data_3BSU
# 
_entry.id   3BSU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3BSU         
NDB   PH0045       
RCSB  RCSB045925   
WWPDB D_1000045925 
# 
_pdbx_database_status.entry_id                        3BSU 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-12-26 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nowotny, M.'      1 
'Cerritelli, S.M.' 2 
'Ghirlando, R.'    3 
'Gaidamakov, S.A.' 4 
'Crouch, R.J.'     5 
'Yang, W.'         6 
# 
_citation.id                        primary 
_citation.title                     'Specific recognition of RNA/DNA hybrid and enhancement of human RNase H1 activity by HBD.' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            27 
_citation.page_first                1172 
_citation.page_last                 1181 
_citation.year                      2008 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18337749 
_citation.pdbx_database_id_DOI      10.1038/emboj.2008.44 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nowotny, M.'      1 
primary 'Cerritelli, S.M.' 2 
primary 'Ghirlando, R.'    3 
primary 'Gaidamakov, S.A.' 4 
primary 'Crouch, R.J.'     5 
primary 'Yang, W.'         6 
# 
_cell.entry_id           3BSU 
_cell.length_a           45.492 
_cell.length_b           64.262 
_cell.length_c           140.322 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3BSU 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;RNA (5'-R(*GP*AP*CP*AP*CP*CP*UP*GP*AP*UP*UP*C)-3')
;
3772.296 2   ?        ? ?                  ? 
2 polymer     syn 
;DNA (5'-D(*DGP*DAP*DAP*DTP*DCP*DAP*DGP*DGP*(5IU)P*DGP*DTP*DC)-3')
;
3814.298 2   ?        ? ?                  ? 
3 polymer     man 'Ribonuclease H1'                                                   6197.077 6   3.1.26.4 ? 'catalytic domain' ? 
4 non-polymer syn 'MAGNESIUM ION'                                                     24.305   2   ?        ? ?                  ? 
5 water       nat water                                                               18.015   252 ?        ? ?                  ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'RNase H1; Ribonuclease H type II' 
# 
_entity_name_sys.entity_id   3 
_entity_name_sys.name        E.C.3.1.26.4 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polyribonucleotide      no no  GACACCUGAUUC                                          GACACCUGAUUC D,I         ? 
2 polydeoxyribonucleotide no yes '(DG)(DA)(DA)(DT)(DC)(DA)(DG)(DG)(5IU)(DG)(DT)(DC)'   GAATCAGGUGTC E,J         ? 
3 'polypeptide(L)'        no no  GSHMFYAVRRGRKTGVFLTWNECRAQVDRFPAARFKKFATEDEAWAFVRKSAS 
GSHMFYAVRRGRKTGVFLTWNECRAQVDRFPAARFKKFATEDEAWAFVRKSAS A,B,C,F,G,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  G   n 
1 2  A   n 
1 3  C   n 
1 4  A   n 
1 5  C   n 
1 6  C   n 
1 7  U   n 
1 8  G   n 
1 9  A   n 
1 10 U   n 
1 11 U   n 
1 12 C   n 
2 1  DG  n 
2 2  DA  n 
2 3  DA  n 
2 4  DT  n 
2 5  DC  n 
2 6  DA  n 
2 7  DG  n 
2 8  DG  n 
2 9  5IU n 
2 10 DG  n 
2 11 DT  n 
2 12 DC  n 
3 1  GLY n 
3 2  SER n 
3 3  HIS n 
3 4  MET n 
3 5  PHE n 
3 6  TYR n 
3 7  ALA n 
3 8  VAL n 
3 9  ARG n 
3 10 ARG n 
3 11 GLY n 
3 12 ARG n 
3 13 LYS n 
3 14 THR n 
3 15 GLY n 
3 16 VAL n 
3 17 PHE n 
3 18 LEU n 
3 19 THR n 
3 20 TRP n 
3 21 ASN n 
3 22 GLU n 
3 23 CYS n 
3 24 ARG n 
3 25 ALA n 
3 26 GLN n 
3 27 VAL n 
3 28 ASP n 
3 29 ARG n 
3 30 PHE n 
3 31 PRO n 
3 32 ALA n 
3 33 ALA n 
3 34 ARG n 
3 35 PHE n 
3 36 LYS n 
3 37 LYS n 
3 38 PHE n 
3 39 ALA n 
3 40 THR n 
3 41 GLU n 
3 42 ASP n 
3 43 GLU n 
3 44 ALA n 
3 45 TRP n 
3 46 ALA n 
3 47 PHE n 
3 48 VAL n 
3 49 ARG n 
3 50 LYS n 
3 51 SER n 
3 52 ALA n 
3 53 SER n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'RNASEH1, RNH1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 Rosetta' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET15 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.entity_id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 3 UNP RNH1_HUMAN O60930 24 GFGMFYAVRRGRKTGVFLTWNECRAQVDRFPAARFKKFATEDEAWAFVRKSAS ? 
2 1 PDB 3BSU       3BSU   ?  ?                                                     ? 
3 2 PDB 3BSU       3BSU   ?  ?                                                     ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3BSU A 1 ? 53 ? O60930 24 ? 76 ? 24 76 
2  1 3BSU B 1 ? 53 ? O60930 24 ? 76 ? 24 76 
3  1 3BSU C 1 ? 53 ? O60930 24 ? 76 ? 24 76 
4  1 3BSU F 1 ? 53 ? O60930 24 ? 76 ? 24 76 
5  1 3BSU G 1 ? 53 ? O60930 24 ? 76 ? 24 76 
6  1 3BSU H 1 ? 53 ? O60930 24 ? 76 ? 24 76 
7  2 3BSU D 1 ? 12 ? 3BSU   1  ? 12 ? 1  12 
8  3 3BSU E 1 ? 12 ? 3BSU   1  ? 12 ? 1  12 
9  2 3BSU I 1 ? 12 ? 3BSU   1  ? 12 ? 1  12 
10 3 3BSU J 1 ? 12 ? 3BSU   1  ? 12 ? 1  12 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3BSU SER A 2 ? UNP O60930 PHE 25 'CLONING ARTIFACT' 25 1  
1 3BSU HIS A 3 ? UNP O60930 GLY 26 'CLONING ARTIFACT' 26 2  
2 3BSU SER B 2 ? UNP O60930 PHE 25 'CLONING ARTIFACT' 25 3  
2 3BSU HIS B 3 ? UNP O60930 GLY 26 'CLONING ARTIFACT' 26 4  
3 3BSU SER C 2 ? UNP O60930 PHE 25 'CLONING ARTIFACT' 25 5  
3 3BSU HIS C 3 ? UNP O60930 GLY 26 'CLONING ARTIFACT' 26 6  
4 3BSU SER F 2 ? UNP O60930 PHE 25 'CLONING ARTIFACT' 25 7  
4 3BSU HIS F 3 ? UNP O60930 GLY 26 'CLONING ARTIFACT' 26 8  
5 3BSU SER G 2 ? UNP O60930 PHE 25 'CLONING ARTIFACT' 25 9  
5 3BSU HIS G 3 ? UNP O60930 GLY 26 'CLONING ARTIFACT' 26 10 
6 3BSU SER H 2 ? UNP O60930 PHE 25 'CLONING ARTIFACT' 25 11 
6 3BSU HIS H 3 ? UNP O60930 GLY 26 'CLONING ARTIFACT' 26 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
5IU 'DNA linking'       n "5-IODO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" ? 'C9 H12 I N2 O8 P' 434.078 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"              ? 'C10 H14 N5 O7 P'  347.221 
ALA 'L-peptide linking' y ALANINE                                   ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                  ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                           ? 'C4 H7 N O4'       133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"               ? 'C9 H14 N3 O8 P'   323.197 
CYS 'L-peptide linking' y CYSTEINE                                  ? 'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"      ? 'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"       ? 'C9 H14 N3 O7 P'   307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"      ? 'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"              ? 'C10 H15 N2 O8 P'  322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"              ? 'C10 H14 N5 O8 P'  363.221 
GLN 'L-peptide linking' y GLUTAMINE                                 ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                           ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                   ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                 ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                     ? 'H2 O'             18.015  
LEU 'L-peptide linking' y LEUCINE                                   ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                    ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                ? 'C5 H11 N O2 S'    149.211 
MG  non-polymer         . 'MAGNESIUM ION'                           ? 'Mg 2'             24.305  
PHE 'L-peptide linking' y PHENYLALANINE                             ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                   ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                    ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                 ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                  ? 'C9 H11 N O3'      181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                ? 'C9 H13 N2 O9 P'   324.181 
VAL 'L-peptide linking' y VALINE                                    ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          3BSU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.96 
_exptl_crystal.density_percent_sol   37.21 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    '1.2 M NaCl, 0.1 M HEPES (pH 7.5), VAPOR DIFFUSION, HANGING DROP, temperature 294K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 NaCl  ? ? ? 
1 2 1 Hepes ? ? ? 
1 3 2 NaCl  ? ? ? 
1 4 2 Hepes ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-08-03 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97928 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97928 
# 
_reflns.entry_id                     3BSU 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.1 
_reflns.d_resolution_low             50 
_reflns.number_all                   24814 
_reflns.number_obs                   23892 
_reflns.percent_possible_obs         96.3 
_reflns.pdbx_Rmerge_I_obs            0.061 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.6 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.10 
_reflns_shell.d_res_low              2.20 
_reflns_shell.percent_possible_all   95.6 
_reflns_shell.Rmerge_I_obs           0.396 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.9 
_reflns_shell.pdbx_redundancy        3.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3BSU 
_refine.ls_d_res_high                            2.10 
_refine.ls_d_res_low                             50 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     24814 
_refine.ls_number_reflns_obs                     23892 
_refine.ls_number_reflns_R_free                  2360 
_refine.ls_percent_reflns_obs                    96.3 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.220 
_refine.ls_R_factor_R_free                       0.290 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2456 
_refine_hist.pdbx_number_atoms_nucleic_acid   1033 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             252 
_refine_hist.number_atoms_total               3743 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.009515 ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.26951  ?   ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d ?        ?   ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d ?        ?   ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.427    1.5 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.293    2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        1.942    2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       2.793    2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  3BSU 
_struct.title                     'Hybrid-binding domain of human RNase H1 in complex with 12-mer RNA/DNA' 
_struct.pdbx_descriptor           'Ribonuclease H1 (E.C.3.1.26.4)/RNA/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3BSU 
_struct_keywords.pdbx_keywords   HYDROLASE/RNA/DNA 
_struct_keywords.text            'RNase H, RNA/DNA hybrid, dsRNA, HYDROLASE-RNA-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 4 ? 
L N N 4 ? 
M N N 5 ? 
N N N 5 ? 
O N N 5 ? 
P N N 5 ? 
Q N N 5 ? 
R N N 5 ? 
S N N 5 ? 
T N N 5 ? 
U N N 5 ? 
V N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR E 19 ? ASP E 28 ? THR A 42 ASP A 51 1 ? 10 
HELX_P HELX_P2  2  THR E 40 ? LYS E 50 ? THR A 63 LYS A 73 1 ? 11 
HELX_P HELX_P3  3  THR F 19 ? ASP F 28 ? THR B 42 ASP B 51 1 ? 10 
HELX_P HELX_P4  4  THR F 40 ? ARG F 49 ? THR B 63 ARG B 72 1 ? 10 
HELX_P HELX_P5  5  THR G 19 ? ASP G 28 ? THR C 42 ASP C 51 1 ? 10 
HELX_P HELX_P6  6  THR G 40 ? LYS G 50 ? THR C 63 LYS C 73 1 ? 11 
HELX_P HELX_P7  7  THR H 19 ? ASP H 28 ? THR F 42 ASP F 51 1 ? 10 
HELX_P HELX_P8  8  THR H 40 ? LYS H 50 ? THR F 63 LYS F 73 1 ? 11 
HELX_P HELX_P9  9  THR I 19 ? ASP I 28 ? THR G 42 ASP G 51 1 ? 10 
HELX_P HELX_P10 10 THR I 40 ? ARG I 49 ? THR G 63 ARG G 72 1 ? 10 
HELX_P HELX_P11 11 THR J 19 ? ASP J 28 ? THR H 42 ASP H 51 1 ? 10 
HELX_P HELX_P12 12 THR J 40 ? ARG J 49 ? THR H 63 ARG H 72 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E GLU 22 OE1   ? ? ? 1_555 K MG  .  MG ? ? A GLU 45 A MG  501 1_555 ? ? ? ? ? ? ?            1.959 ? 
metalc2  metalc ? ? G GLU 22 OE2   ? ? ? 1_555 L MG  .  MG ? ? C GLU 45 C MG  502 1_555 ? ? ? ? ? ? ?            2.123 ? 
covale1  covale ? ? B DG  8  "O3'" ? ? ? 1_555 B 5IU 9  P  ? ? E DG  8  E 5IU 9   1_555 ? ? ? ? ? ? ?            1.616 ? 
covale2  covale ? ? B 5IU 9  "O3'" ? ? ? 1_555 B DG  10 P  ? ? E 5IU 9  E DG  10  1_555 ? ? ? ? ? ? ?            1.603 ? 
covale3  covale ? ? D DG  8  "O3'" ? ? ? 1_555 D 5IU 9  P  ? ? J DG  8  J 5IU 9   1_555 ? ? ? ? ? ? ?            1.609 ? 
covale4  covale ? ? D 5IU 9  "O3'" ? ? ? 1_555 D DG  10 P  ? ? J 5IU 9  J DG  10  1_555 ? ? ? ? ? ? ?            1.597 ? 
hydrog1  hydrog ? ? A G   1  N1    ? ? ? 1_555 B DC  12 N3 ? ? D G   1  E DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A G   1  N2    ? ? ? 1_555 B DC  12 O2 ? ? D G   1  E DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A G   1  O6    ? ? ? 1_555 B DC  12 N4 ? ? D G   1  E DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A A   2  N1    ? ? ? 1_555 B DT  11 N3 ? ? D A   2  E DT  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A A   2  N6    ? ? ? 1_555 B DT  11 O4 ? ? D A   2  E DT  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A C   3  N3    ? ? ? 1_555 B DG  10 N1 ? ? D C   3  E DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A C   3  N4    ? ? ? 1_555 B DG  10 O6 ? ? D C   3  E DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A C   3  O2    ? ? ? 1_555 B DG  10 N2 ? ? D C   3  E DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A A   4  N1    ? ? ? 1_555 B 5IU 9  N3 ? ? D A   4  E 5IU 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A A   4  N6    ? ? ? 1_555 B 5IU 9  O4 ? ? D A   4  E 5IU 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A C   5  N3    ? ? ? 1_555 B DG  8  N1 ? ? D C   5  E DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A C   5  N4    ? ? ? 1_555 B DG  8  O6 ? ? D C   5  E DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A C   5  O2    ? ? ? 1_555 B DG  8  N2 ? ? D C   5  E DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A C   6  N3    ? ? ? 1_555 B DG  7  N1 ? ? D C   6  E DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A C   6  N4    ? ? ? 1_555 B DG  7  O6 ? ? D C   6  E DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A C   6  O2    ? ? ? 1_555 B DG  7  N2 ? ? D C   6  E DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A U   7  N3    ? ? ? 1_555 B DA  6  N1 ? ? D U   7  E DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A U   7  O4    ? ? ? 1_555 B DA  6  N6 ? ? D U   7  E DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A G   8  N1    ? ? ? 1_555 B DC  5  N3 ? ? D G   8  E DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A G   8  N2    ? ? ? 1_555 B DC  5  O2 ? ? D G   8  E DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A G   8  O6    ? ? ? 1_555 B DC  5  N4 ? ? D G   8  E DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A A   9  N1    ? ? ? 1_555 B DT  4  N3 ? ? D A   9  E DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A A   9  N6    ? ? ? 1_555 B DT  4  O4 ? ? D A   9  E DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A U   10 N3    ? ? ? 1_555 B DA  3  N1 ? ? D U   10 E DA  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A U   10 O4    ? ? ? 1_555 B DA  3  N6 ? ? D U   10 E DA  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A U   11 N3    ? ? ? 1_555 B DA  2  N1 ? ? D U   11 E DA  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A U   11 O4    ? ? ? 1_555 B DA  2  N6 ? ? D U   11 E DA  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A C   12 N3    ? ? ? 1_555 B DG  1  N1 ? ? D C   12 E DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? A C   12 N4    ? ? ? 1_555 B DG  1  O6 ? ? D C   12 E DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? A C   12 O2    ? ? ? 1_555 B DG  1  N2 ? ? D C   12 E DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? C G   1  N1    ? ? ? 1_555 D DC  12 N3 ? ? I G   1  J DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? C G   1  N2    ? ? ? 1_555 D DC  12 O2 ? ? I G   1  J DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? C G   1  O6    ? ? ? 1_555 D DC  12 N4 ? ? I G   1  J DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? C A   2  N1    ? ? ? 1_555 D DT  11 N3 ? ? I A   2  J DT  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? C A   2  N6    ? ? ? 1_555 D DT  11 O4 ? ? I A   2  J DT  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? C C   3  N3    ? ? ? 1_555 D DG  10 N1 ? ? I C   3  J DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? C C   3  N4    ? ? ? 1_555 D DG  10 O6 ? ? I C   3  J DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? C C   3  O2    ? ? ? 1_555 D DG  10 N2 ? ? I C   3  J DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? C A   4  N1    ? ? ? 1_555 D 5IU 9  N3 ? ? I A   4  J 5IU 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? C A   4  N6    ? ? ? 1_555 D 5IU 9  O4 ? ? I A   4  J 5IU 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? C C   5  N3    ? ? ? 1_555 D DG  8  N1 ? ? I C   5  J DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? C C   5  N4    ? ? ? 1_555 D DG  8  O6 ? ? I C   5  J DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? C C   5  O2    ? ? ? 1_555 D DG  8  N2 ? ? I C   5  J DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? C C   6  N3    ? ? ? 1_555 D DG  7  N1 A ? I C   6  J DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? C C   6  N4    ? ? ? 1_555 D DG  7  O6 A ? I C   6  J DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? C C   6  O2    ? ? ? 1_555 D DG  7  N2 A ? I C   6  J DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? C G   8  N1    ? ? ? 1_555 D DC  5  N3 ? ? I G   8  J DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? C G   8  N2    ? ? ? 1_555 D DC  5  O2 ? ? I G   8  J DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? C G   8  O6    ? ? ? 1_555 D DC  5  N4 ? ? I G   8  J DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? C A   9  N1    ? ? ? 1_555 D DT  4  N3 ? ? I A   9  J DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? C A   9  N6    ? ? ? 1_555 D DT  4  O4 ? ? I A   9  J DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? C U   10 N3    ? ? ? 1_555 D DA  3  N1 ? ? I U   10 J DA  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ? ? C U   10 O4    ? ? ? 1_555 D DA  3  N6 ? ? I U   10 J DA  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ? ? C U   11 N3    ? ? ? 1_555 D DA  2  N1 ? ? I U   11 J DA  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ? ? C U   11 O4    ? ? ? 1_555 D DA  2  N6 ? ? I U   11 J DA  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ? ? C C   12 N3    ? ? ? 1_555 D DG  1  N1 ? ? I C   12 J DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ? ? C C   12 N4    ? ? ? 1_555 D DG  1  O6 ? ? I C   12 J DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ? ? C C   12 O2    ? ? ? 1_555 D DG  1  N2 ? ? I C   12 J DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
C ? 3 ? 
D ? 3 ? 
E ? 3 ? 
F ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY E 15 ? PHE E 17 ? GLY A 38 PHE A 40 
A 2 PHE E 5  ? ARG E 10 ? PHE A 28 ARG A 33 
A 3 ARG E 34 ? PHE E 38 ? ARG A 57 PHE A 61 
B 1 GLY F 15 ? PHE F 17 ? GLY B 38 PHE B 40 
B 2 PHE F 5  ? ARG F 10 ? PHE B 28 ARG B 33 
B 3 ARG F 34 ? PHE F 38 ? ARG B 57 PHE B 61 
C 1 GLY G 15 ? PHE G 17 ? GLY C 38 PHE C 40 
C 2 PHE G 5  ? ARG G 10 ? PHE C 28 ARG C 33 
C 3 ARG G 34 ? PHE G 38 ? ARG C 57 PHE C 61 
D 1 GLY H 15 ? PHE H 17 ? GLY F 38 PHE F 40 
D 2 PHE H 5  ? ARG H 10 ? PHE F 28 ARG F 33 
D 3 ARG H 34 ? PHE H 38 ? ARG F 57 PHE F 61 
E 1 GLY I 15 ? PHE I 17 ? GLY G 38 PHE G 40 
E 2 PHE I 5  ? ARG I 10 ? PHE G 28 ARG G 33 
E 3 ARG I 34 ? PHE I 38 ? ARG G 57 PHE G 61 
F 1 GLY J 15 ? PHE J 17 ? GLY H 38 PHE H 40 
F 2 PHE J 5  ? ARG J 10 ? PHE H 28 ARG H 33 
F 3 ARG J 34 ? PHE J 38 ? ARG H 57 PHE H 61 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE E 17 ? O PHE A 40 N TYR E 6  ? N TYR A 29 
A 2 3 N PHE E 5  ? N PHE A 28 O PHE E 38 ? O PHE A 61 
B 1 2 O PHE F 17 ? O PHE B 40 N TYR F 6  ? N TYR B 29 
B 2 3 N PHE F 5  ? N PHE B 28 O PHE F 38 ? O PHE B 61 
C 1 2 O PHE G 17 ? O PHE C 40 N TYR G 6  ? N TYR C 29 
C 2 3 N PHE G 5  ? N PHE C 28 O PHE G 38 ? O PHE C 61 
D 1 2 O PHE H 17 ? O PHE F 40 N TYR H 6  ? N TYR F 29 
D 2 3 N PHE H 5  ? N PHE F 28 O PHE H 38 ? O PHE F 61 
E 1 2 O PHE I 17 ? O PHE G 40 N TYR I 6  ? N TYR G 29 
E 2 3 N PHE I 5  ? N PHE G 28 O PHE I 38 ? O PHE G 61 
F 1 2 O PHE J 17 ? O PHE H 40 N TYR J 6  ? N TYR H 29 
F 2 3 N PHE J 5  ? N PHE H 28 O PHE J 38 ? O PHE H 61 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    3 
_struct_site.details              'BINDING SITE FOR RESIDUE MG C 502' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 3 PHE G 17 ? PHE C 40 . ? 1_555 ? 
2 AC1 3 LEU G 18 ? LEU C 41 . ? 1_555 ? 
3 AC1 3 GLU G 22 ? GLU C 45 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3BSU 
_atom_sites.fract_transf_matrix[1][1]   0.021982 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015561 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007126 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
I  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . G   A 1 1  ? 9.111   -15.272 17.790  1.00 32.59 ? 1   G   D "O5'" 1 
ATOM   2    C  "C5'" . G   A 1 1  ? 8.754   -14.015 18.361  1.00 27.81 ? 1   G   D "C5'" 1 
ATOM   3    C  "C4'" . G   A 1 1  ? 9.108   -13.817 19.819  1.00 27.74 ? 1   G   D "C4'" 1 
ATOM   4    O  "O4'" . G   A 1 1  ? 8.588   -12.519 20.193  1.00 28.04 ? 1   G   D "O4'" 1 
ATOM   5    C  "C3'" . G   A 1 1  ? 8.487   -14.801 20.812  1.00 27.24 ? 1   G   D "C3'" 1 
ATOM   6    O  "O3'" . G   A 1 1  ? 9.353   -15.897 21.074  1.00 25.47 ? 1   G   D "O3'" 1 
ATOM   7    C  "C2'" . G   A 1 1  ? 8.326   -13.942 22.050  1.00 27.18 ? 1   G   D "C2'" 1 
ATOM   8    O  "O2'" . G   A 1 1  ? 9.557   -13.760 22.710  1.00 31.47 ? 1   G   D "O2'" 1 
ATOM   9    C  "C1'" . G   A 1 1  ? 7.905   -12.612 21.425  1.00 27.11 ? 1   G   D "C1'" 1 
ATOM   10   N  N9    . G   A 1 1  ? 6.476   -12.524 21.143  1.00 21.31 ? 1   G   D N9    1 
ATOM   11   C  C8    . G   A 1 1  ? 5.865   -12.531 19.915  1.00 20.86 ? 1   G   D C8    1 
ATOM   12   N  N7    . G   A 1 1  ? 4.565   -12.412 19.992  1.00 20.21 ? 1   G   D N7    1 
ATOM   13   C  C5    . G   A 1 1  ? 4.315   -12.332 21.354  1.00 18.78 ? 1   G   D C5    1 
ATOM   14   C  C6    . G   A 1 1  ? 3.107   -12.206 22.047  1.00 19.29 ? 1   G   D C6    1 
ATOM   15   O  O6    . G   A 1 1  ? 1.963   -12.116 21.582  1.00 21.79 ? 1   G   D O6    1 
ATOM   16   N  N1    . G   A 1 1  ? 3.306   -12.186 23.421  1.00 16.24 ? 1   G   D N1    1 
ATOM   17   C  C2    . G   A 1 1  ? 4.528   -12.269 24.039  1.00 18.80 ? 1   G   D C2    1 
ATOM   18   N  N2    . G   A 1 1  ? 4.542   -12.227 25.374  1.00 21.74 ? 1   G   D N2    1 
ATOM   19   N  N3    . G   A 1 1  ? 5.661   -12.382 23.401  1.00 19.15 ? 1   G   D N3    1 
ATOM   20   C  C4    . G   A 1 1  ? 5.485   -12.410 22.070  1.00 19.73 ? 1   G   D C4    1 
ATOM   21   P  P     . A   A 1 2  ? 8.741   -17.326 21.511  1.00 28.59 ? 2   A   D P     1 
ATOM   22   O  OP1   . A   A 1 2  ? 9.885   -18.240 21.791  1.00 29.54 ? 2   A   D OP1   1 
ATOM   23   O  OP2   . A   A 1 2  ? 7.726   -17.725 20.518  1.00 30.56 ? 2   A   D OP2   1 
ATOM   24   O  "O5'" . A   A 1 2  ? 8.018   -17.037 22.905  1.00 26.31 ? 2   A   D "O5'" 1 
ATOM   25   C  "C5'" . A   A 1 2  ? 8.791   -16.843 24.076  1.00 22.40 ? 2   A   D "C5'" 1 
ATOM   26   C  "C4'" . A   A 1 2  ? 7.895   -16.621 25.261  1.00 26.10 ? 2   A   D "C4'" 1 
ATOM   27   O  "O4'" . A   A 1 2  ? 7.067   -15.457 25.022  1.00 24.07 ? 2   A   D "O4'" 1 
ATOM   28   C  "C3'" . A   A 1 2  ? 6.884   -17.708 25.546  1.00 26.19 ? 2   A   D "C3'" 1 
ATOM   29   O  "O3'" . A   A 1 2  ? 7.496   -18.746 26.275  1.00 30.11 ? 2   A   D "O3'" 1 
ATOM   30   C  "C2'" . A   A 1 2  ? 5.876   -16.949 26.387  1.00 24.63 ? 2   A   D "C2'" 1 
ATOM   31   O  "O2'" . A   A 1 2  ? 6.415   -16.666 27.663  1.00 27.07 ? 2   A   D "O2'" 1 
ATOM   32   C  "C1'" . A   A 1 2  ? 5.798   -15.643 25.610  1.00 25.13 ? 2   A   D "C1'" 1 
ATOM   33   N  N9    . A   A 1 2  ? 4.796   -15.591 24.539  1.00 21.82 ? 2   A   D N9    1 
ATOM   34   C  C8    . A   A 1 2  ? 5.008   -15.694 23.184  1.00 19.42 ? 2   A   D C8    1 
ATOM   35   N  N7    . A   A 1 2  ? 3.921   -15.564 22.469  1.00 18.18 ? 2   A   D N7    1 
ATOM   36   C  C5    . A   A 1 2  ? 2.920   -15.369 23.414  1.00 19.87 ? 2   A   D C5    1 
ATOM   37   C  C6    . A   A 1 2  ? 1.540   -15.151 23.297  1.00 21.76 ? 2   A   D C6    1 
ATOM   38   N  N6    . A   A 1 2  ? 0.889   -15.111 22.125  1.00 21.54 ? 2   A   D N6    1 
ATOM   39   N  N1    . A   A 1 2  ? 0.831   -14.977 24.436  1.00 22.17 ? 2   A   D N1    1 
ATOM   40   C  C2    . A   A 1 2  ? 1.475   -15.046 25.603  1.00 21.88 ? 2   A   D C2    1 
ATOM   41   N  N3    . A   A 1 2  ? 2.765   -15.257 25.840  1.00 21.99 ? 2   A   D N3    1 
ATOM   42   C  C4    . A   A 1 2  ? 3.443   -15.400 24.692  1.00 20.45 ? 2   A   D C4    1 
ATOM   43   P  P     . C   A 1 3  ? 6.896   -20.231 26.198  1.00 30.82 ? 3   C   D P     1 
ATOM   44   O  OP1   . C   A 1 3  ? 7.797   -21.031 27.045  1.00 34.99 ? 3   C   D OP1   1 
ATOM   45   O  OP2   . C   A 1 3  ? 6.696   -20.626 24.799  1.00 33.21 ? 3   C   D OP2   1 
ATOM   46   O  "O5'" . C   A 1 3  ? 5.485   -20.078 26.921  1.00 31.47 ? 3   C   D "O5'" 1 
ATOM   47   C  "C5'" . C   A 1 3  ? 5.417   -19.900 28.330  1.00 29.20 ? 3   C   D "C5'" 1 
ATOM   48   C  "C4'" . C   A 1 3  ? 3.988   -19.661 28.775  1.00 27.79 ? 3   C   D "C4'" 1 
ATOM   49   O  "O4'" . C   A 1 3  ? 3.439   -18.484 28.120  1.00 28.43 ? 3   C   D "O4'" 1 
ATOM   50   C  "C3'" . C   A 1 3  ? 2.983   -20.738 28.435  1.00 27.60 ? 3   C   D "C3'" 1 
ATOM   51   O  "O3'" . C   A 1 3  ? 3.109   -21.829 29.325  1.00 28.63 ? 3   C   D "O3'" 1 
ATOM   52   C  "C2'" . C   A 1 3  ? 1.673   -19.983 28.594  1.00 25.92 ? 3   C   D "C2'" 1 
ATOM   53   O  "O2'" . C   A 1 3  ? 1.331   -19.738 29.954  1.00 26.06 ? 3   C   D "O2'" 1 
ATOM   54   C  "C1'" . C   A 1 3  ? 2.034   -18.651 27.941  1.00 27.94 ? 3   C   D "C1'" 1 
ATOM   55   N  N1    . C   A 1 3  ? 1.723   -18.581 26.496  1.00 26.05 ? 3   C   D N1    1 
ATOM   56   C  C2    . C   A 1 3  ? 0.409   -18.304 26.104  1.00 26.54 ? 3   C   D C2    1 
ATOM   57   O  O2    . C   A 1 3  ? -0.481  -18.195 26.983  1.00 26.55 ? 3   C   D O2    1 
ATOM   58   N  N3    . C   A 1 3  ? 0.127   -18.165 24.783  1.00 26.31 ? 3   C   D N3    1 
ATOM   59   C  C4    . C   A 1 3  ? 1.091   -18.307 23.874  1.00 26.85 ? 3   C   D C4    1 
ATOM   60   N  N4    . C   A 1 3  ? 0.762   -18.128 22.588  1.00 28.32 ? 3   C   D N4    1 
ATOM   61   C  C5    . C   A 1 3  ? 2.431   -18.626 24.240  1.00 25.20 ? 3   C   D C5    1 
ATOM   62   C  C6    . C   A 1 3  ? 2.702   -18.755 25.550  1.00 25.59 ? 3   C   D C6    1 
ATOM   63   P  P     . A   A 1 4  ? 2.890   -23.319 28.790  1.00 31.67 ? 4   A   D P     1 
ATOM   64   O  OP1   . A   A 1 4  ? 3.175   -24.208 29.944  1.00 31.69 ? 4   A   D OP1   1 
ATOM   65   O  OP2   . A   A 1 4  ? 3.584   -23.557 27.512  1.00 31.44 ? 4   A   D OP2   1 
ATOM   66   O  "O5'" . A   A 1 4  ? 1.317   -23.368 28.537  1.00 30.18 ? 4   A   D "O5'" 1 
ATOM   67   C  "C5'" . A   A 1 4  ? 0.434   -23.317 29.645  1.00 27.95 ? 4   A   D "C5'" 1 
ATOM   68   C  "C4'" . A   A 1 4  ? -0.989  -23.136 29.198  1.00 22.48 ? 4   A   D "C4'" 1 
ATOM   69   O  "O4'" . A   A 1 4  ? -1.131  -21.875 28.503  1.00 23.45 ? 4   A   D "O4'" 1 
ATOM   70   C  "C3'" . A   A 1 4  ? -1.548  -24.143 28.218  1.00 24.48 ? 4   A   D "C3'" 1 
ATOM   71   O  "O3'" . A   A 1 4  ? -1.861  -25.349 28.880  1.00 26.51 ? 4   A   D "O3'" 1 
ATOM   72   C  "C2'" . A   A 1 4  ? -2.771  -23.389 27.701  1.00 23.01 ? 4   A   D "C2'" 1 
ATOM   73   O  "O2'" . A   A 1 4  ? -3.862  -23.399 28.611  1.00 23.94 ? 4   A   D "O2'" 1 
ATOM   74   C  "C1'" . A   A 1 4  ? -2.203  -21.973 27.564  1.00 21.82 ? 4   A   D "C1'" 1 
ATOM   75   N  N9    . A   A 1 4  ? -1.651  -21.738 26.231  1.00 22.22 ? 4   A   D N9    1 
ATOM   76   C  C8    . A   A 1 4  ? -0.339  -21.870 25.832  1.00 20.25 ? 4   A   D C8    1 
ATOM   77   N  N7    . A   A 1 4  ? -0.138  -21.569 24.576  1.00 20.05 ? 4   A   D N7    1 
ATOM   78   C  C5    . A   A 1 4  ? -1.399  -21.215 24.109  1.00 20.91 ? 4   A   D C5    1 
ATOM   79   C  C6    . A   A 1 4  ? -1.851  -20.790 22.852  1.00 20.43 ? 4   A   D C6    1 
ATOM   80   N  N6    . A   A 1 4  ? -1.041  -20.600 21.811  1.00 22.65 ? 4   A   D N6    1 
ATOM   81   N  N1    . A   A 1 4  ? -3.174  -20.551 22.701  1.00 22.65 ? 4   A   D N1    1 
ATOM   82   C  C2    . A   A 1 4  ? -3.982  -20.727 23.760  1.00 23.42 ? 4   A   D C2    1 
ATOM   83   N  N3    . A   A 1 4  ? -3.667  -21.116 25.005  1.00 21.51 ? 4   A   D N3    1 
ATOM   84   C  C4    . A   A 1 4  ? -2.344  -21.337 25.111  1.00 20.76 ? 4   A   D C4    1 
ATOM   85   P  P     . C   A 1 5  ? -1.768  -26.755 28.102  1.00 29.18 ? 5   C   D P     1 
ATOM   86   O  OP1   . C   A 1 5  ? -2.199  -27.762 29.091  1.00 32.90 ? 5   C   D OP1   1 
ATOM   87   O  OP2   . C   A 1 5  ? -0.481  -26.924 27.390  1.00 34.25 ? 5   C   D OP2   1 
ATOM   88   O  "O5'" . C   A 1 5  ? -2.957  -26.696 27.049  1.00 31.93 ? 5   C   D "O5'" 1 
ATOM   89   C  "C5'" . C   A 1 5  ? -4.298  -26.664 27.510  1.00 29.28 ? 5   C   D "C5'" 1 
ATOM   90   C  "C4'" . C   A 1 5  ? -5.210  -26.222 26.414  1.00 27.22 ? 5   C   D "C4'" 1 
ATOM   91   O  "O4'" . C   A 1 5  ? -4.771  -24.929 25.905  1.00 27.42 ? 5   C   D "O4'" 1 
ATOM   92   C  "C3'" . C   A 1 5  ? -5.202  -27.099 25.180  1.00 29.03 ? 5   C   D "C3'" 1 
ATOM   93   O  "O3'" . C   A 1 5  ? -5.957  -28.293 25.374  1.00 27.83 ? 5   C   D "O3'" 1 
ATOM   94   C  "C2'" . C   A 1 5  ? -5.797  -26.155 24.139  1.00 28.28 ? 5   C   D "C2'" 1 
ATOM   95   O  "O2'" . C   A 1 5  ? -7.204  -26.007 24.274  1.00 29.37 ? 5   C   D "O2'" 1 
ATOM   96   C  "C1'" . C   A 1 5  ? -5.120  -24.831 24.523  1.00 27.22 ? 5   C   D "C1'" 1 
ATOM   97   N  N1    . C   A 1 5  ? -3.904  -24.549 23.732  1.00 23.47 ? 5   C   D N1    1 
ATOM   98   C  C2    . C   A 1 5  ? -4.053  -23.983 22.471  1.00 24.90 ? 5   C   D C2    1 
ATOM   99   O  O2    . C   A 1 5  ? -5.187  -23.705 22.079  1.00 24.15 ? 5   C   D O2    1 
ATOM   100  N  N3    . C   A 1 5  ? -2.959  -23.737 21.719  1.00 23.46 ? 5   C   D N3    1 
ATOM   101  C  C4    . C   A 1 5  ? -1.751  -24.010 22.202  1.00 21.08 ? 5   C   D C4    1 
ATOM   102  N  N4    . C   A 1 5  ? -0.702  -23.713 21.450  1.00 21.59 ? 5   C   D N4    1 
ATOM   103  C  C5    . C   A 1 5  ? -1.568  -24.584 23.486  1.00 20.53 ? 5   C   D C5    1 
ATOM   104  C  C6    . C   A 1 5  ? -2.660  -24.833 24.213  1.00 20.27 ? 5   C   D C6    1 
ATOM   105  P  P     . C   A 1 6  ? -5.647  -29.568 24.474  1.00 28.55 ? 6   C   D P     1 
ATOM   106  O  OP1   . C   A 1 6  ? -6.430  -30.705 24.996  1.00 31.38 ? 6   C   D OP1   1 
ATOM   107  O  OP2   . C   A 1 6  ? -4.176  -29.714 24.310  1.00 32.28 ? 6   C   D OP2   1 
ATOM   108  O  "O5'" . C   A 1 6  ? -6.269  -29.184 23.049  1.00 29.07 ? 6   C   D "O5'" 1 
ATOM   109  C  "C5'" . C   A 1 6  ? -7.672  -28.947 22.909  1.00 28.33 ? 6   C   D "C5'" 1 
ATOM   110  C  "C4'" . C   A 1 6  ? -8.034  -28.576 21.478  1.00 27.18 ? 6   C   D "C4'" 1 
ATOM   111  O  "O4'" . C   A 1 6  ? -7.568  -27.239 21.139  1.00 27.90 ? 6   C   D "O4'" 1 
ATOM   112  C  "C3'" . C   A 1 6  ? -7.427  -29.442 20.396  1.00 27.98 ? 6   C   D "C3'" 1 
ATOM   113  O  "O3'" . C   A 1 6  ? -8.187  -30.615 20.230  1.00 25.83 ? 6   C   D "O3'" 1 
ATOM   114  C  "C2'" . C   A 1 6  ? -7.595  -28.546 19.195  1.00 25.78 ? 6   C   D "C2'" 1 
ATOM   115  O  "O2'" . C   A 1 6  ? -8.962  -28.473 18.862  1.00 29.50 ? 6   C   D "O2'" 1 
ATOM   116  C  "C1'" . C   A 1 6  ? -7.170  -27.214 19.787  1.00 25.15 ? 6   C   D "C1'" 1 
ATOM   117  N  N1    . C   A 1 6  ? -5.715  -27.048 19.725  1.00 24.42 ? 6   C   D N1    1 
ATOM   118  C  C2    . C   A 1 6  ? -5.179  -26.554 18.549  1.00 26.90 ? 6   C   D C2    1 
ATOM   119  O  O2    . C   A 1 6  ? -5.953  -26.338 17.593  1.00 27.08 ? 6   C   D O2    1 
ATOM   120  N  N3    . C   A 1 6  ? -3.843  -26.324 18.467  1.00 25.87 ? 6   C   D N3    1 
ATOM   121  C  C4    . C   A 1 6  ? -3.060  -26.578 19.514  1.00 24.61 ? 6   C   D C4    1 
ATOM   122  N  N4    . C   A 1 6  ? -1.755  -26.293 19.401  1.00 24.50 ? 6   C   D N4    1 
ATOM   123  C  C5    . C   A 1 6  ? -3.581  -27.129 20.724  1.00 24.44 ? 6   C   D C5    1 
ATOM   124  C  C6    . C   A 1 6  ? -4.905  -27.350 20.782  1.00 23.32 ? 6   C   D C6    1 
ATOM   125  P  P     . U   A 1 7  ? -7.461  -31.965 19.862  1.00 26.33 ? 7   U   D P     1 
ATOM   126  O  OP1   . U   A 1 7  ? -8.493  -33.026 19.985  1.00 25.59 ? 7   U   D OP1   1 
ATOM   127  O  OP2   . U   A 1 7  ? -6.185  -32.073 20.623  1.00 26.29 ? 7   U   D OP2   1 
ATOM   128  O  "O5'" . U   A 1 7  ? -7.122  -31.819 18.304  1.00 26.60 ? 7   U   D "O5'" 1 
ATOM   129  C  "C5'" . U   A 1 7  ? -8.172  -31.646 17.368  1.00 26.39 ? 7   U   D "C5'" 1 
ATOM   130  C  "C4'" . U   A 1 7  ? -7.635  -31.152 16.043  1.00 27.68 ? 7   U   D "C4'" 1 
ATOM   131  O  "O4'" . U   A 1 7  ? -7.075  -29.812 16.174  1.00 28.48 ? 7   U   D "O4'" 1 
ATOM   132  C  "C3'" . U   A 1 7  ? -6.483  -31.943 15.463  1.00 27.89 ? 7   U   D "C3'" 1 
ATOM   133  O  "O3'" . U   A 1 7  ? -6.958  -33.129 14.865  1.00 26.22 ? 7   U   D "O3'" 1 
ATOM   134  C  "C2'" . U   A 1 7  ? -5.947  -30.942 14.448  1.00 27.20 ? 7   U   D "C2'" 1 
ATOM   135  O  "O2'" . U   A 1 7  ? -6.866  -30.795 13.398  1.00 24.25 ? 7   U   D "O2'" 1 
ATOM   136  C  "C1'" . U   A 1 7  ? -5.986  -29.660 15.271  1.00 26.37 ? 7   U   D "C1'" 1 
ATOM   137  N  N1    . U   A 1 7  ? -4.758  -29.474 16.056  1.00 26.00 ? 7   U   D N1    1 
ATOM   138  C  C2    . U   A 1 7  ? -3.660  -28.960 15.409  1.00 26.96 ? 7   U   D C2    1 
ATOM   139  O  O2    . U   A 1 7  ? -3.672  -28.645 14.236  1.00 27.51 ? 7   U   D O2    1 
ATOM   140  N  N3    . U   A 1 7  ? -2.542  -28.827 16.184  1.00 24.56 ? 7   U   D N3    1 
ATOM   141  C  C4    . U   A 1 7  ? -2.411  -29.139 17.511  1.00 25.27 ? 7   U   D C4    1 
ATOM   142  O  O4    . U   A 1 7  ? -1.331  -28.925 18.078  1.00 26.29 ? 7   U   D O4    1 
ATOM   143  C  C5    . U   A 1 7  ? -3.596  -29.664 18.120  1.00 22.58 ? 7   U   D C5    1 
ATOM   144  C  C6    . U   A 1 7  ? -4.699  -29.809 17.394  1.00 25.44 ? 7   U   D C6    1 
ATOM   145  P  P     . G   A 1 8  ? -6.028  -34.431 14.840  1.00 30.72 ? 8   G   D P     1 
ATOM   146  O  OP1   . G   A 1 8  ? -6.899  -35.546 14.392  1.00 30.57 ? 8   G   D OP1   1 
ATOM   147  O  OP2   . G   A 1 8  ? -5.293  -34.551 16.140  1.00 32.87 ? 8   G   D OP2   1 
ATOM   148  O  "O5'" . G   A 1 8  ? -4.922  -34.104 13.743  1.00 27.73 ? 8   G   D "O5'" 1 
ATOM   149  C  "C5'" . G   A 1 8  ? -5.287  -33.838 12.397  1.00 27.80 ? 8   G   D "C5'" 1 
ATOM   150  C  "C4'" . G   A 1 8  ? -4.118  -33.269 11.634  1.00 24.85 ? 8   G   D "C4'" 1 
ATOM   151  O  "O4'" . G   A 1 8  ? -3.708  -31.999 12.212  1.00 24.63 ? 8   G   D "O4'" 1 
ATOM   152  C  "C3'" . G   A 1 8  ? -2.841  -34.087 11.625  1.00 25.07 ? 8   G   D "C3'" 1 
ATOM   153  O  "O3'" . G   A 1 8  ? -2.920  -35.134 10.662  1.00 29.75 ? 8   G   D "O3'" 1 
ATOM   154  C  "C2'" . G   A 1 8  ? -1.824  -33.033 11.218  1.00 22.40 ? 8   G   D "C2'" 1 
ATOM   155  O  "O2'" . G   A 1 8  ? -1.920  -32.704 9.857   1.00 21.29 ? 8   G   D "O2'" 1 
ATOM   156  C  "C1'" . G   A 1 8  ? -2.308  -31.832 12.029  1.00 22.67 ? 8   G   D "C1'" 1 
ATOM   157  N  N9    . G   A 1 8  ? -1.681  -31.767 13.347  1.00 20.15 ? 8   G   D N9    1 
ATOM   158  C  C8    . G   A 1 8  ? -2.260  -32.114 14.543  1.00 18.62 ? 8   G   D C8    1 
ATOM   159  N  N7    . G   A 1 8  ? -1.481  -31.901 15.569  1.00 19.75 ? 8   G   D N7    1 
ATOM   160  C  C5    . G   A 1 8  ? -0.316  -31.373 15.015  1.00 18.49 ? 8   G   D C5    1 
ATOM   161  C  C6    . G   A 1 8  ? 0.885   -30.907 15.644  1.00 18.20 ? 8   G   D C6    1 
ATOM   162  O  O6    . G   A 1 8  ? 1.159   -30.826 16.880  1.00 16.66 ? 8   G   D O6    1 
ATOM   163  N  N1    . G   A 1 8  ? 1.817   -30.493 14.700  1.00 15.49 ? 8   G   D N1    1 
ATOM   164  C  C2    . G   A 1 8  ? 1.625   -30.496 13.337  1.00 18.32 ? 8   G   D C2    1 
ATOM   165  N  N2    . G   A 1 8  ? 2.658   -30.072 12.596  1.00 16.61 ? 8   G   D N2    1 
ATOM   166  N  N3    . G   A 1 8  ? 0.505   -30.892 12.746  1.00 19.66 ? 8   G   D N3    1 
ATOM   167  C  C4    . G   A 1 8  ? -0.413  -31.321 13.639  1.00 18.19 ? 8   G   D C4    1 
ATOM   168  P  P     . A   A 1 9  ? -2.134  -36.522 10.913  1.00 30.51 ? 9   A   D P     1 
ATOM   169  O  OP1   . A   A 1 9  ? -2.752  -37.536 10.033  1.00 29.99 ? 9   A   D OP1   1 
ATOM   170  O  OP2   . A   A 1 9  ? -2.095  -36.762 12.380  1.00 29.43 ? 9   A   D OP2   1 
ATOM   171  O  "O5'" . A   A 1 9  ? -0.642  -36.237 10.437  1.00 30.59 ? 9   A   D "O5'" 1 
ATOM   172  C  "C5'" . A   A 1 9  ? -0.366  -35.698 9.143   1.00 28.05 ? 9   A   D "C5'" 1 
ATOM   173  C  "C4'" . A   A 1 9  ? 1.053   -35.176 9.069   1.00 26.35 ? 9   A   D "C4'" 1 
ATOM   174  O  "O4'" . A   A 1 9  ? 1.200   -33.956 9.851   1.00 26.50 ? 9   A   D "O4'" 1 
ATOM   175  C  "C3'" . A   A 1 9  ? 2.153   -36.078 9.602   1.00 26.89 ? 9   A   D "C3'" 1 
ATOM   176  O  "O3'" . A   A 1 9  ? 2.531   -37.065 8.657   1.00 26.48 ? 9   A   D "O3'" 1 
ATOM   177  C  "C2'" . A   A 1 9  ? 3.280   -35.077 9.820   1.00 26.29 ? 9   A   D "C2'" 1 
ATOM   178  O  "O2'" . A   A 1 9  ? 3.863   -34.701 8.586   1.00 29.05 ? 9   A   D "O2'" 1 
ATOM   179  C  "C1'" . A   A 1 9  ? 2.508   -33.894 10.404  1.00 23.24 ? 9   A   D "C1'" 1 
ATOM   180  N  N9    . A   A 1 9  ? 2.378   -33.950 11.865  1.00 21.69 ? 9   A   D N9    1 
ATOM   181  C  C8    . A   A 1 9  ? 1.292   -34.385 12.566  1.00 16.24 ? 9   A   D C8    1 
ATOM   182  N  N7    . A   A 1 9  ? 1.422   -34.279 13.860  1.00 18.92 ? 9   A   D N7    1 
ATOM   183  C  C5    . A   A 1 9  ? 2.689   -33.741 14.028  1.00 19.77 ? 9   A   D C5    1 
ATOM   184  C  C6    . A   A 1 9  ? 3.418   -33.381 15.179  1.00 18.25 ? 9   A   D C6    1 
ATOM   185  N  N6    . A   A 1 9  ? 2.937   -33.486 16.419  1.00 22.15 ? 9   A   D N6    1 
ATOM   186  N  N1    . A   A 1 9  ? 4.659   -32.900 15.007  1.00 20.66 ? 9   A   D N1    1 
ATOM   187  C  C2    . A   A 1 9  ? 5.132   -32.774 13.752  1.00 21.22 ? 9   A   D C2    1 
ATOM   188  N  N3    . A   A 1 9  ? 4.539   -33.067 12.594  1.00 18.52 ? 9   A   D N3    1 
ATOM   189  C  C4    . A   A 1 9  ? 3.302   -33.555 12.808  1.00 18.30 ? 9   A   D C4    1 
ATOM   190  P  P     . U   A 1 10 ? 2.843   -38.563 9.153   1.00 27.66 ? 10  U   D P     1 
ATOM   191  O  OP1   . U   A 1 10 ? 2.841   -39.403 7.930   1.00 29.29 ? 10  U   D OP1   1 
ATOM   192  O  OP2   . U   A 1 10 ? 1.968   -38.930 10.273  1.00 26.99 ? 10  U   D OP2   1 
ATOM   193  O  "O5'" . U   A 1 10 ? 4.330   -38.459 9.701   1.00 26.86 ? 10  U   D "O5'" 1 
ATOM   194  C  "C5'" . U   A 1 10 ? 5.364   -37.934 8.889   1.00 23.05 ? 10  U   D "C5'" 1 
ATOM   195  C  "C4'" . U   A 1 10 ? 6.514   -37.449 9.739   1.00 21.25 ? 10  U   D "C4'" 1 
ATOM   196  O  "O4'" . U   A 1 10 ? 6.054   -36.389 10.598  1.00 21.33 ? 10  U   D "O4'" 1 
ATOM   197  C  "C3'" . U   A 1 10 ? 7.120   -38.431 10.715  1.00 22.40 ? 10  U   D "C3'" 1 
ATOM   198  O  "O3'" . U   A 1 10 ? 8.039   -39.310 10.096  1.00 24.99 ? 10  U   D "O3'" 1 
ATOM   199  C  "C2'" . U   A 1 10 ? 7.842   -37.501 11.674  1.00 20.95 ? 10  U   D "C2'" 1 
ATOM   200  O  "O2'" . U   A 1 10 ? 9.051   -37.005 11.142  1.00 20.54 ? 10  U   D "O2'" 1 
ATOM   201  C  "C1'" . U   A 1 10 ? 6.836   -36.363 11.779  1.00 20.12 ? 10  U   D "C1'" 1 
ATOM   202  N  N1    . U   A 1 10 ? 5.945   -36.483 12.944  1.00 18.26 ? 10  U   D N1    1 
ATOM   203  C  C2    . U   A 1 10 ? 6.468   -36.153 14.163  1.00 18.20 ? 10  U   D C2    1 
ATOM   204  O  O2    . U   A 1 10 ? 7.619   -35.797 14.299  1.00 21.88 ? 10  U   D O2    1 
ATOM   205  N  N3    . U   A 1 10 ? 5.599   -36.248 15.217  1.00 20.37 ? 10  U   D N3    1 
ATOM   206  C  C4    . U   A 1 10 ? 4.277   -36.615 15.160  1.00 19.06 ? 10  U   D C4    1 
ATOM   207  O  O4    . U   A 1 10 ? 3.608   -36.604 16.176  1.00 20.12 ? 10  U   D O4    1 
ATOM   208  C  C5    . U   A 1 10 ? 3.811   -36.951 13.858  1.00 18.91 ? 10  U   D C5    1 
ATOM   209  C  C6    . U   A 1 10 ? 4.649   -36.888 12.820  1.00 17.04 ? 10  U   D C6    1 
ATOM   210  P  P     . U   A 1 11 ? 8.258   -40.773 10.706  1.00 25.94 ? 11  U   D P     1 
ATOM   211  O  OP1   . U   A 1 11 ? 9.074   -41.533 9.740   1.00 27.32 ? 11  U   D OP1   1 
ATOM   212  O  OP2   . U   A 1 11 ? 6.929   -41.273 11.103  1.00 27.49 ? 11  U   D OP2   1 
ATOM   213  O  "O5'" . U   A 1 11 ? 9.096   -40.534 12.035  1.00 22.69 ? 11  U   D "O5'" 1 
ATOM   214  C  "C5'" . U   A 1 11 ? 10.409  -40.037 11.987  1.00 23.90 ? 11  U   D "C5'" 1 
ATOM   215  C  "C4'" . U   A 1 11 ? 10.854  -39.668 13.376  1.00 22.48 ? 11  U   D "C4'" 1 
ATOM   216  O  "O4'" . U   A 1 11 ? 9.963   -38.668 13.920  1.00 23.81 ? 11  U   D "O4'" 1 
ATOM   217  C  "C3'" . U   A 1 11 ? 10.765  -40.779 14.404  1.00 23.44 ? 11  U   D "C3'" 1 
ATOM   218  O  "O3'" . U   A 1 11 ? 11.915  -41.599 14.314  1.00 23.27 ? 11  U   D "O3'" 1 
ATOM   219  C  "C2'" . U   A 1 11 ? 10.819  -39.989 15.691  1.00 21.51 ? 11  U   D "C2'" 1 
ATOM   220  O  "O2'" . U   A 1 11 ? 12.153  -39.569 15.820  1.00 23.55 ? 11  U   D "O2'" 1 
ATOM   221  C  "C1'" . U   A 1 11 ? 9.931   -38.792 15.341  1.00 23.38 ? 11  U   D "C1'" 1 
ATOM   222  N  N1    . U   A 1 11 ? 8.532   -38.954 15.769  1.00 22.50 ? 11  U   D N1    1 
ATOM   223  C  C2    . U   A 1 11 ? 8.212   -38.636 17.071  1.00 23.34 ? 11  U   D C2    1 
ATOM   224  O  O2    . U   A 1 11 ? 9.029   -38.277 17.883  1.00 25.00 ? 11  U   D O2    1 
ATOM   225  N  N3    . U   A 1 11 ? 6.895   -38.758 17.395  1.00 22.85 ? 11  U   D N3    1 
ATOM   226  C  C4    . U   A 1 11 ? 5.887   -39.165 16.584  1.00 23.77 ? 11  U   D C4    1 
ATOM   227  O  O4    . U   A 1 11 ? 4.744   -39.199 17.030  1.00 22.32 ? 11  U   D O4    1 
ATOM   228  C  C5    . U   A 1 11 ? 6.289   -39.506 15.249  1.00 21.54 ? 11  U   D C5    1 
ATOM   229  C  C6    . U   A 1 11 ? 7.568   -39.394 14.900  1.00 23.59 ? 11  U   D C6    1 
ATOM   230  P  P     . C   A 1 12 ? 11.872  -43.101 14.870  1.00 25.66 ? 12  C   D P     1 
ATOM   231  O  OP1   . C   A 1 12 ? 13.225  -43.631 14.619  1.00 23.54 ? 12  C   D OP1   1 
ATOM   232  O  OP2   . C   A 1 12 ? 10.681  -43.824 14.345  1.00 27.75 ? 12  C   D OP2   1 
ATOM   233  O  "O5'" . C   A 1 12 ? 11.704  -42.930 16.450  1.00 25.84 ? 12  C   D "O5'" 1 
ATOM   234  C  "C5'" . C   A 1 12 ? 12.771  -42.388 17.216  1.00 25.33 ? 12  C   D "C5'" 1 
ATOM   235  C  "C4'" . C   A 1 12 ? 12.390  -42.298 18.670  1.00 27.10 ? 12  C   D "C4'" 1 
ATOM   236  O  "O4'" . C   A 1 12 ? 11.363  -41.289 18.864  1.00 30.06 ? 12  C   D "O4'" 1 
ATOM   237  C  "C3'" . C   A 1 12 ? 11.755  -43.534 19.271  1.00 28.00 ? 12  C   D "C3'" 1 
ATOM   238  O  "O3'" . C   A 1 12 ? 12.680  -44.593 19.473  1.00 34.07 ? 12  C   D "O3'" 1 
ATOM   239  C  "C2'" . C   A 1 12 ? 11.123  -42.960 20.527  1.00 28.51 ? 12  C   D "C2'" 1 
ATOM   240  O  "O2'" . C   A 1 12 ? 12.085  -42.671 21.527  1.00 28.20 ? 12  C   D "O2'" 1 
ATOM   241  C  "C1'" . C   A 1 12 ? 10.574  -41.633 19.997  1.00 26.51 ? 12  C   D "C1'" 1 
ATOM   242  N  N1    . C   A 1 12 ? 9.171   -41.717 19.579  1.00 23.01 ? 12  C   D N1    1 
ATOM   243  C  C2    . C   A 1 12 ? 8.183   -41.428 20.506  1.00 23.30 ? 12  C   D C2    1 
ATOM   244  O  O2    . C   A 1 12 ? 8.512   -41.116 21.667  1.00 24.33 ? 12  C   D O2    1 
ATOM   245  N  N3    . C   A 1 12 ? 6.888   -41.501 20.140  1.00 22.89 ? 12  C   D N3    1 
ATOM   246  C  C4    . C   A 1 12 ? 6.560   -41.864 18.905  1.00 22.89 ? 12  C   D C4    1 
ATOM   247  N  N4    . C   A 1 12 ? 5.243   -41.940 18.608  1.00 24.39 ? 12  C   D N4    1 
ATOM   248  C  C5    . C   A 1 12 ? 7.552   -42.172 17.923  1.00 21.28 ? 12  C   D C5    1 
ATOM   249  C  C6    . C   A 1 12 ? 8.838   -42.080 18.301  1.00 23.41 ? 12  C   D C6    1 
ATOM   250  O  "O5'" . DG  B 2 1  ? -1.273  -39.659 25.864  1.00 36.45 ? 1   DG  E "O5'" 1 
ATOM   251  C  "C5'" . DG  B 2 1  ? -0.888  -39.738 27.257  1.00 30.72 ? 1   DG  E "C5'" 1 
ATOM   252  C  "C4'" . DG  B 2 1  ? 0.590   -39.912 27.528  1.00 28.53 ? 1   DG  E "C4'" 1 
ATOM   253  O  "O4'" . DG  B 2 1  ? 1.110   -41.143 26.969  1.00 27.23 ? 1   DG  E "O4'" 1 
ATOM   254  C  "C3'" . DG  B 2 1  ? 1.508   -38.829 26.989  1.00 29.24 ? 1   DG  E "C3'" 1 
ATOM   255  O  "O3'" . DG  B 2 1  ? 1.536   -37.730 27.898  1.00 31.87 ? 1   DG  E "O3'" 1 
ATOM   256  C  "C2'" . DG  B 2 1  ? 2.843   -39.553 26.981  1.00 29.27 ? 1   DG  E "C2'" 1 
ATOM   257  C  "C1'" . DG  B 2 1  ? 2.437   -40.936 26.488  1.00 24.66 ? 1   DG  E "C1'" 1 
ATOM   258  N  N9    . DG  B 2 1  ? 2.386   -41.037 25.033  1.00 22.32 ? 1   DG  E N9    1 
ATOM   259  C  C8    . DG  B 2 1  ? 1.249   -41.059 24.266  1.00 19.76 ? 1   DG  E C8    1 
ATOM   260  N  N7    . DG  B 2 1  ? 1.497   -41.139 22.986  1.00 23.27 ? 1   DG  E N7    1 
ATOM   261  C  C5    . DG  B 2 1  ? 2.878   -41.188 22.900  1.00 18.92 ? 1   DG  E C5    1 
ATOM   262  C  C6    . DG  B 2 1  ? 3.724   -41.287 21.757  1.00 18.37 ? 1   DG  E C6    1 
ATOM   263  O  O6    . DG  B 2 1  ? 3.395   -41.358 20.549  1.00 18.89 ? 1   DG  E O6    1 
ATOM   264  N  N1    . DG  B 2 1  ? 5.071   -41.296 22.119  1.00 15.70 ? 1   DG  E N1    1 
ATOM   265  C  C2    . DG  B 2 1  ? 5.535   -41.207 23.422  1.00 17.84 ? 1   DG  E C2    1 
ATOM   266  N  N2    . DG  B 2 1  ? 6.860   -41.194 23.583  1.00 14.52 ? 1   DG  E N2    1 
ATOM   267  N  N3    . DG  B 2 1  ? 4.749   -41.124 24.490  1.00 19.21 ? 1   DG  E N3    1 
ATOM   268  C  C4    . DG  B 2 1  ? 3.446   -41.119 24.158  1.00 19.39 ? 1   DG  E C4    1 
ATOM   269  P  P     . DA  B 2 2  ? 1.818   -36.246 27.355  1.00 32.96 ? 2   DA  E P     1 
ATOM   270  O  OP1   . DA  B 2 2  ? 1.825   -35.367 28.547  1.00 33.85 ? 2   DA  E OP1   1 
ATOM   271  O  OP2   . DA  B 2 2  ? 0.898   -35.955 26.229  1.00 34.30 ? 2   DA  E OP2   1 
ATOM   272  O  "O5'" . DA  B 2 2  ? 3.309   -36.307 26.792  1.00 31.99 ? 2   DA  E "O5'" 1 
ATOM   273  C  "C5'" . DA  B 2 2  ? 4.395   -36.491 27.698  1.00 31.79 ? 2   DA  E "C5'" 1 
ATOM   274  C  "C4'" . DA  B 2 2  ? 5.702   -36.548 26.949  1.00 28.35 ? 2   DA  E "C4'" 1 
ATOM   275  O  "O4'" . DA  B 2 2  ? 5.727   -37.704 26.087  1.00 29.81 ? 2   DA  E "O4'" 1 
ATOM   276  C  "C3'" . DA  B 2 2  ? 5.921   -35.382 26.007  1.00 28.78 ? 2   DA  E "C3'" 1 
ATOM   277  O  "O3'" . DA  B 2 2  ? 6.424   -34.251 26.719  1.00 32.17 ? 2   DA  E "O3'" 1 
ATOM   278  C  "C2'" . DA  B 2 2  ? 6.957   -35.944 25.061  1.00 29.09 ? 2   DA  E "C2'" 1 
ATOM   279  C  "C1'" . DA  B 2 2  ? 6.510   -37.402 24.927  1.00 27.24 ? 2   DA  E "C1'" 1 
ATOM   280  N  N9    . DA  B 2 2  ? 5.668   -37.633 23.760  1.00 25.14 ? 2   DA  E N9    1 
ATOM   281  C  C8    . DA  B 2 2  ? 4.303   -37.719 23.737  1.00 22.82 ? 2   DA  E C8    1 
ATOM   282  N  N7    . DA  B 2 2  ? 3.808   -37.958 22.555  1.00 21.61 ? 2   DA  E N7    1 
ATOM   283  C  C5    . DA  B 2 2  ? 4.928   -38.031 21.736  1.00 23.02 ? 2   DA  E C5    1 
ATOM   284  C  C6    . DA  B 2 2  ? 5.077   -38.290 20.374  1.00 23.02 ? 2   DA  E C6    1 
ATOM   285  N  N6    . DA  B 2 2  ? 4.053   -38.564 19.564  1.00 24.10 ? 2   DA  E N6    1 
ATOM   286  N  N1    . DA  B 2 2  ? 6.322   -38.285 19.866  1.00 22.73 ? 2   DA  E N1    1 
ATOM   287  C  C2    . DA  B 2 2  ? 7.345   -38.061 20.691  1.00 22.73 ? 2   DA  E C2    1 
ATOM   288  N  N3    . DA  B 2 2  ? 7.334   -37.831 21.995  1.00 24.34 ? 2   DA  E N3    1 
ATOM   289  C  C4    . DA  B 2 2  ? 6.078   -37.823 22.463  1.00 23.41 ? 2   DA  E C4    1 
ATOM   290  P  P     . DA  B 2 3  ? 6.179   -32.782 26.133  1.00 32.94 ? 3   DA  E P     1 
ATOM   291  O  OP1   . DA  B 2 3  ? 6.522   -31.843 27.218  1.00 34.92 ? 3   DA  E OP1   1 
ATOM   292  O  OP2   . DA  B 2 3  ? 4.811   -32.785 25.566  1.00 32.58 ? 3   DA  E OP2   1 
ATOM   293  O  "O5'" . DA  B 2 3  ? 7.267   -32.672 24.974  1.00 29.85 ? 3   DA  E "O5'" 1 
ATOM   294  C  "C5'" . DA  B 2 3  ? 8.632   -32.955 25.262  1.00 27.62 ? 3   DA  E "C5'" 1 
ATOM   295  C  "C4'" . DA  B 2 3  ? 9.432   -33.102 23.991  1.00 26.50 ? 3   DA  E "C4'" 1 
ATOM   296  O  "O4'" . DA  B 2 3  ? 9.133   -34.339 23.310  1.00 28.65 ? 3   DA  E "O4'" 1 
ATOM   297  C  "C3'" . DA  B 2 3  ? 9.230   -32.014 22.950  1.00 26.65 ? 3   DA  E "C3'" 1 
ATOM   298  O  "O3'" . DA  B 2 3  ? 10.069  -30.896 23.274  1.00 26.44 ? 3   DA  E "O3'" 1 
ATOM   299  C  "C2'" . DA  B 2 3  ? 9.717   -32.719 21.695  1.00 28.21 ? 3   DA  E "C2'" 1 
ATOM   300  C  "C1'" . DA  B 2 3  ? 9.183   -34.141 21.900  1.00 25.52 ? 3   DA  E "C1'" 1 
ATOM   301  N  N9    . DA  B 2 3  ? 7.830   -34.353 21.374  1.00 23.73 ? 3   DA  E N9    1 
ATOM   302  C  C8    . DA  B 2 3  ? 6.635   -34.277 22.063  1.00 22.50 ? 3   DA  E C8    1 
ATOM   303  N  N7    . DA  B 2 3  ? 5.580   -34.559 21.328  1.00 21.28 ? 3   DA  E N7    1 
ATOM   304  C  C5    . DA  B 2 3  ? 6.117   -34.842 20.070  1.00 20.41 ? 3   DA  E C5    1 
ATOM   305  C  C6    . DA  B 2 3  ? 5.523   -35.229 18.848  1.00 17.72 ? 3   DA  E C6    1 
ATOM   306  N  N6    . DA  B 2 3  ? 4.214   -35.475 18.703  1.00 18.61 ? 3   DA  E N6    1 
ATOM   307  N  N1    . DA  B 2 3  ? 6.327   -35.375 17.778  1.00 17.75 ? 3   DA  E N1    1 
ATOM   308  C  C2    . DA  B 2 3  ? 7.641   -35.185 17.932  1.00 19.45 ? 3   DA  E C2    1 
