data_3BRF
# 
_entry.id   3BRF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3BRF         
NDB   PD1068       
RCSB  RCSB045874   
WWPDB D_1000045874 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3BRD . unspecified 
PDB 3BRG . unspecified 
# 
_pdbx_database_status.entry_id                        3BRF 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-12-21 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wilson, J.J.' 1 
'Kovall, R.A.' 2 
# 
_citation.id                        primary 
_citation.title                     'RAM-induced Allostery Facilitates Assembly of a Notch Pathway Active Transcription Complex.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            283 
_citation.page_first                14781 
_citation.page_last                 14791 
_citation.year                      2008 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18381292 
_citation.pdbx_database_id_DOI      10.1074/jbc.M709501200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Friedmann, D.R.' 1 ? 
primary 'Wilson, J.J.'    2 ? 
primary 'Kovall, R.A.'    3 ? 
# 
_cell.length_a           62.944 
_cell.length_b           95.972 
_cell.length_c           223.630 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3BRF 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.entry_id                         3BRF 
_symmetry.Int_Tables_number                20 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*DTP*DTP*DAP*DCP*DTP*DGP*DTP*DGP*DGP*DGP*DAP*DAP*DAP*DGP*DA)-3')
;
4673.059  1  ? ? ?             ? 
2 polymer     syn 
;DNA (5'-D(*DAP*DAP*DTP*DCP*DTP*DTP*DTP*DCP*DCP*DCP*DAP*DCP*DAP*DGP*DT)-3')
;
4503.949  1  ? ? ?             ? 
3 polymer     man 'Lin-12 and glp-1 phenotype protein 1, isoform a'                            53848.719 1  ? ? 'core domain' ? 
4 polymer     man 'Protein lin-12'                                                             1649.974  1  ? ? 'RAM peptide' ? 
5 non-polymer syn sorbitol                                                                     182.172   2  ? ? ?             ? 
6 water       nat water                                                                        18.015    57 ? ? ?             ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3 'DNA-binding protein LAG-1, Lag-1 protein' 
4 'Abnormal cell lineage protein 12'         
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DT)(DT)(DA)(DC)(DT)(DG)(DT)(DG)(DG)(DG)(DA)(DA)(DA)(DG)(DA)' TTACTGTGGGAAAGA B ? 
2 polydeoxyribonucleotide no no '(DA)(DA)(DT)(DC)(DT)(DT)(DT)(DC)(DC)(DC)(DA)(DC)(DA)(DG)(DT)' AATCTTTCCCACAGT C ? 
3 'polypeptide(L)'        no no 
;SGPLGSGDSVQSLTSDRMIDFLSNKEKYECVISIFHAKVAQKSYGNEKRFFCPPPCIYLIGQGWKLKKDRVAQLYKTLKA
SAQKDAAIENDPIHEQQATELVAYIGIGSDTSERQQLDFSTGKVRHPGDQRQDPNIYDYCAAKTLYISDSDKRKYFDLNA
QFFYGCGMEIGGFVSQRIKVISKPSKKKQSMKNTDCKYLCIASGTKVALFNRLRSQTVSTRYLHVEGNAFHASSTKWGAF
TIHLFDDERGLQETDNFAVRDGFVYYGSVVKLVDSVTGIALPRLRIRKVDKQQVILDASCSEEPVSQLHKCAFQMIDNEL
VYLCLSHDKIIQHQATAINEHRHQINDGAAWTIISTDKAEYRFFEAMGQVANPISPCPVVGSLEVDGHGEASRVELHGRD
FKPNLKVWFGATPVETTFRSEESLHCSIPPVSQVRNEQTHWMFTNRTTGDVEVPISLVRDDGVVYSSGLTFSYKSLER
;
;SGPLGSGDSVQSLTSDRMIDFLSNKEKYECVISIFHAKVAQKSYGNEKRFFCPPPCIYLIGQGWKLKKDRVAQLYKTLKA
SAQKDAAIENDPIHEQQATELVAYIGIGSDTSERQQLDFSTGKVRHPGDQRQDPNIYDYCAAKTLYISDSDKRKYFDLNA
QFFYGCGMEIGGFVSQRIKVISKPSKKKQSMKNTDCKYLCIASGTKVALFNRLRSQTVSTRYLHVEGNAFHASSTKWGAF
TIHLFDDERGLQETDNFAVRDGFVYYGSVVKLVDSVTGIALPRLRIRKVDKQQVILDASCSEEPVSQLHKCAFQMIDNEL
VYLCLSHDKIIQHQATAINEHRHQINDGAAWTIISTDKAEYRFFEAMGQVANPISPCPVVGSLEVDGHGEASRVELHGRD
FKPNLKVWFGATPVETTFRSEESLHCSIPPVSQVRNEQTHWMFTNRTTGDVEVPISLVRDDGVVYSSGLTFSYKSLER
;
A ? 
4 'polypeptide(L)'        no no SRMINASVWMPPME SRMINASVWMPPME D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DT  n 
1 2   DT  n 
1 3   DA  n 
1 4   DC  n 
1 5   DT  n 
1 6   DG  n 
1 7   DT  n 
1 8   DG  n 
1 9   DG  n 
1 10  DG  n 
1 11  DA  n 
1 12  DA  n 
1 13  DA  n 
1 14  DG  n 
1 15  DA  n 
2 1   DA  n 
2 2   DA  n 
2 3   DT  n 
2 4   DC  n 
2 5   DT  n 
2 6   DT  n 
2 7   DT  n 
2 8   DC  n 
2 9   DC  n 
2 10  DC  n 
2 11  DA  n 
2 12  DC  n 
2 13  DA  n 
2 14  DG  n 
2 15  DT  n 
3 1   SER n 
3 2   GLY n 
3 3   PRO n 
3 4   LEU n 
3 5   GLY n 
3 6   SER n 
3 7   GLY n 
3 8   ASP n 
3 9   SER n 
3 10  VAL n 
3 11  GLN n 
3 12  SER n 
3 13  LEU n 
3 14  THR n 
3 15  SER n 
3 16  ASP n 
3 17  ARG n 
3 18  MET n 
3 19  ILE n 
3 20  ASP n 
3 21  PHE n 
3 22  LEU n 
3 23  SER n 
3 24  ASN n 
3 25  LYS n 
3 26  GLU n 
3 27  LYS n 
3 28  TYR n 
3 29  GLU n 
3 30  CYS n 
3 31  VAL n 
3 32  ILE n 
3 33  SER n 
3 34  ILE n 
3 35  PHE n 
3 36  HIS n 
3 37  ALA n 
3 38  LYS n 
3 39  VAL n 
3 40  ALA n 
3 41  GLN n 
3 42  LYS n 
3 43  SER n 
3 44  TYR n 
3 45  GLY n 
3 46  ASN n 
3 47  GLU n 
3 48  LYS n 
3 49  ARG n 
3 50  PHE n 
3 51  PHE n 
3 52  CYS n 
3 53  PRO n 
3 54  PRO n 
3 55  PRO n 
3 56  CYS n 
3 57  ILE n 
3 58  TYR n 
3 59  LEU n 
3 60  ILE n 
3 61  GLY n 
3 62  GLN n 
3 63  GLY n 
3 64  TRP n 
3 65  LYS n 
3 66  LEU n 
3 67  LYS n 
3 68  LYS n 
3 69  ASP n 
3 70  ARG n 
3 71  VAL n 
3 72  ALA n 
3 73  GLN n 
3 74  LEU n 
3 75  TYR n 
3 76  LYS n 
3 77  THR n 
3 78  LEU n 
3 79  LYS n 
3 80  ALA n 
3 81  SER n 
3 82  ALA n 
3 83  GLN n 
3 84  LYS n 
3 85  ASP n 
3 86  ALA n 
3 87  ALA n 
3 88  ILE n 
3 89  GLU n 
3 90  ASN n 
3 91  ASP n 
3 92  PRO n 
3 93  ILE n 
3 94  HIS n 
3 95  GLU n 
3 96  GLN n 
3 97  GLN n 
3 98  ALA n 
3 99  THR n 
3 100 GLU n 
3 101 LEU n 
3 102 VAL n 
3 103 ALA n 
3 104 TYR n 
3 105 ILE n 
3 106 GLY n 
3 107 ILE n 
3 108 GLY n 
3 109 SER n 
3 110 ASP n 
3 111 THR n 
3 112 SER n 
3 113 GLU n 
3 114 ARG n 
3 115 GLN n 
3 116 GLN n 
3 117 LEU n 
3 118 ASP n 
3 119 PHE n 
3 120 SER n 
3 121 THR n 
3 122 GLY n 
3 123 LYS n 
3 124 VAL n 
3 125 ARG n 
3 126 HIS n 
3 127 PRO n 
3 128 GLY n 
3 129 ASP n 
3 130 GLN n 
3 131 ARG n 
3 132 GLN n 
3 133 ASP n 
3 134 PRO n 
3 135 ASN n 
3 136 ILE n 
3 137 TYR n 
3 138 ASP n 
3 139 TYR n 
3 140 CYS n 
3 141 ALA n 
3 142 ALA n 
3 143 LYS n 
3 144 THR n 
3 145 LEU n 
3 146 TYR n 
3 147 ILE n 
3 148 SER n 
3 149 ASP n 
3 150 SER n 
3 151 ASP n 
3 152 LYS n 
3 153 ARG n 
3 154 LYS n 
3 155 TYR n 
3 156 PHE n 
3 157 ASP n 
3 158 LEU n 
3 159 ASN n 
3 160 ALA n 
3 161 GLN n 
3 162 PHE n 
3 163 PHE n 
3 164 TYR n 
3 165 GLY n 
3 166 CYS n 
3 167 GLY n 
3 168 MET n 
3 169 GLU n 
3 170 ILE n 
3 171 GLY n 
3 172 GLY n 
3 173 PHE n 
3 174 VAL n 
3 175 SER n 
3 176 GLN n 
3 177 ARG n 
3 178 ILE n 
3 179 LYS n 
3 180 VAL n 
3 181 ILE n 
3 182 SER n 
3 183 LYS n 
3 184 PRO n 
3 185 SER n 
3 186 LYS n 
3 187 LYS n 
3 188 LYS n 
3 189 GLN n 
3 190 SER n 
3 191 MET n 
3 192 LYS n 
3 193 ASN n 
3 194 THR n 
3 195 ASP n 
3 196 CYS n 
3 197 LYS n 
3 198 TYR n 
3 199 LEU n 
3 200 CYS n 
3 201 ILE n 
3 202 ALA n 
3 203 SER n 
3 204 GLY n 
3 205 THR n 
3 206 LYS n 
3 207 VAL n 
3 208 ALA n 
3 209 LEU n 
3 210 PHE n 
3 211 ASN n 
3 212 ARG n 
3 213 LEU n 
3 214 ARG n 
3 215 SER n 
3 216 GLN n 
3 217 THR n 
3 218 VAL n 
3 219 SER n 
3 220 THR n 
3 221 ARG n 
3 222 TYR n 
3 223 LEU n 
3 224 HIS n 
3 225 VAL n 
3 226 GLU n 
3 227 GLY n 
3 228 ASN n 
3 229 ALA n 
3 230 PHE n 
3 231 HIS n 
3 232 ALA n 
3 233 SER n 
3 234 SER n 
3 235 THR n 
3 236 LYS n 
3 237 TRP n 
3 238 GLY n 
3 239 ALA n 
3 240 PHE n 
3 241 THR n 
3 242 ILE n 
3 243 HIS n 
3 244 LEU n 
3 245 PHE n 
3 246 ASP n 
3 247 ASP n 
3 248 GLU n 
3 249 ARG n 
3 250 GLY n 
3 251 LEU n 
3 252 GLN n 
3 253 GLU n 
3 254 THR n 
3 255 ASP n 
3 256 ASN n 
3 257 PHE n 
3 258 ALA n 
3 259 VAL n 
3 260 ARG n 
3 261 ASP n 
3 262 GLY n 
3 263 PHE n 
3 264 VAL n 
3 265 TYR n 
3 266 TYR n 
3 267 GLY n 
3 268 SER n 
3 269 VAL n 
3 270 VAL n 
3 271 LYS n 
3 272 LEU n 
3 273 VAL n 
3 274 ASP n 
3 275 SER n 
3 276 VAL n 
3 277 THR n 
3 278 GLY n 
3 279 ILE n 
3 280 ALA n 
3 281 LEU n 
3 282 PRO n 
3 283 ARG n 
3 284 LEU n 
3 285 ARG n 
3 286 ILE n 
3 287 ARG n 
3 288 LYS n 
3 289 VAL n 
3 290 ASP n 
3 291 LYS n 
3 292 GLN n 
3 293 GLN n 
3 294 VAL n 
3 295 ILE n 
3 296 LEU n 
3 297 ASP n 
3 298 ALA n 
3 299 SER n 
3 300 CYS n 
3 301 SER n 
3 302 GLU n 
3 303 GLU n 
3 304 PRO n 
3 305 VAL n 
3 306 SER n 
3 307 GLN n 
3 308 LEU n 
3 309 HIS n 
3 310 LYS n 
3 311 CYS n 
3 312 ALA n 
3 313 PHE n 
3 314 GLN n 
3 315 MET n 
3 316 ILE n 
3 317 ASP n 
3 318 ASN n 
3 319 GLU n 
3 320 LEU n 
3 321 VAL n 
3 322 TYR n 
3 323 LEU n 
3 324 CYS n 
3 325 LEU n 
3 326 SER n 
3 327 HIS n 
3 328 ASP n 
3 329 LYS n 
3 330 ILE n 
3 331 ILE n 
3 332 GLN n 
3 333 HIS n 
3 334 GLN n 
3 335 ALA n 
3 336 THR n 
3 337 ALA n 
3 338 ILE n 
3 339 ASN n 
3 340 GLU n 
3 341 HIS n 
3 342 ARG n 
3 343 HIS n 
3 344 GLN n 
3 345 ILE n 
3 346 ASN n 
3 347 ASP n 
3 348 GLY n 
3 349 ALA n 
3 350 ALA n 
3 351 TRP n 
3 352 THR n 
3 353 ILE n 
3 354 ILE n 
3 355 SER n 
3 356 THR n 
3 357 ASP n 
3 358 LYS n 
3 359 ALA n 
3 360 GLU n 
3 361 TYR n 
3 362 ARG n 
3 363 PHE n 
3 364 PHE n 
3 365 GLU n 
3 366 ALA n 
3 367 MET n 
3 368 GLY n 
3 369 GLN n 
3 370 VAL n 
3 371 ALA n 
3 372 ASN n 
3 373 PRO n 
3 374 ILE n 
3 375 SER n 
3 376 PRO n 
3 377 CYS n 
3 378 PRO n 
3 379 VAL n 
3 380 VAL n 
3 381 GLY n 
3 382 SER n 
3 383 LEU n 
3 384 GLU n 
3 385 VAL n 
3 386 ASP n 
3 387 GLY n 
3 388 HIS n 
3 389 GLY n 
3 390 GLU n 
3 391 ALA n 
3 392 SER n 
3 393 ARG n 
3 394 VAL n 
3 395 GLU n 
3 396 LEU n 
3 397 HIS n 
3 398 GLY n 
3 399 ARG n 
3 400 ASP n 
3 401 PHE n 
3 402 LYS n 
3 403 PRO n 
3 404 ASN n 
3 405 LEU n 
3 406 LYS n 
3 407 VAL n 
3 408 TRP n 
3 409 PHE n 
3 410 GLY n 
3 411 ALA n 
3 412 THR n 
3 413 PRO n 
3 414 VAL n 
3 415 GLU n 
3 416 THR n 
3 417 THR n 
3 418 PHE n 
3 419 ARG n 
3 420 SER n 
3 421 GLU n 
3 422 GLU n 
3 423 SER n 
3 424 LEU n 
3 425 HIS n 
3 426 CYS n 
3 427 SER n 
3 428 ILE n 
3 429 PRO n 
3 430 PRO n 
3 431 VAL n 
3 432 SER n 
3 433 GLN n 
3 434 VAL n 
3 435 ARG n 
3 436 ASN n 
3 437 GLU n 
3 438 GLN n 
3 439 THR n 
3 440 HIS n 
3 441 TRP n 
3 442 MET n 
3 443 PHE n 
3 444 THR n 
3 445 ASN n 
3 446 ARG n 
3 447 THR n 
3 448 THR n 
3 449 GLY n 
3 450 ASP n 
3 451 VAL n 
3 452 GLU n 
3 453 VAL n 
3 454 PRO n 
3 455 ILE n 
3 456 SER n 
3 457 LEU n 
3 458 VAL n 
3 459 ARG n 
3 460 ASP n 
3 461 ASP n 
3 462 GLY n 
3 463 VAL n 
3 464 VAL n 
3 465 TYR n 
3 466 SER n 
3 467 SER n 
3 468 GLY n 
3 469 LEU n 
3 470 THR n 
3 471 PHE n 
3 472 SER n 
3 473 TYR n 
3 474 LYS n 
3 475 SER n 
3 476 LEU n 
3 477 GLU n 
3 478 ARG n 
4 1   SER n 
4 2   ARG n 
4 3   MET n 
4 4   ILE n 
4 5   ASN n 
4 6   ALA n 
4 7   SER n 
4 8   VAL n 
4 9   TRP n 
4 10  MET n 
4 11  PRO n 
4 12  PRO n 
4 13  MET n 
4 14  GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
3 1 sample ? ? ? ? Caenorhabditis lag-1  ? ? ? ? ? ? 'Caenorhabditis elegans' 6239 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? 'Rosetta2(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pGEX6P-1 ? ? 
4 1 sample ? ? ? ? Caenorhabditis lin-12 ? ? ? ? ? ? 'Caenorhabditis elegans' 6239 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? 'Rosetta2(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET28    ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q9TYY1_CAEEL Q9TYY1 3 
;GDSVQSLTSDRMIDFLSNKEKYECVISIFHAKVAQKSYGNEKRFFCPPPCIYLIGQGWKLKKDRVAQLYKTLKASAQKDA
AIENDPIHEQQATELVAYIGIGSDTSERQQLDFSTGKVRHPGDQRQDPNIYDYCAAKTLYISDSDKRKYFDLNAQFFYGC
GMEIGGFVSQRIKVISKPSKKKQSMKNTDCKYLCIASGTKVALFNRLRSQTVSTRYLHVEGNAFHASSTKWGAFTIHLFD
DERGLQETDNFAVRDGFVYYGSVVKLVDSVTGIALPRLRIRKVDKQQVILDASCSEEPVSQLHKCAFQMIDNELVYLCLS
HDKIIQHQATAINEHRHQINDGAAWTIISTDKAEYRFFEAMGQVANPISPCPVVGSLEVDGHGEASRVELHGRDFKPNLK
VWFGATPVETTFRSEESLHCSIPPVSQVRNEQTHWMFTNRTTGDVEVPISLVRDDGVVYSSGLTFSYKSLER
;
192 ? 
2 UNP LIN12_CAEEL  P14585 4 RMINASVWMPPME 938 ? 
3 PDB 3BRF         3BRF   1 TTACTGTGGGAAAGA ?   ? 
4 PDB 3BRF         3BRF   2 AATCTTTCCCACAGT ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3BRF A 7 ? 478 ? Q9TYY1 192 ? 663 ? 192 663 
2 2 3BRF D 2 ? 14  ? P14585 938 ? 950 ? 938 950 
3 3 3BRF B 1 ? 15  ? 3BRF   1   ? 15  ? 1   15  
4 4 3BRF C 1 ? 15  ? 3BRF   1   ? 15  ? 1   15  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3BRF SER A 1 ? UNP Q9TYY1 ? ? 'expression tag' 186 1 
1 3BRF GLY A 2 ? UNP Q9TYY1 ? ? 'expression tag' 187 2 
1 3BRF PRO A 3 ? UNP Q9TYY1 ? ? 'expression tag' 188 3 
1 3BRF LEU A 4 ? UNP Q9TYY1 ? ? 'expression tag' 189 4 
1 3BRF GLY A 5 ? UNP Q9TYY1 ? ? 'expression tag' 190 5 
1 3BRF SER A 6 ? UNP Q9TYY1 ? ? 'expression tag' 191 6 
2 3BRF SER D 1 ? UNP P14585 ? ? 'expression tag' 937 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
SOR D-saccharide        . sorbitol                             ? 'C6 H14 O6'       182.172 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3BRF 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.61 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   52.89 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'under oil microbatch' 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.pdbx_details    'Bis-Tris, MgCl2, PEG 3350, Sorbitol, pH 6.0, under oil microbatch, temperature 277K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1  1 Bis        ? ? ? 
1 2  1 Tris       ? ? ? 
1 3  1 MgCl2      ? ? ? 
1 4  1 'PEG 3350' ? ? ? 
1 5  1 Sorbitol   ? ? ? 
1 6  2 Bis        ? ? ? 
1 7  2 Tris       ? ? ? 
1 8  2 MgCl2      ? ? ? 
1 9  2 'PEG 3350' ? ? ? 
1 10 2 Sorbitol   ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2005-10-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0094 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X6A' 
_diffrn_source.pdbx_wavelength_list        1.0094 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X6A 
# 
_reflns.entry_id                     3BRF 
_reflns.d_resolution_high            2.470 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   24758 
_reflns.pdbx_Rmerge_I_obs            0.070 
_reflns.pdbx_netI_over_sigmaI        11.800 
_reflns.pdbx_chi_squared             1.011 
_reflns.pdbx_redundancy              5.900 
_reflns.percent_possible_obs         99.200 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
2.47 2.56  ? ? ? 0.549 ? ? 0.915 3.80 ? 2325 95.40  ? 1  
2.56 2.66  ? ? ? 0.466 ? ? 0.965 5.80 ? 2438 98.80  ? 2  
2.66 2.78  ? ? ? 0.329 ? ? 1.042 5.70 ? 2458 99.90  ? 3  
2.78 2.93  ? ? ? 0.243 ? ? 1.079 6.30 ? 2456 100.00 ? 4  
2.93 3.11  ? ? ? 0.148 ? ? 1.084 6.00 ? 2480 99.90  ? 5  
3.11 3.35  ? ? ? 0.103 ? ? 1.144 6.10 ? 2478 99.60  ? 6  
3.35 3.69  ? ? ? 0.070 ? ? 1.098 6.20 ? 2489 100.00 ? 7  
3.69 4.22  ? ? ? 0.054 ? ? 0.984 6.40 ? 2491 99.90  ? 8  
4.22 5.32  ? ? ? 0.046 ? ? 0.944 6.40 ? 2534 99.80  ? 9  
5.32 50.00 ? ? ? 0.052 ? ? 0.816 6.00 ? 2609 98.30  ? 10 
# 
_refine.entry_id                                 3BRF 
_refine.ls_d_res_high                            2.470 
_refine.ls_d_res_low                             28.280 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    99.240 
_refine.ls_number_reflns_obs                     24719 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.232 
_refine.ls_R_factor_R_work                       0.230 
_refine.ls_R_factor_R_free                       0.277 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  1255 
_refine.B_iso_mean                               40.915 
_refine.aniso_B[1][1]                            0.160 
_refine.aniso_B[2][2]                            -0.190 
_refine.aniso_B[3][3]                            0.030 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.938 
_refine.correlation_coeff_Fo_to_Fc_free          0.901 
_refine.pdbx_overall_ESU_R                       0.455 
_refine.pdbx_overall_ESU_R_Free                  0.294 
_refine.overall_SU_ML                            0.217 
_refine.overall_SU_B                             19.021 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3489 
_refine_hist.pdbx_number_atoms_nucleic_acid   609 
_refine_hist.pdbx_number_atoms_ligand         24 
_refine_hist.number_atoms_solvent             57 
_refine_hist.number_atoms_total               4179 
_refine_hist.d_res_high                       2.470 
_refine_hist.d_res_low                        28.280 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         4272 0.011  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      5897 1.481  2.135  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   434  6.913  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   168  38.813 23.690 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   620  20.076 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   23   17.250 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           653  0.093  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     3005 0.005  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            1595 0.213  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          2809 0.306  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    182  0.157  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   40   0.188  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 7    0.119  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              2211 0.465  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             3516 0.835  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              2526 1.246  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             2379 1.843  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.47 
_refine_ls_shell.d_res_low                        2.529 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               94.560 
_refine_ls_shell.number_reflns_R_work             1632 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.388 
_refine_ls_shell.R_factor_R_free                  0.390 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             71 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                1703 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3BRF 
_struct.title                     'CSL (Lag-1) bound to DNA with Lin-12 RAM peptide, C2221' 
_struct.pdbx_descriptor           'Lin-12 and glp-1 phenotype protein 1, isoform a, Protein lin-12/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3BRF 
_struct_keywords.text            
;protein-DNA complex, signaling, transcription, Notch, DNA-binding, ANK repeat, Developmental protein, Differentiation, EGF-like domain, Glycoprotein, Membrane, Transmembrane, DNA BINDING PROTEIN-DNA COMPLEX
;
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 6 ? 
I N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR C 14  ? ASN C 24  ? THR A 199 ASN A 209 1 ? 11 
HELX_P HELX_P2 2 ASN C 24  ? GLU C 29  ? ASN A 209 GLU A 214 1 ? 6  
HELX_P HELX_P3 3 GLN C 62  ? LYS C 76  ? GLN A 247 LYS A 261 1 ? 15 
HELX_P HELX_P4 4 ASP C 297 ? GLU C 303 ? ASP A 482 GLU A 488 5 ? 7  
HELX_P HELX_P5 5 ASN C 346 ? ALA C 350 ? ASN A 531 ALA A 535 5 ? 5  
HELX_P HELX_P6 6 PRO C 430 ? ARG C 435 ? PRO A 615 ARG A 620 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
hydrog1  hydrog ? ? A DA 3  N1 ? ? ? 1_555 B DT 15 N3 ? ? B DA 3  C DT 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog2  hydrog ? ? A DA 3  N6 ? ? ? 1_555 B DT 15 O4 ? ? B DA 3  C DT 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog3  hydrog ? ? A DC 4  N3 ? ? ? 1_555 B DG 14 N1 ? ? B DC 4  C DG 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog4  hydrog ? ? A DC 4  N4 ? ? ? 1_555 B DG 14 O6 ? ? B DC 4  C DG 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog5  hydrog ? ? A DC 4  O2 ? ? ? 1_555 B DG 14 N2 ? ? B DC 4  C DG 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog6  hydrog ? ? A DT 5  N3 ? ? ? 1_555 B DA 13 N1 ? ? B DT 5  C DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog7  hydrog ? ? A DT 5  O4 ? ? ? 1_555 B DA 13 N6 ? ? B DT 5  C DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog8  hydrog ? ? A DG 6  N1 ? ? ? 1_555 B DC 12 N3 ? ? B DG 6  C DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog9  hydrog ? ? A DG 6  N2 ? ? ? 1_555 B DC 12 O2 ? ? B DG 6  C DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog10 hydrog ? ? A DG 6  O6 ? ? ? 1_555 B DC 12 N4 ? ? B DG 6  C DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog11 hydrog ? ? A DT 7  N3 ? ? ? 1_555 B DA 11 N1 ? ? B DT 7  C DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog12 hydrog ? ? A DT 7  O4 ? ? ? 1_555 B DA 11 N6 ? ? B DT 7  C DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog13 hydrog ? ? A DG 8  N1 ? ? ? 1_555 B DC 10 N3 ? ? B DG 8  C DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog14 hydrog ? ? A DG 8  N2 ? ? ? 1_555 B DC 10 O2 ? ? B DG 8  C DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog15 hydrog ? ? A DG 8  O6 ? ? ? 1_555 B DC 10 N4 ? ? B DG 8  C DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog16 hydrog ? ? A DG 9  N1 ? ? ? 1_555 B DC 9  N3 ? ? B DG 9  C DC 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog17 hydrog ? ? A DG 9  N2 ? ? ? 1_555 B DC 9  O2 ? ? B DG 9  C DC 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog18 hydrog ? ? A DG 9  O6 ? ? ? 1_555 B DC 9  N4 ? ? B DG 9  C DC 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog19 hydrog ? ? A DG 10 N1 ? ? ? 1_555 B DC 8  N3 ? ? B DG 10 C DC 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog20 hydrog ? ? A DG 10 N2 ? ? ? 1_555 B DC 8  O2 ? ? B DG 10 C DC 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog21 hydrog ? ? A DG 10 O6 ? ? ? 1_555 B DC 8  N4 ? ? B DG 10 C DC 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog22 hydrog ? ? A DA 11 N1 ? ? ? 1_555 B DT 7  N3 ? ? B DA 11 C DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog23 hydrog ? ? A DA 11 N6 ? ? ? 1_555 B DT 7  O4 ? ? B DA 11 C DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog24 hydrog ? ? A DA 12 N1 ? ? ? 1_555 B DT 6  N3 ? ? B DA 12 C DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog25 hydrog ? ? A DA 12 N6 ? ? ? 1_555 B DT 6  O4 ? ? B DA 12 C DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog26 hydrog ? ? A DA 13 N1 ? ? ? 1_555 B DT 5  N3 ? ? B DA 13 C DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog27 hydrog ? ? A DA 13 N6 ? ? ? 1_555 B DT 5  O4 ? ? B DA 13 C DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog28 hydrog ? ? A DG 14 N1 ? ? ? 1_555 B DC 4  N3 ? ? B DG 14 C DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog29 hydrog ? ? A DG 14 N2 ? ? ? 1_555 B DC 4  O2 ? ? B DG 14 C DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog30 hydrog ? ? A DG 14 O6 ? ? ? 1_555 B DC 4  N4 ? ? B DG 14 C DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog31 hydrog ? ? A DA 15 N1 ? ? ? 1_555 B DT 3  N3 ? ? B DA 15 C DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog32 hydrog ? ? A DA 15 N6 ? ? ? 1_555 B DT 3  O4 ? ? B DA 15 C DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 CYS 52  C . ? CYS 237 A PRO 53  C ? PRO 238 A 1 0.75  
2 GLU 253 C . ? GLU 438 A THR 254 C ? THR 439 A 1 -8.12 
3 SER 375 C . ? SER 560 A PRO 376 C ? PRO 561 A 1 2.40  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8  ? 
B ? 7  ? 
C ? 10 ? 
D ? 3  ? 
E ? 4  ? 
F ? 3  ? 
G ? 2  ? 
H ? 3  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2  ? anti-parallel 
A 2 3  ? anti-parallel 
A 3 4  ? anti-parallel 
A 4 5  ? anti-parallel 
A 5 6  ? anti-parallel 
A 6 7  ? anti-parallel 
A 7 8  ? anti-parallel 
B 1 2  ? anti-parallel 
B 2 3  ? anti-parallel 
B 3 4  ? anti-parallel 
B 4 5  ? anti-parallel 
B 5 6  ? anti-parallel 
B 6 7  ? anti-parallel 
C 1 2  ? anti-parallel 
C 2 3  ? anti-parallel 
C 3 4  ? anti-parallel 
C 4 5  ? anti-parallel 
C 5 6  ? anti-parallel 
C 6 7  ? anti-parallel 
C 7 8  ? anti-parallel 
C 8 9  ? anti-parallel 
C 9 10 ? anti-parallel 
D 1 2  ? parallel      
D 2 3  ? anti-parallel 
E 1 2  ? anti-parallel 
E 2 3  ? anti-parallel 
E 3 4  ? anti-parallel 
F 1 2  ? anti-parallel 
F 2 3  ? anti-parallel 
G 1 2  ? anti-parallel 
H 1 2  ? anti-parallel 
H 2 3  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU C 405 ? TRP C 408 ? LEU A 590 TRP A 593 
A 2  GLU C 452 ? ARG C 459 ? GLU A 637 ARG A 644 
A 3  VAL C 463 ? SER C 472 ? VAL A 648 SER A 657 
A 4  TRP C 351 ? GLU C 365 ? TRP A 536 GLU A 550 
A 5  THR C 205 ? ARG C 212 ? THR A 390 ARG A 397 
A 6  PHE C 240 ? PHE C 245 ? PHE A 425 PHE A 430 
A 7  ASN C 256 ? ARG C 260 ? ASN A 441 ARG A 445 
A 8  MET D 3   ? ASN D 5   ? MET D 939 ASN D 941 
B 1  ALA C 229 ? SER C 233 ? ALA A 414 SER A 418 
B 2  THR C 220 ? GLU C 226 ? THR A 405 GLU A 411 
B 3  THR C 205 ? ARG C 212 ? THR A 390 ARG A 397 
B 4  TRP C 351 ? GLU C 365 ? TRP A 536 GLU A 550 
B 5  CYS C 30  ? ALA C 37  ? CYS A 215 ALA A 222 
B 6  CYS C 56  ? ILE C 60  ? CYS A 241 ILE A 245 
B 7  ILE C 136 ? ALA C 141 ? ILE A 321 ALA A 326 
C 1  MET D 3   ? ASN D 5   ? MET D 939 ASN D 941 
C 2  ASN C 256 ? ARG C 260 ? ASN A 441 ARG A 445 
C 3  PHE C 240 ? PHE C 245 ? PHE A 425 PHE A 430 
C 4  VAL C 269 ? ASP C 274 ? VAL A 454 ASP A 459 
C 5  LEU C 284 ? LYS C 288 ? LEU A 469 LYS A 473 
C 6  HIS C 309 ? MET C 315 ? HIS A 494 MET A 500 
C 7  TRP C 351 ? GLU C 365 ? TRP A 536 GLU A 550 
C 8  THR C 205 ? ARG C 212 ? THR A 390 ARG A 397 
C 9  THR C 220 ? GLU C 226 ? THR A 405 GLU A 411 
C 10 ALA C 229 ? SER C 233 ? ALA A 414 SER A 418 
D 1  VAL C 39  ? GLN C 41  ? VAL A 224 GLN A 226 
D 2  ILE C 178 ? ILE C 181 ? ILE A 363 ILE A 366 
D 3  TYR C 155 ? PHE C 156 ? TYR A 340 PHE A 341 
E 1  GLN C 115 ? LEU C 117 ? GLN A 300 LEU A 302 
E 2  LEU C 101 ? GLY C 106 ? LEU A 286 GLY A 291 
E 3  ASN C 159 ? TYR C 164 ? ASN A 344 TYR A 349 
E 4  GLU C 169 ? VAL C 174 ? GLU A 354 VAL A 359 
F 1  GLN C 293 ? ILE C 295 ? GLN A 478 ILE A 480 
F 2  ARG C 342 ? GLN C 344 ? ARG A 527 GLN A 529 
F 3  THR C 336 ? ASN C 339 ? THR A 521 ASN A 524 
G 1  VAL C 321 ? SER C 326 ? VAL A 506 SER A 511 
G 2  LYS C 329 ? GLN C 334 ? LYS A 514 GLN A 519 
H 1  VAL C 379 ? ASP C 386 ? VAL A 564 ASP A 571 
H 2  ARG C 393 ? ARG C 399 ? ARG A 578 ARG A 584 
H 3  SER C 423 ? SER C 427 ? SER A 608 SER A 612 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2  N TRP C 408 ? N TRP A 593 O SER C 456 ? O SER A 641 
A 2 3  N LEU C 457 ? N LEU A 642 O TYR C 465 ? O TYR A 650 
A 3 4  O VAL C 464 ? O VAL A 649 N PHE C 364 ? N PHE A 549 
A 4 5  O ILE C 354 ? O ILE A 539 N ALA C 208 ? N ALA A 393 
A 5 6  N VAL C 207 ? N VAL A 392 O PHE C 240 ? O PHE A 425 
A 6 7  N LEU C 244 ? N LEU A 429 O ARG C 260 ? O ARG A 445 
A 7 8  N PHE C 257 ? N PHE A 442 O ILE D 4   ? O ILE D 940 
B 1 2  O HIS C 231 ? O HIS A 416 N HIS C 224 ? N HIS A 409 
B 2 3  O LEU C 223 ? O LEU A 408 N LEU C 209 ? N LEU A 394 
B 3 4  N ALA C 208 ? N ALA A 393 O ILE C 354 ? O ILE A 539 
B 4 5  O ASP C 357 ? O ASP A 542 N HIS C 36  ? N HIS A 221 
B 5 6  N PHE C 35  ? N PHE A 220 O CYS C 56  ? O CYS A 241 
B 6 7  N LEU C 59  ? N LEU A 244 O TYR C 137 ? O TYR A 322 
C 1 2  O ILE D 4   ? O ILE D 940 N PHE C 257 ? N PHE A 442 
C 2 3  O ARG C 260 ? O ARG A 445 N LEU C 244 ? N LEU A 429 
C 3 4  N THR C 241 ? N THR A 426 O VAL C 273 ? O VAL A 458 
C 4 5  N VAL C 270 ? N VAL A 455 O LEU C 284 ? O LEU A 469 
C 5 6  N ARG C 287 ? N ARG A 472 O ALA C 312 ? O ALA A 497 
C 6 7  N CYS C 311 ? N CYS A 496 O TRP C 351 ? O TRP A 536 
C 7 8  O ILE C 354 ? O ILE A 539 N ALA C 208 ? N ALA A 393 
C 8 9  N LEU C 209 ? N LEU A 394 O LEU C 223 ? O LEU A 408 
C 9 10 N HIS C 224 ? N HIS A 409 O HIS C 231 ? O HIS A 416 
D 1 2  N ALA C 40  ? N ALA A 225 O ILE C 181 ? O ILE A 366 
D 2 3  O ILE C 178 ? O ILE A 363 N PHE C 156 ? N PHE A 341 
E 1 2  O LEU C 117 ? O LEU A 302 N ALA C 103 ? N ALA A 288 
E 2 3  N VAL C 102 ? N VAL A 287 O PHE C 163 ? O PHE A 348 
E 3 4  N ALA C 160 ? N ALA A 345 O PHE C 173 ? O PHE A 358 
F 1 2  N VAL C 294 ? N VAL A 479 O HIS C 343 ? O HIS A 528 
F 2 3  O GLN C 344 ? O GLN A 529 N THR C 336 ? N THR A 521 
G 1 2  N TYR C 322 ? N TYR A 507 O HIS C 333 ? O HIS A 518 
H 1 2  N GLY C 381 ? N GLY A 566 O HIS C 397 ? O HIS A 582 
H 2 3  N VAL C 394 ? N VAL A 579 O CYS C 426 ? O CYS A 611 
# 
_atom_sites.entry_id                    3BRF 
_atom_sites.fract_transf_matrix[1][1]   0.015887 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010420 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004472 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DT  A 1 1   ? -14.099 19.527  63.846  1.00 48.05 ? 1   DT  B "O5'" 1 
ATOM   2    C "C5'" . DT  A 1 1   ? -13.313 18.405  63.488  1.00 48.20 ? 1   DT  B "C5'" 1 
ATOM   3    C "C4'" . DT  A 1 1   ? -14.117 17.540  62.537  1.00 48.66 ? 1   DT  B "C4'" 1 
ATOM   4    O "O4'" . DT  A 1 1   ? -13.950 18.029  61.180  1.00 47.92 ? 1   DT  B "O4'" 1 
ATOM   5    C "C3'" . DT  A 1 1   ? -13.777 16.045  62.508  1.00 48.65 ? 1   DT  B "C3'" 1 
ATOM   6    O "O3'" . DT  A 1 1   ? -14.934 15.271  62.820  1.00 49.54 ? 1   DT  B "O3'" 1 
ATOM   7    C "C2'" . DT  A 1 1   ? -13.385 15.829  61.054  1.00 48.63 ? 1   DT  B "C2'" 1 
ATOM   8    C "C1'" . DT  A 1 1   ? -14.261 16.904  60.418  1.00 47.58 ? 1   DT  B "C1'" 1 
ATOM   9    N N1    . DT  A 1 1   ? -14.088 17.086  58.944  1.00 47.81 ? 1   DT  B N1    1 
ATOM   10   C C2    . DT  A 1 1   ? -15.233 17.191  58.170  1.00 47.15 ? 1   DT  B C2    1 
ATOM   11   O O2    . DT  A 1 1   ? -16.369 17.183  58.613  1.00 46.71 ? 1   DT  B O2    1 
ATOM   12   N N3    . DT  A 1 1   ? -15.004 17.322  56.828  1.00 46.56 ? 1   DT  B N3    1 
ATOM   13   C C4    . DT  A 1 1   ? -13.790 17.345  56.176  1.00 47.41 ? 1   DT  B C4    1 
ATOM   14   O O4    . DT  A 1 1   ? -13.747 17.474  54.949  1.00 47.14 ? 1   DT  B O4    1 
ATOM   15   C C5    . DT  A 1 1   ? -12.625 17.223  57.046  1.00 47.46 ? 1   DT  B C5    1 
ATOM   16   C C7    . DT  A 1 1   ? -11.229 17.233  56.494  1.00 47.20 ? 1   DT  B C7    1 
ATOM   17   C C6    . DT  A 1 1   ? -12.826 17.097  58.368  1.00 47.40 ? 1   DT  B C6    1 
ATOM   18   P P     . DT  A 1 2   ? -14.855 13.721  63.265  1.00 50.55 ? 2   DT  B P     1 
ATOM   19   O OP1   . DT  A 1 2   ? -14.471 13.736  64.692  1.00 50.68 ? 2   DT  B OP1   1 
ATOM   20   O OP2   . DT  A 1 2   ? -14.089 12.930  62.272  1.00 49.49 ? 2   DT  B OP2   1 
ATOM   21   O "O5'" . DT  A 1 2   ? -16.378 13.242  63.163  1.00 50.24 ? 2   DT  B "O5'" 1 
ATOM   22   C "C5'" . DT  A 1 2   ? -17.433 14.218  63.328  1.00 48.50 ? 2   DT  B "C5'" 1 
ATOM   23   C "C4'" . DT  A 1 2   ? -18.559 14.050  62.311  1.00 46.41 ? 2   DT  B "C4'" 1 
ATOM   24   O "O4'" . DT  A 1 2   ? -18.184 14.597  61.019  1.00 44.44 ? 2   DT  B "O4'" 1 
ATOM   25   C "C3'" . DT  A 1 2   ? -19.015 12.607  62.081  1.00 45.16 ? 2   DT  B "C3'" 1 
ATOM   26   O "O3'" . DT  A 1 2   ? -20.406 12.569  62.325  1.00 46.41 ? 2   DT  B "O3'" 1 
ATOM   27   C "C2'" . DT  A 1 2   ? -18.686 12.327  60.621  1.00 43.97 ? 2   DT  B "C2'" 1 
ATOM   28   C "C1'" . DT  A 1 2   ? -18.645 13.722  60.008  1.00 43.44 ? 2   DT  B "C1'" 1 
ATOM   29   N N1    . DT  A 1 2   ? -17.718 13.829  58.834  1.00 43.85 ? 2   DT  B N1    1 
ATOM   30   C C2    . DT  A 1 2   ? -18.226 14.123  57.568  1.00 42.82 ? 2   DT  B C2    1 
ATOM   31   O O2    . DT  A 1 2   ? -19.414 14.311  57.330  1.00 41.71 ? 2   DT  B O2    1 
ATOM   32   N N3    . DT  A 1 2   ? -17.264 14.198  56.583  1.00 40.49 ? 2   DT  B N3    1 
ATOM   33   C C4    . DT  A 1 2   ? -15.904 14.009  56.729  1.00 41.23 ? 2   DT  B C4    1 
ATOM   34   O O4    . DT  A 1 2   ? -15.150 14.096  55.770  1.00 41.74 ? 2   DT  B O4    1 
ATOM   35   C C5    . DT  A 1 2   ? -15.442 13.702  58.069  1.00 42.04 ? 2   DT  B C5    1 
ATOM   36   C C7    . DT  A 1 2   ? -13.988 13.472  58.368  1.00 42.40 ? 2   DT  B C7    1 
ATOM   37   C C6    . DT  A 1 2   ? -16.359 13.628  59.041  1.00 42.86 ? 2   DT  B C6    1 
ATOM   38   P P     . DA  A 1 3   ? -21.273 11.223  62.303  1.00 48.03 ? 3   DA  B P     1 
ATOM   39   O OP1   . DA  A 1 3   ? -22.383 11.439  63.262  1.00 48.09 ? 3   DA  B OP1   1 
ATOM   40   O OP2   . DA  A 1 3   ? -20.381 10.046  62.428  1.00 47.21 ? 3   DA  B OP2   1 
ATOM   41   O "O5'" . DA  A 1 3   ? -21.854 11.196  60.818  1.00 46.76 ? 3   DA  B "O5'" 1 
ATOM   42   C "C5'" . DA  A 1 3   ? -22.621 12.281  60.269  1.00 44.91 ? 3   DA  B "C5'" 1 
ATOM   43   C "C4'" . DA  A 1 3   ? -23.215 11.842  58.926  1.00 44.13 ? 3   DA  B "C4'" 1 
ATOM   44   O "O4'" . DA  A 1 3   ? -22.296 12.110  57.834  1.00 40.94 ? 3   DA  B "O4'" 1 
ATOM   45   C "C3'" . DA  A 1 3   ? -23.594 10.362  58.803  1.00 43.37 ? 3   DA  B "C3'" 1 
ATOM   46   O "O3'" . DA  A 1 3   ? -24.874 10.291  58.179  1.00 45.10 ? 3   DA  B "O3'" 1 
ATOM   47   C "C2'" . DA  A 1 3   ? -22.460 9.764   57.972  1.00 42.03 ? 3   DA  B "C2'" 1 
ATOM   48   C "C1'" . DA  A 1 3   ? -22.046 10.944  57.087  1.00 40.29 ? 3   DA  B "C1'" 1 
ATOM   49   N N9    . DA  A 1 3   ? -20.631 10.994  56.709  1.00 40.06 ? 3   DA  B N9    1 
ATOM   50   C C8    . DA  A 1 3   ? -19.570 10.891  57.565  1.00 40.17 ? 3   DA  B C8    1 
ATOM   51   N N7    . DA  A 1 3   ? -18.396 10.965  56.984  1.00 40.67 ? 3   DA  B N7    1 
ATOM   52   C C5    . DA  A 1 3   ? -18.700 11.136  55.651  1.00 39.49 ? 3   DA  B C5    1 
ATOM   53   C C6    . DA  A 1 3   ? -17.883 11.304  54.525  1.00 38.30 ? 3   DA  B C6    1 
ATOM   54   N N6    . DA  A 1 3   ? -16.556 11.305  54.583  1.00 38.27 ? 3   DA  B N6    1 
ATOM   55   N N1    . DA  A 1 3   ? -18.487 11.461  53.337  1.00 39.05 ? 3   DA  B N1    1 
ATOM   56   C C2    . DA  A 1 3   ? -19.825 11.453  53.285  1.00 39.13 ? 3   DA  B C2    1 
ATOM   57   N N3    . DA  A 1 3   ? -20.699 11.326  54.282  1.00 38.59 ? 3   DA  B N3    1 
ATOM   58   C C4    . DA  A 1 3   ? -20.073 11.163  55.456  1.00 39.56 ? 3   DA  B C4    1 
ATOM   59   P P     . DC  A 1 4   ? -25.616 8.913   57.821  1.00 48.38 ? 4   DC  B P     1 
ATOM   60   O OP1   . DC  A 1 4   ? -27.056 9.265   57.808  1.00 48.03 ? 4   DC  B OP1   1 
ATOM   61   O OP2   . DC  A 1 4   ? -25.088 7.819   58.683  1.00 47.30 ? 4   DC  B OP2   1 
ATOM   62   O "O5'" . DC  A 1 4   ? -25.117 8.566   56.344  1.00 47.13 ? 4   DC  B "O5'" 1 
ATOM   63   C "C5'" . DC  A 1 4   ? -25.185 9.538   55.314  1.00 47.22 ? 4   DC  B "C5'" 1 
ATOM   64   C "C4'" . DC  A 1 4   ? -24.658 8.945   54.025  1.00 46.50 ? 4   DC  B "C4'" 1 
ATOM   65   O "O4'" . DC  A 1 4   ? -23.216 9.059   53.984  1.00 46.04 ? 4   DC  B "O4'" 1 
ATOM   66   C "C3'" . DC  A 1 4   ? -24.965 7.468   53.817  1.00 46.28 ? 4   DC  B "C3'" 1 
ATOM   67   O "O3'" . DC  A 1 4   ? -25.679 7.413   52.597  1.00 47.34 ? 4   DC  B "O3'" 1 
ATOM   68   C "C2'" . DC  A 1 4   ? -23.592 6.781   53.780  1.00 45.04 ? 4   DC  B "C2'" 1 
ATOM   69   C "C1'" . DC  A 1 4   ? -22.661 7.920   53.377  1.00 43.87 ? 4   DC  B "C1'" 1 
ATOM   70   N N1    . DC  A 1 4   ? -21.248 7.872   53.867  1.00 43.74 ? 4   DC  B N1    1 
ATOM   71   C C2    . DC  A 1 4   ? -20.191 8.063   52.955  1.00 44.68 ? 4   DC  B C2    1 
ATOM   72   O O2    . DC  A 1 4   ? -20.454 8.247   51.755  1.00 45.14 ? 4   DC  B O2    1 
ATOM   73   N N3    . DC  A 1 4   ? -18.898 8.043   53.403  1.00 43.37 ? 4   DC  B N3    1 
ATOM   74   C C4    . DC  A 1 4   ? -18.651 7.848   54.700  1.00 44.00 ? 4   DC  B C4    1 
ATOM   75   N N4    . DC  A 1 4   ? -17.374 7.838   55.095  1.00 42.98 ? 4   DC  B N4    1 
ATOM   76   C C5    . DC  A 1 4   ? -19.712 7.653   55.653  1.00 44.66 ? 4   DC  B C5    1 
ATOM   77   C C6    . DC  A 1 4   ? -20.975 7.679   55.200  1.00 44.24 ? 4   DC  B C6    1 
ATOM   78   P P     . DT  A 1 5   ? -26.201 6.058   51.943  1.00 47.80 ? 5   DT  B P     1 
ATOM   79   O OP1   . DT  A 1 5   ? -27.383 6.389   51.127  1.00 48.88 ? 5   DT  B OP1   1 
ATOM   80   O OP2   . DT  A 1 5   ? -26.257 4.959   52.930  1.00 49.87 ? 5   DT  B OP2   1 
ATOM   81   O "O5'" . DT  A 1 5   ? -24.965 5.695   51.005  1.00 48.71 ? 5   DT  B "O5'" 1 
ATOM   82   C "C5'" . DT  A 1 5   ? -24.551 6.502   49.899  1.00 45.89 ? 5   DT  B "C5'" 1 
ATOM   83   C "C4'" . DT  A 1 5   ? -23.570 5.688   49.081  1.00 44.31 ? 5   DT  B "C4'" 1 
ATOM   84   O "O4'" . DT  A 1 5   ? -22.288 5.614   49.744  1.00 42.54 ? 5   DT  B "O4'" 1 
ATOM   85   C "C3'" . DT  A 1 5   ? -23.965 4.231   48.894  1.00 44.76 ? 5   DT  B "C3'" 1 
ATOM   86   O "O3'" . DT  A 1 5   ? -23.855 4.006   47.512  1.00 45.08 ? 5   DT  B "O3'" 1 
ATOM   87   C "C2'" . DT  A 1 5   ? -22.977 3.402   49.724  1.00 41.29 ? 5   DT  B "C2'" 1 
ATOM   88   C "C1'" . DT  A 1 5   ? -21.763 4.312   49.684  1.00 39.90 ? 5   DT  B "C1'" 1 
ATOM   89   N N1    . DT  A 1 5   ? -20.806 4.339   50.838  1.00 39.97 ? 5   DT  B N1    1 
ATOM   90   C C2    . DT  A 1 5   ? -19.448 4.475   50.560  1.00 39.35 ? 5   DT  B C2    1 
ATOM   91   O O2    . DT  A 1 5   ? -18.985 4.526   49.412  1.00 39.77 ? 5   DT  B O2    1 
ATOM   92   N N3    . DT  A 1 5   ? -18.637 4.530   51.669  1.00 36.23 ? 5   DT  B N3    1 
ATOM   93   C C4    . DT  A 1 5   ? -19.035 4.492   52.980  1.00 38.43 ? 5   DT  B C4    1 
ATOM   94   O O4    . DT  A 1 5   ? -18.218 4.569   53.887  1.00 38.62 ? 5   DT  B O4    1 
ATOM   95   C C5    . DT  A 1 5   ? -20.470 4.355   53.202  1.00 40.15 ? 5   DT  B C5    1 
ATOM   96   C C7    . DT  A 1 5   ? -21.031 4.276   54.590  1.00 38.79 ? 5   DT  B C7    1 
ATOM   97   C C6    . DT  A 1 5   ? -21.283 4.303   52.134  1.00 38.99 ? 5   DT  B C6    1 
ATOM   98   P P     . DG  A 1 6   ? -24.476 2.718   46.835  1.00 43.53 ? 6   DG  B P     1 
ATOM   99   O OP1   . DG  A 1 6   ? -25.284 3.275   45.743  1.00 46.15 ? 6   DG  B OP1   1 
ATOM   100  O OP2   . DG  A 1 6   ? -25.010 1.748   47.817  1.00 40.64 ? 6   DG  B OP2   1 
ATOM   101  O "O5'" . DG  A 1 6   ? -23.114 2.143   46.230  1.00 44.77 ? 6   DG  B "O5'" 1 
ATOM   102  C "C5'" . DG  A 1 6   ? -23.011 0.880   45.619  1.00 39.92 ? 6   DG  B "C5'" 1 
ATOM   103  C "C4'" . DG  A 1 6   ? -21.594 0.799   45.085  1.00 37.21 ? 6   DG  B "C4'" 1 
ATOM   104  O "O4'" . DG  A 1 6   ? -20.626 1.410   45.994  1.00 35.47 ? 6   DG  B "O4'" 1 
ATOM   105  C "C3'" . DG  A 1 6   ? -21.102 -0.621  44.834  1.00 34.76 ? 6   DG  B "C3'" 1 
ATOM   106  O "O3'" . DG  A 1 6   ? -20.207 -0.510  43.751  1.00 31.14 ? 6   DG  B "O3'" 1 
ATOM   107  C "C2'" . DG  A 1 6   ? -20.400 -0.926  46.151  1.00 34.83 ? 6   DG  B "C2'" 1 
ATOM   108  C "C1'" . DG  A 1 6   ? -19.755 0.412   46.501  1.00 35.99 ? 6   DG  B "C1'" 1 
ATOM   109  N N9    . DG  A 1 6   ? -19.626 0.610   47.938  1.00 36.85 ? 6   DG  B N9    1 
ATOM   110  C C8    . DG  A 1 6   ? -20.657 0.580   48.860  1.00 36.56 ? 6   DG  B C8    1 
ATOM   111  N N7    . DG  A 1 6   ? -20.249 0.798   50.074  1.00 36.69 ? 6   DG  B N7    1 
ATOM   112  C C5    . DG  A 1 6   ? -18.868 0.962   49.955  1.00 36.15 ? 6   DG  B C5    1 
ATOM   113  C C6    . DG  A 1 6   ? -17.893 1.215   50.945  1.00 36.68 ? 6   DG  B C6    1 
ATOM   114  O O6    . DG  A 1 6   ? -18.065 1.357   52.169  1.00 36.86 ? 6   DG  B O6    1 
ATOM   115  N N1    . DG  A 1 6   ? -16.604 1.311   50.417  1.00 37.19 ? 6   DG  B N1    1 
ATOM   116  C C2    . DG  A 1 6   ? -16.296 1.188   49.080  1.00 36.87 ? 6   DG  B C2    1 
ATOM   117  N N2    . DG  A 1 6   ? -14.997 1.328   48.747  1.00 35.84 ? 6   DG  B N2    1 
ATOM   118  N N3    . DG  A 1 6   ? -17.210 0.944   48.148  1.00 35.17 ? 6   DG  B N3    1 
ATOM   119  C C4    . DG  A 1 6   ? -18.466 0.853   48.651  1.00 35.31 ? 6   DG  B C4    1 
ATOM   120  P P     . DT  A 1 7   ? -19.790 -1.723  42.836  1.00 33.44 ? 7   DT  B P     1 
ATOM   121  O OP1   . DT  A 1 7   ? -19.475 -1.172  41.507  1.00 33.34 ? 7   DT  B OP1   1 
ATOM   122  O OP2   . DT  A 1 7   ? -20.767 -2.843  42.984  1.00 34.99 ? 7   DT  B OP2   1 
ATOM   123  O "O5'" . DT  A 1 7   ? -18.462 -2.286  43.533  1.00 36.67 ? 7   DT  B "O5'" 1 
ATOM   124  C "C5'" . DT  A 1 7   ? -17.294 -1.493  43.692  1.00 36.71 ? 7   DT  B "C5'" 1 
ATOM   125  C "C4'" . DT  A 1 7   ? -16.283 -2.212  44.560  1.00 37.72 ? 7   DT  B "C4'" 1 
ATOM   126  O "O4'" . DT  A 1 7   ? -16.514 -1.781  45.928  1.00 38.77 ? 7   DT  B "O4'" 1 
ATOM   127  C "C3'" . DT  A 1 7   ? -16.334 -3.725  44.542  1.00 37.81 ? 7   DT  B "C3'" 1 
ATOM   128  O "O3'" . DT  A 1 7   ? -15.108 -4.281  44.041  1.00 42.59 ? 7   DT  B "O3'" 1 
ATOM   129  C "C2'" . DT  A 1 7   ? -16.551 -4.098  46.003  1.00 38.49 ? 7   DT  B "C2'" 1 
ATOM   130  C "C1'" . DT  A 1 7   ? -16.216 -2.837  46.790  1.00 38.64 ? 7   DT  B "C1'" 1 
ATOM   131  N N1    . DT  A 1 7   ? -17.007 -2.705  48.062  1.00 39.39 ? 7   DT  B N1    1 
ATOM   132  C C2    . DT  A 1 7   ? -16.312 -2.409  49.210  1.00 39.73 ? 7   DT  B C2    1 
ATOM   133  O O2    . DT  A 1 7   ? -15.116 -2.235  49.243  1.00 40.96 ? 7   DT  B O2    1 
ATOM   134  N N3    . DT  A 1 7   ? -17.052 -2.317  50.347  1.00 38.90 ? 7   DT  B N3    1 
ATOM   135  C C4    . DT  A 1 7   ? -18.386 -2.489  50.455  1.00 38.29 ? 7   DT  B C4    1 
ATOM   136  O O4    . DT  A 1 7   ? -18.898 -2.367  51.546  1.00 38.12 ? 7   DT  B O4    1 
ATOM   137  C C5    . DT  A 1 7   ? -19.095 -2.819  49.220  1.00 40.93 ? 7   DT  B C5    1 
ATOM   138  C C7    . DT  A 1 7   ? -20.596 -3.047  49.224  1.00 38.68 ? 7   DT  B C7    1 
ATOM   139  C C6    . DT  A 1 7   ? -18.370 -2.917  48.091  1.00 37.40 ? 7   DT  B C6    1 
ATOM   140  P P     . DG  A 1 8   ? -14.842 -5.890  43.960  1.00 45.88 ? 8   DG  B P     1 
ATOM   141  O OP1   . DG  A 1 8   ? -14.216 -6.202  42.651  1.00 44.95 ? 8   DG  B OP1   1 
ATOM   142  O OP2   . DG  A 1 8   ? -16.000 -6.672  44.450  1.00 40.39 ? 8   DG  B OP2   1 
ATOM   143  O "O5'" . DG  A 1 8   ? -13.722 -6.075  45.082  1.00 44.11 ? 8   DG  B "O5'" 1 
ATOM   144  C "C5'" . DG  A 1 8   ? -12.648 -5.181  45.257  1.00 41.32 ? 8   DG  B "C5'" 1 
ATOM   145  C "C4'" . DG  A 1 8   ? -11.873 -5.635  46.483  1.00 38.51 ? 8   DG  B "C4'" 1 
ATOM   146  O "O4'" . DG  A 1 8   ? -12.620 -5.286  47.662  1.00 38.91 ? 8   DG  B "O4'" 1 
ATOM   147  C "C3'" . DG  A 1 8   ? -11.629 -7.146  46.596  1.00 39.08 ? 8   DG  B "C3'" 1 
ATOM   148  O "O3'" . DG  A 1 8   ? -10.330 -7.330  47.143  1.00 38.55 ? 8   DG  B "O3'" 1 
ATOM   149  C "C2'" . DG  A 1 8   ? -12.714 -7.644  47.545  1.00 36.80 ? 8   DG  B "C2'" 1 
ATOM   150  C "C1'" . DG  A 1 8   ? -12.912 -6.428  48.444  1.00 37.73 ? 8   DG  B "C1'" 1 
ATOM   151  N N9    . DG  A 1 8   ? -14.260 -6.264  48.988  1.00 37.80 ? 8   DG  B N9    1 
ATOM   152  C C8    . DG  A 1 8   ? -15.460 -6.505  48.340  1.00 38.43 ? 8   DG  B C8    1 
ATOM   153  N N7    . DG  A 1 8   ? -16.518 -6.265  49.079  1.00 38.78 ? 8   DG  B N7    1 
ATOM   154  C C5    . DG  A 1 8   ? -15.992 -5.858  50.303  1.00 38.09 ? 8   DG  B C5    1 
ATOM   155  C C6    . DG  A 1 8   ? -16.658 -5.456  51.484  1.00 37.50 ? 8   DG  B C6    1 
ATOM   156  O O6    . DG  A 1 8   ? -17.887 -5.398  51.680  1.00 38.80 ? 8   DG  B O6    1 
ATOM   157  N N1    . DG  A 1 8   ? -15.772 -5.115  52.507  1.00 37.03 ? 8   DG  B N1    1 
ATOM   158  C C2    . DG  A 1 8   ? -14.384 -5.147  52.377  1.00 38.13 ? 8   DG  B C2    1 
ATOM   159  N N2    . DG  A 1 8   ? -13.660 -4.779  53.449  1.00 37.41 ? 8   DG  B N2    1 
ATOM   160  N N3    . DG  A 1 8   ? -13.749 -5.509  51.263  1.00 37.28 ? 8   DG  B N3    1 
ATOM   161  C C4    . DG  A 1 8   ? -14.605 -5.845  50.262  1.00 38.19 ? 8   DG  B C4    1 
ATOM   162  P P     . DG  A 1 9   ? -9.525  -8.691  47.202  1.00 37.25 ? 9   DG  B P     1 
ATOM   163  O OP1   . DG  A 1 9   ? -8.141  -8.264  46.903  1.00 40.27 ? 9   DG  B OP1   1 
ATOM   164  O OP2   . DG  A 1 9   ? -10.151 -9.817  46.481  1.00 38.42 ? 9   DG  B OP2   1 
ATOM   165  O "O5'" . DG  A 1 9   ? -9.629  -9.058  48.756  1.00 38.04 ? 9   DG  B "O5'" 1 
ATOM   166  C "C5'" . DG  A 1 9   ? -8.975  -8.167  49.648  1.00 39.64 ? 9   DG  B "C5'" 1 
ATOM   167  C "C4'" . DG  A 1 9   ? -9.354  -8.428  51.069  1.00 41.03 ? 9   DG  B "C4'" 1 
ATOM   168  O "O4'" . DG  A 1 9   ? -10.742 -8.051  51.218  1.00 43.09 ? 9   DG  B "O4'" 1 
ATOM   169  C "C3'" . DG  A 1 9   ? -9.220  -9.895  51.460  1.00 42.48 ? 9   DG  B "C3'" 1 
ATOM   170  O "O3'" . DG  A 1 9   ? -8.421  -9.908  52.631  1.00 45.03 ? 9   DG  B "O3'" 1 
ATOM   171  C "C2'" . DG  A 1 9   ? -10.645 -10.360 51.709  1.00 41.30 ? 9   DG  B "C2'" 1 
ATOM   172  C "C1'" . DG  A 1 9   ? -11.368 -9.050  51.979  1.00 40.90 ? 9   DG  B "C1'" 1 
ATOM   173  N N9    . DG  A 1 9   ? -12.791 -9.052  51.673  1.00 39.93 ? 9   DG  B N9    1 
ATOM   174  C C8    . DG  A 1 9   ? -13.434 -9.436  50.522  1.00 40.26 ? 9   DG  B C8    1 
ATOM   175  N N7    . DG  A 1 9   ? -14.740 -9.312  50.603  1.00 40.56 ? 9   DG  B N7    1 
ATOM   176  C C5    . DG  A 1 9   ? -14.958 -8.824  51.905  1.00 39.93 ? 9   DG  B C5    1 
ATOM   177  C C6    . DG  A 1 9   ? -16.146 -8.477  52.593  1.00 39.45 ? 9   DG  B C6    1 
ATOM   178  O O6    . DG  A 1 9   ? -17.292 -8.557  52.164  1.00 41.06 ? 9   DG  B O6    1 
ATOM   179  N N1    . DG  A 1 9   ? -15.939 -8.006  53.897  1.00 40.00 ? 9   DG  B N1    1 
ATOM   180  C C2    . DG  A 1 9   ? -14.672 -7.873  54.471  1.00 40.38 ? 9   DG  B C2    1 
ATOM   181  N N2    . DG  A 1 9   ? -14.591 -7.409  55.731  1.00 39.21 ? 9   DG  B N2    1 
ATOM   182  N N3    . DG  A 1 9   ? -13.553 -8.192  53.828  1.00 38.66 ? 9   DG  B N3    1 
ATOM   183  C C4    . DG  A 1 9   ? -13.764 -8.658  52.567  1.00 39.47 ? 9   DG  B C4    1 
ATOM   184  P P     . DG  A 1 10  ? -7.774  -11.215 53.267  1.00 45.90 ? 10  DG  B P     1 
ATOM   185  O OP1   . DG  A 1 10  ? -6.338  -10.879 53.376  1.00 47.65 ? 10  DG  B OP1   1 
ATOM   186  O OP2   . DG  A 1 10  ? -8.245  -12.440 52.604  1.00 47.07 ? 10  DG  B OP2   1 
ATOM   187  O "O5'" . DG  A 1 10  ? -8.428  -11.268 54.737  1.00 43.12 ? 10  DG  B "O5'" 1 
ATOM   188  C "C5'" . DG  A 1 10  ? -8.516  -10.046 55.541  1.00 39.24 ? 10  DG  B "C5'" 1 
ATOM   189  C "C4'" . DG  A 1 10  ? -9.483  -10.263 56.694  1.00 37.21 ? 10  DG  B "C4'" 1 
ATOM   190  O "O4'" . DG  A 1 10  ? -10.891 -10.124 56.278  1.00 33.54 ? 10  DG  B "O4'" 1 
ATOM   191  C "C3'" . DG  A 1 10  ? -9.361  -11.648 57.322  1.00 36.10 ? 10  DG  B "C3'" 1 
ATOM   192  O "O3'" . DG  A 1 10  ? -9.392  -11.444 58.738  1.00 38.25 ? 10  DG  B "O3'" 1 
ATOM   193  C "C2'" . DG  A 1 10  ? -10.567 -12.422 56.758  1.00 34.91 ? 10  DG  B "C2'" 1 
ATOM   194  C "C1'" . DG  A 1 10  ? -11.593 -11.300 56.605  1.00 33.60 ? 10  DG  B "C1'" 1 
ATOM   195  N N9    . DG  A 1 10  ? -12.665 -11.462 55.615  1.00 34.42 ? 10  DG  B N9    1 
ATOM   196  C C8    . DG  A 1 10  ? -12.553 -11.856 54.296  1.00 33.76 ? 10  DG  B C8    1 
ATOM   197  N N7    . DG  A 1 10  ? -13.729 -11.865 53.677  1.00 35.03 ? 10  DG  B N7    1 
ATOM   198  C C5    . DG  A 1 10  ? -14.659 -11.451 54.653  1.00 33.49 ? 10  DG  B C5    1 
ATOM   199  C C6    . DG  A 1 10  ? -16.078 -11.280 54.596  1.00 33.61 ? 10  DG  B C6    1 
ATOM   200  O O6    . DG  A 1 10  ? -16.829 -11.437 53.630  1.00 33.99 ? 10  DG  B O6    1 
ATOM   201  N N1    . DG  A 1 10  ? -16.656 -10.859 55.791  1.00 32.74 ? 10  DG  B N1    1 
ATOM   202  C C2    . DG  A 1 10  ? -15.949 -10.618 56.943  1.00 32.97 ? 10  DG  B C2    1 
ATOM   203  N N2    . DG  A 1 10  ? -16.676 -10.212 58.002  1.00 30.81 ? 10  DG  B N2    1 
ATOM   204  N N3    . DG  A 1 10  ? -14.607 -10.775 56.997  1.00 33.25 ? 10  DG  B N3    1 
ATOM   205  C C4    . DG  A 1 10  ? -14.024 -11.188 55.835  1.00 32.16 ? 10  DG  B C4    1 
ATOM   206  P P     . DA  A 1 11  ? -9.385  -12.642 59.798  1.00 40.74 ? 11  DA  B P     1 
ATOM   207  O OP1   . DA  A 1 11  ? -8.414  -12.290 60.850  1.00 41.88 ? 11  DA  B OP1   1 
ATOM   208  O OP2   . DA  A 1 11  ? -9.247  -13.924 59.085  1.00 41.99 ? 11  DA  B OP2   1 
ATOM   209  O "O5'" . DA  A 1 11  ? -10.886 -12.630 60.398  1.00 42.89 ? 11  DA  B "O5'" 1 
ATOM   210  C "C5'" . DA  A 1 11  ? -11.481 -11.513 61.097  1.00 40.40 ? 11  DA  B "C5'" 1 
ATOM   211  C "C4'" . DA  A 1 11  ? -12.813 -11.944 61.700  1.00 41.04 ? 11  DA  B "C4'" 1 
ATOM   212  O "O4'" . DA  A 1 11  ? -13.883 -12.042 60.671  1.00 40.02 ? 11  DA  B "O4'" 1 
ATOM   213  C "C3'" . DA  A 1 11  ? -12.766 -13.275 62.458  1.00 40.12 ? 11  DA  B "C3'" 1 
ATOM   214  O "O3'" . DA  A 1 11  ? -13.394 -13.170 63.766  1.00 39.52 ? 11  DA  B "O3'" 1 
ATOM   215  C "C2'" . DA  A 1 11  ? -13.507 -14.237 61.521  1.00 40.94 ? 11  DA  B "C2'" 1 
ATOM   216  C "C1'" . DA  A 1 11  ? -14.419 -13.345 60.662  1.00 39.03 ? 11  DA  B "C1'" 1 
ATOM   217  N N9    . DA  A 1 11  ? -14.554 -13.751 59.258  1.00 39.89 ? 11  DA  B N9    1 
ATOM   218  C C8    . DA  A 1 11  ? -13.543 -14.135 58.412  1.00 37.85 ? 11  DA  B C8    1 
ATOM   219  N N7    . DA  A 1 11  ? -13.980 -14.410 57.205  1.00 38.87 ? 11  DA  B N7    1 
ATOM   220  C C5    . DA  A 1 11  ? -15.362 -14.202 57.246  1.00 39.10 ? 11  DA  B C5    1 
ATOM   221  C C6    . DA  A 1 11  ? -16.419 -14.330 56.296  1.00 38.92 ? 11  DA  B C6    1 
ATOM   222  N N6    . DA  A 1 11  ? -16.271 -14.724 55.030  1.00 38.58 ? 11  DA  B N6    1 
ATOM   223  N N1    . DA  A 1 11  ? -17.675 -14.044 56.693  1.00 37.95 ? 11  DA  B N1    1 
ATOM   224  C C2    . DA  A 1 11  ? -17.874 -13.654 57.949  1.00 37.90 ? 11  DA  B C2    1 
ATOM   225  N N3    . DA  A 1 11  ? -16.968 -13.495 58.910  1.00 39.27 ? 11  DA  B N3    1 
ATOM   226  C C4    . DA  A 1 11  ? -15.727 -13.792 58.509  1.00 38.14 ? 11  DA  B C4    1 
ATOM   227  P P     . DA  A 1 12  ? -13.619 -14.450 64.728  1.00 38.81 ? 12  DA  B P     1 
ATOM   228  O OP1   . DA  A 1 12  ? -13.563 -13.960 66.095  1.00 38.37 ? 12  DA  B OP1   1 
ATOM   229  O OP2   . DA  A 1 12  ? -12.793 -15.583 64.291  1.00 40.26 ? 12  DA  B OP2   1 
ATOM   230  O "O5'" . DA  A 1 12  ? -15.109 -14.989 64.419  1.00 42.23 ? 12  DA  B "O5'" 1 
ATOM   231  C "C5'" . DA  A 1 12  ? -16.279 -14.177 64.320  1.00 40.75 ? 12  DA  B "C5'" 1 
ATOM   232  C "C4'" . DA  A 1 12  ? -17.473 -15.014 63.881  1.00 40.88 ? 12  DA  B "C4'" 1 
ATOM   233  O "O4'" . DA  A 1 12  ? -17.428 -15.263 62.448  1.00 40.80 ? 12  DA  B "O4'" 1 
ATOM   234  C "C3'" . DA  A 1 12  ? -17.572 -16.384 64.547  1.00 41.97 ? 12  DA  B "C3'" 1 
ATOM   235  O "O3'" . DA  A 1 12  ? -18.871 -16.497 65.145  1.00 44.31 ? 12  DA  B "O3'" 1 
ATOM   236  C "C2'" . DA  A 1 12  ? -17.315 -17.413 63.436  1.00 40.39 ? 12  DA  B "C2'" 1 
ATOM   237  C "C1'" . DA  A 1 12  ? -17.708 -16.639 62.184  1.00 38.50 ? 12  DA  B "C1'" 1 
ATOM   238  N N9    . DA  A 1 12  ? -17.009 -16.929 60.929  1.00 38.58 ? 12  DA  B N9    1 
ATOM   239  C C8    . DA  A 1 12  ? -15.677 -17.129 60.738  1.00 37.48 ? 12  DA  B C8    1 
ATOM   240  N N7    . DA  A 1 12  ? -15.363 -17.322 59.480  1.00 38.56 ? 12  DA  B N7    1 
ATOM   241  C C5    . DA  A 1 12  ? -16.545 -17.230 58.773  1.00 37.93 ? 12  DA  B C5    1 
ATOM   242  C C6    . DA  A 1 12  ? -16.910 -17.331 57.405  1.00 36.39 ? 12  DA  B C6    1 
ATOM   243  N N6    . DA  A 1 12  ? -16.116 -17.551 56.386  1.00 36.20 ? 12  DA  B N6    1 
ATOM   244  N N1    . DA  A 1 12  ? -18.203 -17.210 57.082  1.00 37.13 ? 12  DA  B N1    1 
ATOM   245  C C2    . DA  A 1 12  ? -19.073 -16.961 58.058  1.00 37.12 ? 12  DA  B C2    1 
ATOM   246  N N3    . DA  A 1 12  ? -18.859 -16.822 59.361  1.00 37.16 ? 12  DA  B N3    1 
ATOM   247  C C4    . DA  A 1 12  ? -17.572 -16.982 59.669  1.00 39.01 ? 12  DA  B C4    1 
ATOM   248  P P     . DA  A 1 13  ? -19.304 -17.819 65.947  1.00 45.55 ? 13  DA  B P     1 
ATOM   249  O OP1   . DA  A 1 13  ? -20.095 -17.425 67.127  1.00 43.56 ? 13  DA  B OP1   1 
ATOM   250  O OP2   . DA  A 1 13  ? -18.101 -18.671 66.109  1.00 45.48 ? 13  DA  B OP2   1 
ATOM   251  O "O5'" . DA  A 1 13  ? -20.273 -18.551 64.897  1.00 43.82 ? 13  DA  B "O5'" 1 
ATOM   252  C "C5'" . DA  A 1 13  ? -21.217 -17.820 64.134  1.00 43.47 ? 13  DA  B "C5'" 1 
ATOM   253  C "C4'" . DA  A 1 13  ? -21.761 -18.694 63.021  1.00 44.38 ? 13  DA  B "C4'" 1 
ATOM   254  O "O4'" . DA  A 1 13  ? -20.803 -18.862 61.943  1.00 44.59 ? 13  DA  B "O4'" 1 
ATOM   255  C "C3'" . DA  A 1 13  ? -22.122 -20.102 63.454  1.00 45.88 ? 13  DA  B "C3'" 1 
ATOM   256  O "O3'" . DA  A 1 13  ? -23.465 -20.230 63.024  1.00 47.86 ? 13  DA  B "O3'" 1 
ATOM   257  C "C2'" . DA  A 1 13  ? -21.099 -21.008 62.745  1.00 44.64 ? 13  DA  B "C2'" 1 
ATOM   258  C "C1'" . DA  A 1 13  ? -20.784 -20.200 61.494  1.00 42.44 ? 13  DA  B "C1'" 1 
ATOM   259  N N9    . DA  A 1 13  ? -19.503 -20.335 60.786  1.00 42.32 ? 13  DA  B N9    1 
ATOM   260  C C8    . DA  A 1 13  ? -18.244 -20.397 61.318  1.00 41.87 ? 13  DA  B C8    1 
ATOM   261  N N7    . DA  A 1 13  ? -17.281 -20.464 60.417  1.00 41.97 ? 13  DA  B N7    1 
ATOM   262  C C5    . DA  A 1 13  ? -17.947 -20.424 59.204  1.00 41.61 ? 13  DA  B C5    1 
ATOM   263  C C6    . DA  A 1 13  ? -17.502 -20.469 57.865  1.00 40.27 ? 13  DA  B C6    1 
ATOM   264  N N6    . DA  A 1 13  ? -16.219 -20.556 57.526  1.00 39.78 ? 13  DA  B N6    1 
ATOM   265  N N1    . DA  A 1 13  ? -18.440 -20.428 56.884  1.00 41.15 ? 13  DA  B N1    1 
ATOM   266  C C2    . DA  A 1 13  ? -19.736 -20.339 57.219  1.00 41.27 ? 13  DA  B C2    1 
ATOM   267  N N3    . DA  A 1 13  ? -20.270 -20.299 58.446  1.00 41.63 ? 13  DA  B N3    1 
ATOM   268  C C4    . DA  A 1 13  ? -19.321 -20.341 59.408  1.00 42.45 ? 13  DA  B C4    1 
ATOM   269  P P     . DG  A 1 14  ? -24.353 -21.500 63.356  1.00 49.54 ? 14  DG  B P     1 
ATOM   270  O OP1   . DG  A 1 14  ? -25.575 -21.005 64.027  1.00 49.55 ? 14  DG  B OP1   1 
ATOM   271  O OP2   . DG  A 1 14  ? -23.503 -22.557 63.976  1.00 48.41 ? 14  DG  B OP2   1 
ATOM   272  O "O5'" . DG  A 1 14  ? -24.767 -21.995 61.885  1.00 49.02 ? 14  DG  B "O5'" 1 
ATOM   273  C "C5'" . DG  A 1 14  ? -24.276 -21.338 60.709  1.00 48.46 ? 14  DG  B "C5'" 1 
ATOM   274  C "C4'" . DG  A 1 14  ? -24.292 -22.230 59.473  1.00 46.77 ? 14  DG  B "C4'" 1 
ATOM   275  O "O4'" . DG  A 1 14  ? -22.980 -22.286 58.867  1.00 46.04 ? 14  DG  B "O4'" 1 
ATOM   276  C "C3'" . DG  A 1 14  ? -24.724 -23.678 59.670  1.00 46.57 ? 14  DG  B "C3'" 1 
ATOM   277  O "O3'" . DG  A 1 14  ? -25.649 -23.919 58.594  1.00 46.67 ? 14  DG  B "O3'" 1 
ATOM   278  C "C2'" . DG  A 1 14  ? -23.414 -24.474 59.629  1.00 45.14 ? 14  DG  B "C2'" 1 
ATOM   279  C "C1'" . DG  A 1 14  ? -22.551 -23.631 58.695  1.00 43.81 ? 14  DG  B "C1'" 1 
ATOM   280  N N9    . DG  A 1 14  ? -21.088 -23.671 58.918  1.00 44.03 ? 14  DG  B N9    1 
ATOM   281  C C8    . DG  A 1 14  ? -20.434 -23.615 60.129  1.00 43.17 ? 14  DG  B C8    1 
ATOM   282  N N7    . DG  A 1 14  ? -19.129 -23.653 60.029  1.00 43.59 ? 14  DG  B N7    1 
ATOM   283  C C5    . DG  A 1 14  ? -18.888 -23.734 58.666  1.00 43.15 ? 14  DG  B C5    1 
ATOM   284  C C6    . DG  A 1 14  ? -17.657 -23.802 57.966  1.00 42.84 ? 14  DG  B C6    1 
ATOM   285  O O6    . DG  A 1 14  ? -16.508 -23.798 58.426  1.00 42.19 ? 14  DG  B O6    1 
ATOM   286  N N1    . DG  A 1 14  ? -17.853 -23.875 56.589  1.00 42.70 ? 14  DG  B N1    1 
ATOM   287  C C2    . DG  A 1 14  ? -19.077 -23.884 55.975  1.00 42.39 ? 14  DG  B C2    1 
ATOM   288  N N2    . DG  A 1 14  ? -19.064 -23.971 54.651  1.00 42.13 ? 14  DG  B N2    1 
ATOM   289  N N3    . DG  A 1 14  ? -20.237 -23.809 56.613  1.00 43.12 ? 14  DG  B N3    1 
ATOM   290  C C4    . DG  A 1 14  ? -20.077 -23.739 57.962  1.00 43.57 ? 14  DG  B C4    1 
ATOM   291  P P     . DA  A 1 15  ? -26.369 -25.303 58.237  1.00 45.97 ? 15  DA  B P     1 
ATOM   292  O OP1   . DA  A 1 15  ? -27.826 -25.051 58.296  1.00 47.12 ? 15  DA  B OP1   1 
ATOM   293  O OP2   . DA  A 1 15  ? -25.798 -26.449 58.997  1.00 45.72 ? 15  DA  B OP2   1 
ATOM   294  O "O5'" . DA  A 1 15  ? -25.968 -25.449 56.691  1.00 45.84 ? 15  DA  B "O5'" 1 
ATOM   295  C "C5'" . DA  A 1 15  ? -24.651 -25.179 56.198  1.00 44.85 ? 15  DA  B "C5'" 1 
ATOM   296  C "C4'" . DA  A 1 15  ? -24.189 -26.306 55.291  1.00 44.03 ? 15  DA  B "C4'" 1 
ATOM   297  O "O4'" . DA  A 1 15  ? -22.741 -26.350 55.257  1.00 43.51 ? 15  DA  B "O4'" 1 
ATOM   298  C "C3'" . DA  A 1 15  ? -24.676 -27.691 55.701  1.00 43.11 ? 15  DA  B "C3'" 1 
ATOM   299  O "O3'" . DA  A 1 15  ? -25.216 -28.319 54.564  1.00 44.17 ? 15  DA  B "O3'" 1 
ATOM   300  C "C2'" . DA  A 1 15  ? -23.446 -28.441 56.192  1.00 42.47 ? 15  DA  B "C2'" 1 
ATOM   301  C "C1'" . DA  A 1 15  ? -22.282 -27.641 55.629  1.00 42.17 ? 15  DA  B "C1'" 1 
ATOM   302  N N9    . DA  A 1 15  ? -21.192 -27.484 56.595  1.00 42.14 ? 15  DA  B N9    1 
