -7.984  -37.348 1.00 9.97   ? 295 LEU B CD1 1 
ATOM   1342 C CD2 . LEU A 1 168 ? 15.624 -10.193 -36.173 1.00 9.09   ? 295 LEU B CD2 1 
ATOM   1343 N N   . LYS A 1 169 ? 11.948 -7.111  -33.489 1.00 11.89  ? 296 LYS B N   1 
ATOM   1344 C CA  . LYS A 1 169 ? 11.484 -6.543  -32.216 1.00 12.94  ? 296 LYS B CA  1 
ATOM   1345 C C   . LYS A 1 169 ? 10.713 -7.612  -31.439 1.00 12.83  ? 296 LYS B C   1 
ATOM   1346 O O   . LYS A 1 169 ? 10.982 -7.856  -30.261 1.00 12.26  ? 296 LYS B O   1 
ATOM   1347 C CB  . LYS A 1 169 ? 10.593 -5.306  -32.450 1.00 12.63  ? 296 LYS B CB  1 
ATOM   1348 C CG  . LYS A 1 169 ? 11.316 -4.122  -33.095 1.00 14.03  ? 296 LYS B CG  1 
ATOM   1349 C CD  . LYS A 1 169 ? 10.420 -2.893  -33.280 1.00 14.69  ? 296 LYS B CD  1 
ATOM   1350 C CE  . LYS A 1 169 ? 9.555  -2.986  -34.547 1.00 16.74  ? 296 LYS B CE  1 
ATOM   1351 N NZ  . LYS A 1 169 ? 9.245  -1.633  -35.083 1.00 19.89  ? 296 LYS B NZ  1 
ATOM   1352 N N   . ASP A 1 170 ? 9.773  -8.255  -32.134 1.00 13.07  ? 297 ASP B N   1 
ATOM   1353 C CA  . ASP A 1 170 ? 8.906  -9.295  -31.577 1.00 13.12  ? 297 ASP B CA  1 
ATOM   1354 C C   . ASP A 1 170 ? 9.646  -10.564 -31.147 1.00 12.21  ? 297 ASP B C   1 
ATOM   1355 O O   . ASP A 1 170 ? 9.329  -11.161 -30.112 1.00 11.24  ? 297 ASP B O   1 
ATOM   1356 C CB  . ASP A 1 170 ? 7.847  -9.678  -32.604 1.00 13.75  ? 297 ASP B CB  1 
ATOM   1357 C CG  . ASP A 1 170 ? 6.946  -8.525  -32.959 1.00 16.81  ? 297 ASP B CG  1 
ATOM   1358 O OD1 . ASP A 1 170 ? 7.340  -7.697  -33.813 1.00 18.85  ? 297 ASP B OD1 1 
ATOM   1359 O OD2 . ASP A 1 170 ? 5.840  -8.463  -32.379 1.00 19.75  ? 297 ASP B OD2 1 
ATOM   1360 N N   . LEU A 1 171 ? 10.590 -10.992 -31.977 1.00 11.60  ? 298 LEU B N   1 
ATOM   1361 C CA  . LEU A 1 171 ? 11.479 -12.101 -31.650 1.00 10.97  ? 298 LEU B CA  1 
ATOM   1362 C C   . LEU A 1 171 ? 12.306 -11.800 -30.389 1.00 10.94  ? 298 LEU B C   1 
ATOM   1363 O O   . LEU A 1 171 ? 12.486 -12.669 -29.540 1.00 10.17  ? 298 LEU B O   1 
ATOM   1364 C CB  . LEU A 1 171 ? 12.397 -12.400 -32.840 1.00 11.16  ? 298 LEU B CB  1 
ATOM   1365 C CG  . LEU A 1 171 ? 13.360 -13.590 -32.696 1.00 11.28  ? 298 LEU B CG  1 
ATOM   1366 C CD1 . LEU A 1 171 ? 12.627 -14.895 -32.320 1.00 10.24  ? 298 LEU B CD1 1 
ATOM   1367 C CD2 . LEU A 1 171 ? 14.208 -13.775 -33.947 1.00 11.37  ? 298 LEU B CD2 1 
ATOM   1368 N N   . PHE A 1 172 ? 12.804 -10.569 -30.260 1.00 11.35  ? 299 PHE B N   1 
ATOM   1369 C CA  . PHE A 1 172 ? 13.526 -10.197 -29.043 1.00 11.49  ? 299 PHE B CA  1 
ATOM   1370 C C   . PHE A 1 172 ? 12.643 -10.274 -27.776 1.00 12.06  ? 299 PHE B C   1 
ATOM   1371 O O   . PHE A 1 172 ? 13.108 -10.738 -26.730 1.00 12.30  ? 299 PHE B O   1 
ATOM   1372 C CB  . PHE A 1 172 ? 14.211 -8.834  -29.182 1.00 11.76  ? 299 PHE B CB  1 
ATOM   1373 C CG  . PHE A 1 172 ? 14.961 -8.407  -27.941 1.00 11.19  ? 299 PHE B CG  1 
ATOM   1374 C CD1 . PHE A 1 172 ? 15.963 -9.221  -27.402 1.00 11.96  ? 299 PHE B CD1 1 
ATOM   1375 C CD2 . PHE A 1 172 ? 14.654 -7.197  -27.304 1.00 11.42  ? 299 PHE B CD2 1 
ATOM   1376 C CE1 . PHE A 1 172 ? 16.650 -8.844  -26.242 1.00 11.19  ? 299 PHE B CE1 1 
ATOM   1377 C CE2 . PHE A 1 172 ? 15.343 -6.805  -26.135 1.00 11.41  ? 299 PHE B CE2 1 
ATOM   1378 C CZ  . PHE A 1 172 ? 16.339 -7.634  -25.614 1.00 11.69  ? 299 PHE B CZ  1 
ATOM   1379 N N   . THR A 1 173 ? 11.381 -9.843  -27.884 1.00 12.46  ? 300 THR B N   1 
ATOM   1380 C CA  . THR A 1 173 ? 10.379 -9.946  -26.801 1.00 12.89  ? 300 THR B CA  1 
ATOM   1381 C C   . THR A 1 173 ? 10.161 -11.410 -26.381 1.00 13.47  ? 300 THR B C   1 
ATOM   1382 O O   . THR A 1 173 ? 10.184 -11.742 -25.181 1.00 13.00  ? 300 THR B O   1 
ATOM   1383 C CB  . THR A 1 173 ? 9.006  -9.341  -27.250 1.00 12.73  ? 300 THR B CB  1 
ATOM   1384 O OG1 . THR A 1 173 ? 9.159  -7.949  -27.510 1.00 13.24  ? 300 THR B OG1 1 
ATOM   1385 C CG2 . THR A 1 173 ? 7.896  -9.547  -26.194 1.00 13.28  ? 300 THR B CG2 1 
ATOM   1386 N N   . GLU A 1 174 ? 9.955  -12.270 -27.378 1.00 13.74  ? 301 GLU B N   1 
ATOM   1387 C CA  . GLU A 1 174 ? 9.799  -13.706 -27.157 1.00 15.33  ? 301 GLU B CA  1 
ATOM   1388 C C   . GLU A 1 174 ? 11.048 -14.320 -26.523 1.00 15.35  ? 301 GLU B C   1 
ATOM   1389 O O   . GLU A 1 174 ? 10.944 -15.115 -25.588 1.00 16.12  ? 301 GLU B O   1 
ATOM   1390 C CB  . GLU A 1 174 ? 9.479  -14.427 -28.475 1.00 15.71  ? 301 GLU B CB  1 
ATOM   1391 C CG  . GLU A 1 174 ? 9.209  -15.924 -28.311 1.00 19.07  ? 301 GLU B CG  1 
ATOM   1392 C CD  . GLU A 1 174 ? 9.780  -16.766 -29.440 1.00 23.66  ? 301 GLU B CD  1 
ATOM   1393 O OE1 . GLU A 1 174 ? 10.584 -17.697 -29.150 1.00 25.18  ? 301 GLU B OE1 1 
ATOM   1394 O OE2 . GLU A 1 174 ? 9.431  -16.491 -30.613 1.00 24.69  ? 301 GLU B OE2 1 
ATOM   1395 N N   . LEU A 1 175 ? 12.217 -13.955 -27.044 1.00 15.45  ? 302 LEU B N   1 
ATOM   1396 C CA  . LEU A 1 175 ? 13.510 -14.465 -26.561 1.00 15.36  ? 302 LEU B CA  1 
ATOM   1397 C C   . LEU A 1 175 ? 13.667 -14.282 -25.055 1.00 14.82  ? 302 LEU B C   1 
ATOM   1398 O O   . LEU A 1 175 ? 14.097 -15.195 -24.340 1.00 14.62  ? 302 LEU B O   1 
ATOM   1399 C CB  . LEU A 1 175 ? 14.645 -13.726 -27.282 1.00 15.48  ? 302 LEU B CB  1 
ATOM   1400 C CG  . LEU A 1 175 ? 16.146 -14.011 -27.110 1.00 16.30  ? 302 LEU B CG  1 
ATOM   1401 C CD1 . LEU A 1 175 ? 16.844 -13.014 -28.002 1.00 19.90  ? 302 LEU B CD1 1 
ATOM   1402 C CD2 . LEU A 1 175 ? 16.684 -13.834 -25.720 1.00 18.64  ? 302 LEU B CD2 1 
ATOM   1403 N N   . GLN A 1 176 ? 13.330 -13.088 -24.582 1.00 14.41  ? 303 GLN B N   1 
ATOM   1404 C CA  . GLN A 1 176 ? 13.435 -12.762 -23.166 1.00 14.20  ? 303 GLN B CA  1 
ATOM   1405 C C   . GLN A 1 176 ? 12.561 -13.621 -22.255 1.00 14.24  ? 303 GLN B C   1 
ATOM   1406 O O   . GLN A 1 176 ? 12.881 -13.810 -21.080 1.00 14.22  ? 303 GLN B O   1 
ATOM   1407 C CB  . GLN A 1 176 ? 13.166 -11.277 -22.947 1.00 14.25  ? 303 GLN B CB  1 
ATOM   1408 C CG  . GLN A 1 176 ? 14.241 -10.374 -23.553 1.00 14.50  ? 303 GLN B CG  1 
ATOM   1409 C CD  . GLN A 1 176 ? 13.835 -8.929  -23.540 1.00 14.73  ? 303 GLN B CD  1 
ATOM   1410 O OE1 . GLN A 1 176 ? 13.026 -8.483  -24.367 1.00 16.00  ? 303 GLN B OE1 1 
ATOM   1411 N NE2 . GLN A 1 176 ? 14.393 -8.178  -22.610 1.00 12.44  ? 303 GLN B NE2 1 
ATOM   1412 N N   . LYS A 1 177 ? 11.470 -14.152 -22.796 1.00 14.63  ? 304 LYS B N   1 
ATOM   1413 C CA  . LYS A 1 177 ? 10.618 -15.071 -22.038 1.00 14.64  ? 304 LYS B CA  1 
ATOM   1414 C C   . LYS A 1 177 ? 11.231 -16.469 -21.874 1.00 14.72  ? 304 LYS B C   1 
ATOM   1415 O O   . LYS A 1 177 ? 10.717 -17.288 -21.099 1.00 15.30  ? 304 LYS B O   1 
ATOM   1416 C CB  . LYS A 1 177 ? 9.211  -15.120 -22.642 1.00 15.12  ? 304 LYS B CB  1 
ATOM   1417 C CG  . LYS A 1 177 ? 8.399  -13.861 -22.349 1.00 16.21  ? 304 LYS B CG  1 
ATOM   1418 C CD  . LYS A 1 177 ? 7.176  -13.778 -23.234 1.00 20.46  ? 304 LYS B CD  1 
ATOM   1419 C CE  . LYS A 1 177 ? 6.204  -12.740 -22.711 1.00 21.65  ? 304 LYS B CE  1 
ATOM   1420 N NZ  . LYS A 1 177 ? 6.654  -11.377 -23.065 1.00 23.77  ? 304 LYS B NZ  1 
ATOM   1421 N N   . LYS A 1 178 ? 12.333 -16.721 -22.596 1.00 14.53  ? 305 LYS B N   1 
ATOM   1422 C CA  . LYS A 1 178 ? 13.122 -17.955 -22.495 1.00 14.54  ? 305 LYS B CA  1 
ATOM   1423 C C   . LYS A 1 178 ? 14.374 -17.823 -21.610 1.00 14.18  ? 305 LYS B C   1 
ATOM   1424 O O   . LYS A 1 178 ? 15.189 -18.751 -21.540 1.00 13.84  ? 305 LYS B O   1 
ATOM   1425 C CB  . LYS A 1 178 ? 13.538 -18.450 -23.893 1.00 14.84  ? 305 LYS B CB  1 
ATOM   1426 C CG  . LYS A 1 178 ? 12.397 -18.797 -24.835 1.00 16.86  ? 305 LYS B CG  1 
ATOM   1427 C CD  . LYS A 1 178 ? 11.518 -19.891 -24.243 1.00 21.65  ? 305 LYS B CD  1 
ATOM   1428 C CE  . LYS A 1 178 ? 10.658 -20.585 -25.295 1.00 22.16  ? 305 LYS B CE  1 
ATOM   1429 N NZ  . LYS A 1 178 ? 11.419 -21.644 -26.021 1.00 25.11  ? 305 LYS B NZ  1 
ATOM   1430 N N   . ILE A 1 179 ? 14.526 -16.673 -20.947 1.00 13.76  ? 306 ILE B N   1 
ATOM   1431 C CA  . ILE A 1 179 ? 15.670 -16.419 -20.068 1.00 13.74  ? 306 ILE B CA  1 
ATOM   1432 C C   . ILE A 1 179 ? 15.416 -16.904 -18.632 1.00 13.86  ? 306 ILE B C   1 
ATOM   1433 O O   . ILE A 1 179 ? 14.455 -16.472 -17.979 1.00 13.22  ? 306 ILE B O   1 
ATOM   1434 C CB  . ILE A 1 179 ? 16.057 -14.918 -20.047 1.00 14.05  ? 306 ILE B CB  1 
ATOM   1435 C CG1 . ILE A 1 179 ? 16.530 -14.448 -21.430 1.00 12.48  ? 306 ILE B CG1 1 
ATOM   1436 C CG2 . ILE A 1 179 ? 17.149 -14.651 -19.012 1.00 13.90  ? 306 ILE B CG2 1 
ATOM   1437 C CD1 . ILE A 1 179 ? 16.738 -12.956 -21.521 1.00 13.69  ? 306 ILE B CD1 1 
ATOM   1438 N N   . TYR A 1 180 ? 16.271 -17.803 -18.150 1.00 13.89  ? 307 TYR B N   1 
ATOM   1439 C CA  . TYR A 1 180 ? 16.131 -18.322 -16.788 1.00 14.89  ? 307 TYR B CA  1 
ATOM   1440 C C   . TYR A 1 180 ? 17.459 -18.426 -16.059 1.00 15.74  ? 307 TYR B C   1 
ATOM   1441 O O   . TYR A 1 180 ? 18.516 -18.626 -16.677 1.00 15.62  ? 307 TYR B O   1 
ATOM   1442 C CB  . TYR A 1 180 ? 15.478 -19.711 -16.779 1.00 14.32  ? 307 TYR B CB  1 
ATOM   1443 C CG  . TYR A 1 180 ? 14.096 -19.787 -17.383 1.00 14.29  ? 307 TYR B CG  1 
ATOM   1444 C CD1 . TYR A 1 180 ? 13.928 -20.125 -18.726 1.00 13.81  ? 307 TYR B CD1 1 
ATOM   1445 C CD2 . TYR A 1 180 ? 12.952 -19.531 -16.614 1.00 13.88  ? 307 TYR B CD2 1 
ATOM   1446 C CE1 . TYR A 1 180 ? 12.663 -20.195 -19.299 1.00 13.94  ? 307 TYR B CE1 1 
ATOM   1447 C CE2 . TYR A 1 180 ? 11.677 -19.608 -17.179 1.00 13.03  ? 307 TYR B CE2 1 
ATOM   1448 C CZ  . TYR A 1 180 ? 11.547 -19.951 -18.527 1.00 13.50  ? 307 TYR B CZ  1 
ATOM   1449 O OH  . TYR A 1 180 ? 10.305 -20.034 -19.124 1.00 14.44  ? 307 TYR B OH  1 
ATOM   1450 N N   . VAL A 1 181 ? 17.382 -18.310 -14.739 1.00 16.85  ? 308 VAL B N   1 
ATOM   1451 C CA  . VAL A 1 181 ? 18.453 -18.744 -13.862 1.00 18.47  ? 308 VAL B CA  1 
ATOM   1452 C C   . VAL A 1 181 ? 18.297 -20.248 -13.729 1.00 19.87  ? 308 VAL B C   1 
ATOM   1453 O O   . VAL A 1 181 ? 17.249 -20.740 -13.283 1.00 20.46  ? 308 VAL B O   1 
ATOM   1454 C CB  . VAL A 1 181 ? 18.361 -18.090 -12.465 1.00 18.25  ? 308 VAL B CB  1 
ATOM   1455 C CG1 . VAL A 1 181 ? 19.439 -18.653 -11.549 1.00 18.19  ? 308 VAL B CG1 1 
ATOM   1456 C CG2 . VAL A 1 181 ? 18.458 -16.555 -12.567 1.00 17.64  ? 308 VAL B CG2 1 
ATOM   1457 N N   . ILE A 1 182 ? 19.325 -20.984 -14.131 1.00 21.33  ? 309 ILE B N   1 
ATOM   1458 C CA  . ILE A 1 182 ? 19.252 -22.426 -14.073 1.00 23.08  ? 309 ILE B CA  1 
ATOM   1459 C C   . ILE A 1 182 ? 20.042 -22.938 -12.883 1.00 23.82  ? 309 ILE B C   1 
ATOM   1460 O O   . ILE A 1 182 ? 19.464 -23.515 -11.968 1.00 24.72  ? 309 ILE B O   1 
ATOM   1461 C CB  . ILE A 1 182 ? 19.676 -23.107 -15.407 1.00 23.29  ? 309 ILE B CB  1 
ATOM   1462 C CG1 . ILE A 1 182 ? 21.194 -23.277 -15.513 1.00 24.49  ? 309 ILE B CG1 1 
ATOM   1463 C CG2 . ILE A 1 182 ? 19.098 -22.362 -16.618 1.00 23.85  ? 309 ILE B CG2 1 
ATOM   1464 C CD1 . ILE A 1 182 ? 21.597 -24.415 -16.459 1.00 26.83  ? 309 ILE B CD1 1 
ATOM   1465 O OXT . ILE A 1 182 ? 21.261 -22.783 -12.796 1.00 24.92  ? 309 ILE B OXT 1 
ATOM   1466 N N   . GLY B 1 1   ? 8.635  -22.872 -18.078 1.00 14.08  ? 128 GLY C N   1 
ATOM   1467 C CA  . GLY B 1 1   ? 7.464  -21.963 -18.300 1.00 12.82  ? 128 GLY C CA  1 
ATOM   1468 C C   . GLY B 1 1   ? 7.542  -20.761 -17.370 1.00 12.43  ? 128 GLY C C   1 
ATOM   1469 O O   . GLY B 1 1   ? 8.599  -20.128 -17.219 1.00 12.78  ? 128 GLY C O   1 
ATOM   1470 N N   . ASN B 1 2   ? 6.431  -20.456 -16.723 1.00 11.10  ? 129 ASN C N   1 
ATOM   1471 C CA  . ASN B 1 2   ? 6.367  -19.290 -15.859 1.00 10.27  ? 129 ASN C CA  1 
ATOM   1472 C C   . ASN B 1 2   ? 6.929  -19.541 -14.470 1.00 9.46   ? 129 ASN C C   1 
ATOM   1473 O O   . ASN B 1 2   ? 6.780  -20.623 -13.906 1.00 9.20   ? 129 ASN C O   1 
ATOM   1474 C CB  . ASN B 1 2   ? 4.936  -18.761 -15.773 1.00 10.28  ? 129 ASN C CB  1 
ATOM   1475 C CG  . ASN B 1 2   ? 4.396  -18.316 -17.117 1.00 10.33  ? 129 ASN C CG  1 
ATOM   1476 O OD1 . ASN B 1 2   ? 5.134  -17.811 -17.956 1.00 10.51  ? 129 ASN C OD1 1 
ATOM   1477 N ND2 . ASN B 1 2   ? 3.098  -18.487 -17.317 1.00 10.53  ? 129 ASN C ND2 1 
ATOM   1478 N N   . VAL B 1 3   ? 7.591  -18.523 -13.932 1.00 8.85   ? 130 VAL C N   1 
ATOM   1479 C CA  . VAL B 1 3   ? 8.120  -18.581 -12.575 1.00 8.04   ? 130 VAL C CA  1 
ATOM   1480 C C   . VAL B 1 3   ? 7.554  -17.404 -11.757 1.00 7.18   ? 130 VAL C C   1 
ATOM   1481 O O   . VAL B 1 3   ? 7.775  -16.241 -12.103 1.00 6.08   ? 130 VAL C O   1 
ATOM   1482 C CB  . VAL B 1 3   ? 9.669  -18.515 -12.544 1.00 7.78   ? 130 VAL C CB  1 
ATOM   1483 C CG1 . VAL B 1 3   ? 10.175 -18.597 -11.089 1.00 8.19   ? 130 VAL C CG1 1 
ATOM   1484 C CG2 . VAL B 1 3   ? 10.312 -19.609 -13.404 1.00 9.38   ? 130 VAL C CG2 1 
ATOM   1485 N N   . ASP B 1 4   ? 6.818  -17.726 -10.692 1.00 6.35   ? 131 ASP C N   1 
ATOM   1486 C CA  . ASP B 1 4   ? 6.373  -16.741 -9.712  1.00 5.86   ? 131 ASP C CA  1 
ATOM   1487 C C   . ASP B 1 4   ? 7.338  -16.838 -8.543  1.00 5.64   ? 131 ASP C C   1 
ATOM   1488 O O   . ASP B 1 4   ? 7.432  -17.884 -7.880  1.00 6.19   ? 131 ASP C O   1 
ATOM   1489 C CB  . ASP B 1 4   ? 4.954  -17.048 -9.215  1.00 6.20   ? 131 ASP C CB  1 
ATOM   1490 C CG  . ASP B 1 4   ? 3.883  -16.819 -10.262 1.00 6.93   ? 131 ASP C CG  1 
ATOM   1491 O OD1 . ASP B 1 4   ? 4.179  -16.355 -11.397 1.00 5.63   ? 131 ASP C OD1 1 
ATOM   1492 O OD2 . ASP B 1 4   ? 2.712  -17.086 -9.929  1.00 5.69   ? 131 ASP C OD2 1 
ATOM   1493 N N   . LEU B 1 5   ? 8.057  -15.751 -8.287  1.00 4.74   ? 132 LEU C N   1 
ATOM   1494 C CA  . LEU B 1 5   ? 9.071  -15.748 -7.255  1.00 4.17   ? 132 LEU C CA  1 
ATOM   1495 C C   . LEU B 1 5   ? 8.769  -14.742 -6.147  1.00 4.36   ? 132 LEU C C   1 
ATOM   1496 O O   . LEU B 1 5   ? 8.414  -13.599 -6.412  1.00 4.30   ? 132 LEU C O   1 
ATOM   1497 C CB  . LEU B 1 5   ? 10.462 -15.518 -7.875  1.00 3.62   ? 132 LEU C CB  1 
ATOM   1498 C CG  . LEU B 1 5   ? 11.719 -15.636 -7.012  1.00 4.03   ? 132 LEU C CG  1 
ATOM   1499 C CD1 . LEU B 1 5   ? 12.873 -16.135 -7.878  1.00 4.49   ? 132 LEU C CD1 1 
ATOM   1500 C CD2 . LEU B 1 5   ? 12.023 -14.259 -6.415  1.00 2.37   ? 132 LEU C CD2 1 
ATOM   1501 N N   . VAL B 1 6   ? 8.883  -15.197 -4.903  1.00 4.30   ? 133 VAL C N   1 
ATOM   1502 C CA  . VAL B 1 6   ? 8.735  -14.305 -3.750  1.00 4.98   ? 133 VAL C CA  1 
ATOM   1503 C C   . VAL B 1 6   ? 10.062 -14.119 -3.026  1.00 5.21   ? 133 VAL C C   1 
ATOM   1504 O O   . VAL B 1 6   ? 10.737 -15.091 -2.671  1.00 5.52   ? 133 VAL C O   1 
ATOM   1505 C CB  . VAL B 1 6   ? 7.660  -14.804 -2.760  1.00 4.73   ? 133 VAL C CB  1 
ATOM   1506 C CG1 . VAL B 1 6   ? 7.595  -13.906 -1.511  1.00 4.66   ? 133 VAL C CG1 1 
ATOM   1507 C CG2 . VAL B 1 6   ? 6.299  -14.847 -3.458  1.00 5.27   ? 133 VAL C CG2 1 
ATOM   1508 N N   . PHE B 1 7   ? 10.430 -12.857 -2.823  1.00 5.29   ? 134 PHE C N   1 
ATOM   1509 C CA  . PHE B 1 7   ? 11.510 -12.518 -1.930  1.00 5.69   ? 134 PHE C CA  1 
ATOM   1510 C C   . PHE B 1 7   ? 10.924 -12.380 -0.528  1.00 5.65   ? 134 PHE C C   1 
ATOM   1511 O O   . PHE B 1 7   ? 10.024 -11.560 -0.299  1.00 4.96   ? 134 PHE C O   1 
ATOM   1512 C CB  . PHE B 1 7   ? 12.152 -11.189 -2.343  1.00 5.87   ? 134 PHE C CB  1 
ATOM   1513 C CG  . PHE B 1 7   ? 12.808 -11.206 -3.695  1.00 6.39   ? 134 PHE C CG  1 
ATOM   1514 C CD1 . PHE B 1 7   ? 12.193 -10.612 -4.785  1.00 7.98   ? 134 PHE C CD1 1 
ATOM   1515 C CD2 . PHE B 1 7   ? 14.068 -11.788 -3.866  1.00 8.86   ? 134 PHE C CD2 1 
ATOM   1516 C CE1 . PHE B 1 7   ? 12.817 -10.602 -6.055  1.00 10.39  ? 134 PHE C CE1 1 
ATOM   1517 C CE2 . PHE B 1 7   ? 14.710 -11.775 -5.126  1.00 8.58   ? 134 PHE C CE2 1 
ATOM   1518 C CZ  . PHE B 1 7   ? 14.092 -11.187 -6.210  1.00 8.70   ? 134 PHE C CZ  1 
ATOM   1519 N N   . LEU B 1 8   ? 11.421 -13.190 0.405   1.00 5.27   ? 135 LEU C N   1 
ATOM   1520 C CA  . LEU B 1 8   ? 11.009 -13.077 1.811   1.00 5.31   ? 135 LEU C CA  1 
ATOM   1521 C C   . LEU B 1 8   ? 12.204 -12.584 2.600   1.00 5.55   ? 135 LEU C C   1 
ATOM   1522 O O   . LEU B 1 8   ? 13.153 -13.332 2.805   1.00 5.49   ? 135 LEU C O   1 
ATOM   1523 C CB  . LEU B 1 8   ? 10.527 -14.429 2.347   1.00 5.29   ? 135 LEU C CB  1 
ATOM   1524 C CG  . LEU B 1 8   ? 9.986  -14.498 3.786   1.00 5.82   ? 135 LEU C CG  1 
ATOM   1525 C CD1 . LEU B 1 8   ? 8.828  -13.537 4.013   1.00 3.46   ? 135 LEU C CD1 1 
ATOM   1526 C CD2 . LEU B 1 8   ? 9.569  -15.939 4.083   1.00 4.43   ? 135 LEU C CD2 1 
ATOM   1527 N N   . PHE B 1 9   ? 12.161 -11.320 3.015   1.00 6.07   ? 136 PHE C N   1 
ATOM   1528 C CA  . PHE B 1 9   ? 13.315 -10.676 3.637   1.00 6.35   ? 136 PHE C CA  1 
ATOM   1529 C C   . PHE B 1 9   ? 13.137 -10.208 5.086   1.00 6.55   ? 136 PHE C C   1 
ATOM   1530 O O   . PHE B 1 9   ? 12.166 -9.535  5.452   1.00 7.09   ? 136 PHE C O   1 
ATOM   1531 C CB  . PHE B 1 9   ? 13.892 -9.553  2.758   1.00 6.31   ? 136 PHE C CB  1 
ATOM   1532 C CG  . PHE B 1 9   ? 13.010 -8.333  2.636   1.00 6.88   ? 136 PHE C CG  1 
ATOM   1533 C CD1 . PHE B 1 9   ? 13.277 -7.187  3.384   1.00 5.05   ? 136 PHE C CD1 1 
ATOM   1534 C CD2 . PHE B 1 9   ? 11.927 -8.322  1.748   1.00 7.72   ? 136 PHE C CD2 1 
ATOM   1535 C CE1 . PHE B 1 9   ? 12.471 -6.045  3.254   1.00 5.24   ? 136 PHE C CE1 1 
ATOM   1536 C CE2 . PHE B 1 9   ? 11.116 -7.192  1.612   1.00 6.88   ? 136 PHE C CE2 1 
ATOM   1537 C CZ  . PHE B 1 9   ? 11.398 -6.047  2.373   1.00 6.59   ? 136 PHE C CZ  1 
ATOM   1538 N N   . ASP B 1 10  ? 14.136 -10.585 5.870   1.00 6.74   ? 137 ASP C N   1 
ATOM   1539 C CA  . ASP B 1 10  ? 14.293 -10.303 7.295   1.00 7.08   ? 137 ASP C CA  1 
ATOM   1540 C C   . ASP B 1 10  ? 14.360 -8.785  7.530   1.00 7.30   ? 137 ASP C C   1 
ATOM   1541 O O   . ASP B 1 10  ? 15.137 -8.080  6.885   1.00 7.84   ? 137 ASP C O   1 
ATOM   1542 C CB  . ASP B 1 10  ? 15.593 -11.009 7.728   1.00 6.76   ? 137 ASP C CB  1 
ATOM   1543 C CG  . ASP B 1 10  ? 15.877 -10.949 9.220   1.00 7.28   ? 137 ASP C CG  1 
ATOM   1544 O OD1 . ASP B 1 10  ? 15.521 -9.969  9.894   1.00 11.63  ? 137 ASP C OD1 1 
ATOM   1545 O OD2 . ASP B 1 10  ? 16.546 -11.871 9.717   1.00 7.27   ? 137 ASP C OD2 1 
ATOM   1546 N N   . GLY B 1 11  ? 13.521 -8.298  8.441   1.00 7.48   ? 138 GLY C N   1 
ATOM   1547 C CA  . GLY B 1 11  ? 13.545 -6.902  8.872   1.00 7.40   ? 138 GLY C CA  1 
ATOM   1548 C C   . GLY B 1 11  ? 13.710 -6.783  10.379  1.00 7.84   ? 138 GLY C C   1 
ATOM   1549 O O   . GLY B 1 11  ? 13.232 -5.815  10.987  1.00 7.17   ? 138 GLY C O   1 
ATOM   1550 N N   . SER B 1 12  ? 14.391 -7.766  10.986  1.00 8.04   ? 139 SER C N   1 
ATOM   1551 C CA  . SER B 1 12  ? 14.653 -7.768  12.431  1.00 8.51   ? 139 SER C CA  1 
ATOM   1552 C C   . SER B 1 12  ? 15.504 -6.589  12.902  1.00 8.96   ? 139 SER C C   1 
ATOM   1553 O O   . SER B 1 12  ? 16.156 -5.917  12.102  1.00 8.72   ? 139 SER C O   1 
ATOM   1554 C CB  . SER B 1 12  ? 15.359 -9.063  12.851  1.00 8.71   ? 139 SER C CB  1 
ATOM   1555 O OG  . SER B 1 12  ? 16.649 -9.128  12.246  1.00 10.28  ? 139 SER C OG  1 
ATOM   1556 N N   . MET B 1 13  ? 15.507 -6.390  14.222  1.00 9.72   ? 140 MET C N   1 
ATOM   1557 C CA  . MET B 1 13  ? 16.286 -5.377  14.940  1.00 11.15  ? 140 MET C CA  1 
ATOM   1558 C C   . MET B 1 13  ? 17.799 -5.543  14.812  1.00 10.39  ? 140 MET C C   1 
ATOM   1559 O O   . MET B 1 13  ? 18.560 -4.609  15.081  1.00 10.92  ? 140 MET C O   1 
ATOM   1560 C CB  . MET B 1 13  ? 15.920 -5.467  16.424  1.00 11.04  ? 140 MET C CB  1 
ATOM   1561 C CG  . MET B 1 13  ? 16.552 -4.432  17.330  1.00 12.93  ? 140 MET C CG  1 
ATOM   1562 S SD  . MET B 1 13  ? 16.280 -4.823  19.076  1.00 16.12  ? 140 MET C SD  1 
ATOM   1563 C CE  . MET B 1 13  ? 17.041 -6.418  19.169  1.00 14.77  ? 140 MET C CE  1 
ATOM   1564 N N   . SER B 1 14  ? 18.250 -6.737  14.439  1.00 10.04  ? 141 SER C N   1 
ATOM   1565 C CA  . SER B 1 14  ? 19.689 -6.972  14.306  1.00 9.09   ? 141 SER C CA  1 
ATOM   1566 C C   . SER B 1 14  ? 20.302 -6.278  13.089  1.00 8.38   ? 141 SER C C   1 
ATOM   1567 O O   . SER B 1 14  ? 21.486 -5.973  13.073  1.00 7.33   ? 141 SER C O   1 
ATOM   1568 C CB  . SER B 1 14  ? 19.967 -8.462  14.225  1.00 9.49   ? 141 SER C CB  1 
ATOM   1569 O OG  . SER B 1 14  ? 19.485 -8.952  12.999  1.00 10.16  ? 141 SER C OG  1 
ATOM   1570 N N   . LEU B 1 15  ? 19.498 -6.046  12.061  1.00 7.86   ? 142 LEU C N   1 
ATOM   1571 C CA  . LEU B 1 15  ? 20.014 -5.465  10.829  1.00 7.89   ? 142 LEU C CA  1 
ATOM   1572 C C   . LEU B 1 15  ? 20.314 -3.990  10.999  1.00 7.76   ? 142 LEU C C   1 
ATOM   1573 O O   . LEU B 1 15  ? 19.427 -3.211  11.327  1.00 8.13   ? 142 LEU C O   1 
ATOM   1574 C CB  . LEU B 1 15  ? 19.006 -5.659  9.687   1.00 8.22   ? 142 LEU C CB  1 
ATOM   1575 C CG  . LEU B 1 15  ? 18.795 -7.080  9.167   1.00 8.30   ? 142 LEU C CG  1 
ATOM   1576 C CD1 . LEU B 1 15  ? 17.427 -7.202  8.557   1.00 9.19   ? 142 LEU C CD1 1 
ATOM   1577 C CD2 . LEU B 1 15  ? 19.881 -7.443  8.158   1.00 7.85   ? 142 LEU C CD2 1 
ATOM   1578 N N   . GLN B 1 16  ? 21.567 -3.614  10.770  1.00 7.34   ? 143 GLN C N   1 
ATOM   1579 C CA  . GLN B 1 16  ? 21.941 -2.208  10.667  1.00 7.53   ? 143 GLN C CA  1 
ATOM   1580 C C   . GLN B 1 16  ? 21.264 -1.614  9.428   1.00 7.48   ? 143 GLN C C   1 
ATOM   1581 O O   . GLN B 1 16  ? 20.991 -2.350  8.477   1.00 7.49   ? 143 GLN C O   1 
ATOM   1582 C CB  . GLN B 1 16  ? 23.462 -2.083  10.564  1.00 8.14   ? 143 GLN C CB  1 
ATOM   1583 C CG  . GLN B 1 16  ? 24.210 -2.631  11.787  1.00 7.60   ? 143 GLN C CG  1 
ATOM   1584 C CD  . GLN B 1 16  ? 24.068 -1.727  12.984  1.00 12.64  ? 143 GLN C CD  1 
ATOM   1585 O OE1 . GLN B 1 16  ? 23.922 -0.508  12.845  1.00 13.73  ? 143 GLN C OE1 1 
ATOM   1586 N NE2 . GLN B 1 16  ? 24.104 -2.312  14.171  1.00 12.05  ? 143 GLN C NE2 1 
ATOM   1587 N N   . PRO B 1 17  ? 20.954 -0.298  9.447   1.00 7.41   ? 144 PRO C N   1 
ATOM   1588 C CA  . PRO B 1 17  ? 20.338 0.338   8.283   1.00 7.40   ? 144 PRO C CA  1 
ATOM   1589 C C   . PRO B 1 17  ? 21.017 0.007   6.939   1.00 7.74   ? 144 PRO C C   1 
ATOM   1590 O O   . PRO B 1 17  ? 20.326 -0.313  5.979   1.00 7.74   ? 144 PRO C O   1 
ATOM   1591 C CB  . PRO B 1 17  ? 20.436 1.829   8.615   1.00 7.67   ? 144 PRO C CB  1 
ATOM   1592 C CG  . PRO B 1 17  ? 20.312 1.852   10.128  1.00 7.25   ? 144 PRO C CG  1 
ATOM   1593 C CD  . PRO B 1 17  ? 21.138 0.662   10.558  1.00 7.13   ? 144 PRO C CD  1 
ATOM   1594 N N   . ASP B 1 18  ? 22.347 0.039   6.876   1.00 8.13   ? 145 ASP C N   1 
ATOM   1595 C CA  . ASP B 1 18  ? 23.040 -0.256  5.602   1.00 8.51   ? 145 ASP C CA  1 
ATOM   1596 C C   . ASP B 1 18  ? 22.870 -1.726  5.178   1.00 7.92   ? 145 ASP C C   1 
ATOM   1597 O O   . ASP B 1 18  ? 22.801 -2.038  3.988   1.00 6.90   ? 145 ASP C O   1 
ATOM   1598 C CB  . ASP B 1 18  ? 24.518 0.187   5.627   1.00 9.38   ? 145 ASP C CB  1 
ATOM   1599 C CG  . ASP B 1 18  ? 25.439 -0.794  6.363   1.00 11.92  ? 145 ASP C CG  1 
ATOM   1600 O OD1 . ASP B 1 18  ? 25.276 -0.999  7.587   1.00 13.87  ? 145 ASP C OD1 1 
ATOM   1601 O OD2 . ASP B 1 18  ? 26.361 -1.344  5.712   1.00 16.56  ? 145 ASP C OD2 1 
ATOM   1602 N N   . GLU B 1 19  ? 22.737 -2.610  6.167   1.00 7.14   ? 146 GLU C N   1 
ATOM   1603 C CA  . GLU B 1 19  ? 22.591 -4.032  5.897   1.00 6.77   ? 146 GLU C CA  1 
ATOM   1604 C C   . GLU B 1 19  ? 21.213 -4.316  5.305   1.00 6.74   ? 146 GLU C C   1 
ATOM   1605 O O   . GLU B 1 19  ? 21.091 -5.082  4.341   1.00 6.95   ? 146 GLU C O   1 
ATOM   1606 C CB  . GLU B 1 19  ? 22.824 -4.831  7.185   1.00 6.31   ? 146 GLU C CB  1 
ATOM   1607 C CG  . GLU B 1 19  ? 24.235 -4.673  7.723   1.00 6.46   ? 146 GLU C CG  1 
ATOM   1608 C CD  . GLU B 1 19  ? 24.463 -5.409  9.031   1.00 6.33   ? 146 GLU C CD  1 
ATOM   1609 O OE1 . GLU B 1 19  ? 23.469 -5.714  9.719   1.00 3.82   ? 146 GLU C OE1 1 
ATOM   1610 O OE2 . GLU B 1 19  ? 25.640 -5.704  9.349   1.00 7.21   ? 146 GLU C OE2 1 
ATOM   1611 N N   . PHE B 1 20  ? 20.183 -3.701  5.895   1.00 6.81   ? 147 PHE C N   1 
ATOM   1612 C CA  . PHE B 1 20  ? 18.804 -3.738  5.378   1.00 6.06   ? 147 PHE C CA  1 
ATOM   1613 C C   . PHE B 1 20  ? 18.720 -3.198  3.937   1.00 6.49   ? 147 PHE C C   1 
ATOM   1614 O O   . PHE B 1 20  ? 18.080 -3.796  3.076   1.00 5.56   ? 147 PHE C O   1 
ATOM   1615 C CB  . PHE B 1 20  ? 17.893 -2.928  6.310   1.00 5.90   ? 147 PHE C CB  1 
ATOM   1616 C CG  . PHE B 1 20  ? 16.419 -3.089  6.032   1.00 5.67   ? 147 PHE C CG  1 
ATOM   1617 C CD1 . PHE B 1 20  ? 15.770 -4.280  6.320   1.00 4.24   ? 147 PHE C CD1 1 
ATOM   1618 C CD2 . PHE B 1 20  ? 15.675 -2.025  5.489   1.00 5.56   ? 147 PHE C CD2 1 
ATOM   1619 C CE1 . PHE B 1 20  ? 14.404 -4.426  6.078   1.00 4.29   ? 147 PHE C CE1 1 
ATOM   1620 C CE2 . PHE B 1 20  ? 14.314 -2.154  5.231   1.00 4.29   ? 147 PHE C CE2 1 
ATOM   1621 C CZ  . PHE B 1 20  ? 13.669 -3.358  5.526   1.00 4.87   ? 147 PHE C CZ  1 
ATOM   1622 N N   . GLN B 1 21  ? 19.392 -2.080  3.674   1.00 7.15   ? 148 GLN C N   1 
ATOM   1623 C CA  . GLN B 1 21  ? 19.413 -1.513  2.324   1.00 7.75   ? 148 GLN C CA  1 
ATOM   1624 C C   . GLN B 1 21  ? 20.102 -2.407  1.289   1.00 7.31   ? 148 GLN C C   1 
ATOM   1625 O O   . GLN B 1 21  ? 19.641 -2.506  0.148   1.00 7.82   ? 148 GLN C O   1 
ATOM   1626 C CB  . GLN B 1 21  ? 20.009 -0.101  2.303   1.00 8.72   ? 148 GLN C CB  1 
ATOM   1627 C CG  . GLN B 1 21  ? 19.934 0.575   0.915   1.00 11.93  ? 148 GLN C CG  1 
ATOM   1628 C CD  . GLN B 1 21  ? 18.494 0.746   0.376   1.00 14.89  ? 148 GLN C CD  1 