ATOM   309  N  N3    . DA  B 2 3  ? 8.324   -34.855 19.032  1.00 21.84 ? 3   DA  E N3    1 
ATOM   310  C  C4    . DA  B 2 3  ? 7.493   -34.692 20.078  1.00 21.72 ? 3   DA  E C4    1 
ATOM   311  P  P     . DT  B 2 4  ? 9.678   -29.416 22.788  1.00 25.68 ? 4   DT  E P     1 
ATOM   312  O  OP1   . DT  B 2 4  ? 10.699  -28.552 23.416  1.00 25.69 ? 4   DT  E OP1   1 
ATOM   313  O  OP2   . DT  B 2 4  ? 8.244   -29.178 23.056  1.00 26.39 ? 4   DT  E OP2   1 
ATOM   314  O  "O5'" . DT  B 2 4  ? 9.905   -29.424 21.206  1.00 20.10 ? 4   DT  E "O5'" 1 
ATOM   315  C  "C5'" . DT  B 2 4  ? 11.207  -29.548 20.646  1.00 20.28 ? 4   DT  E "C5'" 1 
ATOM   316  C  "C4'" . DT  B 2 4  ? 11.117  -29.736 19.144  1.00 21.54 ? 4   DT  E "C4'" 1 
ATOM   317  O  "O4'" . DT  B 2 4  ? 10.528  -31.014 18.795  1.00 23.84 ? 4   DT  E "O4'" 1 
ATOM   318  C  "C3'" . DT  B 2 4  ? 10.219  -28.735 18.440  1.00 22.93 ? 4   DT  E "C3'" 1 
ATOM   319  O  "O3'" . DT  B 2 4  ? 10.892  -27.493 18.257  1.00 25.57 ? 4   DT  E "O3'" 1 
ATOM   320  C  "C2'" . DT  B 2 4  ? 9.971   -29.438 17.118  1.00 23.21 ? 4   DT  E "C2'" 1 
ATOM   321  C  "C1'" . DT  B 2 4  ? 9.794   -30.887 17.569  1.00 20.75 ? 4   DT  E "C1'" 1 
ATOM   322  N  N1    . DT  B 2 4  ? 8.372   -31.222 17.827  1.00 19.94 ? 4   DT  E N1    1 
ATOM   323  C  C2    . DT  B 2 4  ? 7.616   -31.715 16.774  1.00 15.91 ? 4   DT  E C2    1 
ATOM   324  O  O2    . DT  B 2 4  ? 8.052   -31.876 15.644  1.00 22.68 ? 4   DT  E O2    1 
ATOM   325  N  N3    . DT  B 2 4  ? 6.322   -31.992 17.078  1.00 14.39 ? 4   DT  E N3    1 
ATOM   326  C  C4    . DT  B 2 4  ? 5.690   -31.815 18.284  1.00 17.11 ? 4   DT  E C4    1 
ATOM   327  O  O4    . DT  B 2 4  ? 4.508   -32.125 18.397  1.00 18.48 ? 4   DT  E O4    1 
ATOM   328  C  C5    . DT  B 2 4  ? 6.511   -31.265 19.339  1.00 17.80 ? 4   DT  E C5    1 
ATOM   329  C  C7    . DT  B 2 4  ? 5.875   -30.960 20.667  1.00 22.87 ? 4   DT  E C7    1 
ATOM   330  C  C6    . DT  B 2 4  ? 7.805   -31.024 19.074  1.00 18.23 ? 4   DT  E C6    1 
ATOM   331  P  P     . DC  B 2 5  ? 10.039  -26.150 18.127  1.00 24.13 ? 5   DC  E P     1 
ATOM   332  O  OP1   . DC  B 2 5  ? 11.007  -25.047 18.162  1.00 27.06 ? 5   DC  E OP1   1 
ATOM   333  O  OP2   . DC  B 2 5  ? 8.957   -26.207 19.141  1.00 27.69 ? 5   DC  E OP2   1 
ATOM   334  O  "O5'" . DC  B 2 5  ? 9.359   -26.220 16.687  1.00 25.98 ? 5   DC  E "O5'" 1 
ATOM   335  C  "C5'" . DC  B 2 5  ? 10.142  -26.267 15.485  1.00 23.29 ? 5   DC  E "C5'" 1 
ATOM   336  C  "C4'" . DC  B 2 5  ? 9.291   -26.708 14.313  1.00 22.01 ? 5   DC  E "C4'" 1 
ATOM   337  O  "O4'" . DC  B 2 5  ? 8.773   -28.048 14.528  1.00 21.67 ? 5   DC  E "O4'" 1 
ATOM   338  C  "C3'" . DC  B 2 5  ? 8.051   -25.887 14.002  1.00 22.33 ? 5   DC  E "C3'" 1 
ATOM   339  O  "O3'" . DC  B 2 5  ? 8.357   -24.749 13.197  1.00 28.78 ? 5   DC  E "O3'" 1 
ATOM   340  C  "C2'" . DC  B 2 5  ? 7.260   -26.862 13.159  1.00 22.54 ? 5   DC  E "C2'" 1 
ATOM   341  C  "C1'" . DC  B 2 5  ? 7.503   -28.174 13.887  1.00 20.59 ? 5   DC  E "C1'" 1 
ATOM   342  N  N1    . DC  B 2 5  ? 6.491   -28.428 14.918  1.00 19.89 ? 5   DC  E N1    1 
ATOM   343  C  C2    . DC  B 2 5  ? 5.307   -29.091 14.550  1.00 20.09 ? 5   DC  E C2    1 
ATOM   344  O  O2    . DC  B 2 5  ? 5.140   -29.416 13.374  1.00 22.24 ? 5   DC  E O2    1 
ATOM   345  N  N3    . DC  B 2 5  ? 4.367   -29.341 15.489  1.00 20.83 ? 5   DC  E N3    1 
ATOM   346  C  C4    . DC  B 2 5  ? 4.548   -28.936 16.749  1.00 16.97 ? 5   DC  E C4    1 
ATOM   347  N  N4    . DC  B 2 5  ? 3.562   -29.171 17.616  1.00 17.94 ? 5   DC  E N4    1 
ATOM   348  C  C5    . DC  B 2 5  ? 5.733   -28.262 17.161  1.00 17.36 ? 5   DC  E C5    1 
ATOM   349  C  C6    . DC  B 2 5  ? 6.680   -28.029 16.214  1.00 19.65 ? 5   DC  E C6    1 
ATOM   350  P  P     . DA  B 2 6  ? 7.371   -23.482 13.196  1.00 28.92 ? 6   DA  E P     1 
ATOM   351  O  OP1   . DA  B 2 6  ? 8.083   -22.423 12.461  1.00 31.29 ? 6   DA  E OP1   1 
ATOM   352  O  OP2   . DA  B 2 6  ? 6.925   -23.239 14.580  1.00 32.35 ? 6   DA  E OP2   1 
ATOM   353  O  "O5'" . DA  B 2 6  ? 6.086   -23.921 12.370  1.00 30.28 ? 6   DA  E "O5'" 1 
ATOM   354  C  "C5'" . DA  B 2 6  ? 6.157   -24.173 10.969  1.00 28.52 ? 6   DA  E "C5'" 1 
ATOM   355  C  "C4'" . DA  B 2 6  ? 4.853   -24.759 10.464  1.00 28.53 ? 6   DA  E "C4'" 1 
ATOM   356  O  "O4'" . DA  B 2 6  ? 4.594   -26.056 11.054  1.00 27.31 ? 6   DA  E "O4'" 1 
ATOM   357  C  "C3'" . DA  B 2 6  ? 3.588   -23.968 10.772  1.00 30.27 ? 6   DA  E "C3'" 1 
ATOM   358  O  "O3'" . DA  B 2 6  ? 3.406   -22.889 9.857   1.00 32.68 ? 6   DA  E "O3'" 1 
ATOM   359  C  "C2'" . DA  B 2 6  ? 2.514   -25.019 10.579  1.00 28.73 ? 6   DA  E "C2'" 1 
ATOM   360  C  "C1'" . DA  B 2 6  ? 3.181   -26.240 11.206  1.00 24.68 ? 6   DA  E "C1'" 1 
ATOM   361  N  N9    . DA  B 2 6  ? 2.907   -26.343 12.634  1.00 22.32 ? 6   DA  E N9    1 
ATOM   362  C  C8    . DA  B 2 6  ? 3.734   -25.993 13.659  1.00 22.46 ? 6   DA  E C8    1 
ATOM   363  N  N7    . DA  B 2 6  ? 3.228   -26.224 14.847  1.00 24.50 ? 6   DA  E N7    1 
ATOM   364  C  C5    . DA  B 2 6  ? 1.980   -26.764 14.579  1.00 22.41 ? 6   DA  E C5    1 
ATOM   365  C  C6    . DA  B 2 6  ? 0.949   -27.237 15.418  1.00 22.68 ? 6   DA  E C6    1 
ATOM   366  N  N6    . DA  B 2 6  ? 1.022   -27.263 16.756  1.00 19.62 ? 6   DA  E N6    1 
ATOM   367  N  N1    . DA  B 2 6  ? -0.170  -27.691 14.829  1.00 20.94 ? 6   DA  E N1    1 
ATOM   368  C  C2    . DA  B 2 6  ? -0.239  -27.688 13.488  1.00 23.28 ? 6   DA  E C2    1 
ATOM   369  N  N3    . DA  B 2 6  ? 0.663   -27.286 12.600  1.00 23.74 ? 6   DA  E N3    1 
ATOM   370  C  C4    . DA  B 2 6  ? 1.762   -26.827 13.220  1.00 21.34 ? 6   DA  E C4    1 
ATOM   371  P  P     . DG  B 2 7  ? 2.868   -21.483 10.405  1.00 33.09 ? 7   DG  E P     1 
ATOM   372  O  OP1   . DG  B 2 7  ? 3.273   -20.512 9.359   1.00 33.69 ? 7   DG  E OP1   1 
ATOM   373  O  OP2   . DG  B 2 7  ? 3.324   -21.299 11.812  1.00 32.16 ? 7   DG  E OP2   1 
ATOM   374  O  "O5'" . DG  B 2 7  ? 1.289   -21.646 10.480  1.00 26.49 ? 7   DG  E "O5'" 1 
ATOM   375  C  "C5'" . DG  B 2 7  ? 0.512   -21.783 9.308   1.00 26.68 ? 7   DG  E "C5'" 1 
ATOM   376  C  "C4'" . DG  B 2 7  ? -0.863  -22.284 9.664   1.00 26.24 ? 7   DG  E "C4'" 1 
ATOM   377  O  "O4'" . DG  B 2 7  ? -0.743  -23.584 10.292  1.00 27.28 ? 7   DG  E "O4'" 1 
ATOM   378  C  "C3'" . DG  B 2 7  ? -1.607  -21.465 10.708  1.00 26.76 ? 7   DG  E "C3'" 1 
ATOM   379  O  "O3'" . DG  B 2 7  ? -2.183  -20.254 10.180  1.00 26.26 ? 7   DG  E "O3'" 1 
ATOM   380  C  "C2'" . DG  B 2 7  ? -2.655  -22.463 11.135  1.00 24.50 ? 7   DG  E "C2'" 1 
ATOM   381  C  "C1'" . DG  B 2 7  ? -1.822  -23.744 11.218  1.00 25.13 ? 7   DG  E "C1'" 1 
ATOM   382  N  N9    . DG  B 2 7  ? -1.267  -23.955 12.558  1.00 24.95 ? 7   DG  E N9    1 
ATOM   383  C  C8    . DG  B 2 7  ? -0.012  -23.632 13.022  1.00 23.14 ? 7   DG  E C8    1 
ATOM   384  N  N7    . DG  B 2 7  ? 0.141   -23.887 14.299  1.00 24.33 ? 7   DG  E N7    1 
ATOM   385  C  C5    . DG  B 2 7  ? -1.074  -24.424 14.688  1.00 22.83 ? 7   DG  E C5    1 
ATOM   386  C  C6    . DG  B 2 7  ? -1.497  -24.897 15.942  1.00 21.58 ? 7   DG  E C6    1 
ATOM   387  O  O6    . DG  B 2 7  ? -0.860  -24.948 16.974  1.00 26.74 ? 7   DG  E O6    1 
ATOM   388  N  N1    . DG  B 2 7  ? -2.814  -25.352 15.912  1.00 20.59 ? 7   DG  E N1    1 
ATOM   389  C  C2    . DG  B 2 7  ? -3.621  -25.360 14.782  1.00 22.37 ? 7   DG  E C2    1 
ATOM   390  N  N2    . DG  B 2 7  ? -4.881  -25.800 14.925  1.00 19.79 ? 7   DG  E N2    1 
ATOM   391  N  N3    . DG  B 2 7  ? -3.219  -24.944 13.596  1.00 21.07 ? 7   DG  E N3    1 
ATOM   392  C  C4    . DG  B 2 7  ? -1.949  -24.484 13.624  1.00 22.01 ? 7   DG  E C4    1 
ATOM   393  P  P     . DG  B 2 8  ? -2.439  -19.006 11.168  1.00 29.17 ? 8   DG  E P     1 
ATOM   394  O  OP1   . DG  B 2 8  ? -2.966  -17.894 10.340  1.00 30.00 ? 8   DG  E OP1   1 
ATOM   395  O  OP2   . DG  B 2 8  ? -1.242  -18.783 12.032  1.00 27.10 ? 8   DG  E OP2   1 
ATOM   396  O  "O5'" . DG  B 2 8  ? -3.624  -19.477 12.128  1.00 28.62 ? 8   DG  E "O5'" 1 
ATOM   397  C  "C5'" . DG  B 2 8  ? -4.945  -19.646 11.629  1.00 26.87 ? 8   DG  E "C5'" 1 
ATOM   398  C  "C4'" . DG  B 2 8  ? -5.837  -20.228 12.700  1.00 23.68 ? 8   DG  E "C4'" 1 
ATOM   399  O  "O4'" . DG  B 2 8  ? -5.175  -21.399 13.222  1.00 25.82 ? 8   DG  E "O4'" 1 
ATOM   400  C  "C3'" . DG  B 2 8  ? -6.054  -19.337 13.912  1.00 24.41 ? 8   DG  E "C3'" 1 
ATOM   401  O  "O3'" . DG  B 2 8  ? -7.170  -18.462 13.681  1.00 21.96 ? 8   DG  E "O3'" 1 
ATOM   402  C  "C2'" . DG  B 2 8  ? -6.367  -20.354 14.992  1.00 23.24 ? 8   DG  E "C2'" 1 
ATOM   403  C  "C1'" . DG  B 2 8  ? -5.542  -21.586 14.579  1.00 23.30 ? 8   DG  E "C1'" 1 
ATOM   404  N  N9    . DG  B 2 8  ? -4.324  -21.743 15.363  1.00 21.16 ? 8   DG  E N9    1 
ATOM   405  C  C8    . DG  B 2 8  ? -3.035  -21.473 14.989  1.00 20.23 ? 8   DG  E C8    1 
ATOM   406  N  N7    . DG  B 2 8  ? -2.172  -21.660 15.954  1.00 20.59 ? 8   DG  E N7    1 
ATOM   407  C  C5    . DG  B 2 8  ? -2.941  -22.091 17.025  1.00 18.56 ? 8   DG  E C5    1 
ATOM   408  C  C6    . DG  B 2 8  ? -2.567  -22.466 18.348  1.00 20.61 ? 8   DG  E C6    1 
ATOM   409  O  O6    . DG  B 2 8  ? -1.444  -22.465 18.865  1.00 19.99 ? 8   DG  E O6    1 
ATOM   410  N  N1    . DG  B 2 8  ? -3.671  -22.874 19.093  1.00 18.05 ? 8   DG  E N1    1 
ATOM   411  C  C2    . DG  B 2 8  ? -4.962  -22.883 18.641  1.00 19.46 ? 8   DG  E C2    1 
ATOM   412  N  N2    . DG  B 2 8  ? -5.899  -23.270 19.508  1.00 17.20 ? 8   DG  E N2    1 
ATOM   413  N  N3    . DG  B 2 8  ? -5.318  -22.531 17.426  1.00 20.25 ? 8   DG  E N3    1 
ATOM   414  C  C4    . DG  B 2 8  ? -4.266  -22.159 16.674  1.00 21.30 ? 8   DG  E C4    1 
HETATM 415  N  N1    . 5IU B 2 9  ? -6.741  -19.459 19.453  1.00 24.12 ? 9   5IU E N1    1 
HETATM 416  C  C2    . 5IU B 2 9  ? -6.162  -19.896 20.617  1.00 24.62 ? 9   5IU E C2    1 
HETATM 417  N  N3    . 5IU B 2 9  ? -4.791  -19.880 20.627  1.00 23.21 ? 9   5IU E N3    1 
HETATM 418  C  C4    . 5IU B 2 9  ? -3.972  -19.433 19.610  1.00 20.81 ? 9   5IU E C4    1 
HETATM 419  C  C5    . 5IU B 2 9  ? -4.644  -18.976 18.481  1.00 22.34 ? 9   5IU E C5    1 
HETATM 420  C  C6    . 5IU B 2 9  ? -5.977  -19.008 18.428  1.00 23.07 ? 9   5IU E C6    1 
HETATM 421  O  O2    . 5IU B 2 9  ? -6.804  -20.244 21.559  1.00 24.60 ? 9   5IU E O2    1 
HETATM 422  O  O4    . 5IU B 2 9  ? -2.766  -19.458 19.736  1.00 21.01 ? 9   5IU E O4    1 
HETATM 423  I  I5    . 5IU B 2 9  ? -3.440  -18.163 16.756  0.40 25.92 ? 9   5IU E I5    1 
HETATM 424  C  "C1'" . 5IU B 2 9  ? -8.208  -19.494 19.365  1.00 25.28 ? 9   5IU E "C1'" 1 
HETATM 425  C  "C2'" . 5IU B 2 9  ? -8.856  -18.209 19.874  1.00 25.95 ? 9   5IU E "C2'" 1 
HETATM 426  C  "C3'" . 5IU B 2 9  ? -8.925  -17.385 18.607  1.00 25.65 ? 9   5IU E "C3'" 1 
HETATM 427  C  "C4'" . 5IU B 2 9  ? -9.297  -18.437 17.581  1.00 26.26 ? 9   5IU E "C4'" 1 
HETATM 428  O  "O3'" . 5IU B 2 9  ? -9.957  -16.418 18.686  1.00 30.53 ? 9   5IU E "O3'" 1 
HETATM 429  O  "O4'" . 5IU B 2 9  ? -8.570  -19.618 17.985  1.00 26.38 ? 9   5IU E "O4'" 1 
HETATM 430  C  "C5'" . 5IU B 2 9  ? -9.065  -18.076 16.131  1.00 24.69 ? 9   5IU E "C5'" 1 
HETATM 431  O  "O5'" . 5IU B 2 9  ? -7.778  -17.484 15.947  1.00 24.30 ? 9   5IU E "O5'" 1 
HETATM 432  P  P     . 5IU B 2 9  ? -7.291  -17.064 14.482  1.00 23.94 ? 9   5IU E P     1 
HETATM 433  O  OP1   . 5IU B 2 9  ? -8.396  -16.339 13.797  1.00 23.62 ? 9   5IU E OP1   1 
HETATM 434  O  OP2   . 5IU B 2 9  ? -5.982  -16.412 14.618  1.00 24.71 ? 9   5IU E OP2   1 
ATOM   435  P  P     . DG  B 2 10 ? -9.627  -14.933 19.192  1.00 33.63 ? 10  DG  E P     1 
ATOM   436  O  OP1   . DG  B 2 10 ? -10.925 -14.235 19.199  1.00 33.53 ? 10  DG  E OP1   1 
ATOM   437  O  OP2   . DG  B 2 10 ? -8.498  -14.370 18.415  1.00 33.80 ? 10  DG  E OP2   1 
ATOM   438  O  "O5'" . DG  B 2 10 ? -9.138  -15.131 20.700  1.00 32.10 ? 10  DG  E "O5'" 1 
ATOM   439  C  "C5'" . DG  B 2 10 ? -10.061 -15.410 21.740  1.00 29.19 ? 10  DG  E "C5'" 1 
ATOM   440  C  "C4'" . DG  B 2 10 ? -9.337  -15.702 23.039  1.00 28.24 ? 10  DG  E "C4'" 1 
ATOM   441  O  "O4'" . DG  B 2 10 ? -8.549  -16.910 22.967  1.00 27.23 ? 10  DG  E "O4'" 1 
ATOM   442  C  "C3'" . DG  B 2 10 ? -8.360  -14.659 23.556  1.00 26.71 ? 10  DG  E "C3'" 1 
ATOM   443  O  "O3'" . DG  B 2 10 ? -9.080  -13.565 24.143  1.00 28.04 ? 10  DG  E "O3'" 1 
ATOM   444  C  "C2'" . DG  B 2 10 ? -7.608  -15.464 24.604  1.00 28.01 ? 10  DG  E "C2'" 1 
ATOM   445  C  "C1'" . DG  B 2 10 ? -7.480  -16.830 23.922  1.00 27.53 ? 10  DG  E "C1'" 1 
ATOM   446  N  N9    . DG  B 2 10 ? -6.221  -16.926 23.195  1.00 27.40 ? 10  DG  E N9    1 
ATOM   447  C  C8    . DG  B 2 10 ? -6.017  -16.693 21.855  1.00 24.76 ? 10  DG  E C8    1 
ATOM   448  N  N7    . DG  B 2 10 ? -4.766  -16.782 21.507  1.00 24.21 ? 10  DG  E N7    1 
ATOM   449  C  C5    . DG  B 2 10 ? -4.108  -17.104 22.681  1.00 25.28 ? 10  DG  E C5    1 
ATOM   450  C  C6    . DG  B 2 10 ? -2.724  -17.295 22.931  1.00 25.88 ? 10  DG  E C6    1 
ATOM   451  O  O6    . DG  B 2 10 ? -1.776  -17.220 22.133  1.00 25.46 ? 10  DG  E O6    1 
ATOM   452  N  N1    . DG  B 2 10 ? -2.489  -17.588 24.269  1.00 25.81 ? 10  DG  E N1    1 
ATOM   453  C  C2    . DG  B 2 10 ? -3.462  -17.672 25.239  1.00 26.30 ? 10  DG  E C2    1 
ATOM   454  N  N2    . DG  B 2 10 ? -3.048  -17.956 26.472  1.00 32.13 ? 10  DG  E N2    1 
ATOM   455  N  N3    . DG  B 2 10 ? -4.747  -17.489 25.018  1.00 27.08 ? 10  DG  E N3    1 
ATOM   456  C  C4    . DG  B 2 10 ? -4.997  -17.213 23.727  1.00 26.04 ? 10  DG  E C4    1 
ATOM   457  P  P     . DT  B 2 11 ? -8.381  -12.121 24.298  1.00 28.34 ? 11  DT  E P     1 
ATOM   458  O  OP1   . DT  B 2 11 ? -9.439  -11.228 24.833  1.00 25.92 ? 11  DT  E OP1   1 
ATOM   459  O  OP2   . DT  B 2 11 ? -7.673  -11.739 23.056  1.00 28.31 ? 11  DT  E OP2   1 
ATOM   460  O  "O5'" . DT  B 2 11 ? -7.255  -12.347 25.406  1.00 26.88 ? 11  DT  E "O5'" 1 
ATOM   461  C  "C5'" . DT  B 2 11 ? -7.594  -12.782 26.721  1.00 28.02 ? 11  DT  E "C5'" 1 
ATOM   462  C  "C4'" . DT  B 2 11 ? -6.351  -13.164 27.498  1.00 26.68 ? 11  DT  E "C4'" 1 
ATOM   463  O  "O4'" . DT  B 2 11 ? -5.705  -14.323 26.935  1.00 24.78 ? 11  DT  E "O4'" 1 
ATOM   464  C  "C3'" . DT  B 2 11 ? -5.241  -12.126 27.567  1.00 29.28 ? 11  DT  E "C3'" 1 
ATOM   465  O  "O3'" . DT  B 2 11 ? -5.515  -11.138 28.571  1.00 34.99 ? 11  DT  E "O3'" 1 
ATOM   466  C  "C2'" . DT  B 2 11 ? -4.064  -12.990 27.982  1.00 28.76 ? 11  DT  E "C2'" 1 
ATOM   467  C  "C1'" . DT  B 2 11 ? -4.286  -14.228 27.122  1.00 28.01 ? 11  DT  E "C1'" 1 
ATOM   468  N  N1    . DT  B 2 11 ? -3.628  -14.147 25.781  1.00 25.17 ? 11  DT  E N1    1 
ATOM   469  C  C2    . DT  B 2 11 ? -2.287  -14.459 25.698  1.00 24.50 ? 11  DT  E C2    1 
ATOM   470  O  O2    . DT  B 2 11 ? -1.623  -14.752 26.666  1.00 22.65 ? 11  DT  E O2    1 
ATOM   471  N  N3    . DT  B 2 11 ? -1.751  -14.393 24.428  1.00 24.06 ? 11  DT  E N3    1 
ATOM   472  C  C4    . DT  B 2 11 ? -2.410  -14.021 23.263  1.00 25.44 ? 11  DT  E C4    1 
ATOM   473  O  O4    . DT  B 2 11 ? -1.809  -14.015 22.188  1.00 24.71 ? 11  DT  E O4    1 
ATOM   474  C  C5    . DT  B 2 11 ? -3.808  -13.662 23.433  1.00 24.59 ? 11  DT  E C5    1 
ATOM   475  C  C7    . DT  B 2 11 ? -4.587  -13.174 22.247  1.00 25.80 ? 11  DT  E C7    1 
ATOM   476  C  C6    . DT  B 2 11 ? -4.340  -13.765 24.662  1.00 25.78 ? 11  DT  E C6    1 
ATOM   477  P  P     . DC  B 2 12 ? -4.667  -9.775  28.593  1.00 37.10 ? 12  DC  E P     1 
ATOM   478  O  OP1   . DC  B 2 12 ? -5.097  -9.035  29.795  1.00 38.33 ? 12  DC  E OP1   1 
ATOM   479  O  OP2   . DC  B 2 12 ? -4.760  -9.125  27.259  1.00 36.06 ? 12  DC  E OP2   1 
ATOM   480  O  "O5'" . DC  B 2 12 ? -3.162  -10.263 28.795  1.00 35.08 ? 12  DC  E "O5'" 1 
ATOM   481  C  "C5'" . DC  B 2 12 ? -2.680  -10.695 30.070  1.00 31.69 ? 12  DC  E "C5'" 1 
ATOM   482  C  "C4'" . DC  B 2 12 ? -1.176  -10.865 30.030  1.00 29.32 ? 12  DC  E "C4'" 1 
ATOM   483  O  "O4'" . DC  B 2 12 ? -0.796  -11.919 29.132  1.00 27.78 ? 12  DC  E "O4'" 1 
ATOM   484  C  "C3'" . DC  B 2 12 ? -0.390  -9.672  29.517  1.00 29.11 ? 12  DC  E "C3'" 1 
ATOM   485  O  "O3'" . DC  B 2 12 ? -0.342  -8.614  30.454  1.00 32.60 ? 12  DC  E "O3'" 1 
ATOM   486  C  "C2'" . DC  B 2 12 ? 0.937   -10.317 29.168  1.00 29.37 ? 12  DC  E "C2'" 1 
ATOM   487  C  "C1'" . DC  B 2 12 ? 0.469   -11.614 28.520  1.00 26.90 ? 12  DC  E "C1'" 1 
ATOM   488  N  N1    . DC  B 2 12 ? 0.240   -11.502 27.065  1.00 24.57 ? 12  DC  E N1    1 
ATOM   489  C  C2    . DC  B 2 12 ? 1.286   -11.729 26.178  1.00 24.34 ? 12  DC  E C2    1 
ATOM   490  O  O2    . DC  B 2 12 ? 2.416   -11.986 26.624  1.00 25.21 ? 12  DC  E O2    1 
ATOM   491  N  N3    . DC  B 2 12 ? 1.049   -11.654 24.840  1.00 23.06 ? 12  DC  E N3    1 
ATOM   492  C  C4    . DC  B 2 12 ? -0.169  -11.343 24.391  1.00 20.75 ? 12  DC  E C4    1 
ATOM   493  N  N4    . DC  B 2 12 ? -0.360  -11.265 23.053  1.00 21.13 ? 12  DC  E N4    1 
ATOM   494  C  C5    . DC  B 2 12 ? -1.243  -11.092 25.275  1.00 23.54 ? 12  DC  E C5    1 
ATOM   495  C  C6    . DC  B 2 12 ? -1.000  -11.182 26.593  1.00 24.11 ? 12  DC  E C6    1 
ATOM   496  O  "O5'" . G   C 1 1  ? 7.676   18.072  18.497  1.00 31.03 ? 1   G   I "O5'" 1 
ATOM   497  C  "C5'" . G   C 1 1  ? 9.000   18.274  18.974  1.00 26.78 ? 1   G   I "C5'" 1 
ATOM   498  C  "C4'" . G   C 1 1  ? 8.988   18.541  20.452  1.00 23.68 ? 1   G   I "C4'" 1 
ATOM   499  O  "O4'" . G   C 1 1  ? 8.162   19.693  20.710  1.00 22.43 ? 1   G   I "O4'" 1 
ATOM   500  C  "C3'" . G   C 1 1  ? 8.363   17.462  21.309  1.00 25.91 ? 1   G   I "C3'" 1 
ATOM   501  O  "O3'" . G   C 1 1  ? 9.302   16.438  21.583  1.00 27.87 ? 1   G   I "O3'" 1 
ATOM   502  C  "C2'" . G   C 1 1  ? 8.001   18.232  22.567  1.00 24.45 ? 1   G   I "C2'" 1 
ATOM   503  O  "O2'" . G   C 1 1  ? 9.146   18.462  23.362  1.00 27.59 ? 1   G   I "O2'" 1 
ATOM   504  C  "C1'" . G   C 1 1  ? 7.518   19.555  21.974  1.00 21.63 ? 1   G   I "C1'" 1 
ATOM   505  N  N9    . G   C 1 1  ? 6.068   19.614  21.782  1.00 18.98 ? 1   G   I N9    1 
ATOM   506  C  C8    . G   C 1 1  ? 5.370   19.648  20.588  1.00 15.34 ? 1   G   I C8    1 
ATOM   507  N  N7    . G   C 1 1  ? 4.075   19.679  20.752  1.00 16.18 ? 1   G   I N7    1 
ATOM   508  C  C5    . G   C 1 1  ? 3.906   19.675  22.138  1.00 15.79 ? 1   G   I C5    1 
ATOM   509  C  C6    . G   C 1 1  ? 2.734   19.702  22.920  1.00 13.57 ? 1   G   I C6    1 
ATOM   510  O  O6    . G   C 1 1  ? 1.570   19.725  22.550  1.00 14.97 ? 1   G   I O6    1 
ATOM   511  N  N1    . G   C 1 1  ? 3.020   19.703  24.286  1.00 14.27 ? 1   G   I N1    1 
ATOM   512  C  C2    . G   C 1 1  ? 4.266   19.678  24.820  1.00 16.96 ? 1   G   I C2    1 
ATOM   513  N  N2    . G   C 1 1  ? 4.333   19.705  26.168  1.00 18.06 ? 1   G   I N2    1 
ATOM   514  N  N3    . G   C 1 1  ? 5.378   19.635  24.100  1.00 17.97 ? 1   G   I N3    1 
ATOM   515  C  C4    . G   C 1 1  ? 5.125   19.642  22.781  1.00 15.92 ? 1   G   I C4    1 
ATOM   516  P  P     . A   C 1 2  ? 8.778   14.970  21.924  1.00 29.19 ? 2   A   I P     1 
ATOM   517  O  OP1   . A   C 1 2  ? 9.924   14.013  21.908  1.00 28.01 ? 2   A   I OP1   1 
ATOM   518  O  OP2   . A   C 1 2  ? 7.648   14.774  21.010  1.00 28.43 ? 2   A   I OP2   1 
ATOM   519  O  "O5'" . A   C 1 2  ? 8.221   15.090  23.416  1.00 26.30 ? 2   A   I "O5'" 1 
ATOM   520  C  "C5'" . A   C 1 2  ? 9.099   15.382  24.503  1.00 27.89 ? 2   A   I "C5'" 1 
ATOM   521  C  "C4'" . A   C 1 2  ? 8.354   15.302  25.828  1.00 29.04 ? 2   A   I "C4'" 1 
ATOM   522  O  "O4'" . A   C 1 2  ? 7.453   16.433  26.001  1.00 28.94 ? 2   A   I "O4'" 1 
ATOM   523  C  "C3'" . A   C 1 2  ? 7.469   14.091  25.996  1.00 27.79 ? 2   A   I "C3'" 1 
ATOM   524  O  "O3'" . A   C 1 2  ? 8.243   12.988  26.416  1.00 30.04 ? 2   A   I "O3'" 1 
ATOM   525  C  "C2'" . A   C 1 2  ? 6.484   14.572  27.045  1.00 29.54 ? 2   A   I "C2'" 1 
ATOM   526  O  "O2'" . A   C 1 2  ? 7.071   14.637  28.328  1.00 28.42 ? 2   A   I "O2'" 1 
ATOM   527  C  "C1'" . A   C 1 2  ? 6.230   15.990  26.558  1.00 27.78 ? 2   A   I "C1'" 1 
ATOM   528  N  N9    . A   C 1 2  ? 5.207   16.107  25.516  1.00 26.28 ? 2   A   I N9    1 
ATOM   529  C  C8    . A   C 1 2  ? 5.398   16.125  24.155  1.00 25.01 ? 2   A   I C8    1 
ATOM   530  N  N7    . A   C 1 2  ? 4.296   16.310  23.469  1.00 24.20 ? 2   A   I N7    1 
ATOM   531  C  C5    . A   C 1 2  ? 3.308   16.399  24.444  1.00 22.51 ? 2   A   I C5    1 
ATOM   532  C  C6    . A   C 1 2  ? 1.922   16.585  24.373  1.00 21.49 ? 2   A   I C6    1 
ATOM   533  N  N6    . A   C 1 2  ? 1.251   16.701  23.231  1.00 18.61 ? 2   A   I N6    1 
ATOM   534  N  N1    . A   C 1 2  ? 1.232   16.644  25.536  1.00 23.05 ? 2   A   I N1    1 
ATOM   535  C  C2    . A   C 1 2  ? 1.895   16.510  26.678  1.00 19.94 ? 2   A   I C2    1 
ATOM   536  N  N3    . A   C 1 2  ? 3.191   16.316  26.876  1.00 23.98 ? 2   A   I N3    1 
ATOM   537  C  C4    . A   C 1 2  ? 3.853   16.268  25.705  1.00 24.86 ? 2   A   I C4    1 
ATOM   538  P  P     . C   C 1 3  ? 7.794   11.509  25.998  1.00 31.49 ? 3   C   I P     1 
ATOM   539  O  OP1   . C   C 1 3  ? 8.828   10.607  26.529  1.00 32.49 ? 3   C   I OP1   1 
ATOM   540  O  OP2   . C   C 1 3  ? 7.442   11.449  24.556  1.00 33.47 ? 3   C   I OP2   1 
ATOM   541  O  "O5'" . C   C 1 3  ? 6.461   11.306  26.828  1.00 34.33 ? 3   C   I "O5'" 1 
ATOM   542  C  "C5'" . C   C 1 3  ? 6.501   11.313  28.246  1.00 34.94 ? 3   C   I "C5'" 1 
ATOM   543  C  "C4'" . C   C 1 3  ? 5.108   11.229  28.794  1.00 33.23 ? 3   C   I "C4'" 1 
ATOM   544  O  "O4'" . C   C 1 3  ? 4.406   12.459  28.487  1.00 31.73 ? 3   C   I "O4'" 1 
ATOM   545  C  "C3'" . C   C 1 3  ? 4.237   10.142  28.183  1.00 34.40 ? 3   C   I "C3'" 1 
ATOM   546  O  "O3'" . C   C 1 3  ? 4.487   8.881   28.803  1.00 34.35 ? 3   C   I "O3'" 1 
ATOM   547  C  "C2'" . C   C 1 3  ? 2.861   10.672  28.517  1.00 32.14 ? 3   C   I "C2'" 1 
ATOM   548  O  "O2'" . C   C 1 3  ? 2.618   10.474  29.883  1.00 34.29 ? 3   C   I "O2'" 1 
ATOM   549  C  "C1'" . C   C 1 3  ? 3.042   12.171  28.252  1.00 31.79 ? 3   C   I "C1'" 1 
ATOM   550  N  N1    . C   C 1 3  ? 2.728   12.555  26.862  1.00 32.29 ? 3   C   I N1    1 
ATOM   551  C  C2    . C   C 1 3  ? 1.420   12.891  26.532  1.00 29.70 ? 3   C   I C2    1 
ATOM   552  O  O2    . C   C 1 3  ? 0.564   12.893  27.420  1.00 30.18 ? 3   C   I O2    1 
ATOM   553  N  N3    . C   C 1 3  ? 1.117   13.205  25.250  1.00 33.11 ? 3   C   I N3    1 
ATOM   554  C  C4    . C   C 1 3  ? 2.071   13.192  24.316  1.00 31.81 ? 3   C   I C4    1 
ATOM   555  N  N4    . C   C 1 3  ? 1.727   13.501  23.063  1.00 30.66 ? 3   C   I N4    1 
ATOM   556  C  C5    . C   C 1 3  ? 3.418   12.866  24.625  1.00 32.20 ? 3   C   I C5    1 
ATOM   557  C  C6    . C   C 1 3  ? 3.703   12.563  25.900  1.00 32.60 ? 3   C   I C6    1 
ATOM   558  P  P     . A   C 1 4  ? 4.066   7.521   28.061  1.00 38.49 ? 4   A   I P     1 
ATOM   559  O  OP1   . A   C 1 4  ? 4.610   6.378   28.843  1.00 38.19 ? 4   A   I OP1   1 
ATOM   560  O  OP2   . A   C 1 4  ? 4.393   7.628   26.606  1.00 38.27 ? 4   A   I OP2   1 
ATOM   561  O  "O5'" . A   C 1 4  ? 2.476   7.492   28.168  1.00 37.83 ? 4   A   I "O5'" 1 
ATOM   562  C  "C5'" . A   C 1 4  ? 1.806   7.357   29.416  1.00 37.21 ? 4   A   I "C5'" 1 
ATOM   563  C  "C4'" . A   C 1 4  ? 0.313   7.561   29.232  1.00 33.96 ? 4   A   I "C4'" 1 
ATOM   564  O  "O4'" . A   C 1 4  ? 0.076   8.921   28.772  1.00 32.01 ? 4   A   I "O4'" 1 
ATOM   565  C  "C3'" . A   C 1 4  ? -0.393  6.697   28.193  1.00 32.81 ? 4   A   I "C3'" 1 
ATOM   566  O  "O3'" . A   C 1 4  ? -0.749  5.415   28.714  1.00 32.85 ? 4   A   I "O3'" 1 
ATOM   567  C  "C2'" . A   C 1 4  ? -1.644  7.528   27.939  1.00 30.93 ? 4   A   I "C2'" 1 
ATOM   568  O  "O2'" . A   C 1 4  ? -2.555  7.396   29.003  1.00 30.18 ? 4   A   I "O2'" 1 
ATOM   569  C  "C1'" . A   C 1 4  ? -1.078  8.952   27.943  1.00 32.51 ? 4   A   I "C1'" 1 
ATOM   570  N  N9    . A   C 1 4  ? -0.690  9.419   26.601  1.00 33.05 ? 4   A   I N9    1 
ATOM   571  C  C8    . A   C 1 4  ? 0.574   9.420   26.066  1.00 31.21 ? 4   A   I C8    1 
ATOM   572  N  N7    . A   C 1 4  ? 0.627   9.858   24.830  1.00 29.17 ? 4   A   I N7    1 
ATOM   573  C  C5    . A   C 1 4  ? -0.686  10.182  24.528  1.00 29.40 ? 4   A   I C5    1 
ATOM   574  C  C6    . A   C 1 4  ? -1.286  10.700  23.356  1.00 29.09 ? 4   A   I C6    1 
ATOM   575  N  N6    . A   C 1 4  ? -0.599  11.025  22.262  1.00 28.10 ? 4   A   I N6    1 
ATOM   576  N  N1    . A   C 1 4  ? -2.626  10.882  23.358  1.00 28.44 ? 4   A   I N1    1 
ATOM   577  C  C2    . A   C 1 4  ? -3.304  10.584  24.479  1.00 32.31 ? 4   A   I C2    1 
ATOM   578  N  N3    . A   C 1 4  ? -2.845  10.106  25.654  1.00 31.11 ? 4   A   I N3    1 
ATOM   579  C  C4    . A   C 1 4  ? -1.514  9.921   25.607  1.00 30.17 ? 4   A   I C4    1 
ATOM   580  P  P     . C   C 1 5  ? -0.666  4.101   27.778  1.00 37.14 ? 5   C   I P     1 
ATOM   581  O  OP1   . C   C 1 5  ? -0.827  2.913   28.660  1.00 37.44 ? 5   C   I OP1   1 
ATOM   582  O  OP2   . C   C 1 5  ? 0.523   4.174   26.900  1.00 37.28 ? 5   C   I OP2   1 
ATOM   583  O  "O5'" . C   C 1 5  ? -1.963  4.193   26.856  1.00 36.10 ? 5   C   I "O5'" 1 
ATOM   584  C  "C5'" . C   C 1 5  ? -3.273  4.213   27.422  1.00 36.13 ? 5   C   I "C5'" 1 
ATOM   585  C  "C4'" . C   C 1 5  ? -4.281  4.710   26.405  1.00 34.87 ? 5   C   I "C4'" 1 
ATOM   586  O  "O4'" . C   C 1 5  ? -3.950  6.076   26.020  1.00 35.81 ? 5   C   I "O4'" 1 
ATOM   587  C  "C3'" . C   C 1 5  ? -4.296  3.987   25.065  1.00 33.94 ? 5   C   I "C3'" 1 
ATOM   588  O  "O3'" . C   C 1 5  ? -5.010  2.765   25.085  1.00 28.61 ? 5   C   I "O3'" 1 
ATOM   589  C  "C2'" . C   C 1 5  ? -5.002  4.998   24.183  1.00 34.82 ? 5   C   I "C2'" 1 
ATOM   590  O  "O2'" . C   C 1 5  ? -6.388  4.986   24.452  1.00 35.97 ? 5   C   I "O2'" 1 
ATOM   591  C  "C1'" . C   C 1 5  ? -4.381  6.312   24.675  1.00 35.55 ? 5   C   I "C1'" 1 
ATOM   592  N  N1    . C   C 1 5  ? -3.223  6.755   23.859  1.00 33.30 ? 5   C   I N1    1 
ATOM   593  C  C2    . C   C 1 5  ? -3.445  7.469   22.666  1.00 33.81 ? 5   C   I C2    1 
ATOM   594  O  O2    . C   C 1 5  ? -4.601  7.723   22.315  1.00 34.19 ? 5   C   I O2    1 
ATOM   595  N  N3    . C   C 1 5  ? -2.389  7.864   21.927  1.00 32.54 ? 5   C   I N3    1 
ATOM   596  C  C4    . C   C 1 5  ? -1.154  7.580   22.331  1.00 32.74 ? 5   C   I C4    1 
ATOM   597  N  N4    . C   C 1 5  ? -0.137  7.988   21.576  1.00 30.53 ? 5   C   I N4    1 
ATOM   598  C  C5    . C   C 1 5  ? -0.900  6.864   23.533  1.00 33.03 ? 5   C   I C5    1 
ATOM   599  C  C6    . C   C 1 5  ? -1.951  6.474   24.257  1.00 33.95 ? 5   C   I C6    1 
ATOM   600  P  P     . C   C 1 6  ? -4.594  1.599   24.058  1.00 31.24 ? 6   C   I P     1 
ATOM   601  O  OP1   . C   C 1 6  ? -5.242  0.371   24.551  1.00 28.36 ? 6   C   I OP1   1 
ATOM   602  O  OP2   . C   C 1 6  ? -3.144  1.595   23.814  1.00 27.57 ? 6   C   I OP2   1 
ATOM   603  O  "O5'" . C   C 1 6  ? -5.260  2.059   22.684  1.00 28.39 ? 6   C   I "O5'" 1 
ATOM   604  C  "C5'" . C   C 1 6  ? -6.661  2.306   22.601  1.00 26.40 ? 6   C   I "C5'" 1 
ATOM   605  C  "C4'" . C   C 1 6  ? -7.023  2.788   21.218  1.00 24.21 ? 6   C   I "C4'" 1 
ATOM   606  O  "O4'" . C   C 1 6  ? -6.549  4.148   21.030  1.00 25.63 ? 6   C   I "O4'" 1 
ATOM   607  C  "C3'" . C   C 1 6  ? -6.397  2.023   20.069  1.00 23.71 ? 6   C   I "C3'" 1 
ATOM   608  O  "O3'" . C   C 1 6  ? -7.132  0.841   19.794  1.00 21.83 ? 6   C   I "O3'" 1 
ATOM   609  C  "C2'" . C   C 1 6  ? -6.510  3.044   18.939  1.00 24.62 ? 6   C   I "C2'" 1 
ATOM   610  O  "O2'" . C   C 1 6  ? -7.823  3.144   18.412  1.00 24.97 ? 6   C   I "O2'" 1 
ATOM   611  C  "C1'" . C   C 1 6  ? -6.191  4.343   19.677  1.00 22.39 ? 6   C   I "C1'" 1 
ATOM   612  N  N1    . C   C 1 6  ? -4.768  4.665   19.620  1.00 22.11 ? 6   C   I N1    1 
ATOM   613  C  C2    . C   C 1 6  ? -4.248  5.148   18.421  1.00 22.43 ? 6   C   I C2    1 
ATOM   614  O  O2    . C   C 1 6  ? -5.024  5.321   17.459  1.00 23.36 ? 6   C   I O2    1 
ATOM   615  N  N3    . C   C 1 6  ? -2.930  5.412   18.334  1.00 19.55 ? 6   C   I N3    1 
ATOM   616  C  C4    . C   C 1 6  ? -2.138  5.217   19.394  1.00 22.25 ? 6   C   I C4    1 
ATOM   617  N  N4    . C   C 1 6  ? -0.826  5.484   19.255  1.00 17.33 ? 6   C   I N4    1 
ATOM   618  C  C5    . C   C 1 6  ? -2.650  4.740   20.639  1.00 20.30 ? 6   C   I C5    1 
ATOM   619  C  C6    . C   C 1 6  ? -3.957  4.482   20.705  1.00 21.15 ? 6   C   I C6    1 
ATOM   620  P  P     . U   C 1 7  ? -6.370  -0.462  19.295  1.00 27.66 ? 7   U   I P     1 
ATOM   621  O  OP1   . U   C 1 7  ? -7.307  -1.605  19.436  1.00 29.70 ? 7   U   I OP1   1 
ATOM   622  O  OP2   . U   C 1 7  ? -5.046  -0.534  19.951  1.00 27.98 ? 7   U   I OP2   1 
ATOM   623  O  "O5'" . U   C 1 7  ? -6.087  -0.211  17.731  1.00 27.11 ? 7   U   I "O5'" 1 
ATOM   624  C  "C5'" . U   C 1 7  ? -7.147  0.073   16.819  1.00 24.66 ? 7   U   I "C5'" 1 
ATOM   625  C  "C4'" . U   C 1 7  ? -6.601  0.645   15.519  1.00 25.86 ? 7   U   I "C4'" 1 
ATOM   626  O  "O4'" . U   C 1 7  ? -6.104  2.002   15.691  1.00 25.18 ? 7   U   I "O4'" 1 
ATOM   627  C  "C3'" . U   C 1 7  ? -5.418  -0.087  14.914  1.00 25.58 ? 7   U   I "C3'" 1 
ATOM   628  O  "O3'" . U   C 1 7  ? -5.868  -1.267  14.266  1.00 25.81 ? 7   U   I "O3'" 1 
ATOM   629  C  "C2'" . U   C 1 7  ? -4.897  0.967   13.954  1.00 25.18 ? 7   U   I "C2'" 1 
ATOM   630  O  "O2'" . U   C 1 7  ? -5.745  1.110   12.829  1.00 23.44 ? 7   U   I "O2'" 1 
ATOM   631  C  "C1'" . U   C 1 7  ? -5.002  2.220   14.822  1.00 22.84 ? 7   U   I "C1'" 1 
ATOM   632  N  N1    . U   C 1 7  ? -3.786  2.447   15.625  1.00 23.40 ? 7   U   I N1    1 
ATOM   633  C  C2    . U   C 1 7  ? -2.651  2.923   14.967  1.00 24.94 ? 7   U   I C2    1 
ATOM   634  O  O2    . U   C 1 7  ? -2.628  3.177   13.780  1.00 25.00 ? 7   U   I O2    1 
ATOM   635  N  N3    . U   C 1 7  ? -1.534  3.076   15.756  1.00 25.50 ? 7   U   I N3    1 
ATOM   636  C  C4    . U   C 1 7  ? -1.426  2.805   17.096  1.00 26.90 ? 7   U   I C4    1 
ATOM   637  O  O4    . U   C 1 7  ? -0.333  2.929   17.638  1.00 32.30 ? 7   U   I O4    1 
ATOM   638  C  C5    . U   C 1 7  ? -2.633  2.331   17.718  1.00 25.61 ? 7   U   I C5    1 
ATOM   639  C  C6    . U   C 1 7  ? -3.745  2.177   16.985  1.00 23.63 ? 7   U   I C6    1 
ATOM   640  P  P     . G   C 1 8  ? -4.956  -2.574  14.262  1.00 30.03 ? 8   G   I P     1 
ATOM   641  O  OP1   . G   C 1 8  ? -5.869  -3.677  13.871  1.00 31.26 ? 8   G   I OP1   1 
ATOM   642  O  OP2   . G   C 1 8  ? -4.159  -2.695  15.509  1.00 32.62 ? 8   G   I OP2   1 
ATOM   643  O  "O5'" . G   C 1 8  ? -3.893  -2.297  13.103  1.00 29.66 ? 8   G   I "O5'" 1 
ATOM   644  C  "C5'" . G   C 1 8  ? -4.302  -2.062  11.759  1.00 28.88 ? 8   G   I "C5'" 1 
ATOM   645  C  "C4'" . G   C 1 8  ? -3.186  -1.419  10.968  1.00 27.52 ? 8   G   I "C4'" 1 
ATOM   646  O  "O4'" . G   C 1 8  ? -2.842  -0.155  11.576  1.00 27.74 ? 8   G   I "O4'" 1 
ATOM   647  C  "C3'" . G   C 1 8  ? -1.863  -2.158  10.909  1.00 30.75 ? 8   G   I "C3'" 1 
ATOM   648  O  "O3'" . G   C 1 8  ? -1.887  -3.159  9.901   1.00 33.46 ? 8   G   I "O3'" 1 
ATOM   649  C  "C2'" . G   C 1 8  ? -0.909  -1.031  10.552  1.00 27.31 ? 8   G   I "C2'" 1 
ATOM   650  O  "O2'" . G   C 1 8  ? -1.034  -0.653  9.196   1.00 27.23 ? 8   G   I "O2'" 1 
ATOM   651  C  "C1'" . G   C 1 8  ? -1.466  0.095   11.412  1.00 25.72 ? 8   G   I "C1'" 1 
ATOM   652  N  N9    . G   C 1 8  ? -0.854  0.215   12.734  1.00 26.09 ? 8   G   I N9    1 
ATOM   653  C  C8    . G   C 1 8  ? -1.401  -0.109  13.955  1.00 23.51 ? 8   G   I C8    1 
ATOM   654  N  N7    . G   C 1 8  ? -0.592  0.130   14.961  1.00 24.81 ? 8   G   I N7    1 
ATOM   655  C  C5    . G   C 1 8  ? 0.555   0.648   14.364  1.00 23.47 ? 8   G   I C5    1 
ATOM   656  C  C6    . G   C 1 8  ? 1.789   1.114   14.935  1.00 23.15 ? 8   G   I C6    1 
ATOM   657  O  O6    . G   C 1 8  ? 2.132   1.174   16.126  1.00 21.96 ? 8   G   I O6    1 
ATOM   658  N  N1    . G   C 1 8  ? 2.668   1.552   13.955  1.00 21.24 ? 8   G   I N1    1 
ATOM   659  C  C2    . G   C 1 8  ? 2.413   1.576   12.615  1.00 23.46 ? 8   G   I C2    1 
ATOM   660  N  N2    . G   C 1 8  ? 3.388   2.083   11.846  1.00 23.78 ? 8   G   I N2    1 
ATOM   661  N  N3    . G   C 1 8  ? 1.286   1.149   12.065  1.00 24.89 ? 8   G   I N3    1 
ATOM   662  C  C4    . G   C 1 8  ? 0.407   0.702   12.991  1.00 25.25 ? 8   G   I C4    1 
ATOM   663  P  P     . A   C 1 9  ? -1.123  -4.539  10.141  1.00 36.11 ? 9   A   I P     1 
ATOM   664  O  OP1   . A   C 1 9  ? -1.750  -5.597  9.313   1.00 37.09 ? 9   A   I OP1   1 
ATOM   665  O  OP2   . A   C 1 9  ? -1.099  -4.685  11.625  1.00 37.50 ? 9   A   I OP2   1 
ATOM   666  O  "O5'" . A   C 1 9  ? 0.369   -4.273  9.643   1.00 35.50 ? 9   A   I "O5'" 1 
ATOM   667  C  "C5'" . A   C 1 9  ? 0.640   -3.591  8.425   1.00 32.62 ? 9   A   I "C5'" 1 
ATOM   668  C  "C4'" . A   C 1 9  ? 2.049   -3.050  8.434   1.00 31.40 ? 9   A   I "C4'" 1 
ATOM   669  O  "O4'" . A   C 1 9  ? 2.123   -1.863  9.279   1.00 31.48 ? 9   A   I "O4'" 1 
ATOM   670  C  "C3'" . A   C 1 9  ? 3.103   -3.973  9.019   1.00 33.24 ? 9   A   I "C3'" 1 
ATOM   671  O  "O3'" . A   C 1 9  ? 3.534   -4.999  8.121   1.00 33.62 ? 9   A   I "O3'" 1 
ATOM   672  C  "C2'" . A   C 1 9  ? 4.202   -2.988  9.390   1.00 30.00 ? 9   A   I "C2'" 1 
ATOM   673  O  "O2'" . A   C 1 9  ? 4.918   -2.544  8.251   1.00 32.41 ? 9   A   I "O2'" 1 
ATOM   674  C  "C1'" . A   C 1 9  ? 3.373   -1.837  9.952   1.00 28.21 ? 9   A   I "C1'" 1 
ATOM   675  N  N9    . A   C 1 9  ? 3.106   -1.933  11.386  1.00 25.98 ? 9   A   I N9    1 
ATOM   676  C  C8    . A   C 1 9  ? 1.957   -2.385  12.000  1.00 26.18 ? 9   A   I C8    1 
ATOM   677  N  N7    . A   C 1 9  ? 1.996   -2.309  13.315  1.00 24.20 ? 9   A   I N7    1 
ATOM   678  C  C5    . A   C 1 9  ? 3.253   -1.776  13.582  1.00 22.89 ? 9   A   I C5    1 
ATOM   679  C  C6    . A   C 1 9  ? 3.908   -1.436  14.793  1.00 23.41 ? 9   A   I C6    1 
ATOM   680  N  N6    . A   C 1 9  ? 3.335   -1.515  16.006  1.00 20.73 ? 9   A   I N6    1 
ATOM   681  N  N1    . A   C 1 9  ? 5.170   -0.977  14.710  1.00 20.09 ? 9   A   I N1    1 
ATOM   682  C  C2    . A   C 1 9  ? 5.718   -0.828  13.497  1.00 24.29 ? 9   A   I C2    1 
ATOM   683  N  N3    . A   C 1 9  ? 5.194   -1.073  12.293  1.00 22.23 ? 9   A   I N3    1 
ATOM   684  C  C4    . A   C 1 9  ? 3.950   -1.555  12.406  1.00 22.54 ? 9   A   I C4    1 
ATOM   685  P  P     . U   C 1 10 ? 3.847   -6.465  8.704   1.00 35.36 ? 10  U   I P     1 
ATOM   686  O  OP1   . U   C 1 10 ? 3.941   -7.426  7.584   1.00 36.34 ? 10  U   I OP1   1 
ATOM   687  O  OP2   . U   C 1 10 ? 2.881   -6.701  9.812   1.00 33.47 ? 10  U   I OP2   1 
ATOM   688  O  "O5'" . U   C 1 10 ? 5.303   -6.340  9.308   1.00 33.18 ? 10  U   I "O5'" 1 
ATOM   689  C  "C5'" . U   C 1 10 ? 6.392   -6.041  8.471   1.00 31.91 ? 10  U   I "C5'" 1 
ATOM   690  C  "C4'" . U   C 1 10 ? 7.538   -5.529  9.288   1.00 30.18 ? 10  U   I "C4'" 1 
ATOM   691  O  "O4'" . U   C 1 10 ? 7.116   -4.366  10.030  1.00 30.05 ? 10  U   I "O4'" 1 
ATOM   692  C  "C3'" . U   C 1 10 ? 8.024   -6.457  10.370  1.00 30.66 ? 10  U   I "C3'" 1 
ATOM   693  O  "O3'" . U   C 1 10 ? 8.894   -7.427  9.821   1.00 34.43 ? 10  U   I "O3'" 1 
ATOM   694  C  "C2'" . U   C 1 10 ? 8.768   -5.487  11.265  1.00 30.32 ? 10  U   I "C2'" 1 
ATOM   695  O  "O2'" . U   C 1 10 ? 9.984   -5.070  10.671  1.00 29.24 ? 10  U   I "O2'" 1 
ATOM   696  C  "C1'" . U   C 1 10 ? 7.798   -4.316  11.265  1.00 28.33 ? 10  U   I "C1'" 1 
ATOM   697  N  N1    . U   C 1 10 ? 6.809   -4.412  12.345  1.00 28.23 ? 10  U   I N1    1 
ATOM   698  C  C2    . U   C 1 10 ? 7.244   -4.102  13.610  1.00 27.03 ? 10  U   I C2    1 
ATOM   699  O  O2    . U   C 1 10 ? 8.378   -3.755  13.830  1.00 29.45 ? 10  U   I O2    1 
ATOM   700  N  N3    . U   C 1 10 ? 6.304   -4.208  14.601  1.00 26.43 ? 10  U   I N3    1 
ATOM   701  C  C4    . U   C 1 10 ? 4.986   -4.570  14.450  1.00 25.05 ? 10  U   I C4    1 
ATOM   702  O  O4    . U   C 1 10 ? 4.230   -4.512  15.419  1.00 22.96 ? 10  U   I O4    1 
ATOM   703  C  C5    . U   C 1 10 ? 4.606   -4.878  13.103  1.00 26.88 ? 10  U   I C5    1 
ATOM   704  C  C6    . U   C 1 10 ? 5.517   -4.789  12.117  1.00 26.46 ? 10  U   I C6    1 
ATOM   705  P  P     . U   C 1 11 ? 9.013   -8.852  10.535  1.00 32.85 ? 11  U   I P     1 
ATOM   706  O  OP1   . U   C 1 11 ? 9.692   -9.755  9.600   1.00 34.04 ? 11  U   I OP1   1 
ATOM   707  O  OP2   . U   C 1 11 ? 7.664   -9.164  11.044  1.00 37.18 ? 11  U   I OP2   1 
ATOM   708  O  "O5'" . U   C 1 11 ? 9.933   -8.589  11.790  1.00 32.80 ? 11  U   I "O5'" 1 
ATOM   709  C  "C5'" . U   C 1 11 ? 11.249  -8.112  11.631  1.00 29.96 ? 11  U   I "C5'" 1 
ATOM   710  C  "C4'" . U   C 1 11 ? 11.771  -7.690  12.962  1.00 31.00 ? 11  U   I "C4'" 1 
ATOM   711  O  "O4'" . U   C 1 11 ? 10.919  -6.635  13.484  1.00 30.65 ? 11  U   I "O4'" 1 
ATOM   712  C  "C3'" . U   C 1 11 ? 11.683  -8.756  14.036  1.00 29.45 ? 11  U   I "C3'" 1 
ATOM   713  O  "O3'" . U   C 1 11 ? 12.794  -9.631  13.930  1.00 29.68 ? 11  U   I "O3'" 1 
ATOM   714  C  "C2'" . U   C 1 11 ? 11.759  -7.908  15.294  1.00 28.69 ? 11  U   I "C2'" 1 
ATOM   715  O  "O2'" . U   C 1 11 ? 13.088  -7.474  15.479  1.00 30.36 ? 11  U   I "O2'" 1 
ATOM   716  C  "C1'" . U   C 1 11 ? 10.885  -6.717  14.899  1.00 29.31 ? 11  U   I "C1'" 1 
ATOM   717  N  N1    . U   C 1 11 ? 9.482   -6.850  15.316  1.00 27.61 ? 11  U   I N1    1 
ATOM   718  C  C2    . U   C 1 11 ? 9.187   -6.588  16.626  1.00 26.24 ? 11  U   I C2    1 
ATOM   719  O  O2    . U   C 1 11 ? 10.038  -6.292  17.437  1.00 27.52 ? 11  U   I O2    1 
ATOM   720  N  N3    . U   C 1 11 ? 7.858   -6.690  16.959  1.00 23.11 ? 11  U   I N3    1 
ATOM   721  C  C4    . U   C 1 11 ? 6.824   -7.041  16.134  1.00 23.09 ? 11  U   I C4    1 
ATOM   722  O  O4    . U   C 1 11 ? 5.677   -7.107  16.591  1.00 23.39 ? 11  U   I O4    1 
ATOM   723  C  C5    . U   C 1 11 ? 7.209   -7.322  14.791  1.00 23.44 ? 11  U   I C5    1 
ATOM   724  C  C6    . U   C 1 11 ? 8.498   -7.215  14.432  1.00 27.36 ? 11  U   I C6    1 
ATOM   725  P  P     . C   C 1 12 ? 12.684  -11.133 14.483  1.00 28.56 ? 12  C   I P     1 
ATOM   726  O  OP1   . C   C 1 12 ? 14.036  -11.733 14.362  1.00 28.58 ? 12  C   I OP1   1 
ATOM   727  O  OP2   . C   C 1 12 ? 11.516  -11.804 13.883  1.00 33.20 ? 12  C   I OP2   1 
ATOM   728  O  "O5'" . C   C 1 12 ? 12.440  -10.931 16.037  1.00 28.04 ? 12  C   I "O5'" 1 
ATOM   729  C  "C5'" . C   C 1 12 ? 13.558  -10.686 16.876  1.00 29.14 ? 12  C   I "C5'" 1 
ATOM   730  C  "C4'" . C   C 1 12 ? 13.133  -10.566 18.306  1.00 28.29 ? 12  C   I "C4'" 1 
ATOM   731  O  "O4'" . C   C 1 12 ? 12.175  -9.496  18.395  1.00 29.13 ? 12  C   I "O4'" 1 
ATOM   732  C  "C3'" . C   C 1 12 ? 12.390  -11.744 18.912  1.00 28.56 ? 12  C   I "C3'" 1 
ATOM   733  O  "O3'" . C   C 1 12 ? 13.263  -12.830 19.271  1.00 30.63 ? 12  C   I "O3'" 1 
ATOM   734  C  "C2'" . C   C 1 12 ? 11.708  -11.078 20.099  1.00 30.82 ? 12  C   I "C2'" 1 
ATOM   735  O  "O2'" . C   C 1 12 ? 12.579  -10.806 21.175  1.00 31.06 ? 12  C   I "O2'" 1 
ATOM   736  C  "C1'" . C   C 1 12 ? 11.317  -9.734  19.488  1.00 28.42 ? 12  C   I "C1'" 1 
ATOM   737  N  N1    . C   C 1 12 ? 9.941   -9.755  19.009  1.00 26.74 ? 12  C   I N1    1 
ATOM   738  C  C2    . C   C 1 12 ? 8.971   -9.452  19.907  1.00 23.77 ? 12  C   I C2    1 
ATOM   739  O  O2    . C   C 1 12 ? 9.322   -9.139  21.042  1.00 25.27 ? 12  C   I O2    1 
ATOM   740  N  N3    . C   C 1 12 ? 7.685   -9.491  19.541  1.00 23.30 ? 12  C   I N3    1 
ATOM   741  C  C4    . C   C 1 12 ? 7.363   -9.820  18.289  1.00 23.72 ? 12  C   I C4    1 
ATOM   742  N  N4    . C   C 1 12 ? 6.068   -9.859  17.970  1.00 23.08 ? 12  C   I N4    1 
ATOM   743  C  C5    . C   C 1 12 ? 8.352   -10.121 17.321  1.00 23.74 ? 12  C   I C5    1 
ATOM   744  C  C6    . C   C 1 12 ? 9.626   -10.078 17.720  1.00 25.79 ? 12  C   I C6    1 
ATOM   745  O  "O5'" . DG  D 2 1  ? -0.653  -6.447  27.138  1.00 36.87 ? 1   DG  J "O5'" 1 
ATOM   746  C  "C5'" . DG  D 2 1  ? -0.071  -7.444  26.311  1.00 32.81 ? 1   DG  J "C5'" 1 
ATOM   747  C  "C4'" . DG  D 2 1  ? 1.358   -7.570  26.775  1.00 33.12 ? 1   DG  J "C4'" 1 
ATOM   748  O  "O4'" . DG  D 2 1  ? 1.936   -8.809  26.321  1.00 29.43 ? 1   DG  J "O4'" 1 
ATOM   749  C  "C3'" . DG  D 2 1  ? 2.299   -6.474  26.294  1.00 32.41 ? 1   DG  J "C3'" 1 
ATOM   750  O  "O3'" . DG  D 2 1  ? 2.291   -5.410  27.248  1.00 34.81 ? 1   DG  J "O3'" 1 
ATOM   751  C  "C2'" . DG  D 2 1  ? 3.633   -7.193  26.310  1.00 31.72 ? 1   DG  J "C2'" 1 
ATOM   752  C  "C1'" . DG  D 2 1  ? 3.238   -8.579  25.832  1.00 26.86 ? 1   DG  J "C1'" 1 
ATOM   753  N  N9    . DG  D 2 1  ? 3.166   -8.696  24.385  1.00 25.20 ? 1   DG  J N9    1 
ATOM   754  C  C8    . DG  D 2 1  ? 2.033   -8.669  23.611  1.00 20.37 ? 1   DG  J C8    1 
ATOM   755  N  N7    . DG  D 2 1  ? 2.284   -8.787  22.335  1.00 23.90 ? 1   DG  J N7    1 
ATOM   756  C  C5    . DG  D 2 1  ? 3.664   -8.900  22.264  1.00 22.52 ? 1   DG  J C5    1 
ATOM   757  C  C6    . DG  D 2 1  ? 4.506   -9.061  21.146  1.00 23.04 ? 1   DG  J C6    1 
ATOM   758  O  O6    . DG  D 2 1  ? 4.190   -9.174  19.955  1.00 22.73 ? 1   DG  J O6    1 
ATOM   759  N  N1    . DG  D 2 1  ? 5.844   -9.121  21.517  1.00 22.40 ? 1   DG  J N1    1 
ATOM   760  C  C2    . DG  D 2 1  ? 6.305   -9.066  22.819  1.00 24.15 ? 1   DG  J C2    1 
ATOM   761  N  N2    . DG  D 2 1  ? 7.639   -9.156  22.978  1.00 22.60 ? 1   DG  J N2    1 
ATOM   762  N  N3    . DG  D 2 1  ? 5.521   -8.936  23.875  1.00 20.62 ? 1   DG  J N3    1 
ATOM   763  C  C4    . DG  D 2 1  ? 4.225   -8.853  23.524  1.00 23.79 ? 1   DG  J C4    1 
ATOM   764  P  P     . DA  D 2 2  ? 2.670   -3.927  26.797  1.00 34.88 ? 2   DA  J P     1 
ATOM   765  O  OP1   . DA  D 2 2  ? 2.574   -3.076  28.014  1.00 36.88 ? 2   DA  J OP1   1 
ATOM   766  O  OP2   . DA  D 2 2  ? 1.925   -3.546  25.585  1.00 34.56 ? 2   DA  J OP2   1 
ATOM   767  O  "O5'" . DA  D 2 2  ? 4.198   -4.033  26.379  1.00 36.07 ? 2   DA  J "O5'" 1 
ATOM   768  C  "C5'" . DA  D 2 2  ? 5.211   -4.347  27.324  1.00 32.91 ? 2   DA  J "C5'" 1 
ATOM   769  C  "C4'" . DA  D 2 2  ? 6.536   -4.448  26.609  1.00 32.18 ? 2   DA  J "C4'" 1 
ATOM   770  O  "O4'" . DA  D 2 2  ? 6.565   -5.599  25.732  1.00 30.07 ? 2   DA  J "O4'" 1 
ATOM   771  C  "C3'" . DA  D 2 2  ? 6.783   -3.285  25.670  1.00 33.67 ? 2   DA  J "C3'" 1 
ATOM   772  O  "O3'" . DA  D 2 2  ? 7.219   -2.126  26.385  1.00 35.64 ? 2   DA  J "O3'" 1 
ATOM   773  C  "C2'" . DA  D 2 2  ? 7.840   -3.863  24.753  1.00 31.85 ? 2   DA  J "C2'" 1 
ATOM   774  C  "C1'" . DA  D 2 2  ? 7.321   -5.287  24.559  1.00 28.68 ? 2   DA  J "C1'" 1 
ATOM   775  N  N9    . DA  D 2 2  ? 6.436   -5.449  23.402  1.00 25.49 ? 2   DA  J N9    1 
ATOM   776  C  C8    . DA  D 2 2  ? 5.061   -5.431  23.387  1.00 24.83 ? 2   DA  J C8    1 
ATOM   777  N  N7    . DA  D 2 2  ? 4.543   -5.642  22.200  1.00 22.59 ? 2   DA  J N7    1 
ATOM   778  C  C5    . DA  D 2 2  ? 5.650   -5.799  21.378  1.00 22.45 ? 2   DA  J C5    1 
ATOM   779  C  C6    . DA  D 2 2  ? 5.774   -6.064  20.004  1.00 23.59 ? 2   DA  J C6    1 
ATOM   780  N  N6    . DA  D 2 2  ? 4.728   -6.234  19.181  1.00 22.20 ? 2   DA  J N6    1 
ATOM   781  N  N1    . DA  D 2 2  ? 7.021   -6.160  19.492  1.00 24.63 ? 2   DA  J N1    1 
ATOM   782  C  C2    . DA  D 2 2  ? 8.061   -5.998  20.317  1.00 25.67 ? 2   DA  J C2    1 
ATOM   783  N  N3    . DA  D 2 2  ? 8.068   -5.753  21.628  1.00 25.74 ? 2   DA  J N3    1 
ATOM   784  C  C4    . DA  D 2 2  ? 6.819   -5.669  22.101  1.00 23.22 ? 2   DA  J C4    1 
ATOM   785  P  P     . DA  D 2 3  ? 7.233   -0.705  25.643  1.00 37.06 ? 3   DA  J P     1 
ATOM   786  O  OP1   . DA  D 2 3  ? 7.834   0.236   26.619  1.00 39.84 ? 3   DA  J OP1   1 
ATOM   787  O  OP2   . DA  D 2 3  ? 5.887   -0.414  25.076  1.00 36.29 ? 3   DA  J OP2   1 
ATOM   788  O  "O5'" . DA  D 2 3  ? 8.276   -0.922  24.467  1.00 32.15 ? 3   DA  J "O5'" 1 
ATOM   789  C  "C5'" . DA  D 2 3  ? 9.657   -0.926  24.762  1.00 29.33 ? 3   DA  J "C5'" 1 
ATOM   790  C  "C4'" . DA  D 2 3  ? 10.473  -1.053  23.498  1.00 27.17 ? 3   DA  J "C4'" 1 
ATOM   791  O  "O4'" . DA  D 2 3  ? 10.164  -2.307  22.855  1.00 26.92 ? 3   DA  J "O4'" 1 
ATOM   792  C  "C3'" . DA  D 2 3  ? 10.250  0.007   22.426  1.00 25.72 ? 3   DA  J "C3'" 1 
ATOM   793  O  "O3'" . DA  D 2 3  ? 11.067  1.165   22.675  1.00 28.24 ? 3   DA  J "O3'" 1 
ATOM   794  C  "C2'" . DA  D 2 3  ? 10.738  -0.725  21.195  1.00 25.05 ? 3   DA  J "C2'" 1 
ATOM   795  C  "C1'" . DA  D 2 3  ? 10.232  -2.150  21.443  1.00 24.85 ? 3   DA  J "C1'" 1 
ATOM   796  N  N9    . DA  D 2 3  ? 8.888   -2.379  20.917  1.00 23.74 ? 3   DA  J N9    1 
ATOM   797  C  C8    . DA  D 2 3  ? 7.705   -2.292  21.600  1.00 23.10 ? 3   DA  J C8    1 
ATOM   798  N  N7    . DA  D 2 3  ? 6.651   -2.529  20.857  1.00 23.54 ? 3   DA  J N7    1 
ATOM   799  C  C5    . DA  D 2 3  ? 7.182   -2.803  19.603  1.00 20.84 ? 3   DA  J C5    1 
ATOM   800  C  C6    . DA  D 2 3  ? 6.579   -3.126  18.363  1.00 17.91 ? 3   DA  J C6    1 
ATOM   801  N  N6    . DA  D 2 3  ? 5.267   -3.295  18.199  1.00 18.03 ? 3   DA  J N6    1 
ATOM   802  N  N1    . DA  D 2 3  ? 7.385   -3.287  17.295  1.00 20.85 ? 3   DA  J N1    1 
ATOM   803  C  C2    . DA  D 2 3  ? 8.712   -3.169  17.472  1.00 20.59 ? 3   DA  J C2    1 
ATOM   804  N  N3    . DA  D 2 3  ? 9.395   -2.891  18.598  1.00 23.09 ? 3   DA  J N3    1 
ATOM   805  C  C4    . DA  D 2 3  ? 8.558   -2.711  19.630  1.00 19.95 ? 3   DA  J C4    1 
ATOM   806  P  P     . DT  D 2 4  ? 10.553  2.630   22.240  1.00 27.86 ? 4   DT  J P     1 
ATOM   807  O  OP1   . DT  D 2 4  ? 11.458  3.623   22.836  1.00 27.72 ? 4   DT  J OP1   1 
ATOM   808  O  OP2   . DT  D 2 4  ? 9.100   2.733   22.508  1.00 29.07 ? 4   DT  J OP2   1 
ATOM   809  O  "O5'" . DT  D 2 4  ? 10.766  2.659   20.659  1.00 27.12 ? 4   DT  J "O5'" 1 
ATOM   810  C  "C5'" . DT  D 2 4  ? 12.059  2.536   20.084  1.00 24.91 ? 4   DT  J "C5'" 1 
ATOM   811  C  "C4'" . DT  D 2 4  ? 11.925  2.256   18.604  1.00 23.86 ? 4   DT  J "C4'" 1 
ATOM   812  O  "O4'" . DT  D 2 4  ? 11.233  0.997   18.398  1.00 23.79 ? 4   DT  J "O4'" 1 
ATOM   813  C  "C3'" . DT  D 2 4  ? 11.034  3.260   17.886  1.00 24.15 ? 4   DT  J "C3'" 1 
ATOM   814  O  "O3'" . DT  D 2 4  ? 11.718  4.496   17.609  1.00 23.14 ? 4   DT  J "O3'" 1 
ATOM   815  C  "C2'" . DT  D 2 4  ? 10.685  2.488   16.633  1.00 23.10 ? 4   DT  J "C2'" 1 
ATOM   816  C  "C1'" . DT  D 2 4  ? 10.465  1.077   17.189  1.00 21.13 ? 4   DT  J "C1'" 1 
ATOM   817  N  N1    . DT  D 2 4  ? 9.031   0.767   17.487  1.00 19.51 ? 4   DT  J N1    1 
ATOM   818  C  C2    . DT  D 2 4  ? 8.254   0.305   16.449  1.00 18.15 ? 4   DT  J C2    1 
ATOM   819  O  O2    . DT  D 2 4  ? 8.692   0.115   15.327  1.00 23.76 ? 4   DT  J O2    1 
ATOM   820  N  N3    . DT  D 2 4  ? 6.943   0.068   16.763  1.00 18.12 ? 4   DT  J N3    1 
ATOM   821  C  C4    . DT  D 2 4  ? 6.338   0.241   17.992  1.00 19.13 ? 4   DT  J C4    1 
ATOM   822  O  O4    . DT  D 2 4  ? 5.148   -0.007  18.128  1.00 16.10 ? 4   DT  J O4    1 
ATOM   823  C  C5    . DT  D 2 4  ? 7.212   0.726   19.043  1.00 18.55 ? 4   DT  J C5    1 
ATOM   824  C  C7    . DT  D 2 4  ? 6.640   0.958   20.407  1.00 21.45 ? 4   DT  J C7    1 
ATOM   825  C  C6    . DT  D 2 4  ? 8.497   0.950   18.745  1.00 18.14 ? 4   DT  J C6    1 
ATOM   826  P  P     . DC  D 2 5  ? 10.882  5.869   17.481  1.00 27.59 ? 5   DC  J P     1 
ATOM   827  O  OP1   . DC  D 2 5  ? 11.909  6.946   17.353  1.00 26.20 ? 5   DC  J OP1   1 
ATOM   828  O  OP2   . DC  D 2 5  ? 9.859   5.961   18.554  1.00 23.25 ? 5   DC  J OP2   1 
ATOM   829  O  "O5'" . DC  D 2 5  ? 10.142  5.752   16.072  1.00 27.02 ? 5   DC  J "O5'" 1 
ATOM   830  C  "C5'" . DC  D 2 5  ? 10.901  5.694   14.856  1.00 24.96 ? 5   DC  J "C5'" 1 
ATOM   831  C  "C4'" . DC  D 2 5  ? 10.023  5.286   13.693  1.00 24.75 ? 5   DC  J "C4'" 1 
ATOM   832  O  "O4'" . DC  D 2 5  ? 9.475   3.973   13.928  1.00 25.68 ? 5   DC  J "O4'" 1 
ATOM   833  C  "C3'" . DC  D 2 5  ? 8.796   6.147   13.441  1.00 25.85 ? 5   DC  J "C3'" 1 
ATOM   834  O  "O3'" . DC  D 2 5  ? 9.117   7.276   12.639  1.00 29.53 ? 5   DC  J "O3'" 1 
ATOM   835  C  "C2'" . DC  D 2 5  ? 7.927   5.211   12.633  1.00 26.06 ? 5   DC  J "C2'" 1 
ATOM   836  C  "C1'" . DC  D 2 5  ? 8.198   3.871   13.298  1.00 24.87 ? 5   DC  J "C1'" 1 
ATOM   837  N  N1    . DC  D 2 5  ? 7.214   3.604   14.338  1.00 22.05 ? 5   DC  J N1    1 
ATOM   838  C  C2    . DC  D 2 5  ? 6.031   2.939   13.999  1.00 22.19 ? 5   DC  J C2    1 
ATOM   839  O  O2    . DC  D 2 5  ? 5.855   2.586   12.816  1.00 20.94 ? 5   DC  J O2    1 
ATOM   840  N  N3    . DC  D 2 5  ? 5.108   2.700   14.968  1.00 20.05 ? 5   DC  J N3    1 
ATOM   841  C  C4    . DC  D 2 5  ? 5.340   3.114   16.229  1.00 20.87 ? 5   DC  J C4    1 
ATOM   842  N  N4    . DC  D 2 5  ? 4.401   2.880   17.172  1.00 17.17 ? 5   DC  J N4    1 
ATOM   843  C  C5    . DC  D 2 5  ? 6.536   3.785   16.586  1.00 20.00 ? 5   DC  J C5    1 
ATOM   844  C  C6    . DC  D 2 5  ? 7.441   4.004   15.621  1.00 21.27 ? 5   DC  J C6    1 
ATOM   845  P  P     A DA  D 2 6  ? 8.131   8.529   12.608  0.50 30.13 ? 6   DA  J P     1 