ATOM   303  C C8    . DA  A 1 15  ? -21.284 -27.434 57.961  1.00 41.56 ? 15  DA  B C8    1 
ATOM   304  N N7    . DA  A 1 15  ? -20.132 -27.293 58.563  1.00 41.52 ? 15  DA  B N7    1 
ATOM   305  C C5    . DA  A 1 15  ? -19.213 -27.252 57.526  1.00 41.84 ? 15  DA  B C5    1 
ATOM   306  C C6    . DA  A 1 15  ? -17.800 -27.121 57.499  1.00 41.47 ? 15  DA  B C6    1 
ATOM   307  N N6    . DA  A 1 15  ? -17.042 -26.991 58.594  1.00 40.92 ? 15  DA  B N6    1 
ATOM   308  N N1    . DA  A 1 15  ? -17.196 -27.112 56.289  1.00 41.13 ? 15  DA  B N1    1 
ATOM   309  C C2    . DA  A 1 15  ? -17.959 -27.238 55.186  1.00 41.76 ? 15  DA  B C2    1 
ATOM   310  N N3    . DA  A 1 15  ? -19.289 -27.370 55.078  1.00 40.73 ? 15  DA  B N3    1 
ATOM   311  C C4    . DA  A 1 15  ? -19.856 -27.364 56.299  1.00 41.71 ? 15  DA  B C4    1 
ATOM   312  O "O5'" . DA  B 2 1   ? -9.354  -34.048 63.950  1.00 40.67 ? 1   DA  C "O5'" 1 
ATOM   313  C "C5'" . DA  B 2 1   ? -10.150 -33.892 62.781  1.00 39.15 ? 1   DA  C "C5'" 1 
ATOM   314  C "C4'" . DA  B 2 1   ? -9.210  -33.862 61.594  1.00 38.91 ? 1   DA  C "C4'" 1 
ATOM   315  O "O4'" . DA  B 2 1   ? -9.915  -34.326 60.416  1.00 37.88 ? 1   DA  C "O4'" 1 
ATOM   316  C "C3'" . DA  B 2 1   ? -8.705  -32.470 61.250  1.00 39.39 ? 1   DA  C "C3'" 1 
ATOM   317  O "O3'" . DA  B 2 1   ? -7.443  -32.535 60.588  1.00 41.82 ? 1   DA  C "O3'" 1 
ATOM   318  C "C2'" . DA  B 2 1   ? -9.786  -31.984 60.308  1.00 37.86 ? 1   DA  C "C2'" 1 
ATOM   319  C "C1'" . DA  B 2 1   ? -10.132 -33.248 59.533  1.00 35.33 ? 1   DA  C "C1'" 1 
ATOM   320  N N9    . DA  B 2 1   ? -11.517 -33.272 59.079  1.00 33.66 ? 1   DA  C N9    1 
ATOM   321  C C8    . DA  B 2 1   ? -11.923 -33.433 57.788  1.00 33.22 ? 1   DA  C C8    1 
ATOM   322  N N7    . DA  B 2 1   ? -13.223 -33.419 57.647  1.00 34.21 ? 1   DA  C N7    1 
ATOM   323  C C5    . DA  B 2 1   ? -13.703 -33.229 58.925  1.00 33.25 ? 1   DA  C C5    1 
ATOM   324  C C6    . DA  B 2 1   ? -15.009 -33.126 59.436  1.00 33.61 ? 1   DA  C C6    1 
ATOM   325  N N6    . DA  B 2 1   ? -16.091 -33.207 58.663  1.00 33.65 ? 1   DA  C N6    1 
ATOM   326  N N1    . DA  B 2 1   ? -15.159 -32.933 60.769  1.00 33.60 ? 1   DA  C N1    1 
ATOM   327  C C2    . DA  B 2 1   ? -14.059 -32.868 61.531  1.00 33.91 ? 1   DA  C C2    1 
ATOM   328  N N3    . DA  B 2 1   ? -12.776 -32.969 61.162  1.00 33.38 ? 1   DA  C N3    1 
ATOM   329  C C4    . DA  B 2 1   ? -12.662 -33.143 59.831  1.00 32.94 ? 1   DA  C C4    1 
ATOM   330  P P     . DA  B 2 2   ? -6.632  -31.194 60.277  1.00 42.50 ? 2   DA  C P     1 
ATOM   331  O OP1   . DA  B 2 2   ? -5.207  -31.585 60.168  1.00 42.12 ? 2   DA  C OP1   1 
ATOM   332  O OP2   . DA  B 2 2   ? -7.071  -30.161 61.240  1.00 41.38 ? 2   DA  C OP2   1 
ATOM   333  O "O5'" . DA  B 2 2   ? -7.162  -30.770 58.831  1.00 44.16 ? 2   DA  C "O5'" 1 
ATOM   334  C "C5'" . DA  B 2 2   ? -6.973  -31.690 57.743  1.00 46.04 ? 2   DA  C "C5'" 1 
ATOM   335  C "C4'" . DA  B 2 2   ? -7.795  -31.262 56.545  1.00 46.82 ? 2   DA  C "C4'" 1 
ATOM   336  O "O4'" . DA  B 2 2   ? -9.203  -31.344 56.869  1.00 47.52 ? 2   DA  C "O4'" 1 
ATOM   337  C "C3'" . DA  B 2 2   ? -7.541  -29.832 56.100  1.00 46.72 ? 2   DA  C "C3'" 1 
ATOM   338  O "O3'" . DA  B 2 2   ? -7.297  -29.856 54.713  1.00 46.35 ? 2   DA  C "O3'" 1 
ATOM   339  C "C2'" . DA  B 2 2   ? -8.820  -29.070 56.435  1.00 46.44 ? 2   DA  C "C2'" 1 
ATOM   340  C "C1'" . DA  B 2 2   ? -9.866  -30.170 56.444  1.00 48.29 ? 2   DA  C "C1'" 1 
ATOM   341  N N9    . DA  B 2 2   ? -10.923 -29.944 57.420  1.00 48.45 ? 2   DA  C N9    1 
ATOM   342  C C8    . DA  B 2 2   ? -10.801 -29.618 58.751  1.00 49.15 ? 2   DA  C C8    1 
ATOM   343  N N7    . DA  B 2 2   ? -11.938 -29.503 59.396  1.00 48.88 ? 2   DA  C N7    1 
ATOM   344  C C5    . DA  B 2 2   ? -12.861 -29.765 58.407  1.00 48.46 ? 2   DA  C C5    1 
ATOM   345  C C6    . DA  B 2 2   ? -14.266 -29.789 58.432  1.00 48.72 ? 2   DA  C C6    1 
ATOM   346  N N6    . DA  B 2 2   ? -14.989 -29.542 59.527  1.00 48.13 ? 2   DA  C N6    1 
ATOM   347  N N1    . DA  B 2 2   ? -14.887 -30.093 57.268  1.00 49.75 ? 2   DA  C N1    1 
ATOM   348  C C2    . DA  B 2 2   ? -14.136 -30.348 56.168  1.00 49.32 ? 2   DA  C C2    1 
ATOM   349  N N3    . DA  B 2 2   ? -12.809 -30.360 56.019  1.00 48.17 ? 2   DA  C N3    1 
ATOM   350  C C4    . DA  B 2 2   ? -12.246 -30.044 57.189  1.00 47.73 ? 2   DA  C C4    1 
ATOM   351  P P     . DT  B 2 3   ? -6.900  -28.523 53.923  1.00 46.95 ? 3   DT  C P     1 
ATOM   352  O OP1   . DT  B 2 3   ? -5.834  -29.005 53.012  1.00 45.96 ? 3   DT  C OP1   1 
ATOM   353  O OP2   . DT  B 2 3   ? -6.685  -27.377 54.850  1.00 45.43 ? 3   DT  C OP2   1 
ATOM   354  O "O5'" . DT  B 2 3   ? -8.205  -28.098 53.108  1.00 44.31 ? 3   DT  C "O5'" 1 
ATOM   355  C "C5'" . DT  B 2 3   ? -9.027  -29.056 52.456  1.00 43.60 ? 3   DT  C "C5'" 1 
ATOM   356  C "C4'" . DT  B 2 3   ? -10.376 -28.421 52.182  1.00 43.46 ? 3   DT  C "C4'" 1 
ATOM   357  O "O4'" . DT  B 2 3   ? -11.181 -28.355 53.388  1.00 41.88 ? 3   DT  C "O4'" 1 
ATOM   358  C "C3'" . DT  B 2 3   ? -10.262 -26.991 51.664  1.00 43.31 ? 3   DT  C "C3'" 1 
ATOM   359  O "O3'" . DT  B 2 3   ? -10.731 -27.008 50.318  1.00 44.67 ? 3   DT  C "O3'" 1 
ATOM   360  C "C2'" . DT  B 2 3   ? -11.079 -26.146 52.650  1.00 42.67 ? 3   DT  C "C2'" 1 
ATOM   361  C "C1'" . DT  B 2 3   ? -11.972 -27.187 53.326  1.00 42.05 ? 3   DT  C "C1'" 1 
ATOM   362  N N1    . DT  B 2 3   ? -12.543 -26.949 54.716  1.00 41.90 ? 3   DT  C N1    1 
ATOM   363  C C2    . DT  B 2 3   ? -13.917 -27.112 54.897  1.00 42.85 ? 3   DT  C C2    1 
ATOM   364  O O2    . DT  B 2 3   ? -14.700 -27.390 53.995  1.00 43.30 ? 3   DT  C O2    1 
ATOM   365  N N3    . DT  B 2 3   ? -14.389 -26.926 56.176  1.00 41.66 ? 3   DT  C N3    1 
ATOM   366  C C4    . DT  B 2 3   ? -13.661 -26.579 57.295  1.00 42.57 ? 3   DT  C C4    1 
ATOM   367  O O4    . DT  B 2 3   ? -14.208 -26.441 58.408  1.00 42.03 ? 3   DT  C O4    1 
ATOM   368  C C5    . DT  B 2 3   ? -12.228 -26.429 57.052  1.00 42.77 ? 3   DT  C C5    1 
ATOM   369  C C7    . DT  B 2 3   ? -11.319 -26.076 58.199  1.00 42.12 ? 3   DT  C C7    1 
ATOM   370  C C6    . DT  B 2 3   ? -11.741 -26.614 55.799  1.00 41.54 ? 3   DT  C C6    1 
ATOM   371  P P     . DC  B 2 4   ? -10.515 -25.805 49.263  1.00 46.29 ? 4   DC  C P     1 
ATOM   372  O OP1   . DC  B 2 4   ? -10.113 -26.422 47.982  1.00 45.06 ? 4   DC  C OP1   1 
ATOM   373  O OP2   . DC  B 2 4   ? -9.690  -24.735 49.868  1.00 46.58 ? 4   DC  C OP2   1 
ATOM   374  O "O5'" . DC  B 2 4   ? -12.017 -25.237 49.152  1.00 43.61 ? 4   DC  C "O5'" 1 
ATOM   375  C "C5'" . DC  B 2 4   ? -13.096 -26.184 49.096  1.00 43.33 ? 4   DC  C "C5'" 1 
ATOM   376  C "C4'" . DC  B 2 4   ? -14.431 -25.510 49.322  1.00 43.46 ? 4   DC  C "C4'" 1 
ATOM   377  O "O4'" . DC  B 2 4   ? -14.740 -25.490 50.736  1.00 41.97 ? 4   DC  C "O4'" 1 
ATOM   378  C "C3'" . DC  B 2 4   ? -14.486 -24.062 48.831  1.00 44.26 ? 4   DC  C "C3'" 1 
ATOM   379  O "O3'" . DC  B 2 4   ? -15.653 -23.921 48.015  1.00 45.32 ? 4   DC  C "O3'" 1 
ATOM   380  C "C2'" . DC  B 2 4   ? -14.483 -23.253 50.127  1.00 42.83 ? 4   DC  C "C2'" 1 
ATOM   381  C "C1'" . DC  B 2 4   ? -15.152 -24.205 51.102  1.00 41.19 ? 4   DC  C "C1'" 1 
ATOM   382  N N1    . DC  B 2 4   ? -14.845 -23.982 52.549  1.00 41.58 ? 4   DC  C N1    1 
ATOM   383  C C2    . DC  B 2 4   ? -15.906 -24.168 53.452  1.00 41.66 ? 4   DC  C C2    1 
ATOM   384  O O2    . DC  B 2 4   ? -17.019 -24.530 53.025  1.00 41.11 ? 4   DC  C O2    1 
ATOM   385  N N3    . DC  B 2 4   ? -15.690 -23.963 54.777  1.00 39.65 ? 4   DC  C N3    1 
ATOM   386  C C4    . DC  B 2 4   ? -14.497 -23.594 55.215  1.00 41.39 ? 4   DC  C C4    1 
ATOM   387  N N4    . DC  B 2 4   ? -14.407 -23.425 56.536  1.00 41.53 ? 4   DC  C N4    1 
ATOM   388  C C5    . DC  B 2 4   ? -13.383 -23.382 54.322  1.00 41.09 ? 4   DC  C C5    1 
ATOM   389  C C6    . DC  B 2 4   ? -13.608 -23.582 53.007  1.00 41.23 ? 4   DC  C C6    1 
ATOM   390  P P     . DT  B 2 5   ? -16.281 -22.536 47.519  1.00 45.24 ? 5   DT  C P     1 
ATOM   391  O OP1   . DT  B 2 5   ? -16.706 -22.753 46.127  1.00 44.96 ? 5   DT  C OP1   1 
ATOM   392  O OP2   . DT  B 2 5   ? -15.375 -21.413 47.817  1.00 46.40 ? 5   DT  C OP2   1 
ATOM   393  O "O5'" . DT  B 2 5   ? -17.541 -22.428 48.496  1.00 44.69 ? 5   DT  C "O5'" 1 
ATOM   394  C "C5'" . DT  B 2 5   ? -18.604 -23.390 48.380  1.00 42.91 ? 5   DT  C "C5'" 1 
ATOM   395  C "C4'" . DT  B 2 5   ? -19.791 -23.011 49.263  1.00 41.44 ? 5   DT  C "C4'" 1 
ATOM   396  O "O4'" . DT  B 2 5   ? -19.417 -22.876 50.665  1.00 41.98 ? 5   DT  C "O4'" 1 
ATOM   397  C "C3'" . DT  B 2 5   ? -20.452 -21.697 48.890  1.00 40.02 ? 5   DT  C "C3'" 1 
ATOM   398  O "O3'" . DT  B 2 5   ? -21.859 -21.868 49.010  1.00 40.38 ? 5   DT  C "O3'" 1 
ATOM   399  C "C2'" . DT  B 2 5   ? -19.842 -20.719 49.893  1.00 39.49 ? 5   DT  C "C2'" 1 
ATOM   400  C "C1'" . DT  B 2 5   ? -19.732 -21.577 51.148  1.00 40.39 ? 5   DT  C "C1'" 1 
ATOM   401  N N1    . DT  B 2 5   ? -18.657 -21.216 52.123  1.00 41.39 ? 5   DT  C N1    1 
ATOM   402  C C2    . DT  B 2 5   ? -18.938 -21.141 53.477  1.00 42.99 ? 5   DT  C C2    1 
ATOM   403  O O2    . DT  B 2 5   ? -20.044 -21.341 53.935  1.00 45.07 ? 5   DT  C O2    1 
ATOM   404  N N3    . DT  B 2 5   ? -17.884 -20.843 54.307  1.00 40.84 ? 5   DT  C N3    1 
ATOM   405  C C4    . DT  B 2 5   ? -16.577 -20.586 53.915  1.00 41.17 ? 5   DT  C C4    1 
ATOM   406  O O4    . DT  B 2 5   ? -15.715 -20.307 54.749  1.00 40.05 ? 5   DT  C O4    1 
ATOM   407  C C5    . DT  B 2 5   ? -16.331 -20.649 52.474  1.00 42.68 ? 5   DT  C C5    1 
ATOM   408  C C7    . DT  B 2 5   ? -14.964 -20.383 51.862  1.00 41.58 ? 5   DT  C C7    1 
ATOM   409  C C6    . DT  B 2 5   ? -17.365 -20.969 51.681  1.00 41.82 ? 5   DT  C C6    1 
ATOM   410  P P     . DT  B 2 6   ? -22.953 -20.769 48.543  1.00 43.27 ? 6   DT  C P     1 
ATOM   411  O OP1   . DT  B 2 6   ? -24.102 -21.525 47.990  1.00 44.70 ? 6   DT  C OP1   1 
ATOM   412  O OP2   . DT  B 2 6   ? -22.319 -19.674 47.772  1.00 43.67 ? 6   DT  C OP2   1 
ATOM   413  O "O5'" . DT  B 2 6   ? -23.365 -20.093 49.938  1.00 43.19 ? 6   DT  C "O5'" 1 
ATOM   414  C "C5'" . DT  B 2 6   ? -23.953 -20.829 50.994  1.00 41.48 ? 6   DT  C "C5'" 1 
ATOM   415  C "C4'" . DT  B 2 6   ? -24.177 -19.885 52.167  1.00 42.45 ? 6   DT  C "C4'" 1 
ATOM   416  O "O4'" . DT  B 2 6   ? -22.920 -19.619 52.836  1.00 42.77 ? 6   DT  C "O4'" 1 
ATOM   417  C "C3'" . DT  B 2 6   ? -24.773 -18.513 51.830  1.00 40.98 ? 6   DT  C "C3'" 1 
ATOM   418  O "O3'" . DT  B 2 6   ? -25.984 -18.421 52.583  1.00 38.90 ? 6   DT  C "O3'" 1 
ATOM   419  C "C2'" . DT  B 2 6   ? -23.714 -17.498 52.269  1.00 40.74 ? 6   DT  C "C2'" 1 
ATOM   420  C "C1'" . DT  B 2 6   ? -22.878 -18.279 53.285  1.00 41.57 ? 6   DT  C "C1'" 1 
ATOM   421  N N1    . DT  B 2 6   ? -21.403 -18.020 53.373  1.00 40.88 ? 6   DT  C N1    1 
ATOM   422  C C2    . DT  B 2 6   ? -20.822 -17.904 54.622  1.00 40.19 ? 6   DT  C C2    1 
ATOM   423  O O2    . DT  B 2 6   ? -21.426 -17.975 55.676  1.00 40.22 ? 6   DT  C O2    1 
ATOM   424  N N3    . DT  B 2 6   ? -19.466 -17.691 54.627  1.00 39.66 ? 6   DT  C N3    1 
ATOM   425  C C4    . DT  B 2 6   ? -18.645 -17.585 53.528  1.00 40.76 ? 6   DT  C C4    1 
ATOM   426  O O4    . DT  B 2 6   ? -17.430 -17.426 53.649  1.00 42.71 ? 6   DT  C O4    1 
ATOM   427  C C5    . DT  B 2 6   ? -19.299 -17.704 52.248  1.00 40.87 ? 6   DT  C C5    1 
ATOM   428  C C7    . DT  B 2 6   ? -18.475 -17.597 51.000  1.00 38.23 ? 6   DT  C C7    1 
ATOM   429  C C6    . DT  B 2 6   ? -20.641 -17.924 52.222  1.00 39.82 ? 6   DT  C C6    1 
ATOM   430  P P     . DT  B 2 7   ? -26.910 -17.138 52.504  1.00 39.24 ? 7   DT  C P     1 
ATOM   431  O OP1   . DT  B 2 7   ? -28.293 -17.517 52.765  1.00 38.97 ? 7   DT  C OP1   1 
ATOM   432  O OP2   . DT  B 2 7   ? -26.516 -16.347 51.303  1.00 38.55 ? 7   DT  C OP2   1 
ATOM   433  O "O5'" . DT  B 2 7   ? -26.403 -16.228 53.736  1.00 41.82 ? 7   DT  C "O5'" 1 
ATOM   434  C "C5'" . DT  B 2 7   ? -26.436 -16.645 55.116  1.00 38.94 ? 7   DT  C "C5'" 1 
ATOM   435  C "C4'" . DT  B 2 7   ? -25.691 -15.618 55.970  1.00 39.56 ? 7   DT  C "C4'" 1 
ATOM   436  O "O4'" . DT  B 2 7   ? -24.243 -15.730 55.756  1.00 38.98 ? 7   DT  C "O4'" 1 
ATOM   437  C "C3'" . DT  B 2 7   ? -26.064 -14.150 55.751  1.00 38.79 ? 7   DT  C "C3'" 1 
ATOM   438  O "O3'" . DT  B 2 7   ? -26.672 -13.673 56.968  1.00 40.21 ? 7   DT  C "O3'" 1 
ATOM   439  C "C2'" . DT  B 2 7   ? -24.729 -13.487 55.415  1.00 40.99 ? 7   DT  C "C2'" 1 
ATOM   440  C "C1'" . DT  B 2 7   ? -23.652 -14.475 55.942  1.00 39.78 ? 7   DT  C "C1'" 1 
ATOM   441  N N1    . DT  B 2 7   ? -22.313 -14.434 55.206  1.00 38.94 ? 7   DT  C N1    1 
ATOM   442  C C2    . DT  B 2 7   ? -21.152 -14.346 55.941  1.00 38.78 ? 7   DT  C C2    1 
ATOM   443  O O2    . DT  B 2 7   ? -21.136 -14.322 57.132  1.00 41.99 ? 7   DT  C O2    1 
ATOM   444  N N3    . DT  B 2 7   ? -19.964 -14.308 55.274  1.00 39.04 ? 7   DT  C N3    1 
ATOM   445  C C4    . DT  B 2 7   ? -19.820 -14.352 53.902  1.00 40.11 ? 7   DT  C C4    1 
ATOM   446  O O4    . DT  B 2 7   ? -18.714 -14.327 53.386  1.00 39.89 ? 7   DT  C O4    1 
ATOM   447  C C5    . DT  B 2 7   ? -21.056 -14.436 53.149  1.00 38.80 ? 7   DT  C C5    1 
ATOM   448  C C7    . DT  B 2 7   ? -20.974 -14.443 51.656  1.00 40.10 ? 7   DT  C C7    1 
ATOM   449  C C6    . DT  B 2 7   ? -22.231 -14.472 53.814  1.00 38.06 ? 7   DT  C C6    1 
ATOM   450  P P     . DC  B 2 8   ? -27.053 -12.129 57.263  1.00 39.28 ? 8   DC  C P     1 
ATOM   451  O OP1   . DC  B 2 8   ? -28.154 -12.066 58.207  1.00 41.47 ? 8   DC  C OP1   1 
ATOM   452  O OP2   . DC  B 2 8   ? -27.188 -11.362 56.015  1.00 41.06 ? 8   DC  C OP2   1 
ATOM   453  O "O5'" . DC  B 2 8   ? -25.709 -11.630 58.006  1.00 41.95 ? 8   DC  C "O5'" 1 
ATOM   454  C "C5'" . DC  B 2 8   ? -25.150 -12.297 59.151  1.00 38.33 ? 8   DC  C "C5'" 1 
ATOM   455  C "C4'" . DC  B 2 8   ? -23.919 -11.555 59.633  1.00 38.48 ? 8   DC  C "C4'" 1 
ATOM   456  O "O4'" . DC  B 2 8   ? -22.873 -11.776 58.654  1.00 38.89 ? 8   DC  C "O4'" 1 
ATOM   457  C "C3'" . DC  B 2 8   ? -24.055 -10.026 59.717  1.00 41.01 ? 8   DC  C "C3'" 1 
ATOM   458  O "O3'" . DC  B 2 8   ? -23.627 -9.665  61.017  1.00 41.79 ? 8   DC  C "O3'" 1 
ATOM   459  C "C2'" . DC  B 2 8   ? -23.150 -9.466  58.604  1.00 38.12 ? 8   DC  C "C2'" 1 
ATOM   460  C "C1'" . DC  B 2 8   ? -22.137 -10.599 58.434  1.00 37.23 ? 8   DC  C "C1'" 1 
ATOM   461  N N1    . DC  B 2 8   ? -21.474 -10.746 57.077  1.00 37.81 ? 8   DC  C N1    1 
ATOM   462  C C2    . DC  B 2 8   ? -20.080 -10.882 57.048  1.00 39.04 ? 8   DC  C C2    1 
ATOM   463  O O2    . DC  B 2 8   ? -19.490 -10.882 58.138  1.00 39.01 ? 8   DC  C O2    1 
ATOM   464  N N3    . DC  B 2 8   ? -19.429 -10.997 55.856  1.00 37.51 ? 8   DC  C N3    1 
ATOM   465  C C4    . DC  B 2 8   ? -20.143 -11.019 54.707  1.00 38.49 ? 8   DC  C C4    1 
ATOM   466  N N4    . DC  B 2 8   ? -19.477 -11.163 53.555  1.00 34.78 ? 8   DC  C N4    1 
ATOM   467  C C5    . DC  B 2 8   ? -21.584 -10.876 54.707  1.00 36.96 ? 8   DC  C C5    1 
ATOM   468  C C6    . DC  B 2 8   ? -22.179 -10.745 55.900  1.00 37.32 ? 8   DC  C C6    1 
ATOM   469  P P     . DC  B 2 9   ? -23.681 -8.168  61.575  1.00 41.67 ? 9   DC  C P     1 
ATOM   470  O OP1   . DC  B 2 9   ? -23.904 -8.298  63.029  1.00 40.27 ? 9   DC  C OP1   1 
ATOM   471  O OP2   . DC  B 2 9   ? -24.621 -7.396  60.759  1.00 44.78 ? 9   DC  C OP2   1 
ATOM   472  O "O5'" . DC  B 2 9   ? -22.207 -7.599  61.246  1.00 42.07 ? 9   DC  C "O5'" 1 
ATOM   473  C "C5'" . DC  B 2 9   ? -21.019 -8.269  61.770  1.00 38.90 ? 9   DC  C "C5'" 1 
ATOM   474  C "C4'" . DC  B 2 9   ? -19.767 -7.606  61.216  1.00 39.00 ? 9   DC  C "C4'" 1 
ATOM   475  O "O4'" . DC  B 2 9   ? -19.576 -7.961  59.822  1.00 39.69 ? 9   DC  C "O4'" 1 
ATOM   476  C "C3'" . DC  B 2 9   ? -19.830 -6.086  61.223  1.00 37.97 ? 9   DC  C "C3'" 1 
ATOM   477  O "O3'" . DC  B 2 9   ? -19.021 -5.631  62.294  1.00 36.85 ? 9   DC  C "O3'" 1 
ATOM   478  C "C2'" . DC  B 2 9   ? -19.361 -5.640  59.836  1.00 37.86 ? 9   DC  C "C2'" 1 
ATOM   479  C "C1'" . DC  B 2 9   ? -18.891 -6.926  59.171  1.00 37.22 ? 9   DC  C "C1'" 1 
ATOM   480  N N1    . DC  B 2 9   ? -19.151 -7.111  57.709  1.00 38.17 ? 9   DC  C N1    1 
ATOM   481  C C2    . DC  B 2 9   ? -18.021 -7.336  56.909  1.00 38.88 ? 9   DC  C C2    1 
ATOM   482  O O2    . DC  B 2 9   ? -16.894 -7.354  57.446  1.00 38.85 ? 9   DC  C O2    1 
ATOM   483  N N3    . DC  B 2 9   ? -18.192 -7.515  55.575  1.00 37.46 ? 9   DC  C N3    1 
ATOM   484  C C4    . DC  B 2 9   ? -19.420 -7.494  55.027  1.00 37.87 ? 9   DC  C C4    1 
ATOM   485  N N4    . DC  B 2 9   ? -19.478 -7.704  53.694  1.00 37.47 ? 9   DC  C N4    1 
ATOM   486  C C5    . DC  B 2 9   ? -20.602 -7.271  55.815  1.00 35.87 ? 9   DC  C C5    1 
ATOM   487  C C6    . DC  B 2 9   ? -20.415 -7.089  57.140  1.00 37.25 ? 9   DC  C C6    1 
ATOM   488  P P     . DC  B 2 10  ? -18.869 -4.067  62.582  1.00 42.07 ? 10  DC  C P     1 
ATOM   489  O OP1   . DC  B 2 10  ? -18.483 -3.882  63.999  1.00 43.39 ? 10  DC  C OP1   1 
ATOM   490  O OP2   . DC  B 2 10  ? -20.052 -3.349  62.071  1.00 43.66 ? 10  DC  C OP2   1 
ATOM   491  O "O5'" . DC  B 2 10  ? -17.610 -3.668  61.685  1.00 40.97 ? 10  DC  C "O5'" 1 
ATOM   492  C "C5'" . DC  B 2 10  ? -16.358 -4.275  61.910  1.00 39.91 ? 10  DC  C "C5'" 1 
ATOM   493  C "C4'" . DC  B 2 10  ? -15.434 -3.874  60.776  1.00 39.39 ? 10  DC  C "C4'" 1 
ATOM   494  O "O4'" . DC  B 2 10  ? -15.992 -4.328  59.532  1.00 39.41 ? 10  DC  C "O4'" 1 
ATOM   495  C "C3'" . DC  B 2 10  ? -15.260 -2.380  60.580  1.00 40.76 ? 10  DC  C "C3'" 1 
ATOM   496  O "O3'" . DC  B 2 10  ? -13.869 -2.139  60.460  1.00 42.53 ? 10  DC  C "O3'" 1 
ATOM   497  C "C2'" . DC  B 2 10  ? -15.981 -2.107  59.266  1.00 38.90 ? 10  DC  C "C2'" 1 
ATOM   498  C "C1'" . DC  B 2 10  ? -15.697 -3.419  58.530  1.00 38.10 ? 10  DC  C "C1'" 1 
ATOM   499  N N1    . DC  B 2 10  ? -16.557 -3.690  57.334  1.00 39.41 ? 10  DC  C N1    1 
ATOM   500  C C2    . DC  B 2 10  ? -16.006 -4.112  56.099  1.00 40.33 ? 10  DC  C C2    1 
ATOM   501  O O2    . DC  B 2 10  ? -14.782 -4.275  55.961  1.00 39.95 ? 10  DC  C O2    1 
ATOM   502  N N3    . DC  B 2 10  ? -16.853 -4.331  55.044  1.00 39.03 ? 10  DC  C N3    1 
ATOM   503  C C4    . DC  B 2 10  ? -18.184 -4.130  55.174  1.00 38.24 ? 10  DC  C C4    1 
ATOM   504  N N4    . DC  B 2 10  ? -18.952 -4.348  54.101  1.00 37.82 ? 10  DC  C N4    1 
ATOM   505  C C5    . DC  B 2 10  ? -18.775 -3.714  56.403  1.00 37.26 ? 10  DC  C C5    1 
ATOM   506  C C6    . DC  B 2 10  ? -17.936 -3.503  57.434  1.00 39.84 ? 10  DC  C C6    1 
ATOM   507  P P     . DA  B 2 11  ? -13.210 -0.730  60.760  1.00 43.67 ? 11  DA  C P     1 
ATOM   508  O OP1   . DA  B 2 11  ? -12.603 -0.872  62.089  1.00 46.21 ? 11  DA  C OP1   1 
ATOM   509  O OP2   . DA  B 2 11  ? -14.119 0.405   60.503  1.00 44.59 ? 11  DA  C OP2   1 
ATOM   510  O "O5'" . DA  B 2 11  ? -12.081 -0.665  59.639  1.00 44.93 ? 11  DA  C "O5'" 1 
ATOM   511  C "C5'" . DA  B 2 11  ? -11.186 -1.758  59.376  1.00 42.71 ? 11  DA  C "C5'" 1 
ATOM   512  C "C4'" . DA  B 2 11  ? -10.522 -1.541  58.022  1.00 40.62 ? 11  DA  C "C4'" 1 
ATOM   513  O "O4'" . DA  B 2 11  ? -11.471 -1.797  56.957  1.00 38.64 ? 11  DA  C "O4'" 1 
ATOM   514  C "C3'" . DA  B 2 11  ? -9.975  -0.131  57.743  1.00 40.12 ? 11  DA  C "C3'" 1 
ATOM   515  O "O3'" . DA  B 2 11  ? -8.794  -0.310  56.951  1.00 40.04 ? 11  DA  C "O3'" 1 
ATOM   516  C "C2'" . DA  B 2 11  ? -11.116 0.550   56.982  1.00 39.38 ? 11  DA  C "C2'" 1 
ATOM   517  C "C1'" . DA  B 2 11  ? -11.723 -0.624  56.203  1.00 38.26 ? 11  DA  C "C1'" 1 
ATOM   518  N N9    . DA  B 2 11  ? -13.159 -0.650  55.943  1.00 38.13 ? 11  DA  C N9    1 
ATOM   519  C C8    . DA  B 2 11  ? -14.206 -0.391  56.793  1.00 38.36 ? 11  DA  C C8    1 
ATOM   520  N N7    . DA  B 2 11  ? -15.407 -0.546  56.237  1.00 38.12 ? 11  DA  C N7    1 
ATOM   521  C C5    . DA  B 2 11  ? -15.137 -0.932  54.924  1.00 38.22 ? 11  DA  C C5    1 
ATOM   522  C C6    . DA  B 2 11  ? -15.952 -1.260  53.799  1.00 37.86 ? 11  DA  C C6    1 
ATOM   523  N N6    . DA  B 2 11  ? -17.298 -1.255  53.782  1.00 37.07 ? 11  DA  C N6    1 
ATOM   524  N N1    . DA  B 2 11  ? -15.331 -1.629  52.649  1.00 38.20 ? 11  DA  C N1    1 
ATOM   525  C C2    . DA  B 2 11  ? -13.985 -1.650  52.602  1.00 38.64 ? 11  DA  C C2    1 
ATOM   526  N N3    . DA  B 2 11  ? -13.122 -1.355  53.591  1.00 38.35 ? 11  DA  C N3    1 
ATOM   527  C C4    . DA  B 2 11  ? -13.754 -1.008  54.735  1.00 38.96 ? 11  DA  C C4    1 
ATOM   528  P P     . DC  B 2 12  ? -7.779  0.838   56.551  1.00 40.59 ? 12  DC  C P     1 
ATOM   529  O OP1   . DC  B 2 12  ? -6.444  0.196   56.554  1.00 43.20 ? 12  DC  C OP1   1 
ATOM   530  O OP2   . DC  B 2 12  ? -8.052  2.085   57.314  1.00 41.60 ? 12  DC  C OP2   1 
ATOM   531  O "O5'" . DC  B 2 12  ? -8.131  1.208   55.042  1.00 41.24 ? 12  DC  C "O5'" 1 
ATOM   532  C "C5'" . DC  B 2 12  ? -8.226  0.216   54.023  1.00 39.04 ? 12  DC  C "C5'" 1 
ATOM   533  C "C4'" . DC  B 2 12  ? -8.767  0.875   52.771  1.00 39.08 ? 12  DC  C "C4'" 1 
ATOM   534  O "O4'" . DC  B 2 12  ? -10.219 0.795   52.757  1.00 37.64 ? 12  DC  C "O4'" 1 
ATOM   535  C "C3'" . DC  B 2 12  ? -8.434  2.357   52.617  1.00 38.82 ? 12  DC  C "C3'" 1 
ATOM   536  O "O3'" . DC  B 2 12  ? -7.969  2.496   51.303  1.00 41.49 ? 12  DC  C "O3'" 1 
ATOM   537  C "C2'" . DC  B 2 12  ? -9.783  3.068   52.782  1.00 37.75 ? 12  DC  C "C2'" 1 
ATOM   538  C "C1'" . DC  B 2 12  ? -10.754 2.005   52.271  1.00 36.90 ? 12  DC  C "C1'" 1 
ATOM   539  N N1    . DC  B 2 12  ? -12.187 2.092   52.758  1.00 36.86 ? 12  DC  C N1    1 
ATOM   540  C C2    . DC  B 2 12  ? -13.243 1.715   51.900  1.00 37.21 ? 12  DC  C C2    1 
ATOM   541  O O2    . DC  B 2 12  ? -13.002 1.328   50.747  1.00 35.71 ? 12  DC  C O2    1 
ATOM   542  N N3    . DC  B 2 12  ? -14.526 1.803   52.361  1.00 38.86 ? 12  DC  C N3    1 
ATOM   543  C C4    . DC  B 2 12  ? -14.762 2.244   53.622  1.00 38.89 ? 12  DC  C C4    1 
ATOM   544  N N4    . DC  B 2 12  ? -16.033 2.315   54.052  1.00 36.34 ? 12  DC  C N4    1 
ATOM   545  C C5    . DC  B 2 12  ? -13.694 2.625   54.504  1.00 35.77 ? 12  DC  C C5    1 
ATOM   546  C C6    . DC  B 2 12  ? -12.452 2.528   54.033  1.00 35.33 ? 12  DC  C C6    1 
ATOM   547  P P     . DA  B 2 13  ? -6.957  3.639   50.863  1.00 43.04 ? 13  DA  C P     1 
ATOM   548  O OP1   . DA  B 2 13  ? -5.849  2.875   50.257  1.00 46.34 ? 13  DA  C OP1   1 
ATOM   549  O OP2   . DA  B 2 13  ? -6.717  4.592   51.968  1.00 43.03 ? 13  DA  C OP2   1 
ATOM   550  O "O5'" . DA  B 2 13  ? -7.700  4.459   49.721  1.00 42.68 ? 13  DA  C "O5'" 1 
ATOM   551  C "C5'" . DA  B 2 13  ? -8.316  3.807   48.617  1.00 41.45 ? 13  DA  C "C5'" 1 
ATOM   552  C "C4'" . DA  B 2 13  ? -9.494  4.647   48.163  1.00 41.18 ? 13  DA  C "C4'" 1 
ATOM   553  O "O4'" . DA  B 2 13  ? -10.548 4.413   49.130  1.00 40.15 ? 13  DA  C "O4'" 1 
ATOM   554  C "C3'" . DA  B 2 13  ? -9.284  6.175   48.120  1.00 42.52 ? 13  DA  C "C3'" 1 
ATOM   555  O "O3'" . DA  B 2 13  ? -9.935  6.735   46.988  1.00 44.88 ? 13  DA  C "O3'" 1 
ATOM   556  C "C2'" . DA  B 2 13  ? -10.028 6.644   49.364  1.00 41.23 ? 13  DA  C "C2'" 1 
ATOM   557  C "C1'" . DA  B 2 13  ? -11.191 5.645   49.346  1.00 40.22 ? 13  DA  C "C1'" 1 
ATOM   558  N N9    . DA  B 2 13  ? -12.006 5.623   50.563  1.00 39.70 ? 13  DA  C N9    1 
ATOM   559  C C8    . DA  B 2 13  ? -11.579 5.876   51.835  1.00 39.68 ? 13  DA  C C8    1 
ATOM   560  N N7    . DA  B 2 13  ? -12.508 5.814   52.752  1.00 40.00 ? 13  DA  C N7    1 
ATOM   561  C C5    . DA  B 2 13  ? -13.643 5.496   52.024  1.00 41.10 ? 13  DA  C C5    1 
ATOM   562  C C6    . DA  B 2 13  ? -14.986 5.293   52.414  1.00 40.13 ? 13  DA  C C6    1 
ATOM   563  N N6    . DA  B 2 13  ? -15.390 5.380   53.683  1.00 39.23 ? 13  DA  C N6    1 
ATOM   564  N N1    . DA  B 2 13  ? -15.880 4.992   51.447  1.00 40.05 ? 13  DA  C N1    1 
ATOM   565  C C2    . DA  B 2 13  ? -15.467 4.903   50.172  1.00 39.88 ? 13  DA  C C2    1 
ATOM   566  N N3    . DA  B 2 13  ? -14.234 5.078   49.688  1.00 39.98 ? 13  DA  C N3    1 
ATOM   567  C C4    . DA  B 2 13  ? -13.356 5.376   50.670  1.00 40.41 ? 13  DA  C C4    1 
ATOM   568  P P     . DG  B 2 14  ? -9.260  7.675   45.895  1.00 46.14 ? 14  DG  C P     1 
ATOM   569  O OP1   . DG  B 2 14  ? -9.981  7.400   44.641  1.00 47.76 ? 14  DG  C OP1   1 
ATOM   570  O OP2   . DG  B 2 14  ? -7.793  7.522   45.938  1.00 47.70 ? 14  DG  C OP2   1 
ATOM   571  O "O5'" . DG  B 2 14  ? -9.634  9.171   46.313  1.00 47.14 ? 14  DG  C "O5'" 1 
ATOM   572  C "C5'" . DG  B 2 14  ? -10.858 9.489   46.983  1.00 47.48 ? 14  DG  C "C5'" 1 
ATOM   573  C "C4'" . DG  B 2 14  ? -12.101 9.046   46.224  1.00 46.89 ? 14  DG  C "C4'" 1 
ATOM   574  O "O4'" . DG  B 2 14  ? -12.747 8.001   46.988  1.00 46.43 ? 14  DG  C "O4'" 1 
ATOM   575  C "C3'" . DG  B 2 14  ? -13.134 10.144  45.997  1.00 46.84 ? 14  DG  C "C3'" 1 
ATOM   576  O "O3'" . DG  B 2 14  ? -13.304 10.379  44.600  1.00 47.06 ? 14  DG  C "O3'" 1 
ATOM   577  C "C2'" . DG  B 2 14  ? -14.427 9.646   46.642  1.00 46.30 ? 14  DG  C "C2'" 1 
ATOM   578  C "C1'" . DG  B 2 14  ? -14.026 8.410   47.427  1.00 46.15 ? 14  DG  C "C1'" 1 
ATOM   579  N N9    . DG  B 2 14  ? -14.060 8.558   48.889  1.00 46.28 ? 14  DG  C N9    1 
ATOM   580  C C8    . DG  B 2 14  ? -13.031 8.858   49.756  1.00 45.96 ? 14  DG  C C8    1 
ATOM   581  N N7    . DG  B 2 14  ? -13.396 8.904   51.011  1.00 45.36 ? 14  DG  C N7    1 
ATOM   582  C C5    . DG  B 2 14  ? -14.753 8.627   50.975  1.00 45.19 ? 14  DG  C C5    1 
ATOM   583  C C6    . DG  B 2 14  ? -15.691 8.536   52.024  1.00 45.66 ? 14  DG  C C6    1 
ATOM   584  O O6    . DG  B 2 14  ? -15.488 8.698   53.236  1.00 45.99 ? 14  DG  C O6    1 
ATOM   585  N N1    . DG  B 2 14  ? -16.974 8.223   51.563  1.00 45.97 ? 14  DG  C N1    1 
ATOM   586  C C2    . DG  B 2 14  ? -17.304 8.023   50.238  1.00 46.12 ? 14  DG  C C2    1 
ATOM   587  N N2    . DG  B 2 14  ? -18.583 7.732   49.961  1.00 45.99 ? 14  DG  C N2    1 
ATOM   588  N N3    . DG  B 2 14  ? -16.430 8.110   49.241  1.00 46.30 ? 14  DG  C N3    1 
ATOM   589  C C4    . DG  B 2 14  ? -15.178 8.411   49.682  1.00 45.95 ? 14  DG  C C4    1 
ATOM   590  P P     . DT  B 2 15  ? -14.073 11.698  44.123  1.00 48.57 ? 15  DT  C P     1 
ATOM   591  O OP1   . DT  B 2 15  ? -13.909 11.842  42.660  1.00 48.87 ? 15  DT  C OP1   1 
ATOM   592  O OP2   . DT  B 2 15  ? -13.681 12.824  45.007  1.00 48.74 ? 15  DT  C OP2   1 
ATOM   593  O "O5'" . DT  B 2 15  ? -15.604 11.333  44.398  1.00 47.68 ? 15  DT  C "O5'" 1 
ATOM   594  C "C5'" . DT  B 2 15  ? -16.553 12.384  44.426  1.00 45.93 ? 15  DT  C "C5'" 1 
ATOM   595  C "C4'" . DT  B 2 15  ? -17.876 11.902  44.992  1.00 44.28 ? 15  DT  C "C4'" 1 
ATOM   596  O "O4'" . DT  B 2 15  ? -17.709 11.224  46.265  1.00 42.99 ? 15  DT  C "O4'" 1 
ATOM   597  C "C3'" . DT  B 2 15  ? -18.840 13.038  45.277  1.00 44.14 ? 15  DT  C "C3'" 1 
ATOM   598  O "O3'" . DT  B 2 15  ? -20.160 12.530  45.159  1.00 45.18 ? 15  DT  C "O3'" 1 
ATOM   599  C "C2'" . DT  B 2 15  ? -18.484 13.390  46.716  1.00 42.98 ? 15  DT  C "C2'" 1 
ATOM   600  C "C1'" . DT  B 2 15  ? -18.312 11.991  47.296  1.00 40.73 ? 15  DT  C "C1'" 1 
ATOM   601  N N1    . DT  B 2 15  ? -17.504 11.955  48.568  1.00 39.83 ? 15  DT  C N1    1 
ATOM   602  C C2    . DT  B 2 15  ? -18.167 11.791  49.778  1.00 38.91 ? 15  DT  C C2    1 
ATOM   603  O O2    . DT  B 2 15  ? -19.376 11.671  49.865  1.00 39.09 ? 15  DT  C O2    1 
ATOM   604  N N3    . DT  B 2 15  ? -17.357 11.777  50.891  1.00 38.51 ? 15  DT  C N3    1 
ATOM   605  C C4    . DT  B 2 15  ? -15.972 11.903  50.916  1.00 39.13 ? 15  DT  C C4    1 
ATOM   606  O O4    . DT  B 2 15  ? -15.342 11.875  51.970  1.00 39.28 ? 15  DT  C O4    1 
ATOM   607  C C5    . DT  B 2 15  ? -15.333 12.083  49.617  1.00 38.82 ? 15  DT  C C5    1 
ATOM   608  C C7    . DT  B 2 15  ? -13.841 12.241  49.498  1.00 38.89 ? 15  DT  C C7    1 
ATOM   609  C C6    . DT  B 2 15  ? -16.121 12.104  48.528  1.00 39.54 ? 15  DT  C C6    1 
ATOM   610  N N     . SER C 3 12  ? -51.738 -9.954  6.890   1.00 44.20 ? 197 SER A N     1 
ATOM   611  C CA    . SER C 3 12  ? -51.217 -11.346 6.712   1.00 43.91 ? 197 SER A CA    1 
ATOM   612  C C     . SER C 3 12  ? -50.139 -11.364 5.634   1.00 43.72 ? 197 SER A C     1 
ATOM   613  O O     . SER C 3 12  ? -50.357 -10.878 4.513   1.00 43.83 ? 197 SER A O     1 
ATOM   614  C CB    . SER C 3 12  ? -52.362 -12.315 6.328   1.00 43.93 ? 197 SER A CB    1 
ATOM   615  O OG    . SER C 3 12  ? -51.927 -13.729 6.506   1.00 43.67 ? 197 SER A OG    1 
ATOM   616  N N     . LEU C 3 13  ? -48.982 -11.924 5.985   1.00 43.39 ? 198 LEU A N     1 
ATOM   617  C CA    . LEU C 3 13  ? -47.827 -12.011 5.090   1.00 42.95 ? 198 LEU A CA    1 
ATOM   618  C C     . LEU C 3 13  ? -48.158 -12.752 3.799   1.00 42.91 ? 198 LEU A C     1 
ATOM   619  O O     . LEU C 3 13  ? -48.555 -13.919 3.832   1.00 42.79 ? 198 LEU A O     1 
ATOM   620  C CB    . LEU C 3 13  ? -46.649 -12.700 5.801   1.00 42.85 ? 198 LEU A CB    1 
ATOM   621  C CG    . LEU C 3 13  ? -45.339 -12.907 5.023   1.00 42.52 ? 198 LEU A CG    1 
ATOM   622  C CD1   . LEU C 3 13  ? -44.528 -11.623 4.951   1.00 41.80 ? 198 LEU A CD1   1 
ATOM   623  C CD2   . LEU C 3 13  ? -44.500 -14.033 5.619   1.00 42.41 ? 198 LEU A CD2   1 
ATOM   624  N N     . THR C 3 14  ? -47.995 -12.068 2.670   1.00 42.90 ? 199 THR A N     1 
ATOM   625  C CA    . THR C 3 14  ? -48.197 -12.705 1.371   1.00 43.00 ? 199 THR A CA    1 
ATOM   626  C C     . THR C 3 14  ? -46.865 -13.211 0.807   1.00 42.88 ? 199 THR A C     1 
ATOM   627  O O     . THR C 3 14  ? -45.819 -12.580 0.995   1.00 42.95 ? 199 THR A O     1 
ATOM   628  C CB    . THR C 3 14  ? -48.932 -11.787 0.349   1.00 43.06 ? 199 THR A CB    1 
ATOM   629  O OG1   . THR C 3 14  ? -48.147 -10.616 0.084   1.00 43.52 ? 199 THR A OG1   1 
ATOM   630  C CG2   . THR C 3 14  ? -50.308 -11.375 0.871   1.00 42.99 ? 199 THR A CG2   1 
ATOM   631  N N     . SER C 3 15  ? -46.932 -14.354 0.121   1.00 42.79 ? 200 SER A N     1 
ATOM   632  C CA    . SER C 3 15  ? -45.783 -15.052 -0.484  1.00 42.56 ? 200 SER A CA    1 
ATOM   633  C C     . SER C 3 15  ? -44.685 -14.127 -1.033  1.00 42.31 ? 200 SER A C     1 
ATOM   634  O O     . SER C 3 15  ? -43.485 -14.467 -0.990  1.00 42.25 ? 200 SER A O     1 
ATOM   635  C CB    . SER C 3 15  ? -46.298 -15.982 -1.611  1.00 42.61 ? 200 SER A CB    1 
ATOM   636  O OG    . SER C 3 15  ? -45.252 -16.720 -2.262  1.00 42.80 ? 200 SER A OG    1 
ATOM   637  N N     . ASP C 3 16  ? -45.109 -12.958 -1.519  1.00 41.93 ? 201 ASP A N     1 
ATOM   638  C CA    . ASP C 3 16  ? -44.246 -12.034 -2.247  1.00 41.53 ? 201 ASP A CA    1 
ATOM   639  C C     . ASP C 3 16  ? -43.478 -11.077 -1.337  1.00 41.15 ? 201 ASP A C     1 
ATOM   640  O O     . ASP C 3 16  ? -42.280 -10.879 -1.520  1.00 41.15 ? 201 ASP A O     1 
ATOM   641  C CB    . ASP C 3 16  ? -45.075 -11.252 -3.267  1.00 41.48 ? 201 ASP A CB    1 
ATOM   642  C CG    . ASP C 3 16  ? -46.227 -12.071 -3.826  1.00 41.84 ? 201 ASP A CG    1 
ATOM   643  O OD1   . ASP C 3 16  ? -47.138 -12.425 -3.038  1.00 42.18 ? 201 ASP A OD1   1 
ATOM   644  O OD2   . ASP C 3 16  ? -46.220 -12.366 -5.043  1.00 41.46 ? 201 ASP A OD2   1 
ATOM   645  N N     . ARG C 3 17  ? -44.162 -10.478 -0.365  1.00 40.68 ? 202 ARG A N     1 
ATOM   646  C CA    . ARG C 3 17  ? -43.512 -9.536  0.550   1.00 40.55 ? 202 ARG A CA    1 
ATOM   647  C C     . ARG C 3 17  ? -42.373 -10.202 1.345   1.00 40.11 ? 202 ARG A C     1 
ATOM   648  O O     . ARG C 3 17  ? -41.391 -9.549  1.714   1.00 39.97 ? 202 ARG A O     1 
ATOM   649  C CB    . ARG C 3 17  ? -44.538 -8.876  1.484   1.00 40.72 ? 202 ARG A CB    1 
ATOM   650  C CG    . ARG C 3 17  ? -44.045 -7.586  2.161   1.00 40.95 ? 202 ARG A CG    1 
ATOM   651  C CD    . ARG C 3 17  ? -43.777 -6.461  1.146   1.00 40.68 ? 202 ARG A CD    1 
ATOM   652  N NE    . ARG C 3 17  ? -45.006 -5.849  0.646   1.00 39.51 ? 202 ARG A NE    1 
ATOM   653  C CZ    . ARG C 3 17  ? -45.623 -4.813  1.213   1.00 39.48 ? 202 ARG A CZ    1 
ATOM   654  N NH1   . ARG C 3 17  ? -45.136 -4.254  2.316   1.00 39.16 ? 202 ARG A NH1   1 
ATOM   655  N NH2   . ARG C 3 17  ? -46.739 -4.332  0.674   1.00 39.09 ? 202 ARG A NH2   1 
ATOM   656  N N     . MET C 3 18  ? -42.530 -11.504 1.584   1.00 39.56 ? 203 MET A N     1 
ATOM   657  C CA    . MET C 3 18  ? -41.488 -12.375 2.116   1.00 39.04 ? 203 MET A CA    1 
ATOM   658  C C     . MET C 3 18  ? -40.208 -12.308 1.276   1.00 39.00 ? 203 MET A C     1 
ATOM   659  O O     . MET C 3 18  ? -39.105 -12.153 1.814   1.00 39.01 ? 203 MET A O     1 
ATOM   660  C CB    . MET C 3 18  ? -42.012 -13.825 2.153   1.00 38.73 ? 203 MET A CB    1 
ATOM   661  C CG    . MET C 3 18  ? -41.068 -14.833 2.805   1.00 38.55 ? 203 MET A CG    1 
ATOM   662  S SD    . MET C 3 18  ? -40.643 -14.385 4.495   1.00 36.20 ? 203 MET A SD    1 
ATOM   663  C CE    . MET C 3 18  ? -40.368 -15.997 5.221   1.00 37.77 ? 203 MET A CE    1 
ATOM   664  N N     . ILE C 3 19  ? -40.370 -12.425 -0.042  1.00 38.83 ? 204 ILE A N     1 
ATOM   665  C CA    . ILE C 3 19  ? -39.249 -12.436 -0.982  1.00 38.69 ? 204 ILE A CA    1 
ATOM   666  C C     . ILE C 3 19  ? -38.451 -11.133 -0.923  1.00 38.75 ? 204 ILE A C     1 
ATOM   667  O O     . ILE C 3 19  ? -37.219 -11.158 -0.917  1.00 38.63 ? 204 ILE A O     1 
ATOM   668  C CB    . ILE C 3 19  ? -39.720 -12.728 -2.432  1.00 38.73 ? 204 ILE A CB    1 
ATOM   669  C CG1   . ILE C 3 19  ? -40.489 -14.055 -2.484  1.00 38.71 ? 204 ILE A CG1   1 
ATOM   670  C CG2   . ILE C 3 19  ? -38.534 -12.736 -3.411  1.00 38.39 ? 204 ILE A CG2   1 
ATOM   671  C CD1   . ILE C 3 19  ? -41.419 -14.206 -3.678  1.00 38.35 ? 204 ILE A CD1   1 
ATOM   672  N N     . ASP C 3 20  ? -39.153 -10.002 -0.869  1.00 38.86 ? 205 ASP A N     1 
ATOM   673  C CA    . ASP C 3 20  ? -38.504 -8.703  -0.694  1.00 38.97 ? 205 ASP A CA    1 
ATOM   674  C C     . ASP C 3 20  ? -37.714 -8.649  0.622   1.00 39.29 ? 205 ASP A C     1 
ATOM   675  O O     . ASP C 3 20  ? -36.699 -7.959  0.708   1.00 39.53 ? 205 ASP A O     1 
ATOM   676  C CB    . ASP C 3 20  ? -39.533 -7.566  -0.758  1.00 38.82 ? 205 ASP A CB    1 
ATOM   677  C CG    . ASP C 3 20  ? -38.983 -6.243  -0.243  1.00 38.46 ? 205 ASP A CG    1 
ATOM   678  O OD1   . ASP C 3 20  ? -38.147 -5.626  -0.946  1.00 37.04 ? 205 ASP A OD1   1 
ATOM   679  O OD2   . ASP C 3 20  ? -39.386 -5.827  0.875   1.00 37.89 ? 205 ASP A OD2   1 
ATOM   680  N N     . PHE C 3 21  ? -38.168 -9.381  1.637   1.00 39.22 ? 206 PHE A N     1 
ATOM   681  C CA    . PHE C 3 21  ? -37.457 -9.404  2.915   1.00 39.56 ? 206 PHE A CA    1 
ATOM   682  C C     . PHE C 3 21  ? -36.260 -10.353 2.922   1.00 39.68 ? 206 PHE A C     1 
ATOM   683  O O     . PHE C 3 21  ? -35.173 -9.969  3.341   1.00 39.75 ? 206 PHE A O     1 
ATOM   684  C CB    . PHE C 3 21  ? -38.398 -9.723  4.084   1.00 39.44 ? 206 PHE A CB    1 
ATOM   685  C CG    . PHE C 3 21  ? -37.683 -9.976  5.384   1.00 39.37 ? 206 PHE A CG    1 
ATOM   686  C CD1   . PHE C 3 21  ? -36.949 -8.967  6.001   1.00 39.32 ? 206 PHE A CD1   1 
ATOM   687  C CD2   . PHE C 3 21  ? -37.736 -11.230 5.989   1.00 39.49 ? 206 PHE A CD2   1 
ATOM   688  C CE1   . PHE C 3 21  ? -36.286 -9.200  7.197   1.00 38.88 ? 206 PHE A CE1   1 
ATOM   689  C CE2   . PHE C 3 21  ? -37.076 -11.473 7.189   1.00 38.93 ? 206 PHE A CE2   1 
ATOM   690  C CZ    . PHE C 3 21  ? -36.352 -10.456 7.793   1.00 39.06 ? 206 PHE A CZ    1 
ATOM   691  N N     . LEU C 3 22  ? -36.464 -11.590 2.476   1.00 39.87 ? 207 LEU A N     1 
ATOM   692  C CA    . LEU C 3 22  ? -35.395 -12.583 2.472   1.00 40.05 ? 207 LEU A CA    1 
ATOM   693  C C     . LEU C 3 22  ? -34.214 -12.115 1.624   1.00 40.49 ? 207 LEU A C     1 
ATOM   694  O O     . LEU C 3 22  ? -33.056 -12.359 1.971   1.00 40.40 ? 207 LEU A O     1 
ATOM   695  C CB    . LEU C 3 22  ? -35.912 -13.940 1.988   1.00 39.79 ? 207 LEU A CB    1 
ATOM   696  C CG    . LEU C 3 22  ? -36.928 -14.664 2.876   1.00 39.49 ? 207 LEU A CG    1 
ATOM   697  C CD1   . LEU C 3 22  ? -37.444 -15.914 2.194   1.00 38.52 ? 207 LEU A CD1   1 
ATOM   698  C CD2   . LEU C 3 22  ? -36.341 -15.010 4.252   1.00 39.85 ? 207 LEU A CD2   1 
ATOM   699  N N     . SER C 3 23  ? -34.524 -11.426 0.526   1.00 41.16 ? 208 SER A N     1 
ATOM   700  C CA    . SER C 3 23  ? -33.518 -10.851 -0.371  1.00 41.69 ? 208 SER A CA    1 
ATOM   701  C C     . SER C 3 23  ? -32.860 -9.625  0.254   1.00 42.06 ? 208 SER A C     1 
ATOM   702  O O     . SER C 3 23  ? -31.697 -9.322  -0.029  1.00 42.04 ? 208 SER A O     1 
ATOM   703  C CB    . SER C 3 23  ? -34.156 -10.450 -1.701  1.00 41.71 ? 208 SER A CB    1 
ATOM   704  O OG    . SER C 3 23  ? -35.045 -11.447 -2.172  1.00 41.93 ? 208 SER A OG    1 
ATOM   705  N N     . ASN C 3 24  ? -33.621 -8.925  1.094   1.00 42.45 ? 209 ASN A N     1 
ATOM   706  C CA    . ASN C 3 24  ? -33.155 -7.716  1.757   1.00 42.92 ? 209 ASN A CA    1 
ATOM   707  C C     . ASN C 3 24  ? -33.261 -7.859  3.263   1.00 43.50 ? 209 ASN A C     1 
ATOM   708  O O     . ASN C 3 24  ? -34.005 -7.128  3.924   1.00 43.65 ? 209 ASN A O     1 
ATOM   709  C CB    . ASN C 3 24  ? -33.952 -6.507  1.275   1.00 42.74 ? 209 ASN A CB    1 
ATOM   710  C CG    . ASN C 3 24  ? -33.772 -6.250  -0.199  1.00 42.48 ? 209 ASN A CG    1 
ATOM   711  O OD1   . ASN C 3 24  ? -32.655 -6.032  -0.661  1.00 42.18 ? 209 ASN A OD1   1 
ATOM   712  N ND2   . ASN C 3 24  ? -34.872 -6.275  -0.951  1.00 41.63 ? 209 ASN A ND2   1 
ATOM   713  N N     . LYS C 3 25  ? -32.523 -8.829  3.792   1.00 44.04 ? 210 LYS A N     1 
ATOM   714  C CA    . LYS C 3 25  ? -32.520 -9.119  5.212   1.00 44.36 ? 210 LYS A CA    1 
ATOM   715  C C     . LYS C 3 25  ? -32.133 -7.852  5.968   1.00 44.74 ? 210 LYS A C     1 
ATOM   716  O O     . LYS C 3 25  ? -32.961 -7.250  6.646   1.00 44.96 ? 210 LYS A O     1 
ATOM   717  C CB    . LYS C 3 25  ? -31.526 -10.246 5.510   1.00 44.47 ? 210 LYS A CB    1 
ATOM   718  C CG    . LYS C 3 25  ? -31.894 -11.167 6.674   1.00 44.69 ? 210 LYS A CG    1 
ATOM   719  C CD    . LYS C 3 25  ? -32.778 -12.321 6.210   1.00 44.80 ? 210 LYS A CD    1 
ATOM   720  C CE    . LYS C 3 25  ? -32.724 -13.487 7.186   1.00 45.37 ? 210 LYS A CE    1 
ATOM   721  N NZ    . LYS C 3 25  ? -33.671 -14.568 6.789   1.00 45.50 ? 210 LYS A NZ    1 
ATOM   722  N N     . GLU C 3 26  ? -30.886 -7.424  5.799   1.00 45.15 ? 211 GLU A N     1 
ATOM   723  C CA    . GLU C 3 26  ? -30.290 -6.370  6.631   1.00 45.57 ? 211 GLU A CA    1 
ATOM   724  C C     . GLU C 3 26  ? -30.887 -4.968  6.436   1.00 45.31 ? 211 GLU A C     1 
ATOM   725  O O     . GLU C 3 26  ? -30.560 -4.040  7.180   1.00 45.54 ? 211 GLU A O     1 
ATOM   726  C CB    . GLU C 3 26  ? -28.765 -6.339  6.443   1.00 45.85 ? 211 GLU A CB    1 
ATOM   727  C CG    . GLU C 3 26  ? -28.049 -7.668  6.758   1.00 47.24 ? 211 GLU A CG    1 
ATOM   728  C CD    . GLU C 3 26  ? -28.032 -8.648  5.578   1.00 48.91 ? 211 GLU A CD    1 
ATOM   729  O OE1   . GLU C 3 26  ? -27.610 -9.809  5.780   1.00 49.24 ? 211 GLU A OE1   1 
ATOM   730  O OE2   . GLU C 3 26  ? -28.436 -8.265  4.452   1.00 49.79 ? 211 GLU A OE2   1 
ATOM   731  N N     . LYS C 3 27  ? -31.760 -4.818  5.446   1.00 44.87 ? 212 LYS A N     1 
ATOM   732  C CA    . LYS C 3 27  ? -32.396 -3.533  5.175   1.00 44.45 ? 212 LYS A CA    1 
ATOM   733  C C     . LYS C 3 27  ? -33.587 -3.296  6.095   1.00 43.81 ? 212 LYS A C     1 
ATOM   734  O O     . LYS C 3 27  ? -33.883 -2.159  6.468   1.00 43.76 ? 212 LYS A O     1 
ATOM   735  C CB    . LYS C 3 27  ? -32.835 -3.456  3.711   1.00 44.44 ? 212 LYS A CB    1 
ATOM   736  C CG    . LYS C 3 27  ? -31.679 -3.428  2.709   1.00 45.84 ? 212 LYS A CG    1 
ATOM   737  C CD    . LYS C 3 27  ? -31.006 -4.795  2.565   1.00 47.36 ? 212 LYS A CD    1 
ATOM   738  C CE    . LYS C 3 27  ? -29.488 -4.683  2.558   1.00 47.46 ? 212 LYS A CE    1 
ATOM   739  N NZ    . LYS C 3 27  ? -28.872 -5.936  3.071   1.00 47.43 ? 212 LYS A NZ    1 
ATOM   740  N N     . TYR C 3 28  ? -34.252 -4.382  6.474   1.00 43.10 ? 213 TYR A N     1 
ATOM   741  C CA    . TYR C 3 28  ? -35.536 -4.302  7.149   1.00 42.44 ? 213 TYR A CA    1 
ATOM   742  C C     . TYR C 3 28  ? -35.577 -5.008  8.512   1.00 42.07 ? 213 TYR A C     1 
ATOM   743  O O     . TYR C 3 28  ? -36.473 -4.758  9.319   1.00 42.20 ? 213 TYR A O     1 
ATOM   744  C CB    . TYR C 3 28  ? -36.620 -4.868  6.231   1.00 42.60 ? 213 TYR A CB    1 
ATOM   745  C CG    . TYR C 3 28  ? -36.746 -4.176  4.884   1.00 42.52 ? 213 TYR A CG    1 
ATOM   746  C CD1   . TYR C 3 28  ? -36.744 -4.910  3.702   1.00 42.50 ? 213 TYR A CD1   1 
ATOM   747  C CD2   . TYR C 3 28  ? -36.868 -2.789  4.796   1.00 42.33 ? 213 TYR A CD2   1 
ATOM   748  C CE1   . TYR C 3 28  ? -36.862 -4.281  2.464   1.00 42.77 ? 213 TYR A CE1   1 
ATOM   749  C CE2   . TYR C 3 28  ? -36.984 -2.150  3.572   1.00 42.62 ? 213 TYR A CE2   1 
ATOM   750  C CZ    . TYR C 3 28  ? -36.981 -2.898  2.407   1.00 42.91 ? 213 TYR A CZ    1 
ATOM   751  O OH    . TYR C 3 28  ? -37.100 -2.258  1.188   1.00 43.07 ? 213 TYR A OH    1 
ATOM   752  N N     . GLU C 3 29  ? -34.604 -5.876  8.773   1.00 41.29 ? 214 GLU A N     1 
ATOM   753  C CA    . GLU C 3 29  ? -34.608 -6.698  9.979   1.00 40.49 ? 214 GLU A CA    1 
ATOM   754  C C     . GLU C 3 29  ? -34.083 -5.968  11.216  1.00 40.03 ? 214 GLU A C     1 
ATOM   755  O O     . GLU C 3 29  ? -32.965 -5.436  11.222  1.00 40.09 ? 214 GLU A O     1 
ATOM   756  C CB    . GLU C 3 29  ? -33.826 -7.996  9.740   1.00 40.60 ? 214 GLU A CB    1 
ATOM   757  C CG    . GLU C 3 29  ? -33.585 -8.856  10.983  1.00 40.34 ? 214 GLU A CG    1 
ATOM   758  C CD    . GLU C 3 29  ? -32.960 -10.187 10.630  1.00 40.41 ? 214 GLU A CD    1 
ATOM   759  O OE1   . GLU C 3 29  ? -31.722 -10.317 10.745  1.00 39.62 ? 214 GLU A OE1   1 
ATOM   760  O OE2   . GLU C 3 29  ? -33.706 -11.093 10.207  1.00 40.67 ? 214 GLU A OE2   1 
ATOM   761  N N     . CYS C 3 30  ? -34.909 -5.951  12.257  1.00 39.08 ? 215 CYS A N     1 
ATOM   762  C CA    . CYS C 3 30  ? -34.534 -5.377  13.532  1.00 38.39 ? 215 CYS A CA    1 
ATOM   763  C C     . CYS C 3 30  ? -33.899 -6.451  14.394  1.00 37.82 ? 215 CYS A C     1 
ATOM   764  O O     . CYS C 3 30  ? -34.421 -7.567  14.517  1.00 37.40 ? 215 CYS A O     1 
ATOM   765  C CB    . CYS C 3 30  ? -35.747 -4.784  14.237  1.00 38.49 ? 215 CYS A CB    1 
ATOM   766  S SG    . CYS C 3 30  ? -36.654 -3.590  13.237  1.00 39.51 ? 215 CYS A SG    1 
ATOM   767  N N     . VAL C 3 31  ? -32.758 -6.099  14.976  1.00 37.17 ? 216 VAL A N     1 
ATOM   768  C CA    . VAL C 3 31  ? -31.964 -7.013  15.774  1.00 36.71 ? 216 VAL A CA    1 
ATOM   769  C C     . VAL C 3 31  ? -31.757 -6.368  17.132  1.00 36.57 ? 216 VAL A C     1 
ATOM   770  O O     . VAL C 3 31  ? -31.378 -5.197  17.219  1.00 36.56 ? 216 VAL A O     1 
ATOM   771  C CB    . VAL C 3 31  ? -30.592 -7.307  15.104  1.00 36.61 ? 216 VAL A CB    1 
ATOM   772  C CG1   . VAL C 3 31  ? -29.695 -8.154  16.009  1.00 36.70 ? 216 VAL A CG1   1 
ATOM   773  C CG2   . VAL C 3 31  ? -30.784 -7.988  13.763  1.00 35.99 ? 216 VAL A CG2   1 
ATOM   774  N N     . ILE C 3 32  ? -32.029 -7.128  18.186  1.00 36.30 ? 217 ILE A N     1 
ATOM   775  C CA    . ILE C 3 32  ? -31.780 -6.663  19.543  1.00 36.55 ? 217 ILE A CA    1 
ATOM   776  C C     . ILE C 3 32  ? -30.980 -7.700  20.315  1.00 36.47 ? 217 ILE A C     1 
ATOM   777  O O     . ILE C 3 32  ? -31.352 -8.882  20.368  1.00 36.52 ? 217 ILE A O     1 
ATOM   778  C CB    . ILE C 3 32  ? -33.078 -6.283  20.298  1.00 36.73 ? 217 ILE A CB    1 
ATOM   779  C CG1   . ILE C 3 32  ? -32.760 -5.881  21.737  1.00 37.67 ? 217 ILE A CG1   1 
ATOM   780  C CG2   . ILE C 3 32  ? -34.087 -7.423  20.298  1.00 36.91 ? 217 ILE A CG2   1 
ATOM   781  C CD1   . ILE C 3 32  ? -33.712 -4.829  22.245  1.00 39.32 ? 217 ILE A CD1   1 
ATOM   782  N N     . SER C 3 33  ? -29.873 -7.249  20.898  1.00 35.93 ? 218 SER A N     1 
ATOM   783  C CA    . SER C 3 33  ? -28.974 -8.151  21.597  1.00 35.84 ? 218 SER A CA    1 
ATOM   784  C C     . SER C 3 33  ? -28.684 -7.676  23.000  1.00 35.46 ? 218 SER A C     1 
ATOM   785  O O     . SER C 3 33  ? -28.384 -6.500  23.224  1.00 35.54 ? 218 SER A O     1 
ATOM   786  C CB    . SER C 3 33  ? -27.683 -8.340  20.817  1.00 35.42 ? 218 SER A CB    1 
ATOM   787  O OG    . SER C 3 33  ? -27.991 -8.869  19.550  1.00 36.55 ? 218 SER A OG    1 
ATOM   788  N N     . ILE C 3 34  ? -28.793 -8.616  23.929  1.00 34.93 ? 219 ILE A N     1 
ATOM   789  C CA    . ILE C 3 34  ? -28.660 -8.354  25.343  1.00 34.74 ? 219 ILE A CA    1 
ATOM   790  C C     . ILE C 3 34  ? -27.459 -9.147  25.815  1.00 34.85 ? 219 ILE A C     1 
ATOM   791  O O     . ILE C 3 34  ? -27.436 -10.377 25.709  1.00 35.29 ? 219 ILE A O     1 
ATOM   792  C CB    . ILE C 3 34  ? -29.917 -8.795  26.103  1.00 34.93 ? 219 ILE A CB    1 
ATOM   793  C CG1   . ILE C 3 34  ? -31.152 -8.131  25.478  1.00 34.76 ? 219 ILE A CG1   1 
ATOM   794  C CG2   . ILE C 3 34  ? -29.768 -8.525  27.623  1.00 33.18 ? 219 ILE A CG2   1 
ATOM   795  C CD1   . ILE C 3 34  ? -32.461 -8.420  26.182  1.00 37.75 ? 219 ILE A CD1   1 
ATOM   796  N N     . PHE C 3 35  ? -26.451 -8.432  26.295  1.00 34.19 ? 220 PHE A N     1 
ATOM   797  C CA    . PHE C 3 35  ? -25.215 -9.042  26.755  1.00 34.39 ? 220 PHE A CA    1 
ATOM   798  C C     . PHE C 3 35  ? -25.152 -8.870  28.274  1.00 34.90 ? 220 PHE A C     1 
ATOM   799  O O     . PHE C 3 35  ? -25.418 -7.780  28.803  1.00 34.76 ? 220 PHE A O     1 
ATOM   800  C CB    . PHE C 3 35  ? -24.005 -8.359  26.110  1.00 33.98 ? 220 PHE A CB    1 
ATOM   801  C CG    . PHE C 3 35  ? -23.889 -8.560  24.613  1.00 34.26 ? 220 PHE A CG    1 
ATOM   802  C CD1   . PHE C 3 35  ? -24.598 -7.749  23.714  1.00 34.07 ? 220 PHE A CD1   1 
ATOM   803  C CD2   . PHE C 3 35  ? -23.021 -9.533  24.095  1.00 34.16 ? 220 PHE A CD2   1 
ATOM   804  C CE1   . PHE C 3 35  ? -24.454 -7.918  22.313  1.00 33.54 ? 220 PHE A CE1   1 
ATOM   805  C CE2   . PHE C 3 35  ? -22.874 -9.710  22.720  1.00 33.72 ? 220 PHE A CE2   1 
ATOM   806  C CZ    . PHE C 3 35  ? -23.607 -8.901  21.819  1.00 33.50 ? 220 PHE A CZ    1 
ATOM   807  N N     . HIS C 3 36  ? -24.815 -9.955  28.967  1.00 35.32 ? 221 HIS A N     1 
ATOM   808  C CA    . HIS C 3 36  ? -24.728 -9.971  30.425  1.00 35.40 ? 221 HIS A CA    1 
ATOM   809  C C     . HIS C 3 36  ? -23.779 -11.096 30.902  1.00 34.97 ? 221 HIS A C     1 
ATOM   810  O O     . HIS C 3 36  ? -23.395 -11.982 30.122  1.00 34.52 ? 221 HIS A O     1 
ATOM   811  C CB    . HIS C 3 36  ? -26.124 -10.175 31.010  1.00 35.77 ? 221 HIS A CB    1 
ATOM   812  C CG    . HIS C 3 36  ? -26.705 -11.522 30.705  1.00 37.91 ? 221 HIS A CG    1 
ATOM   813  N ND1   . HIS C 3 36  ? -27.413 -11.784 29.551  1.00 39.13 ? 221 HIS A ND1   1 
ATOM   814  C CD2   . HIS C 3 36  ? -26.636 -12.695 31.377  1.00 39.17 ? 221 HIS A CD2   1 
ATOM   815  C CE1   . HIS C 3 36  ? -27.790 -13.052 29.544  1.00 39.83 ? 221 HIS A CE1   1 
ATOM   816  N NE2   . HIS C 3 36  ? -27.332 -13.627 30.642  1.00 41.84 ? 221 HIS A NE2   1 
ATOM   817  N N     . ALA C 3 37  ? -23.414 -11.075 32.179  1.00 34.38 ? 222 ALA A N     1 
ATOM   818  C CA    . ALA C 3 37  ? -22.636 -12.190 32.740  1.00 34.14 ? 222 ALA A CA    1 
ATOM   819  C C     . ALA C 3 37  ? -23.560 -13.322 33.187  1.00 34.31 ? 222 ALA A C     1 
ATOM   820  O O     . ALA C 3 37  ? -24.734 -13.087 33.477  1.00 34.05 ? 222 ALA A O     1 
ATOM   821  C CB    . ALA C 3 37  ? -21.783 -11.724 33.883  1.00 33.09 ? 222 ALA A CB    1 
ATOM   822  N N     . LYS C 3 38  ? -23.018 -14.536 33.255  1.00 34.79 ? 223 LYS A N     1 
ATOM   823  C CA    . LYS C 3 38  ? -23.758 -15.727 33.683  1.00 35.51 ? 223 LYS A CA    1 
ATOM   824  C C     . LYS C 3 38  ? -24.022 -15.809 35.206  1.00 36.05 ? 223 LYS A C     1 
ATOM   825  O O     . LYS C 3 38  ? -24.743 -16.700 35.671  1.00 36.65 ? 223 LYS A O     1 
ATOM   826  C CB    . LYS C 3 38  ? -23.006 -16.985 33.254  1.00 35.53 ? 223 LYS A CB    1 
ATOM   827  C CG    . LYS C 3 38  ? -23.047 -17.296 31.773  1.00 36.63 ? 223 LYS A CG    1 
ATOM   828  C CD    . LYS C 3 38  ? -22.483 -18.685 31.488  1.00 37.95 ? 223 LYS A CD    1 
ATOM   829  C CE    . LYS C 3 38  ? -23.194 -19.289 30.280  1.00 40.70 ? 223 LYS A CE    1 
ATOM   830  N NZ    . LYS C 3 38  ? -22.354 -20.248 29.495  1.00 41.64 ? 223 LYS A NZ    1 
ATOM   831  N N     . VAL C 3 39  ? -23.461 -14.884 35.974  1.00 35.67 ? 224 VAL A N     1 
ATOM   832  C CA    . VAL C 3 39  ? -23.443 -14.998 37.426  1.00 35.73 ? 224 VAL A CA    1 
ATOM   833  C C     . VAL C 3 39  ? -23.624 -13.606 37.959  1.00 36.53 ? 224 VAL A C     1 
ATOM   834  O O     . VAL C 3 39  ? -23.303 -12.627 37.267  1.00 37.08 ? 224 VAL A O     1 
ATOM   835  C CB    . VAL C 3 39  ? -22.060 -15.587 37.868  1.00 36.49 ? 224 VAL A CB    1 
ATOM   836  C CG1   . VAL C 3 39  ? -21.405 -14.801 38.958  1.00 35.35 ? 224 VAL A CG1   1 
ATOM   837  C CG2   . VAL C 3 39  ? -22.142 -17.098 38.160  1.00 35.82 ? 224 VAL A CG2   1 
ATOM   838  N N     . ALA C 3 40  ? -24.168 -13.488 39.167  1.00 37.00 ? 225 ALA A N     1 
ATOM   839  C CA    . ALA C 3 40  ? -24.140 -12.204 39.854  1.00 37.13 ? 225 ALA A CA    1 
ATOM   840  C C     . ALA C 3 40  ? -23.978 -12.420 41.351  1.00 37.55 ? 225 ALA A C     1 
ATOM   841  O O     . ALA C 3 40  ? -24.571 -13.347 41.917  1.00 38.55 ? 225 ALA A O     1 
ATOM   842  C CB    . ALA C 3 40  ? -25.405 -11.437 39.569  1.00 37.64 ? 225 ALA A CB    1 
ATOM   843  N N     . GLN C 3 41  ? -23.198 -11.554 41.990  1.00 37.23 ? 226 GLN A N     1 
ATOM   844  C CA    . GLN C 3 41  ? -22.999 -11.621 43.428  1.00 37.11 ? 226 GLN A CA    1 
ATOM   845  C C     . GLN C 3 41  ? -24.194 -11.053 44.212  1.00 37.35 ? 226 GLN A C     1 
ATOM   846  O O     . GLN C 3 41  ? -24.599 -9.907  44.016  1.00 37.12 ? 226 GLN A O     1 
ATOM   847  C CB    . GLN C 3 41  ? -21.685 -10.933 43.828  1.00 36.21 ? 226 GLN A CB    1 
ATOM   848  C CG    . GLN C 3 41  ? -21.348 -10.984 45.309  1.00 35.72 ? 226 GLN A CG    1 
ATOM   849  C CD    . GLN C 3 41  ? -19.873 -10.639 45.608  1.00 36.57 ? 226 GLN A CD    1 
ATOM   850  O OE1   . GLN C 3 41  ? -19.008 -10.708 44.730  1.00 36.39 ? 226 GLN A OE1   1 
ATOM   851  N NE2   . GLN C 3 41  ? -19.587 -10.312 46.861  1.00 31.42 ? 226 GLN A NE2   1 
ATOM   852  N N     . LYS C 3 42  ? -24.759 -11.833 45.129  1.00 37.69 ? 227 LYS A N     1 
ATOM   853  C CA    . LYS C 3 42  ? -25.831 -11.240 45.934  1.00 38.12 ? 227 LYS A CA    1 
ATOM   854  C C     . LYS C 3 42  ? -25.349 -10.080 46.822  1.00 37.64 ? 227 LYS A C     1 
ATOM   855  O O     . LYS C 3 42  ? -24.168 -9.985  47.140  1.00 37.16 ? 227 LYS A O     1 
ATOM   856  C CB    . LYS C 3 42  ? -26.609 -12.277 46.713  1.00 37.73 ? 227 LYS A CB    1 
ATOM   857  C CG    . LYS C 3 42  ? -25.833 -13.013 47.765  1.00 40.54 ? 227 LYS A CG    1 
ATOM   858  C CD    . LYS C 3 42  ? -26.462 -14.403 48.001  1.00 41.24 ? 227 LYS A CD    1 
ATOM   859  C CE    . LYS C 3 42  ? -27.653 -14.295 48.921  1.00 40.89 ? 227 LYS A CE    1 
ATOM   860  N NZ    . LYS C 3 42  ? -28.290 -15.621 49.080  1.00 43.16 ? 227 LYS A NZ    1 
ATOM   861  N N     . SER C 3 43  ? -26.283 -9.184  47.138  1.00 37.39 ? 228 SER A N     1 
ATOM   862  C CA    . SER C 3 43  ? -26.097 -8.105  48.083  1.00 37.67 ? 228 SER A CA    1 
ATOM   863  C C     . SER C 3 43  ? -26.749 -8.498  49.407  1.00 37.68 ? 228 SER A C     1 
ATOM   864  O O     . SER C 3 43  ? -27.856 -9.053  49.415  1.00 38.07 ? 228 SER A O     1 
ATOM   865  C CB    . SER C 3 43  ? -26.770 -6.838  47.555  1.00 37.52 ? 228 SER A CB    1 
ATOM   866  O OG    . SER C 3 43  ? -26.226 -6.484  46.302  1.00 37.30 ? 228 SER A OG    1 
ATOM   867  N N     . TYR C 3 44  ? -26.068 -8.214  50.519  1.00 37.49 ? 229 TYR A N     1 
ATOM   868  C CA    . TYR C 3 44  ? -26.583 -8.546  51.857  1.00 36.19 ? 229 TYR A CA    1 
ATOM   869  C C     . TYR C 3 44  ? -27.040 -7.290  52.520  1.00 36.87 ? 229 TYR A C     1 
ATOM   870  O O     . TYR C 3 44  ? -26.496 -6.217  52.257  1.00 37.79 ? 229 TYR A O     1 
ATOM   871  C CB    . TYR C 3 44  ? -25.508 -9.245  52.701  1.00 34.52 ? 229 TYR A CB    1 
ATOM   872  C CG    . TYR C 3 44  ? -25.267 -10.662 52.257  1.00 32.45 ? 229 TYR A CG    1 
ATOM   873  C CD1   . TYR C 3 44  ? -24.170 -11.005 51.467  1.00 32.47 ? 229 TYR A CD1   1 
ATOM   874  C CD2   . TYR C 3 44  ? -26.179 -11.659 52.568  1.00 27.90 ? 229 TYR A CD2   1 
ATOM   875  C CE1   . TYR C 3 44  ? -23.998 -12.349 51.031  1.00 29.30 ? 229 TYR A CE1   1 
ATOM   876  C CE2   . TYR C 3 44  ? -26.025 -12.929 52.125  1.00 28.04 ? 229 TYR A CE2   1 
ATOM   877  C CZ    . TYR C 3 44  ? -24.925 -13.282 51.374  1.00 29.22 ? 229 TYR A CZ    1 
ATOM   878  O OH    . TYR C 3 44  ? -24.824 -14.607 50.983  1.00 31.10 ? 229 TYR A OH    1 
ATOM   879  N N     . GLY C 3 45  ? -28.054 -7.382  53.369  1.00 38.05 ? 230 GLY A N     1 
ATOM   880  C CA    . GLY C 3 45  ? -28.481 -6.192  54.126  1.00 38.58 ? 230 GLY A CA    1 
ATOM   881  C C     . GLY C 3 45  ? -28.897 -5.079  53.200  1.00 39.26 ? 230 GLY A C     1 
ATOM   882  O O     . GLY C 3 45  ? -29.541 -5.331  52.187  1.00 40.58 ? 230 GLY A O     1 
ATOM   883  N N     . ASN C 3 46  ? -28.494 -3.857  53.519  1.00 39.95 ? 231 ASN A N     1 
ATOM   884  C CA    . ASN C 3 46  ? -28.849 -2.669  52.738  1.00 40.39 ? 231 ASN A CA    1 
ATOM   885  C C     . ASN C 3 46  ? -27.815 -2.293  51.681  1.00 40.76 ? 231 ASN A C     1 
ATOM   886  O O     . ASN C 3 46  ? -27.816 -1.157  51.187  1.00 41.69 ? 231 ASN A O     1 
ATOM   887  C CB    . ASN C 3 46  ? -29.037 -1.468  53.669  1.00 39.79 ? 231 ASN A CB    1 
ATOM   888  C CG    . ASN C 3 46  ? -30.033 -1.747  54.777  1.00 41.78 ? 231 ASN A CG    1 
ATOM   889  O OD1   . ASN C 3 46  ? -31.079 -2.371  54.547  1.00 43.46 ? 231 ASN A OD1   1 
ATOM   890  N ND2   . ASN C 3 46  ? -29.724 -1.286  55.986  1.00 41.00 ? 231 ASN A ND2   1 
ATOM   891  N N     . GLU C 3 47  ? -26.950 -3.221  51.312  1.00 40.12 ? 232 GLU A N     1 
ATOM   892  C CA    . GLU C 3 47  ? -25.870 -2.863  50.401  1.00 40.10 ? 232 GLU A CA    1 
ATOM   893  C C     . GLU C 3 47  ? -26.257 -3.141  48.931  1.00 39.29 ? 232 GLU A C     1 
ATOM   894  O O     . GLU C 3 47  ? -27.212 -3.887  48.661  1.00 38.89 ? 232 GLU A O     1 
ATOM   895  C CB    . GLU C 3 47  ? -24.558 -3.599  50.799  1.00 39.68 ? 232 GLU A CB    1 
ATOM   896  C CG    . GLU C 3 47  ? -24.333 -4.885  50.099  1.00 39.48 ? 232 GLU A CG    1 
ATOM   897  C CD    . GLU C 3 47  ? -23.435 -5.847  50.873  1.00 40.94 ? 232 GLU A CD    1 
ATOM   898  O OE1   . GLU C 3 47  ? -23.570 -7.078  50.685  1.00 37.92 ? 232 GLU A OE1   1 
ATOM   899  O OE2   . GLU C 3 47  ? -22.615 -5.372  51.675  1.00 39.33 ? 232 GLU A OE2   1 
ATOM   900  N N     . LYS C 3 48  ? -25.516 -2.549  47.993  1.00 38.21 ? 233 LYS A N     1 
ATOM   901  C CA    . LYS C 3 48  ? -25.706 -2.867  46.581  1.00 37.28 ? 233 LYS A CA    1 
ATOM   902  C C     . LYS C 3 48  ? -24.403 -3.236  45.895  1.00 36.67 ? 233 LYS A C     1 
ATOM   903  O O     . LYS C 3 48  ? -23.490 -2.440  45.851  1.00 36.87 ? 233 LYS A O     1 
ATOM   904  C CB    . LYS C 3 48  ? -26.413 -1.733  45.852  1.00 37.41 ? 233 LYS A CB    1 
ATOM   905  C CG    . LYS C 3 48  ? -27.774 -1.388  46.452  1.00 38.46 ? 233 LYS A CG    1 
ATOM   906  C CD    . LYS C 3 48  ? -28.125 0.049   46.206  1.00 39.72 ? 233 LYS A CD    1 
ATOM   907  C CE    . LYS C 3 48  ? -29.418 0.384   46.907  1.00 41.11 ? 233 LYS A CE    1 
ATOM   908  N NZ    . LYS C 3 48  ? -29.602 1.827   46.938  1.00 41.03 ? 233 LYS A NZ    1 