ATOM   1629 O OE1 . GLN B 1 21  ? 17.563 1.068   1.131   1.00 15.72  ? 148 GLN C OE1 1 
ATOM   1630 N NE2 . GLN B 1 21  ? 18.320 0.547   -0.940  1.00 13.53  ? 148 GLN C NE2 1 
ATOM   1631 N N   . LYS B 1 22  ? 21.184 -3.063  1.692   1.00 7.24   ? 149 LYS C N   1 
ATOM   1632 C CA  . LYS B 1 22  ? 21.908 -3.956  0.810   1.00 7.08   ? 149 LYS C CA  1 
ATOM   1633 C C   . LYS B 1 22  ? 21.035 -5.143  0.417   1.00 6.06   ? 149 LYS C C   1 
ATOM   1634 O O   . LYS B 1 22  ? 21.169 -5.662  -0.678  1.00 5.33   ? 149 LYS C O   1 
ATOM   1635 C CB  . LYS B 1 22  ? 23.241 -4.403  1.427   1.00 7.45   ? 149 LYS C CB  1 
ATOM   1636 C CG  . LYS B 1 22  ? 24.353 -3.327  1.359   1.00 8.38   ? 149 LYS C CG  1 
ATOM   1637 C CD  . LYS B 1 22  ? 25.569 -3.722  2.204   1.00 7.69   ? 149 LYS C CD  1 
ATOM   1638 C CE  . LYS B 1 22  ? 26.696 -2.705  2.090   1.00 10.21  ? 149 LYS C CE  1 
ATOM   1639 N NZ  . LYS B 1 22  ? 26.380 -1.453  2.810   1.00 12.49  ? 149 LYS C NZ  1 
ATOM   1640 N N   . ILE B 1 23  ? 20.143 -5.561  1.315   1.00 6.00   ? 150 ILE C N   1 
ATOM   1641 C CA  . ILE B 1 23  ? 19.145 -6.574  0.969   1.00 5.46   ? 150 ILE C CA  1 
ATOM   1642 C C   . ILE B 1 23  ? 18.223 -6.029  -0.139  1.00 6.21   ? 150 ILE C C   1 
ATOM   1643 O O   . ILE B 1 23  ? 17.967 -6.712  -1.131  1.00 5.48   ? 150 ILE C O   1 
ATOM   1644 C CB  . ILE B 1 23  ? 18.313 -7.038  2.199   1.00 5.58   ? 150 ILE C CB  1 
ATOM   1645 C CG1 . ILE B 1 23  ? 19.208 -7.799  3.193   1.00 4.76   ? 150 ILE C CG1 1 
ATOM   1646 C CG2 . ILE B 1 23  ? 17.102 -7.906  1.752   1.00 4.41   ? 150 ILE C CG2 1 
ATOM   1647 C CD1 . ILE B 1 23  ? 18.524 -8.121  4.529   1.00 5.14   ? 150 ILE C CD1 1 
ATOM   1648 N N   . LEU B 1 24  ? 17.742 -4.795  0.032   1.00 6.36   ? 151 LEU C N   1 
ATOM   1649 C CA  . LEU B 1 24  ? 16.816 -4.201  -0.938  1.00 6.96   ? 151 LEU C CA  1 
ATOM   1650 C C   . LEU B 1 24  ? 17.478 -4.035  -2.298  1.00 7.12   ? 151 LEU C C   1 
ATOM   1651 O O   . LEU B 1 24  ? 16.857 -4.345  -3.320  1.00 7.75   ? 151 LEU C O   1 
ATOM   1652 C CB  . LEU B 1 24  ? 16.214 -2.875  -0.415  1.00 6.77   ? 151 LEU C CB  1 
ATOM   1653 C CG  . LEU B 1 24  ? 15.435 -2.959  0.915   1.00 7.67   ? 151 LEU C CG  1 
ATOM   1654 C CD1 . LEU B 1 24  ? 15.040 -1.566  1.423   1.00 8.25   ? 151 LEU C CD1 1 
ATOM   1655 C CD2 . LEU B 1 24  ? 14.195 -3.855  0.818   1.00 7.12   ? 151 LEU C CD2 1 
ATOM   1656 N N   . ASP B 1 25  ? 18.736 -3.583  -2.305  1.00 7.72   ? 152 ASP C N   1 
ATOM   1657 C CA  . ASP B 1 25  ? 19.535 -3.440  -3.539  1.00 8.06   ? 152 ASP C CA  1 
ATOM   1658 C C   . ASP B 1 25  ? 19.645 -4.780  -4.258  1.00 7.93   ? 152 ASP C C   1 
ATOM   1659 O O   . ASP B 1 25  ? 19.492 -4.850  -5.467  1.00 7.13   ? 152 ASP C O   1 
ATOM   1660 C CB  . ASP B 1 25  ? 20.963 -2.952  -3.248  1.00 8.12   ? 152 ASP C CB  1 
ATOM   1661 C CG  . ASP B 1 25  ? 21.023 -1.532  -2.680  1.00 10.56  ? 152 ASP C CG  1 
ATOM   1662 O OD1 . ASP B 1 25  ? 20.057 -0.771  -2.823  1.00 11.62  ? 152 ASP C OD1 1 
ATOM   1663 O OD2 . ASP B 1 25  ? 22.089 -1.172  -2.116  1.00 14.09  ? 152 ASP C OD2 1 
ATOM   1664 N N   . PHE B 1 26  ? 19.948 -5.836  -3.500  1.00 7.94   ? 153 PHE C N   1 
ATOM   1665 C CA  . PHE B 1 26  ? 20.084 -7.185  -4.060  1.00 7.60   ? 153 PHE C CA  1 
ATOM   1666 C C   . PHE B 1 26  ? 18.788 -7.627  -4.755  1.00 7.96   ? 153 PHE C C   1 
ATOM   1667 O O   . PHE B 1 26  ? 18.816 -8.118  -5.899  1.00 7.04   ? 153 PHE C O   1 
ATOM   1668 C CB  . PHE B 1 26  ? 20.516 -8.176  -2.963  1.00 7.13   ? 153 PHE C CB  1 
ATOM   1669 C CG  . PHE B 1 26  ? 20.623 -9.608  -3.429  1.00 7.47   ? 153 PHE C CG  1 
ATOM   1670 C CD1 . PHE B 1 26  ? 21.689 -10.028 -4.217  1.00 5.90   ? 153 PHE C CD1 1 
ATOM   1671 C CD2 . PHE B 1 26  ? 19.664 -10.544 -3.057  1.00 8.01   ? 153 PHE C CD2 1 
ATOM   1672 C CE1 . PHE B 1 26  ? 21.780 -11.337 -4.646  1.00 8.02   ? 153 PHE C CE1 1 
ATOM   1673 C CE2 . PHE B 1 26  ? 19.752 -11.863 -3.487  1.00 7.72   ? 153 PHE C CE2 1 
ATOM   1674 C CZ  . PHE B 1 26  ? 20.820 -12.260 -4.277  1.00 6.77   ? 153 PHE C CZ  1 
ATOM   1675 N N   . MET B 1 27  ? 17.660 -7.429  -4.072  1.00 7.53   ? 154 MET C N   1 
ATOM   1676 C CA  . MET B 1 27  ? 16.347 -7.774  -4.637  1.00 8.82   ? 154 MET C CA  1 
ATOM   1677 C C   . MET B 1 27  ? 16.078 -6.967  -5.909  1.00 7.92   ? 154 MET C C   1 
ATOM   1678 O O   . MET B 1 27  ? 15.672 -7.523  -6.918  1.00 7.27   ? 154 MET C O   1 
ATOM   1679 C CB  . MET B 1 27  ? 15.216 -7.580  -3.620  1.00 7.52   ? 154 MET C CB  1 
ATOM   1680 C CG  . MET B 1 27  ? 15.313 -8.476  -2.394  1.00 9.90   ? 154 MET C CG  1 
ATOM   1681 S SD  . MET B 1 27  ? 13.927 -8.261  -1.233  1.00 12.61  ? 154 MET C SD  1 
ATOM   1682 C CE  . MET B 1 27  ? 13.842 -6.492  -1.053  1.00 15.18  ? 154 MET C CE  1 
ATOM   1683 N N   . LYS B 1 28  ? 16.354 -5.667  -5.872  1.00 7.56   ? 155 LYS C N   1 
ATOM   1684 C CA  . LYS B 1 28  ? 16.163 -4.839  -7.069  1.00 7.90   ? 155 LYS C CA  1 
ATOM   1685 C C   . LYS B 1 28  ? 17.086 -5.231  -8.214  1.00 7.62   ? 155 LYS C C   1 
ATOM   1686 O O   . LYS B 1 28  ? 16.655 -5.270  -9.362  1.00 7.67   ? 155 LYS C O   1 
ATOM   1687 C CB  . LYS B 1 28  ? 16.249 -3.348  -6.740  1.00 8.38   ? 155 LYS C CB  1 
ATOM   1688 C CG  . LYS B 1 28  ? 15.067 -2.906  -5.872  1.00 9.78   ? 155 LYS C CG  1 
ATOM   1689 C CD  . LYS B 1 28  ? 15.050 -1.401  -5.605  1.00 14.63  ? 155 LYS C CD  1 
ATOM   1690 C CE  . LYS B 1 28  ? 16.223 -0.955  -4.727  1.00 16.65  ? 155 LYS C CE  1 
ATOM   1691 N NZ  . LYS B 1 28  ? 16.172 0.521   -4.462  1.00 18.80  ? 155 LYS C NZ  1 
ATOM   1692 N N   . ASP B 1 29  ? 18.348 -5.528  -7.912  1.00 7.38   ? 156 ASP C N   1 
ATOM   1693 C CA  . ASP B 1 29  ? 19.283 -5.974  -8.945  1.00 7.35   ? 156 ASP C CA  1 
ATOM   1694 C C   . ASP B 1 29  ? 18.797 -7.227  -9.663  1.00 7.03   ? 156 ASP C C   1 
ATOM   1695 O O   . ASP B 1 29  ? 18.931 -7.340  -10.887 1.00 6.69   ? 156 ASP C O   1 
ATOM   1696 C CB  . ASP B 1 29  ? 20.666 -6.251  -8.347  1.00 7.74   ? 156 ASP C CB  1 
ATOM   1697 C CG  . ASP B 1 29  ? 21.357 -4.994  -7.845  1.00 8.54   ? 156 ASP C CG  1 
ATOM   1698 O OD1 . ASP B 1 29  ? 22.329 -5.121  -7.069  1.00 11.54  ? 156 ASP C OD1 1 
ATOM   1699 O OD2 . ASP B 1 29  ? 20.944 -3.891  -8.228  1.00 10.10  ? 156 ASP C OD2 1 
ATOM   1700 N N   . VAL B 1 30  ? 18.280 -8.184  -8.899  1.00 6.62   ? 157 VAL C N   1 
ATOM   1701 C CA  . VAL B 1 30  ? 17.749 -9.410  -9.474  1.00 6.90   ? 157 VAL C CA  1 
ATOM   1702 C C   . VAL B 1 30  ? 16.536 -9.110  -10.360 1.00 7.22   ? 157 VAL C C   1 
ATOM   1703 O O   . VAL B 1 30  ? 16.464 -9.573  -11.494 1.00 7.14   ? 157 VAL C O   1 
ATOM   1704 C CB  . VAL B 1 30  ? 17.392 -10.456 -8.405  1.00 7.14   ? 157 VAL C CB  1 
ATOM   1705 C CG1 . VAL B 1 30  ? 16.652 -11.637 -9.056  1.00 5.78   ? 157 VAL C CG1 1 
ATOM   1706 C CG2 . VAL B 1 30  ? 18.648 -10.948 -7.695  1.00 6.03   ? 157 VAL C CG2 1 
ATOM   1707 N N   . MET B 1 31  ? 15.597 -8.317  -9.854  1.00 7.63   ? 158 MET C N   1 
ATOM   1708 C CA  . MET B 1 31  ? 14.373 -8.020  -10.614 1.00 8.43   ? 158 MET C CA  1 
ATOM   1709 C C   . MET B 1 31  ? 14.635 -7.277  -11.916 1.00 8.02   ? 158 MET C C   1 
ATOM   1710 O O   . MET B 1 31  ? 13.978 -7.546  -12.931 1.00 7.54   ? 158 MET C O   1 
ATOM   1711 C CB  . MET B 1 31  ? 13.386 -7.237  -9.754  1.00 8.16   ? 158 MET C CB  1 
ATOM   1712 C CG  . MET B 1 31  ? 12.662 -8.126  -8.779  1.00 9.78   ? 158 MET C CG  1 
ATOM   1713 S SD  . MET B 1 31  ? 11.524 -7.285  -7.670  1.00 11.32  ? 158 MET C SD  1 
ATOM   1714 C CE  . MET B 1 31  ? 10.589 -6.232  -8.761  1.00 12.71  ? 158 MET C CE  1 
ATOM   1715 N N   . LYS B 1 32  ? 15.584 -6.338  -11.864 1.00 7.72   ? 159 LYS C N   1 
ATOM   1716 C CA  . LYS B 1 32  ? 16.004 -5.557  -13.018 1.00 8.54   ? 159 LYS C CA  1 
ATOM   1717 C C   . LYS B 1 32  ? 16.632 -6.450  -14.081 1.00 7.68   ? 159 LYS C C   1 
ATOM   1718 O O   . LYS B 1 32  ? 16.341 -6.307  -15.256 1.00 7.96   ? 159 LYS C O   1 
ATOM   1719 C CB  . LYS B 1 32  ? 16.981 -4.453  -12.583 1.00 7.96   ? 159 LYS C CB  1 
ATOM   1720 C CG  . LYS B 1 32  ? 16.294 -3.243  -11.962 1.00 9.67   ? 159 LYS C CG  1 
ATOM   1721 C CD  . LYS B 1 32  ? 17.249 -2.286  -11.264 1.00 10.75  ? 159 LYS C CD  1 
ATOM   1722 C CE  . LYS B 1 32  ? 16.430 -1.189  -10.563 1.00 16.31  ? 159 LYS C CE  1 
ATOM   1723 N NZ  . LYS B 1 32  ? 17.227 -0.217  -9.747  1.00 18.90  ? 159 LYS C NZ  1 
ATOM   1724 N N   . LYS B 1 33  ? 17.480 -7.390  -13.662 1.00 8.09   ? 160 LYS C N   1 
ATOM   1725 C CA  . LYS B 1 33  ? 18.131 -8.304  -14.609 1.00 7.96   ? 160 LYS C CA  1 
ATOM   1726 C C   . LYS B 1 33  ? 17.129 -9.207  -15.347 1.00 7.86   ? 160 LYS C C   1 
ATOM   1727 O O   . LYS B 1 33  ? 17.315 -9.494  -16.536 1.00 7.72   ? 160 LYS C O   1 
ATOM   1728 C CB  . LYS B 1 33  ? 19.203 -9.148  -13.910 1.00 8.28   ? 160 LYS C CB  1 
ATOM   1729 C CG  . LYS B 1 33  ? 20.142 -9.900  -14.866 1.00 8.90   ? 160 LYS C CG  1 
ATOM   1730 C CD  . LYS B 1 33  ? 20.976 -8.944  -15.732 1.00 9.14   ? 160 LYS C CD  1 
ATOM   1731 C CE  . LYS B 1 33  ? 21.932 -9.703  -16.673 1.00 9.22   ? 160 LYS C CE  1 
ATOM   1732 N NZ  . LYS B 1 33  ? 22.660 -8.744  -17.575 1.00 8.38   ? 160 LYS C NZ  1 
ATOM   1733 N N   . LEU B 1 34  ? 16.086 -9.647  -14.634 1.00 7.04   ? 161 LEU C N   1 
ATOM   1734 C CA  . LEU B 1 34  ? 15.060 -10.554 -15.181 1.00 7.26   ? 161 LEU C CA  1 
ATOM   1735 C C   . LEU B 1 34  ? 13.755 -9.824  -15.552 1.00 6.99   ? 161 LEU C C   1 
ATOM   1736 O O   . LEU B 1 34  ? 12.679 -10.429 -15.627 1.00 6.71   ? 161 LEU C O   1 
ATOM   1737 C CB  . LEU B 1 34  ? 14.783 -11.709 -14.192 1.00 6.85   ? 161 LEU C CB  1 
ATOM   1738 C CG  . LEU B 1 34  ? 15.988 -12.603 -13.810 1.00 7.97   ? 161 LEU C CG  1 
ATOM   1739 C CD1 . LEU B 1 34  ? 15.674 -13.459 -12.612 1.00 2.86   ? 161 LEU C CD1 1 
ATOM   1740 C CD2 . LEU B 1 34  ? 16.415 -13.498 -14.962 1.00 7.28   ? 161 LEU C CD2 1 
ATOM   1741 N N   . SER B 1 35  ? 13.858 -8.522  -15.797 1.00 7.19   ? 162 SER C N   1 
ATOM   1742 C CA  . SER B 1 35  ? 12.734 -7.751  -16.325 1.00 7.56   ? 162 SER C CA  1 
ATOM   1743 C C   . SER B 1 35  ? 12.316 -8.334  -17.689 1.00 7.65   ? 162 SER C C   1 
ATOM   1744 O O   . SER B 1 35  ? 13.138 -8.956  -18.370 1.00 7.79   ? 162 SER C O   1 
ATOM   1745 C CB  . SER B 1 35  ? 13.146 -6.287  -16.469 1.00 7.16   ? 162 SER C CB  1 
ATOM   1746 O OG  . SER B 1 35  ? 14.099 -6.147  -17.513 1.00 7.67   ? 162 SER C OG  1 
ATOM   1747 N N   . ASN B 1 36  ? 11.049 -8.145  -18.066 1.00 7.77   ? 163 ASN C N   1 
ATOM   1748 C CA  . ASN B 1 36  ? 10.491 -8.661  -19.339 1.00 8.31   ? 163 ASN C CA  1 
ATOM   1749 C C   . ASN B 1 36  ? 10.693 -10.164 -19.632 1.00 8.10   ? 163 ASN C C   1 
ATOM   1750 O O   . ASN B 1 36  ? 10.780 -10.584 -20.804 1.00 8.46   ? 163 ASN C O   1 
ATOM   1751 C CB  . ASN B 1 36  ? 11.024 -7.839  -20.521 1.00 8.27   ? 163 ASN C CB  1 
ATOM   1752 C CG  . ASN B 1 36  ? 10.919 -6.355  -20.299 1.00 9.56   ? 163 ASN C CG  1 
ATOM   1753 O OD1 . ASN B 1 36  ? 9.867  -5.839  -19.911 1.00 11.46  ? 163 ASN C OD1 1 
ATOM   1754 N ND2 . ASN B 1 36  ? 12.016 -5.645  -20.556 1.00 11.15  ? 163 ASN C ND2 1 
ATOM   1755 N N   . THR B 1 37  ? 10.772 -10.979 -18.589 1.00 7.80   ? 164 THR C N   1 
ATOM   1756 C CA  . THR B 1 37  ? 10.954 -12.423 -18.772 1.00 7.29   ? 164 THR C CA  1 
ATOM   1757 C C   . THR B 1 37  ? 9.679  -13.148 -18.368 1.00 7.43   ? 164 THR C C   1 
ATOM   1758 O O   . THR B 1 37  ? 8.645  -12.509 -18.241 1.00 6.43   ? 164 THR C O   1 
ATOM   1759 C CB  . THR B 1 37  ? 12.116 -12.965 -17.938 1.00 7.76   ? 164 THR C CB  1 
ATOM   1760 O OG1 . THR B 1 37  ? 11.842 -12.730 -16.562 1.00 6.86   ? 164 THR C OG1 1 
ATOM   1761 C CG2 . THR B 1 37  ? 13.448 -12.286 -18.321 1.00 8.01   ? 164 THR C CG2 1 
ATOM   1762 N N   . SER B 1 38  ? 9.762  -14.470 -18.169 1.00 6.88   ? 165 SER C N   1 
ATOM   1763 C CA  . SER B 1 38  ? 8.637  -15.253 -17.677 1.00 7.65   ? 165 SER C CA  1 
ATOM   1764 C C   . SER B 1 38  ? 8.526  -15.160 -16.148 1.00 8.20   ? 165 SER C C   1 
ATOM   1765 O O   . SER B 1 38  ? 7.614  -15.732 -15.549 1.00 8.57   ? 165 SER C O   1 
ATOM   1766 C CB  . SER B 1 38  ? 8.734  -16.717 -18.138 1.00 7.61   ? 165 SER C CB  1 
ATOM   1767 O OG  . SER B 1 38  ? 8.495  -16.814 -19.538 1.00 8.76   ? 165 SER C OG  1 
ATOM   1768 N N   . TYR B 1 39  ? 9.442  -14.412 -15.531 1.00 8.31   ? 166 TYR C N   1 
ATOM   1769 C CA  . TYR B 1 39  ? 9.393  -14.148 -14.083 1.00 7.83   ? 166 TYR C CA  1 
ATOM   1770 C C   . TYR B 1 39  ? 8.393  -13.052 -13.713 1.00 8.31   ? 166 TYR C C   1 
ATOM   1771 O O   . TYR B 1 39  ? 8.268  -12.017 -14.401 1.00 7.28   ? 166 TYR C O   1 
ATOM   1772 C CB  . TYR B 1 39  ? 10.782 -13.778 -13.535 1.00 7.12   ? 166 TYR C CB  1 
ATOM   1773 C CG  . TYR B 1 39  ? 11.770 -14.919 -13.487 1.00 6.50   ? 166 TYR C CG  1 
ATOM   1774 C CD1 . TYR B 1 39  ? 12.365 -15.417 -14.655 1.00 6.32   ? 166 TYR C CD1 1 
ATOM   1775 C CD2 . TYR B 1 39  ? 12.126 -15.497 -12.267 1.00 6.18   ? 166 TYR C CD2 1 
ATOM   1776 C CE1 . TYR B 1 39  ? 13.276 -16.464 -14.605 1.00 4.10   ? 166 TYR C CE1 1 
ATOM   1777 C CE2 . TYR B 1 39  ? 13.028 -16.539 -12.205 1.00 3.34   ? 166 TYR C CE2 1 
ATOM   1778 C CZ  . TYR B 1 39  ? 13.598 -17.022 -13.364 1.00 4.83   ? 166 TYR C CZ  1 
ATOM   1779 O OH  . TYR B 1 39  ? 14.487 -18.060 -13.289 1.00 4.23   ? 166 TYR C OH  1 
ATOM   1780 N N   . GLN B 1 40  ? 7.691  -13.317 -12.608 1.00 8.54   ? 167 GLN C N   1 
ATOM   1781 C CA  . GLN B 1 40  ? 6.802  -12.386 -11.940 1.00 9.51   ? 167 GLN C CA  1 
ATOM   1782 C C   . GLN B 1 40  ? 7.304  -12.358 -10.498 1.00 8.81   ? 167 GLN C C   1 
ATOM   1783 O O   . GLN B 1 40  ? 7.759  -13.391 -9.989  1.00 9.39   ? 167 GLN C O   1 
ATOM   1784 C CB  . GLN B 1 40  ? 5.403  -12.986 -11.976 1.00 10.07  ? 167 GLN C CB  1 
ATOM   1785 C CG  . GLN B 1 40  ? 4.260  -12.068 -11.712 1.00 14.36  ? 167 GLN C CG  1 
ATOM   1786 C CD  . GLN B 1 40  ? 2.966  -12.720 -12.139 1.00 16.57  ? 167 GLN C CD  1 
ATOM   1787 O OE1 . GLN B 1 40  ? 2.516  -12.524 -13.276 1.00 20.02  ? 167 GLN C OE1 1 
ATOM   1788 N NE2 . GLN B 1 40  ? 2.399  -13.566 -11.266 1.00 14.72  ? 167 GLN C NE2 1 
ATOM   1789 N N   . PHE B 1 41  ? 7.237  -11.198 -9.843  1.00 7.77   ? 168 PHE C N   1 
ATOM   1790 C CA  . PHE B 1 41  ? 7.783  -11.058 -8.482  1.00 6.86   ? 168 PHE C CA  1 
ATOM   1791 C C   . PHE B 1 41  ? 6.782  -10.532 -7.453  1.00 6.00   ? 168 PHE C C   1 
ATOM   1792 O O   . PHE B 1 41  ? 5.828  -9.839  -7.792  1.00 5.63   ? 168 PHE C O   1 
ATOM   1793 C CB  . PHE B 1 41  ? 9.037  -10.160 -8.490  1.00 6.69   ? 168 PHE C CB  1 
ATOM   1794 C CG  . PHE B 1 41  ? 10.122 -10.633 -9.441  1.00 8.06   ? 168 PHE C CG  1 
ATOM   1795 C CD1 . PHE B 1 41  ? 10.190 -10.135 -10.751 1.00 7.67   ? 168 PHE C CD1 1 
ATOM   1796 C CD2 . PHE B 1 41  ? 11.076 -11.570 -9.028  1.00 8.38   ? 168 PHE C CD2 1 
ATOM   1797 C CE1 . PHE B 1 41  ? 11.199 -10.553 -11.632 1.00 5.75   ? 168 PHE C CE1 1 
ATOM   1798 C CE2 . PHE B 1 41  ? 12.084 -12.008 -9.905  1.00 6.67   ? 168 PHE C CE2 1 
ATOM   1799 C CZ  . PHE B 1 41  ? 12.136 -11.493 -11.215 1.00 5.55   ? 168 PHE C CZ  1 
ATOM   1800 N N   . ALA B 1 42  ? 7.001  -10.910 -6.197  1.00 5.99   ? 169 ALA C N   1 
ATOM   1801 C CA  . ALA B 1 42  ? 6.376  -10.265 -5.045  1.00 6.00   ? 169 ALA C CA  1 
ATOM   1802 C C   . ALA B 1 42  ? 7.425  -10.193 -3.937  1.00 5.92   ? 169 ALA C C   1 
ATOM   1803 O O   . ALA B 1 42  ? 8.433  -10.898 -3.983  1.00 5.80   ? 169 ALA C O   1 
ATOM   1804 C CB  . ALA B 1 42  ? 5.132  -11.041 -4.564  1.00 6.13   ? 169 ALA C CB  1 
ATOM   1805 N N   . ALA B 1 43  ? 7.208  -9.329  -2.954  1.00 5.72   ? 170 ALA C N   1 
ATOM   1806 C CA  . ALA B 1 43  ? 8.158  -9.223  -1.853  1.00 5.73   ? 170 ALA C CA  1 
ATOM   1807 C C   . ALA B 1 43  ? 7.431  -9.012  -0.554  1.00 5.32   ? 170 ALA C C   1 
ATOM   1808 O O   . ALA B 1 43  ? 6.466  -8.249  -0.486  1.00 4.85   ? 170 ALA C O   1 
ATOM   1809 C CB  . ALA B 1 43  ? 9.187  -8.096  -2.089  1.00 6.01   ? 170 ALA C CB  1 
ATOM   1810 N N   . VAL B 1 44  ? 7.936  -9.693  0.468   1.00 5.24   ? 171 VAL C N   1 
ATOM   1811 C CA  . VAL B 1 44  ? 7.353  -9.729  1.800   1.00 4.93   ? 171 VAL C CA  1 
ATOM   1812 C C   . VAL B 1 44  ? 8.467  -9.470  2.808   1.00 4.79   ? 171 VAL C C   1 
ATOM   1813 O O   . VAL B 1 44  ? 9.494  -10.166 2.808   1.00 5.02   ? 171 VAL C O   1 
ATOM   1814 C CB  . VAL B 1 44  ? 6.695  -11.110 2.090   1.00 4.92   ? 171 VAL C CB  1 
ATOM   1815 C CG1 . VAL B 1 44  ? 6.115  -11.167 3.517   1.00 4.19   ? 171 VAL C CG1 1 
ATOM   1816 C CG2 . VAL B 1 44  ? 5.618  -11.415 1.068   1.00 5.31   ? 171 VAL C CG2 1 
ATOM   1817 N N   . GLN B 1 45  ? 8.276  -8.459  3.646   1.00 4.41   ? 172 GLN C N   1 
ATOM   1818 C CA  . GLN B 1 45  ? 9.160  -8.247  4.791   1.00 4.48   ? 172 GLN C CA  1 
ATOM   1819 C C   . GLN B 1 45  ? 8.626  -9.056  5.966   1.00 4.82   ? 172 GLN C C   1 
ATOM   1820 O O   . GLN B 1 45  ? 7.413  -9.090  6.209   1.00 5.44   ? 172 GLN C O   1 
ATOM   1821 C CB  . GLN B 1 45  ? 9.253  -6.764  5.183   1.00 4.24   ? 172 GLN C CB  1 
ATOM   1822 C CG  . GLN B 1 45  ? 10.360 -6.460  6.211   1.00 3.24   ? 172 GLN C CG  1 
ATOM   1823 C CD  . GLN B 1 45  ? 10.364 -5.020  6.712   1.00 4.17   ? 172 GLN C CD  1 
ATOM   1824 O OE1 . GLN B 1 45  ? 9.599  -4.154  6.231   1.00 8.54   ? 172 GLN C OE1 1 
ATOM   1825 N NE2 . GLN B 1 45  ? 11.234 -4.746  7.665   1.00 2.00   ? 172 GLN C NE2 1 
ATOM   1826 N N   . PHE B 1 46  ? 9.529  -9.704  6.687   1.00 5.03   ? 173 PHE C N   1 
ATOM   1827 C CA  . PHE B 1 46  ? 9.156  -10.353 7.953   1.00 5.15   ? 173 PHE C CA  1 
ATOM   1828 C C   . PHE B 1 46  ? 10.045 -9.956  9.125   1.00 5.44   ? 173 PHE C C   1 
ATOM   1829 O O   . PHE B 1 46  ? 11.255 -9.796  8.996   1.00 4.83   ? 173 PHE C O   1 
ATOM   1830 C CB  . PHE B 1 46  ? 9.052  -11.882 7.819   1.00 4.62   ? 173 PHE C CB  1 
ATOM   1831 C CG  . PHE B 1 46  ? 10.395 -12.631 7.825   1.00 5.08   ? 173 PHE C CG  1 
ATOM   1832 C CD1 . PHE B 1 46  ? 11.152 -12.730 6.675   1.00 2.39   ? 173 PHE C CD1 1 
ATOM   1833 C CD2 . PHE B 1 46  ? 10.842 -13.291 8.977   1.00 4.60   ? 173 PHE C CD2 1 
ATOM   1834 C CE1 . PHE B 1 46  ? 12.356 -13.451 6.643   1.00 4.77   ? 173 PHE C CE1 1 
ATOM   1835 C CE2 . PHE B 1 46  ? 12.044 -14.022 8.966   1.00 3.92   ? 173 PHE C CE2 1 
ATOM   1836 C CZ  . PHE B 1 46  ? 12.803 -14.097 7.802   1.00 5.14   ? 173 PHE C CZ  1 
ATOM   1837 N N   . SER B 1 47  ? 9.409  -9.781  10.276  1.00 6.48   ? 174 SER C N   1 
ATOM   1838 C CA  . SER B 1 47  ? 10.140 -9.613  11.502  1.00 7.02   ? 174 SER C CA  1 
ATOM   1839 C C   . SER B 1 47  ? 9.360  -10.340 12.580  1.00 7.48   ? 174 SER C C   1 
ATOM   1840 O O   . SER B 1 47  ? 9.392  -11.581 12.639  1.00 8.10   ? 174 SER C O   1 
ATOM   1841 C CB  . SER B 1 47  ? 10.363 -8.124  11.793  1.00 6.76   ? 174 SER C CB  1 
ATOM   1842 O OG  . SER B 1 47  ? 11.338 -7.942  12.809  1.00 7.52   ? 174 SER C OG  1 
ATOM   1843 N N   . THR B 1 48  ? 8.638  -9.593  13.412  1.00 7.83   ? 175 THR C N   1 
ATOM   1844 C CA  . THR B 1 48  ? 7.616  -10.175 14.281  1.00 7.88   ? 175 THR C CA  1 
ATOM   1845 C C   . THR B 1 48  ? 6.347  -10.466 13.473  1.00 8.40   ? 175 THR C C   1 
ATOM   1846 O O   . THR B 1 48  ? 5.749  -11.545 13.582  1.00 8.27   ? 175 THR C O   1 
ATOM   1847 C CB  . THR B 1 48  ? 7.330  -9.240  15.483  1.00 7.78   ? 175 THR C CB  1 
ATOM   1848 O OG1 . THR B 1 48  ? 8.450  -9.303  16.376  1.00 7.00   ? 175 THR C OG1 1 
ATOM   1849 C CG2 . THR B 1 48  ? 6.049  -9.642  16.228  1.00 6.17   ? 175 THR C CG2 1 
ATOM   1850 N N   . SER B 1 49  ? 5.957  -9.492  12.661  1.00 9.12   ? 176 SER C N   1 
ATOM   1851 C CA  . SER B 1 49  ? 4.819  -9.609  11.753  1.00 9.89   ? 176 SER C CA  1 
ATOM   1852 C C   . SER B 1 49  ? 5.287  -9.665  10.283  1.00 9.32   ? 176 SER C C   1 
ATOM   1853 O O   . SER B 1 49  ? 6.484  -9.639  10.004  1.00 8.35   ? 176 SER C O   1 
ATOM   1854 C CB  . SER B 1 49  ? 3.857  -8.432  11.968  1.00 10.28  ? 176 SER C CB  1 
ATOM   1855 O OG  . SER B 1 49  ? 2.721  -8.584  11.130  1.00 15.61  ? 176 SER C OG  1 
ATOM   1856 N N   . TYR B 1 50  ? 4.326  -9.735  9.361   1.00 8.82   ? 177 TYR C N   1 
ATOM   1857 C CA  . TYR B 1 50  ? 4.591  -9.959  7.935   1.00 9.43   ? 177 TYR C CA  1 
ATOM   1858 C C   . TYR B 1 50  ? 3.866  -8.877  7.132   1.00 9.46   ? 177 TYR C C   1 
ATOM   1859 O O   . TYR B 1 50  ? 2.698  -8.556  7.405   1.00 9.15   ? 177 TYR C O   1 
ATOM   1860 C CB  . TYR B 1 50  ? 4.171  -11.396 7.518   1.00 9.49   ? 177 TYR C CB  1 
ATOM   1861 C CG  . TYR B 1 50  ? 4.380  -12.396 8.651   1.00 9.97   ? 177 TYR C CG  1 
ATOM   1862 C CD1 . TYR B 1 50  ? 3.300  -12.916 9.369   1.00 11.97  ? 177 TYR C CD1 1 
ATOM   1863 C CD2 . TYR B 1 50  ? 5.668  -12.743 9.066   1.00 10.17  ? 177 TYR C CD2 1 
ATOM   1864 C CE1 . TYR B 1 50  ? 3.506  -13.788 10.457  1.00 11.50  ? 177 TYR C CE1 1 
ATOM   1865 C CE2 . TYR B 1 50  ? 5.876  -13.596 10.136  1.00 10.32  ? 177 TYR C CE2 1 
ATOM   1866 C CZ  . TYR B 1 50  ? 4.798  -14.118 10.825  1.00 10.55  ? 177 TYR C CZ  1 
ATOM   1867 O OH  . TYR B 1 50  ? 5.029  -14.974 11.883  1.00 10.56  ? 177 TYR C OH  1 
ATOM   1868 N N   . LYS B 1 51  ? 4.572  -8.279  6.180   1.00 9.12   ? 178 LYS C N   1 
ATOM   1869 C CA  . LYS B 1 51  ? 3.956  -7.284  5.302   1.00 8.77   ? 178 LYS C CA  1 
ATOM   1870 C C   . LYS B 1 51  ? 4.326  -7.585  3.855   1.00 8.76   ? 178 LYS C C   1 
ATOM   1871 O O   . LYS B 1 51  ? 5.519  -7.684  3.524   1.00 7.21   ? 178 LYS C O   1 
ATOM   1872 C CB  . LYS B 1 51  ? 4.370  -5.854  5.692   1.00 10.00  ? 178 LYS C CB  1 
ATOM   1873 C CG  . LYS B 1 51  ? 3.579  -4.764  4.991   1.00 12.01  ? 178 LYS C CG  1 
ATOM   1874 C CD  . LYS B 1 51  ? 4.276  -3.423  5.077   1.00 17.39  ? 178 LYS C CD  1 
ATOM   1875 C CE  . LYS B 1 51  ? 3.775  -2.475  3.985   1.00 17.50  ? 178 LYS C CE  1 
ATOM   1876 N NZ  . LYS B 1 51  ? 4.607  -1.222  3.904   1.00 21.22  ? 178 LYS C NZ  1 
ATOM   1877 N N   . THR B 1 52  ? 3.291  -7.782  3.029   1.00 7.61   ? 179 THR C N   1 
ATOM   1878 C CA  . THR B 1 52  ? 3.443  -7.886  1.591   1.00 7.96   ? 179 THR C CA  1 
ATOM   1879 C C   . THR B 1 52  ? 3.759  -6.490  1.090   1.00 7.91   ? 179 THR C C   1 
ATOM   1880 O O   . THR B 1 52  ? 2.876  -5.633  1.019   1.00 8.41   ? 179 THR C O   1 
ATOM   1881 C CB  . THR B 1 52  ? 2.147  -8.416  0.907   1.00 8.31   ? 179 THR C CB  1 
ATOM   1882 O OG1 . THR B 1 52  ? 1.807  -9.706  1.442   1.00 6.96   ? 179 THR C OG1 1 
ATOM   1883 C CG2 . THR B 1 52  ? 2.333  -8.510  -0.634  1.00 8.13   ? 179 THR C CG2 1 
ATOM   1884 N N   . GLU B 1 53  ? 5.027  -6.257  0.758   1.00 7.58   ? 180 GLU C N   1 
ATOM   1885 C CA  . GLU B 1 53  ? 5.457  -4.937  0.281   1.00 6.76   ? 180 GLU C CA  1 
ATOM   1886 C C   . GLU B 1 53  ? 4.919  -4.630  -1.124  1.00 6.28   ? 180 GLU C C   1 
ATOM   1887 O O   . GLU B 1 53  ? 4.524  -3.495  -1.421  1.00 5.38   ? 180 GLU C O   1 
ATOM   1888 C CB  . GLU B 1 53  ? 6.984  -4.821  0.354   1.00 7.16   ? 180 GLU C CB  1 
ATOM   1889 C CG  . GLU B 1 53  ? 7.556  -5.025  1.761   1.00 7.53   ? 180 GLU C CG  1 
ATOM   1890 C CD  . GLU B 1 53  ? 7.250  -3.881  2.716   1.00 9.84   ? 180 GLU C CD  1 
ATOM   1891 O OE1 . GLU B 1 53  ? 7.668  -3.997  3.878   1.00 9.12   ? 180 GLU C OE1 1 
ATOM   1892 O OE2 . GLU B 1 53  ? 6.592  -2.879  2.317   1.00 9.13   ? 180 GLU C OE2 1 
ATOM   1893 N N   . PHE B 1 54  ? 4.901  -5.663  -1.967  1.00 6.13   ? 181 PHE C N   1 
ATOM   1894 C CA  . PHE B 1 54  ? 4.180  -5.651  -3.240  1.00 6.17   ? 181 PHE C CA  1 
ATOM   1895 C C   . PHE B 1 54  ? 3.884  -7.085  -3.671  1.00 6.23   ? 181 PHE C C   1 
ATOM   1896 O O   . PHE B 1 54  ? 4.674  -7.995  -3.405  1.00 6.29   ? 181 PHE C O   1 
ATOM   1897 C CB  . PHE B 1 54  ? 4.945  -4.869  -4.336  1.00 5.80   ? 181 PHE C CB  1 
ATOM   1898 C CG  . PHE B 1 54  ? 6.231  -5.536  -4.811  1.00 6.06   ? 181 PHE C CG  1 
ATOM   1899 C CD1 . PHE B 1 54  ? 7.461  -5.174  -4.271  1.00 5.17   ? 181 PHE C CD1 1 
ATOM   1900 C CD2 . PHE B 1 54  ? 6.210  -6.477  -5.839  1.00 5.38   ? 181 PHE C CD2 1 
ATOM   1901 C CE1 . PHE B 1 54  ? 8.639  -5.763  -4.719  1.00 5.62   ? 181 PHE C CE1 1 
ATOM   1902 C CE2 . PHE B 1 54  ? 7.385  -7.077  -6.292  1.00 5.59   ? 181 PHE C CE2 1 
ATOM   1903 C CZ  . PHE B 1 54  ? 8.604  -6.718  -5.734  1.00 4.96   ? 181 PHE C CZ  1 
ATOM   1904 N N   . ASP B 1 55  ? 2.739  -7.277  -4.320  1.00 6.81   ? 182 ASP C N   1 
ATOM   1905 C CA  . ASP B 1 55  ? 2.308  -8.591  -4.754  1.00 7.22   ? 182 ASP C CA  1 
ATOM   1906 C C   . ASP B 1 55  ? 2.506  -8.755  -6.261  1.00 6.66   ? 182 ASP C C   1 
ATOM   1907 O O   . ASP B 1 55  ? 2.928  -7.815  -6.937  1.00 6.32   ? 182 ASP C O   1 
ATOM   1908 C CB  . ASP B 1 55  ? 0.864  -8.869  -4.308  1.00 8.14   ? 182 ASP C CB  1 
ATOM   1909 C CG  . ASP B 1 55  ? -0.173 -7.996  -5.003  1.00 10.20  ? 182 ASP C CG  1 
ATOM   1910 O OD1 . ASP B 1 55  ? 0.118  -7.344  -6.034  1.00 11.43  ? 182 ASP C OD1 1 
ATOM   1911 O OD2 . ASP B 1 55  ? -1.323 -7.972  -4.509  1.00 13.18  ? 182 ASP C OD2 1 
ATOM   1912 N N   . PHE B 1 56  ? 2.212  -9.938  -6.784  1.00 6.54   ? 183 PHE C N   1 
ATOM   1913 C CA  . PHE B 1 56  ? 2.409  -10.208 -8.195  1.00 6.96   ? 183 PHE C CA  1 
ATOM   1914 C C   . PHE B 1 56  ? 1.667  -9.210  -9.112  1.00 7.81   ? 183 PHE C C   1 
ATOM   1915 O O   . PHE B 1 56  ? 2.240  -8.751  -10.108 1.00 8.36   ? 183 PHE C O   1 