ATOM   846  P  P     B DA  D 2 6  ? 8.127   8.542   12.633  0.50 30.09 ? 6   DA  J P     1 
ATOM   847  O  OP1   A DA  D 2 6  ? 8.723   9.533   11.696  0.50 31.27 ? 6   DA  J OP1   1 
ATOM   848  O  OP1   B DA  D 2 6  ? 8.765   9.614   11.835  0.50 31.34 ? 6   DA  J OP1   1 
ATOM   849  O  OP2   A DA  D 2 6  ? 7.831   8.898   14.012  0.50 27.42 ? 6   DA  J OP2   1 
ATOM   850  O  OP2   B DA  D 2 6  ? 7.732   8.814   14.035  0.50 27.69 ? 6   DA  J OP2   1 
ATOM   851  O  "O5'" A DA  D 2 6  ? 6.826   7.955   11.899  0.50 28.47 ? 6   DA  J "O5'" 1 
ATOM   852  O  "O5'" B DA  D 2 6  ? 6.842   8.043   11.827  0.50 28.42 ? 6   DA  J "O5'" 1 
ATOM   853  C  "C5'" A DA  D 2 6  ? 6.791   7.752   10.489  0.50 26.06 ? 6   DA  J "C5'" 1 
ATOM   854  C  "C5'" B DA  D 2 6  ? 6.903   7.814   10.421  0.50 25.75 ? 6   DA  J "C5'" 1 
ATOM   855  C  "C4'" A DA  D 2 6  ? 5.385   7.425   10.040  0.50 25.45 ? 6   DA  J "C4'" 1 
ATOM   856  C  "C4'" B DA  D 2 6  ? 5.604   7.221   9.916   0.50 25.73 ? 6   DA  J "C4'" 1 
ATOM   857  O  "O4'" A DA  D 2 6  ? 5.001   6.077   10.392  0.50 24.19 ? 6   DA  J "O4'" 1 
ATOM   858  O  "O4'" B DA  D 2 6  ? 5.309   6.012   10.649  0.50 23.87 ? 6   DA  J "O4'" 1 
ATOM   859  C  "C3'" A DA  D 2 6  ? 4.283   8.296   10.622  0.50 25.34 ? 6   DA  J "C3'" 1 
ATOM   860  C  "C3'" B DA  D 2 6  ? 4.349   8.075   10.064  0.50 25.04 ? 6   DA  J "C3'" 1 
ATOM   861  O  "O3'" A DA  D 2 6  ? 4.264   9.573   9.969   0.50 26.23 ? 6   DA  J "O3'" 1 
ATOM   862  O  "O3'" B DA  D 2 6  ? 4.172   8.939   8.934   0.50 26.08 ? 6   DA  J "O3'" 1 
ATOM   863  C  "C2'" A DA  D 2 6  ? 3.071   7.452   10.293  0.50 24.02 ? 6   DA  J "C2'" 1 
ATOM   864  C  "C2'" B DA  D 2 6  ? 3.242   7.041   10.087  0.50 24.07 ? 6   DA  J "C2'" 1 
ATOM   865  C  "C1'" A DA  D 2 6  ? 3.597   6.063   10.668  0.50 23.89 ? 6   DA  J "C1'" 1 
ATOM   866  C  "C1'" B DA  D 2 6  ? 3.900   5.847   10.773  0.50 23.36 ? 6   DA  J "C1'" 1 
ATOM   867  N  N9    A DA  D 2 6  ? 3.433   5.796   12.094  0.50 20.61 ? 6   DA  J N9    1 
ATOM   868  N  N9    B DA  D 2 6  ? 3.595   5.727   12.196  0.50 20.67 ? 6   DA  J N9    1 
ATOM   869  C  C8    A DA  D 2 6  ? 4.331   6.066   13.090  0.50 20.59 ? 6   DA  J C8    1 
ATOM   870  C  C8    B DA  D 2 6  ? 4.401   6.072   13.247  0.50 20.86 ? 6   DA  J C8    1 
ATOM   871  N  N7    A DA  D 2 6  ? 3.915   5.725   14.284  0.50 19.78 ? 6   DA  J N7    1 
ATOM   872  N  N7    B DA  D 2 6  ? 3.888   5.794   14.420  0.50 19.96 ? 6   DA  J N7    1 
ATOM   873  C  C5    A DA  D 2 6  ? 2.663   5.183   14.057  0.50 18.61 ? 6   DA  J C5    1 
ATOM   874  C  C5    B DA  D 2 6  ? 2.661   5.234   14.121  0.50 19.05 ? 6   DA  J C5    1 
ATOM   875  C  C6    A DA  D 2 6  ? 1.719   4.612   14.914  0.50 18.70 ? 6   DA  J C6    1 
ATOM   876  C  C6    B DA  D 2 6  ? 1.652   4.701   14.929  0.50 19.57 ? 6   DA  J C6    1 
ATOM   877  N  N6    A DA  D 2 6  ? 1.896   4.482   16.235  0.50 18.65 ? 6   DA  J N6    1 
ATOM   878  N  N6    B DA  D 2 6  ? 1.737   4.619   16.265  0.50 19.71 ? 6   DA  J N6    1 
ATOM   879  N  N1    A DA  D 2 6  ? 0.569   4.168   14.367  0.50 18.59 ? 6   DA  J N1    1 
ATOM   880  N  N1    B DA  D 2 6  ? 0.542   4.238   14.320  0.50 19.40 ? 6   DA  J N1    1 
ATOM   881  C  C2    A DA  D 2 6  ? 0.393   4.294   13.041  0.50 20.04 ? 6   DA  J C2    1 
ATOM   882  C  C2    B DA  D 2 6  ? 0.470   4.296   12.978  0.50 20.65 ? 6   DA  J C2    1 
ATOM   883  N  N3    A DA  D 2 6  ? 1.211   4.807   12.131  0.50 19.75 ? 6   DA  J N3    1 
ATOM   884  N  N3    B DA  D 2 6  ? 1.365   4.757   12.108  0.50 20.53 ? 6   DA  J N3    1 
ATOM   885  C  C4    A DA  D 2 6  ? 2.347   5.234   12.710  0.50 20.41 ? 6   DA  J C4    1 
ATOM   886  C  C4    B DA  D 2 6  ? 2.452   5.214   12.752  0.50 20.69 ? 6   DA  J C4    1 
ATOM   887  P  P     A DG  D 2 7  ? 3.810   10.874  10.781  0.50 26.90 ? 7   DG  J P     1 
ATOM   888  P  P     B DG  D 2 7  ? 3.673   10.443  9.173   0.50 25.54 ? 7   DG  J P     1 
ATOM   889  O  OP1   A DG  D 2 7  ? 4.107   12.021  9.884   0.50 27.39 ? 7   DG  J OP1   1 
ATOM   890  O  OP1   B DG  D 2 7  ? 3.491   11.089  7.851   0.50 26.06 ? 7   DG  J OP1   1 
ATOM   891  O  OP2   A DG  D 2 7  ? 4.371   10.837  12.155  0.50 26.33 ? 7   DG  J OP2   1 
ATOM   892  O  OP2   B DG  D 2 7  ? 4.591   11.049  10.164  0.50 25.29 ? 7   DG  J OP2   1 
ATOM   893  O  "O5'" A DG  D 2 7  ? 2.231   10.720  10.874  0.50 25.38 ? 7   DG  J "O5'" 1 
ATOM   894  O  "O5'" B DG  D 2 7  ? 2.246   10.273  9.863   0.50 25.59 ? 7   DG  J "O5'" 1 
ATOM   895  C  "C5'" A DG  D 2 7  ? 1.479   10.483  9.699   0.50 24.32 ? 7   DG  J "C5'" 1 
ATOM   896  C  "C5'" B DG  D 2 7  ? 1.072   10.217  9.076   0.50 25.17 ? 7   DG  J "C5'" 1 
ATOM   897  C  "C4'" A DG  D 2 7  ? 0.116   9.931   10.033  0.50 24.60 ? 7   DG  J "C4'" 1 
ATOM   898  C  "C4'" B DG  D 2 7  ? -0.120  9.788   9.902   0.50 25.26 ? 7   DG  J "C4'" 1 
ATOM   899  O  "O4'" A DG  D 2 7  ? 0.211   8.559   10.473  0.50 23.62 ? 7   DG  J "O4'" 1 
ATOM   900  O  "O4'" B DG  D 2 7  ? 0.046   8.487   10.507  0.50 23.77 ? 7   DG  J "O4'" 1 
ATOM   901  C  "C3'" A DG  D 2 7  ? -0.663  10.622  11.138  0.50 24.31 ? 7   DG  J "C3'" 1 
ATOM   902  C  "C3'" B DG  D 2 7  ? -0.613  10.636  11.064  0.50 24.89 ? 7   DG  J "C3'" 1 
ATOM   903  O  "O3'" A DG  D 2 7  ? -1.238  11.846  10.660  0.50 29.04 ? 7   DG  J "O3'" 1 
ATOM   904  O  "O3'" B DG  D 2 7  ? -1.202  11.870  10.622  0.50 29.26 ? 7   DG  J "O3'" 1 
ATOM   905  C  "C2'" A DG  D 2 7  ? -1.720  9.572   11.394  0.50 23.37 ? 7   DG  J "C2'" 1 
ATOM   906  C  "C2'" B DG  D 2 7  ? -1.706  9.714   11.553  0.50 24.01 ? 7   DG  J "C2'" 1 
ATOM   907  C  "C1'" A DG  D 2 7  ? -0.866  8.302   11.372  0.50 23.36 ? 7   DG  J "C1'" 1 
ATOM   908  C  "C1'" B DG  D 2 7  ? -1.005  8.352   11.471  0.50 23.92 ? 7   DG  J "C1'" 1 
ATOM   909  N  N9    A DG  D 2 7  ? -0.317  8.051   12.699  0.50 23.32 ? 7   DG  J N9    1 
ATOM   910  N  N9    B DG  D 2 7  ? -0.426  8.029   12.769  0.50 23.50 ? 7   DG  J N9    1 
ATOM   911  C  C8    A DG  D 2 7  ? 0.938   8.354   13.175  0.50 22.91 ? 7   DG  J C8    1 
ATOM   912  C  C8    B DG  D 2 7  ? 0.853   8.265   13.222  0.50 23.53 ? 7   DG  J C8    1 
ATOM   913  N  N7    A DG  D 2 7  ? 1.087   8.054   14.437  0.50 23.55 ? 7   DG  J N7    1 
ATOM   914  N  N7    B DG  D 2 7  ? 1.021   7.921   14.472  0.50 24.02 ? 7   DG  J N7    1 
ATOM   915  C  C5    A DG  D 2 7  ? -0.136  7.509   14.807  0.50 24.09 ? 7   DG  J C5    1 
ATOM   916  C  C5    B DG  D 2 7  ? -0.214  7.411   14.854  0.50 24.07 ? 7   DG  J C5    1 
ATOM   917  C  C6    A DG  D 2 7  ? -0.573  6.997   16.052  0.50 23.59 ? 7   DG  J C6    1 
ATOM   918  C  C6    B DG  D 2 7  ? -0.646  6.876   16.094  0.50 23.37 ? 7   DG  J C6    1 
ATOM   919  O  O6    A DG  D 2 7  ? 0.058   6.913   17.107  0.50 27.89 ? 7   DG  J O6    1 
ATOM   920  O  O6    B DG  D 2 7  ? 0.004   6.717   17.130  0.50 27.44 ? 7   DG  J O6    1 
ATOM   921  N  N1    A DG  D 2 7  ? -1.887  6.551   15.991  0.50 22.83 ? 7   DG  J N1    1 
ATOM   922  N  N1    B DG  D 2 7  ? -1.981  6.495   16.049  0.50 22.70 ? 7   DG  J N1    1 
ATOM   923  C  C2    A DG  D 2 7  ? -2.678  6.593   14.863  0.50 23.30 ? 7   DG  J C2    1 
ATOM   924  C  C2    B DG  D 2 7  ? -2.797  6.598   14.942  0.50 23.07 ? 7   DG  J C2    1 
ATOM   925  N  N2    A DG  D 2 7  ? -3.920  6.148   14.980  0.50 22.40 ? 7   DG  J N2    1 
ATOM   926  N  N2    B DG  D 2 7  ? -4.060  6.195   15.081  0.50 22.51 ? 7   DG  J N2    1 
ATOM   927  N  N3    A DG  D 2 7  ? -2.273  7.052   13.697  0.50 23.46 ? 7   DG  J N3    1 
ATOM   928  N  N3    B DG  D 2 7  ? -2.399  7.073   13.780  0.50 23.55 ? 7   DG  J N3    1 
ATOM   929  C  C4    A DG  D 2 7  ? -1.005  7.495   13.742  0.50 22.85 ? 7   DG  J C4    1 
ATOM   930  C  C4    B DG  D 2 7  ? -1.109  7.465   13.809  0.50 23.04 ? 7   DG  J C4    1 
ATOM   931  P  P     . DG  D 2 8  ? -1.541  13.047  11.686  1.00 29.43 ? 8   DG  J P     1 
ATOM   932  O  OP1   . DG  D 2 8  ? -2.090  14.151  10.864  1.00 30.11 ? 8   DG  J OP1   1 
ATOM   933  O  OP2   . DG  D 2 8  ? -0.379  13.302  12.578  1.00 30.32 ? 8   DG  J OP2   1 
ATOM   934  O  "O5'" . DG  D 2 8  ? -2.735  12.489  12.580  1.00 28.51 ? 8   DG  J "O5'" 1 
ATOM   935  C  "C5'" . DG  D 2 8  ? -4.059  12.393  12.045  1.00 26.91 ? 8   DG  J "C5'" 1 
ATOM   936  C  "C4'" . DG  D 2 8  ? -4.976  11.696  13.025  1.00 24.73 ? 8   DG  J "C4'" 1 
ATOM   937  O  "O4'" . DG  D 2 8  ? -4.346  10.480  13.498  1.00 24.09 ? 8   DG  J "O4'" 1 
ATOM   938  C  "C3'" . DG  D 2 8  ? -5.288  12.469  14.292  1.00 23.95 ? 8   DG  J "C3'" 1 
ATOM   939  O  "O3'" . DG  D 2 8  ? -6.362  13.373  14.066  1.00 23.92 ? 8   DG  J "O3'" 1 
ATOM   940  C  "C2'" . DG  D 2 8  ? -5.696  11.352  15.239  1.00 23.76 ? 8   DG  J "C2'" 1 
ATOM   941  C  "C1'" . DG  D 2 8  ? -4.793  10.181  14.822  1.00 22.03 ? 8   DG  J "C1'" 1 
ATOM   942  N  N9    . DG  D 2 8  ? -3.610  10.045  15.671  1.00 20.02 ? 8   DG  J N9    1 
ATOM   943  C  C8    . DG  D 2 8  ? -2.329  10.393  15.336  1.00 21.01 ? 8   DG  J C8    1 
ATOM   944  N  N7    . DG  D 2 8  ? -1.479  10.234  16.313  1.00 20.61 ? 8   DG  J N7    1 
ATOM   945  C  C5    . DG  D 2 8  ? -2.239  9.726   17.351  1.00 19.28 ? 8   DG  J C5    1 
ATOM   946  C  C6    . DG  D 2 8  ? -1.852  9.336   18.653  1.00 19.22 ? 8   DG  J C6    1 
ATOM   947  O  O6    . DG  D 2 8  ? -0.718  9.353   19.148  1.00 16.88 ? 8   DG  J O6    1 
ATOM   948  N  N1    . DG  D 2 8  ? -2.939  8.876   19.393  1.00 17.92 ? 8   DG  J N1    1 
ATOM   949  C  C2    . DG  D 2 8  ? -4.233  8.794   18.921  1.00 20.18 ? 8   DG  J C2    1 
ATOM   950  N  N2    . DG  D 2 8  ? -5.165  8.349   19.779  1.00 19.80 ? 8   DG  J N2    1 
ATOM   951  N  N3    . DG  D 2 8  ? -4.593  9.131   17.701  1.00 20.60 ? 8   DG  J N3    1 
ATOM   952  C  C4    . DG  D 2 8  ? -3.556  9.590   16.973  1.00 20.48 ? 8   DG  J C4    1 
HETATM 953  N  N1    . 5IU D 2 9  ? -5.690  12.059  19.804  1.00 30.39 ? 9   5IU J N1    1 
HETATM 954  C  C2    . 5IU D 2 9  ? -5.063  11.578  20.915  1.00 28.26 ? 9   5IU J C2    1 
HETATM 955  N  N3    . 5IU D 2 9  ? -3.698  11.708  20.923  1.00 27.87 ? 9   5IU J N3    1 
HETATM 956  C  C4    . 5IU D 2 9  ? -2.934  12.253  19.937  1.00 27.47 ? 9   5IU J C4    1 
HETATM 957  C  C5    . 5IU D 2 9  ? -3.674  12.707  18.822  1.00 27.39 ? 9   5IU J C5    1 
HETATM 958  C  C6    . 5IU D 2 9  ? -4.990  12.600  18.795  1.00 28.04 ? 9   5IU J C6    1 
HETATM 959  O  O2    . 5IU D 2 9  ? -5.668  11.067  21.815  1.00 25.84 ? 9   5IU J O2    1 
HETATM 960  O  O4    . 5IU D 2 9  ? -1.703  12.268  20.044  1.00 26.13 ? 9   5IU J O4    1 
HETATM 961  I  I5    . 5IU D 2 9  ? -2.603  13.627  17.088  0.40 28.64 ? 9   5IU J I5    1 
HETATM 962  C  "C1'" . 5IU D 2 9  ? -7.153  11.971  19.765  1.00 31.49 ? 9   5IU J "C1'" 1 
HETATM 963  C  "C2'" . 5IU D 2 9  ? -7.817  13.204  20.339  1.00 31.23 ? 9   5IU J "C2'" 1 
HETATM 964  C  "C3'" . 5IU D 2 9  ? -8.138  14.008  19.102  1.00 33.17 ? 9   5IU J "C3'" 1 
HETATM 965  C  "C4'" . 5IU D 2 9  ? -8.465  12.928  18.081  1.00 33.09 ? 9   5IU J "C4'" 1 
HETATM 966  O  "O3'" . 5IU D 2 9  ? -9.265  14.842  19.346  1.00 34.34 ? 9   5IU J "O3'" 1 
HETATM 967  O  "O4'" . 5IU D 2 9  ? -7.563  11.852  18.406  1.00 32.36 ? 9   5IU J "O4'" 1 
HETATM 968  C  "C5'" . 5IU D 2 9  ? -8.273  13.340  16.637  1.00 32.63 ? 9   5IU J "C5'" 1 
HETATM 969  O  "O5'" . 5IU D 2 9  ? -6.980  13.932  16.451  1.00 31.38 ? 9   5IU J "O5'" 1 
HETATM 970  P  P     . 5IU D 2 9  ? -6.581  14.617  15.062  1.00 28.91 ? 9   5IU J P     1 
HETATM 971  O  OP1   . 5IU D 2 9  ? -7.753  15.379  14.593  1.00 26.74 ? 9   5IU J OP1   1 
HETATM 972  O  OP2   . 5IU D 2 9  ? -5.290  15.317  15.248  1.00 29.23 ? 9   5IU J OP2   1 
ATOM   973  P  P     . DG  D 2 10 ? -9.030  16.332  19.872  1.00 37.80 ? 10  DG  J P     1 
ATOM   974  O  OP1   . DG  D 2 10 ? -10.331 17.039  19.839  1.00 35.60 ? 10  DG  J OP1   1 
ATOM   975  O  OP2   . DG  D 2 10 ? -7.875  16.892  19.124  1.00 37.33 ? 10  DG  J OP2   1 
ATOM   976  O  "O5'" . DG  D 2 10 ? -8.548  16.127  21.389  1.00 35.17 ? 10  DG  J "O5'" 1 
ATOM   977  C  "C5'" . DG  D 2 10 ? -9.453  15.709  22.405  1.00 31.62 ? 10  DG  J "C5'" 1 
ATOM   978  C  "C4'" . DG  D 2 10 ? -8.703  15.334  23.665  1.00 29.38 ? 10  DG  J "C4'" 1 
ATOM   979  O  "O4'" . DG  D 2 10 ? -7.754  14.283  23.391  1.00 30.21 ? 10  DG  J "O4'" 1 
ATOM   980  C  "C3'" . DG  D 2 10 ? -7.862  16.420  24.318  1.00 28.58 ? 10  DG  J "C3'" 1 
ATOM   981  O  "O3'" . DG  D 2 10 ? -8.687  17.283  25.103  1.00 29.47 ? 10  DG  J "O3'" 1 
ATOM   982  C  "C2'" . DG  D 2 10 ? -6.961  15.589  25.204  1.00 27.75 ? 10  DG  J "C2'" 1 
ATOM   983  C  "C1'" . DG  D 2 10 ? -6.681  14.372  24.331  1.00 28.55 ? 10  DG  J "C1'" 1 
ATOM   984  N  N9    . DG  D 2 10 ? -5.425  14.485  23.593  1.00 27.38 ? 10  DG  J N9    1 
ATOM   985  C  C8    . DG  D 2 10 ? -5.250  14.847  22.280  1.00 24.80 ? 10  DG  J C8    1 
ATOM   986  N  N7    . DG  D 2 10 ? -3.998  14.851  21.911  1.00 25.52 ? 10  DG  J N7    1 
ATOM   987  C  C5    . DG  D 2 10 ? -3.297  14.478  23.055  1.00 25.49 ? 10  DG  J C5    1 
ATOM   988  C  C6    . DG  D 2 10 ? -1.890  14.310  23.273  1.00 23.67 ? 10  DG  J C6    1 
ATOM   989  O  O6    . DG  D 2 10 ? -0.966  14.441  22.468  1.00 22.06 ? 10  DG  J O6    1 
ATOM   990  N  N1    . DG  D 2 10 ? -1.611  13.933  24.587  1.00 25.32 ? 10  DG  J N1    1 
ATOM   991  C  C2    . DG  D 2 10 ? -2.569  13.718  25.568  1.00 28.71 ? 10  DG  J C2    1 
ATOM   992  N  N2    . DG  D 2 10 ? -2.119  13.327  26.787  1.00 27.27 ? 10  DG  J N2    1 
ATOM   993  N  N3    . DG  D 2 10 ? -3.882  13.866  25.370  1.00 27.11 ? 10  DG  J N3    1 
ATOM   994  C  C4    . DG  D 2 10 ? -4.166  14.249  24.102  1.00 26.98 ? 10  DG  J C4    1 
ATOM   995  P  P     . DT  D 2 11 ? -8.243  18.807  25.377  1.00 33.77 ? 11  DT  J P     1 
ATOM   996  O  OP1   . DT  D 2 11 ? -9.436  19.473  25.945  1.00 32.82 ? 11  DT  J OP1   1 
ATOM   997  O  OP2   . DT  D 2 11 ? -7.571  19.410  24.189  1.00 34.18 ? 11  DT  J OP2   1 
ATOM   998  O  "O5'" . DT  D 2 11 ? -7.142  18.703  26.535  1.00 33.67 ? 11  DT  J "O5'" 1 
ATOM   999  C  "C5'" . DT  D 2 11 ? -7.442  18.055  27.769  1.00 32.62 ? 11  DT  J "C5'" 1 
ATOM   1000 C  "C4'" . DT  D 2 11 ? -6.181  17.764  28.554  1.00 32.59 ? 11  DT  J "C4'" 1 
ATOM   1001 O  "O4'" . DT  D 2 11 ? -5.392  16.707  27.958  1.00 32.82 ? 11  DT  J "O4'" 1 
ATOM   1002 C  "C3'" . DT  D 2 11 ? -5.214  18.926  28.719  1.00 30.40 ? 11  DT  J "C3'" 1 
ATOM   1003 O  "O3'" . DT  D 2 11 ? -5.642  19.774  29.786  1.00 32.03 ? 11  DT  J "O3'" 1 
ATOM   1004 C  "C2'" . DT  D 2 11 ? -3.941  18.204  29.101  1.00 31.36 ? 11  DT  J "C2'" 1 
ATOM   1005 C  "C1'" . DT  D 2 11 ? -4.006  16.963  28.221  1.00 31.44 ? 11  DT  J "C1'" 1 
ATOM   1006 N  N1    . DT  D 2 11 ? -3.315  17.171  26.941  1.00 28.95 ? 11  DT  J N1    1 
ATOM   1007 C  C2    . DT  D 2 11 ? -1.960  16.948  26.933  1.00 28.58 ? 11  DT  J C2    1 
ATOM   1008 O  O2    . DT  D 2 11 ? -1.333  16.586  27.931  1.00 22.47 ? 11  DT  J O2    1 
ATOM   1009 N  N3    . DT  D 2 11 ? -1.356  17.159  25.713  1.00 27.11 ? 11  DT  J N3    1 
ATOM   1010 C  C4    . DT  D 2 11 ? -1.959  17.560  24.539  1.00 28.10 ? 11  DT  J C4    1 
ATOM   1011 O  O4    . DT  D 2 11 ? -1.284  17.698  23.526  1.00 28.57 ? 11  DT  J O4    1 
ATOM   1012 C  C5    . DT  D 2 11 ? -3.388  17.784  24.620  1.00 27.70 ? 11  DT  J C5    1 
ATOM   1013 C  C7    . DT  D 2 11 ? -4.121  18.236  23.394  1.00 26.33 ? 11  DT  J C7    1 
ATOM   1014 C  C6    . DT  D 2 11 ? -3.990  17.577  25.802  1.00 28.49 ? 11  DT  J C6    1 
ATOM   1015 P  P     . DC  D 2 12 ? -5.154  21.306  29.832  1.00 31.59 ? 12  DC  J P     1 
ATOM   1016 O  OP1   . DC  D 2 12 ? -5.708  21.913  31.064  1.00 33.89 ? 12  DC  J OP1   1 
ATOM   1017 O  OP2   . DC  D 2 12 ? -5.439  21.936  28.506  1.00 31.36 ? 12  DC  J OP2   1 
ATOM   1018 O  "O5'" . DC  D 2 12 ? -3.577  21.190  30.046  1.00 33.01 ? 12  DC  J "O5'" 1 
ATOM   1019 C  "C5'" . DC  D 2 12 ? -3.040  20.500  31.174  1.00 32.14 ? 12  DC  J "C5'" 1 
ATOM   1020 C  "C4'" . DC  D 2 12 ? -1.532  20.496  31.105  1.00 32.18 ? 12  DC  J "C4'" 1 
ATOM   1021 O  "O4'" . DC  D 2 12 ? -1.098  19.624  30.045  1.00 34.00 ? 12  DC  J "O4'" 1 
ATOM   1022 C  "C3'" . DC  D 2 12 ? -0.917  21.850  30.777  1.00 33.35 ? 12  DC  J "C3'" 1 
ATOM   1023 O  "O3'" . DC  D 2 12 ? -0.732  22.591  31.983  1.00 35.14 ? 12  DC  J "O3'" 1 
ATOM   1024 C  "C2'" . DC  D 2 12 ? 0.400   21.475  30.120  1.00 33.17 ? 12  DC  J "C2'" 1 
ATOM   1025 C  "C1'" . DC  D 2 12 ? 0.092   20.140  29.450  1.00 31.61 ? 12  DC  J "C1'" 1 
ATOM   1026 N  N1    . DC  D 2 12 ? -0.126  20.235  28.003  1.00 27.47 ? 12  DC  J N1    1 
ATOM   1027 C  C2    . DC  D 2 12 ? 0.962   20.034  27.154  1.00 27.80 ? 12  DC  J C2    1 
ATOM   1028 O  O2    . DC  D 2 12 ? 2.072   19.821  27.658  1.00 25.00 ? 12  DC  J O2    1 
ATOM   1029 N  N3    . DC  D 2 12 ? 0.776   20.086  25.804  1.00 25.63 ? 12  DC  J N3    1 
ATOM   1030 C  C4    . DC  D 2 12 ? -0.438  20.345  25.316  1.00 25.28 ? 12  DC  J C4    1 
ATOM   1031 N  N4    . DC  D 2 12 ? -0.590  20.377  23.981  1.00 26.47 ? 12  DC  J N4    1 
ATOM   1032 C  C5    . DC  D 2 12 ? -1.559  20.576  26.169  1.00 24.34 ? 12  DC  J C5    1 
ATOM   1033 C  C6    . DC  D 2 12 ? -1.360  20.509  27.491  1.00 26.11 ? 12  DC  J C6    1 
ATOM   1034 N  N     . HIS E 3 3  ? -11.643 -8.029  8.522   1.00 41.59 ? 26  HIS A N     1 
ATOM   1035 C  CA    . HIS E 3 3  ? -10.493 -8.328  7.604   1.00 43.33 ? 26  HIS A CA    1 
ATOM   1036 C  C     . HIS E 3 3  ? -9.854  -9.664  7.932   1.00 43.41 ? 26  HIS A C     1 
ATOM   1037 O  O     . HIS E 3 3  ? -8.625  -9.766  7.992   1.00 44.77 ? 26  HIS A O     1 
ATOM   1038 C  CB    . HIS E 3 3  ? -9.384  -7.278  7.717   1.00 43.57 ? 26  HIS A CB    1 
ATOM   1039 C  CG    . HIS E 3 3  ? -9.828  -5.893  7.400   1.00 44.41 ? 26  HIS A CG    1 
ATOM   1040 N  ND1   . HIS E 3 3  ? -9.985  -5.441  6.109   1.00 45.27 ? 26  HIS A ND1   1 
ATOM   1041 C  CD2   . HIS E 3 3  ? -10.189 -4.871  8.210   1.00 44.59 ? 26  HIS A CD2   1 
ATOM   1042 C  CE1   . HIS E 3 3  ? -10.426 -4.197  6.136   1.00 47.40 ? 26  HIS A CE1   1 
ATOM   1043 N  NE2   . HIS E 3 3  ? -10.558 -3.827  7.399   1.00 47.47 ? 26  HIS A NE2   1 
ATOM   1044 N  N     . MET E 3 4  ? -10.665 -10.683 8.167   1.00 42.60 ? 27  MET A N     1 
ATOM   1045 C  CA    . MET E 3 4  ? -10.110 -11.982 8.465   1.00 40.66 ? 27  MET A CA    1 
ATOM   1046 C  C     . MET E 3 4  ? -10.414 -12.929 7.310   1.00 38.51 ? 27  MET A C     1 
ATOM   1047 O  O     . MET E 3 4  ? -11.570 -13.221 7.003   1.00 36.70 ? 27  MET A O     1 
ATOM   1048 C  CB    . MET E 3 4  ? -10.676 -12.490 9.789   1.00 42.38 ? 27  MET A CB    1 
ATOM   1049 C  CG    . MET E 3 4  ? -10.245 -11.612 10.935  1.00 45.76 ? 27  MET A CG    1 
ATOM   1050 S  SD    . MET E 3 4  ? -10.657 -12.217 12.573  1.00 51.46 ? 27  MET A SD    1 
ATOM   1051 C  CE    . MET E 3 4  ? -10.511 -10.666 13.561  1.00 50.10 ? 27  MET A CE    1 
ATOM   1052 N  N     . PHE E 3 5  ? -9.358  -13.374 6.644   1.00 35.91 ? 28  PHE A N     1 
ATOM   1053 C  CA    . PHE E 3 5  ? -9.506  -14.289 5.531   1.00 34.18 ? 28  PHE A CA    1 
ATOM   1054 C  C     . PHE E 3 5  ? -8.778  -15.596 5.829   1.00 32.18 ? 28  PHE A C     1 
ATOM   1055 O  O     . PHE E 3 5  ? -7.571  -15.599 6.102   1.00 32.25 ? 28  PHE A O     1 
ATOM   1056 C  CB    . PHE E 3 5  ? -8.982  -13.618 4.265   1.00 34.82 ? 28  PHE A CB    1 
ATOM   1057 C  CG    . PHE E 3 5  ? -9.804  -12.436 3.846   1.00 34.42 ? 28  PHE A CG    1 
ATOM   1058 C  CD1   . PHE E 3 5  ? -11.074 -12.619 3.328   1.00 35.22 ? 28  PHE A CD1   1 
ATOM   1059 C  CD2   . PHE E 3 5  ? -9.330  -11.148 4.021   1.00 35.67 ? 28  PHE A CD2   1 
ATOM   1060 C  CE1   . PHE E 3 5  ? -11.866 -11.542 2.989   1.00 35.64 ? 28  PHE A CE1   1 
ATOM   1061 C  CE2   . PHE E 3 5  ? -10.112 -10.052 3.685   1.00 37.02 ? 28  PHE A CE2   1 
ATOM   1062 C  CZ    . PHE E 3 5  ? -11.384 -10.252 3.169   1.00 37.58 ? 28  PHE A CZ    1 
ATOM   1063 N  N     . TYR E 3 6  ? -9.508  -16.706 5.811   1.00 29.34 ? 29  TYR A N     1 
ATOM   1064 C  CA    . TYR E 3 6  ? -8.856  -17.981 6.111   1.00 29.29 ? 29  TYR A CA    1 
ATOM   1065 C  C     . TYR E 3 6  ? -8.764  -18.807 4.857   1.00 28.30 ? 29  TYR A C     1 
ATOM   1066 O  O     . TYR E 3 6  ? -9.761  -19.260 4.315   1.00 27.15 ? 29  TYR A O     1 
ATOM   1067 C  CB    . TYR E 3 6  ? -9.604  -18.746 7.206   1.00 26.74 ? 29  TYR A CB    1 
ATOM   1068 C  CG    . TYR E 3 6  ? -9.746  -17.962 8.511   1.00 25.12 ? 29  TYR A CG    1 
ATOM   1069 C  CD1   . TYR E 3 6  ? -10.692 -16.948 8.634   1.00 24.10 ? 29  TYR A CD1   1 
ATOM   1070 C  CD2   . TYR E 3 6  ? -8.951  -18.247 9.612   1.00 23.45 ? 29  TYR A CD2   1 
ATOM   1071 C  CE1   . TYR E 3 6  ? -10.847 -16.233 9.826   1.00 22.41 ? 29  TYR A CE1   1 
ATOM   1072 C  CE2   . TYR E 3 6  ? -9.097  -17.538 10.807  1.00 23.01 ? 29  TYR A CE2   1 
ATOM   1073 C  CZ    . TYR E 3 6  ? -10.048 -16.534 10.898  1.00 19.92 ? 29  TYR A CZ    1 
ATOM   1074 O  OH    . TYR E 3 6  ? -10.193 -15.823 12.051  1.00 18.38 ? 29  TYR A OH    1 
ATOM   1075 N  N     . ALA E 3 7  ? -7.543  -18.986 4.388   1.00 28.16 ? 30  ALA A N     1 
ATOM   1076 C  CA    . ALA E 3 7  ? -7.338  -19.756 3.183   1.00 29.00 ? 30  ALA A CA    1 
ATOM   1077 C  C     . ALA E 3 7  ? -7.227  -21.235 3.521   1.00 29.15 ? 30  ALA A C     1 
ATOM   1078 O  O     . ALA E 3 7  ? -6.434  -21.619 4.354   1.00 29.59 ? 30  ALA A O     1 
ATOM   1079 C  CB    . ALA E 3 7  ? -6.071  -19.274 2.479   1.00 28.09 ? 30  ALA A CB    1 
ATOM   1080 N  N     . VAL E 3 8  ? -8.039  -22.060 2.875   1.00 31.34 ? 31  VAL A N     1 
ATOM   1081 C  CA    . VAL E 3 8  ? -7.979  -23.499 3.096   1.00 30.74 ? 31  VAL A CA    1 
ATOM   1082 C  C     . VAL E 3 8  ? -7.410  -24.162 1.841   1.00 30.61 ? 31  VAL A C     1 
ATOM   1083 O  O     . VAL E 3 8  ? -8.138  -24.465 0.900   1.00 29.67 ? 31  VAL A O     1 
ATOM   1084 C  CB    . VAL E 3 8  ? -9.372  -24.068 3.397   1.00 30.14 ? 31  VAL A CB    1 
ATOM   1085 C  CG1   . VAL E 3 8  ? -9.299  -25.577 3.572   1.00 31.24 ? 31  VAL A CG1   1 
ATOM   1086 C  CG2   . VAL E 3 8  ? -9.935  -23.417 4.660   1.00 30.92 ? 31  VAL A CG2   1 
ATOM   1087 N  N     . ARG E 3 9  ? -6.101  -24.375 1.829   1.00 31.07 ? 32  ARG A N     1 
ATOM   1088 C  CA    . ARG E 3 9  ? -5.422  -25.023 0.699   1.00 30.97 ? 32  ARG A CA    1 
ATOM   1089 C  C     . ARG E 3 9  ? -5.629  -26.547 0.667   1.00 30.62 ? 32  ARG A C     1 
ATOM   1090 O  O     . ARG E 3 9  ? -5.820  -27.150 -0.389  1.00 29.19 ? 32  ARG A O     1 
ATOM   1091 C  CB    . ARG E 3 9  ? -3.939  -24.713 0.782   1.00 31.83 ? 32  ARG A CB    1 
ATOM   1092 C  CG    . ARG E 3 9  ? -3.133  -25.423 -0.233  1.00 32.68 ? 32  ARG A CG    1 
ATOM   1093 C  CD    . ARG E 3 9  ? -1.716  -24.931 -0.249  1.00 33.04 ? 32  ARG A CD    1 
ATOM   1094 N  NE    . ARG E 3 9  ? -0.976  -25.716 -1.217  1.00 35.00 ? 32  ARG A NE    1 
ATOM   1095 C  CZ    . ARG E 3 9  ? -1.233  -25.717 -2.520  1.00 37.90 ? 32  ARG A CZ    1 
ATOM   1096 N  NH1   . ARG E 3 9  ? -0.512  -26.476 -3.333  1.00 39.62 ? 32  ARG A NH1   1 
ATOM   1097 N  NH2   . ARG E 3 9  ? -2.195  -24.944 -3.018  1.00 35.54 ? 32  ARG A NH2   1 
ATOM   1098 N  N     . ARG E 3 10 ? -5.590  -27.156 1.847   1.00 32.26 ? 33  ARG A N     1 
ATOM   1099 C  CA    . ARG E 3 10 ? -5.785  -28.596 2.025   1.00 32.77 ? 33  ARG A CA    1 
ATOM   1100 C  C     . ARG E 3 10 ? -6.778  -28.828 3.175   1.00 32.67 ? 33  ARG A C     1 
ATOM   1101 O  O     . ARG E 3 10 ? -6.469  -28.582 4.344   1.00 32.71 ? 33  ARG A O     1 
ATOM   1102 C  CB    . ARG E 3 10 ? -4.449  -29.261 2.344   1.00 34.89 ? 33  ARG A CB    1 
ATOM   1103 C  CG    . ARG E 3 10 ? -3.847  -30.018 1.179   1.00 41.18 ? 33  ARG A CG    1 
ATOM   1104 C  CD    . ARG E 3 10 ? -4.596  -31.343 0.931   1.00 44.72 ? 33  ARG A CD    1 
ATOM   1105 N  NE    . ARG E 3 10 ? -4.418  -32.285 2.039   1.00 49.54 ? 33  ARG A NE    1 
ATOM   1106 C  CZ    . ARG E 3 10 ? -4.809  -33.558 2.022   1.00 50.42 ? 33  ARG A CZ    1 
ATOM   1107 N  NH1   . ARG E 3 10 ? -5.411  -34.060 0.947   1.00 50.82 ? 33  ARG A NH1   1 
ATOM   1108 N  NH2   . ARG E 3 10 ? -4.591  -34.334 3.081   1.00 51.02 ? 33  ARG A NH2   1 
ATOM   1109 N  N     . GLY E 3 11 ? -7.969  -29.302 2.843   1.00 31.37 ? 34  GLY A N     1 
ATOM   1110 C  CA    . GLY E 3 11 ? -8.978  -29.529 3.863   1.00 30.45 ? 34  GLY A CA    1 
ATOM   1111 C  C     . GLY E 3 11 ? -10.231 -30.110 3.254   1.00 30.06 ? 34  GLY A C     1 
ATOM   1112 O  O     . GLY E 3 11 ? -10.224 -30.486 2.085   1.00 29.20 ? 34  GLY A O     1 
ATOM   1113 N  N     . ARG E 3 12 ? -11.307 -30.201 4.025   1.00 30.57 ? 35  ARG A N     1 
ATOM   1114 C  CA    . ARG E 3 12 ? -12.535 -30.790 3.499   1.00 31.88 ? 35  ARG A CA    1 
ATOM   1115 C  C     . ARG E 3 12 ? -12.979 -30.043 2.239   1.00 32.13 ? 35  ARG A C     1 
ATOM   1116 O  O     . ARG E 3 12 ? -13.320 -30.630 1.207   1.00 33.13 ? 35  ARG A O     1 
ATOM   1117 C  CB    . ARG E 3 12 ? -13.613 -30.803 4.592   1.00 31.54 ? 35  ARG A CB    1 
ATOM   1118 C  CG    . ARG E 3 12 ? -13.239 -31.782 5.725   1.00 30.67 ? 35  ARG A CG    1 
ATOM   1119 C  CD    . ARG E 3 12 ? -14.366 -32.052 6.738   1.00 29.16 ? 35  ARG A CD    1 
ATOM   1120 N  NE    . ARG E 3 12 ? -13.879 -33.005 7.727   1.00 28.07 ? 35  ARG A NE    1 
ATOM   1121 C  CZ    . ARG E 3 12 ? -13.125 -32.683 8.776   1.00 28.97 ? 35  ARG A CZ    1 
ATOM   1122 N  NH1   . ARG E 3 12 ? -12.785 -31.415 9.017   1.00 26.63 ? 35  ARG A NH1   1 
ATOM   1123 N  NH2   . ARG E 3 12 ? -12.628 -33.648 9.534   1.00 30.04 ? 35  ARG A NH2   1 
ATOM   1124 N  N     . LYS E 3 13 ? -12.948 -28.734 2.335   1.00 33.34 ? 36  LYS A N     1 
ATOM   1125 C  CA    . LYS E 3 13 ? -13.266 -27.890 1.216   1.00 35.02 ? 36  LYS A CA    1 
ATOM   1126 C  C     . LYS E 3 13 ? -12.131 -26.874 1.189   1.00 34.62 ? 36  LYS A C     1 
ATOM   1127 O  O     . LYS E 3 13 ? -11.714 -26.361 2.245   1.00 33.52 ? 36  LYS A O     1 
ATOM   1128 C  CB    . LYS E 3 13 ? -14.623 -27.214 1.419   1.00 35.38 ? 36  LYS A CB    1 
ATOM   1129 C  CG    . LYS E 3 13 ? -15.801 -28.130 1.147   1.00 38.98 ? 36  LYS A CG    1 
ATOM   1130 C  CD    . LYS E 3 13 ? -17.124 -27.444 1.460   1.00 42.10 ? 36  LYS A CD    1 
ATOM   1131 C  CE    . LYS E 3 13 ? -17.236 -27.145 2.952   1.00 44.77 ? 36  LYS A CE    1 
ATOM   1132 N  NZ    . LYS E 3 13 ? -18.424 -26.315 3.296   1.00 47.43 ? 36  LYS A NZ    1 
ATOM   1133 N  N     . THR E 3 14 ? -11.604 -26.639 -0.010  1.00 32.96 ? 37  THR A N     1 
ATOM   1134 C  CA    . THR E 3 14 ? -10.530 -25.673 -0.230  1.00 33.01 ? 37  THR A CA    1 
ATOM   1135 C  C     . THR E 3 14 ? -11.203 -24.295 -0.483  1.00 32.01 ? 37  THR A C     1 
ATOM   1136 O  O     . THR E 3 14 ? -12.375 -24.233 -0.800  1.00 29.87 ? 37  THR A O     1 
ATOM   1137 C  CB    . THR E 3 14 ? -9.679  -26.103 -1.468  1.00 34.86 ? 37  THR A CB    1 
ATOM   1138 O  OG1   . THR E 3 14 ? -8.499  -25.291 -1.574  1.00 37.94 ? 37  THR A OG1   1 
ATOM   1139 C  CG2   . THR E 3 14 ? -10.501 -25.974 -2.746  1.00 34.94 ? 37  THR A CG2   1 
ATOM   1140 N  N     . GLY E 3 15 ? -10.483 -23.194 -0.326  1.00 32.43 ? 38  GLY A N     1 
ATOM   1141 C  CA    . GLY E 3 15 ? -11.111 -21.915 -0.580  1.00 34.18 ? 38  GLY A CA    1 
ATOM   1142 C  C     . GLY E 3 15 ? -10.795 -20.869 0.458   1.00 36.21 ? 38  GLY A C     1 
ATOM   1143 O  O     . GLY E 3 15 ? -9.839  -21.012 1.231   1.00 36.79 ? 38  GLY A O     1 
ATOM   1144 N  N     . VAL E 3 16 ? -11.588 -19.801 0.475   1.00 35.76 ? 39  VAL A N     1 
ATOM   1145 C  CA    . VAL E 3 16 ? -11.360 -18.747 1.442   1.00 34.29 ? 39  VAL A CA    1 
ATOM   1146 C  C     . VAL E 3 16 ? -12.590 -18.648 2.323   1.00 34.20 ? 39  VAL A C     1 
ATOM   1147 O  O     . VAL E 3 16 ? -13.717 -18.740 1.847   1.00 34.66 ? 39  VAL A O     1 
ATOM   1148 C  CB    . VAL E 3 16 ? -11.081 -17.394 0.751   1.00 35.37 ? 39  VAL A CB    1 
ATOM   1149 C  CG1   . VAL E 3 16 ? -10.692 -16.359 1.789   1.00 32.64 ? 39  VAL A CG1   1 
ATOM   1150 C  CG2   . VAL E 3 16 ? -9.943  -17.558 -0.265  1.00 34.50 ? 39  VAL A CG2   1 
ATOM   1151 N  N     . PHE E 3 17 ? -12.359 -18.499 3.617   1.00 32.33 ? 40  PHE A N     1 
ATOM   1152 C  CA    . PHE E 3 17 ? -13.442 -18.394 4.577   1.00 32.43 ? 40  PHE A CA    1 
ATOM   1153 C  C     . PHE E 3 17 ? -13.240 -17.132 5.399   1.00 29.02 ? 40  PHE A C     1 
ATOM   1154 O  O     . PHE E 3 17 ? -12.116 -16.675 5.579   1.00 30.99 ? 40  PHE A O     1 
ATOM   1155 C  CB    . PHE E 3 17 ? -13.456 -19.642 5.458   1.00 32.32 ? 40  PHE A CB    1 
ATOM   1156 C  CG    . PHE E 3 17 ? -13.755 -20.900 4.694   1.00 31.62 ? 40  PHE A CG    1 
ATOM   1157 C  CD1   . PHE E 3 17 ? -15.063 -21.351 4.562   1.00 31.21 ? 40  PHE A CD1   1 
ATOM   1158 C  CD2   . PHE E 3 17 ? -12.739 -21.602 4.055   1.00 31.61 ? 40  PHE A CD2   1 
ATOM   1159 C  CE1   . PHE E 3 17 ? -15.357 -22.482 3.803   1.00 30.95 ? 40  PHE A CE1   1 
ATOM   1160 C  CE2   . PHE E 3 17 ? -13.027 -22.735 3.295   1.00 29.79 ? 40  PHE A CE2   1 
ATOM   1161 C  CZ    . PHE E 3 17 ? -14.336 -23.171 3.171   1.00 31.02 ? 40  PHE A CZ    1 
ATOM   1162 N  N     . LEU E 3 18 ? -14.338 -16.582 5.892   1.00 27.18 ? 41  LEU A N     1 
ATOM   1163 C  CA    . LEU E 3 18 ? -14.319 -15.352 6.667   1.00 24.64 ? 41  LEU A CA    1 
ATOM   1164 C  C     . LEU E 3 18 ? -14.285 -15.496 8.179   1.00 23.19 ? 41  LEU A C     1 
ATOM   1165 O  O     . LEU E 3 18 ? -14.080 -14.512 8.879   1.00 23.86 ? 41  LEU A O     1 
ATOM   1166 C  CB    . LEU E 3 18 ? -15.537 -14.510 6.315   1.00 25.41 ? 41  LEU A CB    1 
ATOM   1167 C  CG    . LEU E 3 18 ? -15.846 -14.241 4.847   1.00 25.35 ? 41  LEU A CG    1 
ATOM   1168 C  CD1   . LEU E 3 18 ? -17.013 -13.301 4.799   1.00 23.55 ? 41  LEU A CD1   1 
ATOM   1169 C  CD2   . LEU E 3 18 ? -14.639 -13.648 4.142   1.00 22.78 ? 41  LEU A CD2   1 
ATOM   1170 N  N     . THR E 3 19 ? -14.522 -16.690 8.694   1.00 22.35 ? 42  THR A N     1 
ATOM   1171 C  CA    . THR E 3 19 ? -14.512 -16.865 10.147  1.00 24.44 ? 42  THR A CA    1 
ATOM   1172 C  C     . THR E 3 19 ? -13.764 -18.119 10.498  1.00 21.86 ? 42  THR A C     1 
ATOM   1173 O  O     . THR E 3 19 ? -13.764 -19.091 9.734   1.00 23.35 ? 42  THR A O     1 
ATOM   1174 C  CB    . THR E 3 19 ? -15.936 -17.010 10.747  1.00 25.59 ? 42  THR A CB    1 
ATOM   1175 O  OG1   . THR E 3 19 ? -16.518 -18.233 10.289  1.00 28.16 ? 42  THR A OG1   1 
ATOM   1176 C  CG2   . THR E 3 19 ? -16.826 -15.826 10.357  1.00 28.38 ? 42  THR A CG2   1 
ATOM   1177 N  N     . TRP E 3 20 ? -13.130 -18.105 11.655  1.00 20.45 ? 43  TRP A N     1 
ATOM   1178 C  CA    . TRP E 3 20 ? -12.395 -19.269 12.093  1.00 21.87 ? 43  TRP A CA    1 
ATOM   1179 C  C     . TRP E 3 20 ? -13.282 -20.492 12.289  1.00 21.29 ? 43  TRP A C     1 
ATOM   1180 O  O     . TRP E 3 20 ? -12.840 -21.593 12.022  1.00 23.62 ? 43  TRP A O     1 
ATOM   1181 C  CB    . TRP E 3 20 ? -11.632 -18.973 13.385  1.00 22.56 ? 43  TRP A CB    1 
ATOM   1182 C  CG    . TRP E 3 20 ? -11.063 -20.235 14.032  1.00 24.52 ? 43  TRP A CG    1 
ATOM   1183 C  CD1   . TRP E 3 20 ? -11.321 -20.693 15.302  1.00 24.43 ? 43  TRP A CD1   1 
ATOM   1184 C  CD2   . TRP E 3 20 ? -10.131 -21.162 13.459  1.00 22.22 ? 43  TRP A CD2   1 
ATOM   1185 N  NE1   . TRP E 3 20 ? -10.603 -21.835 15.549  1.00 22.43 ? 43  TRP A NE1   1 
ATOM   1186 C  CE2   . TRP E 3 20 ? -9.863  -22.146 14.442  1.00 21.53 ? 43  TRP A CE2   1 
ATOM   1187 C  CE3   . TRP E 3 20 ? -9.494  -21.256 12.216  1.00 23.86 ? 43  TRP A CE3   1 
ATOM   1188 C  CZ2   . TRP E 3 20 ? -8.982  -23.208 14.224  1.00 22.67 ? 43  TRP A CZ2   1 
ATOM   1189 C  CZ3   . TRP E 3 20 ? -8.607  -22.328 11.996  1.00 24.43 ? 43  TRP A CZ3   1 
ATOM   1190 C  CH2   . TRP E 3 20 ? -8.364  -23.286 13.001  1.00 22.98 ? 43  TRP A CH2   1 
ATOM   1191 N  N     . ASN E 3 21 ? -14.525 -20.319 12.755  1.00 24.93 ? 44  ASN A N     1 
ATOM   1192 C  CA    . ASN E 3 21 ? -15.409 -21.468 12.961  1.00 24.78 ? 44  ASN A CA    1 
ATOM   1193 C  C     . ASN E 3 21 ? -15.598 -22.197 11.624  1.00 27.27 ? 44  ASN A C     1 
ATOM   1194 O  O     . ASN E 3 21 ? -15.586 -23.432 11.581  1.00 28.35 ? 44  ASN A O     1 
ATOM   1195 C  CB    . ASN E 3 21 ? -16.794 -21.053 13.513  1.00 25.46 ? 44  ASN A CB    1 
ATOM   1196 C  CG    . ASN E 3 21 ? -16.795 -20.744 15.041  1.00 24.21 ? 44  ASN A CG    1 
ATOM   1197 O  OD1   . ASN E 3 21 ? -16.196 -21.451 15.856  1.00 26.17 ? 44  ASN A OD1   1 
ATOM   1198 N  ND2   . ASN E 3 21 ? -17.507 -19.708 15.411  1.00 23.55 ? 44  ASN A ND2   1 
ATOM   1199 N  N     . GLU E 3 22 ? -15.779 -21.435 10.543  1.00 27.41 ? 45  GLU A N     1 
ATOM   1200 C  CA    . GLU E 3 22 ? -15.947 -22.011 9.204   1.00 29.60 ? 45  GLU A CA    1 
ATOM   1201 C  C     . GLU E 3 22 ? -14.728 -22.790 8.738   1.00 28.62 ? 45  GLU A C     1 
ATOM   1202 O  O     . GLU E 3 22 ? -14.831 -23.932 8.313   1.00 30.36 ? 45  GLU A O     1 
ATOM   1203 C  CB    . GLU E 3 22 ? -16.211 -20.923 8.183   1.00 31.86 ? 45  GLU A CB    1 
ATOM   1204 C  CG    . GLU E 3 22 ? -17.661 -20.640 7.930   1.00 35.60 ? 45  GLU A CG    1 
ATOM   1205 C  CD    . GLU E 3 22 ? -17.915 -19.154 7.887   1.00 36.12 ? 45  GLU A CD    1 
ATOM   1206 O  OE1   . GLU E 3 22 ? -17.338 -18.469 7.021   1.00 37.35 ? 45  GLU A OE1   1 
ATOM   1207 O  OE2   . GLU E 3 22 ? -18.681 -18.669 8.739   1.00 41.45 ? 45  GLU A OE2   1 
ATOM   1208 N  N     . CYS E 3 23 ? -13.574 -22.147 8.811   1.00 27.74 ? 46  CYS A N     1 
ATOM   1209 C  CA    . CYS E 3 23 ? -12.315 -22.757 8.416   1.00 27.38 ? 46  CYS A CA    1 
ATOM   1210 C  C     . CYS E 3 23 ? -12.034 -23.985 9.292   1.00 29.27 ? 46  CYS A C     1 
ATOM   1211 O  O     . CYS E 3 23 ? -11.593 -25.042 8.820   1.00 29.29 ? 46  CYS A O     1 
ATOM   1212 C  CB    . CYS E 3 23 ? -11.215 -21.720 8.573   1.00 25.41 ? 46  CYS A CB    1 
ATOM   1213 S  SG    . CYS E 3 23 ? -9.555  -22.299 8.418   1.00 26.55 ? 46  CYS A SG    1 
ATOM   1214 N  N     . ARG E 3 24 ? -12.300 -23.834 10.579  1.00 28.47 ? 47  ARG A N     1 
ATOM   1215 C  CA    . ARG E 3 24 ? -12.075 -24.914 11.512  1.00 28.43 ? 47  ARG A CA    1 
ATOM   1216 C  C     . ARG E 3 24 ? -12.835 -26.185 11.128  1.00 26.30 ? 47  ARG A C     1 
ATOM   1217 O  O     . ARG E 3 24 ? -12.295 -27.283 11.194  1.00 26.22 ? 47  ARG A O     1 
ATOM   1218 C  CB    . ARG E 3 24 ? -12.479 -24.470 12.909  1.00 27.71 ? 47  ARG A CB    1 
ATOM   1219 C  CG    . ARG E 3 24 ? -12.156 -25.491 13.929  1.00 29.54 ? 47  ARG A CG    1 
ATOM   1220 C  CD    . ARG E 3 24 ? -12.390 -24.980 15.318  1.00 30.12 ? 47  ARG A CD    1 
ATOM   1221 N  NE    . ARG E 3 24 ? -12.373 -26.103 16.242  1.00 32.38 ? 47  ARG A NE    1 
ATOM   1222 C  CZ    . ARG E 3 24 ? -12.531 -25.997 17.558  1.00 33.16 ? 47  ARG A CZ    1 
ATOM   1223 N  NH1   . ARG E 3 24 ? -12.706 -24.797 18.114  1.00 29.54 ? 47  ARG A NH1   1 
ATOM   1224 N  NH2   . ARG E 3 24 ? -12.554 -27.101 18.300  1.00 28.93 ? 47  ARG A NH2   1 
ATOM   1225 N  N     . ALA E 3 25 ? -14.085 -26.038 10.713  1.00 26.33 ? 48  ALA A N     1 
ATOM   1226 C  CA    . ALA E 3 25 ? -14.882 -27.202 10.342  1.00 24.83 ? 48  ALA A CA    1 
ATOM   1227 C  C     . ALA E 3 25 ? -14.349 -27.915 9.107   1.00 24.94 ? 48  ALA A C     1 
ATOM   1228 O  O     . ALA E 3 25 ? -14.721 -29.057 8.860   1.00 25.34 ? 48  ALA A O     1 
ATOM   1229 C  CB    . ALA E 3 25 ? -16.340 -26.800 10.127  1.00 25.07 ? 48  ALA A CB    1 
ATOM   1230 N  N     . GLN E 3 26 ? -13.481 -27.260 8.333   1.00 26.00 ? 49  GLN A N     1 
ATOM   1231 C  CA    . GLN E 3 26 ? -12.907 -27.909 7.143   1.00 26.68 ? 49  GLN A CA    1 
ATOM   1232 C  C     . GLN E 3 26 ? -11.533 -28.536 7.446   1.00 25.97 ? 49  GLN A C     1 
ATOM   1233 O  O     . GLN E 3 26 ? -11.115 -29.481 6.775   1.00 25.55 ? 49  GLN A O     1 
ATOM   1234 C  CB    . GLN E 3 26 ? -12.704 -26.913 5.981   1.00 26.72 ? 49  GLN A CB    1 
ATOM   1235 C  CG    . GLN E 3 26 ? -13.789 -25.876 5.735   1.00 27.64 ? 49  GLN A CG    1 
ATOM   1236 C  CD    . GLN E 3 26 ? -15.120 -26.466 5.370   1.00 27.20 ? 49  GLN A CD    1 
ATOM   1237 O  OE1   . GLN E 3 26 ? -15.205 -27.575 4.871   1.00 30.24 ? 49  GLN A OE1   1 
ATOM   1238 N  NE2   . GLN E 3 26 ? -16.176 -25.705 5.596   1.00 28.57 ? 49  GLN A NE2   1 
ATOM   1239 N  N     . VAL E 3 27 ? -10.816 -27.996 8.431   1.00 24.70 ? 50  VAL A N     1 
ATOM   1240 C  CA    . VAL E 3 27 ? -9.488  -28.522 8.749   1.00 24.72 ? 50  VAL A CA    1 
ATOM   1241 C  C     . VAL E 3 27 ? -9.284  -29.309 10.043  1.00 27.32 ? 50  VAL A C     1 
ATOM   1242 O  O     . VAL E 3 27 ? -8.261  -29.991 10.186  1.00 27.88 ? 50  VAL A O     1 
ATOM   1243 C  CB    . VAL E 3 27 ? -8.448  -27.422 8.734   1.00 22.35 ? 50  VAL A CB    1 
ATOM   1244 C  CG1   . VAL E 3 27 ? -8.523  -26.680 7.410   1.00 23.09 ? 50  VAL A CG1   1 
ATOM   1245 C  CG2   . VAL E 3 27 ? -8.664  -26.485 9.899   1.00 20.81 ? 50  VAL A CG2   1 
ATOM   1246 N  N     . ASP E 3 28 ? -10.219 -29.218 10.988  1.00 28.78 ? 51  ASP A N     1 
ATOM   1247 C  CA    . ASP E 3 28 ? -10.063 -29.952 12.237  1.00 30.15 ? 51  ASP A CA    1 
ATOM   1248 C  C     . ASP E 3 28 ? -10.221 -31.449 12.022  1.00 31.46 ? 51  ASP A C     1 
ATOM   1249 O  O     . ASP E 3 28 ? -11.200 -31.906 11.413  1.00 31.20 ? 51  ASP A O     1 
ATOM   1250 C  CB    . ASP E 3 28 ? -11.048 -29.447 13.292  1.00 32.47 ? 51  ASP A CB    1 
ATOM   1251 C  CG    . ASP E 3 28 ? -10.344 -28.772 14.471  1.00 35.50 ? 51  ASP A CG    1 
ATOM   1252 O  OD1   . ASP E 3 28 ? -10.369 -29.344 15.578  1.00 39.23 ? 51  ASP A OD1   1 
ATOM   1253 O  OD2   . ASP E 3 28 ? -9.754  -27.677 14.303  1.00 35.71 ? 51  ASP A OD2   1 
ATOM   1254 N  N     . ARG E 3 29 ? -9.237  -32.202 12.518  1.00 30.75 ? 52  ARG A N     1 
ATOM   1255 C  CA    . ARG E 3 29 ? -9.210  -33.659 12.383  1.00 32.99 ? 52  ARG A CA    1 
ATOM   1256 C  C     . ARG E 3 29 ? -9.049  -34.118 10.944  1.00 32.42 ? 52  ARG A C     1 
ATOM   1257 O  O     . ARG E 3 29 ? -9.333  -35.266 10.622  1.00 32.08 ? 52  ARG A O     1 
ATOM   1258 C  CB    . ARG E 3 29 ? -10.472 -34.288 12.959  1.00 34.84 ? 52  ARG A CB    1 
ATOM   1259 C  CG    . ARG E 3 29 ? -10.471 -34.392 14.456  1.00 40.67 ? 52  ARG A CG    1 
ATOM   1260 C  CD    . ARG E 3 29 ? -11.887 -34.323 14.974  1.00 44.92 ? 52  ARG A CD    1 
ATOM   1261 N  NE    . ARG E 3 29 ? -12.451 -33.000 14.703  1.00 49.81 ? 52  ARG A NE    1 
ATOM   1262 C  CZ    . ARG E 3 29 ? -13.407 -32.750 13.810  1.00 50.34 ? 52  ARG A CZ    1 
ATOM   1263 N  NH1   . ARG E 3 29 ? -13.847 -31.509 13.641  1.00 50.15 ? 52  ARG A NH1   1 
ATOM   1264 N  NH2   . ARG E 3 29 ? -13.934 -33.740 13.100  1.00 51.48 ? 52  ARG A NH2   1 
ATOM   1265 N  N     . PHE E 3 30 ? -8.596  -33.219 10.076  1.00 31.16 ? 53  PHE A N     1 
ATOM   1266 C  CA    . PHE E 3 30 ? -8.380  -33.580 8.685   1.00 27.86 ? 53  PHE A CA    1 
ATOM   1267 C  C     . PHE E 3 30 ? -6.889  -33.816 8.462   1.00 27.46 ? 53  PHE A C     1 
ATOM   1268 O  O     . PHE E 3 30 ? -6.066  -32.974 8.795   1.00 28.07 ? 53  PHE A O     1 
ATOM   1269 C  CB    . PHE E 3 30 ? -8.893  -32.465 7.785   1.00 27.87 ? 53  PHE A CB    1 
ATOM   1270 C  CG    . PHE E 3 30 ? -8.827  -32.784 6.325   1.00 24.70 ? 53  PHE A CG    1 
ATOM   1271 C  CD1   . PHE E 3 30 ? -7.670  -32.552 5.603   1.00 26.67 ? 53  PHE A CD1   1 
ATOM   1272 C  CD2   . PHE E 3 30 ? -9.938  -33.272 5.661   1.00 25.27 ? 53  PHE A CD2   1 
ATOM   1273 C  CE1   . PHE E 3 30 ? -7.630  -32.798 4.224   1.00 25.67 ? 53  PHE A CE1   1 
ATOM   1274 C  CE2   . PHE E 3 30 ? -9.903  -33.516 4.291   1.00 23.53 ? 53  PHE A CE2   1 
ATOM   1275 C  CZ    . PHE E 3 30 ? -8.747  -33.276 3.583   1.00 24.32 ? 53  PHE A CZ    1 
ATOM   1276 N  N     . PRO E 3 31 ? -6.517  -34.979 7.904   1.00 27.84 ? 54  PRO A N     1 
ATOM   1277 C  CA    . PRO E 3 31 ? -5.094  -35.237 7.683   1.00 27.82 ? 54  PRO A CA    1 
ATOM   1278 C  C     . PRO E 3 31 ? -4.346  -34.306 6.737   1.00 28.47 ? 54  PRO A C     1 
ATOM   1279 O  O     . PRO E 3 31 ? -4.797  -34.015 5.630   1.00 28.91 ? 54  PRO A O     1 
ATOM   1280 C  CB    . PRO E 3 31 ? -5.062  -36.706 7.224   1.00 27.84 ? 54  PRO A CB    1 
ATOM   1281 C  CG    . PRO E 3 31 ? -6.474  -37.011 6.816   1.00 28.65 ? 54  PRO A CG    1 
ATOM   1282 C  CD    . PRO E 3 31 ? -7.300  -36.219 7.771   1.00 28.35 ? 54  PRO A CD    1 
ATOM   1283 N  N     . ALA E 3 32 ? -3.193  -33.838 7.201   1.00 27.28 ? 55  ALA A N     1 
ATOM   1284 C  CA    . ALA E 3 32 ? -2.343  -32.963 6.413   1.00 27.78 ? 55  ALA A CA    1 
ATOM   1285 C  C     . ALA E 3 32 ? -3.023  -31.656 6.007   1.00 27.83 ? 55  ALA A C     1 
ATOM   1286 O  O     . ALA E 3 32 ? -2.647  -31.042 5.003   1.00 26.53 ? 55  ALA A O     1 
ATOM   1287 C  CB    . ALA E 3 32 ? -1.878  -33.707 5.176   1.00 27.82 ? 55  ALA A CB    1 
ATOM   1288 N  N     . ALA E 3 33 ? -4.017  -31.236 6.783   1.00 28.22 ? 56  ALA A N     1 
ATOM   1289 C  CA    . ALA E 3 33 ? -4.751  -30.005 6.494   1.00 28.43 ? 56  ALA A CA    1 
ATOM   1290 C  C     . ALA E 3 33 ? -3.781  -28.850 6.338   1.00 29.28 ? 56  ALA A C     1 
ATOM   1291 O  O     . ALA E 3 33 ? -2.766  -28.769 7.036   1.00 31.33 ? 56  ALA A O     1 
ATOM   1292 C  CB    . ALA E 3 33 ? -5.750  -29.701 7.610   1.00 28.25 ? 56  ALA A CB    1 
ATOM   1293 N  N     . ARG E 3 34 ? -4.085  -27.948 5.418   1.00 29.19 ? 57  ARG A N     1 
ATOM   1294 C  CA    . ARG E 3 34 ? -3.210  -26.813 5.190   1.00 29.94 ? 57  ARG A CA    1 
ATOM   1295 C  C     . ARG E 3 34 ? -4.055  -25.551 5.075   1.00 27.86 ? 57  ARG A C     1 
ATOM   1296 O  O     . ARG E 3 34 ? -4.843  -25.386 4.149   1.00 28.30 ? 57  ARG A O     1 
ATOM   1297 C  CB    . ARG E 3 34 ? -2.375  -27.057 3.931   1.00 32.87 ? 57  ARG A CB    1 
ATOM   1298 C  CG    . ARG E 3 34 ? -1.272  -26.054 3.698   1.00 36.54 ? 57  ARG A CG    1 
ATOM   1299 C  CD    . ARG E 3 34 ? -0.385  -25.842 4.920   1.00 39.63 ? 57  ARG A CD    1 
ATOM   1300 N  NE    . ARG E 3 34 ? 0.674   -24.861 4.652   1.00 42.09 ? 57  ARG A NE    1 
ATOM   1301 C  CZ    . ARG E 3 34 ? 1.325   -24.155 5.578   1.00 42.17 ? 57  ARG A CZ    1 
ATOM   1302 N  NH1   . ARG E 3 34 ? 1.048   -24.292 6.868   1.00 41.09 ? 57  ARG A NH1   1 
ATOM   1303 N  NH2   . ARG E 3 34 ? 2.263   -23.297 5.203   1.00 43.94 ? 57  ARG A NH2   1 
ATOM   1304 N  N     . PHE E 3 35 ? -3.893  -24.659 6.034   1.00 26.04 ? 58  PHE A N     1 
ATOM   1305 C  CA    . PHE E 3 35 ? -4.682  -23.446 6.043   1.00 26.02 ? 58  PHE A CA    1 
ATOM   1306 C  C     . PHE E 3 35 ? -3.887  -22.331 6.703   1.00 27.70 ? 58  PHE A C     1 
ATOM   1307 O  O     . PHE E 3 35 ? -2.934  -22.580 7.463   1.00 27.91 ? 58  PHE A O     1 
ATOM   1308 C  CB    . PHE E 3 35 ? -5.998  -23.711 6.789   1.00 25.59 ? 58  PHE A CB    1 
ATOM   1309 C  CG    . PHE E 3 35 ? -5.799  -24.187 8.199   1.00 25.07 ? 58  PHE A CG    1 
ATOM   1310 C  CD1   . PHE E 3 35 ? -5.959  -23.321 9.267   1.00 25.59 ? 58  PHE A CD1   1 
ATOM   1311 C  CD2   . PHE E 3 35 ? -5.377  -25.487 8.448   1.00 25.36 ? 58  PHE A CD2   1 
ATOM   1312 C  CE1   . PHE E 3 35 ? -5.699  -23.741 10.570  1.00 23.77 ? 58  PHE A CE1   1 
ATOM   1313 C  CE2   . PHE E 3 35 ? -5.112  -25.917 9.747   1.00 26.52 ? 58  PHE A CE2   1 
ATOM   1314 C  CZ    . PHE E 3 35 ? -5.274  -25.037 10.805  1.00 25.47 ? 58  PHE A CZ    1 
ATOM   1315 N  N     . LYS E 3 36 ? -4.253  -21.097 6.383   1.00 27.09 ? 59  LYS A N     1 
ATOM   1316 C  CA    . LYS E 3 36 ? -3.576  -19.945 6.946   1.00 27.86 ? 59  LYS A CA    1 
ATOM   1317 C  C     . LYS E 3 36 ? -4.497  -18.736 6.896   1.00 27.92 ? 59  LYS A C     1 
ATOM   1318 O  O     . LYS E 3 36 ? -5.306  -18.605 5.975   1.00 28.69 ? 59  LYS A O     1 
ATOM   1319 C  CB    . LYS E 3 36 ? -2.303  -19.646 6.158   1.00 30.03 ? 59  LYS A CB    1 
ATOM   1320 C  CG    . LYS E 3 36 ? -1.386  -18.675 6.845   1.00 30.24 ? 59  LYS A CG    1 
ATOM   1321 C  CD    . LYS E 3 36 ? -0.069  -18.581 6.117   1.00 31.87 ? 59  LYS A CD    1 
ATOM   1322 C  CE    . LYS E 3 36 ? 0.912   -17.756 6.910   1.00 31.87 ? 59  LYS A CE    1 
ATOM   1323 N  NZ    . LYS E 3 36 ? 0.377   -16.412 7.218   1.00 33.30 ? 59  LYS A NZ    1 
ATOM   1324 N  N     . LYS E 3 37 ? -4.378  -17.858 7.883   1.00 28.09 ? 60  LYS A N     1 
ATOM   1325 C  CA    . LYS E 3 37 ? -5.226  -16.668 7.923   1.00 31.24 ? 60  LYS A CA    1 
ATOM   1326 C  C     . LYS E 3 37 ? -4.517  -15.430 7.386   1.00 30.30 ? 60  LYS A C     1 
ATOM   1327 O  O     . LYS E 3 37 ? -3.387  -15.132 7.779   1.00 28.84 ? 60  LYS A O     1 
ATOM   1328 C  CB    . LYS E 3 37 ? -5.705  -16.375 9.350   1.00 30.58 ? 60  LYS A CB    1 
ATOM   1329 C  CG    . LYS E 3 37 ? -6.602  -15.153 9.399   1.00 33.94 ? 60  LYS A CG    1 
ATOM   1330 C  CD    . LYS E 3 37 ? -7.093  -14.766 10.800  1.00 35.15 ? 60  LYS A CD    1 
ATOM   1331 C  CE    . LYS E 3 37 ? -5.990  -14.188 11.654  1.00 36.50 ? 60  LYS A CE    1 
ATOM   1332 N  NZ    . LYS E 3 37 ? -6.526  -13.737 12.980  1.00 42.05 ? 60  LYS A NZ    1 
ATOM   1333 N  N     . PHE E 3 38 ? -5.190  -14.702 6.504   1.00 31.61 ? 61  PHE A N     1 
ATOM   1334 C  CA    . PHE E 3 38 ? -4.604  -13.487 5.943   1.00 33.57 ? 61  PHE A CA    1 
ATOM   1335 C  C     . PHE E 3 38 ? -5.496  -12.267 6.170   1.00 33.30 ? 61  PHE A C     1 
ATOM   1336 O  O     . PHE E 3 38 ? -6.701  -12.395 6.347   1.00 33.77 ? 61  PHE A O     1 
ATOM   1337 C  CB    . PHE E 3 38 ? -4.335  -13.659 4.445   1.00 34.00 ? 61  PHE A CB    1 
ATOM   1338 C  CG    . PHE E 3 38 ? -3.482  -14.844 4.115   1.00 37.78 ? 61  PHE A CG    1 
ATOM   1339 C  CD1   . PHE E 3 38 ? -4.055  -16.093 3.906   1.00 37.66 ? 61  PHE A CD1   1 
ATOM   1340 C  CD2   . PHE E 3 38 ? -2.100  -14.716 4.022   1.00 39.69 ? 61  PHE A CD2   1 
ATOM   1341 C  CE1   . PHE E 3 38 ? -3.269  -17.195 3.609   1.00 38.90 ? 61  PHE A CE1   1 
ATOM   1342 C  CE2   . PHE E 3 38 ? -1.300  -15.815 3.723   1.00 40.03 ? 61  PHE A CE2   1 
ATOM   1343 C  CZ    . PHE E 3 38 ? -1.887  -17.057 3.518   1.00 39.50 ? 61  PHE A CZ    1 
ATOM   1344 N  N     . ALA E 3 39 ? -4.887  -11.088 6.154   1.00 34.01 ? 62  ALA A N     1 
ATOM   1345 C  CA    . ALA E 3 39 ? -5.593  -9.833  6.354   1.00 34.58 ? 62  ALA A CA    1 
ATOM   1346 C  C     . ALA E 3 39 ? -6.357  -9.380  5.123   1.00 35.64 ? 62  ALA A C     1 
ATOM   1347 O  O     . ALA E 3 39 ? -7.339  -8.661  5.247   1.00 36.97 ? 62  ALA A O     1 
ATOM   1348 C  CB    . ALA E 3 39 ? -4.611  -8.755  6.774   1.00 35.50 ? 62  ALA A CB    1 
ATOM   1349 N  N     . THR E 3 40 ? -5.924  -9.805  3.940   1.00 36.78 ? 63  THR A N     1 
ATOM   1350 C  CA    . THR E 3 40 ? -6.592  -9.403  2.695   1.00 39.29 ? 63  THR A CA    1 
ATOM   1351 C  C     . THR E 3 40 ? -7.011  -10.588 1.813   1.00 39.25 ? 63  THR A C     1 
ATOM   1352 O  O     . THR E 3 40 ? -6.233  -11.503 1.580   1.00 40.45 ? 63  THR A O     1 
ATOM   1353 C  CB    . THR E 3 40 ? -5.679  -8.485  1.876   1.00 40.43 ? 63  THR A CB    1 
ATOM   1354 O  OG1   . THR E 3 40 ? -4.715  -9.276  1.171   1.00 42.20 ? 63  THR A OG1   1 
ATOM   1355 C  CG2   . THR E 3 40 ? -4.931  -7.519  2.811   1.00 41.19 ? 63  THR A CG2   1 
ATOM   1356 N  N     . GLU E 3 41 ? -8.235  -10.563 1.311   1.00 39.96 ? 64  GLU A N     1 
ATOM   1357 C  CA    . GLU E 3 41 ? -8.724  -11.656 0.494   1.00 43.73 ? 64  GLU A CA    1 
ATOM   1358 C  C     . GLU E 3 41 ? -7.742  -12.085 -0.582  1.00 45.15 ? 64  GLU A C     1 
ATOM   1359 O  O     . GLU E 3 41 ? -7.581  -13.279 -0.851  1.00 45.12 ? 64  GLU A O     1 
ATOM   1360 C  CB    . GLU E 3 41 ? -10.049 -11.299 -0.179  1.00 45.35 ? 64  GLU A CB    1 
ATOM   1361 C  CG    . GLU E 3 41 ? -10.846 -12.539 -0.559  1.00 48.73 ? 64  GLU A CG    1 
ATOM   1362 C  CD    . GLU E 3 41 ? -11.799 -12.333 -1.727  1.00 52.05 ? 64  GLU A CD    1 
ATOM   1363 O  OE1   . GLU E 3 41 ? -12.459 -13.322 -2.131  1.00 53.39 ? 64  GLU A OE1   1 
ATOM   1364 O  OE2   . GLU E 3 41 ? -11.890 -11.197 -2.247  1.00 52.71 ? 64  GLU A OE2   1 
ATOM   1365 N  N     . ASP E 3 42 ? -7.086  -11.113 -1.201  1.00 46.01 ? 65  ASP A N     1 
ATOM   1366 C  CA    . ASP E 3 42 ? -6.148  -11.416 -2.265  1.00 46.52 ? 65  ASP A CA    1 
ATOM   1367 C  C     . ASP E 3 42 ? -5.100  -12.427 -1.828  1.00 46.96 ? 65  ASP A C     1 
ATOM   1368 O  O     . ASP E 3 42 ? -4.927  -13.455 -2.482  1.00 47.31 ? 65  ASP A O     1 
ATOM   1369 C  CB    . ASP E 3 42 ? -5.468  -10.147 -2.738  1.00 48.03 ? 65  ASP A CB    1 
ATOM   1370 C  CG    . ASP E 3 42 ? -4.879  -10.294 -4.107  1.00 48.93 ? 65  ASP A CG    1 
ATOM   1371 O  OD1   . ASP E 3 42 ? -3.674  -10.008 -4.262  1.00 51.48 ? 65  ASP A OD1   1 
ATOM   1372 O  OD2   . ASP E 3 42 ? -5.619  -10.694 -5.028  1.00 50.07 ? 65  ASP A OD2   1 
ATOM   1373 N  N     . GLU E 3 43 ? -4.405  -12.133 -0.729  1.00 47.19 ? 66  GLU A N     1 
ATOM   1374 C  CA    . GLU E 3 43 ? -3.365  -13.010 -0.183  1.00 47.61 ? 66  GLU A CA    1 
ATOM   1375 C  C     . GLU E 3 43 ? -3.854  -14.416 0.165   1.00 46.97 ? 66  GLU A C     1 
ATOM   1376 O  O     . GLU E 3 43 ? -3.084  -15.387 0.150   1.00 47.97 ? 66  GLU A O     1 
ATOM   1377 C  CB    . GLU E 3 43 ? -2.772  -12.392 1.074   1.00 50.03 ? 66  GLU A CB    1 
ATOM   1378 C  CG    . GLU E 3 43 ? -2.238  -10.999 0.882   1.00 53.59 ? 66  GLU A CG    1 
ATOM   1379 C  CD    . GLU E 3 43 ? -1.561  -10.478 2.127   1.00 56.62 ? 66  GLU A CD    1 
ATOM   1380 O  OE1   . GLU E 3 43 ? -2.264  -10.207 3.134   1.00 58.47 ? 66  GLU A OE1   1 
ATOM   1381 O  OE2   . GLU E 3 43 ? -0.318  -10.346 2.101   1.00 58.18 ? 66  GLU A OE2   1 
ATOM   1382 N  N     . ALA E 3 44 ? -5.134  -14.510 0.502   1.00 44.30 ? 67  ALA A N     1 
ATOM   1383 C  CA    . ALA E 3 44 ? -5.748  -15.773 0.851   1.00 41.57 ? 67  ALA A CA    1 