ATOM   909  N N     . ARG C 3 49  ? -24.331 -4.456  45.372  1.00 36.09 ? 234 ARG A N     1 
ATOM   910  C CA    . ARG C 3 49  ? -23.211 -4.897  44.575  1.00 35.86 ? 234 ARG A CA    1 
ATOM   911  C C     . ARG C 3 49  ? -23.743 -5.028  43.151  1.00 36.02 ? 234 ARG A C     1 
ATOM   912  O O     . ARG C 3 49  ? -24.471 -5.963  42.823  1.00 36.66 ? 234 ARG A O     1 
ATOM   913  C CB    . ARG C 3 49  ? -22.623 -6.228  45.121  1.00 35.90 ? 234 ARG A CB    1 
ATOM   914  C CG    . ARG C 3 49  ? -22.086 -6.151  46.573  1.00 35.47 ? 234 ARG A CG    1 
ATOM   915  C CD    . ARG C 3 49  ? -21.506 -7.485  47.133  1.00 36.27 ? 234 ARG A CD    1 
ATOM   916  N NE    . ARG C 3 49  ? -21.119 -7.274  48.541  1.00 37.18 ? 234 ARG A NE    1 
ATOM   917  C CZ    . ARG C 3 49  ? -19.924 -6.834  48.944  1.00 35.58 ? 234 ARG A CZ    1 
ATOM   918  N NH1   . ARG C 3 49  ? -19.682 -6.608  50.246  1.00 33.02 ? 234 ARG A NH1   1 
ATOM   919  N NH2   . ARG C 3 49  ? -18.971 -6.604  48.049  1.00 31.38 ? 234 ARG A NH2   1 
ATOM   920  N N     . PHE C 3 50  ? -23.385 -4.061  42.326  1.00 35.89 ? 235 PHE A N     1 
ATOM   921  C CA    . PHE C 3 50  ? -23.870 -3.917  40.948  1.00 35.86 ? 235 PHE A CA    1 
ATOM   922  C C     . PHE C 3 50  ? -23.407 -5.007  39.989  1.00 36.19 ? 235 PHE A C     1 
ATOM   923  O O     . PHE C 3 50  ? -22.234 -5.409  39.997  1.00 36.74 ? 235 PHE A O     1 
ATOM   924  C CB    . PHE C 3 50  ? -23.417 -2.559  40.403  1.00 35.08 ? 235 PHE A CB    1 
ATOM   925  C CG    . PHE C 3 50  ? -23.964 -1.369  41.173  1.00 34.74 ? 235 PHE A CG    1 
ATOM   926  C CD1   . PHE C 3 50  ? -23.194 -0.230  41.341  1.00 33.43 ? 235 PHE A CD1   1 
ATOM   927  C CD2   . PHE C 3 50  ? -25.260 -1.396  41.728  1.00 34.65 ? 235 PHE A CD2   1 
ATOM   928  C CE1   . PHE C 3 50  ? -23.705 0.889   42.039  1.00 35.37 ? 235 PHE A CE1   1 
ATOM   929  C CE2   . PHE C 3 50  ? -25.773 -0.299  42.428  1.00 33.67 ? 235 PHE A CE2   1 
ATOM   930  C CZ    . PHE C 3 50  ? -24.999 0.847   42.586  1.00 33.73 ? 235 PHE A CZ    1 
ATOM   931  N N     . PHE C 3 51  ? -24.309 -5.487  39.140  1.00 36.13 ? 236 PHE A N     1 
ATOM   932  C CA    . PHE C 3 51  ? -23.893 -6.487  38.174  1.00 36.01 ? 236 PHE A CA    1 
ATOM   933  C C     . PHE C 3 51  ? -22.826 -5.835  37.323  1.00 35.55 ? 236 PHE A C     1 
ATOM   934  O O     . PHE C 3 51  ? -22.968 -4.681  36.919  1.00 35.37 ? 236 PHE A O     1 
ATOM   935  C CB    . PHE C 3 51  ? -25.045 -6.984  37.323  1.00 36.06 ? 236 PHE A CB    1 
ATOM   936  C CG    . PHE C 3 51  ? -26.207 -7.485  38.109  1.00 35.63 ? 236 PHE A CG    1 
ATOM   937  C CD1   . PHE C 3 51  ? -27.453 -7.619  37.501  1.00 35.12 ? 236 PHE A CD1   1 
ATOM   938  C CD2   . PHE C 3 51  ? -26.069 -7.834  39.452  1.00 37.96 ? 236 PHE A CD2   1 
ATOM   939  C CE1   . PHE C 3 51  ? -28.551 -8.090  38.211  1.00 36.05 ? 236 PHE A CE1   1 
ATOM   940  C CE2   . PHE C 3 51  ? -27.165 -8.328  40.195  1.00 37.32 ? 236 PHE A CE2   1 
ATOM   941  C CZ    . PHE C 3 51  ? -28.409 -8.452  39.574  1.00 37.19 ? 236 PHE A CZ    1 
ATOM   942  N N     . CYS C 3 52  ? -21.738 -6.567  37.128  1.00 35.93 ? 237 CYS A N     1 
ATOM   943  C CA    . CYS C 3 52  ? -20.544 -6.100  36.436  1.00 35.82 ? 237 CYS A CA    1 
ATOM   944  C C     . CYS C 3 52  ? -19.986 -7.301  35.668  1.00 35.65 ? 237 CYS A C     1 
ATOM   945  O O     . CYS C 3 52  ? -19.837 -8.383  36.238  1.00 35.76 ? 237 CYS A O     1 
ATOM   946  C CB    . CYS C 3 52  ? -19.513 -5.597  37.445  1.00 35.64 ? 237 CYS A CB    1 
ATOM   947  S SG    . CYS C 3 52  ? -18.161 -4.676  36.744  1.00 39.32 ? 237 CYS A SG    1 
ATOM   948  N N     . PRO C 3 53  ? -19.726 -7.139  34.360  1.00 35.35 ? 238 PRO A N     1 
ATOM   949  C CA    . PRO C 3 53  ? -19.913 -5.913  33.603  1.00 35.22 ? 238 PRO A CA    1 
ATOM   950  C C     . PRO C 3 53  ? -21.388 -5.563  33.522  1.00 35.18 ? 238 PRO A C     1 
ATOM   951  O O     . PRO C 3 53  ? -22.243 -6.414  33.764  1.00 34.00 ? 238 PRO A O     1 
ATOM   952  C CB    . PRO C 3 53  ? -19.367 -6.271  32.217  1.00 35.08 ? 238 PRO A CB    1 
ATOM   953  C CG    . PRO C 3 53  ? -19.569 -7.739  32.131  1.00 36.01 ? 238 PRO A CG    1 
ATOM   954  C CD    . PRO C 3 53  ? -19.251 -8.235  33.506  1.00 35.07 ? 238 PRO A CD    1 
ATOM   955  N N     . PRO C 3 54  ? -21.694 -4.308  33.171  1.00 35.74 ? 239 PRO A N     1 
ATOM   956  C CA    . PRO C 3 54  ? -23.097 -3.927  33.225  1.00 35.36 ? 239 PRO A CA    1 
ATOM   957  C C     . PRO C 3 54  ? -23.836 -4.610  32.071  1.00 35.62 ? 239 PRO A C     1 
ATOM   958  O O     . PRO C 3 54  ? -23.355 -4.577  30.939  1.00 35.74 ? 239 PRO A O     1 
ATOM   959  C CB    . PRO C 3 54  ? -23.062 -2.406  33.020  1.00 35.25 ? 239 PRO A CB    1 
ATOM   960  C CG    . PRO C 3 54  ? -21.611 -2.005  33.030  1.00 36.00 ? 239 PRO A CG    1 
ATOM   961  C CD    . PRO C 3 54  ? -20.833 -3.221  32.671  1.00 35.34 ? 239 PRO A CD    1 
ATOM   962  N N     . PRO C 3 55  ? -24.970 -5.272  32.362  1.00 35.52 ? 240 PRO A N     1 
ATOM   963  C CA    . PRO C 3 55  ? -25.800 -5.802  31.307  1.00 35.21 ? 240 PRO A CA    1 
ATOM   964  C C     . PRO C 3 55  ? -26.103 -4.684  30.336  1.00 34.89 ? 240 PRO A C     1 
ATOM   965  O O     . PRO C 3 55  ? -26.329 -3.552  30.755  1.00 34.66 ? 240 PRO A O     1 
ATOM   966  C CB    . PRO C 3 55  ? -27.067 -6.211  32.050  1.00 35.85 ? 240 PRO A CB    1 
ATOM   967  C CG    . PRO C 3 55  ? -26.538 -6.653  33.407  1.00 36.31 ? 240 PRO A CG    1 
ATOM   968  C CD    . PRO C 3 55  ? -25.519 -5.582  33.699  1.00 35.74 ? 240 PRO A CD    1 
ATOM   969  N N     . CYS C 3 56  ? -26.061 -4.993  29.045  1.00 34.48 ? 241 CYS A N     1 
ATOM   970  C CA    . CYS C 3 56  ? -26.253 -3.980  28.027  1.00 34.23 ? 241 CYS A CA    1 
ATOM   971  C C     . CYS C 3 56  ? -26.975 -4.504  26.789  1.00 33.51 ? 241 CYS A C     1 
ATOM   972  O O     . CYS C 3 56  ? -27.066 -5.712  26.540  1.00 32.54 ? 241 CYS A O     1 
ATOM   973  C CB    . CYS C 3 56  ? -24.909 -3.390  27.619  1.00 35.03 ? 241 CYS A CB    1 
ATOM   974  S SG    . CYS C 3 56  ? -23.858 -4.615  26.851  1.00 36.47 ? 241 CYS A SG    1 
ATOM   975  N N     . ILE C 3 57  ? -27.464 -3.557  26.007  1.00 33.25 ? 242 ILE A N     1 
ATOM   976  C CA    . ILE C 3 57  ? -28.336 -3.852  24.899  1.00 33.19 ? 242 ILE A CA    1 
ATOM   977  C C     . ILE C 3 57  ? -27.831 -3.126  23.676  1.00 33.36 ? 242 ILE A C     1 
ATOM   978  O O     . ILE C 3 57  ? -27.630 -1.907  23.704  1.00 33.18 ? 242 ILE A O     1 
ATOM   979  C CB    . ILE C 3 57  ? -29.807 -3.437  25.213  1.00 33.30 ? 242 ILE A CB    1 
ATOM   980  C CG1   . ILE C 3 57  ? -30.362 -4.299  26.358  1.00 32.26 ? 242 ILE A CG1   1 
ATOM   981  C CG2   . ILE C 3 57  ? -30.682 -3.545  23.960  1.00 31.85 ? 242 ILE A CG2   1 
ATOM   982  C CD1   . ILE C 3 57  ? -31.601 -3.751  26.988  1.00 32.05 ? 242 ILE A CD1   1 
ATOM   983  N N     . TYR C 3 58  ? -27.620 -3.892  22.609  1.00 33.84 ? 243 TYR A N     1 
ATOM   984  C CA    . TYR C 3 58  ? -27.287 -3.333  21.306  1.00 34.48 ? 243 TYR A CA    1 
ATOM   985  C C     . TYR C 3 58  ? -28.473 -3.432  20.354  1.00 34.35 ? 243 TYR A C     1 
ATOM   986  O O     . TYR C 3 58  ? -29.019 -4.512  20.149  1.00 34.42 ? 243 TYR A O     1 
ATOM   987  C CB    . TYR C 3 58  ? -26.081 -4.071  20.707  1.00 35.16 ? 243 TYR A CB    1 
ATOM   988  C CG    . TYR C 3 58  ? -24.735 -3.701  21.303  1.00 35.80 ? 243 TYR A CG    1 
ATOM   989  C CD1   . TYR C 3 58  ? -24.227 -4.378  22.405  1.00 37.32 ? 243 TYR A CD1   1 
ATOM   990  C CD2   . TYR C 3 58  ? -23.966 -2.685  20.749  1.00 36.89 ? 243 TYR A CD2   1 
ATOM   991  C CE1   . TYR C 3 58  ? -22.982 -4.041  22.956  1.00 37.13 ? 243 TYR A CE1   1 
ATOM   992  C CE2   . TYR C 3 58  ? -22.721 -2.346  21.275  1.00 37.06 ? 243 TYR A CE2   1 
ATOM   993  C CZ    . TYR C 3 58  ? -22.236 -3.028  22.379  1.00 37.17 ? 243 TYR A CZ    1 
ATOM   994  O OH    . TYR C 3 58  ? -21.003 -2.686  22.902  1.00 37.76 ? 243 TYR A OH    1 
ATOM   995  N N     . LEU C 3 59  ? -28.861 -2.308  19.764  1.00 34.95 ? 244 LEU A N     1 
ATOM   996  C CA    . LEU C 3 59  ? -29.882 -2.300  18.698  1.00 35.31 ? 244 LEU A CA    1 
ATOM   997  C C     . LEU C 3 59  ? -29.209 -2.210  17.347  1.00 35.54 ? 244 LEU A C     1 
ATOM   998  O O     . LEU C 3 59  ? -28.650 -1.177  17.004  1.00 36.54 ? 244 LEU A O     1 
ATOM   999  C CB    . LEU C 3 59  ? -30.877 -1.144  18.883  1.00 35.01 ? 244 LEU A CB    1 
ATOM   1000 C CG    . LEU C 3 59  ? -31.569 -1.061  20.253  1.00 35.40 ? 244 LEU A CG    1 
ATOM   1001 C CD1   . LEU C 3 59  ? -32.487 0.154   20.345  1.00 36.67 ? 244 LEU A CD1   1 
ATOM   1002 C CD2   . LEU C 3 59  ? -32.335 -2.324  20.538  1.00 34.67 ? 244 LEU A CD2   1 
ATOM   1003 N N     . ILE C 3 60  ? -29.256 -3.289  16.573  1.00 35.73 ? 245 ILE A N     1 
ATOM   1004 C CA    . ILE C 3 60  ? -28.511 -3.354  15.306  1.00 35.48 ? 245 ILE A CA    1 
ATOM   1005 C C     . ILE C 3 60  ? -29.460 -3.574  14.153  1.00 35.70 ? 245 ILE A C     1 
ATOM   1006 O O     . ILE C 3 60  ? -30.537 -4.123  14.336  1.00 35.82 ? 245 ILE A O     1 
ATOM   1007 C CB    . ILE C 3 60  ? -27.466 -4.497  15.331  1.00 35.35 ? 245 ILE A CB    1 
ATOM   1008 C CG1   . ILE C 3 60  ? -26.522 -4.326  16.527  1.00 35.29 ? 245 ILE A CG1   1 
ATOM   1009 C CG2   . ILE C 3 60  ? -26.692 -4.552  14.041  1.00 34.62 ? 245 ILE A CG2   1 
ATOM   1010 C CD1   . ILE C 3 60  ? -25.899 -5.607  17.006  1.00 35.19 ? 245 ILE A CD1   1 
ATOM   1011 N N     . GLY C 3 61  ? -29.049 -3.144  12.962  1.00 36.10 ? 246 GLY A N     1 
ATOM   1012 C CA    . GLY C 3 61  ? -29.850 -3.302  11.768  1.00 36.11 ? 246 GLY A CA    1 
ATOM   1013 C C     . GLY C 3 61  ? -30.446 -1.970  11.383  1.00 36.46 ? 246 GLY A C     1 
ATOM   1014 O O     . GLY C 3 61  ? -30.636 -1.092  12.232  1.00 36.14 ? 246 GLY A O     1 
ATOM   1015 N N     . GLN C 3 62  ? -30.730 -1.809  10.095  1.00 36.66 ? 247 GLN A N     1 
ATOM   1016 C CA    . GLN C 3 62  ? -31.324 -0.573  9.626   1.00 37.05 ? 247 GLN A CA    1 
ATOM   1017 C C     . GLN C 3 62  ? -32.825 -0.585  9.808   1.00 37.17 ? 247 GLN A C     1 
ATOM   1018 O O     . GLN C 3 62  ? -33.459 0.472   9.817   1.00 37.22 ? 247 GLN A O     1 
ATOM   1019 C CB    . GLN C 3 62  ? -30.930 -0.267  8.178   1.00 37.28 ? 247 GLN A CB    1 
ATOM   1020 C CG    . GLN C 3 62  ? -29.636 0.551   8.058   1.00 37.97 ? 247 GLN A CG    1 
ATOM   1021 C CD    . GLN C 3 62  ? -29.652 1.842   8.888   1.00 38.71 ? 247 GLN A CD    1 
ATOM   1022 O OE1   . GLN C 3 62  ? -29.824 1.816   10.117  1.00 39.21 ? 247 GLN A OE1   1 
ATOM   1023 N NE2   . GLN C 3 62  ? -29.461 2.973   8.218   1.00 38.25 ? 247 GLN A NE2   1 
ATOM   1024 N N     . GLY C 3 63  ? -33.379 -1.784  9.981   1.00 37.34 ? 248 GLY A N     1 
ATOM   1025 C CA    . GLY C 3 63  ? -34.800 -1.964  10.270  1.00 37.48 ? 248 GLY A CA    1 
ATOM   1026 C C     . GLY C 3 63  ? -35.323 -1.021  11.339  1.00 37.73 ? 248 GLY A C     1 
ATOM   1027 O O     . GLY C 3 63  ? -36.478 -0.593  11.279  1.00 38.19 ? 248 GLY A O     1 
ATOM   1028 N N     . TRP C 3 64  ? -34.470 -0.696  12.311  1.00 37.77 ? 249 TRP A N     1 
ATOM   1029 C CA    . TRP C 3 64  ? -34.806 0.238   13.391  1.00 37.79 ? 249 TRP A CA    1 
ATOM   1030 C C     . TRP C 3 64  ? -35.102 1.654   12.903  1.00 38.16 ? 249 TRP A C     1 
ATOM   1031 O O     . TRP C 3 64  ? -35.948 2.343   13.474  1.00 38.21 ? 249 TRP A O     1 
ATOM   1032 C CB    . TRP C 3 64  ? -33.703 0.262   14.457  1.00 37.22 ? 249 TRP A CB    1 
ATOM   1033 C CG    . TRP C 3 64  ? -33.633 -1.008  15.236  1.00 36.67 ? 249 TRP A CG    1 
ATOM   1034 C CD1   . TRP C 3 64  ? -32.693 -1.987  15.124  1.00 35.61 ? 249 TRP A CD1   1 
ATOM   1035 C CD2   . TRP C 3 64  ? -34.561 -1.455  16.231  1.00 36.17 ? 249 TRP A CD2   1 
ATOM   1036 N NE1   . TRP C 3 64  ? -32.972 -3.015  15.989  1.00 35.12 ? 249 TRP A NE1   1 
ATOM   1037 C CE2   . TRP C 3 64  ? -34.110 -2.712  16.686  1.00 35.45 ? 249 TRP A CE2   1 
ATOM   1038 C CE3   . TRP C 3 64  ? -35.725 -0.910  16.788  1.00 35.94 ? 249 TRP A CE3   1 
ATOM   1039 C CZ2   . TRP C 3 64  ? -34.781 -3.435  17.670  1.00 35.77 ? 249 TRP A CZ2   1 
ATOM   1040 C CZ3   . TRP C 3 64  ? -36.395 -1.632  17.773  1.00 36.21 ? 249 TRP A CZ3   1 
ATOM   1041 C CH2   . TRP C 3 64  ? -35.920 -2.881  18.201  1.00 36.46 ? 249 TRP A CH2   1 
ATOM   1042 N N     . LYS C 3 65  ? -34.399 2.084   11.859  1.00 38.74 ? 250 LYS A N     1 
ATOM   1043 C CA    . LYS C 3 65  ? -34.617 3.397   11.270  1.00 39.44 ? 250 LYS A CA    1 
ATOM   1044 C C     . LYS C 3 65  ? -35.968 3.440   10.557  1.00 39.73 ? 250 LYS A C     1 
ATOM   1045 O O     . LYS C 3 65  ? -36.690 4.430   10.653  1.00 40.01 ? 250 LYS A O     1 
ATOM   1046 C CB    . LYS C 3 65  ? -33.476 3.736   10.309  1.00 39.64 ? 250 LYS A CB    1 
ATOM   1047 C CG    . LYS C 3 65  ? -33.447 5.188   9.827   1.00 40.24 ? 250 LYS A CG    1 
ATOM   1048 C CD    . LYS C 3 65  ? -32.047 5.602   9.346   1.00 41.10 ? 250 LYS A CD    1 
ATOM   1049 C CE    . LYS C 3 65  ? -30.963 5.375   10.417  1.00 40.15 ? 250 LYS A CE    1 
ATOM   1050 N NZ    . LYS C 3 65  ? -31.267 6.060   11.703  1.00 39.98 ? 250 LYS A NZ    1 
ATOM   1051 N N     . LEU C 3 66  ? -36.296 2.357   9.852   1.00 40.07 ? 251 LEU A N     1 
ATOM   1052 C CA    . LEU C 3 66  ? -37.579 2.198   9.167   1.00 40.28 ? 251 LEU A CA    1 
ATOM   1053 C C     . LEU C 3 66  ? -38.744 2.000   10.155  1.00 40.76 ? 251 LEU A C     1 
ATOM   1054 O O     . LEU C 3 66  ? -39.878 2.406   9.881   1.00 40.89 ? 251 LEU A O     1 
ATOM   1055 C CB    . LEU C 3 66  ? -37.495 1.026   8.183   1.00 40.19 ? 251 LEU A CB    1 
ATOM   1056 C CG    . LEU C 3 66  ? -38.708 0.665   7.320   1.00 40.02 ? 251 LEU A CG    1 
ATOM   1057 C CD1   . LEU C 3 66  ? -38.735 1.460   6.023   1.00 40.24 ? 251 LEU A CD1   1 
ATOM   1058 C CD2   . LEU C 3 66  ? -38.712 -0.823  7.034   1.00 39.49 ? 251 LEU A CD2   1 
ATOM   1059 N N     . LYS C 3 67  ? -38.468 1.372   11.296  1.00 41.19 ? 252 LYS A N     1 
ATOM   1060 C CA    . LYS C 3 67  ? -39.456 1.271   12.370  1.00 41.78 ? 252 LYS A CA    1 
ATOM   1061 C C     . LYS C 3 67  ? -39.804 2.652   12.909  1.00 42.04 ? 252 LYS A C     1 
ATOM   1062 O O     . LYS C 3 67  ? -40.981 2.959   13.128  1.00 42.17 ? 252 LYS A O     1 
ATOM   1063 C CB    . LYS C 3 67  ? -38.960 0.378   13.510  1.00 41.70 ? 252 LYS A CB    1 
ATOM   1064 C CG    . LYS C 3 67  ? -39.434 -1.062  13.434  1.00 42.14 ? 252 LYS A CG    1 
ATOM   1065 C CD    . LYS C 3 67  ? -39.293 -1.775  14.801  1.00 42.52 ? 252 LYS A CD    1 
ATOM   1066 C CE    . LYS C 3 67  ? -40.357 -1.320  15.828  1.00 43.01 ? 252 LYS A CE    1 
ATOM   1067 N NZ    . LYS C 3 67  ? -41.739 -1.150  15.204  1.00 43.04 ? 252 LYS A NZ    1 
ATOM   1068 N N     . LYS C 3 68  ? -38.779 3.481   13.109  1.00 42.36 ? 253 LYS A N     1 
ATOM   1069 C CA    . LYS C 3 68  ? -38.975 4.851   13.573  1.00 42.88 ? 253 LYS A CA    1 
ATOM   1070 C C     . LYS C 3 68  ? -39.730 5.664   12.524  1.00 43.11 ? 253 LYS A C     1 
ATOM   1071 O O     . LYS C 3 68  ? -40.578 6.488   12.867  1.00 43.23 ? 253 LYS A O     1 
ATOM   1072 C CB    . LYS C 3 68  ? -37.641 5.530   13.898  1.00 42.92 ? 253 LYS A CB    1 
ATOM   1073 C CG    . LYS C 3 68  ? -37.791 6.728   14.829  1.00 43.38 ? 253 LYS A CG    1 
ATOM   1074 C CD    . LYS C 3 68  ? -36.644 7.722   14.703  1.00 44.18 ? 253 LYS A CD    1 
ATOM   1075 C CE    . LYS C 3 68  ? -36.586 8.662   15.913  1.00 44.49 ? 253 LYS A CE    1 
ATOM   1076 N NZ    . LYS C 3 68  ? -37.855 9.433   16.130  1.00 44.05 ? 253 LYS A NZ    1 
ATOM   1077 N N     . ASP C 3 69  ? -39.415 5.422   11.253  1.00 43.26 ? 254 ASP A N     1 
ATOM   1078 C CA    . ASP C 3 69  ? -40.106 6.065   10.142  1.00 43.68 ? 254 ASP A CA    1 
ATOM   1079 C C     . ASP C 3 69  ? -41.604 5.745   10.158  1.00 43.83 ? 254 ASP A C     1 
ATOM   1080 O O     . ASP C 3 69  ? -42.430 6.642   9.990   1.00 44.01 ? 254 ASP A O     1 
ATOM   1081 C CB    . ASP C 3 69  ? -39.478 5.666   8.796   1.00 43.64 ? 254 ASP A CB    1 
ATOM   1082 C CG    . ASP C 3 69  ? -38.100 6.300   8.566   1.00 43.85 ? 254 ASP A CG    1 
ATOM   1083 O OD1   . ASP C 3 69  ? -37.559 6.956   9.487   1.00 43.48 ? 254 ASP A OD1   1 
ATOM   1084 O OD2   . ASP C 3 69  ? -37.554 6.141   7.448   1.00 43.46 ? 254 ASP A OD2   1 
ATOM   1085 N N     . ARG C 3 70  ? -41.946 4.476   10.378  1.00 43.97 ? 255 ARG A N     1 
ATOM   1086 C CA    . ARG C 3 70  ? -43.343 4.039   10.420  1.00 44.18 ? 255 ARG A CA    1 
ATOM   1087 C C     . ARG C 3 70  ? -44.127 4.686   11.557  1.00 44.44 ? 255 ARG A C     1 
ATOM   1088 O O     . ARG C 3 70  ? -45.219 5.211   11.346  1.00 44.44 ? 255 ARG A O     1 
ATOM   1089 C CB    . ARG C 3 70  ? -43.428 2.520   10.528  1.00 44.12 ? 255 ARG A CB    1 
ATOM   1090 C CG    . ARG C 3 70  ? -43.263 1.799   9.211   1.00 43.86 ? 255 ARG A CG    1 
ATOM   1091 C CD    . ARG C 3 70  ? -43.046 0.328   9.470   1.00 43.94 ? 255 ARG A CD    1 
ATOM   1092 N NE    . ARG C 3 70  ? -43.023 -0.450  8.228   1.00 43.09 ? 255 ARG A NE    1 
ATOM   1093 C CZ    . ARG C 3 70  ? -42.870 -1.771  8.194   1.00 43.10 ? 255 ARG A CZ    1 
ATOM   1094 N NH1   . ARG C 3 70  ? -42.725 -2.466  9.341   1.00 43.13 ? 255 ARG A NH1   1 
ATOM   1095 N NH2   . ARG C 3 70  ? -42.856 -2.397  7.014   1.00 43.03 ? 255 ARG A NH2   1 
ATOM   1096 N N     . VAL C 3 71  ? -43.553 4.646   12.756  1.00 44.92 ? 256 VAL A N     1 
ATOM   1097 C CA    . VAL C 3 71  ? -44.155 5.248   13.944  1.00 45.38 ? 256 VAL A CA    1 
ATOM   1098 C C     . VAL C 3 71  ? -44.276 6.765   13.786  1.00 45.70 ? 256 VAL A C     1 
ATOM   1099 O O     . VAL C 3 71  ? -45.193 7.381   14.334  1.00 45.91 ? 256 VAL A O     1 
ATOM   1100 C CB    . VAL C 3 71  ? -43.345 4.903   15.221  1.00 45.38 ? 256 VAL A CB    1 
ATOM   1101 C CG1   . VAL C 3 71  ? -43.931 5.588   16.451  1.00 45.45 ? 256 VAL A CG1   1 
ATOM   1102 C CG2   . VAL C 3 71  ? -43.300 3.392   15.432  1.00 45.48 ? 256 VAL A CG2   1 
ATOM   1103 N N     . ALA C 3 72  ? -43.354 7.357   13.030  1.00 45.97 ? 257 ALA A N     1 
ATOM   1104 C CA    . ALA C 3 72  ? -43.360 8.794   12.808  1.00 46.30 ? 257 ALA A CA    1 
ATOM   1105 C C     . ALA C 3 72  ? -44.574 9.179   11.972  1.00 46.76 ? 257 ALA A C     1 
ATOM   1106 O O     . ALA C 3 72  ? -45.367 10.032  12.383  1.00 46.76 ? 257 ALA A O     1 
ATOM   1107 C CB    . ALA C 3 72  ? -42.067 9.241   12.145  1.00 46.10 ? 257 ALA A CB    1 
ATOM   1108 N N     . GLN C 3 73  ? -44.716 8.530   10.813  1.00 47.43 ? 258 GLN A N     1 
ATOM   1109 C CA    . GLN C 3 73  ? -45.871 8.707   9.927   1.00 47.87 ? 258 GLN A CA    1 
ATOM   1110 C C     . GLN C 3 73  ? -47.176 8.406   10.649  1.00 48.29 ? 258 GLN A C     1 
ATOM   1111 O O     . GLN C 3 73  ? -48.130 9.177   10.559  1.00 48.41 ? 258 GLN A O     1 
ATOM   1112 C CB    . GLN C 3 73  ? -45.754 7.815   8.686   1.00 47.83 ? 258 GLN A CB    1 
ATOM   1113 C CG    . GLN C 3 73  ? -45.499 8.563   7.378   1.00 47.90 ? 258 GLN A CG    1 
ATOM   1114 C CD    . GLN C 3 73  ? -44.048 8.978   7.185   1.00 48.24 ? 258 GLN A CD    1 
ATOM   1115 O OE1   . GLN C 3 73  ? -43.157 8.581   7.949   1.00 48.16 ? 258 GLN A OE1   1 
ATOM   1116 N NE2   . GLN C 3 73  ? -43.801 9.779   6.151   1.00 47.38 ? 258 GLN A NE2   1 
ATOM   1117 N N     . LEU C 3 74  ? -47.204 7.292   11.378  1.00 48.86 ? 259 LEU A N     1 
ATOM   1118 C CA    . LEU C 3 74  ? -48.400 6.878   12.103  1.00 49.36 ? 259 LEU A CA    1 
ATOM   1119 C C     . LEU C 3 74  ? -48.839 7.920   13.134  1.00 49.63 ? 259 LEU A C     1 
ATOM   1120 O O     . LEU C 3 74  ? -50.029 8.232   13.232  1.00 49.58 ? 259 LEU A O     1 
ATOM   1121 C CB    . LEU C 3 74  ? -48.202 5.509   12.763  1.00 49.31 ? 259 LEU A CB    1 
ATOM   1122 C CG    . LEU C 3 74  ? -49.482 4.678   12.922  1.00 49.53 ? 259 LEU A CG    1 
ATOM   1123 C CD1   . LEU C 3 74  ? -49.868 3.980   11.609  1.00 49.66 ? 259 LEU A CD1   1 
ATOM   1124 C CD2   . LEU C 3 74  ? -49.329 3.668   14.040  1.00 49.50 ? 259 LEU A CD2   1 
ATOM   1125 N N     . TYR C 3 75  ? -47.883 8.470   13.885  1.00 49.92 ? 260 TYR A N     1 
ATOM   1126 C CA    . TYR C 3 75  ? -48.223 9.487   14.881  1.00 50.29 ? 260 TYR A CA    1 
ATOM   1127 C C     . TYR C 3 75  ? -48.285 10.941  14.412  1.00 50.28 ? 260 TYR A C     1 
ATOM   1128 O O     . TYR C 3 75  ? -48.542 11.835  15.223  1.00 50.45 ? 260 TYR A O     1 
ATOM   1129 C CB    . TYR C 3 75  ? -47.398 9.350   16.159  1.00 50.68 ? 260 TYR A CB    1 
ATOM   1130 C CG    . TYR C 3 75  ? -48.283 9.064   17.349  1.00 51.47 ? 260 TYR A CG    1 
ATOM   1131 C CD1   . TYR C 3 75  ? -48.237 7.833   18.009  1.00 51.90 ? 260 TYR A CD1   1 
ATOM   1132 C CD2   . TYR C 3 75  ? -49.202 10.019  17.791  1.00 51.96 ? 260 TYR A CD2   1 
ATOM   1133 C CE1   . TYR C 3 75  ? -49.073 7.572   19.103  1.00 52.16 ? 260 TYR A CE1   1 
ATOM   1134 C CE2   . TYR C 3 75  ? -50.040 9.771   18.872  1.00 52.08 ? 260 TYR A CE2   1 
ATOM   1135 C CZ    . TYR C 3 75  ? -49.974 8.550   19.522  1.00 52.19 ? 260 TYR A CZ    1 
ATOM   1136 O OH    . TYR C 3 75  ? -50.816 8.326   20.590  1.00 52.35 ? 260 TYR A OH    1 
ATOM   1137 N N     . LYS C 3 76  ? -48.074 11.186  13.120  1.00 49.94 ? 261 LYS A N     1 
ATOM   1138 C CA    . LYS C 3 76  ? -48.309 12.524  12.583  1.00 49.72 ? 261 LYS A CA    1 
ATOM   1139 C C     . LYS C 3 76  ? -49.783 12.664  12.180  1.00 49.69 ? 261 LYS A C     1 
ATOM   1140 O O     . LYS C 3 76  ? -50.252 13.762  11.867  1.00 49.60 ? 261 LYS A O     1 
ATOM   1141 C CB    . LYS C 3 76  ? -47.338 12.866  11.437  1.00 49.74 ? 261 LYS A CB    1 
ATOM   1142 C CG    . LYS C 3 76  ? -47.846 12.632  10.017  1.00 49.27 ? 261 LYS A CG    1 
ATOM   1143 C CD    . LYS C 3 76  ? -47.069 13.483  9.019   1.00 48.70 ? 261 LYS A CD    1 
ATOM   1144 C CE    . LYS C 3 76  ? -47.882 13.736  7.752   1.00 48.70 ? 261 LYS A CE    1 
ATOM   1145 N NZ    . LYS C 3 76  ? -47.205 14.670  6.805   1.00 47.92 ? 261 LYS A NZ    1 
ATOM   1146 N N     . THR C 3 77  ? -50.500 11.539  12.212  1.00 49.60 ? 262 THR A N     1 
ATOM   1147 C CA    . THR C 3 77  ? -51.942 11.501  11.960  1.00 49.41 ? 262 THR A CA    1 
ATOM   1148 C C     . THR C 3 77  ? -52.725 11.495  13.277  1.00 49.32 ? 262 THR A C     1 
ATOM   1149 O O     . THR C 3 77  ? -53.759 12.156  13.395  1.00 49.27 ? 262 THR A O     1 
ATOM   1150 C CB    . THR C 3 77  ? -52.356 10.263  11.121  1.00 49.40 ? 262 THR A CB    1 
ATOM   1151 O OG1   . THR C 3 77  ? -51.272 9.853   10.275  1.00 49.14 ? 262 THR A OG1   1 
ATOM   1152 C CG2   . THR C 3 77  ? -53.588 10.579  10.264  1.00 49.48 ? 262 THR A CG2   1 
ATOM   1153 N N     . LEU C 3 78  ? -52.224 10.750  14.262  1.00 49.24 ? 263 LEU A N     1 
ATOM   1154 C CA    . LEU C 3 78  ? -52.858 10.669  15.576  1.00 49.15 ? 263 LEU A CA    1 
ATOM   1155 C C     . LEU C 3 78  ? -52.446 11.863  16.436  1.00 49.12 ? 263 LEU A C     1 
ATOM   1156 O O     . LEU C 3 78  ? -52.628 13.016  16.044  1.00 49.02 ? 263 LEU A O     1 
ATOM   1157 C CB    . LEU C 3 78  ? -52.488 9.355   16.276  1.00 49.02 ? 263 LEU A CB    1 
ATOM   1158 C CG    . LEU C 3 78  ? -53.481 8.669   17.231  1.00 48.93 ? 263 LEU A CG    1 
ATOM   1159 C CD1   . LEU C 3 78  ? -52.908 7.330   17.710  1.00 48.69 ? 263 LEU A CD1   1 
ATOM   1160 C CD2   . LEU C 3 78  ? -53.874 9.537   18.431  1.00 48.70 ? 263 LEU A CD2   1 
ATOM   1161 N N     . THR C 3 99  ? -41.860 9.281   19.952  1.00 45.69 ? 284 THR A N     1 
ATOM   1162 C CA    . THR C 3 99  ? -40.742 10.014  19.366  1.00 45.92 ? 284 THR A CA    1 
ATOM   1163 C C     . THR C 3 99  ? -39.411 9.372   19.761  1.00 46.28 ? 284 THR A C     1 
ATOM   1164 O O     . THR C 3 99  ? -38.834 8.588   18.996  1.00 46.67 ? 284 THR A O     1 
ATOM   1165 C CB    . THR C 3 99  ? -40.747 11.494  19.793  1.00 45.75 ? 284 THR A CB    1 
ATOM   1166 O OG1   . THR C 3 99  ? -41.153 11.589  21.164  1.00 45.44 ? 284 THR A OG1   1 
ATOM   1167 C CG2   . THR C 3 99  ? -41.703 12.304  18.926  1.00 45.97 ? 284 THR A CG2   1 
ATOM   1168 N N     . GLU C 3 100 ? -38.938 9.702   20.964  1.00 46.26 ? 285 GLU A N     1 
ATOM   1169 C CA    . GLU C 3 100 ? -37.681 9.179   21.497  1.00 46.21 ? 285 GLU A CA    1 
ATOM   1170 C C     . GLU C 3 100 ? -37.938 7.867   22.252  1.00 46.10 ? 285 GLU A C     1 
ATOM   1171 O O     . GLU C 3 100 ? -38.806 7.813   23.120  1.00 46.13 ? 285 GLU A O     1 
ATOM   1172 C CB    . GLU C 3 100 ? -36.983 10.233  22.389  1.00 46.26 ? 285 GLU A CB    1 
ATOM   1173 C CG    . GLU C 3 100 ? -37.773 10.748  23.633  1.00 46.98 ? 285 GLU A CG    1 
ATOM   1174 C CD    . GLU C 3 100 ? -38.884 11.783  23.317  1.00 48.23 ? 285 GLU A CD    1 
ATOM   1175 O OE1   . GLU C 3 100 ? -38.698 12.655  22.434  1.00 48.04 ? 285 GLU A OE1   1 
ATOM   1176 O OE2   . GLU C 3 100 ? -39.950 11.733  23.973  1.00 48.30 ? 285 GLU A OE2   1 
ATOM   1177 N N     . LEU C 3 101 ? -37.199 6.811   21.918  1.00 45.95 ? 286 LEU A N     1 
ATOM   1178 C CA    . LEU C 3 101 ? -37.465 5.491   22.507  1.00 45.72 ? 286 LEU A CA    1 
ATOM   1179 C C     . LEU C 3 101 ? -36.759 5.256   23.848  1.00 45.54 ? 286 LEU A C     1 
ATOM   1180 O O     . LEU C 3 101 ? -35.557 5.485   23.980  1.00 45.76 ? 286 LEU A O     1 
ATOM   1181 C CB    . LEU C 3 101 ? -37.198 4.349   21.505  1.00 45.70 ? 286 LEU A CB    1 
ATOM   1182 C CG    . LEU C 3 101 ? -35.832 3.691   21.291  1.00 45.48 ? 286 LEU A CG    1 
ATOM   1183 C CD1   . LEU C 3 101 ? -35.986 2.478   20.379  1.00 44.40 ? 286 LEU A CD1   1 
ATOM   1184 C CD2   . LEU C 3 101 ? -34.813 4.677   20.725  1.00 45.88 ? 286 LEU A CD2   1 
ATOM   1185 N N     . VAL C 3 102 ? -37.524 4.820   24.844  1.00 45.19 ? 287 VAL A N     1 
ATOM   1186 C CA    . VAL C 3 102 ? -36.968 4.547   26.171  1.00 44.91 ? 287 VAL A CA    1 
ATOM   1187 C C     . VAL C 3 102 ? -37.196 3.109   26.603  1.00 44.39 ? 287 VAL A C     1 
ATOM   1188 O O     . VAL C 3 102 ? -38.146 2.456   26.170  1.00 44.33 ? 287 VAL A O     1 
ATOM   1189 C CB    . VAL C 3 102 ? -37.485 5.529   27.265  1.00 45.04 ? 287 VAL A CB    1 
ATOM   1190 C CG1   . VAL C 3 102 ? -36.941 6.951   27.023  1.00 45.38 ? 287 VAL A CG1   1 
ATOM   1191 C CG2   . VAL C 3 102 ? -39.010 5.511   27.350  1.00 45.20 ? 287 VAL A CG2   1 
ATOM   1192 N N     . ALA C 3 103 ? -36.310 2.625   27.464  1.00 43.84 ? 288 ALA A N     1 
ATOM   1193 C CA    . ALA C 3 103 ? -36.338 1.235   27.877  1.00 43.36 ? 288 ALA A CA    1 
ATOM   1194 C C     . ALA C 3 103 ? -36.057 1.084   29.364  1.00 42.93 ? 288 ALA A C     1 
ATOM   1195 O O     . ALA C 3 103 ? -35.336 1.888   29.952  1.00 42.85 ? 288 ALA A O     1 
ATOM   1196 C CB    . ALA C 3 103 ? -35.356 0.434   27.059  1.00 43.22 ? 288 ALA A CB    1 
ATOM   1197 N N     . TYR C 3 104 ? -36.653 0.058   29.961  1.00 42.63 ? 289 TYR A N     1 
ATOM   1198 C CA    . TYR C 3 104 ? -36.489 -0.226  31.376  1.00 42.39 ? 289 TYR A CA    1 
ATOM   1199 C C     . TYR C 3 104 ? -36.030 -1.663  31.527  1.00 42.34 ? 289 TYR A C     1 
ATOM   1200 O O     . TYR C 3 104 ? -36.354 -2.518  30.695  1.00 42.05 ? 289 TYR A O     1 
ATOM   1201 C CB    . TYR C 3 104 ? -37.800 -0.022  32.134  1.00 42.46 ? 289 TYR A CB    1 
ATOM   1202 C CG    . TYR C 3 104 ? -38.478 1.318   31.901  1.00 43.19 ? 289 TYR A CG    1 
ATOM   1203 C CD1   . TYR C 3 104 ? -39.540 1.437   31.004  1.00 43.10 ? 289 TYR A CD1   1 
ATOM   1204 C CD2   . TYR C 3 104 ? -38.069 2.467   32.591  1.00 44.16 ? 289 TYR A CD2   1 
ATOM   1205 C CE1   . TYR C 3 104 ? -40.174 2.665   30.789  1.00 43.60 ? 289 TYR A CE1   1 
ATOM   1206 C CE2   . TYR C 3 104 ? -38.697 3.706   32.378  1.00 43.00 ? 289 TYR A CE2   1 
ATOM   1207 C CZ    . TYR C 3 104 ? -39.749 3.791   31.480  1.00 43.29 ? 289 TYR A CZ    1 
ATOM   1208 O OH    . TYR C 3 104 ? -40.379 4.997   31.265  1.00 43.22 ? 289 TYR A OH    1 
ATOM   1209 N N     . ILE C 3 105 ? -35.277 -1.931  32.590  1.00 42.09 ? 290 ILE A N     1 
ATOM   1210 C CA    . ILE C 3 105 ? -34.766 -3.270  32.822  1.00 42.06 ? 290 ILE A CA    1 
ATOM   1211 C C     . ILE C 3 105 ? -34.926 -3.660  34.277  1.00 42.29 ? 290 ILE A C     1 
ATOM   1212 O O     . ILE C 3 105 ? -34.733 -2.838  35.167  1.00 42.98 ? 290 ILE A O     1 
ATOM   1213 C CB    . ILE C 3 105 ? -33.293 -3.405  32.347  1.00 42.15 ? 290 ILE A CB    1 
ATOM   1214 C CG1   . ILE C 3 105 ? -32.855 -4.878  32.336  1.00 42.50 ? 290 ILE A CG1   1 
ATOM   1215 C CG2   . ILE C 3 105 ? -32.343 -2.498  33.162  1.00 41.44 ? 290 ILE A CG2   1 
ATOM   1216 C CD1   . ILE C 3 105 ? -31.785 -5.183  31.275  1.00 44.50 ? 290 ILE A CD1   1 
ATOM   1217 N N     . GLY C 3 106 ? -35.305 -4.910  34.510  1.00 42.46 ? 291 GLY A N     1 
ATOM   1218 C CA    . GLY C 3 106 ? -35.515 -5.425  35.859  1.00 42.42 ? 291 GLY A CA    1 
ATOM   1219 C C     . GLY C 3 106 ? -35.093 -6.873  35.978  1.00 42.51 ? 291 GLY A C     1 
ATOM   1220 O O     . GLY C 3 106 ? -34.638 -7.472  35.008  1.00 42.45 ? 291 GLY A O     1 
ATOM   1221 N N     . ILE C 3 107 ? -35.258 -7.437  37.168  1.00 42.82 ? 292 ILE A N     1 
ATOM   1222 C CA    . ILE C 3 107 ? -34.818 -8.792  37.448  1.00 43.22 ? 292 ILE A CA    1 
ATOM   1223 C C     . ILE C 3 107 ? -35.986 -9.736  37.749  1.00 44.16 ? 292 ILE A C     1 
ATOM   1224 O O     . ILE C 3 107 ? -35.799 -10.824 38.290  1.00 44.45 ? 292 ILE A O     1 
ATOM   1225 C CB    . ILE C 3 107 ? -33.752 -8.822  38.586  1.00 43.61 ? 292 ILE A CB    1 
ATOM   1226 C CG1   . ILE C 3 107 ? -34.354 -8.433  39.939  1.00 43.26 ? 292 ILE A CG1   1 
ATOM   1227 C CG2   . ILE C 3 107 ? -32.535 -7.924  38.251  1.00 42.93 ? 292 ILE A CG2   1 
ATOM   1228 C CD1   . ILE C 3 107 ? -33.480 -8.870  41.130  1.00 42.35 ? 292 ILE A CD1   1 
ATOM   1229 N N     . GLY C 3 108 ? -37.194 -9.315  37.400  1.00 45.44 ? 293 GLY A N     1 
ATOM   1230 C CA    . GLY C 3 108 ? -38.373 -10.176 37.506  1.00 46.95 ? 293 GLY A CA    1 
ATOM   1231 C C     . GLY C 3 108 ? -38.857 -10.361 38.936  1.00 48.27 ? 293 GLY A C     1 
ATOM   1232 O O     . GLY C 3 108 ? -39.371 -11.425 39.283  1.00 48.39 ? 293 GLY A O     1 
ATOM   1233 N N     . SER C 3 109 ? -38.687 -9.322  39.755  1.00 49.17 ? 294 SER A N     1 
ATOM   1234 C CA    . SER C 3 109 ? -39.167 -9.295  41.137  1.00 50.52 ? 294 SER A CA    1 
ATOM   1235 C C     . SER C 3 109 ? -39.876 -7.955  41.399  1.00 51.39 ? 294 SER A C     1 
ATOM   1236 O O     . SER C 3 109 ? -39.381 -6.892  41.001  1.00 51.79 ? 294 SER A O     1 
ATOM   1237 C CB    . SER C 3 109 ? -37.986 -9.465  42.097  1.00 50.76 ? 294 SER A CB    1 
ATOM   1238 O OG    . SER C 3 109 ? -38.272 -8.963  43.395  1.00 51.22 ? 294 SER A OG    1 
ATOM   1239 N N     . ASP C 3 110 ? -41.017 -7.992  42.076  1.00 51.85 ? 295 ASP A N     1 
ATOM   1240 C CA    . ASP C 3 110 ? -41.809 -6.768  42.260  1.00 52.67 ? 295 ASP A CA    1 
ATOM   1241 C C     . ASP C 3 110 ? -41.411 -5.831  43.413  1.00 52.32 ? 295 ASP A C     1 
ATOM   1242 O O     . ASP C 3 110 ? -42.073 -4.815  43.634  1.00 52.47 ? 295 ASP A O     1 
ATOM   1243 C CB    . ASP C 3 110 ? -43.314 -7.071  42.279  1.00 53.19 ? 295 ASP A CB    1 
ATOM   1244 C CG    . ASP C 3 110 ? -43.608 -8.551  42.166  1.00 55.47 ? 295 ASP A CG    1 
ATOM   1245 O OD1   . ASP C 3 110 ? -43.996 -8.986  41.058  1.00 56.58 ? 295 ASP A OD1   1 
ATOM   1246 O OD2   . ASP C 3 110 ? -43.423 -9.277  43.176  1.00 58.91 ? 295 ASP A OD2   1 
ATOM   1247 N N     . THR C 3 111 ? -40.327 -6.147  44.118  1.00 51.80 ? 296 THR A N     1 
ATOM   1248 C CA    . THR C 3 111 ? -39.772 -5.229  45.125  1.00 51.49 ? 296 THR A CA    1 
ATOM   1249 C C     . THR C 3 111 ? -38.413 -4.688  44.662  1.00 51.69 ? 296 THR A C     1 
ATOM   1250 O O     . THR C 3 111 ? -37.749 -3.908  45.353  1.00 51.81 ? 296 THR A O     1 
ATOM   1251 C CB    . THR C 3 111 ? -39.632 -5.899  46.515  1.00 51.50 ? 296 THR A CB    1 
ATOM   1252 O OG1   . THR C 3 111 ? -38.839 -7.097  46.404  1.00 50.39 ? 296 THR A OG1   1 
ATOM   1253 C CG2   . THR C 3 111 ? -41.006 -6.233  47.083  1.00 50.37 ? 296 THR A CG2   1 
ATOM   1254 N N     . SER C 3 112 ? -37.998 -5.129  43.487  1.00 51.68 ? 297 SER A N     1 
ATOM   1255 C CA    . SER C 3 112 ? -36.807 -4.604  42.868  1.00 51.86 ? 297 SER A CA    1 
ATOM   1256 C C     . SER C 3 112 ? -37.282 -3.663  41.765  1.00 52.03 ? 297 SER A C     1 
ATOM   1257 O O     . SER C 3 112 ? -37.786 -4.118  40.736  1.00 52.04 ? 297 SER A O     1 
ATOM   1258 C CB    . SER C 3 112 ? -35.972 -5.750  42.306  1.00 51.54 ? 297 SER A CB    1 
ATOM   1259 O OG    . SER C 3 112 ? -34.727 -5.289  41.842  1.00 51.51 ? 297 SER A OG    1 
ATOM   1260 N N     . GLU C 3 113 ? -37.161 -2.354  41.996  1.00 52.02 ? 298 GLU A N     1 
ATOM   1261 C CA    . GLU C 3 113 ? -37.589 -1.371  41.000  1.00 52.39 ? 298 GLU A CA    1 
ATOM   1262 C C     . GLU C 3 113 ? -36.927 -1.621  39.655  1.00 51.53 ? 298 GLU A C     1 
ATOM   1263 O O     . GLU C 3 113 ? -35.730 -1.905  39.591  1.00 51.62 ? 298 GLU A O     1 
ATOM   1264 C CB    . GLU C 3 113 ? -37.298 0.071   41.452  1.00 52.80 ? 298 GLU A CB    1 
ATOM   1265 C CG    . GLU C 3 113 ? -38.492 0.776   42.086  1.00 55.59 ? 298 GLU A CG    1 
ATOM   1266 C CD    . GLU C 3 113 ? -38.656 2.224   41.604  1.00 60.12 ? 298 GLU A CD    1 
ATOM   1267 O OE1   . GLU C 3 113 ? -37.628 2.942   41.492  1.00 61.87 ? 298 GLU A OE1   1 
ATOM   1268 O OE2   . GLU C 3 113 ? -39.815 2.643   41.342  1.00 60.32 ? 298 GLU A OE2   1 
ATOM   1269 N N     . ARG C 3 114 ? -37.721 -1.534  38.595  1.00 50.96 ? 299 ARG A N     1 
ATOM   1270 C CA    . ARG C 3 114 ? -37.199 -1.492  37.238  1.00 50.75 ? 299 ARG A CA    1 
ATOM   1271 C C     . ARG C 3 114 ? -36.415 -0.201  37.045  1.00 50.09 ? 299 ARG A C     1 
ATOM   1272 O O     . ARG C 3 114 ? -36.751 0.829   37.618  1.00 49.84 ? 299 ARG A O     1 
ATOM   1273 C CB    . ARG C 3 114 ? -38.332 -1.565  36.217  1.00 50.91 ? 299 ARG A CB    1 
ATOM   1274 C CG    . ARG C 3 114 ? -38.762 -2.982  35.862  1.00 52.50 ? 299 ARG A CG    1 
ATOM   1275 C CD    . ARG C 3 114 ? -39.429 -3.027  34.476  1.00 55.37 ? 299 ARG A CD    1 
ATOM   1276 N NE    . ARG C 3 114 ? -40.461 -1.999  34.310  1.00 56.96 ? 299 ARG A NE    1 
ATOM   1277 C CZ    . ARG C 3 114 ? -41.081 -1.712  33.164  1.00 57.56 ? 299 ARG A CZ    1 
ATOM   1278 N NH1   . ARG C 3 114 ? -41.998 -0.750  33.132  1.00 56.23 ? 299 ARG A NH1   1 
ATOM   1279 N NH2   . ARG C 3 114 ? -40.784 -2.377  32.048  1.00 58.37 ? 299 ARG A NH2   1 
ATOM   1280 N N     . GLN C 3 115 ? -35.365 -0.265  36.242  1.00 49.63 ? 300 GLN A N     1 
ATOM   1281 C CA    . GLN C 3 115 ? -34.495 0.885   36.056  1.00 49.46 ? 300 GLN A CA    1 
ATOM   1282 C C     . GLN C 3 115 ? -34.472 1.321   34.590  1.00 49.87 ? 300 GLN A C     1 
ATOM   1283 O O     . GLN C 3 115 ? -34.435 0.490   33.674  1.00 49.67 ? 300 GLN A O     1 
ATOM   1284 C CB    . GLN C 3 115 ? -33.080 0.594   36.593  1.00 49.12 ? 300 GLN A CB    1 
ATOM   1285 C CG    . GLN C 3 115 ? -33.018 0.367   38.132  1.00 48.42 ? 300 GLN A CG    1 
ATOM   1286 C CD    . GLN C 3 115 ? -31.597 0.125   38.665  1.00 48.98 ? 300 GLN A CD    1 
ATOM   1287 O OE1   . GLN C 3 115 ? -30.638 0.759   38.223  1.00 48.33 ? 300 GLN A OE1   1 
ATOM   1288 N NE2   . GLN C 3 115 ? -31.468 -0.790  39.625  1.00 46.77 ? 300 GLN A NE2   1 
ATOM   1289 N N     . GLN C 3 116 ? -34.521 2.633   34.389  1.00 50.16 ? 301 GLN A N     1 
ATOM   1290 C CA    . GLN C 3 116 ? -34.466 3.242   33.064  1.00 50.93 ? 301 GLN A CA    1 
ATOM   1291 C C     . GLN C 3 116 ? -33.072 3.102   32.457  1.00 50.98 ? 301 GLN A C     1 
ATOM   1292 O O     . GLN C 3 116 ? -32.064 3.366   33.118  1.00 50.94 ? 301 GLN A O     1 
ATOM   1293 C CB    . GLN C 3 116 ? -34.830 4.729   33.129  1.00 50.89 ? 301 GLN A CB    1 
ATOM   1294 C CG    . GLN C 3 116 ? -35.860 5.106   34.196  1.00 53.05 ? 301 GLN A CG    1 
ATOM   1295 C CD    . GLN C 3 116 ? -35.245 5.334   35.583  1.00 55.35 ? 301 GLN A CD    1 
ATOM   1296 O OE1   . GLN C 3 116 ? -34.851 4.383   36.282  1.00 55.44 ? 301 GLN A OE1   1 
ATOM   1297 N NE2   . GLN C 3 116 ? -35.172 6.603   35.990  1.00 56.11 ? 301 GLN A NE2   1 
ATOM   1298 N N     . LEU C 3 117 ? -33.031 2.685   31.196  1.00 51.13 ? 302 LEU A N     1 
ATOM   1299 C CA    . LEU C 3 117 ? -31.796 2.622   30.433  1.00 51.19 ? 302 LEU A CA    1 
ATOM   1300 C C     . LEU C 3 117 ? -31.547 3.952   29.731  1.00 51.80 ? 302 LEU A C     1 
ATOM   1301 O O     . LEU C 3 117 ? -32.430 4.494   29.054  1.00 51.94 ? 302 LEU A O     1 
ATOM   1302 C CB    . LEU C 3 117 ? -31.873 1.489   29.416  1.00 50.84 ? 302 LEU A CB    1 
ATOM   1303 C CG    . LEU C 3 117 ? -31.943 0.072   29.993  1.00 50.34 ? 302 LEU A CG    1 
ATOM   1304 C CD1   . LEU C 3 117 ? -32.776 -0.827  29.108  1.00 50.07 ? 302 LEU A CD1   1 
ATOM   1305 C CD2   . LEU C 3 117 ? -30.564 -0.508  30.196  1.00 47.65 ? 302 LEU A CD2   1 
ATOM   1306 N N     . ASP C 3 118 ? -30.349 4.494   29.909  1.00 52.49 ? 303 ASP A N     1 
ATOM   1307 C CA    . ASP C 3 118 ? -29.973 5.717   29.205  1.00 53.10 ? 303 ASP A CA    1 
ATOM   1308 C C     . ASP C 3 118 ? -29.154 5.363   27.960  1.00 53.12 ? 303 ASP A C     1 
ATOM   1309 O O     . ASP C 3 118 ? -28.281 4.484   28.011  1.00 53.07 ? 303 ASP A O     1 
ATOM   1310 C CB    . ASP C 3 118 ? -29.216 6.680   30.130  1.00 53.35 ? 303 ASP A CB    1 
ATOM   1311 C CG    . ASP C 3 118 ? -27.892 6.102   30.627  1.00 54.70 ? 303 ASP A CG    1 
ATOM   1312 O OD1   . ASP C 3 118 ? -27.905 5.025   31.288  1.00 54.64 ? 303 ASP A OD1   1 
ATOM   1313 O OD2   . ASP C 3 118 ? -26.845 6.737   30.346  1.00 55.12 ? 303 ASP A OD2   1 
ATOM   1314 N N     . PHE C 3 119 ? -29.475 6.031   26.852  1.00 53.07 ? 304 PHE A N     1 
ATOM   1315 C CA    . PHE C 3 119 ? -28.841 5.801   25.553  1.00 53.15 ? 304 PHE A CA    1 
ATOM   1316 C C     . PHE C 3 119 ? -27.806 6.887   25.270  1.00 53.19 ? 304 PHE A C     1 
ATOM   1317 O O     . PHE C 3 119 ? -27.386 7.079   24.129  1.00 53.32 ? 304 PHE A O     1 
ATOM   1318 C CB    . PHE C 3 119 ? -29.896 5.768   24.431  1.00 53.08 ? 304 PHE A CB    1 
ATOM   1319 C CG    . PHE C 3 119 ? -30.889 4.640   24.558  1.00 53.14 ? 304 PHE A CG    1 
ATOM   1320 C CD1   . PHE C 3 119 ? -32.102 4.833   25.207  1.00 52.86 ? 304 PHE A CD1   1 
ATOM   1321 C CD2   . PHE C 3 119 ? -30.603 3.380   24.037  1.00 52.94 ? 304 PHE A CD2   1 
ATOM   1322 C CE1   . PHE C 3 119 ? -33.009 3.787   25.339  1.00 52.71 ? 304 PHE A CE1   1 
ATOM   1323 C CE2   . PHE C 3 119 ? -31.506 2.325   24.164  1.00 52.31 ? 304 PHE A CE2   1 
ATOM   1324 C CZ    . PHE C 3 119 ? -32.710 2.529   24.812  1.00 52.64 ? 304 PHE A CZ    1 
ATOM   1325 N N     . PRO C 3 134 ? -21.834 1.713   13.209  1.00 51.31 ? 319 PRO A N     1 
ATOM   1326 C CA    . PRO C 3 134 ? -22.411 1.958   11.874  1.00 51.39 ? 319 PRO A CA    1 
ATOM   1327 C C     . PRO C 3 134 ? -23.673 1.110   11.639  1.00 51.38 ? 319 PRO A C     1 
ATOM   1328 O O     . PRO C 3 134 ? -24.744 1.649   11.357  1.00 51.44 ? 319 PRO A O     1 
ATOM   1329 C CB    . PRO C 3 134 ? -21.280 1.555   10.918  1.00 51.27 ? 319 PRO A CB    1 
ATOM   1330 C CG    . PRO C 3 134 ? -20.024 1.694   11.731  1.00 51.26 ? 319 PRO A CG    1 
ATOM   1331 C CD    . PRO C 3 134 ? -20.415 1.324   13.146  1.00 51.31 ? 319 PRO A CD    1 
ATOM   1332 N N     . ASN C 3 135 ? -23.528 -0.208  11.760  1.00 51.34 ? 320 ASN A N     1 
ATOM   1333 C CA    . ASN C 3 135 ? -24.653 -1.143  11.857  1.00 50.91 ? 320 ASN A CA    1 
ATOM   1334 C C     . ASN C 3 135 ? -25.414 -0.988  13.188  1.00 50.27 ? 320 ASN A C     1 
ATOM   1335 O O     . ASN C 3 135 ? -26.585 -1.363  13.291  1.00 50.50 ? 320 ASN A O     1 
ATOM   1336 C CB    . ASN C 3 135 ? -24.132 -2.581  11.738  1.00 51.29 ? 320 ASN A CB    1 
ATOM   1337 C CG    . ASN C 3 135 ? -22.878 -2.826  12.595  1.00 52.20 ? 320 ASN A CG    1 
ATOM   1338 O OD1   . ASN C 3 135 ? -21.744 -2.609  12.145  1.00 53.48 ? 320 ASN A OD1   1 
ATOM   1339 N ND2   . ASN C 3 135 ? -23.083 -3.274  13.829  1.00 52.29 ? 320 ASN A ND2   1 
ATOM   1340 N N     . ILE C 3 136 ? -24.735 -0.445  14.200  1.00 49.03 ? 321 ILE A N     1 
ATOM   1341 C CA    . ILE C 3 136 ? -25.319 -0.231  15.528  1.00 47.91 ? 321 ILE A CA    1 
ATOM   1342 C C     . ILE C 3 136 ? -26.237 1.001   15.555  1.00 47.14 ? 321 ILE A C     1 
ATOM   1343 O O     . ILE C 3 136 ? -25.771 2.133   15.438  1.00 47.12 ? 321 ILE A O     1 
ATOM   1344 C CB    . ILE C 3 136 ? -24.205 -0.087  16.610  1.00 47.84 ? 321 ILE A CB    1 
ATOM   1345 C CG1   . ILE C 3 136 ? -23.313 -1.331  16.633  1.00 47.69 ? 321 ILE A CG1   1 
ATOM   1346 C CG2   . ILE C 3 136 ? -24.803 0.173   17.993  1.00 47.56 ? 321 ILE A CG2   1 
ATOM   1347 C CD1   . ILE C 3 136 ? -21.905 -1.078  17.156  1.00 47.68 ? 321 ILE A CD1   1 
ATOM   1348 N N     . TYR C 3 137 ? -27.538 0.776   15.716  1.00 46.16 ? 322 TYR A N     1 
ATOM   1349 C CA    . TYR C 3 137 ? -28.504 1.874   15.829  1.00 45.32 ? 322 TYR A CA    1 
ATOM   1350 C C     . TYR C 3 137 ? -28.377 2.620   17.164  1.00 44.39 ? 322 TYR A C     1 
ATOM   1351 O O     . TYR C 3 137 ? -28.209 3.840   17.181  1.00 44.06 ? 322 TYR A O     1 
ATOM   1352 C CB    . TYR C 3 137 ? -29.937 1.361   15.638  1.00 45.55 ? 322 TYR A CB    1 
ATOM   1353 C CG    . TYR C 3 137 ? -31.004 2.431   15.761  1.00 46.18 ? 322 TYR A CG    1 
ATOM   1354 C CD1   . TYR C 3 137 ? -31.316 3.264   14.677  1.00 46.44 ? 322 TYR A CD1   1 
ATOM   1355 C CD2   . TYR C 3 137 ? -31.712 2.605   16.953  1.00 46.07 ? 322 TYR A CD2   1 
ATOM   1356 C CE1   . TYR C 3 137 ? -32.299 4.248   14.788  1.00 46.51 ? 322 TYR A CE1   1 
ATOM   1357 C CE2   . TYR C 3 137 ? -32.699 3.584   17.075  1.00 46.26 ? 322 TYR A CE2   1 
ATOM   1358 C CZ    . TYR C 3 137 ? -32.987 4.402   15.990  1.00 46.69 ? 322 TYR A CZ    1 
ATOM   1359 O OH    . TYR C 3 137 ? -33.962 5.374   16.102  1.00 47.05 ? 322 TYR A OH    1 
ATOM   1360 N N     . ASP C 3 138 ? -28.483 1.888   18.274  1.00 43.38 ? 323 ASP A N     1 
ATOM   1361 C CA    . ASP C 3 138 ? -28.376 2.496   19.604  1.00 42.46 ? 323 ASP A CA    1 
ATOM   1362 C C     . ASP C 3 138 ? -27.817 1.535   20.651  1.00 41.74 ? 323 ASP A C     1 
ATOM   1363 O O     . ASP C 3 138 ? -27.792 0.320   20.448  1.00 41.52 ? 323 ASP A O     1 
ATOM   1364 C CB    . ASP C 3 138 ? -29.718 3.102   20.057  1.00 42.43 ? 323 ASP A CB    1 
ATOM   1365 C CG    . ASP C 3 138 ? -29.550 4.467   20.737  1.00 42.52 ? 323 ASP A CG    1 
ATOM   1366 O OD1   . ASP C 3 138 ? -28.484 4.703   21.350  1.00 42.95 ? 323 ASP A OD1   1 
ATOM   1367 O OD2   . ASP C 3 138 ? -30.481 5.306   20.656  1.00 41.24 ? 323 ASP A OD2   1 
ATOM   1368 N N     . TYR C 3 139 ? -27.361 2.095   21.767  1.00 41.11 ? 324 TYR A N     1 
ATOM   1369 C CA    . TYR C 3 139 ? -26.689 1.332   22.812  1.00 40.55 ? 324 TYR A CA    1 
ATOM   1370 C C     . TYR C 3 139 ? -27.030 1.904   24.177  1.00 40.52 ? 324 TYR A C     1 
ATOM   1371 O O     . TYR C 3 139 ? -27.053 3.122   24.361  1.00 40.44 ? 324 TYR A O     1 
ATOM   1372 C CB    . TYR C 3 139 ? -25.160 1.343   22.604  1.00 40.08 ? 324 TYR A CB    1 
ATOM   1373 C CG    . TYR C 3 139 ? -24.377 0.793   23.779  1.00 40.02 ? 324 TYR A CG    1 
ATOM   1374 C CD1   . TYR C 3 139 ? -24.237 -0.589  23.965  1.00 39.36 ? 324 TYR A CD1   1 
ATOM   1375 C CD2   . TYR C 3 139 ? -23.792 1.644   24.718  1.00 39.54 ? 324 TYR A CD2   1 
ATOM   1376 C CE1   . TYR C 3 139 ? -23.521 -1.107  25.036  1.00 38.68 ? 324 TYR A CE1   1 
ATOM   1377 C CE2   . TYR C 3 139 ? -23.072 1.125   25.812  1.00 40.07 ? 324 TYR A CE2   1 
ATOM   1378 C CZ    . TYR C 3 139 ? -22.943 -0.251  25.958  1.00 39.87 ? 324 TYR A CZ    1 
ATOM   1379 O OH    . TYR C 3 139 ? -22.247 -0.777  27.029  1.00 39.99 ? 324 TYR A OH    1 
ATOM   1380 N N     . CYS C 3 140 ? -27.286 1.018   25.131  1.00 40.62 ? 325 CYS A N     1 
ATOM   1381 C CA    . CYS C 3 140 ? -27.476 1.419   26.525  1.00 41.22 ? 325 CYS A CA    1 
ATOM   1382 C C     . CYS C 3 140 ? -26.980 0.320   27.451  1.00 40.80 ? 325 CYS A C     1 
ATOM   1383 O O     . CYS C 3 140 ? -27.106 -0.867  27.142  1.00 40.98 ? 325 CYS A O     1 
ATOM   1384 C CB    . CYS C 3 140 ? -28.952 1.695   26.803  1.00 41.29 ? 325 CYS A CB    1 
ATOM   1385 S SG    . CYS C 3 140 ? -29.950 0.218   26.624  1.00 43.33 ? 325 CYS A SG    1 
ATOM   1386 N N     . ALA C 3 141 ? -26.406 0.723   28.579  1.00 40.64 ? 326 ALA A N     1 
ATOM   1387 C CA    . ALA C 3 141 ? -25.980 -0.220  29.613  1.00 39.77 ? 326 ALA A CA    1 
ATOM   1388 C C     . ALA C 3 141 ? -26.687 0.107   30.916  1.00 39.39 ? 326 ALA A C     1 
ATOM   1389 O O     . ALA C 3 141 ? -26.966 1.268   31.187  1.00 39.69 ? 326 ALA A O     1 
ATOM   1390 C CB    . ALA C 3 141 ? -24.484 -0.142  29.803  1.00 39.51 ? 326 ALA A CB    1 
ATOM   1391 N N     . ALA C 3 142 ? -26.963 -0.913  31.725  1.00 38.82 ? 327 ALA A N     1 
ATOM   1392 C CA    . ALA C 3 142 ? -27.521 -0.716  33.056  1.00 38.47 ? 327 ALA A CA    1 
ATOM   1393 C C     . ALA C 3 142 ? -26.454 -0.951  34.146  1.00 38.20 ? 327 ALA A C     1 
ATOM   1394 O O     . ALA C 3 142 ? -26.105 -2.095  34.462  1.00 37.41 ? 327 ALA A O     1 
ATOM   1395 C CB    . ALA C 3 142 ? -28.740 -1.629  33.253  1.00 38.04 ? 327 ALA A CB    1 
ATOM   1396 N N     . LYS C 3 143 ? -25.944 0.143   34.711  1.00 38.36 ? 328 LYS A N     1 
ATOM   1397 C CA    . LYS C 3 143 ? -24.772 0.090   35.596  1.00 38.86 ? 328 LYS A CA    1 
ATOM   1398 C C     . LYS C 3 143 ? -25.078 -0.095  37.069  1.00 39.43 ? 328 LYS A C     1 
ATOM   1399 O O     . LYS C 3 143 ? -24.155 -0.384  37.857  1.00 40.58 ? 328 LYS A O     1 
ATOM   1400 C CB    . LYS C 3 143 ? -23.903 1.332   35.442  1.00 38.65 ? 328 LYS A CB    1 
ATOM   1401 C CG    . LYS C 3 143 ? -23.336 1.559   34.018  1.00 39.81 ? 328 LYS A CG    1 
ATOM   1402 C CD    . LYS C 3 143 ? -22.427 2.761   33.956  1.00 39.85 ? 328 LYS A CD    1 
ATOM   1403 C CE    . LYS C 3 143 ? -23.124 4.022   34.462  1.00 44.03 ? 328 LYS A CE    1 
ATOM   1404 N NZ    . LYS C 3 143 ? -24.103 4.619   33.479  1.00 46.59 ? 328 LYS A NZ    1 
ATOM   1405 N N     . THR C 3 144 ? -26.345 0.057   37.455  1.00 38.70 ? 329 THR A N     1 
ATOM   1406 C CA    . THR C 3 144 ? -26.701 0.005   38.861  1.00 37.79 ? 329 THR A CA    1 
ATOM   1407 C C     . THR C 3 144 ? -27.754 -1.044  39.197  1.00 37.56 ? 329 THR A C     1 
ATOM   1408 O O     . THR C 3 144 ? -28.483 -0.905  40.173  1.00 37.78 ? 329 THR A O     1 
ATOM   1409 C CB    . THR C 3 144 ? -27.101 1.406   39.425  1.00 38.52 ? 329 THR A CB    1 
ATOM   1410 O OG1   . THR C 3 144 ? -28.336 1.847   38.841  1.00 38.88 ? 329 THR A OG1   1 
ATOM   1411 C CG2   . THR C 3 144 ? -26.000 2.468   39.164  1.00 37.26 ? 329 THR A CG2   1 
ATOM   1412 N N     . LEU C 3 145 ? -27.800 -2.126  38.426  1.00 36.93 ? 330 LEU A N     1 
ATOM   1413 C CA    . LEU C 3 145 ? -28.593 -3.293  38.806  1.00 36.58 ? 330 LEU A CA    1 
ATOM   1414 C C     . LEU C 3 145 ? -27.943 -4.087  39.935  1.00 37.06 ? 330 LEU A C     1 
ATOM   1415 O O     . LEU C 3 145 ? -26.712 -4.220  39.995  1.00 37.04 ? 330 LEU A O     1 
ATOM   1416 C CB    . LEU C 3 145 ? -28.799 -4.220  37.613  1.00 36.44 ? 330 LEU A CB    1 
ATOM   1417 C CG    . LEU C 3 145 ? -29.791 -3.777  36.528  1.00 36.51 ? 330 LEU A CG    1 
ATOM   1418 C CD1   . LEU C 3 145 ? -29.826 -4.825  35.417  1.00 35.10 ? 330 LEU A CD1   1 
ATOM   1419 C CD2   . LEU C 3 145 ? -31.180 -3.566  37.121  1.00 34.60 ? 330 LEU A CD2   1 
ATOM   1420 N N     . TYR C 3 146 ? -28.769 -4.626  40.829  1.00 37.20 ? 331 TYR A N     1 
ATOM   1421 C CA    . TYR C 3 146 ? -28.276 -5.480  41.886  1.00 37.71 ? 331 TYR A CA    1 
ATOM   1422 C C     . TYR C 3 146 ? -29.377 -6.400  42.361  1.00 37.96 ? 331 TYR A C     1 
ATOM   1423 O O     . TYR C 3 146 ? -30.540 -6.117  42.151  1.00 38.44 ? 331 TYR A O     1 
ATOM   1424 C CB    . TYR C 3 146 ? -27.803 -4.633  43.053  1.00 37.81 ? 331 TYR A CB    1 
ATOM   1425 C CG    . TYR C 3 146 ? -28.906 -3.834  43.709  1.00 37.64 ? 331 TYR A CG    1 
ATOM   1426 C CD1   . TYR C 3 146 ? -29.594 -4.340  44.819  1.00 36.94 ? 331 TYR A CD1   1 
ATOM   1427 C CD2   . TYR C 3 146 ? -29.251 -2.558  43.241  1.00 36.90 ? 331 TYR A CD2   1 
ATOM   1428 C CE1   . TYR C 3 146 ? -30.622 -3.600  45.428  1.00 36.66 ? 331 TYR A CE1   1 
ATOM   1429 C CE2   . TYR C 3 146 ? -30.269 -1.805  43.851  1.00 35.07 ? 331 TYR A CE2   1 
ATOM   1430 C CZ    . TYR C 3 146 ? -30.935 -2.338  44.945  1.00 37.69 ? 331 TYR A CZ    1 
ATOM   1431 O OH    . TYR C 3 146 ? -31.919 -1.606  45.562  1.00 39.92 ? 331 TYR A OH    1 
ATOM   1432 N N     . ILE C 3 147 ? -29.014 -7.490  43.026  1.00 37.86 ? 332 ILE A N     1 
ATOM   1433 C CA    . ILE C 3 147 ? -30.023 -8.365  43.614  1.00 37.69 ? 332 ILE A CA    1 
ATOM   1434 C C     . ILE C 3 147 ? -29.752 -8.598  45.121  1.00 37.88 ? 332 ILE A C     1 
ATOM   1435 O O     . ILE C 3 147 ? -28.631 -8.902  45.538  1.00 38.20 ? 332 ILE A O     1 
ATOM   1436 C CB    . ILE C 3 147 ? -30.125 -9.688  42.870  1.00 37.08 ? 332 ILE A CB    1 
ATOM   1437 C CG1   . ILE C 3 147 ? -31.334 -10.480 43.384  1.00 36.84 ? 332 ILE A CG1   1 
ATOM   1438 C CG2   . ILE C 3 147 ? -28.807 -10.475 43.003  1.00 37.58 ? 332 ILE A CG2   1 
ATOM   1439 C CD1   . ILE C 3 147 ? -31.525 -11.850 42.688  1.00 37.12 ? 332 ILE A CD1   1 
ATOM   1440 N N     . SER C 3 148 ? -30.793 -8.451  45.914  1.00 37.10 ? 333 SER A N     1 
ATOM   1441 C CA    . SER C 3 148 ? -30.686 -8.489  47.345  1.00 37.26 ? 333 SER A CA    1 
ATOM   1442 C C     . SER C 3 148 ? -30.919 -9.899  47.880  1.00 37.58 ? 333 SER A C     1 
ATOM   1443 O O     . SER C 3 148 ? -31.529 -10.744 47.208  1.00 37.45 ? 333 SER A O     1 
ATOM   1444 C CB    . SER C 3 148 ? -31.691 -7.496  47.914  1.00 37.23 ? 333 SER A CB    1 
ATOM   1445 O OG    . SER C 3 148 ? -32.233 -7.958  49.113  1.00 39.30 ? 333 SER A OG    1 
ATOM   1446 N N     . ASP C 3 149 ? -30.426 -10.161 49.091  1.00 37.90 ? 334 ASP A N     1 
ATOM   1447 C CA    . ASP C 3 149 ? -30.551 -11.485 49.680  1.00 37.90 ? 334 ASP A CA    1 
ATOM   1448 C C     . ASP C 3 149 ? -31.975 -11.769 50.139  1.00 37.35 ? 334 ASP A C     1 
ATOM   1449 O O     . ASP C 3 149 ? -32.293 -12.899 50.555  1.00 36.67 ? 334 ASP A O     1 
ATOM   1450 C CB    . ASP C 3 149 ? -29.593 -11.652 50.837  1.00 38.99 ? 334 ASP A CB    1 
ATOM   1451 C CG    . ASP C 3 149 ? -30.098 -10.997 52.094  1.00 41.21 ? 334 ASP A CG    1 
ATOM   1452 O OD1   . ASP C 3 149 ? -29.874 -9.788  52.276  1.00 40.47 ? 334 ASP A OD1   1 
ATOM   1453 O OD2   . ASP C 3 149 ? -30.737 -11.703 52.905  1.00 47.31 ? 334 ASP A OD2   1 
ATOM   1454 N N     . SER C 3 150 ? -32.847 -10.763 50.043  1.00 36.57 ? 335 SER A N     1 
ATOM   1455 C CA    . SER C 3 150 ? -34.268 -11.001 50.339  1.00 35.97 ? 335 SER A CA    1 
ATOM   1456 C C     . SER C 3 150 ? -34.923 -11.861 49.285  1.00 35.19 ? 335 SER A C     1 
ATOM   1457 O O     . SER C 3 150 ? -35.907 -12.518 49.561  1.00 35.24 ? 335 SER A O     1 
ATOM   1458 C CB    . SER C 3 150 ? -35.039 -9.707  50.518  1.00 35.95 ? 335 SER A CB    1 
ATOM   1459 O OG    . SER C 3 150 ? -34.809 -8.815  49.460  1.00 36.83 ? 335 SER A OG    1 
ATOM   1460 N N     . ASP C 3 151 ? -34.357 -11.852 48.086  1.00 35.23 ? 336 ASP A N     1 
ATOM   1461 C CA    . ASP C 3 151 ? -34.792 -12.694 46.968  1.00 35.94 ? 336 ASP A CA    1 
ATOM   1462 C C     . ASP C 3 151 ? -34.091 -14.056 47.103  1.00 35.56 ? 336 ASP A C     1 
ATOM   1463 O O     . ASP C 3 151 ? -32.860 -14.113 47.206  1.00 35.92 ? 336 ASP A O     1 
ATOM   1464 C CB    . ASP C 3 151 ? -34.322 -11.992 45.684  1.00 37.49 ? 336 ASP A CB    1 
ATOM   1465 C CG    . ASP C 3 151 ? -34.978 -12.513 44.413  1.00 40.28 ? 336 ASP A CG    1 
ATOM   1466 O OD1   . ASP C 3 151 ? -34.879 -13.727 44.094  1.00 44.97 ? 336 ASP A OD1   1 
ATOM   1467 O OD2   . ASP C 3 151 ? -35.557 -11.673 43.701  1.00 42.44 ? 336 ASP A OD2   1 
ATOM   1468 N N     . LYS C 3 152 ? -34.868 -15.135 47.071  1.00 34.08 ? 337 LYS A N     1 
ATOM   1469 C CA    . LYS C 3 152 ? -34.414 -16.495 47.354  1.00 32.63 ? 337 LYS A CA    1 
ATOM   1470 C C     . LYS C 3 152 ? -34.113 -17.306 46.106  1.00 33.06 ? 337 LYS A C     1 
ATOM   1471 O O     . LYS C 3 152 ? -33.795 -18.491 46.203  1.00 32.56 ? 337 LYS A O     1 
ATOM   1472 C CB    . LYS C 3 152 ? -35.493 -17.276 48.148  1.00 32.14 ? 337 LYS A CB    1 
ATOM   1473 C CG    . LYS C 3 152 ? -35.937 -16.695 49.512  1.00 30.58 ? 337 LYS A CG    1 
ATOM   1474 C CD    . LYS C 3 152 ? -34.734 -16.011 50.265  1.00 28.53 ? 337 LYS A CD    1 
ATOM   1475 C CE    . LYS C 3 152 ? -35.193 -15.321 51.541  1.00 26.23 ? 337 LYS A CE    1 
ATOM   1476 N NZ    . LYS C 3 152 ? -34.086 -14.595 52.157  1.00 26.48 ? 337 LYS A NZ    1 
ATOM   1477 N N     . ARG C 3 153 ? -34.232 -16.706 44.929  1.00 33.99 ? 338 ARG A N     1 
ATOM   1478 C CA    . ARG C 3 153 ? -34.111 -17.495 43.704  1.00 34.89 ? 338 ARG A CA    1 
ATOM   1479 C C     . ARG C 3 153 ? -32.670 -17.933 43.500  1.00 36.30 ? 338 ARG A C     1 
ATOM   1480 O O     . ARG C 3 153 ? -31.733 -17.207 43.809  1.00 36.74 ? 338 ARG A O     1 
ATOM   1481 C CB    . ARG C 3 153 ? -34.623 -16.711 42.477  1.00 35.49 ? 338 ARG A CB    1 
ATOM   1482 C CG    . ARG C 3 153 ? -36.193 -16.567 42.389  1.00 34.12 ? 338 ARG A CG    1 
ATOM   1483 C CD    . ARG C 3 153 ? -36.620 -15.601 41.273  1.00 33.35 ? 338 ARG A CD    1 
ATOM   1484 N NE    . ARG C 3 153 ? -36.080 -14.257 41.499  1.00 34.79 ? 338 ARG A NE    1 
ATOM   1485 C CZ    . ARG C 3 153 ? -36.028 -13.277 40.593  1.00 34.88 ? 338 ARG A CZ    1 
ATOM   1486 N NH1   . ARG C 3 153 ? -36.487 -13.457 39.366  1.00 33.06 ? 338 ARG A NH1   1 
ATOM   1487 N NH2   . ARG C 3 153 ? -35.513 -12.102 40.920  1.00 34.62 ? 338 ARG A NH2   1 
ATOM   1488 N N     . LYS C 3 154 ? -32.476 -19.135 43.002  1.00 37.76 ? 339 LYS A N     1 
ATOM   1489 C CA    . LYS C 3 154 ? -31.130 -19.535 42.632  1.00 39.45 ? 339 LYS A CA    1 
ATOM   1490 C C     . LYS C 3 154 ? -30.749 -18.887 41.309  1.00 39.90 ? 339 LYS A C     1 
ATOM   1491 O O     . LYS C 3 154 ? -29.584 -18.566 41.069  1.00 40.87 ? 339 LYS A O     1 
ATOM   1492 C CB    . LYS C 3 154 ? -31.036 -21.046 42.538  1.00 39.61 ? 339 LYS A CB    1 
ATOM   1493 C CG    . LYS C 3 154 ? -31.242 -21.765 43.876  1.00 41.37 ? 339 LYS A CG    1 
ATOM   1494 C CD    . LYS C 3 154 ? -31.153 -23.283 43.633  1.00 45.32 ? 339 LYS A CD    1 
ATOM   1495 C CE    . LYS C 3 154 ? -32.186 -24.073 44.419  1.00 48.48 ? 339 LYS A CE    1 
ATOM   1496 N NZ    . LYS C 3 154 ? -32.068 -23.896 45.911  1.00 51.68 ? 339 LYS A NZ    1 
ATOM   1497 N N     . TYR C 3 155 ? -31.748 -18.687 40.461  1.00 40.21 ? 340 TYR A N     1 
ATOM   1498 C CA    . TYR C 3 155 ? -31.551 -18.127 39.138  1.00 40.34 ? 340 TYR A CA    1 
ATOM   1499 C C     . TYR C 3 155 ? -32.551 -17.030 38.884  1.00 40.19 ? 340 TYR A C     1 
ATOM   1500 O O     . TYR C 3 155 ? -33.670 -17.068 39.399  1.00 39.98 ? 340 TYR A O     1 
ATOM   1501 C CB    . TYR C 3 155 ? -31.756 -19.186 38.091  1.00 40.91 ? 340 TYR A CB    1 
ATOM   1502 C CG    . TYR C 3 155 ? -30.702 -20.259 38.060  1.00 41.94 ? 340 TYR A CG    1 
ATOM   1503 C CD1   . TYR C 3 155 ? -30.917 -21.484 38.686  1.00 42.48 ? 340 TYR A CD1   1 
ATOM   1504 C CD2   . TYR C 3 155 ? -29.507 -20.070 37.363  1.00 42.66 ? 340 TYR A CD2   1 
ATOM   1505 C CE1   . TYR C 3 155 ? -29.957 -22.491 38.641  1.00 43.54 ? 340 TYR A CE1   1 
ATOM   1506 C CE2   . TYR C 3 155 ? -28.537 -21.071 37.305  1.00 43.42 ? 340 TYR A CE2   1 
ATOM   1507 C CZ    . TYR C 3 155 ? -28.767 -22.272 37.952  1.00 43.91 ? 340 TYR A CZ    1 
ATOM   1508 O OH    . TYR C 3 155 ? -27.818 -23.270 37.898  1.00 45.17 ? 340 TYR A OH    1 
ATOM   1509 N N     . PHE C 3 156 ? -32.141 -16.034 38.109  1.00 39.57 ? 341 PHE A N     1 
ATOM   1510 C CA    . PHE C 3 156 ? -33.091 -15.055 37.617  1.00 39.53 ? 341 PHE A CA    1 
ATOM   1511 C C     . PHE C 3 156 ? -32.779 -14.719 36.164  1.00 39.41 ? 341 PHE A C     1 
ATOM   1512 O O     . PHE C 3 156 ? -31.780 -15.169 35.625  1.00 39.56 ? 341 PHE A O     1 
ATOM   1513 C CB    . PHE C 3 156 ? -33.059 -13.795 38.487  1.00 39.43 ? 341 PHE A CB    1 
ATOM   1514 C CG    . PHE C 3 156 ? -31.759 -13.036 38.430  1.00 38.45 ? 341 PHE A CG    1 
ATOM   1515 C CD1   . PHE C 3 156 ? -31.635 -11.911 37.642  1.00 37.47 ? 341 PHE A CD1   1 
