data_3BUC
# 
_entry.id   3BUC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3BUC         pdb_00003buc 10.2210/pdb3buc/pdb 
NDB   PD1074       ?            ?                   
RCSB  RCSB045965   ?            ?                   
WWPDB D_1000045965 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2FD8 'E. coli homolog' unspecified 
PDB 2IUW 'Human homolog'   unspecified 
PDB 3BTX .                 unspecified 
PDB 3BTY .                 unspecified 
PDB 3BTZ .                 unspecified 
PDB 3BU0 .                 unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3BUC 
_pdbx_database_status.recvd_initial_deposition_date   2008-01-02 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yang, C.-G.' 1 
'Yi, C.'      2 
'He, C.'      3 
# 
_citation.id                        primary 
_citation.title                     'Crystal structures of DNA/RNA repair enzymes AlkB and ABH2 bound to dsDNA.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            452 
_citation.page_first                961 
_citation.page_last                 965 
_citation.year                      2008 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18432238 
_citation.pdbx_database_id_DOI      10.1038/nature06889 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Yang, C.G.'     1 ? 
primary 'Yi, C.'         2 ? 
primary 'Duguid, E.M.'   3 ? 
primary 'Sullivan, C.T.' 4 ? 
primary 'Jian, X.'       5 ? 
primary 'Rice, P.A.'     6 ? 
primary 'He, C.'         7 ? 
# 
_cell.entry_id           3BUC 
_cell.length_a           77.910 
_cell.length_b           77.910 
_cell.length_c           226.558 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3BUC 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*DCP*DTP*DGP*DTP*DAP*DTP*(MA7)P*DAP*DCP*DTP*DGP*DCP*DG)-3')
;
3981.631  1  ?         ?                           ? ? 
2 polymer     syn 
;DNA (5'-D(*DTP*DCP*DGP*DCP*DAP*DGP*DTP*DTP*DAP*DTP*DAP*DCP*DA)-3')
;
3950.598  1  ?         ?                           ? ? 
3 polymer     man 'Alpha-ketoglutarate-dependent dioxygenase alkB homolog 2'              23136.414 1  1.14.11.- 
'C67S, C165S, G169C, C192S' ? ? 
4 non-polymer syn propane-1-thiol                                                         76.161    1  ?         ? ? ? 
5 non-polymer syn 'MANGANESE (II) ION'                                                    54.938    1  ?         ? ? ? 
6 non-polymer syn '2-OXOGLUTARIC ACID'                                                    146.098   1  ?         ? ? ? 
7 water       nat water                                                                   18.015    37 ?         ? ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'Alkylated DNA repair protein alkB homolog 2, Oxy DC1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes '(DC)(DT)(DG)(DT)(DA)(DT)(MA7)(DA)(DC)(DT)(DG)(DC)(DG)' CTGTATAACTGCG B ? 
2 polydeoxyribonucleotide no no  '(DT)(DC)(DG)(DC)(DA)(DG)(DT)(DT)(DA)(DT)(DA)(DC)(DA)' TCGCAGTTATACA C ? 