ATOM   1384 C  C     . ALA E 3 44 ? -5.868  -16.641 -0.390  1.00 40.39 ? 67  ALA A C     1 
ATOM   1385 O  O     . ALA E 3 44 ? -5.653  -17.852 -0.341  1.00 39.29 ? 67  ALA A O     1 
ATOM   1386 C  CB    . ALA E 3 44 ? -7.127  -15.523 1.455   1.00 42.38 ? 67  ALA A CB    1 
ATOM   1387 N  N     . TRP E 3 45 ? -6.236  -16.025 -1.506  1.00 38.32 ? 68  TRP A N     1 
ATOM   1388 C  CA    . TRP E 3 45 ? -6.364  -16.768 -2.747  1.00 36.02 ? 68  TRP A CA    1 
ATOM   1389 C  C     . TRP E 3 45 ? -5.034  -17.265 -3.252  1.00 34.19 ? 68  TRP A C     1 
ATOM   1390 O  O     . TRP E 3 45 ? -4.940  -18.370 -3.764  1.00 35.35 ? 68  TRP A O     1 
ATOM   1391 C  CB    . TRP E 3 45 ? -7.025  -15.906 -3.802  1.00 35.56 ? 68  TRP A CB    1 
ATOM   1392 C  CG    . TRP E 3 45 ? -8.456  -15.884 -3.569  1.00 36.18 ? 68  TRP A CG    1 
ATOM   1393 C  CD1   . TRP E 3 45 ? -9.202  -14.827 -3.175  1.00 37.03 ? 68  TRP A CD1   1 
ATOM   1394 C  CD2   . TRP E 3 45 ? -9.332  -17.003 -3.621  1.00 34.99 ? 68  TRP A CD2   1 
ATOM   1395 N  NE1   . TRP E 3 45 ? -10.499 -15.214 -2.972  1.00 36.85 ? 68  TRP A NE1   1 
ATOM   1396 C  CE2   . TRP E 3 45 ? -10.605 -16.550 -3.239  1.00 35.36 ? 68  TRP A CE2   1 
ATOM   1397 C  CE3   . TRP E 3 45 ? -9.162  -18.348 -3.949  1.00 36.01 ? 68  TRP A CE3   1 
ATOM   1398 C  CZ2   . TRP E 3 45 ? -11.706 -17.386 -3.177  1.00 34.78 ? 68  TRP A CZ2   1 
ATOM   1399 C  CZ3   . TRP E 3 45 ? -10.250 -19.181 -3.889  1.00 36.54 ? 68  TRP A CZ3   1 
ATOM   1400 C  CH2   . TRP E 3 45 ? -11.514 -18.697 -3.505  1.00 36.79 ? 68  TRP A CH2   1 
ATOM   1401 N  N     . ALA E 3 46 ? -4.003  -16.453 -3.104  1.00 33.57 ? 69  ALA A N     1 
ATOM   1402 C  CA    . ALA E 3 46 ? -2.686  -16.852 -3.563  1.00 35.12 ? 69  ALA A CA    1 
ATOM   1403 C  C     . ALA E 3 46 ? -2.319  -18.164 -2.875  1.00 37.13 ? 69  ALA A C     1 
ATOM   1404 O  O     . ALA E 3 46 ? -1.921  -19.146 -3.529  1.00 37.11 ? 69  ALA A O     1 
ATOM   1405 C  CB    . ALA E 3 46 ? -1.686  -15.786 -3.225  1.00 33.76 ? 69  ALA A CB    1 
ATOM   1406 N  N     . PHE E 3 47 ? -2.477  -18.170 -1.548  1.00 36.89 ? 70  PHE A N     1 
ATOM   1407 C  CA    . PHE E 3 47 ? -2.187  -19.340 -0.729  1.00 36.29 ? 70  PHE A CA    1 
ATOM   1408 C  C     . PHE E 3 47 ? -2.984  -20.529 -1.222  1.00 35.33 ? 70  PHE A C     1 
ATOM   1409 O  O     . PHE E 3 47 ? -2.474  -21.639 -1.262  1.00 37.23 ? 70  PHE A O     1 
ATOM   1410 C  CB    . PHE E 3 47 ? -2.558  -19.076 0.732   1.00 36.72 ? 70  PHE A CB    1 
ATOM   1411 C  CG    . PHE E 3 47 ? -2.090  -20.142 1.684   1.00 36.65 ? 70  PHE A CG    1 
ATOM   1412 C  CD1   . PHE E 3 47 ? -0.773  -20.175 2.113   1.00 35.67 ? 70  PHE A CD1   1 
ATOM   1413 C  CD2   . PHE E 3 47 ? -2.976  -21.088 2.175   1.00 35.83 ? 70  PHE A CD2   1 
ATOM   1414 C  CE1   . PHE E 3 47 ? -0.349  -21.133 3.023   1.00 36.40 ? 70  PHE A CE1   1 
ATOM   1415 C  CE2   . PHE E 3 47 ? -2.560  -22.049 3.087   1.00 36.52 ? 70  PHE A CE2   1 
ATOM   1416 C  CZ    . PHE E 3 47 ? -1.250  -22.069 3.512   1.00 35.19 ? 70  PHE A CZ    1 
ATOM   1417 N  N     . VAL E 3 48 ? -4.237  -20.299 -1.591  1.00 34.05 ? 71  VAL A N     1 
ATOM   1418 C  CA    . VAL E 3 48 ? -5.097  -21.369 -2.062  1.00 36.22 ? 71  VAL A CA    1 
ATOM   1419 C  C     . VAL E 3 48 ? -4.858  -21.836 -3.507  1.00 39.53 ? 71  VAL A C     1 
ATOM   1420 O  O     . VAL E 3 48 ? -5.134  -22.990 -3.854  1.00 37.94 ? 71  VAL A O     1 
ATOM   1421 C  CB    . VAL E 3 48 ? -6.539  -20.962 -1.950  1.00 35.75 ? 71  VAL A CB    1 
ATOM   1422 C  CG1   . VAL E 3 48 ? -7.419  -22.010 -2.565  1.00 35.64 ? 71  VAL A CG1   1 
ATOM   1423 C  CG2   . VAL E 3 48 ? -6.895  -20.757 -0.499  1.00 39.96 ? 71  VAL A CG2   1 
ATOM   1424 N  N     . ARG E 3 49 ? -4.354  -20.943 -4.354  1.00 42.05 ? 72  ARG A N     1 
ATOM   1425 C  CA    . ARG E 3 49 ? -4.110  -21.300 -5.754  1.00 44.76 ? 72  ARG A CA    1 
ATOM   1426 C  C     . ARG E 3 49 ? -2.666  -21.693 -6.055  1.00 46.05 ? 72  ARG A C     1 
ATOM   1427 O  O     . ARG E 3 49 ? -2.416  -22.331 -7.069  1.00 47.98 ? 72  ARG A O     1 
ATOM   1428 C  CB    . ARG E 3 49 ? -4.538  -20.148 -6.682  1.00 42.55 ? 72  ARG A CB    1 
ATOM   1429 C  CG    . ARG E 3 49 ? -6.035  -20.051 -6.888  1.00 42.96 ? 72  ARG A CG    1 
ATOM   1430 C  CD    . ARG E 3 49 ? -6.495  -18.609 -7.085  1.00 42.81 ? 72  ARG A CD    1 
ATOM   1431 N  NE    . ARG E 3 49 ? -6.165  -18.065 -8.401  1.00 43.16 ? 72  ARG A NE    1 
ATOM   1432 C  CZ    . ARG E 3 49 ? -6.680  -18.515 -9.543  0.50 42.21 ? 72  ARG A CZ    1 
ATOM   1433 N  NH1   . ARG E 3 49 ? -7.552  -19.516 -9.534  0.50 40.78 ? 72  ARG A NH1   1 
ATOM   1434 N  NH2   . ARG E 3 49 ? -6.326  -17.962 -10.697 0.50 41.46 ? 72  ARG A NH2   1 
ATOM   1435 N  N     . LYS E 3 50 ? -1.720  -21.347 -5.183  1.00 47.24 ? 73  LYS A N     1 
ATOM   1436 C  CA    . LYS E 3 50 ? -0.326  -21.685 -5.466  1.00 48.10 ? 73  LYS A CA    1 
ATOM   1437 C  C     . LYS E 3 50 ? -0.101  -23.174 -5.681  1.00 49.11 ? 73  LYS A C     1 
ATOM   1438 O  O     . LYS E 3 50 ? -1.075  -23.945 -5.556  1.00 48.37 ? 73  LYS A O     1 
ATOM   1439 C  CB    . LYS E 3 50 ? 0.599   -21.176 -4.363  1.00 48.07 ? 73  LYS A CB    1 
ATOM   1440 C  CG    . LYS E 3 50 ? 0.710   -22.036 -3.136  1.00 49.47 ? 73  LYS A CG    1 
ATOM   1441 C  CD    . LYS E 3 50 ? 1.915   -21.580 -2.316  1.00 50.66 ? 73  LYS A CD    1 
ATOM   1442 C  CE    . LYS E 3 50 ? 3.199   -21.650 -3.157  1.00 52.19 ? 73  LYS A CE    1 
ATOM   1443 N  NZ    . LYS E 3 50 ? 4.433   -21.144 -2.469  1.00 52.64 ? 73  LYS A NZ    1 
ATOM   1444 N  N     . HIS F 3 3  ? 10.328  -14.802 12.108  1.00 46.59 ? 26  HIS B N     1 
ATOM   1445 C  CA    . HIS F 3 3  ? 11.136  -15.752 11.297  1.00 47.58 ? 26  HIS B CA    1 
ATOM   1446 C  C     . HIS F 3 3  ? 12.459  -16.082 12.013  1.00 47.37 ? 26  HIS B C     1 
ATOM   1447 O  O     . HIS F 3 3  ? 13.427  -15.315 11.928  1.00 49.21 ? 26  HIS B O     1 
ATOM   1448 C  CB    . HIS F 3 3  ? 11.410  -15.144 9.920   1.00 49.52 ? 26  HIS B CB    1 
ATOM   1449 C  CG    . HIS F 3 3  ? 11.262  -16.116 8.786   1.00 52.87 ? 26  HIS B CG    1 
ATOM   1450 N  ND1   . HIS F 3 3  ? 11.332  -15.733 7.461   1.00 53.98 ? 26  HIS B ND1   1 
ATOM   1451 C  CD2   . HIS F 3 3  ? 11.028  -17.453 8.776   1.00 54.02 ? 26  HIS B CD2   1 
ATOM   1452 C  CE1   . HIS F 3 3  ? 11.146  -16.789 6.687   1.00 53.26 ? 26  HIS B CE1   1 
ATOM   1453 N  NE2   . HIS F 3 3  ? 10.959  -17.844 7.458   1.00 54.04 ? 26  HIS B NE2   1 
ATOM   1454 N  N     . MET F 3 4  ? 12.490  -17.229 12.707  1.00 45.29 ? 27  MET B N     1 
ATOM   1455 C  CA    . MET F 3 4  ? 13.655  -17.688 13.470  1.00 41.46 ? 27  MET B CA    1 
ATOM   1456 C  C     . MET F 3 4  ? 14.682  -18.554 12.730  1.00 38.40 ? 27  MET B C     1 
ATOM   1457 O  O     . MET F 3 4  ? 14.656  -18.702 11.504  1.00 37.65 ? 27  MET B O     1 
ATOM   1458 C  CB    . MET F 3 4  ? 13.204  -18.470 14.710  1.00 45.42 ? 27  MET B CB    1 
ATOM   1459 C  CG    . MET F 3 4  ? 12.557  -17.668 15.832  1.00 48.47 ? 27  MET B CG    1 
ATOM   1460 S  SD    . MET F 3 4  ? 10.843  -17.207 15.489  1.00 54.22 ? 27  MET B SD    1 
ATOM   1461 C  CE    . MET F 3 4  ? 10.988  -15.413 15.096  1.00 51.22 ? 27  MET B CE    1 
ATOM   1462 N  N     . PHE F 3 5  ? 15.595  -19.122 13.514  1.00 35.66 ? 28  PHE B N     1 
ATOM   1463 C  CA    . PHE F 3 5  ? 16.656  -19.989 13.026  1.00 32.12 ? 28  PHE B CA    1 
ATOM   1464 C  C     . PHE F 3 5  ? 16.339  -21.430 13.424  1.00 31.66 ? 28  PHE B C     1 
ATOM   1465 O  O     . PHE F 3 5  ? 16.177  -21.736 14.614  1.00 32.24 ? 28  PHE B O     1 
ATOM   1466 C  CB    . PHE F 3 5  ? 17.983  -19.554 13.633  1.00 32.65 ? 28  PHE B CB    1 
ATOM   1467 C  CG    . PHE F 3 5  ? 18.358  -18.144 13.295  1.00 34.21 ? 28  PHE B CG    1 
ATOM   1468 C  CD1   . PHE F 3 5  ? 19.104  -17.863 12.155  1.00 33.06 ? 28  PHE B CD1   1 
ATOM   1469 C  CD2   . PHE F 3 5  ? 17.906  -17.085 14.083  1.00 34.92 ? 28  PHE B CD2   1 
ATOM   1470 C  CE1   . PHE F 3 5  ? 19.396  -16.559 11.797  1.00 33.23 ? 28  PHE B CE1   1 
ATOM   1471 C  CE2   . PHE F 3 5  ? 18.193  -15.762 13.733  1.00 36.00 ? 28  PHE B CE2   1 
ATOM   1472 C  CZ    . PHE F 3 5  ? 18.942  -15.506 12.581  1.00 34.69 ? 28  PHE B CZ    1 
ATOM   1473 N  N     . TYR F 3 6  ? 16.250  -22.315 12.437  1.00 29.15 ? 29  TYR B N     1 
ATOM   1474 C  CA    . TYR F 3 6  ? 15.942  -23.719 12.708  1.00 26.66 ? 29  TYR B CA    1 
ATOM   1475 C  C     . TYR F 3 6  ? 17.214  -24.528 12.778  1.00 26.77 ? 29  TYR B C     1 
ATOM   1476 O  O     . TYR F 3 6  ? 17.920  -24.703 11.781  1.00 24.35 ? 29  TYR B O     1 
ATOM   1477 C  CB    . TYR F 3 6  ? 15.016  -24.309 11.634  1.00 24.41 ? 29  TYR B CB    1 
ATOM   1478 C  CG    . TYR F 3 6  ? 13.676  -23.597 11.509  1.00 23.46 ? 29  TYR B CG    1 
ATOM   1479 C  CD1   . TYR F 3 6  ? 13.580  -22.342 10.895  1.00 25.08 ? 29  TYR B CD1   1 
ATOM   1480 C  CD2   . TYR F 3 6  ? 12.506  -24.195 11.961  1.00 24.90 ? 29  TYR B CD2   1 
ATOM   1481 C  CE1   . TYR F 3 6  ? 12.364  -21.716 10.730  1.00 25.32 ? 29  TYR B CE1   1 
ATOM   1482 C  CE2   . TYR F 3 6  ? 11.277  -23.583 11.805  1.00 24.65 ? 29  TYR B CE2   1 
ATOM   1483 C  CZ    . TYR F 3 6  ? 11.212  -22.339 11.189  1.00 26.67 ? 29  TYR B CZ    1 
ATOM   1484 O  OH    . TYR F 3 6  ? 9.999   -21.710 11.054  1.00 24.47 ? 29  TYR B OH    1 
ATOM   1485 N  N     . ALA F 3 7  ? 17.486  -25.017 13.983  1.00 25.54 ? 30  ALA B N     1 
ATOM   1486 C  CA    . ALA F 3 7  ? 18.663  -25.801 14.283  1.00 25.96 ? 30  ALA B CA    1 
ATOM   1487 C  C     . ALA F 3 7  ? 18.372  -27.277 14.148  1.00 25.11 ? 30  ALA B C     1 
ATOM   1488 O  O     . ALA F 3 7  ? 17.483  -27.792 14.819  1.00 27.94 ? 30  ALA B O     1 
ATOM   1489 C  CB    . ALA F 3 7  ? 19.137  -25.494 15.716  1.00 27.69 ? 30  ALA B CB    1 
ATOM   1490 N  N     . VAL F 3 8  ? 19.119  -27.947 13.276  1.00 24.82 ? 31  VAL B N     1 
ATOM   1491 C  CA    . VAL F 3 8  ? 18.973  -29.383 13.045  1.00 25.37 ? 31  VAL B CA    1 
ATOM   1492 C  C     . VAL F 3 8  ? 20.181  -30.147 13.585  1.00 27.16 ? 31  VAL B C     1 
ATOM   1493 O  O     . VAL F 3 8  ? 21.254  -30.142 12.964  1.00 25.97 ? 31  VAL B O     1 
ATOM   1494 C  CB    . VAL F 3 8  ? 18.848  -29.699 11.539  1.00 23.16 ? 31  VAL B CB    1 
ATOM   1495 C  CG1   . VAL F 3 8  ? 18.757  -31.193 11.330  1.00 24.15 ? 31  VAL B CG1   1 
ATOM   1496 C  CG2   . VAL F 3 8  ? 17.642  -29.012 10.981  1.00 23.77 ? 31  VAL B CG2   1 
ATOM   1497 N  N     . ARG F 3 9  ? 20.026  -30.798 14.740  1.00 27.18 ? 32  ARG B N     1 
ATOM   1498 C  CA    . ARG F 3 9  ? 21.141  -31.557 15.307  1.00 28.05 ? 32  ARG B CA    1 
ATOM   1499 C  C     . ARG F 3 9  ? 21.228  -32.918 14.618  1.00 27.70 ? 32  ARG B C     1 
ATOM   1500 O  O     . ARG F 3 9  ? 22.313  -33.411 14.336  1.00 25.61 ? 32  ARG B O     1 
ATOM   1501 C  CB    . ARG F 3 9  ? 20.983  -31.786 16.818  1.00 27.80 ? 32  ARG B CB    1 
ATOM   1502 C  CG    . ARG F 3 9  ? 22.158  -32.568 17.415  1.00 31.95 ? 32  ARG B CG    1 
ATOM   1503 C  CD    . ARG F 3 9  ? 21.955  -32.847 18.894  1.00 36.43 ? 32  ARG B CD    1 
ATOM   1504 N  NE    . ARG F 3 9  ? 21.512  -31.648 19.594  1.00 37.07 ? 32  ARG B NE    1 
ATOM   1505 C  CZ    . ARG F 3 9  ? 20.973  -31.646 20.804  1.00 41.71 ? 32  ARG B CZ    1 
ATOM   1506 N  NH1   . ARG F 3 9  ? 20.801  -32.789 21.467  1.00 42.60 ? 32  ARG B NH1   1 
ATOM   1507 N  NH2   . ARG F 3 9  ? 20.599  -30.497 21.354  1.00 44.28 ? 32  ARG B NH2   1 
ATOM   1508 N  N     . ARG F 3 10 ? 20.082  -33.547 14.384  1.00 27.27 ? 33  ARG B N     1 
ATOM   1509 C  CA    . ARG F 3 10 ? 20.089  -34.834 13.690  1.00 28.53 ? 33  ARG B CA    1 
ATOM   1510 C  C     . ARG F 3 10 ? 19.114  -34.744 12.515  1.00 25.56 ? 33  ARG B C     1 
ATOM   1511 O  O     . ARG F 3 10 ? 17.948  -34.403 12.696  1.00 24.57 ? 33  ARG B O     1 
ATOM   1512 C  CB    . ARG F 3 10 ? 19.688  -35.983 14.638  1.00 30.64 ? 33  ARG B CB    1 
ATOM   1513 C  CG    . ARG F 3 10 ? 20.810  -36.522 15.519  1.00 32.85 ? 33  ARG B CG    1 
ATOM   1514 C  CD    . ARG F 3 10 ? 20.441  -37.907 16.050  1.00 35.39 ? 33  ARG B CD    1 
ATOM   1515 N  NE    . ARG F 3 10 ? 19.313  -37.860 16.989  1.00 36.20 ? 33  ARG B NE    1 
ATOM   1516 C  CZ    . ARG F 3 10 ? 19.378  -37.321 18.207  1.00 36.24 ? 33  ARG B CZ    1 
ATOM   1517 N  NH1   . ARG F 3 10 ? 20.515  -36.784 18.632  1.00 36.96 ? 33  ARG B NH1   1 
ATOM   1518 N  NH2   . ARG F 3 10 ? 18.310  -37.315 19.004  1.00 35.71 ? 33  ARG B NH2   1 
ATOM   1519 N  N     . GLY F 3 11 ? 19.594  -35.042 11.315  1.00 24.36 ? 34  GLY B N     1 
ATOM   1520 C  CA    . GLY F 3 11 ? 18.733  -34.959 10.145  1.00 23.41 ? 34  GLY B CA    1 
ATOM   1521 C  C     . GLY F 3 11 ? 19.526  -35.285 8.902   1.00 23.21 ? 34  GLY B C     1 
ATOM   1522 O  O     . GLY F 3 11 ? 20.700  -35.583 9.024   1.00 21.35 ? 34  GLY B O     1 
ATOM   1523 N  N     . ARG F 3 12 ? 18.895  -35.225 7.726   1.00 24.76 ? 35  ARG B N     1 
ATOM   1524 C  CA    . ARG F 3 12 ? 19.566  -35.555 6.469   1.00 26.04 ? 35  ARG B CA    1 
ATOM   1525 C  C     . ARG F 3 12 ? 20.792  -34.696 6.412   1.00 27.12 ? 35  ARG B C     1 
ATOM   1526 O  O     . ARG F 3 12 ? 21.885  -35.195 6.405   1.00 28.82 ? 35  ARG B O     1 
ATOM   1527 C  CB    . ARG F 3 12 ? 18.658  -35.261 5.274   1.00 27.81 ? 35  ARG B CB    1 
ATOM   1528 C  CG    . ARG F 3 12 ? 17.306  -35.927 5.423   1.00 30.83 ? 35  ARG B CG    1 
ATOM   1529 C  CD    . ARG F 3 12 ? 16.606  -36.276 4.107   1.00 28.29 ? 35  ARG B CD    1 
ATOM   1530 N  NE    . ARG F 3 12 ? 15.593  -37.276 4.401   1.00 27.51 ? 35  ARG B NE    1 
ATOM   1531 C  CZ    . ARG F 3 12 ? 14.447  -37.011 5.009   1.00 24.19 ? 35  ARG B CZ    1 
ATOM   1532 N  NH1   . ARG F 3 12 ? 14.158  -35.771 5.365   1.00 22.12 ? 35  ARG B NH1   1 
ATOM   1533 N  NH2   . ARG F 3 12 ? 13.621  -37.994 5.304   1.00 24.60 ? 35  ARG B NH2   1 
ATOM   1534 N  N     . LYS F 3 13 ? 20.608  -33.388 6.376   1.00 28.93 ? 36  LYS B N     1 
ATOM   1535 C  CA    . LYS F 3 13 ? 21.748  -32.490 6.395   1.00 31.49 ? 36  LYS B CA    1 
ATOM   1536 C  C     . LYS F 3 13 ? 21.576  -31.639 7.638   1.00 31.41 ? 36  LYS B C     1 
ATOM   1537 O  O     . LYS F 3 13 ? 20.471  -31.147 7.905   1.00 29.66 ? 36  LYS B O     1 
ATOM   1538 C  CB    . LYS F 3 13 ? 21.774  -31.615 5.140   1.00 34.47 ? 36  LYS B CB    1 
ATOM   1539 C  CG    . LYS F 3 13 ? 22.085  -32.423 3.890   1.00 40.05 ? 36  LYS B CG    1 
ATOM   1540 C  CD    . LYS F 3 13 ? 22.740  -31.577 2.810   1.00 42.85 ? 36  LYS B CD    1 
ATOM   1541 C  CE    . LYS F 3 13 ? 23.718  -32.421 1.993   1.00 44.16 ? 36  LYS B CE    1 
ATOM   1542 N  NZ    . LYS F 3 13 ? 24.833  -32.976 2.820   1.00 43.94 ? 36  LYS B NZ    1 
ATOM   1543 N  N     . THR F 3 14 ? 22.645  -31.498 8.421   1.00 31.28 ? 37  THR B N     1 
ATOM   1544 C  CA    . THR F 3 14 ? 22.585  -30.694 9.635   1.00 31.67 ? 37  THR B CA    1 
ATOM   1545 C  C     . THR F 3 14 ? 23.116  -29.288 9.401   1.00 30.59 ? 37  THR B C     1 
ATOM   1546 O  O     . THR F 3 14 ? 23.778  -29.024 8.409   1.00 32.18 ? 37  THR B O     1 
ATOM   1547 C  CB    . THR F 3 14 ? 23.379  -31.324 10.778  1.00 33.41 ? 37  THR B CB    1 
ATOM   1548 O  OG1   . THR F 3 14 ? 24.693  -31.636 10.316  1.00 37.54 ? 37  THR B OG1   1 
ATOM   1549 C  CG2   . THR F 3 14 ? 22.694  -32.583 11.285  1.00 33.10 ? 37  THR B CG2   1 
ATOM   1550 N  N     . GLY F 3 15 ? 22.823  -28.397 10.337  1.00 30.19 ? 38  GLY B N     1 
ATOM   1551 C  CA    . GLY F 3 15 ? 23.236  -27.013 10.226  1.00 28.71 ? 38  GLY B CA    1 
ATOM   1552 C  C     . GLY F 3 15 ? 22.085  -26.153 10.701  1.00 29.55 ? 38  GLY B C     1 
ATOM   1553 O  O     . GLY F 3 15 ? 21.159  -26.637 11.364  1.00 28.79 ? 38  GLY B O     1 
ATOM   1554 N  N     . VAL F 3 16 ? 22.138  -24.868 10.378  1.00 29.64 ? 39  VAL B N     1 
ATOM   1555 C  CA    . VAL F 3 16 ? 21.088  -23.959 10.761  1.00 28.17 ? 39  VAL B CA    1 
ATOM   1556 C  C     . VAL F 3 16 ? 20.415  -23.494 9.472   1.00 29.77 ? 39  VAL B C     1 
ATOM   1557 O  O     . VAL F 3 16 ? 21.081  -23.062 8.533   1.00 30.95 ? 39  VAL B O     1 
ATOM   1558 C  CB    . VAL F 3 16 ? 21.675  -22.795 11.534  1.00 27.38 ? 39  VAL B CB    1 
ATOM   1559 C  CG1   . VAL F 3 16 ? 20.616  -21.801 11.846  1.00 26.89 ? 39  VAL B CG1   1 
ATOM   1560 C  CG2   . VAL F 3 16 ? 22.297  -23.310 12.831  1.00 26.93 ? 39  VAL B CG2   1 
ATOM   1561 N  N     . PHE F 3 17 ? 19.094  -23.628 9.414   1.00 30.71 ? 40  PHE B N     1 
ATOM   1562 C  CA    . PHE F 3 17 ? 18.323  -23.240 8.245   1.00 30.15 ? 40  PHE B CA    1 
ATOM   1563 C  C     . PHE F 3 17 ? 17.447  -22.061 8.622   1.00 30.80 ? 40  PHE B C     1 
ATOM   1564 O  O     . PHE F 3 17 ? 17.151  -21.847 9.817   1.00 31.15 ? 40  PHE B O     1 
ATOM   1565 C  CB    . PHE F 3 17 ? 17.486  -24.428 7.788   1.00 31.32 ? 40  PHE B CB    1 
ATOM   1566 C  CG    . PHE F 3 17 ? 18.309  -25.635 7.454   1.00 32.54 ? 40  PHE B CG    1 
ATOM   1567 C  CD1   . PHE F 3 17 ? 18.699  -25.890 6.144   1.00 32.49 ? 40  PHE B CD1   1 
ATOM   1568 C  CD2   . PHE F 3 17 ? 18.744  -26.494 8.461   1.00 33.02 ? 40  PHE B CD2   1 
ATOM   1569 C  CE1   . PHE F 3 17 ? 19.511  -26.987 5.846   1.00 32.30 ? 40  PHE B CE1   1 
ATOM   1570 C  CE2   . PHE F 3 17 ? 19.556  -27.585 8.172   1.00 31.50 ? 40  PHE B CE2   1 
ATOM   1571 C  CZ    . PHE F 3 17 ? 19.939  -27.833 6.867   1.00 33.26 ? 40  PHE B CZ    1 
ATOM   1572 N  N     . LEU F 3 18 ? 17.009  -21.310 7.614   1.00 29.37 ? 41  LEU B N     1 
ATOM   1573 C  CA    . LEU F 3 18 ? 16.211  -20.127 7.862   1.00 28.28 ? 41  LEU B CA    1 
ATOM   1574 C  C     . LEU F 3 18 ? 14.711  -20.279 7.615   1.00 27.85 ? 41  LEU B C     1 
ATOM   1575 O  O     . LEU F 3 18 ? 13.929  -19.394 7.945   1.00 26.31 ? 41  LEU B O     1 
ATOM   1576 C  CB    . LEU F 3 18 ? 16.786  -18.954 7.042   1.00 30.90 ? 41  LEU B CB    1 
ATOM   1577 C  CG    . LEU F 3 18 ? 18.295  -18.667 7.230   1.00 32.03 ? 41  LEU B CG    1 
ATOM   1578 C  CD1   . LEU F 3 18 ? 18.749  -17.575 6.287   1.00 33.03 ? 41  LEU B CD1   1 
ATOM   1579 C  CD2   . LEU F 3 18 ? 18.586  -18.242 8.686   1.00 34.00 ? 41  LEU B CD2   1 
ATOM   1580 N  N     . THR F 3 19 ? 14.299  -21.409 7.066   1.00 26.84 ? 42  THR B N     1 
ATOM   1581 C  CA    . THR F 3 19 ? 12.881  -21.623 6.785   1.00 26.29 ? 42  THR B CA    1 
ATOM   1582 C  C     . THR F 3 19 ? 12.432  -22.998 7.249   1.00 25.30 ? 42  THR B C     1 
ATOM   1583 O  O     . THR F 3 19 ? 13.211  -23.924 7.243   1.00 23.21 ? 42  THR B O     1 
ATOM   1584 C  CB    . THR F 3 19 ? 12.610  -21.537 5.261   1.00 26.16 ? 42  THR B CB    1 
ATOM   1585 O  OG1   . THR F 3 19 ? 13.192  -22.673 4.608   1.00 21.66 ? 42  THR B OG1   1 
ATOM   1586 C  CG2   . THR F 3 19 ? 13.237  -20.276 4.692   1.00 27.16 ? 42  THR B CG2   1 
ATOM   1587 N  N     . TRP F 3 20 ? 11.170  -23.137 7.641   1.00 27.88 ? 43  TRP B N     1 
ATOM   1588 C  CA    . TRP F 3 20 ? 10.688  -24.444 8.062   1.00 28.81 ? 43  TRP B CA    1 
ATOM   1589 C  C     . TRP F 3 20 ? 10.798  -25.437 6.909   1.00 30.86 ? 43  TRP B C     1 
ATOM   1590 O  O     . TRP F 3 20 ? 11.113  -26.600 7.132   1.00 31.96 ? 43  TRP B O     1 
ATOM   1591 C  CB    . TRP F 3 20 ? 9.238   -24.354 8.542   1.00 28.92 ? 43  TRP B CB    1 
ATOM   1592 C  CG    . TRP F 3 20 ? 8.584   -25.694 8.810   1.00 28.73 ? 43  TRP B CG    1 
ATOM   1593 C  CD1   . TRP F 3 20 ? 7.407   -26.141 8.282   1.00 28.39 ? 43  TRP B CD1   1 
ATOM   1594 C  CD2   . TRP F 3 20 ? 9.057   -26.741 9.670   1.00 26.46 ? 43  TRP B CD2   1 
ATOM   1595 N  NE1   . TRP F 3 20 ? 7.120   -27.390 8.755   1.00 28.58 ? 43  TRP B NE1   1 
ATOM   1596 C  CE2   . TRP F 3 20 ? 8.113   -27.786 9.610   1.00 28.18 ? 43  TRP B CE2   1 
ATOM   1597 C  CE3   . TRP F 3 20 ? 10.182  -26.898 10.482  1.00 29.35 ? 43  TRP B CE3   1 
ATOM   1598 C  CZ2   . TRP F 3 20 ? 8.259   -28.984 10.339  1.00 28.46 ? 43  TRP B CZ2   1 
ATOM   1599 C  CZ3   . TRP F 3 20 ? 10.328  -28.097 11.214  1.00 28.59 ? 43  TRP B CZ3   1 
ATOM   1600 C  CH2   . TRP F 3 20 ? 9.369   -29.118 11.132  1.00 25.79 ? 43  TRP B CH2   1 
ATOM   1601 N  N     . ASN F 3 21 ? 10.548  -24.993 5.675   1.00 31.02 ? 44  ASN B N     1 
ATOM   1602 C  CA    . ASN F 3 21 ? 10.649  -25.900 4.513   1.00 31.96 ? 44  ASN B CA    1 
ATOM   1603 C  C     . ASN F 3 21 ? 11.977  -26.633 4.401   1.00 31.56 ? 44  ASN B C     1 
ATOM   1604 O  O     . ASN F 3 21 ? 12.024  -27.857 4.198   1.00 29.38 ? 44  ASN B O     1 
ATOM   1605 C  CB    . ASN F 3 21 ? 10.443  -25.142 3.201   1.00 33.79 ? 44  ASN B CB    1 
ATOM   1606 C  CG    . ASN F 3 21 ? 9.056   -25.333 2.633   1.00 38.20 ? 44  ASN B CG    1 
ATOM   1607 O  OD1   . ASN F 3 21 ? 8.087   -24.764 3.143   1.00 42.26 ? 44  ASN B OD1   1 
ATOM   1608 N  ND2   . ASN F 3 21 ? 8.944   -26.153 1.580   1.00 37.76 ? 44  ASN B ND2   1 
ATOM   1609 N  N     . GLU F 3 22 ? 13.055  -25.864 4.507   1.00 31.75 ? 45  GLU B N     1 
ATOM   1610 C  CA    . GLU F 3 22 ? 14.403  -26.402 4.407   1.00 32.36 ? 45  GLU B CA    1 
ATOM   1611 C  C     . GLU F 3 22 ? 14.682  -27.276 5.616   1.00 30.82 ? 45  GLU B C     1 
ATOM   1612 O  O     . GLU F 3 22 ? 15.314  -28.310 5.500   1.00 31.92 ? 45  GLU B O     1 
ATOM   1613 C  CB    . GLU F 3 22 ? 15.418  -25.270 4.366   1.00 34.91 ? 45  GLU B CB    1 
ATOM   1614 C  CG    . GLU F 3 22 ? 16.558  -25.501 3.437   1.00 41.35 ? 45  GLU B CG    1 
ATOM   1615 C  CD    . GLU F 3 22 ? 16.325  -24.856 2.081   1.00 46.19 ? 45  GLU B CD    1 
ATOM   1616 O  OE1   . GLU F 3 22 ? 17.187  -25.013 1.192   1.00 48.90 ? 45  GLU B OE1   1 
ATOM   1617 O  OE2   . GLU F 3 22 ? 15.283  -24.179 1.905   1.00 48.82 ? 45  GLU B OE2   1 
ATOM   1618 N  N     . CYS F 3 23 ? 14.231  -26.836 6.786   1.00 29.79 ? 46  CYS B N     1 
ATOM   1619 C  CA    . CYS F 3 23 ? 14.426  -27.612 7.995   1.00 27.55 ? 46  CYS B CA    1 
ATOM   1620 C  C     . CYS F 3 23 ? 13.614  -28.893 7.802   1.00 27.44 ? 46  CYS B C     1 
ATOM   1621 O  O     . CYS F 3 23 ? 14.102  -29.994 8.016   1.00 26.35 ? 46  CYS B O     1 
ATOM   1622 C  CB    . CYS F 3 23 ? 13.910  -26.830 9.204   1.00 27.26 ? 46  CYS B CB    1 
ATOM   1623 S  SG    . CYS F 3 23 ? 13.940  -27.718 10.821  1.00 28.26 ? 46  CYS B SG    1 
ATOM   1624 N  N     . ARG F 3 24 ? 12.365  -28.728 7.377   1.00 28.62 ? 47  ARG B N     1 
ATOM   1625 C  CA    . ARG F 3 24 ? 11.455  -29.850 7.168   1.00 29.00 ? 47  ARG B CA    1 
ATOM   1626 C  C     . ARG F 3 24 ? 12.017  -30.914 6.256   1.00 27.76 ? 47  ARG B C     1 
ATOM   1627 O  O     . ARG F 3 24 ? 11.885  -32.107 6.524   1.00 25.67 ? 47  ARG B O     1 
ATOM   1628 C  CB    . ARG F 3 24 ? 10.130  -29.370 6.596   1.00 32.10 ? 47  ARG B CB    1 
ATOM   1629 C  CG    . ARG F 3 24 ? 9.113   -30.492 6.508   1.00 38.45 ? 47  ARG B CG    1 
ATOM   1630 C  CD    . ARG F 3 24 ? 7.793   -29.993 5.982   1.00 42.36 ? 47  ARG B CD    1 
ATOM   1631 N  NE    . ARG F 3 24 ? 6.797   -31.048 6.015   1.00 47.72 ? 47  ARG B NE    1 
ATOM   1632 C  CZ    . ARG F 3 24 ? 5.517   -30.862 5.721   1.00 50.50 ? 47  ARG B CZ    1 
ATOM   1633 N  NH1   . ARG F 3 24 ? 5.097   -29.647 5.370   1.00 51.38 ? 47  ARG B NH1   1 
ATOM   1634 N  NH2   . ARG F 3 24 ? 4.663   -31.882 5.788   1.00 50.07 ? 47  ARG B NH2   1 
ATOM   1635 N  N     . ALA F 3 25 ? 12.645  -30.474 5.173   1.00 26.47 ? 48  ALA B N     1 
ATOM   1636 C  CA    . ALA F 3 25 ? 13.244  -31.392 4.217   1.00 26.44 ? 48  ALA B CA    1 
ATOM   1637 C  C     . ALA F 3 25 ? 14.322  -32.261 4.857   1.00 26.87 ? 48  ALA B C     1 
ATOM   1638 O  O     . ALA F 3 25 ? 14.644  -33.328 4.341   1.00 26.42 ? 48  ALA B O     1 
ATOM   1639 C  CB    . ALA F 3 25 ? 13.842  -30.611 3.054   1.00 26.39 ? 48  ALA B CB    1 
ATOM   1640 N  N     . GLN F 3 26 ? 14.878  -31.815 5.977   1.00 25.75 ? 49  GLN B N     1 
ATOM   1641 C  CA    . GLN F 3 26 ? 15.931  -32.585 6.630   1.00 24.98 ? 49  GLN B CA    1 
ATOM   1642 C  C     . GLN F 3 26 ? 15.424  -33.502 7.739   1.00 26.79 ? 49  GLN B C     1 
ATOM   1643 O  O     . GLN F 3 26 ? 15.999  -34.555 7.964   1.00 27.56 ? 49  GLN B O     1 
ATOM   1644 C  CB    . GLN F 3 26 ? 16.979  -31.644 7.227   1.00 26.85 ? 49  GLN B CB    1 
ATOM   1645 C  CG    . GLN F 3 26 ? 17.489  -30.573 6.274   1.00 28.70 ? 49  GLN B CG    1 
ATOM   1646 C  CD    . GLN F 3 26 ? 18.054  -31.178 5.015   1.00 30.66 ? 49  GLN B CD    1 
ATOM   1647 O  OE1   . GLN F 3 26 ? 18.824  -32.123 5.073   1.00 33.56 ? 49  GLN B OE1   1 
ATOM   1648 N  NE2   . GLN F 3 26 ? 17.681  -30.631 3.871   1.00 33.44 ? 49  GLN B NE2   1 
ATOM   1649 N  N     . VAL F 3 27 ? 14.346  -33.115 8.419   1.00 26.35 ? 50  VAL B N     1 
ATOM   1650 C  CA    . VAL F 3 27 ? 13.845  -33.912 9.523   1.00 26.19 ? 50  VAL B CA    1 
ATOM   1651 C  C     . VAL F 3 27 ? 12.602  -34.783 9.332   1.00 27.55 ? 50  VAL B C     1 
ATOM   1652 O  O     . VAL F 3 27 ? 12.423  -35.776 10.036  1.00 26.74 ? 50  VAL B O     1 
ATOM   1653 C  CB    . VAL F 3 27 ? 13.658  -33.013 10.775  1.00 24.60 ? 50  VAL B CB    1 
ATOM   1654 C  CG1   . VAL F 3 27 ? 14.982  -32.317 11.090  1.00 22.57 ? 50  VAL B CG1   1 
ATOM   1655 C  CG2   . VAL F 3 27 ? 12.536  -32.000 10.563  1.00 23.63 ? 50  VAL B CG2   1 
ATOM   1656 N  N     . ASP F 3 28 ? 11.755  -34.452 8.369   1.00 30.17 ? 51  ASP B N     1 
ATOM   1657 C  CA    . ASP F 3 28 ? 10.546  -35.242 8.186   1.00 30.63 ? 51  ASP B CA    1 
ATOM   1658 C  C     . ASP F 3 28 ? 10.791  -36.675 7.682   1.00 30.47 ? 51  ASP B C     1 
ATOM   1659 O  O     . ASP F 3 28 ? 11.309  -36.910 6.587   1.00 31.04 ? 51  ASP B O     1 
ATOM   1660 C  CB    . ASP F 3 28 ? 9.566   -34.482 7.292   1.00 33.97 ? 51  ASP B CB    1 
ATOM   1661 C  CG    . ASP F 3 28 ? 8.257   -35.218 7.118   1.00 35.64 ? 51  ASP B CG    1 
ATOM   1662 O  OD1   . ASP F 3 28 ? 8.179   -36.043 6.185   1.00 36.48 ? 51  ASP B OD1   1 
ATOM   1663 O  OD2   . ASP F 3 28 ? 7.327   -34.990 7.925   1.00 38.13 ? 51  ASP B OD2   1 
ATOM   1664 N  N     . ARG F 3 29 ? 10.403  -37.620 8.528   1.00 28.44 ? 52  ARG B N     1 
ATOM   1665 C  CA    . ARG F 3 29 ? 10.557  -39.052 8.312   1.00 27.48 ? 52  ARG B CA    1 
ATOM   1666 C  C     . ARG F 3 29 ? 12.010  -39.495 8.449   1.00 25.98 ? 52  ARG B C     1 
ATOM   1667 O  O     . ARG F 3 29 ? 12.414  -40.495 7.889   1.00 26.51 ? 52  ARG B O     1 
ATOM   1668 C  CB    . ARG F 3 29 ? 9.940   -39.485 6.966   1.00 29.10 ? 52  ARG B CB    1 
ATOM   1669 C  CG    . ARG F 3 29 ? 8.410   -39.266 6.949   1.00 29.53 ? 52  ARG B CG    1 
ATOM   1670 C  CD    . ARG F 3 29 ? 7.748   -39.806 5.693   1.00 31.81 ? 52  ARG B CD    1 
ATOM   1671 N  NE    . ARG F 3 29 ? 8.386   -39.266 4.509   1.00 33.23 ? 52  ARG B NE    1 
ATOM   1672 C  CZ    . ARG F 3 29 ? 9.093   -39.983 3.643   1.00 33.12 ? 52  ARG B CZ    1 
ATOM   1673 N  NH1   . ARG F 3 29 ? 9.634   -39.377 2.607   1.00 35.90 ? 52  ARG B NH1   1 
ATOM   1674 N  NH2   . ARG F 3 29 ? 9.241   -41.296 3.787   1.00 32.57 ? 52  ARG B NH2   1 
ATOM   1675 N  N     . PHE F 3 30 ? 12.791  -38.740 9.217   1.00 24.18 ? 53  PHE B N     1 
ATOM   1676 C  CA    . PHE F 3 30 ? 14.187  -39.094 9.469   1.00 22.87 ? 53  PHE B CA    1 
ATOM   1677 C  C     . PHE F 3 30 ? 14.170  -39.753 10.848  1.00 22.46 ? 53  PHE B C     1 
ATOM   1678 O  O     . PHE F 3 30 ? 13.676  -39.176 11.809  1.00 23.42 ? 53  PHE B O     1 
ATOM   1679 C  CB    . PHE F 3 30 ? 15.068  -37.853 9.474   1.00 20.83 ? 53  PHE B CB    1 
ATOM   1680 C  CG    . PHE F 3 30 ? 16.524  -38.158 9.583   1.00 21.66 ? 53  PHE B CG    1 
ATOM   1681 C  CD1   . PHE F 3 30 ? 17.134  -38.275 10.824  1.00 21.39 ? 53  PHE B CD1   1 
ATOM   1682 C  CD2   . PHE F 3 30 ? 17.289  -38.353 8.436   1.00 21.65 ? 53  PHE B CD2   1 
ATOM   1683 C  CE1   . PHE F 3 30 ? 18.493  -38.583 10.930  1.00 21.36 ? 53  PHE B CE1   1 
ATOM   1684 C  CE2   . PHE F 3 30 ? 18.644  -38.664 8.511   1.00 19.71 ? 53  PHE B CE2   1 
ATOM   1685 C  CZ    . PHE F 3 30 ? 19.256  -38.781 9.772   1.00 22.32 ? 53  PHE B CZ    1 
ATOM   1686 N  N     . PRO F 3 31 ? 14.734  -40.959 10.972  1.00 23.00 ? 54  PRO B N     1 
ATOM   1687 C  CA    . PRO F 3 31 ? 14.666  -41.552 12.305  1.00 22.89 ? 54  PRO B CA    1 
ATOM   1688 C  C     . PRO F 3 31 ? 15.489  -40.842 13.356  1.00 21.32 ? 54  PRO B C     1 
ATOM   1689 O  O     . PRO F 3 31 ? 16.658  -40.529 13.143  1.00 22.61 ? 54  PRO B O     1 
ATOM   1690 C  CB    . PRO F 3 31 ? 15.140  -42.998 12.073  1.00 22.43 ? 54  PRO B CB    1 
ATOM   1691 C  CG    . PRO F 3 31 ? 15.624  -43.038 10.583  1.00 22.75 ? 54  PRO B CG    1 
ATOM   1692 C  CD    . PRO F 3 31 ? 15.775  -41.622 10.173  1.00 21.04 ? 54  PRO B CD    1 
ATOM   1693 N  N     . ALA F 3 32 ? 14.865  -40.555 14.487  1.00 22.39 ? 55  ALA B N     1 
ATOM   1694 C  CA    . ALA F 3 32 ? 15.585  -39.931 15.597  1.00 20.84 ? 55  ALA B CA    1 
ATOM   1695 C  C     . ALA F 3 32 ? 15.999  -38.485 15.350  1.00 21.29 ? 55  ALA B C     1 
ATOM   1696 O  O     . ALA F 3 32 ? 16.947  -37.998 15.982  1.00 21.82 ? 55  ALA B O     1 
ATOM   1697 C  CB    . ALA F 3 32 ? 16.838  -40.769 15.926  1.00 19.81 ? 55  ALA B CB    1 
ATOM   1698 N  N     . ALA F 3 33 ? 15.286  -37.806 14.456  1.00 21.06 ? 56  ALA B N     1 
ATOM   1699 C  CA    . ALA F 3 33 ? 15.591  -36.419 14.115  1.00 23.59 ? 56  ALA B CA    1 
ATOM   1700 C  C     . ALA F 3 33 ? 15.531  -35.460 15.301  1.00 23.98 ? 56  ALA B C     1 
ATOM   1701 O  O     . ALA F 3 33 ? 14.606  -35.506 16.100  1.00 22.68 ? 56  ALA B O     1 
ATOM   1702 C  CB    . ALA F 3 33 ? 14.639  -35.927 13.015  1.00 22.72 ? 56  ALA B CB    1 
ATOM   1703 N  N     . ARG F 3 34 ? 16.516  -34.580 15.410  1.00 24.99 ? 57  ARG B N     1 
ATOM   1704 C  CA    . ARG F 3 34 ? 16.492  -33.610 16.494  1.00 26.58 ? 57  ARG B CA    1 
ATOM   1705 C  C     . ARG F 3 34 ? 16.646  -32.171 15.955  1.00 25.00 ? 57  ARG B C     1 
ATOM   1706 O  O     . ARG F 3 34 ? 17.667  -31.829 15.392  1.00 26.88 ? 57  ARG B O     1 
ATOM   1707 C  CB    . ARG F 3 34 ? 17.584  -33.937 17.532  1.00 26.90 ? 57  ARG B CB    1 
ATOM   1708 C  CG    . ARG F 3 34 ? 17.347  -33.263 18.877  1.00 31.55 ? 57  ARG B CG    1 
ATOM   1709 C  CD    . ARG F 3 34 ? 18.457  -33.562 19.901  1.00 36.58 ? 57  ARG B CD    1 
ATOM   1710 N  NE    . ARG F 3 34 ? 18.375  -32.723 21.102  1.00 37.49 ? 57  ARG B NE    1 
ATOM   1711 C  CZ    . ARG F 3 34 ? 17.267  -32.529 21.811  1.00 40.44 ? 57  ARG B CZ    1 
ATOM   1712 N  NH1   . ARG F 3 34 ? 16.139  -33.112 21.435  1.00 42.74 ? 57  ARG B NH1   1 
ATOM   1713 N  NH2   . ARG F 3 34 ? 17.283  -31.755 22.895  1.00 40.74 ? 57  ARG B NH2   1 
ATOM   1714 N  N     . PHE F 3 35 ? 15.610  -31.346 16.126  1.00 24.93 ? 58  PHE B N     1 
ATOM   1715 C  CA    . PHE F 3 35 ? 15.628  -29.958 15.668  1.00 24.98 ? 58  PHE B CA    1 
ATOM   1716 C  C     . PHE F 3 35 ? 14.807  -29.061 16.590  1.00 24.85 ? 58  PHE B C     1 
ATOM   1717 O  O     . PHE F 3 35 ? 13.940  -29.530 17.330  1.00 24.40 ? 58  PHE B O     1 
ATOM   1718 C  CB    . PHE F 3 35 ? 15.078  -29.869 14.239  1.00 25.06 ? 58  PHE B CB    1 
ATOM   1719 C  CG    . PHE F 3 35 ? 13.667  -30.368 14.112  1.00 25.41 ? 58  PHE B CG    1 
ATOM   1720 C  CD1   . PHE F 3 35 ? 12.608  -29.478 14.022  1.00 23.22 ? 58  PHE B CD1   1 
ATOM   1721 C  CD2   . PHE F 3 35 ? 13.400  -31.731 14.154  1.00 24.11 ? 58  PHE B CD2   1 
ATOM   1722 C  CE1   . PHE F 3 35 ? 11.311  -29.938 13.979  1.00 24.36 ? 58  PHE B CE1   1 
ATOM   1723 C  CE2   . PHE F 3 35 ? 12.114  -32.203 14.114  1.00 23.68 ? 58  PHE B CE2   1 
ATOM   1724 C  CZ    . PHE F 3 35 ? 11.063  -31.314 14.030  1.00 25.50 ? 58  PHE B CZ    1 
ATOM   1725 N  N     . LYS F 3 36 ? 15.094  -27.762 16.549  1.00 24.07 ? 59  LYS B N     1 
ATOM   1726 C  CA    . LYS F 3 36 ? 14.382  -26.798 17.373  1.00 23.70 ? 59  LYS B CA    1 
ATOM   1727 C  C     . LYS F 3 36 ? 14.587  -25.392 16.810  1.00 22.79 ? 59  LYS B C     1 
ATOM   1728 O  O     . LYS F 3 36 ? 15.590  -25.137 16.140  1.00 24.03 ? 59  LYS B O     1 
ATOM   1729 C  CB    . LYS F 3 36 ? 14.925  -26.857 18.795  1.00 24.96 ? 59  LYS B CB    1 
ATOM   1730 C  CG    . LYS F 3 36 ? 14.202  -25.942 19.771  1.00 28.78 ? 59  LYS B CG    1 
ATOM   1731 C  CD    . LYS F 3 36 ? 14.847  -26.025 21.152  1.00 30.97 ? 59  LYS B CD    1 
ATOM   1732 C  CE    . LYS F 3 36 ? 14.056  -25.225 22.169  1.00 33.34 ? 59  LYS B CE    1 
ATOM   1733 N  NZ    . LYS F 3 36 ? 12.751  -25.898 22.425  1.00 36.84 ? 59  LYS B NZ    1 
ATOM   1734 N  N     . LYS F 3 37 ? 13.668  -24.467 17.044  1.00 22.16 ? 60  LYS B N     1 
ATOM   1735 C  CA    . LYS F 3 37 ? 13.936  -23.137 16.516  1.00 25.73 ? 60  LYS B CA    1 
ATOM   1736 C  C     . LYS F 3 37 ? 14.446  -22.190 17.588  1.00 27.88 ? 60  LYS B C     1 
ATOM   1737 O  O     . LYS F 3 37 ? 14.021  -22.260 18.735  1.00 28.52 ? 60  LYS B O     1 
ATOM   1738 C  CB    . LYS F 3 37 ? 12.713  -22.556 15.791  1.00 26.96 ? 60  LYS B CB    1 
ATOM   1739 C  CG    . LYS F 3 37 ? 11.450  -22.386 16.580  1.00 28.69 ? 60  LYS B CG    1 
ATOM   1740 C  CD    . LYS F 3 37 ? 10.370  -21.748 15.694  1.00 27.60 ? 60  LYS B CD    1 
ATOM   1741 C  CE    . LYS F 3 37 ? 8.985   -21.932 16.284  1.00 29.55 ? 60  LYS B CE    1 
ATOM   1742 N  NZ    . LYS F 3 37 ? 7.994   -20.976 15.700  1.00 32.03 ? 60  LYS B NZ    1 
ATOM   1743 N  N     . PHE F 3 38 ? 15.387  -21.327 17.212  1.00 28.32 ? 61  PHE B N     1 
ATOM   1744 C  CA    . PHE F 3 38 ? 15.969  -20.373 18.146  1.00 28.62 ? 61  PHE B CA    1 
ATOM   1745 C  C     . PHE F 3 38 ? 15.932  -18.943 17.624  1.00 29.93 ? 61  PHE B C     1 
ATOM   1746 O  O     . PHE F 3 38 ? 15.946  -18.698 16.409  1.00 29.83 ? 61  PHE B O     1 
ATOM   1747 C  CB    . PHE F 3 38 ? 17.427  -20.731 18.438  1.00 28.25 ? 61  PHE B CB    1 
ATOM   1748 C  CG    . PHE F 3 38 ? 17.601  -22.026 19.159  1.00 29.34 ? 61  PHE B CG    1 
ATOM   1749 C  CD1   . PHE F 3 38 ? 17.725  -23.218 18.451  1.00 28.11 ? 61  PHE B CD1   1 
ATOM   1750 C  CD2   . PHE F 3 38 ? 17.621  -22.063 20.554  1.00 27.06 ? 61  PHE B CD2   1 
ATOM   1751 C  CE1   . PHE F 3 38 ? 17.863  -24.435 19.124  1.00 26.84 ? 61  PHE B CE1   1 
ATOM   1752 C  CE2   . PHE F 3 38 ? 17.759  -23.273 21.220  1.00 28.37 ? 61  PHE B CE2   1 
ATOM   1753 C  CZ    . PHE F 3 38 ? 17.881  -24.462 20.500  1.00 25.70 ? 61  PHE B CZ    1 
ATOM   1754 N  N     . ALA F 3 39 ? 15.907  -18.004 18.558  1.00 29.78 ? 62  ALA B N     1 
ATOM   1755 C  CA    . ALA F 3 39 ? 15.890  -16.585 18.237  1.00 32.19 ? 62  ALA B CA    1 
ATOM   1756 C  C     . ALA F 3 39 ? 17.162  -16.116 17.503  1.00 32.42 ? 62  ALA B C     1 
ATOM   1757 O  O     . ALA F 3 39 ? 17.115  -15.224 16.659  1.00 33.73 ? 62  ALA B O     1 
ATOM   1758 C  CB    . ALA F 3 39 ? 15.709  -15.779 19.530  1.00 31.58 ? 62  ALA B CB    1 
ATOM   1759 N  N     . THR F 3 40 ? 18.301  -16.715 17.813  1.00 33.12 ? 63  THR B N     1 
ATOM   1760 C  CA    . THR F 3 40 ? 19.541  -16.277 17.183  1.00 32.65 ? 63  THR B CA    1 
ATOM   1761 C  C     . THR F 3 40 ? 20.277  -17.421 16.554  1.00 32.23 ? 63  THR B C     1 
ATOM   1762 O  O     . THR F 3 40 ? 20.027  -18.569 16.876  1.00 32.02 ? 63  THR B O     1 
ATOM   1763 C  CB    . THR F 3 40 ? 20.486  -15.619 18.222  1.00 32.26 ? 63  THR B CB    1 
ATOM   1764 O  OG1   . THR F 3 40 ? 20.905  -16.609 19.178  1.00 31.08 ? 63  THR B OG1   1 
ATOM   1765 C  CG2   . THR F 3 40 ? 19.761  -14.497 18.958  1.00 30.57 ? 63  THR B CG2   1 
ATOM   1766 N  N     . GLU F 3 41 ? 21.206  -17.100 15.664  1.00 33.62 ? 64  GLU B N     1 
ATOM   1767 C  CA    . GLU F 3 41 ? 21.988  -18.126 15.001  1.00 35.33 ? 64  GLU B CA    1 
ATOM   1768 C  C     . GLU F 3 41 ? 22.957  -18.792 15.980  1.00 35.02 ? 64  GLU B C     1 
ATOM   1769 O  O     . GLU F 3 41 ? 23.250  -19.988 15.879  1.00 33.11 ? 64  GLU B O     1 
ATOM   1770 C  CB    . GLU F 3 41 ? 22.756  -17.514 13.828  1.00 36.30 ? 64  GLU B CB    1 
ATOM   1771 C  CG    . GLU F 3 41 ? 23.349  -18.538 12.865  1.00 38.80 ? 64  GLU B CG    1 
ATOM   1772 C  CD    . GLU F 3 41 ? 23.759  -17.927 11.516  1.00 41.43 ? 64  GLU B CD    1 
ATOM   1773 O  OE1   . GLU F 3 41 ? 24.292  -18.671 10.650  1.00 41.41 ? 64  GLU B OE1   1 
ATOM   1774 O  OE2   . GLU F 3 41 ? 23.541  -16.704 11.324  1.00 40.56 ? 64  GLU B OE2   1 
ATOM   1775 N  N     . ASP F 3 42 ? 23.447  -18.013 16.934  1.00 36.34 ? 65  ASP B N     1 
ATOM   1776 C  CA    . ASP F 3 42 ? 24.393  -18.528 17.931  1.00 36.61 ? 65  ASP B CA    1 
ATOM   1777 C  C     . ASP F 3 42 ? 23.758  -19.615 18.803  1.00 35.72 ? 65  ASP B C     1 
ATOM   1778 O  O     . ASP F 3 42 ? 24.360  -20.663 19.053  1.00 33.75 ? 65  ASP B O     1 
ATOM   1779 C  CB    . ASP F 3 42 ? 24.921  -17.356 18.773  1.00 39.39 ? 65  ASP B CB    1 
ATOM   1780 C  CG    . ASP F 3 42 ? 25.326  -17.759 20.189  1.00 41.66 ? 65  ASP B CG    1 
ATOM   1781 O  OD1   . ASP F 3 42 ? 25.864  -18.868 20.391  1.00 42.12 ? 65  ASP B OD1   1 
ATOM   1782 O  OD2   . ASP F 3 42 ? 25.115  -16.936 21.111  1.00 44.27 ? 65  ASP B OD2   1 
ATOM   1783 N  N     . GLU F 3 43 ? 22.539  -19.357 19.259  1.00 36.50 ? 66  GLU B N     1 
ATOM   1784 C  CA    . GLU F 3 43 ? 21.813  -20.317 20.074  1.00 37.29 ? 66  GLU B CA    1 
ATOM   1785 C  C     . GLU F 3 43 ? 21.571  -21.567 19.253  1.00 37.50 ? 66  GLU B C     1 
ATOM   1786 O  O     . GLU F 3 43 ? 21.641  -22.691 19.766  1.00 37.20 ? 66  GLU B O     1 
ATOM   1787 C  CB    . GLU F 3 43 ? 20.474  -19.743 20.493  1.00 39.87 ? 66  GLU B CB    1 
ATOM   1788 C  CG    . GLU F 3 43 ? 20.542  -18.830 21.676  1.00 43.51 ? 66  GLU B CG    1 
ATOM   1789 C  CD    . GLU F 3 43 ? 19.168  -18.441 22.150  1.00 46.73 ? 66  GLU B CD    1 
ATOM   1790 O  OE1   . GLU F 3 43 ? 18.537  -17.592 21.485  1.00 49.96 ? 66  GLU B OE1   1 
ATOM   1791 O  OE2   . GLU F 3 43 ? 18.716  -18.999 23.175  1.00 48.06 ? 66  GLU B OE2   1 
ATOM   1792 N  N     . ALA F 3 44 ? 21.292  -21.350 17.970  1.00 36.17 ? 67  ALA B N     1 
ATOM   1793 C  CA    . ALA F 3 44 ? 21.026  -22.425 17.035  1.00 34.67 ? 67  ALA B CA    1 
ATOM   1794 C  C     . ALA F 3 44 ? 22.246  -23.293 16.861  1.00 33.56 ? 67  ALA B C     1 
ATOM   1795 O  O     . ALA F 3 44 ? 22.164  -24.497 17.029  1.00 35.58 ? 67  ALA B O     1 
ATOM   1796 C  CB    . ALA F 3 44 ? 20.584  -21.860 15.678  1.00 35.33 ? 67  ALA B CB    1 
ATOM   1797 N  N     . TRP F 3 45 ? 23.382  -22.713 16.502  1.00 33.10 ? 68  TRP B N     1 
ATOM   1798 C  CA    . TRP F 3 45 ? 24.565  -23.552 16.342  1.00 31.50 ? 68  TRP B CA    1 
ATOM   1799 C  C     . TRP F 3 45 ? 24.979  -24.177 17.669  1.00 31.03 ? 68  TRP B C     1 
ATOM   1800 O  O     . TRP F 3 45 ? 25.746  -25.125 17.697  1.00 31.22 ? 68  TRP B O     1 
ATOM   1801 C  CB    . TRP F 3 45 ? 25.728  -22.772 15.764  1.00 30.28 ? 68  TRP B CB    1 
ATOM   1802 C  CG    . TRP F 3 45 ? 25.597  -22.542 14.330  1.00 28.84 ? 68  TRP B CG    1 
ATOM   1803 C  CD1   . TRP F 3 45 ? 25.275  -21.374 13.718  1.00 29.55 ? 68  TRP B CD1   1 
ATOM   1804 C  CD2   . TRP F 3 45 ? 25.813  -23.495 13.292  1.00 27.85 ? 68  TRP B CD2   1 
ATOM   1805 N  NE1   . TRP F 3 45 ? 25.282  -21.537 12.358  1.00 26.62 ? 68  TRP B NE1   1 
ATOM   1806 C  CE2   . TRP F 3 45 ? 25.608  -22.832 12.070  1.00 26.30 ? 68  TRP B CE2   1 
ATOM   1807 C  CE3   . TRP F 3 45 ? 26.163  -24.848 13.276  1.00 26.37 ? 68  TRP B CE3   1 
ATOM   1808 C  CZ2   . TRP F 3 45 ? 25.740  -23.474 10.841  1.00 26.39 ? 68  TRP B CZ2   1 
ATOM   1809 C  CZ3   . TRP F 3 45 ? 26.297  -25.485 12.057  1.00 26.20 ? 68  TRP B CZ3   1 
ATOM   1810 C  CH2   . TRP F 3 45 ? 26.085  -24.798 10.855  1.00 25.36 ? 68  TRP B CH2   1 
ATOM   1811 N  N     . ALA F 3 46 ? 24.472  -23.649 18.773  1.00 33.12 ? 69  ALA B N     1 
ATOM   1812 C  CA    . ALA F 3 46 ? 24.795  -24.232 20.074  1.00 34.01 ? 69  ALA B CA    1 
ATOM   1813 C  C     . ALA F 3 46 ? 24.039  -25.562 20.174  1.00 34.25 ? 69  ALA B C     1 
ATOM   1814 O  O     . ALA F 3 46 ? 24.568  -26.573 20.642  1.00 35.54 ? 69  ALA B O     1 
ATOM   1815 C  CB    . ALA F 3 46 ? 24.370  -23.296 21.198  1.00 34.29 ? 69  ALA B CB    1 
ATOM   1816 N  N     . PHE F 3 47 ? 22.797  -25.557 19.705  1.00 33.67 ? 70  PHE B N     1 
ATOM   1817 C  CA    . PHE F 3 47 ? 21.965  -26.745 19.750  1.00 32.42 ? 70  PHE B CA    1 
ATOM   1818 C  C     . PHE F 3 47 ? 22.484  -27.802 18.773  1.00 32.97 ? 70  PHE B C     1 
ATOM   1819 O  O     . PHE F 3 47 ? 22.380  -28.993 19.021  1.00 32.87 ? 70  PHE B O     1 
ATOM   1820 C  CB    . PHE F 3 47 ? 20.523  -26.354 19.421  1.00 29.67 ? 70  PHE B CB    1 
ATOM   1821 C  CG    . PHE F 3 47 ? 19.571  -27.498 19.440  1.00 28.55 ? 70  PHE B CG    1 
ATOM   1822 C  CD1   . PHE F 3 47 ? 19.001  -27.930 20.631  1.00 28.56 ? 70  PHE B CD1   1 
ATOM   1823 C  CD2   . PHE F 3 47 ? 19.236  -28.153 18.256  1.00 29.35 ? 70  PHE B CD2   1 
ATOM   1824 C  CE1   . PHE F 3 47 ? 18.106  -29.003 20.648  1.00 27.69 ? 70  PHE B CE1   1 
ATOM   1825 C  CE2   . PHE F 3 47 ? 18.347  -29.224 18.255  1.00 26.92 ? 70  PHE B CE2   1 
ATOM   1826 C  CZ    . PHE F 3 47 ? 17.778  -29.651 19.451  1.00 27.87 ? 70  PHE B CZ    1 
ATOM   1827 N  N     . VAL F 3 48 ? 23.049  -27.364 17.658  1.00 34.34 ? 71  VAL B N     1 
ATOM   1828 C  CA    . VAL F 3 48 ? 23.568  -28.306 16.676  1.00 35.97 ? 71  VAL B CA    1 
ATOM   1829 C  C     . VAL F 3 48 ? 24.718  -29.148 17.225  1.00 38.30 ? 71  VAL B C     1 
ATOM   1830 O  O     . VAL F 3 48 ? 24.858  -30.315 16.868  1.00 38.29 ? 71  VAL B O     1 
ATOM   1831 C  CB    . VAL F 3 48 ? 24.058  -27.575 15.390  1.00 34.95 ? 71  VAL B CB    1 
ATOM   1832 C  CG1   . VAL F 3 48 ? 24.930  -28.491 14.564  1.00 33.59 ? 71  VAL B CG1   1 
ATOM   1833 C  CG2   . VAL F 3 48 ? 22.866  -27.126 14.550  1.00 34.47 ? 71  VAL B CG2   1 
ATOM   1834 N  N     . ARG F 3 49 ? 25.533  -28.560 18.092  1.00 39.80 ? 72  ARG B N     1 
ATOM   1835 C  CA    . ARG F 3 49 ? 26.681  -29.272 18.636  1.00 43.80 ? 72  ARG B CA    1 
ATOM   1836 C  C     . ARG F 3 49 ? 26.525  -30.052 19.934  1.00 45.43 ? 72  ARG B C     1 
ATOM   1837 O  O     . ARG F 3 49 ? 27.494  -30.638 20.404  1.00 46.63 ? 72  ARG B O     1 
ATOM   1838 C  CB    . ARG F 3 49 ? 27.864  -28.309 18.776  1.00 44.71 ? 72  ARG B CB    1 
ATOM   1839 C  CG    . ARG F 3 49 ? 28.647  -28.185 17.494  1.00 47.53 ? 72  ARG B CG    1 
ATOM   1840 C  CD    . ARG F 3 49 ? 29.207  -26.804 17.280  1.00 48.08 ? 72  ARG B CD    1 
ATOM   1841 N  NE    . ARG F 3 49 ? 29.399  -26.598 15.851  1.00 50.35 ? 72  ARG B NE    1 
ATOM   1842 C  CZ    . ARG F 3 49 ? 29.691  -25.428 15.295  1.00 51.84 ? 72  ARG B CZ    1 
ATOM   1843 N  NH1   . ARG F 3 49 ? 29.842  -25.341 13.977  1.00 50.96 ? 72  ARG B NH1   1 
ATOM   1844 N  NH2   . ARG F 3 49 ? 29.834  -24.347 16.058  1.00 52.91 ? 72  ARG B NH2   1 
ATOM   1845 N  N     . LYS F 3 50 ? 25.340  -30.083 20.526  1.00 47.62 ? 73  LYS B N     1 
ATOM   1846 C  CA    . LYS F 3 50 ? 25.195  -30.832 21.775  1.00 49.78 ? 73  LYS B CA    1 
ATOM   1847 C  C     . LYS F 3 50 ? 24.975  -32.330 21.541  1.00 50.81 ? 73  LYS B C     1 
ATOM   1848 O  O     . LYS F 3 50 ? 24.883  -32.742 20.361  1.00 51.87 ? 73  LYS B O     1 
ATOM   1849 C  CB    . LYS F 3 50 ? 24.053  -30.249 22.607  1.00 50.89 ? 73  LYS B CB    1 
ATOM   1850 C  CG    . LYS F 3 50 ? 24.223  -28.762 22.898  1.00 53.93 ? 73  LYS B CG    1 
ATOM   1851 C  CD    . LYS F 3 50 ? 23.145  -28.215 23.830  1.00 56.29 ? 73  LYS B CD    1 
ATOM   1852 C  CE    . LYS F 3 50 ? 23.424  -28.564 25.285  1.00 58.23 ? 73  LYS B CE    1 
ATOM   1853 N  NZ    . LYS F 3 50 ? 24.643  -27.859 25.798  1.00 59.55 ? 73  LYS B NZ    1 
ATOM   1854 N  N     . MET G 3 4  ? -10.171 -3.990  32.239  1.00 47.42 ? 27  MET C N     1 
ATOM   1855 C  CA    . MET G 3 4  ? -10.858 -4.966  31.333  1.00 48.06 ? 27  MET C CA    1 
ATOM   1856 C  C     . MET G 3 4  ? -11.630 -6.012  32.131  1.00 46.91 ? 27  MET C C     1 
ATOM   1857 O  O     . MET G 3 4  ? -11.350 -6.253  33.305  1.00 47.51 ? 27  MET C O     1 
ATOM   1858 C  CB    . MET G 3 4  ? -9.839  -5.674  30.432  1.00 49.53 ? 27  MET C CB    1 
ATOM   1859 C  CG    . MET G 3 4  ? -9.070  -4.756  29.485  1.00 53.44 ? 27  MET C CG    1 
ATOM   1860 S  SD    . MET G 3 4  ? -10.047 -4.128  28.087  1.00 57.59 ? 27  MET C SD    1 
ATOM   1861 C  CE    . MET G 3 4  ? -10.766 -2.621  28.818  1.00 55.69 ? 27  MET C CE    1 
ATOM   1862 N  N     . PHE G 3 5  ? -12.605 -6.641  31.494  1.00 44.25 ? 28  PHE C N     1 
ATOM   1863 C  CA    . PHE G 3 5  ? -13.390 -7.656  32.178  1.00 41.78 ? 28  PHE C CA    1 
ATOM   1864 C  C     . PHE G 3 5  ? -13.133 -8.987  31.522  1.00 39.50 ? 28  PHE C C     1 
ATOM   1865 O  O     . PHE G 3 5  ? -13.366 -9.147  30.326  1.00 36.61 ? 28  PHE C O     1 
ATOM   1866 C  CB    . PHE G 3 5  ? -14.876 -7.331  32.096  1.00 43.20 ? 28  PHE C CB    1 
ATOM   1867 C  CG    . PHE G 3 5  ? -15.267 -6.117  32.874  1.00 46.06 ? 28  PHE C CG    1 
ATOM   1868 C  CD1   . PHE G 3 5  ? -15.557 -6.214  34.239  1.00 45.99 ? 28  PHE C CD1   1 
ATOM   1869 C  CD2   . PHE G 3 5  ? -15.350 -4.873  32.244  1.00 46.36 ? 28  PHE C CD2   1 
ATOM   1870 C  CE1   . PHE G 3 5  ? -15.928 -5.094  34.968  1.00 47.00 ? 28  PHE C CE1   1 
ATOM   1871 C  CE2   . PHE G 3 5  ? -15.719 -3.736  32.959  1.00 47.93 ? 28  PHE C CE2   1 
ATOM   1872 C  CZ    . PHE G 3 5  ? -16.010 -3.844  34.327  1.00 48.65 ? 28  PHE C CZ    1 
ATOM   1873 N  N     . TYR G 3 6  ? -12.663 -9.944  32.314  1.00 36.73 ? 29  TYR C N     1 
ATOM   1874 C  CA    . TYR G 3 6  ? -12.363 -11.260 31.783  1.00 36.35 ? 29  TYR C CA    1 
ATOM   1875 C  C     . TYR G 3 6  ? -13.546 -12.247 31.848  1.00 35.58 ? 29  TYR C C     1 
ATOM   1876 O  O     . TYR G 3 6  ? -14.026 -12.624 32.923  1.00 34.93 ? 29  TYR C O     1 
ATOM   1877 C  CB    . TYR G 3 6  ? -11.117 -11.830 32.484  1.00 36.62 ? 29  TYR C CB    1 
ATOM   1878 C  CG    . TYR G 3 6  ? -9.881  -10.963 32.304  1.00 36.05 ? 29  TYR C CG    1 
ATOM   1879 C  CD1   . TYR G 3 6  ? -9.726  -9.783  33.017  1.00 36.92 ? 29  TYR C CD1   1 
ATOM   1880 C  CD2   . TYR G 3 6  ? -8.893  -11.303 31.381  1.00 36.69 ? 29  TYR C CD2   1 
ATOM   1881 C  CE1   . TYR G 3 6  ? -8.627  -8.965  32.817  1.00 36.09 ? 29  TYR C CE1   1 
ATOM   1882 C  CE2   . TYR G 3 6  ? -7.785  -10.489 31.167  1.00 34.88 ? 29  TYR C CE2   1 
ATOM   1883 C  CZ    . TYR G 3 6  ? -7.659  -9.324  31.887  1.00 36.20 ? 29  TYR C CZ    1 
ATOM   1884 O  OH    . TYR G 3 6  ? -6.574  -8.502  31.684  1.00 33.10 ? 29  TYR C OH    1 
ATOM   1885 N  N     . ALA G 3 7  ? -14.014 -12.642 30.671  1.00 33.24 ? 30  ALA C N     1 
ATOM   1886 C  CA    . ALA G 3 7  ? -15.123 -13.568 30.549  1.00 33.21 ? 30  ALA C CA    1 
ATOM   1887 C  C     . ALA G 3 7  ? -14.630 -14.985 30.258  1.00 34.00 ? 30  ALA C C     1 
ATOM   1888 O  O     . ALA G 3 7  ? -13.861 -15.223 29.308  1.00 33.12 ? 30  ALA C O     1 
ATOM   1889 C  CB    . ALA G 3 7  ? -16.069 -13.106 29.441  1.00 32.54 ? 30  ALA C CB    1 
ATOM   1890 N  N     . VAL G 3 8  ? -15.058 -15.917 31.103  1.00 32.98 ? 31  VAL C N     1 
ATOM   1891 C  CA    . VAL G 3 8  ? -14.729 -17.323 30.938  1.00 33.42 ? 31  VAL C CA    1 
ATOM   1892 C  C     . VAL G 3 8  ? -16.064 -18.015 30.744  1.00 35.48 ? 31  VAL C C     1 
ATOM   1893 O  O     . VAL G 3 8  ? -16.812 -18.202 31.710  1.00 36.14 ? 31  VAL C O     1 
ATOM   1894 C  CB    . VAL G 3 8  ? -14.098 -17.918 32.185  1.00 33.49 ? 31  VAL C CB    1 
ATOM   1895 C  CG1   . VAL G 3 8  ? -13.922 -19.416 31.983  1.00 30.79 ? 31  VAL C CG1   1 
ATOM   1896 C  CG2   . VAL G 3 8  ? -12.765 -17.209 32.500  1.00 30.72 ? 31  VAL C CG2   1 
ATOM   1897 N  N     . ARG G 3 9  ? -16.389 -18.392 29.512  1.00 35.43 ? 32  ARG C N     1 
ATOM   1898 C  CA    . ARG G 3 9  ? -17.669 -19.041 29.308  1.00 36.13 ? 32  ARG C CA    1 
ATOM   1899 C  C     . ARG G 3 9  ? -17.531 -20.528 29.558  1.00 35.84 ? 32  ARG C C     1 
ATOM   1900 O  O     . ARG G 3 9  ? -18.518 -21.210 29.827  1.00 36.62 ? 32  ARG C O     1 
ATOM   1901 C  CB    . ARG G 3 9  ? -18.201 -18.755 27.903  1.00 35.94 ? 32  ARG C CB    1 
ATOM   1902 C  CG    . ARG G 3 9  ? -18.159 -19.914 26.967  1.00 38.32 ? 32  ARG C CG    1 
ATOM   1903 C  CD    . ARG G 3 9  ? -19.153 -19.713 25.845  1.00 39.02 ? 32  ARG C CD    1 
ATOM   1904 N  NE    . ARG G 3 9  ? -18.994 -18.422 25.192  1.00 40.13 ? 32  ARG C NE    1 
ATOM   1905 C  CZ    . ARG G 3 9  ? -19.385 -18.186 23.946  1.00 40.75 ? 32  ARG C CZ    1 
ATOM   1906 N  NH1   . ARG G 3 9  ? -19.218 -16.985 23.411  1.00 40.79 ? 32  ARG C NH1   1 
ATOM   1907 N  NH2   . ARG G 3 9  ? -19.933 -19.166 23.240  1.00 39.96 ? 32  ARG C NH2   1 
ATOM   1908 N  N     . ARG G 3 10 ? -16.298 -21.019 29.470  1.00 35.89 ? 33  ARG C N     1 
ATOM   1909 C  CA    . ARG G 3 10 ? -15.989 -22.419 29.709  1.00 35.67 ? 33  ARG C CA    1 
ATOM   1910 C  C     . ARG G 3 10 ? -14.601 -22.557 30.348  1.00 35.39 ? 33  ARG C C     1 
ATOM   1911 O  O     . ARG G 3 10 ? -13.594 -22.155 29.768  1.00 33.85 ? 33  ARG C O     1 
ATOM   1912 C  CB    . ARG G 3 10 ? -16.031 -23.220 28.410  1.00 38.41 ? 33  ARG C CB    1 
ATOM   1913 C  CG    . ARG G 3 10 ? -15.879 -24.717 28.655  1.00 41.50 ? 33  ARG C CG    1 
ATOM   1914 C  CD    . ARG G 3 10 ? -15.124 -25.436 27.542  1.00 47.22 ? 33  ARG C CD    1 
ATOM   1915 N  NE    . ARG G 3 10 ? -15.980 -25.992 26.498  1.00 48.58 ? 33  ARG C NE    1 
ATOM   1916 C  CZ    . ARG G 3 10 ? -16.528 -25.289 25.508  1.00 51.60 ? 33  ARG C CZ    1 
ATOM   1917 N  NH1   . ARG G 3 10 ? -16.314 -23.984 25.410  1.00 51.96 ? 33  ARG C NH1   1 
ATOM   1918 N  NH2   . ARG G 3 10 ? -17.298 -25.897 24.607  1.00 52.04 ? 33  ARG C NH2   1 
ATOM   1919 N  N     . GLY G 3 11 ? -14.567 -23.131 31.548  1.00 34.84 ? 34  GLY C N     1 
ATOM   1920 C  CA    . GLY G 3 11 ? -13.328 -23.328 32.276  1.00 33.16 ? 34  GLY C CA    1 