ATOM   1516 C CD2   . PHE C 3 156 ? -30.660 -13.441 39.192  1.00 40.16 ? 341 PHE A CD2   1 
ATOM   1517 C CE1   . PHE C 3 156 ? -30.440 -11.191 37.608  1.00 38.71 ? 341 PHE A CE1   1 
ATOM   1518 C CE2   . PHE C 3 156 ? -29.453 -12.727 39.176  1.00 37.27 ? 341 PHE A CE2   1 
ATOM   1519 C CZ    . PHE C 3 156 ? -29.342 -11.605 38.379  1.00 38.43 ? 341 PHE A CZ    1 
ATOM   1520 N N     . ASP C 3 157 ? -33.614 -13.912 35.533  1.00 39.17 ? 342 ASP A N     1 
ATOM   1521 C CA    . ASP C 3 157 ? -33.234 -13.365 34.254  1.00 39.79 ? 342 ASP A CA    1 
ATOM   1522 C C     . ASP C 3 157 ? -33.547 -11.882 34.202  1.00 39.09 ? 342 ASP A C     1 
ATOM   1523 O O     . ASP C 3 157 ? -34.224 -11.358 35.070  1.00 39.16 ? 342 ASP A O     1 
ATOM   1524 C CB    . ASP C 3 157 ? -33.879 -14.142 33.110  1.00 40.60 ? 342 ASP A CB    1 
ATOM   1525 C CG    . ASP C 3 157 ? -35.339 -14.324 33.307  1.00 42.37 ? 342 ASP A CG    1 
ATOM   1526 O OD1   . ASP C 3 157 ? -35.986 -13.360 33.752  1.00 46.21 ? 342 ASP A OD1   1 
ATOM   1527 O OD2   . ASP C 3 157 ? -35.848 -15.428 33.028  1.00 46.75 ? 342 ASP A OD2   1 
ATOM   1528 N N     . LEU C 3 158 ? -32.984 -11.200 33.222  1.00 38.87 ? 343 LEU A N     1 
ATOM   1529 C CA    . LEU C 3 158 ? -33.263 -9.795  33.021  1.00 38.71 ? 343 LEU A CA    1 
ATOM   1530 C C     . LEU C 3 158 ? -34.365 -9.673  32.003  1.00 38.49 ? 343 LEU A C     1 
ATOM   1531 O O     . LEU C 3 158 ? -34.412 -10.427 31.033  1.00 38.60 ? 343 LEU A O     1 
ATOM   1532 C CB    . LEU C 3 158 ? -32.023 -9.074  32.500  1.00 38.74 ? 343 LEU A CB    1 
ATOM   1533 C CG    . LEU C 3 158 ? -30.775 -9.197  33.373  1.00 38.20 ? 343 LEU A CG    1 
ATOM   1534 C CD1   . LEU C 3 158 ? -29.614 -8.671  32.566  1.00 38.22 ? 343 LEU A CD1   1 
ATOM   1535 C CD2   . LEU C 3 158 ? -30.948 -8.438  34.695  1.00 36.45 ? 343 LEU A CD2   1 
ATOM   1536 N N     . ASN C 3 159 ? -35.246 -8.714  32.232  1.00 38.31 ? 344 ASN A N     1 
ATOM   1537 C CA    . ASN C 3 159 ? -36.281 -8.397  31.296  1.00 38.57 ? 344 ASN A CA    1 
ATOM   1538 C C     . ASN C 3 159 ? -36.232 -6.907  30.972  1.00 38.38 ? 344 ASN A C     1 
ATOM   1539 O O     . ASN C 3 159 ? -36.373 -6.055  31.838  1.00 38.01 ? 344 ASN A O     1 
ATOM   1540 C CB    . ASN C 3 159 ? -37.641 -8.868  31.817  1.00 38.86 ? 344 ASN A CB    1 
ATOM   1541 C CG    . ASN C 3 159 ? -38.801 -8.339  30.998  1.00 41.97 ? 344 ASN A CG    1 
ATOM   1542 O OD1   . ASN C 3 159 ? -39.592 -7.543  31.501  1.00 46.08 ? 344 ASN A OD1   1 
ATOM   1543 N ND2   . ASN C 3 159 ? -38.911 -8.765  29.729  1.00 43.67 ? 344 ASN A ND2   1 
ATOM   1544 N N     . ALA C 3 160 ? -35.976 -6.614  29.703  1.00 38.73 ? 345 ALA A N     1 
ATOM   1545 C CA    . ALA C 3 160 ? -35.914 -5.252  29.222  1.00 38.83 ? 345 ALA A CA    1 
ATOM   1546 C C     . ALA C 3 160 ? -37.172 -5.015  28.421  1.00 38.97 ? 345 ALA A C     1 
ATOM   1547 O O     . ALA C 3 160 ? -37.516 -5.851  27.599  1.00 39.48 ? 345 ALA A O     1 
ATOM   1548 C CB    . ALA C 3 160 ? -34.698 -5.074  28.353  1.00 38.39 ? 345 ALA A CB    1 
ATOM   1549 N N     . GLN C 3 161 ? -37.862 -3.903  28.677  1.00 39.01 ? 346 GLN A N     1 
ATOM   1550 C CA    . GLN C 3 161 ? -39.010 -3.489  27.866  1.00 39.61 ? 346 GLN A CA    1 
ATOM   1551 C C     . GLN C 3 161 ? -38.729 -2.176  27.157  1.00 39.00 ? 346 GLN A C     1 
ATOM   1552 O O     . GLN C 3 161 ? -38.190 -1.250  27.754  1.00 38.86 ? 346 GLN A O     1 
ATOM   1553 C CB    . GLN C 3 161 ? -40.265 -3.309  28.716  1.00 40.38 ? 346 GLN A CB    1 
ATOM   1554 C CG    . GLN C 3 161 ? -40.750 -4.569  29.437  1.00 43.64 ? 346 GLN A CG    1 
ATOM   1555 C CD    . GLN C 3 161 ? -42.244 -4.821  29.228  1.00 48.08 ? 346 GLN A CD    1 
ATOM   1556 O OE1   . GLN C 3 161 ? -42.988 -3.953  28.734  1.00 48.80 ? 346 GLN A OE1   1 
ATOM   1557 N NE2   . GLN C 3 161 ? -42.689 -6.025  29.596  1.00 49.33 ? 346 GLN A NE2   1 
ATOM   1558 N N     . PHE C 3 162 ? -39.127 -2.099  25.891  1.00 38.51 ? 347 PHE A N     1 
ATOM   1559 C CA    . PHE C 3 162 ? -38.928 -0.910  25.072  1.00 38.28 ? 347 PHE A CA    1 
ATOM   1560 C C     . PHE C 3 162 ? -40.248 -0.228  24.697  1.00 38.64 ? 347 PHE A C     1 
ATOM   1561 O O     . PHE C 3 162 ? -41.225 -0.893  24.353  1.00 38.38 ? 347 PHE A O     1 
ATOM   1562 C CB    . PHE C 3 162 ? -38.155 -1.285  23.809  1.00 37.85 ? 347 PHE A CB    1 
ATOM   1563 C CG    . PHE C 3 162 ? -36.764 -1.750  24.076  1.00 37.16 ? 347 PHE A CG    1 
ATOM   1564 C CD1   . PHE C 3 162 ? -36.526 -3.036  24.542  1.00 36.76 ? 347 PHE A CD1   1 
ATOM   1565 C CD2   . PHE C 3 162 ? -35.690 -0.898  23.878  1.00 36.44 ? 347 PHE A CD2   1 
ATOM   1566 C CE1   . PHE C 3 162 ? -35.255 -3.459  24.814  1.00 35.81 ? 347 PHE A CE1   1 
ATOM   1567 C CE2   . PHE C 3 162 ? -34.405 -1.318  24.134  1.00 35.71 ? 347 PHE A CE2   1 
ATOM   1568 C CZ    . PHE C 3 162 ? -34.189 -2.602  24.603  1.00 36.54 ? 347 PHE A CZ    1 
ATOM   1569 N N     . PHE C 3 163 ? -40.248 1.102   24.770  1.00 39.27 ? 348 PHE A N     1 
ATOM   1570 C CA    . PHE C 3 163 ? -41.380 1.944   24.390  1.00 39.87 ? 348 PHE A CA    1 
ATOM   1571 C C     . PHE C 3 163 ? -40.853 3.117   23.583  1.00 40.47 ? 348 PHE A C     1 
ATOM   1572 O O     . PHE C 3 163 ? -39.706 3.517   23.754  1.00 40.68 ? 348 PHE A O     1 
ATOM   1573 C CB    . PHE C 3 163 ? -42.055 2.543   25.627  1.00 39.89 ? 348 PHE A CB    1 
ATOM   1574 C CG    . PHE C 3 163 ? -42.634 1.532   26.576  1.00 40.11 ? 348 PHE A CG    1 
ATOM   1575 C CD1   . PHE C 3 163 ? -41.856 0.990   27.597  1.00 39.27 ? 348 PHE A CD1   1 
ATOM   1576 C CD2   . PHE C 3 163 ? -43.968 1.147   26.471  1.00 39.71 ? 348 PHE A CD2   1 
ATOM   1577 C CE1   . PHE C 3 163 ? -42.391 0.062   28.475  1.00 39.62 ? 348 PHE A CE1   1 
ATOM   1578 C CE2   . PHE C 3 163 ? -44.513 0.220   27.356  1.00 39.74 ? 348 PHE A CE2   1 
ATOM   1579 C CZ    . PHE C 3 163 ? -43.726 -0.322  28.357  1.00 39.18 ? 348 PHE A CZ    1 
ATOM   1580 N N     . TYR C 3 164 ? -41.688 3.683   22.721  1.00 41.14 ? 349 TYR A N     1 
ATOM   1581 C CA    . TYR C 3 164 ? -41.405 5.008   22.184  1.00 41.79 ? 349 TYR A CA    1 
ATOM   1582 C C     . TYR C 3 164 ? -41.949 6.048   23.156  1.00 42.30 ? 349 TYR A C     1 
ATOM   1583 O O     . TYR C 3 164 ? -42.843 5.754   23.945  1.00 42.53 ? 349 TYR A O     1 
ATOM   1584 C CB    . TYR C 3 164 ? -42.009 5.184   20.789  1.00 41.96 ? 349 TYR A CB    1 
ATOM   1585 C CG    . TYR C 3 164 ? -41.310 4.352   19.745  1.00 42.01 ? 349 TYR A CG    1 
ATOM   1586 C CD1   . TYR C 3 164 ? -41.878 3.173   19.272  1.00 42.40 ? 349 TYR A CD1   1 
ATOM   1587 C CD2   . TYR C 3 164 ? -40.065 4.730   19.248  1.00 42.19 ? 349 TYR A CD2   1 
ATOM   1588 C CE1   . TYR C 3 164 ? -41.228 2.395   18.321  1.00 42.91 ? 349 TYR A CE1   1 
ATOM   1589 C CE2   . TYR C 3 164 ? -39.404 3.959   18.300  1.00 42.58 ? 349 TYR A CE2   1 
ATOM   1590 C CZ    . TYR C 3 164 ? -39.989 2.792   17.842  1.00 42.73 ? 349 TYR A CZ    1 
ATOM   1591 O OH    . TYR C 3 164 ? -39.337 2.025   16.903  1.00 42.89 ? 349 TYR A OH    1 
ATOM   1592 N N     . GLY C 3 165 ? -41.397 7.257   23.110  1.00 42.80 ? 350 GLY A N     1 
ATOM   1593 C CA    . GLY C 3 165 ? -41.851 8.356   23.963  1.00 43.32 ? 350 GLY A CA    1 
ATOM   1594 C C     . GLY C 3 165 ? -43.326 8.678   23.801  1.00 43.91 ? 350 GLY A C     1 
ATOM   1595 O O     . GLY C 3 165 ? -43.967 9.134   24.749  1.00 44.16 ? 350 GLY A O     1 
ATOM   1596 N N     . CYS C 3 166 ? -43.866 8.443   22.604  1.00 44.03 ? 351 CYS A N     1 
ATOM   1597 C CA    . CYS C 3 166 ? -45.306 8.583   22.371  1.00 44.37 ? 351 CYS A CA    1 
ATOM   1598 C C     . CYS C 3 166 ? -46.135 7.508   23.089  1.00 44.55 ? 351 CYS A C     1 
ATOM   1599 O O     . CYS C 3 166 ? -47.328 7.699   23.321  1.00 44.55 ? 351 CYS A O     1 
ATOM   1600 C CB    . CYS C 3 166 ? -45.625 8.607   20.872  1.00 44.38 ? 351 CYS A CB    1 
ATOM   1601 S SG    . CYS C 3 166 ? -45.424 7.026   20.025  1.00 45.24 ? 351 CYS A SG    1 
ATOM   1602 N N     . GLY C 3 167 ? -45.506 6.382   23.435  1.00 44.84 ? 352 GLY A N     1 
ATOM   1603 C CA    . GLY C 3 167 ? -46.150 5.377   24.285  1.00 44.95 ? 352 GLY A CA    1 
ATOM   1604 C C     . GLY C 3 167 ? -46.500 4.036   23.661  1.00 45.11 ? 352 GLY A C     1 
ATOM   1605 O O     . GLY C 3 167 ? -47.038 3.156   24.340  1.00 45.21 ? 352 GLY A O     1 
ATOM   1606 N N     . MET C 3 168 ? -46.213 3.872   22.372  1.00 45.08 ? 353 MET A N     1 
ATOM   1607 C CA    . MET C 3 168 ? -46.426 2.583   21.717  1.00 44.94 ? 353 MET A CA    1 
ATOM   1608 C C     . MET C 3 168 ? -45.360 1.594   22.197  1.00 44.26 ? 353 MET A C     1 
ATOM   1609 O O     . MET C 3 168 ? -44.161 1.813   22.013  1.00 44.09 ? 353 MET A O     1 
ATOM   1610 C CB    . MET C 3 168 ? -46.426 2.724   20.192  1.00 45.02 ? 353 MET A CB    1 
ATOM   1611 C CG    . MET C 3 168 ? -47.366 3.820   19.654  1.00 46.94 ? 353 MET A CG    1 
ATOM   1612 S SD    . MET C 3 168 ? -49.157 3.468   19.576  1.00 50.60 ? 353 MET A SD    1 
ATOM   1613 C CE    . MET C 3 168 ? -49.645 3.413   21.312  1.00 49.35 ? 353 MET A CE    1 
ATOM   1614 N N     . GLU C 3 169 ? -45.813 0.527   22.847  1.00 43.61 ? 354 GLU A N     1 
ATOM   1615 C CA    . GLU C 3 169 ? -44.920 -0.513  23.323  1.00 43.22 ? 354 GLU A CA    1 
ATOM   1616 C C     . GLU C 3 169 ? -44.357 -1.315  22.165  1.00 42.51 ? 354 GLU A C     1 
ATOM   1617 O O     . GLU C 3 169 ? -45.112 -1.845  21.349  1.00 42.72 ? 354 GLU A O     1 
ATOM   1618 C CB    . GLU C 3 169 ? -45.623 -1.460  24.298  1.00 43.16 ? 354 GLU A CB    1 
ATOM   1619 C CG    . GLU C 3 169 ? -44.651 -2.494  24.907  1.00 43.58 ? 354 GLU A CG    1 
ATOM   1620 C CD    . GLU C 3 169 ? -45.347 -3.656  25.593  1.00 44.14 ? 354 GLU A CD    1 
ATOM   1621 O OE1   . GLU C 3 169 ? -44.689 -4.320  26.426  1.00 45.09 ? 354 GLU A OE1   1 
ATOM   1622 O OE2   . GLU C 3 169 ? -46.544 -3.911  25.304  1.00 45.43 ? 354 GLU A OE2   1 
ATOM   1623 N N     . ILE C 3 170 ? -43.030 -1.384  22.099  1.00 41.65 ? 355 ILE A N     1 
ATOM   1624 C CA    . ILE C 3 170 ? -42.341 -2.286  21.192  1.00 40.90 ? 355 ILE A CA    1 
ATOM   1625 C C     . ILE C 3 170 ? -42.431 -3.698  21.783  1.00 40.56 ? 355 ILE A C     1 
ATOM   1626 O O     . ILE C 3 170 ? -42.944 -4.611  21.146  1.00 40.45 ? 355 ILE A O     1 
ATOM   1627 C CB    . ILE C 3 170 ? -40.868 -1.859  20.980  1.00 41.19 ? 355 ILE A CB    1 
ATOM   1628 C CG1   . ILE C 3 170 ? -40.789 -0.431  20.425  1.00 41.03 ? 355 ILE A CG1   1 
ATOM   1629 C CG2   . ILE C 3 170 ? -40.142 -2.833  20.056  1.00 40.67 ? 355 ILE A CG2   1 
ATOM   1630 C CD1   . ILE C 3 170 ? -39.450 0.272   20.702  1.00 40.57 ? 355 ILE A CD1   1 
ATOM   1631 N N     . GLY C 3 171 ? -41.952 -3.869  23.011  1.00 40.20 ? 356 GLY A N     1 
ATOM   1632 C CA    . GLY C 3 171 ? -42.130 -5.133  23.712  1.00 39.89 ? 356 GLY A CA    1 
ATOM   1633 C C     . GLY C 3 171 ? -41.034 -5.461  24.700  1.00 39.59 ? 356 GLY A C     1 
ATOM   1634 O O     . GLY C 3 171 ? -40.150 -4.652  24.947  1.00 39.93 ? 356 GLY A O     1 
ATOM   1635 N N     . GLY C 3 172 ? -41.097 -6.661  25.260  1.00 39.33 ? 357 GLY A N     1 
ATOM   1636 C CA    . GLY C 3 172 ? -40.201 -7.068  26.322  1.00 39.33 ? 357 GLY A CA    1 
ATOM   1637 C C     . GLY C 3 172 ? -39.339 -8.236  25.885  1.00 39.70 ? 357 GLY A C     1 
ATOM   1638 O O     . GLY C 3 172 ? -39.809 -9.137  25.188  1.00 40.01 ? 357 GLY A O     1 
ATOM   1639 N N     . PHE C 3 173 ? -38.075 -8.208  26.297  1.00 39.43 ? 358 PHE A N     1 
ATOM   1640 C CA    . PHE C 3 173 ? -37.083 -9.187  25.893  1.00 39.21 ? 358 PHE A CA    1 
ATOM   1641 C C     . PHE C 3 173 ? -36.309 -9.640  27.122  1.00 39.60 ? 358 PHE A C     1 
ATOM   1642 O O     . PHE C 3 173 ? -35.972 -8.825  27.997  1.00 39.52 ? 358 PHE A O     1 
ATOM   1643 C CB    . PHE C 3 173 ? -36.124 -8.559  24.900  1.00 39.29 ? 358 PHE A CB    1 
ATOM   1644 C CG    . PHE C 3 173 ? -36.798 -7.967  23.702  1.00 39.04 ? 358 PHE A CG    1 
ATOM   1645 C CD1   . PHE C 3 173 ? -37.281 -6.655  23.733  1.00 39.22 ? 358 PHE A CD1   1 
ATOM   1646 C CD2   . PHE C 3 173 ? -36.960 -8.716  22.542  1.00 38.16 ? 358 PHE A CD2   1 
ATOM   1647 C CE1   . PHE C 3 173 ? -37.920 -6.102  22.619  1.00 37.51 ? 358 PHE A CE1   1 
ATOM   1648 C CE2   . PHE C 3 173 ? -37.598 -8.168  21.430  1.00 37.28 ? 358 PHE A CE2   1 
ATOM   1649 C CZ    . PHE C 3 173 ? -38.068 -6.861  21.471  1.00 37.55 ? 358 PHE A CZ    1 
ATOM   1650 N N     . VAL C 3 174 ? -36.050 -10.940 27.202  1.00 39.36 ? 359 VAL A N     1 
ATOM   1651 C CA    . VAL C 3 174 ? -35.352 -11.486 28.347  1.00 39.82 ? 359 VAL A CA    1 
ATOM   1652 C C     . VAL C 3 174 ? -33.937 -11.929 27.986  1.00 39.98 ? 359 VAL A C     1 
ATOM   1653 O O     . VAL C 3 174 ? -33.623 -12.198 26.821  1.00 39.85 ? 359 VAL A O     1 
ATOM   1654 C CB    . VAL C 3 174 ? -36.116 -12.649 29.005  1.00 39.78 ? 359 VAL A CB    1 
ATOM   1655 C CG1   . VAL C 3 174 ? -37.466 -12.163 29.487  1.00 41.03 ? 359 VAL A CG1   1 
ATOM   1656 C CG2   . VAL C 3 174 ? -36.270 -13.812 28.030  1.00 40.32 ? 359 VAL A CG2   1 
ATOM   1657 N N     . SER C 3 175 ? -33.089 -11.974 29.001  1.00 39.76 ? 360 SER A N     1 
ATOM   1658 C CA    . SER C 3 175 ? -31.735 -12.435 28.843  1.00 40.10 ? 360 SER A CA    1 
ATOM   1659 C C     . SER C 3 175 ? -31.757 -13.921 29.125  1.00 39.93 ? 360 SER A C     1 
ATOM   1660 O O     . SER C 3 175 ? -32.814 -14.495 29.384  1.00 39.52 ? 360 SER A O     1 
ATOM   1661 C CB    . SER C 3 175 ? -30.848 -11.735 29.866  1.00 40.16 ? 360 SER A CB    1 
ATOM   1662 O OG    . SER C 3 175 ? -31.271 -12.063 31.195  1.00 42.09 ? 360 SER A OG    1 
ATOM   1663 N N     . GLN C 3 176 ? -30.577 -14.531 29.096  1.00 40.04 ? 361 GLN A N     1 
ATOM   1664 C CA    . GLN C 3 176 ? -30.391 -15.904 29.550  1.00 39.88 ? 361 GLN A CA    1 
ATOM   1665 C C     . GLN C 3 176 ? -30.444 -15.970 31.083  1.00 38.90 ? 361 GLN A C     1 
ATOM   1666 O O     . GLN C 3 176 ? -30.458 -14.949 31.758  1.00 38.32 ? 361 GLN A O     1 
ATOM   1667 C CB    . GLN C 3 176 ? -29.038 -16.426 29.053  1.00 40.31 ? 361 GLN A CB    1 
ATOM   1668 C CG    . GLN C 3 176 ? -28.880 -16.431 27.556  1.00 42.17 ? 361 GLN A CG    1 
ATOM   1669 C CD    . GLN C 3 176 ? -29.973 -17.232 26.870  1.00 44.99 ? 361 GLN A CD    1 
ATOM   1670 O OE1   . GLN C 3 176 ? -30.839 -16.669 26.215  1.00 46.39 ? 361 GLN A OE1   1 
ATOM   1671 N NE2   . GLN C 3 176 ? -29.949 -18.552 27.043  1.00 46.28 ? 361 GLN A NE2   1 
ATOM   1672 N N     . ARG C 3 177 ? -30.499 -17.187 31.597  1.00 38.75 ? 362 ARG A N     1 
ATOM   1673 C CA    A ARG C 3 177 ? -30.404 -17.523 33.015  0.50 39.10 ? 362 ARG A CA    1 
ATOM   1674 C CA    B ARG C 3 177 ? -30.485 -17.368 33.023  0.50 39.04 ? 362 ARG A CA    1 
ATOM   1675 C C     . ARG C 3 177 ? -29.143 -16.915 33.603  1.00 39.21 ? 362 ARG A C     1 
ATOM   1676 O O     . ARG C 3 177 ? -28.093 -17.043 32.975  1.00 39.91 ? 362 ARG A O     1 
ATOM   1677 C CB    A ARG C 3 177 ? -30.259 -19.048 33.153  0.50 39.34 ? 362 ARG A CB    1 
ATOM   1678 C CB    B ARG C 3 177 ? -30.775 -18.820 33.382  0.50 39.31 ? 362 ARG A CB    1 
ATOM   1679 C CG    A ARG C 3 177 ? -31.545 -19.862 33.205  0.50 40.13 ? 362 ARG A CG    1 
ATOM   1680 C CG    B ARG C 3 177 ? -31.803 -18.975 34.489  0.50 39.95 ? 362 ARG A CG    1 
ATOM   1681 C CD    A ARG C 3 177 ? -31.939 -20.151 34.644  0.50 41.52 ? 362 ARG A CD    1 
ATOM   1682 C CD    B ARG C 3 177 ? -33.232 -18.944 33.945  0.50 40.89 ? 362 ARG A CD    1 
ATOM   1683 N NE    A ARG C 3 177 ? -33.053 -21.092 34.771  0.50 41.32 ? 362 ARG A NE    1 
ATOM   1684 N NE    B ARG C 3 177 ? -34.210 -19.357 34.951  0.50 40.58 ? 362 ARG A NE    1 
ATOM   1685 C CZ    A ARG C 3 177 ? -32.970 -22.277 35.371  0.50 41.77 ? 362 ARG A CZ    1 
ATOM   1686 C CZ    B ARG C 3 177 ? -34.931 -18.521 35.689  0.50 40.85 ? 362 ARG A CZ    1 
ATOM   1687 N NH1   A ARG C 3 177 ? -31.826 -22.691 35.900  0.50 40.37 ? 362 ARG A NH1   1 
ATOM   1688 N NH1   B ARG C 3 177 ? -34.798 -17.208 35.544  0.50 41.53 ? 362 ARG A NH1   1 
ATOM   1689 N NH2   A ARG C 3 177 ? -34.039 -23.058 35.434  0.50 42.89 ? 362 ARG A NH2   1 
ATOM   1690 N NH2   B ARG C 3 177 ? -35.795 -19.001 36.571  0.50 41.78 ? 362 ARG A NH2   1 
ATOM   1691 N N     . ILE C 3 178 ? -29.229 -16.331 34.801  1.00 38.70 ? 363 ILE A N     1 
ATOM   1692 C CA    . ILE C 3 178 ? -28.102 -15.793 35.559  1.00 39.00 ? 363 ILE A CA    1 
ATOM   1693 C C     . ILE C 3 178 ? -28.109 -16.475 36.939  1.00 39.75 ? 363 ILE A C     1 
ATOM   1694 O O     . ILE C 3 178 ? -29.156 -16.522 37.609  1.00 39.86 ? 363 ILE A O     1 
ATOM   1695 C CB    . ILE C 3 178 ? -28.208 -14.232 35.724  1.00 39.17 ? 363 ILE A CB    1 
ATOM   1696 C CG1   . ILE C 3 178 ? -28.326 -13.555 34.339  1.00 38.95 ? 363 ILE A CG1   1 
ATOM   1697 C CG2   . ILE C 3 178 ? -27.026 -13.665 36.524  1.00 38.00 ? 363 ILE A CG2   1 
ATOM   1698 C CD1   . ILE C 3 178 ? -28.256 -12.048 34.326  1.00 38.03 ? 363 ILE A CD1   1 
ATOM   1699 N N     . LYS C 3 179 ? -26.967 -17.012 37.373  1.00 39.69 ? 364 LYS A N     1 
ATOM   1700 C CA    . LYS C 3 179 ? -26.940 -17.704 38.657  1.00 40.22 ? 364 LYS A CA    1 
ATOM   1701 C C     . LYS C 3 179 ? -26.553 -16.766 39.804  1.00 39.83 ? 364 LYS A C     1 
ATOM   1702 O O     . LYS C 3 179 ? -25.617 -16.000 39.681  1.00 40.96 ? 364 LYS A O     1 
ATOM   1703 C CB    . LYS C 3 179 ? -26.035 -18.925 38.605  1.00 40.40 ? 364 LYS A CB    1 
ATOM   1704 C CG    . LYS C 3 179 ? -25.877 -19.630 39.950  1.00 41.74 ? 364 LYS A CG    1 
ATOM   1705 C CD    . LYS C 3 179 ? -25.270 -21.003 39.790  1.00 42.45 ? 364 LYS A CD    1 
ATOM   1706 C CE    . LYS C 3 179 ? -25.505 -21.853 41.029  1.00 44.68 ? 364 LYS A CE    1 
ATOM   1707 N NZ    . LYS C 3 179 ? -25.286 -23.302 40.730  1.00 45.88 ? 364 LYS A NZ    1 
ATOM   1708 N N     . VAL C 3 180 ? -27.294 -16.794 40.903  1.00 39.42 ? 365 VAL A N     1 
ATOM   1709 C CA    . VAL C 3 180 ? -26.931 -15.968 42.072  1.00 38.94 ? 365 VAL A CA    1 
ATOM   1710 C C     . VAL C 3 180 ? -25.792 -16.642 42.816  1.00 37.97 ? 365 VAL A C     1 
ATOM   1711 O O     . VAL C 3 180 ? -25.850 -17.847 43.093  1.00 37.48 ? 365 VAL A O     1 
ATOM   1712 C CB    . VAL C 3 180 ? -28.133 -15.737 43.023  1.00 39.08 ? 365 VAL A CB    1 
ATOM   1713 C CG1   . VAL C 3 180 ? -27.753 -14.778 44.108  1.00 38.74 ? 365 VAL A CG1   1 
ATOM   1714 C CG2   . VAL C 3 180 ? -29.282 -15.161 42.244  1.00 39.73 ? 365 VAL A CG2   1 
ATOM   1715 N N     . ILE C 3 181 ? -24.722 -15.895 43.070  1.00 37.04 ? 366 ILE A N     1 
ATOM   1716 C CA    . ILE C 3 181 ? -23.643 -16.438 43.889  1.00 36.24 ? 366 ILE A CA    1 
ATOM   1717 C C     . ILE C 3 181 ? -23.491 -15.611 45.139  1.00 35.83 ? 366 ILE A C     1 
ATOM   1718 O O     . ILE C 3 181 ? -23.785 -14.417 45.136  1.00 35.79 ? 366 ILE A O     1 
ATOM   1719 C CB    . ILE C 3 181 ? -22.268 -16.584 43.174  1.00 36.17 ? 366 ILE A CB    1 
ATOM   1720 C CG1   . ILE C 3 181 ? -21.784 -15.235 42.655  1.00 37.47 ? 366 ILE A CG1   1 
ATOM   1721 C CG2   . ILE C 3 181 ? -22.298 -17.641 42.098  1.00 34.28 ? 366 ILE A CG2   1 
ATOM   1722 C CD1   . ILE C 3 181 ? -20.277 -15.116 42.678  1.00 41.28 ? 366 ILE A CD1   1 
ATOM   1723 N N     . SER C 3 182 ? -23.019 -16.248 46.203  1.00 35.75 ? 367 SER A N     1 
ATOM   1724 C CA    . SER C 3 182 ? -22.811 -15.568 47.463  1.00 36.57 ? 367 SER A CA    1 
ATOM   1725 C C     . SER C 3 182 ? -21.500 -14.785 47.412  1.00 37.14 ? 367 SER A C     1 
ATOM   1726 O O     . SER C 3 182 ? -21.418 -13.684 47.927  1.00 37.38 ? 367 SER A O     1 
ATOM   1727 C CB    . SER C 3 182 ? -22.789 -16.574 48.611  1.00 36.39 ? 367 SER A CB    1 
ATOM   1728 O OG    . SER C 3 182 ? -21.597 -17.363 48.562  1.00 37.86 ? 367 SER A OG    1 
ATOM   1729 N N     . LYS C 3 183 ? -20.486 -15.369 46.777  1.00 37.62 ? 368 LYS A N     1 
ATOM   1730 C CA    . LYS C 3 183 ? -19.133 -14.787 46.723  1.00 37.87 ? 368 LYS A CA    1 
ATOM   1731 C C     . LYS C 3 183 ? -18.264 -15.528 45.718  1.00 37.43 ? 368 LYS A C     1 
ATOM   1732 O O     . LYS C 3 183 ? -18.491 -16.715 45.465  1.00 37.63 ? 368 LYS A O     1 
ATOM   1733 C CB    . LYS C 3 183 ? -18.452 -14.819 48.102  1.00 37.66 ? 368 LYS A CB    1 
ATOM   1734 C CG    . LYS C 3 183 ? -18.359 -13.416 48.739  1.00 38.48 ? 368 LYS A CG    1 
ATOM   1735 C CD    . LYS C 3 183 ? -17.884 -13.479 50.194  1.00 38.32 ? 368 LYS A CD    1 
ATOM   1736 C CE    . LYS C 3 183 ? -16.422 -13.226 50.288  1.00 37.83 ? 368 LYS A CE    1 
ATOM   1737 N NZ    . LYS C 3 183 ? -16.149 -12.792 51.667  1.00 40.43 ? 368 LYS A NZ    1 
ATOM   1738 N N     . PRO C 3 184 ? -17.259 -14.846 45.147  1.00 37.40 ? 369 PRO A N     1 
ATOM   1739 C CA    . PRO C 3 184 ? -16.387 -15.596 44.242  1.00 37.50 ? 369 PRO A CA    1 
ATOM   1740 C C     . PRO C 3 184 ? -15.890 -16.826 44.994  1.00 37.78 ? 369 PRO A C     1 
ATOM   1741 O O     . PRO C 3 184 ? -15.536 -16.716 46.164  1.00 38.10 ? 369 PRO A O     1 
ATOM   1742 C CB    . PRO C 3 184 ? -15.229 -14.628 44.002  1.00 37.35 ? 369 PRO A CB    1 
ATOM   1743 C CG    . PRO C 3 184 ? -15.804 -13.287 44.210  1.00 35.56 ? 369 PRO A CG    1 
ATOM   1744 C CD    . PRO C 3 184 ? -16.844 -13.432 45.272  1.00 37.35 ? 369 PRO A CD    1 
ATOM   1745 N N     . SER C 3 185 ? -15.915 -17.982 44.351  1.00 37.29 ? 370 SER A N     1 
ATOM   1746 C CA    . SER C 3 185 ? -15.399 -19.200 44.946  1.00 37.56 ? 370 SER A CA    1 
ATOM   1747 C C     . SER C 3 185 ? -13.880 -19.165 45.271  1.00 37.53 ? 370 SER A C     1 
ATOM   1748 O O     . SER C 3 185 ? -13.102 -18.459 44.622  1.00 36.99 ? 370 SER A O     1 
ATOM   1749 C CB    . SER C 3 185 ? -15.685 -20.379 44.009  1.00 37.84 ? 370 SER A CB    1 
ATOM   1750 O OG    . SER C 3 185 ? -14.963 -21.536 44.417  1.00 37.79 ? 370 SER A OG    1 
ATOM   1751 N N     . LYS C 3 186 ? -13.482 -19.972 46.255  1.00 37.56 ? 371 LYS A N     1 
ATOM   1752 C CA    . LYS C 3 186 ? -12.085 -20.074 46.692  1.00 38.19 ? 371 LYS A CA    1 
ATOM   1753 C C     . LYS C 3 186 ? -11.559 -21.519 46.658  1.00 38.32 ? 371 LYS A C     1 
ATOM   1754 O O     . LYS C 3 186 ? -10.645 -21.854 47.409  1.00 37.81 ? 371 LYS A O     1 
ATOM   1755 C CB    . LYS C 3 186 ? -11.926 -19.552 48.131  1.00 38.13 ? 371 LYS A CB    1 
ATOM   1756 C CG    . LYS C 3 186 ? -12.299 -18.105 48.397  1.00 38.34 ? 371 LYS A CG    1 
ATOM   1757 C CD    . LYS C 3 186 ? -12.252 -17.838 49.915  1.00 38.31 ? 371 LYS A CD    1 
ATOM   1758 C CE    . LYS C 3 186 ? -12.455 -16.356 50.262  1.00 38.99 ? 371 LYS A CE    1 
ATOM   1759 N NZ    . LYS C 3 186 ? -12.011 -16.042 51.670  1.00 39.14 ? 371 LYS A NZ    1 
ATOM   1760 N N     . LYS C 3 187 ? -12.127 -22.380 45.818  1.00 39.01 ? 372 LYS A N     1 
ATOM   1761 C CA    . LYS C 3 187 ? -11.696 -23.780 45.826  1.00 40.12 ? 372 LYS A CA    1 
ATOM   1762 C C     . LYS C 3 187 ? -10.339 -23.942 45.130  1.00 40.31 ? 372 LYS A C     1 
ATOM   1763 O O     . LYS C 3 187 ? -10.106 -23.380 44.058  1.00 39.91 ? 372 LYS A O     1 
ATOM   1764 C CB    . LYS C 3 187 ? -12.777 -24.743 45.293  1.00 40.09 ? 372 LYS A CB    1 
ATOM   1765 C CG    . LYS C 3 187 ? -12.805 -24.991 43.791  1.00 42.15 ? 372 LYS A CG    1 
ATOM   1766 C CD    . LYS C 3 187 ? -13.645 -23.966 43.040  1.00 46.32 ? 372 LYS A CD    1 
ATOM   1767 C CE    . LYS C 3 187 ? -12.820 -23.072 42.087  1.00 49.58 ? 372 LYS A CE    1 
ATOM   1768 N NZ    . LYS C 3 187 ? -12.187 -21.859 42.713  1.00 50.83 ? 372 LYS A NZ    1 
ATOM   1769 N N     . LYS C 3 188 ? -9.447  -24.687 45.775  1.00 40.60 ? 373 LYS A N     1 
ATOM   1770 C CA    . LYS C 3 188 ? -8.076  -24.837 45.303  1.00 41.54 ? 373 LYS A CA    1 
ATOM   1771 C C     . LYS C 3 188 ? -7.890  -26.021 44.348  1.00 42.18 ? 373 LYS A C     1 
ATOM   1772 O O     . LYS C 3 188 ? -6.890  -26.084 43.638  1.00 42.34 ? 373 LYS A O     1 
ATOM   1773 C CB    . LYS C 3 188 ? -7.098  -24.952 46.489  1.00 41.40 ? 373 LYS A CB    1 
ATOM   1774 C CG    . LYS C 3 188 ? -7.097  -23.758 47.455  1.00 41.62 ? 373 LYS A CG    1 
ATOM   1775 C CD    . LYS C 3 188 ? -6.942  -22.445 46.712  1.00 42.91 ? 373 LYS A CD    1 
ATOM   1776 C CE    . LYS C 3 188 ? -7.357  -21.246 47.549  1.00 44.04 ? 373 LYS A CE    1 
ATOM   1777 N NZ    . LYS C 3 188 ? -7.700  -20.075 46.650  1.00 43.56 ? 373 LYS A NZ    1 
ATOM   1778 N N     . GLN C 3 189 ? -8.855  -26.942 44.328  1.00 42.96 ? 374 GLN A N     1 
ATOM   1779 C CA    . GLN C 3 189 ? -8.731  -28.215 43.601  1.00 43.75 ? 374 GLN A CA    1 
ATOM   1780 C C     . GLN C 3 189 ? -9.907  -28.432 42.655  1.00 43.82 ? 374 GLN A C     1 
ATOM   1781 O O     . GLN C 3 189 ? -10.734 -27.540 42.489  1.00 43.82 ? 374 GLN A O     1 
ATOM   1782 C CB    . GLN C 3 189 ? -8.682  -29.398 44.586  1.00 43.79 ? 374 GLN A CB    1 
ATOM   1783 C CG    . GLN C 3 189 ? -7.729  -29.248 45.763  1.00 45.53 ? 374 GLN A CG    1 
ATOM   1784 C CD    . GLN C 3 189 ? -6.260  -29.412 45.377  1.00 48.12 ? 374 GLN A CD    1 
ATOM   1785 O OE1   . GLN C 3 189 ? -5.404  -28.633 45.810  1.00 48.73 ? 374 GLN A OE1   1 
ATOM   1786 N NE2   . GLN C 3 189 ? -5.961  -30.429 44.563  1.00 48.76 ? 374 GLN A NE2   1 
ATOM   1787 N N     . SER C 3 190 ? -9.978  -29.633 42.063  1.00 44.24 ? 375 SER A N     1 
ATOM   1788 C CA    . SER C 3 190 ? -11.128 -30.095 41.262  1.00 44.46 ? 375 SER A CA    1 
ATOM   1789 C C     . SER C 3 190 ? -11.286 -29.306 39.959  1.00 44.45 ? 375 SER A C     1 
ATOM   1790 O O     . SER C 3 190 ? -12.240 -29.503 39.199  1.00 44.37 ? 375 SER A O     1 
ATOM   1791 C CB    . SER C 3 190 ? -12.429 -30.052 42.093  1.00 44.68 ? 375 SER A CB    1 
ATOM   1792 O OG    . SER C 3 190 ? -13.331 -31.087 41.725  1.00 45.03 ? 375 SER A OG    1 
ATOM   1793 N N     . ASP C 3 195 ? -19.359 -33.371 39.726  1.00 56.59 ? 380 ASP A N     1 
ATOM   1794 C CA    . ASP C 3 195 ? -19.591 -32.134 40.475  1.00 56.70 ? 380 ASP A CA    1 
ATOM   1795 C C     . ASP C 3 195 ? -19.773 -30.887 39.589  1.00 56.48 ? 380 ASP A C     1 
ATOM   1796 O O     . ASP C 3 195 ? -19.587 -30.938 38.367  1.00 56.53 ? 380 ASP A O     1 
ATOM   1797 C CB    . ASP C 3 195 ? -18.498 -31.908 41.531  1.00 56.80 ? 380 ASP A CB    1 
ATOM   1798 C CG    . ASP C 3 195 ? -17.098 -32.102 40.978  1.00 57.23 ? 380 ASP A CG    1 
ATOM   1799 O OD1   . ASP C 3 195 ? -16.708 -33.273 40.750  1.00 57.89 ? 380 ASP A OD1   1 
ATOM   1800 O OD2   . ASP C 3 195 ? -16.391 -31.088 40.781  1.00 56.53 ? 380 ASP A OD2   1 
ATOM   1801 N N     . CYS C 3 196 ? -20.104 -29.773 40.242  1.00 56.21 ? 381 CYS A N     1 
ATOM   1802 C CA    . CYS C 3 196 ? -20.707 -28.579 39.621  1.00 55.55 ? 381 CYS A CA    1 
ATOM   1803 C C     . CYS C 3 196 ? -20.231 -28.120 38.230  1.00 54.68 ? 381 CYS A C     1 
ATOM   1804 O O     . CYS C 3 196 ? -20.958 -28.291 37.256  1.00 54.91 ? 381 CYS A O     1 
ATOM   1805 C CB    . CYS C 3 196 ? -20.687 -27.406 40.599  1.00 55.87 ? 381 CYS A CB    1 
ATOM   1806 S SG    . CYS C 3 196 ? -22.063 -26.282 40.335  1.00 57.19 ? 381 CYS A SG    1 
ATOM   1807 N N     . LYS C 3 197 ? -19.049 -27.511 38.145  1.00 53.41 ? 382 LYS A N     1 
ATOM   1808 C CA    . LYS C 3 197 ? -18.483 -27.023 36.861  1.00 52.19 ? 382 LYS A CA    1 
ATOM   1809 C C     . LYS C 3 197 ? -19.050 -25.684 36.344  1.00 51.12 ? 382 LYS A C     1 
ATOM   1810 O O     . LYS C 3 197 ? -18.394 -25.006 35.544  1.00 51.04 ? 382 LYS A O     1 
ATOM   1811 C CB    . LYS C 3 197 ? -18.557 -28.083 35.742  1.00 52.20 ? 382 LYS A CB    1 
ATOM   1812 C CG    . LYS C 3 197 ? -17.770 -29.366 35.999  1.00 52.31 ? 382 LYS A CG    1 
ATOM   1813 C CD    . LYS C 3 197 ? -17.958 -30.348 34.853  1.00 52.20 ? 382 LYS A CD    1 
ATOM   1814 C CE    . LYS C 3 197 ? -17.513 -31.744 35.241  1.00 52.49 ? 382 LYS A CE    1 
ATOM   1815 N NZ    . LYS C 3 197 ? -17.570 -32.682 34.081  1.00 52.51 ? 382 LYS A NZ    1 
ATOM   1816 N N     . TYR C 3 198 ? -20.247 -25.307 36.794  1.00 49.61 ? 383 TYR A N     1 
ATOM   1817 C CA    . TYR C 3 198 ? -20.877 -24.046 36.358  1.00 48.15 ? 383 TYR A CA    1 
ATOM   1818 C C     . TYR C 3 198 ? -20.013 -22.801 36.603  1.00 46.83 ? 383 TYR A C     1 
ATOM   1819 O O     . TYR C 3 198 ? -20.097 -21.826 35.858  1.00 46.59 ? 383 TYR A O     1 
ATOM   1820 C CB    . TYR C 3 198 ? -22.242 -23.855 37.034  1.00 48.28 ? 383 TYR A CB    1 
ATOM   1821 C CG    . TYR C 3 198 ? -23.110 -22.780 36.391  1.00 48.45 ? 383 TYR A CG    1 
ATOM   1822 C CD1   . TYR C 3 198 ? -24.040 -23.108 35.397  1.00 48.66 ? 383 TYR A CD1   1 
ATOM   1823 C CD2   . TYR C 3 198 ? -23.014 -21.445 36.780  1.00 47.78 ? 383 TYR A CD2   1 
ATOM   1824 C CE1   . TYR C 3 198 ? -24.842 -22.135 34.804  1.00 47.66 ? 383 TYR A CE1   1 
ATOM   1825 C CE2   . TYR C 3 198 ? -23.814 -20.464 36.186  1.00 47.61 ? 383 TYR A CE2   1 
ATOM   1826 C CZ    . TYR C 3 198 ? -24.725 -20.819 35.205  1.00 47.73 ? 383 TYR A CZ    1 
ATOM   1827 O OH    . TYR C 3 198 ? -25.520 -19.856 34.621  1.00 48.69 ? 383 TYR A OH    1 
ATOM   1828 N N     . LEU C 3 199 ? -19.203 -22.834 37.657  1.00 45.42 ? 384 LEU A N     1 
ATOM   1829 C CA    . LEU C 3 199 ? -18.373 -21.687 38.017  1.00 44.15 ? 384 LEU A CA    1 
ATOM   1830 C C     . LEU C 3 199 ? -17.021 -21.683 37.313  1.00 43.30 ? 384 LEU A C     1 
ATOM   1831 O O     . LEU C 3 199 ? -16.289 -20.698 37.374  1.00 43.21 ? 384 LEU A O     1 
ATOM   1832 C CB    . LEU C 3 199 ? -18.214 -21.582 39.539  1.00 43.92 ? 384 LEU A CB    1 
ATOM   1833 C CG    . LEU C 3 199 ? -19.529 -21.417 40.326  1.00 43.80 ? 384 LEU A CG    1 
ATOM   1834 C CD1   . LEU C 3 199 ? -19.330 -21.699 41.823  1.00 44.00 ? 384 LEU A CD1   1 
ATOM   1835 C CD2   . LEU C 3 199 ? -20.163 -20.047 40.110  1.00 42.29 ? 384 LEU A CD2   1 
ATOM   1836 N N     . CYS C 3 200 ? -16.700 -22.781 36.634  1.00 42.40 ? 385 CYS A N     1 
ATOM   1837 C CA    . CYS C 3 200 ? -15.459 -22.869 35.868  1.00 41.73 ? 385 CYS A CA    1 
ATOM   1838 C C     . CYS C 3 200 ? -15.550 -22.171 34.524  1.00 40.48 ? 385 CYS A C     1 
ATOM   1839 O O     . CYS C 3 200 ? -16.612 -21.713 34.112  1.00 41.29 ? 385 CYS A O     1 
ATOM   1840 C CB    . CYS C 3 200 ? -15.034 -24.314 35.690  1.00 41.64 ? 385 CYS A CB    1 
ATOM   1841 S SG    . CYS C 3 200 ? -14.609 -25.060 37.255  1.00 44.56 ? 385 CYS A SG    1 
ATOM   1842 N N     . ILE C 3 201 ? -14.416 -22.077 33.857  1.00 38.93 ? 386 ILE A N     1 
ATOM   1843 C CA    . ILE C 3 201 ? -14.333 -21.424 32.577  1.00 37.23 ? 386 ILE A CA    1 
ATOM   1844 C C     . ILE C 3 201 ? -13.699 -22.436 31.664  1.00 36.42 ? 386 ILE A C     1 
ATOM   1845 O O     . ILE C 3 201 ? -12.543 -22.812 31.849  1.00 36.48 ? 386 ILE A O     1 
ATOM   1846 C CB    . ILE C 3 201 ? -13.495 -20.116 32.650  1.00 37.26 ? 386 ILE A CB    1 
ATOM   1847 C CG1   . ILE C 3 201 ? -14.214 -19.083 33.527  1.00 36.94 ? 386 ILE A CG1   1 
ATOM   1848 C CG2   . ILE C 3 201 ? -13.255 -19.552 31.280  1.00 36.23 ? 386 ILE A CG2   1 
ATOM   1849 C CD1   . ILE C 3 201 ? -13.420 -17.823 33.786  1.00 36.87 ? 386 ILE A CD1   1 
ATOM   1850 N N     . ALA C 3 202 ? -14.496 -22.900 30.708  1.00 35.32 ? 387 ALA A N     1 
ATOM   1851 C CA    . ALA C 3 202 ? -14.096 -23.899 29.745  1.00 33.99 ? 387 ALA A CA    1 
ATOM   1852 C C     . ALA C 3 202 ? -13.481 -23.215 28.537  1.00 33.53 ? 387 ALA A C     1 
ATOM   1853 O O     . ALA C 3 202 ? -13.936 -22.136 28.117  1.00 33.26 ? 387 ALA A O     1 
ATOM   1854 C CB    . ALA C 3 202 ? -15.292 -24.726 29.333  1.00 33.66 ? 387 ALA A CB    1 
ATOM   1855 N N     . SER C 3 203 ? -12.447 -23.851 27.983  1.00 32.55 ? 388 SER A N     1 
ATOM   1856 C CA    . SER C 3 203 ? -11.805 -23.380 26.760  1.00 32.20 ? 388 SER A CA    1 
ATOM   1857 C C     . SER C 3 203 ? -12.821 -23.157 25.641  1.00 32.02 ? 388 SER A C     1 
ATOM   1858 O O     . SER C 3 203 ? -13.679 -24.013 25.379  1.00 31.97 ? 388 SER A O     1 
ATOM   1859 C CB    . SER C 3 203 ? -10.749 -24.387 26.298  1.00 32.15 ? 388 SER A CB    1 
ATOM   1860 O OG    . SER C 3 203 ? -9.971  -23.849 25.251  1.00 31.58 ? 388 SER A OG    1 
ATOM   1861 N N     . GLY C 3 204 ? -12.731 -22.000 24.995  1.00 31.81 ? 389 GLY A N     1 
ATOM   1862 C CA    . GLY C 3 204 ? -13.613 -21.679 23.879  1.00 31.52 ? 389 GLY A CA    1 
ATOM   1863 C C     . GLY C 3 204 ? -14.911 -21.002 24.266  1.00 31.78 ? 389 GLY A C     1 
ATOM   1864 O O     . GLY C 3 204 ? -15.796 -20.861 23.429  1.00 32.08 ? 389 GLY A O     1 
ATOM   1865 N N     . THR C 3 205 ? -15.050 -20.594 25.529  1.00 31.96 ? 390 THR A N     1 
ATOM   1866 C CA    . THR C 3 205 ? -16.246 -19.847 25.965  1.00 32.02 ? 390 THR A CA    1 
ATOM   1867 C C     . THR C 3 205 ? -15.928 -18.367 26.130  1.00 31.87 ? 390 THR A C     1 
ATOM   1868 O O     . THR C 3 205 ? -14.772 -17.951 26.032  1.00 32.36 ? 390 THR A O     1 
ATOM   1869 C CB    . THR C 3 205 ? -16.888 -20.408 27.267  1.00 31.93 ? 390 THR A CB    1 
ATOM   1870 O OG1   . THR C 3 205 ? -15.924 -20.392 28.330  1.00 33.86 ? 390 THR A OG1   1 
ATOM   1871 C CG2   . THR C 3 205 ? -17.395 -21.836 27.058  1.00 31.63 ? 390 THR A CG2   1 
ATOM   1872 N N     . LYS C 3 206 ? -16.957 -17.576 26.381  1.00 31.85 ? 391 LYS A N     1 
ATOM   1873 C CA    . LYS C 3 206 ? -16.837 -16.131 26.381  1.00 32.00 ? 391 LYS A CA    1 
ATOM   1874 C C     . LYS C 3 206 ? -16.619 -15.575 27.768  1.00 32.10 ? 391 LYS A C     1 
ATOM   1875 O O     . LYS C 3 206 ? -17.148 -16.097 28.765  1.00 32.54 ? 391 LYS A O     1 
ATOM   1876 C CB    . LYS C 3 206 ? -18.076 -15.493 25.725  1.00 32.91 ? 391 LYS A CB    1 
ATOM   1877 C CG    . LYS C 3 206 ? -18.329 -16.038 24.308  1.00 33.37 ? 391 LYS A CG    1 
ATOM   1878 C CD    . LYS C 3 206 ? -18.541 -14.926 23.298  1.00 35.64 ? 391 LYS A CD    1 
ATOM   1879 C CE    . LYS C 3 206 ? -18.086 -15.329 21.900  1.00 36.04 ? 391 LYS A CE    1 
ATOM   1880 N NZ    . LYS C 3 206 ? -18.522 -16.693 21.510  1.00 38.44 ? 391 LYS A NZ    1 
ATOM   1881 N N     . VAL C 3 207 ? -15.823 -14.516 27.848  1.00 31.77 ? 392 VAL A N     1 
ATOM   1882 C CA    . VAL C 3 207 ? -15.529 -13.905 29.144  1.00 31.35 ? 392 VAL A CA    1 
ATOM   1883 C C     . VAL C 3 207 ? -15.448 -12.390 28.989  1.00 31.42 ? 392 VAL A C     1 
ATOM   1884 O O     . VAL C 3 207 ? -15.080 -11.879 27.931  1.00 32.30 ? 392 VAL A O     1 
ATOM   1885 C CB    . VAL C 3 207 ? -14.196 -14.446 29.773  1.00 31.60 ? 392 VAL A CB    1 
ATOM   1886 C CG1   . VAL C 3 207 ? -14.293 -15.943 30.137  1.00 31.04 ? 392 VAL A CG1   1 
ATOM   1887 C CG2   . VAL C 3 207 ? -12.998 -14.185 28.853  1.00 30.27 ? 392 VAL A CG2   1 
ATOM   1888 N N     . ALA C 3 208 ? -15.818 -11.675 30.032  1.00 31.66 ? 393 ALA A N     1 
ATOM   1889 C CA    . ALA C 3 208 ? -15.500 -10.256 30.139  1.00 31.81 ? 393 ALA A CA    1 
ATOM   1890 C C     . ALA C 3 208 ? -14.345 -10.112 31.102  1.00 31.73 ? 393 ALA A C     1 
ATOM   1891 O O     . ALA C 3 208 ? -14.170 -10.951 31.981  1.00 31.70 ? 393 ALA A O     1 
ATOM   1892 C CB    . ALA C 3 208 ? -16.724 -9.448  30.633  1.00 31.10 ? 393 ALA A CB    1 
ATOM   1893 N N     . LEU C 3 209 ? -13.561 -9.048  30.939  1.00 32.42 ? 394 LEU A N     1 
ATOM   1894 C CA    . LEU C 3 209 ? -12.464 -8.753  31.854  1.00 33.39 ? 394 LEU A CA    1 
ATOM   1895 C C     . LEU C 3 209 ? -12.540 -7.305  32.271  1.00 33.42 ? 394 LEU A C     1 
ATOM   1896 O O     . LEU C 3 209 ? -12.549 -6.398  31.430  1.00 32.77 ? 394 LEU A O     1 
ATOM   1897 C CB    . LEU C 3 209 ? -11.110 -9.021  31.190  1.00 34.42 ? 394 LEU A CB    1 
ATOM   1898 C CG    . LEU C 3 209 ? -10.799 -10.496 30.930  1.00 36.06 ? 394 LEU A CG    1 
ATOM   1899 C CD1   . LEU C 3 209 ? -9.711  -10.623 29.941  1.00 36.16 ? 394 LEU A CD1   1 
ATOM   1900 C CD2   . LEU C 3 209 ? -10.430 -11.172 32.242  1.00 36.83 ? 394 LEU A CD2   1 
ATOM   1901 N N     . PHE C 3 210 ? -12.628 -7.082  33.577  1.00 33.60 ? 395 PHE A N     1 
ATOM   1902 C CA    . PHE C 3 210 ? -12.727 -5.731  34.058  1.00 33.23 ? 395 PHE A CA    1 
ATOM   1903 C C     . PHE C 3 210 ? -11.726 -5.426  35.152  1.00 33.77 ? 395 PHE A C     1 
ATOM   1904 O O     . PHE C 3 210 ? -11.054 -6.317  35.675  1.00 33.56 ? 395 PHE A O     1 
ATOM   1905 C CB    . PHE C 3 210 ? -14.180 -5.361  34.421  1.00 33.17 ? 395 PHE A CB    1 
ATOM   1906 C CG    . PHE C 3 210 ? -14.766 -6.114  35.594  1.00 32.23 ? 395 PHE A CG    1 
ATOM   1907 C CD1   . PHE C 3 210 ? -14.619 -5.630  36.891  1.00 29.80 ? 395 PHE A CD1   1 
ATOM   1908 C CD2   . PHE C 3 210 ? -15.512 -7.260  35.395  1.00 31.58 ? 395 PHE A CD2   1 
ATOM   1909 C CE1   . PHE C 3 210 ? -15.183 -6.290  37.973  1.00 31.23 ? 395 PHE A CE1   1 
ATOM   1910 C CE2   . PHE C 3 210 ? -16.085 -7.941  36.481  1.00 32.68 ? 395 PHE A CE2   1 
ATOM   1911 C CZ    . PHE C 3 210 ? -15.930 -7.446  37.775  1.00 31.23 ? 395 PHE A CZ    1 
ATOM   1912 N N     . ASN C 3 211 ? -11.616 -4.147  35.470  1.00 34.31 ? 396 ASN A N     1 
ATOM   1913 C CA    . ASN C 3 211 ? -10.572 -3.671  36.335  1.00 34.96 ? 396 ASN A CA    1 
ATOM   1914 C C     . ASN C 3 211 ? -11.131 -2.569  37.202  1.00 35.80 ? 396 ASN A C     1 
ATOM   1915 O O     . ASN C 3 211 ? -11.648 -1.563  36.693  1.00 35.12 ? 396 ASN A O     1 
ATOM   1916 C CB    . ASN C 3 211 ? -9.360  -3.199  35.507  1.00 34.40 ? 396 ASN A CB    1 
ATOM   1917 C CG    . ASN C 3 211 ? -8.265  -2.585  36.360  1.00 34.05 ? 396 ASN A CG    1 
ATOM   1918 O OD1   . ASN C 3 211 ? -7.290  -3.245  36.678  1.00 36.85 ? 396 ASN A OD1   1 
ATOM   1919 N ND2   . ASN C 3 211 ? -8.417  -1.319  36.726  1.00 32.24 ? 396 ASN A ND2   1 
ATOM   1920 N N     . ARG C 3 212 ? -11.052 -2.815  38.510  1.00 37.29 ? 397 ARG A N     1 
ATOM   1921 C CA    . ARG C 3 212 ? -11.406 -1.875  39.565  1.00 39.26 ? 397 ARG A CA    1 
ATOM   1922 C C     . ARG C 3 212 ? -10.151 -1.174  39.991  1.00 40.52 ? 397 ARG A C     1 
ATOM   1923 O O     . ARG C 3 212 ? -9.062  -1.729  39.915  1.00 41.30 ? 397 ARG A O     1 
ATOM   1924 C CB    . ARG C 3 212 ? -11.926 -2.613  40.807  1.00 39.11 ? 397 ARG A CB    1 
ATOM   1925 C CG    . ARG C 3 212 ? -13.050 -3.622  40.578  1.00 40.22 ? 397 ARG A CG    1 
ATOM   1926 C CD    . ARG C 3 212 ? -14.436 -3.019  40.793  1.00 38.39 ? 397 ARG A CD    1 
ATOM   1927 N NE    . ARG C 3 212 ? -15.432 -4.073  40.960  1.00 36.95 ? 397 ARG A NE    1 
ATOM   1928 C CZ    . ARG C 3 212 ? -16.639 -4.063  40.405  1.00 38.18 ? 397 ARG A CZ    1 
ATOM   1929 N NH1   . ARG C 3 212 ? -17.010 -3.053  39.616  1.00 38.95 ? 397 ARG A NH1   1 
ATOM   1930 N NH2   . ARG C 3 212 ? -17.472 -5.075  40.624  1.00 37.07 ? 397 ARG A NH2   1 
ATOM   1931 N N     . LEU C 3 213 ? -10.317 0.024   40.517  1.00 42.21 ? 398 LEU A N     1 
ATOM   1932 C CA    . LEU C 3 213 ? -9.208  0.824   40.996  1.00 43.67 ? 398 LEU A CA    1 
ATOM   1933 C C     . LEU C 3 213 ? -9.475  1.191   42.456  1.00 44.45 ? 398 LEU A C     1 
ATOM   1934 O O     . LEU C 3 213 ? -10.468 1.852   42.756  1.00 44.78 ? 398 LEU A O     1 
ATOM   1935 C CB    . LEU C 3 213 ? -9.104  2.064   40.115  1.00 44.05 ? 398 LEU A CB    1 
ATOM   1936 C CG    . LEU C 3 213 ? -10.404 2.304   39.323  1.00 44.39 ? 398 LEU A CG    1 
ATOM   1937 C CD1   . LEU C 3 213 ? -11.493 3.025   40.146  1.00 43.61 ? 398 LEU A CD1   1 
ATOM   1938 C CD2   . LEU C 3 213 ? -10.080 3.043   38.033  1.00 46.05 ? 398 LEU A CD2   1 
ATOM   1939 N N     . ARG C 3 214 ? -8.587  0.759   43.354  1.00 45.35 ? 399 ARG A N     1 
ATOM   1940 C CA    . ARG C 3 214 ? -8.846  0.747   44.819  1.00 45.98 ? 399 ARG A CA    1 
ATOM   1941 C C     . ARG C 3 214 ? -10.338 0.598   45.185  1.00 46.19 ? 399 ARG A C     1 
ATOM   1942 O O     . ARG C 3 214 ? -10.820 1.246   46.125  1.00 46.13 ? 399 ARG A O     1 
ATOM   1943 C CB    . ARG C 3 214 ? -8.232  1.963   45.547  1.00 46.01 ? 399 ARG A CB    1 
ATOM   1944 C CG    . ARG C 3 214 ? -6.738  2.202   45.322  1.00 46.71 ? 399 ARG A CG    1 
ATOM   1945 C CD    . ARG C 3 214 ? -6.481  3.527   44.590  1.00 47.51 ? 399 ARG A CD    1 
ATOM   1946 N NE    . ARG C 3 214 ? -6.257  4.635   45.521  1.00 48.35 ? 399 ARG A NE    1 
ATOM   1947 C CZ    . ARG C 3 214 ? -5.060  5.001   45.982  1.00 49.19 ? 399 ARG A CZ    1 
ATOM   1948 N NH1   . ARG C 3 214 ? -3.962  4.349   45.597  1.00 49.49 ? 399 ARG A NH1   1 
ATOM   1949 N NH2   . ARG C 3 214 ? -4.955  6.023   46.828  1.00 48.39 ? 399 ARG A NH2   1 
ATOM   1950 N N     . SER C 3 215 ? -11.054 -0.258  44.437  1.00 46.83 ? 400 SER A N     1 
ATOM   1951 C CA    . SER C 3 215 ? -12.507 -0.461  44.598  1.00 46.61 ? 400 SER A CA    1 
ATOM   1952 C C     . SER C 3 215 ? -13.213 0.878   44.848  1.00 46.87 ? 400 SER A C     1 
ATOM   1953 O O     . SER C 3 215 ? -14.249 0.932   45.533  1.00 46.76 ? 400 SER A O     1 
ATOM   1954 C CB    . SER C 3 215 ? -12.795 -1.461  45.738  1.00 47.09 ? 400 SER A CB    1 
ATOM   1955 O OG    . SER C 3 215 ? -12.131 -1.121  46.959  1.00 44.60 ? 400 SER A OG    1 
ATOM   1956 N N     . GLN C 3 216 ? -12.622 1.948   44.295  1.00 46.52 ? 401 GLN A N     1 
ATOM   1957 C CA    . GLN C 3 216 ? -13.013 3.328   44.570  1.00 46.18 ? 401 GLN A CA    1 
ATOM   1958 C C     . GLN C 3 216 ? -12.110 4.380   43.931  1.00 45.92 ? 401 GLN A C     1 
ATOM   1959 O O     . GLN C 3 216 ? -10.959 4.568   44.343  1.00 45.97 ? 401 GLN A O     1 
ATOM   1960 C CB    . GLN C 3 216 ? -13.087 3.594   46.087  1.00 46.26 ? 401 GLN A CB    1 
ATOM   1961 C CG    . GLN C 3 216 ? -13.785 4.889   46.472  1.00 46.43 ? 401 GLN A CG    1 
ATOM   1962 C CD    . GLN C 3 216 ? -15.206 4.995   45.924  1.00 48.10 ? 401 GLN A CD    1 
ATOM   1963 O OE1   . GLN C 3 216 ? -15.412 5.091   44.713  1.00 49.09 ? 401 GLN A OE1   1 
ATOM   1964 N NE2   . GLN C 3 216 ? -16.193 4.993   46.820  1.00 49.10 ? 401 GLN A NE2   1 
ATOM   1965 N N     . THR C 3 217 ? -12.639 5.005   42.883  1.00 45.66 ? 402 THR A N     1 
ATOM   1966 C CA    . THR C 3 217 ? -12.421 6.426   42.551  1.00 45.53 ? 402 THR A CA    1 
ATOM   1967 C C     . THR C 3 217 ? -13.833 6.816   42.122  1.00 45.28 ? 402 THR A C     1 
ATOM   1968 O O     . THR C 3 217 ? -14.375 7.869   42.483  1.00 45.62 ? 402 THR A O     1 
ATOM   1969 C CB    . THR C 3 217 ? -11.388 6.715   41.384  1.00 45.53 ? 402 THR A CB    1 
ATOM   1970 O OG1   . THR C 3 217 ? -11.967 6.417   40.104  1.00 45.20 ? 402 THR A OG1   1 
ATOM   1971 C CG2   . THR C 3 217 ? -10.046 5.967   41.559  1.00 45.36 ? 402 THR A CG2   1 
ATOM   1972 N N     . VAL C 3 218 ? -14.388 5.896   41.340  1.00 44.85 ? 403 VAL A N     1 
ATOM   1973 C CA    . VAL C 3 218 ? -15.778 5.774   40.908  1.00 44.10 ? 403 VAL A CA    1 
ATOM   1974 C C     . VAL C 3 218 ? -15.666 4.558   39.986  1.00 43.54 ? 403 VAL A C     1 
ATOM   1975 O O     . VAL C 3 218 ? -16.470 3.603   40.030  1.00 43.34 ? 403 VAL A O     1 
ATOM   1976 C CB    . VAL C 3 218 ? -16.303 7.036   40.126  1.00 44.35 ? 403 VAL A CB    1 
ATOM   1977 C CG1   . VAL C 3 218 ? -15.265 7.580   39.105  1.00 44.00 ? 403 VAL A CG1   1 
ATOM   1978 C CG2   . VAL C 3 218 ? -17.656 6.758   39.458  1.00 44.41 ? 403 VAL A CG2   1 
ATOM   1979 N N     . SER C 3 219 ? -14.562 4.571   39.243  1.00 42.31 ? 404 SER A N     1 
ATOM   1980 C CA    . SER C 3 219 ? -14.465 3.913   37.978  1.00 41.32 ? 404 SER A CA    1 
ATOM   1981 C C     . SER C 3 219 ? -14.282 2.395   38.022  1.00 40.47 ? 404 SER A C     1 
ATOM   1982 O O     . SER C 3 219 ? -13.915 1.782   39.029  1.00 40.84 ? 404 SER A O     1 
ATOM   1983 C CB    . SER C 3 219 ? -13.386 4.589   37.125  1.00 41.66 ? 404 SER A CB    1 
ATOM   1984 O OG    . SER C 3 219 ? -13.782 5.908   36.752  1.00 41.81 ? 404 SER A OG    1 
ATOM   1985 N N     . THR C 3 220 ? -14.613 1.810   36.890  1.00 38.49 ? 405 THR A N     1 
ATOM   1986 C CA    . THR C 3 220 ? -14.357 0.447   36.600  1.00 36.65 ? 405 THR A CA    1 
ATOM   1987 C C     . THR C 3 220 ? -14.109 0.613   35.129  1.00 35.79 ? 405 THR A C     1 
ATOM   1988 O O     . THR C 3 220 ? -14.648 1.534   34.529  1.00 35.25 ? 405 THR A O     1 
ATOM   1989 C CB    . THR C 3 220 ? -15.598 -0.403  36.889  1.00 36.27 ? 405 THR A CB    1 
ATOM   1990 O OG1   . THR C 3 220 ? -15.837 -0.394  38.305  1.00 36.17 ? 405 THR A OG1   1 
ATOM   1991 C CG2   . THR C 3 220 ? -15.399 -1.824  36.427  1.00 34.86 ? 405 THR A CG2   1 
ATOM   1992 N N     . ARG C 3 221 ? -13.240 -0.217  34.567  1.00 35.13 ? 406 ARG A N     1 
ATOM   1993 C CA    . ARG C 3 221 ? -12.999 -0.192  33.142  1.00 35.04 ? 406 ARG A CA    1 
ATOM   1994 C C     . ARG C 3 221 ? -13.024 -1.603  32.595  1.00 34.86 ? 406 ARG A C     1 
ATOM   1995 O O     . ARG C 3 221 ? -12.811 -2.560  33.336  1.00 34.87 ? 406 ARG A O     1 
ATOM   1996 C CB    . ARG C 3 221 ? -11.688 0.506   32.826  1.00 34.97 ? 406 ARG A CB    1 
ATOM   1997 C CG    . ARG C 3 221 ? -11.785 2.000   32.930  1.00 36.00 ? 406 ARG A CG    1 
ATOM   1998 C CD    . ARG C 3 221 ? -10.536 2.648   32.401  1.00 38.55 ? 406 ARG A CD    1 
ATOM   1999 N NE    . ARG C 3 221 ? -10.619 4.108   32.434  1.00 39.65 ? 406 ARG A NE    1 
ATOM   2000 C CZ    . ARG C 3 221 ? -11.024 4.866   31.418  1.00 40.33 ? 406 ARG A CZ    1 
ATOM   2001 N NH1   . ARG C 3 221 ? -11.408 4.312   30.269  1.00 39.98 ? 406 ARG A NH1   1 
ATOM   2002 N NH2   . ARG C 3 221 ? -11.044 6.187   31.553  1.00 40.61 ? 406 ARG A NH2   1 
ATOM   2003 N N     . TYR C 3 222 ? -13.302 -1.732  31.303  1.00 34.61 ? 407 TYR A N     1 
ATOM   2004 C CA    . TYR C 3 222 ? -13.529 -3.039  30.714  1.00 34.95 ? 407 TYR A CA    1 
ATOM   2005 C C     . TYR C 3 222 ? -12.670 -3.273  29.489  1.00 34.94 ? 407 TYR A C     1 
ATOM   2006 O O     . TYR C 3 222 ? -12.507 -2.383  28.651  1.00 35.02 ? 407 TYR A O     1 
ATOM   2007 C CB    . TYR C 3 222 ? -15.006 -3.189  30.334  1.00 35.43 ? 407 TYR A CB    1 
ATOM   2008 C CG    . TYR C 3 222 ? -15.956 -2.691  31.403  1.00 36.16 ? 407 TYR A CG    1 
ATOM   2009 C CD1   . TYR C 3 222 ? -16.465 -1.389  31.352  1.00 36.28 ? 407 TYR A CD1   1 
ATOM   2010 C CD2   . TYR C 3 222 ? -16.325 -3.506  32.477  1.00 33.31 ? 407 TYR A CD2   1 
ATOM   2011 C CE1   . TYR C 3 222 ? -17.326 -0.910  32.344  1.00 35.65 ? 407 TYR A CE1   1 
ATOM   2012 C CE2   . TYR C 3 222 ? -17.181 -3.037  33.456  1.00 34.46 ? 407 TYR A CE2   1 
ATOM   2013 C CZ    . TYR C 3 222 ? -17.677 -1.736  33.380  1.00 35.26 ? 407 TYR A CZ    1 
ATOM   2014 O OH    . TYR C 3 222 ? -18.537 -1.261  34.345  1.00 37.77 ? 407 TYR A OH    1 
ATOM   2015 N N     . LEU C 3 223 ? -12.143 -4.483  29.372  1.00 34.98 ? 408 LEU A N     1 
ATOM   2016 C CA    . LEU C 3 223 ? -11.455 -4.864  28.160  1.00 35.47 ? 408 LEU A CA    1 
ATOM   2017 C C     . LEU C 3 223 ? -12.423 -4.819  26.974  1.00 35.58 ? 408 LEU A C     1 
ATOM   2018 O O     . LEU C 3 223 ? -13.516 -5.399  27.025  1.00 35.77 ? 408 LEU A O     1 
ATOM   2019 C CB    . LEU C 3 223 ? -10.796 -6.240  28.302  1.00 35.50 ? 408 LEU A CB    1 
ATOM   2020 C CG    . LEU C 3 223 ? -9.797  -6.514  27.163  1.00 35.34 ? 408 LEU A CG    1 
ATOM   2021 C CD1   . LEU C 3 223 ? -8.677  -5.516  27.233  1.00 34.72 ? 408 LEU A CD1   1 
ATOM   2022 C CD2   . LEU C 3 223 ? -9.257  -7.927  27.236  1.00 34.73 ? 408 LEU A CD2   1 
ATOM   2023 N N     . HIS C 3 224 ? -12.015 -4.111  25.924  1.00 35.71 ? 409 HIS A N     1 
ATOM   2024 C CA    . HIS C 3 224 ? -12.867 -3.844  24.770  1.00 36.24 ? 409 HIS A CA    1 
ATOM   2025 C C     . HIS C 3 224 ? -12.000 -3.503  23.566  1.00 36.74 ? 409 HIS A C     1 
ATOM   2026 O O     . HIS C 3 224 ? -11.090 -2.676  23.680  1.00 37.28 ? 409 HIS A O     1 
ATOM   2027 C CB    . HIS C 3 224 ? -13.816 -2.676  25.094  1.00 36.09 ? 409 HIS A CB    1 
ATOM   2028 C CG    . HIS C 3 224 ? -14.752 -2.310  23.982  1.00 35.66 ? 409 HIS A CG    1 
ATOM   2029 N ND1   . HIS C 3 224 ? -14.887 -1.016  23.524  1.00 35.77 ? 409 HIS A ND1   1 
ATOM   2030 C CD2   . HIS C 3 224 ? -15.607 -3.059  23.245  1.00 34.64 ? 409 HIS A CD2   1 
ATOM   2031 C CE1   . HIS C 3 224 ? -15.775 -0.984  22.547  1.00 33.81 ? 409 HIS A CE1   1 
ATOM   2032 N NE2   . HIS C 3 224 ? -16.229 -2.210  22.361  1.00 34.65 ? 409 HIS A NE2   1 
ATOM   2033 N N     . VAL C 3 225 ? -12.253 -4.152  22.427  1.00 37.09 ? 410 VAL A N     1 
ATOM   2034 C CA    . VAL C 3 225 ? -11.597 -3.759  21.181  1.00 36.98 ? 410 VAL A CA    1 
ATOM   2035 C C     . VAL C 3 225 ? -12.416 -2.760  20.368  1.00 37.51 ? 410 VAL A C     1 
ATOM   2036 O O     . VAL C 3 225 ? -13.611 -2.947  20.131  1.00 37.54 ? 410 VAL A O     1 
ATOM   2037 C CB    . VAL C 3 225 ? -11.015 -4.938  20.319  1.00 37.37 ? 410 VAL A CB    1 
ATOM   2038 C CG1   . VAL C 3 225 ? -11.215 -6.284  20.966  1.00 36.87 ? 410 VAL A CG1   1 
ATOM   2039 C CG2   . VAL C 3 225 ? -11.488 -4.888  18.834  1.00 36.94 ? 410 VAL A CG2   1 
ATOM   2040 N N     . GLU C 3 226 ? -11.738 -1.697  19.961  1.00 37.87 ? 411 GLU A N     1 
ATOM   2041 C CA    . GLU C 3 226 ? -12.349 -0.572  19.307  1.00 38.52 ? 411 GLU A CA    1 
ATOM   2042 C C     . GLU C 3 226 ? -11.363 -0.077  18.243  1.00 38.66 ? 411 GLU A C     1 
ATOM   2043 O O     . GLU C 3 226 ? -10.258 0.384   18.564  1.00 38.67 ? 411 GLU A O     1 
ATOM   2044 C CB    . GLU C 3 226 ? -12.632 0.517   20.340  1.00 38.83 ? 411 GLU A CB    1 
ATOM   2045 C CG    . GLU C 3 226 ? -13.514 1.672   19.845  1.00 41.15 ? 411 GLU A CG    1 
ATOM   2046 C CD    . GLU C 3 226 ? -12.975 3.040   20.273  1.00 43.66 ? 411 GLU A CD    1 
ATOM   2047 O OE1   . GLU C 3 226 ? -12.765 3.252   21.492  1.00 44.73 ? 411 GLU A OE1   1 
ATOM   2048 O OE2   . GLU C 3 226 ? -12.756 3.899   19.382  1.00 44.50 ? 411 GLU A OE2   1 
ATOM   2049 N N     . GLY C 3 227 ? -11.753 -0.207  16.977  1.00 38.28 ? 412 GLY A N     1 
ATOM   2050 C CA    . GLY C 3 227 ? -10.890 0.184   15.880  1.00 38.43 ? 412 GLY A CA    1 
ATOM   2051 C C     . GLY C 3 227 ? -9.539  -0.499  15.931  1.00 38.34 ? 412 GLY A C     1 
ATOM   2052 O O     . GLY C 3 227 ? -8.505  0.164   16.076  1.00 38.36 ? 412 GLY A O     1 
ATOM   2053 N N     . ASN C 3 228 ? -9.557  -1.828  15.832  1.00 38.21 ? 413 ASN A N     1 
ATOM   2054 C CA    . ASN C 3 228 ? -8.344  -2.640  15.654  1.00 38.33 ? 413 ASN A CA    1 
ATOM   2055 C C     . ASN C 3 228 ? -7.406  -2.675  16.845  1.00 38.34 ? 413 ASN A C     1 
ATOM   2056 O O     . ASN C 3 228 ? -6.301  -3.207  16.732  1.00 39.19 ? 413 ASN A O     1 
ATOM   2057 C CB    . ASN C 3 228 ? -7.529  -2.193  14.425  1.00 38.26 ? 413 ASN A CB    1 
ATOM   2058 C CG    . ASN C 3 228 ? -8.353  -2.132  13.161  1.00 38.19 ? 413 ASN A CG    1 
ATOM   2059 O OD1   . ASN C 3 228 ? -9.458  -2.671  13.089  1.00 37.52 ? 413 ASN A OD1   1 
ATOM   2060 N ND2   . ASN C 3 228 ? -7.814  -1.465  12.147  1.00 39.15 ? 413 ASN A ND2   1 
ATOM   2061 N N     . ALA C 3 229 ? -7.822  -2.095  17.965  1.00 37.74 ? 414 ALA A N     1 
ATOM   2062 C CA    . ALA C 3 229 ? -6.978  -2.048  19.144  1.00 37.29 ? 414 ALA A CA    1 
ATOM   2063 C C     . ALA C 3 229 ? -7.747  -2.418  20.417  1.00 37.02 ? 414 ALA A C     1 
ATOM   2064 O O     . ALA C 3 229 ? -8.919  -2.072  20.580  1.00 36.60 ? 414 ALA A O     1 
ATOM   2065 C CB    . ALA C 3 229 ? -6.335  -0.671  19.277  1.00 37.38 ? 414 ALA A CB    1 
ATOM   2066 N N     . PHE C 3 230 ? -7.081  -3.142  21.308  1.00 36.56 ? 415 PHE A N     1 
ATOM   2067 C CA    . PHE C 3 230 ? -7.651  -3.407  22.619  1.00 36.58 ? 415 PHE A CA    1 
ATOM   2068 C C     . PHE C 3 230 ? -7.519  -2.128  23.427  1.00 36.45 ? 415 PHE A C     1 
ATOM   2069 O O     . PHE C 3 230 ? -6.459  -1.501  23.431  1.00 36.76 ? 415 PHE A O     1 
ATOM   2070 C CB    . PHE C 3 230 ? -6.917  -4.547  23.310  1.00 36.29 ? 415 PHE A CB    1 
ATOM   2071 C CG    . PHE C 3 230 ? -7.252  -5.914  22.772  1.00 35.61 ? 415 PHE A CG    1 
ATOM   2072 C CD1   . PHE C 3 230 ? -6.712  -6.361  21.563  1.00 34.84 ? 415 PHE A CD1   1 
ATOM   2073 C CD2   . PHE C 3 230 ? -8.087  -6.765  23.493  1.00 34.43 ? 415 PHE A CD2   1 
ATOM   2074 C CE1   . PHE C 3 230 ? -7.012  -7.638  21.081  1.00 34.94 ? 415 PHE A CE1   1 
ATOM   2075 C CE2   . PHE C 3 230 ? -8.389  -8.038  23.036  1.00 33.94 ? 415 PHE A CE2   1 
ATOM   2076 C CZ    . PHE C 3 230 ? -7.857  -8.481  21.824  1.00 35.61 ? 415 PHE A CZ    1 
ATOM   2077 N N     . HIS C 3 231 ? -8.605  -1.709  24.059  1.00 36.24 ? 416 HIS A N     1 
ATOM   2078 C CA    . HIS C 3 231 ? -8.518  -0.611  25.012  1.00 36.52 ? 416 HIS A CA    1 
ATOM   2079 C C     . HIS C 3 231 ? -9.288  -0.950  26.292  1.00 35.56 ? 416 HIS A C     1 
ATOM   2080 O O     . HIS C 3 231 ? -9.740  -2.085  26.446  1.00 34.86 ? 416 HIS A O     1 
ATOM   2081 C CB    . HIS C 3 231 ? -8.828  0.769   24.369  1.00 37.27 ? 416 HIS A CB    1 
ATOM   2082 C CG    . HIS C 3 231 ? -10.287 1.119   24.256  1.00 40.30 ? 416 HIS A CG    1 
ATOM   2083 N ND1   . HIS C 3 231 ? -11.246 0.236   23.801  1.00 43.39 ? 416 HIS A ND1   1 
ATOM   2084 C CD2   . HIS C 3 231 ? -10.934 2.295   24.468  1.00 42.77 ? 416 HIS A CD2   1 
ATOM   2085 C CE1   . HIS C 3 231 ? -12.425 0.843   23.771  1.00 44.27 ? 416 HIS A CE1   1 
ATOM   2086 N NE2   . HIS C 3 231 ? -12.262 2.094   24.168  1.00 43.99 ? 416 HIS A NE2   1 
ATOM   2087 N N     . ALA C 3 232 ? -9.350  -0.018  27.236  1.00 34.80 ? 417 ALA A N     1 
ATOM   2088 C CA    . ALA C 3 232 ? -10.107 -0.237  28.459  1.00 34.51 ? 417 ALA A CA    1 
ATOM   2089 C C     . ALA C 3 232 ? -11.202 0.820   28.535  1.00 34.37 ? 417 ALA A C     1 
ATOM   2090 O O     . ALA C 3 232 ? -10.945 1.994   28.819  1.00 34.45 ? 417 ALA A O     1 
ATOM   2091 C CB    . ALA C 3 232 ? -9.200  -0.211  29.693  1.00 34.33 ? 417 ALA A CB    1 
ATOM   2092 N N     . SER C 3 233 ? -12.425 0.394   28.243  1.00 33.86 ? 418 SER A N     1 
ATOM   2093 C CA    . SER C 3 233 ? -13.511 1.335   28.059  1.00 33.68 ? 418 SER A CA    1 
ATOM   2094 C C     . SER C 3 233 ? -14.249 1.546   29.360  1.00 33.50 ? 418 SER A C     1 
ATOM   2095 O O     . SER C 3 233 ? -14.301 0.650   30.209  1.00 33.97 ? 418 SER A O     1 
ATOM   2096 C CB    . SER C 3 233 ? -14.465 0.856   26.965  1.00 33.52 ? 418 SER A CB    1 
ATOM   2097 O OG    . SER C 3 233 ? -15.757 1.384   27.172  1.00 33.54 ? 418 SER A OG    1 
ATOM   2098 N N     . SER C 3 234 ? -14.816 2.735   29.509  1.00 33.08 ? 419 SER A N     1 
ATOM   2099 C CA    . SER C 3 234 ? -15.572 3.073   30.691  1.00 33.14 ? 419 SER A CA    1 
ATOM   2100 C C     . SER C 3 234 ? -17.057 2.777   30.491  1.00 32.89 ? 419 SER A C     1 
ATOM   2101 O O     . SER C 3 234 ? -17.848 2.909   31.428  1.00 32.93 ? 419 SER A O     1 
ATOM   2102 C CB    . SER C 3 234 ? -15.372 4.548   31.021  1.00 33.17 ? 419 SER A CB    1 
ATOM   2103 O OG    . SER C 3 234 ? -16.001 5.361   30.046  1.00 34.06 ? 419 SER A OG    1 
ATOM   2104 N N     . THR C 3 235 ? -17.439 2.380   29.277  1.00 32.44 ? 420 THR A N     1 
ATOM   2105 C CA    . THR C 3 235 ? -18.862 2.208   28.955  1.00 32.31 ? 420 THR A CA    1 
ATOM   2106 C C     . THR C 3 235 ? -19.211 0.890   28.269  1.00 32.32 ? 420 THR A C     1 
ATOM   2107 O O     . THR C 3 235 ? -20.329 0.389   28.419  1.00 33.08 ? 420 THR A O     1 
ATOM   2108 C CB    . THR C 3 235 ? -19.412 3.376   28.108  1.00 32.19 ? 420 THR A CB    1 
ATOM   2109 O OG1   . THR C 3 235 ? -18.569 3.584   26.969  1.00 32.00 ? 420 THR A OG1   1 
ATOM   2110 C CG2   . THR C 3 235 ? -19.475 4.669   28.931  1.00 31.71 ? 420 THR A CG2   1 
ATOM   2111 N N     . LYS C 3 236 ? -18.261 0.330   27.528  1.00 31.47 ? 421 LYS A N     1 
ATOM   2112 C CA    . LYS C 3 236 ? -18.507 -0.862  26.729  1.00 30.67 ? 421 LYS A CA    1 
ATOM   2113 C C     . LYS C 3 236 ? -17.541 -1.961  27.123  1.00 30.16 ? 421 LYS A C     1 
ATOM   2114 O O     . LYS C 3 236 ? -16.411 -1.684  27.525  1.00 30.46 ? 421 LYS A O     1 
ATOM   2115 C CB    . LYS C 3 236 ? -18.298 -0.556  25.251  1.00 30.44 ? 421 LYS A CB    1 
ATOM   2116 C CG    . LYS C 3 236 ? -19.333 0.344   24.628  1.00 31.64 ? 421 LYS A CG    1 
ATOM   2117 C CD    . LYS C 3 236 ? -19.156 0.361   23.120  1.00 31.90 ? 421 LYS A CD    1 
ATOM   2118 C CE    . LYS C 3 236 ? -20.442 0.731   22.403  1.00 34.29 ? 421 LYS A CE    1 
ATOM   2119 N NZ    . LYS C 3 236 ? -20.729 2.185   22.446  1.00 34.49 ? 421 LYS A NZ    1 
ATOM   2120 N N     . TRP C 3 237 ? -17.968 -3.205  26.970  1.00 29.19 ? 422 TRP A N     1 
ATOM   2121 C CA    . TRP C 3 237 ? -17.123 -4.326  27.301  1.00 29.67 ? 422 TRP A CA    1 