ATOM   1916 C CB  . PHE B 1 56  ? 2.036  -11.667 -8.514  1.00 7.05   ? 183 PHE C CB  1 
ATOM   1917 C CG  . PHE B 1 56  ? 2.913  -12.696 -7.813  1.00 5.98   ? 183 PHE C CG  1 
ATOM   1918 C CD1 . PHE B 1 56  ? 2.366  -13.580 -6.899  1.00 5.00   ? 183 PHE C CD1 1 
ATOM   1919 C CD2 . PHE B 1 56  ? 4.287  -12.784 -8.100  1.00 6.03   ? 183 PHE C CD2 1 
ATOM   1920 C CE1 . PHE B 1 56  ? 3.156  -14.530 -6.264  1.00 6.04   ? 183 PHE C CE1 1 
ATOM   1921 C CE2 . PHE B 1 56  ? 5.094  -13.711 -7.470  1.00 3.90   ? 183 PHE C CE2 1 
ATOM   1922 C CZ  . PHE B 1 56  ? 4.528  -14.604 -6.556  1.00 5.49   ? 183 PHE C CZ  1 
ATOM   1923 N N   . SER B 1 57  ? 0.417  -8.862  -8.764  1.00 8.45   ? 184 SER C N   1 
ATOM   1924 C CA  . SER B 1 57  ? -0.379 -7.853  -9.512  1.00 9.01   ? 184 SER C CA  1 
ATOM   1925 C C   . SER B 1 57  ? 0.342  -6.513  -9.629  1.00 9.02   ? 184 SER C C   1 
ATOM   1926 O O   . SER B 1 57  ? 0.376  -5.903  -10.707 1.00 8.71   ? 184 SER C O   1 
ATOM   1927 C CB  . SER B 1 57  ? -1.720 -7.586  -8.823  1.00 9.16   ? 184 SER C CB  1 
ATOM   1928 O OG  . SER B 1 57  ? -2.543 -8.716  -8.859  1.00 12.63  ? 184 SER C OG  1 
ATOM   1929 N N   . ASP B 1 58  ? 0.888  -6.063  -8.499  1.00 8.82   ? 185 ASP C N   1 
ATOM   1930 C CA  . ASP B 1 58  ? 1.656  -4.816  -8.410  1.00 9.68   ? 185 ASP C CA  1 
ATOM   1931 C C   . ASP B 1 58  ? 2.876  -4.823  -9.315  1.00 9.03   ? 185 ASP C C   1 
ATOM   1932 O O   . ASP B 1 58  ? 3.139  -3.835  -10.013 1.00 8.95   ? 185 ASP C O   1 
ATOM   1933 C CB  . ASP B 1 58  ? 2.107  -4.552  -6.964  1.00 9.26   ? 185 ASP C CB  1 
ATOM   1934 C CG  . ASP B 1 58  ? 0.947  -4.366  -6.009  1.00 11.22  ? 185 ASP C CG  1 
ATOM   1935 O OD1 . ASP B 1 58  ? 1.083  -4.791  -4.838  1.00 12.23  ? 185 ASP C OD1 1 
ATOM   1936 O OD2 . ASP B 1 58  ? -0.094 -3.797  -6.417  1.00 11.06  ? 185 ASP C OD2 1 
ATOM   1937 N N   . TYR B 1 59  ? 3.623  -5.928  -9.287  1.00 9.44   ? 186 TYR C N   1 
ATOM   1938 C CA  . TYR B 1 59  ? 4.774  -6.093  -10.160 1.00 9.03   ? 186 TYR C CA  1 
ATOM   1939 C C   . TYR B 1 59  ? 4.361  -5.959  -11.618 1.00 9.54   ? 186 TYR C C   1 
ATOM   1940 O O   . TYR B 1 59  ? 5.015  -5.261  -12.384 1.00 8.35   ? 186 TYR C O   1 
ATOM   1941 C CB  . TYR B 1 59  ? 5.509  -7.430  -9.955  1.00 9.12   ? 186 TYR C CB  1 
ATOM   1942 C CG  . TYR B 1 59  ? 6.616  -7.545  -10.965 1.00 9.28   ? 186 TYR C CG  1 
ATOM   1943 C CD1 . TYR B 1 59  ? 7.834  -6.890  -10.761 1.00 10.17  ? 186 TYR C CD1 1 
ATOM   1944 C CD2 . TYR B 1 59  ? 6.409  -8.200  -12.187 1.00 8.48   ? 186 TYR C CD2 1 
ATOM   1945 C CE1 . TYR B 1 59  ? 8.845  -6.935  -11.710 1.00 9.91   ? 186 TYR C CE1 1 
ATOM   1946 C CE2 . TYR B 1 59  ? 7.410  -8.235  -13.156 1.00 10.31  ? 186 TYR C CE2 1 
ATOM   1947 C CZ  . TYR B 1 59  ? 8.622  -7.605  -12.907 1.00 10.48  ? 186 TYR C CZ  1 
ATOM   1948 O OH  . TYR B 1 59  ? 9.605  -7.639  -13.848 1.00 10.81  ? 186 TYR C OH  1 
ATOM   1949 N N   . VAL B 1 60  ? 3.285  -6.648  -11.999 1.00 10.43  ? 187 VAL C N   1 
ATOM   1950 C CA  . VAL B 1 60  ? 2.842  -6.649  -13.400 1.00 11.32  ? 187 VAL C CA  1 
ATOM   1951 C C   . VAL B 1 60  ? 2.435  -5.237  -13.862 1.00 11.46  ? 187 VAL C C   1 
ATOM   1952 O O   . VAL B 1 60  ? 2.810  -4.807  -14.970 1.00 11.21  ? 187 VAL C O   1 
ATOM   1953 C CB  . VAL B 1 60  ? 1.758  -7.742  -13.666 1.00 11.56  ? 187 VAL C CB  1 
ATOM   1954 C CG1 . VAL B 1 60  ? 1.126  -7.597  -15.043 1.00 11.78  ? 187 VAL C CG1 1 
ATOM   1955 C CG2 . VAL B 1 60  ? 2.375  -9.117  -13.531 1.00 11.72  ? 187 VAL C CG2 1 
ATOM   1956 N N   . LYS B 1 61  ? 1.710  -4.504  -13.014 1.00 12.01  ? 188 LYS C N   1 
ATOM   1957 C CA  . LYS B 1 61  ? 1.301  -3.137  -13.365 1.00 12.55  ? 188 LYS C CA  1 
ATOM   1958 C C   . LYS B 1 61  ? 2.487  -2.182  -13.524 1.00 12.71  ? 188 LYS C C   1 
ATOM   1959 O O   . LYS B 1 61  ? 2.498  -1.343  -14.434 1.00 12.86  ? 188 LYS C O   1 
ATOM   1960 C CB  . LYS B 1 61  ? 0.339  -2.532  -12.336 1.00 12.87  ? 188 LYS C CB  1 
ATOM   1961 C CG  . LYS B 1 61  ? -1.082 -3.023  -12.402 1.00 14.50  ? 188 LYS C CG  1 
ATOM   1962 C CD  . LYS B 1 61  ? -1.819 -2.624  -13.676 1.00 16.60  ? 188 LYS C CD  1 
ATOM   1963 C CE  . LYS B 1 61  ? -3.089 -3.478  -13.790 1.00 17.21  ? 188 LYS C CE  1 
ATOM   1964 N NZ  . LYS B 1 61  ? -3.796 -3.350  -15.095 1.00 20.55  ? 188 LYS C NZ  1 
ATOM   1965 N N   . TRP B 1 62  ? 3.466  -2.314  -12.631 1.00 11.72  ? 189 TRP C N   1 
ATOM   1966 C CA  . TRP B 1 62  ? 4.503  -1.313  -12.456 1.00 12.12  ? 189 TRP C CA  1 
ATOM   1967 C C   . TRP B 1 62  ? 5.825  -1.647  -13.159 1.00 11.64  ? 189 TRP C C   1 
ATOM   1968 O O   . TRP B 1 62  ? 6.428  -0.782  -13.797 1.00 11.98  ? 189 TRP C O   1 
ATOM   1969 C CB  . TRP B 1 62  ? 4.759  -1.094  -10.961 1.00 12.72  ? 189 TRP C CB  1 
ATOM   1970 C CG  . TRP B 1 62  ? 3.738  -0.223  -10.257 1.00 13.60  ? 189 TRP C CG  1 
ATOM   1971 C CD1 . TRP B 1 62  ? 2.643  -0.639  -9.560  1.00 15.11  ? 189 TRP C CD1 1 
ATOM   1972 C CD2 . TRP B 1 62  ? 3.753  1.213   -10.161 1.00 15.39  ? 189 TRP C CD2 1 
ATOM   1973 N NE1 . TRP B 1 62  ? 1.965  0.449   -9.037  1.00 13.52  ? 189 TRP C NE1 1 
ATOM   1974 C CE2 . TRP B 1 62  ? 2.625  1.595   -9.394  1.00 14.85  ? 189 TRP C CE2 1 
ATOM   1975 C CE3 . TRP B 1 62  ? 4.615  2.211   -10.645 1.00 15.29  ? 189 TRP C CE3 1 
ATOM   1976 C CZ2 . TRP B 1 62  ? 2.328  2.937   -9.106  1.00 14.45  ? 189 TRP C CZ2 1 
ATOM   1977 C CZ3 . TRP B 1 62  ? 4.314  3.550   -10.363 1.00 15.62  ? 189 TRP C CZ3 1 
ATOM   1978 C CH2 . TRP B 1 62  ? 3.180  3.894   -9.597  1.00 15.13  ? 189 TRP C CH2 1 
ATOM   1979 N N   . LYS B 1 63  ? 6.284  -2.886  -13.012 1.00 11.26  ? 190 LYS C N   1 
ATOM   1980 C CA  . LYS B 1 63  ? 7.545  -3.338  -13.611 1.00 11.16  ? 190 LYS C CA  1 
ATOM   1981 C C   . LYS B 1 63  ? 8.699  -2.380  -13.270 1.00 10.97  ? 190 LYS C C   1 
ATOM   1982 O O   . LYS B 1 63  ? 9.591  -2.118  -14.092 1.00 10.70  ? 190 LYS C O   1 
ATOM   1983 C CB  . LYS B 1 63  ? 7.394  -3.499  -15.133 1.00 10.66  ? 190 LYS C CB  1 
ATOM   1984 C CG  . LYS B 1 63  ? 6.395  -4.580  -15.563 1.00 11.96  ? 190 LYS C CG  1 
ATOM   1985 C CD  . LYS B 1 63  ? 6.333  -4.684  -17.084 1.00 11.56  ? 190 LYS C CD  1 
ATOM   1986 C CE  . LYS B 1 63  ? 5.744  -6.014  -17.529 1.00 15.73  ? 190 LYS C CE  1 
ATOM   1987 N NZ  . LYS B 1 63  ? 4.316  -6.179  -17.165 1.00 16.34  ? 190 LYS C NZ  1 
ATOM   1988 N N   . ASP B 1 64  ? 8.665  -1.854  -12.052 1.00 10.52  ? 191 ASP C N   1 
ATOM   1989 C CA  . ASP B 1 64  ? 9.631  -0.870  -11.606 1.00 10.82  ? 191 ASP C CA  1 
ATOM   1990 C C   . ASP B 1 64  ? 10.062 -1.224  -10.177 1.00 10.76  ? 191 ASP C C   1 
ATOM   1991 O O   . ASP B 1 64  ? 9.438  -0.769  -9.231  1.00 10.04  ? 191 ASP C O   1 
ATOM   1992 C CB  . ASP B 1 64  ? 8.997  0.530   -11.669 1.00 10.64  ? 191 ASP C CB  1 
ATOM   1993 C CG  . ASP B 1 64  ? 9.965  1.634   -11.327 1.00 11.75  ? 191 ASP C CG  1 
ATOM   1994 O OD1 . ASP B 1 64  ? 11.009 1.384   -10.689 1.00 10.12  ? 191 ASP C OD1 1 
ATOM   1995 O OD2 . ASP B 1 64  ? 9.672  2.790   -11.693 1.00 14.73  ? 191 ASP C OD2 1 
ATOM   1996 N N   . PRO B 1 65  ? 11.134 -2.034  -10.023 1.00 10.86  ? 192 PRO C N   1 
ATOM   1997 C CA  . PRO B 1 65  ? 11.575 -2.439  -8.686  1.00 11.52  ? 192 PRO C CA  1 
ATOM   1998 C C   . PRO B 1 65  ? 11.751 -1.265  -7.722  1.00 11.80  ? 192 PRO C C   1 
ATOM   1999 O O   . PRO B 1 65  ? 11.350 -1.381  -6.570  1.00 12.23  ? 192 PRO C O   1 
ATOM   2000 C CB  . PRO B 1 65  ? 12.917 -3.134  -8.950  1.00 11.22  ? 192 PRO C CB  1 
ATOM   2001 C CG  . PRO B 1 65  ? 12.770 -3.676  -10.313 1.00 11.76  ? 192 PRO C CG  1 
ATOM   2002 C CD  . PRO B 1 65  ? 11.981 -2.632  -11.070 1.00 11.28  ? 192 PRO C CD  1 
ATOM   2003 N N   . ASP B 1 66  ? 12.315 -0.142  -8.171  1.00 12.06  ? 193 ASP C N   1 
ATOM   2004 C CA  . ASP B 1 66  ? 12.468 0.994   -7.263  1.00 12.96  ? 193 ASP C CA  1 
ATOM   2005 C C   . ASP B 1 66  ? 11.137 1.476   -6.707  1.00 12.28  ? 193 ASP C C   1 
ATOM   2006 O O   . ASP B 1 66  ? 10.979 1.620   -5.492  1.00 12.33  ? 193 ASP C O   1 
ATOM   2007 C CB  . ASP B 1 66  ? 13.201 2.193   -7.893  1.00 13.84  ? 193 ASP C CB  1 
ATOM   2008 C CG  . ASP B 1 66  ? 13.677 3.197   -6.828  1.00 17.47  ? 193 ASP C CG  1 
ATOM   2009 O OD1 . ASP B 1 66  ? 14.613 2.855   -6.068  1.00 22.34  ? 193 ASP C OD1 1 
ATOM   2010 O OD2 . ASP B 1 66  ? 13.105 4.305   -6.715  1.00 21.97  ? 193 ASP C OD2 1 
ATOM   2011 N N   . ALA B 1 67  ? 10.197 1.758   -7.603  1.00 12.03  ? 194 ALA C N   1 
ATOM   2012 C CA  . ALA B 1 67  ? 8.912  2.299   -7.205  1.00 11.36  ? 194 ALA C CA  1 
ATOM   2013 C C   . ALA B 1 67  ? 8.211  1.303   -6.285  1.00 10.53  ? 194 ALA C C   1 
ATOM   2014 O O   . ALA B 1 67  ? 7.563  1.690   -5.315  1.00 10.42  ? 194 ALA C O   1 
ATOM   2015 C CB  . ALA B 1 67  ? 8.050  2.599   -8.441  1.00 11.56  ? 194 ALA C CB  1 
ATOM   2016 N N   . LEU B 1 68  ? 8.359  0.022   -6.600  1.00 9.87   ? 195 LEU C N   1 
ATOM   2017 C CA  . LEU B 1 68  ? 7.660  -1.040  -5.881  1.00 9.56   ? 195 LEU C CA  1 
ATOM   2018 C C   . LEU B 1 68  ? 8.123  -1.167  -4.414  1.00 10.02  ? 195 LEU C C   1 
ATOM   2019 O O   . LEU B 1 68  ? 7.327  -1.506  -3.532  1.00 10.01  ? 195 LEU C O   1 
ATOM   2020 C CB  . LEU B 1 68  ? 7.774  -2.364  -6.634  1.00 9.24   ? 195 LEU C CB  1 
ATOM   2021 C CG  . LEU B 1 68  ? 6.957  -2.544  -7.924  1.00 8.19   ? 195 LEU C CG  1 
ATOM   2022 C CD1 . LEU B 1 68  ? 7.472  -3.734  -8.703  1.00 4.57   ? 195 LEU C CD1 1 
ATOM   2023 C CD2 . LEU B 1 68  ? 5.443  -2.704  -7.655  1.00 6.20   ? 195 LEU C CD2 1 
ATOM   2024 N N   . LEU B 1 69  ? 9.385  -0.837  -4.150  1.00 10.13  ? 196 LEU C N   1 
ATOM   2025 C CA  . LEU B 1 69  ? 9.930  -0.979  -2.792  1.00 10.39  ? 196 LEU C CA  1 
ATOM   2026 C C   . LEU B 1 69  ? 10.117 0.351   -2.082  1.00 10.96  ? 196 LEU C C   1 
ATOM   2027 O O   . LEU B 1 69  ? 10.792 0.428   -1.032  1.00 10.56  ? 196 LEU C O   1 
ATOM   2028 C CB  . LEU B 1 69  ? 11.233 -1.789  -2.807  1.00 9.88   ? 196 LEU C CB  1 
ATOM   2029 C CG  . LEU B 1 69  ? 11.117 -3.282  -3.174  1.00 9.30   ? 196 LEU C CG  1 
ATOM   2030 C CD1 . LEU B 1 69  ? 12.472 -3.855  -3.502  1.00 8.98   ? 196 LEU C CD1 1 
ATOM   2031 C CD2 . LEU B 1 69  ? 10.474 -4.116  -2.073  1.00 7.91   ? 196 LEU C CD2 1 
ATOM   2032 N N   . LYS B 1 70  ? 9.490  1.386   -2.642  1.00 11.02  ? 197 LYS C N   1 
ATOM   2033 C CA  . LYS B 1 70  ? 9.665  2.758   -2.170  1.00 12.53  ? 197 LYS C CA  1 
ATOM   2034 C C   . LYS B 1 70  ? 9.077  3.041   -0.786  1.00 11.85  ? 197 LYS C C   1 
ATOM   2035 O O   . LYS B 1 70  ? 9.516  3.961   -0.113  1.00 12.18  ? 197 LYS C O   1 
ATOM   2036 C CB  . LYS B 1 70  ? 9.168  3.760   -3.226  1.00 12.04  ? 197 LYS C CB  1 
ATOM   2037 C CG  . LYS B 1 70  ? 8.117  4.756   -2.751  1.00 14.68  ? 197 LYS C CG  1 
ATOM   2038 C CD  . LYS B 1 70  ? 8.045  6.018   -3.628  1.00 15.02  ? 197 LYS C CD  1 
ATOM   2039 C CE  . LYS B 1 70  ? 7.014  5.880   -4.739  1.00 19.06  ? 197 LYS C CE  1 
ATOM   2040 N NZ  . LYS B 1 70  ? 6.634  7.239   -5.314  1.00 21.27  ? 197 LYS C NZ  1 
ATOM   2041 N N   . HIS B 1 71  ? 8.108  2.230   -0.364  1.00 11.80  ? 198 HIS C N   1 
ATOM   2042 C CA  . HIS B 1 71  ? 7.385  2.463   0.883   1.00 11.48  ? 198 HIS C CA  1 
ATOM   2043 C C   . HIS B 1 71  ? 7.864  1.580   2.035   1.00 10.75  ? 198 HIS C C   1 
ATOM   2044 O O   . HIS B 1 71  ? 7.311  1.658   3.140   1.00 10.51  ? 198 HIS C O   1 
ATOM   2045 C CB  . HIS B 1 71  ? 5.882  2.245   0.675   1.00 12.13  ? 198 HIS C CB  1 
ATOM   2046 C CG  . HIS B 1 71  ? 5.269  3.178   -0.322  1.00 14.70  ? 198 HIS C CG  1 
ATOM   2047 N ND1 . HIS B 1 71  ? 4.991  2.803   -1.619  1.00 17.34  ? 198 HIS C ND1 1 
ATOM   2048 C CD2 . HIS B 1 71  ? 4.894  4.475   -0.215  1.00 16.93  ? 198 HIS C CD2 1 
ATOM   2049 C CE1 . HIS B 1 71  ? 4.464  3.827   -2.267  1.00 17.96  ? 198 HIS C CE1 1 
ATOM   2050 N NE2 . HIS B 1 71  ? 4.395  4.855   -1.438  1.00 19.47  ? 198 HIS C NE2 1 
ATOM   2051 N N   . VAL B 1 72  ? 8.868  0.746   1.777   1.00 9.31   ? 199 VAL C N   1 
ATOM   2052 C CA  . VAL B 1 72  ? 9.395  -0.174  2.783   1.00 9.18   ? 199 VAL C CA  1 
ATOM   2053 C C   . VAL B 1 72  ? 9.845  0.582   4.028   1.00 9.17   ? 199 VAL C C   1 
ATOM   2054 O O   . VAL B 1 72  ? 10.566 1.579   3.930   1.00 8.79   ? 199 VAL C O   1 
ATOM   2055 C CB  . VAL B 1 72  ? 10.596 -1.017  2.235   1.00 9.08   ? 199 VAL C CB  1 
ATOM   2056 C CG1 . VAL B 1 72  ? 11.197 -1.896  3.322   1.00 9.46   ? 199 VAL C CG1 1 
ATOM   2057 C CG2 . VAL B 1 72  ? 10.146 -1.883  1.086   1.00 8.96   ? 199 VAL C CG2 1 
ATOM   2058 N N   . LYS B 1 73  ? 9.401  0.108   5.191   1.00 9.24   ? 200 LYS C N   1 
ATOM   2059 C CA  . LYS B 1 73  ? 9.918  0.593   6.464   1.00 9.62   ? 200 LYS C CA  1 
ATOM   2060 C C   . LYS B 1 73  ? 10.437 -0.595  7.269   1.00 9.17   ? 200 LYS C C   1 
ATOM   2061 O O   . LYS B 1 73  ? 9.742  -1.593  7.449   1.00 8.97   ? 200 LYS C O   1 
ATOM   2062 C CB  . LYS B 1 73  ? 8.864  1.372   7.256   1.00 9.98   ? 200 LYS C CB  1 
ATOM   2063 C CG  . LYS B 1 73  ? 8.158  2.488   6.483   1.00 13.16  ? 200 LYS C CG  1 
ATOM   2064 C CD  . LYS B 1 73  ? 9.124  3.548   5.934   1.00 18.40  ? 200 LYS C CD  1 
ATOM   2065 C CE  . LYS B 1 73  ? 8.396  4.505   4.991   1.00 20.94  ? 200 LYS C CE  1 
ATOM   2066 N NZ  . LYS B 1 73  ? 9.309  5.198   4.057   1.00 22.79  ? 200 LYS C NZ  1 
ATOM   2067 N N   . HIS B 1 74  ? 11.672 -0.461  7.732   1.00 8.41   ? 201 HIS C N   1 
ATOM   2068 C CA  . HIS B 1 74  ? 12.379 -1.493  8.481   1.00 7.94   ? 201 HIS C CA  1 
ATOM   2069 C C   . HIS B 1 74  ? 11.683 -1.737  9.810   1.00 7.57   ? 201 HIS C C   1 
ATOM   2070 O O   . HIS B 1 74  ? 11.645 -0.853  10.665  1.00 6.39   ? 201 HIS C O   1 
ATOM   2071 C CB  . HIS B 1 74  ? 13.813 -1.025  8.717   1.00 7.45   ? 201 HIS C CB  1 
ATOM   2072 C CG  . HIS B 1 74  ? 14.709 -2.061  9.317   1.00 6.88   ? 201 HIS C CG  1 
ATOM   2073 N ND1 . HIS B 1 74  ? 16.044 -1.823  9.567   1.00 6.92   ? 201 HIS C ND1 1 
ATOM   2074 C CD2 . HIS B 1 74  ? 14.483 -3.351  9.671   1.00 6.62   ? 201 HIS C CD2 1 
ATOM   2075 C CE1 . HIS B 1 74  ? 16.592 -2.909  10.084  1.00 7.42   ? 201 HIS C CE1 1 
ATOM   2076 N NE2 . HIS B 1 74  ? 15.666 -3.851  10.155  1.00 6.03   ? 201 HIS C NE2 1 
ATOM   2077 N N   . MET B 1 75  ? 11.114 -2.936  9.948   1.00 7.28   ? 202 MET C N   1 
ATOM   2078 C CA  . MET B 1 75  ? 10.294 -3.323  11.107  1.00 7.74   ? 202 MET C CA  1 
ATOM   2079 C C   . MET B 1 75  ? 11.020 -3.259  12.449  1.00 7.54   ? 202 MET C C   1 
ATOM   2080 O O   . MET B 1 75  ? 10.448 -2.805  13.434  1.00 7.38   ? 202 MET C O   1 
ATOM   2081 C CB  . MET B 1 75  ? 9.731  -4.736  10.900  1.00 7.41   ? 202 MET C CB  1 
ATOM   2082 C CG  . MET B 1 75  ? 8.503  -4.765  10.017  1.00 6.85   ? 202 MET C CG  1 
ATOM   2083 S SD  . MET B 1 75  ? 8.172  -6.418  9.389   1.00 8.08   ? 202 MET C SD  1 
ATOM   2084 C CE  . MET B 1 75  ? 6.585  -6.157  8.567   1.00 6.66   ? 202 MET C CE  1 
ATOM   2085 N N   . LEU B 1 76  ? 12.264 -3.744  12.475  1.00 7.47   ? 203 LEU C N   1 
ATOM   2086 C CA  . LEU B 1 76  ? 13.141 -3.648  13.655  1.00 7.54   ? 203 LEU C CA  1 
ATOM   2087 C C   . LEU B 1 76  ? 12.675 -4.482  14.853  1.00 7.28   ? 203 LEU C C   1 
ATOM   2088 O O   . LEU B 1 76  ? 12.850 -4.072  15.995  1.00 7.48   ? 203 LEU C O   1 
ATOM   2089 C CB  . LEU B 1 76  ? 13.370 -2.172  14.064  1.00 7.31   ? 203 LEU C CB  1 
ATOM   2090 C CG  . LEU B 1 76  ? 14.159 -1.286  13.080  1.00 8.29   ? 203 LEU C CG  1 
ATOM   2091 C CD1 . LEU B 1 76  ? 13.996 0.177   13.417  1.00 9.57   ? 203 LEU C CD1 1 
ATOM   2092 C CD2 . LEU B 1 76  ? 15.637 -1.656  13.110  1.00 8.92   ? 203 LEU C CD2 1 
ATOM   2093 N N   . LEU B 1 77  ? 12.089 -5.650  14.597  1.00 7.17   ? 204 LEU C N   1 
ATOM   2094 C CA  . LEU B 1 77  ? 11.607 -6.531  15.683  1.00 6.88   ? 204 LEU C CA  1 
ATOM   2095 C C   . LEU B 1 77  ? 12.231 -7.929  15.618  1.00 6.86   ? 204 LEU C C   1 
ATOM   2096 O O   . LEU B 1 77  ? 13.450 -8.038  15.466  1.00 7.83   ? 204 LEU C O   1 
ATOM   2097 C CB  . LEU B 1 77  ? 10.061 -6.561  15.758  1.00 7.22   ? 204 LEU C CB  1 
ATOM   2098 C CG  . LEU B 1 77  ? 9.405  -5.199  16.056  1.00 7.73   ? 204 LEU C CG  1 
ATOM   2099 C CD1 . LEU B 1 77  ? 7.905  -5.221  15.845  1.00 9.03   ? 204 LEU C CD1 1 
ATOM   2100 C CD2 . LEU B 1 77  ? 9.744  -4.708  17.471  1.00 7.93   ? 204 LEU C CD2 1 
ATOM   2101 N N   . LEU B 1 78  ? 11.428 -8.989  15.715  1.00 6.33   ? 205 LEU C N   1 
ATOM   2102 C CA  . LEU B 1 78  ? 11.983 -10.349 15.832  1.00 6.29   ? 205 LEU C CA  1 
ATOM   2103 C C   . LEU B 1 78  ? 12.195 -11.036 14.467  1.00 6.22   ? 205 LEU C C   1 
ATOM   2104 O O   . LEU B 1 78  ? 12.288 -10.363 13.436  1.00 6.46   ? 205 LEU C O   1 
ATOM   2105 C CB  . LEU B 1 78  ? 11.160 -11.222 16.805  1.00 6.25   ? 205 LEU C CB  1 
ATOM   2106 C CG  . LEU B 1 78  ? 11.011 -10.703 18.249  1.00 6.84   ? 205 LEU C CG  1 
ATOM   2107 C CD1 . LEU B 1 78  ? 9.909  -11.434 19.023  1.00 6.57   ? 205 LEU C CD1 1 
ATOM   2108 C CD2 . LEU B 1 78  ? 12.327 -10.795 19.005  1.00 7.29   ? 205 LEU C CD2 1 
ATOM   2109 N N   . THR B 1 79  ? 12.305 -12.361 14.474  1.00 5.86   ? 206 THR C N   1 
ATOM   2110 C CA  . THR B 1 79  ? 12.632 -13.128 13.275  1.00 5.70   ? 206 THR C CA  1 
ATOM   2111 C C   . THR B 1 79  ? 11.740 -14.368 13.236  1.00 5.70   ? 206 THR C C   1 
ATOM   2112 O O   . THR B 1 79  ? 12.206 -15.487 13.462  1.00 5.55   ? 206 THR C O   1 
ATOM   2113 C CB  . THR B 1 79  ? 14.138 -13.537 13.272  1.00 5.88   ? 206 THR C CB  1 
ATOM   2114 O OG1 . THR B 1 79  ? 14.945 -12.402 13.612  1.00 6.86   ? 206 THR C OG1 1 
ATOM   2115 C CG2 . THR B 1 79  ? 14.572 -14.100 11.907  1.00 5.39   ? 206 THR C CG2 1 
ATOM   2116 N N   . ASN B 1 80  ? 10.452 -14.158 12.951  1.00 5.73   ? 207 ASN C N   1 
ATOM   2117 C CA  . ASN B 1 80  ? 9.474  -15.246 12.937  1.00 5.61   ? 207 ASN C CA  1 
ATOM   2118 C C   . ASN B 1 80  ? 9.426  -15.954 11.581  1.00 5.42   ? 207 ASN C C   1 
ATOM   2119 O O   . ASN B 1 80  ? 8.475  -15.811 10.828  1.00 5.29   ? 207 ASN C O   1 
ATOM   2120 C CB  . ASN B 1 80  ? 8.090  -14.728 13.332  1.00 6.04   ? 207 ASN C CB  1 
ATOM   2121 C CG  . ASN B 1 80  ? 7.983  -14.422 14.816  1.00 7.60   ? 207 ASN C CG  1 
ATOM   2122 O OD1 . ASN B 1 80  ? 8.769  -14.924 15.630  1.00 8.08   ? 207 ASN C OD1 1 
ATOM   2123 N ND2 . ASN B 1 80  ? 6.994  -13.617 15.180  1.00 7.72   ? 207 ASN C ND2 1 
ATOM   2124 N N   . THR B 1 81  ? 10.475 -16.709 11.298  1.00 5.14   ? 208 THR C N   1 
ATOM   2125 C CA  . THR B 1 81  ? 10.692 -17.339 9.998   1.00 4.75   ? 208 THR C CA  1 
ATOM   2126 C C   . THR B 1 81  ? 9.643  -18.416 9.644   1.00 5.20   ? 208 THR C C   1 
ATOM   2127 O O   . THR B 1 81  ? 9.257  -18.540 8.475   1.00 4.76   ? 208 THR C O   1 
ATOM   2128 C CB  . THR B 1 81  ? 12.116 -17.923 9.911   1.00 5.09   ? 208 THR C CB  1 
ATOM   2129 O OG1 . THR B 1 81  ? 13.054 -16.985 10.465  1.00 5.31   ? 208 THR C OG1 1 
ATOM   2130 C CG2 . THR B 1 81  ? 12.499 -18.219 8.451   1.00 5.25   ? 208 THR C CG2 1 
ATOM   2131 N N   . PHE B 1 82  ? 9.193  -19.198 10.634  1.00 5.25   ? 209 PHE C N   1 
ATOM   2132 C CA  . PHE B 1 82  ? 8.180  -20.225 10.369  1.00 6.21   ? 209 PHE C CA  1 
ATOM   2133 C C   . PHE B 1 82  ? 6.892  -19.560 9.926   1.00 6.58   ? 209 PHE C C   1 
ATOM   2134 O O   . PHE B 1 82  ? 6.325  -19.924 8.891   1.00 6.88   ? 209 PHE C O   1 
ATOM   2135 C CB  . PHE B 1 82  ? 7.915  -21.108 11.591  1.00 6.46   ? 209 PHE C CB  1 
ATOM   2136 C CG  . PHE B 1 82  ? 8.851  -22.273 11.719  1.00 6.83   ? 209 PHE C CG  1 
ATOM   2137 C CD1 . PHE B 1 82  ? 9.999  -22.174 12.499  1.00 8.69   ? 209 PHE C CD1 1 
ATOM   2138 C CD2 . PHE B 1 82  ? 8.586  -23.470 11.066  1.00 6.79   ? 209 PHE C CD2 1 
ATOM   2139 C CE1 . PHE B 1 82  ? 10.872 -23.255 12.634  1.00 9.69   ? 209 PHE C CE1 1 
ATOM   2140 C CE2 . PHE B 1 82  ? 9.456  -24.549 11.187  1.00 9.09   ? 209 PHE C CE2 1 
ATOM   2141 C CZ  . PHE B 1 82  ? 10.602 -24.440 11.975  1.00 8.87   ? 209 PHE C CZ  1 
ATOM   2142 N N   . GLY B 1 83  ? 6.450  -18.578 10.712  1.00 6.80   ? 210 GLY C N   1 
ATOM   2143 C CA  . GLY B 1 83  ? 5.220  -17.827 10.434  1.00 7.64   ? 210 GLY C CA  1 
ATOM   2144 C C   . GLY B 1 83  ? 5.289  -17.112 9.094   1.00 7.62   ? 210 GLY C C   1 
ATOM   2145 O O   . GLY B 1 83  ? 4.308  -17.079 8.351   1.00 7.59   ? 210 GLY C O   1 
ATOM   2146 N N   . ALA B 1 84  ? 6.467  -16.558 8.792   1.00 7.54   ? 211 ALA C N   1 
ATOM   2147 C CA  . ALA B 1 84  ? 6.725  -15.851 7.537   1.00 7.48   ? 211 ALA C CA  1 
ATOM   2148 C C   . ALA B 1 84  ? 6.553  -16.754 6.333   1.00 7.41   ? 211 ALA C C   1 
ATOM   2149 O O   . ALA B 1 84  ? 5.887  -16.380 5.374   1.00 6.48   ? 211 ALA C O   1 
ATOM   2150 C CB  . ALA B 1 84  ? 8.130  -15.270 7.530   1.00 7.85   ? 211 ALA C CB  1 
ATOM   2151 N N   . ILE B 1 85  ? 7.174  -17.930 6.381   1.00 7.52   ? 212 ILE C N   1 
ATOM   2152 C CA  . ILE B 1 85  ? 7.084  -18.884 5.261   1.00 7.51   ? 212 ILE C CA  1 
ATOM   2153 C C   . ILE B 1 85  ? 5.641  -19.350 5.046   1.00 7.99   ? 212 ILE C C   1 
ATOM   2154 O O   . ILE B 1 85  ? 5.146  -19.369 3.916   1.00 7.35   ? 212 ILE C O   1 
ATOM   2155 C CB  . ILE B 1 85  ? 8.069  -20.058 5.439   1.00 7.38   ? 212 ILE C CB  1 
ATOM   2156 C CG1 . ILE B 1 85  ? 9.499  -19.553 5.220   1.00 6.82   ? 212 ILE C CG1 1 
ATOM   2157 C CG2 . ILE B 1 85  ? 7.737  -21.208 4.475   1.00 6.81   ? 212 ILE C CG2 1 
ATOM   2158 C CD1 . ILE B 1 85  ? 10.553 -20.479 5.730   1.00 5.58   ? 212 ILE C CD1 1 
ATOM   2159 N N   . ASN B 1 86  ? 4.975  -19.719 6.135   1.00 8.62   ? 213 ASN C N   1 
ATOM   2160 C CA  . ASN B 1 86  ? 3.547  -20.043 6.092   1.00 10.06  ? 213 ASN C CA  1 
ATOM   2161 C C   . ASN B 1 86  ? 2.702  -18.900 5.516   1.00 10.05  ? 213 ASN C C   1 
ATOM   2162 O O   . ASN B 1 86  ? 1.799  -19.144 4.718   1.00 10.61  ? 213 ASN C O   1 
ATOM   2163 C CB  . ASN B 1 86  ? 3.056  -20.434 7.489   1.00 10.09  ? 213 ASN C CB  1 
ATOM   2164 C CG  . ASN B 1 86  ? 3.411  -21.863 7.847   1.00 11.88  ? 213 ASN C CG  1 
ATOM   2165 O OD1 . ASN B 1 86  ? 2.921  -22.814 7.227   1.00 13.60  ? 213 ASN C OD1 1 
ATOM   2166 N ND2 . ASN B 1 86  ? 4.270  -22.026 8.844   1.00 11.19  ? 213 ASN C ND2 1 
ATOM   2167 N N   . TYR B 1 87  ? 3.009  -17.661 5.916   1.00 10.79  ? 214 TYR C N   1 
ATOM   2168 C CA  . TYR B 1 87  ? 2.315  -16.474 5.405   1.00 10.58  ? 214 TYR C CA  1 
ATOM   2169 C C   . TYR B 1 87  ? 2.468  -16.371 3.881   1.00 10.51  ? 214 TYR C C   1 
ATOM   2170 O O   . TYR B 1 87  ? 1.501  -16.100 3.172   1.00 10.34  ? 214 TYR C O   1 
ATOM   2171 C CB  . TYR B 1 87  ? 2.809  -15.193 6.107   1.00 10.93  ? 214 TYR C CB  1 
ATOM   2172 C CG  . TYR B 1 87  ? 2.303  -13.887 5.508   1.00 11.34  ? 214 TYR C CG  1 
ATOM   2173 C CD1 . TYR B 1 87  ? 1.139  -13.277 5.989   1.00 12.61  ? 214 TYR C CD1 1 
ATOM   2174 C CD2 . TYR B 1 87  ? 2.987  -13.264 4.463   1.00 11.78  ? 214 TYR C CD2 1 
ATOM   2175 C CE1 . TYR B 1 87  ? 0.670  -12.081 5.450   1.00 11.89  ? 214 TYR C CE1 1 
ATOM   2176 C CE2 . TYR B 1 87  ? 2.533  -12.077 3.919   1.00 11.52  ? 214 TYR C CE2 1 
ATOM   2177 C CZ  . TYR B 1 87  ? 1.378  -11.491 4.410   1.00 12.72  ? 214 TYR C CZ  1 
ATOM   2178 O OH  . TYR B 1 87  ? 0.940  -10.315 3.856   1.00 12.11  ? 214 TYR C OH  1 
ATOM   2179 N N   . VAL B 1 88  ? 3.683  -16.592 3.386   1.00 9.94   ? 215 VAL C N   1 
ATOM   2180 C CA  . VAL B 1 88  ? 3.933  -16.574 1.946   1.00 9.54   ? 215 VAL C CA  1 
ATOM   2181 C C   . VAL B 1 88  ? 3.117  -17.651 1.221   1.00 9.96   ? 215 VAL C C   1 
ATOM   2182 O O   . VAL B 1 88  ? 2.443  -17.369 0.220   1.00 10.43  ? 215 VAL C O   1 
ATOM   2183 C CB  . VAL B 1 88  ? 5.456  -16.710 1.648   1.00 9.37   ? 215 VAL C CB  1 
ATOM   2184 C CG1 . VAL B 1 88  ? 5.721  -16.967 0.183   1.00 9.01   ? 215 VAL C CG1 1 
ATOM   2185 C CG2 . VAL B 1 88  ? 6.202  -15.456 2.127   1.00 9.01   ? 215 VAL C CG2 1 
ATOM   2186 N N   . ALA B 1 89  ? 3.163  -18.874 1.734   1.00 9.89   ? 216 ALA C N   1 
ATOM   2187 C CA  . ALA B 1 89  ? 2.493  -20.011 1.091   1.00 10.55  ? 216 ALA C CA  1 
ATOM   2188 C C   . ALA B 1 89  ? 0.981  -19.830 1.032   1.00 11.15  ? 216 ALA C C   1 
ATOM   2189 O O   . ALA B 1 89  ? 0.343  -20.204 0.040   1.00 11.22  ? 216 ALA C O   1 
ATOM   2190 C CB  . ALA B 1 89  ? 2.837  -21.314 1.810   1.00 9.96   ? 216 ALA C CB  1 
ATOM   2191 N N   . THR B 1 90  ? 0.404  -19.270 2.093   1.00 11.68  ? 217 THR C N   1 
ATOM   2192 C CA  . THR B 1 90  ? -1.056 -19.182 2.182   1.00 13.12  ? 217 THR C CA  1 
ATOM   2193 C C   . THR B 1 90  ? -1.612 -17.822 1.787   1.00 13.38  ? 217 THR C C   1 
ATOM   2194 O O   . THR B 1 90  ? -2.743 -17.738 1.320   1.00 14.19  ? 217 THR C O   1 
ATOM   2195 C CB  . THR B 1 90  ? -1.591 -19.536 3.591   1.00 13.11  ? 217 THR C CB  1 
ATOM   2196 O OG1 . THR B 1 90  ? -1.076 -18.601 4.543   1.00 14.83  ? 217 THR C OG1 1 
ATOM   2197 C CG2 . THR B 1 90  ? -1.217 -20.960 3.990   1.00 13.66  ? 217 THR C CG2 1 
ATOM   2198 N N   . GLU B 1 91  ? -0.829 -16.764 1.980   1.00 13.62  ? 218 GLU C N   1 
ATOM   2199 C CA  . GLU B 1 91  ? -1.319 -15.401 1.771   1.00 13.70  ? 218 GLU C CA  1 
ATOM   2200 C C   . GLU B 1 91  ? -0.710 -14.676 0.564   1.00 13.08  ? 218 GLU C C   1 
ATOM   2201 O O   . GLU B 1 91  ? -1.194 -13.611 0.186   1.00 14.04  ? 218 GLU C O   1 
ATOM   2202 C CB  . GLU B 1 91  ? -1.118 -14.548 3.032   1.00 14.48  ? 218 GLU C CB  1 
ATOM   2203 C CG  . GLU B 1 91  ? -1.759 -15.101 4.301   1.00 16.56  ? 218 GLU C CG  1 