ATOM   1921 C  C     . GLY G 3 11 ? -13.630 -23.962 33.625  1.00 35.39 ? 34  GLY C C     1 
ATOM   1922 O  O     . GLY G 3 11 ? -14.755 -24.417 33.858  1.00 34.22 ? 34  GLY C O     1 
ATOM   1923 N  N     . ARG G 3 12 ? -12.636 -24.007 34.513  1.00 35.80 ? 35  ARG C N     1 
ATOM   1924 C  CA    . ARG G 3 12 ? -12.831 -24.589 35.833  1.00 36.44 ? 35  ARG C CA    1 
ATOM   1925 C  C     . ARG G 3 12 ? -14.010 -23.897 36.475  1.00 37.04 ? 35  ARG C C     1 
ATOM   1926 O  O     . ARG G 3 12 ? -14.978 -24.552 36.825  1.00 37.21 ? 35  ARG C O     1 
ATOM   1927 C  CB    . ARG G 3 12 ? -11.574 -24.426 36.693  1.00 35.41 ? 35  ARG C CB    1 
ATOM   1928 C  CG    . ARG G 3 12 ? -10.416 -25.204 36.129  1.00 32.10 ? 35  ARG C CG    1 
ATOM   1929 C  CD    . ARG G 3 12 ? -9.208  -25.257 37.022  1.00 28.97 ? 35  ARG C CD    1 
ATOM   1930 N  NE    . ARG G 3 12 ? -8.167  -25.979 36.299  1.00 26.86 ? 35  ARG C NE    1 
ATOM   1931 C  CZ    . ARG G 3 12 ? -7.366  -25.435 35.383  1.00 27.59 ? 35  ARG C CZ    1 
ATOM   1932 N  NH1   . ARG G 3 12 ? -7.456  -24.135 35.084  1.00 25.94 ? 35  ARG C NH1   1 
ATOM   1933 N  NH2   . ARG G 3 12 ? -6.512  -26.210 34.713  1.00 28.35 ? 35  ARG C NH2   1 
ATOM   1934 N  N     . LYS G 3 13 ? -13.929 -22.572 36.601  1.00 39.70 ? 36  LYS C N     1 
ATOM   1935 C  CA    . LYS G 3 13 ? -15.006 -21.755 37.193  1.00 41.42 ? 36  LYS C CA    1 
ATOM   1936 C  C     . LYS G 3 13 ? -15.403 -20.639 36.225  1.00 41.49 ? 36  LYS C C     1 
ATOM   1937 O  O     . LYS G 3 13 ? -14.616 -19.720 35.985  1.00 44.07 ? 36  LYS C O     1 
ATOM   1938 C  CB    . LYS G 3 13 ? -14.544 -21.105 38.508  1.00 42.36 ? 36  LYS C CB    1 
ATOM   1939 C  CG    . LYS G 3 13 ? -15.674 -20.859 39.512  1.00 45.75 ? 36  LYS C CG    1 
ATOM   1940 C  CD    . LYS G 3 13 ? -15.318 -19.877 40.627  1.00 45.63 ? 36  LYS C CD    1 
ATOM   1941 C  CE    . LYS G 3 13 ? -15.355 -18.442 40.116  1.00 46.98 ? 36  LYS C CE    1 
ATOM   1942 N  NZ    . LYS G 3 13 ? -15.540 -17.421 41.201  1.00 48.29 ? 36  LYS C NZ    1 
ATOM   1943 N  N     . THR G 3 14 ? -16.614 -20.709 35.672  1.00 40.54 ? 37  THR C N     1 
ATOM   1944 C  CA    . THR G 3 14 ? -17.096 -19.683 34.744  1.00 38.92 ? 37  THR C CA    1 
ATOM   1945 C  C     . THR G 3 14 ? -17.529 -18.411 35.463  1.00 38.37 ? 37  THR C C     1 
ATOM   1946 O  O     . THR G 3 14 ? -17.815 -18.427 36.670  1.00 38.24 ? 37  THR C O     1 
ATOM   1947 C  CB    . THR G 3 14 ? -18.309 -20.162 33.935  1.00 39.52 ? 37  THR C CB    1 
ATOM   1948 O  OG1   . THR G 3 14 ? -19.359 -20.538 34.840  1.00 40.41 ? 37  THR C OG1   1 
ATOM   1949 C  CG2   . THR G 3 14 ? -17.929 -21.342 33.029  1.00 40.44 ? 37  THR C CG2   1 
ATOM   1950 N  N     . GLY G 3 15 ? -17.609 -17.325 34.698  1.00 36.20 ? 38  GLY C N     1 
ATOM   1951 C  CA    . GLY G 3 15 ? -18.004 -16.047 35.248  1.00 35.92 ? 38  GLY C CA    1 
ATOM   1952 C  C     . GLY G 3 15 ? -17.163 -14.937 34.665  1.00 35.14 ? 38  GLY C C     1 
ATOM   1953 O  O     . GLY G 3 15 ? -16.429 -15.146 33.696  1.00 36.08 ? 38  GLY C O     1 
ATOM   1954 N  N     . VAL G 3 16 ? -17.277 -13.749 35.239  1.00 34.42 ? 39  VAL C N     1 
ATOM   1955 C  CA    . VAL G 3 16 ? -16.501 -12.606 34.782  1.00 35.09 ? 39  VAL C CA    1 
ATOM   1956 C  C     . VAL G 3 16 ? -15.527 -12.285 35.902  1.00 34.96 ? 39  VAL C C     1 
ATOM   1957 O  O     . VAL G 3 16 ? -15.890 -12.340 37.071  1.00 36.26 ? 39  VAL C O     1 
ATOM   1958 C  CB    . VAL G 3 16 ? -17.417 -11.372 34.476  1.00 34.72 ? 39  VAL C CB    1 
ATOM   1959 C  CG1   . VAL G 3 16 ? -16.562 -10.127 34.168  1.00 32.67 ? 39  VAL C CG1   1 
ATOM   1960 C  CG2   . VAL G 3 16 ? -18.345 -11.693 33.291  1.00 32.42 ? 39  VAL C CG2   1 
ATOM   1961 N  N     . PHE G 3 17 ? -14.287 -11.975 35.550  1.00 35.95 ? 40  PHE C N     1 
ATOM   1962 C  CA    . PHE G 3 17 ? -13.269 -11.664 36.548  1.00 35.61 ? 40  PHE C CA    1 
ATOM   1963 C  C     . PHE G 3 17 ? -12.595 -10.346 36.209  1.00 35.30 ? 40  PHE C C     1 
ATOM   1964 O  O     . PHE G 3 17 ? -12.592 -9.906  35.048  1.00 34.59 ? 40  PHE C O     1 
ATOM   1965 C  CB    . PHE G 3 17 ? -12.263 -12.809 36.618  1.00 37.63 ? 40  PHE C CB    1 
ATOM   1966 C  CG    . PHE G 3 17 ? -12.909 -14.151 36.812  1.00 37.72 ? 40  PHE C CG    1 
ATOM   1967 C  CD1   . PHE G 3 17 ? -13.244 -14.604 38.082  1.00 38.21 ? 40  PHE C CD1   1 
ATOM   1968 C  CD2   . PHE G 3 17 ? -13.241 -14.943 35.716  1.00 36.80 ? 40  PHE C CD2   1 
ATOM   1969 C  CE1   . PHE G 3 17 ? -13.902 -15.829 38.261  1.00 36.71 ? 40  PHE C CE1   1 
ATOM   1970 C  CE2   . PHE G 3 17 ? -13.897 -16.162 35.890  1.00 36.49 ? 40  PHE C CE2   1 
ATOM   1971 C  CZ    . PHE G 3 17 ? -14.225 -16.601 37.171  1.00 37.56 ? 40  PHE C CZ    1 
ATOM   1972 N  N     . LEU G 3 18 ? -12.032 -9.703  37.231  1.00 35.01 ? 41  LEU C N     1 
ATOM   1973 C  CA    . LEU G 3 18 ? -11.412 -8.406  37.033  1.00 34.35 ? 41  LEU C CA    1 
ATOM   1974 C  C     . LEU G 3 18 ? -9.928  -8.428  36.738  1.00 32.40 ? 41  LEU C C     1 
ATOM   1975 O  O     . LEU G 3 18 ? -9.338  -7.389  36.518  1.00 33.06 ? 41  LEU C O     1 
ATOM   1976 C  CB    . LEU G 3 18 ? -11.686 -7.490  38.234  1.00 34.56 ? 41  LEU C CB    1 
ATOM   1977 C  CG    . LEU G 3 18 ? -13.149 -7.216  38.640  1.00 36.62 ? 41  LEU C CG    1 
ATOM   1978 C  CD1   . LEU G 3 18 ? -13.200 -5.891  39.381  1.00 37.33 ? 41  LEU C CD1   1 
ATOM   1979 C  CD2   . LEU G 3 18 ? -14.060 -7.164  37.431  1.00 36.24 ? 41  LEU C CD2   1 
ATOM   1980 N  N     . THR G 3 19 ? -9.315  -9.599  36.716  1.00 31.16 ? 42  THR C N     1 
ATOM   1981 C  CA    . THR G 3 19 ? -7.890  -9.645  36.441  1.00 29.90 ? 42  THR C CA    1 
ATOM   1982 C  C     . THR G 3 19 ? -7.510  -10.897 35.703  1.00 30.17 ? 42  THR C C     1 
ATOM   1983 O  O     . THR G 3 19 ? -8.122  -11.961 35.883  1.00 30.98 ? 42  THR C O     1 
ATOM   1984 C  CB    . THR G 3 19 ? -7.020  -9.632  37.734  1.00 31.24 ? 42  THR C CB    1 
ATOM   1985 O  OG1   . THR G 3 19 ? -7.168  -10.886 38.405  1.00 28.16 ? 42  THR C OG1   1 
ATOM   1986 C  CG2   . THR G 3 19 ? -7.423  -8.484  38.682  1.00 27.93 ? 42  THR C CG2   1 
ATOM   1987 N  N     . TRP G 3 20 ? -6.477  -10.767 34.880  1.00 29.47 ? 43  TRP C N     1 
ATOM   1988 C  CA    . TRP G 3 20 ? -5.968  -11.905 34.127  1.00 28.09 ? 43  TRP C CA    1 
ATOM   1989 C  C     . TRP G 3 20 ? -5.528  -12.988 35.102  1.00 27.69 ? 43  TRP C C     1 
ATOM   1990 O  O     . TRP G 3 20 ? -5.658  -14.181 34.818  1.00 24.12 ? 43  TRP C O     1 
ATOM   1991 C  CB    . TRP G 3 20 ? -4.782  -11.479 33.270  1.00 27.29 ? 43  TRP C CB    1 
ATOM   1992 C  CG    . TRP G 3 20 ? -4.011  -12.620 32.642  1.00 27.82 ? 43  TRP C CG    1 
ATOM   1993 C  CD1   . TRP G 3 20 ? -2.660  -12.786 32.656  1.00 28.01 ? 43  TRP C CD1   1 
ATOM   1994 C  CD2   . TRP G 3 20 ? -4.542  -13.723 31.891  1.00 28.75 ? 43  TRP C CD2   1 
ATOM   1995 N  NE1   . TRP G 3 20 ? -2.312  -13.919 31.965  1.00 29.61 ? 43  TRP C NE1   1 
ATOM   1996 C  CE2   . TRP G 3 20 ? -3.440  -14.515 31.481  1.00 29.15 ? 43  TRP C CE2   1 
ATOM   1997 C  CE3   . TRP G 3 20 ? -5.836  -14.119 31.522  1.00 27.96 ? 43  TRP C CE3   1 
ATOM   1998 C  CZ2   . TRP G 3 20 ? -3.591  -15.682 30.720  1.00 29.13 ? 43  TRP C CZ2   1 
ATOM   1999 C  CZ3   . TRP G 3 20 ? -5.985  -15.289 30.764  1.00 29.55 ? 43  TRP C CZ3   1 
ATOM   2000 C  CH2   . TRP G 3 20 ? -4.866  -16.051 30.372  1.00 28.72 ? 43  TRP C CH2   1 
ATOM   2001 N  N     . ASN G 3 21 ? -4.992  -12.563 36.249  1.00 29.24 ? 44  ASN C N     1 
ATOM   2002 C  CA    . ASN G 3 21 ? -4.519  -13.499 37.269  1.00 29.86 ? 44  ASN C CA    1 
ATOM   2003 C  C     . ASN G 3 21 ? -5.585  -14.495 37.726  1.00 29.26 ? 44  ASN C C     1 
ATOM   2004 O  O     . ASN G 3 21 ? -5.346  -15.694 37.833  1.00 28.29 ? 44  ASN C O     1 
ATOM   2005 C  CB    . ASN G 3 21 ? -4.005  -12.745 38.497  1.00 30.62 ? 44  ASN C CB    1 
ATOM   2006 C  CG    . ASN G 3 21 ? -3.645  -13.687 39.621  1.00 35.72 ? 44  ASN C CG    1 
ATOM   2007 O  OD1   . ASN G 3 21 ? -4.414  -13.871 40.580  1.00 38.09 ? 44  ASN C OD1   1 
ATOM   2008 N  ND2   . ASN G 3 21 ? -2.490  -14.337 39.491  1.00 34.47 ? 44  ASN C ND2   1 
ATOM   2009 N  N     . GLU G 3 22 ? -6.767  -13.980 38.010  1.00 31.18 ? 45  GLU C N     1 
ATOM   2010 C  CA    . GLU G 3 22 ? -7.860  -14.818 38.460  1.00 32.19 ? 45  GLU C CA    1 
ATOM   2011 C  C     . GLU G 3 22 ? -8.495  -15.545 37.251  1.00 31.79 ? 45  GLU C C     1 
ATOM   2012 O  O     . GLU G 3 22 ? -8.915  -16.719 37.337  1.00 30.77 ? 45  GLU C O     1 
ATOM   2013 C  CB    . GLU G 3 22 ? -8.870  -13.934 39.227  1.00 36.00 ? 45  GLU C CB    1 
ATOM   2014 C  CG    . GLU G 3 22 ? -10.263 -14.528 39.333  1.00 42.17 ? 45  GLU C CG    1 
ATOM   2015 C  CD    . GLU G 3 22 ? -10.991 -14.161 40.621  1.00 44.52 ? 45  GLU C CD    1 
ATOM   2016 O  OE1   . GLU G 3 22 ? -10.970 -14.979 41.576  1.00 45.65 ? 45  GLU C OE1   1 
ATOM   2017 O  OE2   . GLU G 3 22 ? -11.583 -13.062 40.672  1.00 46.27 ? 45  GLU C OE2   1 
ATOM   2018 N  N     . CYS G 3 23 ? -8.534  -14.860 36.112  1.00 29.23 ? 46  CYS C N     1 
ATOM   2019 C  CA    . CYS G 3 23 ? -9.109  -15.462 34.913  1.00 28.61 ? 46  CYS C CA    1 
ATOM   2020 C  C     . CYS G 3 23 ? -8.352  -16.723 34.525  1.00 27.08 ? 46  CYS C C     1 
ATOM   2021 O  O     . CYS G 3 23 ? -8.938  -17.786 34.335  1.00 26.72 ? 46  CYS C O     1 
ATOM   2022 C  CB    . CYS G 3 23 ? -9.087  -14.458 33.747  1.00 28.00 ? 46  CYS C CB    1 
ATOM   2023 S  SG    . CYS G 3 23 ? -9.626  -15.169 32.169  1.00 34.90 ? 46  CYS C SG    1 
ATOM   2024 N  N     . ARG G 3 24 ? -7.029  -16.599 34.446  1.00 28.65 ? 47  ARG C N     1 
ATOM   2025 C  CA    . ARG G 3 24 ? -6.163  -17.708 34.055  1.00 28.78 ? 47  ARG C CA    1 
ATOM   2026 C  C     . ARG G 3 24 ? -6.240  -18.935 34.955  1.00 27.68 ? 47  ARG C C     1 
ATOM   2027 O  O     . ARG G 3 24 ? -5.918  -20.049 34.520  1.00 28.40 ? 47  ARG C O     1 
ATOM   2028 C  CB    . ARG G 3 24 ? -4.698  -17.224 33.941  1.00 29.89 ? 47  ARG C CB    1 
ATOM   2029 C  CG    . ARG G 3 24 ? -3.820  -17.535 35.127  1.00 31.34 ? 47  ARG C CG    1 
ATOM   2030 C  CD    . ARG G 3 24 ? -2.427  -16.912 34.987  1.00 32.82 ? 47  ARG C CD    1 
ATOM   2031 N  NE    . ARG G 3 24 ? -1.739  -17.285 33.751  1.00 32.40 ? 47  ARG C NE    1 
ATOM   2032 C  CZ    . ARG G 3 24 ? -0.625  -16.691 33.318  1.00 33.42 ? 47  ARG C CZ    1 
ATOM   2033 N  NH1   . ARG G 3 24 ? -0.086  -15.703 34.028  1.00 31.76 ? 47  ARG C NH1   1 
ATOM   2034 N  NH2   . ARG G 3 24 ? -0.055  -17.058 32.174  1.00 30.33 ? 47  ARG C NH2   1 
ATOM   2035 N  N     . ALA G 3 25 ? -6.671  -18.759 36.197  1.00 26.75 ? 48  ALA C N     1 
ATOM   2036 C  CA    . ALA G 3 25 ? -6.761  -19.904 37.092  1.00 27.77 ? 48  ALA C CA    1 
ATOM   2037 C  C     . ALA G 3 25 ? -7.853  -20.857 36.604  1.00 28.42 ? 48  ALA C C     1 
ATOM   2038 O  O     . ALA G 3 25 ? -7.827  -22.081 36.876  1.00 25.87 ? 48  ALA C O     1 
ATOM   2039 C  CB    . ALA G 3 25 ? -7.042  -19.429 38.548  1.00 27.88 ? 48  ALA C CB    1 
ATOM   2040 N  N     . GLN G 3 26 ? -8.805  -20.296 35.860  1.00 30.03 ? 49  GLN C N     1 
ATOM   2041 C  CA    . GLN G 3 26 ? -9.924  -21.085 35.337  1.00 31.22 ? 49  GLN C CA    1 
ATOM   2042 C  C     . GLN G 3 26 ? -9.632  -21.758 33.987  1.00 31.70 ? 49  GLN C C     1 
ATOM   2043 O  O     . GLN G 3 26 ? -10.087 -22.878 33.722  1.00 31.21 ? 49  GLN C O     1 
ATOM   2044 C  CB    . GLN G 3 26 ? -11.166 -20.201 35.154  1.00 31.20 ? 49  GLN C CB    1 
ATOM   2045 C  CG    . GLN G 3 26 ? -11.517 -19.288 36.299  1.00 31.95 ? 49  GLN C CG    1 
ATOM   2046 C  CD    . GLN G 3 26 ? -11.314 -19.961 37.630  1.00 30.36 ? 49  GLN C CD    1 
ATOM   2047 O  OE1   . GLN G 3 26 ? -11.646 -21.128 37.808  1.00 31.61 ? 49  GLN C OE1   1 
ATOM   2048 N  NE2   . GLN G 3 26 ? -10.755 -19.230 38.568  1.00 32.37 ? 49  GLN C NE2   1 
ATOM   2049 N  N     . VAL G 3 27 ? -8.861  -21.071 33.145  1.00 32.50 ? 50  VAL C N     1 
ATOM   2050 C  CA    . VAL G 3 27 ? -8.562  -21.548 31.790  1.00 29.89 ? 50  VAL C CA    1 
ATOM   2051 C  C     . VAL G 3 27 ? -7.182  -22.167 31.472  1.00 30.82 ? 50  VAL C C     1 
ATOM   2052 O  O     . VAL G 3 27 ? -7.084  -23.000 30.581  1.00 30.92 ? 50  VAL C O     1 
ATOM   2053 C  CB    . VAL G 3 27 ? -8.871  -20.401 30.784  1.00 28.67 ? 50  VAL C CB    1 
ATOM   2054 C  CG1   . VAL G 3 27 ? -10.318 -19.970 30.939  1.00 28.44 ? 50  VAL C CG1   1 
ATOM   2055 C  CG2   . VAL G 3 27 ? -7.956  -19.213 31.016  1.00 26.61 ? 50  VAL C CG2   1 
ATOM   2056 N  N     . ASP G 3 28 ? -6.115  -21.782 32.173  1.00 31.79 ? 51  ASP C N     1 
ATOM   2057 C  CA    . ASP G 3 28 ? -4.795  -22.371 31.882  1.00 32.81 ? 51  ASP C CA    1 
ATOM   2058 C  C     . ASP G 3 28 ? -4.766  -23.898 32.153  1.00 31.26 ? 51  ASP C C     1 
ATOM   2059 O  O     . ASP G 3 28 ? -5.142  -24.349 33.230  1.00 31.81 ? 51  ASP C O     1 
ATOM   2060 C  CB    . ASP G 3 28 ? -3.684  -21.668 32.700  1.00 34.09 ? 51  ASP C CB    1 
ATOM   2061 C  CG    . ASP G 3 28 ? -3.129  -20.403 32.018  1.00 38.67 ? 51  ASP C CG    1 
ATOM   2062 O  OD1   . ASP G 3 28 ? -2.211  -19.769 32.608  1.00 38.95 ? 51  ASP C OD1   1 
ATOM   2063 O  OD2   . ASP G 3 28 ? -3.590  -20.035 30.899  1.00 39.09 ? 51  ASP C OD2   1 
ATOM   2064 N  N     . ARG G 3 29 ? -4.321  -24.668 31.162  1.00 29.45 ? 52  ARG C N     1 
ATOM   2065 C  CA    . ARG G 3 29 ? -4.220  -26.137 31.239  1.00 30.38 ? 52  ARG C CA    1 
ATOM   2066 C  C     . ARG G 3 29 ? -5.579  -26.834 31.243  1.00 29.40 ? 52  ARG C C     1 
ATOM   2067 O  O     . ARG G 3 29 ? -5.680  -28.030 31.520  1.00 27.76 ? 52  ARG C O     1 
ATOM   2068 C  CB    . ARG G 3 29 ? -3.419  -26.565 32.485  1.00 31.59 ? 52  ARG C CB    1 
ATOM   2069 C  CG    . ARG G 3 29 ? -2.154  -25.776 32.677  1.00 31.06 ? 52  ARG C CG    1 
ATOM   2070 C  CD    . ARG G 3 29 ? -1.052  -26.618 33.263  1.00 34.46 ? 52  ARG C CD    1 
ATOM   2071 N  NE    . ARG G 3 29 ? 0.164   -25.826 33.368  1.00 36.81 ? 52  ARG C NE    1 
ATOM   2072 C  CZ    . ARG G 3 29 ? 1.383   -26.332 33.273  1.00 39.51 ? 52  ARG C CZ    1 
ATOM   2073 N  NH1   . ARG G 3 29 ? 1.542   -27.637 33.080  1.00 39.81 ? 52  ARG C NH1   1 
ATOM   2074 N  NH2   . ARG G 3 29 ? 2.438   -25.528 33.322  1.00 38.29 ? 52  ARG C NH2   1 
ATOM   2075 N  N     . PHE G 3 30 ? -6.623  -26.075 30.926  1.00 30.03 ? 53  PHE C N     1 
ATOM   2076 C  CA    . PHE G 3 30 ? -7.973  -26.617 30.886  1.00 30.85 ? 53  PHE C CA    1 
ATOM   2077 C  C     . PHE G 3 30 ? -8.329  -26.814 29.414  1.00 31.35 ? 53  PHE C C     1 
ATOM   2078 O  O     . PHE G 3 30 ? -8.575  -25.851 28.677  1.00 32.15 ? 53  PHE C O     1 
ATOM   2079 C  CB    . PHE G 3 30 ? -8.924  -25.642 31.586  1.00 28.22 ? 53  PHE C CB    1 
ATOM   2080 C  CG    . PHE G 3 30 ? -10.349 -26.090 31.617  1.00 27.59 ? 53  PHE C CG    1 
ATOM   2081 C  CD1   . PHE G 3 30 ? -11.175 -25.901 30.513  1.00 27.63 ? 53  PHE C CD1   1 
ATOM   2082 C  CD2   . PHE G 3 30 ? -10.891 -26.624 32.773  1.00 25.57 ? 53  PHE C CD2   1 
ATOM   2083 C  CE1   . PHE G 3 30 ? -12.519 -26.231 30.574  1.00 25.93 ? 53  PHE C CE1   1 
ATOM   2084 C  CE2   . PHE G 3 30 ? -12.226 -26.954 32.843  1.00 25.25 ? 53  PHE C CE2   1 
ATOM   2085 C  CZ    . PHE G 3 30 ? -13.045 -26.756 31.745  1.00 27.68 ? 53  PHE C CZ    1 
ATOM   2086 N  N     . PRO G 3 31 ? -8.366  -28.075 28.966  1.00 32.62 ? 54  PRO C N     1 
ATOM   2087 C  CA    . PRO G 3 31 ? -8.688  -28.338 27.560  1.00 33.71 ? 54  PRO C CA    1 
ATOM   2088 C  C     . PRO G 3 31 ? -9.865  -27.592 26.946  1.00 34.06 ? 54  PRO C C     1 
ATOM   2089 O  O     . PRO G 3 31 ? -10.969 -27.568 27.481  1.00 34.67 ? 54  PRO C O     1 
ATOM   2090 C  CB    . PRO G 3 31 ? -8.841  -29.870 27.504  1.00 32.79 ? 54  PRO C CB    1 
ATOM   2091 C  CG    . PRO G 3 31 ? -8.945  -30.306 28.936  1.00 32.58 ? 54  PRO C CG    1 
ATOM   2092 C  CD    . PRO G 3 31 ? -8.072  -29.328 29.679  1.00 32.79 ? 54  PRO C CD    1 
ATOM   2093 N  N     . ALA G 3 32 ? -9.599  -26.950 25.818  1.00 34.16 ? 55  ALA C N     1 
ATOM   2094 C  CA    . ALA G 3 32 ? -10.630 -26.231 25.102  1.00 35.17 ? 55  ALA C CA    1 
ATOM   2095 C  C     . ALA G 3 32 ? -11.347 -25.155 25.917  1.00 36.16 ? 55  ALA C C     1 
ATOM   2096 O  O     . ALA G 3 32 ? -12.558 -24.961 25.768  1.00 37.49 ? 55  ALA C O     1 
ATOM   2097 C  CB    . ALA G 3 32 ? -11.643 -27.228 24.557  1.00 35.57 ? 55  ALA C CB    1 
ATOM   2098 N  N     . ALA G 3 33 ? -10.617 -24.465 26.783  1.00 35.40 ? 56  ALA C N     1 
ATOM   2099 C  CA    . ALA G 3 33 ? -11.208 -23.391 27.574  1.00 35.26 ? 56  ALA C CA    1 
ATOM   2100 C  C     . ALA G 3 33 ? -11.619 -22.247 26.631  1.00 35.60 ? 56  ALA C C     1 
ATOM   2101 O  O     . ALA G 3 33 ? -10.901 -21.954 25.672  1.00 36.95 ? 56  ALA C O     1 
ATOM   2102 C  CB    . ALA G 3 33 ? -10.187 -22.875 28.570  1.00 35.77 ? 56  ALA C CB    1 
ATOM   2103 N  N     . ARG G 3 34 ? -12.765 -21.619 26.886  1.00 34.58 ? 57  ARG C N     1 
ATOM   2104 C  CA    . ARG G 3 34 ? -13.231 -20.485 26.077  1.00 34.49 ? 57  ARG C CA    1 
ATOM   2105 C  C     . ARG G 3 34 ? -13.353 -19.241 26.953  1.00 32.40 ? 57  ARG C C     1 
ATOM   2106 O  O     . ARG G 3 34 ? -14.202 -19.160 27.846  1.00 32.16 ? 57  ARG C O     1 
ATOM   2107 C  CB    . ARG G 3 34 ? -14.601 -20.764 25.420  1.00 37.41 ? 57  ARG C CB    1 
ATOM   2108 C  CG    . ARG G 3 34 ? -14.553 -21.601 24.143  1.00 42.64 ? 57  ARG C CG    1 
ATOM   2109 C  CD    . ARG G 3 34 ? -13.761 -20.895 23.034  1.00 46.29 ? 57  ARG C CD    1 
ATOM   2110 N  NE    . ARG G 3 34 ? -14.429 -19.683 22.548  1.00 49.04 ? 57  ARG C NE    1 
ATOM   2111 C  CZ    . ARG G 3 34 ? -15.595 -19.670 21.901  1.00 50.88 ? 57  ARG C CZ    1 
ATOM   2112 N  NH1   . ARG G 3 34 ? -16.248 -20.803 21.651  1.00 50.69 ? 57  ARG C NH1   1 
ATOM   2113 N  NH2   . ARG G 3 34 ? -16.107 -18.519 21.493  1.00 51.15 ? 57  ARG C NH2   1 
ATOM   2114 N  N     . PHE G 3 35 ? -12.497 -18.268 26.696  1.00 30.52 ? 58  PHE C N     1 
ATOM   2115 C  CA    . PHE G 3 35 ? -12.504 -17.037 27.458  1.00 28.53 ? 58  PHE C CA    1 
ATOM   2116 C  C     . PHE G 3 35 ? -12.172 -15.868 26.567  1.00 28.44 ? 58  PHE C C     1 
ATOM   2117 O  O     . PHE G 3 35 ? -11.627 -16.044 25.481  1.00 30.38 ? 58  PHE C O     1 
ATOM   2118 C  CB    . PHE G 3 35 ? -11.495 -17.127 28.610  1.00 26.22 ? 58  PHE C CB    1 
ATOM   2119 C  CG    . PHE G 3 35 ? -10.083 -17.462 28.178  1.00 22.39 ? 58  PHE C CG    1 
ATOM   2120 C  CD1   . PHE G 3 35 ? -9.086  -16.487 28.192  1.00 21.04 ? 58  PHE C CD1   1 
ATOM   2121 C  CD2   . PHE G 3 35 ? -9.737  -18.773 27.824  1.00 19.85 ? 58  PHE C CD2   1 
ATOM   2122 C  CE1   . PHE G 3 35 ? -7.743  -16.815 27.860  1.00 19.98 ? 58  PHE C CE1   1 
ATOM   2123 C  CE2   . PHE G 3 35 ? -8.409  -19.117 27.493  1.00 20.42 ? 58  PHE C CE2   1 
ATOM   2124 C  CZ    . PHE G 3 35 ? -7.411  -18.138 27.512  1.00 19.56 ? 58  PHE C CZ    1 
ATOM   2125 N  N     . LYS G 3 36 ? -12.483 -14.664 27.031  1.00 29.10 ? 59  LYS C N     1 
ATOM   2126 C  CA    . LYS G 3 36 ? -12.201 -13.479 26.245  1.00 29.06 ? 59  LYS C CA    1 
ATOM   2127 C  C     . LYS G 3 36 ? -12.323 -12.208 27.103  1.00 29.63 ? 59  LYS C C     1 
ATOM   2128 O  O     . LYS G 3 36 ? -13.241 -12.080 27.930  1.00 27.90 ? 59  LYS C O     1 
ATOM   2129 C  CB    . LYS G 3 36 ? -13.163 -13.441 25.052  1.00 29.77 ? 59  LYS C CB    1 
ATOM   2130 C  CG    . LYS G 3 36 ? -12.924 -12.312 24.092  1.00 32.75 ? 59  LYS C CG    1 
ATOM   2131 C  CD    . LYS G 3 36 ? -13.632 -12.554 22.794  1.00 34.52 ? 59  LYS C CD    1 
ATOM   2132 C  CE    . LYS G 3 36 ? -13.356 -11.406 21.855  1.00 37.44 ? 59  LYS C CE    1 
ATOM   2133 N  NZ    . LYS G 3 36 ? -14.053 -11.578 20.546  1.00 39.85 ? 59  LYS C NZ    1 
ATOM   2134 N  N     . LYS G 3 37 ? -11.408 -11.261 26.917  1.00 29.23 ? 60  LYS C N     1 
ATOM   2135 C  CA    . LYS G 3 37 ? -11.488 -10.050 27.714  1.00 33.04 ? 60  LYS C CA    1 
ATOM   2136 C  C     . LYS G 3 37 ? -12.354 -8.987  27.040  1.00 34.33 ? 60  LYS C C     1 
ATOM   2137 O  O     . LYS G 3 37 ? -12.440 -8.933  25.808  1.00 33.00 ? 60  LYS C O     1 
ATOM   2138 C  CB    . LYS G 3 37 ? -10.078 -9.518  28.051  1.00 34.82 ? 60  LYS C CB    1 
ATOM   2139 C  CG    . LYS G 3 37 ? -9.513  -8.446  27.144  1.00 36.39 ? 60  LYS C CG    1 
ATOM   2140 C  CD    . LYS G 3 37 ? -8.360  -7.722  27.837  1.00 36.72 ? 60  LYS C CD    1 
ATOM   2141 C  CE    . LYS G 3 37 ? -7.452  -7.030  26.826  1.00 36.79 ? 60  LYS C CE    1 
ATOM   2142 N  NZ    . LYS G 3 37 ? -6.675  -8.039  26.030  1.00 38.21 ? 60  LYS C NZ    1 
ATOM   2143 N  N     . PHE G 3 38 ? -13.036 -8.178  27.854  1.00 34.53 ? 61  PHE C N     1 
ATOM   2144 C  CA    . PHE G 3 38 ? -13.911 -7.128  27.338  1.00 36.27 ? 61  PHE C CA    1 
ATOM   2145 C  C     . PHE G 3 38 ? -13.740 -5.820  28.099  1.00 37.46 ? 61  PHE C C     1 
ATOM   2146 O  O     . PHE G 3 38 ? -13.262 -5.812  29.231  1.00 37.04 ? 61  PHE C O     1 
ATOM   2147 C  CB    . PHE G 3 38 ? -15.383 -7.555  27.408  1.00 36.08 ? 61  PHE C CB    1 
ATOM   2148 C  CG    . PHE G 3 38 ? -15.722 -8.712  26.521  1.00 37.33 ? 61  PHE C CG    1 
ATOM   2149 C  CD1   . PHE G 3 38 ? -15.450 -10.025 26.928  1.00 36.78 ? 61  PHE C CD1   1 
ATOM   2150 C  CD2   . PHE G 3 38 ? -16.287 -8.493  25.259  1.00 37.20 ? 61  PHE C CD2   1 
ATOM   2151 C  CE1   . PHE G 3 38 ? -15.731 -11.108 26.086  1.00 36.63 ? 61  PHE C CE1   1 
ATOM   2152 C  CE2   . PHE G 3 38 ? -16.574 -9.561  24.410  1.00 37.36 ? 61  PHE C CE2   1 
ATOM   2153 C  CZ    . PHE G 3 38 ? -16.294 -10.880 24.823  1.00 37.75 ? 61  PHE C CZ    1 
ATOM   2154 N  N     . ALA G 3 39 ? -14.166 -4.726  27.470  1.00 38.61 ? 62  ALA C N     1 
ATOM   2155 C  CA    . ALA G 3 39 ? -14.061 -3.388  28.041  1.00 40.35 ? 62  ALA C CA    1 
ATOM   2156 C  C     . ALA G 3 39 ? -15.196 -3.071  29.011  1.00 41.89 ? 62  ALA C C     1 
ATOM   2157 O  O     . ALA G 3 39 ? -15.055 -2.229  29.903  1.00 42.97 ? 62  ALA C O     1 
ATOM   2158 C  CB    . ALA G 3 39 ? -14.027 -2.334  26.905  1.00 38.46 ? 62  ALA C CB    1 
ATOM   2159 N  N     . THR G 3 40 ? -16.321 -3.747  28.841  1.00 43.25 ? 63  THR C N     1 
ATOM   2160 C  CA    . THR G 3 40 ? -17.463 -3.505  29.703  1.00 44.87 ? 63  THR C CA    1 
ATOM   2161 C  C     . THR G 3 40 ? -17.888 -4.802  30.371  1.00 45.48 ? 63  THR C C     1 
ATOM   2162 O  O     . THR G 3 40 ? -17.682 -5.891  29.824  1.00 44.77 ? 63  THR C O     1 
ATOM   2163 C  CB    . THR G 3 40 ? -18.658 -2.970  28.889  1.00 45.93 ? 63  THR C CB    1 
ATOM   2164 O  OG1   . THR G 3 40 ? -19.251 -4.050  28.152  1.00 45.31 ? 63  THR C OG1   1 
ATOM   2165 C  CG2   . THR G 3 40 ? -18.191 -1.882  27.909  1.00 45.64 ? 63  THR C CG2   1 
ATOM   2166 N  N     . GLU G 3 41 ? -18.489 -4.687  31.551  1.00 45.95 ? 64  GLU C N     1 
ATOM   2167 C  CA    . GLU G 3 41 ? -18.941 -5.878  32.243  1.00 46.87 ? 64  GLU C CA    1 
ATOM   2168 C  C     . GLU G 3 41 ? -20.045 -6.525  31.431  1.00 46.38 ? 64  GLU C C     1 
ATOM   2169 O  O     . GLU G 3 41 ? -20.098 -7.752  31.312  1.00 47.05 ? 64  GLU C O     1 
ATOM   2170 C  CB    . GLU G 3 41 ? -19.448 -5.541  33.642  1.00 47.35 ? 64  GLU C CB    1 
ATOM   2171 C  CG    . GLU G 3 41 ? -20.025 -6.744  34.350  1.00 49.93 ? 64  GLU C CG    1 
ATOM   2172 C  CD    . GLU G 3 41 ? -20.039 -6.613  35.865  1.00 49.88 ? 64  GLU C CD    1 
ATOM   2173 O  OE1   . GLU G 3 41 ? -20.515 -7.557  36.527  1.00 50.59 ? 64  GLU C OE1   1 
ATOM   2174 O  OE2   . GLU G 3 41 ? -19.573 -5.586  36.396  1.00 49.04 ? 64  GLU C OE2   1 
ATOM   2175 N  N     . ASP G 3 42 ? -20.907 -5.686  30.864  1.00 45.76 ? 65  ASP C N     1 
ATOM   2176 C  CA    . ASP G 3 42 ? -22.041 -6.132  30.049  1.00 46.94 ? 65  ASP C CA    1 
ATOM   2177 C  C     . ASP G 3 42 ? -21.640 -7.107  28.941  1.00 45.68 ? 65  ASP C C     1 
ATOM   2178 O  O     . ASP G 3 42 ? -22.331 -8.103  28.700  1.00 45.80 ? 65  ASP C O     1 
ATOM   2179 C  CB    . ASP G 3 42 ? -22.757 -4.920  29.421  1.00 49.29 ? 65  ASP C CB    1 
ATOM   2180 C  CG    . ASP G 3 42 ? -23.540 -4.087  30.440  1.00 51.49 ? 65  ASP C CG    1 
ATOM   2181 O  OD1   . ASP G 3 42 ? -24.020 -2.998  30.059  1.00 53.05 ? 65  ASP C OD1   1 
ATOM   2182 O  OD2   . ASP G 3 42 ? -23.688 -4.511  31.610  1.00 52.85 ? 65  ASP C OD2   1 
ATOM   2183 N  N     . GLU G 3 43 ? -20.535 -6.815  28.264  1.00 44.42 ? 66  GLU C N     1 
ATOM   2184 C  CA    . GLU G 3 43 ? -20.054 -7.678  27.194  1.00 43.76 ? 66  GLU C CA    1 
ATOM   2185 C  C     . GLU G 3 43 ? -19.466 -8.972  27.708  1.00 42.64 ? 66  GLU C C     1 
ATOM   2186 O  O     . GLU G 3 43 ? -19.643 -10.018 27.094  1.00 42.35 ? 66  GLU C O     1 
ATOM   2187 C  CB    . GLU G 3 43 ? -18.996 -6.971  26.373  1.00 45.95 ? 66  GLU C CB    1 
ATOM   2188 C  CG    . GLU G 3 43 ? -19.549 -5.994  25.379  1.00 47.34 ? 66  GLU C CG    1 
ATOM   2189 C  CD    . GLU G 3 43 ? -18.461 -5.162  24.793  1.00 47.42 ? 66  GLU C CD    1 
ATOM   2190 O  OE1   . GLU G 3 43 ? -17.910 -4.315  25.529  1.00 48.78 ? 66  GLU C OE1   1 
ATOM   2191 O  OE2   . GLU G 3 43 ? -18.143 -5.370  23.609  1.00 48.28 ? 66  GLU C OE2   1 
ATOM   2192 N  N     . ALA G 3 44 ? -18.747 -8.890  28.821  1.00 40.48 ? 67  ALA C N     1 
ATOM   2193 C  CA    . ALA G 3 44 ? -18.143 -10.062 29.416  1.00 38.54 ? 67  ALA C CA    1 
ATOM   2194 C  C     . ALA G 3 44 ? -19.270 -11.038 29.742  1.00 37.80 ? 67  ALA C C     1 
ATOM   2195 O  O     . ALA G 3 44 ? -19.201 -12.236 29.408  1.00 37.09 ? 67  ALA C O     1 
ATOM   2196 C  CB    . ALA G 3 44 ? -17.393 -9.671  30.684  1.00 37.47 ? 67  ALA C CB    1 
ATOM   2197 N  N     . TRP G 3 45 ? -20.314 -10.524 30.389  1.00 37.70 ? 68  TRP C N     1 
ATOM   2198 C  CA    . TRP G 3 45 ? -21.453 -11.363 30.759  1.00 37.48 ? 68  TRP C CA    1 
ATOM   2199 C  C     . TRP G 3 45 ? -22.178 -11.932 29.550  1.00 37.06 ? 68  TRP C C     1 
ATOM   2200 O  O     . TRP G 3 45 ? -22.555 -13.096 29.549  1.00 37.03 ? 68  TRP C O     1 
ATOM   2201 C  CB    . TRP G 3 45 ? -22.420 -10.599 31.660  1.00 36.27 ? 68  TRP C CB    1 
ATOM   2202 C  CG    . TRP G 3 45 ? -21.921 -10.542 33.075  1.00 37.45 ? 68  TRP C CG    1 
ATOM   2203 C  CD1   . TRP G 3 45 ? -21.663 -9.423  33.808  1.00 36.71 ? 68  TRP C CD1   1 
ATOM   2204 C  CD2   . TRP G 3 45 ? -21.555 -11.654 33.901  1.00 36.92 ? 68  TRP C CD2   1 
ATOM   2205 N  NE1   . TRP G 3 45 ? -21.152 -9.764  35.028  1.00 37.69 ? 68  TRP C NE1   1 
ATOM   2206 C  CE2   . TRP G 3 45 ? -21.076 -11.126 35.119  1.00 37.09 ? 68  TRP C CE2   1 
ATOM   2207 C  CE3   . TRP G 3 45 ? -21.582 -13.048 33.727  1.00 37.57 ? 68  TRP C CE3   1 
ATOM   2208 C  CZ2   . TRP G 3 45 ? -20.623 -11.944 36.173  1.00 38.45 ? 68  TRP C CZ2   1 
ATOM   2209 C  CZ3   . TRP G 3 45 ? -21.130 -13.868 34.770  1.00 37.38 ? 68  TRP C CZ3   1 
ATOM   2210 C  CH2   . TRP G 3 45 ? -20.655 -13.306 35.983  1.00 36.80 ? 68  TRP C CH2   1 
ATOM   2211 N  N     . ALA G 3 46 ? -22.352 -11.136 28.509  1.00 38.56 ? 69  ALA C N     1 
ATOM   2212 C  CA    . ALA G 3 46 ? -23.022 -11.654 27.317  1.00 40.02 ? 69  ALA C CA    1 
ATOM   2213 C  C     . ALA G 3 46 ? -22.271 -12.904 26.847  1.00 40.27 ? 69  ALA C C     1 
ATOM   2214 O  O     . ALA G 3 46 ? -22.879 -13.939 26.578  1.00 40.14 ? 69  ALA C O     1 
ATOM   2215 C  CB    . ALA G 3 46 ? -23.045 -10.596 26.221  1.00 39.07 ? 69  ALA C CB    1 
ATOM   2216 N  N     . PHE G 3 47 ? -20.944 -12.802 26.778  1.00 41.41 ? 70  PHE C N     1 
ATOM   2217 C  CA    . PHE G 3 47 ? -20.065 -13.904 26.356  1.00 42.23 ? 70  PHE C CA    1 
ATOM   2218 C  C     . PHE G 3 47 ? -20.312 -15.164 27.186  1.00 43.50 ? 70  PHE C C     1 
ATOM   2219 O  O     . PHE G 3 47 ? -20.486 -16.268 26.650  1.00 44.41 ? 70  PHE C O     1 
ATOM   2220 C  CB    . PHE G 3 47 ? -18.596 -13.478 26.523  1.00 41.43 ? 70  PHE C CB    1 
ATOM   2221 C  CG    . PHE G 3 47 ? -17.607 -14.391 25.845  1.00 40.44 ? 70  PHE C CG    1 
ATOM   2222 C  CD1   . PHE G 3 47 ? -17.409 -14.325 24.469  1.00 39.15 ? 70  PHE C CD1   1 
ATOM   2223 C  CD2   . PHE G 3 47 ? -16.891 -15.337 26.579  1.00 39.24 ? 70  PHE C CD2   1 
ATOM   2224 C  CE1   . PHE G 3 47 ? -16.518 -15.185 23.839  1.00 38.28 ? 70  PHE C CE1   1 
ATOM   2225 C  CE2   . PHE G 3 47 ? -15.999 -16.200 25.955  1.00 37.96 ? 70  PHE C CE2   1 
ATOM   2226 C  CZ    . PHE G 3 47 ? -15.812 -16.124 24.578  1.00 37.26 ? 70  PHE C CZ    1 
ATOM   2227 N  N     . VAL G 3 48 ? -20.302 -14.982 28.504  1.00 44.58 ? 71  VAL C N     1 
ATOM   2228 C  CA    . VAL G 3 48 ? -20.510 -16.069 29.444  1.00 44.82 ? 71  VAL C CA    1 
ATOM   2229 C  C     . VAL G 3 48 ? -21.795 -16.795 29.070  1.00 45.96 ? 71  VAL C C     1 
ATOM   2230 O  O     . VAL G 3 48 ? -21.808 -17.997 28.836  1.00 44.52 ? 71  VAL C O     1 
ATOM   2231 C  CB    . VAL G 3 48 ? -20.650 -15.516 30.882  1.00 45.26 ? 71  VAL C CB    1 
ATOM   2232 C  CG1   . VAL G 3 48 ? -20.834 -16.656 31.860  1.00 45.43 ? 71  VAL C CG1   1 
ATOM   2233 C  CG2   . VAL G 3 48 ? -19.439 -14.655 31.245  1.00 45.06 ? 71  VAL C CG2   1 
ATOM   2234 N  N     . ARG G 3 49 ? -22.875 -16.031 28.997  1.00 48.33 ? 72  ARG C N     1 
ATOM   2235 C  CA    . ARG G 3 49 ? -24.179 -16.570 28.679  1.00 52.13 ? 72  ARG C CA    1 
ATOM   2236 C  C     . ARG G 3 49 ? -24.381 -17.127 27.268  1.00 53.81 ? 72  ARG C C     1 
ATOM   2237 O  O     . ARG G 3 49 ? -25.437 -17.695 26.996  1.00 54.54 ? 72  ARG C O     1 
ATOM   2238 C  CB    . ARG G 3 49 ? -25.268 -15.530 29.003  1.00 53.11 ? 72  ARG C CB    1 
ATOM   2239 C  CG    . ARG G 3 49 ? -25.624 -15.464 30.500  1.00 53.62 ? 72  ARG C CG    1 
ATOM   2240 C  CD    . ARG G 3 49 ? -26.773 -14.487 30.811  1.00 54.89 ? 72  ARG C CD    1 
ATOM   2241 N  NE    . ARG G 3 49 ? -26.343 -13.091 30.878  1.00 56.55 ? 72  ARG C NE    1 
ATOM   2242 C  CZ    . ARG G 3 49 ? -26.342 -12.237 29.856  1.00 57.31 ? 72  ARG C CZ    1 
ATOM   2243 N  NH1   . ARG G 3 49 ? -26.761 -12.623 28.656  1.00 58.32 ? 72  ARG C NH1   1 
ATOM   2244 N  NH2   . ARG G 3 49 ? -25.906 -10.994 30.033  1.00 56.50 ? 72  ARG C NH2   1 
ATOM   2245 N  N     . LYS G 3 50 ? -23.405 -16.983 26.369  1.00 55.46 ? 73  LYS C N     1 
ATOM   2246 C  CA    . LYS G 3 50 ? -23.580 -17.547 25.023  1.00 57.99 ? 73  LYS C CA    1 
ATOM   2247 C  C     . LYS G 3 50 ? -23.252 -19.031 25.062  1.00 59.24 ? 73  LYS C C     1 
ATOM   2248 O  O     . LYS G 3 50 ? -22.808 -19.615 24.071  1.00 59.86 ? 73  LYS C O     1 
ATOM   2249 C  CB    . LYS G 3 50 ? -22.690 -16.865 23.978  1.00 58.69 ? 73  LYS C CB    1 
ATOM   2250 C  CG    . LYS G 3 50 ? -23.260 -15.575 23.395  1.00 59.51 ? 73  LYS C CG    1 
ATOM   2251 C  CD    . LYS G 3 50 ? -22.511 -15.169 22.127  1.00 60.15 ? 73  LYS C CD    1 
ATOM   2252 C  CE    . LYS G 3 50 ? -22.267 -13.658 22.050  1.00 59.33 ? 73  LYS C CE    1 
ATOM   2253 N  NZ    . LYS G 3 50 ? -21.231 -13.169 23.017  1.00 57.84 ? 73  LYS C NZ    1 
ATOM   2254 N  N     . SER G 3 51 ? -23.484 -19.621 26.229  1.00 60.29 ? 74  SER C N     1 
ATOM   2255 C  CA    . SER G 3 51 ? -23.249 -21.030 26.493  1.00 61.87 ? 74  SER C CA    1 
ATOM   2256 C  C     . SER G 3 51 ? -23.149 -21.170 28.010  1.00 62.87 ? 74  SER C C     1 
ATOM   2257 O  O     . SER G 3 51 ? -22.110 -21.657 28.499  1.00 62.37 ? 74  SER C O     1 
ATOM   2258 C  CB    . SER G 3 51 ? -21.957 -21.495 25.830  1.00 62.48 ? 74  SER C CB    1 
ATOM   2259 N  N     . SER H 3 2  ? -14.470 22.957  10.308  1.00 56.83 ? 25  SER F N     1 
ATOM   2260 C  CA    . SER H 3 2  ? -13.219 23.693  10.650  1.00 55.78 ? 25  SER F CA    1 
ATOM   2261 C  C     . SER H 3 2  ? -12.329 23.787  9.418   1.00 55.83 ? 25  SER F C     1 
ATOM   2262 O  O     . SER H 3 2  ? -12.807 23.944  8.287   1.00 56.15 ? 25  SER F O     1 
ATOM   2263 C  CB    . SER H 3 2  ? -12.482 22.964  11.763  1.00 56.33 ? 25  SER F CB    1 
ATOM   2264 N  N     . HIS H 3 3  ? -11.026 23.704  9.641   1.00 54.49 ? 26  HIS F N     1 
ATOM   2265 C  CA    . HIS H 3 3  ? -10.083 23.748  8.534   1.00 53.11 ? 26  HIS F CA    1 
ATOM   2266 C  C     . HIS H 3 3  ? -9.182  22.541  8.694   1.00 50.77 ? 26  HIS F C     1 
ATOM   2267 O  O     . HIS H 3 3  ? -7.952  22.603  8.596   1.00 50.81 ? 26  HIS F O     1 
ATOM   2268 C  CB    . HIS H 3 3  ? -9.323  25.072  8.540   1.00 53.88 ? 26  HIS F CB    1 
ATOM   2269 C  CG    . HIS H 3 3  ? -10.142 26.213  8.022   1.00 54.57 ? 26  HIS F CG    1 
ATOM   2270 N  ND1   . HIS H 3 3  ? -10.354 26.420  6.675   1.00 54.90 ? 26  HIS F ND1   1 
ATOM   2271 C  CD2   . HIS H 3 3  ? -10.886 27.141  8.669   1.00 55.29 ? 26  HIS F CD2   1 
ATOM   2272 C  CE1   . HIS H 3 3  ? -11.197 27.424  6.515   1.00 56.43 ? 26  HIS F CE1   1 
ATOM   2273 N  NE2   . HIS H 3 3  ? -11.536 27.879  7.709   1.00 55.44 ? 26  HIS F NE2   1 
ATOM   2274 N  N     . MET H 3 4  ? -9.863  21.429  8.947   1.00 47.21 ? 27  MET F N     1 
ATOM   2275 C  CA    . MET H 3 4  ? -9.253  20.137  9.140   1.00 42.27 ? 27  MET F CA    1 
ATOM   2276 C  C     . MET H 3 4  ? -9.662  19.235  7.973   1.00 37.28 ? 27  MET F C     1 
ATOM   2277 O  O     . MET H 3 4  ? -10.834 18.979  7.745   1.00 35.56 ? 27  MET F O     1 
ATOM   2278 C  CB    . MET H 3 4  ? -9.732  19.570  10.473  1.00 44.75 ? 27  MET F CB    1 
ATOM   2279 C  CG    . MET H 3 4  ? -11.170 19.928  10.781  1.00 48.41 ? 27  MET F CG    1 
ATOM   2280 S  SD    . MET H 3 4  ? -11.695 19.401  12.432  1.00 55.19 ? 27  MET F SD    1 
ATOM   2281 C  CE    . MET H 3 4  ? -10.635 20.441  13.478  1.00 51.66 ? 27  MET F CE    1 
ATOM   2282 N  N     . PHE H 3 5  ? -8.674  18.780  7.223   1.00 31.54 ? 28  PHE F N     1 
ATOM   2283 C  CA    . PHE H 3 5  ? -8.912  17.911  6.104   1.00 27.05 ? 28  PHE F CA    1 
ATOM   2284 C  C     . PHE H 3 5  ? -8.152  16.623  6.329   1.00 24.38 ? 28  PHE F C     1 
ATOM   2285 O  O     . PHE H 3 5  ? -6.926  16.613  6.432   1.00 23.57 ? 28  PHE F O     1 
ATOM   2286 C  CB    . PHE H 3 5  ? -8.479  18.606  4.813   1.00 25.79 ? 28  PHE F CB    1 
ATOM   2287 C  CG    . PHE H 3 5  ? -9.338  19.798  4.461   1.00 28.09 ? 28  PHE F CG    1 
ATOM   2288 C  CD1   . PHE H 3 5  ? -10.645 19.620  4.014   1.00 26.81 ? 28  PHE F CD1   1 
ATOM   2289 C  CD2   . PHE H 3 5  ? -8.867  21.094  4.646   1.00 28.90 ? 28  PHE F CD2   1 
ATOM   2290 C  CE1   . PHE H 3 5  ? -11.466 20.699  3.765   1.00 26.77 ? 28  PHE F CE1   1 
ATOM   2291 C  CE2   . PHE H 3 5  ? -9.684  22.195  4.399   1.00 28.87 ? 28  PHE F CE2   1 
ATOM   2292 C  CZ    . PHE H 3 5  ? -10.987 21.996  3.960   1.00 28.38 ? 28  PHE F CZ    1 
ATOM   2293 N  N     . TYR H 3 6  ? -8.884  15.524  6.417   1.00 22.40 ? 29  TYR F N     1 
ATOM   2294 C  CA    . TYR H 3 6  ? -8.251  14.239  6.648   1.00 20.89 ? 29  TYR F CA    1 
ATOM   2295 C  C     . TYR H 3 6  ? -8.126  13.467  5.353   1.00 20.46 ? 29  TYR F C     1 
ATOM   2296 O  O     . TYR H 3 6  ? -9.099  13.042  4.758   1.00 23.04 ? 29  TYR F O     1 
ATOM   2297 C  CB    . TYR H 3 6  ? -9.046  13.447  7.699   1.00 21.15 ? 29  TYR F CB    1 
ATOM   2298 C  CG    . TYR H 3 6  ? -9.130  14.148  9.064   1.00 20.71 ? 29  TYR F CG    1 
ATOM   2299 C  CD1   . TYR H 3 6  ? -9.871  15.305  9.220   1.00 19.78 ? 29  TYR F CD1   1 
ATOM   2300 C  CD2   . TYR H 3 6  ? -8.453  13.649  10.192  1.00 22.16 ? 29  TYR F CD2   1 
ATOM   2301 C  CE1   . TYR H 3 6  ? -9.953  15.962  10.438  1.00 16.98 ? 29  TYR F CE1   1 
ATOM   2302 C  CE2   . TYR H 3 6  ? -8.533  14.317  11.431  1.00 21.95 ? 29  TYR F CE2   1 
ATOM   2303 C  CZ    . TYR H 3 6  ? -9.292  15.474  11.522  1.00 18.49 ? 29  TYR F CZ    1 
ATOM   2304 O  OH    . TYR H 3 6  ? -9.420  16.157  12.694  1.00 20.81 ? 29  TYR F OH    1 
ATOM   2305 N  N     . ALA H 3 7  ? -6.905  13.285  4.898   1.00 21.08 ? 30  ALA F N     1 
ATOM   2306 C  CA    . ALA H 3 7  ? -6.710  12.553  3.671   1.00 20.81 ? 30  ALA F CA    1 
ATOM   2307 C  C     . ALA H 3 7  ? -6.364  11.094  3.905   1.00 19.96 ? 30  ALA F C     1 
ATOM   2308 O  O     . ALA H 3 7  ? -5.488  10.779  4.731   1.00 21.72 ? 30  ALA F O     1 
ATOM   2309 C  CB    . ALA H 3 7  ? -5.611  13.208  2.877   1.00 22.92 ? 30  ALA F CB    1 
ATOM   2310 N  N     . VAL H 3 8  ? -7.065  10.195  3.218   1.00 19.35 ? 31  VAL F N     1 
ATOM   2311 C  CA    . VAL H 3 8  ? -6.731  8.782   3.293   1.00 20.28 ? 31  VAL F CA    1 
ATOM   2312 C  C     . VAL H 3 8  ? -6.282  8.241   1.908   1.00 23.46 ? 31  VAL F C     1 
ATOM   2313 O  O     . VAL H 3 8  ? -7.032  8.231   0.919   1.00 22.62 ? 31  VAL F O     1 
ATOM   2314 C  CB    . VAL H 3 8  ? -7.878  7.912   3.919   1.00 22.27 ? 31  VAL F CB    1 
ATOM   2315 C  CG1   . VAL H 3 8  ? -8.939  8.786   4.587   1.00 20.46 ? 31  VAL F CG1   1 
ATOM   2316 C  CG2   . VAL H 3 8  ? -8.452  6.999   2.927   1.00 27.48 ? 31  VAL F CG2   1 
ATOM   2317 N  N     . ARG H 3 9  ? -5.021  7.828   1.842   1.00 24.13 ? 32  ARG F N     1 
ATOM   2318 C  CA    . ARG H 3 9  ? -4.444  7.281   0.618   1.00 24.82 ? 32  ARG F CA    1 
ATOM   2319 C  C     . ARG H 3 9  ? -4.801  5.814   0.488   1.00 24.55 ? 32  ARG F C     1 
ATOM   2320 O  O     . ARG H 3 9  ? -4.975  5.295   -0.612  1.00 25.66 ? 32  ARG F O     1 
ATOM   2321 C  CB    . ARG H 3 9  ? -2.922  7.433   0.653   1.00 25.62 ? 32  ARG F CB    1 
ATOM   2322 C  CG    . ARG H 3 9  ? -2.189  6.884   -0.558  1.00 28.31 ? 32  ARG F CG    1 
ATOM   2323 C  CD    . ARG H 3 9  ? -0.668  6.948   -0.330  1.00 29.09 ? 32  ARG F CD    1 
ATOM   2324 N  NE    . ARG H 3 9  ? -0.270  8.333   -0.146  1.00 29.51 ? 32  ARG F NE    1 
ATOM   2325 C  CZ    . ARG H 3 9  ? 0.778   8.745   0.555   1.00 31.96 ? 32  ARG F CZ    1 
ATOM   2326 N  NH1   . ARG H 3 9  ? 1.571   7.874   1.165   1.00 34.77 ? 32  ARG F NH1   1 
ATOM   2327 N  NH2   . ARG H 3 9  ? 1.031   10.046  0.640   1.00 32.21 ? 32  ARG F NH2   1 
ATOM   2328 N  N     . ARG H 3 10 ? -4.920  5.143   1.622   1.00 24.32 ? 33  ARG F N     1 
ATOM   2329 C  CA    . ARG H 3 10 ? -5.249  3.722   1.639   1.00 24.49 ? 33  ARG F CA    1 
ATOM   2330 C  C     . ARG H 3 10 ? -6.155  3.532   2.859   1.00 23.69 ? 33  ARG F C     1 
ATOM   2331 O  O     . ARG H 3 10 ? -5.818  3.935   3.969   1.00 22.29 ? 33  ARG F O     1 
ATOM   2332 C  CB    . ARG H 3 10 ? -3.944  2.917   1.743   1.00 27.19 ? 33  ARG F CB    1 
ATOM   2333 C  CG    . ARG H 3 10 ? -3.980  1.462   1.264   1.00 33.89 ? 33  ARG F CG    1 
ATOM   2334 C  CD    . ARG H 3 10 ? -2.562  1.016   0.823   1.00 36.57 ? 33  ARG F CD    1 
ATOM   2335 N  NE    . ARG H 3 10 ? -1.551  1.454   1.784   1.00 36.24 ? 33  ARG F NE    1 
ATOM   2336 C  CZ    . ARG H 3 10 ? -0.418  2.089   1.476   1.00 38.58 ? 33  ARG F CZ    1 
ATOM   2337 N  NH1   . ARG H 3 10 ? 0.430   2.440   2.443   1.00 34.36 ? 33  ARG F NH1   1 
ATOM   2338 N  NH2   . ARG H 3 10 ? -0.125  2.371   0.208   1.00 37.39 ? 33  ARG F NH2   1 
ATOM   2339 N  N     . GLY H 3 11 ? -7.327  2.956   2.634   1.00 24.09 ? 34  GLY F N     1 
ATOM   2340 C  CA    . GLY H 3 11 ? -8.289  2.762   3.699   1.00 23.91 ? 34  GLY F CA    1 
ATOM   2341 C  C     . GLY H 3 11 ? -9.535  2.197   3.042   1.00 26.09 ? 34  GLY F C     1 
ATOM   2342 O  O     . GLY H 3 11 ? -9.499  1.898   1.847   1.00 26.91 ? 34  GLY F O     1 
ATOM   2343 N  N     . ARG H 3 12 ? -10.624 2.062   3.789   1.00 24.18 ? 35  ARG F N     1 
ATOM   2344 C  CA    . ARG H 3 12 ? -11.855 1.479   3.255   1.00 25.32 ? 35  ARG F CA    1 
ATOM   2345 C  C     . ARG H 3 12 ? -12.373 2.264   2.072   1.00 24.73 ? 35  ARG F C     1 
ATOM   2346 O  O     . ARG H 3 12 ? -12.767 1.711   1.049   1.00 23.48 ? 35  ARG F O     1 
ATOM   2347 C  CB    . ARG H 3 12 ? -12.902 1.364   4.366   1.00 24.21 ? 35  ARG F CB    1 
ATOM   2348 C  CG    . ARG H 3 12 ? -12.408 0.422   5.467   1.00 26.45 ? 35  ARG F CG    1 
ATOM   2349 C  CD    . ARG H 3 12 ? -13.424 0.088   6.541   1.00 25.18 ? 35  ARG F CD    1 
ATOM   2350 N  NE    . ARG H 3 12 ? -12.825 -0.886  7.460   1.00 27.40 ? 35  ARG F NE    1 
ATOM   2351 C  CZ    . ARG H 3 12 ? -12.085 -0.576  8.523   1.00 25.51 ? 35  ARG F CZ    1 
ATOM   2352 N  NH1   . ARG H 3 12 ? -11.847 0.700   8.830   1.00 20.55 ? 35  ARG F NH1   1 
ATOM   2353 N  NH2   . ARG H 3 12 ? -11.574 -1.547  9.269   1.00 26.52 ? 35  ARG F NH2   1 
ATOM   2354 N  N     . LYS H 3 13 ? -12.382 3.567   2.227   1.00 26.42 ? 36  LYS F N     1 
ATOM   2355 C  CA    . LYS H 3 13 ? -12.758 4.428   1.139   1.00 28.28 ? 36  LYS F CA    1 
ATOM   2356 C  C     . LYS H 3 13 ? -11.693 5.505   1.207   1.00 27.03 ? 36  LYS F C     1 
ATOM   2357 O  O     . LYS H 3 13 ? -11.456 6.065   2.277   1.00 26.06 ? 36  LYS F O     1 
ATOM   2358 C  CB    . LYS H 3 13 ? -14.167 4.977   1.348   1.00 28.51 ? 36  LYS F CB    1 
ATOM   2359 C  CG    . LYS H 3 13 ? -15.185 3.844   1.358   1.00 35.00 ? 36  LYS F CG    1 
ATOM   2360 C  CD    . LYS H 3 13 ? -16.496 4.174   0.629   1.00 37.00 ? 36  LYS F CD    1 
ATOM   2361 C  CE    . LYS H 3 13 ? -17.321 5.179   1.419   1.00 39.53 ? 36  LYS F CE    1 
ATOM   2362 N  NZ    . LYS H 3 13 ? -17.461 4.788   2.867   1.00 40.85 ? 36  LYS F NZ    1 
ATOM   2363 N  N     . THR H 3 14 ? -11.001 5.734   0.091   1.00 25.80 ? 37  THR F N     1 
ATOM   2364 C  CA    . THR H 3 14 ? -9.973  6.778   0.047   1.00 23.79 ? 37  THR F CA    1 
ATOM   2365 C  C     . THR H 3 14 ? -10.613 8.121   -0.279  1.00 21.91 ? 37  THR F C     1 
ATOM   2366 O  O     . THR H 3 14 ? -11.788 8.192   -0.623  1.00 20.09 ? 37  THR F O     1 
ATOM   2367 C  CB    . THR H 3 14 ? -8.889  6.485   -1.005  1.00 25.46 ? 37  THR F CB    1 
ATOM   2368 O  OG1   . THR H 3 14 ? -9.501  6.351   -2.294  1.00 26.67 ? 37  THR F OG1   1 
ATOM   2369 C  CG2   . THR H 3 14 ? -8.122  5.204   -0.628  1.00 24.34 ? 37  THR F CG2   1 
ATOM   2370 N  N     . GLY H 3 15 ? -9.840  9.191   -0.159  1.00 20.09 ? 38  GLY F N     1 
ATOM   2371 C  CA    . GLY H 3 15 ? -10.379 10.511  -0.422  1.00 21.23 ? 38  GLY F CA    1 
ATOM   2372 C  C     . GLY H 3 15 ? -10.087 11.470  0.722   1.00 21.06 ? 38  GLY F C     1 
ATOM   2373 O  O     . GLY H 3 15 ? -9.225  11.211  1.546   1.00 20.20 ? 38  GLY F O     1 
ATOM   2374 N  N     . VAL H 3 16 ? -10.813 12.578  0.772   1.00 20.67 ? 39  VAL F N     1 
ATOM   2375 C  CA    . VAL H 3 16 ? -10.597 13.586  1.798   1.00 22.33 ? 39  VAL F CA    1 
ATOM   2376 C  C     . VAL H 3 16 ? -11.872 13.681  2.610   1.00 22.96 ? 39  VAL F C     1 
ATOM   2377 O  O     . VAL H 3 16 ? -12.968 13.725  2.050   1.00 22.74 ? 39  VAL F O     1 
ATOM   2378 C  CB    . VAL H 3 16 ? -10.255 14.965  1.146   1.00 22.57 ? 39  VAL F CB    1 
ATOM   2379 C  CG1   . VAL H 3 16 ? -10.318 16.043  2.154   1.00 23.94 ? 39  VAL F CG1   1 
ATOM   2380 C  CG2   . VAL H 3 16 ? -8.856  14.931  0.518   1.00 23.85 ? 39  VAL F CG2   1 
ATOM   2381 N  N     . PHE H 3 17 ? -11.735 13.667  3.932   1.00 23.22 ? 40  PHE F N     1 
ATOM   2382 C  CA    . PHE H 3 17 ? -12.898 13.758  4.800   1.00 21.32 ? 40  PHE F CA    1 
ATOM   2383 C  C     . PHE H 3 17 ? -12.760 14.990  5.671   1.00 20.80 ? 40  PHE F C     1 
ATOM   2384 O  O     . PHE H 3 17 ? -11.661 15.488  5.857   1.00 22.69 ? 40  PHE F O     1 
ATOM   2385 C  CB    . PHE H 3 17 ? -13.009 12.486  5.623   1.00 23.19 ? 40  PHE F CB    1 
ATOM   2386 C  CG    . PHE H 3 17 ? -13.059 11.247  4.792   1.00 23.82 ? 40  PHE F CG    1 
ATOM   2387 C  CD1   . PHE H 3 17 ? -14.277 10.629  4.508   1.00 24.59 ? 40  PHE F CD1   1 
ATOM   2388 C  CD2   . PHE H 3 17 ? -11.900 10.725  4.238   1.00 24.82 ? 40  PHE F CD2   1 
ATOM   2389 C  CE1   . PHE H 3 17 ? -14.341 9.508   3.688   1.00 24.03 ? 40  PHE F CE1   1 
ATOM   2390 C  CE2   . PHE H 3 17 ? -11.951 9.601   3.409   1.00 24.16 ? 40  PHE F CE2   1 
ATOM   2391 C  CZ    . PHE H 3 17 ? -13.174 8.992   3.134   1.00 26.59 ? 40  PHE F CZ    1 
ATOM   2392 N  N     . LEU H 3 18 ? -13.870 15.480  6.217   1.00 19.75 ? 41  LEU F N     1 
ATOM   2393 C  CA    . LEU H 3 18 ? -13.866 16.700  7.022   1.00 21.33 ? 41  LEU F CA    1 
ATOM   2394 C  C     . LEU H 3 18 ? -13.857 16.574  8.553   1.00 22.06 ? 41  LEU F C     1 
ATOM   2395 O  O     . LEU H 3 18 ? -13.832 17.576  9.267   1.00 23.44 ? 41  LEU F O     1 
ATOM   2396 C  CB    . LEU H 3 18 ? -15.052 17.577  6.609   1.00 23.21 ? 41  LEU F CB    1 
ATOM   2397 C  CG    . LEU H 3 18 ? -15.244 17.900  5.126   1.00 22.15 ? 41  LEU F CG    1 
ATOM   2398 C  CD1   . LEU H 3 18 ? -16.430 18.825  4.997   1.00 22.31 ? 41  LEU F CD1   1 
ATOM   2399 C  CD2   . LEU H 3 18 ? -13.997 18.565  4.563   1.00 23.10 ? 41  LEU F CD2   1 
ATOM   2400 N  N     . THR H 3 19 ? -13.920 15.365  9.067   1.00 20.87 ? 42  THR F N     1 
ATOM   2401 C  CA    . THR H 3 19 ? -13.855 15.206  10.508  1.00 23.05 ? 42  THR F CA    1 
ATOM   2402 C  C     . THR H 3 19 ? -13.018 13.965  10.748  1.00 21.92 ? 42  THR F C     1 
ATOM   2403 O  O     . THR H 3 19 ? -12.894 13.110  9.869   1.00 19.95 ? 42  THR F O     1 
ATOM   2404 C  CB    . THR H 3 19 ? -15.246 14.964  11.162  1.00 21.94 ? 42  THR F CB    1 
ATOM   2405 O  OG1   . THR H 3 19 ? -15.728 13.690  10.769  1.00 25.74 ? 42  THR F OG1   1 
ATOM   2406 C  CG2   . THR H 3 19 ? -16.256 15.997  10.741  1.00 25.57 ? 42  THR F CG2   1 
ATOM   2407 N  N     . TRP H 3 20 ? -12.438 13.862  11.939  1.00 22.12 ? 43  TRP F N     1 
ATOM   2408 C  CA    . TRP H 3 20 ? -11.656 12.688  12.271  1.00 22.61 ? 43  TRP F CA    1 
ATOM   2409 C  C     . TRP H 3 20 ? -12.609 11.489  12.375  1.00 21.79 ? 43  TRP F C     1 
ATOM   2410 O  O     . TRP H 3 20 ? -12.264 10.374  12.007  1.00 19.88 ? 43  TRP F O     1 
ATOM   2411 C  CB    . TRP H 3 20 ? -10.915 12.899  13.604  1.00 23.39 ? 43  TRP F CB    1 
ATOM   2412 C  CG    . TRP H 3 20 ? -10.398 11.630  14.243  1.00 23.08 ? 43  TRP F CG    1 
ATOM   2413 C  CD1   . TRP H 3 20 ? -10.708 11.157  15.500  1.00 25.67 ? 43  TRP F CD1   1 
ATOM   2414 C  CD2   . TRP H 3 20 ? -9.462  10.697  13.693  1.00 23.39 ? 43  TRP F CD2   1 
ATOM   2415 N  NE1   . TRP H 3 20 ? -10.020 9.997   15.758  1.00 23.91 ? 43  TRP F NE1   1 
ATOM   2416 C  CE2   . TRP H 3 20 ? -9.249  9.689   14.668  1.00 23.32 ? 43  TRP F CE2   1 
ATOM   2417 C  CE3   . TRP H 3 20 ? -8.778  10.611  12.471  1.00 24.08 ? 43  TRP F CE3   1 
ATOM   2418 C  CZ2   . TRP H 3 20 ? -8.388  8.614   14.458  1.00 22.22 ? 43  TRP F CZ2   1 
ATOM   2419 C  CZ3   . TRP H 3 20 ? -7.925  9.547   12.259  1.00 21.31 ? 43  TRP F CZ3   1 
ATOM   2420 C  CH2   . TRP H 3 20 ? -7.735  8.557   13.249  1.00 24.94 ? 43  TRP F CH2   1 
ATOM   2421 N  N     . ASN H 3 21 ? -13.814 11.715  12.875  1.00 22.96 ? 44  ASN F N     1 
ATOM   2422 C  CA    . ASN H 3 21 ? -14.756 10.599  13.012  1.00 25.42 ? 44  ASN F CA    1 
ATOM   2423 C  C     . ASN H 3 21 ? -14.934 9.866   11.681  1.00 25.17 ? 44  ASN F C     1 
ATOM   2424 O  O     . ASN H 3 21 ? -14.927 8.645   11.632  1.00 26.46 ? 44  ASN F O     1 
ATOM   2425 C  CB    . ASN H 3 21 ? -16.126 11.082  13.509  1.00 24.71 ? 44  ASN F CB    1 
ATOM   2426 C  CG    . ASN H 3 21 ? -16.155 11.370  15.011  1.00 26.32 ? 44  ASN F CG    1 
ATOM   2427 O  OD1   . ASN H 3 21 ? -15.658 10.590  15.814  1.00 27.23 ? 44  ASN F OD1   1 
ATOM   2428 N  ND2   . ASN H 3 21 ? -16.766 12.494  15.389  1.00 27.64 ? 44  ASN F ND2   1 
ATOM   2429 N  N     . GLU H 3 22 ? -15.074 10.613  10.595  1.00 26.08 ? 45  GLU F N     1 
ATOM   2430 C  CA    . GLU H 3 22 ? -15.262 9.998   9.289   1.00 26.28 ? 45  GLU F CA    1 
ATOM   2431 C  C     . GLU H 3 22 ? -14.005 9.319   8.791   1.00 24.14 ? 45  GLU F C     1 
ATOM   2432 O  O     . GLU H 3 22 ? -14.062 8.222   8.272   1.00 23.88 ? 45  GLU F O     1 
ATOM   2433 C  CB    . GLU H 3 22 ? -15.740 11.061  8.321   1.00 29.77 ? 45  GLU F CB    1 
ATOM   2434 C  CG    . GLU H 3 22 ? -16.958 11.767  8.876   1.00 33.30 ? 45  GLU F CG    1 
ATOM   2435 C  CD    . GLU H 3 22 ? -17.330 13.023  8.125   1.00 35.10 ? 45  GLU F CD    1 
ATOM   2436 O  OE1   . GLU H 3 22 ? -17.713 12.930  6.938   1.00 36.16 ? 45  GLU F OE1   1 
ATOM   2437 O  OE2   . GLU H 3 22 ? -17.237 14.105  8.738   1.00 37.33 ? 45  GLU F OE2   1 
ATOM   2438 N  N     . CYS H 3 23 ? -12.861 9.956   8.994   1.00 23.21 ? 46  CYS F N     1 
ATOM   2439 C  CA    . CYS H 3 23 ? -11.580 9.389   8.572   1.00 22.93 ? 46  CYS F CA    1 
ATOM   2440 C  C     . CYS H 3 23 ? -11.289 8.089   9.321   1.00 23.75 ? 46  CYS F C     1 
ATOM   2441 O  O     . CYS H 3 23 ? -10.876 7.084   8.732   1.00 23.80 ? 46  CYS F O     1 
ATOM   2442 C  CB    . CYS H 3 23 ? -10.463 10.399  8.833   1.00 22.06 ? 46  CYS F CB    1 
ATOM   2443 S  SG    . CYS H 3 23 ? -8.784  9.808   8.565   1.00 23.64 ? 46  CYS F SG    1 
ATOM   2444 N  N     . ARG H 3 24 ? -11.503 8.134   10.631  1.00 22.96 ? 47  ARG F N     1 
ATOM   2445 C  CA    . ARG H 3 24 ? -11.301 6.994   11.505  1.00 23.49 ? 47  ARG F CA    1 
ATOM   2446 C  C     . ARG H 3 24 ? -12.043 5.758   10.992  1.00 20.39 ? 47  ARG F C     1 
ATOM   2447 O  O     . ARG H 3 24 ? -11.488 4.671   10.943  1.00 18.74 ? 47  ARG F O     1 
ATOM   2448 C  CB    . ARG H 3 24 ? -11.787 7.363   12.916  1.00 23.85 ? 47  ARG F CB    1 
ATOM   2449 C  CG    . ARG H 3 24 ? -11.758 6.240   13.917  1.00 25.89 ? 47  ARG F CG    1 
ATOM   2450 C  CD    . ARG H 3 24 ? -11.736 6.825   15.341  1.00 28.93 ? 47  ARG F CD    1 
ATOM   2451 N  NE    . ARG H 3 24 ? -11.813 5.791   16.370  1.00 33.44 ? 47  ARG F NE    1 
ATOM   2452 C  CZ    . ARG H 3 24 ? -11.978 6.038   17.673  1.00 36.28 ? 47  ARG F CZ    1 
ATOM   2453 N  NH1   . ARG H 3 24 ? -12.047 5.022   18.526  1.00 37.74 ? 47  ARG F NH1   1 
ATOM   2454 N  NH2   . ARG H 3 24 ? -12.066 7.291   18.129  1.00 32.66 ? 47  ARG F NH2   1 
ATOM   2455 N  N     . ALA H 3 25 ? -13.303 5.942   10.606  1.00 22.44 ? 48  ALA F N     1 
ATOM   2456 C  CA    . ALA H 3 25 ? -14.126 4.856   10.076  1.00 21.90 ? 48  ALA F CA    1 
ATOM   2457 C  C     . ALA H 3 25 ? -13.519 4.194   8.832   1.00 22.42 ? 48  ALA F C     1 
ATOM   2458 O  O     . ALA H 3 25 ? -13.864 3.067   8.506   1.00 24.61 ? 48  ALA F O     1 