ATOM   2122 C C     . TRP C 3 237 ? -17.134 -5.396  26.250  1.00 29.76 ? 422 TRP A C     1 
ATOM   2123 O O     . TRP C 3 237 ? -18.160 -5.690  25.671  1.00 29.91 ? 422 TRP A O     1 
ATOM   2124 C CB    . TRP C 3 237 ? -17.506 -4.955  28.646  1.00 29.24 ? 422 TRP A CB    1 
ATOM   2125 C CG    . TRP C 3 237 ? -18.975 -5.221  28.846  1.00 29.58 ? 422 TRP A CG    1 
ATOM   2126 C CD1   . TRP C 3 237 ? -19.920 -4.320  29.244  1.00 28.21 ? 422 TRP A CD1   1 
ATOM   2127 C CD2   . TRP C 3 237 ? -19.653 -6.483  28.719  1.00 29.32 ? 422 TRP A CD2   1 
ATOM   2128 N NE1   . TRP C 3 237 ? -21.135 -4.936  29.351  1.00 28.88 ? 422 TRP A NE1   1 
ATOM   2129 C CE2   . TRP C 3 237 ? -21.001 -6.261  29.037  1.00 28.29 ? 422 TRP A CE2   1 
ATOM   2130 C CE3   . TRP C 3 237 ? -19.252 -7.772  28.347  1.00 29.79 ? 422 TRP A CE3   1 
ATOM   2131 C CZ2   . TRP C 3 237 ? -21.953 -7.280  29.012  1.00 28.90 ? 422 TRP A CZ2   1 
ATOM   2132 C CZ3   . TRP C 3 237 ? -20.198 -8.781  28.311  1.00 28.89 ? 422 TRP A CZ3   1 
ATOM   2133 C CH2   . TRP C 3 237 ? -21.531 -8.532  28.649  1.00 28.99 ? 422 TRP A CH2   1 
ATOM   2134 N N     . GLY C 3 238 ? -15.990 -6.025  26.042  1.00 29.84 ? 423 GLY A N     1 
ATOM   2135 C CA    . GLY C 3 238 ? -15.940 -7.087  25.068  1.00 30.37 ? 423 GLY A CA    1 
ATOM   2136 C C     . GLY C 3 238 ? -16.263 -8.427  25.665  1.00 30.60 ? 423 GLY A C     1 
ATOM   2137 O O     . GLY C 3 238 ? -15.862 -8.734  26.799  1.00 30.87 ? 423 GLY A O     1 
ATOM   2138 N N     . ALA C 3 239 ? -17.008 -9.216  24.902  1.00 30.81 ? 424 ALA A N     1 
ATOM   2139 C CA    . ALA C 3 239 ? -17.131 -10.638 25.159  1.00 31.24 ? 424 ALA A CA    1 
ATOM   2140 C C     . ALA C 3 239 ? -15.997 -11.324 24.410  1.00 31.47 ? 424 ALA A C     1 
ATOM   2141 O O     . ALA C 3 239 ? -16.042 -11.394 23.183  1.00 31.73 ? 424 ALA A O     1 
ATOM   2142 C CB    . ALA C 3 239 ? -18.480 -11.154 24.650  1.00 30.16 ? 424 ALA A CB    1 
ATOM   2143 N N     . PHE C 3 240 ? -15.006 -11.854 25.125  1.00 31.90 ? 425 PHE A N     1 
ATOM   2144 C CA    . PHE C 3 240 ? -13.859 -12.514 24.444  1.00 32.51 ? 425 PHE A CA    1 
ATOM   2145 C C     . PHE C 3 240 ? -13.916 -14.014 24.562  1.00 32.89 ? 425 PHE A C     1 
ATOM   2146 O O     . PHE C 3 240 ? -14.302 -14.551 25.605  1.00 34.41 ? 425 PHE A O     1 
ATOM   2147 C CB    . PHE C 3 240 ? -12.516 -12.017 25.002  1.00 32.28 ? 425 PHE A CB    1 
ATOM   2148 C CG    . PHE C 3 240 ? -12.371 -10.534 24.962  1.00 31.48 ? 425 PHE A CG    1 
ATOM   2149 C CD1   . PHE C 3 240 ? -12.753 -9.764  26.049  1.00 31.52 ? 425 PHE A CD1   1 
ATOM   2150 C CD2   . PHE C 3 240 ? -11.888 -9.903  23.822  1.00 31.60 ? 425 PHE A CD2   1 
ATOM   2151 C CE1   . PHE C 3 240 ? -12.660 -8.373  26.007  1.00 32.18 ? 425 PHE A CE1   1 
ATOM   2152 C CE2   . PHE C 3 240 ? -11.792 -8.516  23.762  1.00 31.63 ? 425 PHE A CE2   1 
ATOM   2153 C CZ    . PHE C 3 240 ? -12.181 -7.747  24.855  1.00 32.45 ? 425 PHE A CZ    1 
ATOM   2154 N N     . THR C 3 241 ? -13.517 -14.697 23.509  1.00 32.65 ? 426 THR A N     1 
ATOM   2155 C CA    . THR C 3 241 ? -13.376 -16.129 23.573  1.00 32.77 ? 426 THR A CA    1 
ATOM   2156 C C     . THR C 3 241 ? -12.011 -16.458 24.208  1.00 33.16 ? 426 THR A C     1 
ATOM   2157 O O     . THR C 3 241 ? -10.968 -16.030 23.728  1.00 32.45 ? 426 THR A O     1 
ATOM   2158 C CB    . THR C 3 241 ? -13.496 -16.746 22.185  1.00 32.61 ? 426 THR A CB    1 
ATOM   2159 O OG1   . THR C 3 241 ? -14.604 -16.151 21.495  1.00 33.58 ? 426 THR A OG1   1 
ATOM   2160 C CG2   . THR C 3 241 ? -13.715 -18.245 22.286  1.00 32.53 ? 426 THR A CG2   1 
ATOM   2161 N N     . ILE C 3 242 ? -12.029 -17.196 25.311  1.00 33.67 ? 427 ILE A N     1 
ATOM   2162 C CA    . ILE C 3 242 ? -10.785 -17.586 25.948  1.00 34.06 ? 427 ILE A CA    1 
ATOM   2163 C C     . ILE C 3 242 ? -10.425 -18.985 25.504  1.00 34.77 ? 427 ILE A C     1 
ATOM   2164 O O     . ILE C 3 242 ? -11.243 -19.914 25.621  1.00 35.03 ? 427 ILE A O     1 
ATOM   2165 C CB    . ILE C 3 242 ? -10.833 -17.463 27.501  1.00 34.32 ? 427 ILE A CB    1 
ATOM   2166 C CG1   . ILE C 3 242 ? -9.422  -17.660 28.086  1.00 34.33 ? 427 ILE A CG1   1 
ATOM   2167 C CG2   . ILE C 3 242 ? -11.878 -18.400 28.110  1.00 33.16 ? 427 ILE A CG2   1 
ATOM   2168 C CD1   . ILE C 3 242 ? -9.273  -17.234 29.552  1.00 33.71 ? 427 ILE A CD1   1 
ATOM   2169 N N     . HIS C 3 243 ? -9.208  -19.115 24.968  1.00 34.72 ? 428 HIS A N     1 
ATOM   2170 C CA    . HIS C 3 243 ? -8.707  -20.377 24.448  1.00 35.05 ? 428 HIS A CA    1 
ATOM   2171 C C     . HIS C 3 243 ? -7.519  -20.881 25.244  1.00 35.26 ? 428 HIS A C     1 
ATOM   2172 O O     . HIS C 3 243 ? -6.620  -20.118 25.581  1.00 35.49 ? 428 HIS A O     1 
ATOM   2173 C CB    . HIS C 3 243 ? -8.256  -20.225 22.983  1.00 35.18 ? 428 HIS A CB    1 
ATOM   2174 C CG    . HIS C 3 243 ? -9.378  -20.067 22.004  1.00 34.80 ? 428 HIS A CG    1 
ATOM   2175 N ND1   . HIS C 3 243 ? -10.260 -21.084 21.708  1.00 34.70 ? 428 HIS A ND1   1 
ATOM   2176 C CD2   . HIS C 3 243 ? -9.737  -19.019 21.224  1.00 34.65 ? 428 HIS A CD2   1 
ATOM   2177 C CE1   . HIS C 3 243 ? -11.123 -20.665 20.798  1.00 34.60 ? 428 HIS A CE1   1 
ATOM   2178 N NE2   . HIS C 3 243 ? -10.824 -19.417 20.483  1.00 34.22 ? 428 HIS A NE2   1 
ATOM   2179 N N     . LEU C 3 244 ? -7.513  -22.178 25.521  1.00 35.66 ? 429 LEU A N     1 
ATOM   2180 C CA    . LEU C 3 244 ? -6.314  -22.862 25.976  1.00 36.10 ? 429 LEU A CA    1 
ATOM   2181 C C     . LEU C 3 244 ? -5.375  -23.131 24.800  1.00 36.71 ? 429 LEU A C     1 
ATOM   2182 O O     . LEU C 3 244 ? -5.607  -24.042 23.991  1.00 36.59 ? 429 LEU A O     1 
ATOM   2183 C CB    . LEU C 3 244 ? -6.685  -24.171 26.679  1.00 36.15 ? 429 LEU A CB    1 
ATOM   2184 C CG    . LEU C 3 244 ? -6.465  -24.365 28.186  1.00 35.99 ? 429 LEU A CG    1 
ATOM   2185 C CD1   . LEU C 3 244 ? -6.395  -23.062 28.970  1.00 35.47 ? 429 LEU A CD1   1 
ATOM   2186 C CD2   . LEU C 3 244 ? -7.550  -25.274 28.734  1.00 36.67 ? 429 LEU A CD2   1 
ATOM   2187 N N     . PHE C 3 245 ? -4.318  -22.320 24.718  1.00 37.41 ? 430 PHE A N     1 
ATOM   2188 C CA    . PHE C 3 245 ? -3.269  -22.427 23.688  1.00 37.59 ? 430 PHE A CA    1 
ATOM   2189 C C     . PHE C 3 245 ? -2.538  -23.764 23.796  1.00 37.93 ? 430 PHE A C     1 
ATOM   2190 O O     . PHE C 3 245 ? -2.281  -24.239 24.904  1.00 37.90 ? 430 PHE A O     1 
ATOM   2191 C CB    . PHE C 3 245 ? -2.286  -21.257 23.854  1.00 37.50 ? 430 PHE A CB    1 
ATOM   2192 C CG    . PHE C 3 245 ? -1.168  -21.232 22.845  1.00 38.06 ? 430 PHE A CG    1 
ATOM   2193 C CD1   . PHE C 3 245 ? -1.358  -20.670 21.586  1.00 37.91 ? 430 PHE A CD1   1 
ATOM   2194 C CD2   . PHE C 3 245 ? 0.087   -21.751 23.166  1.00 38.34 ? 430 PHE A CD2   1 
ATOM   2195 C CE1   . PHE C 3 245 ? -0.322  -20.639 20.655  1.00 39.04 ? 430 PHE A CE1   1 
ATOM   2196 C CE2   . PHE C 3 245 ? 1.129   -21.729 22.242  1.00 38.81 ? 430 PHE A CE2   1 
ATOM   2197 C CZ    . PHE C 3 245 ? 0.925   -21.173 20.980  1.00 38.79 ? 430 PHE A CZ    1 
ATOM   2198 N N     . ASP C 3 246 ? -2.206  -24.364 22.654  1.00 38.32 ? 431 ASP A N     1 
ATOM   2199 C CA    . ASP C 3 246 ? -1.525  -25.663 22.643  1.00 39.03 ? 431 ASP A CA    1 
ATOM   2200 C C     . ASP C 3 246 ? -0.024  -25.605 22.249  1.00 39.33 ? 431 ASP A C     1 
ATOM   2201 O O     . ASP C 3 246 ? 0.735   -24.848 22.854  1.00 39.45 ? 431 ASP A O     1 
ATOM   2202 C CB    . ASP C 3 246 ? -2.301  -26.676 21.794  1.00 39.18 ? 431 ASP A CB    1 
ATOM   2203 C CG    . ASP C 3 246 ? -1.940  -28.109 22.131  1.00 39.68 ? 431 ASP A CG    1 
ATOM   2204 O OD1   . ASP C 3 246 ? -2.393  -28.622 23.177  1.00 40.41 ? 431 ASP A OD1   1 
ATOM   2205 O OD2   . ASP C 3 246 ? -1.194  -28.724 21.352  1.00 39.56 ? 431 ASP A OD2   1 
ATOM   2206 N N     . ASP C 3 247 ? 0.388   -26.397 21.255  1.00 39.53 ? 432 ASP A N     1 
ATOM   2207 C CA    . ASP C 3 247 ? 1.815   -26.631 20.931  1.00 40.15 ? 432 ASP A CA    1 
ATOM   2208 C C     . ASP C 3 247 ? 2.110   -26.847 19.439  1.00 40.24 ? 432 ASP A C     1 
ATOM   2209 O O     . ASP C 3 247 ? 1.242   -27.284 18.680  1.00 40.02 ? 432 ASP A O     1 
ATOM   2210 C CB    . ASP C 3 247 ? 2.333   -27.878 21.665  1.00 40.28 ? 432 ASP A CB    1 
ATOM   2211 C CG    . ASP C 3 247 ? 2.870   -27.580 23.056  1.00 40.71 ? 432 ASP A CG    1 
ATOM   2212 O OD1   . ASP C 3 247 ? 2.732   -26.439 23.551  1.00 40.45 ? 432 ASP A OD1   1 
ATOM   2213 O OD2   . ASP C 3 247 ? 3.440   -28.514 23.659  1.00 41.31 ? 432 ASP A OD2   1 
ATOM   2214 N N     . GLU C 3 248 ? 3.353   -26.563 19.044  1.00 40.49 ? 433 GLU A N     1 
ATOM   2215 C CA    . GLU C 3 248 ? 3.871   -26.892 17.708  1.00 40.77 ? 433 GLU A CA    1 
ATOM   2216 C C     . GLU C 3 248 ? 5.390   -26.813 17.643  1.00 40.71 ? 433 GLU A C     1 
ATOM   2217 O O     . GLU C 3 248 ? 6.016   -27.502 16.837  1.00 40.62 ? 433 GLU A O     1 
ATOM   2218 C CB    . GLU C 3 248 ? 3.239   -26.021 16.614  1.00 40.92 ? 433 GLU A CB    1 
ATOM   2219 C CG    . GLU C 3 248 ? 2.442   -26.827 15.585  1.00 41.50 ? 433 GLU A CG    1 
ATOM   2220 C CD    . GLU C 3 248 ? 1.081   -26.225 15.263  1.00 41.78 ? 433 GLU A CD    1 
ATOM   2221 O OE1   . GLU C 3 248 ? 0.896   -25.730 14.131  1.00 42.71 ? 433 GLU A OE1   1 
ATOM   2222 O OE2   . GLU C 3 248 ? 0.192   -26.256 16.138  1.00 41.49 ? 433 GLU A OE2   1 
ATOM   2223 N N     . GLN C 3 252 ? 7.508   -19.313 18.110  1.00 57.27 ? 437 GLN A N     1 
ATOM   2224 C CA    . GLN C 3 252 ? 6.211   -19.745 18.607  1.00 57.34 ? 437 GLN A CA    1 
ATOM   2225 C C     . GLN C 3 252 ? 5.195   -18.593 18.615  1.00 57.50 ? 437 GLN A C     1 
ATOM   2226 O O     . GLN C 3 252 ? 5.159   -17.776 19.545  1.00 57.54 ? 437 GLN A O     1 
ATOM   2227 C CB    . GLN C 3 252 ? 6.362   -20.392 19.987  1.00 57.36 ? 437 GLN A CB    1 
ATOM   2228 C CG    . GLN C 3 252 ? 6.689   -21.881 19.931  1.00 56.88 ? 437 GLN A CG    1 
ATOM   2229 C CD    . GLN C 3 252 ? 5.454   -22.737 19.697  1.00 56.57 ? 437 GLN A CD    1 
ATOM   2230 O OE1   . GLN C 3 252 ? 4.468   -22.642 20.433  1.00 56.81 ? 437 GLN A OE1   1 
ATOM   2231 N NE2   . GLN C 3 252 ? 5.502   -23.581 18.674  1.00 56.31 ? 437 GLN A NE2   1 
ATOM   2232 N N     . GLU C 3 253 ? 4.363   -18.566 17.570  1.00 57.59 ? 438 GLU A N     1 
ATOM   2233 C CA    . GLU C 3 253 ? 3.513   -17.418 17.207  1.00 57.50 ? 438 GLU A CA    1 
ATOM   2234 C C     . GLU C 3 253 ? 2.874   -17.712 15.822  1.00 57.15 ? 438 GLU A C     1 
ATOM   2235 O O     . GLU C 3 253 ? 3.347   -18.620 15.127  1.00 57.30 ? 438 GLU A O     1 
ATOM   2236 C CB    . GLU C 3 253 ? 4.389   -16.146 17.155  1.00 57.81 ? 438 GLU A CB    1 
ATOM   2237 C CG    . GLU C 3 253 ? 5.113   -15.848 15.815  1.00 58.25 ? 438 GLU A CG    1 
ATOM   2238 C CD    . GLU C 3 253 ? 6.189   -16.865 15.423  1.00 59.50 ? 438 GLU A CD    1 
ATOM   2239 O OE1   . GLU C 3 253 ? 6.254   -17.226 14.226  1.00 58.51 ? 438 GLU A OE1   1 
ATOM   2240 O OE2   . GLU C 3 253 ? 6.977   -17.290 16.298  1.00 60.76 ? 438 GLU A OE2   1 
ATOM   2241 N N     . THR C 3 254 ? 1.831   -16.998 15.377  1.00 56.25 ? 439 THR A N     1 
ATOM   2242 C CA    . THR C 3 254 ? 1.046   -16.011 16.105  1.00 55.44 ? 439 THR A CA    1 
ATOM   2243 C C     . THR C 3 254 ? -0.368  -16.138 15.571  1.00 54.79 ? 439 THR A C     1 
ATOM   2244 O O     . THR C 3 254 ? -1.224  -16.744 16.212  1.00 54.94 ? 439 THR A O     1 
ATOM   2245 C CB    . THR C 3 254 ? 1.483   -14.545 15.836  1.00 55.56 ? 439 THR A CB    1 
ATOM   2246 O OG1   . THR C 3 254 ? 2.301   -14.479 14.664  1.00 55.15 ? 439 THR A OG1   1 
ATOM   2247 C CG2   . THR C 3 254 ? 2.223   -13.952 17.027  1.00 55.78 ? 439 THR A CG2   1 
ATOM   2248 N N     . ASP C 3 255 ? -0.591  -15.581 14.378  1.00 53.73 ? 440 ASP A N     1 
ATOM   2249 C CA    . ASP C 3 255 ? -1.928  -15.442 13.792  1.00 52.85 ? 440 ASP A CA    1 
ATOM   2250 C C     . ASP C 3 255 ? -2.726  -16.737 13.750  1.00 52.17 ? 440 ASP A C     1 
ATOM   2251 O O     . ASP C 3 255 ? -3.930  -16.724 13.977  1.00 52.10 ? 440 ASP A O     1 
ATOM   2252 C CB    . ASP C 3 255 ? -1.861  -14.820 12.388  1.00 53.01 ? 440 ASP A CB    1 
ATOM   2253 C CG    . ASP C 3 255 ? -1.716  -13.302 12.416  1.00 53.12 ? 440 ASP A CG    1 
ATOM   2254 O OD1   . ASP C 3 255 ? -1.466  -12.732 13.503  1.00 52.93 ? 440 ASP A OD1   1 
ATOM   2255 O OD2   . ASP C 3 255 ? -1.847  -12.676 11.340  1.00 53.33 ? 440 ASP A OD2   1 
ATOM   2256 N N     . ASN C 3 256 ? -2.055  -17.849 13.467  1.00 51.36 ? 441 ASN A N     1 
ATOM   2257 C CA    . ASN C 3 256 ? -2.725  -19.138 13.389  1.00 50.64 ? 441 ASN A CA    1 
ATOM   2258 C C     . ASN C 3 256 ? -2.181  -20.096 14.441  1.00 49.97 ? 441 ASN A C     1 
ATOM   2259 O O     . ASN C 3 256 ? -1.001  -20.446 14.414  1.00 50.00 ? 441 ASN A O     1 
ATOM   2260 C CB    . ASN C 3 256 ? -2.578  -19.726 11.985  1.00 50.83 ? 441 ASN A CB    1 
ATOM   2261 C CG    . ASN C 3 256 ? -3.777  -20.558 11.568  1.00 51.13 ? 441 ASN A CG    1 
ATOM   2262 O OD1   . ASN C 3 256 ? -3.711  -21.785 11.535  1.00 52.21 ? 441 ASN A OD1   1 
ATOM   2263 N ND2   . ASN C 3 256 ? -4.878  -19.893 11.240  1.00 50.95 ? 441 ASN A ND2   1 
ATOM   2264 N N     . PHE C 3 257 ? -3.045  -20.515 15.365  1.00 49.01 ? 442 PHE A N     1 
ATOM   2265 C CA    . PHE C 3 257 ? -2.614  -21.304 16.526  1.00 48.08 ? 442 PHE A CA    1 
ATOM   2266 C C     . PHE C 3 257 ? -3.528  -22.482 16.860  1.00 47.37 ? 442 PHE A C     1 
ATOM   2267 O O     . PHE C 3 257 ? -4.701  -22.492 16.488  1.00 47.23 ? 442 PHE A O     1 
ATOM   2268 C CB    . PHE C 3 257 ? -2.431  -20.400 17.760  1.00 48.03 ? 442 PHE A CB    1 
ATOM   2269 C CG    . PHE C 3 257 ? -3.662  -19.610 18.140  1.00 48.02 ? 442 PHE A CG    1 
ATOM   2270 C CD1   . PHE C 3 257 ? -3.935  -18.382 17.536  1.00 47.85 ? 442 PHE A CD1   1 
ATOM   2271 C CD2   . PHE C 3 257 ? -4.535  -20.081 19.121  1.00 48.22 ? 442 PHE A CD2   1 
ATOM   2272 C CE1   . PHE C 3 257 ? -5.068  -17.647 17.889  1.00 47.84 ? 442 PHE A CE1   1 
ATOM   2273 C CE2   . PHE C 3 257 ? -5.674  -19.354 19.482  1.00 47.62 ? 442 PHE A CE2   1 
ATOM   2274 C CZ    . PHE C 3 257 ? -5.940  -18.134 18.867  1.00 47.43 ? 442 PHE A CZ    1 
ATOM   2275 N N     . ALA C 3 258 ? -2.968  -23.466 17.566  1.00 46.50 ? 443 ALA A N     1 
ATOM   2276 C CA    . ALA C 3 258 ? -3.710  -24.644 18.013  1.00 45.70 ? 443 ALA A CA    1 
ATOM   2277 C C     . ALA C 3 258 ? -4.235  -24.478 19.441  1.00 45.14 ? 443 ALA A C     1 
ATOM   2278 O O     . ALA C 3 258 ? -3.573  -23.878 20.291  1.00 44.84 ? 443 ALA A O     1 
ATOM   2279 C CB    . ALA C 3 258 ? -2.847  -25.891 17.908  1.00 45.44 ? 443 ALA A CB    1 
ATOM   2280 N N     . VAL C 3 259 ? -5.427  -25.025 19.683  1.00 44.66 ? 444 VAL A N     1 
ATOM   2281 C CA    . VAL C 3 259 ? -6.088  -24.961 20.985  1.00 44.26 ? 444 VAL A CA    1 
ATOM   2282 C C     . VAL C 3 259 ? -6.526  -26.344 21.487  1.00 44.12 ? 444 VAL A C     1 
ATOM   2283 O O     . VAL C 3 259 ? -6.889  -27.209 20.688  1.00 44.35 ? 444 VAL A O     1 
ATOM   2284 C CB    . VAL C 3 259 ? -7.317  -23.993 20.971  1.00 44.33 ? 444 VAL A CB    1 
ATOM   2285 C CG1   . VAL C 3 259 ? -6.929  -22.627 20.415  1.00 44.02 ? 444 VAL A CG1   1 
ATOM   2286 C CG2   . VAL C 3 259 ? -8.494  -24.580 20.190  1.00 43.72 ? 444 VAL A CG2   1 
ATOM   2287 N N     . ARG C 3 260 ? -6.477  -26.543 22.806  1.00 43.86 ? 445 ARG A N     1 
ATOM   2288 C CA    . ARG C 3 260 ? -7.020  -27.746 23.450  1.00 43.52 ? 445 ARG A CA    1 
ATOM   2289 C C     . ARG C 3 260 ? -8.377  -27.443 24.055  1.00 42.93 ? 445 ARG A C     1 
ATOM   2290 O O     . ARG C 3 260 ? -8.719  -26.282 24.298  1.00 42.70 ? 445 ARG A O     1 
ATOM   2291 C CB    . ARG C 3 260 ? -6.134  -28.249 24.603  1.00 43.81 ? 445 ARG A CB    1 
ATOM   2292 C CG    . ARG C 3 260 ? -4.660  -27.985 24.500  1.00 45.32 ? 445 ARG A CG    1 
ATOM   2293 C CD    . ARG C 3 260 ? -4.221  -26.843 25.405  1.00 48.30 ? 445 ARG A CD    1 
ATOM   2294 N NE    . ARG C 3 260 ? -4.125  -27.231 26.814  1.00 50.35 ? 445 ARG A NE    1 
ATOM   2295 C CZ    . ARG C 3 260 ? -3.613  -26.465 27.780  1.00 51.31 ? 445 ARG A CZ    1 
ATOM   2296 N NH1   . ARG C 3 260 ? -3.130  -25.253 27.509  1.00 51.72 ? 445 ARG A NH1   1 
ATOM   2297 N NH2   . ARG C 3 260 ? -3.583  -26.911 29.029  1.00 51.52 ? 445 ARG A NH2   1 
ATOM   2298 N N     . ASP C 3 261 ? -9.129  -28.506 24.326  1.00 42.34 ? 446 ASP A N     1 
ATOM   2299 C CA    . ASP C 3 261 ? -10.318 -28.422 25.164  1.00 41.64 ? 446 ASP A CA    1 
ATOM   2300 C C     . ASP C 3 261 ? -9.942  -28.549 26.635  1.00 41.19 ? 446 ASP A C     1 
ATOM   2301 O O     . ASP C 3 261 ? -8.805  -28.919 26.961  1.00 41.19 ? 446 ASP A O     1 
ATOM   2302 C CB    . ASP C 3 261 ? -11.320 -29.506 24.779  1.00 41.76 ? 446 ASP A CB    1 
ATOM   2303 C CG    . ASP C 3 261 ? -12.041 -29.193 23.485  1.00 42.22 ? 446 ASP A CG    1 
ATOM   2304 O OD1   . ASP C 3 261 ? -12.148 -27.991 23.148  1.00 42.10 ? 446 ASP A OD1   1 
ATOM   2305 O OD2   . ASP C 3 261 ? -12.494 -30.147 22.805  1.00 43.00 ? 446 ASP A OD2   1 
ATOM   2306 N N     . GLY C 3 262 ? -10.890 -28.220 27.515  1.00 40.37 ? 447 GLY A N     1 
ATOM   2307 C CA    . GLY C 3 262 ? -10.708 -28.386 28.955  1.00 39.49 ? 447 GLY A CA    1 
ATOM   2308 C C     . GLY C 3 262 ? -10.985 -27.116 29.732  1.00 39.17 ? 447 GLY A C     1 
ATOM   2309 O O     . GLY C 3 262 ? -11.160 -26.040 29.148  1.00 39.07 ? 447 GLY A O     1 
ATOM   2310 N N     . PHE C 3 263 ? -11.041 -27.234 31.056  1.00 38.69 ? 448 PHE A N     1 
ATOM   2311 C CA    . PHE C 3 263 ? -11.240 -26.059 31.898  1.00 38.27 ? 448 PHE A CA    1 
ATOM   2312 C C     . PHE C 3 263 ? -9.940  -25.295 32.055  1.00 37.93 ? 448 PHE A C     1 
ATOM   2313 O O     . PHE C 3 263 ? -8.862  -25.881 32.039  1.00 38.08 ? 448 PHE A O     1 
ATOM   2314 C CB    . PHE C 3 263 ? -11.860 -26.439 33.250  1.00 38.37 ? 448 PHE A CB    1 
ATOM   2315 C CG    . PHE C 3 263 ? -13.281 -26.938 33.140  1.00 38.29 ? 448 PHE A CG    1 
ATOM   2316 C CD1   . PHE C 3 263 ? -13.580 -28.278 33.353  1.00 38.21 ? 448 PHE A CD1   1 
ATOM   2317 C CD2   . PHE C 3 263 ? -14.319 -26.065 32.789  1.00 38.56 ? 448 PHE A CD2   1 
ATOM   2318 C CE1   . PHE C 3 263 ? -14.895 -28.748 33.231  1.00 37.76 ? 448 PHE A CE1   1 
ATOM   2319 C CE2   . PHE C 3 263 ? -15.637 -26.518 32.664  1.00 37.38 ? 448 PHE A CE2   1 
ATOM   2320 C CZ    . PHE C 3 263 ? -15.923 -27.868 32.886  1.00 38.03 ? 448 PHE A CZ    1 
ATOM   2321 N N     . VAL C 3 264 ? -10.043 -23.979 32.164  1.00 37.71 ? 449 VAL A N     1 
ATOM   2322 C CA    . VAL C 3 264 ? -8.866  -23.138 32.353  1.00 37.50 ? 449 VAL A CA    1 
ATOM   2323 C C     . VAL C 3 264 ? -8.407  -23.134 33.823  1.00 37.81 ? 449 VAL A C     1 
ATOM   2324 O O     . VAL C 3 264 ? -9.195  -22.855 34.727  1.00 37.47 ? 449 VAL A O     1 
ATOM   2325 C CB    . VAL C 3 264 ? -9.119  -21.693 31.873  1.00 37.31 ? 449 VAL A CB    1 
ATOM   2326 C CG1   . VAL C 3 264 ? -7.838  -20.873 31.921  1.00 36.23 ? 449 VAL A CG1   1 
ATOM   2327 C CG2   . VAL C 3 264 ? -9.712  -21.688 30.470  1.00 36.57 ? 449 VAL A CG2   1 
ATOM   2328 N N     . TYR C 3 265 ? -7.122  -23.439 34.029  1.00 38.43 ? 450 TYR A N     1 
ATOM   2329 C CA    . TYR C 3 265 ? -6.472  -23.426 35.342  1.00 38.45 ? 450 TYR A CA    1 
ATOM   2330 C C     . TYR C 3 265 ? -5.436  -22.337 35.405  1.00 38.28 ? 450 TYR A C     1 
ATOM   2331 O O     . TYR C 3 265 ? -4.902  -21.921 34.376  1.00 38.77 ? 450 TYR A O     1 
ATOM   2332 C CB    . TYR C 3 265 ? -5.790  -24.764 35.616  1.00 38.78 ? 450 TYR A CB    1 
ATOM   2333 C CG    . TYR C 3 265 ? -6.763  -25.887 35.858  1.00 40.00 ? 450 TYR A CG    1 
ATOM   2334 C CD1   . TYR C 3 265 ? -7.333  -26.580 34.792  1.00 40.25 ? 450 TYR A CD1   1 
ATOM   2335 C CD2   . TYR C 3 265 ? -7.134  -26.249 37.162  1.00 41.49 ? 450 TYR A CD2   1 
ATOM   2336 C CE1   . TYR C 3 265 ? -8.245  -27.619 35.012  1.00 41.35 ? 450 TYR A CE1   1 
ATOM   2337 C CE2   . TYR C 3 265 ? -8.050  -27.289 37.397  1.00 41.07 ? 450 TYR A CE2   1 
ATOM   2338 C CZ    . TYR C 3 265 ? -8.601  -27.964 36.313  1.00 41.20 ? 450 TYR A CZ    1 
ATOM   2339 O OH    . TYR C 3 265 ? -9.503  -28.988 36.518  1.00 41.26 ? 450 TYR A OH    1 
ATOM   2340 N N     . TYR C 3 266 ? -5.141  -21.879 36.616  1.00 37.84 ? 451 TYR A N     1 
ATOM   2341 C CA    . TYR C 3 266 ? -4.071  -20.929 36.819  1.00 37.26 ? 451 TYR A CA    1 
ATOM   2342 C C     . TYR C 3 266 ? -2.749  -21.561 36.369  1.00 37.49 ? 451 TYR A C     1 
ATOM   2343 O O     . TYR C 3 266 ? -2.515  -22.760 36.574  1.00 36.70 ? 451 TYR A O     1 
ATOM   2344 C CB    . TYR C 3 266 ? -4.046  -20.459 38.285  1.00 38.02 ? 451 TYR A CB    1 
ATOM   2345 C CG    . TYR C 3 266 ? -5.211  -19.538 38.558  1.00 37.71 ? 451 TYR A CG    1 
ATOM   2346 C CD1   . TYR C 3 266 ? -6.313  -19.966 39.275  1.00 37.86 ? 451 TYR A CD1   1 
ATOM   2347 C CD2   . TYR C 3 266 ? -5.244  -18.269 37.993  1.00 38.13 ? 451 TYR A CD2   1 
ATOM   2348 C CE1   . TYR C 3 266 ? -7.397  -19.120 39.467  1.00 38.46 ? 451 TYR A CE1   1 
ATOM   2349 C CE2   . TYR C 3 266 ? -6.304  -17.436 38.167  1.00 36.91 ? 451 TYR A CE2   1 
ATOM   2350 C CZ    . TYR C 3 266 ? -7.372  -17.863 38.896  1.00 37.51 ? 451 TYR A CZ    1 
ATOM   2351 O OH    . TYR C 3 266 ? -8.411  -17.009 39.047  1.00 39.19 ? 451 TYR A OH    1 
ATOM   2352 N N     . GLY C 3 267 ? -1.918  -20.763 35.706  1.00 37.19 ? 452 GLY A N     1 
ATOM   2353 C CA    . GLY C 3 267 ? -0.684  -21.276 35.141  1.00 37.60 ? 452 GLY A CA    1 
ATOM   2354 C C     . GLY C 3 267 ? -0.780  -21.700 33.688  1.00 37.47 ? 452 GLY A C     1 
ATOM   2355 O O     . GLY C 3 267 ? 0.234   -21.901 33.059  1.00 37.49 ? 452 GLY A O     1 
ATOM   2356 N N     . SER C 3 268 ? -1.994  -21.837 33.156  1.00 37.72 ? 453 SER A N     1 
ATOM   2357 C CA    . SER C 3 268 ? -2.202  -22.227 31.746  1.00 37.65 ? 453 SER A CA    1 
ATOM   2358 C C     . SER C 3 268 ? -1.900  -21.076 30.786  1.00 37.13 ? 453 SER A C     1 
ATOM   2359 O O     . SER C 3 268 ? -2.158  -19.909 31.096  1.00 36.82 ? 453 SER A O     1 
ATOM   2360 C CB    . SER C 3 268 ? -3.658  -22.634 31.510  1.00 37.67 ? 453 SER A CB    1 
ATOM   2361 O OG    . SER C 3 268 ? -4.080  -23.687 32.360  1.00 39.98 ? 453 SER A OG    1 
ATOM   2362 N N     . VAL C 3 269 ? -1.403  -21.413 29.603  1.00 36.82 ? 454 VAL A N     1 
ATOM   2363 C CA    . VAL C 3 269 ? -1.258  -20.428 28.535  1.00 36.57 ? 454 VAL A CA    1 
ATOM   2364 C C     . VAL C 3 269 ? -2.580  -20.278 27.792  1.00 36.65 ? 454 VAL A C     1 
ATOM   2365 O O     . VAL C 3 269 ? -3.161  -21.250 27.322  1.00 36.99 ? 454 VAL A O     1 
ATOM   2366 C CB    . VAL C 3 269 ? -0.133  -20.780 27.544  1.00 36.54 ? 454 VAL A CB    1 
ATOM   2367 C CG1   . VAL C 3 269 ? 0.079   -19.638 26.594  1.00 35.87 ? 454 VAL A CG1   1 
ATOM   2368 C CG2   . VAL C 3 269 ? 1.152   -21.096 28.286  1.00 35.94 ? 454 VAL A CG2   1 
ATOM   2369 N N     . VAL C 3 270 ? -3.023  -19.037 27.667  1.00 36.67 ? 455 VAL A N     1 
ATOM   2370 C CA    . VAL C 3 270 ? -4.357  -18.727 27.217  1.00 36.86 ? 455 VAL A CA    1 
ATOM   2371 C C     . VAL C 3 270 ? -4.332  -17.705 26.092  1.00 36.80 ? 455 VAL A C     1 
ATOM   2372 O O     . VAL C 3 270 ? -3.426  -16.864 26.025  1.00 36.70 ? 455 VAL A O     1 
ATOM   2373 C CB    . VAL C 3 270 ? -5.183  -18.204 28.405  1.00 36.85 ? 455 VAL A CB    1 
ATOM   2374 C CG1   . VAL C 3 270 ? -5.864  -16.903 28.070  1.00 37.39 ? 455 VAL A CG1   1 
ATOM   2375 C CG2   . VAL C 3 270 ? -6.150  -19.257 28.876  1.00 37.29 ? 455 VAL A CG2   1 
ATOM   2376 N N     . LYS C 3 271 ? -5.324  -17.802 25.208  1.00 36.48 ? 456 LYS A N     1 
ATOM   2377 C CA    . LYS C 3 271 ? -5.521  -16.833 24.142  1.00 36.23 ? 456 LYS A CA    1 
ATOM   2378 C C     . LYS C 3 271 ? -6.875  -16.142 24.244  1.00 36.02 ? 456 LYS A C     1 
ATOM   2379 O O     . LYS C 3 271 ? -7.920  -16.786 24.345  1.00 35.86 ? 456 LYS A O     1 
ATOM   2380 C CB    . LYS C 3 271 ? -5.372  -17.502 22.786  1.00 36.46 ? 456 LYS A CB    1 
ATOM   2381 C CG    . LYS C 3 271 ? -3.967  -17.431 22.224  1.00 36.97 ? 456 LYS A CG    1 
ATOM   2382 C CD    . LYS C 3 271 ? -3.878  -16.318 21.206  1.00 37.43 ? 456 LYS A CD    1 
ATOM   2383 C CE    . LYS C 3 271 ? -2.453  -15.953 20.940  1.00 37.55 ? 456 LYS A CE    1 
ATOM   2384 N NZ    . LYS C 3 271 ? -2.324  -15.238 19.654  1.00 39.63 ? 456 LYS A NZ    1 
ATOM   2385 N N     . LEU C 3 272 ? -6.838  -14.819 24.227  1.00 35.72 ? 457 LEU A N     1 
ATOM   2386 C CA    . LEU C 3 272 ? -8.039  -14.011 24.271  1.00 35.48 ? 457 LEU A CA    1 
ATOM   2387 C C     . LEU C 3 272 ? -8.351  -13.479 22.884  1.00 35.87 ? 457 LEU A C     1 
ATOM   2388 O O     . LEU C 3 272 ? -7.508  -12.819 22.270  1.00 36.15 ? 457 LEU A O     1 
ATOM   2389 C CB    . LEU C 3 272 ? -7.852  -12.881 25.281  1.00 34.91 ? 457 LEU A CB    1 
ATOM   2390 C CG    . LEU C 3 272 ? -7.974  -13.406 26.724  1.00 34.85 ? 457 LEU A CG    1 
ATOM   2391 C CD1   . LEU C 3 272 ? -7.335  -12.440 27.726  1.00 33.66 ? 457 LEU A CD1   1 
ATOM   2392 C CD2   . LEU C 3 272 ? -9.442  -13.701 27.087  1.00 31.71 ? 457 LEU A CD2   1 
ATOM   2393 N N     . VAL C 3 273 ? -9.549  -13.791 22.392  1.00 36.19 ? 458 VAL A N     1 
ATOM   2394 C CA    . VAL C 3 273 ? -9.966  -13.477 21.029  1.00 36.56 ? 458 VAL A CA    1 
ATOM   2395 C C     . VAL C 3 273 ? -11.311 -12.754 20.996  1.00 37.71 ? 458 VAL A C     1 
ATOM   2396 O O     . VAL C 3 273 ? -12.315 -13.254 21.522  1.00 37.63 ? 458 VAL A O     1 
ATOM   2397 C CB    . VAL C 3 273 ? -10.106 -14.763 20.187  1.00 36.65 ? 458 VAL A CB    1 
ATOM   2398 C CG1   . VAL C 3 273 ? -10.365 -14.436 18.699  1.00 34.94 ? 458 VAL A CG1   1 
ATOM   2399 C CG2   . VAL C 3 273 ? -8.878  -15.656 20.351  1.00 37.39 ? 458 VAL A CG2   1 
ATOM   2400 N N     . ASP C 3 274 ? -11.336 -11.592 20.348  1.00 38.94 ? 459 ASP A N     1 
ATOM   2401 C CA    . ASP C 3 274 ? -12.560 -10.809 20.223  1.00 40.33 ? 459 ASP A CA    1 
ATOM   2402 C C     . ASP C 3 274 ? -13.624 -11.542 19.408  1.00 41.03 ? 459 ASP A C     1 
ATOM   2403 O O     . ASP C 3 274 ? -13.325 -12.085 18.331  1.00 40.87 ? 459 ASP A O     1 
ATOM   2404 C CB    . ASP C 3 274 ? -12.272 -9.441  19.596  1.00 40.51 ? 459 ASP A CB    1 
ATOM   2405 C CG    . ASP C 3 274 ? -13.440 -8.461  19.749  1.00 41.59 ? 459 ASP A CG    1 
ATOM   2406 O OD1   . ASP C 3 274 ? -13.861 -7.871  18.725  1.00 42.11 ? 459 ASP A OD1   1 
ATOM   2407 O OD2   . ASP C 3 274 ? -13.932 -8.280  20.898  1.00 42.82 ? 459 ASP A OD2   1 
ATOM   2408 N N     . SER C 3 275 ? -14.854 -11.567 19.943  1.00 41.86 ? 460 SER A N     1 
ATOM   2409 C CA    . SER C 3 275 ? -16.028 -12.083 19.214  1.00 42.63 ? 460 SER A CA    1 
ATOM   2410 C C     . SER C 3 275 ? -16.163 -11.373 17.884  1.00 42.60 ? 460 SER A C     1 
ATOM   2411 O O     . SER C 3 275 ? -16.026 -11.979 16.822  1.00 43.11 ? 460 SER A O     1 
ATOM   2412 C CB    . SER C 3 275 ? -17.324 -11.872 20.021  1.00 42.74 ? 460 SER A CB    1 
ATOM   2413 O OG    . SER C 3 275 ? -17.268 -12.504 21.287  1.00 42.90 ? 460 SER A OG    1 
ATOM   2414 N N     . VAL C 3 276 ? -16.386 -10.065 17.977  1.00 42.82 ? 461 VAL A N     1 
ATOM   2415 C CA    . VAL C 3 276 ? -16.771 -9.206  16.852  1.00 42.77 ? 461 VAL A CA    1 
ATOM   2416 C C     . VAL C 3 276 ? -15.720 -9.138  15.750  1.00 42.43 ? 461 VAL A C     1 
ATOM   2417 O O     . VAL C 3 276 ? -15.998 -9.490  14.604  1.00 42.29 ? 461 VAL A O     1 
ATOM   2418 C CB    . VAL C 3 276 ? -17.039 -7.750  17.339  1.00 43.07 ? 461 VAL A CB    1 
ATOM   2419 C CG1   . VAL C 3 276 ? -18.035 -7.048  16.426  1.00 43.07 ? 461 VAL A CG1   1 
ATOM   2420 C CG2   . VAL C 3 276 ? -17.503 -7.720  18.829  1.00 43.46 ? 461 VAL A CG2   1 
ATOM   2421 N N     . THR C 3 277 ? -14.515 -8.688  16.109  1.00 41.93 ? 462 THR A N     1 
ATOM   2422 C CA    . THR C 3 277 ? -13.490 -8.338  15.118  1.00 41.38 ? 462 THR A CA    1 
ATOM   2423 C C     . THR C 3 277 ? -12.586 -9.495  14.709  1.00 40.93 ? 462 THR A C     1 
ATOM   2424 O O     . THR C 3 277 ? -12.050 -9.499  13.610  1.00 40.63 ? 462 THR A O     1 
ATOM   2425 C CB    . THR C 3 277 ? -12.595 -7.168  15.601  1.00 41.28 ? 462 THR A CB    1 
ATOM   2426 O OG1   . THR C 3 277 ? -12.026 -7.491  16.875  1.00 41.76 ? 462 THR A OG1   1 
ATOM   2427 C CG2   . THR C 3 277 ? -13.394 -5.876  15.719  1.00 41.10 ? 462 THR A CG2   1 
ATOM   2428 N N     . GLY C 3 278 ? -12.411 -10.469 15.597  1.00 40.78 ? 463 GLY A N     1 
ATOM   2429 C CA    . GLY C 3 278 ? -11.415 -11.527 15.378  1.00 40.42 ? 463 GLY A CA    1 
ATOM   2430 C C     . GLY C 3 278 ? -9.991  -11.167 15.812  1.00 39.90 ? 463 GLY A C     1 
ATOM   2431 O O     . GLY C 3 278 ? -9.055  -11.921 15.545  1.00 39.80 ? 463 GLY A O     1 
ATOM   2432 N N     . ILE C 3 279 ? -9.836  -10.025 16.487  1.00 39.25 ? 464 ILE A N     1 
ATOM   2433 C CA    . ILE C 3 279 ? -8.531  -9.524  16.948  1.00 38.83 ? 464 ILE A CA    1 
ATOM   2434 C C     . ILE C 3 279 ? -8.132  -10.253 18.231  1.00 38.26 ? 464 ILE A C     1 
ATOM   2435 O O     . ILE C 3 279 ? -8.962  -10.406 19.126  1.00 38.50 ? 464 ILE A O     1 
ATOM   2436 C CB    . ILE C 3 279 ? -8.576  -7.975  17.200  1.00 38.76 ? 464 ILE A CB    1 
ATOM   2437 C CG1   . ILE C 3 279 ? -9.028  -7.208  15.943  1.00 38.98 ? 464 ILE A CG1   1 
ATOM   2438 C CG2   . ILE C 3 279 ? -7.239  -7.438  17.688  1.00 38.81 ? 464 ILE A CG2   1 
ATOM   2439 C CD1   . ILE C 3 279 ? -8.137  -7.335  14.746  1.00 38.09 ? 464 ILE A CD1   1 
ATOM   2440 N N     . ALA C 3 280 ? -6.881  -10.709 18.324  1.00 37.52 ? 465 ALA A N     1 
ATOM   2441 C CA    . ALA C 3 280 ? -6.417  -11.419 19.531  1.00 37.07 ? 465 ALA A CA    1 
ATOM   2442 C C     . ALA C 3 280 ? -5.251  -10.756 20.249  1.00 36.76 ? 465 ALA A C     1 
ATOM   2443 O O     . ALA C 3 280 ? -4.401  -10.145 19.624  1.00 37.17 ? 465 ALA A O     1 
ATOM   2444 C CB    . ALA C 3 280 ? -6.075  -12.868 19.218  1.00 36.78 ? 465 ALA A CB    1 
ATOM   2445 N N     . LEU C 3 281 ? -5.233  -10.871 21.573  1.00 36.89 ? 466 LEU A N     1 
ATOM   2446 C CA    . LEU C 3 281 ? -4.078  -10.475 22.377  1.00 36.48 ? 466 LEU A CA    1 
ATOM   2447 C C     . LEU C 3 281 ? -2.941  -11.489 22.186  1.00 36.40 ? 466 LEU A C     1 
ATOM   2448 O O     . LEU C 3 281 ? -3.174  -12.583 21.656  1.00 36.29 ? 466 LEU A O     1 
ATOM   2449 C CB    . LEU C 3 281 ? -4.474  -10.379 23.849  1.00 36.07 ? 466 LEU A CB    1 
ATOM   2450 C CG    . LEU C 3 281 ? -5.189  -9.091  24.275  1.00 35.80 ? 466 LEU A CG    1 
ATOM   2451 C CD1   . LEU C 3 281 ? -5.685  -9.204  25.722  1.00 32.85 ? 466 LEU A CD1   1 
ATOM   2452 C CD2   . LEU C 3 281 ? -4.314  -7.837  24.085  1.00 33.64 ? 466 LEU A CD2   1 
ATOM   2453 N N     . PRO C 3 282 ? -1.704  -11.134 22.584  1.00 36.38 ? 467 PRO A N     1 
ATOM   2454 C CA    . PRO C 3 282 ? -0.670  -12.172 22.487  1.00 36.57 ? 467 PRO A CA    1 
ATOM   2455 C C     . PRO C 3 282 ? -0.972  -13.304 23.458  1.00 36.44 ? 467 PRO A C     1 
ATOM   2456 O O     . PRO C 3 282 ? -1.742  -13.111 24.395  1.00 36.79 ? 467 PRO A O     1 
ATOM   2457 C CB    . PRO C 3 282 ? 0.621   -11.443 22.892  1.00 36.35 ? 467 PRO A CB    1 
ATOM   2458 C CG    . PRO C 3 282 ? 0.186   -10.258 23.652  1.00 36.40 ? 467 PRO A CG    1 
ATOM   2459 C CD    . PRO C 3 282 ? -1.164  -9.864  23.098  1.00 36.52 ? 467 PRO A CD    1 
ATOM   2460 N N     . ARG C 3 283 ? -0.388  -14.474 23.233  1.00 36.31 ? 468 ARG A N     1 
ATOM   2461 C CA    . ARG C 3 283 ? -0.591  -15.583 24.151  1.00 36.45 ? 468 ARG A CA    1 
ATOM   2462 C C     . ARG C 3 283 ? -0.119  -15.169 25.559  1.00 36.12 ? 468 ARG A C     1 
ATOM   2463 O O     . ARG C 3 283 ? 0.917   -14.521 25.702  1.00 36.16 ? 468 ARG A O     1 
ATOM   2464 C CB    . ARG C 3 283 ? 0.057   -16.886 23.627  1.00 36.74 ? 468 ARG A CB    1 
ATOM   2465 C CG    . ARG C 3 283 ? 1.568   -16.971 23.672  1.00 37.52 ? 468 ARG A CG    1 
ATOM   2466 C CD    . ARG C 3 283 ? 2.224   -17.118 22.303  1.00 40.67 ? 468 ARG A CD    1 
ATOM   2467 N NE    . ARG C 3 283 ? 3.686   -17.122 22.441  1.00 41.88 ? 468 ARG A NE    1 
ATOM   2468 C CZ    . ARG C 3 283 ? 4.435   -18.210 22.629  1.00 43.17 ? 468 ARG A CZ    1 
ATOM   2469 N NH1   . ARG C 3 283 ? 3.888   -19.418 22.680  1.00 43.27 ? 468 ARG A NH1   1 
ATOM   2470 N NH2   . ARG C 3 283 ? 5.750   -18.092 22.749  1.00 45.14 ? 468 ARG A NH2   1 
ATOM   2471 N N     . LEU C 3 284 ? -0.915  -15.489 26.578  1.00 35.70 ? 469 LEU A N     1 
ATOM   2472 C CA    . LEU C 3 284 ? -0.670  -15.018 27.949  1.00 35.18 ? 469 LEU A CA    1 
ATOM   2473 C C     . LEU C 3 284 ? -0.833  -16.153 28.947  1.00 35.34 ? 469 LEU A C     1 
ATOM   2474 O O     . LEU C 3 284 ? -1.542  -17.120 28.675  1.00 35.54 ? 469 LEU A O     1 
ATOM   2475 C CB    . LEU C 3 284 ? -1.640  -13.890 28.306  1.00 34.61 ? 469 LEU A CB    1 
ATOM   2476 C CG    . LEU C 3 284 ? -1.460  -12.560 27.566  1.00 34.16 ? 469 LEU A CG    1 
ATOM   2477 C CD1   . LEU C 3 284 ? -2.702  -11.720 27.632  1.00 32.52 ? 469 LEU A CD1   1 
ATOM   2478 C CD2   . LEU C 3 284 ? -0.251  -11.773 28.081  1.00 33.41 ? 469 LEU A CD2   1 
ATOM   2479 N N     . ARG C 3 285 ? -0.188  -16.039 30.107  1.00 35.25 ? 470 ARG A N     1 
ATOM   2480 C CA    . ARG C 3 285 ? -0.379  -17.030 31.150  1.00 35.38 ? 470 ARG A CA    1 
ATOM   2481 C C     . ARG C 3 285 ? -1.227  -16.424 32.257  1.00 35.55 ? 470 ARG A C     1 
ATOM   2482 O O     . ARG C 3 285 ? -0.923  -15.323 32.734  1.00 36.25 ? 470 ARG A O     1 
ATOM   2483 C CB    . ARG C 3 285 ? 0.953   -17.536 31.686  1.00 35.22 ? 470 ARG A CB    1 
ATOM   2484 C CG    . ARG C 3 285 ? 0.857   -18.831 32.490  1.00 35.22 ? 470 ARG A CG    1 
ATOM   2485 C CD    . ARG C 3 285 ? 2.244   -19.295 32.997  1.00 36.17 ? 470 ARG A CD    1 
ATOM   2486 N NE    . ARG C 3 285 ? 3.054   -19.967 31.974  1.00 37.26 ? 470 ARG A NE    1 
ATOM   2487 C CZ    . ARG C 3 285 ? 3.982   -19.361 31.229  1.00 40.58 ? 470 ARG A CZ    1 
ATOM   2488 N NH1   . ARG C 3 285 ? 4.217   -18.055 31.382  1.00 41.80 ? 470 ARG A NH1   1 
ATOM   2489 N NH2   . ARG C 3 285 ? 4.686   -20.054 30.329  1.00 39.20 ? 470 ARG A NH2   1 
ATOM   2490 N N     . ILE C 3 286 ? -2.292  -17.129 32.646  1.00 34.75 ? 471 ILE A N     1 
ATOM   2491 C CA    . ILE C 3 286 ? -3.216  -16.623 33.648  1.00 34.79 ? 471 ILE A CA    1 
ATOM   2492 C C     . ILE C 3 286 ? -2.729  -16.968 35.065  1.00 35.40 ? 471 ILE A C     1 
ATOM   2493 O O     . ILE C 3 286 ? -2.322  -18.115 35.350  1.00 35.79 ? 471 ILE A O     1 
ATOM   2494 C CB    . ILE C 3 286 ? -4.715  -17.039 33.365  1.00 34.57 ? 471 ILE A CB    1 
ATOM   2495 C CG1   . ILE C 3 286 ? -5.705  -16.231 34.230  1.00 34.40 ? 471 ILE A CG1   1 
ATOM   2496 C CG2   . ILE C 3 286 ? -4.932  -18.558 33.497  1.00 32.88 ? 471 ILE A CG2   1 
ATOM   2497 C CD1   . ILE C 3 286 ? -7.205  -16.283 33.721  1.00 35.23 ? 471 ILE A CD1   1 
ATOM   2498 N N     . ARG C 3 287 ? -2.719  -15.956 35.931  1.00 35.25 ? 472 ARG A N     1 
ATOM   2499 C CA    . ARG C 3 287 ? -2.255  -16.127 37.306  1.00 35.97 ? 472 ARG A CA    1 
ATOM   2500 C C     . ARG C 3 287 ? -3.282  -15.543 38.268  1.00 36.98 ? 472 ARG A C     1 
ATOM   2501 O O     . ARG C 3 287 ? -3.945  -14.547 37.944  1.00 37.00 ? 472 ARG A O     1 
ATOM   2502 C CB    . ARG C 3 287 ? -0.908  -15.426 37.535  1.00 35.07 ? 472 ARG A CB    1 
ATOM   2503 C CG    . ARG C 3 287 ? 0.222   -15.807 36.568  1.00 34.70 ? 472 ARG A CG    1 
ATOM   2504 C CD    . ARG C 3 287 ? 0.817   -17.169 36.893  1.00 33.11 ? 472 ARG A CD    1 
ATOM   2505 N NE    . ARG C 3 287 ? 2.144   -17.324 36.288  1.00 34.36 ? 472 ARG A NE    1 
ATOM   2506 C CZ    . ARG C 3 287 ? 2.951   -18.371 36.473  1.00 33.34 ? 472 ARG A CZ    1 
ATOM   2507 N NH1   . ARG C 3 287 ? 2.587   -19.377 37.257  1.00 33.04 ? 472 ARG A NH1   1 
ATOM   2508 N NH2   . ARG C 3 287 ? 4.126   -18.415 35.865  1.00 32.25 ? 472 ARG A NH2   1 
ATOM   2509 N N     . LYS C 3 288 ? -3.405  -16.157 39.446  1.00 37.45 ? 473 LYS A N     1 
ATOM   2510 C CA    . LYS C 3 288 ? -4.327  -15.679 40.443  1.00 38.35 ? 473 LYS A CA    1 
ATOM   2511 C C     . LYS C 3 288 ? -3.701  -14.454 41.064  1.00 38.75 ? 473 LYS A C     1 
ATOM   2512 O O     . LYS C 3 288 ? -2.476  -14.368 41.167  1.00 38.97 ? 473 LYS A O     1 
ATOM   2513 C CB    . LYS C 3 288 ? -4.571  -16.757 41.510  1.00 38.97 ? 473 LYS A CB    1 
ATOM   2514 C CG    . LYS C 3 288 ? -5.674  -16.419 42.507  1.00 39.87 ? 473 LYS A CG    1 
ATOM   2515 C CD    . LYS C 3 288 ? -7.028  -16.324 41.773  1.00 44.55 ? 473 LYS A CD    1 
ATOM   2516 C CE    . LYS C 3 288 ? -8.040  -15.420 42.492  1.00 46.74 ? 473 LYS A CE    1 
ATOM   2517 N NZ    . LYS C 3 288 ? -8.473  -16.049 43.778  1.00 47.46 ? 473 LYS A NZ    1 
ATOM   2518 N N     . VAL C 3 289 ? -4.519  -13.488 41.459  1.00 38.99 ? 474 VAL A N     1 
ATOM   2519 C CA    . VAL C 3 289 ? -3.972  -12.410 42.250  1.00 39.72 ? 474 VAL A CA    1 
ATOM   2520 C C     . VAL C 3 289 ? -4.645  -12.345 43.604  1.00 40.20 ? 474 VAL A C     1 
ATOM   2521 O O     . VAL C 3 289 ? -5.788  -12.722 43.740  1.00 40.93 ? 474 VAL A O     1 
ATOM   2522 C CB    . VAL C 3 289 ? -3.921  -11.036 41.522  1.00 39.17 ? 474 VAL A CB    1 
ATOM   2523 C CG1   . VAL C 3 289 ? -3.809  -11.220 40.048  1.00 39.03 ? 474 VAL A CG1   1 
ATOM   2524 C CG2   . VAL C 3 289 ? -5.083  -10.167 41.871  1.00 39.83 ? 474 VAL A CG2   1 
ATOM   2525 N N     . ASP C 3 290 ? -3.889  -11.908 44.595  1.00 40.87 ? 475 ASP A N     1 
ATOM   2526 C CA    . ASP C 3 290 ? -4.323  -11.807 45.974  1.00 41.96 ? 475 ASP A CA    1 
ATOM   2527 C C     . ASP C 3 290 ? -3.919  -10.414 46.439  1.00 41.60 ? 475 ASP A C     1 
ATOM   2528 O O     . ASP C 3 290 ? -2.818  -10.244 46.920  1.00 41.61 ? 475 ASP A O     1 
ATOM   2529 C CB    . ASP C 3 290 ? -3.578  -12.866 46.791  1.00 42.73 ? 475 ASP A CB    1 
ATOM   2530 C CG    . ASP C 3 290 ? -3.959  -12.870 48.258  1.00 44.68 ? 475 ASP A CG    1 
ATOM   2531 O OD1   . ASP C 3 290 ? -4.516  -11.866 48.762  1.00 46.94 ? 475 ASP A OD1   1 
ATOM   2532 O OD2   . ASP C 3 290 ? -3.688  -13.899 48.911  1.00 47.75 ? 475 ASP A OD2   1 
ATOM   2533 N N     . LYS C 3 291 ? -4.801  -9.428  46.278  1.00 42.12 ? 476 LYS A N     1 
ATOM   2534 C CA    . LYS C 3 291 ? -4.453  -8.009  46.456  1.00 42.20 ? 476 LYS A CA    1 
ATOM   2535 C C     . LYS C 3 291 ? -3.131  -7.695  45.797  1.00 42.27 ? 476 LYS A C     1 
ATOM   2536 O O     . LYS C 3 291 ? -2.088  -8.139  46.290  1.00 43.19 ? 476 LYS A O     1 
ATOM   2537 C CB    . LYS C 3 291 ? -4.237  -7.640  47.935  1.00 41.70 ? 476 LYS A CB    1 
ATOM   2538 C CG    . LYS C 3 291 ? -4.915  -8.490  48.970  1.00 42.51 ? 476 LYS A CG    1 
ATOM   2539 C CD    . LYS C 3 291 ? -4.831  -7.778  50.319  1.00 43.31 ? 476 LYS A CD    1 
ATOM   2540 C CE    . LYS C 3 291 ? -5.274  -8.673  51.453  1.00 43.74 ? 476 LYS A CE    1 
ATOM   2541 N NZ    . LYS C 3 291 ? -4.394  -9.859  51.599  1.00 43.40 ? 476 LYS A NZ    1 
ATOM   2542 N N     . GLN C 3 292 ? -3.110  -6.918  44.726  1.00 41.66 ? 477 GLN A N     1 
ATOM   2543 C CA    . GLN C 3 292 ? -1.817  -6.286  44.360  1.00 40.89 ? 477 GLN A CA    1 
ATOM   2544 C C     . GLN C 3 292 ? -0.600  -7.246  44.187  1.00 39.41 ? 477 GLN A C     1 
ATOM   2545 O O     . GLN C 3 292 ? 0.471   -6.808  43.758  1.00 39.18 ? 477 GLN A O     1 
ATOM   2546 C CB    . GLN C 3 292 ? -1.478  -5.199  45.411  1.00 40.94 ? 477 GLN A CB    1 
ATOM   2547 C CG    . GLN C 3 292 ? -2.317  -3.901  45.312  1.00 43.09 ? 477 GLN A CG    1 
ATOM   2548 C CD    . GLN C 3 292 ? -3.842  -4.131  45.387  1.00 46.74 ? 477 GLN A CD    1 
ATOM   2549 O OE1   . GLN C 3 292 ? -4.410  -4.215  46.484  1.00 47.07 ? 477 GLN A OE1   1 
ATOM   2550 N NE2   . GLN C 3 292 ? -4.508  -4.223  44.211  1.00 46.26 ? 477 GLN A NE2   1 
ATOM   2551 N N     . GLN C 3 293 ? -0.765  -8.530  44.528  1.00 37.87 ? 478 GLN A N     1 
ATOM   2552 C CA    . GLN C 3 293 ? 0.288   -9.542  44.360  1.00 36.62 ? 478 GLN A CA    1 
ATOM   2553 C C     . GLN C 3 293 ? -0.120  -10.698 43.442  1.00 36.40 ? 478 GLN A C     1 
ATOM   2554 O O     . GLN C 3 293 ? -1.221  -11.246 43.546  1.00 36.15 ? 478 GLN A O     1 
ATOM   2555 C CB    . GLN C 3 293 ? 0.767   -10.088 45.707  1.00 36.53 ? 478 GLN A CB    1 
ATOM   2556 C CG    . GLN C 3 293 ? 1.707   -9.145  46.468  1.00 36.07 ? 478 GLN A CG    1 
ATOM   2557 C CD    . GLN C 3 293 ? 2.168   -9.688  47.826  1.00 36.34 ? 478 GLN A CD    1 
ATOM   2558 O OE1   . GLN C 3 293 ? 2.078   -10.883 48.107  1.00 35.88 ? 478 GLN A OE1   1 
ATOM   2559 N NE2   . GLN C 3 293 ? 2.670   -8.796  48.671  1.00 36.04 ? 478 GLN A NE2   1 
ATOM   2560 N N     . VAL C 3 294 ? 0.772   -11.048 42.525  1.00 35.73 ? 479 VAL A N     1 
ATOM   2561 C CA    . VAL C 3 294 ? 0.561   -12.197 41.658  1.00 35.85 ? 479 VAL A CA    1 
ATOM   2562 C C     . VAL C 3 294 ? 1.060   -13.434 42.388  1.00 36.16 ? 479 VAL A C     1 
ATOM   2563 O O     . VAL C 3 294 ? 2.180   -13.433 42.916  1.00 35.99 ? 479 VAL A O     1 
ATOM   2564 C CB    . VAL C 3 294 ? 1.288   -12.034 40.284  1.00 35.59 ? 479 VAL A CB    1 
ATOM   2565 C CG1   . VAL C 3 294 ? 0.957   -13.171 39.361  1.00 34.62 ? 479 VAL A CG1   1 
ATOM   2566 C CG2   . VAL C 3 294 ? 0.893   -10.748 39.626  1.00 35.13 ? 479 VAL A CG2   1 
ATOM   2567 N N     . ILE C 3 295 ? 0.231   -14.475 42.443  1.00 36.76 ? 480 ILE A N     1 
ATOM   2568 C CA    . ILE C 3 295 ? 0.668   -15.722 43.069  1.00 38.10 ? 480 ILE A CA    1 
ATOM   2569 C C     . ILE C 3 295 ? 1.235   -16.683 42.020  1.00 38.56 ? 480 ILE A C     1 
ATOM   2570 O O     . ILE C 3 295 ? 0.819   -16.663 40.857  1.00 38.47 ? 480 ILE A O     1 
ATOM   2571 C CB    . ILE C 3 295 ? -0.382  -16.342 44.052  1.00 38.09 ? 480 ILE A CB    1 
ATOM   2572 C CG1   . ILE C 3 295 ? -1.449  -17.161 43.347  1.00 39.57 ? 480 ILE A CG1   1 
ATOM   2573 C CG2   . ILE C 3 295 ? -1.067  -15.249 44.908  1.00 37.91 ? 480 ILE A CG2   1 
ATOM   2574 C CD1   . ILE C 3 295 ? -2.443  -17.806 44.347  1.00 38.83 ? 480 ILE A CD1   1 
ATOM   2575 N N     . LEU C 3 296 ? 2.247   -17.456 42.417  1.00 39.62 ? 481 LEU A N     1 
ATOM   2576 C CA    . LEU C 3 296 ? 3.037   -18.259 41.468  1.00 40.38 ? 481 LEU A CA    1 
ATOM   2577 C C     . LEU C 3 296 ? 3.298   -19.703 41.920  1.00 40.95 ? 481 LEU A C     1 
ATOM   2578 O O     . LEU C 3 296 ? 3.832   -20.513 41.153  1.00 41.13 ? 481 LEU A O     1 
ATOM   2579 C CB    . LEU C 3 296 ? 4.350   -17.541 41.107  1.00 40.12 ? 481 LEU A CB    1 
ATOM   2580 C CG    . LEU C 3 296 ? 4.257   -16.111 40.551  1.00 40.02 ? 481 LEU A CG    1 
ATOM   2581 C CD1   . LEU C 3 296 ? 5.589   -15.419 40.634  1.00 40.62 ? 481 LEU A CD1   1 
ATOM   2582 C CD2   . LEU C 3 296 ? 3.759   -16.092 39.122  1.00 38.91 ? 481 LEU A CD2   1 
ATOM   2583 N N     . ASP C 3 297 ? 2.907   -20.022 43.150  1.00 41.60 ? 482 ASP A N     1 
ATOM   2584 C CA    . ASP C 3 297 ? 2.908   -21.407 43.648  1.00 42.91 ? 482 ASP A CA    1 
ATOM   2585 C C     . ASP C 3 297 ? 2.498   -22.442 42.584  1.00 43.65 ? 482 ASP A C     1 
ATOM   2586 O O     . ASP C 3 297 ? 1.404   -22.375 42.034  1.00 43.77 ? 482 ASP A O     1 
ATOM   2587 C CB    . ASP C 3 297 ? 1.976   -21.526 44.866  1.00 42.79 ? 482 ASP A CB    1 
ATOM   2588 C CG    . ASP C 3 297 ? 2.467   -20.727 46.060  1.00 42.78 ? 482 ASP A CG    1 
ATOM   2589 O OD1   . ASP C 3 297 ? 1.985   -19.593 46.255  1.00 40.32 ? 482 ASP A OD1   1 
ATOM   2590 O OD2   . ASP C 3 297 ? 3.350   -21.231 46.794  1.00 44.27 ? 482 ASP A OD2   1 
ATOM   2591 N N     . ALA C 3 298 ? 3.385   -23.395 42.307  1.00 44.91 ? 483 ALA A N     1 
ATOM   2592 C CA    . ALA C 3 298 ? 3.104   -24.536 41.415  1.00 45.91 ? 483 ALA A CA    1 
ATOM   2593 C C     . ALA C 3 298 ? 1.710   -25.141 41.632  1.00 46.75 ? 483 ALA A C     1 
ATOM   2594 O O     . ALA C 3 298 ? 1.001   -25.450 40.659  1.00 47.07 ? 483 ALA A O     1 
ATOM   2595 C CB    . ALA C 3 298 ? 4.170   -25.610 41.583  1.00 45.69 ? 483 ALA A CB    1 
ATOM   2596 N N     . SER C 3 299 ? 1.322   -25.289 42.904  1.00 47.22 ? 484 SER A N     1 
ATOM   2597 C CA    . SER C 3 299 ? 0.007   -25.824 43.285  1.00 47.53 ? 484 SER A CA    1 
ATOM   2598 C C     . SER C 3 299 ? -1.193  -25.125 42.622  1.00 47.35 ? 484 SER A C     1 
ATOM   2599 O O     . SER C 3 299 ? -2.259  -25.731 42.511  1.00 47.29 ? 484 SER A O     1 
ATOM   2600 C CB    . SER C 3 299 ? -0.155  -25.830 44.814  1.00 47.60 ? 484 SER A CB    1 
ATOM   2601 O OG    . SER C 3 299 ? -0.304  -24.515 45.329  1.00 48.46 ? 484 SER A OG    1 
ATOM   2602 N N     . CYS C 3 300 ? -1.008  -23.873 42.184  1.00 47.52 ? 485 CYS A N     1 
ATOM   2603 C CA    A CYS C 3 300 ? -2.057  -23.102 41.492  0.50 47.79 ? 485 CYS A CA    1 
ATOM   2604 C CA    B CYS C 3 300 ? -2.067  -23.111 41.501  0.50 47.29 ? 485 CYS A CA    1 
ATOM   2605 C C     . CYS C 3 300 ? -2.567  -23.792 40.226  1.00 47.57 ? 485 CYS A C     1 
ATOM   2606 O O     . CYS C 3 300 ? -3.685  -23.541 39.790  1.00 47.88 ? 485 CYS A O     1 
ATOM   2607 C CB    A CYS C 3 300 ? -1.575  -21.683 41.151  0.50 47.88 ? 485 CYS A CB    1 
ATOM   2608 C CB    B CYS C 3 300 ? -1.603  -21.689 41.172  0.50 47.28 ? 485 CYS A CB    1 
ATOM   2609 S SG    A CYS C 3 300 ? -0.682  -21.489 39.552  0.50 49.56 ? 485 CYS A SG    1 
ATOM   2610 S SG    B CYS C 3 300 ? -2.350  -20.367 42.156  0.50 45.98 ? 485 CYS A SG    1 
ATOM   2611 N N     . SER C 3 301 ? -1.729  -24.647 39.634  1.00 47.62 ? 486 SER A N     1 
ATOM   2612 C CA    . SER C 3 301 ? -2.086  -25.427 38.442  1.00 47.31 ? 486 SER A CA    1 
ATOM   2613 C C     . SER C 3 301 ? -3.242  -26.366 38.735  1.00 46.66 ? 486 SER A C     1 
ATOM   2614 O O     . SER C 3 301 ? -3.961  -26.786 37.822  1.00 46.95 ? 486 SER A O     1 
ATOM   2615 C CB    . SER C 3 301 ? -0.892  -26.260 37.963  1.00 47.56 ? 486 SER A CB    1 
ATOM   2616 O OG    . SER C 3 301 ? 0.199   -25.429 37.613  1.00 49.19 ? 486 SER A OG    1 
ATOM   2617 N N     . GLU C 3 302 ? -3.392  -26.718 40.009  1.00 45.60 ? 487 GLU A N     1 
ATOM   2618 C CA    . GLU C 3 302 ? -4.546  -27.484 40.460  1.00 44.65 ? 487 GLU A CA    1 
ATOM   2619 C C     . GLU C 3 302 ? -5.781  -26.590 40.642  1.00 43.48 ? 487 GLU A C     1 
ATOM   2620 O O     . GLU C 3 302 ? -6.886  -27.101 40.831  1.00 43.61 ? 487 GLU A O     1 
ATOM   2621 C CB    . GLU C 3 302 ? -4.224  -28.238 41.756  1.00 44.76 ? 487 GLU A CB    1 
ATOM   2622 C CG    . GLU C 3 302 ? -3.576  -29.610 41.555  1.00 45.89 ? 487 GLU A CG    1 
ATOM   2623 C CD    . GLU C 3 302 ? -2.143  -29.548 41.027  1.00 47.86 ? 487 GLU A CD    1 
ATOM   2624 O OE1   . GLU C 3 302 ? -1.685  -30.552 40.434  1.00 48.37 ? 487 GLU A OE1   1 
ATOM   2625 O OE2   . GLU C 3 302 ? -1.467  -28.510 41.211  1.00 49.08 ? 487 GLU A OE2   1 
ATOM   2626 N N     . GLU C 3 303 ? -5.600  -25.269 40.574  1.00 41.70 ? 488 GLU A N     1 
ATOM   2627 C CA    . GLU C 3 303 ? -6.695  -24.339 40.851  1.00 40.65 ? 488 GLU A CA    1 
ATOM   2628 C C     . GLU C 3 303 ? -7.414  -23.853 39.577  1.00 38.91 ? 488 GLU A C     1 
ATOM   2629 O O     . GLU C 3 303 ? -6.795  -23.245 38.692  1.00 38.38 ? 488 GLU A O     1 
ATOM   2630 C CB    . GLU C 3 303 ? -6.242  -23.169 41.744  1.00 40.61 ? 488 GLU A CB    1 
ATOM   2631 C CG    . GLU C 3 303 ? -7.428  -22.362 42.339  1.00 42.64 ? 488 GLU A CG    1 
ATOM   2632 C CD    . GLU C 3 303 ? -7.036  -21.064 43.088  1.00 42.34 ? 488 GLU A CD    1 
ATOM   2633 O OE1   . GLU C 3 303 ? -7.853  -20.113 43.051  1.00 43.38 ? 488 GLU A OE1   1 
ATOM   2634 O OE2   . GLU C 3 303 ? -5.949  -20.998 43.719  1.00 42.79 ? 488 GLU A OE2   1 
ATOM   2635 N N     . PRO C 3 304 ? -8.726  -24.152 39.477  1.00 37.58 ? 489 PRO A N     1 
ATOM   2636 C CA    . PRO C 3 304 ? -9.552  -23.736 38.350  1.00 36.48 ? 489 PRO A CA    1 
ATOM   2637 C C     . PRO C 3 304 ? -9.783  -22.244 38.391  1.00 35.45 ? 489 PRO A C     1 
ATOM   2638 O O     . PRO C 3 304 ? -10.006 -21.692 39.469  1.00 35.29 ? 489 PRO A O     1 
ATOM   2639 C CB    . PRO C 3 304 ? -10.890 -24.453 38.596  1.00 36.14 ? 489 PRO A CB    1 
ATOM   2640 C CG    . PRO C 3 304 ? -10.602 -25.494 39.626  1.00 37.19 ? 489 PRO A CG    1 
ATOM   2641 C CD    . PRO C 3 304 ? -9.509  -24.929 40.456  1.00 37.52 ? 489 PRO A CD    1 
ATOM   2642 N N     . VAL C 3 305 ? -9.711  -21.597 37.233  1.00 34.19 ? 490 VAL A N     1 
ATOM   2643 C CA    . VAL C 3 305 ? -10.118 -20.219 37.149  1.00 33.82 ? 490 VAL A CA    1 
ATOM   2644 C C     . VAL C 3 305 ? -11.634 -20.270 37.323  1.00 33.51 ? 490 VAL A C     1 
ATOM   2645 O O     . VAL C 3 305 ? -12.290 -21.204 36.851  1.00 33.74 ? 490 VAL A O     1 
ATOM   2646 C CB    . VAL C 3 305 ? -9.690  -19.538 35.819  1.00 33.78 ? 490 VAL A CB    1 
ATOM   2647 C CG1   . VAL C 3 305 ? -10.038 -18.083 35.854  1.00 33.54 ? 490 VAL A CG1   1 
ATOM   2648 C CG2   . VAL C 3 305 ? -8.187  -19.663 35.601  1.00 33.22 ? 490 VAL A CG2   1 
ATOM   2649 N N     . SER C 3 306 ? -12.166 -19.300 38.051  1.00 32.69 ? 491 SER A N     1 
ATOM   2650 C CA    . SER C 3 306 ? -13.563 -19.304 38.453  1.00 32.17 ? 491 SER A CA    1 
ATOM   2651 C C     . SER C 3 306 ? -14.194 -17.911 38.309  1.00 31.28 ? 491 SER A C     1 
ATOM   2652 O O     . SER C 3 306 ? -13.486 -16.906 38.295  1.00 30.17 ? 491 SER A O     1 
ATOM   2653 C CB    . SER C 3 306 ? -13.653 -19.773 39.907  1.00 32.27 ? 491 SER A CB    1 
ATOM   2654 O OG    . SER C 3 306 ? -14.953 -20.235 40.209  1.00 34.42 ? 491 SER A OG    1 
ATOM   2655 N N     . GLN C 3 307 ? -15.529 -17.860 38.228  1.00 31.22 ? 492 GLN A N     1 
ATOM   2656 C CA    . GLN C 3 307 ? -16.286 -16.586 38.122  1.00 30.03 ? 492 GLN A CA    1 
ATOM   2657 C C     . GLN C 3 307 ? -15.866 -15.575 39.188  1.00 29.70 ? 492 GLN A C     1 
ATOM   2658 O O     . GLN C 3 307 ? -15.821 -15.884 40.386  1.00 28.05 ? 492 GLN A O     1 
ATOM   2659 C CB    . GLN C 3 307 ? -17.803 -16.823 38.234  1.00 30.13 ? 492 GLN A CB    1 
ATOM   2660 C CG    . GLN C 3 307 ? -18.374 -17.959 37.387  1.00 30.49 ? 492 GLN A CG    1 
ATOM   2661 C CD    . GLN C 3 307 ? -18.048 -17.782 35.918  1.00 31.32 ? 492 GLN A CD    1 
ATOM   2662 O OE1   . GLN C 3 307 ? -18.189 -16.681 35.372  1.00 31.67 ? 492 GLN A OE1   1 
ATOM   2663 N NE2   . GLN C 3 307 ? -17.575 -18.848 35.280  1.00 29.37 ? 492 GLN A NE2   1 
ATOM   2664 N N     . LEU C 3 308 ? -15.583 -14.362 38.728  1.00 29.95 ? 493 LEU A N     1 
ATOM   2665 C CA    . LEU C 3 308 ? -15.248 -13.210 39.586  1.00 30.32 ? 493 LEU A CA    1 
ATOM   2666 C C     . LEU C 3 308 ? -13.899 -13.280 40.351  1.00 30.70 ? 493 LEU A C     1 
ATOM   2667 O O     . LEU C 3 308 ? -13.666 -12.518 41.298  1.00 29.82 ? 493 LEU A O     1 
ATOM   2668 C CB    . LEU C 3 308 ? -16.411 -12.796 40.473  1.00 29.84 ? 493 LEU A CB    1 
ATOM   2669 C CG    . LEU C 3 308 ? -17.526 -12.013 39.730  1.00 32.01 ? 493 LEU A CG    1 
ATOM   2670 C CD1   . LEU C 3 308 ? -18.867 -12.005 40.515  1.00 29.39 ? 493 LEU A CD1   1 
ATOM   2671 C CD2   . LEU C 3 308 ? -17.127 -10.573 39.363  1.00 27.60 ? 493 LEU A CD2   1 
ATOM   2672 N N     . HIS C 3 309 ? -13.016 -14.177 39.890  1.00 30.70 ? 494 HIS A N     1 
ATOM   2673 C CA    . HIS C 3 309 ? -11.651 -14.250 40.368  1.00 31.36 ? 494 HIS A CA    1 
ATOM   2674 C C     . HIS C 3 309 ? -10.860 -13.015 39.961  1.00 31.45 ? 494 HIS A C     1 
ATOM   2675 O O     . HIS C 3 309 ? -10.917 -12.576 38.785  1.00 32.84 ? 494 HIS A O     1 
ATOM   2676 C CB    . HIS C 3 309 ? -10.977 -15.500 39.774  1.00 31.71 ? 494 HIS A CB    1 
ATOM   2677 C CG    . HIS C 3 309 ? -11.071 -16.714 40.650  1.00 31.76 ? 494 HIS A CG    1 
ATOM   2678 N ND1   . HIS C 3 309 ? -10.418 -17.891 40.362  1.00 31.18 ? 494 HIS A ND1   1 
ATOM   2679 C CD2   . HIS C 3 309 ? -11.750 -16.933 41.801  1.00 30.65 ? 494 HIS A CD2   1 
ATOM   2680 C CE1   . HIS C 3 309 ? -10.677 -18.780 41.303  1.00 29.77 ? 494 HIS A CE1   1 
ATOM   2681 N NE2   . HIS C 3 309 ? -11.478 -18.222 42.191  1.00 31.05 ? 494 HIS A NE2   1 
ATOM   2682 N N     . LYS C 3 310 ? -10.141 -12.440 40.912  1.00 31.13 ? 495 LYS A N     1 
ATOM   2683 C CA    . LYS C 3 310 ? -9.054  -11.520 40.575  1.00 32.30 ? 495 LYS A CA    1 
ATOM   2684 C C     . LYS C 3 310 ? -7.877  -12.306 39.927  1.00 32.56 ? 495 LYS A C     1 
ATOM   2685 O O     . LYS C 3 310 ? -7.466  -13.338 40.425  1.00 32.26 ? 495 LYS A O     1 
ATOM   2686 C CB    . LYS C 3 310 ? -8.609  -10.738 41.807  1.00 33.40 ? 495 LYS A CB    1 
ATOM   2687 C CG    . LYS C 3 310 ? -9.676  -9.735  42.401  1.00 35.44 ? 495 LYS A CG    1 
ATOM   2688 C CD    . LYS C 3 310 ? -9.652  -8.344  41.668  1.00 39.41 ? 495 LYS A CD    1 
ATOM   2689 C CE    . LYS C 3 310 ? -10.640 -7.293  42.269  1.00 37.93 ? 495 LYS A CE    1 
ATOM   2690 N NZ    . LYS C 3 310 ? -12.085 -7.671  42.006  1.00 41.14 ? 495 LYS A NZ    1 
ATOM   2691 N N     . CYS C 3 311 ? -7.369  -11.827 38.797  1.00 32.67 ? 496 CYS A N     1 
ATOM   2692 C CA    . CYS C 3 311 ? -6.359  -12.543 38.054  1.00 33.40 ? 496 CYS A CA    1 
ATOM   2693 C C     . CYS C 3 311 ? -5.456  -11.598 37.239  1.00 32.86 ? 496 CYS A C     1 
ATOM   2694 O O     . CYS C 3 311 ? -5.716  -10.391 37.153  1.00 33.26 ? 496 CYS A O     1 
ATOM   2695 C CB    . CYS C 3 311 ? -7.023  -13.587 37.153  1.00 33.72 ? 496 CYS A CB    1 
ATOM   2696 S SG    . CYS C 3 311 ? -8.078  -12.858 35.904  1.00 38.19 ? 496 CYS A SG    1 
ATOM   2697 N N     . ALA C 3 312 ? -4.378  -12.141 36.685  1.00 32.65 ? 497 ALA A N     1 
ATOM   2698 C CA    . ALA C 3 312 ? -3.401  -11.353 35.922  1.00 32.91 ? 497 ALA A CA    1 
ATOM   2699 C C     . ALA C 3 312 ? -2.927  -12.160 34.743  1.00 33.33 ? 497 ALA A C     1 
ATOM   2700 O O     . ALA C 3 312 ? -3.066  -13.395 34.745  1.00 33.57 ? 497 ALA A O     1 
ATOM   2701 C CB    . ALA C 3 312 ? -2.236  -10.972 36.772  1.00 32.07 ? 497 ALA A CB    1 
ATOM   2702 N N     . PHE C 3 313 ? -2.351  -11.467 33.758  1.00 33.47 ? 498 PHE A N     1 
ATOM   2703 C CA    . PHE C 3 313 ? -1.892  -12.102 32.532  1.00 34.10 ? 498 PHE A CA    1 
ATOM   2704 C C     . PHE C 3 313 ? -0.417  -11.771 32.240  1.00 34.90 ? 498 PHE A C     1 
ATOM   2705 O O     . PHE C 3 313 ? -0.077  -10.654 31.820  1.00 34.90 ? 498 PHE A O     1 
ATOM   2706 C CB    . PHE C 3 313 ? -2.820  -11.721 31.372  1.00 34.17 ? 498 PHE A CB    1 
ATOM   2707 C CG    . PHE C 3 313 ? -4.254  -12.154 31.586  1.00 34.92 ? 498 PHE A CG    1 
ATOM   2708 C CD1   . PHE C 3 313 ? -5.158  -11.323 32.256  1.00 34.81 ? 498 PHE A CD1   1 
ATOM   2709 C CD2   . PHE C 3 313 ? -4.687  -13.397 31.159  1.00 34.49 ? 498 PHE A CD2   1 
ATOM   2710 C CE1   . PHE C 3 313 ? -6.472  -11.716 32.486  1.00 36.41 ? 498 PHE A CE1   1 
ATOM   2711 C CE2   . PHE C 3 313 ? -6.005  -13.804 31.383  1.00 35.19 ? 498 PHE A CE2   1 
ATOM   2712 C CZ    . PHE C 3 313 ? -6.897  -12.962 32.052  1.00 36.30 ? 498 PHE A CZ    1 
ATOM   2713 N N     . GLN C 3 314 ? 0.469   -12.730 32.489  1.00 34.96 ? 499 GLN A N     1 
ATOM   2714 C CA    . GLN C 3 314 ? 1.882   -12.469 32.245  1.00 35.47 ? 499 GLN A CA    1 
ATOM   2715 C C     . GLN C 3 314 ? 2.306   -12.845 30.838  1.00 35.69 ? 499 GLN A C     1 
ATOM   2716 O O     . GLN C 3 314 ? 1.881   -13.872 30.305  1.00 35.90 ? 499 GLN A O     1 
ATOM   2717 C CB    . GLN C 3 314 ? 2.793   -13.136 33.285  1.00 35.47 ? 499 GLN A CB    1 
ATOM   2718 C CG    . GLN C 3 314 ? 2.528   -14.598 33.510  1.00 35.32 ? 499 GLN A CG    1 
ATOM   2719 C CD    . GLN C 3 314 ? 3.568   -15.261 34.388  1.00 35.06 ? 499 GLN A CD    1 
ATOM   2720 O OE1   . GLN C 3 314 ? 3.863   -16.439 34.208  1.00 35.33 ? 499 GLN A OE1   1 
ATOM   2721 N NE2   . GLN C 3 314 ? 4.118   -14.518 35.351  1.00 34.42 ? 499 GLN A NE2   1 
ATOM   2722 N N     . MET C 3 315 ? 3.136   -11.998 30.236  1.00 35.84 ? 500 MET A N     1 
ATOM   2723 C CA    . MET C 3 315 ? 3.747   -12.317 28.951  1.00 36.04 ? 500 MET A CA    1 
ATOM   2724 C C     . MET C 3 315 ? 4.494   -13.628 29.080  1.00 35.97 ? 500 MET A C     1 
ATOM   2725 O O     . MET C 3 315 ? 4.955   -13.981 30.162  1.00 35.84 ? 500 MET A O     1 
ATOM   2726 C CB    . MET C 3 315 ? 4.708   -11.218 28.540  1.00 36.20 ? 500 MET A CB    1 
ATOM   2727 C CG    . MET C 3 315 ? 4.034   -9.885  28.347  1.00 37.83 ? 500 MET A CG    1 