ATOM   2204 C CD  . GLU B 1 91  ? -3.201 -14.664 4.491   1.00 20.71  ? 218 GLU C CD  1 
ATOM   2205 O OE1 . GLU B 1 91  ? -3.554 -14.299 5.633   1.00 24.67  ? 218 GLU C OE1 1 
ATOM   2206 O OE2 . GLU B 1 91  ? -3.989 -14.669 3.523   1.00 21.69  ? 218 GLU C OE2 1 
ATOM   2207 N N   . VAL B 1 92  ? 0.347  -15.219 -0.029  1.00 11.70  ? 219 VAL C N   1 
ATOM   2208 C CA  . VAL B 1 92  ? 0.993  -14.529 -1.158  1.00 10.50  ? 219 VAL C CA  1 
ATOM   2209 C C   . VAL B 1 92  ? 0.893  -15.277 -2.492  1.00 10.08  ? 219 VAL C C   1 
ATOM   2210 O O   . VAL B 1 92  ? 0.620  -14.668 -3.533  1.00 9.61   ? 219 VAL C O   1 
ATOM   2211 C CB  . VAL B 1 92  ? 2.466  -14.140 -0.837  1.00 10.59  ? 219 VAL C CB  1 
ATOM   2212 C CG1 . VAL B 1 92  ? 3.068  -13.328 -1.974  1.00 10.49  ? 219 VAL C CG1 1 
ATOM   2213 C CG2 . VAL B 1 92  ? 2.535  -13.358 0.479   1.00 9.41   ? 219 VAL C CG2 1 
ATOM   2214 N N   . PHE B 1 93  ? 1.133  -16.585 -2.464  1.00 8.99   ? 220 PHE C N   1 
ATOM   2215 C CA  . PHE B 1 93  ? 0.933  -17.408 -3.650  1.00 8.98   ? 220 PHE C CA  1 
ATOM   2216 C C   . PHE B 1 93  ? -0.574 -17.668 -3.876  1.00 9.03   ? 220 PHE C C   1 
ATOM   2217 O O   . PHE B 1 93  ? -1.078 -18.758 -3.642  1.00 9.16   ? 220 PHE C O   1 
ATOM   2218 C CB  . PHE B 1 93  ? 1.737  -18.707 -3.534  1.00 8.32   ? 220 PHE C CB  1 
ATOM   2219 C CG  . PHE B 1 93  ? 3.206  -18.546 -3.841  1.00 7.76   ? 220 PHE C CG  1 
ATOM   2220 C CD1 . PHE B 1 93  ? 4.155  -18.584 -2.826  1.00 7.62   ? 220 PHE C CD1 1 
ATOM   2221 C CD2 . PHE B 1 93  ? 3.641  -18.366 -5.151  1.00 7.41   ? 220 PHE C CD2 1 
ATOM   2222 C CE1 . PHE B 1 93  ? 5.530  -18.447 -3.108  1.00 7.15   ? 220 PHE C CE1 1 
ATOM   2223 C CE2 . PHE B 1 93  ? 5.004  -18.225 -5.441  1.00 6.79   ? 220 PHE C CE2 1 
ATOM   2224 C CZ  . PHE B 1 93  ? 5.946  -18.268 -4.425  1.00 6.54   ? 220 PHE C CZ  1 
ATOM   2225 N N   . ARG B 1 94  ? -1.272 -16.632 -4.323  1.00 9.50   ? 221 ARG C N   1 
ATOM   2226 C CA  . ARG B 1 94  ? -2.718 -16.648 -4.455  1.00 10.04  ? 221 ARG C CA  1 
ATOM   2227 C C   . ARG B 1 94  ? -3.078 -16.003 -5.784  1.00 9.47   ? 221 ARG C C   1 
ATOM   2228 O O   . ARG B 1 94  ? -2.572 -14.929 -6.109  1.00 9.40   ? 221 ARG C O   1 
ATOM   2229 C CB  . ARG B 1 94  ? -3.372 -15.842 -3.322  1.00 9.46   ? 221 ARG C CB  1 
ATOM   2230 C CG  . ARG B 1 94  ? -3.311 -16.471 -1.939  1.00 9.97   ? 221 ARG C CG  1 
ATOM   2231 C CD  . ARG B 1 94  ? -4.166 -15.702 -0.953  1.00 12.52  ? 221 ARG C CD  1 
ATOM   2232 N NE  . ARG B 1 94  ? -5.571 -15.775 -1.349  1.00 18.85  ? 221 ARG C NE  1 
ATOM   2233 C CZ  . ARG B 1 94  ? -6.520 -14.914 -0.985  1.00 21.81  ? 221 ARG C CZ  1 
ATOM   2234 N NH1 . ARG B 1 94  ? -6.235 -13.889 -0.178  1.00 23.40  ? 221 ARG C NH1 1 
ATOM   2235 N NH2 . ARG B 1 94  ? -7.765 -15.086 -1.436  1.00 20.81  ? 221 ARG C NH2 1 
ATOM   2236 N N   . GLU B 1 95  ? -3.989 -16.628 -6.523  1.00 9.43   ? 222 GLU C N   1 
ATOM   2237 C CA  . GLU B 1 95  ? -4.454 -16.050 -7.796  1.00 9.11   ? 222 GLU C CA  1 
ATOM   2238 C C   . GLU B 1 95  ? -5.151 -14.688 -7.636  1.00 9.41   ? 222 GLU C C   1 
ATOM   2239 O O   . GLU B 1 95  ? -5.088 -13.867 -8.548  1.00 9.14   ? 222 GLU C O   1 
ATOM   2240 C CB  . GLU B 1 95  ? -5.315 -17.040 -8.587  1.00 9.21   ? 222 GLU C CB  1 
ATOM   2241 C CG  . GLU B 1 95  ? -6.660 -17.454 -7.941  1.00 7.05   ? 222 GLU C CG  1 
ATOM   2242 C CD  . GLU B 1 95  ? -7.383 -18.530 -8.749  1.00 8.53   ? 222 GLU C CD  1 
ATOM   2243 O OE1 . GLU B 1 95  ? -6.790 -19.073 -9.715  1.00 6.94   ? 222 GLU C OE1 1 
ATOM   2244 O OE2 . GLU B 1 95  ? -8.543 -18.856 -8.416  1.00 6.82   ? 222 GLU C OE2 1 
ATOM   2245 N N   . GLU B 1 96  ? -5.785 -14.455 -6.478  1.00 9.78   ? 223 GLU C N   1 
ATOM   2246 C CA  . GLU B 1 96  ? -6.393 -13.149 -6.138  1.00 10.57  ? 223 GLU C CA  1 
ATOM   2247 C C   . GLU B 1 96  ? -5.332 -12.056 -5.996  1.00 10.32  ? 223 GLU C C   1 
ATOM   2248 O O   . GLU B 1 96  ? -5.650 -10.857 -6.072  1.00 9.99   ? 223 GLU C O   1 
ATOM   2249 C CB  . GLU B 1 96  ? -7.207 -13.232 -4.832  1.00 11.26  ? 223 GLU C CB  1 
ATOM   2250 C CG  . GLU B 1 96  ? -8.278 -12.138 -4.657  1.00 13.92  ? 223 GLU C CG  1 
ATOM   2251 C CD  . GLU B 1 96  ? -7.794 -10.844 -3.991  1.00 17.32  ? 223 GLU C CD  1 
ATOM   2252 O OE1 . GLU B 1 96  ? -8.330 -9.751  -4.329  1.00 18.69  ? 223 GLU C OE1 1 
ATOM   2253 O OE2 . GLU B 1 96  ? -6.895 -10.901 -3.125  1.00 18.69  ? 223 GLU C OE2 1 
ATOM   2254 N N   . LEU B 1 97  ? -4.078 -12.467 -5.792  1.00 9.92   ? 224 LEU C N   1 
ATOM   2255 C CA  . LEU B 1 97  ? -2.963 -11.506 -5.708  1.00 9.70   ? 224 LEU C CA  1 
ATOM   2256 C C   . LEU B 1 97  ? -2.034 -11.504 -6.934  1.00 9.42   ? 224 LEU C C   1 
ATOM   2257 O O   . LEU B 1 97  ? -0.919 -10.964 -6.883  1.00 8.78   ? 224 LEU C O   1 
ATOM   2258 C CB  . LEU B 1 97  ? -2.165 -11.715 -4.425  1.00 9.82   ? 224 LEU C CB  1 
ATOM   2259 C CG  . LEU B 1 97  ? -2.903 -11.538 -3.097  1.00 10.66  ? 224 LEU C CG  1 
ATOM   2260 C CD1 . LEU B 1 97  ? -1.870 -11.494 -1.977  1.00 11.37  ? 224 LEU C CD1 1 
ATOM   2261 C CD2 . LEU B 1 97  ? -3.772 -10.278 -3.075  1.00 12.09  ? 224 LEU C CD2 1 
ATOM   2262 N N   . GLY B 1 98  ? -2.497 -12.108 -8.028  1.00 8.61   ? 225 GLY C N   1 
ATOM   2263 C CA  . GLY B 1 98  ? -1.778 -12.057 -9.299  1.00 8.13   ? 225 GLY C CA  1 
ATOM   2264 C C   . GLY B 1 98  ? -0.894 -13.252 -9.594  1.00 7.33   ? 225 GLY C C   1 
ATOM   2265 O O   . GLY B 1 98  ? -0.185 -13.252 -10.589 1.00 7.19   ? 225 GLY C O   1 
ATOM   2266 N N   . ALA B 1 99  ? -0.923 -14.252 -8.716  1.00 7.67   ? 226 ALA C N   1 
ATOM   2267 C CA  . ALA B 1 99  ? -0.157 -15.495 -8.892  1.00 8.01   ? 226 ALA C CA  1 
ATOM   2268 C C   . ALA B 1 99  ? -0.761 -16.309 -10.013 1.00 8.44   ? 226 ALA C C   1 
ATOM   2269 O O   . ALA B 1 99  ? -1.980 -16.337 -10.182 1.00 8.92   ? 226 ALA C O   1 
ATOM   2270 C CB  . ALA B 1 99  ? -0.154 -16.314 -7.621  1.00 7.67   ? 226 ALA C CB  1 
ATOM   2271 N N   . ARG B 1 100 ? 0.105  -16.979 -10.758 1.00 9.09   ? 227 ARG C N   1 
ATOM   2272 C CA  . ARG B 1 100 ? -0.290 -17.780 -11.889 1.00 9.40   ? 227 ARG C CA  1 
ATOM   2273 C C   . ARG B 1 100 ? -0.291 -19.238 -11.449 1.00 10.16  ? 227 ARG C C   1 
ATOM   2274 O O   . ARG B 1 100 ? 0.751  -19.755 -11.045 1.00 10.17  ? 227 ARG C O   1 
ATOM   2275 C CB  . ARG B 1 100 ? 0.691  -17.558 -13.043 1.00 9.34   ? 227 ARG C CB  1 
ATOM   2276 C CG  . ARG B 1 100 ? 0.671  -16.150 -13.604 1.00 8.59   ? 227 ARG C CG  1 
ATOM   2277 C CD  . ARG B 1 100 ? 1.794  -15.972 -14.594 1.00 6.41   ? 227 ARG C CD  1 
ATOM   2278 N NE  . ARG B 1 100 ? 3.093  -15.989 -13.928 1.00 7.01   ? 227 ARG C NE  1 
ATOM   2279 C CZ  . ARG B 1 100 ? 4.232  -15.634 -14.515 1.00 7.88   ? 227 ARG C CZ  1 
ATOM   2280 N NH1 . ARG B 1 100 ? 4.247  -15.267 -15.798 1.00 6.11   ? 227 ARG C NH1 1 
ATOM   2281 N NH2 . ARG B 1 100 ? 5.355  -15.671 -13.831 1.00 7.66   ? 227 ARG C NH2 1 
ATOM   2282 N N   . PRO B 1 101 ? -1.466 -19.900 -11.518 1.00 11.13  ? 228 PRO C N   1 
ATOM   2283 C CA  . PRO B 1 101 ? -1.669 -21.299 -11.141 1.00 11.91  ? 228 PRO C CA  1 
ATOM   2284 C C   . PRO B 1 101 ? -0.694 -22.257 -11.820 1.00 12.33  ? 228 PRO C C   1 
ATOM   2285 O O   . PRO B 1 101 ? -0.243 -23.213 -11.185 1.00 12.28  ? 228 PRO C O   1 
ATOM   2286 C CB  . PRO B 1 101 ? -3.089 -21.581 -11.635 1.00 12.08  ? 228 PRO C CB  1 
ATOM   2287 C CG  . PRO B 1 101 ? -3.754 -20.280 -11.517 1.00 11.73  ? 228 PRO C CG  1 
ATOM   2288 C CD  . PRO B 1 101 ? -2.725 -19.303 -11.993 1.00 11.23  ? 228 PRO C CD  1 
ATOM   2289 N N   . ASP B 1 102 ? -0.382 -21.989 -13.085 1.00 12.69  ? 229 ASP C N   1 
ATOM   2290 C CA  . ASP B 1 102 ? 0.548  -22.814 -13.868 1.00 13.74  ? 229 ASP C CA  1 
ATOM   2291 C C   . ASP B 1 102 ? 2.042  -22.672 -13.490 1.00 13.45  ? 229 ASP C C   1 
ATOM   2292 O O   . ASP B 1 102 ? 2.861  -23.558 -13.803 1.00 14.13  ? 229 ASP C O   1 
ATOM   2293 C CB  . ASP B 1 102 ? 0.353  -22.536 -15.372 1.00 14.34  ? 229 ASP C CB  1 
ATOM   2294 C CG  . ASP B 1 102 ? 0.694  -21.093 -15.768 1.00 16.43  ? 229 ASP C CG  1 
ATOM   2295 O OD1 . ASP B 1 102 ? 1.791  -20.606 -15.444 1.00 18.00  ? 229 ASP C OD1 1 
ATOM   2296 O OD2 . ASP B 1 102 ? -0.136 -20.437 -16.442 1.00 22.31  ? 229 ASP C OD2 1 
ATOM   2297 N N   . ALA B 1 103 ? 2.399  -21.569 -12.828 1.00 12.35  ? 230 ALA C N   1 
ATOM   2298 C CA  . ALA B 1 103 ? 3.812  -21.224 -12.619 1.00 11.17  ? 230 ALA C CA  1 
ATOM   2299 C C   . ALA B 1 103 ? 4.559  -22.121 -11.627 1.00 10.58  ? 230 ALA C C   1 
ATOM   2300 O O   . ALA B 1 103 ? 3.967  -22.657 -10.696 1.00 9.80   ? 230 ALA C O   1 
ATOM   2301 C CB  . ALA B 1 103 ? 3.944  -19.754 -12.209 1.00 11.46  ? 230 ALA C CB  1 
ATOM   2302 N N   . THR B 1 104 ? 5.871  -22.261 -11.825 1.00 10.16  ? 231 THR C N   1 
ATOM   2303 C CA  . THR B 1 104 ? 6.741  -22.848 -10.807 1.00 9.87   ? 231 THR C CA  1 
ATOM   2304 C C   . THR B 1 104 ? 6.890  -21.789 -9.706  1.00 9.98   ? 231 THR C C   1 
ATOM   2305 O O   . THR B 1 104 ? 7.150  -20.619 -9.989  1.00 10.28  ? 231 THR C O   1 
ATOM   2306 C CB  . THR B 1 104 ? 8.135  -23.244 -11.379 1.00 10.00  ? 231 THR C CB  1 
ATOM   2307 O OG1 . THR B 1 104 ? 7.978  -24.066 -12.549 1.00 10.00  ? 231 THR C OG1 1 
ATOM   2308 C CG2 . THR B 1 104 ? 8.951  -24.038 -10.348 1.00 9.99   ? 231 THR C CG2 1 
ATOM   2309 N N   . LYS B 1 105 ? 6.724  -22.203 -8.458  1.00 9.10   ? 232 LYS C N   1 
ATOM   2310 C CA  . LYS B 1 105 ? 6.786  -21.283 -7.333  1.00 8.86   ? 232 LYS C CA  1 
ATOM   2311 C C   . LYS B 1 105 ? 8.182  -21.314 -6.731  1.00 8.18   ? 232 LYS C C   1 
ATOM   2312 O O   . LYS B 1 105 ? 8.707  -22.386 -6.429  1.00 8.27   ? 232 LYS C O   1 
ATOM   2313 C CB  . LYS B 1 105 ? 5.759  -21.679 -6.271  1.00 9.02   ? 232 LYS C CB  1 
ATOM   2314 C CG  . LYS B 1 105 ? 4.308  -21.512 -6.697  1.00 8.73   ? 232 LYS C CG  1 
ATOM   2315 C CD  . LYS B 1 105 ? 3.350  -22.110 -5.680  1.00 10.09  ? 232 LYS C CD  1 
ATOM   2316 C CE  . LYS B 1 105 ? 3.196  -23.615 -5.892  1.00 13.75  ? 232 LYS C CE  1 
ATOM   2317 N NZ  . LYS B 1 105 ? 1.934  -24.157 -5.316  1.00 17.46  ? 232 LYS C NZ  1 
ATOM   2318 N N   . VAL B 1 106 ? 8.776  -20.135 -6.550  1.00 7.28   ? 233 VAL C N   1 
ATOM   2319 C CA  . VAL B 1 106 ? 10.132 -20.031 -6.014  1.00 6.27   ? 233 VAL C CA  1 
ATOM   2320 C C   . VAL B 1 106 ? 10.131 -19.060 -4.848  1.00 6.26   ? 233 VAL C C   1 
ATOM   2321 O O   . VAL B 1 106 ? 9.520  -17.994 -4.914  1.00 5.80   ? 233 VAL C O   1 
ATOM   2322 C CB  . VAL B 1 106 ? 11.157 -19.592 -7.102  1.00 6.43   ? 233 VAL C CB  1 
ATOM   2323 C CG1 . VAL B 1 106 ? 12.565 -19.440 -6.524  1.00 6.74   ? 233 VAL C CG1 1 
ATOM   2324 C CG2 . VAL B 1 106 ? 11.165 -20.595 -8.274  1.00 4.73   ? 233 VAL C CG2 1 
ATOM   2325 N N   . LEU B 1 107 ? 10.798 -19.452 -3.772  1.00 5.65   ? 234 LEU C N   1 
ATOM   2326 C CA  . LEU B 1 107 ? 10.955 -18.572 -2.624  1.00 6.07   ? 234 LEU C CA  1 
ATOM   2327 C C   . LEU B 1 107 ? 12.432 -18.281 -2.328  1.00 5.25   ? 234 LEU C C   1 
ATOM   2328 O O   . LEU B 1 107 ? 13.236 -19.195 -2.215  1.00 5.62   ? 234 LEU C O   1 
ATOM   2329 C CB  . LEU B 1 107 ? 10.227 -19.172 -1.434  1.00 5.64   ? 234 LEU C CB  1 
ATOM   2330 C CG  . LEU B 1 107 ? 10.172 -18.493 -0.073  1.00 7.55   ? 234 LEU C CG  1 
ATOM   2331 C CD1 . LEU B 1 107 ? 9.607  -17.068 -0.159  1.00 6.93   ? 234 LEU C CD1 1 
ATOM   2332 C CD2 . LEU B 1 107 ? 9.343  -19.380 0.846   1.00 6.46   ? 234 LEU C CD2 1 
ATOM   2333 N N   . ILE B 1 108 ? 12.779 -17.001 -2.238  1.00 4.94   ? 235 ILE C N   1 
ATOM   2334 C CA  . ILE B 1 108 ? 14.120 -16.594 -1.812  1.00 4.96   ? 235 ILE C CA  1 
ATOM   2335 C C   . ILE B 1 108 ? 14.016 -15.976 -0.424  1.00 5.12   ? 235 ILE C C   1 
ATOM   2336 O O   . ILE B 1 108 ? 13.468 -14.868 -0.266  1.00 5.23   ? 235 ILE C O   1 
ATOM   2337 C CB  . ILE B 1 108 ? 14.775 -15.579 -2.785  1.00 5.30   ? 235 ILE C CB  1 
ATOM   2338 C CG1 . ILE B 1 108 ? 14.739 -16.070 -4.253  1.00 4.63   ? 235 ILE C CG1 1 
ATOM   2339 C CG2 . ILE B 1 108 ? 16.197 -15.224 -2.320  1.00 5.18   ? 235 ILE C CG2 1 
ATOM   2340 C CD1 . ILE B 1 108 ? 15.589 -17.348 -4.555  1.00 3.10   ? 235 ILE C CD1 1 
ATOM   2341 N N   . ILE B 1 109 ? 14.521 -16.693 0.575   1.00 5.16   ? 236 ILE C N   1 
ATOM   2342 C CA  . ILE B 1 109 ? 14.492 -16.235 1.980   1.00 5.45   ? 236 ILE C CA  1 
ATOM   2343 C C   . ILE B 1 109 ? 15.840 -15.630 2.346   1.00 5.57   ? 236 ILE C C   1 
ATOM   2344 O O   . ILE B 1 109 ? 16.887 -16.247 2.132   1.00 6.19   ? 236 ILE C O   1 
ATOM   2345 C CB  . ILE B 1 109 ? 14.138 -17.373 2.968   1.00 5.85   ? 236 ILE C CB  1 
ATOM   2346 C CG1 . ILE B 1 109 ? 12.876 -18.101 2.499   1.00 6.44   ? 236 ILE C CG1 1 
ATOM   2347 C CG2 . ILE B 1 109 ? 13.935 -16.822 4.383   1.00 6.27   ? 236 ILE C CG2 1 
ATOM   2348 C CD1 . ILE B 1 109 ? 12.792 -19.589 2.935   1.00 8.38   ? 236 ILE C CD1 1 
ATOM   2349 N N   . ILE B 1 110 ? 15.812 -14.406 2.868   1.00 4.77   ? 237 ILE C N   1 
ATOM   2350 C CA  . ILE B 1 110 ? 17.040 -13.687 3.186   1.00 5.22   ? 237 ILE C CA  1 
ATOM   2351 C C   . ILE B 1 110 ? 16.970 -13.280 4.653   1.00 4.83   ? 237 ILE C C   1 
ATOM   2352 O O   . ILE B 1 110 ? 16.080 -12.513 5.041   1.00 5.09   ? 237 ILE C O   1 
ATOM   2353 C CB  . ILE B 1 110 ? 17.217 -12.445 2.285   1.00 4.46   ? 237 ILE C CB  1 
ATOM   2354 C CG1 . ILE B 1 110 ? 17.172 -12.832 0.793   1.00 5.17   ? 237 ILE C CG1 1 
ATOM   2355 C CG2 . ILE B 1 110 ? 18.523 -11.764 2.605   1.00 5.57   ? 237 ILE C CG2 1 
ATOM   2356 C CD1 . ILE B 1 110 ? 17.066 -11.650 -0.146  1.00 4.68   ? 237 ILE C CD1 1 
ATOM   2357 N N   . THR B 1 111 ? 17.893 -13.819 5.451   1.00 5.20   ? 238 THR C N   1 
ATOM   2358 C CA  . THR B 1 111 ? 17.862 -13.678 6.908   1.00 5.38   ? 238 THR C CA  1 
ATOM   2359 C C   . THR B 1 111 ? 19.258 -13.483 7.541   1.00 5.53   ? 238 THR C C   1 
ATOM   2360 O O   . THR B 1 111 ? 20.266 -13.907 6.977   1.00 6.25   ? 238 THR C O   1 
ATOM   2361 C CB  . THR B 1 111 ? 17.102 -14.885 7.567   1.00 5.11   ? 238 THR C CB  1 
ATOM   2362 O OG1 . THR B 1 111 ? 16.860 -14.611 8.950   1.00 5.49   ? 238 THR C OG1 1 
ATOM   2363 C CG2 . THR B 1 111 ? 17.896 -16.195 7.419   1.00 5.96   ? 238 THR C CG2 1 
ATOM   2364 N N   . ASP B 1 112 ? 19.314 -12.796 8.680   1.00 5.47   ? 239 ASP C N   1 
ATOM   2365 C CA  . ASP B 1 112 ? 20.577 -12.612 9.404   1.00 5.72   ? 239 ASP C CA  1 
ATOM   2366 C C   . ASP B 1 112 ? 20.504 -13.220 10.802  1.00 6.35   ? 239 ASP C C   1 
ATOM   2367 O O   . ASP B 1 112 ? 21.307 -12.882 11.683  1.00 5.99   ? 239 ASP C O   1 
ATOM   2368 C CB  . ASP B 1 112 ? 21.003 -11.126 9.453   1.00 5.92   ? 239 ASP C CB  1 
ATOM   2369 C CG  . ASP B 1 112 ? 20.287 -10.332 10.543  1.00 6.95   ? 239 ASP C CG  1 
ATOM   2370 O OD1 . ASP B 1 112 ? 19.123 -10.647 10.857  1.00 7.39   ? 239 ASP C OD1 1 
ATOM   2371 O OD2 . ASP B 1 112 ? 20.881 -9.372  11.076  1.00 7.95   ? 239 ASP C OD2 1 
ATOM   2372 N N   . GLY B 1 113 ? 19.549 -14.131 10.995  1.00 6.34   ? 240 GLY C N   1 
ATOM   2373 C CA  . GLY B 1 113 ? 19.344 -14.728 12.314  1.00 7.34   ? 240 GLY C CA  1 
ATOM   2374 C C   . GLY B 1 113 ? 18.535 -16.002 12.301  1.00 7.38   ? 240 GLY C C   1 
ATOM   2375 O O   . GLY B 1 113 ? 17.829 -16.289 11.326  1.00 7.20   ? 240 GLY C O   1 
ATOM   2376 N N   . GLU B 1 114 ? 18.637 -16.767 13.393  1.00 7.75   ? 241 GLU C N   1 
ATOM   2377 C CA  . GLU B 1 114 ? 17.825 -17.987 13.570  1.00 8.75   ? 241 GLU C CA  1 
ATOM   2378 C C   . GLU B 1 114 ? 16.389 -17.588 13.881  1.00 8.25   ? 241 GLU C C   1 
ATOM   2379 O O   . GLU B 1 114 ? 16.143 -16.499 14.412  1.00 7.44   ? 241 GLU C O   1 
ATOM   2380 C CB  . GLU B 1 114 ? 18.390 -18.887 14.694  1.00 8.52   ? 241 GLU C CB  1 
ATOM   2381 C CG  . GLU B 1 114 ? 19.820 -19.371 14.474  1.00 10.05  ? 241 GLU C CG  1 
ATOM   2382 C CD  . GLU B 1 114 ? 20.274 -20.443 15.482  1.00 11.65  ? 241 GLU C CD  1 
ATOM   2383 O OE1 . GLU B 1 114 ? 21.495 -20.708 15.562  1.00 16.53  ? 241 GLU C OE1 1 
ATOM   2384 O OE2 . GLU B 1 114 ? 19.429 -21.024 16.198  1.00 16.65  ? 241 GLU C OE2 1 
ATOM   2385 N N   . ALA B 1 115 ? 15.440 -18.459 13.538  1.00 8.47   ? 242 ALA C N   1 
ATOM   2386 C CA  . ALA B 1 115 ? 14.018 -18.195 13.802  1.00 8.26   ? 242 ALA C CA  1 
ATOM   2387 C C   . ALA B 1 115 ? 13.738 -18.013 15.297  1.00 8.92   ? 242 ALA C C   1 
ATOM   2388 O O   . ALA B 1 115 ? 14.314 -18.720 16.130  1.00 8.11   ? 242 ALA C O   1 
ATOM   2389 C CB  . ALA B 1 115 ? 13.153 -19.336 13.239  1.00 8.42   ? 242 ALA C CB  1 
ATOM   2390 N N   . THR B 1 116 ? 12.878 -17.044 15.622  1.00 9.26   ? 243 THR C N   1 
ATOM   2391 C CA  . THR B 1 116 ? 12.418 -16.817 16.998  1.00 10.26  ? 243 THR C CA  1 
ATOM   2392 C C   . THR B 1 116 ? 11.041 -17.438 17.232  1.00 10.51  ? 243 THR C C   1 
ATOM   2393 O O   . THR B 1 116 ? 10.453 -17.312 18.323  1.00 11.44  ? 243 THR C O   1 
ATOM   2394 C CB  . THR B 1 116 ? 12.357 -15.307 17.357  1.00 10.48  ? 243 THR C CB  1 
ATOM   2395 O OG1 . THR B 1 116 ? 11.653 -14.603 16.330  1.00 12.08  ? 243 THR C OG1 1 
ATOM   2396 C CG2 . THR B 1 116 ? 13.766 -14.719 17.511  1.00 9.43   ? 243 THR C CG2 1 
ATOM   2397 N N   . ASP B 1 117 ? 10.520 -18.108 16.209  1.00 10.43  ? 244 ASP C N   1 
ATOM   2398 C CA  . ASP B 1 117 ? 9.283  -18.862 16.355  1.00 10.31  ? 244 ASP C CA  1 
ATOM   2399 C C   . ASP B 1 117 ? 9.533  -20.331 16.038  1.00 10.75  ? 244 ASP C C   1 
ATOM   2400 O O   . ASP B 1 117 ? 10.676 -20.734 15.819  1.00 11.39  ? 244 ASP C O   1 
ATOM   2401 C CB  . ASP B 1 117 ? 8.144  -18.247 15.517  1.00 9.72   ? 244 ASP C CB  1 
ATOM   2402 C CG  . ASP B 1 117 ? 8.388  -18.322 14.012  1.00 9.17   ? 244 ASP C CG  1 
ATOM   2403 O OD1 . ASP B 1 117 ? 9.495  -18.696 13.564  1.00 8.24   ? 244 ASP C OD1 1 
ATOM   2404 O OD2 . ASP B 1 117 ? 7.441  -18.013 13.262  1.00 9.22   ? 244 ASP C OD2 1 
ATOM   2405 N N   . SER B 1 118 ? 8.475  -21.132 16.026  1.00 11.28  ? 245 SER C N   1 
ATOM   2406 C CA  . SER B 1 118 ? 8.614  -22.554 15.798  1.00 11.96  ? 245 SER C CA  1 
ATOM   2407 C C   . SER B 1 118 ? 7.415  -23.085 15.016  1.00 12.20  ? 245 SER C C   1 
ATOM   2408 O O   . SER B 1 118 ? 6.453  -22.361 14.795  1.00 12.40  ? 245 SER C O   1 
ATOM   2409 C CB  . SER B 1 118 ? 8.783  -23.288 17.141  1.00 12.46  ? 245 SER C CB  1 
ATOM   2410 O OG  . SER B 1 118 ? 7.726  -22.976 18.030  1.00 12.15  ? 245 SER C OG  1 
ATOM   2411 N N   . GLY B 1 119 ? 7.496  -24.338 14.577  1.00 12.48  ? 246 GLY C N   1 
ATOM   2412 C CA  . GLY B 1 119 ? 6.381  -24.995 13.917  1.00 12.78  ? 246 GLY C CA  1 
ATOM   2413 C C   . GLY B 1 119 ? 6.805  -25.910 12.793  1.00 12.62  ? 246 GLY C C   1 
ATOM   2414 O O   . GLY B 1 119 ? 7.740  -26.709 12.937  1.00 12.66  ? 246 GLY C O   1 
ATOM   2415 N N   . ASN B 1 120 ? 6.102  -25.804 11.671  1.00 12.87  ? 247 ASN C N   1 
ATOM   2416 C CA  . ASN B 1 120 ? 6.448  -26.573 10.476  1.00 13.61  ? 247 ASN C CA  1 
ATOM   2417 C C   . ASN B 1 120 ? 6.174  -25.750 9.217   1.00 13.75  ? 247 ASN C C   1 
ATOM   2418 O O   . ASN B 1 120 ? 5.382  -24.808 9.258   1.00 13.98  ? 247 ASN C O   1 
ATOM   2419 C CB  . ASN B 1 120 ? 5.670  -27.897 10.453  1.00 13.64  ? 247 ASN C CB  1 
ATOM   2420 C CG  . ASN B 1 120 ? 4.206  -27.706 10.113  1.00 14.20  ? 247 ASN C CG  1 
ATOM   2421 O OD1 . ASN B 1 120 ? 3.866  -27.380 8.981   1.00 16.31  ? 247 ASN C OD1 1 
ATOM   2422 N ND2 . ASN B 1 120 ? 3.331  -27.921 11.086  1.00 13.66  ? 247 ASN C ND2 1 
ATOM   2423 N N   . ILE B 1 121 ? 6.811  -26.111 8.102   1.00 14.46  ? 248 ILE C N   1 
ATOM   2424 C CA  . ILE B 1 121 ? 6.542  -25.433 6.817   1.00 14.93  ? 248 ILE C CA  1 
ATOM   2425 C C   . ILE B 1 121 ? 5.881  -26.373 5.789   1.00 15.45  ? 248 ILE C C   1 
ATOM   2426 O O   . ILE B 1 121 ? 6.089  -26.235 4.580   1.00 15.18  ? 248 ILE C O   1 
ATOM   2427 C CB  . ILE B 1 121 ? 7.817  -24.726 6.232   1.00 15.07  ? 248 ILE C CB  1 
ATOM   2428 C CG1 . ILE B 1 121 ? 8.901  -25.745 5.877   1.00 14.70  ? 248 ILE C CG1 1 
ATOM   2429 C CG2 . ILE B 1 121 ? 8.365  -23.681 7.221   1.00 14.50  ? 248 ILE C CG2 1 
ATOM   2430 C CD1 . ILE B 1 121 ? 9.893  -25.241 4.868   1.00 16.32  ? 248 ILE C CD1 1 
ATOM   2431 N N   . ASP B 1 122 ? 5.079  -27.324 6.287   1.00 16.12  ? 249 ASP C N   1 
ATOM   2432 C CA  . ASP B 1 122 ? 4.350  -28.287 5.426   1.00 16.51  ? 249 ASP C CA  1 
ATOM   2433 C C   . ASP B 1 122 ? 3.552  -27.597 4.314   1.00 16.23  ? 249 ASP C C   1 
ATOM   2434 O O   . ASP B 1 122 ? 3.486  -28.097 3.180   1.00 16.53  ? 249 ASP C O   1 
ATOM   2435 C CB  . ASP B 1 122 ? 3.420  -29.180 6.260   1.00 16.59  ? 249 ASP C CB  1 
ATOM   2436 C CG  . ASP B 1 122 ? 4.175  -30.083 7.237   1.00 17.83  ? 249 ASP C CG  1 
ATOM   2437 O OD1 . ASP B 1 122 ? 5.400  -30.308 7.053   1.00 15.31  ? 249 ASP C OD1 1 
ATOM   2438 O OD2 . ASP B 1 122 ? 3.522  -30.593 8.188   1.00 18.83  ? 249 ASP C OD2 1 
ATOM   2439 N N   . ALA B 1 123 ? 2.982  -26.436 4.641   1.00 16.08  ? 250 ALA C N   1 
ATOM   2440 C CA  . ALA B 1 123 ? 2.182  -25.624 3.706   1.00 15.37  ? 250 ALA C CA  1 
ATOM   2441 C C   . ALA B 1 123 ? 2.959  -25.128 2.484   1.00 15.64  ? 250 ALA C C   1 
ATOM   2442 O O   . ALA B 1 123 ? 2.362  -24.891 1.431   1.00 14.91  ? 250 ALA C O   1 
ATOM   2443 C CB  . ALA B 1 123 ? 1.558  -24.440 4.439   1.00 15.68  ? 250 ALA C CB  1 
ATOM   2444 N N   . ALA B 1 124 ? 4.279  -24.966 2.641   1.00 15.48  ? 251 ALA C N   1 
ATOM   2445 C CA  . ALA B 1 124 ? 5.158  -24.485 1.574   1.00 15.54  ? 251 ALA C CA  1 
ATOM   2446 C C   . ALA B 1 124 ? 5.902  -25.593 0.819   1.00 15.93  ? 251 ALA C C   1 
ATOM   2447 O O   . ALA B 1 124 ? 6.807  -25.300 0.039   1.00 15.39  ? 251 ALA C O   1 
ATOM   2448 C CB  . ALA B 1 124 ? 6.166  -23.470 2.131   1.00 15.20  ? 251 ALA C CB  1 
ATOM   2449 N N   . LYS B 1 125 ? 5.502  -26.851 1.024   1.00 16.44  ? 252 LYS C N   1 
ATOM   2450 C CA  . LYS B 1 125 ? 6.180  -28.000 0.399   1.00 17.07  ? 252 LYS C CA  1 
ATOM   2451 C C   . LYS B 1 125 ? 6.114  -27.993 -1.139  1.00 17.23  ? 252 LYS C C   1 
ATOM   2452 O O   . LYS B 1 125 ? 6.904  -28.667 -1.801  1.00 17.29  ? 252 LYS C O   1 
ATOM   2453 C CB  . LYS B 1 125 ? 5.637  -29.327 0.958   1.00 17.23  ? 252 LYS C CB  1 
ATOM   2454 N N   . ASP B 1 126 ? 5.183  -27.220 -1.700  1.00 17.24  ? 253 ASP C N   1 
ATOM   2455 C CA  . ASP B 1 126 ? 5.038  -27.125 -3.154  1.00 17.21  ? 253 ASP C CA  1 
ATOM   2456 C C   . ASP B 1 126 ? 5.875  -25.989 -3.774  1.00 15.94  ? 253 ASP C C   1 
ATOM   2457 O O   . ASP B 1 126 ? 5.834  -25.753 -4.982  1.00 16.32  ? 253 ASP C O   1 
ATOM   2458 C CB  . ASP B 1 126 ? 3.551  -27.028 -3.524  1.00 18.25  ? 253 ASP C CB  1 
ATOM   2459 C CG  . ASP B 1 126 ? 2.786  -28.319 -3.210  1.00 21.60  ? 253 ASP C CG  1 
ATOM   2460 O OD1 . ASP B 1 126 ? 3.405  -29.264 -2.655  1.00 25.02  ? 253 ASP C OD1 1 
ATOM   2461 O OD2 . ASP B 1 126 ? 1.573  -28.406 -3.521  1.00 24.17  ? 253 ASP C OD2 1 
ATOM   2462 N N   . ILE B 1 127 ? 6.659  -25.312 -2.939  1.00 14.17  ? 254 ILE C N   1 
ATOM   2463 C CA  . ILE B 1 127 ? 7.491  -24.193 -3.375  1.00 12.15  ? 254 ILE C CA  1 
ATOM   2464 C C   . ILE B 1 127 ? 8.965  -24.602 -3.354  1.00 11.51  ? 254 ILE C C   1 
ATOM   2465 O O   . ILE B 1 127 ? 9.398  -25.314 -2.453  1.00 11.44  ? 254 ILE C O   1 
ATOM   2466 C CB  . ILE B 1 127 ? 7.268  -22.940 -2.468  1.00 12.05  ? 254 ILE C CB  1 
ATOM   2467 C CG1 . ILE B 1 127 ? 5.766  -22.636 -2.300  1.00 11.48  ? 254 ILE C CG1 1 
ATOM   2468 C CG2 . ILE B 1 127 ? 8.003  -21.719 -3.012  1.00 10.67  ? 254 ILE C CG2 1 
ATOM   2469 C CD1 . ILE B 1 127 ? 5.435  -21.715 -1.111  1.00 11.27  ? 254 ILE C CD1 1 
ATOM   2470 N N   . ILE B 1 128 ? 9.717  -24.161 -4.361  1.00 10.79  ? 255 ILE C N   1 
ATOM   2471 C CA  . ILE B 1 128 ? 11.175 -24.327 -4.411  1.00 10.17  ? 255 ILE C CA  1 
ATOM   2472 C C   . ILE B 1 128 ? 11.799 -23.249 -3.533  1.00 9.96   ? 255 ILE C C   1 
ATOM   2473 O O   . ILE B 1 128 ? 11.683 -22.052 -3.838  1.00 9.87   ? 255 ILE C O   1 
ATOM   2474 C CB  . ILE B 1 128 ? 11.718 -24.213 -5.875  1.00 10.17  ? 255 ILE C CB  1 
ATOM   2475 C CG1 . ILE B 1 128 ? 11.057 -25.255 -6.797  1.00 10.20  ? 255 ILE C CG1 1 
ATOM   2476 C CG2 . ILE B 1 128 ? 13.250 -24.340 -5.906  1.00 9.85   ? 255 ILE C CG2 1 
ATOM   2477 C CD1 . ILE B 1 128 ? 11.580 -25.237 -8.237  1.00 10.75  ? 255 ILE C CD1 1 
ATOM   2478 N N   . ARG B 1 129 ? 12.468 -23.658 -2.453  1.00 8.95   ? 256 ARG C N   1 
ATOM   2479 C CA  . ARG B 1 129 ? 12.875 -22.706 -1.400  1.00 8.42   ? 256 ARG C CA  1 
ATOM   2480 C C   . ARG B 1 129 ? 14.399 -22.538 -1.255  1.00 8.28   ? 256 ARG C C   1 
ATOM   2481 O O   . ARG B 1 129 ? 15.125 -23.506 -0.934  1.00 8.33   ? 256 ARG C O   1 
ATOM   2482 C CB  . ARG B 1 129 ? 12.239 -23.099 -0.064  1.00 8.55   ? 256 ARG C CB  1 
ATOM   2483 C CG  . ARG B 1 129 ? 10.709 -23.009 -0.031  1.00 9.12   ? 256 ARG C CG  1 
ATOM   2484 C CD  . ARG B 1 129 ? 10.111 -23.868 1.082   1.00 13.48  ? 256 ARG C CD  1 
ATOM   2485 N NE  . ARG B 1 129 ? 9.853  -25.222 0.586   1.00 18.37  ? 256 ARG C NE  1 
ATOM   2486 C CZ  . ARG B 1 129 ? 10.551 -26.296 0.924   1.00 19.45  ? 256 ARG C CZ  1 
ATOM   2487 N NH1 . ARG B 1 129 ? 11.547 -26.211 1.795   1.00 19.65  ? 256 ARG C NH1 1 
ATOM   2488 N NH2 . ARG B 1 129 ? 10.236 -27.467 0.401   1.00 21.60  ? 256 ARG C NH2 1 
ATOM   2489 N N   . TYR B 1 130 ? 14.873 -21.321 -1.527  1.00 7.07   ? 257 TYR C N   1 
ATOM   2490 C CA  . TYR B 1 130 ? 16.270 -20.955 -1.305  1.00 6.96   ? 257 TYR C CA  1 
ATOM   2491 C C   . TYR B 1 130 ? 16.374 -20.137 -0.026  1.00 6.46   ? 257 TYR C C   1 