3 'polypeptide(L)'        no no  
;SWRHIRAEGLDSSYTVLFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLSPKPWI
PVLERIRDHVSGVTGQTFNFVLINRYKDGSDHICEHRDDERELAPGSPIASVSFGASRDFVFRHKDSRGKSPSRRVAVVR
LPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILL
;
;SWRHIRAEGLDSSYTVLFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLSPKPWI
PVLERIRDHVSGVTGQTFNFVLINRYKDGSDHICEHRDDERELAPGSPIASVSFGASRDFVFRHKDSRGKSPSRRVAVVR
LPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILL
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DT  n 
1 3   DG  n 
1 4   DT  n 
1 5   DA  n 
1 6   DT  n 
1 7   MA7 n 
1 8   DA  n 
1 9   DC  n 
1 10  DT  n 
1 11  DG  n 
1 12  DC  n 
1 13  DG  n 
2 1   DT  n 
2 2   DC  n 
2 3   DG  n 
2 4   DC  n 
2 5   DA  n 
2 6   DG  n 
2 7   DT  n 
2 8   DT  n 
2 9   DA  n 
2 10  DT  n 
2 11  DA  n 
2 12  DC  n 
2 13  DA  n 
3 1   SER n 
3 2   TRP n 
3 3   ARG n 
3 4   HIS n 
3 5   ILE n 
3 6   ARG n 
3 7   ALA n 
3 8   GLU n 
3 9   GLY n 
3 10  LEU n 
3 11  ASP n 
3 12  SER n 
3 13  SER n 
3 14  TYR n 
3 15  THR n 
3 16  VAL n 
3 17  LEU n 
3 18  PHE n 
3 19  GLY n 
3 20  LYS n 
3 21  ALA n 
3 22  GLU n 
3 23  ALA n 
3 24  ASP n 
3 25  GLU n 
3 26  ILE n 
3 27  PHE n 
3 28  GLN n 
3 29  GLU n 
3 30  LEU n 
3 31  GLU n 
3 32  LYS n 
3 33  GLU n 
3 34  VAL n 
3 35  GLU n 
3 36  TYR n 
3 37  PHE n 
3 38  THR n 
3 39  GLY n 
3 40  ALA n 
3 41  LEU n 
3 42  ALA n 
3 43  ARG n 
3 44  VAL n 
3 45  GLN n 
3 46  VAL n 
3 47  PHE n 
3 48  GLY n 
3 49  LYS n 
3 50  TRP n 
3 51  HIS n 
3 52  SER n 
3 53  VAL n 
3 54  PRO n 
3 55  ARG n 
3 56  LYS n 
3 57  GLN n 
3 58  ALA n 
3 59  THR n 
3 60  TYR n 
3 61  GLY n 
3 62  ASP n 
3 63  ALA n 
3 64  GLY n 
3 65  LEU n 
3 66  THR n 
3 67  TYR n 
3 68  THR n 
3 69  PHE n 
3 70  SER n 
3 71  GLY n 
3 72  LEU n 
3 73  THR n 
3 74  LEU n 
3 75  SER n 
3 76  PRO n 
3 77  LYS n 
3 78  PRO n 
3 79  TRP n 
3 80  ILE n 
3 81  PRO n 
3 82  VAL n 
3 83  LEU n 
3 84  GLU n 
3 85  ARG n 
3 86  ILE n 
3 87  ARG n 
3 88  ASP n 
3 89  HIS n 
3 90  VAL n 
3 91  SER n 
3 92  GLY n 
3 93  VAL n 
3 94  THR n 
3 95  GLY n 
3 96  GLN n 
3 97  THR n 
3 98  PHE n 
3 99  ASN n 
3 100 PHE n 
3 101 VAL n 
3 102 LEU n 
3 103 ILE n 
3 104 ASN n 
3 105 ARG n 
3 106 TYR n 
3 107 LYS n 
3 108 ASP n 
3 109 GLY n 
3 110 SER n 
3 111 ASP n 
3 112 HIS n 
3 113 ILE n 
3 114 CYS n 
3 115 GLU n 
3 116 HIS n 
3 117 ARG n 
3 118 ASP n 
3 119 ASP n 
3 120 GLU n 
3 121 ARG n 
3 122 GLU n 
3 123 LEU n 
3 124 ALA n 
3 125 PRO n 
3 126 GLY n 
3 127 SER n 
3 128 PRO n 
3 129 ILE n 
3 130 ALA n 
3 131 SER n 
3 132 VAL n 
3 133 SER n 
3 134 PHE n 
3 135 GLY n 
3 136 ALA n 
3 137 SER n 
3 138 ARG n 
3 139 ASP n 
3 140 PHE n 
3 141 VAL n 
3 142 PHE n 
3 143 ARG n 
3 144 HIS n 
3 145 LYS n 
3 146 ASP n 
3 147 SER n 
3 148 ARG n 
3 149 GLY n 
3 150 LYS n 
3 151 SER n 
3 152 PRO n 
3 153 SER n 
3 154 ARG n 
3 155 ARG n 
3 156 VAL n 
3 157 ALA n 
3 158 VAL n 
3 159 VAL n 
3 160 ARG n 
3 161 LEU n 
3 162 PRO n 
3 163 LEU n 
3 164 ALA n 
3 165 HIS n 
3 166 GLY n 
3 167 SER n 
3 168 LEU n 
3 169 LEU n 
3 170 MET n 
3 171 MET n 
3 172 ASN n 
3 173 HIS n 
3 174 PRO n 
3 175 THR n 
3 176 ASN n 
3 177 THR n 
3 178 HIS n 
3 179 TRP n 
3 180 TYR n 
3 181 HIS n 
3 182 SER n 
3 183 LEU n 
3 184 PRO n 
3 185 VAL n 
3 186 ARG n 
3 187 LYS n 
3 188 LYS n 
3 189 VAL n 
3 190 LEU n 
3 191 ALA n 
3 192 PRO n 
3 193 ARG n 
3 194 VAL n 
3 195 ASN n 
3 196 LEU n 
3 197 THR n 
3 198 PHE n 
3 199 ARG n 
3 200 LYS n 
3 201 ILE n 
3 202 LEU n 
3 203 LEU n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'ALKBH2, ABH2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP ALKB2_HUMAN Q6NS38 3 
;SWRHIRAEGLDCSYTVLFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLSPKPWI
PVLERIRDHVSGVTGQTFNFVLINRYKDGCDHIGEHRDDERELAPGSPIASVSFGACRDFVFRHKDSRGKSPSRRVAVVR
LPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILL
;
56 ? 
2 PDB 3BUC        3BUC   1 CTGTATAACTGCG ?  ? 
3 PDB 3BUC        3BUC   2 TCGCAGTTATACA ?  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3BUC A 1 ? 203 ? Q6NS38 56 ? 258 ? 56 258 
2 2 3BUC B 1 ? 13  ? 3BUC   1  ? 13  ? 1  13  
3 3 3BUC C 1 ? 13  ? 3BUC   1  ? 13  ? 1  13  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3BUC SER A 12  ? UNP Q6NS38 CYS 67  'engineered mutation' 67  1 
1 3BUC SER A 110 ? UNP Q6NS38 CYS 165 'engineered mutation' 165 2 
1 3BUC CYS A 114 ? UNP Q6NS38 GLY 169 'engineered mutation' 169 3 
1 3BUC SER A 137 ? UNP Q6NS38 CYS 192 'engineered mutation' 192 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
AKG non-polymer         . '2-OXOGLUTARIC ACID'                  ? 'C5 H6 O5'          146.098 
ALA 'L-peptide linking' y ALANINE                               ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                              ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                            ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                       ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                              ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"  ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"   ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"  ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"          ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                             ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                       ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                               ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                             ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                 ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                            ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                               ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                ? 'C6 H15 N2 O2 1'    147.195 
MA7 'DNA linking'       n "1N-METHYLADENOSINE-5'-MONOPHOSPHATE" ? 'C11 H17 N5 O6 P 1' 346.256 
MET 'L-peptide linking' y METHIONINE                            ? 'C5 H11 N O2 S'     149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                  ? 'Mn 2'              54.938  
PHE 'L-peptide linking' y PHENYLALANINE                         ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                               ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                             ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                            ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                              ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                ? 'C5 H11 N O2'       117.146 
XL3 non-polymer         . propane-1-thiol                       ? 'C3 H8 S'           76.161  
# 
_exptl.entry_id          3BUC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.19 
_exptl_crystal.density_percent_sol   61.50 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
;8% PEG 8000, 0.1M sodium chloride, 0.05M magnesium chloride, 0.1M cacodylate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 8000'           ? ? ? 
1 2 1 'sodium chloride'    ? ? ? 
1 3 1 'magnesium chloride' ? ? ? 
1 4 1 cacodylate           ? ? ? 
1 5 2 'PEG 8000'           ? ? ? 
1 6 2 'sodium chloride'    ? ? ? 
1 7 2 'magnesium chloride' ? ? ? 