ATOM   2459 C  CB    . ALA H 3 25 ? -15.524 5.369   9.747   1.00 21.77 ? 48  ALA F CB    1 
ATOM   2460 N  N     . GLN H 3 26 ? -12.638 4.884   8.124   1.00 20.54 ? 49  GLN F N     1 
ATOM   2461 C  CA    . GLN H 3 26 ? -12.036 4.288   6.931   1.00 23.35 ? 49  GLN F CA    1 
ATOM   2462 C  C     . GLN H 3 26 ? -10.690 3.630   7.260   1.00 21.25 ? 49  GLN F C     1 
ATOM   2463 O  O     . GLN H 3 26 ? -10.204 2.795   6.486   1.00 22.00 ? 49  GLN F O     1 
ATOM   2464 C  CB    . GLN H 3 26 ? -11.757 5.357   5.844   1.00 21.74 ? 49  GLN F CB    1 
ATOM   2465 C  CG    . GLN H 3 26 ? -12.844 6.367   5.568   1.00 25.24 ? 49  GLN F CG    1 
ATOM   2466 C  CD    . GLN H 3 26 ? -14.180 5.706   5.302   1.00 26.85 ? 49  GLN F CD    1 
ATOM   2467 O  OE1   . GLN H 3 26 ? -14.248 4.678   4.630   1.00 26.93 ? 49  GLN F OE1   1 
ATOM   2468 N  NE2   . GLN H 3 26 ? -15.250 6.292   5.833   1.00 27.11 ? 49  GLN F NE2   1 
ATOM   2469 N  N     . VAL H 3 27 ? -10.074 4.028   8.374   1.00 20.47 ? 50  VAL F N     1 
ATOM   2470 C  CA    . VAL H 3 27 ? -8.751  3.497   8.707   1.00 22.76 ? 50  VAL F CA    1 
ATOM   2471 C  C     . VAL H 3 27 ? -8.588  2.645   9.964   1.00 24.71 ? 50  VAL F C     1 
ATOM   2472 O  O     . VAL H 3 27 ? -7.641  1.875   10.050  1.00 26.06 ? 50  VAL F O     1 
ATOM   2473 C  CB    . VAL H 3 27 ? -7.684  4.625   8.784   1.00 20.57 ? 50  VAL F CB    1 
ATOM   2474 C  CG1   . VAL H 3 27 ? -7.523  5.321   7.434   1.00 23.17 ? 50  VAL F CG1   1 
ATOM   2475 C  CG2   . VAL H 3 27 ? -8.066  5.617   9.811   1.00 21.27 ? 50  VAL F CG2   1 
ATOM   2476 N  N     . ASP H 3 28 ? -9.474  2.781   10.939  1.00 25.07 ? 51  ASP F N     1 
ATOM   2477 C  CA    . ASP H 3 28 ? -9.333  1.986   12.145  1.00 28.43 ? 51  ASP F CA    1 
ATOM   2478 C  C     . ASP H 3 28 ? -9.378  0.515   11.814  1.00 28.54 ? 51  ASP F C     1 
ATOM   2479 O  O     . ASP H 3 28 ? -10.302 0.051   11.148  1.00 30.05 ? 51  ASP F O     1 
ATOM   2480 C  CB    . ASP H 3 28 ? -10.430 2.325   13.151  1.00 31.14 ? 51  ASP F CB    1 
ATOM   2481 C  CG    . ASP H 3 28 ? -9.907  3.144   14.326  1.00 36.07 ? 51  ASP F CG    1 
ATOM   2482 O  OD1   . ASP H 3 28 ? -9.448  4.287   14.114  1.00 38.61 ? 51  ASP F OD1   1 
ATOM   2483 O  OD2   . ASP H 3 28 ? -9.938  2.645   15.469  1.00 37.45 ? 51  ASP F OD2   1 
ATOM   2484 N  N     . ARG H 3 29 ? -8.365  -0.217  12.265  1.00 29.05 ? 52  ARG F N     1 
ATOM   2485 C  CA    . ARG H 3 29 ? -8.283  -1.651  12.023  1.00 28.45 ? 52  ARG F CA    1 
ATOM   2486 C  C     . ARG H 3 29 ? -8.118  -1.995  10.548  1.00 29.29 ? 52  ARG F C     1 
ATOM   2487 O  O     . ARG H 3 29 ? -8.403  -3.122  10.151  1.00 28.92 ? 52  ARG F O     1 
ATOM   2488 C  CB    . ARG H 3 29 ? -9.524  -2.343  12.582  1.00 31.27 ? 52  ARG F CB    1 
ATOM   2489 C  CG    . ARG H 3 29 ? -9.559  -2.345  14.117  1.00 35.52 ? 52  ARG F CG    1 
ATOM   2490 C  CD    . ARG H 3 29 ? -10.979 -2.307  14.649  1.00 39.31 ? 52  ARG F CD    1 
ATOM   2491 N  NE    . ARG H 3 29 ? -11.685 -1.119  14.151  1.00 44.12 ? 52  ARG F NE    1 
ATOM   2492 C  CZ    . ARG H 3 29 ? -12.648 -1.145  13.228  1.00 44.72 ? 52  ARG F CZ    1 
ATOM   2493 N  NH1   . ARG H 3 29 ? -13.223 -0.014  12.834  1.00 44.58 ? 52  ARG F NH1   1 
ATOM   2494 N  NH2   . ARG H 3 29 ? -13.049 -2.307  12.710  1.00 46.23 ? 52  ARG F NH2   1 
ATOM   2495 N  N     . PHE H 3 30 ? -7.647  -1.045  9.740   1.00 24.97 ? 53  PHE F N     1 
ATOM   2496 C  CA    . PHE H 3 30 ? -7.454  -1.325  8.322   1.00 24.22 ? 53  PHE F CA    1 
ATOM   2497 C  C     . PHE H 3 30 ? -5.980  -1.561  8.006   1.00 24.24 ? 53  PHE F C     1 
ATOM   2498 O  O     . PHE H 3 30 ? -5.146  -0.689  8.195   1.00 25.41 ? 53  PHE F O     1 
ATOM   2499 C  CB    . PHE H 3 30 ? -8.014  -0.180  7.466   1.00 22.86 ? 53  PHE F CB    1 
ATOM   2500 C  CG    . PHE H 3 30 ? -7.996  -0.465  5.985   1.00 21.03 ? 53  PHE F CG    1 
ATOM   2501 C  CD1   . PHE H 3 30 ? -6.844  -0.283  5.243   1.00 21.65 ? 53  PHE F CD1   1 
ATOM   2502 C  CD2   . PHE H 3 30 ? -9.129  -0.931  5.342   1.00 19.45 ? 53  PHE F CD2   1 
ATOM   2503 C  CE1   . PHE H 3 30 ? -6.823  -0.571  3.850   1.00 22.89 ? 53  PHE F CE1   1 
ATOM   2504 C  CE2   . PHE H 3 30 ? -9.114  -1.215  3.992   1.00 20.20 ? 53  PHE F CE2   1 
ATOM   2505 C  CZ    . PHE H 3 30 ? -7.951  -1.033  3.241   1.00 21.94 ? 53  PHE F CZ    1 
ATOM   2506 N  N     . PRO H 3 31 ? -5.648  -2.756  7.503   1.00 24.92 ? 54  PRO F N     1 
ATOM   2507 C  CA    . PRO H 3 31 ? -4.276  -3.135  7.158   1.00 25.60 ? 54  PRO F CA    1 
ATOM   2508 C  C     . PRO H 3 31 ? -3.569  -2.119  6.273   1.00 24.97 ? 54  PRO F C     1 
ATOM   2509 O  O     . PRO H 3 31 ? -4.040  -1.787  5.196   1.00 27.09 ? 54  PRO F O     1 
ATOM   2510 C  CB    . PRO H 3 31 ? -4.455  -4.486  6.449   1.00 24.69 ? 54  PRO F CB    1 
ATOM   2511 C  CG    . PRO H 3 31 ? -5.695  -5.021  7.057   1.00 24.63 ? 54  PRO F CG    1 
ATOM   2512 C  CD    . PRO H 3 31 ? -6.587  -3.817  7.110   1.00 23.78 ? 54  PRO F CD    1 
ATOM   2513 N  N     . ALA H 3 32 ? -2.429  -1.650  6.744   1.00 24.85 ? 55  ALA F N     1 
ATOM   2514 C  CA    . ALA H 3 32 ? -1.606  -0.696  6.029   1.00 25.51 ? 55  ALA F CA    1 
ATOM   2515 C  C     . ALA H 3 32 ? -2.312  0.611   5.702   1.00 25.26 ? 55  ALA F C     1 
ATOM   2516 O  O     . ALA H 3 32 ? -2.033  1.226   4.672   1.00 23.86 ? 55  ALA F O     1 
ATOM   2517 C  CB    . ALA H 3 32 ? -1.061  -1.342  4.743   1.00 26.91 ? 55  ALA F CB    1 
ATOM   2518 N  N     . ALA H 3 33 ? -3.217  1.041   6.571   1.00 23.91 ? 56  ALA F N     1 
ATOM   2519 C  CA    . ALA H 3 33 ? -3.913  2.284   6.327   1.00 25.81 ? 56  ALA F CA    1 
ATOM   2520 C  C     . ALA H 3 33 ? -2.843  3.339   6.075   1.00 25.60 ? 56  ALA F C     1 
ATOM   2521 O  O     . ALA H 3 33 ? -1.682  3.146   6.422   1.00 28.04 ? 56  ALA F O     1 
ATOM   2522 C  CB    . ALA H 3 33 ? -4.762  2.665   7.531   1.00 25.35 ? 56  ALA F CB    1 
ATOM   2523 N  N     . ARG H 3 34 ? -3.222  4.444   5.454   1.00 25.42 ? 57  ARG F N     1 
ATOM   2524 C  CA    . ARG H 3 34 ? -2.277  5.519   5.177   1.00 24.89 ? 57  ARG F CA    1 
ATOM   2525 C  C     . ARG H 3 34 ? -3.129  6.770   5.118   1.00 24.47 ? 57  ARG F C     1 
ATOM   2526 O  O     . ARG H 3 34 ? -3.939  6.949   4.205   1.00 24.58 ? 57  ARG F O     1 
ATOM   2527 C  CB    . ARG H 3 34 ? -1.563  5.251   3.850   1.00 27.36 ? 57  ARG F CB    1 
ATOM   2528 C  CG    . ARG H 3 34 ? -0.291  6.033   3.645   1.00 30.32 ? 57  ARG F CG    1 
ATOM   2529 C  CD    . ARG H 3 34 ? 0.640   5.994   4.867   1.00 32.19 ? 57  ARG F CD    1 
ATOM   2530 N  NE    . ARG H 3 34 ? 1.700   6.993   4.741   1.00 30.88 ? 57  ARG F NE    1 
ATOM   2531 C  CZ    . ARG H 3 34 ? 1.958   7.960   5.621   1.00 30.83 ? 57  ARG F CZ    1 
ATOM   2532 N  NH1   . ARG H 3 34 ? 1.251   8.092   6.731   1.00 31.57 ? 57  ARG F NH1   1 
ATOM   2533 N  NH2   . ARG H 3 34 ? 2.915   8.837   5.366   1.00 32.60 ? 57  ARG F NH2   1 
ATOM   2534 N  N     . PHE H 3 35 ? -2.971  7.619   6.122   1.00 22.35 ? 58  PHE F N     1 
ATOM   2535 C  CA    . PHE H 3 35 ? -3.754  8.843   6.213   1.00 22.48 ? 58  PHE F CA    1 
ATOM   2536 C  C     . PHE H 3 35 ? -3.026  9.933   6.988   1.00 20.30 ? 58  PHE F C     1 
ATOM   2537 O  O     . PHE H 3 35 ? -2.123  9.657   7.777   1.00 22.00 ? 58  PHE F O     1 
ATOM   2538 C  CB    . PHE H 3 35 ? -5.104  8.545   6.881   1.00 21.69 ? 58  PHE F CB    1 
ATOM   2539 C  CG    . PHE H 3 35 ? -4.978  8.013   8.276   1.00 22.16 ? 58  PHE F CG    1 
ATOM   2540 C  CD1   . PHE H 3 35 ? -5.194  8.837   9.369   1.00 24.59 ? 58  PHE F CD1   1 
ATOM   2541 C  CD2   . PHE H 3 35 ? -4.564  6.704   8.498   1.00 22.58 ? 58  PHE F CD2   1 
ATOM   2542 C  CE1   . PHE H 3 35 ? -4.991  8.375   10.652  1.00 24.02 ? 58  PHE F CE1   1 
ATOM   2543 C  CE2   . PHE H 3 35 ? -4.357  6.237   9.774   1.00 21.59 ? 58  PHE F CE2   1 
ATOM   2544 C  CZ    . PHE H 3 35 ? -4.568  7.071   10.856  1.00 22.76 ? 58  PHE F CZ    1 
ATOM   2545 N  N     . LYS H 3 36 ? -3.429  11.175  6.745   1.00 20.61 ? 59  LYS F N     1 
ATOM   2546 C  CA    . LYS H 3 36 ? -2.839  12.339  7.387   1.00 21.11 ? 59  LYS F CA    1 
ATOM   2547 C  C     . LYS H 3 36 ? -3.812  13.506  7.380   1.00 22.79 ? 59  LYS F C     1 
ATOM   2548 O  O     . LYS H 3 36 ? -4.639  13.628  6.461   1.00 24.52 ? 59  LYS F O     1 
ATOM   2549 C  CB    . LYS H 3 36 ? -1.564  12.741  6.660   1.00 21.81 ? 59  LYS F CB    1 
ATOM   2550 C  CG    . LYS H 3 36 ? -0.800  13.882  7.311   1.00 24.14 ? 59  LYS F CG    1 
ATOM   2551 C  CD    . LYS H 3 36 ? 0.642   13.884  6.835   1.00 27.90 ? 59  LYS F CD    1 
ATOM   2552 C  CE    . LYS H 3 36 ? 1.407   15.062  7.371   1.00 30.18 ? 59  LYS F CE    1 
ATOM   2553 N  NZ    . LYS H 3 36 ? 2.756   15.019  6.784   1.00 34.97 ? 59  LYS F NZ    1 
ATOM   2554 N  N     . LYS H 3 37 ? -3.697  14.368  8.389   1.00 21.37 ? 60  LYS F N     1 
ATOM   2555 C  CA    . LYS H 3 37 ? -4.563  15.528  8.522   1.00 24.46 ? 60  LYS F CA    1 
ATOM   2556 C  C     . LYS H 3 37 ? -3.899  16.755  7.915   1.00 23.52 ? 60  LYS F C     1 
ATOM   2557 O  O     . LYS H 3 37 ? -2.706  16.974  8.091   1.00 23.90 ? 60  LYS F O     1 
ATOM   2558 C  CB    . LYS H 3 37 ? -4.893  15.772  10.013  1.00 24.52 ? 60  LYS F CB    1 
ATOM   2559 C  CG    . LYS H 3 37 ? -5.657  17.072  10.285  1.00 31.08 ? 60  LYS F CG    1 
ATOM   2560 C  CD    . LYS H 3 37 ? -6.105  17.254  11.754  1.00 29.91 ? 60  LYS F CD    1 
ATOM   2561 C  CE    . LYS H 3 37 ? -4.906  17.237  12.712  1.00 35.12 ? 60  LYS F CE    1 
ATOM   2562 N  NZ    . LYS H 3 37 ? -5.220  17.644  14.121  1.00 34.26 ? 60  LYS F NZ    1 
ATOM   2563 N  N     . PHE H 3 38 ? -4.662  17.537  7.164   1.00 24.61 ? 61  PHE F N     1 
ATOM   2564 C  CA    . PHE H 3 38 ? -4.122  18.763  6.559   1.00 27.09 ? 61  PHE F CA    1 
ATOM   2565 C  C     . PHE H 3 38 ? -5.012  19.969  6.822   1.00 26.32 ? 61  PHE F C     1 
ATOM   2566 O  O     . PHE H 3 38 ? -6.211  19.814  7.041   1.00 26.43 ? 61  PHE F O     1 
ATOM   2567 C  CB    . PHE H 3 38 ? -3.910  18.587  5.056   1.00 25.20 ? 61  PHE F CB    1 
ATOM   2568 C  CG    . PHE H 3 38 ? -2.846  17.596  4.729   1.00 26.66 ? 61  PHE F CG    1 
ATOM   2569 C  CD1   . PHE H 3 38 ? -3.134  16.232  4.681   1.00 26.11 ? 61  PHE F CD1   1 
ATOM   2570 C  CD2   . PHE H 3 38 ? -1.533  18.011  4.532   1.00 26.85 ? 61  PHE F CD2   1 
ATOM   2571 C  CE1   . PHE H 3 38 ? -2.128  15.299  4.444   1.00 26.87 ? 61  PHE F CE1   1 
ATOM   2572 C  CE2   . PHE H 3 38 ? -0.520  17.083  4.297   1.00 26.53 ? 61  PHE F CE2   1 
ATOM   2573 C  CZ    . PHE H 3 38 ? -0.819  15.723  4.255   1.00 26.74 ? 61  PHE F CZ    1 
ATOM   2574 N  N     . ALA H 3 39 ? -4.420  21.161  6.795   1.00 27.14 ? 62  ALA F N     1 
ATOM   2575 C  CA    . ALA H 3 39 ? -5.161  22.388  7.042   1.00 28.02 ? 62  ALA F CA    1 
ATOM   2576 C  C     . ALA H 3 39 ? -5.950  22.882  5.828   1.00 29.16 ? 62  ALA F C     1 
ATOM   2577 O  O     . ALA H 3 39 ? -6.876  23.680  5.982   1.00 29.14 ? 62  ALA F O     1 
ATOM   2578 C  CB    . ALA H 3 39 ? -4.230  23.473  7.542   1.00 28.37 ? 62  ALA F CB    1 
ATOM   2579 N  N     . THR H 3 40 ? -5.602  22.404  4.635   1.00 29.45 ? 63  THR F N     1 
ATOM   2580 C  CA    . THR H 3 40 ? -6.335  22.795  3.428   1.00 30.23 ? 63  THR F CA    1 
ATOM   2581 C  C     . THR H 3 40 ? -6.658  21.590  2.553   1.00 30.15 ? 63  THR F C     1 
ATOM   2582 O  O     . THR H 3 40 ? -5.935  20.602  2.531   1.00 29.32 ? 63  THR F O     1 
ATOM   2583 C  CB    . THR H 3 40 ? -5.563  23.821  2.576   1.00 30.85 ? 63  THR F CB    1 
ATOM   2584 O  OG1   . THR H 3 40 ? -4.553  23.157  1.807   1.00 30.46 ? 63  THR F OG1   1 
ATOM   2585 C  CG2   . THR H 3 40 ? -4.902  24.855  3.486   1.00 34.33 ? 63  THR F CG2   1 
ATOM   2586 N  N     . GLU H 3 41 ? -7.766  21.695  1.835   1.00 30.01 ? 64  GLU F N     1 
ATOM   2587 C  CA    . GLU H 3 41 ? -8.237  20.646  0.967   1.00 31.65 ? 64  GLU F CA    1 
ATOM   2588 C  C     . GLU H 3 41 ? -7.206  20.231  -0.079  1.00 30.78 ? 64  GLU F C     1 
ATOM   2589 O  O     . GLU H 3 41 ? -7.021  19.039  -0.357  1.00 30.00 ? 64  GLU F O     1 
ATOM   2590 C  CB    . GLU H 3 41 ? -9.519  21.125  0.290   1.00 34.55 ? 64  GLU F CB    1 
ATOM   2591 C  CG    . GLU H 3 41 ? -10.132 20.151  -0.676  1.00 39.70 ? 64  GLU F CG    1 
ATOM   2592 C  CD    . GLU H 3 41 ? -11.228 20.795  -1.523  1.00 43.57 ? 64  GLU F CD    1 
ATOM   2593 O  OE1   . GLU H 3 41 ? -11.871 20.065  -2.318  1.00 44.61 ? 64  GLU F OE1   1 
ATOM   2594 O  OE2   . GLU H 3 41 ? -11.439 22.028  -1.394  1.00 44.03 ? 64  GLU F OE2   1 
ATOM   2595 N  N     . ASP H 3 42 ? -6.530  21.220  -0.640  1.00 29.90 ? 65  ASP F N     1 
ATOM   2596 C  CA    . ASP H 3 42 ? -5.542  20.991  -1.682  1.00 31.88 ? 65  ASP F CA    1 
ATOM   2597 C  C     . ASP H 3 42 ? -4.331  20.182  -1.178  1.00 31.16 ? 65  ASP F C     1 
ATOM   2598 O  O     . ASP H 3 42 ? -3.832  19.303  -1.873  1.00 30.41 ? 65  ASP F O     1 
ATOM   2599 C  CB    . ASP H 3 42 ? -5.096  22.348  -2.247  1.00 34.10 ? 65  ASP F CB    1 
ATOM   2600 C  CG    . ASP H 3 42 ? -4.395  22.228  -3.575  1.00 36.52 ? 65  ASP F CG    1 
ATOM   2601 O  OD1   . ASP H 3 42 ? -3.299  22.804  -3.720  1.00 39.51 ? 65  ASP F OD1   1 
ATOM   2602 O  OD2   . ASP H 3 42 ? -4.938  21.573  -4.482  1.00 39.39 ? 65  ASP F OD2   1 
ATOM   2603 N  N     . GLU H 3 43 ? -3.855  20.459  0.032   1.00 31.06 ? 66  GLU F N     1 
ATOM   2604 C  CA    . GLU H 3 43 ? -2.711  19.696  0.523   1.00 29.33 ? 66  GLU F CA    1 
ATOM   2605 C  C     . GLU H 3 43 ? -3.101  18.246  0.783   1.00 27.60 ? 66  GLU F C     1 
ATOM   2606 O  O     . GLU H 3 43 ? -2.266  17.338  0.664   1.00 24.52 ? 66  GLU F O     1 
ATOM   2607 C  CB    . GLU H 3 43 ? -2.182  20.295  1.804   1.00 32.90 ? 66  GLU F CB    1 
ATOM   2608 C  CG    . GLU H 3 43 ? -1.544  21.631  1.665   1.00 35.49 ? 66  GLU F CG    1 
ATOM   2609 C  CD    . GLU H 3 43 ? -1.508  22.321  3.009   1.00 37.78 ? 66  GLU F CD    1 
ATOM   2610 O  OE1   . GLU H 3 43 ? -1.133  21.657  3.994   1.00 37.65 ? 66  GLU F OE1   1 
ATOM   2611 O  OE2   . GLU H 3 43 ? -1.862  23.513  3.084   1.00 41.90 ? 66  GLU F OE2   1 
ATOM   2612 N  N     . ALA H 3 44 ? -4.373  18.039  1.150   1.00 24.93 ? 67  ALA F N     1 
ATOM   2613 C  CA    . ALA H 3 44 ? -4.891  16.701  1.413   1.00 22.40 ? 67  ALA F CA    1 
ATOM   2614 C  C     . ALA H 3 44 ? -4.939  15.884  0.126   1.00 21.60 ? 67  ALA F C     1 
ATOM   2615 O  O     . ALA H 3 44 ? -4.556  14.718  0.113   1.00 21.81 ? 67  ALA F O     1 
ATOM   2616 C  CB    . ALA H 3 44 ? -6.288  16.795  2.030   1.00 22.70 ? 67  ALA F CB    1 
ATOM   2617 N  N     . TRP H 3 45 ? -5.421  16.485  -0.960  1.00 20.64 ? 68  TRP F N     1 
ATOM   2618 C  CA    . TRP H 3 45 ? -5.486  15.748  -2.216  1.00 21.14 ? 68  TRP F CA    1 
ATOM   2619 C  C     . TRP H 3 45 ? -4.112  15.379  -2.720  1.00 20.23 ? 68  TRP F C     1 
ATOM   2620 O  O     . TRP H 3 45 ? -3.923  14.302  -3.243  1.00 22.69 ? 68  TRP F O     1 
ATOM   2621 C  CB    . TRP H 3 45 ? -6.256  16.539  -3.261  1.00 21.93 ? 68  TRP F CB    1 
ATOM   2622 C  CG    . TRP H 3 45 ? -7.684  16.391  -3.030  1.00 21.12 ? 68  TRP F CG    1 
ATOM   2623 C  CD1   . TRP H 3 45 ? -8.554  17.340  -2.607  1.00 22.38 ? 68  TRP F CD1   1 
ATOM   2624 C  CD2   . TRP H 3 45 ? -8.419  15.178  -3.127  1.00 23.12 ? 68  TRP F CD2   1 
ATOM   2625 N  NE1   . TRP H 3 45 ? -9.799  16.789  -2.429  1.00 22.14 ? 68  TRP F NE1   1 
ATOM   2626 C  CE2   . TRP H 3 45 ? -9.742  15.462  -2.746  1.00 22.33 ? 68  TRP F CE2   1 
ATOM   2627 C  CE3   . TRP H 3 45 ? -8.086  13.869  -3.506  1.00 23.75 ? 68  TRP F CE3   1 
ATOM   2628 C  CZ2   . TRP H 3 45 ? -10.740 14.492  -2.732  1.00 23.70 ? 68  TRP F CZ2   1 
ATOM   2629 C  CZ3   . TRP H 3 45 ? -9.081  12.897  -3.491  1.00 23.07 ? 68  TRP F CZ3   1 
ATOM   2630 C  CH2   . TRP H 3 45 ? -10.392 13.217  -3.106  1.00 23.94 ? 68  TRP F CH2   1 
ATOM   2631 N  N     . ALA H 3 46 ? -3.148  16.267  -2.531  1.00 22.02 ? 69  ALA F N     1 
ATOM   2632 C  CA    . ALA H 3 46 ? -1.783  15.998  -2.956  1.00 23.57 ? 69  ALA F CA    1 
ATOM   2633 C  C     . ALA H 3 46 ? -1.309  14.702  -2.284  1.00 25.97 ? 69  ALA F C     1 
ATOM   2634 O  O     . ALA H 3 46 ? -0.713  13.831  -2.931  1.00 27.97 ? 69  ALA F O     1 
ATOM   2635 C  CB    . ALA H 3 46 ? -0.884  17.164  -2.555  1.00 23.91 ? 69  ALA F CB    1 
ATOM   2636 N  N     . PHE H 3 47 ? -1.602  14.574  -0.989  1.00 25.04 ? 70  PHE F N     1 
ATOM   2637 C  CA    . PHE H 3 47 ? -1.218  13.396  -0.230  1.00 23.91 ? 70  PHE F CA    1 
ATOM   2638 C  C     . PHE H 3 47 ? -1.965  12.175  -0.730  1.00 23.77 ? 70  PHE F C     1 
ATOM   2639 O  O     . PHE H 3 47 ? -1.397  11.094  -0.837  1.00 24.87 ? 70  PHE F O     1 
ATOM   2640 C  CB    . PHE H 3 47 ? -1.505  13.599  1.255   1.00 22.75 ? 70  PHE F CB    1 
ATOM   2641 C  CG    . PHE H 3 47 ? -1.158  12.406  2.105   1.00 22.53 ? 70  PHE F CG    1 
ATOM   2642 C  CD1   . PHE H 3 47 ? 0.117   12.283  2.674   1.00 19.55 ? 70  PHE F CD1   1 
ATOM   2643 C  CD2   . PHE H 3 47 ? -2.126  11.451  2.399   1.00 18.91 ? 70  PHE F CD2   1 
ATOM   2644 C  CE1   . PHE H 3 47 ? 0.406   11.234  3.534   1.00 18.91 ? 70  PHE F CE1   1 
ATOM   2645 C  CE2   . PHE H 3 47 ? -1.850  10.395  3.258   1.00 19.78 ? 70  PHE F CE2   1 
ATOM   2646 C  CZ    . PHE H 3 47 ? -0.598  10.283  3.828   1.00 20.10 ? 70  PHE F CZ    1 
ATOM   2647 N  N     . VAL H 3 48 ? -3.245  12.344  -1.036  1.00 24.67 ? 71  VAL F N     1 
ATOM   2648 C  CA    . VAL H 3 48 ? -4.014  11.236  -1.544  1.00 24.31 ? 71  VAL F CA    1 
ATOM   2649 C  C     . VAL H 3 48 ? -3.440  10.828  -2.871  1.00 27.59 ? 71  VAL F C     1 
ATOM   2650 O  O     . VAL H 3 48 ? -3.512  9.669   -3.249  1.00 30.52 ? 71  VAL F O     1 
ATOM   2651 C  CB    . VAL H 3 48 ? -5.499  11.584  -1.785  1.00 19.80 ? 71  VAL F CB    1 
ATOM   2652 C  CG1   . VAL H 3 48 ? -6.143  10.468  -2.526  1.00 13.41 ? 71  VAL F CG1   1 
ATOM   2653 C  CG2   . VAL H 3 48 ? -6.227  11.784  -0.467  1.00 20.95 ? 71  VAL F CG2   1 
ATOM   2654 N  N     . ARG H 3 49 ? -2.879  11.781  -3.596  1.00 33.11 ? 72  ARG F N     1 
ATOM   2655 C  CA    . ARG H 3 49 ? -2.324  11.488  -4.914  1.00 38.37 ? 72  ARG F CA    1 
ATOM   2656 C  C     . ARG H 3 49 ? -0.931  10.854  -4.958  1.00 40.81 ? 72  ARG F C     1 
ATOM   2657 O  O     . ARG H 3 49 ? -0.548  10.265  -5.968  1.00 42.18 ? 72  ARG F O     1 
ATOM   2658 C  CB    . ARG H 3 49 ? -2.345  12.762  -5.766  1.00 39.93 ? 72  ARG F CB    1 
ATOM   2659 C  CG    . ARG H 3 49 ? -3.749  13.241  -6.093  1.00 40.12 ? 72  ARG F CG    1 
ATOM   2660 C  CD    . ARG H 3 49 ? -4.551  12.087  -6.652  1.00 44.89 ? 72  ARG F CD    1 
ATOM   2661 N  NE    . ARG H 3 49 ? -5.934  12.424  -6.983  1.00 46.32 ? 72  ARG F NE    1 
ATOM   2662 C  CZ    . ARG H 3 49 ? -6.899  11.515  -7.066  1.00 46.66 ? 72  ARG F CZ    1 
ATOM   2663 N  NH1   . ARG H 3 49 ? -8.141  11.870  -7.373  1.00 45.85 ? 72  ARG F NH1   1 
ATOM   2664 N  NH2   . ARG H 3 49 ? -6.614  10.243  -6.826  1.00 47.38 ? 72  ARG F NH2   1 
ATOM   2665 N  N     . LYS H 3 50 ? -0.175  10.966  -3.871  1.00 44.23 ? 73  LYS F N     1 
ATOM   2666 C  CA    . LYS H 3 50 ? 1.166   10.389  -3.826  1.00 46.37 ? 73  LYS F CA    1 
ATOM   2667 C  C     . LYS H 3 50 ? 1.226   8.996   -4.467  1.00 47.90 ? 73  LYS F C     1 
ATOM   2668 O  O     . LYS H 3 50 ? 1.331   8.944   -5.711  1.00 48.56 ? 73  LYS F O     1 
ATOM   2669 C  CB    . LYS H 3 50 ? 1.636   10.304  -2.382  1.00 47.01 ? 73  LYS F CB    1 
ATOM   2670 C  CG    . LYS H 3 50 ? 2.798   11.202  -2.067  1.00 48.71 ? 73  LYS F CG    1 
ATOM   2671 C  CD    . LYS H 3 50 ? 4.040   10.745  -2.794  1.00 49.69 ? 73  LYS F CD    1 
ATOM   2672 C  CE    . LYS H 3 50 ? 5.218   11.599  -2.389  1.00 50.92 ? 73  LYS F CE    1 
ATOM   2673 N  NZ    . LYS H 3 50 ? 5.417   11.545  -0.918  1.00 52.36 ? 73  LYS F NZ    1 
ATOM   2674 N  N     . GLY I 3 1  ? 9.910   16.394  16.716  1.00 51.92 ? 24  GLY G N     1 
ATOM   2675 C  CA    . GLY I 3 1  ? 9.983   17.424  15.649  1.00 51.92 ? 24  GLY G CA    1 
ATOM   2676 C  C     . GLY I 3 1  ? 9.614   16.830  14.308  1.00 51.37 ? 24  GLY G C     1 
ATOM   2677 O  O     . GLY I 3 1  ? 9.346   15.635  14.216  1.00 51.66 ? 24  GLY G O     1 
ATOM   2678 N  N     . SER I 3 2  ? 9.608   17.663  13.270  1.00 51.27 ? 25  SER G N     1 
ATOM   2679 C  CA    . SER I 3 2  ? 9.255   17.225  11.918  1.00 48.87 ? 25  SER G CA    1 
ATOM   2680 C  C     . SER I 3 2  ? 10.524  16.954  11.126  1.00 47.02 ? 25  SER G C     1 
ATOM   2681 O  O     . SER I 3 2  ? 10.482  16.633  9.940   1.00 46.33 ? 25  SER G O     1 
ATOM   2682 C  CB    . SER I 3 2  ? 8.449   18.321  11.206  1.00 49.65 ? 25  SER G CB    1 
ATOM   2683 O  OG    . SER I 3 2  ? 7.470   18.895  12.060  1.00 49.37 ? 25  SER G OG    1 
ATOM   2684 N  N     . HIS I 3 3  ? 11.661  17.090  11.785  1.00 44.94 ? 26  HIS G N     1 
ATOM   2685 C  CA    . HIS I 3 3  ? 12.923  16.891  11.101  1.00 43.25 ? 26  HIS G CA    1 
ATOM   2686 C  C     . HIS I 3 3  ? 13.938  16.168  11.959  1.00 40.39 ? 26  HIS G C     1 
ATOM   2687 O  O     . HIS I 3 3  ? 15.019  16.695  12.202  1.00 39.94 ? 26  HIS G O     1 
ATOM   2688 C  CB    . HIS I 3 3  ? 13.519  18.240  10.687  1.00 43.97 ? 26  HIS G CB    1 
ATOM   2689 C  CG    . HIS I 3 3  ? 12.500  19.249  10.268  1.00 45.18 ? 26  HIS G CG    1 
ATOM   2690 N  ND1   . HIS I 3 3  ? 11.710  19.924  11.173  1.00 46.03 ? 26  HIS G ND1   1 
ATOM   2691 C  CD2   . HIS I 3 3  ? 12.105  19.661  9.043   1.00 45.02 ? 26  HIS G CD2   1 
ATOM   2692 C  CE1   . HIS I 3 3  ? 10.870  20.705  10.521  1.00 45.76 ? 26  HIS G CE1   1 
ATOM   2693 N  NE2   . HIS I 3 3  ? 11.089  20.563  9.228   1.00 45.06 ? 26  HIS G NE2   1 
ATOM   2694 N  N     . MET I 3 4  ? 13.608  14.975  12.429  1.00 38.06 ? 27  MET G N     1 
ATOM   2695 C  CA    . MET I 3 4  ? 14.570  14.262  13.233  1.00 35.19 ? 27  MET G CA    1 
ATOM   2696 C  C     . MET I 3 4  ? 15.501  13.405  12.441  1.00 31.47 ? 27  MET G C     1 
ATOM   2697 O  O     . MET I 3 4  ? 15.377  13.287  11.232  1.00 32.16 ? 27  MET G O     1 
ATOM   2698 C  CB    . MET I 3 4  ? 13.872  13.454  14.289  1.00 37.81 ? 27  MET G CB    1 
ATOM   2699 C  CG    . MET I 3 4  ? 13.594  14.336  15.463  1.00 40.44 ? 27  MET G CG    1 
ATOM   2700 S  SD    . MET I 3 4  ? 11.984  14.058  16.076  1.00 45.55 ? 27  MET G SD    1 
ATOM   2701 C  CE    . MET I 3 4  ? 12.404  13.650  17.829  1.00 40.74 ? 27  MET G CE    1 
ATOM   2702 N  N     . PHE I 3 5  ? 16.466  12.833  13.136  1.00 29.54 ? 28  PHE G N     1 
ATOM   2703 C  CA    . PHE I 3 5  ? 17.468  11.982  12.517  1.00 26.63 ? 28  PHE G CA    1 
ATOM   2704 C  C     . PHE I 3 5  ? 17.118  10.532  12.812  1.00 26.32 ? 28  PHE G C     1 
ATOM   2705 O  O     . PHE I 3 5  ? 16.830  10.181  13.951  1.00 24.53 ? 28  PHE G O     1 
ATOM   2706 C  CB    . PHE I 3 5  ? 18.839  12.362  13.082  1.00 26.98 ? 28  PHE G CB    1 
ATOM   2707 C  CG    . PHE I 3 5  ? 19.274  13.753  12.709  1.00 27.65 ? 28  PHE G CG    1 
ATOM   2708 C  CD1   . PHE I 3 5  ? 19.996  13.981  11.526  1.00 26.60 ? 28  PHE G CD1   1 
ATOM   2709 C  CD2   . PHE I 3 5  ? 18.914  14.837  13.495  1.00 27.88 ? 28  PHE G CD2   1 
ATOM   2710 C  CE1   . PHE I 3 5  ? 20.347  15.271  11.135  1.00 28.31 ? 28  PHE G CE1   1 
ATOM   2711 C  CE2   . PHE I 3 5  ? 19.256  16.143  13.120  1.00 29.61 ? 28  PHE G CE2   1 
ATOM   2712 C  CZ    . PHE I 3 5  ? 19.976  16.361  11.934  1.00 28.91 ? 28  PHE G CZ    1 
ATOM   2713 N  N     . TYR I 3 6  ? 17.096  9.685   11.787  1.00 26.89 ? 29  TYR G N     1 
ATOM   2714 C  CA    . TYR I 3 6  ? 16.766  8.282   12.027  1.00 28.34 ? 29  TYR G CA    1 
ATOM   2715 C  C     . TYR I 3 6  ? 18.025  7.473   12.171  1.00 27.93 ? 29  TYR G C     1 
ATOM   2716 O  O     . TYR I 3 6  ? 18.761  7.281   11.219  1.00 31.96 ? 29  TYR G O     1 
ATOM   2717 C  CB    . TYR I 3 6  ? 15.906  7.723   10.906  1.00 29.51 ? 29  TYR G CB    1 
ATOM   2718 C  CG    . TYR I 3 6  ? 14.563  8.398   10.827  1.00 30.73 ? 29  TYR G CG    1 
ATOM   2719 C  CD1   . TYR I 3 6  ? 14.447  9.687   10.307  1.00 31.04 ? 29  TYR G CD1   1 
ATOM   2720 C  CD2   . TYR I 3 6  ? 13.409  7.766   11.298  1.00 30.09 ? 29  TYR G CD2   1 
ATOM   2721 C  CE1   . TYR I 3 6  ? 13.213  10.326  10.258  1.00 31.41 ? 29  TYR G CE1   1 
ATOM   2722 C  CE2   . TYR I 3 6  ? 12.176  8.400   11.243  1.00 30.62 ? 29  TYR G CE2   1 
ATOM   2723 C  CZ    . TYR I 3 6  ? 12.091  9.681   10.719  1.00 29.60 ? 29  TYR G CZ    1 
ATOM   2724 O  OH    . TYR I 3 6  ? 10.886  10.324  10.629  1.00 28.34 ? 29  TYR G OH    1 
ATOM   2725 N  N     . ALA I 3 7  ? 18.282  7.027   13.391  1.00 28.22 ? 30  ALA G N     1 
ATOM   2726 C  CA    . ALA I 3 7  ? 19.470  6.257   13.685  1.00 27.72 ? 30  ALA G CA    1 
ATOM   2727 C  C     . ALA I 3 7  ? 19.160  4.778   13.610  1.00 26.98 ? 30  ALA G C     1 
ATOM   2728 O  O     . ALA I 3 7  ? 18.284  4.287   14.313  1.00 27.67 ? 30  ALA G O     1 
ATOM   2729 C  CB    . ALA I 3 7  ? 19.984  6.613   15.076  1.00 26.33 ? 30  ALA G CB    1 
ATOM   2730 N  N     . VAL I 3 8  ? 19.872  4.079   12.740  1.00 28.86 ? 31  VAL G N     1 
ATOM   2731 C  CA    . VAL I 3 8  ? 19.696  2.634   12.582  1.00 29.71 ? 31  VAL G CA    1 
ATOM   2732 C  C     . VAL I 3 8  ? 20.891  1.891   13.125  1.00 29.37 ? 31  VAL G C     1 
ATOM   2733 O  O     . VAL I 3 8  ? 21.948  1.874   12.502  1.00 29.36 ? 31  VAL G O     1 
ATOM   2734 C  CB    . VAL I 3 8  ? 19.525  2.213   11.114  1.00 31.61 ? 31  VAL G CB    1 
ATOM   2735 C  CG1   . VAL I 3 8  ? 19.537  0.674   11.019  1.00 32.69 ? 31  VAL G CG1   1 
ATOM   2736 C  CG2   . VAL I 3 8  ? 18.205  2.774   10.559  1.00 30.99 ? 31  VAL G CG2   1 
ATOM   2737 N  N     . ARG I 3 9  ? 20.725  1.286   14.297  1.00 30.45 ? 32  ARG G N     1 
ATOM   2738 C  CA    . ARG I 3 9  ? 21.797  0.511   14.905  1.00 31.93 ? 32  ARG G CA    1 
ATOM   2739 C  C     . ARG I 3 9  ? 21.917  -0.869  14.242  1.00 30.69 ? 32  ARG G C     1 
ATOM   2740 O  O     . ARG I 3 9  ? 23.025  -1.344  13.989  1.00 32.05 ? 32  ARG G O     1 
ATOM   2741 C  CB    . ARG I 3 9  ? 21.565  0.359   16.418  1.00 34.14 ? 32  ARG G CB    1 
ATOM   2742 C  CG    . ARG I 3 9  ? 22.710  -0.321  17.146  1.00 36.15 ? 32  ARG G CG    1 
ATOM   2743 C  CD    . ARG I 3 9  ? 22.731  0.091   18.606  1.00 41.21 ? 32  ARG G CD    1 
ATOM   2744 N  NE    . ARG I 3 9  ? 21.608  -0.446  19.366  1.00 42.56 ? 32  ARG G NE    1 
ATOM   2745 C  CZ    . ARG I 3 9  ? 21.145  0.099   20.483  1.00 43.96 ? 32  ARG G CZ    1 
ATOM   2746 N  NH1   . ARG I 3 9  ? 20.122  -0.455  21.128  1.00 45.26 ? 32  ARG G NH1   1 
ATOM   2747 N  NH2   . ARG I 3 9  ? 21.688  1.218   20.937  1.00 44.53 ? 32  ARG G NH2   1 
ATOM   2748 N  N     . ARG I 3 10 ? 20.797  -1.529  13.975  1.00 29.52 ? 33  ARG G N     1 
ATOM   2749 C  CA    . ARG I 3 10 ? 20.868  -2.841  13.320  1.00 28.80 ? 33  ARG G CA    1 
ATOM   2750 C  C     . ARG I 3 10 ? 19.898  -2.847  12.144  1.00 26.39 ? 33  ARG G C     1 
ATOM   2751 O  O     . ARG I 3 10 ? 18.709  -2.646  12.344  1.00 26.07 ? 33  ARG G O     1 
ATOM   2752 C  CB    . ARG I 3 10 ? 20.505  -3.986  14.295  1.00 29.90 ? 33  ARG G CB    1 
ATOM   2753 C  CG    . ARG I 3 10 ? 21.485  -4.208  15.464  1.00 33.88 ? 33  ARG G CG    1 
ATOM   2754 C  CD    . ARG I 3 10 ? 21.340  -5.608  16.091  1.00 34.01 ? 33  ARG G CD    1 
ATOM   2755 N  NE    . ARG I 3 10 ? 20.130  -5.739  16.903  1.00 35.49 ? 33  ARG G NE    1 
ATOM   2756 C  CZ    . ARG I 3 10 ? 20.021  -5.330  18.164  1.00 37.50 ? 33  ARG G CZ    1 
ATOM   2757 N  NH1   . ARG I 3 10 ? 21.056  -4.767  18.770  1.00 37.91 ? 33  ARG G NH1   1 
ATOM   2758 N  NH2   . ARG I 3 10 ? 18.868  -5.470  18.820  1.00 37.73 ? 33  ARG G NH2   1 
ATOM   2759 N  N     . GLY I 3 11 ? 20.401  -3.072  10.928  1.00 23.71 ? 34  GLY G N     1 
ATOM   2760 C  CA    . GLY I 3 11 ? 19.532  -3.090  9.760   1.00 22.15 ? 34  GLY G CA    1 
ATOM   2761 C  C     . GLY I 3 11 ? 20.338  -3.324  8.494   1.00 23.74 ? 34  GLY G C     1 
ATOM   2762 O  O     . GLY I 3 11 ? 21.557  -3.421  8.568   1.00 24.23 ? 34  GLY G O     1 
ATOM   2763 N  N     . ARG I 3 12 ? 19.695  -3.401  7.328   1.00 25.74 ? 35  ARG G N     1 
ATOM   2764 C  CA    . ARG I 3 12 ? 20.463  -3.659  6.114   1.00 28.21 ? 35  ARG G CA    1 
ATOM   2765 C  C     . ARG I 3 12 ? 21.620  -2.714  6.036   1.00 28.84 ? 35  ARG G C     1 
ATOM   2766 O  O     . ARG I 3 12 ? 22.763  -3.138  5.978   1.00 31.19 ? 35  ARG G O     1 
ATOM   2767 C  CB    . ARG I 3 12 ? 19.587  -3.577  4.873   1.00 28.59 ? 35  ARG G CB    1 
ATOM   2768 C  CG    . ARG I 3 12 ? 18.563  -4.685  4.906   1.00 32.60 ? 35  ARG G CG    1 
ATOM   2769 C  CD    . ARG I 3 12 ? 17.744  -4.787  3.659   1.00 34.18 ? 35  ARG G CD    1 
ATOM   2770 N  NE    . ARG I 3 12 ? 16.601  -5.635  3.946   1.00 37.12 ? 35  ARG G NE    1 
ATOM   2771 C  CZ    . ARG I 3 12 ? 15.513  -5.222  4.582   1.00 37.02 ? 35  ARG G CZ    1 
ATOM   2772 N  NH1   . ARG I 3 12 ? 15.417  -3.971  4.982   1.00 37.83 ? 35  ARG G NH1   1 
ATOM   2773 N  NH2   . ARG I 3 12 ? 14.532  -6.067  4.844   1.00 38.99 ? 35  ARG G NH2   1 
ATOM   2774 N  N     . LYS I 3 13 ? 21.325  -1.425  6.051   1.00 32.44 ? 36  LYS G N     1 
ATOM   2775 C  CA    . LYS I 3 13 ? 22.354  -0.396  6.035   1.00 31.50 ? 36  LYS G CA    1 
ATOM   2776 C  C     . LYS I 3 13 ? 22.156  0.322   7.367   1.00 31.04 ? 36  LYS G C     1 
ATOM   2777 O  O     . LYS I 3 13 ? 21.031  0.660   7.715   1.00 30.89 ? 36  LYS G O     1 
ATOM   2778 C  CB    . LYS I 3 13 ? 22.107  0.580   4.881   1.00 33.22 ? 36  LYS G CB    1 
ATOM   2779 C  CG    . LYS I 3 13 ? 22.356  -0.003  3.490   1.00 37.26 ? 36  LYS G CG    1 
ATOM   2780 C  CD    . LYS I 3 13 ? 23.836  -0.342  3.278   1.00 37.26 ? 36  LYS G CD    1 
ATOM   2781 C  CE    . LYS I 3 13 ? 24.089  -0.949  1.900   1.00 39.68 ? 36  LYS G CE    1 
ATOM   2782 N  NZ    . LYS I 3 13 ? 25.544  -1.240  1.706   1.00 40.00 ? 36  LYS G NZ    1 
ATOM   2783 N  N     . THR I 3 14 ? 23.228  0.535   8.118   1.00 30.17 ? 37  THR G N     1 
ATOM   2784 C  CA    . THR I 3 14 ? 23.126  1.234   9.398   1.00 30.62 ? 37  THR G CA    1 
ATOM   2785 C  C     . THR I 3 14 ? 23.731  2.632   9.256   1.00 30.80 ? 37  THR G C     1 
ATOM   2786 O  O     . THR I 3 14 ? 24.351  2.941   8.238   1.00 31.76 ? 37  THR G O     1 
ATOM   2787 C  CB    . THR I 3 14 ? 23.892  0.500   10.499  1.00 30.96 ? 37  THR G CB    1 
ATOM   2788 O  OG1   . THR I 3 14 ? 25.289  0.510   10.188  1.00 33.77 ? 37  THR G OG1   1 
ATOM   2789 C  CG2   . THR I 3 14 ? 23.431  -0.939  10.605  1.00 33.34 ? 37  THR G CG2   1 
ATOM   2790 N  N     . GLY I 3 15 ? 23.578  3.456   10.291  1.00 30.13 ? 38  GLY G N     1 
ATOM   2791 C  CA    . GLY I 3 15 ? 24.090  4.815   10.268  1.00 28.88 ? 38  GLY G CA    1 
ATOM   2792 C  C     . GLY I 3 15 ? 22.955  5.763   10.606  1.00 30.12 ? 38  GLY G C     1 
ATOM   2793 O  O     . GLY I 3 15 ? 21.989  5.361   11.270  1.00 27.98 ? 38  GLY G O     1 
ATOM   2794 N  N     . VAL I 3 16 ? 23.048  7.016   10.162  1.00 30.60 ? 39  VAL G N     1 
ATOM   2795 C  CA    . VAL I 3 16 ? 21.983  7.973   10.426  1.00 29.62 ? 39  VAL G CA    1 
ATOM   2796 C  C     . VAL I 3 16 ? 21.293  8.419   9.125   1.00 31.05 ? 39  VAL G C     1 
ATOM   2797 O  O     . VAL I 3 16 ? 21.961  8.741   8.136   1.00 29.07 ? 39  VAL G O     1 
ATOM   2798 C  CB    . VAL I 3 16 ? 22.516  9.172   11.174  1.00 30.10 ? 39  VAL G CB    1 
ATOM   2799 C  CG1   . VAL I 3 16 ? 21.357  10.102  11.548  1.00 30.31 ? 39  VAL G CG1   1 
ATOM   2800 C  CG2   . VAL I 3 16 ? 23.249  8.691   12.445  1.00 30.71 ? 39  VAL G CG2   1 
ATOM   2801 N  N     . PHE I 3 17 ? 19.955  8.415   9.132   1.00 30.74 ? 40  PHE G N     1 
ATOM   2802 C  CA    . PHE I 3 17 ? 19.164  8.782   7.960   1.00 31.13 ? 40  PHE G CA    1 
ATOM   2803 C  C     . PHE I 3 17 ? 18.264  9.963   8.254   1.00 31.71 ? 40  PHE G C     1 
ATOM   2804 O  O     . PHE I 3 17 ? 17.881  10.198  9.404   1.00 31.31 ? 40  PHE G O     1 
ATOM   2805 C  CB    . PHE I 3 17 ? 18.325  7.587   7.507   1.00 33.36 ? 40  PHE G CB    1 
ATOM   2806 C  CG    . PHE I 3 17 ? 19.148  6.377   7.187   1.00 35.06 ? 40  PHE G CG    1 
ATOM   2807 C  CD1   . PHE I 3 17 ? 19.726  6.223   5.920   1.00 35.97 ? 40  PHE G CD1   1 
ATOM   2808 C  CD2   . PHE I 3 17 ? 19.423  5.432   8.171   1.00 34.08 ? 40  PHE G CD2   1 
ATOM   2809 C  CE1   . PHE I 3 17 ? 20.573  5.144   5.645   1.00 35.49 ? 40  PHE G CE1   1 
ATOM   2810 C  CE2   . PHE I 3 17 ? 20.267  4.357   7.912   1.00 33.40 ? 40  PHE G CE2   1 
ATOM   2811 C  CZ    . PHE I 3 17 ? 20.846  4.212   6.643   1.00 35.67 ? 40  PHE G CZ    1 
ATOM   2812 N  N     . LEU I 3 18 ? 17.913  10.693  7.201   1.00 30.08 ? 41  LEU G N     1 
ATOM   2813 C  CA    . LEU I 3 18 ? 17.101  11.879  7.344   1.00 29.58 ? 41  LEU G CA    1 
ATOM   2814 C  C     . LEU I 3 18 ? 15.611  11.706  7.097   1.00 28.30 ? 41  LEU G C     1 
ATOM   2815 O  O     . LEU I 3 18 ? 14.844  12.618  7.372   1.00 29.56 ? 41  LEU G O     1 
ATOM   2816 C  CB    . LEU I 3 18 ? 17.663  12.986  6.439   1.00 29.69 ? 41  LEU G CB    1 
ATOM   2817 C  CG    . LEU I 3 18 ? 19.079  13.451  6.811   1.00 31.14 ? 41  LEU G CG    1 
ATOM   2818 C  CD1   . LEU I 3 18 ? 19.588  14.479  5.805   1.00 30.89 ? 41  LEU G CD1   1 
ATOM   2819 C  CD2   . LEU I 3 18 ? 19.071  14.045  8.206   1.00 32.47 ? 41  LEU G CD2   1 
ATOM   2820 N  N     . THR I 3 19 ? 15.194  10.554  6.585   1.00 27.12 ? 42  THR G N     1 
ATOM   2821 C  CA    . THR I 3 19 ? 13.768  10.324  6.326   1.00 27.36 ? 42  THR G CA    1 
ATOM   2822 C  C     . THR I 3 19 ? 13.344  8.959   6.837   1.00 27.88 ? 42  THR G C     1 
ATOM   2823 O  O     . THR I 3 19 ? 14.152  8.030   6.872   1.00 26.49 ? 42  THR G O     1 
ATOM   2824 C  CB    . THR I 3 19 ? 13.434  10.304  4.816   1.00 26.99 ? 42  THR G CB    1 
ATOM   2825 O  OG1   . THR I 3 19 ? 14.168  9.243   4.190   1.00 28.05 ? 42  THR G OG1   1 
ATOM   2826 C  CG2   . THR I 3 19 ? 13.795  11.617  4.157   1.00 25.82 ? 42  THR G CG2   1 
ATOM   2827 N  N     . TRP I 3 20 ? 12.072  8.831   7.209   1.00 27.19 ? 43  TRP G N     1 
ATOM   2828 C  CA    . TRP I 3 20 ? 11.576  7.535   7.647   1.00 27.94 ? 43  TRP G CA    1 
ATOM   2829 C  C     . TRP I 3 20 ? 11.678  6.545   6.482   1.00 28.50 ? 43  TRP G C     1 
ATOM   2830 O  O     . TRP I 3 20 ? 12.112  5.411   6.671   1.00 28.21 ? 43  TRP G O     1 
ATOM   2831 C  CB    . TRP I 3 20 ? 10.125  7.634   8.096   1.00 27.06 ? 43  TRP G CB    1 
ATOM   2832 C  CG    . TRP I 3 20 ? 9.491   6.292   8.308   1.00 28.94 ? 43  TRP G CG    1 
ATOM   2833 C  CD1   . TRP I 3 20 ? 8.296   5.862   7.808   1.00 30.04 ? 43  TRP G CD1   1 
ATOM   2834 C  CD2   . TRP I 3 20 ? 9.987   5.229   9.122   1.00 28.92 ? 43  TRP G CD2   1 
ATOM   2835 N  NE1   . TRP I 3 20 ? 8.015   4.593   8.262   1.00 30.31 ? 43  TRP G NE1   1 
ATOM   2836 C  CE2   . TRP I 3 20 ? 9.037   4.182   9.072   1.00 30.17 ? 43  TRP G CE2   1 
ATOM   2837 C  CE3   . TRP I 3 20 ? 11.141  5.057   9.896   1.00 29.53 ? 43  TRP G CE3   1 
ATOM   2838 C  CZ2   . TRP I 3 20 ? 9.206   2.983   9.768   1.00 32.46 ? 43  TRP G CZ2   1 
ATOM   2839 C  CZ3   . TRP I 3 20 ? 11.311  3.879   10.581  1.00 29.57 ? 43  TRP G CZ3   1 
ATOM   2840 C  CH2   . TRP I 3 20 ? 10.348  2.849   10.517  1.00 32.12 ? 43  TRP G CH2   1 
ATOM   2841 N  N     . ASN I 3 21 ? 11.264  6.973   5.283   1.00 29.80 ? 44  ASN G N     1 
ATOM   2842 C  CA    . ASN I 3 21 ? 11.314  6.131   4.074   1.00 31.43 ? 44  ASN G CA    1 
ATOM   2843 C  C     . ASN I 3 21 ? 12.647  5.410   3.971   1.00 32.87 ? 44  ASN G C     1 
ATOM   2844 O  O     . ASN I 3 21 ? 12.711  4.179   3.857   1.00 32.87 ? 44  ASN G O     1 
ATOM   2845 C  CB    . ASN I 3 21 ? 11.099  6.996   2.823   1.00 35.51 ? 44  ASN G CB    1 
ATOM   2846 C  CG    . ASN I 3 21 ? 11.265  6.216   1.504   1.00 37.63 ? 44  ASN G CG    1 
ATOM   2847 O  OD1   . ASN I 3 21 ? 12.152  6.516   0.692   1.00 39.17 ? 44  ASN G OD1   1 
ATOM   2848 N  ND2   . ASN I 3 21 ? 10.400  5.229   1.284   1.00 39.93 ? 44  ASN G ND2   1 
ATOM   2849 N  N     . GLU I 3 22 ? 13.717  6.192   4.015   1.00 32.86 ? 45  GLU G N     1 
ATOM   2850 C  CA    . GLU I 3 22 ? 15.063  5.663   3.952   1.00 32.35 ? 45  GLU G CA    1 
ATOM   2851 C  C     . GLU I 3 22 ? 15.417  4.778   5.150   1.00 32.84 ? 45  GLU G C     1 
ATOM   2852 O  O     . GLU I 3 22 ? 16.167  3.804   5.007   1.00 32.54 ? 45  GLU G O     1 
ATOM   2853 C  CB    . GLU I 3 22 ? 16.049  6.806   3.894   1.00 34.26 ? 45  GLU G CB    1 
ATOM   2854 C  CG    . GLU I 3 22 ? 17.444  6.330   3.814   1.00 38.50 ? 45  GLU G CG    1 
ATOM   2855 C  CD    . GLU I 3 22 ? 17.665  5.526   2.568   1.00 42.72 ? 45  GLU G CD    1 
ATOM   2856 O  OE1   . GLU I 3 22 ? 18.757  4.943   2.425   1.00 44.34 ? 45  GLU G OE1   1 
ATOM   2857 O  OE2   . GLU I 3 22 ? 16.741  5.488   1.724   1.00 45.39 ? 45  GLU G OE2   1 
ATOM   2858 N  N     . CYS I 3 23 ? 14.912  5.135   6.332   1.00 31.69 ? 46  CYS G N     1 
ATOM   2859 C  CA    . CYS I 3 23 ? 15.185  4.356   7.542   1.00 31.33 ? 46  CYS G CA    1 
ATOM   2860 C  C     . CYS I 3 23 ? 14.421  3.053   7.443   1.00 32.19 ? 46  CYS G C     1 
ATOM   2861 O  O     . CYS I 3 23 ? 14.976  1.989   7.656   1.00 32.76 ? 46  CYS G O     1 
ATOM   2862 C  CB    . CYS I 3 23 ? 14.722  5.101   8.791   1.00 29.87 ? 46  CYS G CB    1 
ATOM   2863 S  SG    . CYS I 3 23 ? 15.036  4.172   10.345  1.00 34.59 ? 46  CYS G SG    1 
ATOM   2864 N  N     . ARG I 3 24 ? 13.137  3.160   7.103   1.00 34.23 ? 47  ARG G N     1 
ATOM   2865 C  CA    . ARG I 3 24 ? 12.265  2.008   6.947   1.00 35.58 ? 47  ARG G CA    1 
ATOM   2866 C  C     . ARG I 3 24 ? 12.883  0.964   6.036   1.00 34.98 ? 47  ARG G C     1 
ATOM   2867 O  O     . ARG I 3 24 ? 12.745  -0.225  6.260   1.00 35.09 ? 47  ARG G O     1 
ATOM   2868 C  CB    . ARG I 3 24 ? 10.917  2.443   6.377   1.00 38.05 ? 47  ARG G CB    1 
ATOM   2869 C  CG    . ARG I 3 24 ? 10.019  1.276   6.036   1.00 41.40 ? 47  ARG G CG    1 
ATOM   2870 C  CD    . ARG I 3 24 ? 8.576   1.692   5.789   1.00 45.43 ? 47  ARG G CD    1 
ATOM   2871 N  NE    . ARG I 3 24 ? 7.732   0.504   5.706   1.00 50.41 ? 47  ARG G NE    1 
ATOM   2872 C  CZ    . ARG I 3 24 ? 6.404   0.510   5.715   1.00 51.65 ? 47  ARG G CZ    1 
ATOM   2873 N  NH1   . ARG I 3 24 ? 5.736   1.656   5.806   1.00 52.52 ? 47  ARG G NH1   1 
ATOM   2874 N  NH2   . ARG I 3 24 ? 5.746   -0.639  5.633   1.00 51.90 ? 47  ARG G NH2   1 
ATOM   2875 N  N     . ALA I 3 25 ? 13.580  1.409   5.004   1.00 35.14 ? 48  ALA G N     1 
ATOM   2876 C  CA    . ALA I 3 25 ? 14.203  0.483   4.076   1.00 34.25 ? 48  ALA G CA    1 
ATOM   2877 C  C     . ALA I 3 25 ? 15.334  -0.317  4.692   1.00 33.79 ? 48  ALA G C     1 
ATOM   2878 O  O     . ALA I 3 25 ? 15.737  -1.348  4.160   1.00 32.75 ? 48  ALA G O     1 
ATOM   2879 C  CB    . ALA I 3 25 ? 14.717  1.228   2.872   1.00 36.44 ? 48  ALA G CB    1 
ATOM   2880 N  N     . GLN I 3 26 ? 15.872  0.137   5.812   1.00 33.63 ? 49  GLN G N     1 
ATOM   2881 C  CA    . GLN I 3 26 ? 16.974  -0.607  6.391   1.00 31.29 ? 49  GLN G CA    1 
ATOM   2882 C  C     . GLN I 3 26 ? 16.532  -1.619  7.437   1.00 30.49 ? 49  GLN G C     1 
ATOM   2883 O  O     . GLN I 3 26 ? 17.166  -2.659  7.589   1.00 27.67 ? 49  GLN G O     1 
ATOM   2884 C  CB    . GLN I 3 26 ? 17.975  0.360   7.003   1.00 33.25 ? 49  GLN G CB    1 
ATOM   2885 C  CG    . GLN I 3 26 ? 18.353  1.468   6.074   1.00 34.70 ? 49  GLN G CG    1 
ATOM   2886 C  CD    . GLN I 3 26 ? 18.557  0.970   4.652   1.00 36.57 ? 49  GLN G CD    1 
ATOM   2887 O  OE1   . GLN I 3 26 ? 19.132  -0.104  4.425   1.00 37.54 ? 49  GLN G OE1   1 
ATOM   2888 N  NE2   . GLN I 3 26 ? 18.089  1.748   3.686   1.00 37.59 ? 49  GLN G NE2   1 
ATOM   2889 N  N     . VAL I 3 27 ? 15.421  -1.316  8.110   1.00 29.75 ? 50  VAL G N     1 
ATOM   2890 C  CA    . VAL I 3 27 ? 14.914  -2.133  9.199   1.00 29.86 ? 50  VAL G CA    1 
ATOM   2891 C  C     . VAL I 3 27 ? 13.683  -3.013  8.951   1.00 33.43 ? 50  VAL G C     1 
ATOM   2892 O  O     . VAL I 3 27 ? 13.595  -4.121  9.487   1.00 33.00 ? 50  VAL G O     1 
ATOM   2893 C  CB    . VAL I 3 27 ? 14.629  -1.242  10.438  1.00 27.32 ? 50  VAL G CB    1 
ATOM   2894 C  CG1   . VAL I 3 27 ? 15.789  -0.304  10.679  1.00 21.25 ? 50  VAL G CG1   1 
ATOM   2895 C  CG2   . VAL I 3 27 ? 13.355  -0.460  10.244  1.00 27.09 ? 50  VAL G CG2   1 
ATOM   2896 N  N     . ASP I 3 28 ? 12.738  -2.547  8.146   1.00 36.25 ? 51  ASP G N     1 
ATOM   2897 C  CA    . ASP I 3 28 ? 11.538  -3.340  7.910   1.00 39.98 ? 51  ASP G CA    1 
ATOM   2898 C  C     . ASP I 3 28 ? 11.836  -4.770  7.449   1.00 40.38 ? 51  ASP G C     1 
ATOM   2899 O  O     . ASP I 3 28 ? 12.666  -5.007  6.560   1.00 40.88 ? 51  ASP G O     1 
ATOM   2900 C  CB    . ASP I 3 28 ? 10.620  -2.639  6.921   1.00 42.47 ? 51  ASP G CB    1 
ATOM   2901 C  CG    . ASP I 3 28 ? 9.276   -3.317  6.813   1.00 45.81 ? 51  ASP G CG    1 
ATOM   2902 O  OD1   . ASP I 3 28 ? 9.188   -4.328  6.071   1.00 47.71 ? 51  ASP G OD1   1 
ATOM   2903 O  OD2   . ASP I 3 28 ? 8.324   -2.852  7.486   1.00 45.06 ? 51  ASP G OD2   1 
ATOM   2904 N  N     . ARG I 3 29 ? 11.158  -5.724  8.085   1.00 40.53 ? 52  ARG G N     1 
ATOM   2905 C  CA    . ARG I 3 29 ? 11.357  -7.144  7.799   1.00 39.83 ? 52  ARG G CA    1 
ATOM   2906 C  C     . ARG I 3 29 ? 12.806  -7.537  8.040   1.00 38.41 ? 52  ARG G C     1 
ATOM   2907 O  O     . ARG I 3 29 ? 13.297  -8.463  7.412   1.00 37.22 ? 52  ARG G O     1 
ATOM   2908 C  CB    . ARG I 3 29 ? 10.979  -7.493  6.353   1.00 39.27 ? 52  ARG G CB    1 
ATOM   2909 C  CG    . ARG I 3 29 ? 9.483   -7.565  6.094   1.00 41.45 ? 52  ARG G CG    1 
ATOM   2910 C  CD    . ARG I 3 29 ? 9.198   -7.658  4.598   1.00 42.40 ? 52  ARG G CD    1 
ATOM   2911 N  NE    . ARG I 3 29 ? 7.775   -7.542  4.318   1.00 43.14 ? 52  ARG G NE    1 
ATOM   2912 C  CZ    . ARG I 3 29 ? 6.896   -8.514  4.527   1.00 43.53 ? 52  ARG G CZ    1 
ATOM   2913 N  NH1   . ARG I 3 29 ? 5.618   -8.322  4.253   1.00 45.80 ? 52  ARG G NH1   1 
ATOM   2914 N  NH2   . ARG I 3 29 ? 7.295   -9.688  4.998   1.00 44.89 ? 52  ARG G NH2   1 
ATOM   2915 N  N     . PHE I 3 30 ? 13.495  -6.824  8.933   1.00 37.61 ? 53  PHE G N     1 
ATOM   2916 C  CA    . PHE I 3 30 ? 14.888  -7.158  9.248   1.00 37.01 ? 53  PHE G CA    1 
ATOM   2917 C  C     . PHE I 3 30 ? 14.917  -7.807  10.636  1.00 37.86 ? 53  PHE G C     1 
ATOM   2918 O  O     . PHE I 3 30 ? 14.252  -7.333  11.570  1.00 38.44 ? 53  PHE G O     1 
ATOM   2919 C  CB    . PHE I 3 30 ? 15.782  -5.914  9.212   1.00 34.95 ? 53  PHE G CB    1 
ATOM   2920 C  CG    . PHE I 3 30 ? 17.255  -6.223  9.339   1.00 34.58 ? 53  PHE G CG    1 
ATOM   2921 C  CD1   . PHE I 3 30 ? 17.889  -6.181  10.574  1.00 33.22 ? 53  PHE G CD1   1 
ATOM   2922 C  CD2   . PHE I 3 30 ? 18.003  -6.585  8.221   1.00 34.60 ? 53  PHE G CD2   1 
ATOM   2923 C  CE1   . PHE I 3 30 ? 19.243  -6.498  10.699  1.00 32.98 ? 53  PHE G CE1   1 
ATOM   2924 C  CE2   . PHE I 3 30 ? 19.353  -6.902  8.334   1.00 33.07 ? 53  PHE G CE2   1 
ATOM   2925 C  CZ    . PHE I 3 30 ? 19.975  -6.858  9.574   1.00 33.09 ? 53  PHE G CZ    1 
ATOM   2926 N  N     . PRO I 3 31 ? 15.681  -8.904  10.793  1.00 36.42 ? 54  PRO G N     1 
ATOM   2927 C  CA    . PRO I 3 31 ? 15.724  -9.562  12.096  1.00 35.30 ? 54  PRO G CA    1 
ATOM   2928 C  C     . PRO I 3 31 ? 16.463  -8.779  13.167  1.00 32.51 ? 54  PRO G C     1 
ATOM   2929 O  O     . PRO I 3 31 ? 17.623  -8.428  13.007  1.00 33.45 ? 54  PRO G O     1 
ATOM   2930 C  CB    . PRO I 3 31 ? 16.375  -10.907 11.771  1.00 35.13 ? 54  PRO G CB    1 
ATOM   2931 C  CG    . PRO I 3 31 ? 17.362  -10.538 10.712  1.00 34.52 ? 54  PRO G CG    1 
ATOM   2932 C  CD    . PRO I 3 31 ? 16.587  -9.568  9.839   1.00 36.13 ? 54  PRO G CD    1 
ATOM   2933 N  N     . ALA I 3 32 ? 15.769  -8.514  14.262  1.00 31.10 ? 55  ALA G N     1 
ATOM   2934 C  CA    . ALA I 3 32 ? 16.328  -7.786  15.400  1.00 30.99 ? 55  ALA G CA    1 
ATOM   2935 C  C     . ALA I 3 32 ? 16.744  -6.347  15.074  1.00 29.99 ? 55  ALA G C     1 
ATOM   2936 O  O     . ALA I 3 32 ? 17.703  -5.816  15.657  1.00 27.64 ? 55  ALA G O     1 
ATOM   2937 C  CB    . ALA I 3 32 ? 17.516  -8.566  16.000  1.00 29.08 ? 55  ALA G CB    1 
ATOM   2938 N  N     . ALA I 3 33 ? 15.998  -5.729  14.158  1.00 28.19 ? 56  ALA G N     1 
ATOM   2939 C  CA    . ALA I 3 33 ? 16.242  -4.355  13.736  1.00 28.90 ? 56  ALA G CA    1 
ATOM   2940 C  C     . ALA I 3 33 ? 16.283  -3.419  14.935  1.00 28.44 ? 56  ALA G C     1 
ATOM   2941 O  O     . ALA I 3 33 ? 15.416  -3.476  15.823  1.00 29.65 ? 56  ALA G O     1 
ATOM   2942 C  CB    . ALA I 3 33 ? 15.139  -3.902  12.767  1.00 26.43 ? 56  ALA G CB    1 
ATOM   2943 N  N     . ARG I 3 34 ? 17.275  -2.541  14.968  1.00 27.22 ? 57  ARG G N     1 
ATOM   2944 C  CA    . ARG I 3 34 ? 17.379  -1.625  16.089  1.00 26.77 ? 57  ARG G CA    1 
ATOM   2945 C  C     . ARG I 3 34 ? 17.517  -0.181  15.596  1.00 24.22 ? 57  ARG G C     1 
ATOM   2946 O  O     . ARG I 3 34 ? 18.530  0.193   15.029  1.00 24.16 ? 57  ARG G O     1 
ATOM   2947 C  CB    . ARG I 3 34 ? 18.561  -2.044  16.963  1.00 26.57 ? 57  ARG G CB    1 
ATOM   2948 C  CG    . ARG I 3 34 ? 18.676  -1.289  18.264  1.00 30.60 ? 57  ARG G CG    1 
ATOM   2949 C  CD    . ARG I 3 34 ? 17.373  -1.296  19.059  1.00 32.34 ? 57  ARG G CD    1 
ATOM   2950 N  NE    . ARG I 3 34 ? 17.590  -0.960  20.473  1.00 35.50 ? 57  ARG G NE    1 
ATOM   2951 C  CZ    . ARG I 3 34 ? 16.791  -0.166  21.182  1.00 38.32 ? 57  ARG G CZ    1 
ATOM   2952 N  NH1   . ARG I 3 34 ? 15.718  0.385   20.601  1.00 38.20 ? 57  ARG G NH1   1 
ATOM   2953 N  NH2   . ARG I 3 34 ? 17.061  0.083   22.466  1.00 35.94 ? 57  ARG G NH2   1 
ATOM   2954 N  N     . PHE I 3 35 ? 16.498  0.634   15.835  1.00 23.30 ? 58  PHE G N     1 
ATOM   2955 C  CA    . PHE I 3 35 ? 16.518  1.998   15.344  1.00 25.01 ? 58  PHE G CA    1 
ATOM   2956 C  C     . PHE I 3 35 ? 15.653  2.930   16.180  1.00 25.12 ? 58  PHE G C     1 
ATOM   2957 O  O     . PHE I 3 35 ? 14.748  2.486   16.866  1.00 26.13 ? 58  PHE G O     1 
ATOM   2958 C  CB    . PHE I 3 35 ? 16.039  1.997   13.885  1.00 24.07 ? 58  PHE G CB    1 
ATOM   2959 C  CG    . PHE I 3 35 ? 14.646  1.475   13.717  1.00 23.09 ? 58  PHE G CG    1 
ATOM   2960 C  CD1   . PHE I 3 35 ? 13.567  2.351   13.638  1.00 21.90 ? 58  PHE G CD1   1 
ATOM   2961 C  CD2   . PHE I 3 35 ? 14.401  0.105   13.732  1.00 21.91 ? 58  PHE G CD2   1 
ATOM   2962 C  CE1   . PHE I 3 35 ? 12.262  1.871   13.584  1.00 21.54 ? 58  PHE G CE1   1 
ATOM   2963 C  CE2   . PHE I 3 35 ? 13.097  -0.380  13.679  1.00 22.54 ? 58  PHE G CE2   1 
ATOM   2964 C  CZ    . PHE I 3 35 ? 12.035  0.502   13.609  1.00 20.01 ? 58  PHE G CZ    1 
ATOM   2965 N  N     . LYS I 3 36 ? 15.926  4.228   16.091  1.00 25.23 ? 59  LYS G N     1 
ATOM   2966 C  CA    . LYS I 3 36 ? 15.193  5.207   16.877  1.00 26.04 ? 59  LYS G CA    1 
ATOM   2967 C  C     . LYS I 3 36 ? 15.502  6.602   16.341  1.00 26.05 ? 59  LYS G C     1 
ATOM   2968 O  O     . LYS I 3 36 ? 16.605  6.848   15.836  1.00 28.68 ? 59  LYS G O     1 
ATOM   2969 C  CB    . LYS I 3 36 ? 15.641  5.091   18.343  1.00 25.89 ? 59  LYS G CB    1 
ATOM   2970 C  CG    . LYS I 3 36 ? 14.988  6.058   19.316  1.00 25.05 ? 59  LYS G CG    1 
ATOM   2971 C  CD    . LYS I 3 36 ? 15.533  5.781   20.713  1.00 28.00 ? 59  LYS G CD    1 
ATOM   2972 C  CE    . LYS I 3 36 ? 14.620  6.299   21.809  1.00 27.67 ? 59  LYS G CE    1 
ATOM   2973 N  NZ    . LYS I 3 36 ? 14.624  7.769   21.841  1.00 30.51 ? 59  LYS G NZ    1 
ATOM   2974 N  N     . LYS I 3 37 ? 14.551  7.521   16.454  1.00 27.32 ? 60  LYS G N     1 
ATOM   2975 C  CA    . LYS I 3 37 ? 14.789  8.870   15.952  1.00 28.44 ? 60  LYS G CA    1 
ATOM   2976 C  C     . LYS I 3 37 ? 15.148  9.866   17.054  1.00 29.41 ? 60  LYS G C     1 
ATOM   2977 O  O     . LYS I 3 37 ? 14.623  9.794   18.170  1.00 28.63 ? 60  LYS G O     1 
ATOM   2978 C  CB    . LYS I 3 37 ? 13.582  9.360   15.141  1.00 29.41 ? 60  LYS G CB    1 
ATOM   2979 C  CG    . LYS I 3 37 ? 12.305  9.519   15.902  1.00 30.94 ? 60  LYS G CG    1 
ATOM   2980 C  CD    . LYS I 3 37 ? 11.230  10.095  14.983  1.00 33.87 ? 60  LYS G CD    1 
ATOM   2981 C  CE    . LYS I 3 37 ? 9.877   10.111  15.669  1.00 35.42 ? 60  LYS G CE    1 
ATOM   2982 N  NZ    . LYS I 3 37 ? 10.068  10.565  17.070  1.00 38.05 ? 60  LYS G NZ    1 
ATOM   2983 N  N     . PHE I 3 38 ? 16.059  10.786  16.730  1.00 28.16 ? 61  PHE G N     1 
ATOM   2984 C  CA    . PHE I 3 38 ? 16.523  11.787  17.694  1.00 27.04 ? 61  PHE G CA    1 
ATOM   2985 C  C     . PHE I 3 38 ? 16.579  13.182  17.104  1.00 26.49 ? 61  PHE G C     1 
ATOM   2986 O  O     . PHE I 3 38 ? 16.718  13.366  15.886  1.00 26.49 ? 61  PHE G O     1 
ATOM   2987 C  CB    . PHE I 3 38 ? 17.931  11.470  18.193  1.00 25.62 ? 61  PHE G CB    1 
ATOM   2988 C  CG    . PHE I 3 38 ? 18.074  10.126  18.797  1.00 26.57 ? 61  PHE G CG    1 
ATOM   2989 C  CD1   . PHE I 3 38 ? 18.235  9.007   17.991  1.00 23.57 ? 61  PHE G CD1   1 
ATOM   2990 C  CD2   . PHE I 3 38 ? 18.048  9.973   20.181  1.00 23.03 ? 61  PHE G CD2   1 
ATOM   2991 C  CE1   . PHE I 3 38 ? 18.365  7.752   18.556  1.00 24.46 ? 61  PHE G CE1   1 
ATOM   2992 C  CE2   . PHE I 3 38 ? 18.175  8.726   20.749  1.00 23.39 ? 61  PHE G CE2   1 
ATOM   2993 C  CZ    . PHE I 3 38 ? 18.332  7.610   19.947  1.00 22.19 ? 61  PHE G CZ    1 
ATOM   2994 N  N     . ALA I 3 39 ? 16.517  14.157  17.995  1.00 26.85 ? 62  ALA G N     1 
ATOM   2995 C  CA    . ALA I 3 39 ? 16.559  15.552  17.614  1.00 30.80 ? 62  ALA G CA    1 