ATOM   2492 O O   . TYR B 1 130 ? 15.492 -19.328 0.278   1.00 6.41   ? 257 TYR C O   1 
ATOM   2493 C CB  . TYR B 1 130 ? 16.834 -20.129 -2.476  1.00 6.55   ? 257 TYR C CB  1 
ATOM   2494 C CG  . TYR B 1 130 ? 16.913 -20.858 -3.799  1.00 6.93   ? 257 TYR C CG  1 
ATOM   2495 C CD1 . TYR B 1 130 ? 15.808 -20.923 -4.645  1.00 6.35   ? 257 TYR C CD1 1 
ATOM   2496 C CD2 . TYR B 1 130 ? 18.097 -21.484 -4.202  1.00 6.73   ? 257 TYR C CD2 1 
ATOM   2497 C CE1 . TYR B 1 130 ? 15.873 -21.598 -5.870  1.00 9.36   ? 257 TYR C CE1 1 
ATOM   2498 C CE2 . TYR B 1 130 ? 18.178 -22.160 -5.432  1.00 6.72   ? 257 TYR C CE2 1 
ATOM   2499 C CZ  . TYR B 1 130 ? 17.064 -22.213 -6.254  1.00 7.31   ? 257 TYR C CZ  1 
ATOM   2500 O OH  . TYR B 1 130 ? 17.133 -22.876 -7.464  1.00 6.99   ? 257 TYR C OH  1 
ATOM   2501 N N   . ILE B 1 131 ? 17.451 -20.338 0.720   1.00 6.62   ? 258 ILE C N   1 
ATOM   2502 C CA  . ILE B 1 131 ? 17.712 -19.486 1.892   1.00 6.28   ? 258 ILE C CA  1 
ATOM   2503 C C   . ILE B 1 131 ? 19.133 -18.915 1.891   1.00 6.61   ? 258 ILE C C   1 
ATOM   2504 O O   . ILE B 1 131 ? 20.114 -19.606 1.595   1.00 5.98   ? 258 ILE C O   1 
ATOM   2505 C CB  . ILE B 1 131 ? 17.343 -20.197 3.229   1.00 6.70   ? 258 ILE C CB  1 
ATOM   2506 C CG1 . ILE B 1 131 ? 17.308 -19.184 4.395   1.00 6.63   ? 258 ILE C CG1 1 
ATOM   2507 C CG2 . ILE B 1 131 ? 18.265 -21.387 3.499   1.00 5.05   ? 258 ILE C CG2 1 
ATOM   2508 C CD1 . ILE B 1 131 ? 16.461 -19.626 5.551   1.00 8.48   ? 258 ILE C CD1 1 
ATOM   2509 N N   . ILE B 1 132 ? 19.211 -17.624 2.182   1.00 6.81   ? 259 ILE C N   1 
ATOM   2510 C CA  . ILE B 1 132 ? 20.462 -16.915 2.294   1.00 6.91   ? 259 ILE C CA  1 
ATOM   2511 C C   . ILE B 1 132 ? 20.568 -16.441 3.737   1.00 6.96   ? 259 ILE C C   1 
ATOM   2512 O O   . ILE B 1 132 ? 19.820 -15.561 4.168   1.00 7.23   ? 259 ILE C O   1 
ATOM   2513 C CB  . ILE B 1 132 ? 20.524 -15.701 1.324   1.00 6.61   ? 259 ILE C CB  1 
ATOM   2514 C CG1 . ILE B 1 132 ? 20.271 -16.155 -0.120  1.00 7.73   ? 259 ILE C CG1 1 
ATOM   2515 C CG2 . ILE B 1 132 ? 21.888 -14.999 1.410   1.00 5.85   ? 259 ILE C CG2 1 
ATOM   2516 C CD1 . ILE B 1 132 ? 19.971 -15.030 -1.083  1.00 6.92   ? 259 ILE C CD1 1 
ATOM   2517 N N   . GLY B 1 133 ? 21.482 -17.047 4.487   1.00 6.95   ? 260 GLY C N   1 
ATOM   2518 C CA  . GLY B 1 133 ? 21.764 -16.605 5.851   1.00 7.06   ? 260 GLY C CA  1 
ATOM   2519 C C   . GLY B 1 133 ? 23.044 -15.805 5.849   1.00 7.24   ? 260 GLY C C   1 
ATOM   2520 O O   . GLY B 1 133 ? 24.073 -16.286 5.360   1.00 7.65   ? 260 GLY C O   1 
ATOM   2521 N N   . ILE B 1 134 ? 22.982 -14.588 6.392   1.00 7.23   ? 261 ILE C N   1 
ATOM   2522 C CA  . ILE B 1 134 ? 24.089 -13.629 6.300   1.00 6.75   ? 261 ILE C CA  1 
ATOM   2523 C C   . ILE B 1 134 ? 24.672 -13.206 7.648   1.00 6.86   ? 261 ILE C C   1 
ATOM   2524 O O   . ILE B 1 134 ? 23.938 -12.948 8.626   1.00 6.87   ? 261 ILE C O   1 
ATOM   2525 C CB  . ILE B 1 134 ? 23.662 -12.353 5.526   1.00 7.03   ? 261 ILE C CB  1 
ATOM   2526 C CG1 . ILE B 1 134 ? 22.969 -12.726 4.219   1.00 6.36   ? 261 ILE C CG1 1 
ATOM   2527 C CG2 . ILE B 1 134 ? 24.882 -11.443 5.256   1.00 6.45   ? 261 ILE C CG2 1 
ATOM   2528 C CD1 . ILE B 1 134 ? 22.140 -11.598 3.617   1.00 6.07   ? 261 ILE C CD1 1 
ATOM   2529 N N   . GLY B 1 135 ? 26.004 -13.163 7.690   1.00 7.53   ? 262 GLY C N   1 
ATOM   2530 C CA  . GLY B 1 135 ? 26.747 -12.510 8.764   1.00 7.73   ? 262 GLY C CA  1 
ATOM   2531 C C   . GLY B 1 135 ? 27.042 -13.378 9.972   1.00 7.75   ? 262 GLY C C   1 
ATOM   2532 O O   . GLY B 1 135 ? 26.853 -14.596 9.933   1.00 7.44   ? 262 GLY C O   1 
ATOM   2533 N N   . LYS B 1 136 ? 27.453 -12.721 11.058  1.00 8.17   ? 263 LYS C N   1 
ATOM   2534 C CA  . LYS B 1 136 ? 28.068 -13.383 12.229  1.00 9.35   ? 263 LYS C CA  1 
ATOM   2535 C C   . LYS B 1 136 ? 27.177 -14.305 13.038  1.00 8.90   ? 263 LYS C C   1 
ATOM   2536 O O   . LYS B 1 136 ? 27.680 -15.127 13.818  1.00 8.17   ? 263 LYS C O   1 
ATOM   2537 C CB  . LYS B 1 136 ? 28.715 -12.356 13.169  1.00 9.20   ? 263 LYS C CB  1 
ATOM   2538 C CG  . LYS B 1 136 ? 29.979 -11.688 12.623  1.00 11.04  ? 263 LYS C CG  1 
ATOM   2539 C CD  . LYS B 1 136 ? 30.590 -10.750 13.678  1.00 11.05  ? 263 LYS C CD  1 
ATOM   2540 C CE  . LYS B 1 136 ? 31.268 -9.540  13.051  1.00 15.38  ? 263 LYS C CE  1 
ATOM   2541 N NZ  . LYS B 1 136 ? 32.238 -9.907  11.982  1.00 16.86  ? 263 LYS C NZ  1 
ATOM   2542 N N   . HIS B 1 137 ? 25.867 -14.183 12.866  1.00 8.48   ? 264 HIS C N   1 
ATOM   2543 C CA  . HIS B 1 137 ? 24.955 -15.095 13.551  1.00 8.93   ? 264 HIS C CA  1 
ATOM   2544 C C   . HIS B 1 137 ? 25.107 -16.535 13.052  1.00 8.95   ? 264 HIS C C   1 
ATOM   2545 O O   . HIS B 1 137 ? 24.762 -17.478 13.764  1.00 8.92   ? 264 HIS C O   1 
ATOM   2546 C CB  . HIS B 1 137 ? 23.501 -14.612 13.463  1.00 8.85   ? 264 HIS C CB  1 
ATOM   2547 C CG  . HIS B 1 137 ? 23.223 -13.399 14.298  1.00 9.96   ? 264 HIS C CG  1 
ATOM   2548 N ND1 . HIS B 1 137 ? 22.432 -13.440 15.427  1.00 10.76  ? 264 HIS C ND1 1 
ATOM   2549 C CD2 . HIS B 1 137 ? 23.652 -12.118 14.187  1.00 9.99   ? 264 HIS C CD2 1 
ATOM   2550 C CE1 . HIS B 1 137 ? 22.370 -12.233 15.963  1.00 10.00  ? 264 HIS C CE1 1 
ATOM   2551 N NE2 . HIS B 1 137 ? 23.112 -11.416 15.238  1.00 10.25  ? 264 HIS C NE2 1 
ATOM   2552 N N   . PHE B 1 138 ? 25.669 -16.695 11.860  1.00 8.64   ? 265 PHE C N   1 
ATOM   2553 C CA  . PHE B 1 138 ? 25.782 -18.015 11.237  1.00 8.80   ? 265 PHE C CA  1 
ATOM   2554 C C   . PHE B 1 138 ? 27.219 -18.560 11.194  1.00 9.26   ? 265 PHE C C   1 
ATOM   2555 O O   . PHE B 1 138 ? 27.578 -19.311 10.295  1.00 9.02   ? 265 PHE C O   1 
ATOM   2556 C CB  . PHE B 1 138 ? 25.130 -17.978 9.843   1.00 8.53   ? 265 PHE C CB  1 
ATOM   2557 C CG  . PHE B 1 138 ? 23.651 -17.659 9.886   1.00 7.64   ? 265 PHE C CG  1 
ATOM   2558 C CD1 . PHE B 1 138 ? 23.155 -16.496 9.315   1.00 6.30   ? 265 PHE C CD1 1 
ATOM   2559 C CD2 . PHE B 1 138 ? 22.765 -18.507 10.544  1.00 7.75   ? 265 PHE C CD2 1 
ATOM   2560 C CE1 . PHE B 1 138 ? 21.786 -16.196 9.370   1.00 5.07   ? 265 PHE C CE1 1 
ATOM   2561 C CE2 . PHE B 1 138 ? 21.395 -18.223 10.590  1.00 6.93   ? 265 PHE C CE2 1 
ATOM   2562 C CZ  . PHE B 1 138 ? 20.913 -17.060 10.011  1.00 6.73   ? 265 PHE C CZ  1 
ATOM   2563 N N   . GLN B 1 139 ? 28.025 -18.190 12.190  1.00 9.53   ? 266 GLN C N   1 
ATOM   2564 C CA  . GLN B 1 139 ? 29.426 -18.604 12.249  1.00 10.46  ? 266 GLN C CA  1 
ATOM   2565 C C   . GLN B 1 139 ? 29.633 -20.092 12.511  1.00 10.39  ? 266 GLN C C   1 
ATOM   2566 O O   . GLN B 1 139 ? 30.562 -20.704 11.962  1.00 9.91   ? 266 GLN C O   1 
ATOM   2567 C CB  . GLN B 1 139 ? 30.182 -17.823 13.324  1.00 11.03  ? 266 GLN C CB  1 
ATOM   2568 C CG  . GLN B 1 139 ? 31.692 -18.033 13.195  1.00 14.40  ? 266 GLN C CG  1 
ATOM   2569 C CD  . GLN B 1 139 ? 32.461 -17.645 14.432  1.00 17.60  ? 266 GLN C CD  1 
ATOM   2570 O OE1 . GLN B 1 139 ? 32.113 -16.671 15.108  1.00 18.24  ? 266 GLN C OE1 1 
ATOM   2571 N NE2 . GLN B 1 139 ? 33.530 -18.402 14.736  1.00 16.39  ? 266 GLN C NE2 1 
ATOM   2572 N N   . THR B 1 140 ? 28.793 -20.668 13.371  1.00 10.01  ? 267 THR C N   1 
ATOM   2573 C CA  . THR B 1 140 ? 28.936 -22.086 13.726  1.00 10.46  ? 267 THR C CA  1 
ATOM   2574 C C   . THR B 1 140 ? 28.232 -22.995 12.719  1.00 10.18  ? 267 THR C C   1 
ATOM   2575 O O   . THR B 1 140 ? 27.234 -22.610 12.089  1.00 9.33   ? 267 THR C O   1 
ATOM   2576 C CB  . THR B 1 140 ? 28.396 -22.394 15.137  1.00 10.54  ? 267 THR C CB  1 
ATOM   2577 O OG1 . THR B 1 140 ? 26.968 -22.257 15.138  1.00 10.50  ? 267 THR C OG1 1 
ATOM   2578 C CG2 . THR B 1 140 ? 29.015 -21.450 16.173  1.00 10.55  ? 267 THR C CG2 1 
ATOM   2579 N N   . LYS B 1 141 ? 28.765 -24.206 12.579  1.00 10.29  ? 268 LYS C N   1 
ATOM   2580 C CA  . LYS B 1 141 ? 28.121 -25.254 11.801  1.00 10.11  ? 268 LYS C CA  1 
ATOM   2581 C C   . LYS B 1 141 ? 26.683 -25.490 12.255  1.00 9.30   ? 268 LYS C C   1 
ATOM   2582 O O   . LYS B 1 141 ? 25.814 -25.698 11.419  1.00 9.34   ? 268 LYS C O   1 
ATOM   2583 C CB  . LYS B 1 141 ? 28.921 -26.561 11.898  1.00 9.90   ? 268 LYS C CB  1 
ATOM   2584 C CG  . LYS B 1 141 ? 28.297 -27.721 11.124  1.00 11.90  ? 268 LYS C CG  1 
ATOM   2585 C CD  . LYS B 1 141 ? 28.800 -29.085 11.600  1.00 13.57  ? 268 LYS C CD  1 
ATOM   2586 C CE  . LYS B 1 141 ? 28.085 -29.529 12.883  1.00 15.72  ? 268 LYS C CE  1 
ATOM   2587 N NZ  . LYS B 1 141 ? 28.564 -30.875 13.327  1.00 16.85  ? 268 LYS C NZ  1 
ATOM   2588 N N   . GLU B 1 142 ? 26.448 -25.470 13.572  1.00 9.53   ? 269 GLU C N   1 
ATOM   2589 C CA  . GLU B 1 142 ? 25.104 -25.716 14.161  1.00 9.62   ? 269 GLU C CA  1 
ATOM   2590 C C   . GLU B 1 142 ? 24.102 -24.621 13.769  1.00 9.36   ? 269 GLU C C   1 
ATOM   2591 O O   . GLU B 1 142 ? 22.944 -24.922 13.457  1.00 9.03   ? 269 GLU C O   1 
ATOM   2592 C CB  . GLU B 1 142 ? 25.172 -25.803 15.692  1.00 9.88   ? 269 GLU C CB  1 
ATOM   2593 C CG  . GLU B 1 142 ? 25.858 -27.062 16.250  1.00 12.68  ? 269 GLU C CG  1 
ATOM   2594 C CD  . GLU B 1 142 ? 27.384 -26.984 16.296  1.00 14.44  ? 269 GLU C CD  1 
ATOM   2595 O OE1 . GLU B 1 142 ? 28.011 -27.991 16.724  1.00 16.36  ? 269 GLU C OE1 1 
ATOM   2596 O OE2 . GLU B 1 142 ? 27.955 -25.937 15.920  1.00 12.02  ? 269 GLU C OE2 1 
ATOM   2597 N N   . SER B 1 143 ? 24.542 -23.360 13.779  1.00 8.43   ? 270 SER C N   1 
ATOM   2598 C CA  . SER B 1 143 ? 23.672 -22.241 13.367  1.00 8.20   ? 270 SER C CA  1 
ATOM   2599 C C   . SER B 1 143 ? 23.285 -22.343 11.883  1.00 8.77   ? 270 SER C C   1 
ATOM   2600 O O   . SER B 1 143 ? 22.165 -21.988 11.477  1.00 8.64   ? 270 SER C O   1 
ATOM   2601 C CB  . SER B 1 143 ? 24.346 -20.898 13.634  1.00 8.03   ? 270 SER C CB  1 
ATOM   2602 O OG  . SER B 1 143 ? 25.441 -20.720 12.767  1.00 6.93   ? 270 SER C OG  1 
ATOM   2603 N N   . GLN B 1 144 ? 24.225 -22.832 11.079  1.00 9.31   ? 271 GLN C N   1 
ATOM   2604 C CA  . GLN B 1 144 ? 24.005 -23.018 9.649   1.00 9.80   ? 271 GLN C CA  1 
ATOM   2605 C C   . GLN B 1 144 ? 23.022 -24.161 9.366   1.00 10.31  ? 271 GLN C C   1 
ATOM   2606 O O   . GLN B 1 144 ? 22.146 -24.032 8.509   1.00 10.41  ? 271 GLN C O   1 
ATOM   2607 C CB  . GLN B 1 144 ? 25.337 -23.231 8.924   1.00 9.47   ? 271 GLN C CB  1 
ATOM   2608 C CG  . GLN B 1 144 ? 26.266 -22.034 8.971   1.00 9.60   ? 271 GLN C CG  1 
ATOM   2609 C CD  . GLN B 1 144 ? 27.721 -22.417 8.831   1.00 10.68  ? 271 GLN C CD  1 
ATOM   2610 O OE1 . GLN B 1 144 ? 28.051 -23.504 8.342   1.00 11.40  ? 271 GLN C OE1 1 
ATOM   2611 N NE2 . GLN B 1 144 ? 28.610 -21.524 9.255   1.00 9.12   ? 271 GLN C NE2 1 
ATOM   2612 N N   . GLU B 1 145 ? 23.169 -25.271 10.090  1.00 10.98  ? 272 GLU C N   1 
ATOM   2613 C CA  . GLU B 1 145 ? 22.313 -26.445 9.904   1.00 11.77  ? 272 GLU C CA  1 
ATOM   2614 C C   . GLU B 1 145 ? 20.820 -26.152 10.190  1.00 11.85  ? 272 GLU C C   1 
ATOM   2615 O O   . GLU B 1 145 ? 19.941 -26.733 9.569   1.00 10.91  ? 272 GLU C O   1 
ATOM   2616 C CB  . GLU B 1 145 ? 22.846 -27.623 10.744  1.00 12.91  ? 272 GLU C CB  1 
ATOM   2617 C CG  . GLU B 1 145 ? 21.924 -28.834 10.878  1.00 16.06  ? 272 GLU C CG  1 
ATOM   2618 C CD  . GLU B 1 145 ? 21.711 -29.573 9.571   1.00 20.74  ? 272 GLU C CD  1 
ATOM   2619 O OE1 . GLU B 1 145 ? 22.612 -29.525 8.708   1.00 22.84  ? 272 GLU C OE1 1 
ATOM   2620 O OE2 . GLU B 1 145 ? 20.642 -30.209 9.412   1.00 23.13  ? 272 GLU C OE2 1 
ATOM   2621 N N   . THR B 1 146 ? 20.539 -25.226 11.099  1.00 11.82  ? 273 THR C N   1 
ATOM   2622 C CA  . THR B 1 146 ? 19.150 -24.903 11.442  1.00 12.37  ? 273 THR C CA  1 
ATOM   2623 C C   . THR B 1 146 ? 18.369 -24.298 10.274  1.00 11.68  ? 273 THR C C   1 
ATOM   2624 O O   . THR B 1 146 ? 17.142 -24.408 10.232  1.00 11.21  ? 273 THR C O   1 
ATOM   2625 C CB  . THR B 1 146 ? 19.046 -23.977 12.672  1.00 12.65  ? 273 THR C CB  1 
ATOM   2626 O OG1 . THR B 1 146 ? 19.577 -22.689 12.340  1.00 16.49  ? 273 THR C OG1 1 
ATOM   2627 C CG2 . THR B 1 146 ? 19.824 -24.560 13.834  1.00 13.39  ? 273 THR C CG2 1 
ATOM   2628 N N   . LEU B 1 147 ? 19.074 -23.684 9.320   1.00 10.77  ? 274 LEU C N   1 
ATOM   2629 C CA  . LEU B 1 147 ? 18.409 -23.061 8.163   1.00 10.27  ? 274 LEU C CA  1 
ATOM   2630 C C   . LEU B 1 147 ? 17.939 -24.081 7.134   1.00 10.18  ? 274 LEU C C   1 
ATOM   2631 O O   . LEU B 1 147 ? 17.038 -23.788 6.328   1.00 10.16  ? 274 LEU C O   1 
ATOM   2632 C CB  . LEU B 1 147 ? 19.319 -22.018 7.489   1.00 9.66   ? 274 LEU C CB  1 
ATOM   2633 C CG  . LEU B 1 147 ? 19.762 -20.811 8.323   1.00 9.15   ? 274 LEU C CG  1 
ATOM   2634 C CD1 . LEU B 1 147 ? 20.629 -19.919 7.477   1.00 8.77   ? 274 LEU C CD1 1 
ATOM   2635 C CD2 . LEU B 1 147 ? 18.571 -20.022 8.892   1.00 7.54   ? 274 LEU C CD2 1 
ATOM   2636 N N   . HIS B 1 148 ? 18.537 -25.277 7.184   1.00 10.03  ? 275 HIS C N   1 
ATOM   2637 C CA  . HIS B 1 148 ? 18.266 -26.363 6.226   1.00 9.66   ? 275 HIS C CA  1 
ATOM   2638 C C   . HIS B 1 148 ? 16.793 -26.737 6.152   1.00 9.74   ? 275 HIS C C   1 
ATOM   2639 O O   . HIS B 1 148 ? 16.266 -27.023 5.065   1.00 9.65   ? 275 HIS C O   1 
ATOM   2640 C CB  . HIS B 1 148 ? 19.118 -27.595 6.566   1.00 9.45   ? 275 HIS C CB  1 
ATOM   2641 C CG  . HIS B 1 148 ? 20.584 -27.403 6.312   1.00 8.92   ? 275 HIS C CG  1 
ATOM   2642 N ND1 . HIS B 1 148 ? 21.437 -28.451 6.043   1.00 10.55  ? 275 HIS C ND1 1 
ATOM   2643 C CD2 . HIS B 1 148 ? 21.343 -26.285 6.274   1.00 9.02   ? 275 HIS C CD2 1 
ATOM   2644 C CE1 . HIS B 1 148 ? 22.660 -27.988 5.863   1.00 10.29  ? 275 HIS C CE1 1 
ATOM   2645 N NE2 . HIS B 1 148 ? 22.627 -26.672 5.985   1.00 10.29  ? 275 HIS C NE2 1 
ATOM   2646 N N   . LYS B 1 149 ? 16.127 -26.689 7.302   1.00 10.24  ? 276 LYS C N   1 
ATOM   2647 C CA  . LYS B 1 149 ? 14.713 -27.064 7.408   1.00 10.84  ? 276 LYS C CA  1 
ATOM   2648 C C   . LYS B 1 149 ? 13.777 -26.123 6.644   1.00 10.63  ? 276 LYS C C   1 
ATOM   2649 O O   . LYS B 1 149 ? 12.654 -26.505 6.301   1.00 11.08  ? 276 LYS C O   1 
ATOM   2650 C CB  . LYS B 1 149 ? 14.293 -27.211 8.879   1.00 10.99  ? 276 LYS C CB  1 
ATOM   2651 C CG  . LYS B 1 149 ? 14.097 -25.906 9.642   1.00 12.61  ? 276 LYS C CG  1 
ATOM   2652 C CD  . LYS B 1 149 ? 13.680 -26.189 11.065  1.00 15.47  ? 276 LYS C CD  1 
ATOM   2653 C CE  . LYS B 1 149 ? 14.883 -26.219 11.991  1.00 17.90  ? 276 LYS C CE  1 
ATOM   2654 N NZ  . LYS B 1 149 ? 15.247 -24.843 12.441  1.00 17.52  ? 276 LYS C NZ  1 
ATOM   2655 N N   . PHE B 1 150 ? 14.237 -24.905 6.356   1.00 10.01  ? 277 PHE C N   1 
ATOM   2656 C CA  . PHE B 1 150 ? 13.396 -23.957 5.623   1.00 9.45   ? 277 PHE C CA  1 
ATOM   2657 C C   . PHE B 1 150 ? 13.580 -24.102 4.116   1.00 8.99   ? 277 PHE C C   1 
ATOM   2658 O O   . PHE B 1 150 ? 12.713 -23.694 3.341   1.00 8.29   ? 277 PHE C O   1 
ATOM   2659 C CB  . PHE B 1 150 ? 13.686 -22.510 6.032   1.00 9.55   ? 277 PHE C CB  1 
ATOM   2660 C CG  . PHE B 1 150 ? 13.541 -22.243 7.505   1.00 9.44   ? 277 PHE C CG  1 
ATOM   2661 C CD1 . PHE B 1 150 ? 12.305 -22.423 8.149   1.00 9.77   ? 277 PHE C CD1 1 
ATOM   2662 C CD2 . PHE B 1 150 ? 14.634 -21.787 8.246   1.00 8.84   ? 277 PHE C CD2 1 
ATOM   2663 C CE1 . PHE B 1 150 ? 12.170 -22.182 9.514   1.00 9.97   ? 277 PHE C CE1 1 
ATOM   2664 C CE2 . PHE B 1 150 ? 14.514 -21.526 9.620   1.00 10.51  ? 277 PHE C CE2 1 
ATOM   2665 C CZ  . PHE B 1 150 ? 13.269 -21.735 10.260  1.00 9.80   ? 277 PHE C CZ  1 
ATOM   2666 N N   . ALA B 1 151 ? 14.727 -24.651 3.715   1.00 8.35   ? 278 ALA C N   1 
ATOM   2667 C CA  . ALA B 1 151 ? 15.109 -24.742 2.310   1.00 8.15   ? 278 ALA C CA  1 
ATOM   2668 C C   . ALA B 1 151 ? 14.784 -26.084 1.657   1.00 8.76   ? 278 ALA C C   1 
ATOM   2669 O O   . ALA B 1 151 ? 14.622 -27.108 2.341   1.00 7.99   ? 278 ALA C O   1 
ATOM   2670 C CB  . ALA B 1 151 ? 16.580 -24.446 2.157   1.00 8.69   ? 278 ALA C CB  1 
ATOM   2671 N N   . SER B 1 152 ? 14.681 -26.067 0.326   1.00 8.90   ? 279 SER C N   1 
ATOM   2672 C CA  . SER B 1 152 ? 14.591 -27.291 -0.444  1.00 9.41   ? 279 SER C CA  1 
ATOM   2673 C C   . SER B 1 152 ? 15.910 -28.054 -0.316  1.00 9.81   ? 279 SER C C   1 
ATOM   2674 O O   . SER B 1 152 ? 16.901 -27.539 0.210   1.00 9.71   ? 279 SER C O   1 
ATOM   2675 C CB  . SER B 1 152 ? 14.259 -26.989 -1.915  1.00 9.72   ? 279 SER C CB  1 
ATOM   2676 O OG  . SER B 1 152 ? 13.008 -26.338 -2.026  1.00 7.46   ? 279 SER C OG  1 
ATOM   2677 N N   . LYS B 1 153 ? 15.910 -29.289 -0.791  1.00 10.67  ? 280 LYS C N   1 
ATOM   2678 C CA  . LYS B 1 153 ? 17.068 -30.167 -0.679  1.00 11.48  ? 280 LYS C CA  1 
ATOM   2679 C C   . LYS B 1 153 ? 17.672 -30.453 -2.060  1.00 11.72  ? 280 LYS C C   1 
ATOM   2680 O O   . LYS B 1 153 ? 16.933 -30.595 -3.041  1.00 12.61  ? 280 LYS C O   1 
ATOM   2681 C CB  . LYS B 1 153 ? 16.654 -31.466 0.014   1.00 11.81  ? 280 LYS C CB  1 
ATOM   2682 C CG  . LYS B 1 153 ? 16.189 -31.304 1.440   1.00 12.50  ? 280 LYS C CG  1 
ATOM   2683 C CD  . LYS B 1 153 ? 15.545 -32.590 1.961   1.00 16.32  ? 280 LYS C CD  1 
ATOM   2684 C CE  . LYS B 1 153 ? 14.963 -32.395 3.361   1.00 17.05  ? 280 LYS C CE  1 
ATOM   2685 N NZ  . LYS B 1 153 ? 14.854 -33.688 4.097   1.00 17.83  ? 280 LYS C NZ  1 
ATOM   2686 N N   . PRO B 1 154 ? 19.014 -30.573 -2.145  1.00 11.76  ? 281 PRO C N   1 
ATOM   2687 C CA  . PRO B 1 154 ? 19.981 -30.554 -1.036  1.00 11.38  ? 281 PRO C CA  1 
ATOM   2688 C C   . PRO B 1 154 ? 20.413 -29.135 -0.644  1.00 11.39  ? 281 PRO C C   1 
ATOM   2689 O O   . PRO B 1 154 ? 20.323 -28.214 -1.456  1.00 10.65  ? 281 PRO C O   1 
ATOM   2690 C CB  . PRO B 1 154 ? 21.166 -31.317 -1.611  1.00 11.84  ? 281 PRO C CB  1 
ATOM   2691 C CG  . PRO B 1 154 ? 21.119 -30.980 -3.099  1.00 11.84  ? 281 PRO C CG  1 
ATOM   2692 C CD  . PRO B 1 154 ? 19.671 -30.762 -3.453  1.00 11.02  ? 281 PRO C CD  1 
ATOM   2693 N N   . ALA B 1 155 ? 20.876 -28.978 0.596   1.00 11.57  ? 282 ALA C N   1 
ATOM   2694 C CA  . ALA B 1 155 ? 21.397 -27.692 1.084   1.00 11.50  ? 282 ALA C CA  1 
ATOM   2695 C C   . ALA B 1 155 ? 22.517 -27.117 0.216   1.00 11.36  ? 282 ALA C C   1 
ATOM   2696 O O   . ALA B 1 155 ? 22.661 -25.896 0.109   1.00 10.73  ? 282 ALA C O   1 
ATOM   2697 C CB  . ALA B 1 155 ? 21.854 -27.827 2.514   1.00 11.66  ? 282 ALA C CB  1 
ATOM   2698 N N   . SER B 1 156 ? 23.302 -27.996 -0.411  1.00 11.45  ? 283 SER C N   1 
ATOM   2699 C CA  . SER B 1 156 ? 24.421 -27.571 -1.232  1.00 11.71  ? 283 SER C CA  1 
ATOM   2700 C C   . SER B 1 156 ? 23.944 -26.679 -2.364  1.00 11.63  ? 283 SER C C   1 
ATOM   2701 O O   . SER B 1 156 ? 24.679 -25.807 -2.819  1.00 11.40  ? 283 SER C O   1 
ATOM   2702 C CB  . SER B 1 156 ? 25.221 -28.773 -1.778  1.00 12.45  ? 283 SER C CB  1 
ATOM   2703 O OG  . SER B 1 156 ? 24.379 -29.784 -2.326  1.00 12.95  ? 283 SER C OG  1 
ATOM   2704 N N   . GLU B 1 157 ? 22.692 -26.880 -2.777  1.00 11.57  ? 284 GLU C N   1 
ATOM   2705 C CA  . GLU B 1 157 ? 22.072 -26.112 -3.857  1.00 11.41  ? 284 GLU C CA  1 
ATOM   2706 C C   . GLU B 1 157 ? 21.195 -24.972 -3.322  1.00 11.13  ? 284 GLU C C   1 
ATOM   2707 O O   . GLU B 1 157 ? 21.141 -23.884 -3.900  1.00 11.14  ? 284 GLU C O   1 
ATOM   2708 C CB  . GLU B 1 157 ? 21.234 -27.052 -4.742  1.00 11.62  ? 284 GLU C CB  1 
ATOM   2709 C CG  . GLU B 1 157 ? 20.491 -26.374 -5.906  1.00 11.92  ? 284 GLU C CG  1 
ATOM   2710 C CD  . GLU B 1 157 ? 19.619 -27.338 -6.698  1.00 11.51  ? 284 GLU C CD  1 
ATOM   2711 O OE1 . GLU B 1 157 ? 19.509 -28.532 -6.323  1.00 10.70  ? 284 GLU C OE1 1 
ATOM   2712 O OE2 . GLU B 1 157 ? 19.009 -26.881 -7.689  1.00 12.98  ? 284 GLU C OE2 1 
ATOM   2713 N N   . PHE B 1 158 ? 20.515 -25.216 -2.211  1.00 10.72  ? 285 PHE C N   1 
ATOM   2714 C CA  . PHE B 1 158 ? 19.469 -24.303 -1.769  1.00 10.10  ? 285 PHE C CA  1 
ATOM   2715 C C   . PHE B 1 158 ? 19.796 -23.435 -0.546  1.00 10.00  ? 285 PHE C C   1 
ATOM   2716 O O   . PHE B 1 158 ? 19.074 -22.476 -0.260  1.00 9.98   ? 285 PHE C O   1 
ATOM   2717 C CB  . PHE B 1 158 ? 18.161 -25.078 -1.570  1.00 9.86   ? 285 PHE C CB  1 
ATOM   2718 C CG  . PHE B 1 158 ? 17.628 -25.696 -2.848  1.00 9.57   ? 285 PHE C CG  1 
ATOM   2719 C CD1 . PHE B 1 158 ? 17.745 -27.061 -3.078  1.00 7.68   ? 285 PHE C CD1 1 
ATOM   2720 C CD2 . PHE B 1 158 ? 17.029 -24.903 -3.824  1.00 8.60   ? 285 PHE C CD2 1 
ATOM   2721 C CE1 . PHE B 1 158 ? 17.250 -27.632 -4.254  1.00 7.67   ? 285 PHE C CE1 1 
ATOM   2722 C CE2 . PHE B 1 158 ? 16.543 -25.461 -5.007  1.00 7.98   ? 285 PHE C CE2 1 
ATOM   2723 C CZ  . PHE B 1 158 ? 16.651 -26.836 -5.216  1.00 7.92   ? 285 PHE C CZ  1 
ATOM   2724 N N   . VAL B 1 159 ? 20.874 -23.766 0.160   1.00 9.16   ? 286 VAL C N   1 
ATOM   2725 C CA  . VAL B 1 159 ? 21.315 -22.964 1.306   1.00 8.98   ? 286 VAL C CA  1 
ATOM   2726 C C   . VAL B 1 159 ? 22.612 -22.223 0.995   1.00 9.01   ? 286 VAL C C   1 
ATOM   2727 O O   . VAL B 1 159 ? 23.602 -22.852 0.591   1.00 8.13   ? 286 VAL C O   1 
ATOM   2728 C CB  . VAL B 1 159 ? 21.555 -23.828 2.563   1.00 9.16   ? 286 VAL C CB  1 
ATOM   2729 C CG1 . VAL B 1 159 ? 22.096 -22.960 3.702   1.00 8.28   ? 286 VAL C CG1 1 
ATOM   2730 C CG2 . VAL B 1 159 ? 20.272 -24.541 2.973   1.00 7.72   ? 286 VAL C CG2 1 
ATOM   2731 N N   . LYS B 1 160 ? 22.609 -20.907 1.216   1.00 8.35   ? 287 LYS C N   1 
ATOM   2732 C CA  . LYS B 1 160 ? 23.790 -20.082 0.970   1.00 9.38   ? 287 LYS C CA  1 
ATOM   2733 C C   . LYS B 1 160 ? 24.156 -19.323 2.227   1.00 9.29   ? 287 LYS C C   1 
ATOM   2734 O O   . LYS B 1 160 ? 23.376 -18.493 2.687   1.00 9.47   ? 287 LYS C O   1 
ATOM   2735 C CB  . LYS B 1 160 ? 23.484 -19.054 -0.119  1.00 9.77   ? 287 LYS C CB  1 
ATOM   2736 C CG  . LYS B 1 160 ? 24.446 -19.027 -1.289  1.00 13.12  ? 287 LYS C CG  1 
ATOM   2737 C CD  . LYS B 1 160 ? 25.862 -18.722 -0.894  1.00 15.53  ? 287 LYS C CD  1 
ATOM   2738 C CE  . LYS B 1 160 ? 26.772 -18.865 -2.100  1.00 18.35  ? 287 LYS C CE  1 
ATOM   2739 N NZ  . LYS B 1 160 ? 26.814 -20.256 -2.630  1.00 19.42  ? 287 LYS C NZ  1 
ATOM   2740 N N   . ILE B 1 161 ? 25.337 -19.590 2.776   1.00 9.22   ? 288 ILE C N   1 
ATOM   2741 C CA  . ILE B 1 161 ? 25.811 -18.858 3.945   1.00 9.64   ? 288 ILE C CA  1 
ATOM   2742 C C   . ILE B 1 161 ? 26.841 -17.805 3.524   1.00 9.38   ? 288 ILE C C   1 
ATOM   2743 O O   . ILE B 1 161 ? 27.915 -18.139 3.031   1.00 9.72   ? 288 ILE C O   1 
ATOM   2744 C CB  . ILE B 1 161 ? 26.394 -19.795 5.064   1.00 9.56   ? 288 ILE C CB  1 
ATOM   2745 C CG1 . ILE B 1 161 ? 25.453 -20.980 5.382   1.00 9.43   ? 288 ILE C CG1 1 
ATOM   2746 C CG2 . ILE B 1 161 ? 26.762 -18.962 6.314   1.00 10.67  ? 288 ILE C CG2 1 
ATOM   2747 C CD1 . ILE B 1 161 ? 24.132 -20.638 6.126   1.00 7.92   ? 288 ILE C CD1 1 
ATOM   2748 N N   . LEU B 1 162 ? 26.486 -16.538 3.712   1.00 9.50   ? 289 LEU C N   1 
ATOM   2749 C CA  . LEU B 1 162 ? 27.330 -15.411 3.326   1.00 9.89   ? 289 LEU C CA  1 
ATOM   2750 C C   . LEU B 1 162 ? 27.911 -14.746 4.555   1.00 9.96   ? 289 LEU C C   1 
ATOM   2751 O O   . LEU B 1 162 ? 27.193 -14.481 5.521   1.00 10.08  ? 289 LEU C O   1 
ATOM   2752 C CB  . LEU B 1 162 ? 26.540 -14.374 2.529   1.00 10.02  ? 289 LEU C CB  1 
ATOM   2753 C CG  . LEU B 1 162 ? 25.844 -14.775 1.231   1.00 10.19  ? 289 LEU C CG  1 
ATOM   2754 C CD1 . LEU B 1 162 ? 25.155 -13.531 0.692   1.00 10.47  ? 289 LEU C CD1 1 
ATOM   2755 C CD2 . LEU B 1 162 ? 26.813 -15.362 0.214   1.00 11.96  ? 289 LEU C CD2 1 
ATOM   2756 N N   . ASP B 1 163 ? 29.213 -14.476 4.513   1.00 10.04  ? 290 ASP C N   1 
ATOM   2757 C CA  . ASP B 1 163 ? 29.907 -13.931 5.668   1.00 10.33  ? 290 ASP C CA  1 
ATOM   2758 C C   . ASP B 1 163 ? 29.512 -12.503 6.007   1.00 10.04  ? 290 ASP C C   1 
ATOM   2759 O O   . ASP B 1 163 ? 29.466 -12.146 7.173   1.00 9.69   ? 290 ASP C O   1 
ATOM   2760 C CB  . ASP B 1 163 ? 31.417 -14.063 5.507   1.00 10.83  ? 290 ASP C CB  1 
ATOM   2761 C CG  . ASP B 1 163 ? 31.877 -15.514 5.580   1.00 12.03  ? 290 ASP C CG  1 
ATOM   2762 O OD1 . ASP B 1 163 ? 32.540 -15.872 6.563   1.00 15.91  ? 290 ASP C OD1 1 
ATOM   2763 O OD2 . ASP B 1 163 ? 31.576 -16.304 4.662   1.00 15.12  ? 290 ASP C OD2 1 
ATOM   2764 N N   . THR B 1 164 ? 29.223 -11.689 4.993   1.00 10.07  ? 291 THR C N   1 
ATOM   2765 C CA  . THR B 1 164 ? 28.891 -10.282 5.230   1.00 9.81   ? 291 THR C CA  1 
ATOM   2766 C C   . THR B 1 164 ? 27.807 -9.818  4.263   1.00 9.78   ? 291 THR C C   1 
ATOM   2767 O O   . THR B 1 164 ? 27.507 -10.493 3.289   1.00 10.61  ? 291 THR C O   1 
ATOM   2768 C CB  . THR B 1 164 ? 30.126 -9.357  5.005   1.00 10.47  ? 291 THR C CB  1 
ATOM   2769 O OG1 . THR B 1 164 ? 30.452 -9.353  3.614   1.00 8.34   ? 291 THR C OG1 1 
ATOM   2770 C CG2 . THR B 1 164 ? 31.360 -9.810  5.833   1.00 10.00  ? 291 THR C CG2 1 
ATOM   2771 N N   . PHE B 1 165 ? 27.244 -8.644  4.510   1.00 9.31   ? 292 PHE C N   1 
ATOM   2772 C CA  . PHE B 1 165 ? 26.236 -8.100  3.618   1.00 9.16   ? 292 PHE C CA  1 
ATOM   2773 C C   . PHE B 1 165 ? 26.825 -7.625  2.294   1.00 9.23   ? 292 PHE C C   1 
ATOM   2774 O O   . PHE B 1 165 ? 26.153 -7.656  1.279   1.00 8.91   ? 292 PHE C O   1 
ATOM   2775 C CB  . PHE B 1 165 ? 25.396 -7.035  4.336   1.00 8.74   ? 292 PHE C CB  1 
ATOM   2776 C CG  . PHE B 1 165 ? 24.373 -7.632  5.249   1.00 8.01   ? 292 PHE C CG  1 
ATOM   2777 C CD1 . PHE B 1 165 ? 24.717 -8.033  6.533   1.00 9.07   ? 292 PHE C CD1 1 
ATOM   2778 C CD2 . PHE B 1 165 ? 23.070 -7.844  4.804   1.00 10.39  ? 292 PHE C CD2 1 