1 8 2 cacodylate           ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               ? 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2007-10-19 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9717 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9717 
# 
_reflns.entry_id                     3BUC 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.59 
_reflns.d_resolution_low             50 
_reflns.number_all                   13373 
_reflns.number_obs                   13373 
_reflns.percent_possible_obs         98.9 
_reflns.pdbx_Rmerge_I_obs            0.049 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.3 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.2 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.59 
_reflns_shell.d_res_low              2.63 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.677 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.1 
_reflns_shell.pdbx_redundancy        5.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      649 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3BUC 
_refine.ls_number_reflns_obs                     12394 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.59 
_refine.ls_percent_reflns_obs                    97.42 
_refine.ls_R_factor_obs                          0.2504 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.24848 
_refine.ls_R_factor_R_free                       0.28673 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  654 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.922 
_refine.correlation_coeff_Fo_to_Fc_free          0.904 
_refine.B_iso_mean                               46.994 
_refine.aniso_B[1][1]                            -1.67 
_refine.aniso_B[2][2]                            -1.67 
_refine.aniso_B[3][3]                            2.50 
_refine.aniso_B[1][2]                            -0.83 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.515 
_refine.pdbx_overall_ESU_R_Free                  0.321 
_refine.overall_SU_ML                            0.263 
_refine.overall_SU_B                             25.480 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1617 
_refine_hist.pdbx_number_atoms_nucleic_acid   526 
_refine_hist.pdbx_number_atoms_ligand         15 
_refine_hist.number_atoms_solvent             37 
_refine_hist.number_atoms_total               2195 
_refine_hist.d_res_high                       2.59 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.007  0.021  ? 2263 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.279  2.248  ? 3170 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.710  5.000  ? 198  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       31.165 21.519 ? 79   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.343 15.000 ? 275  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       14.424 15.000 ? 18   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.072  0.200  ? 344  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.020  ? 1556 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.195  0.200  ? 892  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.305  0.200  ? 1447 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.166  0.200  ? 95   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.195  0.200  ? 31   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.129  0.200  ? 4    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.265  1.500  ? 1016 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.480  2.000  ? 1614 'X-RAY DIFFRACTION' ? 
r_scbond_it                  0.777  3.000  ? 1582 'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.354  4.500  ? 1556 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.590 
_refine_ls_shell.d_res_low                        2.656 
_refine_ls_shell.number_reflns_R_work             882 
_refine_ls_shell.R_factor_R_work                  0.409 
_refine_ls_shell.percent_reflns_obs               99.68 
_refine_ls_shell.R_factor_R_free                  0.493 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             45 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3BUC 
_struct.title                     'X-ray structure of human ABH2 bound to dsDNA with Mn(II) and 2KG' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3BUC 
_struct_keywords.pdbx_keywords   Oxidoreductase/DNA 
_struct_keywords.text            
;protein/DNA interaction, human dioxygenase, DNA repair, cross-link, DNA damage, Iron, Metal-binding, Nucleus, Oxidoreductase, Oxidoreductase-DNA COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 7 ? 
H N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY C 19  ? VAL C 34  ? GLY A 74  VAL A 89  1 ? 16 
HELX_P HELX_P2 2 THR C 38  ? LEU C 41  ? THR A 93  LEU A 96  5 ? 4  
HELX_P HELX_P3 3 ILE C 80  ? GLY C 95  ? ILE A 135 GLY A 150 1 ? 16 
HELX_P HELX_P4 4 ASP C 146 ? ARG C 148 ? ASP A 201 ARG A 203 5 ? 3  
HELX_P HELX_P5 5 PRO C 174 ? HIS C 178 ? PRO A 229 HIS A 233 1 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale both ? A DT  6  "O3'" ? ? ? 1_555 A MA7 7   P   ? ? B DT  6  B MA7 7   1_555 ? ? ? ? ? ? ?            1.595 ? ? 
covale2  covale both ? A MA7 7  "O3'" ? ? ? 1_555 A DA  8   P   ? ? B MA7 7  B DA  8   1_555 ? ? ? ? ? ? ?            1.591 ? ? 
covale3  covale none ? A DC  9  N4    ? ? ? 1_555 D XL3 .   CA  ? ? B DC  9  B XL3 14  1_555 ? ? ? ? ? ? ?            1.474 ? ? 