ATOM   2728 S SD    . MET C 3 315 ? 2.790   -9.963  27.064  1.00 42.24 ? 500 MET A SD    1 
ATOM   2729 C CE    . MET C 3 315 ? 3.811   -10.154 25.592  1.00 39.81 ? 500 MET A CE    1 
ATOM   2730 N N     . ILE C 3 316 ? 4.574   -14.371 27.990  1.00 36.45 ? 501 ILE A N     1 
ATOM   2731 C CA    . ILE C 3 316 ? 5.230   -15.672 28.013  1.00 37.27 ? 501 ILE A CA    1 
ATOM   2732 C C     . ILE C 3 316 ? 6.751   -15.542 27.949  1.00 37.58 ? 501 ILE A C     1 
ATOM   2733 O O     . ILE C 3 316 ? 7.472   -16.280 28.629  1.00 37.74 ? 501 ILE A O     1 
ATOM   2734 C CB    . ILE C 3 316 ? 4.654   -16.587 26.926  1.00 37.39 ? 501 ILE A CB    1 
ATOM   2735 C CG1   . ILE C 3 316 ? 3.521   -17.395 27.542  1.00 38.20 ? 501 ILE A CG1   1 
ATOM   2736 C CG2   . ILE C 3 316 ? 5.702   -17.525 26.351  1.00 37.53 ? 501 ILE A CG2   1 
ATOM   2737 C CD1   . ILE C 3 316 ? 2.315   -17.438 26.700  1.00 38.93 ? 501 ILE A CD1   1 
ATOM   2738 N N     . ASP C 3 317 ? 7.214   -14.572 27.165  1.00 37.76 ? 502 ASP A N     1 
ATOM   2739 C CA    . ASP C 3 317 ? 8.643   -14.275 27.006  1.00 38.24 ? 502 ASP A CA    1 
ATOM   2740 C C     . ASP C 3 317 ? 9.265   -13.665 28.273  1.00 37.98 ? 502 ASP A C     1 
ATOM   2741 O O     . ASP C 3 317 ? 10.454  -13.861 28.537  1.00 37.96 ? 502 ASP A O     1 
ATOM   2742 C CB    . ASP C 3 317 ? 8.844   -13.323 25.811  1.00 38.18 ? 502 ASP A CB    1 
ATOM   2743 C CG    . ASP C 3 317 ? 7.963   -12.052 25.907  1.00 39.57 ? 502 ASP A CG    1 
ATOM   2744 O OD1   . ASP C 3 317 ? 6.705   -12.164 26.027  1.00 36.98 ? 502 ASP A OD1   1 
ATOM   2745 O OD2   . ASP C 3 317 ? 8.543   -10.939 25.863  1.00 40.44 ? 502 ASP A OD2   1 
ATOM   2746 N N     . ASN C 3 318 ? 8.457   -12.932 29.039  1.00 37.79 ? 503 ASN A N     1 
ATOM   2747 C CA    . ASN C 3 318 ? 8.938   -12.166 30.196  1.00 37.86 ? 503 ASN A CA    1 
ATOM   2748 C C     . ASN C 3 318 ? 8.027   -12.269 31.434  1.00 37.66 ? 503 ASN A C     1 
ATOM   2749 O O     . ASN C 3 318 ? 6.979   -11.627 31.515  1.00 37.17 ? 503 ASN A O     1 
ATOM   2750 C CB    . ASN C 3 318 ? 9.143   -10.696 29.804  1.00 37.92 ? 503 ASN A CB    1 
ATOM   2751 C CG    . ASN C 3 318 ? 10.188  -9.993  30.658  1.00 38.52 ? 503 ASN A CG    1 
ATOM   2752 O OD1   . ASN C 3 318 ? 10.895  -9.107  30.170  1.00 39.65 ? 503 ASN A OD1   1 
ATOM   2753 N ND2   . ASN C 3 318 ? 10.295  -10.381 31.930  1.00 38.15 ? 503 ASN A ND2   1 
ATOM   2754 N N     . GLU C 3 319 ? 8.478   -13.058 32.405  1.00 37.73 ? 504 GLU A N     1 
ATOM   2755 C CA    . GLU C 3 319 ? 7.725   -13.370 33.626  1.00 37.53 ? 504 GLU A CA    1 
ATOM   2756 C C     . GLU C 3 319 ? 7.264   -12.172 34.422  1.00 36.65 ? 504 GLU A C     1 
ATOM   2757 O O     . GLU C 3 319 ? 6.274   -12.257 35.134  1.00 36.74 ? 504 GLU A O     1 
ATOM   2758 C CB    . GLU C 3 319 ? 8.546   -14.302 34.534  1.00 38.21 ? 504 GLU A CB    1 
ATOM   2759 C CG    . GLU C 3 319 ? 8.720   -15.727 33.976  1.00 40.23 ? 504 GLU A CG    1 
ATOM   2760 C CD    . GLU C 3 319 ? 7.416   -16.303 33.438  1.00 42.99 ? 504 GLU A CD    1 
ATOM   2761 O OE1   . GLU C 3 319 ? 6.927   -15.797 32.399  1.00 44.48 ? 504 GLU A OE1   1 
ATOM   2762 O OE2   . GLU C 3 319 ? 6.877   -17.255 34.049  1.00 44.18 ? 504 GLU A OE2   1 
ATOM   2763 N N     . LEU C 3 320 ? 7.975   -11.060 34.304  1.00 35.84 ? 505 LEU A N     1 
ATOM   2764 C CA    . LEU C 3 320 ? 7.641   -9.862  35.068  1.00 35.25 ? 505 LEU A CA    1 
ATOM   2765 C C     . LEU C 3 320 ? 6.727   -8.877  34.338  1.00 34.97 ? 505 LEU A C     1 
ATOM   2766 O O     . LEU C 3 320 ? 6.358   -7.834  34.890  1.00 34.78 ? 505 LEU A O     1 
ATOM   2767 C CB    . LEU C 3 320 ? 8.912   -9.160  35.549  1.00 34.84 ? 505 LEU A CB    1 
ATOM   2768 C CG    . LEU C 3 320 ? 9.318   -9.458  36.995  1.00 34.92 ? 505 LEU A CG    1 
ATOM   2769 C CD1   . LEU C 3 320 ? 9.383   -10.955 37.267  1.00 33.77 ? 505 LEU A CD1   1 
ATOM   2770 C CD2   . LEU C 3 320 ? 10.655  -8.783  37.326  1.00 35.05 ? 505 LEU A CD2   1 
ATOM   2771 N N     . VAL C 3 321 ? 6.370   -9.204  33.102  1.00 34.42 ? 506 VAL A N     1 
ATOM   2772 C CA    . VAL C 3 321 ? 5.557   -8.298  32.322  1.00 34.42 ? 506 VAL A CA    1 
ATOM   2773 C C     . VAL C 3 321 ? 4.104   -8.774  32.254  1.00 34.72 ? 506 VAL A C     1 
ATOM   2774 O O     . VAL C 3 321 ? 3.818   -9.912  31.846  1.00 34.15 ? 506 VAL A O     1 
ATOM   2775 C CB    . VAL C 3 321 ? 6.150   -8.017  30.915  1.00 34.33 ? 506 VAL A CB    1 
ATOM   2776 C CG1   . VAL C 3 321 ? 5.263   -7.051  30.171  1.00 33.95 ? 506 VAL A CG1   1 
ATOM   2777 C CG2   . VAL C 3 321 ? 7.561   -7.423  31.027  1.00 33.23 ? 506 VAL A CG2   1 
ATOM   2778 N N     . TYR C 3 322 ? 3.206   -7.878  32.663  1.00 34.86 ? 507 TYR A N     1 
ATOM   2779 C CA    . TYR C 3 322 ? 1.785   -8.162  32.739  1.00 35.60 ? 507 TYR A CA    1 
ATOM   2780 C C     . TYR C 3 322 ? 0.911   -7.226  31.909  1.00 35.82 ? 507 TYR A C     1 
ATOM   2781 O O     . TYR C 3 322 ? 1.204   -6.041  31.751  1.00 35.82 ? 507 TYR A O     1 
ATOM   2782 C CB    . TYR C 3 322 ? 1.323   -8.127  34.200  1.00 35.56 ? 507 TYR A CB    1 
ATOM   2783 C CG    . TYR C 3 322 ? 1.906   -9.239  35.038  1.00 36.04 ? 507 TYR A CG    1 
ATOM   2784 C CD1   . TYR C 3 322 ? 3.160   -9.104  35.629  1.00 34.73 ? 507 TYR A CD1   1 
ATOM   2785 C CD2   . TYR C 3 322 ? 1.203   -10.430 35.244  1.00 36.59 ? 507 TYR A CD2   1 
ATOM   2786 C CE1   . TYR C 3 322 ? 3.702   -10.116 36.397  1.00 34.69 ? 507 TYR A CE1   1 
ATOM   2787 C CE2   . TYR C 3 322 ? 1.752   -11.462 36.026  1.00 35.51 ? 507 TYR A CE2   1 
ATOM   2788 C CZ    . TYR C 3 322 ? 3.002   -11.291 36.592  1.00 34.59 ? 507 TYR A CZ    1 
ATOM   2789 O OH    . TYR C 3 322 ? 3.561   -12.290 37.361  1.00 33.66 ? 507 TYR A OH    1 
ATOM   2790 N N     . LEU C 3 323 ? -0.176  -7.788  31.398  1.00 36.54 ? 508 LEU A N     1 
ATOM   2791 C CA    . LEU C 3 323 ? -1.232  -7.034  30.732  1.00 37.16 ? 508 LEU A CA    1 
ATOM   2792 C C     . LEU C 3 323 ? -1.810  -6.054  31.744  1.00 37.34 ? 508 LEU A C     1 
ATOM   2793 O O     . LEU C 3 323 ? -2.137  -6.423  32.876  1.00 37.21 ? 508 LEU A O     1 
ATOM   2794 C CB    . LEU C 3 323 ? -2.308  -7.995  30.242  1.00 37.18 ? 508 LEU A CB    1 
ATOM   2795 C CG    . LEU C 3 323 ? -3.264  -7.709  29.075  1.00 38.36 ? 508 LEU A CG    1 
ATOM   2796 C CD1   . LEU C 3 323 ? -4.539  -7.024  29.513  1.00 37.62 ? 508 LEU A CD1   1 
ATOM   2797 C CD2   . LEU C 3 323 ? -2.590  -7.003  27.895  1.00 39.17 ? 508 LEU A CD2   1 
ATOM   2798 N N     . CYS C 3 324 ? -1.912  -4.800  31.335  1.00 37.81 ? 509 CYS A N     1 
ATOM   2799 C CA    . CYS C 3 324 ? -2.160  -3.729  32.267  1.00 38.16 ? 509 CYS A CA    1 
ATOM   2800 C C     . CYS C 3 324 ? -2.878  -2.582  31.584  1.00 38.65 ? 509 CYS A C     1 
ATOM   2801 O O     . CYS C 3 324 ? -2.759  -2.384  30.376  1.00 38.86 ? 509 CYS A O     1 
ATOM   2802 C CB    . CYS C 3 324 ? -0.835  -3.233  32.841  1.00 38.04 ? 509 CYS A CB    1 
ATOM   2803 S SG    . CYS C 3 324 ? -1.008  -1.989  34.145  1.00 38.71 ? 509 CYS A SG    1 
ATOM   2804 N N     . LEU C 3 325 ? -3.602  -1.814  32.383  1.00 39.14 ? 510 LEU A N     1 
ATOM   2805 C CA    . LEU C 3 325 ? -4.391  -0.699  31.896  1.00 39.91 ? 510 LEU A CA    1 
ATOM   2806 C C     . LEU C 3 325 ? -3.789  0.630   32.363  1.00 40.14 ? 510 LEU A C     1 
ATOM   2807 O O     . LEU C 3 325 ? -3.310  0.728   33.491  1.00 40.09 ? 510 LEU A O     1 
ATOM   2808 C CB    . LEU C 3 325 ? -5.841  -0.896  32.369  1.00 39.96 ? 510 LEU A CB    1 
ATOM   2809 C CG    . LEU C 3 325 ? -6.777  0.148   32.976  1.00 41.34 ? 510 LEU A CG    1 
ATOM   2810 C CD1   . LEU C 3 325 ? -8.138  -0.490  33.142  1.00 41.62 ? 510 LEU A CD1   1 
ATOM   2811 C CD2   . LEU C 3 325 ? -6.294  0.667   34.331  1.00 42.26 ? 510 LEU A CD2   1 
ATOM   2812 N N     . SER C 3 326 ? -3.785  1.630   31.480  1.00 40.38 ? 511 SER A N     1 
ATOM   2813 C CA    . SER C 3 326 ? -3.458  3.005   31.854  1.00 40.76 ? 511 SER A CA    1 
ATOM   2814 C C     . SER C 3 326 ? -4.495  3.935   31.242  1.00 41.21 ? 511 SER A C     1 
ATOM   2815 O O     . SER C 3 326 ? -4.531  4.117   30.021  1.00 41.24 ? 511 SER A O     1 
ATOM   2816 C CB    . SER C 3 326 ? -2.048  3.396   31.400  1.00 41.07 ? 511 SER A CB    1 
ATOM   2817 O OG    . SER C 3 326 ? -1.860  4.803   31.469  1.00 40.42 ? 511 SER A OG    1 
ATOM   2818 N N     . HIS C 3 327 ? -5.315  4.535   32.105  1.00 41.66 ? 512 HIS A N     1 
ATOM   2819 C CA    . HIS C 3 327 ? -6.595  5.128   31.713  1.00 42.13 ? 512 HIS A CA    1 
ATOM   2820 C C     . HIS C 3 327 ? -7.301  4.168   30.755  1.00 42.03 ? 512 HIS A C     1 
ATOM   2821 O O     . HIS C 3 327 ? -7.596  3.040   31.129  1.00 42.14 ? 512 HIS A O     1 
ATOM   2822 C CB    . HIS C 3 327 ? -6.423  6.534   31.115  1.00 42.45 ? 512 HIS A CB    1 
ATOM   2823 C CG    . HIS C 3 327 ? -6.108  7.596   32.127  1.00 43.93 ? 512 HIS A CG    1 
ATOM   2824 N ND1   . HIS C 3 327 ? -6.625  8.873   32.051  1.00 45.60 ? 512 HIS A ND1   1 
ATOM   2825 C CD2   . HIS C 3 327 ? -5.320  7.576   33.231  1.00 45.03 ? 512 HIS A CD2   1 
ATOM   2826 C CE1   . HIS C 3 327 ? -6.165  9.595   33.058  1.00 46.03 ? 512 HIS A CE1   1 
ATOM   2827 N NE2   . HIS C 3 327 ? -5.374  8.831   33.791  1.00 45.92 ? 512 HIS A NE2   1 
ATOM   2828 N N     . ASP C 3 328 ? -7.533  4.587   29.515  1.00 42.10 ? 513 ASP A N     1 
ATOM   2829 C CA    . ASP C 3 328 ? -8.223  3.721   28.566  1.00 41.98 ? 513 ASP A CA    1 
ATOM   2830 C C     . ASP C 3 328 ? -7.298  2.880   27.677  1.00 41.52 ? 513 ASP A C     1 
ATOM   2831 O O     . ASP C 3 328 ? -7.775  2.154   26.811  1.00 41.52 ? 513 ASP A O     1 
ATOM   2832 C CB    . ASP C 3 328 ? -9.198  4.528   27.710  1.00 42.18 ? 513 ASP A CB    1 
ATOM   2833 C CG    . ASP C 3 328 ? -8.501  5.460   26.763  1.00 43.43 ? 513 ASP A CG    1 
ATOM   2834 O OD1   . ASP C 3 328 ? -7.601  6.201   27.222  1.00 45.50 ? 513 ASP A OD1   1 
ATOM   2835 O OD2   . ASP C 3 328 ? -8.857  5.457   25.564  1.00 44.38 ? 513 ASP A OD2   1 
ATOM   2836 N N     . LYS C 3 329 ? -5.989  2.968   27.887  1.00 40.87 ? 514 LYS A N     1 
ATOM   2837 C CA    . LYS C 3 329 ? -5.056  2.231   27.034  1.00 40.37 ? 514 LYS A CA    1 
ATOM   2838 C C     . LYS C 3 329 ? -4.587  0.906   27.619  1.00 39.87 ? 514 LYS A C     1 
ATOM   2839 O O     . LYS C 3 329 ? -4.402  0.767   28.836  1.00 40.00 ? 514 LYS A O     1 
ATOM   2840 C CB    . LYS C 3 329 ? -3.857  3.092   26.591  1.00 40.71 ? 514 LYS A CB    1 
ATOM   2841 C CG    . LYS C 3 329 ? -3.750  4.478   27.219  1.00 41.33 ? 514 LYS A CG    1 
ATOM   2842 C CD    . LYS C 3 329 ? -4.530  5.526   26.431  1.00 42.12 ? 514 LYS A CD    1 
ATOM   2843 C CE    . LYS C 3 329 ? -3.684  6.184   25.348  1.00 42.85 ? 514 LYS A CE    1 
ATOM   2844 N NZ    . LYS C 3 329 ? -4.448  7.241   24.614  1.00 42.70 ? 514 LYS A NZ    1 
ATOM   2845 N N     . ILE C 3 330 ? -4.415  -0.073  26.740  1.00 39.01 ? 515 ILE A N     1 
ATOM   2846 C CA    . ILE C 3 330 ? -3.849  -1.354  27.130  1.00 38.36 ? 515 ILE A CA    1 
ATOM   2847 C C     . ILE C 3 330 ? -2.339  -1.368  26.847  1.00 38.51 ? 515 ILE A C     1 
ATOM   2848 O O     . ILE C 3 330 ? -1.893  -1.071  25.728  1.00 38.34 ? 515 ILE A O     1 
ATOM   2849 C CB    . ILE C 3 330 ? -4.594  -2.533  26.473  1.00 38.36 ? 515 ILE A CB    1 
ATOM   2850 C CG1   . ILE C 3 330 ? -6.086  -2.520  26.873  1.00 37.70 ? 515 ILE A CG1   1 
ATOM   2851 C CG2   . ILE C 3 330 ? -3.946  -3.868  26.849  1.00 37.47 ? 515 ILE A CG2   1 
ATOM   2852 C CD1   . ILE C 3 330 ? -6.352  -2.714  28.380  1.00 36.06 ? 515 ILE A CD1   1 
ATOM   2853 N N     . ILE C 3 331 ? -1.571  -1.677  27.893  1.00 38.07 ? 516 ILE A N     1 
ATOM   2854 C CA    . ILE C 3 331 ? -0.119  -1.640  27.866  1.00 37.57 ? 516 ILE A CA    1 
ATOM   2855 C C     . ILE C 3 331 ? 0.502   -2.864  28.548  1.00 37.40 ? 516 ILE A C     1 
ATOM   2856 O O     . ILE C 3 331 ? -0.192  -3.659  29.211  1.00 37.00 ? 516 ILE A O     1 
ATOM   2857 C CB    . ILE C 3 331 ? 0.428   -0.377  28.578  1.00 37.80 ? 516 ILE A CB    1 
ATOM   2858 C CG1   . ILE C 3 331 ? -0.138  -0.262  30.005  1.00 38.10 ? 516 ILE A CG1   1 
ATOM   2859 C CG2   . ILE C 3 331 ? 0.149   0.879   27.757  1.00 38.17 ? 516 ILE A CG2   1 
ATOM   2860 C CD1   . ILE C 3 331 ? 0.821   0.383   30.993  1.00 36.58 ? 516 ILE A CD1   1 
ATOM   2861 N N     . GLN C 3 332 ? 1.816   -2.995  28.382  1.00 37.06 ? 517 GLN A N     1 
ATOM   2862 C CA    . GLN C 3 332 ? 2.601   -3.996  29.089  1.00 37.05 ? 517 GLN A CA    1 
ATOM   2863 C C     . GLN C 3 332 ? 3.237   -3.332  30.297  1.00 36.86 ? 517 GLN A C     1 
ATOM   2864 O O     . GLN C 3 332 ? 3.908   -2.300  30.177  1.00 36.98 ? 517 GLN A O     1 
ATOM   2865 C CB    . GLN C 3 332 ? 3.667   -4.610  28.181  1.00 36.96 ? 517 GLN A CB    1 
ATOM   2866 C CG    . GLN C 3 332 ? 3.083   -5.422  27.022  1.00 37.82 ? 517 GLN A CG    1 
ATOM   2867 C CD    . GLN C 3 332 ? 4.144   -6.045  26.132  1.00 37.39 ? 517 GLN A CD    1 
ATOM   2868 O OE1   . GLN C 3 332 ? 4.909   -6.906  26.569  1.00 38.94 ? 517 GLN A OE1   1 
ATOM   2869 N NE2   . GLN C 3 332 ? 4.182   -5.626  24.877  1.00 35.48 ? 517 GLN A NE2   1 
ATOM   2870 N N     . HIS C 3 333 ? 2.996   -3.922  31.463  1.00 36.53 ? 518 HIS A N     1 
ATOM   2871 C CA    . HIS C 3 333 ? 3.508   -3.402  32.717  1.00 36.49 ? 518 HIS A CA    1 
ATOM   2872 C C     . HIS C 3 333 ? 4.514   -4.386  33.277  1.00 36.06 ? 518 HIS A C     1 
ATOM   2873 O O     . HIS C 3 333 ? 4.270   -5.598  33.272  1.00 35.98 ? 518 HIS A O     1 
ATOM   2874 C CB    . HIS C 3 333 ? 2.347   -3.192  33.693  1.00 37.01 ? 518 HIS A CB    1 
ATOM   2875 C CG    . HIS C 3 333 ? 2.757   -3.076  35.128  1.00 37.40 ? 518 HIS A CG    1 
ATOM   2876 N ND1   . HIS C 3 333 ? 3.538   -2.042  35.601  1.00 38.43 ? 518 HIS A ND1   1 
ATOM   2877 C CD2   . HIS C 3 333 ? 2.470   -3.852  36.200  1.00 37.58 ? 518 HIS A CD2   1 
ATOM   2878 C CE1   . HIS C 3 333 ? 3.723   -2.193  36.901  1.00 39.32 ? 518 HIS A CE1   1 
ATOM   2879 N NE2   . HIS C 3 333 ? 3.084   -3.283  37.289  1.00 39.63 ? 518 HIS A NE2   1 
ATOM   2880 N N     . GLN C 3 334 ? 5.650   -3.857  33.725  1.00 35.40 ? 519 GLN A N     1 
ATOM   2881 C CA    . GLN C 3 334 ? 6.687   -4.657  34.359  1.00 34.71 ? 519 GLN A CA    1 
ATOM   2882 C C     . GLN C 3 334 ? 6.544   -4.612  35.883  1.00 34.20 ? 519 GLN A C     1 
ATOM   2883 O O     . GLN C 3 334 ? 6.602   -3.539  36.500  1.00 34.00 ? 519 GLN A O     1 
ATOM   2884 C CB    . GLN C 3 334 ? 8.087   -4.202  33.913  1.00 34.65 ? 519 GLN A CB    1 
ATOM   2885 C CG    . GLN C 3 334 ? 9.218   -4.793  34.767  1.00 34.42 ? 519 GLN A CG    1 
ATOM   2886 C CD    . GLN C 3 334 ? 10.586  -4.716  34.112  1.00 34.80 ? 519 GLN A CD    1 
ATOM   2887 O OE1   . GLN C 3 334 ? 10.760  -5.069  32.948  1.00 35.21 ? 519 GLN A OE1   1 
ATOM   2888 N NE2   . GLN C 3 334 ? 11.570  -4.273  34.872  1.00 35.12 ? 519 GLN A NE2   1 
ATOM   2889 N N     . ALA C 3 335 ? 6.353   -5.786  36.477  1.00 33.77 ? 520 ALA A N     1 
ATOM   2890 C CA    . ALA C 3 335 ? 6.187   -5.915  37.930  1.00 33.30 ? 520 ALA A CA    1 
ATOM   2891 C C     . ALA C 3 335 ? 7.541   -5.981  38.658  1.00 33.30 ? 520 ALA A C     1 
ATOM   2892 O O     . ALA C 3 335 ? 8.594   -6.122  38.030  1.00 32.71 ? 520 ALA A O     1 
ATOM   2893 C CB    . ALA C 3 335 ? 5.346   -7.145  38.252  1.00 32.71 ? 520 ALA A CB    1 
ATOM   2894 N N     . THR C 3 336 ? 7.506   -5.874  39.985  1.00 33.32 ? 521 THR A N     1 
ATOM   2895 C CA    . THR C 3 336 ? 8.706   -6.078  40.785  1.00 33.46 ? 521 THR A CA    1 
ATOM   2896 C C     . THR C 3 336 ? 8.546   -7.311  41.668  1.00 33.11 ? 521 THR A C     1 
ATOM   2897 O O     . THR C 3 336 ? 7.499   -7.508  42.302  1.00 33.67 ? 521 THR A O     1 
ATOM   2898 C CB    . THR C 3 336 ? 9.090   -4.834  41.627  1.00 33.67 ? 521 THR A CB    1 
ATOM   2899 O OG1   . THR C 3 336 ? 7.910   -4.239  42.185  1.00 34.80 ? 521 THR A OG1   1 
ATOM   2900 C CG2   . THR C 3 336 ? 9.799   -3.808  40.762  1.00 33.74 ? 521 THR A CG2   1 
ATOM   2901 N N     . ALA C 3 337 ? 9.590   -8.135  41.689  1.00 32.18 ? 522 ALA A N     1 
ATOM   2902 C CA    . ALA C 3 337 ? 9.588   -9.396  42.410  1.00 31.17 ? 522 ALA A CA    1 
ATOM   2903 C C     . ALA C 3 337 ? 9.619   -9.147  43.910  1.00 30.37 ? 522 ALA A C     1 
ATOM   2904 O O     . ALA C 3 337 ? 10.216  -8.189  44.371  1.00 30.40 ? 522 ALA A O     1 
ATOM   2905 C CB    . ALA C 3 337 ? 10.778  -10.248 41.978  1.00 31.29 ? 522 ALA A CB    1 
ATOM   2906 N N     . ILE C 3 338 ? 8.933   -9.999  44.653  1.00 29.64 ? 523 ILE A N     1 
ATOM   2907 C CA    . ILE C 3 338 ? 8.919   -9.951  46.094  1.00 29.28 ? 523 ILE A CA    1 
ATOM   2908 C C     . ILE C 3 338 ? 9.527   -11.279 46.513  1.00 29.44 ? 523 ILE A C     1 
ATOM   2909 O O     . ILE C 3 338 ? 10.239  -11.382 47.513  1.00 28.43 ? 523 ILE A O     1 
ATOM   2910 C CB    . ILE C 3 338 ? 7.471   -9.835  46.650  1.00 29.28 ? 523 ILE A CB    1 
ATOM   2911 C CG1   . ILE C 3 338 ? 6.800   -8.528  46.204  1.00 29.66 ? 523 ILE A CG1   1 
ATOM   2912 C CG2   . ILE C 3 338 ? 7.444   -9.942  48.191  1.00 28.50 ? 523 ILE A CG2   1 
ATOM   2913 C CD1   . ILE C 3 338 ? 7.289   -7.279  46.975  1.00 32.25 ? 523 ILE A CD1   1 
ATOM   2914 N N     . ASN C 3 339 ? 9.269   -12.273 45.673  1.00 29.96 ? 524 ASN A N     1 
ATOM   2915 C CA    . ASN C 3 339 ? 9.462   -13.665 46.004  1.00 30.61 ? 524 ASN A CA    1 
ATOM   2916 C C     . ASN C 3 339 ? 9.709   -14.483 44.768  1.00 30.97 ? 524 ASN A C     1 
ATOM   2917 O O     . ASN C 3 339 ? 9.263   -14.104 43.669  1.00 30.32 ? 524 ASN A O     1 
ATOM   2918 C CB    . ASN C 3 339 ? 8.153   -14.202 46.604  1.00 30.71 ? 524 ASN A CB    1 
ATOM   2919 C CG    . ASN C 3 339 ? 8.088   -14.021 48.072  1.00 30.28 ? 524 ASN A CG    1 
ATOM   2920 O OD1   . ASN C 3 339 ? 7.023   -14.094 48.667  1.00 28.19 ? 524 ASN A OD1   1 
ATOM   2921 N ND2   . ASN C 3 339 ? 9.245   -13.781 48.687  1.00 31.60 ? 524 ASN A ND2   1 
ATOM   2922 N N     . GLU C 3 340 ? 10.361  -15.632 44.970  1.00 31.34 ? 525 GLU A N     1 
ATOM   2923 C CA    . GLU C 3 340 ? 10.314  -16.731 44.003  1.00 32.13 ? 525 GLU A CA    1 
ATOM   2924 C C     . GLU C 3 340 ? 8.857   -16.992 43.549  1.00 32.38 ? 525 GLU A C     1 
ATOM   2925 O O     . GLU C 3 340 ? 8.633   -17.315 42.382  1.00 32.66 ? 525 GLU A O     1 
ATOM   2926 C CB    . GLU C 3 340 ? 10.932  -18.027 44.573  1.00 32.32 ? 525 GLU A CB    1 
ATOM   2927 C CG    . GLU C 3 340 ? 12.346  -17.924 45.196  1.00 33.50 ? 525 GLU A CG    1 
ATOM   2928 C CD    . GLU C 3 340 ? 13.509  -18.270 44.228  1.00 35.24 ? 525 GLU A CD    1 
ATOM   2929 O OE1   . GLU C 3 340 ? 13.348  -18.129 42.993  1.00 36.53 ? 525 GLU A OE1   1 
ATOM   2930 O OE2   . GLU C 3 340 ? 14.595  -18.681 44.711  1.00 34.70 ? 525 GLU A OE2   1 
ATOM   2931 N N     . HIS C 3 341 ? 7.882   -16.816 44.455  1.00 32.74 ? 526 HIS A N     1 
ATOM   2932 C CA    . HIS C 3 341 ? 6.461   -17.124 44.181  1.00 33.10 ? 526 HIS A CA    1 
ATOM   2933 C C     . HIS C 3 341 ? 5.486   -15.928 44.199  1.00 33.10 ? 526 HIS A C     1 
ATOM   2934 O O     . HIS C 3 341 ? 4.268   -16.131 44.258  1.00 32.82 ? 526 HIS A O     1 
ATOM   2935 C CB    . HIS C 3 341 ? 5.898   -18.178 45.160  1.00 33.02 ? 526 HIS A CB    1 
ATOM   2936 C CG    . HIS C 3 341 ? 6.804   -19.335 45.424  1.00 35.64 ? 526 HIS A CG    1 
ATOM   2937 N ND1   . HIS C 3 341 ? 6.871   -19.951 46.657  1.00 37.64 ? 526 HIS A ND1   1 
ATOM   2938 C CD2   . HIS C 3 341 ? 7.697   -19.980 44.633  1.00 36.70 ? 526 HIS A CD2   1 
ATOM   2939 C CE1   . HIS C 3 341 ? 7.758   -20.929 46.612  1.00 37.20 ? 526 HIS A CE1   1 
ATOM   2940 N NE2   . HIS C 3 341 ? 8.275   -20.966 45.397  1.00 37.15 ? 526 HIS A NE2   1 
ATOM   2941 N N     . ARG C 3 342 ? 5.986   -14.698 44.126  1.00 33.46 ? 527 ARG A N     1 
ATOM   2942 C CA    . ARG C 3 342 ? 5.121   -13.533 44.354  1.00 33.74 ? 527 ARG A CA    1 
ATOM   2943 C C     . ARG C 3 342 ? 5.581   -12.272 43.592  1.00 33.70 ? 527 ARG A C     1 
ATOM   2944 O O     . ARG C 3 342 ? 6.735   -11.865 43.713  1.00 33.00 ? 527 ARG A O     1 
ATOM   2945 C CB    . ARG C 3 342 ? 5.053   -13.271 45.875  1.00 33.55 ? 527 ARG A CB    1 
ATOM   2946 C CG    . ARG C 3 342 ? 3.738   -12.794 46.443  1.00 35.83 ? 527 ARG A CG    1 
ATOM   2947 C CD    . ARG C 3 342 ? 2.516   -13.701 46.099  1.00 38.80 ? 527 ARG A CD    1 
ATOM   2948 N NE    . ARG C 3 342 ? 2.631   -15.025 46.709  1.00 40.47 ? 527 ARG A NE    1 
ATOM   2949 C CZ    . ARG C 3 342 ? 1.745   -15.549 47.546  1.00 40.89 ? 527 ARG A CZ    1 
ATOM   2950 N NH1   . ARG C 3 342 ? 0.645   -14.868 47.869  1.00 41.92 ? 527 ARG A NH1   1 
ATOM   2951 N NH2   . ARG C 3 342 ? 1.958   -16.759 48.049  1.00 39.50 ? 527 ARG A NH2   1 
ATOM   2952 N N     . HIS C 3 343 ? 4.683   -11.636 42.829  1.00 34.22 ? 528 HIS A N     1 
ATOM   2953 C CA    . HIS C 3 343 ? 5.039   -10.358 42.166  1.00 34.67 ? 528 HIS A CA    1 
ATOM   2954 C C     . HIS C 3 343 ? 4.179   -9.198  42.639  1.00 35.31 ? 528 HIS A C     1 
ATOM   2955 O O     . HIS C 3 343 ? 3.008   -9.392  42.893  1.00 36.09 ? 528 HIS A O     1 
ATOM   2956 C CB    . HIS C 3 343 ? 4.936   -10.455 40.644  1.00 34.20 ? 528 HIS A CB    1 
ATOM   2957 C CG    . HIS C 3 343 ? 5.870   -11.443 40.022  1.00 33.34 ? 528 HIS A CG    1 
ATOM   2958 N ND1   . HIS C 3 343 ? 6.949   -11.981 40.686  1.00 33.26 ? 528 HIS A ND1   1 
ATOM   2959 C CD2   . HIS C 3 343 ? 5.908   -11.960 38.773  1.00 33.62 ? 528 HIS A CD2   1 
ATOM   2960 C CE1   . HIS C 3 343 ? 7.596   -12.803 39.882  1.00 32.47 ? 528 HIS A CE1   1 
ATOM   2961 N NE2   . HIS C 3 343 ? 6.975   -12.819 38.718  1.00 31.71 ? 528 HIS A NE2   1 
ATOM   2962 N N     . GLN C 3 344 ? 4.758   -7.999  42.747  1.00 36.17 ? 529 GLN A N     1 
ATOM   2963 C CA    . GLN C 3 344 ? 3.998   -6.767  43.040  1.00 36.83 ? 529 GLN A CA    1 
ATOM   2964 C C     . GLN C 3 344 ? 3.544   -6.132  41.734  1.00 37.00 ? 529 GLN A C     1 
ATOM   2965 O O     . GLN C 3 344 ? 4.377   -5.798  40.888  1.00 36.84 ? 529 GLN A O     1 
ATOM   2966 C CB    . GLN C 3 344 ? 4.850   -5.740  43.798  1.00 37.24 ? 529 GLN A CB    1 
ATOM   2967 C CG    . GLN C 3 344 ? 4.632   -5.625  45.309  1.00 38.95 ? 529 GLN A CG    1 
ATOM   2968 C CD    . GLN C 3 344 ? 3.243   -5.136  45.688  1.00 40.57 ? 529 GLN A CD    1 
ATOM   2969 O OE1   . GLN C 3 344 ? 2.624   -4.360  44.962  1.00 41.90 ? 529 GLN A OE1   1 
ATOM   2970 N NE2   . GLN C 3 344 ? 2.747   -5.596  46.838  1.00 40.55 ? 529 GLN A NE2   1 
ATOM   2971 N N     . ILE C 3 345 ? 2.231   -5.951  41.565  1.00 37.37 ? 530 ILE A N     1 
ATOM   2972 C CA    . ILE C 3 345 ? 1.719   -5.282  40.364  1.00 37.24 ? 530 ILE A CA    1 
ATOM   2973 C C     . ILE C 3 345 ? 1.005   -3.960  40.659  1.00 37.74 ? 530 ILE A C     1 
ATOM   2974 O O     . ILE C 3 345 ? 0.586   -3.711  41.785  1.00 37.48 ? 530 ILE A O     1 
ATOM   2975 C CB    . ILE C 3 345 ? 0.810   -6.203  39.546  1.00 37.42 ? 530 ILE A CB    1 
ATOM   2976 C CG1   . ILE C 3 345 ? -0.139  -6.978  40.465  1.00 37.36 ? 530 ILE A CG1   1 
ATOM   2977 C CG2   . ILE C 3 345 ? 1.641   -7.154  38.675  1.00 35.87 ? 530 ILE A CG2   1 
ATOM   2978 C CD1   . ILE C 3 345 ? -1.398  -7.477  39.773  1.00 37.31 ? 530 ILE A CD1   1 
ATOM   2979 N N     . ASN C 3 346 ? 0.907   -3.102  39.643  1.00 38.55 ? 531 ASN A N     1 
ATOM   2980 C CA    . ASN C 3 346 ? 0.019   -1.935  39.677  1.00 39.35 ? 531 ASN A CA    1 
ATOM   2981 C C     . ASN C 3 346 ? -1.445  -2.372  39.732  1.00 39.40 ? 531 ASN A C     1 
ATOM   2982 O O     . ASN C 3 346 ? -1.768  -3.484  39.316  1.00 39.52 ? 531 ASN A O     1 
ATOM   2983 C CB    . ASN C 3 346 ? 0.210   -1.104  38.413  1.00 39.74 ? 531 ASN A CB    1 
ATOM   2984 C CG    . ASN C 3 346 ? 1.200   0.027   38.589  1.00 42.12 ? 531 ASN A CG    1 
ATOM   2985 O OD1   . ASN C 3 346 ? 1.878   0.148   39.622  1.00 44.34 ? 531 ASN A OD1   1 
ATOM   2986 N ND2   . ASN C 3 346 ? 1.283   0.884   37.570  1.00 43.49 ? 531 ASN A ND2   1 
ATOM   2987 N N     . ASP C 3 347 ? -2.325  -1.489  40.211  1.00 39.39 ? 532 ASP A N     1 
ATOM   2988 C CA    . ASP C 3 347 ? -3.770  -1.743  40.229  1.00 39.44 ? 532 ASP A CA    1 
ATOM   2989 C C     . ASP C 3 347 ? -4.331  -2.071  38.854  1.00 38.77 ? 532 ASP A C     1 
ATOM   2990 O O     . ASP C 3 347 ? -5.320  -2.811  38.744  1.00 39.08 ? 532 ASP A O     1 
ATOM   2991 C CB    . ASP C 3 347 ? -4.536  -0.533  40.757  1.00 39.86 ? 532 ASP A CB    1 
ATOM   2992 C CG    . ASP C 3 347 ? -4.300  -0.285  42.231  1.00 42.28 ? 532 ASP A CG    1 
ATOM   2993 O OD1   . ASP C 3 347 ? -3.183  0.182   42.589  1.00 44.01 ? 532 ASP A OD1   1 
ATOM   2994 O OD2   . ASP C 3 347 ? -5.252  -0.528  43.021  1.00 43.33 ? 532 ASP A OD2   1 
ATOM   2995 N N     . GLY C 3 348 ? -3.713  -1.499  37.821  1.00 37.43 ? 533 GLY A N     1 
ATOM   2996 C CA    . GLY C 3 348 ? -4.175  -1.648  36.455  1.00 36.43 ? 533 GLY A CA    1 
ATOM   2997 C C     . GLY C 3 348 ? -3.925  -3.026  35.889  1.00 36.11 ? 533 GLY A C     1 
ATOM   2998 O O     . GLY C 3 348 ? -4.453  -3.372  34.829  1.00 35.78 ? 533 GLY A O     1 
ATOM   2999 N N     . ALA C 3 349 ? -3.119  -3.815  36.599  1.00 35.74 ? 534 ALA A N     1 
ATOM   3000 C CA    . ALA C 3 349 ? -2.779  -5.164  36.164  1.00 35.27 ? 534 ALA A CA    1 
ATOM   3001 C C     . ALA C 3 349 ? -3.626  -6.227  36.850  1.00 35.03 ? 534 ALA A C     1 
ATOM   3002 O O     . ALA C 3 349 ? -3.462  -7.411  36.563  1.00 35.29 ? 534 ALA A O     1 
ATOM   3003 C CB    . ALA C 3 349 ? -1.285  -5.445  36.379  1.00 35.48 ? 534 ALA A CB    1 
ATOM   3004 N N     . ALA C 3 350 ? -4.527  -5.821  37.743  1.00 34.58 ? 535 ALA A N     1 
ATOM   3005 C CA    . ALA C 3 350 ? -5.405  -6.792  38.413  1.00 34.73 ? 535 ALA A CA    1 
ATOM   3006 C C     . ALA C 3 350 ? -6.799  -6.814  37.796  1.00 34.77 ? 535 ALA A C     1 
ATOM   3007 O O     . ALA C 3 350 ? -7.551  -5.849  37.933  1.00 35.55 ? 535 ALA A O     1 
ATOM   3008 C CB    . ALA C 3 350 ? -5.479  -6.530  39.917  1.00 34.10 ? 535 ALA A CB    1 
ATOM   3009 N N     . TRP C 3 351 ? -7.139  -7.921  37.134  1.00 34.22 ? 536 TRP A N     1 
ATOM   3010 C CA    . TRP C 3 351 ? -8.376  -8.016  36.352  1.00 33.75 ? 536 TRP A CA    1 
ATOM   3011 C C     . TRP C 3 351 ? -9.392  -8.873  37.068  1.00 33.85 ? 536 TRP A C     1 
ATOM   3012 O O     . TRP C 3 351 ? -9.069  -9.550  38.048  1.00 34.71 ? 536 TRP A O     1 
ATOM   3013 C CB    . TRP C 3 351 ? -8.100  -8.608  34.963  1.00 33.45 ? 536 TRP A CB    1 
ATOM   3014 C CG    . TRP C 3 351 ? -7.223  -7.742  34.156  1.00 33.16 ? 536 TRP A CG    1 
ATOM   3015 C CD1   . TRP C 3 351 ? -5.845  -7.755  34.124  1.00 33.69 ? 536 TRP A CD1   1 
ATOM   3016 C CD2   . TRP C 3 351 ? -7.635  -6.695  33.285  1.00 33.06 ? 536 TRP A CD2   1 
ATOM   3017 N NE1   . TRP C 3 351 ? -5.387  -6.781  33.273  1.00 32.96 ? 536 TRP A NE1   1 
ATOM   3018 C CE2   . TRP C 3 351 ? -6.465  -6.115  32.746  1.00 33.55 ? 536 TRP A CE2   1 
ATOM   3019 C CE3   . TRP C 3 351 ? -8.884  -6.178  32.907  1.00 33.48 ? 536 TRP A CE3   1 
ATOM   3020 C CZ2   . TRP C 3 351 ? -6.511  -5.047  31.849  1.00 33.49 ? 536 TRP A CZ2   1 
ATOM   3021 C CZ3   . TRP C 3 351 ? -8.926  -5.119  32.006  1.00 32.73 ? 536 TRP A CZ3   1 
ATOM   3022 C CH2   . TRP C 3 351 ? -7.752  -4.565  31.494  1.00 33.79 ? 536 TRP A CH2   1 
ATOM   3023 N N     . THR C 3 352 ? -10.630 -8.856  36.592  1.00 32.73 ? 537 THR A N     1 
ATOM   3024 C CA    . THR C 3 352 ? -11.634 -9.705  37.185  1.00 31.95 ? 537 THR A CA    1 
ATOM   3025 C C     . THR C 3 352 ? -12.255 -10.344 36.001  1.00 32.15 ? 537 THR A C     1 
ATOM   3026 O O     . THR C 3 352 ? -12.545 -9.663  35.032  1.00 33.34 ? 537 THR A O     1 
ATOM   3027 C CB    . THR C 3 352 ? -12.668 -8.917  38.018  1.00 32.10 ? 537 THR A CB    1 
ATOM   3028 O OG1   . THR C 3 352 ? -11.991 -8.147  39.025  1.00 30.97 ? 537 THR A OG1   1 
ATOM   3029 C CG2   . THR C 3 352 ? -13.612 -9.859  38.721  1.00 30.72 ? 537 THR A CG2   1 
ATOM   3030 N N     . ILE C 3 353 ? -12.381 -11.665 36.058  1.00 31.70 ? 538 ILE A N     1 
ATOM   3031 C CA    . ILE C 3 353 ? -12.841 -12.463 34.958  1.00 31.08 ? 538 ILE A CA    1 
ATOM   3032 C C     . ILE C 3 353 ? -14.180 -13.081 35.316  1.00 31.30 ? 538 ILE A C     1 
ATOM   3033 O O     . ILE C 3 353 ? -14.385 -13.518 36.463  1.00 31.44 ? 538 ILE A O     1 
ATOM   3034 C CB    . ILE C 3 353 ? -11.802 -13.577 34.642  1.00 31.64 ? 538 ILE A CB    1 
ATOM   3035 C CG1   . ILE C 3 353 ? -12.021 -14.120 33.219  1.00 31.96 ? 538 ILE A CG1   1 
ATOM   3036 C CG2   . ILE C 3 353 ? -11.826 -14.695 35.715  1.00 30.06 ? 538 ILE A CG2   1 
ATOM   3037 C CD1   . ILE C 3 353 ? -11.001 -15.102 32.741  1.00 30.94 ? 538 ILE A CD1   1 
ATOM   3038 N N     . ILE C 3 354 ? -15.097 -13.101 34.343  1.00 30.83 ? 539 ILE A N     1 
ATOM   3039 C CA    . ILE C 3 354 ? -16.460 -13.602 34.534  1.00 29.35 ? 539 ILE A CA    1 
ATOM   3040 C C     . ILE C 3 354 ? -16.941 -14.125 33.187  1.00 29.72 ? 539 ILE A C     1 
ATOM   3041 O O     . ILE C 3 354 ? -16.667 -13.490 32.186  1.00 29.66 ? 539 ILE A O     1 
ATOM   3042 C CB    . ILE C 3 354 ? -17.399 -12.478 35.084  1.00 29.31 ? 539 ILE A CB    1 
ATOM   3043 C CG1   . ILE C 3 354 ? -18.812 -12.982 35.383  1.00 28.42 ? 539 ILE A CG1   1 
ATOM   3044 C CG2   . ILE C 3 354 ? -17.513 -11.290 34.141  1.00 28.23 ? 539 ILE A CG2   1 
ATOM   3045 C CD1   . ILE C 3 354 ? -19.531 -12.095 36.393  1.00 26.22 ? 539 ILE A CD1   1 
ATOM   3046 N N     . SER C 3 355 ? -17.606 -15.283 33.164  1.00 29.71 ? 540 SER A N     1 
ATOM   3047 C CA    . SER C 3 355 ? -18.226 -15.828 31.945  1.00 30.42 ? 540 SER A CA    1 
ATOM   3048 C C     . SER C 3 355 ? -19.413 -14.981 31.554  1.00 31.59 ? 540 SER A C     1 
ATOM   3049 O O     . SER C 3 355 ? -20.176 -14.544 32.438  1.00 32.09 ? 540 SER A O     1 
ATOM   3050 C CB    . SER C 3 355 ? -18.761 -17.227 32.191  1.00 29.47 ? 540 SER A CB    1 
ATOM   3051 O OG    . SER C 3 355 ? -17.750 -18.083 32.674  1.00 30.36 ? 540 SER A OG    1 
ATOM   3052 N N     . THR C 3 356 ? -19.594 -14.758 30.257  1.00 31.73 ? 541 THR A N     1 
ATOM   3053 C CA    . THR C 3 356 ? -20.739 -13.995 29.797  1.00 32.64 ? 541 THR A CA    1 
ATOM   3054 C C     . THR C 3 356 ? -21.646 -14.706 28.778  1.00 32.55 ? 541 THR A C     1 
ATOM   3055 O O     . THR C 3 356 ? -21.318 -15.754 28.241  1.00 32.12 ? 541 THR A O     1 
ATOM   3056 C CB    . THR C 3 356 ? -20.292 -12.641 29.246  1.00 33.13 ? 541 THR A CB    1 
ATOM   3057 O OG1   . THR C 3 356 ? -19.414 -12.860 28.140  1.00 34.15 ? 541 THR A OG1   1 
ATOM   3058 C CG2   . THR C 3 356 ? -19.565 -11.842 30.351  1.00 33.96 ? 541 THR A CG2   1 
ATOM   3059 N N     . ASP C 3 357 ? -22.797 -14.110 28.524  1.00 33.22 ? 542 ASP A N     1 
ATOM   3060 C CA    . ASP C 3 357 ? -23.765 -14.682 27.607  1.00 34.15 ? 542 ASP A CA    1 
ATOM   3061 C C     . ASP C 3 357 ? -24.452 -13.582 26.842  1.00 34.57 ? 542 ASP A C     1 
ATOM   3062 O O     . ASP C 3 357 ? -24.280 -12.405 27.148  1.00 34.77 ? 542 ASP A O     1 
ATOM   3063 C CB    . ASP C 3 357 ? -24.803 -15.521 28.358  1.00 34.13 ? 542 ASP A CB    1 
ATOM   3064 C CG    . ASP C 3 357 ? -25.274 -16.715 27.556  1.00 35.05 ? 542 ASP A CG    1 
ATOM   3065 O OD1   . ASP C 3 357 ? -25.368 -16.599 26.311  1.00 36.10 ? 542 ASP A OD1   1 
ATOM   3066 O OD2   . ASP C 3 357 ? -25.558 -17.770 28.165  1.00 35.96 ? 542 ASP A OD2   1 
ATOM   3067 N N     . LYS C 3 358 ? -25.238 -13.980 25.850  1.00 35.35 ? 543 LYS A N     1 
ATOM   3068 C CA    . LYS C 3 358 ? -25.916 -13.056 24.964  1.00 36.10 ? 543 LYS A CA    1 
ATOM   3069 C C     . LYS C 3 358 ? -27.288 -13.610 24.598  1.00 36.31 ? 543 LYS A C     1 
ATOM   3070 O O     . LYS C 3 358 ? -27.461 -14.816 24.495  1.00 36.59 ? 543 LYS A O     1 
ATOM   3071 C CB    . LYS C 3 358 ? -25.050 -12.856 23.722  1.00 36.75 ? 543 LYS A CB    1 
ATOM   3072 C CG    . LYS C 3 358 ? -25.781 -12.777 22.398  1.00 38.19 ? 543 LYS A CG    1 
ATOM   3073 C CD    . LYS C 3 358 ? -24.863 -13.215 21.261  1.00 40.98 ? 543 LYS A CD    1 
ATOM   3074 C CE    . LYS C 3 358 ? -24.354 -12.033 20.457  1.00 43.35 ? 543 LYS A CE    1 
ATOM   3075 N NZ    . LYS C 3 358 ? -25.450 -11.391 19.650  1.00 45.94 ? 543 LYS A NZ    1 
ATOM   3076 N N     . ALA C 3 359 ? -28.267 -12.729 24.432  1.00 36.55 ? 544 ALA A N     1 
ATOM   3077 C CA    . ALA C 3 359 ? -29.581 -13.128 23.953  1.00 36.76 ? 544 ALA A CA    1 
ATOM   3078 C C     . ALA C 3 359 ? -29.906 -12.257 22.775  1.00 37.15 ? 544 ALA A C     1 
ATOM   3079 O O     . ALA C 3 359 ? -30.032 -11.041 22.934  1.00 37.93 ? 544 ALA A O     1 
ATOM   3080 C CB    . ALA C 3 359 ? -30.637 -12.955 25.024  1.00 36.83 ? 544 ALA A CB    1 
ATOM   3081 N N     . GLU C 3 360 ? -30.038 -12.869 21.597  1.00 36.69 ? 545 GLU A N     1 
ATOM   3082 C CA    . GLU C 3 360 ? -30.355 -12.117 20.404  1.00 36.55 ? 545 GLU A CA    1 
ATOM   3083 C C     . GLU C 3 360 ? -31.772 -12.362 19.879  1.00 36.00 ? 545 GLU A C     1 
ATOM   3084 O O     . GLU C 3 360 ? -32.261 -13.498 19.852  1.00 35.79 ? 545 GLU A O     1 
ATOM   3085 C CB    . GLU C 3 360 ? -29.333 -12.418 19.328  1.00 37.00 ? 545 GLU A CB    1 
ATOM   3086 C CG    . GLU C 3 360 ? -29.319 -11.409 18.215  1.00 38.47 ? 545 GLU A CG    1 
ATOM   3087 C CD    . GLU C 3 360 ? -28.185 -11.647 17.238  1.00 42.23 ? 545 GLU A CD    1 
ATOM   3088 O OE1   . GLU C 3 360 ? -27.015 -11.752 17.685  1.00 43.81 ? 545 GLU A OE1   1 
ATOM   3089 O OE2   . GLU C 3 360 ? -28.464 -11.716 16.020  1.00 43.10 ? 545 GLU A OE2   1 
ATOM   3090 N N     . TYR C 3 361 ? -32.426 -11.286 19.453  1.00 35.41 ? 546 TYR A N     1 
ATOM   3091 C CA    . TYR C 3 361 ? -33.775 -11.379 18.899  1.00 34.52 ? 546 TYR A CA    1 
ATOM   3092 C C     . TYR C 3 361 ? -33.855 -10.640 17.581  1.00 34.56 ? 546 TYR A C     1 
ATOM   3093 O O     . TYR C 3 361 ? -33.291 -9.552  17.442  1.00 34.37 ? 546 TYR A O     1 
ATOM   3094 C CB    . TYR C 3 361 ? -34.803 -10.818 19.880  1.00 33.57 ? 546 TYR A CB    1 
ATOM   3095 C CG    . TYR C 3 361 ? -34.783 -11.500 21.228  1.00 33.17 ? 546 TYR A CG    1 
ATOM   3096 C CD1   . TYR C 3 361 ? -33.985 -11.006 22.270  1.00 32.53 ? 546 TYR A CD1   1 
ATOM   3097 C CD2   . TYR C 3 361 ? -35.559 -12.633 21.469  1.00 31.82 ? 546 TYR A CD2   1 
ATOM   3098 C CE1   . TYR C 3 361 ? -33.954 -11.630 23.514  1.00 31.57 ? 546 TYR A CE1   1 
ATOM   3099 C CE2   . TYR C 3 361 ? -35.535 -13.259 22.710  1.00 33.14 ? 546 TYR A CE2   1 
ATOM   3100 C CZ    . TYR C 3 361 ? -34.723 -12.751 23.719  1.00 31.90 ? 546 TYR A CZ    1 
ATOM   3101 O OH    . TYR C 3 361 ? -34.693 -13.359 24.922  1.00 31.96 ? 546 TYR A OH    1 
ATOM   3102 N N     . ARG C 3 362 ? -34.564 -11.235 16.622  1.00 34.95 ? 547 ARG A N     1 
ATOM   3103 C CA    . ARG C 3 362 ? -34.739 -10.648 15.290  1.00 35.35 ? 547 ARG A CA    1 
ATOM   3104 C C     . ARG C 3 362 ? -36.181 -10.722 14.846  1.00 35.34 ? 547 ARG A C     1 
ATOM   3105 O O     . ARG C 3 362 ? -36.829 -11.766 14.963  1.00 35.19 ? 547 ARG A O     1 
ATOM   3106 C CB    . ARG C 3 362 ? -33.836 -11.322 14.258  1.00 35.06 ? 547 ARG A CB    1 
ATOM   3107 C CG    . ARG C 3 362 ? -32.364 -11.224 14.616  1.00 37.83 ? 547 ARG A CG    1 
ATOM   3108 C CD    . ARG C 3 362 ? -31.475 -11.495 13.447  1.00 40.74 ? 547 ARG A CD    1 
ATOM   3109 N NE    . ARG C 3 362 ? -31.314 -12.919 13.199  1.00 44.39 ? 547 ARG A NE    1 
ATOM   3110 C CZ    . ARG C 3 362 ? -30.151 -13.558 13.287  1.00 47.23 ? 547 ARG A CZ    1 
ATOM   3111 N NH1   . ARG C 3 362 ? -29.042 -12.893 13.613  1.00 47.67 ? 547 ARG A NH1   1 
ATOM   3112 N NH2   . ARG C 3 362 ? -30.092 -14.863 13.034  1.00 48.93 ? 547 ARG A NH2   1 
ATOM   3113 N N     . PHE C 3 363 ? -36.668 -9.600  14.333  1.00 35.41 ? 548 PHE A N     1 
ATOM   3114 C CA    . PHE C 3 363 ? -38.025 -9.481  13.860  1.00 36.06 ? 548 PHE A CA    1 
ATOM   3115 C C     . PHE C 3 363 ? -38.084 -8.406  12.780  1.00 36.91 ? 548 PHE A C     1 
ATOM   3116 O O     . PHE C 3 363 ? -37.225 -7.516  12.735  1.00 37.05 ? 548 PHE A O     1 
ATOM   3117 C CB    . PHE C 3 363 ? -38.961 -9.100  15.013  1.00 35.55 ? 548 PHE A CB    1 
ATOM   3118 C CG    . PHE C 3 363 ? -38.687 -7.743  15.586  1.00 35.05 ? 548 PHE A CG    1 
ATOM   3119 C CD1   . PHE C 3 363 ? -39.360 -6.624  15.110  1.00 35.34 ? 548 PHE A CD1   1 
ATOM   3120 C CD2   . PHE C 3 363 ? -37.747 -7.579  16.596  1.00 34.67 ? 548 PHE A CD2   1 
ATOM   3121 C CE1   . PHE C 3 363 ? -39.102 -5.362  15.633  1.00 35.91 ? 548 PHE A CE1   1 
ATOM   3122 C CE2   . PHE C 3 363 ? -37.483 -6.325  17.130  1.00 34.71 ? 548 PHE A CE2   1 
ATOM   3123 C CZ    . PHE C 3 363 ? -38.154 -5.216  16.654  1.00 35.31 ? 548 PHE A CZ    1 
ATOM   3124 N N     . PHE C 3 364 ? -39.099 -8.500  11.923  1.00 37.58 ? 549 PHE A N     1 
ATOM   3125 C CA    . PHE C 3 364 ? -39.445 -7.439  10.979  1.00 38.68 ? 549 PHE A CA    1 
ATOM   3126 C C     . PHE C 3 364 ? -40.951 -7.450  10.671  1.00 39.67 ? 549 PHE A C     1 
ATOM   3127 O O     . PHE C 3 364 ? -41.495 -8.458  10.197  1.00 39.13 ? 549 PHE A O     1 
ATOM   3128 C CB    . PHE C 3 364 ? -38.625 -7.564  9.691   1.00 38.40 ? 549 PHE A CB    1 
ATOM   3129 C CG    . PHE C 3 364 ? -39.130 -6.708  8.548   1.00 38.21 ? 549 PHE A CG    1 
ATOM   3130 C CD1   . PHE C 3 364 ? -39.316 -5.333  8.706   1.00 37.88 ? 549 PHE A CD1   1 
ATOM   3131 C CD2   . PHE C 3 364 ? -39.393 -7.279  7.305   1.00 37.47 ? 549 PHE A CD2   1 
ATOM   3132 C CE1   . PHE C 3 364 ? -39.771 -4.543  7.651   1.00 38.16 ? 549 PHE A CE1   1 
ATOM   3133 C CE2   . PHE C 3 364 ? -39.846 -6.498  6.238   1.00 38.59 ? 549 PHE A CE2   1 
ATOM   3134 C CZ    . PHE C 3 364 ? -40.041 -5.127  6.412   1.00 38.37 ? 549 PHE A CZ    1 
ATOM   3135 N N     . GLU C 3 365 ? -41.612 -6.323  10.937  1.00 41.10 ? 550 GLU A N     1 
ATOM   3136 C CA    . GLU C 3 365 ? -43.055 -6.171  10.681  1.00 43.26 ? 550 GLU A CA    1 
ATOM   3137 C C     . GLU C 3 365 ? -43.318 -6.115  9.160   1.00 43.38 ? 550 GLU A C     1 
ATOM   3138 O O     . GLU C 3 365 ? -43.513 -5.020  8.569   1.00 43.61 ? 550 GLU A O     1 
ATOM   3139 C CB    . GLU C 3 365 ? -43.622 -4.921  11.381  1.00 42.87 ? 550 GLU A CB    1 
ATOM   3140 C CG    . GLU C 3 365 ? -43.085 -4.634  12.813  1.00 45.53 ? 550 GLU A CG    1 
ATOM   3141 C CD    . GLU C 3 365 ? -43.550 -3.271  13.344  1.00 45.95 ? 550 GLU A CD    1 
ATOM   3142 O OE1   . GLU C 3 365 ? -43.676 -3.162  14.638  1.00 48.95 ? 550 GLU A OE1   1 
ATOM   3143 O OE2   . GLU C 3 365 ? -43.819 -2.313  12.463  1.00 50.72 ? 550 GLU A OE2   1 
ATOM   3144 N N     . ALA C 3 366 ? -43.347 -7.300  8.538   1.00 43.81 ? 551 ALA A N     1 
ATOM   3145 C CA    . ALA C 3 366 ? -43.211 -7.436  7.083   1.00 44.17 ? 551 ALA A CA    1 
ATOM   3146 C C     . ALA C 3 366 ? -44.329 -6.782  6.271   1.00 44.64 ? 551 ALA A C     1 
ATOM   3147 O O     . ALA C 3 366 ? -44.078 -6.222  5.197   1.00 44.83 ? 551 ALA A O     1 
ATOM   3148 C CB    . ALA C 3 366 ? -43.051 -8.892  6.699   1.00 44.05 ? 551 ALA A CB    1 
ATOM   3149 N N     . MET C 3 367 ? -45.561 -6.876  6.766   1.00 45.04 ? 552 MET A N     1 
ATOM   3150 C CA    . MET C 3 367 ? -46.666 -6.107  6.195   1.00 45.30 ? 552 MET A CA    1 
ATOM   3151 C C     . MET C 3 367 ? -46.573 -4.700  6.781   1.00 45.71 ? 552 MET A C     1 
ATOM   3152 O O     . MET C 3 367 ? -45.455 -4.050  6.726   1.00 46.15 ? 552 MET A O     1 
ATOM   3153 C CB    . MET C 3 367 ? -48.018 -6.766  6.508   1.00 44.96 ? 552 MET A CB    1 
ATOM   3154 C CG    . MET C 3 367 ? -48.146 -8.197  5.981   1.00 44.50 ? 552 MET A CG    1 
ATOM   3155 S SD    . MET C 3 367 ? -47.771 -8.388  4.204   1.00 43.58 ? 552 MET A SD    1 
ATOM   3156 C CE    . MET C 3 367 ? -49.279 -7.747  3.435   1.00 42.83 ? 552 MET A CE    1 
ATOM   3157 N N     . GLY C 3 368 ? -47.713 -4.224  7.353   1.00 46.11 ? 553 GLY A N     1 
ATOM   3158 C CA    . GLY C 3 368 ? -47.644 -2.934  8.014   1.00 46.51 ? 553 GLY A CA    1 
ATOM   3159 C C     . GLY C 3 368 ? -46.893 -2.993  9.339   1.00 47.35 ? 553 GLY A C     1 
ATOM   3160 O O     . GLY C 3 368 ? -46.412 -4.074  9.809   1.00 46.94 ? 553 GLY A O     1 
ATOM   3161 N N     . GLN C 3 369 ? -46.767 -1.807  9.935   1.00 47.60 ? 554 GLN A N     1 
ATOM   3162 C CA    . GLN C 3 369 ? -46.425 -1.724  11.322  1.00 48.10 ? 554 GLN A CA    1 
ATOM   3163 C C     . GLN C 3 369 ? -47.640 -2.174  12.151  1.00 47.97 ? 554 GLN A C     1 
ATOM   3164 O O     . GLN C 3 369 ? -48.784 -1.853  11.820  1.00 48.17 ? 554 GLN A O     1 
ATOM   3165 C CB    . GLN C 3 369 ? -45.921 -0.310  11.654  1.00 48.67 ? 554 GLN A CB    1 
ATOM   3166 C CG    . GLN C 3 369 ? -46.943 0.714   12.086  1.00 49.46 ? 554 GLN A CG    1 
ATOM   3167 C CD    . GLN C 3 369 ? -46.913 0.919   13.581  1.00 51.30 ? 554 GLN A CD    1 
ATOM   3168 O OE1   . GLN C 3 369 ? -45.888 1.325   14.154  1.00 52.38 ? 554 GLN A OE1   1 
ATOM   3169 N NE2   . GLN C 3 369 ? -48.034 0.629   14.233  1.00 52.20 ? 554 GLN A NE2   1 
ATOM   3170 N N     . VAL C 3 370 ? -47.387 -2.937  13.211  1.00 48.05 ? 555 VAL A N     1 
ATOM   3171 C CA    . VAL C 3 370 ? -48.456 -3.651  13.919  1.00 47.72 ? 555 VAL A CA    1 
ATOM   3172 C C     . VAL C 3 370 ? -48.894 -2.967  15.204  1.00 47.35 ? 555 VAL A C     1 
ATOM   3173 O O     . VAL C 3 370 ? -48.104 -2.286  15.844  1.00 47.66 ? 555 VAL A O     1 
ATOM   3174 C CB    . VAL C 3 370 ? -48.070 -5.126  14.197  1.00 47.83 ? 555 VAL A CB    1 
ATOM   3175 C CG1   . VAL C 3 370 ? -48.233 -5.959  12.923  1.00 47.96 ? 555 VAL A CG1   1 
ATOM   3176 C CG2   . VAL C 3 370 ? -46.650 -5.221  14.734  1.00 47.24 ? 555 VAL A CG2   1 
ATOM   3177 N N     . ALA C 3 371 ? -50.160 -3.158  15.562  1.00 46.98 ? 556 ALA A N     1 
ATOM   3178 C CA    . ALA C 3 371 ? -50.758 -2.535  16.741  1.00 46.48 ? 556 ALA A CA    1 
ATOM   3179 C C     . ALA C 3 371 ? -50.240 -3.169  18.016  1.00 46.12 ? 556 ALA A C     1 
ATOM   3180 O O     . ALA C 3 371 ? -50.000 -2.476  19.007  1.00 46.30 ? 556 ALA A O     1 
ATOM   3181 C CB    . ALA C 3 371 ? -52.275 -2.637  16.682  1.00 46.63 ? 556 ALA A CB    1 
ATOM   3182 N N     . ASN C 3 372 ? -50.061 -4.486  17.988  1.00 45.54 ? 557 ASN A N     1 
ATOM   3183 C CA    . ASN C 3 372 ? -49.558 -5.213  19.149  1.00 44.81 ? 557 ASN A CA    1 
ATOM   3184 C C     . ASN C 3 372 ? -48.048 -5.109  19.299  1.00 44.68 ? 557 ASN A C     1 
ATOM   3185 O O     . ASN C 3 372 ? -47.339 -4.868  18.321  1.00 44.77 ? 557 ASN A O     1 
ATOM   3186 C CB    . ASN C 3 372 ? -49.973 -6.683  19.089  1.00 44.64 ? 557 ASN A CB    1 
ATOM   3187 C CG    . ASN C 3 372 ? -51.430 -6.887  19.431  1.00 44.38 ? 557 ASN A CG    1 
ATOM   3188 O OD1   . ASN C 3 372 ? -52.131 -7.637  18.762  1.00 43.05 ? 557 ASN A OD1   1 
ATOM   3189 N ND2   . ASN C 3 372 ? -51.895 -6.213  20.476  1.00 44.14 ? 557 ASN A ND2   1 
ATOM   3190 N N     . PRO C 3 373 ? -47.547 -5.282  20.534  1.00 44.27 ? 558 PRO A N     1 
ATOM   3191 C CA    . PRO C 3 373 ? -46.109 -5.417  20.692  1.00 43.75 ? 558 PRO A CA    1 
ATOM   3192 C C     . PRO C 3 373 ? -45.587 -6.636  19.926  1.00 43.35 ? 558 PRO A C     1 
ATOM   3193 O O     . PRO C 3 373 ? -46.289 -7.646  19.836  1.00 42.76 ? 558 PRO A O     1 
ATOM   3194 C CB    . PRO C 3 373 ? -45.940 -5.618  22.205  1.00 43.86 ? 558 PRO A CB    1 
ATOM   3195 C CG    . PRO C 3 373 ? -47.284 -6.031  22.711  1.00 44.54 ? 558 PRO A CG    1 
ATOM   3196 C CD    . PRO C 3 373 ? -48.264 -5.349  21.822  1.00 44.05 ? 558 PRO A CD    1 
ATOM   3197 N N     . ILE C 3 374 ? -44.369 -6.548  19.379  1.00 43.17 ? 559 ILE A N     1 
ATOM   3198 C CA    . ILE C 3 374 ? -43.768 -7.717  18.707  1.00 42.86 ? 559 ILE A CA    1 
ATOM   3199 C C     . ILE C 3 374 ? -43.260 -8.798  19.685  1.00 42.05 ? 559 ILE A C     1 
ATOM   3200 O O     . ILE C 3 374 ? -42.879 -9.896  19.262  1.00 42.00 ? 559 ILE A O     1 
ATOM   3201 C CB    . ILE C 3 374 ? -42.669 -7.367  17.623  1.00 43.14 ? 559 ILE A CB    1 
ATOM   3202 C CG1   . ILE C 3 374 ? -41.275 -7.203  18.245  1.00 43.83 ? 559 ILE A CG1   1 
ATOM   3203 C CG2   . ILE C 3 374 ? -43.097 -6.206  16.712  1.00 42.91 ? 559 ILE A CG2   1 
ATOM   3204 C CD1   . ILE C 3 374 ? -41.029 -5.890  18.929  1.00 46.38 ? 559 ILE A CD1   1 
ATOM   3205 N N     . SER C 3 375 ? -43.268 -8.503  20.984  1.00 41.35 ? 560 SER A N     1 
ATOM   3206 C CA    . SER C 3 375 ? -42.920 -9.533  21.958  1.00 40.80 ? 560 SER A CA    1 
ATOM   3207 C C     . SER C 3 375 ? -44.170 -10.355 22.248  1.00 40.81 ? 560 SER A C     1 
ATOM   3208 O O     . SER C 3 375 ? -45.281 -9.833  22.140  1.00 40.97 ? 560 SER A O     1 
ATOM   3209 C CB    . SER C 3 375 ? -42.339 -8.923  23.228  1.00 40.37 ? 560 SER A CB    1 
ATOM   3210 O OG    . SER C 3 375 ? -43.285 -8.144  23.932  1.00 40.24 ? 560 SER A OG    1 
ATOM   3211 N N     . PRO C 3 376 ? -44.009 -11.643 22.606  1.00 40.72 ? 561 PRO A N     1 
ATOM   3212 C CA    . PRO C 3 376 ? -42.750 -12.350 22.800  1.00 40.73 ? 561 PRO A CA    1 
ATOM   3213 C C     . PRO C 3 376 ? -42.208 -12.969 21.508  1.00 40.91 ? 561 PRO A C     1 
ATOM   3214 O O     . PRO C 3 376 ? -42.930 -13.693 20.827  1.00 40.90 ? 561 PRO A O     1 
ATOM   3215 C CB    . PRO C 3 376 ? -43.137 -13.448 23.790  1.00 40.71 ? 561 PRO A CB    1 
ATOM   3216 C CG    . PRO C 3 376 ? -44.568 -13.759 23.457  1.00 40.46 ? 561 PRO A CG    1 
ATOM   3217 C CD    . PRO C 3 376 ? -45.172 -12.516 22.861  1.00 40.27 ? 561 PRO A CD    1 
ATOM   3218 N N     . CYS C 3 377 ? -40.948 -12.682 21.183  1.00 41.13 ? 562 CYS A N     1 
ATOM   3219 C CA    . CYS C 3 377 ? -40.283 -13.326 20.057  1.00 41.51 ? 562 CYS A CA    1 
ATOM   3220 C C     . CYS C 3 377 ? -40.090 -14.794 20.365  1.00 41.33 ? 562 CYS A C     1 
ATOM   3221 O O     . CYS C 3 377 ? -39.673 -15.138 21.463  1.00 41.75 ? 562 CYS A O     1 
ATOM   3222 C CB    . CYS C 3 377 ? -38.910 -12.716 19.805  1.00 41.58 ? 562 CYS A CB    1 
ATOM   3223 S SG    . CYS C 3 377 ? -38.907 -10.952 19.547  1.00 43.73 ? 562 CYS A SG    1 
ATOM   3224 N N     . PRO C 3 378 ? -40.387 -15.672 19.398  1.00 41.22 ? 563 PRO A N     1 
ATOM   3225 C CA    . PRO C 3 378 ? -40.014 -17.069 19.594  1.00 41.17 ? 563 PRO A CA    1 
ATOM   3226 C C     . PRO C 3 378 ? -38.510 -17.258 19.376  1.00 41.20 ? 563 PRO A C     1 
ATOM   3227 O O     . PRO C 3 378 ? -37.870 -16.417 18.736  1.00 41.28 ? 563 PRO A O     1 
ATOM   3228 C CB    . PRO C 3 378 ? -40.809 -17.792 18.504  1.00 41.15 ? 563 PRO A CB    1 
ATOM   3229 C CG    . PRO C 3 378 ? -40.957 -16.775 17.419  1.00 40.96 ? 563 PRO A CG    1 
ATOM   3230 C CD    . PRO C 3 378 ? -41.058 -15.444 18.105  1.00 41.05 ? 563 PRO A CD    1 
ATOM   3231 N N     . VAL C 3 379 ? -37.949 -18.333 19.923  1.00 41.25 ? 564 VAL A N     1 
ATOM   3232 C CA    . VAL C 3 379 ? -36.585 -18.755 19.576  1.00 41.40 ? 564 VAL A CA    1 
ATOM   3233 C C     . VAL C 3 379 ? -36.544 -20.248 19.291  1.00 41.33 ? 564 VAL A C     1 
ATOM   3234 O O     . VAL C 3 379 ? -37.186 -21.038 19.989  1.00 41.19 ? 564 VAL A O     1 
ATOM   3235 C CB    . VAL C 3 379 ? -35.521 -18.404 20.660  1.00 41.67 ? 564 VAL A CB    1 
ATOM   3236 C CG1   . VAL C 3 379 ? -34.553 -17.320 20.154  1.00 42.07 ? 564 VAL A CG1   1 
ATOM   3237 C CG2   . VAL C 3 379 ? -36.173 -18.014 21.976  1.00 41.13 ? 564 VAL A CG2   1 
ATOM   3238 N N     . VAL C 3 380 ? -35.782 -20.624 18.267  1.00 41.16 ? 565 VAL A N     1 
ATOM   3239 C CA    . VAL C 3 380 ? -35.715 -22.012 17.824  1.00 41.13 ? 565 VAL A CA    1 
ATOM   3240 C C     . VAL C 3 380 ? -34.368 -22.640 18.166  1.00 41.28 ? 565 VAL A C     1 
ATOM   3241 O O     . VAL C 3 380 ? -33.316 -22.137 17.766  1.00 41.16 ? 565 VAL A O     1 
ATOM   3242 C CB    . VAL C 3 380 ? -35.984 -22.132 16.309  1.00 41.03 ? 565 VAL A CB    1 
ATOM   3243 C CG1   . VAL C 3 380 ? -36.081 -23.592 15.895  1.00 41.02 ? 565 VAL A CG1   1 
ATOM   3244 C CG2   . VAL C 3 380 ? -37.256 -21.389 15.936  1.00 40.98 ? 565 VAL A CG2   1 
ATOM   3245 N N     . GLY C 3 381 ? -34.414 -23.739 18.917  1.00 41.61 ? 566 GLY A N     1 
ATOM   3246 C CA    . GLY C 3 381 ? -33.219 -24.502 19.276  1.00 41.69 ? 566 GLY A CA    1 
ATOM   3247 C C     . GLY C 3 381 ? -32.706 -25.290 18.087  1.00 41.92 ? 566 GLY A C     1 
ATOM   3248 O O     . GLY C 3 381 ? -31.740 -24.887 17.438  1.00 41.96 ? 566 GLY A O     1 
ATOM   3249 N N     . SER C 3 382 ? -33.375 -26.400 17.784  1.00 41.99 ? 567 SER A N     1 
ATOM   3250 C CA    . SER C 3 382 ? -32.913 -27.316 16.746  1.00 42.19 ? 567 SER A CA    1 
ATOM   3251 C C     . SER C 3 382 ? -34.035 -27.840 15.846  1.00 42.33 ? 567 SER A C     1 
ATOM   3252 O O     . SER C 3 382 ? -35.204 -27.478 16.012  1.00 42.43 ? 567 SER A O     1 
ATOM   3253 C CB    . SER C 3 382 ? -32.180 -28.494 17.393  1.00 42.22 ? 567 SER A CB    1 
ATOM   3254 O OG    . SER C 3 382 ? -33.085 -29.331 18.096  1.00 42.28 ? 567 SER A OG    1 
ATOM   3255 N N     . LEU C 3 383 ? -33.659 -28.697 14.896  1.00 42.44 ? 568 LEU A N     1 
ATOM   3256 C CA    . LEU C 3 383 ? -34.613 -29.416 14.050  1.00 42.55 ? 568 LEU A CA    1 
ATOM   3257 C C     . LEU C 3 383 ? -34.559 -30.918 14.285  1.00 42.61 ? 568 LEU A C     1 
ATOM   3258 O O     . LEU C 3 383 ? -33.510 -31.467 14.626  1.00 42.71 ? 568 LEU A O     1 
ATOM   3259 C CB    . LEU C 3 383 ? -34.345 -29.146 12.571  1.00 42.50 ? 568 LEU A CB    1 
ATOM   3260 C CG    . LEU C 3 383 ? -34.578 -27.746 12.011  1.00 42.61 ? 568 LEU A CG    1 
ATOM   3261 C CD1   . LEU C 3 383 ? -34.704 -27.846 10.499  1.00 42.34 ? 568 LEU A CD1   1 
ATOM   3262 C CD2   . LEU C 3 383 ? -35.814 -27.091 12.620  1.00 42.59 ? 568 LEU A CD2   1 
ATOM   3263 N N     . GLU C 3 384 ? -35.699 -31.575 14.097  1.00 42.64 ? 569 GLU A N     1 
ATOM   3264 C CA    . GLU C 3 384 ? -35.775 -33.030 14.153  1.00 42.78 ? 569 GLU A CA    1 
ATOM   3265 C C     . GLU C 3 384 ? -36.610 -33.552 12.987  1.00 42.76 ? 569 GLU A C     1 
ATOM   3266 O O     . GLU C 3 384 ? -37.815 -33.297 12.905  1.00 42.79 ? 569 GLU A O     1 
ATOM   3267 C CB    . GLU C 3 384 ? -36.338 -33.504 15.500  1.00 42.76 ? 569 GLU A CB    1 
ATOM   3268 C CG    . GLU C 3 384 ? -35.289 -33.619 16.611  1.00 43.00 ? 569 GLU A CG    1 
ATOM   3269 C CD    . GLU C 3 384 ? -35.889 -33.837 17.998  1.00 42.92 ? 569 GLU A CD    1 
ATOM   3270 O OE1   . GLU C 3 384 ? -36.918 -34.543 18.112  1.00 42.53 ? 569 GLU A OE1   1 
ATOM   3271 O OE2   . GLU C 3 384 ? -35.318 -33.303 18.978  1.00 42.92 ? 569 GLU A OE2   1 
ATOM   3272 N N     . VAL C 3 385 ? -35.953 -34.271 12.081  1.00 42.76 ? 570 VAL A N     1 
ATOM   3273 C CA    . VAL C 3 385 ? -36.613 -34.819 10.900  1.00 42.82 ? 570 VAL A CA    1 
ATOM   3274 C C     . VAL C 3 385 ? -36.866 -36.336 11.035  1.00 42.88 ? 570 VAL A C     1 
ATOM   3275 O O     . VAL C 3 385 ? -35.955 -37.155 10.859  1.00 42.92 ? 570 VAL A O     1 
ATOM   3276 C CB    . VAL C 3 385 ? -35.851 -34.427 9.584   1.00 42.83 ? 570 VAL A CB    1 
ATOM   3277 C CG1   . VAL C 3 385 ? -34.357 -34.770 9.666   1.00 42.56 ? 570 VAL A CG1   1 
ATOM   3278 C CG2   . VAL C 3 385 ? -36.513 -35.042 8.343   1.00 42.85 ? 570 VAL A CG2   1 
ATOM   3279 N N     . ASP C 3 386 ? -38.108 -36.694 11.369  1.00 42.88 ? 571 ASP A N     1 
ATOM   3280 C CA    . ASP C 3 386 ? -38.503 -38.103 11.510  1.00 42.82 ? 571 ASP A CA    1 
ATOM   3281 C C     . ASP C 3 386 ? -39.367 -38.580 10.340  1.00 42.85 ? 571 ASP A C     1 
ATOM   3282 O O     . ASP C 3 386 ? -40.125 -37.798 9.756   1.00 42.87 ? 571 ASP A O     1 
ATOM   3283 C CB    . ASP C 3 386 ? -39.190 -38.368 12.867  1.00 42.79 ? 571 ASP A CB    1 
ATOM   3284 C CG    . ASP C 3 386 ? -40.686 -38.048 12.864  1.00 42.55 ? 571 ASP A CG    1 
ATOM   3285 O OD1   . ASP C 3 386 ? -41.079 -36.939 12.442  1.00 42.39 ? 571 ASP A OD1   1 
ATOM   3286 O OD2   . ASP C 3 386 ? -41.472 -38.912 13.309  1.00 42.09 ? 571 ASP A OD2   1 
ATOM   3287 N N     . GLY C 3 387 ? -39.235 -39.864 10.004  1.00 42.86 ? 572 GLY A N     1 
ATOM   3288 C CA    . GLY C 3 387 ? -39.969 -40.475 8.893   1.00 42.75 ? 572 GLY A CA    1 
ATOM   3289 C C     . GLY C 3 387 ? -39.493 -39.997 7.534   1.00 42.72 ? 572 GLY A C     1 
ATOM   3290 O O     . GLY C 3 387 ? -38.696 -39.061 7.436   1.00 42.71 ? 572 GLY A O     1 
ATOM   3291 N N     . HIS C 3 388 ? -39.976 -40.640 6.477   1.00 42.71 ? 573 HIS A N     1 
ATOM   3292 C CA    . HIS C 3 388 ? -39.643 -40.200 5.127   1.00 42.76 ? 573 HIS A CA    1 
ATOM   3293 C C     . HIS C 3 388 ? -40.889 -40.012 4.256   1.00 42.77 ? 573 HIS A C     1 
ATOM   3294 O O     . HIS C 3 388 ? -42.015 -40.038 4.760   1.00 42.72 ? 573 HIS A O     1 
ATOM   3295 C CB    . HIS C 3 388 ? -38.618 -41.135 4.476   1.00 42.76 ? 573 HIS A CB    1 
ATOM   3296 C CG    . HIS C 3 388 ? -37.641 -40.425 3.591   1.00 42.84 ? 573 HIS A CG    1 
ATOM   3297 N ND1   . HIS C 3 388 ? -37.682 -40.509 2.216   1.00 42.93 ? 573 HIS A ND1   1 
ATOM   3298 C CD2   . HIS C 3 388 ? -36.608 -39.600 3.886   1.00 42.95 ? 573 HIS A CD2   1 
ATOM   3299 C CE1   . HIS C 3 388 ? -36.709 -39.777 1.703   1.00 42.96 ? 573 HIS A CE1   1 
ATOM   3300 N NE2   . HIS C 3 388 ? -36.043 -39.214 2.695   1.00 42.92 ? 573 HIS A NE2   1 
ATOM   3301 N N     . GLY C 3 389 ? -40.679 -39.814 2.956   1.00 42.85 ? 574 GLY A N     1 
ATOM   3302 C CA    . GLY C 3 389 ? -41.766 -39.528 2.024   1.00 42.90 ? 574 GLY A CA    1 
ATOM   3303 C C     . GLY C 3 389 ? -42.267 -38.106 2.191   1.00 42.95 ? 574 GLY A C     1 
ATOM   3304 O O     . GLY C 3 389 ? -41.586 -37.264 2.783   1.00 42.86 ? 574 GLY A O     1 
ATOM   3305 N N     . GLU C 3 390 ? -43.461 -37.840 1.669   1.00 43.00 ? 575 GLU A N     1 
ATOM   3306 C CA    . GLU C 3 390 ? -44.077 -36.518 1.786   1.00 43.06 ? 575 GLU A CA    1 
ATOM   3307 C C     . GLU C 3 390 ? -44.665 -36.279 3.181   1.00 43.07 ? 575 GLU A C     1 
ATOM   3308 O O     . GLU C 3 390 ? -44.564 -35.175 3.724   1.00 43.07 ? 575 GLU A O     1 
ATOM   3309 C CB    . GLU C 3 390 ? -45.132 -36.298 0.685   1.00 43.05 ? 575 GLU A CB    1 
ATOM   3310 C CG    . GLU C 3 390 ? -46.452 -37.078 0.836   1.00 43.11 ? 575 GLU A CG    1 
ATOM   3311 C CD    . GLU C 3 390 ? -46.291 -38.591 0.731   1.00 43.08 ? 575 GLU A CD    1 
ATOM   3312 O OE1   . GLU C 3 390 ? -45.356 -39.058 0.046   1.00 42.97 ? 575 GLU A OE1   1 
ATOM   3313 O OE2   . GLU C 3 390 ? -47.108 -39.314 1.337   1.00 43.14 ? 575 GLU A OE2   1 
ATOM   3314 N N     . ALA C 3 391 ? -45.250 -37.328 3.758   1.00 43.09 ? 576 ALA A N     1 
ATOM   3315 C CA    . ALA C 3 391 ? -45.946 -37.244 5.042   1.00 43.09 ? 576 ALA A CA    1 
ATOM   3316 C C     . ALA C 3 391 ? -45.007 -37.137 6.253   1.00 43.10 ? 576 ALA A C     1 
ATOM   3317 O O     . ALA C 3 391 ? -45.465 -37.137 7.399   1.00 43.09 ? 576 ALA A O     1 
ATOM   3318 C CB    . ALA C 3 391 ? -46.902 -38.428 5.200   1.00 43.07 ? 576 ALA A CB    1 
ATOM   3319 N N     . SER C 3 392 ? -43.703 -37.035 5.995   1.00 43.12 ? 577 SER A N     1 
ATOM   3320 C CA    . SER C 3 392 ? -42.702 -36.923 7.056   1.00 43.13 ? 577 SER A CA    1 
ATOM   3321 C C     . SER C 3 392 ? -42.757 -35.556 7.728   1.00 43.26 ? 577 SER A C     1 
ATOM   3322 O O     . SER C 3 392 ? -42.753 -34.524 7.056   1.00 43.30 ? 577 SER A O     1 
ATOM   3323 C CB    . SER C 3 392 ? -41.297 -37.178 6.507   1.00 43.05 ? 577 SER A CB    1 
ATOM   3324 O OG    . SER C 3 392 ? -40.905 -36.162 5.603   1.00 42.81 ? 577 SER A OG    1 
ATOM   3325 N N     . ARG C 3 393 ? -42.809 -35.558 9.056   1.00 43.34 ? 578 ARG A N     1 
ATOM   3326 C CA    . ARG C 3 393 ? -42.896 -34.319 9.815   1.00 43.50 ? 578 ARG A CA    1 
ATOM   3327 C C     . ARG C 3 393 ? -41.526 -33.819 10.269  1.00 43.64 ? 578 ARG A C     1 
ATOM   3328 O O     . ARG C 3 393 ? -40.632 -34.609 10.584  1.00 43.64 ? 578 ARG A O     1 
ATOM   3329 C CB    . ARG C 3 393 ? -43.825 -34.478 11.024  1.00 43.48 ? 578 ARG A CB    1 
ATOM   3330 C CG    . ARG C 3 393 ? -45.298 -34.642 10.680  1.00 43.54 ? 578 ARG A CG    1 
ATOM   3331 C CD    . ARG C 3 393 ? -46.188 -34.040 11.762  1.00 43.73 ? 578 ARG A CD    1 
ATOM   3332 N NE    . ARG C 3 393 ? -47.561 -34.544 11.705  1.00 44.00 ? 578 ARG A NE    1 
ATOM   3333 C CZ    . ARG C 3 393 ? -48.161 -35.232 12.677  1.00 43.95 ? 578 ARG A CZ    1 