ATOM   2779 C CE1 . PHE B 1 165 ? 23.769 -8.609  7.375   1.00 9.56   ? 292 PHE C CE1 1 
ATOM   2780 C CE2 . PHE B 1 165 ? 22.114 -8.428  5.634   1.00 9.14   ? 292 PHE C CE2 1 
ATOM   2781 C CZ  . PHE B 1 165 ? 22.472 -8.818  6.921   1.00 8.96   ? 292 PHE C CZ  1 
ATOM   2782 N N   . GLU B 1 166 ? 28.089 -7.209  2.300   1.00 9.96   ? 293 GLU C N   1 
ATOM   2783 C CA  . GLU B 1 166 ? 28.768 -6.868  1.044   1.00 10.57  ? 293 GLU C CA  1 
ATOM   2784 C C   . GLU B 1 166 ? 28.853 -8.049  0.065   1.00 10.15  ? 293 GLU C C   1 
ATOM   2785 O O   . GLU B 1 166 ? 28.846 -7.845  -1.144  1.00 10.02  ? 293 GLU C O   1 
ATOM   2786 C CB  . GLU B 1 166 ? 30.145 -6.255  1.303   1.00 11.07  ? 293 GLU C CB  1 
ATOM   2787 C CG  . GLU B 1 166 ? 30.149 -4.732  1.202   1.00 14.10  ? 293 GLU C CG  1 
ATOM   2788 C CD  . GLU B 1 166 ? 29.733 -4.212  -0.190  1.00 18.45  ? 293 GLU C CD  1 
ATOM   2789 O OE1 . GLU B 1 166 ? 28.569 -3.781  -0.358  1.00 20.02  ? 293 GLU C OE1 1 
ATOM   2790 O OE2 . GLU B 1 166 ? 30.564 -4.236  -1.129  1.00 20.91  ? 293 GLU C OE2 1 
ATOM   2791 N N   . LYS B 1 167 ? 28.918 -9.274  0.597   1.00 9.67   ? 294 LYS C N   1 
ATOM   2792 C CA  . LYS B 1 167 ? 28.929 -10.514 -0.218  1.00 9.37   ? 294 LYS C CA  1 
ATOM   2793 C C   . LYS B 1 167 ? 27.687 -10.709 -1.096  1.00 9.00   ? 294 LYS C C   1 
ATOM   2794 O O   . LYS B 1 167 ? 27.688 -11.539 -2.002  1.00 8.55   ? 294 LYS C O   1 
ATOM   2795 C CB  . LYS B 1 167 ? 29.113 -11.756 0.667   1.00 9.39   ? 294 LYS C CB  1 
ATOM   2796 C CG  . LYS B 1 167 ? 30.506 -11.907 1.295   1.00 11.03  ? 294 LYS C CG  1 
ATOM   2797 C CD  . LYS B 1 167 ? 31.617 -12.111 0.258   1.00 13.98  ? 294 LYS C CD  1 
ATOM   2798 C CE  . LYS B 1 167 ? 31.434 -13.424 -0.534  1.00 15.70  ? 294 LYS C CE  1 
ATOM   2799 N NZ  . LYS B 1 167 ? 32.443 -13.571 -1.653  1.00 16.56  ? 294 LYS C NZ  1 
ATOM   2800 N N   . LEU B 1 168 ? 26.629 -9.953  -0.819  1.00 8.57   ? 295 LEU C N   1 
ATOM   2801 C CA  . LEU B 1 168 ? 25.435 -9.952  -1.681  1.00 7.92   ? 295 LEU C CA  1 
ATOM   2802 C C   . LEU B 1 168 ? 25.801 -9.477  -3.090  1.00 8.17   ? 295 LEU C C   1 
ATOM   2803 O O   . LEU B 1 168 ? 25.276 -9.978  -4.080  1.00 7.97   ? 295 LEU C O   1 
ATOM   2804 C CB  . LEU B 1 168 ? 24.309 -9.105  -1.073  1.00 7.55   ? 295 LEU C CB  1 
ATOM   2805 C CG  . LEU B 1 168 ? 23.482 -9.754  0.049   1.00 7.41   ? 295 LEU C CG  1 
ATOM   2806 C CD1 . LEU B 1 168 ? 22.493 -8.763  0.714   1.00 5.83   ? 295 LEU C CD1 1 
ATOM   2807 C CD2 . LEU B 1 168 ? 22.750 -11.007 -0.454  1.00 5.25   ? 295 LEU C CD2 1 
ATOM   2808 N N   . LYS B 1 169 ? 26.734 -8.532  -3.173  1.00 8.89   ? 296 LYS C N   1 
ATOM   2809 C CA  . LYS B 1 169 ? 27.289 -8.100  -4.456  1.00 9.85   ? 296 LYS C CA  1 
ATOM   2810 C C   . LYS B 1 169 ? 27.894 -9.275  -5.236  1.00 10.36  ? 296 LYS C C   1 
ATOM   2811 O O   . LYS B 1 169 ? 27.593 -9.477  -6.421  1.00 9.75   ? 296 LYS C O   1 
ATOM   2812 C CB  . LYS B 1 169 ? 28.341 -7.001  -4.233  1.00 10.68  ? 296 LYS C CB  1 
ATOM   2813 N N   . ASP B 1 170 ? 28.739 -10.053 -4.561  1.00 10.36  ? 297 ASP C N   1 
ATOM   2814 C CA  . ASP B 1 170 ? 29.382 -11.220 -5.158  1.00 10.98  ? 297 ASP C CA  1 
ATOM   2815 C C   . ASP B 1 170 ? 28.358 -12.282 -5.554  1.00 10.31  ? 297 ASP C C   1 
ATOM   2816 O O   . ASP B 1 170 ? 28.488 -12.922 -6.593  1.00 9.84   ? 297 ASP C O   1 
ATOM   2817 C CB  . ASP B 1 170 ? 30.389 -11.819 -4.179  1.00 11.68  ? 297 ASP C CB  1 
ATOM   2818 C CG  . ASP B 1 170 ? 31.558 -10.880 -3.890  1.00 15.13  ? 297 ASP C CG  1 
ATOM   2819 O OD1 . ASP B 1 170 ? 31.649 -9.789  -4.513  1.00 18.02  ? 297 ASP C OD1 1 
ATOM   2820 O OD2 . ASP B 1 170 ? 32.403 -11.258 -3.050  1.00 18.24  ? 297 ASP C OD2 1 
ATOM   2821 N N   . LEU B 1 171 ? 27.341 -12.460 -4.713  1.00 9.56   ? 298 LEU C N   1 
ATOM   2822 C CA  . LEU B 1 171 ? 26.279 -13.421 -4.995  1.00 8.75   ? 298 LEU C CA  1 
ATOM   2823 C C   . LEU B 1 171 ? 25.503 -13.044 -6.257  1.00 8.75   ? 298 LEU C C   1 
ATOM   2824 O O   . LEU B 1 171 ? 25.188 -13.914 -7.068  1.00 8.40   ? 298 LEU C O   1 
ATOM   2825 C CB  . LEU B 1 171 ? 25.345 -13.582 -3.796  1.00 8.36   ? 298 LEU C CB  1 
ATOM   2826 C CG  . LEU B 1 171 ? 24.275 -14.676 -3.894  1.00 8.83   ? 298 LEU C CG  1 
ATOM   2827 C CD1 . LEU B 1 171 ? 24.881 -16.077 -4.059  1.00 8.19   ? 298 LEU C CD1 1 
ATOM   2828 C CD2 . LEU B 1 171 ? 23.376 -14.625 -2.678  1.00 7.93   ? 298 LEU C CD2 1 
ATOM   2829 N N   . PHE B 1 172 ? 25.200 -11.756 -6.420  1.00 8.63   ? 299 PHE C N   1 
ATOM   2830 C CA  . PHE B 1 172 ? 24.587 -11.270 -7.655  1.00 8.86   ? 299 PHE C CA  1 
ATOM   2831 C C   . PHE B 1 172 ? 25.488 -11.478 -8.895  1.00 9.40   ? 299 PHE C C   1 
ATOM   2832 O O   . PHE B 1 172 ? 25.006 -11.818 -9.967  1.00 8.85   ? 299 PHE C O   1 
ATOM   2833 C CB  . PHE B 1 172 ? 24.162 -9.805  -7.517  1.00 8.94   ? 299 PHE C CB  1 
ATOM   2834 C CG  . PHE B 1 172 ? 23.416 -9.276  -8.718  1.00 8.18   ? 299 PHE C CG  1 
ATOM   2835 C CD1 . PHE B 1 172 ? 22.224 -9.869  -9.133  1.00 9.43   ? 299 PHE C CD1 1 
ATOM   2836 C CD2 . PHE B 1 172 ? 23.908 -8.181  -9.429  1.00 9.24   ? 299 PHE C CD2 1 
ATOM   2837 C CE1 . PHE B 1 172 ? 21.528 -9.376  -10.257 1.00 9.24   ? 299 PHE C CE1 1 
ATOM   2838 C CE2 . PHE B 1 172 ? 23.224 -7.674  -10.553 1.00 8.85   ? 299 PHE C CE2 1 
ATOM   2839 C CZ  . PHE B 1 172 ? 22.036 -8.287  -10.967 1.00 9.08   ? 299 PHE C CZ  1 
ATOM   2840 N N   . THR B 1 173 ? 26.794 -11.268 -8.740  1.00 10.38  ? 300 THR C N   1 
ATOM   2841 C CA  . THR B 1 173 ? 27.758 -11.534 -9.821  1.00 11.18  ? 300 THR C CA  1 
ATOM   2842 C C   . THR B 1 173 ? 27.715 -13.004 -10.252 1.00 12.07  ? 300 THR C C   1 
ATOM   2843 O O   . THR B 1 173 ? 27.640 -13.318 -11.458 1.00 11.74  ? 300 THR C O   1 
ATOM   2844 C CB  . THR B 1 173 ? 29.197 -11.116 -9.404  1.00 11.22  ? 300 THR C CB  1 
ATOM   2845 O OG1 . THR B 1 173 ? 29.230 -9.701  -9.188  1.00 10.52  ? 300 THR C OG1 1 
ATOM   2846 C CG2 . THR B 1 173 ? 30.226 -11.488 -10.477 1.00 12.05  ? 300 THR C CG2 1 
ATOM   2847 N N   . GLU B 1 174 ? 27.761 -13.894 -9.258  1.00 12.84  ? 301 GLU C N   1 
ATOM   2848 C CA  . GLU B 1 174 ? 27.686 -15.348 -9.462  1.00 13.55  ? 301 GLU C CA  1 
ATOM   2849 C C   . GLU B 1 174 ? 26.354 -15.763 -10.076 1.00 13.39  ? 301 GLU C C   1 
ATOM   2850 O O   . GLU B 1 174 ? 26.293 -16.630 -10.965 1.00 13.17  ? 301 GLU C O   1 
ATOM   2851 C CB  . GLU B 1 174 ? 27.857 -16.069 -8.123  1.00 13.96  ? 301 GLU C CB  1 
ATOM   2852 C CG  . GLU B 1 174 ? 29.295 -16.225 -7.710  1.00 16.89  ? 301 GLU C CG  1 
ATOM   2853 C CD  . GLU B 1 174 ? 29.494 -16.269 -6.206  1.00 20.19  ? 301 GLU C CD  1 
ATOM   2854 O OE1 . GLU B 1 174 ? 28.578 -16.721 -5.473  1.00 21.80  ? 301 GLU C OE1 1 
ATOM   2855 O OE2 . GLU B 1 174 ? 30.582 -15.842 -5.761  1.00 22.32  ? 301 GLU C OE2 1 
ATOM   2856 N N   . LEU B 1 175 ? 25.287 -15.142 -9.595  1.00 12.94  ? 302 LEU C N   1 
ATOM   2857 C CA  . LEU B 1 175 ? 23.943 -15.476 -10.046 1.00 13.05  ? 302 LEU C CA  1 
ATOM   2858 C C   . LEU B 1 175 ? 23.762 -15.235 -11.557 1.00 12.80  ? 302 LEU C C   1 
ATOM   2859 O O   . LEU B 1 175 ? 23.199 -16.071 -12.280 1.00 12.33  ? 302 LEU C O   1 
ATOM   2860 C CB  . LEU B 1 175 ? 22.916 -14.663 -9.259  1.00 13.14  ? 302 LEU C CB  1 
ATOM   2861 C CG  . LEU B 1 175 ? 21.523 -14.641 -9.862  1.00 14.41  ? 302 LEU C CG  1 
ATOM   2862 C CD1 . LEU B 1 175 ? 20.834 -15.998 -9.679  1.00 14.78  ? 302 LEU C CD1 1 
ATOM   2863 C CD2 . LEU B 1 175 ? 20.736 -13.515 -9.239  1.00 15.63  ? 302 LEU C CD2 1 
ATOM   2864 N N   . GLN B 1 176 ? 24.237 -14.080 -12.002 1.00 12.50  ? 303 GLN C N   1 
ATOM   2865 C CA  . GLN B 1 176 ? 24.144 -13.664 -13.396 1.00 12.85  ? 303 GLN C CA  1 
ATOM   2866 C C   . GLN B 1 176 ? 24.885 -14.584 -14.367 1.00 12.87  ? 303 GLN C C   1 
ATOM   2867 O O   . GLN B 1 176 ? 24.541 -14.623 -15.543 1.00 12.56  ? 303 GLN C O   1 
ATOM   2868 C CB  . GLN B 1 176 ? 24.669 -12.247 -13.551 1.00 12.78  ? 303 GLN C CB  1 
ATOM   2869 C CG  . GLN B 1 176 ? 23.797 -11.185 -12.927 1.00 12.88  ? 303 GLN C CG  1 
ATOM   2870 C CD  . GLN B 1 176 ? 24.447 -9.829  -12.989 1.00 14.40  ? 303 GLN C CD  1 
ATOM   2871 O OE1 . GLN B 1 176 ? 25.490 -9.596  -12.365 1.00 15.11  ? 303 GLN C OE1 1 
ATOM   2872 N NE2 . GLN B 1 176 ? 23.839 -8.917  -13.742 1.00 12.32  ? 303 GLN C NE2 1 
ATOM   2873 N N   . LYS B 1 177 ? 25.889 -15.308 -13.875 1.00 12.97  ? 304 LYS C N   1 
ATOM   2874 C CA  . LYS B 1 177 ? 26.626 -16.290 -14.690 1.00 13.70  ? 304 LYS C CA  1 
ATOM   2875 C C   . LYS B 1 177 ? 25.814 -17.559 -14.903 1.00 13.81  ? 304 LYS C C   1 
ATOM   2876 O O   . LYS B 1 177 ? 26.183 -18.409 -15.721 1.00 14.18  ? 304 LYS C O   1 
ATOM   2877 C CB  . LYS B 1 177 ? 28.006 -16.631 -14.082 1.00 14.07  ? 304 LYS C CB  1 
ATOM   2878 C CG  . LYS B 1 177 ? 28.963 -15.441 -14.003 1.00 15.28  ? 304 LYS C CG  1 
ATOM   2879 C CD  . LYS B 1 177 ? 30.420 -15.870 -13.929 1.00 18.90  ? 304 LYS C CD  1 
ATOM   2880 C CE  . LYS B 1 177 ? 31.295 -14.791 -13.293 1.00 20.25  ? 304 LYS C CE  1 
ATOM   2881 N NZ  . LYS B 1 177 ? 31.181 -13.474 -13.985 1.00 22.08  ? 304 LYS C NZ  1 
ATOM   2882 N N   . LYS B 1 178 ? 24.714 -17.685 -14.161 1.00 13.83  ? 305 LYS C N   1 
ATOM   2883 C CA  . LYS B 1 178 ? 23.792 -18.822 -14.303 1.00 13.51  ? 305 LYS C CA  1 
ATOM   2884 C C   . LYS B 1 178 ? 22.554 -18.478 -15.151 1.00 12.96  ? 305 LYS C C   1 
ATOM   2885 O O   . LYS B 1 178 ? 21.593 -19.255 -15.216 1.00 12.77  ? 305 LYS C O   1 
ATOM   2886 C CB  . LYS B 1 178 ? 23.391 -19.362 -12.921 1.00 13.63  ? 305 LYS C CB  1 
ATOM   2887 C CG  . LYS B 1 178 ? 24.492 -20.147 -12.186 1.00 14.08  ? 305 LYS C CG  1 
ATOM   2888 C CD  . LYS B 1 178 ? 24.150 -20.382 -10.697 1.00 15.51  ? 305 LYS C CD  1 
ATOM   2889 C CE  . LYS B 1 178 ? 23.095 -21.481 -10.505 1.00 18.58  ? 305 LYS C CE  1 
ATOM   2890 N NZ  . LYS B 1 178 ? 22.326 -21.371 -9.216  1.00 20.65  ? 305 LYS C NZ  1 
ATOM   2891 N N   . ILE B 1 179 ? 22.589 -17.325 -15.817 1.00 12.31  ? 306 ILE C N   1 
ATOM   2892 C CA  . ILE B 1 179 ? 21.471 -16.873 -16.651 1.00 12.38  ? 306 ILE C CA  1 
ATOM   2893 C C   . ILE B 1 179 ? 21.619 -17.333 -18.106 1.00 12.82  ? 306 ILE C C   1 
ATOM   2894 O O   . ILE B 1 179 ? 22.577 -16.954 -18.778 1.00 12.78  ? 306 ILE C O   1 
ATOM   2895 C CB  . ILE B 1 179 ? 21.313 -15.331 -16.599 1.00 11.94  ? 306 ILE C CB  1 
ATOM   2896 C CG1 . ILE B 1 179 ? 20.764 -14.906 -15.234 1.00 10.72  ? 306 ILE C CG1 1 
ATOM   2897 C CG2 . ILE B 1 179 ? 20.419 -14.833 -17.737 1.00 11.96  ? 306 ILE C CG2 1 
ATOM   2898 C CD1 . ILE B 1 179 ? 20.858 -13.438 -14.971 1.00 8.60   ? 306 ILE C CD1 1 
ATOM   2899 N N   . TYR B 1 180 ? 20.671 -18.144 -18.578 1.00 12.91  ? 307 TYR C N   1 
ATOM   2900 C CA  . TYR B 1 180 ? 20.722 -18.660 -19.943 1.00 13.79  ? 307 TYR C CA  1 
ATOM   2901 C C   . TYR B 1 180 ? 19.410 -18.500 -20.694 1.00 14.34  ? 307 TYR C C   1 
ATOM   2902 O O   . TYR B 1 180 ? 18.349 -18.492 -20.088 1.00 14.06  ? 307 TYR C O   1 
ATOM   2903 C CB  . TYR B 1 180 ? 21.115 -20.141 -19.931 1.00 13.16  ? 307 TYR C CB  1 
ATOM   2904 C CG  . TYR B 1 180 ? 22.475 -20.410 -19.324 1.00 13.71  ? 307 TYR C CG  1 
ATOM   2905 C CD1 . TYR B 1 180 ? 22.601 -20.817 -17.990 1.00 13.74  ? 307 TYR C CD1 1 
ATOM   2906 C CD2 . TYR B 1 180 ? 23.639 -20.254 -20.082 1.00 14.49  ? 307 TYR C CD2 1 
ATOM   2907 C CE1 . TYR B 1 180 ? 23.847 -21.068 -17.428 1.00 12.40  ? 307 TYR C CE1 1 
ATOM   2908 C CE2 . TYR B 1 180 ? 24.897 -20.494 -19.527 1.00 13.90  ? 307 TYR C CE2 1 
ATOM   2909 C CZ  . TYR B 1 180 ? 24.990 -20.903 -18.198 1.00 13.59  ? 307 TYR C CZ  1 
ATOM   2910 O OH  . TYR B 1 180 ? 26.231 -21.155 -17.657 1.00 12.18  ? 307 TYR C OH  1 
ATOM   2911 N N   . VAL B 1 181 ? 19.504 -18.387 -22.020 1.00 15.38  ? 308 VAL C N   1 
ATOM   2912 C CA  . VAL B 1 181 ? 18.373 -18.549 -22.921 1.00 16.54  ? 308 VAL C CA  1 
ATOM   2913 C C   . VAL B 1 181 ? 18.093 -20.054 -23.049 1.00 18.31  ? 308 VAL C C   1 
ATOM   2914 O O   . VAL B 1 181 ? 18.973 -20.826 -23.455 1.00 18.12  ? 308 VAL C O   1 
ATOM   2915 C CB  . VAL B 1 181 ? 18.673 -17.925 -24.311 1.00 16.45  ? 308 VAL C CB  1 
ATOM   2916 C CG1 . VAL B 1 181 ? 17.570 -18.236 -25.314 1.00 15.87  ? 308 VAL C CG1 1 
ATOM   2917 C CG2 . VAL B 1 181 ? 18.893 -16.411 -24.185 1.00 15.28  ? 308 VAL C CG2 1 
ATOM   2918 N N   . ILE B 1 182 ? 16.859 -20.430 -22.710 1.00 20.04  ? 309 ILE C N   1 
ATOM   2919 C CA  . ILE B 1 182 ? 16.380 -21.820 -22.472 1.00 22.04  ? 309 ILE C CA  1 
ATOM   2920 C C   . ILE B 1 182 ? 17.119 -22.746 -21.484 1.00 22.72  ? 309 ILE C C   1 
ATOM   2921 O O   . ILE B 1 182 ? 17.442 -22.388 -20.342 1.00 23.01  ? 309 ILE C O   1 
ATOM   2922 C CB  . ILE B 1 182 ? 15.908 -22.604 -23.755 1.00 22.27  ? 309 ILE C CB  1 
ATOM   2923 C CG1 . ILE B 1 182 ? 16.844 -22.435 -24.965 1.00 22.89  ? 309 ILE C CG1 1 
ATOM   2924 C CG2 . ILE B 1 182 ? 14.456 -22.263 -24.053 1.00 23.28  ? 309 ILE C CG2 1 
ATOM   2925 C CD1 . ILE B 1 182 ? 16.360 -21.484 -26.044 1.00 22.60  ? 309 ILE C CD1 1 
ATOM   2926 O OXT . ILE B 1 182 ? 17.360 -23.924 -21.776 1.00 23.70  ? 309 ILE C OXT 1 
HETATM 2927 F F6  . BQM C 2 .   ? 19.949 -14.310 -30.344 1.00 15.77  ? 1   BQM B F6  1 
HETATM 2928 C C12 . BQM C 2 .   ? 18.728 -14.759 -30.497 1.00 15.16  ? 1   BQM B C12 1 
HETATM 2929 F F4  . BQM C 2 .   ? 17.852 -14.005 -29.898 1.00 16.38  ? 1   BQM B F4  1 
HETATM 2930 F F5  . BQM C 2 .   ? 18.592 -14.608 -31.790 1.00 16.58  ? 1   BQM B F5  1 
HETATM 2931 C C11 . BQM C 2 .   ? 18.688 -16.232 -30.101 1.00 15.46  ? 1   BQM B C11 1 
HETATM 2932 C C9  . BQM C 2 .   ? 19.525 -16.692 -29.062 1.00 14.86  ? 1   BQM B C9  1 
HETATM 2933 C C10 . BQM C 2 .   ? 20.354 -15.723 -28.240 1.00 15.78  ? 1   BQM B C10 1 
HETATM 2934 F F3  . BQM C 2 .   ? 21.528 -15.416 -28.731 1.00 17.54  ? 1   BQM B F3  1 
HETATM 2935 F F2  . BQM C 2 .   ? 19.667 -14.604 -28.085 1.00 16.63  ? 1   BQM B F2  1 
HETATM 2936 F F1  . BQM C 2 .   ? 20.459 -16.144 -26.995 1.00 15.17  ? 1   BQM B F1  1 
HETATM 2937 C C13 . BQM C 2 .   ? 17.877 -17.150 -30.813 1.00 15.04  ? 1   BQM B C13 1 
HETATM 2938 S S   . BQM C 2 .   ? 16.800 -16.693 -32.074 1.00 15.28  ? 1   BQM B S   1 
HETATM 2939 C C14 . BQM C 2 .   ? 16.141 -18.071 -32.847 1.00 14.75  ? 1   BQM B C14 1 
HETATM 2940 C C19 . BQM C 2 .   ? 15.113 -18.828 -32.274 1.00 15.56  ? 1   BQM B C19 1 
HETATM 2941 C C18 . BQM C 2 .   ? 14.611 -19.943 -32.949 1.00 15.86  ? 1   BQM B C18 1 
HETATM 2942 N N2  . BQM C 2 .   ? 13.621 -20.688 -32.406 1.00 16.54  ? 1   BQM B N2  1 
HETATM 2943 C C17 . BQM C 2 .   ? 15.130 -20.317 -34.188 1.00 14.80  ? 1   BQM B C17 1 
HETATM 2944 C C16 . BQM C 2 .   ? 16.152 -19.565 -34.758 1.00 14.81  ? 1   BQM B C16 1 
HETATM 2945 C C15 . BQM C 2 .   ? 16.648 -18.445 -34.091 1.00 15.07  ? 1   BQM B C15 1 
HETATM 2946 C C20 . BQM C 2 .   ? 17.903 -18.501 -30.453 1.00 14.13  ? 1   BQM B C20 1 
HETATM 2947 C C21 . BQM C 2 .   ? 18.720 -18.957 -29.420 1.00 14.45  ? 1   BQM B C21 1 
HETATM 2948 C C8  . BQM C 2 .   ? 19.516 -18.060 -28.710 1.00 15.29  ? 1   BQM B C8  1 
HETATM 2949 C C7  . BQM C 2 .   ? 20.393 -18.576 -27.623 1.00 15.09  ? 1   BQM B C7  1 
HETATM 2950 C C6  . BQM C 2 .   ? 20.619 -19.877 -27.414 1.00 14.64  ? 1   BQM B C6  1 
HETATM 2951 C C1  . BQM C 2 .   ? 21.541 -20.294 -26.337 1.00 14.78  ? 1   BQM B C1  1 
HETATM 2952 O O1  . BQM C 2 .   ? 22.306 -19.468 -25.879 1.00 13.50  ? 1   BQM B O1  1 
HETATM 2953 N N1  . BQM C 2 .   ? 21.540 -21.547 -25.875 1.00 16.16  ? 1   BQM B N1  1 
HETATM 2954 C C5  . BQM C 2 .   ? 22.437 -21.922 -24.780 1.00 17.76  ? 1   BQM B C5  1 
HETATM 2955 C C4  . BQM C 2 .   ? 23.345 -23.012 -25.333 1.00 17.56  ? 1   BQM B C4  1 
HETATM 2956 O O2  . BQM C 2 .   ? 22.534 -24.088 -25.820 1.00 19.61  ? 1   BQM B O2  1 
HETATM 2957 C C3  . BQM C 2 .   ? 21.626 -23.707 -26.858 1.00 18.11  ? 1   BQM B C3  1 
HETATM 2958 C C2  . BQM C 2 .   ? 20.676 -22.622 -26.352 1.00 16.80  ? 1   BQM B C2  1 
HETATM 2959 F F6  . BQM D 2 .   ? 17.454 -14.199 -6.443  1.00 13.63  ? 1   BQM C F6  1 
HETATM 2960 C C12 . BQM D 2 .   ? 18.567 -14.865 -6.192  1.00 14.24  ? 1   BQM C C12 1 
HETATM 2961 F F4  . BQM D 2 .   ? 19.613 -14.279 -6.698  1.00 11.47  ? 1   BQM C F4  1 
HETATM 2962 F F5  . BQM D 2 .   ? 18.572 -14.811 -4.868  1.00 12.30  ? 1   BQM C F5  1 
HETATM 2963 C C11 . BQM D 2 .   ? 18.438 -16.316 -6.618  1.00 14.52  ? 1   BQM C C11 1 
HETATM 2964 C C9  . BQM D 2 .   ? 17.547 -16.692 -7.638  1.00 14.43  ? 1   BQM C C9  1 
HETATM 2965 C C10 . BQM D 2 .   ? 16.828 -15.675 -8.494  1.00 14.99  ? 1   BQM C C10 1 
HETATM 2966 F F3  . BQM D 2 .   ? 15.635 -15.268 -8.130  1.00 15.67  ? 1   BQM C F3  1 
HETATM 2967 F F2  . BQM D 2 .   ? 17.617 -14.649 -8.664  1.00 14.23  ? 1   BQM C F2  1 
HETATM 2968 F F1  . BQM D 2 .   ? 16.817 -16.105 -9.737  1.00 14.50  ? 1   BQM C F1  1 
HETATM 2969 C C13 . BQM D 2 .   ? 19.140 -17.305 -5.909  1.00 14.45  ? 1   BQM C C13 1 
HETATM 2970 S S   . BQM D 2 .   ? 20.245 -16.946 -4.653  1.00 15.69  ? 1   BQM C S   1 
HETATM 2971 C C14 . BQM D 2 .   ? 20.775 -18.379 -3.880  1.00 14.60  ? 1   BQM C C14 1 
HETATM 2972 C C19 . BQM D 2 .   ? 21.785 -19.193 -4.402  1.00 14.67  ? 1   BQM C C19 1 
HETATM 2973 C C18 . BQM D 2 .   ? 22.167 -20.363 -3.724  1.00 15.51  ? 1   BQM C C18 1 
HETATM 2974 N N2  . BQM D 2 .   ? 23.148 -21.161 -4.213  1.00 16.13  ? 1   BQM C N2  1 
HETATM 2975 C C17 . BQM D 2 .   ? 21.547 -20.730 -2.534  1.00 14.60  ? 1   BQM C C17 1 
HETATM 2976 C C16 . BQM D 2 .   ? 20.546 -19.920 -2.012  1.00 14.33  ? 1   BQM C C16 1 
HETATM 2977 C C15 . BQM D 2 .   ? 20.164 -18.758 -2.684  1.00 15.41  ? 1   BQM C C15 1 
HETATM 2978 C C20 . BQM D 2 .   ? 18.973 -18.646 -6.250  1.00 15.08  ? 1   BQM C C20 1 
HETATM 2979 C C21 . BQM D 2 .   ? 18.115 -19.019 -7.282  1.00 14.83  ? 1   BQM C C21 1 
HETATM 2980 C C8  . BQM D 2 .   ? 17.419 -18.045 -7.979  1.00 14.40  ? 1   BQM C C8  1 
HETATM 2981 C C7  . BQM D 2 .   ? 16.496 -18.450 -9.060  1.00 14.92  ? 1   BQM C C7  1 
HETATM 2982 C C6  . BQM D 2 .   ? 16.057 -19.699 -9.212  1.00 15.18  ? 1   BQM C C6  1 
HETATM 2983 C C1  . BQM D 2 .   ? 15.101 -19.977 -10.305 1.00 14.72  ? 1   BQM C C1  1 
HETATM 2984 O O1  . BQM D 2 .   ? 14.453 -19.032 -10.718 1.00 15.94  ? 1   BQM C O1  1 
HETATM 2985 N N1  . BQM D 2 .   ? 14.955 -21.221 -10.793 1.00 15.74  ? 1   BQM C N1  1 
HETATM 2986 C C5  . BQM D 2 .   ? 14.011 -21.494 -11.897 1.00 16.24  ? 1   BQM C C5  1 
HETATM 2987 C C4  . BQM D 2 .   ? 13.043 -22.576 -11.425 1.00 15.92  ? 1   BQM C C4  1 
HETATM 2988 O O2  . BQM D 2 .   ? 13.765 -23.702 -10.919 1.00 16.75  ? 1   BQM C O2  1 
HETATM 2989 C C3  . BQM D 2 .   ? 14.682 -23.399 -9.864  1.00 15.22  ? 1   BQM C C3  1 
HETATM 2990 C C2  . BQM D 2 .   ? 15.721 -22.382 -10.324 1.00 15.26  ? 1   BQM C C2  1 
HETATM 2991 O O   . HOH E 3 .   ? 20.976 -12.310 -48.899 1.00 11.08  ? 310 HOH B O   1 
HETATM 2992 O O   . HOH E 3 .   ? 7.174  -16.012 -40.961 1.00 7.81   ? 311 HOH B O   1 
HETATM 2993 O O   . HOH E 3 .   ? 34.865 -15.651 -25.279 1.00 10.08  ? 312 HOH B O   1 
HETATM 2994 O O   . HOH E 3 .   ? 14.030 -11.443 -47.677 1.00 2.82   ? 313 HOH B O   1 
HETATM 2995 O O   . HOH E 3 .   ? 20.257 -21.069 -48.998 1.00 2.77   ? 314 HOH B O   1 
HETATM 2996 O O   . HOH E 3 .   ? 26.809 -18.860 -57.665 1.00 4.04   ? 315 HOH B O   1 
HETATM 2997 O O   . HOH E 3 .   ? 30.439 -10.312 -55.334 1.00 8.89   ? 316 HOH B O   1 
HETATM 2998 O O   . HOH E 3 .   ? 28.309 -11.387 -20.571 1.00 6.85   ? 317 HOH B O   1 
HETATM 2999 O O   . HOH E 3 .   ? 6.904  -13.237 -38.793 1.00 3.70   ? 318 HOH B O   1 
HETATM 3000 O O   . HOH E 3 .   ? 22.646 -12.138 -52.707 1.00 19.44  ? 319 HOH B O   1 
HETATM 3001 O O   . HOH E 3 .   ? 4.949  -20.773 -47.547 1.00 16.74  ? 320 HOH B O   1 
HETATM 3002 O O   . HOH E 3 .   ? 12.042 -16.425 -18.401 1.00 7.88   ? 321 HOH B O   1 
HETATM 3003 O O   . HOH E 3 .   ? 28.977 -7.935  -20.147 1.00 8.95   ? 322 HOH B O   1 
HETATM 3004 O O   . HOH E 3 .   ? 26.573 -6.773  -23.286 1.00 10.86  ? 323 HOH B O   1 
HETATM 3005 O O   . HOH E 3 .   ? 32.306 -3.354  -41.730 1.00 15.41  ? 324 HOH B O   1 
HETATM 3006 O O   . HOH E 3 .   ? 16.791 -15.556 -52.048 1.00 9.87   ? 325 HOH B O   1 
HETATM 3007 O O   . HOH E 3 .   ? 42.682 -12.679 -27.388 1.00 21.67  ? 326 HOH B O   1 
HETATM 3008 O O   . HOH E 3 .   ? 17.797 -27.535 -39.499 1.00 14.27  ? 328 HOH B O   1 
HETATM 3009 O O   . HOH E 3 .   ? 15.583 -4.632  -34.550 1.00 10.38  ? 329 HOH B O   1 
HETATM 3010 O O   . HOH E 3 .   ? 9.120  -23.539 -42.965 1.00 12.27  ? 330 HOH B O   1 
HETATM 3011 O O   . HOH E 3 .   ? 31.727 -15.132 -54.419 1.00 10.88  ? 331 HOH B O   1 
HETATM 3012 O O   . HOH E 3 .   ? 35.395 -19.686 -45.750 1.00 11.56  ? 332 HOH B O   1 
HETATM 3013 O O   . HOH E 3 .   ? 7.375  -13.674 -36.119 1.00 18.55  ? 333 HOH B O   1 
HETATM 3014 O O   . HOH E 3 .   ? 33.340 -27.515 -43.855 1.00 9.38   ? 334 HOH B O   1 
HETATM 3015 O O   . HOH E 3 .   ? 31.443 -8.774  -48.911 1.00 4.49   ? 335 HOH B O   1 
HETATM 3016 O O   . HOH E 3 .   ? 21.683 -17.428 -46.438 1.00 11.08  ? 336 HOH B O   1 
HETATM 3017 O O   . HOH E 3 .   ? 39.925 -12.611 -24.064 1.00 23.80  ? 337 HOH B O   1 
HETATM 3018 O O   . HOH E 3 .   ? 5.189  -22.457 -50.585 1.00 11.24  ? 338 HOH B O   1 
HETATM 3019 O O   . HOH E 3 .   ? 18.873 -5.113  -21.608 1.00 17.32  ? 339 HOH B O   1 
HETATM 3020 O O   . HOH E 3 .   ? 9.774  -10.158 -23.274 1.00 6.25   ? 340 HOH B O   1 
HETATM 3021 O O   . HOH E 3 .   ? 30.490 -11.792 -17.131 1.00 21.05  ? 341 HOH B O   1 
HETATM 3022 O O   . HOH E 3 .   ? 40.545 -18.033 -24.199 1.00 12.81  ? 342 HOH B O   1 
HETATM 3023 O O   . HOH E 3 .   ? 12.714 -8.327  -47.563 1.00 17.13  ? 343 HOH B O   1 
HETATM 3024 O O   . HOH E 3 .   ? 32.603 -25.934 -48.361 1.00 17.68  ? 344 HOH B O   1 
HETATM 3025 O O   . HOH E 3 .   ? 18.565 -5.301  -24.255 1.00 9.72   ? 345 HOH B O   1 
HETATM 3026 O O   . HOH E 3 .   ? 14.426 -17.074 -52.282 1.00 8.58   ? 346 HOH B O   1 
HETATM 3027 O O   . HOH E 3 .   ? 44.764 -18.474 -35.153 1.00 23.66  ? 347 HOH B O   1 
HETATM 3028 O O   . HOH E 3 .   ? 10.984 -20.769 -53.623 1.00 10.18  ? 348 HOH B O   1 
HETATM 3029 O O   . HOH E 3 .   ? 13.348 -4.524  -35.702 1.00 7.71   ? 349 HOH B O   1 
HETATM 3030 O O   . HOH E 3 .   ? 23.549 -4.181  -20.654 1.00 16.06  ? 350 HOH B O   1 
HETATM 3031 O O   . HOH E 3 .   ? 29.356 -17.596 -54.823 1.00 13.65  ? 351 HOH B O   1 
HETATM 3032 O O   . HOH E 3 .   ? 26.365 -0.353  -25.532 1.00 15.63  ? 352 HOH B O   1 
HETATM 3033 O O   . HOH E 3 .   ? 14.740 -6.123  -20.934 1.00 21.71  ? 353 HOH B O   1 
HETATM 3034 O O   . HOH E 3 .   ? 34.946 -21.718 -27.924 1.00 10.87  ? 354 HOH B O   1 
HETATM 3035 O O   . HOH E 3 .   ? 15.321 -5.765  -31.863 1.00 17.41  ? 355 HOH B O   1 
HETATM 3036 O O   . HOH E 3 .   ? 36.898 -22.137 -29.713 1.00 15.42  ? 356 HOH B O   1 
HETATM 3037 O O   . HOH E 3 .   ? 11.608 -23.653 -41.481 1.00 23.32  ? 357 HOH B O   1 
HETATM 3038 O O   . HOH E 3 .   ? 32.211 -1.937  -35.410 1.00 20.44  ? 358 HOH B O   1 
HETATM 3039 O O   . HOH E 3 .   ? 7.486  -3.980  -52.119 1.00 19.73  ? 359 HOH B O   1 
HETATM 3040 O O   . HOH E 3 .   ? 31.609 -19.143 -54.310 1.00 13.25  ? 360 HOH B O   1 
HETATM 3041 O O   . HOH E 3 .   ? 22.277 -30.858 -35.148 1.00 11.90  ? 361 HOH B O   1 
HETATM 3042 O O   . HOH E 3 .   ? 34.818 -24.339 -34.535 1.00 16.29  ? 362 HOH B O   1 
HETATM 3043 O O   . HOH E 3 .   ? 16.172 2.316   -45.350 1.00 16.17  ? 363 HOH B O   1 
HETATM 3044 O O   . HOH E 3 .   ? 18.236 -11.657 -50.445 1.00 6.62   ? 364 HOH B O   1 
HETATM 3045 O O   . HOH E 3 .   ? 17.841 -6.333  -18.019 1.00 16.07  ? 365 HOH B O   1 
HETATM 3046 O O   . HOH E 3 .   ? 16.015 1.026   -38.920 1.00 16.96  ? 366 HOH B O   1 
HETATM 3047 O O   . HOH E 3 .   ? 32.088 -24.858 -17.296 1.00 27.60  ? 367 HOH B O   1 
HETATM 3048 O O   . HOH E 3 .   ? 28.372 -9.022  -56.685 1.00 9.68   ? 368 HOH B O   1 
HETATM 3049 O O   . HOH E 3 .   ? 15.406 -1.370  -34.145 1.00 22.63  ? 369 HOH B O   1 
HETATM 3050 O O   . HOH E 3 .   ? 9.196  -12.530 -34.447 1.00 25.86  ? 370 HOH B O   1 
HETATM 3051 O O   . HOH E 3 .   ? 7.188  -6.952  -29.131 1.00 20.58  ? 371 HOH B O   1 
HETATM 3052 O O   . HOH E 3 .   ? 37.213 -24.595 -30.500 1.00 17.63  ? 372 HOH B O   1 
HETATM 3053 O O   . HOH E 3 .   ? 32.493 -24.144 -20.270 1.00 14.15  ? 373 HOH B O   1 
HETATM 3054 O O   . HOH E 3 .   ? 21.230 -28.506 -28.796 1.00 21.45  ? 374 HOH B O   1 
HETATM 3055 O O   . HOH E 3 .   ? 12.044 -22.478 -34.780 1.00 16.41  ? 375 HOH B O   1 
HETATM 3056 O O   . HOH E 3 .   ? 8.793  -20.844 -35.295 1.00 28.50  ? 376 HOH B O   1 
HETATM 3057 O O   . HOH E 3 .   ? 16.939 -24.124 -28.581 1.00 18.27  ? 377 HOH B O   1 
HETATM 3058 O O   . HOH E 3 .   ? 8.613  -14.272 -31.618 1.00 36.17  ? 378 HOH B O   1 
HETATM 3059 O O   . HOH E 3 .   ? 10.903 -28.464 -31.754 1.00 23.96  ? 379 HOH B O   1 
HETATM 3060 O O   . HOH E 3 .   ? 8.639  -19.663 -22.197 1.00 31.95  ? 380 HOH B O   1 
HETATM 3061 O O   . HOH E 3 .   ? 21.099 -36.535 -41.152 1.00 41.41  ? 381 HOH B O   1 
HETATM 3062 O O   . HOH E 3 .   ? 2.590  -13.765 -44.131 1.00 15.22  ? 382 HOH B O   1 
HETATM 3063 O O   . HOH E 3 .   ? 20.034 -1.491  -29.951 1.00 24.46  ? 383 HOH B O   1 
HETATM 3064 O O   . HOH E 3 .   ? 9.051  -16.908 -25.604 1.00 19.20  ? 384 HOH B O   1 
HETATM 3065 O O   . HOH E 3 .   ? 20.616 -1.186  -49.735 1.00 20.04  ? 385 HOH B O   1 
HETATM 3066 O O   . HOH E 3 .   ? 23.112 0.253   -46.074 1.00 23.38  ? 386 HOH B O   1 