covale4  covale none ? D XL3 .  SG    ? ? ? 1_555 C CYS 114 SG  ? ? B XL3 14 A CYS 169 1_555 ? ? ? ? ? ? ?            2.034 ? ? 
metalc1  metalc ?    ? E MN  .  MN    ? ? ? 1_555 C ASP 118 OD2 ? ? A MN  1  A ASP 173 1_555 ? ? ? ? ? ? ?            2.047 ? ? 
metalc2  metalc ?    ? E MN  .  MN    ? ? ? 1_555 F AKG .   O5  ? ? A MN  1  A AKG 259 1_555 ? ? ? ? ? ? ?            2.405 ? ? 
metalc3  metalc ?    ? E MN  .  MN    ? ? ? 1_555 F AKG .   O1  ? ? A MN  1  A AKG 259 1_555 ? ? ? ? ? ? ?            1.995 ? ? 
metalc4  metalc ?    ? E MN  .  MN    ? ? ? 1_555 H HOH .   O   ? ? A MN  1  A HOH 270 1_555 ? ? ? ? ? ? ?            1.868 ? ? 
hydrog1  hydrog ?    ? A DG  3  N1    ? ? ? 1_555 B DC  12  N3  ? ? B DG  3  C DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog2  hydrog ?    ? A DG  3  N2    ? ? ? 1_555 B DC  12  O2  ? ? B DG  3  C DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog3  hydrog ?    ? A DG  3  O6    ? ? ? 1_555 B DC  12  N4  ? ? B DG  3  C DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog4  hydrog ?    ? A DT  4  N3    ? ? ? 1_555 B DA  11  N1  ? ? B DT  4  C DA  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog5  hydrog ?    ? A DT  4  O4    ? ? ? 1_555 B DA  11  N6  ? ? B DT  4  C DA  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog6  hydrog ?    ? A DA  5  N6    ? ? ? 1_555 B DT  8   O4  ? ? B DA  5  C DT  8   1_555 ? ? ? ? ? ? 'DA-DT PAIR' ?     ? ? 
hydrog7  hydrog ?    ? A DA  5  N1    ? ? ? 1_555 B DT  10  N3  ? ? B DA  5  C DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog8  hydrog ?    ? A DA  5  N6    ? ? ? 1_555 B DT  10  O4  ? ? B DA  5  C DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog9  hydrog ?    ? A DT  6  N3    ? ? ? 1_555 B DT  8   O4  ? ? B DT  6  C DT  8   1_555 ? ? ? ? ? ? TYPE_16_PAIR ?     ? ? 
hydrog10 hydrog ?    ? A DT  6  O2    ? ? ? 1_555 B DT  8   N3  ? ? B DT  6  C DT  8   1_555 ? ? ? ? ? ? TYPE_16_PAIR ?     ? ? 
hydrog11 hydrog ?    ? A DA  8  N1    ? ? ? 1_555 B DT  7   N3  ? ? B DA  8  C DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog12 hydrog ?    ? A DA  8  N6    ? ? ? 1_555 B DT  7   O4  ? ? B DA  8  C DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog13 hydrog ?    ? A DC  9  O2    ? ? ? 1_555 B DG  6   N1  ? ? B DC  9  C DG  6   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? ? 