ATOM   3334 N NH1   . ARG C 3 393 ? -47.525 -35.500 13.812  1.00 43.95 ? 578 ARG A NH1   1 
ATOM   3335 N NH2   . ARG C 3 393 ? -49.412 -35.644 12.517  1.00 43.49 ? 578 ARG A NH2   1 
ATOM   3336 N N     . VAL C 3 394 ? -41.376 -32.498 10.281  1.00 43.77 ? 579 VAL A N     1 
ATOM   3337 C CA    . VAL C 3 394 ? -40.216 -31.840 10.877  1.00 43.89 ? 579 VAL A CA    1 
ATOM   3338 C C     . VAL C 3 394 ? -40.664 -31.046 12.110  1.00 43.94 ? 579 VAL A C     1 
ATOM   3339 O O     . VAL C 3 394 ? -41.612 -30.257 12.044  1.00 43.97 ? 579 VAL A O     1 
ATOM   3340 C CB    . VAL C 3 394 ? -39.455 -30.945 9.848   1.00 43.90 ? 579 VAL A CB    1 
ATOM   3341 C CG1   . VAL C 3 394 ? -40.419 -30.062 9.056   1.00 43.92 ? 579 VAL A CG1   1 
ATOM   3342 C CG2   . VAL C 3 394 ? -38.368 -30.111 10.534  1.00 43.87 ? 579 VAL A CG2   1 
ATOM   3343 N N     . GLU C 3 395 ? -39.990 -31.281 13.234  1.00 44.00 ? 580 GLU A N     1 
ATOM   3344 C CA    . GLU C 3 395 ? -40.334 -30.629 14.497  1.00 44.03 ? 580 GLU A CA    1 
ATOM   3345 C C     . GLU C 3 395 ? -39.345 -29.533 14.867  1.00 44.07 ? 580 GLU A C     1 
ATOM   3346 O O     . GLU C 3 395 ? -38.177 -29.566 14.470  1.00 44.20 ? 580 GLU A O     1 
ATOM   3347 C CB    . GLU C 3 395 ? -40.416 -31.648 15.635  1.00 44.07 ? 580 GLU A CB    1 
ATOM   3348 C CG    . GLU C 3 395 ? -41.522 -32.682 15.479  1.00 44.39 ? 580 GLU A CG    1 
ATOM   3349 C CD    . GLU C 3 395 ? -42.019 -33.243 16.809  1.00 44.78 ? 580 GLU A CD    1 
ATOM   3350 O OE1   . GLU C 3 395 ? -41.654 -32.699 17.880  1.00 44.64 ? 580 GLU A OE1   1 
ATOM   3351 O OE2   . GLU C 3 395 ? -42.789 -34.229 16.778  1.00 44.50 ? 580 GLU A OE2   1 
ATOM   3352 N N     . LEU C 3 396 ? -39.830 -28.563 15.635  1.00 44.00 ? 581 LEU A N     1 
ATOM   3353 C CA    . LEU C 3 396 ? -39.015 -27.453 16.100  1.00 43.87 ? 581 LEU A CA    1 
ATOM   3354 C C     . LEU C 3 396 ? -39.091 -27.359 17.614  1.00 43.90 ? 581 LEU A C     1 
ATOM   3355 O O     . LEU C 3 396 ? -40.165 -27.528 18.203  1.00 43.83 ? 581 LEU A O     1 
ATOM   3356 C CB    . LEU C 3 396 ? -39.483 -26.140 15.469  1.00 43.86 ? 581 LEU A CB    1 
ATOM   3357 C CG    . LEU C 3 396 ? -39.022 -25.779 14.052  1.00 43.78 ? 581 LEU A CG    1 
ATOM   3358 C CD1   . LEU C 3 396 ? -39.628 -26.674 12.986  1.00 43.69 ? 581 LEU A CD1   1 
ATOM   3359 C CD2   . LEU C 3 396 ? -39.354 -24.328 13.756  1.00 43.89 ? 581 LEU A CD2   1 
ATOM   3360 N N     . HIS C 3 397 ? -37.941 -27.094 18.232  1.00 43.88 ? 582 HIS A N     1 
ATOM   3361 C CA    . HIS C 3 397 ? -37.836 -26.920 19.683  1.00 43.77 ? 582 HIS A CA    1 
ATOM   3362 C C     . HIS C 3 397 ? -37.283 -25.539 20.027  1.00 43.56 ? 582 HIS A C     1 
ATOM   3363 O O     . HIS C 3 397 ? -36.453 -24.997 19.300  1.00 43.28 ? 582 HIS A O     1 
ATOM   3364 C CB    . HIS C 3 397 ? -36.960 -28.016 20.295  1.00 43.83 ? 582 HIS A CB    1 
ATOM   3365 C CG    . HIS C 3 397 ? -37.468 -29.404 20.046  1.00 43.92 ? 582 HIS A CG    1 
ATOM   3366 N ND1   . HIS C 3 397 ? -38.489 -29.966 20.782  1.00 44.19 ? 582 HIS A ND1   1 
ATOM   3367 C CD2   . HIS C 3 397 ? -37.094 -30.342 19.144  1.00 43.72 ? 582 HIS A CD2   1 
ATOM   3368 C CE1   . HIS C 3 397 ? -38.723 -31.190 20.345  1.00 44.13 ? 582 HIS A CE1   1 
ATOM   3369 N NE2   . HIS C 3 397 ? -37.890 -31.443 19.351  1.00 44.21 ? 582 HIS A NE2   1 
ATOM   3370 N N     . GLY C 3 398 ? -37.759 -24.971 21.130  1.00 43.56 ? 583 GLY A N     1 
ATOM   3371 C CA    . GLY C 3 398 ? -37.343 -23.635 21.543  1.00 43.57 ? 583 GLY A CA    1 
ATOM   3372 C C     . GLY C 3 398 ? -38.197 -23.039 22.642  1.00 43.67 ? 583 GLY A C     1 
ATOM   3373 O O     . GLY C 3 398 ? -38.671 -23.753 23.520  1.00 43.58 ? 583 GLY A O     1 
ATOM   3374 N N     . ARG C 3 399 ? -38.378 -21.721 22.597  1.00 43.77 ? 584 ARG A N     1 
ATOM   3375 C CA    . ARG C 3 399 ? -39.121 -20.999 23.631  1.00 44.09 ? 584 ARG A CA    1 
ATOM   3376 C C     . ARG C 3 399 ? -40.134 -20.062 22.997  1.00 43.56 ? 584 ARG A C     1 
ATOM   3377 O O     . ARG C 3 399 ? -39.916 -19.546 21.898  1.00 43.23 ? 584 ARG A O     1 
ATOM   3378 C CB    . ARG C 3 399 ? -38.192 -20.156 24.523  1.00 44.00 ? 584 ARG A CB    1 
ATOM   3379 C CG    . ARG C 3 399 ? -36.896 -20.809 25.007  1.00 45.24 ? 584 ARG A CG    1 
ATOM   3380 C CD    . ARG C 3 399 ? -36.011 -19.799 25.782  1.00 45.55 ? 584 ARG A CD    1 
ATOM   3381 N NE    . ARG C 3 399 ? -35.915 -18.504 25.098  1.00 48.54 ? 584 ARG A NE    1 
ATOM   3382 C CZ    . ARG C 3 399 ? -35.643 -17.335 25.684  1.00 49.33 ? 584 ARG A CZ    1 
ATOM   3383 N NH1   . ARG C 3 399 ? -35.420 -17.261 26.997  1.00 49.92 ? 584 ARG A NH1   1 
ATOM   3384 N NH2   . ARG C 3 399 ? -35.594 -16.230 24.947  1.00 48.70 ? 584 ARG A NH2   1 
ATOM   3385 N N     . ASP C 3 400 ? -41.230 -19.838 23.719  1.00 43.44 ? 585 ASP A N     1 
ATOM   3386 C CA    . ASP C 3 400 ? -42.258 -18.851 23.365  1.00 43.36 ? 585 ASP A CA    1 
ATOM   3387 C C     . ASP C 3 400 ? -42.895 -19.039 21.987  1.00 43.36 ? 585 ASP A C     1 
ATOM   3388 O O     . ASP C 3 400 ? -43.195 -18.069 21.280  1.00 43.50 ? 585 ASP A O     1 
ATOM   3389 C CB    . ASP C 3 400 ? -41.735 -17.421 23.551  1.00 43.50 ? 585 ASP A CB    1 
ATOM   3390 C CG    . ASP C 3 400 ? -41.281 -17.148 24.976  1.00 43.60 ? 585 ASP A CG    1 
ATOM   3391 O OD1   . ASP C 3 400 ? -40.220 -16.519 25.162  1.00 44.48 ? 585 ASP A OD1   1 
ATOM   3392 O OD2   . ASP C 3 400 ? -41.982 -17.566 25.915  1.00 43.70 ? 585 ASP A OD2   1 
ATOM   3393 N N     . PHE C 3 401 ? -43.102 -20.296 21.611  1.00 43.19 ? 586 PHE A N     1 
ATOM   3394 C CA    . PHE C 3 401 ? -43.991 -20.592 20.511  1.00 43.06 ? 586 PHE A CA    1 
ATOM   3395 C C     . PHE C 3 401 ? -45.393 -20.240 20.985  1.00 42.93 ? 586 PHE A C     1 
ATOM   3396 O O     . PHE C 3 401 ? -45.800 -20.638 22.075  1.00 42.77 ? 586 PHE A O     1 
ATOM   3397 C CB    . PHE C 3 401 ? -43.920 -22.070 20.120  1.00 43.06 ? 586 PHE A CB    1 
ATOM   3398 C CG    . PHE C 3 401 ? -42.560 -22.520 19.664  1.00 42.75 ? 586 PHE A CG    1 
ATOM   3399 C CD1   . PHE C 3 401 ? -42.106 -23.797 19.972  1.00 42.85 ? 586 PHE A CD1   1 
ATOM   3400 C CD2   . PHE C 3 401 ? -41.734 -21.674 18.925  1.00 42.27 ? 586 PHE A CD2   1 
ATOM   3401 C CE1   . PHE C 3 401 ? -40.849 -24.226 19.551  1.00 42.69 ? 586 PHE A CE1   1 
ATOM   3402 C CE2   . PHE C 3 401 ? -40.477 -22.093 18.500  1.00 41.85 ? 586 PHE A CE2   1 
ATOM   3403 C CZ    . PHE C 3 401 ? -40.034 -23.371 18.813  1.00 42.27 ? 586 PHE A CZ    1 
ATOM   3404 N N     . LYS C 3 402 ? -46.103 -19.456 20.180  1.00 42.93 ? 587 LYS A N     1 
ATOM   3405 C CA    . LYS C 3 402 ? -47.490 -19.092 20.462  1.00 42.81 ? 587 LYS A CA    1 
ATOM   3406 C C     . LYS C 3 402 ? -48.388 -19.759 19.418  1.00 42.63 ? 587 LYS A C     1 
ATOM   3407 O O     . LYS C 3 402 ? -47.885 -20.265 18.415  1.00 42.81 ? 587 LYS A O     1 
ATOM   3408 C CB    . LYS C 3 402 ? -47.657 -17.564 20.452  1.00 43.09 ? 587 LYS A CB    1 
ATOM   3409 C CG    . LYS C 3 402 ? -47.199 -16.835 21.727  1.00 42.94 ? 587 LYS A CG    1 
ATOM   3410 C CD    . LYS C 3 402 ? -48.306 -16.781 22.782  1.00 43.39 ? 587 LYS A CD    1 
ATOM   3411 C CE    . LYS C 3 402 ? -47.968 -15.837 23.952  1.00 44.22 ? 587 LYS A CE    1 
ATOM   3412 N NZ    . LYS C 3 402 ? -46.737 -16.212 24.745  1.00 45.54 ? 587 LYS A NZ    1 
ATOM   3413 N N     . PRO C 3 403 ? -49.716 -19.790 19.649  1.00 42.43 ? 588 PRO A N     1 
ATOM   3414 C CA    . PRO C 3 403 ? -50.580 -20.426 18.649  1.00 42.14 ? 588 PRO A CA    1 
ATOM   3415 C C     . PRO C 3 403 ? -50.607 -19.692 17.305  1.00 41.89 ? 588 PRO A C     1 
ATOM   3416 O O     . PRO C 3 403 ? -50.957 -20.292 16.290  1.00 41.89 ? 588 PRO A O     1 
ATOM   3417 C CB    . PRO C 3 403 ? -51.972 -20.379 19.299  1.00 42.22 ? 588 PRO A CB    1 
ATOM   3418 C CG    . PRO C 3 403 ? -51.729 -20.120 20.756  1.00 42.53 ? 588 PRO A CG    1 
ATOM   3419 C CD    . PRO C 3 403 ? -50.488 -19.291 20.802  1.00 42.46 ? 588 PRO A CD    1 
ATOM   3420 N N     . ASN C 3 404 ? -50.224 -18.416 17.303  1.00 41.56 ? 589 ASN A N     1 
ATOM   3421 C CA    . ASN C 3 404 ? -50.370 -17.542 16.131  1.00 41.07 ? 589 ASN A CA    1 
ATOM   3422 C C     . ASN C 3 404 ? -49.143 -17.472 15.204  1.00 40.84 ? 589 ASN A C     1 
ATOM   3423 O O     . ASN C 3 404 ? -48.850 -16.412 14.637  1.00 41.01 ? 589 ASN A O     1 
ATOM   3424 C CB    . ASN C 3 404 ? -50.774 -16.130 16.588  1.00 40.94 ? 589 ASN A CB    1 
ATOM   3425 C CG    . ASN C 3 404 ? -49.872 -15.587 17.703  1.00 41.30 ? 589 ASN A CG    1 
ATOM   3426 O OD1   . ASN C 3 404 ? -48.730 -16.023 17.871  1.00 40.30 ? 589 ASN A OD1   1 
ATOM   3427 N ND2   . ASN C 3 404 ? -50.390 -14.629 18.465  1.00 41.20 ? 589 ASN A ND2   1 
ATOM   3428 N N     . LEU C 3 405 ? -48.439 -18.595 15.037  1.00 40.25 ? 590 LEU A N     1 
ATOM   3429 C CA    . LEU C 3 405 ? -47.214 -18.627 14.221  1.00 39.60 ? 590 LEU A CA    1 
ATOM   3430 C C     . LEU C 3 405 ? -47.190 -19.716 13.143  1.00 39.02 ? 590 LEU A C     1 
ATOM   3431 O O     . LEU C 3 405 ? -47.642 -20.837 13.368  1.00 38.83 ? 590 LEU A O     1 
ATOM   3432 C CB    . LEU C 3 405 ? -45.983 -18.765 15.120  1.00 39.57 ? 590 LEU A CB    1 
ATOM   3433 C CG    . LEU C 3 405 ? -45.611 -17.554 15.982  1.00 40.00 ? 590 LEU A CG    1 
ATOM   3434 C CD1   . LEU C 3 405 ? -44.730 -17.971 17.153  1.00 38.84 ? 590 LEU A CD1   1 
ATOM   3435 C CD2   . LEU C 3 405 ? -44.938 -16.468 15.136  1.00 40.41 ? 590 LEU A CD2   1 
ATOM   3436 N N     . LYS C 3 406 ? -46.635 -19.382 11.982  1.00 38.46 ? 591 LYS A N     1 
ATOM   3437 C CA    . LYS C 3 406 ? -46.523 -20.333 10.877  1.00 38.19 ? 591 LYS A CA    1 
ATOM   3438 C C     . LYS C 3 406 ? -45.087 -20.456 10.355  1.00 37.79 ? 591 LYS A C     1 
ATOM   3439 O O     . LYS C 3 406 ? -44.424 -19.449 10.092  1.00 37.65 ? 591 LYS A O     1 
ATOM   3440 C CB    . LYS C 3 406 ? -47.470 -19.946 9.731   1.00 38.19 ? 591 LYS A CB    1 
ATOM   3441 C CG    . LYS C 3 406 ? -48.934 -20.326 9.935   1.00 38.64 ? 591 LYS A CG    1 
ATOM   3442 C CD    . LYS C 3 406 ? -49.744 -19.243 10.656  1.00 38.86 ? 591 LYS A CD    1 
ATOM   3443 C CE    . LYS C 3 406 ? -51.212 -19.237 10.193  1.00 39.55 ? 591 LYS A CE    1 
ATOM   3444 N NZ    . LYS C 3 406 ? -51.963 -20.492 10.508  1.00 39.24 ? 591 LYS A NZ    1 
ATOM   3445 N N     . VAL C 3 407 ? -44.621 -21.695 10.206  1.00 37.42 ? 592 VAL A N     1 
ATOM   3446 C CA    . VAL C 3 407 ? -43.278 -21.976 9.689   1.00 37.11 ? 592 VAL A CA    1 
ATOM   3447 C C     . VAL C 3 407 ? -43.192 -21.758 8.175   1.00 37.16 ? 592 VAL A C     1 
ATOM   3448 O O     . VAL C 3 407 ? -44.008 -22.281 7.408   1.00 37.09 ? 592 VAL A O     1 
ATOM   3449 C CB    . VAL C 3 407 ? -42.772 -23.398 10.092  1.00 36.96 ? 592 VAL A CB    1 
ATOM   3450 C CG1   . VAL C 3 407 ? -43.874 -24.425 9.968   1.00 37.24 ? 592 VAL A CG1   1 
ATOM   3451 C CG2   . VAL C 3 407 ? -41.550 -23.814 9.273   1.00 36.52 ? 592 VAL A CG2   1 
ATOM   3452 N N     . TRP C 3 408 ? -42.201 -20.975 7.761   1.00 37.08 ? 593 TRP A N     1 
ATOM   3453 C CA    . TRP C 3 408 ? -41.999 -20.661 6.353   1.00 37.00 ? 593 TRP A CA    1 
ATOM   3454 C C     . TRP C 3 408 ? -40.653 -21.193 5.873   1.00 37.03 ? 593 TRP A C     1 
ATOM   3455 O O     . TRP C 3 408 ? -39.592 -20.617 6.149   1.00 36.88 ? 593 TRP A O     1 
ATOM   3456 C CB    . TRP C 3 408 ? -42.155 -19.155 6.104   1.00 36.94 ? 593 TRP A CB    1 
ATOM   3457 C CG    . TRP C 3 408 ? -43.594 -18.702 6.168   1.00 36.93 ? 593 TRP A CG    1 
ATOM   3458 C CD1   . TRP C 3 408 ? -44.466 -18.907 7.191   1.00 36.77 ? 593 TRP A CD1   1 
ATOM   3459 C CD2   . TRP C 3 408 ? -44.326 -17.985 5.159   1.00 37.59 ? 593 TRP A CD2   1 
ATOM   3460 N NE1   . TRP C 3 408 ? -45.693 -18.364 6.895   1.00 37.04 ? 593 TRP A NE1   1 
ATOM   3461 C CE2   . TRP C 3 408 ? -45.635 -17.786 5.654   1.00 37.77 ? 593 TRP A CE2   1 
ATOM   3462 C CE3   . TRP C 3 408 ? -44.005 -17.494 3.883   1.00 37.14 ? 593 TRP A CE3   1 
ATOM   3463 C CZ2   . TRP C 3 408 ? -46.628 -17.115 4.918   1.00 37.43 ? 593 TRP A CZ2   1 
ATOM   3464 C CZ3   . TRP C 3 408 ? -44.988 -16.818 3.160   1.00 36.83 ? 593 TRP A CZ3   1 
ATOM   3465 C CH2   . TRP C 3 408 ? -46.284 -16.640 3.679   1.00 36.79 ? 593 TRP A CH2   1 
ATOM   3466 N N     . PHE C 3 409 ? -40.721 -22.314 5.160   1.00 37.12 ? 594 PHE A N     1 
ATOM   3467 C CA    . PHE C 3 409 ? -39.545 -22.979 4.610   1.00 37.21 ? 594 PHE A CA    1 
ATOM   3468 C C     . PHE C 3 409 ? -38.777 -22.114 3.616   1.00 37.52 ? 594 PHE A C     1 
ATOM   3469 O O     . PHE C 3 409 ? -37.638 -22.420 3.276   1.00 37.54 ? 594 PHE A O     1 
ATOM   3470 C CB    . PHE C 3 409 ? -39.933 -24.312 3.973   1.00 37.04 ? 594 PHE A CB    1 
ATOM   3471 C CG    . PHE C 3 409 ? -39.725 -25.490 4.872   1.00 36.55 ? 594 PHE A CG    1 
ATOM   3472 C CD1   . PHE C 3 409 ? -40.642 -25.793 5.871   1.00 36.14 ? 594 PHE A CD1   1 
ATOM   3473 C CD2   . PHE C 3 409 ? -38.603 -26.296 4.726   1.00 36.34 ? 594 PHE A CD2   1 
ATOM   3474 C CE1   . PHE C 3 409 ? -40.454 -26.887 6.705   1.00 36.14 ? 594 PHE A CE1   1 
ATOM   3475 C CE2   . PHE C 3 409 ? -38.401 -27.393 5.556   1.00 36.53 ? 594 PHE A CE2   1 
ATOM   3476 C CZ    . PHE C 3 409 ? -39.330 -27.688 6.549   1.00 36.61 ? 594 PHE A CZ    1 
ATOM   3477 N N     . GLY C 3 410 ? -39.401 -21.034 3.163   1.00 37.82 ? 595 GLY A N     1 
ATOM   3478 C CA    . GLY C 3 410 ? -38.713 -20.044 2.358   1.00 38.29 ? 595 GLY A CA    1 
ATOM   3479 C C     . GLY C 3 410 ? -39.627 -18.887 2.056   1.00 38.70 ? 595 GLY A C     1 
ATOM   3480 O O     . GLY C 3 410 ? -39.881 -18.044 2.915   1.00 38.58 ? 595 GLY A O     1 
ATOM   3481 N N     . ALA C 3 411 ? -40.109 -18.851 0.820   1.00 39.15 ? 596 ALA A N     1 
ATOM   3482 C CA    . ALA C 3 411 ? -41.126 -17.899 0.409   1.00 39.82 ? 596 ALA A CA    1 
ATOM   3483 C C     . ALA C 3 411 ? -42.509 -18.504 0.626   1.00 40.26 ? 596 ALA A C     1 
ATOM   3484 O O     . ALA C 3 411 ? -43.447 -17.792 0.976   1.00 40.69 ? 596 ALA A O     1 
ATOM   3485 C CB    . ALA C 3 411 ? -40.938 -17.514 -1.049  1.00 39.87 ? 596 ALA A CB    1 
ATOM   3486 N N     . THR C 3 412 ? -42.632 -19.812 0.400   1.00 40.43 ? 597 THR A N     1 
ATOM   3487 C CA    . THR C 3 412 ? -43.874 -20.534 0.668   1.00 40.42 ? 597 THR A CA    1 
ATOM   3488 C C     . THR C 3 412 ? -44.070 -20.780 2.169   1.00 40.69 ? 597 THR A C     1 
ATOM   3489 O O     . THR C 3 412 ? -43.092 -20.978 2.899   1.00 40.57 ? 597 THR A O     1 
ATOM   3490 C CB    . THR C 3 412 ? -43.926 -21.890 -0.080  1.00 40.45 ? 597 THR A CB    1 
ATOM   3491 O OG1   . THR C 3 412 ? -42.631 -22.508 -0.061  1.00 39.84 ? 597 THR A OG1   1 
ATOM   3492 C CG2   . THR C 3 412 ? -44.399 -21.699 -1.540  1.00 40.49 ? 597 THR A CG2   1 
ATOM   3493 N N     . PRO C 3 413 ? -45.338 -20.757 2.633   1.00 40.87 ? 598 PRO A N     1 
ATOM   3494 C CA    . PRO C 3 413 ? -45.658 -21.193 3.989   1.00 41.05 ? 598 PRO A CA    1 
ATOM   3495 C C     . PRO C 3 413 ? -45.749 -22.711 4.015   1.00 41.31 ? 598 PRO A C     1 
ATOM   3496 O O     . PRO C 3 413 ? -45.516 -23.354 2.989   1.00 41.53 ? 598 PRO A O     1 
ATOM   3497 C CB    . PRO C 3 413 ? -47.045 -20.586 4.252   1.00 40.93 ? 598 PRO A CB    1 
ATOM   3498 C CG    . PRO C 3 413 ? -47.480 -19.943 2.983   1.00 40.97 ? 598 PRO A CG    1 
ATOM   3499 C CD    . PRO C 3 413 ? -46.541 -20.333 1.897   1.00 40.88 ? 598 PRO A CD    1 
ATOM   3500 N N     . VAL C 3 414 ? -46.070 -23.282 5.171   1.00 41.66 ? 599 VAL A N     1 
ATOM   3501 C CA    . VAL C 3 414 ? -46.285 -24.724 5.271   1.00 42.08 ? 599 VAL A CA    1 
ATOM   3502 C C     . VAL C 3 414 ? -47.334 -25.061 6.322   1.00 42.45 ? 599 VAL A C     1 
ATOM   3503 O O     . VAL C 3 414 ? -47.606 -24.260 7.225   1.00 42.54 ? 599 VAL A O     1 
ATOM   3504 C CB    . VAL C 3 414 ? -44.988 -25.514 5.606   1.00 42.08 ? 599 VAL A CB    1 
ATOM   3505 C CG1   . VAL C 3 414 ? -45.056 -26.902 4.992   1.00 42.02 ? 599 VAL A CG1   1 
ATOM   3506 C CG2   . VAL C 3 414 ? -43.738 -24.790 5.119   1.00 42.32 ? 599 VAL A CG2   1 
ATOM   3507 N N     . GLU C 3 415 ? -47.918 -26.252 6.182   1.00 42.87 ? 600 GLU A N     1 
ATOM   3508 C CA    . GLU C 3 415 ? -48.769 -26.855 7.202   1.00 43.29 ? 600 GLU A CA    1 
ATOM   3509 C C     . GLU C 3 415 ? -48.037 -26.896 8.548   1.00 43.56 ? 600 GLU A C     1 
ATOM   3510 O O     . GLU C 3 415 ? -46.967 -27.502 8.674   1.00 43.46 ? 600 GLU A O     1 
ATOM   3511 C CB    . GLU C 3 415 ? -49.193 -28.267 6.771   1.00 43.30 ? 600 GLU A CB    1 
ATOM   3512 C CG    . GLU C 3 415 ? -49.908 -29.095 7.849   1.00 43.51 ? 600 GLU A CG    1 
ATOM   3513 C CD    . GLU C 3 415 ? -51.370 -28.710 8.044   1.00 43.75 ? 600 GLU A CD    1 
ATOM   3514 O OE1   . GLU C 3 415 ? -52.106 -28.586 7.038   1.00 43.45 ? 600 GLU A OE1   1 
ATOM   3515 O OE2   . GLU C 3 415 ? -51.786 -28.550 9.214   1.00 43.77 ? 600 GLU A OE2   1 
ATOM   3516 N N     . THR C 3 416 ? -48.623 -26.226 9.536   1.00 43.88 ? 601 THR A N     1 
ATOM   3517 C CA    . THR C 3 416 ? -48.109 -26.204 10.896  1.00 44.25 ? 601 THR A CA    1 
ATOM   3518 C C     . THR C 3 416 ? -49.234 -26.608 11.835  1.00 44.48 ? 601 THR A C     1 
ATOM   3519 O O     . THR C 3 416 ? -50.409 -26.438 11.512  1.00 44.45 ? 601 THR A O     1 
ATOM   3520 C CB    . THR C 3 416 ? -47.631 -24.790 11.296  1.00 44.23 ? 601 THR A CB    1 
ATOM   3521 O OG1   . THR C 3 416 ? -47.103 -24.108 10.152  1.00 44.58 ? 601 THR A OG1   1 
ATOM   3522 C CG2   . THR C 3 416 ? -46.570 -24.865 12.373  1.00 44.21 ? 601 THR A CG2   1 
ATOM   3523 N N     . THR C 3 417 ? -48.875 -27.152 12.991  1.00 44.86 ? 602 THR A N     1 
ATOM   3524 C CA    . THR C 3 417 ? -49.828 -27.302 14.081  1.00 45.28 ? 602 THR A CA    1 
ATOM   3525 C C     . THR C 3 417 ? -49.357 -26.431 15.247  1.00 45.68 ? 602 THR A C     1 
ATOM   3526 O O     . THR C 3 417 ? -49.062 -25.248 15.052  1.00 45.86 ? 602 THR A O     1 
ATOM   3527 C CB    . THR C 3 417 ? -50.025 -28.780 14.496  1.00 45.22 ? 602 THR A CB    1 
ATOM   3528 O OG1   . THR C 3 417 ? -48.750 -29.413 14.639  1.00 45.30 ? 602 THR A OG1   1 
ATOM   3529 C CG2   . THR C 3 417 ? -50.844 -29.533 13.451  1.00 45.23 ? 602 THR A CG2   1 
ATOM   3530 N N     . PHE C 3 418 ? -49.273 -27.017 16.441  1.00 46.05 ? 603 PHE A N     1 
ATOM   3531 C CA    . PHE C 3 418 ? -48.856 -26.322 17.659  1.00 46.25 ? 603 PHE A CA    1 
ATOM   3532 C C     . PHE C 3 418 ? -49.041 -27.277 18.836  1.00 46.52 ? 603 PHE A C     1 
ATOM   3533 O O     . PHE C 3 418 ? -50.172 -27.634 19.181  1.00 46.47 ? 603 PHE A O     1 
ATOM   3534 C CB    . PHE C 3 418 ? -49.677 -25.036 17.867  1.00 46.18 ? 603 PHE A CB    1 
ATOM   3535 C CG    . PHE C 3 418 ? -49.460 -24.375 19.199  1.00 46.15 ? 603 PHE A CG    1 
ATOM   3536 C CD1   . PHE C 3 418 ? -48.378 -23.529 19.404  1.00 45.82 ? 603 PHE A CD1   1 
ATOM   3537 C CD2   . PHE C 3 418 ? -50.351 -24.586 20.247  1.00 46.19 ? 603 PHE A CD2   1 
ATOM   3538 C CE1   . PHE C 3 418 ? -48.182 -22.916 20.634  1.00 45.91 ? 603 PHE A CE1   1 
ATOM   3539 C CE2   . PHE C 3 418 ? -50.159 -23.977 21.483  1.00 45.77 ? 603 PHE A CE2   1 
ATOM   3540 C CZ    . PHE C 3 418 ? -49.075 -23.140 21.675  1.00 45.84 ? 603 PHE A CZ    1 
ATOM   3541 N N     . ARG C 3 419 ? -47.934 -27.698 19.442  1.00 46.88 ? 604 ARG A N     1 
ATOM   3542 C CA    . ARG C 3 419 ? -48.009 -28.524 20.646  1.00 47.29 ? 604 ARG A CA    1 
ATOM   3543 C C     . ARG C 3 419 ? -48.059 -27.654 21.904  1.00 47.59 ? 604 ARG A C     1 
ATOM   3544 O O     . ARG C 3 419 ? -49.037 -27.707 22.657  1.00 47.68 ? 604 ARG A O     1 
ATOM   3545 C CB    . ARG C 3 419 ? -46.867 -29.550 20.714  1.00 47.29 ? 604 ARG A CB    1 
ATOM   3546 C CG    . ARG C 3 419 ? -46.922 -30.626 19.631  1.00 47.03 ? 604 ARG A CG    1 
ATOM   3547 C CD    . ARG C 3 419 ? -46.494 -32.010 20.134  1.00 46.76 ? 604 ARG A CD    1 
ATOM   3548 N NE    . ARG C 3 419 ? -45.124 -32.052 20.651  1.00 46.75 ? 604 ARG A NE    1 
ATOM   3549 C CZ    . ARG C 3 419 ? -44.498 -33.160 21.045  1.00 46.50 ? 604 ARG A CZ    1 
ATOM   3550 N NH1   . ARG C 3 419 ? -45.108 -34.339 20.979  1.00 46.39 ? 604 ARG A NH1   1 
ATOM   3551 N NH2   . ARG C 3 419 ? -43.254 -33.092 21.505  1.00 46.20 ? 604 ARG A NH2   1 
ATOM   3552 N N     . SER C 3 420 ? -47.015 -26.849 22.114  1.00 47.91 ? 605 SER A N     1 
ATOM   3553 C CA    . SER C 3 420 ? -46.949 -25.921 23.246  1.00 48.22 ? 605 SER A CA    1 
ATOM   3554 C C     . SER C 3 420 ? -45.938 -24.796 23.012  1.00 48.49 ? 605 SER A C     1 
ATOM   3555 O O     . SER C 3 420 ? -45.604 -24.473 21.870  1.00 48.34 ? 605 SER A O     1 
ATOM   3556 C CB    . SER C 3 420 ? -46.631 -26.669 24.549  1.00 48.22 ? 605 SER A CB    1 
ATOM   3557 O OG    . SER C 3 420 ? -45.317 -27.199 24.534  1.00 48.38 ? 605 SER A OG    1 
ATOM   3558 N N     . GLU C 3 421 ? -45.457 -24.214 24.111  1.00 48.92 ? 606 GLU A N     1 
ATOM   3559 C CA    . GLU C 3 421 ? -44.522 -23.088 24.085  1.00 49.38 ? 606 GLU A CA    1 
ATOM   3560 C C     . GLU C 3 421 ? -43.119 -23.489 23.635  1.00 49.51 ? 606 GLU A C     1 
ATOM   3561 O O     . GLU C 3 421 ? -42.391 -22.679 23.057  1.00 49.65 ? 606 GLU A O     1 
ATOM   3562 C CB    . GLU C 3 421 ? -44.434 -22.437 25.471  1.00 49.55 ? 606 GLU A CB    1 
ATOM   3563 C CG    . GLU C 3 421 ? -45.773 -22.004 26.075  1.00 50.25 ? 606 GLU A CG    1 
ATOM   3564 C CD    . GLU C 3 421 ? -46.261 -20.653 25.566  1.00 51.06 ? 606 GLU A CD    1 
ATOM   3565 O OE1   . GLU C 3 421 ? -47.362 -20.232 25.976  1.00 51.39 ? 606 GLU A OE1   1 
ATOM   3566 O OE2   . GLU C 3 421 ? -45.550 -20.007 24.765  1.00 51.92 ? 606 GLU A OE2   1 
ATOM   3567 N N     . GLU C 3 422 ? -42.744 -24.735 23.906  1.00 49.54 ? 607 GLU A N     1 
ATOM   3568 C CA    . GLU C 3 422 ? -41.381 -25.203 23.642  1.00 49.53 ? 607 GLU A CA    1 
ATOM   3569 C C     . GLU C 3 422 ? -41.286 -26.288 22.562  1.00 49.38 ? 607 GLU A C     1 
ATOM   3570 O O     . GLU C 3 422 ? -40.219 -26.877 22.354  1.00 49.42 ? 607 GLU A O     1 
ATOM   3571 C CB    . GLU C 3 422 ? -40.679 -25.640 24.944  1.00 49.64 ? 607 GLU A CB    1 
ATOM   3572 C CG    . GLU C 3 422 ? -41.590 -25.833 26.169  1.00 50.22 ? 607 GLU A CG    1 
ATOM   3573 C CD    . GLU C 3 422 ? -41.892 -24.533 26.925  1.00 50.63 ? 607 GLU A CD    1 
ATOM   3574 O OE1   . GLU C 3 422 ? -42.567 -24.604 27.974  1.00 51.37 ? 607 GLU A OE1   1 
ATOM   3575 O OE2   . GLU C 3 422 ? -41.463 -23.446 26.481  1.00 50.38 ? 607 GLU A OE2   1 
ATOM   3576 N N     . SER C 3 423 ? -42.399 -26.531 21.868  1.00 49.16 ? 608 SER A N     1 
ATOM   3577 C CA    . SER C 3 423 ? -42.459 -27.549 20.818  1.00 48.89 ? 608 SER A CA    1 
ATOM   3578 C C     . SER C 3 423 ? -43.463 -27.197 19.720  1.00 48.55 ? 608 SER A C     1 
ATOM   3579 O O     . SER C 3 423 ? -44.489 -26.562 19.975  1.00 48.51 ? 608 SER A O     1 
ATOM   3580 C CB    . SER C 3 423 ? -42.795 -28.918 21.415  1.00 49.03 ? 608 SER A CB    1 
ATOM   3581 O OG    . SER C 3 423 ? -44.043 -28.883 22.084  1.00 49.20 ? 608 SER A OG    1 
ATOM   3582 N N     . LEU C 3 424 ? -43.163 -27.638 18.503  1.00 48.05 ? 609 LEU A N     1 
ATOM   3583 C CA    . LEU C 3 424 ? -43.941 -27.260 17.336  1.00 47.63 ? 609 LEU A CA    1 
ATOM   3584 C C     . LEU C 3 424 ? -43.691 -28.240 16.185  1.00 47.48 ? 609 LEU A C     1 
ATOM   3585 O O     . LEU C 3 424 ? -42.723 -28.098 15.433  1.00 47.40 ? 609 LEU A O     1 
ATOM   3586 C CB    . LEU C 3 424 ? -43.586 -25.818 16.941  1.00 47.57 ? 609 LEU A CB    1 
ATOM   3587 C CG    . LEU C 3 424 ? -44.428 -25.023 15.943  1.00 47.32 ? 609 LEU A CG    1 
ATOM   3588 C CD1   . LEU C 3 424 ? -44.605 -23.585 16.405  1.00 46.64 ? 609 LEU A CD1   1 
ATOM   3589 C CD2   . LEU C 3 424 ? -43.796 -25.068 14.567  1.00 47.54 ? 609 LEU A CD2   1 
ATOM   3590 N N     . HIS C 3 425 ? -44.555 -29.248 16.065  1.00 47.32 ? 610 HIS A N     1 
ATOM   3591 C CA    . HIS C 3 425 ? -44.451 -30.213 14.963  1.00 47.17 ? 610 HIS A CA    1 
ATOM   3592 C C     . HIS C 3 425 ? -45.169 -29.712 13.708  1.00 46.92 ? 610 HIS A C     1 
ATOM   3593 O O     . HIS C 3 425 ? -46.276 -29.172 13.790  1.00 46.81 ? 610 HIS A O     1 
ATOM   3594 C CB    . HIS C 3 425 ? -44.897 -31.631 15.381  1.00 47.23 ? 610 HIS A CB    1 
ATOM   3595 C CG    . HIS C 3 425 ? -46.381 -31.816 15.514  1.00 47.59 ? 610 HIS A CG    1 
ATOM   3596 N ND1   . HIS C 3 425 ? -47.063 -31.559 16.684  1.00 47.97 ? 610 HIS A ND1   1 
ATOM   3597 C CD2   . HIS C 3 425 ? -47.304 -32.283 14.638  1.00 47.77 ? 610 HIS A CD2   1 
ATOM   3598 C CE1   . HIS C 3 425 ? -48.345 -31.835 16.516  1.00 47.66 ? 610 HIS A CE1   1 
ATOM   3599 N NE2   . HIS C 3 425 ? -48.518 -32.274 15.283  1.00 47.62 ? 610 HIS A NE2   1 
ATOM   3600 N N     . CYS C 3 426 ? -44.519 -29.867 12.556  1.00 46.67 ? 611 CYS A N     1 
ATOM   3601 C CA    . CYS C 3 426 ? -45.076 -29.378 11.295  1.00 46.52 ? 611 CYS A CA    1 
ATOM   3602 C C     . CYS C 3 426 ? -44.702 -30.255 10.093  1.00 46.48 ? 611 CYS A C     1 
ATOM   3603 O O     . CYS C 3 426 ? -43.725 -31.007 10.138  1.00 46.53 ? 611 CYS A O     1 
ATOM   3604 C CB    . CYS C 3 426 ? -44.651 -27.926 11.052  1.00 46.37 ? 611 CYS A CB    1 
ATOM   3605 S SG    . CYS C 3 426 ? -43.219 -27.741 9.979   1.00 46.18 ? 611 CYS A SG    1 
ATOM   3606 N N     . SER C 3 427 ? -45.488 -30.142 9.024   1.00 46.32 ? 612 SER A N     1 
ATOM   3607 C CA    . SER C 3 427 ? -45.221 -30.848 7.771   1.00 46.17 ? 612 SER A CA    1 
ATOM   3608 C C     . SER C 3 427 ? -44.143 -30.134 6.958   1.00 46.16 ? 612 SER A C     1 
ATOM   3609 O O     . SER C 3 427 ? -43.969 -28.922 7.079   1.00 46.11 ? 612 SER A O     1 
ATOM   3610 C CB    . SER C 3 427 ? -46.502 -30.962 6.935   1.00 46.07 ? 612 SER A CB    1 
ATOM   3611 O OG    . SER C 3 427 ? -47.537 -31.598 7.661   1.00 45.69 ? 612 SER A OG    1 
ATOM   3612 N N     . ILE C 3 428 ? -43.421 -30.900 6.139   1.00 46.16 ? 613 ILE A N     1 
ATOM   3613 C CA    . ILE C 3 428 ? -42.473 -30.355 5.160   1.00 46.07 ? 613 ILE A CA    1 
ATOM   3614 C C     . ILE C 3 428 ? -43.173 -30.193 3.798   1.00 46.01 ? 613 ILE A C     1 
ATOM   3615 O O     . ILE C 3 428 ? -43.930 -31.078 3.388   1.00 46.04 ? 613 ILE A O     1 
ATOM   3616 C CB    . ILE C 3 428 ? -41.189 -31.245 5.038   1.00 46.06 ? 613 ILE A CB    1 
ATOM   3617 C CG1   . ILE C 3 428 ? -40.188 -30.645 4.040   1.00 45.99 ? 613 ILE A CG1   1 
ATOM   3618 C CG2   . ILE C 3 428 ? -41.543 -32.696 4.678   1.00 46.03 ? 613 ILE A CG2   1 
ATOM   3619 C CD1   . ILE C 3 428 ? -38.835 -31.329 4.002   1.00 46.05 ? 613 ILE A CD1   1 
ATOM   3620 N N     . PRO C 3 429 ? -42.939 -29.058 3.102   1.00 45.96 ? 614 PRO A N     1 
ATOM   3621 C CA    . PRO C 3 429 ? -43.574 -28.879 1.794   1.00 45.92 ? 614 PRO A CA    1 
ATOM   3622 C C     . PRO C 3 429 ? -42.865 -29.686 0.705   1.00 45.86 ? 614 PRO A C     1 
ATOM   3623 O O     . PRO C 3 429 ? -41.630 -29.725 0.684   1.00 45.75 ? 614 PRO A O     1 
ATOM   3624 C CB    . PRO C 3 429 ? -43.429 -27.378 1.532   1.00 45.91 ? 614 PRO A CB    1 
ATOM   3625 C CG    . PRO C 3 429 ? -42.225 -26.971 2.297   1.00 45.99 ? 614 PRO A CG    1 
ATOM   3626 C CD    . PRO C 3 429 ? -42.095 -27.904 3.469   1.00 45.90 ? 614 PRO A CD    1 
ATOM   3627 N N     . PRO C 3 430 ? -43.641 -30.337 -0.190  1.00 45.84 ? 615 PRO A N     1 
ATOM   3628 C CA    . PRO C 3 430 ? -43.060 -31.098 -1.295  1.00 45.83 ? 615 PRO A CA    1 
ATOM   3629 C C     . PRO C 3 430 ? -41.940 -30.317 -1.982  1.00 45.84 ? 615 PRO A C     1 
ATOM   3630 O O     . PRO C 3 430 ? -42.139 -29.159 -2.368  1.00 45.82 ? 615 PRO A O     1 
ATOM   3631 C CB    . PRO C 3 430 ? -44.249 -31.299 -2.237  1.00 45.84 ? 615 PRO A CB    1 
ATOM   3632 C CG    . PRO C 3 430 ? -45.417 -31.367 -1.324  1.00 45.81 ? 615 PRO A CG    1 
ATOM   3633 C CD    . PRO C 3 430 ? -45.116 -30.398 -0.204  1.00 45.84 ? 615 PRO A CD    1 
ATOM   3634 N N     . VAL C 3 431 ? -40.777 -30.958 -2.109  1.00 45.84 ? 616 VAL A N     1 
ATOM   3635 C CA    . VAL C 3 431 ? -39.544 -30.337 -2.620  1.00 45.83 ? 616 VAL A CA    1 
ATOM   3636 C C     . VAL C 3 431 ? -39.783 -29.393 -3.804  1.00 45.90 ? 616 VAL A C     1 
ATOM   3637 O O     . VAL C 3 431 ? -39.141 -28.347 -3.905  1.00 45.84 ? 616 VAL A O     1 
ATOM   3638 C CB    . VAL C 3 431 ? -38.476 -31.404 -3.013  1.00 45.87 ? 616 VAL A CB    1 
ATOM   3639 C CG1   . VAL C 3 431 ? -37.097 -30.766 -3.173  1.00 45.70 ? 616 VAL A CG1   1 
ATOM   3640 C CG2   . VAL C 3 431 ? -38.414 -32.525 -1.982  1.00 45.81 ? 616 VAL A CG2   1 
ATOM   3641 N N     . SER C 3 432 ? -40.713 -29.770 -4.682  1.00 45.94 ? 617 SER A N     1 
ATOM   3642 C CA    . SER C 3 432 ? -41.049 -28.994 -5.878  1.00 46.02 ? 617 SER A CA    1 
ATOM   3643 C C     . SER C 3 432 ? -41.472 -27.551 -5.582  1.00 46.17 ? 617 SER A C     1 
ATOM   3644 O O     . SER C 3 432 ? -40.991 -26.615 -6.221  1.00 46.22 ? 617 SER A O     1 
ATOM   3645 C CB    . SER C 3 432 ? -42.155 -29.694 -6.678  1.00 45.94 ? 617 SER A CB    1 
ATOM   3646 O OG    . SER C 3 432 ? -41.794 -31.022 -7.007  1.00 45.61 ? 617 SER A OG    1 
ATOM   3647 N N     . GLN C 3 433 ? -42.350 -27.381 -4.597  1.00 46.32 ? 618 GLN A N     1 
ATOM   3648 C CA    . GLN C 3 433 ? -43.067 -26.119 -4.400  1.00 46.48 ? 618 GLN A CA    1 
ATOM   3649 C C     . GLN C 3 433 ? -42.293 -25.017 -3.672  1.00 46.60 ? 618 GLN A C     1 
ATOM   3650 O O     . GLN C 3 433 ? -42.886 -24.016 -3.268  1.00 46.63 ? 618 GLN A O     1 
ATOM   3651 C CB    . GLN C 3 433 ? -44.388 -26.381 -3.672  1.00 46.48 ? 618 GLN A CB    1 
ATOM   3652 C CG    . GLN C 3 433 ? -45.318 -27.360 -4.377  1.00 46.45 ? 618 GLN A CG    1 
ATOM   3653 C CD    . GLN C 3 433 ? -46.385 -27.917 -3.455  1.00 46.51 ? 618 GLN A CD    1 
ATOM   3654 O OE1   . GLN C 3 433 ? -46.244 -27.891 -2.229  1.00 46.91 ? 618 GLN A OE1   1 
ATOM   3655 N NE2   . GLN C 3 433 ? -47.460 -28.426 -4.040  1.00 46.11 ? 618 GLN A NE2   1 
ATOM   3656 N N     . VAL C 3 434 ? -40.980 -25.183 -3.519  1.00 46.80 ? 619 VAL A N     1 
ATOM   3657 C CA    . VAL C 3 434 ? -40.181 -24.234 -2.725  1.00 47.02 ? 619 VAL A CA    1 
ATOM   3658 C C     . VAL C 3 434 ? -39.306 -23.255 -3.532  1.00 47.25 ? 619 VAL A C     1 
ATOM   3659 O O     . VAL C 3 434 ? -39.020 -22.152 -3.060  1.00 47.22 ? 619 VAL A O     1 
ATOM   3660 C CB    . VAL C 3 434 ? -39.360 -24.941 -1.604  1.00 46.98 ? 619 VAL A CB    1 
ATOM   3661 C CG1   . VAL C 3 434 ? -40.291 -25.670 -0.639  1.00 46.85 ? 619 VAL A CG1   1 
ATOM   3662 C CG2   . VAL C 3 434 ? -38.327 -25.896 -2.185  1.00 46.84 ? 619 VAL A CG2   1 
ATOM   3663 N N     . ARG C 3 435 ? -38.888 -23.649 -4.734  1.00 47.60 ? 620 ARG A N     1 
ATOM   3664 C CA    . ARG C 3 435 ? -38.186 -22.732 -5.650  1.00 47.85 ? 620 ARG A CA    1 
ATOM   3665 C C     . ARG C 3 435 ? -38.917 -22.623 -6.985  1.00 47.85 ? 620 ARG A C     1 
ATOM   3666 O O     . ARG C 3 435 ? -39.707 -23.504 -7.328  1.00 48.03 ? 620 ARG A O     1 
ATOM   3667 C CB    . ARG C 3 435 ? -36.709 -23.125 -5.853  1.00 47.92 ? 620 ARG A CB    1 
ATOM   3668 C CG    . ARG C 3 435 ? -36.447 -24.539 -6.372  1.00 48.14 ? 620 ARG A CG    1 
ATOM   3669 C CD    . ARG C 3 435 ? -36.269 -25.535 -5.227  1.00 48.95 ? 620 ARG A CD    1 
ATOM   3670 N NE    . ARG C 3 435 ? -35.890 -26.870 -5.691  1.00 49.59 ? 620 ARG A NE    1 
ATOM   3671 C CZ    . ARG C 3 435 ? -36.742 -27.789 -6.142  1.00 50.13 ? 620 ARG A CZ    1 
ATOM   3672 N NH1   . ARG C 3 435 ? -38.043 -27.532 -6.207  1.00 50.39 ? 620 ARG A NH1   1 
ATOM   3673 N NH2   . ARG C 3 435 ? -36.291 -28.972 -6.538  1.00 50.20 ? 620 ARG A NH2   1 
ATOM   3674 N N     . ASN C 3 436 ? -38.667 -21.543 -7.727  1.00 47.91 ? 621 ASN A N     1 
ATOM   3675 C CA    . ASN C 3 436 ? -39.302 -21.343 -9.038  1.00 48.00 ? 621 ASN A CA    1 
ATOM   3676 C C     . ASN C 3 436 ? -38.493 -20.503 -10.036 1.00 48.09 ? 621 ASN A C     1 
ATOM   3677 O O     . ASN C 3 436 ? -37.723 -21.047 -10.834 1.00 48.24 ? 621 ASN A O     1 
ATOM   3678 C CB    . ASN C 3 436 ? -40.740 -20.807 -8.889  1.00 47.93 ? 621 ASN A CB    1 
ATOM   3679 C CG    . ASN C 3 436 ? -40.858 -19.707 -7.847  1.00 47.90 ? 621 ASN A CG    1 
ATOM   3680 O OD1   . ASN C 3 436 ? -39.937 -18.911 -7.657  1.00 47.73 ? 621 ASN A OD1   1 
ATOM   3681 N ND2   . ASN C 3 436 ? -42.001 -19.656 -7.171  1.00 47.76 ? 621 ASN A ND2   1 
ATOM   3682 N N     . GLU C 3 437 ? -38.687 -19.184 -9.988  1.00 48.04 ? 622 GLU A N     1 
ATOM   3683 C CA    . GLU C 3 437 ? -38.058 -18.226 -10.906 1.00 47.91 ? 622 GLU A CA    1 
ATOM   3684 C C     . GLU C 3 437 ? -38.170 -16.825 -10.310 1.00 47.77 ? 622 GLU A C     1 
ATOM   3685 O O     . GLU C 3 437 ? -38.044 -15.811 -11.003 1.00 47.76 ? 622 GLU A O     1 
ATOM   3686 C CB    . GLU C 3 437 ? -38.696 -18.296 -12.299 1.00 47.85 ? 622 GLU A CB    1 
ATOM   3687 C CG    . GLU C 3 437 ? -40.216 -18.209 -12.308 1.00 47.79 ? 622 GLU A CG    1 
ATOM   3688 C CD    . GLU C 3 437 ? -40.844 -19.282 -13.170 1.00 47.64 ? 622 GLU A CD    1 
ATOM   3689 O OE1   . GLU C 3 437 ? -40.724 -20.474 -12.810 1.00 47.24 ? 622 GLU A OE1   1 
ATOM   3690 O OE2   . GLU C 3 437 ? -41.462 -18.937 -14.201 1.00 48.10 ? 622 GLU A OE2   1 
ATOM   3691 N N     . GLN C 3 438 ? -38.431 -16.811 -9.009  1.00 47.59 ? 623 GLN A N     1 
ATOM   3692 C CA    . GLN C 3 438 ? -38.465 -15.619 -8.177  1.00 47.47 ? 623 GLN A CA    1 
ATOM   3693 C C     . GLN C 3 438 ? -37.668 -16.015 -6.931  1.00 47.44 ? 623 GLN A C     1 
ATOM   3694 O O     . GLN C 3 438 ? -36.992 -15.191 -6.311  1.00 47.29 ? 623 GLN A O     1 
ATOM   3695 C CB    . GLN C 3 438 ? -39.916 -15.266 -7.838  1.00 47.38 ? 623 GLN A CB    1 
ATOM   3696 C CG    . GLN C 3 438 ? -40.113 -13.981 -7.040  1.00 47.26 ? 623 GLN A CG    1 
ATOM   3697 C CD    . GLN C 3 438 ? -39.922 -12.712 -7.853  1.00 46.92 ? 623 GLN A CD    1 
ATOM   3698 O OE1   . GLN C 3 438 ? -39.461 -11.697 -7.326  1.00 46.48 ? 623 GLN A OE1   1 
ATOM   3699 N NE2   . GLN C 3 438 ? -40.281 -12.756 -9.133  1.00 46.47 ? 623 GLN A NE2   1 
ATOM   3700 N N     . THR C 3 439 ? -37.769 -17.297 -6.586  1.00 47.46 ? 624 THR A N     1 
ATOM   3701 C CA    . THR C 3 439 ? -36.845 -17.964 -5.683  1.00 47.41 ? 624 THR A CA    1 
ATOM   3702 C C     . THR C 3 439 ? -36.173 -19.097 -6.455  1.00 47.65 ? 624 THR A C     1 
ATOM   3703 O O     . THR C 3 439 ? -36.837 -19.857 -7.169  1.00 47.63 ? 624 THR A O     1 
ATOM   3704 C CB    . THR C 3 439 ? -37.552 -18.529 -4.439  1.00 47.37 ? 624 THR A CB    1 
ATOM   3705 O OG1   . THR C 3 439 ? -38.597 -19.422 -4.837  1.00 46.83 ? 624 THR A OG1   1 
ATOM   3706 C CG2   . THR C 3 439 ? -38.145 -17.405 -3.603  1.00 47.51 ? 624 THR A CG2   1 
ATOM   3707 N N     . HIS C 3 440 ? -34.854 -19.189 -6.319  1.00 47.91 ? 625 HIS A N     1 
ATOM   3708 C CA    . HIS C 3 440 ? -34.032 -20.157 -7.045  1.00 48.11 ? 625 HIS A CA    1 
ATOM   3709 C C     . HIS C 3 440 ? -32.567 -19.817 -6.799  1.00 48.21 ? 625 HIS A C     1 
ATOM   3710 O O     . HIS C 3 440 ? -31.792 -20.647 -6.318  1.00 48.24 ? 625 HIS A O     1 
ATOM   3711 C CB    . HIS C 3 440 ? -34.323 -20.103 -8.547  1.00 48.10 ? 625 HIS A CB    1 
ATOM   3712 C CG    . HIS C 3 440 ? -33.744 -21.246 -9.319  1.00 48.44 ? 625 HIS A CG    1 
ATOM   3713 N ND1   . HIS C 3 440 ? -34.524 -22.238 -9.874  1.00 48.90 ? 625 HIS A ND1   1 
ATOM   3714 C CD2   . HIS C 3 440 ? -32.464 -21.554 -9.634  1.00 48.56 ? 625 HIS A CD2   1 
ATOM   3715 C CE1   . HIS C 3 440 ? -33.750 -23.108 -10.497 1.00 48.78 ? 625 HIS A CE1   1 
ATOM   3716 N NE2   . HIS C 3 440 ? -32.495 -22.717 -10.366 1.00 48.84 ? 625 HIS A NE2   1 
ATOM   3717 N N     . TRP C 3 441 ? -32.212 -18.579 -7.138  1.00 48.25 ? 626 TRP A N     1 
ATOM   3718 C CA    . TRP C 3 441 ? -30.869 -18.031 -6.948  1.00 48.19 ? 626 TRP A CA    1 
ATOM   3719 C C     . TRP C 3 441 ? -30.476 -17.939 -5.477  1.00 47.95 ? 626 TRP A C     1 
ATOM   3720 O O     . TRP C 3 441 ? -29.312 -18.138 -5.129  1.00 47.94 ? 626 TRP A O     1 
ATOM   3721 C CB    . TRP C 3 441 ? -30.765 -16.652 -7.610  1.00 48.38 ? 626 TRP A CB    1 
ATOM   3722 C CG    . TRP C 3 441 ? -32.082 -15.924 -7.692  1.00 48.70 ? 626 TRP A CG    1 
ATOM   3723 C CD1   . TRP C 3 441 ? -32.716 -15.254 -6.681  1.00 48.89 ? 626 TRP A CD1   1 
ATOM   3724 C CD2   . TRP C 3 441 ? -32.928 -15.806 -8.846  1.00 48.58 ? 626 TRP A CD2   1 
ATOM   3725 N NE1   . TRP C 3 441 ? -33.902 -14.724 -7.136  1.00 48.98 ? 626 TRP A NE1   1 
ATOM   3726 C CE2   . TRP C 3 441 ? -34.056 -15.046 -8.460  1.00 48.74 ? 626 TRP A CE2   1 
ATOM   3727 C CE3   . TRP C 3 441 ? -32.841 -16.266 -10.168 1.00 48.96 ? 626 TRP A CE3   1 
ATOM   3728 C CZ2   . TRP C 3 441 ? -35.092 -14.733 -9.350  1.00 48.61 ? 626 TRP A CZ2   1 
ATOM   3729 C CZ3   . TRP C 3 441 ? -33.873 -15.954 -11.055 1.00 48.81 ? 626 TRP A CZ3   1 
ATOM   3730 C CH2   . TRP C 3 441 ? -34.982 -15.194 -10.639 1.00 48.72 ? 626 TRP A CH2   1 
ATOM   3731 N N     . MET C 3 442 ? -31.449 -17.637 -4.623  1.00 47.68 ? 627 MET A N     1 
ATOM   3732 C CA    . MET C 3 442 ? -31.217 -17.555 -3.180  1.00 47.60 ? 627 MET A CA    1 
ATOM   3733 C C     . MET C 3 442 ? -31.355 -18.916 -2.496  1.00 47.17 ? 627 MET A C     1 
ATOM   3734 O O     . MET C 3 442 ? -30.943 -19.080 -1.348  1.00 47.07 ? 627 MET A O     1 
ATOM   3735 C CB    . MET C 3 442 ? -32.168 -16.534 -2.538  1.00 47.51 ? 627 MET A CB    1 
ATOM   3736 C CG    . MET C 3 442 ? -33.639 -16.729 -2.909  1.00 47.94 ? 627 MET A CG    1 
ATOM   3737 S SD    . MET C 3 442 ? -34.729 -15.350 -2.488  1.00 48.25 ? 627 MET A SD    1 
ATOM   3738 C CE    . MET C 3 442 ? -34.401 -14.204 -3.826  1.00 47.57 ? 627 MET A CE    1 
ATOM   3739 N N     . PHE C 3 443 ? -31.911 -19.890 -3.216  1.00 46.82 ? 628 PHE A N     1 
ATOM   3740 C CA    . PHE C 3 443 ? -32.341 -21.161 -2.620  1.00 46.44 ? 628 PHE A CA    1 
ATOM   3741 C C     . PHE C 3 443 ? -31.484 -22.375 -2.973  1.00 46.22 ? 628 PHE A C     1 
ATOM   3742 O O     . PHE C 3 443 ? -31.335 -23.290 -2.163  1.00 46.21 ? 628 PHE A O     1 
ATOM   3743 C CB    . PHE C 3 443 ? -33.812 -21.427 -2.964  1.00 46.42 ? 628 PHE A CB    1 
ATOM   3744 C CG    . PHE C 3 443 ? -34.787 -20.827 -1.985  1.00 46.13 ? 628 PHE A CG    1 
ATOM   3745 C CD1   . PHE C 3 443 ? -34.460 -19.686 -1.256  1.00 45.84 ? 628 PHE A CD1   1 
ATOM   3746 C CD2   . PHE C 3 443 ? -36.040 -21.396 -1.802  1.00 45.88 ? 628 PHE A CD2   1 
ATOM   3747 C CE1   . PHE C 3 443 ? -35.354 -19.134 -0.358  1.00 45.62 ? 628 PHE A CE1   1 
ATOM   3748 C CE2   . PHE C 3 443 ? -36.944 -20.847 -0.904  1.00 45.82 ? 628 PHE A CE2   1 
ATOM   3749 C CZ    . PHE C 3 443 ? -36.598 -19.713 -0.183  1.00 45.88 ? 628 PHE A CZ    1 
ATOM   3750 N N     . THR C 3 444 ? -30.942 -22.392 -4.183  1.00 45.96 ? 629 THR A N     1 
ATOM   3751 C CA    . THR C 3 444 ? -30.026 -23.448 -4.586  1.00 45.74 ? 629 THR A CA    1 
ATOM   3752 C C     . THR C 3 444 ? -28.617 -23.048 -4.185  1.00 45.63 ? 629 THR A C     1 
ATOM   3753 O O     . THR C 3 444 ? -28.223 -21.891 -4.352  1.00 45.52 ? 629 THR A O     1 
ATOM   3754 C CB    . THR C 3 444 ? -30.077 -23.699 -6.109  1.00 45.68 ? 629 THR A CB    1 
ATOM   3755 O OG1   . THR C 3 444 ? -31.424 -23.988 -6.503  1.00 45.64 ? 629 THR A OG1   1 
ATOM   3756 C CG2   . THR C 3 444 ? -29.176 -24.869 -6.501  1.00 45.53 ? 629 THR A CG2   1 
ATOM   3757 N N     . ASN C 3 445 ? -27.863 -24.002 -3.647  1.00 45.61 ? 630 ASN A N     1 
ATOM   3758 C CA    . ASN C 3 445 ? -26.460 -23.761 -3.343  1.00 45.64 ? 630 ASN A CA    1 
ATOM   3759 C C     . ASN C 3 445 ? -25.621 -23.664 -4.615  1.00 45.58 ? 630 ASN A C     1 
ATOM   3760 O O     . ASN C 3 445 ? -25.858 -24.377 -5.600  1.00 45.51 ? 630 ASN A O     1 
ATOM   3761 C CB    . ASN C 3 445 ? -25.896 -24.827 -2.401  1.00 45.70 ? 630 ASN A CB    1 
ATOM   3762 C CG    . ASN C 3 445 ? -24.540 -24.440 -1.820  1.00 45.95 ? 630 ASN A CG    1 
ATOM   3763 O OD1   . ASN C 3 445 ? -24.223 -23.257 -1.669  1.00 46.32 ? 630 ASN A OD1   1 
ATOM   3764 N ND2   . ASN C 3 445 ? -23.736 -25.441 -1.485  1.00 46.02 ? 630 ASN A ND2   1 
ATOM   3765 N N     . ARG C 3 446 ? -24.648 -22.761 -4.575  1.00 45.48 ? 631 ARG A N     1 
ATOM   3766 C CA    . ARG C 3 446 ? -23.754 -22.494 -5.698  1.00 45.37 ? 631 ARG A CA    1 
ATOM   3767 C C     . ARG C 3 446 ? -22.525 -23.412 -5.678  1.00 45.10 ? 631 ARG A C     1 
ATOM   3768 O O     . ARG C 3 446 ? -21.659 -23.325 -6.551  1.00 44.95 ? 631 ARG A O     1 
ATOM   3769 C CB    . ARG C 3 446 ? -23.341 -21.015 -5.686  1.00 45.50 ? 631 ARG A CB    1 
ATOM   3770 C CG    . ARG C 3 446 ? -22.842 -20.490 -4.322  1.00 45.83 ? 631 ARG A CG    1 
ATOM   3771 C CD    . ARG C 3 446 ? -23.410 -19.105 -3.968  1.00 46.46 ? 631 ARG A CD    1 
ATOM   3772 N NE    . ARG C 3 446 ? -23.403 -18.179 -5.103  1.00 47.04 ? 631 ARG A NE    1 
ATOM   3773 C CZ    . ARG C 3 446 ? -24.473 -17.864 -5.832  1.00 47.26 ? 631 ARG A CZ    1 
ATOM   3774 N NH1   . ARG C 3 446 ? -25.660 -18.389 -5.549  1.00 47.14 ? 631 ARG A NH1   1 
ATOM   3775 N NH2   . ARG C 3 446 ? -24.359 -17.019 -6.850  1.00 47.32 ? 631 ARG A NH2   1 
ATOM   3776 N N     . THR C 3 447 ? -22.468 -24.289 -4.677  1.00 44.84 ? 632 THR A N     1 
ATOM   3777 C CA    . THR C 3 447 ? -21.355 -25.216 -4.499  1.00 44.54 ? 632 THR A CA    1 
ATOM   3778 C C     . THR C 3 447 ? -21.828 -26.670 -4.613  1.00 44.27 ? 632 THR A C     1 
ATOM   3779 O O     . THR C 3 447 ? -21.373 -27.405 -5.491  1.00 44.20 ? 632 THR A O     1 
ATOM   3780 C CB    . THR C 3 447 ? -20.634 -24.995 -3.138  1.00 44.58 ? 632 THR A CB    1 
ATOM   3781 O OG1   . THR C 3 447 ? -20.433 -23.593 -2.914  1.00 44.71 ? 632 THR A OG1   1 
ATOM   3782 C CG2   . THR C 3 447 ? -19.284 -25.706 -3.110  1.00 44.65 ? 632 THR A CG2   1 
ATOM   3783 N N     . THR C 3 448 ? -22.744 -27.069 -3.731  1.00 43.91 ? 633 THR A N     1 
ATOM   3784 C CA    . THR C 3 448 ? -23.222 -28.454 -3.663  1.00 43.51 ? 633 THR A CA    1 
ATOM   3785 C C     . THR C 3 448 ? -24.204 -28.796 -4.786  1.00 43.21 ? 633 THR A C     1 
ATOM   3786 O O     . THR C 3 448 ? -24.178 -29.904 -5.326  1.00 43.20 ? 633 THR A O     1 
ATOM   3787 C CB    . THR C 3 448 ? -23.873 -28.787 -2.283  1.00 43.58 ? 633 THR A CB    1 
ATOM   3788 O OG1   . THR C 3 448 ? -24.956 -27.886 -2.020  1.00 43.46 ? 633 THR A OG1   1 
ATOM   3789 C CG2   . THR C 3 448 ? -22.848 -28.699 -1.146  1.00 43.42 ? 633 THR A CG2   1 
ATOM   3790 N N     . GLY C 3 449 ? -25.060 -27.838 -5.136  1.00 42.83 ? 634 GLY A N     1 
ATOM   3791 C CA    . GLY C 3 449 ? -26.143 -28.076 -6.089  1.00 42.27 ? 634 GLY A CA    1 
ATOM   3792 C C     . GLY C 3 449 ? -27.432 -28.475 -5.389  1.00 41.90 ? 634 GLY A C     1 
ATOM   3793 O O     . GLY C 3 449 ? -28.504 -28.464 -5.995  1.00 41.91 ? 634 GLY A O     1 
ATOM   3794 N N     . ASP C 3 450 ? -27.320 -28.830 -4.110  1.00 41.47 ? 635 ASP A N     1 
ATOM   3795 C CA    . ASP C 3 450 ? -28.467 -29.206 -3.290  1.00 40.94 ? 635 ASP A CA    1 
ATOM   3796 C C     . ASP C 3 450 ? -29.199 -27.957 -2.822  1.00 40.55 ? 635 ASP A C     1 
ATOM   3797 O O     . ASP C 3 450 ? -28.603 -26.883 -2.719  1.00 40.46 ? 635 ASP A O     1 
ATOM   3798 C CB    . ASP C 3 450 ? -28.017 -30.046 -2.090  1.00 41.00 ? 635 ASP A CB    1 
ATOM   3799 C CG    . ASP C 3 450 ? -27.252 -31.300 -2.501  1.00 41.18 ? 635 ASP A CG    1 
ATOM   3800 O OD1   . ASP C 3 450 ? -27.774 -32.087 -3.323  1.00 40.94 ? 635 ASP A OD1   1 
ATOM   3801 O OD2   . ASP C 3 450 ? -26.127 -31.499 -1.995  1.00 41.40 ? 635 ASP A OD2   1 
ATOM   3802 N N     . VAL C 3 451 ? -30.491 -28.105 -2.545  1.00 40.11 ? 636 VAL A N     1 
ATOM   3803 C CA    . VAL C 3 451 ? -31.329 -26.979 -2.150  1.00 39.72 ? 636 VAL A CA    1 
ATOM   3804 C C     . VAL C 3 451 ? -31.249 -26.762 -0.642  1.00 39.49 ? 636 VAL A C     1 
ATOM   3805 O O     . VAL C 3 451 ? -31.478 -27.689 0.134   1.00 39.57 ? 636 VAL A O     1 
ATOM   3806 C CB    . VAL C 3 451 ? -32.805 -27.188 -2.561  1.00 39.70 ? 636 VAL A CB    1 
ATOM   3807 C CG1   . VAL C 3 451 ? -33.543 -25.863 -2.561  1.00 39.73 ? 636 VAL A CG1   1 
ATOM   3808 C CG2   . VAL C 3 451 ? -32.900 -27.837 -3.938  1.00 39.90 ? 636 VAL A CG2   1 
ATOM   3809 N N     . GLU C 3 452 ? -30.913 -25.538 -0.239  1.00 39.11 ? 637 GLU A N     1 
ATOM   3810 C CA    . GLU C 3 452 ? -30.849 -25.159 1.177   1.00 38.72 ? 637 GLU A CA    1 
ATOM   3811 C C     . GLU C 3 452 ? -31.732 -23.937 1.446   1.00 38.36 ? 637 GLU A C     1 
ATOM   3812 O O     . GLU C 3 452 ? -31.513 -22.868 0.872   1.00 38.41 ? 637 GLU A O     1 
ATOM   3813 C CB    . GLU C 3 452 ? -29.401 -24.885 1.601   1.00 38.71 ? 637 GLU A CB    1 
ATOM   3814 C CG    . GLU C 3 452 ? -28.538 -26.140 1.724   1.00 39.20 ? 637 GLU A CG    1 
ATOM   3815 C CD    . GLU C 3 452 ? -27.046 -25.875 1.528   1.00 39.86 ? 637 GLU A CD    1 
ATOM   3816 O OE1   . GLU C 3 452 ? -26.597 -24.730 1.761   1.00 40.34 ? 637 GLU A OE1   1 
ATOM   3817 O OE2   . GLU C 3 452 ? -26.319 -26.818 1.141   1.00 39.59 ? 637 GLU A OE2   1 
ATOM   3818 N N     . VAL C 3 453 ? -32.722 -24.103 2.323   1.00 37.95 ? 638 VAL A N     1 
ATOM   3819 C CA    . VAL C 3 453 ? -33.760 -23.086 2.551   1.00 37.60 ? 638 VAL A CA    1 
ATOM   3820 C C     . VAL C 3 453 ? -33.724 -22.412 3.933   1.00 37.46 ? 638 VAL A C     1 
ATOM   3821 O O     . VAL C 3 453 ? -33.599 -23.097 4.948   1.00 37.60 ? 638 VAL A O     1 
ATOM   3822 C CB    . VAL C 3 453 ? -35.176 -23.673 2.339   1.00 37.51 ? 638 VAL A CB    1 
ATOM   3823 C CG1   . VAL C 3 453 ? -35.495 -23.786 0.863   1.00 37.73 ? 638 VAL A CG1   1 
ATOM   3824 C CG2   . VAL C 3 453 ? -35.334 -25.024 3.046   1.00 37.12 ? 638 VAL A CG2   1 
ATOM   3825 N N     . PRO C 3 454 ? -33.850 -21.067 3.978   1.00 37.23 ? 639 PRO A N     1 
ATOM   3826 C CA    . PRO C 3 454 ? -33.949 -20.380 5.276   1.00 36.87 ? 639 PRO A CA    1 
ATOM   3827 C C     . PRO C 3 454 ? -35.319 -20.567 5.931   1.00 36.64 ? 639 PRO A C     1 
ATOM   3828 O O     . PRO C 3 454 ? -36.355 -20.317 5.307   1.00 36.69 ? 639 PRO A O     1 
ATOM   3829 C CB    . PRO C 3 454 ? -33.714 -18.909 4.922   1.00 36.88 ? 639 PRO A CB    1 
ATOM   3830 C CG    . PRO C 3 454 ? -34.120 -18.789 3.481   1.00 37.08 ? 639 PRO A CG    1 
ATOM   3831 C CD    . PRO C 3 454 ? -33.884 -20.127 2.839   1.00 37.05 ? 639 PRO A CD    1 
ATOM   3832 N N     . ILE C 3 455 ? -35.307 -21.018 7.181   1.00 36.38 ? 640 ILE A N     1 
ATOM   3833 C CA    . ILE C 3 455 ? -36.528 -21.245 7.952   1.00 36.00 ? 640 ILE A CA    1 
ATOM   3834 C C     . ILE C 3 455 ? -36.955 -19.972 8.667   1.00 35.74 ? 640 ILE A C     1 
ATOM   3835 O O     . ILE C 3 455 ? -36.123 -19.233 9.186   1.00 35.82 ? 640 ILE A O     1 
ATOM   3836 C CB    . ILE C 3 455 ? -36.345 -22.411 8.957   1.00 35.95 ? 640 ILE A CB    1 
ATOM   3837 C CG1   . ILE C 3 455 ? -36.506 -23.750 8.226   1.00 36.17 ? 640 ILE A CG1   1 
ATOM   3838 C CG2   . ILE C 3 455 ? -37.330 -22.310 10.122  1.00 35.69 ? 640 ILE A CG2   1 
ATOM   3839 C CD1   . ILE C 3 455 ? -36.053 -24.959 9.022   1.00 35.56 ? 640 ILE A CD1   1 
ATOM   3840 N N     . SER C 3 456 ? -38.258 -19.718 8.680   1.00 35.48 ? 641 SER A N     1 
ATOM   3841 C CA    . SER C 3 456 ? -38.792 -18.560 9.373   1.00 35.22 ? 641 SER A CA    1 
ATOM   3842 C C     . SER C 3 456 ? -40.047 -18.890 10.144  1.00 35.00 ? 641 SER A C     1 
ATOM   3843 O O     . SER C 3 456 ? -40.796 -19.784 9.760   1.00 35.05 ? 641 SER A O     1 
ATOM   3844 C CB    . SER C 3 456 ? -39.076 -17.428 8.390   1.00 35.08 ? 641 SER A CB    1 
ATOM   3845 O OG    . SER C 3 456 ? -37.886 -16.718 8.101   1.00 35.40 ? 641 SER A OG    1 
ATOM   3846 N N     . LEU C 3 457 ? -40.253 -18.168 11.242  1.00 34.59 ? 642 LEU A N     1 
ATOM   3847 C CA    . LEU C 3 457 ? -41.542 -18.121 11.908  1.00 34.50 ? 642 LEU A CA    1 
ATOM   3848 C C     . LEU C 3 457 ? -42.130 -16.734 11.684  1.00 34.74 ? 642 LEU A C     1 
ATOM   3849 O O     . LEU C 3 457 ? -41.434 -15.734 11.862  1.00 34.64 ? 642 LEU A O     1 
ATOM   3850 C CB    . LEU C 3 457 ? -41.402 -18.417 13.400  1.00 34.39 ? 642 LEU A CB    1 
ATOM   3851 C CG    . LEU C 3 457 ? -40.937 -19.818 13.806  1.00 34.18 ? 642 LEU A CG    1 
ATOM   3852 C CD1   . LEU C 3 457 ? -40.830 -19.916 15.305  1.00 34.56 ? 642 LEU A CD1   1 
ATOM   3853 C CD2   . LEU C 3 457 ? -41.860 -20.906 13.279  1.00 35.15 ? 642 LEU A CD2   1 
ATOM   3854 N N     . VAL C 3 458 ? -43.396 -16.683 11.262  1.00 35.03 ? 643 VAL A N     1 
ATOM   3855 C CA    . VAL C 3 458 ? -44.100 -15.419 11.002  1.00 35.30 ? 643 VAL A CA    1 
ATOM   3856 C C     . VAL C 3 458 ? -45.457 -15.361 11.703  1.00 35.61 ? 643 VAL A C     1 
ATOM   3857 O O     . VAL C 3 458 ? -46.237 -16.320 11.673  1.00 35.44 ? 643 VAL A O     1 
ATOM   3858 C CB    . VAL C 3 458 ? -44.299 -15.165 9.493   1.00 35.36 ? 643 VAL A CB    1 
ATOM   3859 C CG1   . VAL C 3 458 ? -45.018 -16.313 8.869   1.00 35.44 ? 643 VAL A CG1   1 
ATOM   3860 C CG2   . VAL C 3 458 ? -45.088 -13.871 9.243   1.00 35.11 ? 643 VAL A CG2   1 
ATOM   3861 N N     . ARG C 3 459 ? -45.722 -14.216 12.323  1.00 36.06 ? 644 ARG A N     1 
ATOM   3862 C CA    . ARG C 3 459 ? -46.955 -13.987 13.057  1.00 36.50 ? 644 ARG A CA    1 
ATOM   3863 C C     . ARG C 3 459 ? -48.020 -13.507 12.089  1.00 37.00 ? 644 ARG A C     1 
ATOM   3864 O O     . ARG C 3 459 ? -47.710 -12.906 11.053  1.00 37.25 ? 644 ARG A O     1 
ATOM   3865 C CB    . ARG C 3 459 ? -46.725 -12.947 14.155  1.00 36.34 ? 644 ARG A CB    1 
ATOM   3866 C CG    . ARG C 3 459 ? -47.576 -13.147 15.404  1.00 35.74 ? 644 ARG A CG    1 
ATOM   3867 C CD    . ARG C 3 459 ? -47.076 -12.258 16.539  1.00 34.79 ? 644 ARG A CD    1 
ATOM   3868 N NE    . ARG C 3 459 ? -47.349 -10.814 16.259  1.00 33.63 ? 644 ARG A NE    1 
ATOM   3869 C CZ    . ARG C 3 459 ? -46.959 -9.821  17.060  1.00 35.39 ? 644 ARG A CZ    1 
ATOM   3870 N NH1   . ARG C 3 459 ? -46.230 -10.082 18.244  1.00 36.65 ? 644 ARG A NH1   1 
ATOM   3871 N NH2   . ARG C 3 459 ? -47.209 -8.547  16.661  1.00 34.82 ? 644 ARG A NH2   1 
ATOM   3872 N N     . ASP C 3 460 ? -49.277 -13.768 12.419  1.00 37.48 ? 645 ASP A N     1 
ATOM   3873 C CA    . ASP C 3 460 ? -50.376 -13.383 11.542  1.00 38.04 ? 645 ASP A CA    1 
ATOM   3874 C C     . ASP C 3 460 ? -50.436 -11.869 11.363  1.00 38.14 ? 645 ASP A C     1 
ATOM   3875 O O     . ASP C 3 460 ? -50.754 -11.382 10.281  1.00 38.78 ? 645 ASP A O     1 
ATOM   3876 C CB    . ASP C 3 460 ? -51.691 -13.955 12.059  1.00 38.17 ? 645 ASP A CB    1 
ATOM   3877 C CG    . ASP C 3 460 ? -51.661 -15.475 12.157  1.00 38.82 ? 645 ASP A CG    1 
ATOM   3878 O OD1   . ASP C 3 460 ? -52.333 -16.020 13.061  1.00 39.54 ? 645 ASP A OD1   1 
ATOM   3879 O OD2   . ASP C 3 460 ? -50.955 -16.121 11.344  1.00 38.87 ? 645 ASP A OD2   1 
ATOM   3880 N N     . ASP C 3 461 ? -50.116 -11.146 12.432  1.00 38.32 ? 646 ASP A N     1 
ATOM   3881 C CA    . ASP C 3 461 ? -49.793 -9.718  12.397  1.00 38.39 ? 646 ASP A CA    1 
ATOM   3882 C C     . ASP C 3 461 ? -49.091 -9.277  11.116  1.00 37.92 ? 646 ASP A C     1 
ATOM   3883 O O     . ASP C 3 461 ? -49.326 -8.179  10.627  1.00 37.54 ? 646 ASP A O     1 
ATOM   3884 C CB    . ASP C 3 461 ? -48.853 -9.384  13.572  1.00 38.58 ? 646 ASP A CB    1 
ATOM   3885 C CG    . ASP C 3 461 ? -49.595 -9.153  14.878  1.00 40.16 ? 646 ASP A CG    1 
ATOM   3886 O OD1   . ASP C 3 461 ? -50.321 -10.101 15.346  1.00 41.86 ? 646 ASP A OD1   1 
ATOM   3887 O OD2   . ASP C 3 461 ? -49.441 -8.004  15.453  1.00 42.95 ? 646 ASP A OD2   1 
ATOM   3888 N N     . GLY C 3 462 ? -48.202 -10.127 10.605  1.00 37.65 ? 647 GLY A N     1 
ATOM   3889 C CA    . GLY C 3 462 ? -47.309 -9.750  9.525   1.00 37.74 ? 647 GLY A CA    1 
ATOM   3890 C C     . GLY C 3 462 ? -45.835 -9.669  9.901   1.00 38.19 ? 647 GLY A C     1 
ATOM   3891 O O     . GLY C 3 462 ? -44.996 -9.446  9.028   1.00 38.21 ? 647 GLY A O     1 
ATOM   3892 N N     . VAL C 3 463 ? -45.501 -9.846  11.181  1.00 38.15 ? 648 VAL A N     1 
ATOM   3893 C CA    . VAL C 3 463 ? -44.103 -9.741  11.598  1.00 38.37 ? 648 VAL A CA    1 
ATOM   3894 C C     . VAL C 3 463 ? -43.389 -11.094 11.473  1.00 38.56 ? 648 VAL A C     1 
ATOM   3895 O O     . VAL C 3 463 ? -43.885 -12.120 11.954  1.00 38.72 ? 648 VAL A O     1 
ATOM   3896 C CB    . VAL C 3 463 ? -43.908 -9.102  13.026  1.00 38.53 ? 648 VAL A CB    1 
ATOM   3897 C CG1   . VAL C 3 463 ? -45.215 -8.577  13.600  1.00 37.82 ? 648 VAL A CG1   1 
ATOM   3898 C CG2   . VAL C 3 463 ? -43.275 -10.069 13.986  1.00 38.05 ? 648 VAL A CG2   1 
ATOM   3899 N N     . VAL C 3 464 ? -42.244 -11.089 10.797  1.00 38.43 ? 649 VAL A N     1 
ATOM   3900 C CA    . VAL C 3 464 ? -41.459 -12.309 10.623  1.00 38.43 ? 649 VAL A CA    1 
ATOM   3901 C C     . VAL C 3 464 ? -40.232 -12.338 11.524  1.00 38.22 ? 649 VAL A C     1 
ATOM   3902 O O     . VAL C 3 464 ? -39.520 -11.342 11.676  1.00 37.76 ? 649 VAL A O     1 
ATOM   3903 C CB    . VAL C 3 464 ? -41.078 -12.605 9.130   1.00 38.76 ? 649 VAL A CB    1 
ATOM   3904 C CG1   . VAL C 3 464 ? -41.065 -11.335 8.277   1.00 39.39 ? 649 VAL A CG1   1 
ATOM   3905 C CG2   . VAL C 3 464 ? -39.736 -13.368 9.026   1.00 38.59 ? 649 VAL A CG2   1 
ATOM   3906 N N     . TYR C 3 465 ? -40.028 -13.506 12.122  1.00 38.04 ? 650 TYR A N     1 
ATOM   3907 C CA    . TYR C 3 465 ? -38.915 -13.784 12.985  1.00 37.80 ? 650 TYR A CA    1 
ATOM   3908 C C     . TYR C 3 465 ? -37.996 -14.752 12.269  1.00 37.84 ? 650 TYR A C     1 
ATOM   3909 O O     . TYR C 3 465 ? -38.241 -15.958 12.260  1.00 37.80 ? 650 TYR A O     1 
ATOM   3910 C CB    . TYR C 3 465 ? -39.423 -14.423 14.277  1.00 37.97 ? 650 TYR A CB    1 
ATOM   3911 C CG    . TYR C 3 465 ? -40.511 -13.639 14.978  1.00 37.91 ? 650 TYR A CG    1 
ATOM   3912 C CD1   . TYR C 3 465 ? -41.843 -14.040 14.907  1.00 37.50 ? 650 TYR A CD1   1 
ATOM   3913 C CD2   . TYR C 3 465 ? -40.207 -12.495 15.710  1.00 38.14 ? 650 TYR A CD2   1 
ATOM   3914 C CE1   . TYR C 3 465 ? -42.847 -13.320 15.554  1.00 37.98 ? 650 TYR A CE1   1 
ATOM   3915 C CE2   . TYR C 3 465 ? -41.200 -11.767 16.357  1.00 38.61 ? 650 TYR A CE2   1 
ATOM   3916 C CZ    . TYR C 3 465 ? -42.519 -12.184 16.278  1.00 38.13 ? 650 TYR A CZ    1 
ATOM   3917 O OH    . TYR C 3 465 ? -43.507 -11.463 16.918  1.00 37.55 ? 650 TYR A OH    1 
ATOM   3918 N N     . SER C 3 466 ? -36.941 -14.228 11.654  1.00 37.95 ? 651 SER A N     1 
ATOM   3919 C CA    . SER C 3 466 ? -35.962 -15.095 11.000  1.00 38.26 ? 651 SER A CA    1 
ATOM   3920 C C     . SER C 3 466 ? -35.274 -15.919 12.071  1.00 38.13 ? 651 SER A C     1 
ATOM   3921 O O     . SER C 3 466 ? -34.760 -15.368 13.040  1.00 38.41 ? 651 SER A O     1 
ATOM   3922 C CB    . SER C 3 466 ? -34.952 -14.282 10.190  1.00 38.33 ? 651 SER A CB    1 
ATOM   3923 O OG    . SER C 3 466 ? -34.475 -13.183 10.940  1.00 39.05 ? 651 SER A OG    1 
ATOM   3924 N N     . SER C 3 467 ? -35.301 -17.238 11.912  1.00 38.18 ? 652 SER A N     1 
ATOM   3925 C CA    . SER C 3 467 ? -34.828 -18.151 12.950  1.00 38.40 ? 652 SER A CA    1 
ATOM   3926 C C     . SER C 3 467 ? -33.304 -18.216 13.095  1.00 38.71 ? 652 SER A C     1 
ATOM   3927 O O     . SER C 3 467 ? -32.800 -18.596 14.149  1.00 38.94 ? 652 SER A O     1 
ATOM   3928 C CB    . SER C 3 467 ? -35.378 -19.557 12.715  1.00 38.34 ? 652 SER A CB    1 
ATOM   3929 O OG    . SER C 3 467 ? -34.857 -20.115 11.517  1.00 38.63 ? 652 SER A OG    1 
ATOM   3930 N N     . GLY C 3 468 ? -32.580 -17.839 12.044  1.00 39.01 ? 653 GLY A N     1 
ATOM   3931 C CA    . GLY C 3 468 ? -31.134 -18.022 11.989  1.00 39.42 ? 653 GLY A CA    1 
ATOM   3932 C C     . GLY C 3 468 ? -30.762 -19.398 11.457  1.00 39.79 ? 653 GLY A C     1 
ATOM   3933 O O     . GLY C 3 468 ? -29.587 -19.685 11.206  1.00 39.94 ? 653 GLY A O     1 
ATOM   3934 N N     . LEU C 3 469 ? -31.773 -20.249 11.290  1.00 40.00 ? 654 LEU A N     1 
ATOM   3935 C CA    . LEU C 3 469 ? -31.589 -21.610 10.797  1.00 40.28 ? 654 LEU A CA    1 
ATOM   3936 C C     . LEU C 3 469 ? -31.965 -21.703 9.330   1.00 40.42 ? 654 LEU A C     1 
ATOM   3937 O O     . LEU C 3 469 ? -32.960 -21.116 8.912   1.00 40.57 ? 654 LEU A O     1 
ATOM   3938 C CB    . LEU C 3 469 ? -32.440 -22.592 11.613  1.00 40.28 ? 654 LEU A CB    1 
ATOM   3939 C CG    . LEU C 3 469 ? -31.813 -23.296 12.828  1.00 40.34 ? 654 LEU A CG    1 
ATOM   3940 C CD1   . LEU C 3 469 ? -31.098 -22.328 13.775  1.00 40.73 ? 654 LEU A CD1   1 