HETATM 3067 O O   . HOH E 3 .   ? 7.043  -12.258 -28.813 1.00 36.27  ? 387 HOH B O   1 
HETATM 3068 O O   . HOH E 3 .   ? 12.302 1.978   -40.250 1.00 30.11  ? 388 HOH B O   1 
HETATM 3069 O O   . HOH E 3 .   ? 37.665 -6.006  -39.290 1.00 28.46  ? 389 HOH B O   1 
HETATM 3070 O O   . HOH E 3 .   ? 11.596 -5.784  -28.736 1.00 18.27  ? 390 HOH B O   1 
HETATM 3071 O O   . HOH E 3 .   ? 34.998 -16.954 -18.754 1.00 9.88   ? 391 HOH B O   1 
HETATM 3072 O O   . HOH E 3 .   ? 25.955 -8.024  -55.315 1.00 11.64  ? 392 HOH B O   1 
HETATM 3073 O O   . HOH E 3 .   ? 36.181 -3.962  -32.963 1.00 30.17  ? 393 HOH B O   1 
HETATM 3074 O O   . HOH E 3 .   ? 13.731 -26.322 -50.776 1.00 18.81  ? 394 HOH B O   1 
HETATM 3075 O O   . HOH E 3 .   ? 6.244  -5.351  -35.017 1.00 36.52  ? 395 HOH B O   1 
HETATM 3076 O O   . HOH E 3 .   ? 14.734 -22.707 -29.957 1.00 24.97  ? 396 HOH B O   1 
HETATM 3077 O O   . HOH E 3 .   ? 32.139 -19.238 -51.048 1.00 23.76  ? 397 HOH B O   1 
HETATM 3078 O O   . HOH E 3 .   ? 33.681 -2.805  -37.425 1.00 26.52  ? 398 HOH B O   1 
HETATM 3079 O O   . HOH E 3 .   ? 10.342 -24.856 -44.813 1.00 29.23  ? 399 HOH B O   1 
HETATM 3080 O O   . HOH E 3 .   ? 31.564 -14.680 -19.374 1.00 16.19  ? 400 HOH B O   1 
HETATM 3081 O O   . HOH E 3 .   ? 18.369 -27.288 -46.497 1.00 17.32  ? 401 HOH B O   1 
HETATM 3082 O O   . HOH E 3 .   ? 8.595  -19.752 -28.210 1.00 34.03  ? 402 HOH B O   1 
HETATM 3083 O O   . HOH E 3 .   ? 38.475 0.236   -28.384 1.00 42.73  ? 403 HOH B O   1 
HETATM 3084 O O   . HOH E 3 .   ? 12.058 -28.165 -50.839 1.00 21.07  ? 404 HOH B O   1 
HETATM 3085 O O   . HOH E 3 .   ? 17.972 -0.386  -52.779 1.00 24.25  ? 405 HOH B O   1 
HETATM 3086 O O   . HOH E 3 .   ? 24.243 -3.891  -17.841 1.00 33.11  ? 406 HOH B O   1 
HETATM 3087 O O   . HOH E 3 .   ? 34.900 -14.589 -50.571 1.00 21.34  ? 407 HOH B O   1 
HETATM 3088 O O   . HOH E 3 .   ? 30.707 -22.760 -53.785 1.00 21.15  ? 408 HOH B O   1 
HETATM 3089 O O   . HOH E 3 .   ? 26.226 1.229   -43.563 1.00 27.73  ? 409 HOH B O   1 
HETATM 3090 O O   . HOH E 3 .   ? 32.487 -3.596  -44.914 1.00 30.83  ? 410 HOH B O   1 
HETATM 3091 O O   . HOH E 3 .   ? 35.030 -22.383 -21.095 1.00 14.86  ? 411 HOH B O   1 
HETATM 3092 O O   . HOH E 3 .   ? 27.197 0.837   -37.214 1.00 32.11  ? 412 HOH B O   1 
HETATM 3093 O O   . HOH E 3 .   ? 23.445 -23.320 -52.144 1.00 18.04  ? 413 HOH B O   1 
HETATM 3094 O O   . HOH E 3 .   ? 26.087 -4.138  -22.050 1.00 27.44  ? 414 HOH B O   1 
HETATM 3095 O O   . HOH E 3 .   ? 12.081 -5.627  -24.245 1.00 43.00  ? 415 HOH B O   1 
HETATM 3096 O O   . HOH E 3 .   ? 9.663  -7.280  -24.333 1.00 51.93  ? 416 HOH B O   1 
HETATM 3097 O O   . HOH E 3 .   ? 11.189 -23.314 -38.845 1.00 15.06  ? 417 HOH B O   1 
HETATM 3098 O O   . HOH E 3 .   ? 7.853  -8.969  -22.284 1.00 35.22  ? 418 HOH B O   1 
HETATM 3099 O O   . HOH E 3 .   ? 5.976  -6.305  -39.517 1.00 15.00  ? 419 HOH B O   1 
HETATM 3100 O O   . HOH E 3 .   ? 38.111 -9.473  -40.179 1.00 16.78  ? 420 HOH B O   1 
HETATM 3101 O O   . HOH E 3 .   ? 16.878 -29.911 -28.359 1.00 19.38  ? 421 HOH B O   1 
HETATM 3102 O O   . HOH E 3 .   ? 23.069 -26.868 -24.560 1.00 47.99  ? 422 HOH B O   1 
HETATM 3103 O O   . HOH E 3 .   ? 32.933 -22.899 -48.205 1.00 25.61  ? 423 HOH B O   1 
HETATM 3104 O O   . HOH E 3 .   ? 9.706  -14.618 -52.610 1.00 22.57  ? 424 HOH B O   1 
HETATM 3105 O O   . HOH E 3 .   ? 4.256  -11.934 -39.146 1.00 47.12  ? 425 HOH B O   1 
HETATM 3106 O O   . HOH E 3 .   ? 27.119 -29.471 -45.021 1.00 30.06  ? 426 HOH B O   1 
HETATM 3107 O O   . HOH E 3 .   ? 6.485  -27.890 -50.819 1.00 25.86  ? 427 HOH B O   1 
HETATM 3108 O O   . HOH E 3 .   ? 38.468 0.282   -34.136 1.00 63.82  ? 428 HOH B O   1 
HETATM 3109 O O   . HOH E 3 .   ? 26.445 0.912   -32.750 1.00 27.32  ? 429 HOH B O   1 
HETATM 3110 O O   . HOH E 3 .   ? 15.486 -7.780  -47.769 1.00 22.49  ? 430 HOH B O   1 
HETATM 3111 O O   . HOH E 3 .   ? 4.779  -15.675 -47.109 1.00 144.98 ? 431 HOH B O   1 
HETATM 3112 O O   . HOH E 3 .   ? 30.958 -24.859 -55.969 1.00 44.61  ? 432 HOH B O   1 
HETATM 3113 O O   . HOH E 3 .   ? 30.534 -10.367 -19.389 1.00 23.87  ? 433 HOH B O   1 
HETATM 3114 O O   . HOH E 3 .   ? 24.955 1.273   -35.767 1.00 41.65  ? 434 HOH B O   1 
HETATM 3115 O O   . HOH E 3 .   ? 7.975  -4.882  -25.017 1.00 38.03  ? 435 HOH B O   1 
HETATM 3116 O O   . HOH E 3 .   ? 7.377  -3.894  -42.520 1.00 39.89  ? 436 HOH B O   1 
HETATM 3117 O O   . HOH E 3 .   ? 18.776 -26.679 -26.229 1.00 32.97  ? 437 HOH B O   1 
HETATM 3118 O O   . HOH E 3 .   ? 11.478 -6.822  -26.353 1.00 92.83  ? 438 HOH B O   1 
HETATM 3119 O O   . HOH E 3 .   ? 28.655 3.224   -26.422 1.00 16.26  ? 439 HOH B O   1 
HETATM 3120 O O   . HOH E 3 .   ? 4.281  -9.581  -40.149 1.00 41.10  ? 440 HOH B O   1 
HETATM 3121 O O   . HOH E 3 .   ? 26.429 0.421   -40.609 1.00 19.63  ? 441 HOH B O   1 
HETATM 3122 O O   . HOH E 3 .   ? 8.672  -28.090 -54.478 1.00 33.64  ? 442 HOH B O   1 
HETATM 3123 O O   . HOH E 3 .   ? 21.740 1.111   -24.309 1.00 31.77  ? 443 HOH B O   1 
HETATM 3124 O O   . HOH E 3 .   ? 12.720 -1.175  -45.757 1.00 29.94  ? 444 HOH B O   1 
HETATM 3125 O O   . HOH E 3 .   ? 44.393 -24.022 -26.328 1.00 20.56  ? 445 HOH B O   1 
HETATM 3126 O O   . HOH E 3 .   ? 6.032  -4.501  -44.625 1.00 53.10  ? 446 HOH B O   1 
HETATM 3127 O O   . HOH E 3 .   ? 7.136  -24.447 -41.159 1.00 28.51  ? 447 HOH B O   1 
HETATM 3128 O O   . HOH E 3 .   ? 20.508 -19.278 -54.257 1.00 26.62  ? 448 HOH B O   1 
HETATM 3129 O O   . HOH E 3 .   ? 18.820 -26.922 -50.772 1.00 28.19  ? 449 HOH B O   1 
HETATM 3130 O O   . HOH E 3 .   ? 11.676 -21.478 -40.201 1.00 118.79 ? 450 HOH B O   1 
HETATM 3131 O O   . HOH E 3 .   ? 6.458  -13.961 -26.573 1.00 52.71  ? 451 HOH B O   1 
HETATM 3132 O O   . HOH E 3 .   ? 25.921 -3.587  -54.705 1.00 22.14  ? 452 HOH B O   1 
HETATM 3133 O O   . HOH E 3 .   ? 21.376 -1.729  -45.742 1.00 250.69 ? 453 HOH B O   1 
HETATM 3134 O O   . HOH E 3 .   ? 12.249 -17.510 -52.413 1.00 155.22 ? 454 HOH B O   1 
HETATM 3135 O O   . HOH E 3 .   ? 26.011 -1.736  -22.966 1.00 25.98  ? 455 HOH B O   1 
HETATM 3136 O O   . HOH E 3 .   ? 17.794 -2.767  -25.750 1.00 35.53  ? 456 HOH B O   1 
HETATM 3137 O O   . HOH E 3 .   ? 14.878 -4.056  -22.654 1.00 30.44  ? 457 HOH B O   1 
HETATM 3138 O O   . HOH E 3 .   ? 14.547 1.355   -37.079 1.00 29.78  ? 458 HOH B O   1 
HETATM 3139 O O   . HOH E 3 .   ? 12.879 -3.760  -48.770 1.00 53.93  ? 459 HOH B O   1 
HETATM 3140 O O   . HOH E 3 .   ? 9.705  -23.100 -27.794 1.00 28.33  ? 460 HOH B O   1 
HETATM 3141 O O   . HOH E 3 .   ? 8.498  -7.607  -45.957 1.00 24.46  ? 461 HOH B O   1 
HETATM 3142 O O   . HOH E 3 .   ? 25.456 3.566   -25.282 1.00 23.34  ? 462 HOH B O   1 
HETATM 3143 O O   . HOH E 3 .   ? 16.427 -27.521 -49.944 1.00 20.23  ? 463 HOH B O   1 
HETATM 3144 O O   . HOH E 3 .   ? 34.976 -22.473 -47.167 1.00 23.48  ? 464 HOH B O   1 
HETATM 3145 O O   . HOH E 3 .   ? 3.924  -7.615  -41.769 1.00 40.20  ? 465 HOH B O   1 
HETATM 3146 O O   . HOH E 3 .   ? 37.640 -8.972  -17.802 1.00 23.25  ? 466 HOH B O   1 
HETATM 3147 O O   . HOH E 3 .   ? 18.015 -0.852  -23.590 1.00 35.53  ? 467 HOH B O   1 
HETATM 3148 O O   . HOH E 3 .   ? 29.605 -2.115  -52.135 1.00 31.42  ? 468 HOH B O   1 
HETATM 3149 O O   . HOH E 3 .   ? 2.429  -9.515  -38.238 1.00 36.81  ? 469 HOH B O   1 
HETATM 3150 O O   . HOH F 3 .   ? 5.706  -16.879 18.230  1.00 17.04  ? 327 HOH C O   1 
HETATM 3151 O O   . HOH F 3 .   ? 23.465 -5.613  -2.077  1.00 5.78   ? 328 HOH C O   1 
HETATM 3152 O O   . HOH F 3 .   ? 9.815  -10.363 -15.922 1.00 6.94   ? 329 HOH C O   1 
HETATM 3153 O O   . HOH F 3 .   ? 30.265 -18.522 4.639   1.00 14.70  ? 330 HOH C O   1 
HETATM 3154 O O   . HOH F 3 .   ? -1.653 -6.598  -12.775 1.00 5.23   ? 331 HOH C O   1 
HETATM 3155 O O   . HOH F 3 .   ? 20.435 -5.663  -12.506 1.00 4.62   ? 332 HOH C O   1 
HETATM 3156 O O   . HOH F 3 .   ? 27.121 -9.502  10.883  1.00 16.27  ? 333 HOH C O   1 
HETATM 3157 O O   . HOH F 3 .   ? 20.172 -31.168 2.754   1.00 11.21  ? 334 HOH C O   1 
HETATM 3158 O O   . HOH F 3 .   ? 25.341 -17.305 -18.070 1.00 18.43  ? 335 HOH C O   1 
HETATM 3159 O O   . HOH F 3 .   ? 24.183 -12.465 11.153  1.00 5.05   ? 336 HOH C O   1 
HETATM 3160 O O   . HOH F 3 .   ? 10.238 -17.478 21.178  1.00 6.85   ? 337 HOH C O   1 
HETATM 3161 O O   . HOH F 3 .   ? 17.161 -11.977 12.243  1.00 8.24   ? 338 HOH C O   1 
HETATM 3162 O O   . HOH F 3 .   ? 16.381 -20.857 12.686  1.00 6.91   ? 339 HOH C O   1 
HETATM 3163 O O   . HOH F 3 .   ? 19.245 -1.159  12.927  1.00 6.53   ? 340 HOH C O   1 
HETATM 3164 O O   . HOH F 3 .   ? 16.735 0.821   3.454   1.00 10.73  ? 341 HOH C O   1 
HETATM 3165 O O   . HOH F 3 .   ? 24.684 -24.858 5.454   1.00 9.62   ? 342 HOH C O   1 
HETATM 3166 O O   . HOH F 3 .   ? 25.897 -5.770  -0.964  1.00 11.03  ? 343 HOH C O   1 
HETATM 3167 O O   . HOH F 3 .   ? 7.884  -15.493 18.457  1.00 11.65  ? 344 HOH C O   1 
HETATM 3168 O O   . HOH F 3 .   ? 13.169 1.859   -0.069  1.00 9.82   ? 345 HOH C O   1 
HETATM 3169 O O   . HOH F 3 .   ? 7.009  -0.150  -1.353  1.00 13.80  ? 346 HOH C O   1 
HETATM 3170 O O   . HOH F 3 .   ? 14.043 1.171   3.697   1.00 10.06  ? 347 HOH C O   1 
HETATM 3171 O O   . HOH F 3 .   ? 17.000 0.536   8.829   1.00 9.84   ? 348 HOH C O   1 
HETATM 3172 O O   . HOH F 3 .   ? 0.632  -7.114  4.045   1.00 6.73   ? 349 HOH C O   1 
HETATM 3173 O O   . HOH F 3 .   ? 9.441  -6.862  -16.374 1.00 8.86   ? 350 HOH C O   1 
HETATM 3174 O O   . HOH F 3 .   ? 23.656 -7.036  -4.583  1.00 16.38  ? 351 HOH C O   1 
HETATM 3175 O O   . HOH F 3 .   ? 8.186  -8.379  18.802  1.00 9.61   ? 352 HOH C O   1 
HETATM 3176 O O   . HOH F 3 .   ? 17.163 -31.706 -5.663  1.00 12.95  ? 353 HOH C O   1 
HETATM 3177 O O   . HOH F 3 .   ? 15.738 -17.156 9.898   1.00 16.68  ? 354 HOH C O   1 
HETATM 3178 O O   . HOH F 3 .   ? 20.774 -6.676  -18.627 1.00 11.26  ? 355 HOH C O   1 
HETATM 3179 O O   . HOH F 3 .   ? 31.691 -12.694 16.096  1.00 12.13  ? 356 HOH C O   1 
HETATM 3180 O O   . HOH F 3 .   ? 7.269  -8.882  -16.991 1.00 23.80  ? 357 HOH C O   1 
HETATM 3181 O O   . HOH F 3 .   ? 18.664 -2.065  15.449  1.00 16.14  ? 358 HOH C O   1 
HETATM 3182 O O   . HOH F 3 .   ? 28.224 -11.712 -13.227 1.00 13.98  ? 359 HOH C O   1 
HETATM 3183 O O   . HOH F 3 .   ? 0.062  -19.608 -6.549  1.00 15.64  ? 360 HOH C O   1 
HETATM 3184 O O   . HOH F 3 .   ? 11.957 -5.897  -13.024 1.00 15.05  ? 361 HOH C O   1 
HETATM 3185 O O   . HOH F 3 .   ? 1.131  -11.850 -4.678  1.00 16.73  ? 362 HOH C O   1 
HETATM 3186 O O   . HOH F 3 .   ? 12.237 2.659   2.104   1.00 14.86  ? 363 HOH C O   1 
HETATM 3187 O O   . HOH F 3 .   ? 2.621  -25.343 7.350   1.00 17.54  ? 364 HOH C O   1 
HETATM 3188 O O   . HOH F 3 .   ? 13.428 -30.509 -1.404  1.00 9.66   ? 365 HOH C O   1 
HETATM 3189 O O   . HOH F 3 .   ? 7.427  -6.863  12.484  1.00 9.37   ? 366 HOH C O   1 
HETATM 3190 O O   . HOH F 3 .   ? 17.901 -27.796 2.827   1.00 10.52  ? 367 HOH C O   1 
HETATM 3191 O O   . HOH F 3 .   ? 6.458  -10.631 19.773  1.00 16.01  ? 368 HOH C O   1 
HETATM 3192 O O   . HOH F 3 .   ? 23.853 -6.910  -15.587 1.00 17.43  ? 369 HOH C O   1 
HETATM 3193 O O   . HOH F 3 .   ? 17.319 -14.334 15.836  1.00 11.99  ? 370 HOH C O   1 
HETATM 3194 O O   . HOH F 3 .   ? 31.718 -23.488 10.810  1.00 16.75  ? 371 HOH C O   1 
HETATM 3195 O O   . HOH F 3 .   ? -1.079 -17.756 -16.695 1.00 25.51  ? 372 HOH C O   1 
HETATM 3196 O O   . HOH F 3 .   ? 3.142  -12.064 14.589  1.00 20.74  ? 373 HOH C O   1 
HETATM 3197 O O   . HOH F 3 .   ? 23.960 -30.678 0.836   1.00 21.07  ? 374 HOH C O   1 
HETATM 3198 O O   . HOH F 3 .   ? 20.004 -11.772 13.757  1.00 5.62   ? 375 HOH C O   1 
HETATM 3199 O O   . HOH F 3 .   ? 8.793  -28.471 8.481   1.00 19.34  ? 376 HOH C O   1 
HETATM 3200 O O   . HOH F 3 .   ? 2.203  -14.706 -17.883 1.00 9.56   ? 377 HOH C O   1 
HETATM 3201 O O   . HOH F 3 .   ? 5.972  -13.065 -17.048 1.00 13.41  ? 378 HOH C O   1 
HETATM 3202 O O   . HOH F 3 .   ? 1.779  -17.426 9.303   1.00 13.37  ? 379 HOH C O   1 
HETATM 3203 O O   . HOH F 3 .   ? 18.516 -34.071 -5.786  1.00 19.43  ? 380 HOH C O   1 
HETATM 3204 O O   . HOH F 3 .   ? -9.687 -13.165 0.618   1.00 22.98  ? 381 HOH C O   1 
HETATM 3205 O O   . HOH F 3 .   ? 25.978 -26.839 8.960   1.00 19.31  ? 382 HOH C O   1 
HETATM 3206 O O   . HOH F 3 .   ? 9.723  -25.753 15.365  1.00 20.84  ? 383 HOH C O   1 
HETATM 3207 O O   . HOH F 3 .   ? 30.987 -24.848 14.212  1.00 15.26  ? 384 HOH C O   1 
HETATM 3208 O O   . HOH F 3 .   ? -2.664 -5.160  -5.890  1.00 37.66  ? 385 HOH C O   1 
HETATM 3209 O O   . HOH F 3 .   ? 23.017 -17.562 15.996  1.00 14.48  ? 386 HOH C O   1 
HETATM 3210 O O   . HOH F 3 .   ? 4.142  -11.552 -15.855 1.00 11.55  ? 387 HOH C O   1 
HETATM 3211 O O   . HOH F 3 .   ? 14.364 -32.298 -5.477  1.00 25.54  ? 388 HOH C O   1 
HETATM 3212 O O   . HOH F 3 .   ? 5.088  -1.363  0.427   1.00 11.42  ? 389 HOH C O   1 
HETATM 3213 O O   . HOH F 3 .   ? 3.755  -24.183 11.861  1.00 16.32  ? 390 HOH C O   1 
HETATM 3214 O O   . HOH F 3 .   ? 7.282  -6.814  -20.192 1.00 19.88  ? 391 HOH C O   1 
HETATM 3215 O O   . HOH F 3 .   ? 17.715 -30.132 -7.785  1.00 14.93  ? 392 HOH C O   1 
HETATM 3216 O O   . HOH F 3 .   ? 4.246  -20.878 11.611  1.00 27.35  ? 393 HOH C O   1 
HETATM 3217 O O   . HOH F 3 .   ? 1.925  -19.583 -8.301  1.00 18.44  ? 394 HOH C O   1 
HETATM 3218 O O   . HOH F 3 .   ? 24.179 1.148   8.831   1.00 16.55  ? 395 HOH C O   1 
HETATM 3219 O O   . HOH F 3 .   ? 3.382  -0.072  1.797   1.00 22.74  ? 396 HOH C O   1 
HETATM 3220 O O   . HOH F 3 .   ? 4.181  -22.394 -16.511 1.00 17.70  ? 397 HOH C O   1 
HETATM 3221 O O   . HOH F 3 .   ? 24.492 -29.270 -4.968  1.00 20.61  ? 398 HOH C O   1 
HETATM 3222 O O   . HOH F 3 .   ? 23.956 0.161   1.387   1.00 26.83  ? 399 HOH C O   1 
HETATM 3223 O O   . HOH F 3 .   ? 5.151  -27.064 16.574  1.00 33.46  ? 400 HOH C O   1 
HETATM 3224 O O   . HOH F 3 .   ? 12.844 -6.882  18.965  1.00 10.68  ? 401 HOH C O   1 
HETATM 3225 O O   . HOH F 3 .   ? 7.091  -1.796  5.241   1.00 14.30  ? 402 HOH C O   1 
HETATM 3226 O O   . HOH F 3 .   ? 19.772 -5.193  -15.237 1.00 12.49  ? 403 HOH C O   1 
HETATM 3227 O O   . HOH F 3 .   ? 23.359 -8.038  11.139  1.00 11.79  ? 404 HOH C O   1 
HETATM 3228 O O   . HOH F 3 .   ? 12.816 1.446   -3.586  1.00 10.16  ? 405 HOH C O   1 
HETATM 3229 O O   . HOH F 3 .   ? 1.837  -21.690 -9.319  1.00 19.58  ? 406 HOH C O   1 
HETATM 3230 O O   . HOH F 3 .   ? 7.852  -2.397  13.520  1.00 16.77  ? 407 HOH C O   1 
HETATM 3231 O O   . HOH F 3 .   ? 6.071  2.111   -14.138 1.00 22.71  ? 408 HOH C O   1 
HETATM 3232 O O   . HOH F 3 .   ? 7.299  -10.334 -19.397 1.00 20.62  ? 409 HOH C O   1 
HETATM 3233 O O   . HOH F 3 .   ? 15.674 1.453   -0.707  1.00 31.82  ? 410 HOH C O   1 
HETATM 3234 O O   . HOH F 3 .   ? 10.521 -7.620  20.035  1.00 16.98  ? 411 HOH C O   1 
HETATM 3235 O O   . HOH F 3 .   ? 19.583 -24.073 -8.319  1.00 18.20  ? 412 HOH C O   1 
HETATM 3236 O O   . HOH F 3 .   ? 24.426 -23.314 -1.839  1.00 28.24  ? 413 HOH C O   1 
HETATM 3237 O O   . HOH F 3 .   ? 7.054  -23.187 -14.830 1.00 22.43  ? 414 HOH C O   1 
HETATM 3238 O O   . HOH F 3 .   ? 4.308  -16.015 -19.862 1.00 44.19  ? 415 HOH C O   1 
HETATM 3239 O O   . HOH F 3 .   ? -2.316 -20.408 -15.024 1.00 36.75  ? 416 HOH C O   1 
HETATM 3240 O O   . HOH F 3 .   ? 6.214  -10.352 -15.183 1.00 16.71  ? 417 HOH C O   1 
HETATM 3241 O O   . HOH F 3 .   ? 30.234 -25.051 9.074   1.00 15.87  ? 418 HOH C O   1 
HETATM 3242 O O   . HOH F 3 .   ? -3.724 -12.580 0.925   1.00 24.11  ? 419 HOH C O   1 
HETATM 3243 O O   . HOH F 3 .   ? 30.264 -13.154 9.573   1.00 15.70  ? 420 HOH C O   1 
HETATM 3244 O O   . HOH F 3 .   ? -0.878 -7.677  -1.928  1.00 47.74  ? 421 HOH C O   1 
HETATM 3245 O O   . HOH F 3 .   ? 5.595  -25.073 -7.782  1.00 19.54  ? 422 HOH C O   1 
HETATM 3246 O O   . HOH F 3 .   ? 10.172 -4.248  -17.579 1.00 27.64  ? 423 HOH C O   1 
HETATM 3247 O O   . HOH F 3 .   ? 26.923 -21.826 1.887   1.00 17.85  ? 424 HOH C O   1 
HETATM 3248 O O   . HOH F 3 .   ? 4.576  -20.210 14.346  1.00 17.30  ? 425 HOH C O   1 
HETATM 3249 O O   . HOH F 3 .   ? 28.078 -18.881 -10.831 1.00 15.95  ? 426 HOH C O   1 
HETATM 3250 O O   . HOH F 3 .   ? 9.059  6.847   -0.508  1.00 32.78  ? 427 HOH C O   1 
HETATM 3251 O O   . HOH F 3 .   ? 25.318 -22.263 17.191  1.00 22.59  ? 428 HOH C O   1 
HETATM 3252 O O   . HOH F 3 .   ? 11.688 -30.060 1.975   1.00 29.87  ? 429 HOH C O   1 
HETATM 3253 O O   . HOH F 3 .   ? 6.294  -12.692 18.012  1.00 19.13  ? 430 HOH C O   1 
HETATM 3254 O O   . HOH F 3 .   ? 2.844  -26.418 -11.367 1.00 34.43  ? 431 HOH C O   1 
HETATM 3255 O O   . HOH F 3 .   ? 23.288 -2.066  -6.213  1.00 28.96  ? 432 HOH C O   1 
HETATM 3256 O O   . HOH F 3 .   ? 17.631 1.054   -13.137 1.00 31.47  ? 433 HOH C O   1 
HETATM 3257 O O   . HOH F 3 .   ? 7.779  -30.917 8.034   1.00 37.94  ? 434 HOH C O   1 
HETATM 3258 O O   . HOH F 3 .   ? 29.950 -0.960  2.067   1.00 46.73  ? 435 HOH C O   1 
HETATM 3259 O O   . HOH F 3 .   ? 4.255  -20.024 -9.271  1.00 113.60 ? 436 HOH C O   1 
HETATM 3260 O O   . HOH F 3 .   ? 13.026 -22.162 16.353  1.00 29.41  ? 437 HOH C O   1 
HETATM 3261 O O   . HOH F 3 .   ? 25.312 1.153   11.338  1.00 19.43  ? 438 HOH C O   1 
HETATM 3262 O O   . HOH F 3 .   ? 27.469 -3.956  6.027   1.00 32.33  ? 439 HOH C O   1 
HETATM 3263 O O   . HOH F 3 .   ? 27.079 -1.873  9.521   1.00 24.41  ? 440 HOH C O   1 
HETATM 3264 O O   . HOH F 3 .   ? 3.834  -27.442 -6.415  1.00 36.77  ? 441 HOH C O   1 
HETATM 3265 O O   . HOH F 3 .   ? 27.454 -25.625 6.789   1.00 26.51  ? 442 HOH C O   1 
HETATM 3266 O O   . HOH F 3 .   ? 18.972 -11.220 -18.305 1.00 15.55  ? 443 HOH C O   1 
HETATM 3267 O O   . HOH F 3 .   ? -0.559 -16.491 8.328   1.00 44.73  ? 444 HOH C O   1 
HETATM 3268 O O   . HOH F 3 .   ? 12.429 -6.054  -6.450  1.00 20.90  ? 445 HOH C O   1 
HETATM 3269 O O   . HOH F 3 .   ? 24.864 -24.821 2.437   1.00 37.46  ? 446 HOH C O   1 
HETATM 3270 O O   . HOH F 3 .   ? 10.524 8.076   -2.547  1.00 29.80  ? 447 HOH C O   1 
HETATM 3271 O O   . HOH F 3 .   ? 17.173 -22.682 16.334  1.00 25.10  ? 448 HOH C O   1 
HETATM 3272 O O   . HOH F 3 .   ? 16.730 -18.500 17.787  1.00 21.49  ? 449 HOH C O   1 
HETATM 3273 O O   . HOH F 3 .   ? 32.647 -11.523 -7.439  1.00 17.04  ? 450 HOH C O   1 
HETATM 3274 O O   . HOH F 3 .   ? 34.145 -15.494 8.335   1.00 23.68  ? 451 HOH C O   1 
HETATM 3275 O O   . HOH F 3 .   ? 16.973 -27.087 14.052  1.00 31.57  ? 452 HOH C O   1 
HETATM 3276 O O   . HOH F 3 .   ? 22.009 -17.332 13.571  1.00 248.75 ? 453 HOH C O   1 
HETATM 3277 O O   . HOH F 3 .   ? 22.185 -7.747  -6.367  1.00 69.16  ? 454 HOH C O   1 
HETATM 3278 O O   . HOH F 3 .   ? 5.839  -20.040 -25.125 1.00 33.85  ? 455 HOH C O   1 
HETATM 3279 O O   . HOH F 3 .   ? 23.879 -16.261 3.018   1.00 229.59 ? 456 HOH C O   1 
HETATM 3280 O O   . HOH F 3 .   ? 1.054  -21.829 -2.176  1.00 20.94  ? 457 HOH C O   1 
HETATM 3281 O O   . HOH F 3 .   ? 32.945 -8.263  3.051   1.00 28.25  ? 458 HOH C O   1 
HETATM 3282 O O   . HOH F 3 .   ? 19.142 0.577   -15.383 1.00 55.53  ? 459 HOH C O   1 
HETATM 3283 O O   . HOH F 3 .   ? 0.988  0.147   -15.850 0.50 18.38  ? 460 HOH C O   1 
HETATM 3284 O O   . HOH F 3 .   ? 16.351 1.927   7.020   1.00 17.72  ? 461 HOH C O   1 
HETATM 3285 O O   . HOH F 3 .   ? 27.145 -9.105  8.573   1.00 36.29  ? 462 HOH C O   1 
HETATM 3286 O O   . HOH F 3 .   ? 14.473 -28.678 15.558  1.00 34.50  ? 463 HOH C O   1 
HETATM 3287 O O   . HOH F 3 .   ? 3.872  -18.290 -24.468 1.00 24.14  ? 464 HOH C O   1 
HETATM 3288 O O   . HOH F 3 .   ? 23.157 -20.606 8.969   1.00 256.38 ? 465 HOH C O   1 
HETATM 3289 O O   . HOH F 3 .   ? 3.069  -8.699  -18.409 1.00 23.51  ? 466 HOH C O   1 
HETATM 3290 O O   . HOH F 3 .   ? 6.127  -21.969 7.136   1.00 54.83  ? 467 HOH C O   1 
HETATM 3291 O O   . HOH F 3 .   ? 26.990 -16.484 16.012  1.00 64.49  ? 468 HOH C O   1 
HETATM 3292 O O   . HOH F 3 .   ? 8.226  -12.191 16.770  1.00 250.30 ? 469 HOH C O   1 
HETATM 3293 O O   . HOH F 3 .   ? 11.070 -28.502 6.750   1.00 23.60  ? 470 HOH C O   1 
HETATM 3294 O O   . HOH F 3 .   ? 31.651 -27.455 9.193   1.00 34.87  ? 471 HOH C O   1 
HETATM 3295 O O   . HOH F 3 .   ? 32.083 -7.406  -1.977  1.00 33.29  ? 472 HOH C O   1 
HETATM 3296 O O   . HOH F 3 .   ? 5.773  3.527   4.336   1.00 32.26  ? 473 HOH C O   1 
HETATM 3297 O O   . HOH F 3 .   ? 10.313 -3.602  -22.105 1.00 40.60  ? 474 HOH C O   1 
HETATM 3298 O O   . HOH F 3 .   ? 7.607  -2.455  -1.128  1.00 163.64 ? 475 HOH C O   1 
HETATM 3299 O O   . HOH F 3 .   ? -1.003 -3.705  -16.975 1.00 34.17  ? 476 HOH C O   1 
HETATM 3300 O O   . HOH F 3 .   ? 26.060 -5.663  12.197  1.00 14.82  ? 477 HOH C O   1 
HETATM 3301 O O   . HOH F 3 .   ? 9.800  -28.080 11.688  1.00 32.73  ? 478 HOH C O   1 
HETATM 3302 O O   . HOH F 3 .   ? 4.840  2.102   -4.957  1.00 53.01  ? 479 HOH C O   1 
HETATM 3303 O O   . HOH F 3 .   ? 0.461  -28.056 10.732  1.00 34.56  ? 480 HOH C O   1 
HETATM 3304 O O   . HOH F 3 .   ? 32.654 -6.277  5.171   1.00 37.51  ? 481 HOH C O   1 
HETATM 3305 O O   . HOH F 3 .   ? 12.580 -28.291 4.497   1.00 27.63  ? 482 HOH C O   1 
HETATM 3306 O O   . HOH F 3 .   ? 15.367 -26.450 -24.691 1.00 28.03  ? 483 HOH C O   1 
HETATM 3307 O O   . HOH F 3 .   ? 11.541 -27.853 13.799  1.00 36.74  ? 484 HOH C O   1 
HETATM 3308 O O   . HOH F 3 .   ? 7.351  -27.109 -8.781  1.00 22.08  ? 485 HOH C O   1 
HETATM 3309 O O   . HOH F 3 .   ? 14.800 -23.602 -3.632  1.00 245.00 ? 486 HOH C O   1 
HETATM 3310 O O   . HOH F 3 .   ? 30.103 -15.210 11.912  1.00 57.57  ? 487 HOH C O   1 
HETATM 3311 O O   . HOH F 3 .   ? 19.146 -8.604  -18.300 1.00 156.40 ? 488 HOH C O   1 
HETATM 3312 O O   . HOH F 3 .   ? -3.824 -17.622 5.597   1.00 65.72  ? 489 HOH C O   1 
HETATM 3313 O O   . HOH F 3 .   ? 12.488 -23.556 -15.611 1.00 20.13  ? 490 HOH C O   1 
HETATM 3314 O O   . HOH F 3 .   ? 26.909 -29.177 7.456   1.00 37.48  ? 491 HOH C O   1 
HETATM 3315 O O   . HOH F 3 .   ? 34.256 -17.546 -11.067 1.00 49.50  ? 492 HOH C O   1 
HETATM 3316 O O   . HOH F 3 .   ? 6.746  5.953   1.679   1.00 33.84  ? 493 HOH C O   1 
HETATM 3317 O O   . HOH F 3 .   ? 30.314 -15.041 15.033  1.00 15.88  ? 494 HOH C O   1 
HETATM 3318 O O   . HOH F 3 .   ? 4.329  -11.380 -20.442 1.00 40.50  ? 495 HOH C O   1 
HETATM 3319 O O   . HOH F 3 .   ? 18.894 -28.182 13.262  1.00 29.11  ? 496 HOH C O   1 
HETATM 3320 O O   . HOH F 3 .   ? 25.401 -28.588 4.686   1.00 32.93  ? 497 HOH C O   1 
HETATM 3321 O O   . HOH F 3 .   ? 5.628  -16.660 -22.949 1.00 27.95  ? 498 HOH C O   1 
HETATM 3322 O O   . HOH F 3 .   ? 24.265 -20.262 -7.132  1.00 37.86  ? 499 HOH C O   1 
HETATM 3323 O O   . HOH F 3 .   ? 21.978 -23.286 -6.583  1.00 31.69  ? 500 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   128 128 GLY GLY B . n 
A 1 2   ASN 2   129 129 ASN ASN B . n 
A 1 3   VAL 3   130 130 VAL VAL B . n 
A 1 4   ASP 4   131 131 ASP ASP B . n 
A 1 5   LEU 5   132 132 LEU LEU B . n 
A 1 6   VAL 6   133 133 VAL VAL B . n 
A 1 7   PHE 7   134 134 PHE PHE B . n 
A 1 8   LEU 8   135 135 LEU LEU B . n 
A 1 9   PHE 9   136 136 PHE PHE B . n 
A 1 10  ASP 10  137 137 ASP ASP B . n 
A 1 11  GLY 11  138 138 GLY GLY B . n 
A 1 12  SER 12  139 139 SER SER B . n 
A 1 13  MET 13  140 140 MET MET B . n 
A 1 14  SER 14  141 141 SER SER B . n 
A 1 15  LEU 15  142 142 LEU LEU B . n 
A 1 16  GLN 16  143 143 GLN GLN B . n 
A 1 17  PRO 17  144 144 PRO PRO B . n 
A 1 18  ASP 18  145 145 ASP ASP B . n 
A 1 19  GLU 19  146 146 GLU GLU B . n 
A 1 20  PHE 20  147 147 PHE PHE B . n 
A 1 21  GLN 21  148 148 GLN GLN B . n 
A 1 22  LYS 22  149 149 LYS LYS B . n 
A 1 23  ILE 23  150 150 ILE ILE B . n 
A 1 24  LEU 24  151 151 LEU LEU B . n 
A 1 25  ASP 25  152 152 ASP ASP B . n 
A 1 26  PHE 26  153 153 PHE PHE B . n 
A 1 27  MET 27  154 154 MET MET B . n 
A 1 28  LYS 28  155 155 LYS LYS B . n 
A 1 29  ASP 29  156 156 ASP ASP B . n 
A 1 30  VAL 30  157 157 VAL VAL B . n 
A 1 31  MET 31  158 158 MET MET B . n 
A 1 32  LYS 32  159 159 LYS LYS B . n 
A 1 33  LYS 33  160 160 LYS LYS B . n 
A 1 34  LEU 34  161 161 LEU LEU B . n 
A 1 35  SER 35  162 162 SER SER B . n 
A 1 36  ASN 36  163 163 ASN ASN B . n 
A 1 37  THR 37  164 164 THR THR B . n 
A 1 38  SER 38  165 165 SER SER B . n 
A 1 39  TYR 39  166 166 TYR TYR B . n 
A 1 40  GLN 40  167 167 GLN GLN B . n 
A 1 41  PHE 41  168 168 PHE PHE B . n 
A 1 42  ALA 42  169 169 ALA ALA B . n 
A 1 43  ALA 43  170 170 ALA ALA B . n 
A 1 44  VAL 44  171 171 VAL VAL B . n 
A 1 45  GLN 45  172 172 GLN GLN B . n 
A 1 46  PHE 46  173 173 PHE PHE B . n 
A 1 47  SER 47  174 174 SER SER B . n 
A 1 48  THR 48  175 175 THR THR B . n 
A 1 49  SER 49  176 176 SER SER B . n 
A 1 50  TYR 50  177 177 TYR TYR B . n 
A 1 51  LYS 51  178 178 LYS LYS B . n 
A 1 52  THR 52  179 179 THR THR B . n 
A 1 53  GLU 53  180 180 GLU GLU B . n 
A 1 54  PHE 54  181 181 PHE PHE B . n 
A 1 55  ASP 55  182 182 ASP ASP B . n 
A 1 56  PHE 56  183 183 PHE PHE B . n 
A 1 57  SER 57  184 184 SER SER B . n 
A 1 58  ASP 58  185 185 ASP ASP B . n 
A 1 59  TYR 59  186 186 TYR TYR B . n 
A 1 60  VAL 60  187 187 VAL VAL B . n 
A 1 61  LYS 61  188 188 LYS LYS B . n 
A 1 62  TRP 62  189 189 TRP TRP B . n 
A 1 63  LYS 63  190 190 LYS LYS B . n 
A 1 64  ASP 64  191 191 ASP ASP B . n 
A 1 65  PRO 65  192 192 PRO PRO B . n 
A 1 66  ASP 66  193 193 ASP ASP B . n 
A 1 67  ALA 67  194 194 ALA ALA B . n 