ATOM   2996 C  C     . ALA I 3 39 ? 17.892  15.953  16.969  1.00 32.60 ? 62  ALA G C     1 
ATOM   2997 O  O     . ALA I 3 39 ? 17.896  16.756  16.048  1.00 32.67 ? 62  ALA G O     1 
ATOM   2998 C  CB    . ALA I 3 39 ? 16.264  16.441  18.837  1.00 30.16 ? 62  ALA G CB    1 
ATOM   2999 N  N     . THR I 3 40 ? 19.014  15.397  17.431  1.00 33.18 ? 63  THR G N     1 
ATOM   3000 C  CA    . THR I 3 40 ? 20.305  15.772  16.853  1.00 32.98 ? 63  THR G CA    1 
ATOM   3001 C  C     . THR I 3 40 ? 21.108  14.630  16.283  1.00 32.91 ? 63  THR G C     1 
ATOM   3002 O  O     . THR I 3 40 ? 20.976  13.491  16.697  1.00 32.43 ? 63  THR G O     1 
ATOM   3003 C  CB    . THR I 3 40 ? 21.230  16.498  17.872  1.00 32.09 ? 63  THR G CB    1 
ATOM   3004 O  OG1   . THR I 3 40 ? 21.646  15.587  18.898  1.00 31.78 ? 63  THR G OG1   1 
ATOM   3005 C  CG2   . THR I 3 40 ? 20.524  17.668  18.486  1.00 31.28 ? 63  THR G CG2   1 
ATOM   3006 N  N     . GLU I 3 41 ? 21.962  14.963  15.329  1.00 34.70 ? 64  GLU G N     1 
ATOM   3007 C  CA    . GLU I 3 41 ? 22.809  13.983  14.693  1.00 36.78 ? 64  GLU G CA    1 
ATOM   3008 C  C     . GLU I 3 41 ? 23.694  13.245  15.711  1.00 37.39 ? 64  GLU G C     1 
ATOM   3009 O  O     . GLU I 3 41 ? 23.864  12.022  15.628  1.00 36.76 ? 64  GLU G O     1 
ATOM   3010 C  CB    . GLU I 3 41 ? 23.667  14.670  13.641  1.00 39.60 ? 64  GLU G CB    1 
ATOM   3011 C  CG    . GLU I 3 41 ? 24.366  13.717  12.699  1.00 44.04 ? 64  GLU G CG    1 
ATOM   3012 C  CD    . GLU I 3 41 ? 25.071  14.439  11.568  1.00 48.13 ? 64  GLU G CD    1 
ATOM   3013 O  OE1   . GLU I 3 41 ? 25.701  13.759  10.711  1.00 51.41 ? 64  GLU G OE1   1 
ATOM   3014 O  OE2   . GLU I 3 41 ? 24.992  15.690  11.538  1.00 49.21 ? 64  GLU G OE2   1 
ATOM   3015 N  N     . ASP I 3 42 ? 24.248  13.982  16.672  1.00 37.88 ? 65  ASP G N     1 
ATOM   3016 C  CA    . ASP I 3 42 ? 25.104  13.392  17.713  1.00 37.22 ? 65  ASP G CA    1 
ATOM   3017 C  C     . ASP I 3 42 ? 24.426  12.277  18.484  1.00 35.46 ? 65  ASP G C     1 
ATOM   3018 O  O     . ASP I 3 42 ? 25.019  11.221  18.723  1.00 33.93 ? 65  ASP G O     1 
ATOM   3019 C  CB    . ASP I 3 42 ? 25.546  14.452  18.724  1.00 41.25 ? 65  ASP G CB    1 
ATOM   3020 C  CG    . ASP I 3 42 ? 26.878  15.076  18.376  1.00 44.86 ? 65  ASP G CG    1 
ATOM   3021 O  OD1   . ASP I 3 42 ? 27.253  16.086  19.022  1.00 44.57 ? 65  ASP G OD1   1 
ATOM   3022 O  OD2   . ASP I 3 42 ? 27.552  14.546  17.461  1.00 47.71 ? 65  ASP G OD2   1 
ATOM   3023 N  N     . GLU I 3 43 ? 23.193  12.527  18.907  1.00 33.90 ? 66  GLU G N     1 
ATOM   3024 C  CA    . GLU I 3 43 ? 22.448  11.525  19.658  1.00 33.25 ? 66  GLU G CA    1 
ATOM   3025 C  C     . GLU I 3 43 ? 22.215  10.340  18.762  1.00 31.11 ? 66  GLU G C     1 
ATOM   3026 O  O     . GLU I 3 43 ? 22.310  9.196   19.193  1.00 30.66 ? 66  GLU G O     1 
ATOM   3027 C  CB    . GLU I 3 43 ? 21.085  12.053  20.093  1.00 36.38 ? 66  GLU G CB    1 
ATOM   3028 C  CG    . GLU I 3 43 ? 21.096  13.368  20.809  1.00 42.31 ? 66  GLU G CG    1 
ATOM   3029 C  CD    . GLU I 3 43 ? 19.699  13.948  20.914  1.00 46.19 ? 66  GLU G CD    1 
ATOM   3030 O  OE1   . GLU I 3 43 ? 18.863  13.371  21.649  1.00 48.27 ? 66  GLU G OE1   1 
ATOM   3031 O  OE2   . GLU I 3 43 ? 19.438  14.975  20.246  1.00 48.98 ? 66  GLU G OE2   1 
ATOM   3032 N  N     . ALA I 3 44 ? 21.890  10.625  17.505  1.00 29.71 ? 67  ALA G N     1 
ATOM   3033 C  CA    . ALA I 3 44 ? 21.636  9.574   16.538  1.00 28.73 ? 67  ALA G CA    1 
ATOM   3034 C  C     . ALA I 3 44 ? 22.894  8.710   16.369  1.00 29.35 ? 67  ALA G C     1 
ATOM   3035 O  O     . ALA I 3 44 ? 22.809  7.492   16.351  1.00 29.97 ? 67  ALA G O     1 
ATOM   3036 C  CB    . ALA I 3 44 ? 21.201  10.185  15.190  1.00 26.87 ? 67  ALA G CB    1 
ATOM   3037 N  N     . TRP I 3 45 ? 24.063  9.319   16.237  1.00 28.93 ? 68  TRP G N     1 
ATOM   3038 C  CA    . TRP I 3 45 ? 25.258  8.502   16.088  1.00 29.92 ? 68  TRP G CA    1 
ATOM   3039 C  C     . TRP I 3 45 ? 25.640  7.768   17.370  1.00 31.13 ? 68  TRP G C     1 
ATOM   3040 O  O     . TRP I 3 45 ? 26.219  6.688   17.310  1.00 31.31 ? 68  TRP G O     1 
ATOM   3041 C  CB    . TRP I 3 45 ? 26.435  9.337   15.603  1.00 29.21 ? 68  TRP G CB    1 
ATOM   3042 C  CG    . TRP I 3 45 ? 26.380  9.589   14.148  1.00 25.76 ? 68  TRP G CG    1 
ATOM   3043 C  CD1   . TRP I 3 45 ? 26.081  10.768  13.521  1.00 25.15 ? 68  TRP G CD1   1 
ATOM   3044 C  CD2   . TRP I 3 45 ? 26.584  8.627   13.121  1.00 25.74 ? 68  TRP G CD2   1 
ATOM   3045 N  NE1   . TRP I 3 45 ? 26.083  10.589  12.159  1.00 24.19 ? 68  TRP G NE1   1 
ATOM   3046 C  CE2   . TRP I 3 45 ? 26.393  9.284   11.889  1.00 26.36 ? 68  TRP G CE2   1 
ATOM   3047 C  CE3   . TRP I 3 45 ? 26.908  7.271   13.121  1.00 27.15 ? 68  TRP G CE3   1 
ATOM   3048 C  CZ2   . TRP I 3 45 ? 26.521  8.626   10.671  1.00 25.86 ? 68  TRP G CZ2   1 
ATOM   3049 C  CZ3   . TRP I 3 45 ? 27.030  6.618   11.912  1.00 28.46 ? 68  TRP G CZ3   1 
ATOM   3050 C  CH2   . TRP I 3 45 ? 26.839  7.297   10.703  1.00 26.27 ? 68  TRP G CH2   1 
ATOM   3051 N  N     . ALA I 3 46 ? 25.312  8.327   18.530  1.00 32.02 ? 69  ALA G N     1 
ATOM   3052 C  CA    . ALA I 3 46 ? 25.646  7.640   19.776  1.00 34.11 ? 69  ALA G CA    1 
ATOM   3053 C  C     . ALA I 3 46 ? 24.829  6.352   19.878  1.00 35.19 ? 69  ALA G C     1 
ATOM   3054 O  O     . ALA I 3 46 ? 25.324  5.317   20.336  1.00 37.47 ? 69  ALA G O     1 
ATOM   3055 C  CB    . ALA I 3 46 ? 25.366  8.531   20.976  1.00 33.04 ? 69  ALA G CB    1 
ATOM   3056 N  N     . PHE I 3 47 ? 23.574  6.414   19.447  1.00 35.34 ? 70  PHE G N     1 
ATOM   3057 C  CA    . PHE I 3 47 ? 22.707  5.251   19.493  1.00 34.64 ? 70  PHE G CA    1 
ATOM   3058 C  C     . PHE I 3 47 ? 23.215  4.177   18.507  1.00 36.21 ? 70  PHE G C     1 
ATOM   3059 O  O     . PHE I 3 47 ? 23.175  2.980   18.797  1.00 36.01 ? 70  PHE G O     1 
ATOM   3060 C  CB    . PHE I 3 47 ? 21.281  5.696   19.158  1.00 34.31 ? 70  PHE G CB    1 
ATOM   3061 C  CG    . PHE I 3 47 ? 20.288  4.579   19.102  1.00 32.60 ? 70  PHE G CG    1 
ATOM   3062 C  CD1   . PHE I 3 47 ? 19.661  4.135   20.244  1.00 31.77 ? 70  PHE G CD1   1 
ATOM   3063 C  CD2   . PHE I 3 47 ? 19.961  3.981   17.888  1.00 32.99 ? 70  PHE G CD2   1 
ATOM   3064 C  CE1   . PHE I 3 47 ? 18.714  3.110   20.182  1.00 31.10 ? 70  PHE G CE1   1 
ATOM   3065 C  CE2   . PHE I 3 47 ? 19.017  2.961   17.824  1.00 30.51 ? 70  PHE G CE2   1 
ATOM   3066 C  CZ    . PHE I 3 47 ? 18.397  2.531   18.976  1.00 29.62 ? 70  PHE G CZ    1 
ATOM   3067 N  N     . VAL I 3 48 ? 23.717  4.612   17.353  1.00 36.49 ? 71  VAL G N     1 
ATOM   3068 C  CA    . VAL I 3 48 ? 24.218  3.687   16.341  1.00 37.20 ? 71  VAL G CA    1 
ATOM   3069 C  C     . VAL I 3 48 ? 25.391  2.868   16.857  1.00 40.38 ? 71  VAL G C     1 
ATOM   3070 O  O     . VAL I 3 48 ? 25.580  1.730   16.447  1.00 41.16 ? 71  VAL G O     1 
ATOM   3071 C  CB    . VAL I 3 48 ? 24.677  4.440   15.051  1.00 35.11 ? 71  VAL G CB    1 
ATOM   3072 C  CG1   . VAL I 3 48 ? 25.442  3.498   14.128  1.00 32.47 ? 71  VAL G CG1   1 
ATOM   3073 C  CG2   . VAL I 3 48 ? 23.464  5.018   14.312  1.00 33.54 ? 71  VAL G CG2   1 
ATOM   3074 N  N     . ARG I 3 49 ? 26.165  3.436   17.769  1.00 43.43 ? 72  ARG G N     1 
ATOM   3075 C  CA    . ARG I 3 49 ? 27.340  2.746   18.279  1.00 48.08 ? 72  ARG G CA    1 
ATOM   3076 C  C     . ARG I 3 49 ? 27.262  2.241   19.720  1.00 50.21 ? 72  ARG G C     1 
ATOM   3077 O  O     . ARG I 3 49 ? 28.229  2.337   20.463  1.00 51.69 ? 72  ARG G O     1 
ATOM   3078 C  CB    . ARG I 3 49 ? 28.558  3.660   18.112  1.00 48.56 ? 72  ARG G CB    1 
ATOM   3079 C  CG    . ARG I 3 49 ? 28.830  4.089   16.665  1.00 50.69 ? 72  ARG G CG    1 
ATOM   3080 C  CD    . ARG I 3 49 ? 29.840  5.224   16.618  1.00 52.20 ? 72  ARG G CD    1 
ATOM   3081 N  NE    . ARG I 3 49 ? 29.468  6.269   17.570  1.00 54.93 ? 72  ARG G NE    1 
ATOM   3082 C  CZ    . ARG I 3 49 ? 30.037  7.469   17.666  1.00 55.66 ? 72  ARG G CZ    1 
ATOM   3083 N  NH1   . ARG I 3 49 ? 31.037  7.816   16.860  1.00 57.29 ? 72  ARG G NH1   1 
ATOM   3084 N  NH2   . ARG I 3 49 ? 29.595  8.332   18.574  1.00 55.21 ? 72  ARG G NH2   1 
ATOM   3085 N  N     . LYS I 3 50 ? 26.116  1.713   20.129  1.00 52.71 ? 73  LYS G N     1 
ATOM   3086 C  CA    . LYS I 3 50 ? 25.994  1.186   21.483  1.00 54.64 ? 73  LYS G CA    1 
ATOM   3087 C  C     . LYS I 3 50 ? 25.954  -0.332  21.426  1.00 55.72 ? 73  LYS G C     1 
ATOM   3088 O  O     . LYS I 3 50 ? 26.150  -0.968  22.493  1.00 57.59 ? 73  LYS G O     1 
ATOM   3089 C  CB    . LYS I 3 50 ? 24.732  1.702   22.175  1.00 56.10 ? 73  LYS G CB    1 
ATOM   3090 C  CG    . LYS I 3 50 ? 24.877  3.060   22.834  1.00 57.46 ? 73  LYS G CG    1 
ATOM   3091 C  CD    . LYS I 3 50 ? 23.655  3.361   23.708  1.00 58.89 ? 73  LYS G CD    1 
ATOM   3092 C  CE    . LYS I 3 50 ? 23.712  4.764   24.300  1.00 59.21 ? 73  LYS G CE    1 
ATOM   3093 N  NZ    . LYS I 3 50 ? 23.817  5.816   23.242  1.00 59.70 ? 73  LYS G NZ    1 
ATOM   3094 N  N     . HIS J 3 3  ? -11.677 28.865  34.575  1.00 56.08 ? 26  HIS H N     1 
ATOM   3095 C  CA    . HIS J 3 3  ? -11.902 27.530  35.209  1.00 56.07 ? 26  HIS H CA    1 
ATOM   3096 C  C     . HIS J 3 3  ? -12.584 26.588  34.219  1.00 55.18 ? 26  HIS H C     1 
ATOM   3097 O  O     . HIS J 3 3  ? -13.547 26.965  33.544  1.00 56.25 ? 26  HIS H O     1 
ATOM   3098 C  CB    . HIS J 3 3  ? -12.756 27.681  36.470  1.00 55.26 ? 26  HIS H CB    1 
ATOM   3099 N  N     . MET J 3 4  ? -12.086 25.363  34.122  1.00 53.36 ? 27  MET H N     1 
ATOM   3100 C  CA    . MET J 3 4  ? -12.686 24.431  33.192  1.00 51.01 ? 27  MET H CA    1 
ATOM   3101 C  C     . MET J 3 4  ? -13.037 23.061  33.746  1.00 48.31 ? 27  MET H C     1 
ATOM   3102 O  O     . MET J 3 4  ? -12.580 22.657  34.820  1.00 47.96 ? 27  MET H O     1 
ATOM   3103 C  CB    . MET J 3 4  ? -11.838 24.355  31.926  1.00 52.00 ? 27  MET H CB    1 
ATOM   3104 C  CG    . MET J 3 4  ? -12.022 25.628  31.103  1.00 52.77 ? 27  MET H CG    1 
ATOM   3105 S  SD    . MET J 3 4  ? -11.090 25.694  29.572  1.00 57.52 ? 27  MET H SD    1 
ATOM   3106 C  CE    . MET J 3 4  ? -12.219 24.882  28.395  1.00 54.69 ? 27  MET H CE    1 
ATOM   3107 N  N     . PHE J 3 5  ? -13.887 22.366  33.004  1.00 45.57 ? 28  PHE H N     1 
ATOM   3108 C  CA    . PHE J 3 5  ? -14.400 21.081  33.431  1.00 42.02 ? 28  PHE H CA    1 
ATOM   3109 C  C     . PHE J 3 5  ? -13.925 19.935  32.571  1.00 39.15 ? 28  PHE H C     1 
ATOM   3110 O  O     . PHE J 3 5  ? -14.185 19.889  31.370  1.00 36.62 ? 28  PHE H O     1 
ATOM   3111 C  CB    . PHE J 3 5  ? -15.926 21.159  33.446  1.00 43.50 ? 28  PHE H CB    1 
ATOM   3112 C  CG    . PHE J 3 5  ? -16.458 22.386  34.141  1.00 44.34 ? 28  PHE H CG    1 
ATOM   3113 C  CD1   . PHE J 3 5  ? -16.817 22.342  35.489  1.00 45.02 ? 28  PHE H CD1   1 
ATOM   3114 C  CD2   . PHE J 3 5  ? -16.572 23.597  33.455  1.00 44.73 ? 28  PHE H CD2   1 
ATOM   3115 C  CE1   . PHE J 3 5  ? -17.284 23.490  36.152  1.00 43.59 ? 28  PHE H CE1   1 
ATOM   3116 C  CE2   . PHE J 3 5  ? -17.038 24.754  34.105  1.00 45.15 ? 28  PHE H CE2   1 
ATOM   3117 C  CZ    . PHE J 3 5  ? -17.394 24.694  35.460  1.00 45.11 ? 28  PHE H CZ    1 
ATOM   3118 N  N     . TYR J 3 6  ? -13.244 18.997  33.216  1.00 37.22 ? 29  TYR H N     1 
ATOM   3119 C  CA    . TYR J 3 6  ? -12.693 17.830  32.541  1.00 37.58 ? 29  TYR H CA    1 
ATOM   3120 C  C     . TYR J 3 6  ? -13.645 16.642  32.526  1.00 36.91 ? 29  TYR H C     1 
ATOM   3121 O  O     . TYR J 3 6  ? -13.825 15.965  33.533  1.00 37.10 ? 29  TYR H O     1 
ATOM   3122 C  CB    . TYR J 3 6  ? -11.370 17.425  33.197  1.00 35.17 ? 29  TYR H CB    1 
ATOM   3123 C  CG    . TYR J 3 6  ? -10.358 18.541  33.213  1.00 37.28 ? 29  TYR H CG    1 
ATOM   3124 C  CD1   . TYR J 3 6  ? -10.542 19.671  34.022  1.00 35.55 ? 29  TYR H CD1   1 
ATOM   3125 C  CD2   . TYR J 3 6  ? -9.236  18.496  32.385  1.00 36.13 ? 29  TYR H CD2   1 
ATOM   3126 C  CE1   . TYR J 3 6  ? -9.640  20.719  34.003  1.00 37.26 ? 29  TYR H CE1   1 
ATOM   3127 C  CE2   . TYR J 3 6  ? -8.333  19.543  32.356  1.00 37.18 ? 29  TYR H CE2   1 
ATOM   3128 C  CZ    . TYR J 3 6  ? -8.535  20.652  33.165  1.00 37.00 ? 29  TYR H CZ    1 
ATOM   3129 O  OH    . TYR J 3 6  ? -7.631  21.685  33.120  1.00 37.09 ? 29  TYR H OH    1 
ATOM   3130 N  N     . ALA J 3 7  ? -14.254 16.400  31.373  1.00 36.88 ? 30  ALA H N     1 
ATOM   3131 C  CA    . ALA J 3 7  ? -15.180 15.299  31.228  1.00 37.04 ? 30  ALA H CA    1 
ATOM   3132 C  C     . ALA J 3 7  ? -14.424 14.053  30.812  1.00 37.31 ? 30  ALA H C     1 
ATOM   3133 O  O     . ALA J 3 7  ? -13.646 14.098  29.862  1.00 36.46 ? 30  ALA H O     1 
ATOM   3134 C  CB    . ALA J 3 7  ? -16.209 15.643  30.181  1.00 38.08 ? 30  ALA H CB    1 
ATOM   3135 N  N     . VAL J 3 8  ? -14.631 12.945  31.521  1.00 37.85 ? 31  VAL H N     1 
ATOM   3136 C  CA    . VAL J 3 8  ? -13.971 11.688  31.146  1.00 38.47 ? 31  VAL H CA    1 
ATOM   3137 C  C     . VAL J 3 8  ? -15.015 10.624  30.790  1.00 38.75 ? 31  VAL H C     1 
ATOM   3138 O  O     . VAL J 3 8  ? -15.782 10.175  31.643  1.00 40.03 ? 31  VAL H O     1 
ATOM   3139 C  CB    . VAL J 3 8  ? -13.002 11.180  32.271  1.00 38.69 ? 31  VAL H CB    1 
ATOM   3140 C  CG1   . VAL J 3 8  ? -13.062 12.109  33.440  1.00 38.20 ? 31  VAL H CG1   1 
ATOM   3141 C  CG2   . VAL J 3 8  ? -13.314 9.725   32.678  1.00 39.42 ? 31  VAL H CG2   1 
ATOM   3142 N  N     . ARG J 3 9  ? -15.056 10.239  29.518  1.00 37.24 ? 32  ARG H N     1 
ATOM   3143 C  CA    . ARG J 3 9  ? -16.009 9.243   29.074  1.00 36.98 ? 32  ARG H CA    1 
ATOM   3144 C  C     . ARG J 3 9  ? -15.585 7.828   29.441  1.00 37.30 ? 32  ARG H C     1 
ATOM   3145 O  O     . ARG J 3 9  ? -16.423 6.972   29.712  1.00 37.20 ? 32  ARG H O     1 
ATOM   3146 C  CB    . ARG J 3 9  ? -16.218 9.348   27.575  1.00 37.32 ? 32  ARG H CB    1 
ATOM   3147 C  CG    . ARG J 3 9  ? -17.288 8.420   27.075  1.00 38.60 ? 32  ARG H CG    1 
ATOM   3148 C  CD    . ARG J 3 9  ? -18.088 9.082   25.968  1.00 40.65 ? 32  ARG H CD    1 
ATOM   3149 N  NE    . ARG J 3 9  ? -17.442 9.022   24.660  1.00 41.53 ? 32  ARG H NE    1 
ATOM   3150 C  CZ    . ARG J 3 9  ? -17.359 10.049  23.815  1.00 41.72 ? 32  ARG H CZ    1 
ATOM   3151 N  NH1   . ARG J 3 9  ? -17.861 11.235  24.130  1.00 40.64 ? 32  ARG H NH1   1 
ATOM   3152 N  NH2   . ARG J 3 9  ? -16.805 9.874   22.624  1.00 44.10 ? 32  ARG H NH2   1 
ATOM   3153 N  N     . ARG J 3 10 ? -14.282 7.577   29.428  1.00 37.26 ? 33  ARG H N     1 
ATOM   3154 C  CA    . ARG J 3 10 ? -13.736 6.273   29.806  1.00 37.57 ? 33  ARG H CA    1 
ATOM   3155 C  C     . ARG J 3 10 ? -12.421 6.446   30.569  1.00 35.58 ? 33  ARG H C     1 
ATOM   3156 O  O     . ARG J 3 10 ? -11.486 7.081   30.087  1.00 35.31 ? 33  ARG H O     1 
ATOM   3157 C  CB    . ARG J 3 10 ? -13.514 5.393   28.574  1.00 39.62 ? 33  ARG H CB    1 
ATOM   3158 C  CG    . ARG J 3 10 ? -14.802 4.798   28.016  1.00 46.01 ? 33  ARG H CG    1 
ATOM   3159 C  CD    . ARG J 3 10 ? -15.056 5.300   26.610  1.00 47.92 ? 33  ARG H CD    1 
ATOM   3160 N  NE    . ARG J 3 10 ? -13.923 4.965   25.750  1.00 52.28 ? 33  ARG H NE    1 
ATOM   3161 C  CZ    . ARG J 3 10 ? -13.767 5.407   24.508  1.00 52.39 ? 33  ARG H CZ    1 
ATOM   3162 N  NH1   . ARG J 3 10 ? -12.695 5.043   23.814  1.00 53.64 ? 33  ARG H NH1   1 
ATOM   3163 N  NH2   . ARG J 3 10 ? -14.675 6.213   23.968  1.00 52.41 ? 33  ARG H NH2   1 
ATOM   3164 N  N     . GLY J 3 11 ? -12.360 5.877   31.760  1.00 33.34 ? 34  GLY H N     1 
ATOM   3165 C  CA    . GLY J 3 11 ? -11.170 5.991   32.564  1.00 32.82 ? 34  GLY H CA    1 
ATOM   3166 C  C     . GLY J 3 11 ? -11.522 5.272   33.841  1.00 35.39 ? 34  GLY H C     1 
ATOM   3167 O  O     . GLY J 3 11 ? -12.614 4.722   33.948  1.00 34.26 ? 34  GLY H O     1 
ATOM   3168 N  N     . ARG J 3 12 ? -10.620 5.278   34.814  1.00 36.26 ? 35  ARG H N     1 
ATOM   3169 C  CA    . ARG J 3 12 ? -10.837 4.580   36.071  1.00 36.35 ? 35  ARG H CA    1 
ATOM   3170 C  C     . ARG J 3 12 ? -12.152 4.990   36.706  1.00 38.36 ? 35  ARG H C     1 
ATOM   3171 O  O     . ARG J 3 12 ? -12.877 4.152   37.241  1.00 36.25 ? 35  ARG H O     1 
ATOM   3172 C  CB    . ARG J 3 12 ? -9.654  4.836   37.001  1.00 36.97 ? 35  ARG H CB    1 
ATOM   3173 C  CG    . ARG J 3 12 ? -8.334  4.425   36.349  1.00 36.32 ? 35  ARG H CG    1 
ATOM   3174 C  CD    . ARG J 3 12 ? -7.191  4.360   37.336  1.00 35.48 ? 35  ARG H CD    1 
ATOM   3175 N  NE    . ARG J 3 12 ? -6.030  3.746   36.714  1.00 34.71 ? 35  ARG H NE    1 
ATOM   3176 C  CZ    . ARG J 3 12 ? -5.343  4.293   35.717  1.00 34.45 ? 35  ARG H CZ    1 
ATOM   3177 N  NH1   . ARG J 3 12 ? -5.701  5.482   35.246  1.00 33.30 ? 35  ARG H NH1   1 
ATOM   3178 N  NH2   . ARG J 3 12 ? -4.335  3.625   35.163  1.00 31.13 ? 35  ARG H NH2   1 
ATOM   3179 N  N     . LYS J 3 13 ? -12.452 6.284   36.631  1.00 40.48 ? 36  LYS H N     1 
ATOM   3180 C  CA    . LYS J 3 13 ? -13.700 6.837   37.141  1.00 43.01 ? 36  LYS H CA    1 
ATOM   3181 C  C     . LYS J 3 13 ? -14.169 7.941   36.212  1.00 43.60 ? 36  LYS H C     1 
ATOM   3182 O  O     . LYS J 3 13 ? -13.442 8.902   35.972  1.00 44.57 ? 36  LYS H O     1 
ATOM   3183 C  CB    . LYS J 3 13 ? -13.526 7.393   38.556  1.00 43.62 ? 36  LYS H CB    1 
ATOM   3184 C  CG    . LYS J 3 13 ? -13.989 6.418   39.627  1.00 47.82 ? 36  LYS H CG    1 
ATOM   3185 C  CD    . LYS J 3 13 ? -12.877 6.018   40.595  1.00 49.57 ? 36  LYS H CD    1 
ATOM   3186 C  CE    . LYS J 3 13 ? -12.595 7.117   41.618  1.00 50.96 ? 36  LYS H CE    1 
ATOM   3187 N  NZ    . LYS J 3 13 ? -11.708 6.632   42.721  1.00 50.43 ? 36  LYS H NZ    1 
ATOM   3188 N  N     . THR J 3 14 ? -15.381 7.803   35.682  1.00 44.07 ? 37  THR H N     1 
ATOM   3189 C  CA    . THR J 3 14 ? -15.918 8.820   34.788  1.00 44.35 ? 37  THR H CA    1 
ATOM   3190 C  C     . THR J 3 14 ? -16.688 9.936   35.509  1.00 44.27 ? 37  THR H C     1 
ATOM   3191 O  O     . THR J 3 14 ? -16.865 9.907   36.742  1.00 42.64 ? 37  THR H O     1 
ATOM   3192 C  CB    . THR J 3 14 ? -16.821 8.193   33.714  1.00 45.57 ? 37  THR H CB    1 
ATOM   3193 O  OG1   . THR J 3 14 ? -17.906 7.494   34.336  1.00 46.85 ? 37  THR H OG1   1 
ATOM   3194 C  CG2   . THR J 3 14 ? -16.011 7.228   32.860  1.00 45.89 ? 37  THR H CG2   1 
ATOM   3195 N  N     . GLY J 3 15 ? -17.150 10.908  34.717  1.00 42.83 ? 38  GLY H N     1 
ATOM   3196 C  CA    . GLY J 3 15 ? -17.864 12.064  35.236  1.00 41.13 ? 38  GLY H CA    1 
ATOM   3197 C  C     . GLY J 3 15 ? -17.013 13.300  34.989  1.00 39.42 ? 38  GLY H C     1 
ATOM   3198 O  O     . GLY J 3 15 ? -16.017 13.209  34.278  1.00 40.63 ? 38  GLY H O     1 
ATOM   3199 N  N     . VAL J 3 16 ? -17.384 14.444  35.564  1.00 38.75 ? 39  VAL H N     1 
ATOM   3200 C  CA    . VAL J 3 16 ? -16.638 15.698  35.381  1.00 38.03 ? 39  VAL H CA    1 
ATOM   3201 C  C     . VAL J 3 16 ? -15.789 16.065  36.601  1.00 38.22 ? 39  VAL H C     1 
ATOM   3202 O  O     . VAL J 3 16 ? -16.257 16.044  37.745  1.00 39.67 ? 39  VAL H O     1 
ATOM   3203 C  CB    . VAL J 3 16 ? -17.593 16.876  35.060  1.00 37.14 ? 39  VAL H CB    1 
ATOM   3204 C  CG1   . VAL J 3 16 ? -16.825 18.190  34.979  1.00 35.40 ? 39  VAL H CG1   1 
ATOM   3205 C  CG2   . VAL J 3 16 ? -18.314 16.597  33.738  1.00 39.04 ? 39  VAL H CG2   1 
ATOM   3206 N  N     . PHE J 3 17 ? -14.542 16.427  36.333  1.00 37.34 ? 40  PHE H N     1 
ATOM   3207 C  CA    . PHE J 3 17 ? -13.586 16.771  37.365  1.00 35.85 ? 40  PHE H CA    1 
ATOM   3208 C  C     . PHE J 3 17 ? -13.147 18.204  37.166  1.00 35.73 ? 40  PHE H C     1 
ATOM   3209 O  O     . PHE J 3 17 ? -13.098 18.697  36.037  1.00 36.16 ? 40  PHE H O     1 
ATOM   3210 C  CB    . PHE J 3 17 ? -12.394 15.825  37.273  1.00 35.92 ? 40  PHE H CB    1 
ATOM   3211 C  CG    . PHE J 3 17 ? -12.748 14.374  37.455  1.00 35.49 ? 40  PHE H CG    1 
ATOM   3212 C  CD1   . PHE J 3 17 ? -12.731 13.789  38.730  1.00 34.67 ? 40  PHE H CD1   1 
ATOM   3213 C  CD2   . PHE J 3 17 ? -13.058 13.572  36.352  1.00 34.18 ? 40  PHE H CD2   1 
ATOM   3214 C  CE1   . PHE J 3 17 ? -13.008 12.432  38.896  1.00 34.45 ? 40  PHE H CE1   1 
ATOM   3215 C  CE2   . PHE J 3 17 ? -13.340 12.211  36.511  1.00 34.48 ? 40  PHE H CE2   1 
ATOM   3216 C  CZ    . PHE J 3 17 ? -13.313 11.638  37.784  1.00 35.50 ? 40  PHE H CZ    1 
ATOM   3217 N  N     . LEU J 3 18 ? -12.808 18.867  38.264  1.00 35.09 ? 41  LEU H N     1 
ATOM   3218 C  CA    . LEU J 3 18 ? -12.440 20.281  38.227  1.00 34.00 ? 41  LEU H CA    1 
ATOM   3219 C  C     . LEU J 3 18 ? -10.961 20.605  38.002  1.00 32.93 ? 41  LEU H C     1 
ATOM   3220 O  O     . LEU J 3 18 ? -10.601 21.776  37.837  1.00 31.75 ? 41  LEU H O     1 
ATOM   3221 C  CB    . LEU J 3 18 ? -12.941 20.958  39.515  1.00 34.20 ? 41  LEU H CB    1 
ATOM   3222 C  CG    . LEU J 3 18 ? -14.420 20.668  39.829  1.00 36.18 ? 41  LEU H CG    1 
ATOM   3223 C  CD1   . LEU J 3 18 ? -14.831 21.337  41.145  1.00 37.07 ? 41  LEU H CD1   1 
ATOM   3224 C  CD2   . LEU J 3 18 ? -15.295 21.163  38.686  1.00 35.48 ? 41  LEU H CD2   1 
ATOM   3225 N  N     . THR J 3 19 ? -10.107 19.583  38.011  1.00 31.99 ? 42  THR H N     1 
ATOM   3226 C  CA    . THR J 3 19 ? -8.678  19.800  37.782  1.00 33.31 ? 42  THR H CA    1 
ATOM   3227 C  C     . THR J 3 19 ? -8.052  18.728  36.891  1.00 31.78 ? 42  THR H C     1 
ATOM   3228 O  O     . THR J 3 19 ? -8.559  17.617  36.766  1.00 30.86 ? 42  THR H O     1 
ATOM   3229 C  CB    . THR J 3 19 ? -7.845  19.843  39.111  1.00 32.86 ? 42  THR H CB    1 
ATOM   3230 O  OG1   . THR J 3 19 ? -7.828  18.541  39.698  1.00 32.89 ? 42  THR H OG1   1 
ATOM   3231 C  CG2   . THR J 3 19 ? -8.428  20.863  40.104  1.00 35.05 ? 42  THR H CG2   1 
ATOM   3232 N  N     . TRP J 3 20 ? -6.933  19.080  36.279  1.00 32.23 ? 43  TRP H N     1 
ATOM   3233 C  CA    . TRP J 3 20 ? -6.232  18.166  35.409  1.00 34.60 ? 43  TRP H CA    1 
ATOM   3234 C  C     . TRP J 3 20 ? -5.770  16.940  36.206  1.00 35.38 ? 43  TRP H C     1 
ATOM   3235 O  O     . TRP J 3 20 ? -5.891  15.808  35.723  1.00 34.86 ? 43  TRP H O     1 
ATOM   3236 C  CB    . TRP J 3 20 ? -5.038  18.891  34.780  1.00 38.04 ? 43  TRP H CB    1 
ATOM   3237 C  CG    . TRP J 3 20 ? -4.149  18.012  33.946  1.00 40.76 ? 43  TRP H CG    1 
ATOM   3238 C  CD1   . TRP J 3 20 ? -2.785  18.003  33.949  1.00 40.79 ? 43  TRP H CD1   1 
ATOM   3239 C  CD2   . TRP J 3 20 ? -4.556  17.002  33.005  1.00 42.50 ? 43  TRP H CD2   1 
ATOM   3240 N  NE1   . TRP J 3 20 ? -2.318  17.050  33.078  1.00 42.78 ? 43  TRP H NE1   1 
ATOM   3241 C  CE2   . TRP J 3 20 ? -3.381  16.421  32.486  1.00 43.22 ? 43  TRP H CE2   1 
ATOM   3242 C  CE3   . TRP J 3 20 ? -5.799  16.533  32.553  1.00 43.65 ? 43  TRP H CE3   1 
ATOM   3243 C  CZ2   . TRP J 3 20 ? -3.407  15.392  31.537  1.00 43.92 ? 43  TRP H CZ2   1 
ATOM   3244 C  CZ3   . TRP J 3 20 ? -5.825  15.502  31.601  1.00 43.16 ? 43  TRP H CZ3   1 
ATOM   3245 C  CH2   . TRP J 3 20 ? -4.637  14.949  31.110  1.00 44.06 ? 43  TRP H CH2   1 
ATOM   3246 N  N     . ASN J 3 21 ? -5.284  17.169  37.433  1.00 34.51 ? 44  ASN H N     1 
ATOM   3247 C  CA    . ASN J 3 21 ? -4.788  16.102  38.312  1.00 34.81 ? 44  ASN H CA    1 
ATOM   3248 C  C     . ASN J 3 21 ? -5.790  14.973  38.527  1.00 35.04 ? 44  ASN H C     1 
ATOM   3249 O  O     . ASN J 3 21 ? -5.440  13.789  38.431  1.00 34.99 ? 44  ASN H O     1 
ATOM   3250 C  CB    . ASN J 3 21 ? -4.424  16.665  39.697  1.00 38.72 ? 44  ASN H CB    1 
ATOM   3251 C  CG    . ASN J 3 21 ? -2.923  16.855  39.898  1.00 41.35 ? 44  ASN H CG    1 
ATOM   3252 O  OD1   . ASN J 3 21 ? -2.485  17.303  40.969  1.00 43.74 ? 44  ASN H OD1   1 
ATOM   3253 N  ND2   . ASN J 3 21 ? -2.133  16.515  38.886  1.00 39.21 ? 44  ASN H ND2   1 
ATOM   3254 N  N     . GLU J 3 22 ? -7.021  15.347  38.865  1.00 34.41 ? 45  GLU H N     1 
ATOM   3255 C  CA    . GLU J 3 22 ? -8.083  14.383  39.114  1.00 34.89 ? 45  GLU H CA    1 
ATOM   3256 C  C     . GLU J 3 22 ? -8.425  13.710  37.785  1.00 32.77 ? 45  GLU H C     1 
ATOM   3257 O  O     . GLU J 3 22 ? -8.571  12.490  37.714  1.00 31.63 ? 45  GLU H O     1 
ATOM   3258 C  CB    . GLU J 3 22 ? -9.326  15.087  39.692  1.00 37.41 ? 45  GLU H CB    1 
ATOM   3259 C  CG    . GLU J 3 22 ? -9.057  16.031  40.876  1.00 41.28 ? 45  GLU H CG    1 
ATOM   3260 C  CD    . GLU J 3 22 ? -10.248 16.948  41.205  1.00 42.46 ? 45  GLU H CD    1 
ATOM   3261 O  OE1   . GLU J 3 22 ? -11.206 16.464  41.839  1.00 43.37 ? 45  GLU H OE1   1 
ATOM   3262 O  OE2   . GLU J 3 22 ? -10.235 18.147  40.817  1.00 41.92 ? 45  GLU H OE2   1 
ATOM   3263 N  N     . CYS J 3 23 ? -8.545  14.503  36.724  1.00 33.21 ? 46  CYS H N     1 
ATOM   3264 C  CA    . CYS J 3 23 ? -8.852  13.939  35.412  1.00 30.80 ? 46  CYS H CA    1 
ATOM   3265 C  C     . CYS J 3 23 ? -7.790  12.936  35.005  1.00 31.17 ? 46  CYS H C     1 
ATOM   3266 O  O     . CYS J 3 23 ? -8.084  11.800  34.642  1.00 31.35 ? 46  CYS H O     1 
ATOM   3267 C  CB    . CYS J 3 23 ? -8.893  15.021  34.363  1.00 30.18 ? 46  CYS H CB    1 
ATOM   3268 S  SG    . CYS J 3 23 ? -9.354  14.352  32.756  1.00 33.07 ? 46  CYS H SG    1 
ATOM   3269 N  N     . ARG J 3 24 ? -6.542  13.373  35.085  1.00 32.80 ? 47  ARG H N     1 
ATOM   3270 C  CA    . ARG J 3 24 ? -5.395  12.560  34.714  1.00 32.70 ? 47  ARG H CA    1 
ATOM   3271 C  C     . ARG J 3 24 ? -5.298  11.242  35.468  1.00 32.22 ? 47  ARG H C     1 
ATOM   3272 O  O     . ARG J 3 24 ? -4.780  10.257  34.950  1.00 32.40 ? 47  ARG H O     1 
ATOM   3273 C  CB    . ARG J 3 24 ? -4.125  13.385  34.912  1.00 34.82 ? 47  ARG H CB    1 
ATOM   3274 C  CG    . ARG J 3 24 ? -2.846  12.744  34.391  1.00 37.98 ? 47  ARG H CG    1 
ATOM   3275 C  CD    . ARG J 3 24 ? -1.673  13.716  34.557  1.00 38.19 ? 47  ARG H CD    1 
ATOM   3276 N  NE    . ARG J 3 24 ? -0.400  13.133  34.144  1.00 39.04 ? 47  ARG H NE    1 
ATOM   3277 C  CZ    . ARG J 3 24 ? 0.262   12.204  34.826  1.00 39.87 ? 47  ARG H CZ    1 
ATOM   3278 N  NH1   . ARG J 3 24 ? 1.417   11.742  34.360  1.00 38.54 ? 47  ARG H NH1   1 
ATOM   3279 N  NH2   . ARG J 3 24 ? -0.221  11.747  35.976  1.00 36.94 ? 47  ARG H NH2   1 
ATOM   3280 N  N     . ALA J 3 25 ? -5.812  11.204  36.690  1.00 33.04 ? 48  ALA H N     1 
ATOM   3281 C  CA    . ALA J 3 25 ? -5.755  9.973   37.469  1.00 32.08 ? 48  ALA H CA    1 
ATOM   3282 C  C     . ALA J 3 25 ? -6.722  8.953   36.867  1.00 31.74 ? 48  ALA H C     1 
ATOM   3283 O  O     . ALA J 3 25 ? -6.580  7.739   37.072  1.00 32.52 ? 48  ALA H O     1 
ATOM   3284 C  CB    . ALA J 3 25 ? -6.122  10.257  38.919  1.00 31.02 ? 48  ALA H CB    1 
ATOM   3285 N  N     . GLN J 3 26 ? -7.703  9.442   36.120  1.00 30.23 ? 49  GLN H N     1 
ATOM   3286 C  CA    . GLN J 3 26 ? -8.684  8.542   35.506  1.00 31.89 ? 49  GLN H CA    1 
ATOM   3287 C  C     . GLN J 3 26 ? -8.236  7.947   34.167  1.00 30.43 ? 49  GLN H C     1 
ATOM   3288 O  O     . GLN J 3 26 ? -8.590  6.809   33.830  1.00 29.17 ? 49  GLN H O     1 
ATOM   3289 C  CB    . GLN J 3 26 ? -10.015 9.285   35.302  1.00 32.92 ? 49  GLN H CB    1 
ATOM   3290 C  CG    . GLN J 3 26 ? -10.472 10.061  36.524  1.00 34.42 ? 49  GLN H CG    1 
ATOM   3291 C  CD    . GLN J 3 26 ? -10.377 9.226   37.771  1.00 35.24 ? 49  GLN H CD    1 
ATOM   3292 O  OE1   . GLN J 3 26 ? -10.914 8.124   37.825  1.00 36.46 ? 49  GLN H OE1   1 
ATOM   3293 N  NE2   . GLN J 3 26 ? -9.680  9.736   38.783  1.00 36.18 ? 49  GLN H NE2   1 
ATOM   3294 N  N     . VAL J 3 27 ? -7.415  8.701   33.439  1.00 29.51 ? 50  VAL H N     1 
ATOM   3295 C  CA    . VAL J 3 27 ? -6.972  8.302   32.094  1.00 29.35 ? 50  VAL H CA    1 
ATOM   3296 C  C     . VAL J 3 27 ? -5.519  7.854   31.874  1.00 29.95 ? 50  VAL H C     1 
ATOM   3297 O  O     . VAL J 3 27 ? -5.233  7.199   30.879  1.00 30.86 ? 50  VAL H O     1 
ATOM   3298 C  CB    . VAL J 3 27 ? -7.268  9.447   31.132  1.00 24.46 ? 50  VAL H CB    1 
ATOM   3299 C  CG1   . VAL J 3 27 ? -8.694  9.917   31.340  1.00 25.15 ? 50  VAL H CG1   1 
ATOM   3300 C  CG2   . VAL J 3 27 ? -6.335  10.591  31.402  1.00 25.81 ? 50  VAL H CG2   1 
ATOM   3301 N  N     . ASP J 3 28 ? -4.610  8.205   32.777  1.00 31.28 ? 51  ASP H N     1 
ATOM   3302 C  CA    . ASP J 3 28 ? -3.206  7.816   32.646  1.00 33.53 ? 51  ASP H CA    1 
ATOM   3303 C  C     . ASP J 3 28 ? -3.051  6.302   32.565  1.00 33.62 ? 51  ASP H C     1 
ATOM   3304 O  O     . ASP J 3 28 ? -3.449  5.586   33.479  1.00 34.56 ? 51  ASP H O     1 
ATOM   3305 C  CB    . ASP J 3 28 ? -2.392  8.311   33.843  1.00 36.24 ? 51  ASP H CB    1 
ATOM   3306 C  CG    . ASP J 3 28 ? -0.904  8.028   33.689  1.00 39.62 ? 51  ASP H CG    1 
ATOM   3307 O  OD1   . ASP J 3 28 ? -0.240  7.761   34.715  1.00 41.92 ? 51  ASP H OD1   1 
ATOM   3308 O  OD2   . ASP J 3 28 ? -0.400  8.085   32.537  1.00 38.34 ? 51  ASP H OD2   1 
ATOM   3309 N  N     . ARG J 3 29 ? -2.468  5.819   31.475  1.00 33.38 ? 52  ARG H N     1 
ATOM   3310 C  CA    . ARG J 3 29 ? -2.269  4.385   31.282  1.00 33.59 ? 52  ARG H CA    1 
ATOM   3311 C  C     . ARG J 3 29 ? -3.577  3.578   31.324  1.00 33.95 ? 52  ARG H C     1 
ATOM   3312 O  O     . ARG J 3 29 ? -3.564  2.354   31.534  1.00 32.48 ? 52  ARG H O     1 
ATOM   3313 C  CB    . ARG J 3 29 ? -1.256  3.860   32.316  1.00 34.78 ? 52  ARG H CB    1 
ATOM   3314 C  CG    . ARG J 3 29 ? 0.192   4.090   31.900  1.00 37.02 ? 52  ARG H CG    1 
ATOM   3315 C  CD    . ARG J 3 29 ? 1.112   4.661   32.991  1.00 39.98 ? 52  ARG H CD    1 
ATOM   3316 N  NE    . ARG J 3 29 ? 1.922   3.660   33.680  1.00 43.83 ? 52  ARG H NE    1 
ATOM   3317 C  CZ    . ARG J 3 29 ? 3.185   3.844   34.075  1.00 45.96 ? 52  ARG H CZ    1 
ATOM   3318 N  NH1   . ARG J 3 29 ? 3.831   2.874   34.704  1.00 46.33 ? 52  ARG H NH1   1 
ATOM   3319 N  NH2   . ARG J 3 29 ? 3.819   4.988   33.832  1.00 48.88 ? 52  ARG H NH2   1 
ATOM   3320 N  N     . PHE J 3 30 ? -4.706  4.261   31.121  1.00 33.52 ? 53  PHE H N     1 
ATOM   3321 C  CA    . PHE J 3 30 ? -6.003  3.582   31.118  1.00 34.14 ? 53  PHE H CA    1 
ATOM   3322 C  C     . PHE J 3 30 ? -6.377  3.221   29.682  1.00 32.59 ? 53  PHE H C     1 
ATOM   3323 O  O     . PHE J 3 30 ? -6.633  4.107   28.867  1.00 32.98 ? 53  PHE H O     1 
ATOM   3324 C  CB    . PHE J 3 30 ? -7.109  4.454   31.716  1.00 33.74 ? 53  PHE H CB    1 
ATOM   3325 C  CG    . PHE J 3 30 ? -8.410  3.725   31.853  1.00 35.05 ? 53  PHE H CG    1 
ATOM   3326 C  CD1   . PHE J 3 30 ? -9.314  3.684   30.796  1.00 33.31 ? 53  PHE H CD1   1 
ATOM   3327 C  CD2   . PHE J 3 30 ? -8.698  3.006   33.019  1.00 34.87 ? 53  PHE H CD2   1 
ATOM   3328 C  CE1   . PHE J 3 30 ? -10.480 2.940   30.886  1.00 32.89 ? 53  PHE H CE1   1 
ATOM   3329 C  CE2   . PHE J 3 30 ? -9.869  2.248   33.128  1.00 34.89 ? 53  PHE H CE2   1 
ATOM   3330 C  CZ    . PHE J 3 30 ? -10.762 2.212   32.061  1.00 34.92 ? 53  PHE H CZ    1 
ATOM   3331 N  N     . PRO J 3 31 ? -6.442  1.913   29.363  1.00 31.99 ? 54  PRO H N     1 
ATOM   3332 C  CA    . PRO J 3 31 ? -6.780  1.521   27.988  1.00 31.75 ? 54  PRO H CA    1 
ATOM   3333 C  C     . PRO J 3 31 ? -8.042  2.147   27.407  1.00 31.50 ? 54  PRO H C     1 
ATOM   3334 O  O     . PRO J 3 31 ? -9.103  2.128   28.023  1.00 30.44 ? 54  PRO H O     1 
ATOM   3335 C  CB    . PRO J 3 31 ? -6.834  -0.016  28.056  1.00 32.88 ? 54  PRO H CB    1 
ATOM   3336 C  CG    . PRO J 3 31 ? -7.167  -0.297  29.490  1.00 31.93 ? 54  PRO H CG    1 
ATOM   3337 C  CD    . PRO J 3 31 ? -6.347  0.733   30.242  1.00 30.67 ? 54  PRO H CD    1 
ATOM   3338 N  N     . ALA J 3 32 ? -7.889  2.737   26.224  1.00 31.41 ? 55  ALA H N     1 
ATOM   3339 C  CA    . ALA J 3 32 ? -8.989  3.364   25.503  1.00 30.59 ? 55  ALA H CA    1 
ATOM   3340 C  C     . ALA J 3 32 ? -9.655  4.528   26.234  1.00 30.18 ? 55  ALA H C     1 
ATOM   3341 O  O     . ALA J 3 32 ? -10.816 4.825   25.987  1.00 28.80 ? 55  ALA H O     1 
ATOM   3342 C  CB    . ALA J 3 32 ? -10.046 2.296   25.142  1.00 30.88 ? 55  ALA H CB    1 
ATOM   3343 N  N     . ALA J 3 33 ? -8.942  5.170   27.152  1.00 29.88 ? 56  ALA H N     1 
ATOM   3344 C  CA    . ALA J 3 33 ? -9.526  6.307   27.845  1.00 28.55 ? 56  ALA H CA    1 
ATOM   3345 C  C     . ALA J 3 33 ? -9.974  7.310   26.790  1.00 28.79 ? 56  ALA H C     1 
ATOM   3346 O  O     . ALA J 3 33 ? -9.401  7.387   25.693  1.00 29.21 ? 56  ALA H O     1 
ATOM   3347 C  CB    . ALA J 3 33 ? -8.520  6.940   28.727  1.00 25.62 ? 56  ALA H CB    1 
ATOM   3348 N  N     . ARG J 3 34 ? -10.998 8.076   27.125  1.00 29.61 ? 57  ARG H N     1 
ATOM   3349 C  CA    . ARG J 3 34 ? -11.514 9.106   26.241  1.00 30.90 ? 57  ARG H CA    1 
ATOM   3350 C  C     . ARG J 3 34 ? -11.878 10.266  27.136  1.00 29.41 ? 57  ARG H C     1 
ATOM   3351 O  O     . ARG J 3 34 ? -12.842 10.197  27.887  1.00 30.17 ? 57  ARG H O     1 
ATOM   3352 C  CB    . ARG J 3 34 ? -12.763 8.629   25.491  1.00 33.36 ? 57  ARG H CB    1 
ATOM   3353 C  CG    . ARG J 3 34 ? -13.209 9.604   24.390  1.00 37.68 ? 57  ARG H CG    1 
ATOM   3354 C  CD    . ARG J 3 34 ? -12.369 9.443   23.102  1.00 38.51 ? 57  ARG H CD    1 
ATOM   3355 N  NE    . ARG J 3 34 ? -12.513 10.583  22.189  1.00 41.17 ? 57  ARG H NE    1 
ATOM   3356 C  CZ    . ARG J 3 34 ? -12.089 11.820  22.454  1.00 42.44 ? 57  ARG H CZ    1 
ATOM   3357 N  NH1   . ARG J 3 34 ? -11.487 12.097  23.606  1.00 45.19 ? 57  ARG H NH1   1 
ATOM   3358 N  NH2   . ARG J 3 34 ? -12.270 12.791  21.575  1.00 42.43 ? 57  ARG H NH2   1 
ATOM   3359 N  N     . PHE J 3 35 ? -11.099 11.329  27.055  1.00 29.51 ? 58  PHE H N     1 
ATOM   3360 C  CA    . PHE J 3 35 ? -11.308 12.514  27.872  1.00 30.42 ? 58  PHE H CA    1 
ATOM   3361 C  C     . PHE J 3 35 ? -11.190 13.801  27.073  1.00 30.01 ? 58  PHE H C     1 
ATOM   3362 O  O     . PHE J 3 35 ? -10.644 13.802  25.957  1.00 28.76 ? 58  PHE H O     1 
ATOM   3363 C  CB    . PHE J 3 35 ? -10.298 12.521  29.039  1.00 31.03 ? 58  PHE H CB    1 
ATOM   3364 C  CG    . PHE J 3 35 ? -8.848  12.566  28.605  1.00 31.42 ? 58  PHE H CG    1 
ATOM   3365 C  CD1   . PHE J 3 35 ? -8.159  13.773  28.561  1.00 32.49 ? 58  PHE H CD1   1 
ATOM   3366 C  CD2   . PHE J 3 35 ? -8.176  11.404  28.256  1.00 31.61 ? 58  PHE H CD2   1 
ATOM   3367 C  CE1   . PHE J 3 35 ? -6.828  13.822  28.177  1.00 32.96 ? 58  PHE H CE1   1 
ATOM   3368 C  CE2   . PHE J 3 35 ? -6.826  11.445  27.864  1.00 32.64 ? 58  PHE H CE2   1 
ATOM   3369 C  CZ    . PHE J 3 35 ? -6.158  12.657  27.828  1.00 31.93 ? 58  PHE H CZ    1 
ATOM   3370 N  N     . LYS J 3 36 ? -11.702 14.887  27.649  1.00 29.19 ? 59  LYS H N     1 
ATOM   3371 C  CA    . LYS J 3 36 ? -11.663 16.204  27.021  1.00 32.83 ? 59  LYS H CA    1 
ATOM   3372 C  C     . LYS J 3 36 ? -12.181 17.289  27.970  1.00 33.57 ? 59  LYS H C     1 
ATOM   3373 O  O     . LYS J 3 36 ? -13.105 17.046  28.765  1.00 31.93 ? 59  LYS H O     1 
ATOM   3374 C  CB    . LYS J 3 36 ? -12.486 16.184  25.729  1.00 33.41 ? 59  LYS H CB    1 
ATOM   3375 C  CG    . LYS J 3 36 ? -12.511 17.493  24.977  1.00 37.76 ? 59  LYS H CG    1 
ATOM   3376 C  CD    . LYS J 3 36 ? -12.878 17.254  23.511  1.00 38.88 ? 59  LYS H CD    1 
ATOM   3377 C  CE    . LYS J 3 36 ? -12.974 18.557  22.752  1.00 40.02 ? 59  LYS H CE    1 
ATOM   3378 N  NZ    . LYS J 3 36 ? -11.806 19.405  23.069  1.00 44.10 ? 59  LYS H NZ    1 
ATOM   3379 N  N     . LYS J 3 37 ? -11.589 18.486  27.894  1.00 36.06 ? 60  LYS H N     1 
ATOM   3380 C  CA    . LYS J 3 37 ? -11.999 19.604  28.765  1.00 37.74 ? 60  LYS H CA    1 
ATOM   3381 C  C     . LYS J 3 37 ? -12.880 20.629  28.063  1.00 38.14 ? 60  LYS H C     1 
ATOM   3382 O  O     . LYS J 3 37 ? -12.734 20.871  26.863  1.00 37.11 ? 60  LYS H O     1 
ATOM   3383 C  CB    . LYS J 3 37 ? -10.775 20.329  29.359  1.00 40.35 ? 60  LYS H CB    1 
ATOM   3384 C  CG    . LYS J 3 37 ? -10.137 21.369  28.451  1.00 42.67 ? 60  LYS H CG    1 
ATOM   3385 C  CD    . LYS J 3 37 ? -9.076  22.162  29.209  1.00 45.23 ? 60  LYS H CD    1 
ATOM   3386 C  CE    . LYS J 3 37 ? -8.448  23.258  28.349  1.00 46.05 ? 60  LYS H CE    1 
ATOM   3387 N  NZ    . LYS J 3 37 ? -7.408  24.045  29.082  1.00 43.71 ? 60  LYS H NZ    1 
ATOM   3388 N  N     . PHE J 3 38 ? -13.782 21.240  28.828  1.00 38.85 ? 61  PHE H N     1 
ATOM   3389 C  CA    . PHE J 3 38 ? -14.713 22.237  28.293  1.00 39.32 ? 61  PHE H CA    1 
ATOM   3390 C  C     . PHE J 3 38 ? -14.838 23.466  29.207  1.00 40.18 ? 61  PHE H C     1 
ATOM   3391 O  O     . PHE J 3 38 ? -14.445 23.420  30.390  1.00 38.88 ? 61  PHE H O     1 
ATOM   3392 C  CB    . PHE J 3 38 ? -16.089 21.604  28.088  1.00 38.88 ? 61  PHE H CB    1 
ATOM   3393 C  CG    . PHE J 3 38 ? -16.066 20.366  27.233  1.00 39.64 ? 61  PHE H CG    1 
ATOM   3394 C  CD1   . PHE J 3 38 ? -15.774 19.117  27.792  1.00 39.76 ? 61  PHE H CD1   1 
ATOM   3395 C  CD2   . PHE J 3 38 ? -16.317 20.445  25.866  1.00 38.79 ? 61  PHE H CD2   1 
ATOM   3396 C  CE1   . PHE J 3 38 ? -15.730 17.965  26.997  1.00 39.53 ? 61  PHE H CE1   1 
ATOM   3397 C  CE2   . PHE J 3 38 ? -16.275 19.298  25.062  1.00 39.32 ? 61  PHE H CE2   1 
ATOM   3398 C  CZ    . PHE J 3 38 ? -15.984 18.063  25.622  1.00 39.33 ? 61  PHE H CZ    1 
ATOM   3399 N  N     . ALA J 3 39 ? -15.388 24.549  28.649  1.00 39.20 ? 62  ALA H N     1 
ATOM   3400 C  CA    . ALA J 3 39 ? -15.552 25.827  29.355  1.00 39.91 ? 62  ALA H CA    1 
ATOM   3401 C  C     . ALA J 3 39 ? -16.771 25.909  30.283  1.00 40.11 ? 62  ALA H C     1 
ATOM   3402 O  O     . ALA J 3 39 ? -16.858 26.808  31.128  1.00 39.56 ? 62  ALA H O     1 
ATOM   3403 C  CB    . ALA J 3 39 ? -15.597 26.979  28.338  1.00 39.67 ? 62  ALA H CB    1 
ATOM   3404 N  N     . THR J 3 40 ? -17.704 24.979  30.110  1.00 39.94 ? 63  THR H N     1 
ATOM   3405 C  CA    . THR J 3 40 ? -18.907 24.918  30.927  1.00 40.27 ? 63  THR H CA    1 
ATOM   3406 C  C     . THR J 3 40 ? -19.145 23.467  31.325  1.00 40.92 ? 63  THR H C     1 
ATOM   3407 O  O     . THR J 3 40 ? -18.795 22.540  30.581  1.00 38.29 ? 63  THR H O     1 
ATOM   3408 C  CB    . THR J 3 40 ? -20.145 25.493  30.172  1.00 39.83 ? 63  THR H CB    1 
ATOM   3409 O  OG1   . THR J 3 40 ? -20.285 24.864  28.889  1.00 38.75 ? 63  THR H OG1   1 
ATOM   3410 C  CG2   . THR J 3 40 ? -19.979 26.988  29.974  1.00 40.46 ? 63  THR H CG2   1 
ATOM   3411 N  N     . GLU J 3 41 ? -19.738 23.263  32.500  1.00 41.95 ? 64  GLU H N     1 
ATOM   3412 C  CA    . GLU J 3 41 ? -19.967 21.903  32.974  1.00 42.67 ? 64  GLU H CA    1 
ATOM   3413 C  C     . GLU J 3 41 ? -21.008 21.124  32.171  1.00 43.10 ? 64  GLU H C     1 
ATOM   3414 O  O     . GLU J 3 41 ? -20.892 19.902  32.004  1.00 41.64 ? 64  GLU H O     1 
ATOM   3415 C  CB    . GLU J 3 41 ? -20.348 21.891  34.462  1.00 42.90 ? 64  GLU H CB    1 
ATOM   3416 C  CG    . GLU J 3 41 ? -20.574 20.464  34.945  1.00 45.30 ? 64  GLU H CG    1 
ATOM   3417 C  CD    . GLU J 3 41 ? -20.081 20.206  36.356  1.00 45.68 ? 64  GLU H CD    1 
ATOM   3418 O  OE1   . GLU J 3 41 ? -20.042 19.019  36.752  1.00 44.25 ? 64  GLU H OE1   1 
ATOM   3419 O  OE2   . GLU J 3 41 ? -19.743 21.181  37.061  1.00 45.75 ? 64  GLU H OE2   1 
ATOM   3420 N  N     . ASP J 3 42 ? -22.023 21.824  31.679  1.00 43.23 ? 65  ASP H N     1 
ATOM   3421 C  CA    . ASP J 3 42 ? -23.064 21.171  30.908  1.00 45.33 ? 65  ASP H CA    1 
ATOM   3422 C  C     . ASP J 3 42 ? -22.456 20.549  29.667  1.00 45.10 ? 65  ASP H C     1 
ATOM   3423 O  O     . ASP J 3 42 ? -22.820 19.450  29.256  1.00 45.00 ? 65  ASP H O     1 
ATOM   3424 C  CB    . ASP J 3 42 ? -24.123 22.176  30.483  1.00 47.09 ? 65  ASP H CB    1 
ATOM   3425 C  CG    . ASP J 3 42 ? -25.062 21.603  29.461  1.00 50.19 ? 65  ASP H CG    1 
ATOM   3426 O  OD1   . ASP J 3 42 ? -25.442 22.344  28.523  1.00 52.89 ? 65  ASP H OD1   1 
ATOM   3427 O  OD2   . ASP J 3 42 ? -25.415 20.408  29.595  1.00 51.16 ? 65  ASP H OD2   1 
ATOM   3428 N  N     . GLU J 3 43 ? -21.529 21.290  29.077  1.00 45.60 ? 66  GLU H N     1 
ATOM   3429 C  CA    . GLU J 3 43 ? -20.819 20.883  27.876  1.00 46.47 ? 66  GLU H CA    1 
ATOM   3430 C  C     . GLU J 3 43 ? -19.984 19.646  28.214  1.00 46.33 ? 66  GLU H C     1 
ATOM   3431 O  O     . GLU J 3 43 ? -19.799 18.746  27.391  1.00 44.96 ? 66  GLU H O     1 
ATOM   3432 C  CB    . GLU J 3 43 ? -19.909 22.034  27.456  1.00 48.14 ? 66  GLU H CB    1 
ATOM   3433 C  CG    . GLU J 3 43 ? -19.623 22.154  25.983  1.00 48.73 ? 66  GLU H CG    1 
ATOM   3434 C  CD    . GLU J 3 43 ? -18.832 23.408  25.693  1.00 50.56 ? 66  GLU H CD    1 
ATOM   3435 O  OE1   . GLU J 3 43 ? -18.337 23.563  24.550  1.00 50.56 ? 66  GLU H OE1   1 
ATOM   3436 O  OE2   . GLU J 3 43 ? -18.711 24.240  26.623  1.00 49.81 ? 66  GLU H OE2   1 
ATOM   3437 N  N     . ALA J 3 44 ? -19.487 19.623  29.445  1.00 45.77 ? 67  ALA H N     1 
ATOM   3438 C  CA    . ALA J 3 44 ? -18.675 18.525  29.917  1.00 46.55 ? 67  ALA H CA    1 
ATOM   3439 C  C     . ALA J 3 44 ? -19.497 17.235  30.027  1.00 47.34 ? 67  ALA H C     1 
ATOM   3440 O  O     . ALA J 3 44 ? -19.140 16.222  29.421  1.00 46.44 ? 67  ALA H O     1 
ATOM   3441 C  CB    . ALA J 3 44 ? -18.053 18.885  31.261  1.00 46.60 ? 67  ALA H CB    1 
ATOM   3442 N  N     . TRP J 3 45 ? -20.589 17.253  30.788  1.00 47.42 ? 68  TRP H N     1 
ATOM   3443 C  CA    . TRP J 3 45 ? -21.390 16.033  30.913  1.00 49.40 ? 68  TRP H CA    1 
ATOM   3444 C  C     . TRP J 3 45 ? -21.955 15.562  29.567  1.00 48.52 ? 68  TRP H C     1 
ATOM   3445 O  O     . TRP J 3 45 ? -22.156 14.366  29.344  1.00 46.66 ? 68  TRP H O     1 
ATOM   3446 C  CB    . TRP J 3 45 ? -22.538 16.221  31.919  1.00 51.45 ? 68  TRP H CB    1 
ATOM   3447 C  CG    . TRP J 3 45 ? -22.119 16.119  33.362  1.00 54.43 ? 68  TRP H CG    1 
ATOM   3448 C  CD1   . TRP J 3 45 ? -21.755 17.146  34.190  1.00 55.28 ? 68  TRP H CD1   1 
ATOM   3449 C  CD2   . TRP J 3 45 ? -22.008 14.919  34.142  1.00 55.82 ? 68  TRP H CD2   1 
ATOM   3450 N  NE1   . TRP J 3 45 ? -21.428 16.660  35.437  1.00 56.92 ? 68  TRP H NE1   1 
ATOM   3451 C  CE2   . TRP J 3 45 ? -21.572 15.296  35.432  1.00 57.19 ? 68  TRP H CE2   1 
ATOM   3452 C  CE3   . TRP J 3 45 ? -22.230 13.562  33.875  1.00 56.42 ? 68  TRP H CE3   1 
ATOM   3453 C  CZ2   . TRP J 3 45 ? -21.355 14.360  36.452  1.00 58.60 ? 68  TRP H CZ2   1 
ATOM   3454 C  CZ3   . TRP J 3 45 ? -22.013 12.635  34.886  1.00 56.68 ? 68  TRP H CZ3   1 
ATOM   3455 C  CH2   . TRP J 3 45 ? -21.580 13.038  36.157  1.00 58.27 ? 68  TRP H CH2   1 
ATOM   3456 N  N     . ALA J 3 46 ? -22.205 16.503  28.665  1.00 49.41 ? 69  ALA H N     1 
ATOM   3457 C  CA    . ALA J 3 46 ? -22.744 16.146  27.356  1.00 50.39 ? 69  ALA H CA    1 
ATOM   3458 C  C     . ALA J 3 46 ? -21.774 15.184  26.689  1.00 51.25 ? 69  ALA H C     1 
ATOM   3459 O  O     . ALA J 3 46 ? -22.179 14.275  25.963  1.00 51.23 ? 69  ALA H O     1 
ATOM   3460 C  CB    . ALA J 3 46 ? -22.921 17.389  26.502  1.00 48.78 ? 69  ALA H CB    1 
ATOM   3461 N  N     . PHE J 3 47 ? -20.490 15.408  26.953  1.00 52.38 ? 70  PHE H N     1 
ATOM   3462 C  CA    . PHE J 3 47 ? -19.405 14.591  26.412  1.00 53.94 ? 70  PHE H CA    1 
ATOM   3463 C  C     . PHE J 3 47 ? -19.376 13.222  27.113  1.00 54.92 ? 70  PHE H C     1 
ATOM   3464 O  O     . PHE J 3 47 ? -19.282 12.186  26.463  1.00 54.20 ? 70  PHE H O     1 
ATOM   3465 C  CB    . PHE J 3 47 ? -18.067 15.326  26.615  1.00 54.05 ? 70  PHE H CB    1 
ATOM   3466 C  CG    . PHE J 3 47 ? -16.874 14.590  26.072  1.00 54.68 ? 70  PHE H CG    1 
ATOM   3467 C  CD1   . PHE J 3 47 ? -16.347 14.915  24.826  1.00 54.22 ? 70  PHE H CD1   1 
ATOM   3468 C  CD2   . PHE J 3 47 ? -16.288 13.553  26.802  1.00 54.07 ? 70  PHE H CD2   1 
ATOM   3469 C  CE1   . PHE J 3 47 ? -15.254 14.217  24.310  1.00 55.09 ? 70  PHE H CE1   1 
ATOM   3470 C  CE2   . PHE J 3 47 ? -15.193 12.846  26.298  1.00 54.33 ? 70  PHE H CE2   1 
ATOM   3471 C  CZ    . PHE J 3 47 ? -14.675 13.176  25.051  1.00 55.43 ? 70  PHE H CZ    1 
ATOM   3472 N  N     . VAL J 3 48 ? -19.448 13.234  28.442  1.00 56.27 ? 71  VAL H N     1 
ATOM   3473 C  CA    . VAL J 3 48 ? -19.442 12.013  29.242  1.00 58.02 ? 71  VAL H CA    1 
ATOM   3474 C  C     . VAL J 3 48 ? -20.659 11.139  28.914  1.00 59.86 ? 71  VAL H C     1 
ATOM   3475 O  O     . VAL J 3 48 ? -20.542 9.919   28.782  1.00 59.96 ? 71  VAL H O     1 
ATOM   3476 C  CB    . VAL J 3 48 ? -19.438 12.356  30.764  1.00 58.05 ? 71  VAL H CB    1 
ATOM   3477 C  CG1   . VAL J 3 48 ? -19.700 11.125  31.590  1.00 56.95 ? 71  VAL H CG1   1 
ATOM   3478 C  CG2   . VAL J 3 48 ? -18.100 12.953  31.157  1.00 58.20 ? 71  VAL H CG2   1 
ATOM   3479 N  N     . ARG J 3 49 ? -21.825 11.768  28.779  1.00 61.56 ? 72  ARG H N     1 
ATOM   3480 C  CA    . ARG J 3 49 ? -23.059 11.051  28.461  1.00 62.60 ? 72  ARG H CA    1 
ATOM   3481 C  C     . ARG J 3 49 ? -24.249 11.997  28.309  1.00 63.21 ? 72  ARG H C     1 
ATOM   3482 O  O     . ARG J 3 49 ? -24.747 12.126  27.168  1.00 63.39 ? 72  ARG H O     1 
ATOM   3483 C  CB    . ARG J 3 49 ? -23.367 10.014  29.541  1.00 63.06 ? 72  ARG H CB    1 
ATOM   3484 C  CG    . ARG J 3 49 ? -23.326 10.562  30.950  1.00 64.12 ? 72  ARG H CG    1 
ATOM   3485 C  CD    . ARG J 3 49 ? -23.881 9.573   31.955  1.00 64.80 ? 72  ARG H CD    1 
ATOM   3486 N  NE    . ARG J 3 49 ? -23.280 9.758   33.273  1.00 65.29 ? 72  ARG H NE    1 
ATOM   3487 C  CZ    . ARG J 3 49 ? -22.053 9.351   33.594  1.00 66.71 ? 72  ARG H CZ    1 
ATOM   3488 N  NH1   . ARG J 3 49 ? -21.572 9.559   34.817  1.00 66.72 ? 72  ARG H NH1   1 
ATOM   3489 N  NH2   . ARG J 3 49 ? -21.309 8.717   32.694  1.00 66.64 ? 72  ARG H NH2   1 
HETATM 3490 MG MG    . MG  K 4 .  ? -17.555 -18.492 5.074   1.00 51.45 ? 501 MG  A MG    1 
HETATM 3491 MG MG    . MG  L 4 .  ? -12.345 -11.364 39.650  1.00 51.79 ? 502 MG  C MG    1 
HETATM 3492 O  O     . HOH M 5 .  ? 7.952   -42.882 7.684   1.00 35.51 ? 13  HOH D O     1 
HETATM 3493 O  O     . HOH M 5 .  ? 5.333   -42.118 7.263   1.00 44.78 ? 14  HOH D O     1 
HETATM 3494 O  O     . HOH M 5 .  ? 0.560   -31.013 19.427  1.00 23.56 ? 15  HOH D O     1 
HETATM 3495 O  O     . HOH M 5 .  ? 0.568   -12.121 19.648  1.00 32.79 ? 16  HOH D O     1 
HETATM 3496 O  O     . HOH M 5 .  ? -4.196  -30.579 22.115  1.00 27.31 ? 17  HOH D O     1 
HETATM 3497 O  O     . HOH M 5 .  ? -1.127  -18.815 29.790  1.00 29.38 ? 18  HOH D O     1 
HETATM 3498 O  O     . HOH M 5 .  ? 11.610  -14.922 22.468  1.00 36.34 ? 19  HOH D O     1 
HETATM 3499 O  O     . HOH M 5 .  ? -1.146  -35.604 14.739  1.00 32.04 ? 20  HOH D O     1 
HETATM 3500 O  O     . HOH M 5 .  ? 8.523   -12.586 24.679  1.00 53.15 ? 21  HOH D O     1 
HETATM 3501 O  O     . HOH M 5 .  ? 4.099   -35.329 6.210   1.00 46.96 ? 22  HOH D O     1 
HETATM 3502 O  O     . HOH M 5 .  ? -8.774  -26.095 16.729  1.00 26.03 ? 23  HOH D O     1 
HETATM 3503 O  O     . HOH M 5 .  ? 1.951   -22.209 22.956  1.00 33.68 ? 24  HOH D O     1 
HETATM 3504 O  O     . HOH M 5 .  ? -7.411  -35.642 20.693  1.00 49.53 ? 25  HOH D O     1 
HETATM 3505 O  O     . HOH M 5 .  ? -1.520  -32.644 18.007  1.00 33.97 ? 26  HOH D O     1 
HETATM 3506 O  O     . HOH M 5 .  ? 3.360   -11.452 17.909  1.00 44.50 ? 27  HOH D O     1 
HETATM 3507 O  O     . HOH M 5 .  ? 10.639  -35.358 12.401  1.00 32.05 ? 28  HOH D O     1 
HETATM 3508 O  O     . HOH M 5 .  ? -0.065  -11.726 16.940  1.00 23.88 ? 29  HOH D O     1 
HETATM 3509 O  O     . HOH M 5 .  ? 4.648   -41.904 13.213  1.00 48.04 ? 30  HOH D O     1 
HETATM 3510 O  O     . HOH M 5 .  ? -1.339  -34.064 21.477  1.00 77.27 ? 31  HOH D O     1 
HETATM 3511 O  O     . HOH M 5 .  ? -4.302  -33.285 18.931  1.00 25.89 ? 32  HOH D O     1 
HETATM 3512 O  O     . HOH M 5 .  ? -2.706  -30.612 26.043  1.00 43.77 ? 33  HOH D O     1 
HETATM 3513 O  O     . HOH M 5 .  ? 0.181   -27.370 21.446  1.00 26.92 ? 34  HOH D O     1 
HETATM 3514 O  O     . HOH M 5 .  ? 10.286  -20.764 27.920  1.00 39.62 ? 35  HOH D O     1 
HETATM 3515 O  O     . HOH M 5 .  ? 15.533  -44.235 15.313  1.00 24.38 ? 36  HOH D O     1 
HETATM 3516 O  O     . HOH M 5 .  ? 11.127  -13.412 26.354  1.00 53.68 ? 37  HOH D O     1 
HETATM 3517 O  O     . HOH M 5 .  ? 4.516   -38.298 6.102   1.00 72.53 ? 38  HOH D O     1 
HETATM 3518 O  O     . HOH M 5 .  ? 6.383   -43.540 10.358  1.00 51.91 ? 39  HOH D O     1 
HETATM 3519 O  O     . HOH M 5 .  ? -1.246  -30.432 20.804  1.00 41.66 ? 40  HOH D O     1 
HETATM 3520 O  O     . HOH M 5 .  ? 1.355   -25.338 25.486  1.00 41.47 ? 41  HOH D O     1 
HETATM 3521 O  O     . HOH M 5 .  ? 2.550   -10.836 15.658  1.00 54.81 ? 42  HOH D O     1 
HETATM 3522 O  O     . HOH M 5 .  ? -3.339  -33.525 23.686  1.00 45.00 ? 43  HOH D O     1 
HETATM 3523 O  O     . HOH M 5 .  ? 4.593   -43.045 15.990  1.00 31.27 ? 44  HOH D O     1 
HETATM 3524 O  O     . HOH M 5 .  ? 9.217   -33.418 11.423  1.00 44.57 ? 45  HOH D O     1 
HETATM 3525 O  O     . HOH M 5 .  ? 0.924   -29.150 27.415  1.00 48.35 ? 46  HOH D O     1 
HETATM 3526 O  O     . HOH M 5 .  ? 9.917   -42.125 23.761  1.00 44.76 ? 47  HOH D O     1 
HETATM 3527 O  O     . HOH M 5 .  ? 4.182   -34.965 1.367   1.00 56.73 ? 48  HOH D O     1 
HETATM 3528 O  O     . HOH M 5 .  ? -0.897  -28.323 30.938  1.00 36.68 ? 49  HOH D O     1 
HETATM 3529 O  O     . HOH M 5 .  ? 8.891   -22.783 28.866  1.00 36.29 ? 50  HOH D O     1 
HETATM 3530 O  O     . HOH M 5 .  ? -5.326  -30.192 27.854  1.00 49.31 ? 51  HOH D O     1 
HETATM 3531 O  O     . HOH N 5 .  ? -2.711  -9.969  22.008  1.00 24.58 ? 13  HOH E O     1 
HETATM 3532 O  O     . HOH N 5 .  ? -0.417  -42.524 20.620  1.00 34.65 ? 14  HOH E O     1 