ATOM   3941 C CD2   . LEU C 3 469 ? -32.853 -24.115 13.585  1.00 40.06 ? 654 LEU A CD2   1 
ATOM   3942 N N     . THR C 3 470 ? -31.155 -22.415 8.548   1.00 40.77 ? 655 THR A N     1 
ATOM   3943 C CA    . THR C 3 470 ? -31.540 -22.787 7.183   1.00 41.13 ? 655 THR A CA    1 
ATOM   3944 C C     . THR C 3 470 ? -31.511 -24.309 7.039   1.00 41.43 ? 655 THR A C     1 
ATOM   3945 O O     . THR C 3 470 ? -30.568 -24.965 7.486   1.00 41.44 ? 655 THR A O     1 
ATOM   3946 C CB    . THR C 3 470 ? -30.672 -22.119 6.066   1.00 41.03 ? 655 THR A CB    1 
ATOM   3947 O OG1   . THR C 3 470 ? -29.559 -22.957 5.737   1.00 41.35 ? 655 THR A OG1   1 
ATOM   3948 C CG2   . THR C 3 470 ? -30.182 -20.733 6.470   1.00 40.87 ? 655 THR A CG2   1 
ATOM   3949 N N     . PHE C 3 471 ? -32.554 -24.858 6.419   1.00 41.88 ? 656 PHE A N     1 
ATOM   3950 C CA    . PHE C 3 471 ? -32.711 -26.306 6.262   1.00 42.27 ? 656 PHE A CA    1 
ATOM   3951 C C     . PHE C 3 471 ? -32.020 -26.841 5.006   1.00 42.52 ? 656 PHE A C     1 
ATOM   3952 O O     . PHE C 3 471 ? -32.109 -26.238 3.936   1.00 42.70 ? 656 PHE A O     1 
ATOM   3953 C CB    . PHE C 3 471 ? -34.201 -26.683 6.259   1.00 42.26 ? 656 PHE A CB    1 
ATOM   3954 C CG    . PHE C 3 471 ? -34.471 -28.097 5.819   1.00 42.34 ? 656 PHE A CG    1 
ATOM   3955 C CD1   . PHE C 3 471 ? -34.302 -29.159 6.703   1.00 42.47 ? 656 PHE A CD1   1 
ATOM   3956 C CD2   . PHE C 3 471 ? -34.884 -28.366 4.519   1.00 42.07 ? 656 PHE A CD2   1 
ATOM   3957 C CE1   . PHE C 3 471 ? -34.543 -30.467 6.302   1.00 42.47 ? 656 PHE A CE1   1 
ATOM   3958 C CE2   . PHE C 3 471 ? -35.127 -29.670 4.107   1.00 42.45 ? 656 PHE A CE2   1 
ATOM   3959 C CZ    . PHE C 3 471 ? -34.958 -30.724 5.000   1.00 42.52 ? 656 PHE A CZ    1 
ATOM   3960 N N     . SER C 3 472 ? -31.362 -27.992 5.144   1.00 42.80 ? 657 SER A N     1 
ATOM   3961 C CA    . SER C 3 472 ? -30.628 -28.625 4.039   1.00 42.92 ? 657 SER A CA    1 
ATOM   3962 C C     . SER C 3 472 ? -31.379 -29.815 3.419   1.00 42.88 ? 657 SER A C     1 
ATOM   3963 O O     . SER C 3 472 ? -31.500 -30.876 4.040   1.00 42.83 ? 657 SER A O     1 
ATOM   3964 C CB    . SER C 3 472 ? -29.235 -29.052 4.523   1.00 42.94 ? 657 SER A CB    1 
ATOM   3965 O OG    . SER C 3 472 ? -28.457 -29.587 3.467   1.00 43.13 ? 657 SER A OG    1 
ATOM   3966 N N     . TYR C 3 473 ? -31.869 -29.629 2.191   1.00 43.03 ? 658 TYR A N     1 
ATOM   3967 C CA    . TYR C 3 473 ? -32.601 -30.676 1.456   1.00 43.09 ? 658 TYR A CA    1 
ATOM   3968 C C     . TYR C 3 473 ? -31.729 -31.869 1.087   1.00 43.14 ? 658 TYR A C     1 
ATOM   3969 O O     . TYR C 3 473 ? -31.209 -31.953 -0.027  1.00 43.08 ? 658 TYR A O     1 
ATOM   3970 C CB    . TYR C 3 473 ? -33.271 -30.113 0.195   1.00 43.07 ? 658 TYR A CB    1 
ATOM   3971 C CG    . TYR C 3 473 ? -34.689 -29.647 0.413   1.00 43.14 ? 658 TYR A CG    1 
ATOM   3972 C CD1   . TYR C 3 473 ? -34.963 -28.324 0.759   1.00 43.26 ? 658 TYR A CD1   1 
ATOM   3973 C CD2   . TYR C 3 473 ? -35.761 -30.529 0.281   1.00 42.95 ? 658 TYR A CD2   1 
ATOM   3974 C CE1   . TYR C 3 473 ? -36.272 -27.888 0.967   1.00 43.25 ? 658 TYR A CE1   1 
ATOM   3975 C CE2   . TYR C 3 473 ? -37.074 -30.105 0.488   1.00 43.14 ? 658 TYR A CE2   1 
ATOM   3976 C CZ    . TYR C 3 473 ? -37.321 -28.783 0.830   1.00 43.21 ? 658 TYR A CZ    1 
ATOM   3977 O OH    . TYR C 3 473 ? -38.613 -28.352 1.036   1.00 43.32 ? 658 TYR A OH    1 
ATOM   3978 N N     . LYS C 3 474 ? -31.579 -32.788 2.037   1.00 43.28 ? 659 LYS A N     1 
ATOM   3979 C CA    . LYS C 3 474 ? -30.778 -33.991 1.837   1.00 43.35 ? 659 LYS A CA    1 
ATOM   3980 C C     . LYS C 3 474 ? -31.585 -35.245 2.174   1.00 43.43 ? 659 LYS A C     1 
ATOM   3981 O O     . LYS C 3 474 ? -31.741 -36.128 1.327   1.00 43.40 ? 659 LYS A O     1 
ATOM   3982 C CB    . LYS C 3 474 ? -29.487 -33.936 2.672   1.00 43.36 ? 659 LYS A CB    1 
ATOM   3983 C CG    . LYS C 3 474 ? -28.623 -32.675 2.480   1.00 43.15 ? 659 LYS A CG    1 
ATOM   3984 C CD    . LYS C 3 474 ? -28.138 -32.474 1.034   1.00 42.59 ? 659 LYS A CD    1 
ATOM   3985 C CE    . LYS C 3 474 ? -26.853 -33.236 0.735   1.00 42.23 ? 659 LYS A CE    1 
ATOM   3986 N NZ    . LYS C 3 474 ? -27.078 -34.693 0.536   1.00 42.03 ? 659 LYS A NZ    1 
ATOM   3987 N N     . SER C 3 475 ? -32.093 -35.299 3.409   1.00 43.50 ? 660 SER A N     1 
ATOM   3988 C CA    . SER C 3 475 ? -32.871 -36.430 3.943   1.00 43.54 ? 660 SER A CA    1 
ATOM   3989 C C     . SER C 3 475 ? -33.260 -37.486 2.909   1.00 43.49 ? 660 SER A C     1 
ATOM   3990 O O     . SER C 3 475 ? -32.673 -38.567 2.859   1.00 43.47 ? 660 SER A O     1 
ATOM   3991 C CB    . SER C 3 475 ? -34.128 -35.918 4.652   1.00 43.56 ? 660 SER A CB    1 
ATOM   3992 O OG    . SER C 3 475 ? -35.073 -35.428 3.715   1.00 43.58 ? 660 SER A OG    1 
ATOM   3993 N N     . ARG D 4 2   ? -7.645  -28.337 17.351  1.00 46.88 ? 938 ARG D N     1 
ATOM   3994 C CA    . ARG D 4 2   ? -8.357  -27.359 16.482  1.00 46.89 ? 938 ARG D CA    1 
ATOM   3995 C C     . ARG D 4 2   ? -7.467  -26.150 16.200  1.00 46.74 ? 938 ARG D C     1 
ATOM   3996 O O     . ARG D 4 2   ? -6.525  -25.871 16.948  1.00 46.77 ? 938 ARG D O     1 
ATOM   3997 C CB    . ARG D 4 2   ? -9.666  -26.914 17.140  1.00 47.11 ? 938 ARG D CB    1 
ATOM   3998 C CG    . ARG D 4 2   ? -10.738 -26.409 16.166  1.00 47.85 ? 938 ARG D CG    1 
ATOM   3999 C CD    . ARG D 4 2   ? -11.715 -25.453 16.850  1.00 48.57 ? 938 ARG D CD    1 
ATOM   4000 N NE    . ARG D 4 2   ? -12.269 -26.005 18.088  1.00 49.65 ? 938 ARG D NE    1 
ATOM   4001 C CZ    . ARG D 4 2   ? -12.820 -25.278 19.061  1.00 50.82 ? 938 ARG D CZ    1 
ATOM   4002 N NH1   . ARG D 4 2   ? -12.895 -23.954 18.960  1.00 50.66 ? 938 ARG D NH1   1 
ATOM   4003 N NH2   . ARG D 4 2   ? -13.288 -25.874 20.149  1.00 51.37 ? 938 ARG D NH2   1 
ATOM   4004 N N     . MET D 4 3   ? -7.784  -25.436 15.122  1.00 46.42 ? 939 MET D N     1 
ATOM   4005 C CA    . MET D 4 3   ? -6.988  -24.313 14.647  1.00 46.16 ? 939 MET D CA    1 
ATOM   4006 C C     . MET D 4 3   ? -7.849  -23.050 14.584  1.00 45.98 ? 939 MET D C     1 
ATOM   4007 O O     . MET D 4 3   ? -9.015  -23.101 14.180  1.00 45.96 ? 939 MET D O     1 
ATOM   4008 C CB    . MET D 4 3   ? -6.427  -24.640 13.261  1.00 46.29 ? 939 MET D CB    1 
ATOM   4009 C CG    . MET D 4 3   ? -4.979  -24.226 13.028  1.00 46.47 ? 939 MET D CG    1 
ATOM   4010 S SD    . MET D 4 3   ? -3.735  -25.213 13.900  1.00 46.87 ? 939 MET D SD    1 
ATOM   4011 C CE    . MET D 4 3   ? -4.133  -26.877 13.361  1.00 46.94 ? 939 MET D CE    1 
ATOM   4012 N N     . ILE D 4 4   ? -7.272  -21.923 14.994  1.00 45.78 ? 940 ILE D N     1 
ATOM   4013 C CA    . ILE D 4 4   ? -7.962  -20.628 15.006  1.00 45.57 ? 940 ILE D CA    1 
ATOM   4014 C C     . ILE D 4 4   ? -7.051  -19.574 14.381  1.00 45.43 ? 940 ILE D C     1 
ATOM   4015 O O     . ILE D 4 4   ? -5.832  -19.614 14.573  1.00 45.55 ? 940 ILE D O     1 
ATOM   4016 C CB    . ILE D 4 4   ? -8.384  -20.211 16.460  1.00 45.58 ? 940 ILE D CB    1 
ATOM   4017 C CG1   . ILE D 4 4   ? -9.704  -20.875 16.865  1.00 45.87 ? 940 ILE D CG1   1 
ATOM   4018 C CG2   . ILE D 4 4   ? -8.594  -18.709 16.584  1.00 45.27 ? 940 ILE D CG2   1 
ATOM   4019 C CD1   . ILE D 4 4   ? -9.557  -22.238 17.497  1.00 46.59 ? 940 ILE D CD1   1 
ATOM   4020 N N     . ASN D 4 5   ? -7.636  -18.647 13.624  1.00 45.10 ? 941 ASN D N     1 
ATOM   4021 C CA    . ASN D 4 5   ? -6.883  -17.537 13.049  1.00 45.06 ? 941 ASN D CA    1 
ATOM   4022 C C     . ASN D 4 5   ? -7.308  -16.226 13.655  1.00 44.79 ? 941 ASN D C     1 
ATOM   4023 O O     . ASN D 4 5   ? -8.499  -15.974 13.826  1.00 44.67 ? 941 ASN D O     1 
ATOM   4024 C CB    . ASN D 4 5   ? -7.038  -17.471 11.524  1.00 45.47 ? 941 ASN D CB    1 
ATOM   4025 C CG    . ASN D 4 5   ? -6.053  -16.492 10.868  1.00 46.25 ? 941 ASN D CG    1 
ATOM   4026 O OD1   . ASN D 4 5   ? -6.048  -15.289 11.161  1.00 46.90 ? 941 ASN D OD1   1 
ATOM   4027 N ND2   . ASN D 4 5   ? -5.226  -17.009 9.965   1.00 46.88 ? 941 ASN D ND2   1 
ATOM   4028 N N     . ALA D 4 6   ? -6.326  -15.384 13.954  1.00 44.86 ? 942 ALA D N     1 
ATOM   4029 C CA    . ALA D 4 6   ? -6.571  -14.112 14.615  1.00 45.07 ? 942 ALA D CA    1 
ATOM   4030 C C     . ALA D 4 6   ? -5.352  -13.207 14.557  1.00 45.18 ? 942 ALA D C     1 
ATOM   4031 O O     . ALA D 4 6   ? -4.298  -13.552 15.090  1.00 45.41 ? 942 ALA D O     1 
ATOM   4032 C CB    . ALA D 4 6   ? -6.965  -14.349 16.065  1.00 45.17 ? 942 ALA D CB    1 
ATOM   4033 N N     . SER D 4 7   ? -5.498  -12.044 13.926  1.00 45.24 ? 943 SER D N     1 
ATOM   4034 C CA    . SER D 4 7   ? -4.437  -11.049 13.940  1.00 45.20 ? 943 SER D CA    1 
ATOM   4035 C C     . SER D 4 7   ? -4.116  -10.707 15.397  1.00 45.04 ? 943 SER D C     1 
ATOM   4036 O O     . SER D 4 7   ? -5.015  -10.453 16.202  1.00 45.58 ? 943 SER D O     1 
ATOM   4037 C CB    . SER D 4 7   ? -4.843  -9.794  13.171  1.00 45.29 ? 943 SER D CB    1 
ATOM   4038 O OG    . SER D 4 7   ? -5.278  -8.783  14.066  1.00 46.47 ? 943 SER D OG    1 
ATOM   4039 N N     . VAL D 4 8   ? -2.831  -10.735 15.730  1.00 44.57 ? 944 VAL D N     1 
ATOM   4040 C CA    . VAL D 4 8   ? -2.373  -10.477 17.082  1.00 43.89 ? 944 VAL D CA    1 
ATOM   4041 C C     . VAL D 4 8   ? -2.170  -8.979  17.267  1.00 43.48 ? 944 VAL D C     1 
ATOM   4042 O O     . VAL D 4 8   ? -1.523  -8.331  16.453  1.00 43.20 ? 944 VAL D O     1 
ATOM   4043 C CB    . VAL D 4 8   ? -1.080  -11.282 17.390  1.00 43.92 ? 944 VAL D CB    1 
ATOM   4044 C CG1   . VAL D 4 8   ? -0.382  -10.776 18.646  1.00 43.69 ? 944 VAL D CG1   1 
ATOM   4045 C CG2   . VAL D 4 8   ? -1.416  -12.762 17.529  1.00 43.98 ? 944 VAL D CG2   1 
ATOM   4046 N N     . TRP D 4 9   ? -2.758  -8.429  18.325  1.00 42.88 ? 945 TRP D N     1 
ATOM   4047 C CA    . TRP D 4 9   ? -2.507  -7.048  18.689  1.00 42.41 ? 945 TRP D CA    1 
ATOM   4048 C C     . TRP D 4 9   ? -1.553  -7.022  19.875  1.00 42.73 ? 945 TRP D C     1 
ATOM   4049 O O     . TRP D 4 9   ? -1.880  -7.508  20.973  1.00 42.95 ? 945 TRP D O     1 
ATOM   4050 C CB    . TRP D 4 9   ? -3.806  -6.326  19.028  1.00 41.81 ? 945 TRP D CB    1 
ATOM   4051 C CG    . TRP D 4 9   ? -3.629  -4.852  19.266  1.00 40.82 ? 945 TRP D CG    1 
ATOM   4052 C CD1   . TRP D 4 9   ? -3.600  -3.874  18.324  1.00 40.24 ? 945 TRP D CD1   1 
ATOM   4053 C CD2   . TRP D 4 9   ? -3.472  -4.194  20.531  1.00 39.91 ? 945 TRP D CD2   1 
ATOM   4054 N NE1   . TRP D 4 9   ? -3.430  -2.645  18.913  1.00 40.61 ? 945 TRP D NE1   1 
ATOM   4055 C CE2   . TRP D 4 9   ? -3.344  -2.813  20.270  1.00 39.91 ? 945 TRP D CE2   1 
ATOM   4056 C CE3   . TRP D 4 9   ? -3.425  -4.638  21.857  1.00 39.44 ? 945 TRP D CE3   1 
ATOM   4057 C CZ2   . TRP D 4 9   ? -3.180  -1.867  21.284  1.00 39.99 ? 945 TRP D CZ2   1 
ATOM   4058 C CZ3   . TRP D 4 9   ? -3.264  -3.694  22.871  1.00 40.09 ? 945 TRP D CZ3   1 
ATOM   4059 C CH2   . TRP D 4 9   ? -3.144  -2.325  22.576  1.00 40.10 ? 945 TRP D CH2   1 
ATOM   4060 N N     . MET D 4 10  ? -0.369  -6.463  19.641  1.00 42.55 ? 946 MET D N     1 
ATOM   4061 C CA    . MET D 4 10  ? 0.648   -6.331  20.672  1.00 42.40 ? 946 MET D CA    1 
ATOM   4062 C C     . MET D 4 10  ? 0.499   -4.974  21.354  1.00 42.30 ? 946 MET D C     1 
ATOM   4063 O O     . MET D 4 10  ? 0.623   -3.933  20.701  1.00 42.55 ? 946 MET D O     1 
ATOM   4064 C CB    . MET D 4 10  ? 2.038   -6.475  20.060  1.00 42.29 ? 946 MET D CB    1 
ATOM   4065 C CG    . MET D 4 10  ? 3.163   -6.599  21.073  1.00 42.88 ? 946 MET D CG    1 
ATOM   4066 S SD    . MET D 4 10  ? 3.169   -8.145  22.008  1.00 42.91 ? 946 MET D SD    1 
ATOM   4067 C CE    . MET D 4 10  ? 2.795   -9.345  20.725  1.00 43.11 ? 946 MET D CE    1 
ATOM   4068 N N     . PRO D 4 11  ? 0.192   -4.981  22.663  1.00 42.08 ? 947 PRO D N     1 
ATOM   4069 C CA    . PRO D 4 11  ? 0.166   -3.750  23.451  1.00 41.98 ? 947 PRO D CA    1 
ATOM   4070 C C     . PRO D 4 11  ? 1.537   -3.071  23.545  1.00 42.03 ? 947 PRO D C     1 
ATOM   4071 O O     . PRO D 4 11  ? 2.547   -3.761  23.650  1.00 41.38 ? 947 PRO D O     1 
ATOM   4072 C CB    . PRO D 4 11  ? -0.296  -4.225  24.844  1.00 41.91 ? 947 PRO D CB    1 
ATOM   4073 C CG    . PRO D 4 11  ? -0.123  -5.690  24.856  1.00 41.56 ? 947 PRO D CG    1 
ATOM   4074 C CD    . PRO D 4 11  ? -0.193  -6.167  23.455  1.00 41.96 ? 947 PRO D CD    1 
ATOM   4075 N N     . PRO D 4 12  ? 1.565   -1.721  23.517  1.00 42.54 ? 948 PRO D N     1 
ATOM   4076 C CA    . PRO D 4 12  ? 2.814   -0.946  23.612  1.00 42.77 ? 948 PRO D CA    1 
ATOM   4077 C C     . PRO D 4 12  ? 3.391   -1.061  25.015  1.00 43.32 ? 948 PRO D C     1 
ATOM   4078 O O     . PRO D 4 12  ? 2.859   -1.810  25.840  1.00 43.10 ? 948 PRO D O     1 
ATOM   4079 C CB    . PRO D 4 12  ? 2.369   0.499   23.345  1.00 42.94 ? 948 PRO D CB    1 
ATOM   4080 C CG    . PRO D 4 12  ? 0.951   0.413   22.822  1.00 42.71 ? 948 PRO D CG    1 
ATOM   4081 C CD    . PRO D 4 12  ? 0.382   -0.848  23.401  1.00 42.30 ? 948 PRO D CD    1 
ATOM   4082 N N     . MET D 4 13  ? 4.463   -0.332  25.305  1.00 43.84 ? 949 MET D N     1 
ATOM   4083 C CA    . MET D 4 13  ? 5.156   -0.574  26.566  1.00 44.29 ? 949 MET D CA    1 
ATOM   4084 C C     . MET D 4 13  ? 5.288   0.572   27.555  1.00 44.30 ? 949 MET D C     1 
ATOM   4085 O O     . MET D 4 13  ? 6.287   1.279   27.575  1.00 44.86 ? 949 MET D O     1 
ATOM   4086 C CB    . MET D 4 13  ? 6.483   -1.295  26.334  1.00 44.21 ? 949 MET D CB    1 
ATOM   4087 C CG    . MET D 4 13  ? 6.287   -2.788  26.141  1.00 44.54 ? 949 MET D CG    1 
ATOM   4088 S SD    . MET D 4 13  ? 7.380   -3.811  27.155  1.00 45.18 ? 949 MET D SD    1 
ATOM   4089 C CE    . MET D 4 13  ? 7.404   -2.950  28.739  1.00 44.30 ? 949 MET D CE    1 
ATOM   4090 N N     . GLU D 4 14  ? 4.238   0.740   28.355  1.00 44.59 ? 950 GLU D N     1 
ATOM   4091 C CA    . GLU D 4 14  ? 4.209   1.553   29.578  1.00 44.73 ? 950 GLU D CA    1 
ATOM   4092 C C     . GLU D 4 14  ? 4.701   2.984   29.406  1.00 44.96 ? 950 GLU D C     1 
ATOM   4093 O O     . GLU D 4 14  ? 5.768   3.362   29.907  1.00 45.50 ? 950 GLU D O     1 
ATOM   4094 C CB    . GLU D 4 14  ? 4.941   0.826   30.718  1.00 44.63 ? 950 GLU D CB    1 
ATOM   4095 C CG    . GLU D 4 14  ? 4.389   1.113   32.116  1.00 44.88 ? 950 GLU D CG    1 
ATOM   4096 C CD    . GLU D 4 14  ? 4.963   0.187   33.197  1.00 45.00 ? 950 GLU D CD    1 
ATOM   4097 O OE1   . GLU D 4 14  ? 6.194   -0.046  33.214  1.00 45.01 ? 950 GLU D OE1   1 
ATOM   4098 O OE2   . GLU D 4 14  ? 4.180   -0.299  34.041  1.00 44.27 ? 950 GLU D OE2   1 
HETATM 4099 C C1    . SOR E 5 .   ? -29.504 -7.601  57.417  0.50 23.99 ? 1   SOR A C1    1 
HETATM 4100 C C2    . SOR E 5 .   ? -31.020 -7.730  57.256  0.50 23.07 ? 1   SOR A C2    1 
HETATM 4101 C C3    . SOR E 5 .   ? -31.407 -8.919  56.380  0.50 23.59 ? 1   SOR A C3    1 
HETATM 4102 C C4    . SOR E 5 .   ? -32.913 -8.977  56.093  0.50 23.33 ? 1   SOR A C4    1 
HETATM 4103 C C5    . SOR E 5 .   ? -33.282 -9.313  54.650  0.50 24.64 ? 1   SOR A C5    1 
HETATM 4104 C C6    . SOR E 5 .   ? -33.874 -8.100  53.983  0.50 24.58 ? 1   SOR A C6    1 
HETATM 4105 O O1    . SOR E 5 .   ? -29.189 -6.950  58.647  0.50 26.18 ? 1   SOR A O1    1 
HETATM 4106 O O2    . SOR E 5 .   ? -31.599 -7.838  58.547  0.50 20.37 ? 1   SOR A O2    1 
HETATM 4107 O O3    . SOR E 5 .   ? -31.022 -10.142 57.002  0.50 27.47 ? 1   SOR A O3    1 
HETATM 4108 O O4    . SOR E 5 .   ? -33.573 -9.943  56.895  0.50 19.89 ? 1   SOR A O4    1 
HETATM 4109 O O5    . SOR E 5 .   ? -32.258 -9.878  53.831  0.50 25.02 ? 1   SOR A O5    1 
HETATM 4110 O O6    . SOR E 5 .   ? -34.430 -8.615  52.813  0.50 25.12 ? 1   SOR A O6    1 
HETATM 4111 C C1    . SOR F 5 .   ? -29.613 -17.173 47.165  1.00 60.65 ? 2   SOR A C1    1 
HETATM 4112 C C2    . SOR F 5 .   ? -30.655 -18.189 47.655  1.00 62.41 ? 2   SOR A C2    1 
HETATM 4113 C C3    . SOR F 5 .   ? -30.053 -19.573 47.895  1.00 64.13 ? 2   SOR A C3    1 
HETATM 4114 C C4    . SOR F 5 .   ? -30.541 -20.088 49.236  1.00 66.74 ? 2   SOR A C4    1 
HETATM 4115 C C5    . SOR F 5 .   ? -30.610 -21.616 49.190  1.00 68.39 ? 2   SOR A C5    1 
HETATM 4116 C C6    . SOR F 5 .   ? -31.780 -22.162 50.028  1.00 71.07 ? 2   SOR A C6    1 
HETATM 4117 O O1    . SOR F 5 .   ? -28.916 -17.728 46.078  1.00 57.09 ? 2   SOR A O1    1 
HETATM 4118 O O2    . SOR F 5 .   ? -31.316 -17.750 48.832  1.00 58.28 ? 2   SOR A O2    1 
HETATM 4119 O O3    . SOR F 5 .   ? -28.636 -19.583 47.899  1.00 64.53 ? 2   SOR A O3    1 
HETATM 4120 O O4    . SOR F 5 .   ? -29.678 -19.564 50.241  1.00 65.95 ? 2   SOR A O4    1 
HETATM 4121 O O5    . SOR F 5 .   ? -30.733 -22.001 47.833  1.00 67.39 ? 2   SOR A O5    1 
HETATM 4122 O O6    . SOR F 5 .   ? -32.091 -23.521 49.731  1.00 71.74 ? 2   SOR A O6    1 
HETATM 4123 O O     . HOH G 6 .   ? -24.489 -28.264 59.851  1.00 57.93 ? 16  HOH B O     1 
HETATM 4124 O O     . HOH G 6 .   ? -20.064 4.361   46.116  1.00 36.08 ? 17  HOH B O     1 
HETATM 4125 O O     . HOH G 6 .   ? -23.881 -0.304  48.876  1.00 38.15 ? 18  HOH B O     1 
HETATM 4126 O O     . HOH G 6 .   ? -11.566 -7.598  55.587  1.00 35.43 ? 19  HOH B O     1 
HETATM 4127 O O     . HOH G 6 .   ? -13.336 -9.307  58.678  1.00 44.45 ? 20  HOH B O     1 
HETATM 4128 O O     . HOH G 6 .   ? -20.293 0.896   53.564  1.00 42.25 ? 21  HOH B O     1 
HETATM 4129 O O     . HOH G 6 .   ? -20.490 -5.212  41.995  1.00 38.91 ? 22  HOH B O     1 
HETATM 4130 O O     . HOH H 6 .   ? -13.018 9.089   55.001  1.00 65.62 ? 16  HOH C O     1 
HETATM 4131 O O     . HOH H 6 .   ? -20.833 -10.583 51.188  1.00 24.36 ? 17  HOH C O     1 
HETATM 4132 O O     . HOH H 6 .   ? -18.909 -11.229 60.897  1.00 52.20 ? 18  HOH C O     1 
HETATM 4133 O O     . HOH H 6 .   ? -16.505 2.894   56.821  1.00 52.75 ? 19  HOH C O     1 
HETATM 4134 O O     . HOH H 6 .   ? -12.363 6.461   55.345  1.00 48.94 ? 20  HOH C O     1 
HETATM 4135 O O     . HOH H 6 .   ? -13.061 -19.733 54.892  1.00 32.95 ? 21  HOH C O     1 
HETATM 4136 O O     . HOH H 6 .   ? -23.029 -18.325 57.965  1.00 34.31 ? 22  HOH C O     1 
HETATM 4137 O O     . HOH H 6 .   ? -17.322 -32.189 62.427  1.00 63.50 ? 23  HOH C O     1 
HETATM 4138 O O     . HOH H 6 .   ? -22.365 -21.995 54.783  1.00 31.93 ? 24  HOH C O     1 
HETATM 4139 O O     . HOH H 6 .   ? -25.589 -9.007  56.012  1.00 32.91 ? 25  HOH C O     1 
HETATM 4140 O O     . HOH H 6 .   ? -12.902 11.646  53.070  1.00 58.64 ? 26  HOH C O     1 
HETATM 4141 O O     . HOH I 6 .   ? -37.052 -16.290 37.651  1.00 48.33 ? 664 HOH A O     1 
HETATM 4142 O O     . HOH I 6 .   ? -29.706 -23.171 34.432  1.00 52.81 ? 665 HOH A O     1 
HETATM 4143 O O     . HOH I 6 .   ? -32.883 -5.484  43.407  1.00 40.28 ? 666 HOH A O     1 
HETATM 4144 O O     . HOH I 6 .   ? -38.609 -6.825  35.901  1.00 25.29 ? 667 HOH A O     1 
HETATM 4145 O O     . HOH I 6 .   ? -10.710 -23.692 22.910  1.00 41.85 ? 668 HOH A O     1 
HETATM 4146 O O     . HOH I 6 .   ? -33.615 -7.563  45.112  1.00 20.81 ? 669 HOH A O     1 
HETATM 4147 O O     . HOH I 6 .   ? -34.684 -6.364  50.113  1.00 45.31 ? 670 HOH A O     1 
HETATM 4148 O O     . HOH I 6 .   ? -31.416 -5.435  55.974  0.50 52.60 ? 671 HOH A O     1 
HETATM 4149 O O     . HOH I 6 .   ? -14.025 -15.150 47.528  1.00 38.43 ? 672 HOH A O     1 
HETATM 4150 O O     . HOH I 6 .   ? -2.736  7.614   31.284  1.00 63.40 ? 673 HOH A O     1 
HETATM 4151 O O     . HOH I 6 .   ? -29.294 -4.748  49.340  1.00 27.79 ? 674 HOH A O     1 
HETATM 4152 O O     . HOH I 6 .   ? -27.824 -19.733 42.883  1.00 35.00 ? 675 HOH A O     1 
HETATM 4153 O O     . HOH I 6 .   ? 6.305   -18.387 49.009  1.00 58.65 ? 676 HOH A O     1 
HETATM 4154 O O     . HOH I 6 .   ? -20.486 -20.998 33.223  1.00 60.21 ? 677 HOH A O     1 
HETATM 4155 O O     . HOH I 6 .   ? -2.221  -8.680  34.238  1.00 37.72 ? 678 HOH A O     1 
HETATM 4156 O O     . HOH I 6 .   ? -15.992 -25.630 24.512  1.00 49.98 ? 679 HOH A O     1 
HETATM 4157 O O     . HOH I 6 .   ? -4.225  -13.838 24.992  1.00 61.08 ? 680 HOH A O     1 
HETATM 4158 O O     . HOH I 6 .   ? -25.492 -3.178  36.902  1.00 28.82 ? 681 HOH A O     1 
HETATM 4159 O O     . HOH I 6 .   ? -26.288 -7.824  43.754  1.00 24.04 ? 682 HOH A O     1 
HETATM 4160 O O     . HOH I 6 .   ? -37.480 -6.284  38.743  1.00 38.18 ? 683 HOH A O     1 
HETATM 4161 O O     . HOH I 6 .   ? -16.464 -18.038 41.626  1.00 32.26 ? 684 HOH A O     1 
HETATM 4162 O O     . HOH I 6 .   ? -30.248 4.019   36.933  1.00 65.07 ? 685 HOH A O     1 
HETATM 4163 O O     . HOH I 6 .   ? 6.224   -19.823 33.803  1.00 63.90 ? 686 HOH A O     1 
HETATM 4164 O O     . HOH I 6 .   ? -12.738 -30.581 19.791  1.00 62.70 ? 687 HOH A O     1 
HETATM 4165 O O     . HOH I 6 .   ? -28.959 0.100   36.028  1.00 42.78 ? 688 HOH A O     1 
HETATM 4166 O O     . HOH I 6 .   ? -11.916 -23.126 35.007  1.00 43.64 ? 689 HOH A O     1 
HETATM 4167 O O     . HOH I 6 .   ? -10.590 -13.626 43.679  1.00 34.88 ? 690 HOH A O     1 
HETATM 4168 O O     . HOH I 6 .   ? -21.977 -11.109 48.605  1.00 20.67 ? 691 HOH A O     1 
HETATM 4169 O O     . HOH I 6 .   ? -33.896 -20.515 46.924  1.00 41.44 ? 692 HOH A O     1 
HETATM 4170 O O     . HOH I 6 .   ? -33.574 -1.780  41.034  1.00 44.61 ? 693 HOH A O     1 
HETATM 4171 O O     . HOH I 6 .   ? -13.499 -13.195 51.042  1.00 42.68 ? 694 HOH A O     1 
HETATM 4172 O O     . HOH I 6 .   ? -38.480 -13.027 48.802  1.00 34.62 ? 695 HOH A O     1 
HETATM 4173 O O     . HOH I 6 .   ? -38.588 -15.084 23.970  1.00 57.90 ? 696 HOH A O     1 
HETATM 4174 O O     . HOH I 6 .   ? -23.771 -8.284  42.149  1.00 27.83 ? 697 HOH A O     1 
HETATM 4175 O O     . HOH I 6 .   ? -30.920 -15.137 49.415  1.00 27.33 ? 698 HOH A O     1 
HETATM 4176 O O     . HOH I 6 .   ? -14.263 -7.399  28.820  1.00 41.79 ? 699 HOH A O     1 
HETATM 4177 O O     . HOH I 6 .   ? -23.636 -10.235 36.893  1.00 37.17 ? 700 HOH A O     1 
HETATM 4178 O O     . HOH I 6 .   ? -35.793 -9.265  44.648  1.00 44.48 ? 701 HOH A O     1 
HETATM 4179 O O     . HOH I 6 .   ? -27.699 3.594   36.459  1.00 62.19 ? 702 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DT  1   1   1   DT  T   B . n 
A 1 2   DT  2   2   2   DT  T   B . n 
A 1 3   DA  3   3   3   DA  A   B . n 
A 1 4   DC  4   4   4   DC  C   B . n 
A 1 5   DT  5   5   5   DT  T   B . n 
A 1 6   DG  6   6   6   DG  G   B . n 
A 1 7   DT  7   7   7   DT  T   B . n 
A 1 8   DG  8   8   8   DG  G   B . n 
A 1 9   DG  9   9   9   DG  G   B . n 
A 1 10  DG  10  10  10  DG  G   B . n 
A 1 11  DA  11  11  11  DA  A   B . n 
A 1 12  DA  12  12  12  DA  A   B . n 
A 1 13  DA  13  13  13  DA  A   B . n 
A 1 14  DG  14  14  14  DG  G   B . n 
A 1 15  DA  15  15  15  DA  A   B . n 
B 2 1   DA  1   1   1   DA  A   C . n 
B 2 2   DA  2   2   2   DA  A   C . n 
B 2 3   DT  3   3   3   DT  T   C . n 
B 2 4   DC  4   4   4   DC  C   C . n 
B 2 5   DT  5   5   5   DT  T   C . n 
B 2 6   DT  6   6   6   DT  T   C . n 
B 2 7   DT  7   7   7   DT  T   C . n 
B 2 8   DC  8   8   8   DC  C   C . n 
B 2 9   DC  9   9   9   DC  C   C . n 
B 2 10  DC  10  10  10  DC  C   C . n 
B 2 11  DA  11  11  11  DA  A   C . n 
B 2 12  DC  12  12  12  DC  C   C . n 
B 2 13  DA  13  13  13  DA  A   C . n 
B 2 14  DG  14  14  14  DG  G   C . n 
B 2 15  DT  15  15  15  DT  T   C . n 
C 3 1   SER 1   186 ?   ?   ?   A . n 
C 3 2   GLY 2   187 ?   ?   ?   A . n 
C 3 3   PRO 3   188 ?   ?   ?   A . n 
C 3 4   LEU 4   189 ?   ?   ?   A . n 
C 3 5   GLY 5   190 ?   ?   ?   A . n 
C 3 6   SER 6   191 ?   ?   ?   A . n 
C 3 7   GLY 7   192 ?   ?   ?   A . n 
C 3 8   ASP 8   193 ?   ?   ?   A . n 
C 3 9   SER 9   194 ?   ?   ?   A . n 
C 3 10  VAL 10  195 ?   ?   ?   A . n 
C 3 11  GLN 11  196 ?   ?   ?   A . n 
C 3 12  SER 12  197 197 SER SER A . n 
C 3 13  LEU 13  198 198 LEU LEU A . n 
C 3 14  THR 14  199 199 THR THR A . n 
C 3 15  SER 15  200 200 SER SER A . n 
C 3 16  ASP 16  201 201 ASP ASP A . n 
C 3 17  ARG 17  202 202 ARG ARG A . n 
C 3 18  MET 18  203 203 MET MET A . n 
C 3 19  ILE 19  204 204 ILE ILE A . n 
C 3 20  ASP 20  205 205 ASP ASP A . n 
C 3 21  PHE 21  206 206 PHE PHE A . n 
C 3 22  LEU 22  207 207 LEU LEU A . n 
C 3 23  SER 23  208 208 SER SER A . n 
C 3 24  ASN 24  209 209 ASN ASN A . n 
C 3 25  LYS 25  210 210 LYS LYS A . n 
C 3 26  GLU 26  211 211 GLU GLU A . n 
C 3 27  LYS 27  212 212 LYS LYS A . n 
C 3 28  TYR 28  213 213 TYR TYR A . n 
C 3 29  GLU 29  214 214 GLU GLU A . n 
C 3 30  CYS 30  215 215 CYS CYS A . n 
C 3 31  VAL 31  216 216 VAL VAL A . n 
C 3 32  ILE 32  217 217 ILE ILE A . n 
C 3 33  SER 33  218 218 SER SER A . n 
C 3 34  ILE 34  219 219 ILE ILE A . n 
C 3 35  PHE 35  220 220 PHE PHE A . n 
C 3 36  HIS 36  221 221 HIS HIS A . n 
C 3 37  ALA 37  222 222 ALA ALA A . n 
C 3 38  LYS 38  223 223 LYS LYS A . n 
C 3 39  VAL 39  224 224 VAL VAL A . n 
C 3 40  ALA 40  225 225 ALA ALA A . n 
C 3 41  GLN 41  226 226 GLN GLN A . n 
C 3 42  LYS 42  227 227 LYS LYS A . n 
C 3 43  SER 43  228 228 SER SER A . n 
C 3 44  TYR 44  229 229 TYR TYR A . n 
C 3 45  GLY 45  230 230 GLY GLY A . n 
C 3 46  ASN 46  231 231 ASN ASN A . n 
C 3 47  GLU 47  232 232 GLU GLU A . n 
C 3 48  LYS 48  233 233 LYS LYS A . n 
C 3 49  ARG 49  234 234 ARG ARG A . n 
C 3 50  PHE 50  235 235 PHE PHE A . n 
C 3 51  PHE 51  236 236 PHE PHE A . n 
C 3 52  CYS 52  237 237 CYS CYS A . n 
C 3 53  PRO 53  238 238 PRO PRO A . n 
C 3 54  PRO 54  239 239 PRO PRO A . n 
C 3 55  PRO 55  240 240 PRO PRO A . n 
C 3 56  CYS 56  241 241 CYS CYS A . n 
C 3 57  ILE 57  242 242 ILE ILE A . n 
C 3 58  TYR 58  243 243 TYR TYR A . n 
C 3 59  LEU 59  244 244 LEU LEU A . n 
C 3 60  ILE 60  245 245 ILE ILE A . n 
C 3 61  GLY 61  246 246 GLY GLY A . n 
C 3 62  GLN 62  247 247 GLN GLN A . n 
C 3 63  GLY 63  248 248 GLY GLY A . n 
C 3 64  TRP 64  249 249 TRP TRP A . n 
C 3 65  LYS 65  250 250 LYS LYS A . n 
C 3 66  LEU 66  251 251 LEU LEU A . n 
C 3 67  LYS 67  252 252 LYS LYS A . n 
C 3 68  LYS 68  253 253 LYS LYS A . n 
C 3 69  ASP 69  254 254 ASP ASP A . n 
C 3 70  ARG 70  255 255 ARG ARG A . n 
C 3 71  VAL 71  256 256 VAL VAL A . n 
C 3 72  ALA 72  257 257 ALA ALA A . n 
C 3 73  GLN 73  258 258 GLN GLN A . n 
C 3 74  LEU 74  259 259 LEU LEU A . n 
C 3 75  TYR 75  260 260 TYR TYR A . n 
C 3 76  LYS 76  261 261 LYS LYS A . n 
C 3 77  THR 77  262 262 THR THR A . n 
C 3 78  LEU 78  263 263 LEU LEU A . n 
C 3 79  LYS 79  264 ?   ?   ?   A . n 
C 3 80  ALA 80  265 ?   ?   ?   A . n 
C 3 81  SER 81  266 ?   ?   ?   A . n 
C 3 82  ALA 82  267 ?   ?   ?   A . n 
C 3 83  GLN 83  268 ?   ?   ?   A . n 
C 3 84  LYS 84  269 ?   ?   ?   A . n 
C 3 85  ASP 85  270 ?   ?   ?   A . n 
C 3 86  ALA 86  271 ?   ?   ?   A . n 
C 3 87  ALA 87  272 ?   ?   ?   A . n 
C 3 88  ILE 88  273 ?   ?   ?   A . n 
C 3 89  GLU 89  274 ?   ?   ?   A . n 
C 3 90  ASN 90  275 ?   ?   ?   A . n 
C 3 91  ASP 91  276 ?   ?   ?   A . n 
C 3 92  PRO 92  277 ?   ?   ?   A . n 
C 3 93  ILE 93  278 ?   ?   ?   A . n 
C 3 94  HIS 94  279 ?   ?   ?   A . n 
C 3 95  GLU 95  280 ?   ?   ?   A . n 
C 3 96  GLN 96  281 ?   ?   ?   A . n 
C 3 97  GLN 97  282 ?   ?   ?   A . n 
C 3 98  ALA 98  283 ?   ?   ?   A . n 
C 3 99  THR 99  284 284 THR THR A . n 
C 3 100 GLU 100 285 285 GLU GLU A . n 
C 3 101 LEU 101 286 286 LEU LEU A . n 
C 3 102 VAL 102 287 287 VAL VAL A . n 
C 3 103 ALA 103 288 288 ALA ALA A . n 
C 3 104 TYR 104 289 289 TYR TYR A . n 
C 3 105 ILE 105 290 290 ILE ILE A . n 
C 3 106 GLY 106 291 291 GLY GLY A . n 
C 3 107 ILE 107 292 292 ILE ILE A . n 
C 3 108 GLY 108 293 293 GLY GLY A . n 
C 3 109 SER 109 294 294 SER SER A . n 
C 3 110 ASP 110 295 295 ASP ASP A . n 
C 3 111 THR 111 296 296 THR THR A . n 
C 3 112 SER 112 297 297 SER SER A . n 
C 3 113 GLU 113 298 298 GLU GLU A . n 
C 3 114 ARG 114 299 299 ARG ARG A . n 
C 3 115 GLN 115 300 300 GLN GLN A . n 
C 3 116 GLN 116 301 301 GLN GLN A . n 
C 3 117 LEU 117 302 302 LEU LEU A . n 
C 3 118 ASP 118 303 303 ASP ASP A . n 
C 3 119 PHE 119 304 304 PHE PHE A . n 
C 3 120 SER 120 305 ?   ?   ?   A . n 
C 3 121 THR 121 306 ?   ?   ?   A . n 
C 3 122 GLY 122 307 ?   ?   ?   A . n 
C 3 123 LYS 123 308 ?   ?   ?   A . n 
C 3 124 VAL 124 309 ?   ?   ?   A . n 
C 3 125 ARG 125 310 ?   ?   ?   A . n 
C 3 126 HIS 126 311 ?   ?   ?   A . n 
C 3 127 PRO 127 312 ?   ?   ?   A . n 
C 3 128 GLY 128 313 ?   ?   ?   A . n 
C 3 129 ASP 129 314 ?   ?   ?   A . n 
C 3 130 GLN 130 315 ?   ?   ?   A . n 
C 3 131 ARG 131 316 ?   ?   ?   A . n 
C 3 132 GLN 132 317 ?   ?   ?   A . n 
C 3 133 ASP 133 318 ?   ?   ?   A . n 
C 3 134 PRO 134 319 319 PRO PRO A . n 
C 3 135 ASN 135 320 320 ASN ASN A . n 
C 3 136 ILE 136 321 321 ILE ILE A . n 
C 3 137 TYR 137 322 322 TYR TYR A . n 
C 3 138 ASP 138 323 323 ASP ASP A . n 
C 3 139 TYR 139 324 324 TYR TYR A . n 
C 3 140 CYS 140 325 325 CYS CYS A . n 
C 3 141 ALA 141 326 326 ALA ALA A . n 
C 3 142 ALA 142 327 327 ALA ALA A . n 
C 3 143 LYS 143 328 328 LYS LYS A . n 
C 3 144 THR 144 329 329 THR THR A . n 
C 3 145 LEU 145 330 330 LEU LEU A . n 
C 3 146 TYR 146 331 331 TYR TYR A . n 
C 3 147 ILE 147 332 332 ILE ILE A . n 
C 3 148 SER 148 333 333 SER SER A . n 
C 3 149 ASP 149 334 334 ASP ASP A . n 
C 3 150 SER 150 335 335 SER SER A . n 
C 3 151 ASP 151 336 336 ASP ASP A . n 
C 3 152 LYS 152 337 337 LYS LYS A . n 
C 3 153 ARG 153 338 338 ARG ARG A . n 
C 3 154 LYS 154 339 339 LYS LYS A . n 
C 3 155 TYR 155 340 340 TYR TYR A . n 
C 3 156 PHE 156 341 341 PHE PHE A . n 
C 3 157 ASP 157 342 342 ASP ASP A . n 
C 3 158 LEU 158 343 343 LEU LEU A . n 
C 3 159 ASN 159 344 344 ASN ASN A . n 
C 3 160 ALA 160 345 345 ALA ALA A . n 
C 3 161 GLN 161 346 346 GLN GLN A . n 
C 3 162 PHE 162 347 347 PHE PHE A . n 
C 3 163 PHE 163 348 348 PHE PHE A . n 
C 3 164 TYR 164 349 349 TYR TYR A . n 
C 3 165 GLY 165 350 350 GLY GLY A . n 
C 3 166 CYS 166 351 351 CYS CYS A . n 
C 3 167 GLY 167 352 352 GLY GLY A . n 
C 3 168 MET 168 353 353 MET MET A . n 
C 3 169 GLU 169 354 354 GLU GLU A . n 
C 3 170 ILE 170 355 355 ILE ILE A . n 
C 3 171 GLY 171 356 356 GLY GLY A . n 
C 3 172 GLY 172 357 357 GLY GLY A . n 
C 3 173 PHE 173 358 358 PHE PHE A . n 
C 3 174 VAL 174 359 359 VAL VAL A . n 
C 3 175 SER 175 360 360 SER SER A . n 
C 3 176 GLN 176 361 361 GLN GLN A . n 
C 3 177 ARG 177 362 362 ARG ARG A . n 
C 3 178 ILE 178 363 363 ILE ILE A . n 
C 3 179 LYS 179 364 364 LYS LYS A . n 
C 3 180 VAL 180 365 365 VAL VAL A . n 
C 3 181 ILE 181 366 366 ILE ILE A . n 
C 3 182 SER 182 367 367 SER SER A . n 
C 3 183 LYS 183 368 368 LYS LYS A . n 
C 3 184 PRO 184 369 369 PRO PRO A . n 
C 3 185 SER 185 370 370 SER SER A . n 
C 3 186 LYS 186 371 371 LYS LYS A . n 
C 3 187 LYS 187 372 372 LYS LYS A . n 
C 3 188 LYS 188 373 373 LYS LYS A . n 
C 3 189 GLN 189 374 374 GLN GLN A . n 
C 3 190 SER 190 375 375 SER SER A . n 
C 3 191 MET 191 376 ?   ?   ?   A . n 
C 3 192 LYS 192 377 ?   ?   ?   A . n 
C 3 193 ASN 193 378 ?   ?   ?   A . n 
C 3 194 THR 194 379 ?   ?   ?   A . n 
C 3 195 ASP 195 380 380 ASP ASP A . n 
C 3 196 CYS 196 381 381 CYS CYS A . n 
C 3 197 LYS 197 382 382 LYS LYS A . n 
C 3 198 TYR 198 383 383 TYR TYR A . n 
C 3 199 LEU 199 384 384 LEU LEU A . n 
C 3 200 CYS 200 385 385 CYS CYS A . n 
C 3 201 ILE 201 386 386 ILE ILE A . n 
C 3 202 ALA 202 387 387 ALA ALA A . n 
C 3 203 SER 203 388 388 SER SER A . n 
C 3 204 GLY 204 389 389 GLY GLY A . n 
C 3 205 THR 205 390 390 THR THR A . n 
C 3 206 LYS 206 391 391 LYS LYS A . n 
C 3 207 VAL 207 392 392 VAL VAL A . n 
C 3 208 ALA 208 393 393 ALA ALA A . n 
C 3 209 LEU 209 394 394 LEU LEU A . n 
C 3 210 PHE 210 395 395 PHE PHE A . n 
C 3 211 ASN 211 396 396 ASN ASN A . n 
C 3 212 ARG 212 397 397 ARG ARG A . n 
C 3 213 LEU 213 398 398 LEU LEU A . n 
C 3 214 ARG 214 399 399 ARG ARG A . n 
C 3 215 SER 215 400 400 SER SER A . n 
C 3 216 GLN 216 401 401 GLN GLN A . n 
C 3 217 THR 217 402 402 THR THR A . n 
C 3 218 VAL 218 403 403 VAL VAL A . n 
C 3 219 SER 219 404 404 SER SER A . n 
C 3 220 THR 220 405 405 THR THR A . n 
C 3 221 ARG 221 406 406 ARG ARG A . n 
C 3 222 TYR 222 407 407 TYR TYR A . n 
C 3 223 LEU 223 408 408 LEU LEU A . n 
C 3 224 HIS 224 409 409 HIS HIS A . n 
C 3 225 VAL 225 410 410 VAL VAL A . n 
C 3 226 GLU 226 411 411 GLU GLU A . n 
C 3 227 GLY 227 412 412 GLY GLY A . n 
C 3 228 ASN 228 413 413 ASN ASN A . n 
C 3 229 ALA 229 414 414 ALA ALA A . n 
C 3 230 PHE 230 415 415 PHE PHE A . n 
C 3 231 HIS 231 416 416 HIS HIS A . n 
C 3 232 ALA 232 417 417 ALA ALA A . n 
C 3 233 SER 233 418 418 SER SER A . n 
C 3 234 SER 234 419 419 SER SER A . n 
C 3 235 THR 235 420 420 THR THR A . n 
C 3 236 LYS 236 421 421 LYS LYS A . n 
C 3 237 TRP 237 422 422 TRP TRP A . n 
C 3 238 GLY 238 423 423 GLY GLY A . n 
C 3 239 ALA 239 424 424 ALA ALA A . n 
C 3 240 PHE 240 425 425 PHE PHE A . n 
C 3 241 THR 241 426 426 THR THR A . n 
C 3 242 ILE 242 427 427 ILE ILE A . n 
C 3 243 HIS 243 428 428 HIS HIS A . n 
C 3 244 LEU 244 429 429 LEU LEU A . n 
C 3 245 PHE 245 430 430 PHE PHE A . n 
C 3 246 ASP 246 431 431 ASP ASP A . n 
C 3 247 ASP 247 432 432 ASP ASP A . n 
C 3 248 GLU 248 433 433 GLU GLU A . n 
C 3 249 ARG 249 434 ?   ?   ?   A . n 
C 3 250 GLY 250 435 ?   ?   ?   A . n 
C 3 251 LEU 251 436 ?   ?   ?   A . n 
C 3 252 GLN 252 437 437 GLN GLN A . n 
C 3 253 GLU 253 438 438 GLU GLU A . n 
C 3 254 THR 254 439 439 THR THR A . n 
C 3 255 ASP 255 440 440 ASP ASP A . n 
C 3 256 ASN 256 441 441 ASN ASN A . n 
C 3 257 PHE 257 442 442 PHE PHE A . n 
C 3 258 ALA 258 443 443 ALA ALA A . n 
C 3 259 VAL 259 444 444 VAL VAL A . n 
C 3 260 ARG 260 445 445 ARG ARG A . n 
C 3 261 ASP 261 446 446 ASP ASP A . n 
C 3 262 GLY 262 447 447 GLY GLY A . n 
C 3 263 PHE 263 448 448 PHE PHE A . n 
C 3 264 VAL 264 449 449 VAL VAL A . n 
C 3 265 TYR 265 450 450 TYR TYR A . n 
C 3 266 TYR 266 451 451 TYR TYR A . n 
C 3 267 GLY 267 452 452 GLY GLY A . n 
C 3 268 SER 268 453 453 SER SER A . n 
C 3 269 VAL 269 454 454 VAL VAL A . n 
C 3 270 VAL 270 455 455 VAL VAL A . n 
C 3 271 LYS 271 456 456 LYS LYS A . n 
C 3 272 LEU 272 457 457 LEU LEU A . n 
C 3 273 VAL 273 458 458 VAL VAL A . n 
C 3 274 ASP 274 459 459 ASP ASP A . n 
C 3 275 SER 275 460 460 SER SER A . n 
C 3 276 VAL 276 461 461 VAL VAL A . n 
C 3 277 THR 277 462 462 THR THR A . n 
C 3 278 GLY 278 463 463 GLY GLY A . n 
C 3 279 ILE 279 464 464 ILE ILE A . n 
C 3 280 ALA 280 465 465 ALA ALA A . n 
C 3 281 LEU 281 466 466 LEU LEU A . n 
C 3 282 PRO 282 467 467 PRO PRO A . n 
C 3 283 ARG 283 468 468 ARG ARG A . n 
C 3 284 LEU 284 469 469 LEU LEU A . n 
C 3 285 ARG 285 470 470 ARG ARG A . n 
C 3 286 ILE 286 471 471 ILE ILE A . n 
C 3 287 ARG 287 472 472 ARG ARG A . n 
C 3 288 LYS 288 473 473 LYS LYS A . n 
C 3 289 VAL 289 474 474 VAL VAL A . n 
C 3 290 ASP 290 475 475 ASP ASP A . n 
C 3 291 LYS 291 476 476 LYS LYS A . n 
C 3 292 GLN 292 477 477 GLN GLN A . n 
C 3 293 GLN 293 478 478 GLN GLN A . n 
C 3 294 VAL 294 479 479 VAL VAL A . n 
C 3 295 ILE 295 480 480 ILE ILE A . n 
C 3 296 LEU 296 481 481 LEU LEU A . n 
C 3 297 ASP 297 482 482 ASP ASP A . n 
C 3 298 ALA 298 483 483 ALA ALA A . n 
C 3 299 SER 299 484 484 SER SER A . n 
C 3 300 CYS 300 485 485 CYS CYS A . n 
C 3 301 SER 301 486 486 SER SER A . n 
C 3 302 GLU 302 487 487 GLU GLU A . n 
C 3 303 GLU 303 488 488 GLU GLU A . n 
C 3 304 PRO 304 489 489 PRO PRO A . n 
C 3 305 VAL 305 490 490 VAL VAL A . n 
C 3 306 SER 306 491 491 SER SER A . n 
C 3 307 GLN 307 492 492 GLN GLN A . n 
C 3 308 LEU 308 493 493 LEU LEU A . n 
C 3 309 HIS 309 494 494 HIS HIS A . n 
C 3 310 LYS 310 495 495 LYS LYS A . n 
C 3 311 CYS 311 496 496 CYS CYS A . n 
C 3 312 ALA 312 497 497 ALA ALA A . n 
C 3 313 PHE 313 498 498 PHE PHE A . n 
C 3 314 GLN 314 499 499 GLN GLN A . n 
C 3 315 MET 315 500 500 MET MET A . n 
C 3 316 ILE 316 501 501 ILE ILE A . n 
C 3 317 ASP 317 502 502 ASP ASP A . n 
C 3 318 ASN 318 503 503 ASN ASN A . n 
C 3 319 GLU 319 504 504 GLU GLU A . n 
C 3 320 LEU 320 505 505 LEU LEU A . n 
C 3 321 VAL 321 506 506 VAL VAL A . n 
C 3 322 TYR 322 507 507 TYR TYR A . n 
C 3 323 LEU 323 508 508 LEU LEU A . n 
C 3 324 CYS 324 509 509 CYS CYS A . n 
C 3 325 LEU 325 510 510 LEU LEU A . n 
C 3 326 SER 326 511 511 SER SER A . n 
C 3 327 HIS 327 512 512 HIS HIS A . n 
C 3 328 ASP 328 513 513 ASP ASP A . n 
C 3 329 LYS 329 514 514 LYS LYS A . n 
C 3 330 ILE 330 515 515 ILE ILE A . n 
C 3 331 ILE 331 516 516 ILE ILE A . n 
C 3 332 GLN 332 517 517 GLN GLN A . n 
C 3 333 HIS 333 518 518 HIS HIS A . n 
C 3 334 GLN 334 519 519 GLN GLN A . n 
C 3 335 ALA 335 520 520 ALA ALA A . n 
C 3 336 THR 336 521 521 THR THR A . n 
C 3 337 ALA 337 522 522 ALA ALA A . n 
C 3 338 ILE 338 523 523 ILE ILE A . n 
C 3 339 ASN 339 524 524 ASN ASN A . n 
C 3 340 GLU 340 525 525 GLU GLU A . n 
C 3 341 HIS 341 526 526 HIS HIS A . n 
C 3 342 ARG 342 527 527 ARG ARG A . n 
C 3 343 HIS 343 528 528 HIS HIS A . n 
C 3 344 GLN 344 529 529 GLN GLN A . n 
C 3 345 ILE 345 530 530 ILE ILE A . n 
C 3 346 ASN 346 531 531 ASN ASN A . n 
C 3 347 ASP 347 532 532 ASP ASP A . n 
C 3 348 GLY 348 533 533 GLY GLY A . n 
C 3 349 ALA 349 534 534 ALA ALA A . n 
C 3 350 ALA 350 535 535 ALA ALA A . n 
C 3 351 TRP 351 536 536 TRP TRP A . n 
C 3 352 THR 352 537 537 THR THR A . n 
C 3 353 ILE 353 538 538 ILE ILE A . n 
C 3 354 ILE 354 539 539 ILE ILE A . n 
C 3 355 SER 355 540 540 SER SER A . n 
C 3 356 THR 356 541 541 THR THR A . n 
C 3 357 ASP 357 542 542 ASP ASP A . n 
C 3 358 LYS 358 543 543 LYS LYS A . n 
C 3 359 ALA 359 544 544 ALA ALA A . n 
C 3 360 GLU 360 545 545 GLU GLU A . n 
C 3 361 TYR 361 546 546 TYR TYR A . n 
C 3 362 ARG 362 547 547 ARG ARG A . n 
C 3 363 PHE 363 548 548 PHE PHE A . n 
C 3 364 PHE 364 549 549 PHE PHE A . n 
C 3 365 GLU 365 550 550 GLU GLU A . n 
C 3 366 ALA 366 551 551 ALA ALA A . n 
C 3 367 MET 367 552 552 MET MET A . n 
C 3 368 GLY 368 553 553 GLY GLY A . n 
C 3 369 GLN 369 554 554 GLN GLN A . n 
C 3 370 VAL 370 555 555 VAL VAL A . n 
C 3 371 ALA 371 556 556 ALA ALA A . n 
C 3 372 ASN 372 557 557 ASN ASN A . n 
C 3 373 PRO 373 558 558 PRO PRO A . n 
C 3 374 ILE 374 559 559 ILE ILE A . n 
C 3 375 SER 375 560 560 SER SER A . n 
C 3 376 PRO 376 561 561 PRO PRO A . n 
C 3 377 CYS 377 562 562 CYS CYS A . n 
C 3 378 PRO 378 563 563 PRO PRO A . n 
C 3 379 VAL 379 564 564 VAL VAL A . n 
C 3 380 VAL 380 565 565 VAL VAL A . n 
C 3 381 GLY 381 566 566 GLY GLY A . n 
C 3 382 SER 382 567 567 SER SER A . n 
C 3 383 LEU 383 568 568 LEU LEU A . n 
C 3 384 GLU 384 569 569 GLU GLU A . n 
C 3 385 VAL 385 570 570 VAL VAL A . n 
C 3 386 ASP 386 571 571 ASP ASP A . n 
C 3 387 GLY 387 572 572 GLY GLY A . n 
C 3 388 HIS 388 573 573 HIS HIS A . n 
C 3 389 GLY 389 574 574 GLY GLY A . n 
C 3 390 GLU 390 575 575 GLU GLU A . n 
C 3 391 ALA 391 576 576 ALA ALA A . n 
C 3 392 SER 392 577 577 SER SER A . n 
C 3 393 ARG 393 578 578 ARG ARG A . n 
C 3 394 VAL 394 579 579 VAL VAL A . n 
C 3 395 GLU 395 580 580 GLU GLU A . n 
C 3 396 LEU 396 581 581 LEU LEU A . n 
C 3 397 HIS 397 582 582 HIS HIS A . n 
C 3 398 GLY 398 583 583 GLY GLY A . n 
C 3 399 ARG 399 584 584 ARG ARG A . n 
C 3 400 ASP 400 585 585 ASP ASP A . n 
C 3 401 PHE 401 586 586 PHE PHE A . n 
C 3 402 LYS 402 587 587 LYS LYS A . n 
C 3 403 PRO 403 588 588 PRO PRO A . n 
C 3 404 ASN 404 589 589 ASN ASN A . n 
C 3 405 LEU 405 590 590 LEU LEU A . n 
C 3 406 LYS 406 591 591 LYS LYS A . n 
C 3 407 VAL 407 592 592 VAL VAL A . n 
C 3 408 TRP 408 593 593 TRP TRP A . n 
C 3 409 PHE 409 594 594 PHE PHE A . n 
C 3 410 GLY 410 595 595 GLY GLY A . n 
C 3 411 ALA 411 596 596 ALA ALA A . n 
C 3 412 THR 412 597 597 THR THR A . n 
C 3 413 PRO 413 598 598 PRO PRO A . n 
C 3 414 VAL 414 599 599 VAL VAL A . n 
C 3 415 GLU 415 600 600 GLU GLU A . n 
C 3 416 THR 416 601 601 THR THR A . n 
C 3 417 THR 417 602 602 THR THR A . n 
C 3 418 PHE 418 603 603 PHE PHE A . n 
C 3 419 ARG 419 604 604 ARG ARG A . n 
C 3 420 SER 420 605 605 SER SER A . n 
C 3 421 GLU 421 606 606 GLU GLU A . n 
C 3 422 GLU 422 607 607 GLU GLU A . n 
C 3 423 SER 423 608 608 SER SER A . n 
C 3 424 LEU 424 609 609 LEU LEU A . n 
C 3 425 HIS 425 610 610 HIS HIS A . n 
C 3 426 CYS 426 611 611 CYS CYS A . n 
C 3 427 SER 427 612 612 SER SER A . n 
C 3 428 ILE 428 613 613 ILE ILE A . n 
C 3 429 PRO 429 614 614 PRO PRO A . n 
C 3 430 PRO 430 615 615 PRO PRO A . n 
C 3 431 VAL 431 616 616 VAL VAL A . n 
C 3 432 SER 432 617 617 SER SER A . n 
C 3 433 GLN 433 618 618 GLN GLN A . n 
C 3 434 VAL 434 619 619 VAL VAL A . n 
C 3 435 ARG 435 620 620 ARG ARG A . n 
C 3 436 ASN 436 621 621 ASN ASN A . n 
C 3 437 GLU 437 622 622 GLU GLU A . n 
C 3 438 GLN 438 623 623 GLN GLN A . n 
C 3 439 THR 439 624 624 THR THR A . n 
C 3 440 HIS 440 625 625 HIS HIS A . n 
C 3 441 TRP 441 626 626 TRP TRP A . n 
C 3 442 MET 442 627 627 MET MET A . n 
C 3 443 PHE 443 628 628 PHE PHE A . n 
C 3 444 THR 444 629 629 THR THR A . n 
C 3 445 ASN 445 630 630 ASN ASN A . n 
C 3 446 ARG 446 631 631 ARG ARG A . n 
C 3 447 THR 447 632 632 THR THR A . n 
C 3 448 THR 448 633 633 THR THR A . n 
C 3 449 GLY 449 634 634 GLY GLY A . n 
C 3 450 ASP 450 635 635 ASP ASP A . n 
C 3 451 VAL 451 636 636 VAL VAL A . n 
C 3 452 GLU 452 637 637 GLU GLU A . n 
C 3 453 VAL 453 638 638 VAL VAL A . n 
C 3 454 PRO 454 639 639 PRO PRO A . n 
C 3 455 ILE 455 640 640 ILE ILE A . n 
C 3 456 SER 456 641 641 SER SER A . n 
C 3 457 LEU 457 642 642 LEU LEU A . n 
C 3 458 VAL 458 643 643 VAL VAL A . n 
C 3 459 ARG 459 644 644 ARG ARG A . n 
C 3 460 ASP 460 645 645 ASP ASP A . n 
C 3 461 ASP 461 646 646 ASP ASP A . n 
C 3 462 GLY 462 647 647 GLY GLY A . n 
C 3 463 VAL 463 648 648 VAL VAL A . n 
C 3 464 VAL 464 649 649 VAL VAL A . n 
C 3 465 TYR 465 650 650 TYR TYR A . n 
C 3 466 SER 466 651 651 SER SER A . n 
C 3 467 SER 467 652 652 SER SER A . n 
C 3 468 GLY 468 653 653 GLY GLY A . n 
C 3 469 LEU 469 654 654 LEU LEU A . n 
C 3 470 THR 470 655 655 THR THR A . n 
C 3 471 PHE 471 656 656 PHE PHE A . n 
C 3 472 SER 472 657 657 SER SER A . n 
C 3 473 TYR 473 658 658 TYR TYR A . n 
C 3 474 LYS 474 659 659 LYS LYS A . n 
C 3 475 SER 475 660 660 SER SER A . n 
C 3 476 LEU 476 661 ?   ?   ?   A . n 
C 3 477 GLU 477 662 ?   ?   ?   A . n 
C 3 478 ARG 478 663 ?   ?   ?   A . n 
D 4 1   SER 1   937 ?   ?   ?   D . n 
D 4 2   ARG 2   938 938 ARG ARG D . n 
D 4 3   MET 3   939 939 MET MET D . n 
D 4 4   ILE 4   940 940 ILE ILE D . n 
D 4 5   ASN 5   941 941 ASN ASN D . n 
D 4 6   ALA 6   942 942 ALA ALA D . n 
D 4 7   SER 7   943 943 SER SER D . n 
D 4 8   VAL 8   944 944 VAL VAL D . n 
D 4 9   TRP 9   945 945 TRP TRP D . n 
D 4 10  MET 10  946 946 MET MET D . n 
D 4 11  PRO 11  947 947 PRO PRO D . n 
D 4 12  PRO 12  948 948 PRO PRO D . n 
D 4 13  MET 13  949 949 MET MET D . n 
D 4 14  GLU 14  950 950 GLU GLU D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 SOR 1  1   1  SOR SOR A . 
F 5 SOR 1  2   2  SOR SOR A . 
G 6 HOH 1  16  2  HOH HOH B . 
G 6 HOH 2  17  11 HOH HOH B . 
G 6 HOH 3  18  21 HOH HOH B . 
G 6 HOH 4  19  32 HOH HOH B . 
G 6 HOH 5  20  33 HOH HOH B . 
G 6 HOH 6  21  35 HOH HOH B . 
G 6 HOH 7  22  57 HOH HOH B . 
H 6 HOH 1  16  5  HOH HOH C . 
H 6 HOH 2  17  6  HOH HOH C . 
H 6 HOH 3  18  14 HOH HOH C . 
H 6 HOH 4  19  22 HOH HOH C . 
H 6 HOH 5  20  24 HOH HOH C . 
H 6 HOH 6  21  36 HOH HOH C . 
H 6 HOH 7  22  43 HOH HOH C . 
H 6 HOH 8  23  48 HOH HOH C . 
H 6 HOH 9  24  53 HOH HOH C . 
H 6 HOH 10 25  55 HOH HOH C . 
H 6 HOH 11 26  60 HOH HOH C . 
I 6 HOH 1  664 1  HOH HOH A . 
I 6 HOH 2  665 3  HOH HOH A . 
I 6 HOH 3  666 4  HOH HOH A . 
I 6 HOH 4  667 7  HOH HOH A . 
I 6 HOH 5  668 8  HOH HOH A . 
I 6 HOH 6  669 9  HOH HOH A . 
I 6 HOH 7  670 10 HOH HOH A . 
I 6 HOH 8  671 12 HOH HOH A . 
I 6 HOH 9  672 13 HOH HOH A . 
I 6 HOH 10 673 15 HOH HOH A . 
I 6 HOH 11 674 16 HOH HOH A . 
I 6 HOH 12 675 17 HOH HOH A . 
I 6 HOH 13 676 18 HOH HOH A . 
I 6 HOH 14 677 19 HOH HOH A . 
I 6 HOH 15 678 20 HOH HOH A . 
I 6 HOH 16 679 23 HOH HOH A . 
I 6 HOH 17 680 25 HOH HOH A . 
I 6 HOH 18 681 26 HOH HOH A . 
I 6 HOH 19 682 27 HOH HOH A . 
I 6 HOH 20 683 28 HOH HOH A . 
I 6 HOH 21 684 30 HOH HOH A . 
I 6 HOH 22 685 34 HOH HOH A . 
I 6 HOH 23 686 38 HOH HOH A . 
I 6 HOH 24 687 39 HOH HOH A . 
I 6 HOH 25 688 42 HOH HOH A . 
I 6 HOH 26 689 44 HOH HOH A . 
I 6 HOH 27 690 45 HOH HOH A . 
I 6 HOH 28 691 46 HOH HOH A . 
I 6 HOH 29 692 47 HOH HOH A . 
I 6 HOH 30 693 49 HOH HOH A . 
I 6 HOH 31 694 50 HOH HOH A . 
I 6 HOH 32 695 51 HOH HOH A . 
I 6 HOH 33 696 52 HOH HOH A . 
I 6 HOH 34 697 54 HOH HOH A . 
I 6 HOH 35 698 56 HOH HOH A . 
I 6 HOH 36 699 58 HOH HOH A . 
I 6 HOH 37 700 59 HOH HOH A . 
I 6 HOH 38 701 61 HOH HOH A . 
I 6 HOH 39 702 62 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
_pdbx_struct_assembly_prop.biol_id   1 
_pdbx_struct_assembly_prop.type      'ABSA (A^2)' 
_pdbx_struct_assembly_prop.value     5980 
_pdbx_struct_assembly_prop.details   ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     671 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   I 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-04-01 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-10-25 
4 'Structure model' 1 3 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Derived calculations'      
5 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' software            
2 4 'Structure model' chem_comp           
3 4 'Structure model' entity              
4 4 'Structure model' pdbx_entity_nonpoly 
5 4 'Structure model' struct_ref_seq_dif  
6 4 'Structure model' struct_site         
7 4 'Structure model' struct_site_gen     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_chem_comp.name'             
2 4 'Structure model' '_chem_comp.type'             
3 4 'Structure model' '_entity.pdbx_description'    
4 4 'Structure model' '_pdbx_entity_nonpoly.name'   
5 4 'Structure model' '_struct_ref_seq_dif.details' 
# 
_phasing.method   MR 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .        ?                    package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu       'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK   .        ?                    package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu       'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
PHASER      .        ?                    other   'R. J. Read'         cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/      ?          ? 3 
REFMAC      5.3.0020 ?                    program 'Murshudov, G.N.'    ccp4@dl.ac.uk               refinement        
http://www.ccp4.ac.uk/main.html                  Fortran_77 ? 4 
PDB_EXTRACT 3.004    'September 10, 2007' package PDB                  sw-help@rcsb.rutgers.edu    'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 5 
HKL-2000    .        ?                    ?       ?                    ?                           'data collection' ? ?          
? 6 
HKL-2000    .        ?                    ?       ?                    ?                           'data reduction'  ? ?          
? 7 
HKL-2000    .        ?                    ?       ?                    ?                           'data scaling'    ? ?          
? 8 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   LYS 
_pdbx_validate_close_contact.auth_seq_id_1    337 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    692 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.15 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CD A GLU 550 ? ? OE2 A GLU 550 ? ? 1.329 1.252 0.077 0.011 N 
2 1 CZ A ARG 644 ? ? NH1 A ARG 644 ? ? 1.415 1.326 0.089 0.013 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "C1'" B DT 1  ? ? "O4'" B DT 1  ? ? "C4'" B DT 1  ? ? 102.32 110.10 -7.78 1.00 N 
2  1 "O4'" B DT 1  ? ? "C1'" B DT 1  ? ? N1    B DT 1  ? ? 114.51 108.30 6.21  0.30 N 
3  1 "O4'" B DT 5  ? ? "C1'" B DT 5  ? ? N1    B DT 5  ? ? 100.89 108.00 -7.11 0.70 N 
4  1 "O4'" B DT 7  ? ? "C1'" B DT 7  ? ? N1    B DT 7  ? ? 110.11 108.30 1.81  0.30 N 
5  1 C2    B DG 10 ? ? N3    B DG 10 ? ? C4    B DG 10 ? ? 115.17 111.90 3.27  0.50 N 
6  1 N1    B DA 12 ? ? C6    B DA 12 ? ? N6    B DA 12 ? ? 114.39 118.60 -4.21 0.60 N 
7  1 "C3'" B DG 14 ? ? "O3'" B DG 14 ? ? P     B DA 15 ? ? 126.92 119.70 7.22  1.20 Y 
8  1 C4    C DT 5  ? ? C5    C DT 5  ? ? C7    C DT 5  ? ? 122.67 119.00 3.67  0.60 N 
9  1 "O4'" C DT 6  ? ? "C1'" C DT 6  ? ? N1    C DT 6  ? ? 102.21 108.00 -5.79 0.70 N 
10 1 N1    C DT 7  ? ? C2    C DT 7  ? ? N3    C DT 7  ? ? 118.39 114.60 3.79  0.60 N 
11 1 N3    C DT 7  ? ? C2    C DT 7  ? ? O2    C DT 7  ? ? 118.49 122.30 -3.81 0.60 N 
12 1 "O4'" C DC 10 ? ? "C1'" C DC 10 ? ? "C2'" C DC 10 ? ? 100.09 105.90 -5.81 0.80 N 
13 1 "O4'" C DA 13 ? ? "C1'" C DA 13 ? ? N9    C DA 13 ? ? 111.64 108.30 3.34  0.30 N 
14 1 "O4'" C DG 14 ? ? "C1'" C DG 14 ? ? N9    C DG 14 ? ? 111.05 108.30 2.75  0.30 N 
15 1 "O4'" C DT 15 ? ? "C1'" C DT 15 ? ? N1    C DT 15 ? ? 111.86 108.30 3.56  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 200 ? ? -34.78  -32.36  
2  1 CYS A 381 ? ? -39.07  -75.09  
3  1 LYS A 382 ? ? 79.02   -21.77  
4  1 ARG A 399 ? ? 28.31   39.86   
5  1 SER A 400 ? ? 40.38   29.44   
6  1 GLN A 401 ? ? 174.34  106.08  
7  1 THR A 402 ? ? -139.07 -43.65  
8  1 VAL A 403 ? ? 176.97  -40.14  
9  1 ASP A 431 ? ? -106.79 -126.60 
10 1 GLU A 438 ? ? 171.39  164.76  
11 1 THR A 439 ? ? -146.32 -77.25  
12 1 LYS A 476 ? ? 44.00   111.47  
13 1 GLN A 477 ? ? 54.12   -7.60   
14 1 ASP A 482 ? ? -37.35  121.25  
15 1 HIS A 512 ? ? 43.34   -117.09 
16 1 MET A 552 ? ? -81.01  -127.68 
17 1 HIS A 573 ? ? -128.55 -169.94 
18 1 ASN A 589 ? ? -93.12  36.22   
19 1 THR A 602 ? ? -115.73 -129.08 
20 1 PHE A 603 ? ? 173.56  112.63  
21 1 SER A 605 ? ? -159.87 -156.60 
22 1 LEU A 609 ? ? -161.07 94.58   
23 1 ASN A 621 ? ? -151.98 -88.38  
24 1 GLU A 622 ? ? -163.35 18.07   
25 1 GLN A 623 ? ? -134.22 -32.72  
26 1 HIS A 625 ? ? 171.20  -56.83  
27 1 ASP A 646 ? ? -32.87  -38.06  
28 1 TYR A 658 ? ? -66.40  83.67   
29 1 LYS A 659 ? ? -126.90 -56.98  
30 1 ALA D 942 ? ? -166.90 118.91  
31 1 PRO D 948 ? ? -69.87  -174.63 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   GLN 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    401 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   THR 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    402 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            144.41 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 186 ? C SER 1   
2  1 Y 1 A GLY 187 ? C GLY 2   
3  1 Y 1 A PRO 188 ? C PRO 3   
4  1 Y 1 A LEU 189 ? C LEU 4   
5  1 Y 1 A GLY 190 ? C GLY 5   
6  1 Y 1 A SER 191 ? C SER 6   
7  1 Y 1 A GLY 192 ? C GLY 7   
8  1 Y 1 A ASP 193 ? C ASP 8   
9  1 Y 1 A SER 194 ? C SER 9   
10 1 Y 1 A VAL 195 ? C VAL 10  
11 1 Y 1 A GLN 196 ? C GLN 11  
12 1 Y 1 A LYS 264 ? C LYS 79  
13 1 Y 1 A ALA 265 ? C ALA 80  
14 1 Y 1 A SER 266 ? C SER 81  
15 1 Y 1 A ALA 267 ? C ALA 82  
16 1 Y 1 A GLN 268 ? C GLN 83  
17 1 Y 1 A LYS 269 ? C LYS 84  
18 1 Y 1 A ASP 270 ? C ASP 85  
19 1 Y 1 A ALA 271 ? C ALA 86  
20 1 Y 1 A ALA 272 ? C ALA 87  
21 1 Y 1 A ILE 273 ? C ILE 88  
22 1 Y 1 A GLU 274 ? C GLU 89  
23 1 Y 1 A ASN 275 ? C ASN 90  
24 1 Y 1 A ASP 276 ? C ASP 91  
25 1 Y 1 A PRO 277 ? C PRO 92  
26 1 Y 1 A ILE 278 ? C ILE 93  
27 1 Y 1 A HIS 279 ? C HIS 94  
28 1 Y 1 A GLU 280 ? C GLU 95  
29 1 Y 1 A GLN 281 ? C GLN 96  
30 1 Y 1 A GLN 282 ? C GLN 97  
31 1 Y 1 A ALA 283 ? C ALA 98  
32 1 Y 1 A SER 305 ? C SER 120 
33 1 Y 1 A THR 306 ? C THR 121 
34 1 Y 1 A GLY 307 ? C GLY 122 
35 1 Y 1 A LYS 308 ? C LYS 123 
36 1 Y 1 A VAL 309 ? C VAL 124 
37 1 Y 1 A ARG 310 ? C ARG 125 
38 1 Y 1 A HIS 311 ? C HIS 126 
39 1 Y 1 A PRO 312 ? C PRO 127 
40 1 Y 1 A GLY 313 ? C GLY 128 
41 1 Y 1 A ASP 314 ? C ASP 129 
42 1 Y 1 A GLN 315 ? C GLN 130 
43 1 Y 1 A ARG 316 ? C ARG 131 
44 1 Y 1 A GLN 317 ? C GLN 132 
45 1 Y 1 A ASP 318 ? C ASP 133 
46 1 Y 1 A MET 376 ? C MET 191 
47 1 Y 1 A LYS 377 ? C LYS 192 
48 1 Y 1 A ASN 378 ? C ASN 193 
49 1 Y 1 A THR 379 ? C THR 194 
50 1 Y 1 A ARG 434 ? C ARG 249 
51 1 Y 1 A GLY 435 ? C GLY 250 
52 1 Y 1 A LEU 436 ? C LEU 251 
53 1 Y 1 A LEU 661 ? C LEU 476 
54 1 Y 1 A GLU 662 ? C GLU 477 
55 1 Y 1 A ARG 663 ? C ARG 478 
56 1 Y 1 D SER 937 ? D SER 1   
# 
_ndb_struct_conf_na.entry_id   3BRF 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DA 3  1_555 B DT 15 1_555 0.218  -0.207 0.048  0.451  -5.991  1.798  1  B_DA3:DT15_C B 3  ? C 15 ? 20 1 
1 A DC 4  1_555 B DG 14 1_555 0.171  -0.334 0.053  0.257  -17.227 0.750  2  B_DC4:DG14_C B 4  ? C 14 ? 19 1 
1 A DT 5  1_555 B DA 13 1_555 -0.358 -0.128 0.236  -5.296 -8.154  -0.588 3  B_DT5:DA13_C B 5  ? C 13 ? 20 1 
1 A DG 6  1_555 B DC 12 1_555 -0.271 -0.143 -0.101 -3.230 -12.747 -0.626 4  B_DG6:DC12_C B 6  ? C 12 ? 19 1 
1 A DT 7  1_555 B DA 11 1_555 0.228  -0.024 0.155  -2.496 -10.797 -0.214 5  B_DT7:DA11_C B 7  ? C 11 ? 20 1 
1 A DG 8  1_555 B DC 10 1_555 -0.060 -0.138 0.011  0.373  -7.132  -1.867 6  B_DG8:DC10_C B 8  ? C 10 ? 19 1 
1 A DG 9  1_555 B DC 9  1_555 -0.017 -0.133 0.080  7.517  -9.331  -1.544 7  B_DG9:DC9_C  B 9  ? C 9  ? 19 1 
1 A DG 10 1_555 B DC 8  1_555 -0.123 -0.251 -0.297 4.566  -12.077 -2.524 8  B_DG10:DC8_C B 10 ? C 8  ? 19 1 
1 A DA 11 1_555 B DT 7  1_555 0.176  -0.165 0.059  2.511  -17.406 3.890  9  B_DA11:DT7_C B 11 ? C 7  ? 20 1 
1 A DA 12 1_555 B DT 6  1_555 0.205  -0.082 -0.094 3.359  -17.594 5.747  10 B_DA12:DT6_C B 12 ? C 6  ? 20 1 
1 A DA 13 1_555 B DT 5  1_555 0.091  -0.269 -0.140 3.103  -16.376 1.275  11 B_DA13:DT5_C B 13 ? C 5  ? 20 1 
1 A DG 14 1_555 B DC 4  1_555 0.002  -0.141 -0.210 -9.576 -14.003 2.036  12 B_DG14:DC4_C B 14 ? C 4  ? 19 1 
1 A DA 15 1_555 B DT 3  1_555 -0.154 -0.157 -0.060 -0.615 -9.330  0.081  13 B_DA15:DT3_C B 15 ? C 3  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DA 3  1_555 B DT 15 1_555 A DC 4  1_555 B DG 14 1_555 0.164  -0.729 3.323 -0.945 6.034  33.639 -2.191 -0.427 3.144 10.321 
1.616  34.173 1  BB_DA3DC4:DG14DT15_CC B 3  ? C 15 ? B 4  ? C 14 ? 
1 A DC 4  1_555 B DG 14 1_555 A DT 5  1_555 B DA 13 1_555 -0.472 -0.351 3.461 -0.714 5.258  29.532 -1.816 0.757  3.360 10.212 
1.386  29.994 2  BB_DC4DT5:DA13DG14_CC B 4  ? C 14 ? B 5  ? C 13 ? 
1 A DT 5  1_555 B DA 13 1_555 A DG 6  1_555 B DC 12 1_555 -0.854 0.887  3.285 -0.033 10.258 34.766 -0.079 1.369  3.403 16.722 
0.054  36.203 3  BB_DT5DG6:DC12DA13_CC B 5  ? C 13 ? B 6  ? C 12 ? 
1 A DG 6  1_555 B DC 12 1_555 A DT 7  1_555 B DA 11 1_555 0.192  -0.290 3.335 -1.020 1.036  33.836 -0.667 -0.496 3.318 1.780  
1.752  33.866 4  BB_DG6DT7:DA11DC12_CC B 6  ? C 12 ? B 7  ? C 11 ? 
1 A DT 7  1_555 B DA 11 1_555 A DG 8  1_555 B DC 10 1_555 0.333  0.577  3.225 3.401  7.037  38.049 0.004  -0.083 3.293 10.657 
-5.150 38.814 5  BB_DT7DG8:DC10DA11_CC B 7  ? C 11 ? B 8  ? C 10 ? 
1 A DG 8  1_555 B DC 10 1_555 A DG 9  1_555 B DC 9  1_555 -0.006 -0.072 3.092 -1.718 2.712  30.437 -0.643 -0.309 3.070 5.148  
3.261  30.602 6  BB_DG8DG9:DC9DC10_CC  B 8  ? C 10 ? B 9  ? C 9  ? 
1 A DG 9  1_555 B DC 9  1_555 A DG 10 1_555 B DC 8  1_555 -0.552 -0.469 3.398 -0.321 5.125  33.638 -1.643 0.891  3.298 8.792  
0.551  34.016 7  BB_DG9DG10:DC8DC9_CC  B 9  ? C 9  ? B 10 ? C 8  ? 
1 A DG 10 1_555 B DC 8  1_555 A DA 11 1_555 B DT 7  1_555 -0.319 -0.144 3.242 -3.815 1.509  39.924 -0.381 0.033  3.250 2.204  
5.570  40.126 8  BB_DG10DA11:DT7DC8_CC B 10 ? C 8  ? B 11 ? C 7  ? 
1 A DA 11 1_555 B DT 7  1_555 A DA 12 1_555 B DT 6  1_555 -0.127 -0.018 3.195 1.564  5.642  31.982 -0.995 0.495  3.136 10.134 
-2.809 32.500 9  BB_DA11DA12:DT6DT7_CC B 11 ? C 7  ? B 12 ? C 6  ? 
1 A DA 12 1_555 B DT 6  1_555 A DA 13 1_555 B DT 5  1_555 -0.006 -0.029 3.164 0.178  4.250  34.719 -0.667 0.035  3.138 7.090  
-0.297 34.971 10 BB_DA12DA13:DT5DT6_CC B 12 ? C 6  ? B 13 ? C 5  ? 
1 A DA 13 1_555 B DT 5  1_555 A DG 14 1_555 B DC 4  1_555 0.380  -0.286 3.531 -0.653 2.903  38.581 -0.815 -0.660 3.494 4.386  
0.987  38.691 11 BB_DA13DG14:DC4DT5_CC B 13 ? C 5  ? B 14 ? C 4  ? 
1 A DG 14 1_555 B DC 4  1_555 A DA 15 1_555 B DT 3  1_555 -0.097 -0.039 3.079 -1.259 2.014  32.505 -0.400 -0.034 3.072 3.592  
2.246  32.589 12 BB_DG14DA15:DT3DC4_CC B 14 ? C 4  ? B 15 ? C 3  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 sorbitol SOR 
6 water    HOH 
#