A 1 68  LEU 68  195 195 LEU LEU B . n 
A 1 69  LEU 69  196 196 LEU LEU B . n 
A 1 70  LYS 70  197 197 LYS LYS B . n 
A 1 71  HIS 71  198 198 HIS HIS B . n 
A 1 72  VAL 72  199 199 VAL VAL B . n 
A 1 73  LYS 73  200 200 LYS LYS B . n 
A 1 74  HIS 74  201 201 HIS HIS B . n 
A 1 75  MET 75  202 202 MET MET B . n 
A 1 76  LEU 76  203 203 LEU LEU B . n 
A 1 77  LEU 77  204 204 LEU LEU B . n 
A 1 78  LEU 78  205 205 LEU LEU B . n 
A 1 79  THR 79  206 206 THR THR B . n 
A 1 80  ASN 80  207 207 ASN ASN B . n 
A 1 81  THR 81  208 208 THR THR B . n 
A 1 82  PHE 82  209 209 PHE PHE B . n 
A 1 83  GLY 83  210 210 GLY GLY B . n 
A 1 84  ALA 84  211 211 ALA ALA B . n 
A 1 85  ILE 85  212 212 ILE ILE B . n 
A 1 86  ASN 86  213 213 ASN ASN B . n 
A 1 87  TYR 87  214 214 TYR TYR B . n 
A 1 88  VAL 88  215 215 VAL VAL B . n 
A 1 89  ALA 89  216 216 ALA ALA B . n 
A 1 90  THR 90  217 217 THR THR B . n 
A 1 91  GLU 91  218 218 GLU GLU B . n 
A 1 92  VAL 92  219 219 VAL VAL B . n 
A 1 93  PHE 93  220 220 PHE PHE B . n 
A 1 94  ARG 94  221 221 ARG ARG B . n 
A 1 95  GLU 95  222 222 GLU GLU B . n 
A 1 96  GLU 96  223 223 GLU GLU B . n 
A 1 97  LEU 97  224 224 LEU LEU B . n 
A 1 98  GLY 98  225 225 GLY GLY B . n 
A 1 99  ALA 99  226 226 ALA ALA B . n 
A 1 100 ARG 100 227 227 ARG ARG B . n 
A 1 101 PRO 101 228 228 PRO PRO B . n 
A 1 102 ASP 102 229 229 ASP ASP B . n 
A 1 103 ALA 103 230 230 ALA ALA B . n 
A 1 104 THR 104 231 231 THR THR B . n 
A 1 105 LYS 105 232 232 LYS LYS B . n 
A 1 106 VAL 106 233 233 VAL VAL B . n 
A 1 107 LEU 107 234 234 LEU LEU B . n 
A 1 108 ILE 108 235 235 ILE ILE B . n 
A 1 109 ILE 109 236 236 ILE ILE B . n 
A 1 110 ILE 110 237 237 ILE ILE B . n 
A 1 111 THR 111 238 238 THR THR B . n 
A 1 112 ASP 112 239 239 ASP ASP B . n 
A 1 113 GLY 113 240 240 GLY GLY B . n 
A 1 114 GLU 114 241 241 GLU GLU B . n 
A 1 115 ALA 115 242 242 ALA ALA B . n 
A 1 116 THR 116 243 243 THR THR B . n 
A 1 117 ASP 117 244 244 ASP ASP B . n 
A 1 118 SER 118 245 245 SER SER B . n 
A 1 119 GLY 119 246 246 GLY GLY B . n 
A 1 120 ASN 120 247 247 ASN ASN B . n 
A 1 121 ILE 121 248 248 ILE ILE B . n 
A 1 122 ASP 122 249 249 ASP ASP B . n 
A 1 123 ALA 123 250 250 ALA ALA B . n 
A 1 124 ALA 124 251 251 ALA ALA B . n 
A 1 125 LYS 125 252 252 LYS LYS B . n 
A 1 126 ASP 126 253 253 ASP ASP B . n 
A 1 127 ILE 127 254 254 ILE ILE B . n 
A 1 128 ILE 128 255 255 ILE ILE B . n 
A 1 129 ARG 129 256 256 ARG ARG B . n 
A 1 130 TYR 130 257 257 TYR TYR B . n 
A 1 131 ILE 131 258 258 ILE ILE B . n 
A 1 132 ILE 132 259 259 ILE ILE B . n 
A 1 133 GLY 133 260 260 GLY GLY B . n 
A 1 134 ILE 134 261 261 ILE ILE B . n 
A 1 135 GLY 135 262 262 GLY GLY B . n 
A 1 136 LYS 136 263 263 LYS LYS B . n 
A 1 137 HIS 137 264 264 HIS HIS B . n 
A 1 138 PHE 138 265 265 PHE PHE B . n 
A 1 139 GLN 139 266 266 GLN GLN B . n 
A 1 140 THR 140 267 267 THR THR B . n 
A 1 141 LYS 141 268 268 LYS LYS B . n 
A 1 142 GLU 142 269 269 GLU GLU B . n 
A 1 143 SER 143 270 270 SER SER B . n 
A 1 144 GLN 144 271 271 GLN GLN B . n 
A 1 145 GLU 145 272 272 GLU GLU B . n 
A 1 146 THR 146 273 273 THR THR B . n 
A 1 147 LEU 147 274 274 LEU LEU B . n 
A 1 148 HIS 148 275 275 HIS HIS B . n 
A 1 149 LYS 149 276 276 LYS LYS B . n 
A 1 150 PHE 150 277 277 PHE PHE B . n 
A 1 151 ALA 151 278 278 ALA ALA B . n 
A 1 152 SER 152 279 279 SER SER B . n 
A 1 153 LYS 153 280 280 LYS LYS B . n 
A 1 154 PRO 154 281 281 PRO PRO B . n 
A 1 155 ALA 155 282 282 ALA ALA B . n 
A 1 156 SER 156 283 283 SER SER B . n 
A 1 157 GLU 157 284 284 GLU GLU B . n 
A 1 158 PHE 158 285 285 PHE PHE B . n 
A 1 159 VAL 159 286 286 VAL VAL B . n 
A 1 160 LYS 160 287 287 LYS LYS B . n 
A 1 161 ILE 161 288 288 ILE ILE B . n 
A 1 162 LEU 162 289 289 LEU LEU B . n 
A 1 163 ASP 163 290 290 ASP ASP B . n 
A 1 164 THR 164 291 291 THR THR B . n 
A 1 165 PHE 165 292 292 PHE PHE B . n 
A 1 166 GLU 166 293 293 GLU GLU B . n 
A 1 167 LYS 167 294 294 LYS LYS B . n 
A 1 168 LEU 168 295 295 LEU LEU B . n 
A 1 169 LYS 169 296 296 LYS LYS B . n 
A 1 170 ASP 170 297 297 ASP ASP B . n 
A 1 171 LEU 171 298 298 LEU LEU B . n 
A 1 172 PHE 172 299 299 PHE PHE B . n 
A 1 173 THR 173 300 300 THR THR B . n 
A 1 174 GLU 174 301 301 GLU GLU B . n 
A 1 175 LEU 175 302 302 LEU LEU B . n 
A 1 176 GLN 176 303 303 GLN GLN B . n 
A 1 177 LYS 177 304 304 LYS LYS B . n 
A 1 178 LYS 178 305 305 LYS LYS B . n 
A 1 179 ILE 179 306 306 ILE ILE B . n 
A 1 180 TYR 180 307 307 TYR TYR B . n 
A 1 181 VAL 181 308 308 VAL VAL B . n 
A 1 182 ILE 182 309 309 ILE ILE B . n 
B 1 1   GLY 1   128 128 GLY GLY C . n 
B 1 2   ASN 2   129 129 ASN ASN C . n 
B 1 3   VAL 3   130 130 VAL VAL C . n 
B 1 4   ASP 4   131 131 ASP ASP C . n 
B 1 5   LEU 5   132 132 LEU LEU C . n 
B 1 6   VAL 6   133 133 VAL VAL C . n 
B 1 7   PHE 7   134 134 PHE PHE C . n 
B 1 8   LEU 8   135 135 LEU LEU C . n 
B 1 9   PHE 9   136 136 PHE PHE C . n 
B 1 10  ASP 10  137 137 ASP ASP C . n 
B 1 11  GLY 11  138 138 GLY GLY C . n 
B 1 12  SER 12  139 139 SER SER C . n 
B 1 13  MET 13  140 140 MET MET C . n 
B 1 14  SER 14  141 141 SER SER C . n 
B 1 15  LEU 15  142 142 LEU LEU C . n 
B 1 16  GLN 16  143 143 GLN GLN C . n 
B 1 17  PRO 17  144 144 PRO PRO C . n 
B 1 18  ASP 18  145 145 ASP ASP C . n 
B 1 19  GLU 19  146 146 GLU GLU C . n 
B 1 20  PHE 20  147 147 PHE PHE C . n 
B 1 21  GLN 21  148 148 GLN GLN C . n 
B 1 22  LYS 22  149 149 LYS LYS C . n 
B 1 23  ILE 23  150 150 ILE ILE C . n 
B 1 24  LEU 24  151 151 LEU LEU C . n 
B 1 25  ASP 25  152 152 ASP ASP C . n 
B 1 26  PHE 26  153 153 PHE PHE C . n 
B 1 27  MET 27  154 154 MET MET C . n 
B 1 28  LYS 28  155 155 LYS LYS C . n 
B 1 29  ASP 29  156 156 ASP ASP C . n 
B 1 30  VAL 30  157 157 VAL VAL C . n 
B 1 31  MET 31  158 158 MET MET C . n 
B 1 32  LYS 32  159 159 LYS LYS C . n 
B 1 33  LYS 33  160 160 LYS LYS C . n 
B 1 34  LEU 34  161 161 LEU LEU C . n 
B 1 35  SER 35  162 162 SER SER C . n 
B 1 36  ASN 36  163 163 ASN ASN C . n 
B 1 37  THR 37  164 164 THR THR C . n 
B 1 38  SER 38  165 165 SER SER C . n 
B 1 39  TYR 39  166 166 TYR TYR C . n 
B 1 40  GLN 40  167 167 GLN GLN C . n 
B 1 41  PHE 41  168 168 PHE PHE C . n 
B 1 42  ALA 42  169 169 ALA ALA C . n 
B 1 43  ALA 43  170 170 ALA ALA C . n 
B 1 44  VAL 44  171 171 VAL VAL C . n 
B 1 45  GLN 45  172 172 GLN GLN C . n 
B 1 46  PHE 46  173 173 PHE PHE C . n 
B 1 47  SER 47  174 174 SER SER C . n 
B 1 48  THR 48  175 175 THR THR C . n 
B 1 49  SER 49  176 176 SER SER C . n 
B 1 50  TYR 50  177 177 TYR TYR C . n 
B 1 51  LYS 51  178 178 LYS LYS C . n 
B 1 52  THR 52  179 179 THR THR C . n 
B 1 53  GLU 53  180 180 GLU GLU C . n 
B 1 54  PHE 54  181 181 PHE PHE C . n 
B 1 55  ASP 55  182 182 ASP ASP C . n 
B 1 56  PHE 56  183 183 PHE PHE C . n 
B 1 57  SER 57  184 184 SER SER C . n 
B 1 58  ASP 58  185 185 ASP ASP C . n 
B 1 59  TYR 59  186 186 TYR TYR C . n 
B 1 60  VAL 60  187 187 VAL VAL C . n 
B 1 61  LYS 61  188 188 LYS LYS C . n 
B 1 62  TRP 62  189 189 TRP TRP C . n 
B 1 63  LYS 63  190 190 LYS LYS C . n 
B 1 64  ASP 64  191 191 ASP ASP C . n 
B 1 65  PRO 65  192 192 PRO PRO C . n 
B 1 66  ASP 66  193 193 ASP ASP C . n 
B 1 67  ALA 67  194 194 ALA ALA C . n 
B 1 68  LEU 68  195 195 LEU LEU C . n 
B 1 69  LEU 69  196 196 LEU LEU C . n 
B 1 70  LYS 70  197 197 LYS LYS C . n 
B 1 71  HIS 71  198 198 HIS HIS C . n 
B 1 72  VAL 72  199 199 VAL VAL C . n 
B 1 73  LYS 73  200 200 LYS LYS C . n 
B 1 74  HIS 74  201 201 HIS HIS C . n 
B 1 75  MET 75  202 202 MET MET C . n 
B 1 76  LEU 76  203 203 LEU LEU C . n 
B 1 77  LEU 77  204 204 LEU LEU C . n 
B 1 78  LEU 78  205 205 LEU LEU C . n 
B 1 79  THR 79  206 206 THR THR C . n 
B 1 80  ASN 80  207 207 ASN ASN C . n 
B 1 81  THR 81  208 208 THR THR C . n 
B 1 82  PHE 82  209 209 PHE PHE C . n 
B 1 83  GLY 83  210 210 GLY GLY C . n 
B 1 84  ALA 84  211 211 ALA ALA C . n 
B 1 85  ILE 85  212 212 ILE ILE C . n 
B 1 86  ASN 86  213 213 ASN ASN C . n 
B 1 87  TYR 87  214 214 TYR TYR C . n 
B 1 88  VAL 88  215 215 VAL VAL C . n 
B 1 89  ALA 89  216 216 ALA ALA C . n 
B 1 90  THR 90  217 217 THR THR C . n 
B 1 91  GLU 91  218 218 GLU GLU C . n 
B 1 92  VAL 92  219 219 VAL VAL C . n 
B 1 93  PHE 93  220 220 PHE PHE C . n 
B 1 94  ARG 94  221 221 ARG ARG C . n 
B 1 95  GLU 95  222 222 GLU GLU C . n 
B 1 96  GLU 96  223 223 GLU GLU C . n 
B 1 97  LEU 97  224 224 LEU LEU C . n 
B 1 98  GLY 98  225 225 GLY GLY C . n 
B 1 99  ALA 99  226 226 ALA ALA C . n 
B 1 100 ARG 100 227 227 ARG ARG C . n 
B 1 101 PRO 101 228 228 PRO PRO C . n 
B 1 102 ASP 102 229 229 ASP ASP C . n 
B 1 103 ALA 103 230 230 ALA ALA C . n 
B 1 104 THR 104 231 231 THR THR C . n 
B 1 105 LYS 105 232 232 LYS LYS C . n 
B 1 106 VAL 106 233 233 VAL VAL C . n 
B 1 107 LEU 107 234 234 LEU LEU C . n 
B 1 108 ILE 108 235 235 ILE ILE C . n 
B 1 109 ILE 109 236 236 ILE ILE C . n 
B 1 110 ILE 110 237 237 ILE ILE C . n 
B 1 111 THR 111 238 238 THR THR C . n 
B 1 112 ASP 112 239 239 ASP ASP C . n 
B 1 113 GLY 113 240 240 GLY GLY C . n 
B 1 114 GLU 114 241 241 GLU GLU C . n 
B 1 115 ALA 115 242 242 ALA ALA C . n 
B 1 116 THR 116 243 243 THR THR C . n 
B 1 117 ASP 117 244 244 ASP ASP C . n 
B 1 118 SER 118 245 245 SER SER C . n 
B 1 119 GLY 119 246 246 GLY GLY C . n 
B 1 120 ASN 120 247 247 ASN ASN C . n 
B 1 121 ILE 121 248 248 ILE ILE C . n 
B 1 122 ASP 122 249 249 ASP ASP C . n 
B 1 123 ALA 123 250 250 ALA ALA C . n 
B 1 124 ALA 124 251 251 ALA ALA C . n 
B 1 125 LYS 125 252 252 LYS LYS C . n 
B 1 126 ASP 126 253 253 ASP ASP C . n 
B 1 127 ILE 127 254 254 ILE ILE C . n 
B 1 128 ILE 128 255 255 ILE ILE C . n 
B 1 129 ARG 129 256 256 ARG ARG C . n 
B 1 130 TYR 130 257 257 TYR TYR C . n 
B 1 131 ILE 131 258 258 ILE ILE C . n 
B 1 132 ILE 132 259 259 ILE ILE C . n 
B 1 133 GLY 133 260 260 GLY GLY C . n 
B 1 134 ILE 134 261 261 ILE ILE C . n 
B 1 135 GLY 135 262 262 GLY GLY C . n 
B 1 136 LYS 136 263 263 LYS LYS C . n 
B 1 137 HIS 137 264 264 HIS HIS C . n 
B 1 138 PHE 138 265 265 PHE PHE C . n 
B 1 139 GLN 139 266 266 GLN GLN C . n 
B 1 140 THR 140 267 267 THR THR C . n 
B 1 141 LYS 141 268 268 LYS LYS C . n 
B 1 142 GLU 142 269 269 GLU GLU C . n 
B 1 143 SER 143 270 270 SER SER C . n 
B 1 144 GLN 144 271 271 GLN GLN C . n 
B 1 145 GLU 145 272 272 GLU GLU C . n 
B 1 146 THR 146 273 273 THR THR C . n 
B 1 147 LEU 147 274 274 LEU LEU C . n 
B 1 148 HIS 148 275 275 HIS HIS C . n 
B 1 149 LYS 149 276 276 LYS LYS C . n 
B 1 150 PHE 150 277 277 PHE PHE C . n 
B 1 151 ALA 151 278 278 ALA ALA C . n 
B 1 152 SER 152 279 279 SER SER C . n 
B 1 153 LYS 153 280 280 LYS LYS C . n 
B 1 154 PRO 154 281 281 PRO PRO C . n 
B 1 155 ALA 155 282 282 ALA ALA C . n 
B 1 156 SER 156 283 283 SER SER C . n 
B 1 157 GLU 157 284 284 GLU GLU C . n 
B 1 158 PHE 158 285 285 PHE PHE C . n 
B 1 159 VAL 159 286 286 VAL VAL C . n 
B 1 160 LYS 160 287 287 LYS LYS C . n 
B 1 161 ILE 161 288 288 ILE ILE C . n 
B 1 162 LEU 162 289 289 LEU LEU C . n 
B 1 163 ASP 163 290 290 ASP ASP C . n 
B 1 164 THR 164 291 291 THR THR C . n 
B 1 165 PHE 165 292 292 PHE PHE C . n 
B 1 166 GLU 166 293 293 GLU GLU C . n 
B 1 167 LYS 167 294 294 LYS LYS C . n 
B 1 168 LEU 168 295 295 LEU LEU C . n 
B 1 169 LYS 169 296 296 LYS LYS C . n 
B 1 170 ASP 170 297 297 ASP ASP C . n 
B 1 171 LEU 171 298 298 LEU LEU C . n 
B 1 172 PHE 172 299 299 PHE PHE C . n 
B 1 173 THR 173 300 300 THR THR C . n 
B 1 174 GLU 174 301 301 GLU GLU C . n 
B 1 175 LEU 175 302 302 LEU LEU C . n 
B 1 176 GLN 176 303 303 GLN GLN C . n 
B 1 177 LYS 177 304 304 LYS LYS C . n 
B 1 178 LYS 178 305 305 LYS LYS C . n 
B 1 179 ILE 179 306 306 ILE ILE C . n 
B 1 180 TYR 180 307 307 TYR TYR C . n 
B 1 181 VAL 181 308 308 VAL VAL C . n 
B 1 182 ILE 182 309 309 ILE ILE C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 BQM 1   1   1   BQM BIO B . 
D 2 BQM 1   1   1   BQM BIO C . 
E 3 HOH 1   310 1   HOH HOH B . 
E 3 HOH 2   311 4   HOH HOH B . 
E 3 HOH 3   312 5   HOH HOH B . 
E 3 HOH 4   313 6   HOH HOH B . 
E 3 HOH 5   314 8   HOH HOH B . 
E 3 HOH 6   315 11  HOH HOH B . 
E 3 HOH 7   316 14  HOH HOH B . 
E 3 HOH 8   317 19  HOH HOH B . 
E 3 HOH 9   318 21  HOH HOH B . 
E 3 HOH 10  319 22  HOH HOH B . 
E 3 HOH 11  320 24  HOH HOH B . 
E 3 HOH 12  321 25  HOH HOH B . 
E 3 HOH 13  322 27  HOH HOH B . 
E 3 HOH 14  323 31  HOH HOH B . 
E 3 HOH 15  324 32  HOH HOH B . 
E 3 HOH 16  325 34  HOH HOH B . 
E 3 HOH 17  326 40  HOH HOH B . 
E 3 HOH 18  328 45  HOH HOH B . 
E 3 HOH 19  329 46  HOH HOH B . 
E 3 HOH 20  330 47  HOH HOH B . 
E 3 HOH 21  331 48  HOH HOH B . 
E 3 HOH 22  332 49  HOH HOH B . 
E 3 HOH 23  333 50  HOH HOH B . 
E 3 HOH 24  334 56  HOH HOH B . 
E 3 HOH 25  335 57  HOH HOH B . 
E 3 HOH 26  336 58  HOH HOH B . 
E 3 HOH 27  337 65  HOH HOH B . 
E 3 HOH 28  338 68  HOH HOH B . 
E 3 HOH 29  339 73  HOH HOH B . 
E 3 HOH 30  340 76  HOH HOH B . 
E 3 HOH 31  341 85  HOH HOH B . 
E 3 HOH 32  342 86  HOH HOH B . 
E 3 HOH 33  343 88  HOH HOH B . 
E 3 HOH 34  344 89  HOH HOH B . 
E 3 HOH 35  345 92  HOH HOH B . 
E 3 HOH 36  346 94  HOH HOH B . 
E 3 HOH 37  347 96  HOH HOH B . 
E 3 HOH 38  348 102 HOH HOH B . 
E 3 HOH 39  349 104 HOH HOH B . 
E 3 HOH 40  350 110 HOH HOH B . 
E 3 HOH 41  351 115 HOH HOH B . 
E 3 HOH 42  352 119 HOH HOH B . 
E 3 HOH 43  353 122 HOH HOH B . 
E 3 HOH 44  354 124 HOH HOH B . 
E 3 HOH 45  355 126 HOH HOH B . 
E 3 HOH 46  356 132 HOH HOH B . 
E 3 HOH 47  357 138 HOH HOH B . 
E 3 HOH 48  358 146 HOH HOH B . 
E 3 HOH 49  359 148 HOH HOH B . 
E 3 HOH 50  360 149 HOH HOH B . 
E 3 HOH 51  361 150 HOH HOH B . 
E 3 HOH 52  362 153 HOH HOH B . 
E 3 HOH 53  363 156 HOH HOH B . 
E 3 HOH 54  364 165 HOH HOH B . 
E 3 HOH 55  365 170 HOH HOH B . 
E 3 HOH 56  366 172 HOH HOH B . 
E 3 HOH 57  367 174 HOH HOH B . 
E 3 HOH 58  368 176 HOH HOH B . 
E 3 HOH 59  369 178 HOH HOH B . 
E 3 HOH 60  370 181 HOH HOH B . 
E 3 HOH 61  371 183 HOH HOH B . 
E 3 HOH 62  372 187 HOH HOH B . 
E 3 HOH 63  373 195 HOH HOH B . 
E 3 HOH 64  374 204 HOH HOH B . 
E 3 HOH 65  375 205 HOH HOH B . 
E 3 HOH 66  376 206 HOH HOH B . 
E 3 HOH 67  377 207 HOH HOH B . 
E 3 HOH 68  378 209 HOH HOH B . 
E 3 HOH 69  379 210 HOH HOH B . 
E 3 HOH 70  380 211 HOH HOH B . 
E 3 HOH 71  381 214 HOH HOH B . 
E 3 HOH 72  382 216 HOH HOH B . 
E 3 HOH 73  383 219 HOH HOH B . 
E 3 HOH 74  384 220 HOH HOH B . 
E 3 HOH 75  385 221 HOH HOH B . 
E 3 HOH 76  386 222 HOH HOH B . 
E 3 HOH 77  387 223 HOH HOH B . 
E 3 HOH 78  388 227 HOH HOH B . 
E 3 HOH 79  389 230 HOH HOH B . 
E 3 HOH 80  390 231 HOH HOH B . 
E 3 HOH 81  391 234 HOH HOH B . 
E 3 HOH 82  392 235 HOH HOH B . 
E 3 HOH 83  393 239 HOH HOH B . 
E 3 HOH 84  394 241 HOH HOH B . 
E 3 HOH 85  395 242 HOH HOH B . 
E 3 HOH 86  396 246 HOH HOH B . 
E 3 HOH 87  397 248 HOH HOH B . 
E 3 HOH 88  398 252 HOH HOH B . 
E 3 HOH 89  399 255 HOH HOH B . 
E 3 HOH 90  400 256 HOH HOH B . 
E 3 HOH 91  401 258 HOH HOH B . 
E 3 HOH 92  402 259 HOH HOH B . 
E 3 HOH 93  403 261 HOH HOH B . 
E 3 HOH 94  404 262 HOH HOH B . 
E 3 HOH 95  405 268 HOH HOH B . 
E 3 HOH 96  406 273 HOH HOH B . 
E 3 HOH 97  407 275 HOH HOH B . 
E 3 HOH 98  408 278 HOH HOH B . 
E 3 HOH 99  409 280 HOH HOH B . 
E 3 HOH 100 410 284 HOH HOH B . 
E 3 HOH 101 411 285 HOH HOH B . 
E 3 HOH 102 412 286 HOH HOH B . 
E 3 HOH 103 413 289 HOH HOH B . 
E 3 HOH 104 414 290 HOH HOH B . 
E 3 HOH 105 415 293 HOH HOH B . 
E 3 HOH 106 416 297 HOH HOH B . 
E 3 HOH 107 417 299 HOH HOH B . 
E 3 HOH 108 418 301 HOH HOH B . 
E 3 HOH 109 419 302 HOH HOH B . 
E 3 HOH 110 420 306 HOH HOH B . 
E 3 HOH 111 421 308 HOH HOH B . 
E 3 HOH 112 422 309 HOH HOH B . 
E 3 HOH 113 423 313 HOH HOH B . 
E 3 HOH 114 424 319 HOH HOH B . 
E 3 HOH 115 425 325 HOH HOH B . 
E 3 HOH 116 426 330 HOH HOH B . 
E 3 HOH 117 427 338 HOH HOH B . 
E 3 HOH 118 428 339 HOH HOH B . 
E 3 HOH 119 429 342 HOH HOH B . 
E 3 HOH 120 430 344 HOH HOH B . 
E 3 HOH 121 431 346 HOH HOH B . 
E 3 HOH 122 432 348 HOH HOH B . 
E 3 HOH 123 433 349 HOH HOH B . 
E 3 HOH 124 434 350 HOH HOH B . 
E 3 HOH 125 435 351 HOH HOH B . 
E 3 HOH 126 436 352 HOH HOH B . 
E 3 HOH 127 437 354 HOH HOH B . 
E 3 HOH 128 438 359 HOH HOH B . 
E 3 HOH 129 439 360 HOH HOH B . 
E 3 HOH 130 440 362 HOH HOH B . 
E 3 HOH 131 441 364 HOH HOH B . 
E 3 HOH 132 442 366 HOH HOH B . 
E 3 HOH 133 443 370 HOH HOH B . 
E 3 HOH 134 444 375 HOH HOH B . 
E 3 HOH 135 445 376 HOH HOH B . 
E 3 HOH 136 446 377 HOH HOH B . 
E 3 HOH 137 447 380 HOH HOH B . 
E 3 HOH 138 448 386 HOH HOH B . 
E 3 HOH 139 449 397 HOH HOH B . 
E 3 HOH 140 450 407 HOH HOH B . 
E 3 HOH 141 451 409 HOH HOH B . 
E 3 HOH 142 452 411 HOH HOH B . 
E 3 HOH 143 453 414 HOH HOH B . 
E 3 HOH 144 454 415 HOH HOH B . 
E 3 HOH 145 455 420 HOH HOH B . 
E 3 HOH 146 456 425 HOH HOH B . 
E 3 HOH 147 457 432 HOH HOH B . 
E 3 HOH 148 458 433 HOH HOH B . 
E 3 HOH 149 459 434 HOH HOH B . 
E 3 HOH 150 460 435 HOH HOH B . 
E 3 HOH 151 461 437 HOH HOH B . 
E 3 HOH 152 462 450 HOH HOH B . 
E 3 HOH 153 463 453 HOH HOH B . 
E 3 HOH 154 464 459 HOH HOH B . 
E 3 HOH 155 465 465 HOH HOH B . 
E 3 HOH 156 466 468 HOH HOH B . 
E 3 HOH 157 467 471 HOH HOH B . 
E 3 HOH 158 468 473 HOH HOH B . 
E 3 HOH 159 469 474 HOH HOH B . 
F 3 HOH 1   327 41  HOH HOH C . 
F 3 HOH 2   328 3   HOH HOH C . 
F 3 HOH 3   329 7   HOH HOH C . 
F 3 HOH 4   330 9   HOH HOH C . 
F 3 HOH 5   331 10  HOH HOH C . 
F 3 HOH 6   332 12  HOH HOH C . 
F 3 HOH 7   333 13  HOH HOH C . 
F 3 HOH 8   334 15  HOH HOH C . 
F 3 HOH 9   335 18  HOH HOH C . 
F 3 HOH 10  336 20  HOH HOH C . 
F 3 HOH 11  337 23  HOH HOH C . 
F 3 HOH 12  338 26  HOH HOH C . 
F 3 HOH 13  339 28  HOH HOH C . 
F 3 HOH 14  340 29  HOH HOH C . 
F 3 HOH 15  341 30  HOH HOH C . 
F 3 HOH 16  342 33  HOH HOH C . 
F 3 HOH 17  343 35  HOH HOH C . 
F 3 HOH 18  344 36  HOH HOH C . 
F 3 HOH 19  345 37  HOH HOH C . 
F 3 HOH 20  346 38  HOH HOH C . 
F 3 HOH 21  347 42  HOH HOH C . 
F 3 HOH 22  348 43  HOH HOH C . 
F 3 HOH 23  349 44  HOH HOH C . 
F 3 HOH 24  350 52  HOH HOH C . 
F 3 HOH 25  351 53  HOH HOH C . 
F 3 HOH 26  352 54  HOH HOH C . 
F 3 HOH 27  353 55  HOH HOH C . 
F 3 HOH 28  354 60  HOH HOH C . 
F 3 HOH 29  355 61  HOH HOH C . 
F 3 HOH 30  356 62  HOH HOH C . 
F 3 HOH 31  357 63  HOH HOH C . 
F 3 HOH 32  358 64  HOH HOH C . 
F 3 HOH 33  359 66  HOH HOH C . 
F 3 HOH 34  360 69  HOH HOH C . 
F 3 HOH 35  361 70  HOH HOH C . 
F 3 HOH 36  362 75  HOH HOH C . 
F 3 HOH 37  363 78  HOH HOH C . 
F 3 HOH 38  364 79  HOH HOH C . 
F 3 HOH 39  365 80  HOH HOH C . 
F 3 HOH 40  366 81  HOH HOH C . 
F 3 HOH 41  367 82  HOH HOH C . 
F 3 HOH 42  368 83  HOH HOH C . 
F 3 HOH 43  369 84  HOH HOH C . 
F 3 HOH 44  370 87  HOH HOH C . 
F 3 HOH 45  371 91  HOH HOH C . 
F 3 HOH 46  372 95  HOH HOH C . 
F 3 HOH 47  373 99  HOH HOH C . 
F 3 HOH 48  374 100 HOH HOH C . 
F 3 HOH 49  375 101 HOH HOH C . 
F 3 HOH 50  376 103 HOH HOH C . 
F 3 HOH 51  377 105 HOH HOH C . 
F 3 HOH 52  378 106 HOH HOH C . 
F 3 HOH 53  379 109 HOH HOH C . 
F 3 HOH 54  380 111 HOH HOH C . 
F 3 HOH 55  381 112 HOH HOH C . 
F 3 HOH 56  382 113 HOH HOH C . 
F 3 HOH 57  383 116 HOH HOH C . 
F 3 HOH 58  384 118 HOH HOH C . 
F 3 HOH 59  385 120 HOH HOH C . 
F 3 HOH 60  386 121 HOH HOH C . 
F 3 HOH 61  387 125 HOH HOH C . 
F 3 HOH 62  388 127 HOH HOH C . 
F 3 HOH 63  389 128 HOH HOH C . 
F 3 HOH 64  390 133 HOH HOH C . 
F 3 HOH 65  391 134 HOH HOH C . 
F 3 HOH 66  392 135 HOH HOH C . 
F 3 HOH 67  393 139 HOH HOH C . 
F 3 HOH 68  394 142 HOH HOH C . 
F 3 HOH 69  395 152 HOH HOH C . 
F 3 HOH 70  396 157 HOH HOH C . 
F 3 HOH 71  397 159 HOH HOH C . 
F 3 HOH 72  398 160 HOH HOH C . 
F 3 HOH 73  399 163 HOH HOH C . 
F 3 HOH 74  400 166 HOH HOH C . 
F 3 HOH 75  401 167 HOH HOH C . 
F 3 HOH 76  402 171 HOH HOH C . 
F 3 HOH 77  403 177 HOH HOH C . 
F 3 HOH 78  404 179 HOH HOH C . 
F 3 HOH 79  405 189 HOH HOH C . 
F 3 HOH 80  406 190 HOH HOH C . 
F 3 HOH 81  407 192 HOH HOH C . 
F 3 HOH 82  408 194 HOH HOH C . 
F 3 HOH 83  409 196 HOH HOH C . 
F 3 HOH 84  410 199 HOH HOH C . 
F 3 HOH 85  411 200 HOH HOH C . 
F 3 HOH 86  412 201 HOH HOH C . 
F 3 HOH 87  413 203 HOH HOH C . 
F 3 HOH 88  414 208 HOH HOH C . 
F 3 HOH 89  415 212 HOH HOH C . 
F 3 HOH 90  416 213 HOH HOH C . 
F 3 HOH 91  417 215 HOH HOH C . 
F 3 HOH 92  418 217 HOH HOH C . 
F 3 HOH 93  419 218 HOH HOH C . 
F 3 HOH 94  420 225 HOH HOH C . 
F 3 HOH 95  421 226 HOH HOH C . 
F 3 HOH 96  422 228 HOH HOH C . 
F 3 HOH 97  423 229 HOH HOH C . 
F 3 HOH 98  424 232 HOH HOH C . 
F 3 HOH 99  425 233 HOH HOH C . 
F 3 HOH 100 426 236 HOH HOH C . 
F 3 HOH 101 427 238 HOH HOH C . 
F 3 HOH 102 428 240 HOH HOH C . 
F 3 HOH 103 429 243 HOH HOH C . 
F 3 HOH 104 430 244 HOH HOH C . 
F 3 HOH 105 431 250 HOH HOH C . 
F 3 HOH 106 432 257 HOH HOH C . 
F 3 HOH 107 433 264 HOH HOH C . 
F 3 HOH 108 434 265 HOH HOH C . 
F 3 HOH 109 435 267 HOH HOH C . 
F 3 HOH 110 436 269 HOH HOH C . 
F 3 HOH 111 437 270 HOH HOH C . 
F 3 HOH 112 438 272 HOH HOH C . 
F 3 HOH 113 439 277 HOH HOH C . 
F 3 HOH 114 440 281 HOH HOH C . 
F 3 HOH 115 441 287 HOH HOH C . 
F 3 HOH 116 442 288 HOH HOH C . 
F 3 HOH 117 443 291 HOH HOH C . 
F 3 HOH 118 444 292 HOH HOH C . 
F 3 HOH 119 445 294 HOH HOH C . 
F 3 HOH 120 446 295 HOH HOH C . 
F 3 HOH 121 447 298 HOH HOH C . 
F 3 HOH 122 448 300 HOH HOH C . 
F 3 HOH 123 449 303 HOH HOH C . 
F 3 HOH 124 450 304 HOH HOH C . 
F 3 HOH 125 451 305 HOH HOH C . 
F 3 HOH 126 452 307 HOH HOH C . 
F 3 HOH 127 453 310 HOH HOH C . 
F 3 HOH 128 454 311 HOH HOH C . 
F 3 HOH 129 455 314 HOH HOH C . 
F 3 HOH 130 456 317 HOH HOH C . 
F 3 HOH 131 457 324 HOH HOH C . 
F 3 HOH 132 458 329 HOH HOH C . 
F 3 HOH 133 459 343 HOH HOH C . 
F 3 HOH 134 460 356 HOH HOH C . 
F 3 HOH 135 461 357 HOH HOH C . 
F 3 HOH 136 462 361 HOH HOH C . 
F 3 HOH 137 463 363 HOH HOH C . 
F 3 HOH 138 464 365 HOH HOH C . 
F 3 HOH 139 465 372 HOH HOH C . 
F 3 HOH 140 466 373 HOH HOH C . 
F 3 HOH 141 467 378 HOH HOH C . 
F 3 HOH 142 468 379 HOH HOH C . 
F 3 HOH 143 469 381 HOH HOH C . 
F 3 HOH 144 470 383 HOH HOH C . 
F 3 HOH 145 471 390 HOH HOH C . 
F 3 HOH 146 472 391 HOH HOH C . 
F 3 HOH 147 473 392 HOH HOH C . 
F 3 HOH 148 474 393 HOH HOH C . 
F 3 HOH 149 475 395 HOH HOH C . 
F 3 HOH 150 476 402 HOH HOH C . 
F 3 HOH 151 477 403 HOH HOH C . 
F 3 HOH 152 478 405 HOH HOH C . 
F 3 HOH 153 479 416 HOH HOH C . 
F 3 HOH 154 480 417 HOH HOH C . 
F 3 HOH 155 481 421 HOH HOH C . 
F 3 HOH 156 482 423 HOH HOH C . 
F 3 HOH 157 483 427 HOH HOH C . 
F 3 HOH 158 484 439 HOH HOH C . 
F 3 HOH 159 485 441 HOH HOH C . 
F 3 HOH 160 486 445 HOH HOH C . 
F 3 HOH 161 487 446 HOH HOH C . 
F 3 HOH 162 488 448 HOH HOH C . 
F 3 HOH 163 489 454 HOH HOH C . 
F 3 HOH 164 490 456 HOH HOH C . 
F 3 HOH 165 491 458 HOH HOH C . 
F 3 HOH 166 492 460 HOH HOH C . 
F 3 HOH 167 493 461 HOH HOH C . 
F 3 HOH 168 494 462 HOH HOH C . 
F 3 HOH 169 495 463 HOH HOH C . 
F 3 HOH 170 496 464 HOH HOH C . 
F 3 HOH 171 497 466 HOH HOH C . 
F 3 HOH 172 498 469 HOH HOH C . 
F 3 HOH 173 499 1   HOH HOH C . 
F 3 HOH 174 500 2   HOH HOH C . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?    monomeric 1 
2 author_defined_assembly   ?    monomeric 1 
3 software_defined_assembly PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E       
2 1 B,D,F       
3 1 A,B,C,D,E,F 
# 
_pdbx_struct_assembly_prop.biol_id   3 
_pdbx_struct_assembly_prop.type      'ABSA (A^2)' 
_pdbx_struct_assembly_prop.value     1970 
_pdbx_struct_assembly_prop.details   ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-08-19 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC       refinement        5.2.0019 ? 1 
CrystalClear 'data collection' .        ? 2 
HKL-2000     'data reduction'  .        ? 3 
HKL-2000     'data scaling'    .        ? 4 
PHASER       phasing           .        ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   SD 
_pdbx_validate_close_contact.auth_asym_id_1   C 
_pdbx_validate_close_contact.auth_comp_id_1   MET 
_pdbx_validate_close_contact.auth_seq_id_1    158 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   C 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    445 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.96 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              234 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              234 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              234 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                129.85 
_pdbx_validate_rmsd_angle.angle_target_value         115.30 
_pdbx_validate_rmsd_angle.angle_deviation            14.55 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 THR B 164 ? ? -113.10 -164.80 
2 1 SER B 174 ? ? -146.84 -106.16 
3 1 LEU B 204 ? ? -121.05 -136.32 
4 1 LEU B 205 ? ? -85.42  -158.90 
5 1 THR C 164 ? ? -110.33 -164.66 
6 1 SER C 174 ? ? -142.48 -102.99 
7 1 LEU C 204 ? ? -123.10 -131.81 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 B LYS 252 ? CG ? A LYS 125 CG 
2  1 Y 1 B LYS 252 ? CD ? A LYS 125 CD 
3  1 Y 1 B LYS 252 ? CE ? A LYS 125 CE 
4  1 Y 1 B LYS 252 ? NZ ? A LYS 125 NZ 
5  1 Y 1 C LYS 252 ? CG ? B LYS 125 CG 
6  1 Y 1 C LYS 252 ? CD ? B LYS 125 CD 
7  1 Y 1 C LYS 252 ? CE ? B LYS 125 CE 
8  1 Y 1 C LYS 252 ? NZ ? B LYS 125 NZ 
9  1 Y 1 C LYS 296 ? CG ? B LYS 169 CG 
10 1 Y 1 C LYS 296 ? CD ? B LYS 169 CD 
11 1 Y 1 C LYS 296 ? CE ? B LYS 169 CE 
12 1 Y 1 C LYS 296 ? NZ ? B LYS 169 NZ 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '3-({4-[(1E)-3-morpholin-4-yl-3-oxoprop-1-en-1-yl]-2,3-bis(trifluoromethyl)phenyl}sulfanyl)aniline' BQM 
3 water                                                                                               HOH 
#