HETATM 3533 O  O     . HOH N 5 .  ? 8.313   -27.475 26.221  1.00 43.66 ? 15  HOH E O     1 
HETATM 3534 O  O     . HOH N 5 .  ? 0.220   -20.683 16.179  1.00 23.52 ? 16  HOH E O     1 
HETATM 3535 O  O     . HOH N 5 .  ? -1.091  -16.526 19.255  1.00 30.45 ? 17  HOH E O     1 
HETATM 3536 O  O     . HOH N 5 .  ? 0.657   -21.304 18.634  1.00 36.07 ? 18  HOH E O     1 
HETATM 3537 O  O     . HOH N 5 .  ? -9.222  -12.314 15.811  1.00 45.71 ? 19  HOH E O     1 
HETATM 3538 O  O     . HOH N 5 .  ? 1.269   -35.027 23.893  1.00 25.31 ? 20  HOH E O     1 
HETATM 3539 O  O     . HOH N 5 .  ? 4.425   -29.267 26.968  1.00 71.42 ? 21  HOH E O     1 
HETATM 3540 O  O     . HOH N 5 .  ? -0.239  -18.872 18.457  1.00 44.25 ? 22  HOH E O     1 
HETATM 3541 O  O     . HOH N 5 .  ? 1.504   -41.599 18.910  1.00 30.58 ? 23  HOH E O     1 
HETATM 3542 O  O     . HOH N 5 .  ? 3.828   -27.887 20.030  1.00 30.95 ? 24  HOH E O     1 
HETATM 3543 O  O     . HOH N 5 .  ? 3.802   -25.090 17.105  1.00 27.88 ? 25  HOH E O     1 
HETATM 3544 O  O     . HOH N 5 .  ? -5.959  -15.537 17.212  1.00 44.85 ? 26  HOH E O     1 
HETATM 3545 O  O     . HOH N 5 .  ? -4.518  -15.325 19.232  1.00 41.81 ? 27  HOH E O     1 
HETATM 3546 O  O     . HOH N 5 .  ? -1.785  -13.047 19.946  1.00 39.23 ? 28  HOH E O     1 
HETATM 3547 O  O     . HOH N 5 .  ? -1.158  -17.108 15.417  0.60 31.87 ? 29  HOH E O     1 
HETATM 3548 O  O     . HOH O 5 .  ? -0.428  -0.732  17.928  1.00 29.09 ? 13  HOH I O     1 
HETATM 3549 O  O     . HOH O 5 .  ? 0.811   19.687  20.290  1.00 23.24 ? 14  HOH I O     1 
HETATM 3550 O  O     . HOH O 5 .  ? -3.549  10.924  28.887  1.00 43.20 ? 15  HOH I O     1 
HETATM 3551 O  O     . HOH O 5 .  ? 10.698  11.259  28.433  1.00 33.40 ? 16  HOH I O     1 
HETATM 3552 O  O     . HOH O 5 .  ? -4.519  8.843   28.093  1.00 36.64 ? 17  HOH I O     1 
HETATM 3553 O  O     . HOH O 5 .  ? 14.525  -9.287  22.039  1.00 60.52 ? 18  HOH I O     1 
HETATM 3554 O  O     . HOH O 5 .  ? -2.582  3.166   10.995  1.00 22.44 ? 19  HOH I O     1 
HETATM 3555 O  O     . HOH O 5 .  ? -8.412  6.176   17.479  1.00 37.24 ? 20  HOH I O     1 
HETATM 3556 O  O     . HOH O 5 .  ? -7.943  6.574   23.241  1.00 46.18 ? 21  HOH I O     1 
HETATM 3557 O  O     . HOH O 5 .  ? 6.651   6.824   30.448  1.00 42.10 ? 22  HOH I O     1 
HETATM 3558 O  O     . HOH O 5 .  ? 1.222   1.008   18.352  1.00 23.94 ? 23  HOH I O     1 
HETATM 3559 O  O     . HOH O 5 .  ? -0.539  20.522  17.734  1.00 34.20 ? 24  HOH I O     1 
HETATM 3560 O  O     . HOH O 5 .  ? 9.829   -1.124  11.562  1.00 40.46 ? 25  HOH I O     1 
HETATM 3561 O  O     . HOH O 5 .  ? 8.249   -10.404 7.556   1.00 37.61 ? 26  HOH I O     1 
HETATM 3562 O  O     . HOH O 5 .  ? -0.100  1.306   20.500  1.00 28.36 ? 27  HOH I O     1 
HETATM 3563 O  O     . HOH O 5 .  ? 5.651   4.030   27.286  1.00 54.03 ? 28  HOH I O     1 
HETATM 3564 O  O     . HOH O 5 .  ? 8.102   9.366   30.526  1.00 34.56 ? 29  HOH I O     1 
HETATM 3565 O  O     . HOH O 5 .  ? 1.628   17.082  20.493  1.00 33.31 ? 30  HOH I O     1 
HETATM 3566 O  O     . HOH O 5 .  ? 15.738  -8.365  19.368  1.00 32.58 ? 31  HOH I O     1 
HETATM 3567 O  O     . HOH O 5 .  ? 11.765  -12.053 10.628  1.00 28.29 ? 32  HOH I O     1 
HETATM 3568 O  O     . HOH O 5 .  ? 5.639   -10.620 9.303   1.00 38.97 ? 33  HOH I O     1 
HETATM 3569 O  O     . HOH O 5 .  ? 10.913  9.466   30.225  1.00 39.98 ? 34  HOH I O     1 
HETATM 3570 O  O     . HOH O 5 .  ? 3.269   12.607  31.900  1.00 32.31 ? 35  HOH I O     1 
HETATM 3571 O  O     . HOH O 5 .  ? 0.223   -3.756  14.545  1.00 27.96 ? 36  HOH I O     1 
HETATM 3572 O  O     . HOH O 5 .  ? 5.558   12.693  22.222  1.00 33.21 ? 37  HOH I O     1 
HETATM 3573 O  O     . HOH O 5 .  ? 11.087  -3.180  14.085  1.00 56.05 ? 38  HOH I O     1 
HETATM 3574 O  O     . HOH O 5 .  ? 0.829   3.933   21.141  1.00 37.41 ? 39  HOH I O     1 
HETATM 3575 O  O     . HOH O 5 .  ? 6.463   19.709  28.361  1.00 27.92 ? 40  HOH I O     1 
HETATM 3576 O  O     . HOH O 5 .  ? -2.840  -1.414  18.878  1.00 32.17 ? 41  HOH I O     1 
HETATM 3577 O  O     . HOH O 5 .  ? 7.672   11.556  20.294  1.00 44.86 ? 42  HOH I O     1 
HETATM 3578 O  O     . HOH O 5 .  ? -2.681  1.042   20.920  1.00 39.18 ? 43  HOH I O     1 
HETATM 3579 O  O     . HOH O 5 .  ? -8.122  -4.614  16.157  1.00 38.32 ? 44  HOH I O     1 
HETATM 3580 O  O     . HOH O 5 .  ? 13.523  -14.296 16.924  1.00 44.80 ? 45  HOH I O     1 
HETATM 3581 O  O     . HOH P 5 .  ? -2.758  21.876  22.878  1.00 27.23 ? 13  HOH J O     1 
HETATM 3582 O  O     . HOH P 5 .  ? 0.997   20.941  34.303  1.00 27.43 ? 14  HOH J O     1 
HETATM 3583 O  O     . HOH P 5 .  ? 0.749   -9.323  20.146  1.00 32.54 ? 15  HOH J O     1 
HETATM 3584 O  O     . HOH P 5 .  ? -0.544  15.304  20.012  1.00 34.60 ? 16  HOH J O     1 
HETATM 3585 O  O     . HOH P 5 .  ? -1.800  18.203  21.262  1.00 22.80 ? 17  HOH J O     1 
HETATM 3586 O  O     . HOH P 5 .  ? -3.224  16.059  19.753  1.00 31.04 ? 18  HOH J O     1 
HETATM 3587 O  O     . HOH P 5 .  ? -8.773  19.913  21.492  1.00 66.52 ? 19  HOH J O     1 
HETATM 3588 O  O     . HOH P 5 .  ? 3.366   -2.936  19.723  1.00 25.11 ? 20  HOH J O     1 
HETATM 3589 O  O     . HOH P 5 .  ? 1.256   11.009  16.040  1.00 23.21 ? 21  HOH J O     1 
HETATM 3590 O  O     . HOH P 5 .  ? -0.032  4.505   9.439   1.00 48.06 ? 22  HOH J O     1 
HETATM 3591 O  O     . HOH P 5 .  ? 1.191   10.834  18.533  1.00 42.52 ? 23  HOH J O     1 
HETATM 3592 O  O     . HOH P 5 .  ? -2.372  -5.997  29.320  1.00 66.40 ? 24  HOH J O     1 
HETATM 3593 O  O     . HOH P 5 .  ? 3.185   8.838   15.788  1.00 44.25 ? 25  HOH J O     1 
HETATM 3594 O  O     . HOH P 5 .  ? 12.302  -2.470  17.182  1.00 25.81 ? 26  HOH J O     1 
HETATM 3595 O  O     . HOH P 5 .  ? 2.438   -9.276  18.241  1.00 23.68 ? 27  HOH J O     1 
HETATM 3596 O  O     . HOH P 5 .  ? -5.336  21.306  25.281  1.00 53.88 ? 28  HOH J O     1 
HETATM 3597 O  O     . HOH P 5 .  ? -0.668  14.593  15.466  0.60 19.50 ? 29  HOH J O     1 
HETATM 3598 O  O     . HOH P 5 .  ? -6.224  5.227   13.133  1.00 32.66 ? 30  HOH J O     1 
HETATM 3599 O  O     . HOH P 5 .  ? 2.485   2.818   19.160  1.00 45.03 ? 31  HOH J O     1 
HETATM 3600 O  O     . HOH P 5 .  ? -10.409 21.366  24.975  1.00 43.18 ? 32  HOH J O     1 
HETATM 3601 O  O     . HOH P 5 .  ? 7.740   4.750   25.462  1.00 51.46 ? 33  HOH J O     1 
HETATM 3602 O  O     . HOH P 5 .  ? 4.782   6.853   16.639  1.00 41.32 ? 34  HOH J O     1 
HETATM 3603 O  O     . HOH P 5 .  ? 12.239  7.893   19.661  1.00 32.80 ? 35  HOH J O     1 
HETATM 3604 O  O     . HOH P 5 .  ? 6.655   5.853   23.427  1.00 56.91 ? 36  HOH J O     1 
HETATM 3605 O  O     . HOH P 5 .  ? 7.078   2.685   24.071  1.00 43.83 ? 37  HOH J O     1 
HETATM 3606 O  O     . HOH P 5 .  ? 4.797   -1.974  22.227  1.00 34.84 ? 38  HOH J O     1 
HETATM 3607 O  O     . HOH P 5 .  ? 2.013   8.010   18.254  1.00 26.06 ? 39  HOH J O     1 
HETATM 3608 O  O     . HOH P 5 .  ? 1.103   -1.808  29.748  1.00 46.49 ? 40  HOH J O     1 
HETATM 3609 O  O     . HOH Q 5 .  ? -1.217  -30.602 2.361   1.00 39.21 ? 502 HOH A O     1 
HETATM 3610 O  O     . HOH Q 5 .  ? -7.331  -26.858 13.156  1.00 30.50 ? 503 HOH A O     1 
HETATM 3611 O  O     . HOH Q 5 .  ? -10.418 -24.762 20.819  1.00 28.10 ? 504 HOH A O     1 
HETATM 3612 O  O     . HOH Q 5 .  ? 0.762   -19.310 -8.689  1.00 45.50 ? 505 HOH A O     1 
HETATM 3613 O  O     . HOH Q 5 .  ? -9.874  -31.417 -0.282  1.00 39.75 ? 506 HOH A O     1 
HETATM 3614 O  O     . HOH Q 5 .  ? -7.092  -10.655 9.937   1.00 34.91 ? 507 HOH A O     1 
HETATM 3615 O  O     . HOH Q 5 .  ? -1.143  -25.192 7.424   1.00 37.97 ? 508 HOH A O     1 
HETATM 3616 O  O     . HOH Q 5 .  ? -0.400  -7.618  3.153   1.00 68.47 ? 509 HOH A O     1 
HETATM 3617 O  O     . HOH Q 5 .  ? -17.728 -29.920 7.622   1.00 46.17 ? 510 HOH A O     1 
HETATM 3618 O  O     . HOH Q 5 .  ? -12.546 -5.436  10.156  1.00 41.42 ? 511 HOH A O     1 
HETATM 3619 O  O     . HOH Q 5 .  ? -14.897 -20.013 -0.825  1.00 28.33 ? 512 HOH A O     1 
HETATM 3620 O  O     . HOH Q 5 .  ? -0.726  -18.836 -6.320  1.00 38.37 ? 513 HOH A O     1 
HETATM 3621 O  O     . HOH Q 5 .  ? -0.609  -28.795 -1.601  1.00 33.76 ? 514 HOH A O     1 
HETATM 3622 O  O     . HOH Q 5 .  ? -15.215 -17.753 13.692  1.00 30.58 ? 515 HOH A O     1 
HETATM 3623 O  O     . HOH Q 5 .  ? -16.509 -29.862 4.647   1.00 61.67 ? 516 HOH A O     1 
HETATM 3624 O  O     . HOH Q 5 .  ? -14.844 -35.583 6.742   1.00 36.85 ? 517 HOH A O     1 
HETATM 3625 O  O     . HOH R 5 .  ? 12.044  -24.062 -0.912  1.00 54.69 ? 77  HOH B O     1 
HETATM 3626 O  O     . HOH R 5 .  ? 29.332  -28.118 13.483  1.00 32.09 ? 78  HOH B O     1 
HETATM 3627 O  O     . HOH R 5 .  ? 10.092  -20.773 7.869   1.00 33.58 ? 79  HOH B O     1 
HETATM 3628 O  O     . HOH R 5 .  ? 17.137  -25.888 23.791  1.00 42.40 ? 80  HOH B O     1 
HETATM 3629 O  O     . HOH R 5 .  ? 23.144  -24.381 7.957   1.00 42.77 ? 81  HOH B O     1 
HETATM 3630 O  O     . HOH R 5 .  ? 21.779  -36.390 11.481  1.00 37.79 ? 82  HOH B O     1 
HETATM 3631 O  O     . HOH R 5 .  ? 27.094  -27.158 21.420  1.00 53.70 ? 83  HOH B O     1 
HETATM 3632 O  O     . HOH R 5 .  ? 25.044  -31.231 7.077   1.00 51.20 ? 84  HOH B O     1 
HETATM 3633 O  O     . HOH R 5 .  ? 20.721  -23.034 22.372  1.00 37.10 ? 85  HOH B O     1 
HETATM 3634 O  O     . HOH R 5 .  ? 19.284  -27.795 24.315  1.00 41.78 ? 86  HOH B O     1 
HETATM 3635 O  O     . HOH R 5 .  ? 26.505  -29.141 11.345  1.00 33.66 ? 87  HOH B O     1 
HETATM 3636 O  O     . HOH R 5 .  ? 15.734  -18.672 21.091  1.00 19.98 ? 88  HOH B O     1 
HETATM 3637 O  O     . HOH R 5 .  ? 28.867  -23.906 18.411  1.00 40.22 ? 89  HOH B O     1 
HETATM 3638 O  O     . HOH R 5 .  ? 11.751  -34.698 17.105  1.00 46.77 ? 90  HOH B O     1 
HETATM 3639 O  O     . HOH R 5 .  ? 16.306  -31.661 25.222  1.00 59.27 ? 91  HOH B O     1 
HETATM 3640 O  O     . HOH R 5 .  ? 10.380  -18.748 11.805  1.00 40.40 ? 92  HOH B O     1 
HETATM 3641 O  O     . HOH R 5 .  ? 21.670  -14.063 14.729  1.00 23.52 ? 93  HOH B O     1 
HETATM 3642 O  O     . HOH R 5 .  ? 23.512  -14.546 16.910  1.00 34.11 ? 94  HOH B O     1 
HETATM 3643 O  O     . HOH R 5 .  ? 19.114  -33.106 2.454   1.00 38.16 ? 95  HOH B O     1 
HETATM 3644 O  O     . HOH R 5 .  ? 13.605  -34.008 1.712   1.00 29.22 ? 96  HOH B O     1 
HETATM 3645 O  O     . HOH R 5 .  ? 22.769  -18.665 5.973   1.00 42.86 ? 97  HOH B O     1 
HETATM 3646 O  O     . HOH R 5 .  ? 13.361  -22.811 2.120   1.00 47.47 ? 98  HOH B O     1 
HETATM 3647 O  O     . HOH R 5 .  ? 23.945  -35.073 13.882  1.00 39.65 ? 99  HOH B O     1 
HETATM 3648 O  O     . HOH R 5 .  ? 9.614   -43.067 5.997   1.00 30.22 ? 100 HOH B O     1 
HETATM 3649 O  O     . HOH R 5 .  ? 12.387  -32.745 -0.013  1.00 40.39 ? 101 HOH B O     1 
HETATM 3650 O  O     . HOH R 5 .  ? 11.752  -26.058 0.743   1.00 42.73 ? 102 HOH B O     1 
HETATM 3651 O  O     . HOH R 5 .  ? 14.828  -30.553 21.020  1.00 49.17 ? 103 HOH B O     1 
HETATM 3652 O  O     . HOH R 5 .  ? 9.503   -29.274 3.422   1.00 35.30 ? 104 HOH B O     1 
HETATM 3653 O  O     . HOH S 5 .  ? -5.942  -6.148  24.067  1.00 41.87 ? 503 HOH C O     1 
HETATM 3654 O  O     . HOH S 5 .  ? -11.268 -18.966 24.384  1.00 35.28 ? 504 HOH C O     1 
HETATM 3655 O  O     . HOH S 5 .  ? -4.998  -19.288 28.627  1.00 27.22 ? 505 HOH C O     1 
HETATM 3656 O  O     . HOH S 5 .  ? -15.290 -28.411 29.273  1.00 22.77 ? 506 HOH C O     1 
HETATM 3657 O  O     . HOH S 5 .  ? -5.061  -8.281  34.545  1.00 24.67 ? 507 HOH C O     1 
HETATM 3658 O  O     . HOH S 5 .  ? -3.746  -10.018 36.484  1.00 34.16 ? 508 HOH C O     1 
HETATM 3659 O  O     . HOH S 5 .  ? -8.154  -22.271 24.673  1.00 49.63 ? 509 HOH C O     1 
HETATM 3660 O  O     . HOH S 5 .  ? -13.747 -18.437 46.855  1.00 62.42 ? 510 HOH C O     1 
HETATM 3661 O  O     . HOH S 5 .  ? -18.729 -1.949  32.766  1.00 32.28 ? 511 HOH C O     1 
HETATM 3662 O  O     . HOH S 5 .  ? -18.375 -13.896 38.204  1.00 33.55 ? 512 HOH C O     1 
HETATM 3663 O  O     . HOH S 5 .  ? -2.383  -7.031  34.578  1.00 55.34 ? 513 HOH C O     1 
HETATM 3664 O  O     . HOH S 5 .  ? -28.723 -14.120 28.383  1.00 62.63 ? 514 HOH C O     1 
HETATM 3665 O  O     . HOH S 5 .  ? -17.518 -24.206 22.082  1.00 55.60 ? 515 HOH C O     1 
HETATM 3666 O  O     . HOH S 5 .  ? -17.415 -11.847 21.353  1.00 48.08 ? 516 HOH C O     1 
HETATM 3667 O  O     . HOH S 5 .  ? -15.246 -4.709  24.946  1.00 47.79 ? 517 HOH C O     1 
HETATM 3668 O  O     . HOH S 5 .  ? -23.391 -6.558  33.143  1.00 48.48 ? 518 HOH C O     1 
HETATM 3669 O  O     . HOH S 5 .  ? -16.883 -16.060 39.683  1.00 67.47 ? 519 HOH C O     1 
HETATM 3670 O  O     . HOH T 5 .  ? -15.435 25.746  7.386   1.00 57.96 ? 77  HOH F O     1 
HETATM 3671 O  O     . HOH T 5 .  ? -13.339 12.058  -0.626  1.00 29.14 ? 78  HOH F O     1 
HETATM 3672 O  O     . HOH T 5 .  ? -12.159 16.391  13.425  1.00 33.40 ? 79  HOH F O     1 
HETATM 3673 O  O     . HOH T 5 .  ? -10.109 9.494   19.204  1.00 33.11 ? 80  HOH F O     1 
HETATM 3674 O  O     . HOH T 5 .  ? -4.176  -1.998  2.556   1.00 68.12 ? 81  HOH F O     1 
HETATM 3675 O  O     . HOH T 5 .  ? -15.603 1.902   9.688   1.00 33.56 ? 82  HOH F O     1 
HETATM 3676 O  O     . HOH T 5 .  ? -1.047  3.355   -1.848  1.00 35.23 ? 83  HOH F O     1 
HETATM 3677 O  O     . HOH T 5 .  ? -14.644 1.442   -1.358  1.00 37.01 ? 84  HOH F O     1 
HETATM 3678 O  O     . HOH T 5 .  ? -11.334 4.241   -2.843  1.00 30.72 ? 85  HOH F O     1 
HETATM 3679 O  O     . HOH T 5 .  ? -6.620  1.258   0.048   1.00 33.71 ? 86  HOH F O     1 
HETATM 3680 O  O     . HOH T 5 .  ? -0.451  6.891   7.770   1.00 28.04 ? 87  HOH F O     1 
HETATM 3681 O  O     . HOH T 5 .  ? -1.147  5.188   -3.602  1.00 42.27 ? 88  HOH F O     1 
HETATM 3682 O  O     . HOH T 5 .  ? -16.381 2.370   4.305   1.00 45.60 ? 89  HOH F O     1 
HETATM 3683 O  O     . HOH T 5 .  ? 0.242   17.852  1.408   1.00 38.91 ? 90  HOH F O     1 
HETATM 3684 O  O     . HOH T 5 .  ? -17.101 2.598   7.250   1.00 34.91 ? 91  HOH F O     1 
HETATM 3685 O  O     . HOH T 5 .  ? -8.775  7.201   20.436  1.00 73.12 ? 92  HOH F O     1 
HETATM 3686 O  O     . HOH T 5 .  ? 1.942   16.990  10.279  1.00 47.06 ? 93  HOH F O     1 
HETATM 3687 O  O     . HOH T 5 .  ? 0.957   19.716  3.062   1.00 37.00 ? 94  HOH F O     1 
HETATM 3688 O  O     . HOH T 5 .  ? -9.378  8.682   -3.305  1.00 29.77 ? 95  HOH F O     1 
HETATM 3689 O  O     . HOH T 5 .  ? -16.940 10.206  5.694   1.00 57.79 ? 96  HOH F O     1 
HETATM 3690 O  O     . HOH T 5 .  ? 0.996   2.281   5.474   1.00 32.25 ? 97  HOH F O     1 
HETATM 3691 O  O     . HOH T 5 .  ? -9.886  23.035  12.416  1.00 34.54 ? 98  HOH F O     1 
HETATM 3692 O  O     . HOH T 5 .  ? 1.294   15.440  1.551   1.00 41.39 ? 99  HOH F O     1 
HETATM 3693 O  O     . HOH T 5 .  ? -10.882 16.335  15.911  1.00 53.89 ? 100 HOH F O     1 
HETATM 3694 O  O     . HOH T 5 .  ? -1.542  21.257  6.257   1.00 32.55 ? 101 HOH F O     1 
HETATM 3695 O  O     . HOH T 5 .  ? 2.707   14.997  3.899   1.00 30.13 ? 102 HOH F O     1 
HETATM 3696 O  O     . HOH T 5 .  ? -15.484 22.177  3.683   1.00 36.92 ? 103 HOH F O     1 
HETATM 3697 O  O     . HOH T 5 .  ? -1.225  24.503  5.445   1.00 43.91 ? 104 HOH F O     1 
HETATM 3698 O  O     . HOH T 5 .  ? -10.851 19.114  16.022  1.00 44.49 ? 105 HOH F O     1 
HETATM 3699 O  O     . HOH U 5 .  ? 9.523   9.049   -1.449  1.00 45.45 ? 77  HOH G O     1 
HETATM 3700 O  O     . HOH U 5 .  ? 30.470  6.733   14.235  1.00 24.86 ? 78  HOH G O     1 
HETATM 3701 O  O     . HOH U 5 .  ? 9.996   11.235  7.514   1.00 29.32 ? 79  HOH G O     1 
HETATM 3702 O  O     . HOH U 5 .  ? 14.274  -0.373  17.709  1.00 28.23 ? 80  HOH G O     1 
HETATM 3703 O  O     . HOH U 5 .  ? 16.039  13.508  20.518  1.00 26.35 ? 81  HOH G O     1 
HETATM 3704 O  O     . HOH U 5 .  ? 9.779   2.793   3.252   1.00 50.41 ? 82  HOH G O     1 
HETATM 3705 O  O     . HOH U 5 .  ? 29.590  3.749   13.103  1.00 38.97 ? 83  HOH G O     1 
HETATM 3706 O  O     . HOH U 5 .  ? 22.106  17.832  15.043  1.00 24.23 ? 84  HOH G O     1 
HETATM 3707 O  O     . HOH U 5 .  ? 14.771  11.090  20.467  1.00 33.65 ? 85  HOH G O     1 
HETATM 3708 O  O     . HOH U 5 .  ? 19.207  -1.034  1.987   1.00 23.68 ? 86  HOH G O     1 
HETATM 3709 O  O     . HOH U 5 .  ? 24.451  17.687  16.838  1.00 41.80 ? 87  HOH G O     1 
HETATM 3710 O  O     . HOH U 5 .  ? 14.884  2.471   22.316  1.00 36.97 ? 88  HOH G O     1 
HETATM 3711 O  O     . HOH U 5 .  ? 27.872  11.197  18.633  1.00 33.13 ? 89  HOH G O     1 
HETATM 3712 O  O     . HOH U 5 .  ? 23.765  -4.681  17.879  1.00 53.55 ? 90  HOH G O     1 
HETATM 3713 O  O     . HOH U 5 .  ? 20.855  13.036  24.562  1.00 42.31 ? 91  HOH G O     1 
HETATM 3714 O  O     . HOH U 5 .  ? 16.178  17.460  14.398  1.00 44.21 ? 92  HOH G O     1 
HETATM 3715 O  O     . HOH U 5 .  ? 5.215   -9.409  1.564   1.00 50.58 ? 93  HOH G O     1 
HETATM 3716 O  O     . HOH U 5 .  ? 16.935  0.354   25.249  1.00 49.73 ? 94  HOH G O     1 
HETATM 3717 O  O     . HOH U 5 .  ? 9.001   14.052  15.971  1.00 40.19 ? 95  HOH G O     1 
HETATM 3718 O  O     . HOH U 5 .  ? 20.987  15.428  23.132  1.00 61.03 ? 96  HOH G O     1 
HETATM 3719 O  O     . HOH U 5 .  ? 18.599  1.322   1.145   1.00 52.60 ? 97  HOH G O     1 
HETATM 3720 O  O     . HOH U 5 .  ? 21.325  4.443   27.030  1.00 30.22 ? 98  HOH G O     1 
HETATM 3721 O  O     . HOH V 5 .  ? -1.066  20.752  36.266  1.00 27.03 ? 77  HOH H O     1 
HETATM 3722 O  O     . HOH V 5 .  ? -6.492  21.964  36.471  1.00 38.65 ? 78  HOH H O     1 
HETATM 3723 O  O     . HOH V 5 .  ? 7.300   3.044   31.402  1.00 37.75 ? 79  HOH H O     1 
HETATM 3724 O  O     . HOH V 5 .  ? -9.547  23.255  36.455  1.00 41.83 ? 80  HOH H O     1 
HETATM 3725 O  O     . HOH V 5 .  ? -19.204 7.590   30.035  1.00 37.69 ? 81  HOH H O     1 
HETATM 3726 O  O     . HOH V 5 .  ? -2.763  0.892   29.261  1.00 67.10 ? 82  HOH H O     1 
HETATM 3727 O  O     . HOH V 5 .  ? -10.914 22.158  22.358  1.00 46.06 ? 83  HOH H O     1 
HETATM 3728 O  O     . HOH V 5 .  ? -20.249 25.930  33.365  1.00 41.61 ? 84  HOH H O     1 
HETATM 3729 O  O     . HOH V 5 .  ? -12.442 14.847  20.730  1.00 38.41 ? 85  HOH H O     1 
HETATM 3730 O  O     . HOH V 5 .  ? -2.780  12.603  38.007  1.00 38.86 ? 86  HOH H O     1 
HETATM 3731 O  O     . HOH V 5 .  ? -1.244  19.176  38.234  1.00 39.15 ? 87  HOH H O     1 
HETATM 3732 O  O     . HOH V 5 .  ? -16.192 18.288  21.903  1.00 41.10 ? 88  HOH H O     1 
HETATM 3733 O  O     . HOH V 5 .  ? -4.115  19.599  38.461  1.00 30.11 ? 89  HOH H O     1 
HETATM 3734 O  O     . HOH V 5 .  ? -6.721  0.605   35.299  1.00 42.18 ? 90  HOH H O     1 
HETATM 3735 O  O     . HOH V 5 .  ? 2.194   8.064   35.045  1.00 42.89 ? 91  HOH H O     1 
HETATM 3736 O  O     . HOH V 5 .  ? 2.200   7.157   32.654  1.00 16.86 ? 92  HOH H O     1 
HETATM 3737 O  O     . HOH V 5 .  ? -15.525 11.454  21.227  1.00 45.78 ? 93  HOH H O     1 
HETATM 3738 O  O     . HOH V 5 .  ? -22.442 10.278  25.888  1.00 48.92 ? 94  HOH H O     1 
HETATM 3739 O  O     . HOH V 5 .  ? -13.470 16.727  40.525  1.00 34.41 ? 95  HOH H O     1 
HETATM 3740 O  O     . HOH V 5 .  ? -16.031 7.586   21.844  1.00 34.40 ? 96  HOH H O     1 
HETATM 3741 O  O     . HOH V 5 .  ? -16.564 4.079   30.403  1.00 30.05 ? 97  HOH H O     1 
HETATM 3742 O  O     . HOH V 5 .  ? -15.848 24.164  25.987  1.00 38.92 ? 98  HOH H O     1 
HETATM 3743 O  O     . HOH V 5 .  ? -18.877 6.249   23.173  1.00 37.33 ? 99  HOH H O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  G   1  1  1  G   G   D . n 
A 1 2  A   2  2  2  A   A   D . n 
A 1 3  C   3  3  3  C   C   D . n 
A 1 4  A   4  4  4  A   A   D . n 
A 1 5  C   5  5  5  C   C   D . n 
A 1 6  C   6  6  6  C   C   D . n 
A 1 7  U   7  7  7  U   U   D . n 
A 1 8  G   8  8  8  G   G   D . n 
A 1 9  A   9  9  9  A   A   D . n 
A 1 10 U   10 10 10 U   U   D . n 
A 1 11 U   11 11 11 U   U   D . n 
A 1 12 C   12 12 12 C   C   D . n 
B 2 1  DG  1  1  1  DG  G   E . n 
B 2 2  DA  2  2  2  DA  A   E . n 
B 2 3  DA  3  3  3  DA  A   E . n 
B 2 4  DT  4  4  4  DT  T   E . n 
B 2 5  DC  5  5  5  DC  C   E . n 
B 2 6  DA  6  6  6  DA  A   E . n 
B 2 7  DG  7  7  7  DG  G   E . n 
B 2 8  DG  8  8  8  DG  G   E . n 
B 2 9  5IU 9  9  9  5IU 5IU E . n 
B 2 10 DG  10 10 10 DG  G   E . n 
B 2 11 DT  11 11 11 DT  T   E . n 
B 2 12 DC  12 12 12 DC  C   E . n 
C 1 1  G   1  1  1  G   G   I . n 
C 1 2  A   2  2  2  A   A   I . n 
C 1 3  C   3  3  3  C   C   I . n 
C 1 4  A   4  4  4  A   A   I . n 
C 1 5  C   5  5  5  C   C   I . n 
C 1 6  C   6  6  6  C   C   I . n 
C 1 7  U   7  7  7  U   U   I . n 
C 1 8  G   8  8  8  G   G   I . n 
C 1 9  A   9  9  9  A   A   I . n 
C 1 10 U   10 10 10 U   U   I . n 
C 1 11 U   11 11 11 U   U   I . n 
C 1 12 C   12 12 12 C   C   I . n 
D 2 1  DG  1  1  1  DG  G   J . n 
D 2 2  DA  2  2  2  DA  A   J . n 
D 2 3  DA  3  3  3  DA  A   J . n 
D 2 4  DT  4  4  4  DT  T   J . n 
D 2 5  DC  5  5  5  DC  C   J . n 
D 2 6  DA  6  6  6  DA  A   J . n 
D 2 7  DG  7  7  7  DG  G   J . n 
D 2 8  DG  8  8  8  DG  G   J . n 
D 2 9  5IU 9  9  9  5IU 5IU J . n 
D 2 10 DG  10 10 10 DG  G   J . n 
D 2 11 DT  11 11 11 DT  T   J . n 
D 2 12 DC  12 12 12 DC  C   J . n 
E 3 1  GLY 1  24 ?  ?   ?   A . n 
E 3 2  SER 2  25 ?  ?   ?   A . n 
E 3 3  HIS 3  26 26 HIS HIS A . n 
E 3 4  MET 4  27 27 MET MET A . n 
E 3 5  PHE 5  28 28 PHE PHE A . n 
E 3 6  TYR 6  29 29 TYR TYR A . n 
E 3 7  ALA 7  30 30 ALA ALA A . n 
E 3 8  VAL 8  31 31 VAL VAL A . n 
E 3 9  ARG 9  32 32 ARG ARG A . n 
E 3 10 ARG 10 33 33 ARG ARG A . n 
E 3 11 GLY 11 34 34 GLY GLY A . n 
E 3 12 ARG 12 35 35 ARG ARG A . n 
E 3 13 LYS 13 36 36 LYS LYS A . n 
E 3 14 THR 14 37 37 THR THR A . n 
E 3 15 GLY 15 38 38 GLY GLY A . n 
E 3 16 VAL 16 39 39 VAL VAL A . n 
E 3 17 PHE 17 40 40 PHE PHE A . n 
E 3 18 LEU 18 41 41 LEU LEU A . n 
E 3 19 THR 19 42 42 THR THR A . n 
E 3 20 TRP 20 43 43 TRP TRP A . n 
E 3 21 ASN 21 44 44 ASN ASN A . n 
E 3 22 GLU 22 45 45 GLU GLU A . n 
E 3 23 CYS 23 46 46 CYS CYS A . n 
E 3 24 ARG 24 47 47 ARG ARG A . n 
E 3 25 ALA 25 48 48 ALA ALA A . n 
E 3 26 GLN 26 49 49 GLN GLN A . n 
E 3 27 VAL 27 50 50 VAL VAL A . n 
E 3 28 ASP 28 51 51 ASP ASP A . n 
E 3 29 ARG 29 52 52 ARG ARG A . n 
E 3 30 PHE 30 53 53 PHE PHE A . n 
E 3 31 PRO 31 54 54 PRO PRO A . n 
E 3 32 ALA 32 55 55 ALA ALA A . n 
E 3 33 ALA 33 56 56 ALA ALA A . n 
E 3 34 ARG 34 57 57 ARG ARG A . n 
E 3 35 PHE 35 58 58 PHE PHE A . n 
E 3 36 LYS 36 59 59 LYS LYS A . n 
E 3 37 LYS 37 60 60 LYS LYS A . n 
E 3 38 PHE 38 61 61 PHE PHE A . n 
E 3 39 ALA 39 62 62 ALA ALA A . n 
E 3 40 THR 40 63 63 THR THR A . n 
E 3 41 GLU 41 64 64 GLU GLU A . n 
E 3 42 ASP 42 65 65 ASP ASP A . n 
E 3 43 GLU 43 66 66 GLU GLU A . n 
E 3 44 ALA 44 67 67 ALA ALA A . n 
E 3 45 TRP 45 68 68 TRP TRP A . n 
E 3 46 ALA 46 69 69 ALA ALA A . n 
E 3 47 PHE 47 70 70 PHE PHE A . n 
E 3 48 VAL 48 71 71 VAL VAL A . n 
E 3 49 ARG 49 72 72 ARG ARG A . n 
E 3 50 LYS 50 73 73 LYS LYS A . n 
E 3 51 SER 51 74 ?  ?   ?   A . n 
E 3 52 ALA 52 75 ?  ?   ?   A . n 
E 3 53 SER 53 76 ?  ?   ?   A . n 
F 3 1  GLY 1  24 ?  ?   ?   B . n 
F 3 2  SER 2  25 ?  ?   ?   B . n 
F 3 3  HIS 3  26 26 HIS HIS B . n 
F 3 4  MET 4  27 27 MET MET B . n 
F 3 5  PHE 5  28 28 PHE PHE B . n 
F 3 6  TYR 6  29 29 TYR TYR B . n 
F 3 7  ALA 7  30 30 ALA ALA B . n 
F 3 8  VAL 8  31 31 VAL VAL B . n 
F 3 9  ARG 9  32 32 ARG ARG B . n 
F 3 10 ARG 10 33 33 ARG ARG B . n 
F 3 11 GLY 11 34 34 GLY GLY B . n 
F 3 12 ARG 12 35 35 ARG ARG B . n 
F 3 13 LYS 13 36 36 LYS LYS B . n 
F 3 14 THR 14 37 37 THR THR B . n 
F 3 15 GLY 15 38 38 GLY GLY B . n 
F 3 16 VAL 16 39 39 VAL VAL B . n 
F 3 17 PHE 17 40 40 PHE PHE B . n 
F 3 18 LEU 18 41 41 LEU LEU B . n 
F 3 19 THR 19 42 42 THR THR B . n 
F 3 20 TRP 20 43 43 TRP TRP B . n 
F 3 21 ASN 21 44 44 ASN ASN B . n 
F 3 22 GLU 22 45 45 GLU GLU B . n 
F 3 23 CYS 23 46 46 CYS CYS B . n 
F 3 24 ARG 24 47 47 ARG ARG B . n 
F 3 25 ALA 25 48 48 ALA ALA B . n 
F 3 26 GLN 26 49 49 GLN GLN B . n 
F 3 27 VAL 27 50 50 VAL VAL B . n 
F 3 28 ASP 28 51 51 ASP ASP B . n 
F 3 29 ARG 29 52 52 ARG ARG B . n 
F 3 30 PHE 30 53 53 PHE PHE B . n 
F 3 31 PRO 31 54 54 PRO PRO B . n 
F 3 32 ALA 32 55 55 ALA ALA B . n 
F 3 33 ALA 33 56 56 ALA ALA B . n 
F 3 34 ARG 34 57 57 ARG ARG B . n 
F 3 35 PHE 35 58 58 PHE PHE B . n 
F 3 36 LYS 36 59 59 LYS LYS B . n 
F 3 37 LYS 37 60 60 LYS LYS B . n 
F 3 38 PHE 38 61 61 PHE PHE B . n 
F 3 39 ALA 39 62 62 ALA ALA B . n 
F 3 40 THR 40 63 63 THR THR B . n 
F 3 41 GLU 41 64 64 GLU GLU B . n 
F 3 42 ASP 42 65 65 ASP ASP B . n 
F 3 43 GLU 43 66 66 GLU GLU B . n 
F 3 44 ALA 44 67 67 ALA ALA B . n 
F 3 45 TRP 45 68 68 TRP TRP B . n 
F 3 46 ALA 46 69 69 ALA ALA B . n 
F 3 47 PHE 47 70 70 PHE PHE B . n 
F 3 48 VAL 48 71 71 VAL VAL B . n 
F 3 49 ARG 49 72 72 ARG ARG B . n 
F 3 50 LYS 50 73 73 LYS LYS B . n 
F 3 51 SER 51 74 ?  ?   ?   B . n 
F 3 52 ALA 52 75 ?  ?   ?   B . n 
F 3 53 SER 53 76 ?  ?   ?   B . n 
G 3 1  GLY 1  24 ?  ?   ?   C . n 
G 3 2  SER 2  25 ?  ?   ?   C . n 
G 3 3  HIS 3  26 ?  ?   ?   C . n 
G 3 4  MET 4  27 27 MET MET C . n 
G 3 5  PHE 5  28 28 PHE PHE C . n 
G 3 6  TYR 6  29 29 TYR TYR C . n 
G 3 7  ALA 7  30 30 ALA ALA C . n 
G 3 8  VAL 8  31 31 VAL VAL C . n 
G 3 9  ARG 9  32 32 ARG ARG C . n 
G 3 10 ARG 10 33 33 ARG ARG C . n 
G 3 11 GLY 11 34 34 GLY GLY C . n 
G 3 12 ARG 12 35 35 ARG ARG C . n 
G 3 13 LYS 13 36 36 LYS LYS C . n 
G 3 14 THR 14 37 37 THR THR C . n 
G 3 15 GLY 15 38 38 GLY GLY C . n 
G 3 16 VAL 16 39 39 VAL VAL C . n 
G 3 17 PHE 17 40 40 PHE PHE C . n 
G 3 18 LEU 18 41 41 LEU LEU C . n 
G 3 19 THR 19 42 42 THR THR C . n 
G 3 20 TRP 20 43 43 TRP TRP C . n 
G 3 21 ASN 21 44 44 ASN ASN C . n 
G 3 22 GLU 22 45 45 GLU GLU C . n 
G 3 23 CYS 23 46 46 CYS CYS C . n 
G 3 24 ARG 24 47 47 ARG ARG C . n 
G 3 25 ALA 25 48 48 ALA ALA C . n 
G 3 26 GLN 26 49 49 GLN GLN C . n 
G 3 27 VAL 27 50 50 VAL VAL C . n 
G 3 28 ASP 28 51 51 ASP ASP C . n 
G 3 29 ARG 29 52 52 ARG ARG C . n 
G 3 30 PHE 30 53 53 PHE PHE C . n 
G 3 31 PRO 31 54 54 PRO PRO C . n 
G 3 32 ALA 32 55 55 ALA ALA C . n 
G 3 33 ALA 33 56 56 ALA ALA C . n 
G 3 34 ARG 34 57 57 ARG ARG C . n 
G 3 35 PHE 35 58 58 PHE PHE C . n 
G 3 36 LYS 36 59 59 LYS LYS C . n 
G 3 37 LYS 37 60 60 LYS LYS C . n 
G 3 38 PHE 38 61 61 PHE PHE C . n 
G 3 39 ALA 39 62 62 ALA ALA C . n 
G 3 40 THR 40 63 63 THR THR C . n 
G 3 41 GLU 41 64 64 GLU GLU C . n 
G 3 42 ASP 42 65 65 ASP ASP C . n 
G 3 43 GLU 43 66 66 GLU GLU C . n 
G 3 44 ALA 44 67 67 ALA ALA C . n 
G 3 45 TRP 45 68 68 TRP TRP C . n 
G 3 46 ALA 46 69 69 ALA ALA C . n 
G 3 47 PHE 47 70 70 PHE PHE C . n 
G 3 48 VAL 48 71 71 VAL VAL C . n 
G 3 49 ARG 49 72 72 ARG ARG C . n 
G 3 50 LYS 50 73 73 LYS LYS C . n 
G 3 51 SER 51 74 74 SER SER C . n 
G 3 52 ALA 52 75 ?  ?   ?   C . n 
G 3 53 SER 53 76 ?  ?   ?   C . n 
H 3 1  GLY 1  24 ?  ?   ?   F . n 
H 3 2  SER 2  25 25 SER SER F . n 
H 3 3  HIS 3  26 26 HIS HIS F . n 
H 3 4  MET 4  27 27 MET MET F . n 
H 3 5  PHE 5  28 28 PHE PHE F . n 
H 3 6  TYR 6  29 29 TYR TYR F . n 
H 3 7  ALA 7  30 30 ALA ALA F . n 
H 3 8  VAL 8  31 31 VAL VAL F . n 
H 3 9  ARG 9  32 32 ARG ARG F . n 
H 3 10 ARG 10 33 33 ARG ARG F . n 
H 3 11 GLY 11 34 34 GLY GLY F . n 
H 3 12 ARG 12 35 35 ARG ARG F . n 
H 3 13 LYS 13 36 36 LYS LYS F . n 
H 3 14 THR 14 37 37 THR THR F . n 
H 3 15 GLY 15 38 38 GLY GLY F . n 
H 3 16 VAL 16 39 39 VAL VAL F . n 
H 3 17 PHE 17 40 40 PHE PHE F . n 
H 3 18 LEU 18 41 41 LEU LEU F . n 
H 3 19 THR 19 42 42 THR THR F . n 
H 3 20 TRP 20 43 43 TRP TRP F . n 
H 3 21 ASN 21 44 44 ASN ASN F . n 
H 3 22 GLU 22 45 45 GLU GLU F . n 
H 3 23 CYS 23 46 46 CYS CYS F . n 
H 3 24 ARG 24 47 47 ARG ARG F . n 
H 3 25 ALA 25 48 48 ALA ALA F . n 
H 3 26 GLN 26 49 49 GLN GLN F . n 
H 3 27 VAL 27 50 50 VAL VAL F . n 
H 3 28 ASP 28 51 51 ASP ASP F . n 
H 3 29 ARG 29 52 52 ARG ARG F . n 
H 3 30 PHE 30 53 53 PHE PHE F . n 
H 3 31 PRO 31 54 54 PRO PRO F . n 
H 3 32 ALA 32 55 55 ALA ALA F . n 
H 3 33 ALA 33 56 56 ALA ALA F . n 
H 3 34 ARG 34 57 57 ARG ARG F . n 
H 3 35 PHE 35 58 58 PHE PHE F . n 
H 3 36 LYS 36 59 59 LYS LYS F . n 
H 3 37 LYS 37 60 60 LYS LYS F . n 
H 3 38 PHE 38 61 61 PHE PHE F . n 
H 3 39 ALA 39 62 62 ALA ALA F . n 
H 3 40 THR 40 63 63 THR THR F . n 
H 3 41 GLU 41 64 64 GLU GLU F . n 
H 3 42 ASP 42 65 65 ASP ASP F . n 
H 3 43 GLU 43 66 66 GLU GLU F . n 
H 3 44 ALA 44 67 67 ALA ALA F . n 
H 3 45 TRP 45 68 68 TRP TRP F . n 
H 3 46 ALA 46 69 69 ALA ALA F . n 
H 3 47 PHE 47 70 70 PHE PHE F . n 
H 3 48 VAL 48 71 71 VAL VAL F . n 
H 3 49 ARG 49 72 72 ARG ARG F . n 
H 3 50 LYS 50 73 73 LYS LYS F . n 
H 3 51 SER 51 74 ?  ?   ?   F . n 
H 3 52 ALA 52 75 ?  ?   ?   F . n 
H 3 53 SER 53 76 ?  ?   ?   F . n 
I 3 1  GLY 1  24 24 GLY GLY G . n 
I 3 2  SER 2  25 25 SER SER G . n 
I 3 3  HIS 3  26 26 HIS HIS G . n 
I 3 4  MET 4  27 27 MET MET G . n 
I 3 5  PHE 5  28 28 PHE PHE G . n 
I 3 6  TYR 6  29 29 TYR TYR G . n 
I 3 7  ALA 7  30 30 ALA ALA G . n 
I 3 8  VAL 8  31 31 VAL VAL G . n 
I 3 9  ARG 9  32 32 ARG ARG G . n 
I 3 10 ARG 10 33 33 ARG ARG G . n 
I 3 11 GLY 11 34 34 GLY GLY G . n 
I 3 12 ARG 12 35 35 ARG ARG G . n 
I 3 13 LYS 13 36 36 LYS LYS G . n 
I 3 14 THR 14 37 37 THR THR G . n 
I 3 15 GLY 15 38 38 GLY GLY G . n 
I 3 16 VAL 16 39 39 VAL VAL G . n 
I 3 17 PHE 17 40 40 PHE PHE G . n 
I 3 18 LEU 18 41 41 LEU LEU G . n 
I 3 19 THR 19 42 42 THR THR G . n 
I 3 20 TRP 20 43 43 TRP TRP G . n 
I 3 21 ASN 21 44 44 ASN ASN G . n 
I 3 22 GLU 22 45 45 GLU GLU G . n 
I 3 23 CYS 23 46 46 CYS CYS G . n 
I 3 24 ARG 24 47 47 ARG ARG G . n 
I 3 25 ALA 25 48 48 ALA ALA G . n 
I 3 26 GLN 26 49 49 GLN GLN G . n 
I 3 27 VAL 27 50 50 VAL VAL G . n 
I 3 28 ASP 28 51 51 ASP ASP G . n 
I 3 29 ARG 29 52 52 ARG ARG G . n 
I 3 30 PHE 30 53 53 PHE PHE G . n 
I 3 31 PRO 31 54 54 PRO PRO G . n 
I 3 32 ALA 32 55 55 ALA ALA G . n 
I 3 33 ALA 33 56 56 ALA ALA G . n 
I 3 34 ARG 34 57 57 ARG ARG G . n 
I 3 35 PHE 35 58 58 PHE PHE G . n 
I 3 36 LYS 36 59 59 LYS LYS G . n 
I 3 37 LYS 37 60 60 LYS LYS G . n 
I 3 38 PHE 38 61 61 PHE PHE G . n 
I 3 39 ALA 39 62 62 ALA ALA G . n 
I 3 40 THR 40 63 63 THR THR G . n 
I 3 41 GLU 41 64 64 GLU GLU G . n 
I 3 42 ASP 42 65 65 ASP ASP G . n 
I 3 43 GLU 43 66 66 GLU GLU G . n 
I 3 44 ALA 44 67 67 ALA ALA G . n 
I 3 45 TRP 45 68 68 TRP TRP G . n 
I 3 46 ALA 46 69 69 ALA ALA G . n 
I 3 47 PHE 47 70 70 PHE PHE G . n 
I 3 48 VAL 48 71 71 VAL VAL G . n 
I 3 49 ARG 49 72 72 ARG ARG G . n 
I 3 50 LYS 50 73 73 LYS LYS G . n 
I 3 51 SER 51 74 ?  ?   ?   G . n 
I 3 52 ALA 52 75 ?  ?   ?   G . n 
I 3 53 SER 53 76 ?  ?   ?   G . n 
J 3 1  GLY 1  24 ?  ?   ?   H . n 
J 3 2  SER 2  25 ?  ?   ?   H . n 
J 3 3  HIS 3  26 26 HIS HIS H . n 
J 3 4  MET 4  27 27 MET MET H . n 
J 3 5  PHE 5  28 28 PHE PHE H . n 
J 3 6  TYR 6  29 29 TYR TYR H . n 
J 3 7  ALA 7  30 30 ALA ALA H . n 
J 3 8  VAL 8  31 31 VAL VAL H . n 
J 3 9  ARG 9  32 32 ARG ARG H . n 
J 3 10 ARG 10 33 33 ARG ARG H . n 
J 3 11 GLY 11 34 34 GLY GLY H . n 
J 3 12 ARG 12 35 35 ARG ARG H . n 
J 3 13 LYS 13 36 36 LYS LYS H . n 
J 3 14 THR 14 37 37 THR THR H . n 
J 3 15 GLY 15 38 38 GLY GLY H . n 
J 3 16 VAL 16 39 39 VAL VAL H . n 
J 3 17 PHE 17 40 40 PHE PHE H . n 
J 3 18 LEU 18 41 41 LEU LEU H . n 
J 3 19 THR 19 42 42 THR THR H . n 
J 3 20 TRP 20 43 43 TRP TRP H . n 
J 3 21 ASN 21 44 44 ASN ASN H . n 
J 3 22 GLU 22 45 45 GLU GLU H . n 
J 3 23 CYS 23 46 46 CYS CYS H . n 
J 3 24 ARG 24 47 47 ARG ARG H . n 
J 3 25 ALA 25 48 48 ALA ALA H . n 
J 3 26 GLN 26 49 49 GLN GLN H . n 
J 3 27 VAL 27 50 50 VAL VAL H . n 
J 3 28 ASP 28 51 51 ASP ASP H . n 
J 3 29 ARG 29 52 52 ARG ARG H . n 
J 3 30 PHE 30 53 53 PHE PHE H . n 
J 3 31 PRO 31 54 54 PRO PRO H . n 
J 3 32 ALA 32 55 55 ALA ALA H . n 
J 3 33 ALA 33 56 56 ALA ALA H . n 
J 3 34 ARG 34 57 57 ARG ARG H . n 
J 3 35 PHE 35 58 58 PHE PHE H . n 
J 3 36 LYS 36 59 59 LYS LYS H . n 
J 3 37 LYS 37 60 60 LYS LYS H . n 
J 3 38 PHE 38 61 61 PHE PHE H . n 
J 3 39 ALA 39 62 62 ALA ALA H . n 
J 3 40 THR 40 63 63 THR THR H . n 
J 3 41 GLU 41 64 64 GLU GLU H . n 
J 3 42 ASP 42 65 65 ASP ASP H . n 
J 3 43 GLU 43 66 66 GLU GLU H . n 
J 3 44 ALA 44 67 67 ALA ALA H . n 
J 3 45 TRP 45 68 68 TRP TRP H . n 
J 3 46 ALA 46 69 69 ALA ALA H . n 
J 3 47 PHE 47 70 70 PHE PHE H . n 
J 3 48 VAL 48 71 71 VAL VAL H . n 
J 3 49 ARG 49 72 72 ARG ARG H . n 
J 3 50 LYS 50 73 ?  ?   ?   H . n 
J 3 51 SER 51 74 ?  ?   ?   H . n 
J 3 52 ALA 52 75 ?  ?   ?   H . n 
J 3 53 SER 53 76 ?  ?   ?   H . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 B 5IU 9 E 5IU 9 ? DU "5-IODO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" 
2 D 5IU 9 J 5IU 9 ? DU "5-IODO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? pentameric 5 
2 author_defined_assembly ? pentameric 5 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F,G,K,L,M,N,Q,R,S 
2 1 C,D,H,I,J,O,P,T,U,V     
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-03-25 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHASER phasing          .   ? 1 
CNS    refinement       1.1 ? 2 
XDS    'data reduction' .   ? 3 
XDS    'data scaling'   .   ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 HIS G 26 ? ? -140.77 57.60  
2 1 ARG H 52 ? ? 58.06   19.54  
3 1 LYS H 59 ? ? -173.65 144.84 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 C SER 74 ? OG  ? G SER 51 OG  
2 1 Y 1 F SER 25 ? OG  ? H SER 2  OG  
3 1 Y 1 H HIS 26 ? CG  ? J HIS 3  CG  
4 1 Y 1 H HIS 26 ? ND1 ? J HIS 3  ND1 
5 1 Y 1 H HIS 26 ? CD2 ? J HIS 3  CD2 
6 1 Y 1 H HIS 26 ? CE1 ? J HIS 3  CE1 
7 1 Y 1 H HIS 26 ? NE2 ? J HIS 3  NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 24 ? E GLY 1  
2  1 Y 1 A SER 25 ? E SER 2  
3  1 Y 1 A SER 74 ? E SER 51 
4  1 Y 1 A ALA 75 ? E ALA 52 
5  1 Y 1 A SER 76 ? E SER 53 
6  1 Y 1 B GLY 24 ? F GLY 1  
7  1 Y 1 B SER 25 ? F SER 2  
8  1 Y 1 B SER 74 ? F SER 51 
9  1 Y 1 B ALA 75 ? F ALA 52 
10 1 Y 1 B SER 76 ? F SER 53 
11 1 Y 1 C GLY 24 ? G GLY 1  
12 1 Y 1 C SER 25 ? G SER 2  
13 1 Y 1 C HIS 26 ? G HIS 3  
14 1 Y 1 C ALA 75 ? G ALA 52 
15 1 Y 1 C SER 76 ? G SER 53 
16 1 Y 1 F GLY 24 ? H GLY 1  
17 1 Y 1 F SER 74 ? H SER 51 
18 1 Y 1 F ALA 75 ? H ALA 52 
19 1 Y 1 F SER 76 ? H SER 53 
20 1 Y 1 G SER 74 ? I SER 51 
21 1 Y 1 G ALA 75 ? I ALA 52 
22 1 Y 1 G SER 76 ? I SER 53 
23 1 Y 1 H GLY 24 ? J GLY 1  
24 1 Y 1 H SER 25 ? J SER 2  
25 1 Y 1 H LYS 73 ? J LYS 50 
26 1 Y 1 H SER 74 ? J SER 51 
27 1 Y 1 H ALA 75 ? J ALA 52 
28 1 Y 1 H SER 76 ? J SER 53 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
3BSU 'double helix'         
3BSU 'a-form double helix'  
3BSU 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG  1  1_555 A C 12 1_555 -0.190 -0.304 -0.187 -7.485  -10.053 2.085  1  E_DG1:C12_D E 1  ? D 12 ? 19 1 
1 B DA  2  1_555 A U 11 1_555 0.054  -0.364 -0.054 -4.147  -7.293  1.612  2  E_DA2:U11_D E 2  ? D 11 ? 20 1 
1 B DA  3  1_555 A U 10 1_555 0.312  -0.152 0.319  2.451   -10.676 -1.985 3  E_DA3:U10_D E 3  ? D 10 ? 20 1 
1 B DT  4  1_555 A A 9  1_555 -0.136 -0.153 0.056  4.017   -14.292 -1.335 4  E_DT4:A9_D  E 4  ? D 9  ? 20 1 
1 B DC  5  1_555 A G 8  1_555 0.043  -0.052 0.020  6.989   -14.844 3.089  5  E_DC5:G8_D  E 5  ? D 8  ? 19 1 
1 B DA  6  1_555 A U 7  1_555 0.062  0.038  0.203  0.426   -14.535 3.146  6  E_DA6:U7_D  E 6  ? D 7  ? 20 1 
1 B DG  7  1_555 A C 6  1_555 -0.229 -0.131 0.037  0.589   -13.108 -1.143 7  E_DG7:C6_D  E 7  ? D 6  ? 19 1 
1 B DG  8  1_555 A C 5  1_555 -0.447 -0.196 -0.068 -5.699  -10.266 2.656  8  E_DG8:C5_D  E 8  ? D 5  ? 19 1 
1 B 5IU 9  1_555 A A 4  1_555 -0.563 -0.217 -0.025 0.512   -12.518 1.426  9  E_5IU9:A4_D E 9  ? D 4  ? 20 1 
1 B DG  10 1_555 A C 3  1_555 -0.304 -0.337 0.138  -1.384  -9.591  -0.331 10 E_DG10:C3_D E 10 ? D 3  ? 19 1 
1 B DT  11 1_555 A A 2  1_555 0.115  -0.289 0.124  3.667   -12.676 3.175  11 E_DT11:A2_D E 11 ? D 2  ? 20 1 
1 B DC  12 1_555 A G 1  1_555 0.401  -0.340 0.175  4.006   -8.608  3.225  12 E_DC12:G1_D E 12 ? D 1  ? 19 1 
1 D DG  1  1_555 C C 12 1_555 -0.217 -0.292 -0.075 -5.165  -9.630  2.461  13 J_DG1:C12_I J 1  ? I 12 ? 19 1 
1 D DA  2  1_555 C U 11 1_555 0.305  -0.195 0.127  -0.501  -8.767  2.245  14 J_DA2:U11_I J 2  ? I 11 ? 20 1 
1 D DA  3  1_555 C U 10 1_555 -0.163 0.091  0.335  1.671   -11.767 1.711  15 J_DA3:U10_I J 3  ? I 10 ? 20 1 
1 D DT  4  1_555 C A 9  1_555 -0.244 0.006  0.231  2.555   -13.667 3.805  16 J_DT4:A9_I  J 4  ? I 9  ? 20 1 
1 D DC  5  1_555 C G 8  1_555 0.366  -0.132 0.047  6.179   -15.534 2.938  17 J_DC5:G8_I  J 5  ? I 8  ? 19 1 
1 D DG  7  1_555 C C 6  1_555 -0.057 -0.243 0.273  3.478   -8.583  -3.028 18 J_DG7:C6_I  J 7  ? I 6  ? 19 1 
1 D DG  8  1_555 C C 5  1_555 -0.198 -0.222 -0.166 -11.673 -11.934 0.676  19 J_DG8:C5_I  J 8  ? I 5  ? 19 1 
1 D 5IU 9  1_555 C A 4  1_555 0.237  -0.242 -0.062 -3.197  -13.830 -2.721 20 J_5IU9:A4_I J 9  ? I 4  ? 20 1 
1 D DG  10 1_555 C C 3  1_555 -0.095 -0.106 0.181  -4.559  -7.022  -0.286 21 J_DG10:C3_I J 10 ? I 3  ? 19 1 
1 D DT  11 1_555 C A 2  1_555 -0.169 -0.323 0.249  -0.014  -12.129 -1.477 22 J_DT11:A2_I J 11 ? I 2  ? 20 1 
1 D DC  12 1_555 C G 1  1_555 0.253  -0.337 0.112  6.454   -8.092  -2.656 23 J_DC12:G1_I J 12 ? I 1  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG  1  1_555 A C 12 1_555 B DA  2  1_555 A U 11 1_555 -0.108 -1.593 3.150 -1.796 8.282  32.817 -3.944 -0.077 2.682 14.363  
3.115  33.865  1  EE_DG1DA2:U11C12_DD E 1  ? D 12 ? E 2  ? D 11 ? 
1 B DA  2  1_555 A U 11 1_555 B DA  3  1_555 A U 10 1_555 -0.344 -1.214 3.023 -2.245 4.145  33.503 -2.692 0.262  2.873 7.146   
3.871  33.824  2  EE_DA2DA3:U10U11_DD E 2  ? D 11 ? E 3  ? D 10 ? 
1 B DA  3  1_555 A U 10 1_555 B DT  4  1_555 A A 9  1_555 -0.270 -1.251 3.252 2.101  7.506  28.617 -3.940 0.946  2.814 14.841  
-4.154 29.638  3  EE_DA3DT4:A9U10_DD  E 3  ? D 10 ? E 4  ? D 9  ? 
1 B DT  4  1_555 A A 9  1_555 B DC  5  1_555 A G 8  1_555 0.700  -1.057 3.188 2.535  6.655  32.937 -2.856 -0.815 2.968 11.569  
-4.407 33.677  4  EE_DT4DC5:G8A9_DD   E 4  ? D 9  ? E 5  ? D 8  ? 
1 B DC  5  1_555 A G 8  1_555 B DA  6  1_555 A U 7  1_555 -0.172 -1.481 3.276 -2.361 12.251 32.744 -4.176 -0.044 2.580 20.813  
4.011  34.979  5  EE_DC5DA6:U7G8_DD   E 5  ? D 8  ? E 6  ? D 7  ? 
1 B DA  6  1_555 A U 7  1_555 B DG  7  1_555 A C 6  1_555 -0.368 -1.370 3.106 1.144  10.729 29.918 -4.233 0.857  2.465 19.983  
-2.132 31.762  6  EE_DA6DG7:C6U7_DD   E 6  ? D 7  ? E 7  ? D 6  ? 
1 B DG  7  1_555 A C 6  1_555 B DG  8  1_555 A C 5  1_555 0.674  -1.698 3.380 -0.021 12.204 31.239 -4.840 -1.173 2.555 21.656  
0.036  33.483  7  EE_DG7DG8:C5C6_DD   E 7  ? D 6  ? E 8  ? D 5  ? 
1 B DG  8  1_555 A C 5  1_555 B 5IU 9  1_555 A A 4  1_555 -0.784 -1.374 3.128 -0.254 5.740  31.759 -3.412 1.369  2.848 10.383  
0.460  32.261  8  EE_DG85IU9:A4C5_DD  E 8  ? D 5  ? E 9  ? D 4  ? 
1 B 5IU 9  1_555 A A 4  1_555 B DG  10 1_555 A C 3  1_555 0.025  -1.334 3.220 -3.432 12.368 31.524 -4.088 -0.544 2.518 21.674  
6.014  33.975  9  EE_5IU9DG10:C3A4_DD E 9  ? D 4  ? E 10 ? D 3  ? 
1 B DG  10 1_555 A C 3  1_555 B DT  11 1_555 A A 2  1_555 0.426  -1.483 3.097 1.885  3.720  33.059 -3.160 -0.453 2.937 6.505   
-3.296 33.314  10 EE_DG10DT11:A2C3_DD E 10 ? D 3  ? E 11 ? D 2  ? 
1 B DT  11 1_555 A A 2  1_555 B DC  12 1_555 A G 1  1_555 0.008  -1.602 3.162 -0.192 4.780  36.746 -3.121 -0.036 2.938 7.543   
0.302  37.045  11 EE_DT11DC12:G1A2_DD E 11 ? D 2  ? E 12 ? D 1  ? 
1 B DC  12 1_555 A G 1  1_555 D DG  1  1_555 C C 12 1_555 -0.321 -3.775 3.435 1.898  10.659 -9.234 -0.375 1.485  5.100 -48.885 
8.705  -14.221 12 EJ_DC12DG1:C12G1_ID E 12 ? D 1  ? J 1  ? I 12 ? 
1 D DG  1  1_555 C C 12 1_555 D DA  2  1_555 C U 11 1_555 -0.146 -1.401 3.106 -2.527 7.592  33.888 -3.391 -0.104 2.742 12.804  
4.261  34.792  13 JJ_DG1DA2:U11C12_II J 1  ? I 12 ? J 2  ? I 11 ? 
1 D DA  2  1_555 C U 11 1_555 D DA  3  1_555 C U 10 1_555 -0.172 -1.420 3.025 -1.543 4.984  30.759 -3.487 0.058  2.772 9.313   
2.884  31.188  14 JJ_DA2DA3:U10U11_II J 2  ? I 11 ? J 3  ? I 10 ? 
1 D DA  3  1_555 C U 10 1_555 D DT  4  1_555 C A 9  1_555 0.197  -1.256 3.232 2.120  8.369  29.338 -3.942 0.022  2.783 16.090  
-4.076 30.555  15 JJ_DA3DT4:A9U10_II  J 3  ? I 10 ? J 4  ? I 9  ? 
1 D DT  4  1_555 C A 9  1_555 D DC  5  1_555 C G 8  1_555 0.261  -0.964 3.132 3.758  7.248  36.391 -2.407 0.057  2.905 11.430  
-5.926 37.266  16 JJ_DT4DC5:G8A9_II   J 4  ? I 9  ? J 5  ? I 8  ? 
1 D DC  5  1_555 C G 8  1_555 D DG  7  1_555 C C 6  1_555 0.036  -3.037 6.062 -0.886 21.684 60.972 -4.448 -0.099 4.849 20.681  
0.845  64.367  17 JJ_DC5DG7:C6G8_II   J 5  ? I 8  ? J 7  ? I 6  ? 
1 D DG  7  1_555 C C 6  1_555 D DG  8  1_555 C C 5  1_555 0.518  -1.968 3.641 5.241  11.834 32.182 -5.176 -0.043 2.812 20.351  
-9.012 34.623  18 JJ_DG7DG8:C5C6_II   J 7  ? I 6  ? J 8  ? I 5  ? 
1 D DG  8  1_555 C C 5  1_555 D 5IU 9  1_555 C A 4  1_555 -0.530 -1.443 3.057 -0.120 6.402  34.519 -3.253 0.863  2.756 10.674  
0.200  35.090  19 JJ_DG85IU9:A4C5_II  J 8  ? I 5  ? J 9  ? I 4  ? 
1 D 5IU 9  1_555 C A 4  1_555 D DG  10 1_555 C C 3  1_555 0.307  -1.298 3.245 -1.226 10.831 28.742 -4.414 -0.802 2.583 20.894  
2.365  30.699  20 JJ_5IU9DG10:C3A4_II J 9  ? I 4  ? J 10 ? I 3  ? 
1 D DG  10 1_555 C C 3  1_555 D DT  11 1_555 C A 2  1_555 -0.157 -1.182 3.246 0.194  5.187  30.806 -3.144 0.327  3.011 9.678   
-0.361 31.229  21 JJ_DG10DT11:A2C3_II J 10 ? I 3  ? J 11 ? I 2  ? 
1 D DT  11 1_555 C A 2  1_555 D DC  12 1_555 C G 1  1_555 0.637  -1.341 3.012 1.879  7.794  38.281 -2.836 -0.752 2.725 11.729  
-2.827 39.081  22 JJ_DT11DC12:G1A2_II J 11 ? I 2  ? J 12 ? I 1  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MAGNESIUM ION' MG  
5 water           HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
K 4 MG  1  501 501 MG  MG  A . 
L 4 MG  1  502 502 MG  MG  C . 
M 5 HOH 1  13  55  HOH HOH D . 
M 5 HOH 2  14  93  HOH HOH D . 
M 5 HOH 3  15  8   HOH HOH D . 
M 5 HOH 4  16  21  HOH HOH D . 
M 5 HOH 5  17  24  HOH HOH D . 
M 5 HOH 6  18  26  HOH HOH D . 
M 5 HOH 7  19  27  HOH HOH D . 
M 5 HOH 8  20  29  HOH HOH D . 
M 5 HOH 9  21  31  HOH HOH D . 
M 5 HOH 10 22  39  HOH HOH D . 
M 5 HOH 11 23  44  HOH HOH D . 
M 5 HOH 12 24  52  HOH HOH D . 
M 5 HOH 13 25  58  HOH HOH D . 
M 5 HOH 14 26  59  HOH HOH D . 
M 5 HOH 15 27  62  HOH HOH D . 
M 5 HOH 16 28  63  HOH HOH D . 
M 5 HOH 17 29  77  HOH HOH D . 
M 5 HOH 18 30  80  HOH HOH D . 
M 5 HOH 19 31  85  HOH HOH D . 
M 5 HOH 20 32  106 HOH HOH D . 
M 5 HOH 21 33  110 HOH HOH D . 
M 5 HOH 22 34  114 HOH HOH D . 
M 5 HOH 23 35  115 HOH HOH D . 
M 5 HOH 24 36  123 HOH HOH D . 
M 5 HOH 25 37  128 HOH HOH D . 
M 5 HOH 26 38  136 HOH HOH D . 
M 5 HOH 27 39  141 HOH HOH D . 
M 5 HOH 28 40  142 HOH HOH D . 
M 5 HOH 29 41  146 HOH HOH D . 
M 5 HOH 30 42  150 HOH HOH D . 
M 5 HOH 31 43  155 HOH HOH D . 
M 5 HOH 32 44  165 HOH HOH D . 
M 5 HOH 33 45  185 HOH HOH D . 
M 5 HOH 34 46  187 HOH HOH D . 
M 5 HOH 35 47  205 HOH HOH D . 
M 5 HOH 36 48  212 HOH HOH D . 
M 5 HOH 37 49  227 HOH HOH D . 
M 5 HOH 38 50  235 HOH HOH D . 
M 5 HOH 39 51  243 HOH HOH D . 
N 5 HOH 1  13  20  HOH HOH E . 
N 5 HOH 2  14  38  HOH HOH E . 
N 5 HOH 3  15  86  HOH HOH E . 
N 5 HOH 4  16  105 HOH HOH E . 
N 5 HOH 5  17  107 HOH HOH E . 
N 5 HOH 6  18  116 HOH HOH E . 
N 5 HOH 7  19  129 HOH HOH E . 
N 5 HOH 8  20  130 HOH HOH E . 
N 5 HOH 9  21  139 HOH HOH E . 
N 5 HOH 10 22  151 HOH HOH E . 
N 5 HOH 11 23  171 HOH HOH E . 
N 5 HOH 12 24  191 HOH HOH E . 
N 5 HOH 13 25  203 HOH HOH E . 
N 5 HOH 14 26  204 HOH HOH E . 
N 5 HOH 15 27  231 HOH HOH E . 
N 5 HOH 16 28  239 HOH HOH E . 
N 5 HOH 17 29  252 HOH HOH E . 
O 5 HOH 1  13  6   HOH HOH I . 
O 5 HOH 2  14  7   HOH HOH I . 
O 5 HOH 3  15  13  HOH HOH I . 
O 5 HOH 4  16  33  HOH HOH I . 
O 5 HOH 5  17  34  HOH HOH I . 
O 5 HOH 6  18  36  HOH HOH I . 
O 5 HOH 7  19  74  HOH HOH I . 
O 5 HOH 8  20  91  HOH HOH I . 
O 5 HOH 9  21  98  HOH HOH I . 
O 5 HOH 10 22  100 HOH HOH I . 
O 5 HOH 11 23  102 HOH HOH I . 
O 5 HOH 12 24  119 HOH HOH I . 
O 5 HOH 13 25  126 HOH HOH I . 
O 5 HOH 14 26  131 HOH HOH I . 
O 5 HOH 15 27  133 HOH HOH I . 
O 5 HOH 16 28  147 HOH HOH I . 
O 5 HOH 17 29  149 HOH HOH I . 
O 5 HOH 18 30  160 HOH HOH I . 
O 5 HOH 19 31  166 HOH HOH I . 
O 5 HOH 20 32  173 HOH HOH I . 
O 5 HOH 21 33  182 HOH HOH I . 
O 5 HOH 22 34  183 HOH HOH I . 
O 5 HOH 23 35  186 HOH HOH I . 
O 5 HOH 24 36  188 HOH HOH I . 
O 5 HOH 25 37  194 HOH HOH I . 
O 5 HOH 26 38  195 HOH HOH I . 
O 5 HOH 27 39  208 HOH HOH I . 
O 5 HOH 28 40  210 HOH HOH I . 
O 5 HOH 29 41  225 HOH HOH I . 
O 5 HOH 30 42  237 HOH HOH I . 
O 5 HOH 31 43  238 HOH HOH I . 
O 5 HOH 32 44  244 HOH HOH I . 
O 5 HOH 33 45  247 HOH HOH I . 
P 5 HOH 1  13  3   HOH HOH J . 
P 5 HOH 2  14  4   HOH HOH J . 
P 5 HOH 3  15  9   HOH HOH J . 
P 5 HOH 4  16  11  HOH HOH J . 
P 5 HOH 5  17  18  HOH HOH J . 
P 5 HOH 6  18  19  HOH HOH J . 
P 5 HOH 7  19  43  HOH HOH J . 
P 5 HOH 8  20  48  HOH HOH J . 
P 5 HOH 9  21  49  HOH HOH J . 
P 5 HOH 10 22  61  HOH HOH J . 
P 5 HOH 11 23  73  HOH HOH J . 
P 5 HOH 12 24  92  HOH HOH J . 
P 5 HOH 13 25  97  HOH HOH J . 
P 5 HOH 14 26  108 HOH HOH J . 
P 5 HOH 15 27  121 HOH HOH J . 
P 5 HOH 16 28  135 HOH HOH J . 
P 5 HOH 17 29  161 HOH HOH J . 
P 5 HOH 18 30  164 HOH HOH J . 
P 5 HOH 19 31  172 HOH HOH J . 
P 5 HOH 20 32  175 HOH HOH J . 
P 5 HOH 21 33  176 HOH HOH J . 
P 5 HOH 22 34  196 HOH HOH J . 
P 5 HOH 23 35  198 HOH HOH J . 
P 5 HOH 24 36  201 HOH HOH J . 
P 5 HOH 25 37  216 HOH HOH J . 
P 5 HOH 26 38  221 HOH HOH J . 
P 5 HOH 27 39  233 HOH HOH J . 
P 5 HOH 28 40  248 HOH HOH J . 
Q 5 HOH 1  502 1   HOH HOH A . 
Q 5 HOH 2  503 10  HOH HOH A . 
Q 5 HOH 3  504 37  HOH HOH A . 
Q 5 HOH 4  505 42  HOH HOH A . 
Q 5 HOH 5  506 60  HOH HOH A . 
Q 5 HOH 6  507 71  HOH HOH A . 
Q 5 HOH 7  508 76  HOH HOH A . 
Q 5 HOH 8  509 90  HOH HOH A . 
Q 5 HOH 9  510 113 HOH HOH A . 
Q 5 HOH 10 511 122 HOH HOH A . 
Q 5 HOH 11 512 125 HOH HOH A . 
Q 5 HOH 12 513 163 HOH HOH A . 
Q 5 HOH 13 514 168 HOH HOH A . 
Q 5 HOH 14 515 211 HOH HOH A . 
Q 5 HOH 15 516 215 HOH HOH A . 
Q 5 HOH 16 517 229 HOH HOH A . 
R 5 HOH 1  77  89  HOH HOH B . 
R 5 HOH 2  78  23  HOH HOH B . 
R 5 HOH 3  79  32  HOH HOH B . 
R 5 HOH 4  80  47  HOH HOH B . 
R 5 HOH 5  81  50  HOH HOH B . 
R 5 HOH 6  82  53  HOH HOH B . 
R 5 HOH 7  83  57  HOH HOH B . 
R 5 HOH 8  84  65  HOH HOH B . 
R 5 HOH 9  85  79  HOH HOH B . 
R 5 HOH 10 86  87  HOH HOH B . 
R 5 HOH 11 87  95  HOH HOH B . 
R 5 HOH 12 88  112 HOH HOH B . 
R 5 HOH 13 89  118 HOH HOH B . 
R 5 HOH 14 90  145 HOH HOH B . 
R 5 HOH 15 91  152 HOH HOH B . 
R 5 HOH 16 92  154 HOH HOH B . 
R 5 HOH 17 93  158 HOH HOH B . 
R 5 HOH 18 94  174 HOH HOH B . 
R 5 HOH 19 95  177 HOH HOH B . 
R 5 HOH 20 96  178 HOH HOH B . 
R 5 HOH 21 97  181 HOH HOH B . 
R 5 HOH 22 98  189 HOH HOH B . 
R 5 HOH 23 99  202 HOH HOH B . 
R 5 HOH 24 100 224 HOH HOH B . 
R 5 HOH 25 101 230 HOH HOH B . 
R 5 HOH 26 102 236 HOH HOH B . 
R 5 HOH 27 103 240 HOH HOH B . 
R 5 HOH 28 104 241 HOH HOH B . 
S 5 HOH 1  503 5   HOH HOH C . 
S 5 HOH 2  504 46  HOH HOH C . 
S 5 HOH 3  505 70  HOH HOH C . 
S 5 HOH 4  506 78  HOH HOH C . 
S 5 HOH 5  507 96  HOH HOH C . 
S 5 HOH 6  508 99  HOH HOH C . 
S 5 HOH 7  509 111 HOH HOH C . 
S 5 HOH 8  510 137 HOH HOH C . 
S 5 HOH 9  511 157 HOH HOH C . 
S 5 HOH 10 512 170 HOH HOH C . 
S 5 HOH 11 513 184 HOH HOH C . 
S 5 HOH 12 514 220 HOH HOH C . 
S 5 HOH 13 515 226 HOH HOH C . 
S 5 HOH 14 516 234 HOH HOH C . 
S 5 HOH 15 517 242 HOH HOH C . 
S 5 HOH 16 518 246 HOH HOH C . 
S 5 HOH 17 519 83  HOH HOH C . 
T 5 HOH 1  77  30  HOH HOH F . 
T 5 HOH 2  78  2   HOH HOH F . 
T 5 HOH 3  79  16  HOH HOH F . 
T 5 HOH 4  80  17  HOH HOH F . 
T 5 HOH 5  81  22  HOH HOH F . 
T 5 HOH 6  82  25  HOH HOH F . 
T 5 HOH 7  83  40  HOH HOH F . 
T 5 HOH 8  84  45  HOH HOH F . 
T 5 HOH 9  85  64  HOH HOH F . 
T 5 HOH 10 86  66  HOH HOH F . 
T 5 HOH 11 87  69  HOH HOH F . 
T 5 HOH 12 88  81  HOH HOH F . 
T 5 HOH 13 89  84  HOH HOH F . 
T 5 HOH 14 90  94  HOH HOH F . 
T 5 HOH 15 91  134 HOH HOH F . 
T 5 HOH 16 92  138 HOH HOH F . 
T 5 HOH 17 93  144 HOH HOH F . 
T 5 HOH 18 94  148 HOH HOH F . 
T 5 HOH 19 95  153 HOH HOH F . 
T 5 HOH 20 96  179 HOH HOH F . 
T 5 HOH 21 97  192 HOH HOH F . 
T 5 HOH 22 98  193 HOH HOH F . 
T 5 HOH 23 99  207 HOH HOH F . 
T 5 HOH 24 100 217 HOH HOH F . 
T 5 HOH 25 101 222 HOH HOH F . 
T 5 HOH 26 102 223 HOH HOH F . 
T 5 HOH 27 103 232 HOH HOH F . 
T 5 HOH 28 104 250 HOH HOH F . 
T 5 HOH 29 105 251 HOH HOH F . 
U 5 HOH 1  77  219 HOH HOH G . 
U 5 HOH 2  78  12  HOH HOH G . 
U 5 HOH 3  79  15  HOH HOH G . 
U 5 HOH 4  80  41  HOH HOH G . 
U 5 HOH 5  81  56  HOH HOH G . 
U 5 HOH 6  82  67  HOH HOH G . 
U 5 HOH 7  83  75  HOH HOH G . 
U 5 HOH 8  84  88  HOH HOH G . 
U 5 HOH 9  85  104 HOH HOH G . 
U 5 HOH 10 86  120 HOH HOH G . 
U 5 HOH 11 87  127 HOH HOH G . 
U 5 HOH 12 88  140 HOH HOH G . 
U 5 HOH 13 89  143 HOH HOH G . 
U 5 HOH 14 90  156 HOH HOH G . 
U 5 HOH 15 91  159 HOH HOH G . 
U 5 HOH 16 92  169 HOH HOH G . 
U 5 HOH 17 93  180 HOH HOH G . 
U 5 HOH 18 94  197 HOH HOH G . 
U 5 HOH 19 95  206 HOH HOH G . 
U 5 HOH 20 96  209 HOH HOH G . 
U 5 HOH 21 97  214 HOH HOH G . 
U 5 HOH 22 98  249 HOH HOH G . 
V 5 HOH 1  77  51  HOH HOH H . 
V 5 HOH 2  78  14  HOH HOH H . 
V 5 HOH 3  79  28  HOH HOH H . 
V 5 HOH 4  80  35  HOH HOH H . 
V 5 HOH 5  81  54  HOH HOH H . 
V 5 HOH 6  82  68  HOH HOH H . 
V 5 HOH 7  83  72  HOH HOH H . 
V 5 HOH 8  84  82  HOH HOH H . 
V 5 HOH 9  85  101 HOH HOH H . 
V 5 HOH 10 86  103 HOH HOH H . 
V 5 HOH 11 87  109 HOH HOH H . 
V 5 HOH 12 88  117 HOH HOH H . 
V 5 HOH 13 89  124 HOH HOH H . 
V 5 HOH 14 90  132 HOH HOH H . 
V 5 HOH 15 91  162 HOH HOH H . 
V 5 HOH 16 92  167 HOH HOH H . 
V 5 HOH 17 93  190 HOH HOH H . 
V 5 HOH 18 94  199 HOH HOH H . 
V 5 HOH 19 95  200 HOH HOH H . 
V 5 HOH 20 96  213 HOH HOH H . 
V 5 HOH 21 97  218 HOH HOH H . 
V 5 HOH 22 98  228 HOH HOH H . 
V 5 HOH 23 99  245 HOH HOH H . 
#