hydrog14 hydrog ?    ? A DT  10 N3    ? ? ? 1_555 B DA  5   N1  ? ? B DT  10 C DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog15 hydrog ?    ? A DT  10 O4    ? ? ? 1_555 B DA  5   N6  ? ? B DT  10 C DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog16 hydrog ?    ? A DG  11 N1    ? ? ? 1_555 B DC  4   N3  ? ? B DG  11 C DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog17 hydrog ?    ? A DG  11 N2    ? ? ? 1_555 B DC  4   O2  ? ? B DG  11 C DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog18 hydrog ?    ? A DG  11 O6    ? ? ? 1_555 B DC  4   N4  ? ? B DG  11 C DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog19 hydrog ?    ? A DC  12 N3    ? ? ? 1_555 B DG  3   N1  ? ? B DC  12 C DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog20 hydrog ?    ? A DC  12 N4    ? ? ? 1_555 B DG  3   O6  ? ? B DC  12 C DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog21 hydrog ?    ? A DC  12 O2    ? ? ? 1_555 B DG  3   N2  ? ? B DC  12 C DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog22 hydrog ?    ? A DG  13 N1    ? ? ? 1_555 B DC  2   N3  ? ? B DG  13 C DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog23 hydrog ?    ? A DG  13 N2    ? ? ? 1_555 B DC  2   O2  ? ? B DG  13 C DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog24 hydrog ?    ? A DG  13 O6    ? ? ? 1_555 B DC  2   N4  ? ? B DG  13 C DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog25 hydrog ?    ? A DC  1  N4    ? ? ? 1_555 A DG  13  O6  ? ? B DC  1  B DG  13  8_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? ? 
hydrog26 hydrog ?    ? A DG  13 O6    ? ? ? 1_555 A DC  1   N4  ? ? B DG  13 B DC  1   8_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          HIS 
_struct_mon_prot_cis.label_seq_id           173 
_struct_mon_prot_cis.label_asym_id          C 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           HIS 
_struct_mon_prot_cis.auth_seq_id            228 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    174 
_struct_mon_prot_cis.pdbx_label_asym_id_2   C 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     229 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       3.95 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 2 ? 
C ? 2 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG C 3   ? ALA C 7   ? ARG A 58  ALA A 62  
A 2 LEU C 10  ? VAL C 16  ? LEU A 65  VAL A 71  
A 3 SER C 167 ? MET C 171 ? SER A 222 MET A 226 
A 4 ILE C 129 ? GLY C 135 ? ILE A 184 GLY A 190 
A 5 ARG C 193 ? ARG C 199 ? ARG A 248 ARG A 254 
A 6 PHE C 100 ? TYR C 106 ? PHE A 155 TYR A 161 
A 7 LYS C 56  ? GLY C 61  ? LYS A 111 GLY A 116 
B 1 ARG C 43  ? VAL C 46  ? ARG A 98  VAL A 101 
B 2 LYS C 49  ? SER C 52  ? LYS A 104 SER A 107 
C 1 TYR C 67  ? PHE C 69  ? TYR A 122 PHE A 124 
C 2 LEU C 72  ? LEU C 74  ? LEU A 127 LEU A 129 
D 1 ILE C 113 ? HIS C 116 ? ILE A 168 HIS A 171 
D 2 TRP C 179 ? LEU C 183 ? TRP A 234 LEU A 238 
D 3 ARG C 138 ? HIS C 144 ? ARG A 193 HIS A 199 
D 4 VAL C 159 ? LEU C 163 ? VAL A 214 LEU A 218 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG C 3   ? N ARG A 58  O TYR C 14  ? O TYR A 69  
A 2 3 N SER C 13  ? N SER A 68  O MET C 170 ? O MET A 225 
A 3 4 O LEU C 169 ? O LEU A 224 N SER C 131 ? N SER A 186 
A 4 5 N VAL C 132 ? N VAL A 187 O LEU C 196 ? O LEU A 251 
A 5 6 O ASN C 195 ? O ASN A 250 N ASN C 104 ? N ASN A 159 
A 6 7 O ILE C 103 ? O ILE A 158 N ALA C 58  ? N ALA A 113 
B 1 2 N VAL C 46  ? N VAL A 101 O LYS C 49  ? O LYS A 104 
C 1 2 N TYR C 67  ? N TYR A 122 O LEU C 74  ? O LEU A 129 
D 1 2 N HIS C 116 ? N HIS A 171 O HIS C 181 ? O HIS A 236 
D 2 3 O TYR C 180 ? O TYR A 235 N ARG C 143 ? N ARG A 198 
D 3 4 N PHE C 142 ? N PHE A 197 O VAL C 159 ? O VAL A 214 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MN  1   ? 4  'BINDING SITE FOR RESIDUE MN A 1'    
AC2 Software B XL3 14  ? 4  'BINDING SITE FOR RESIDUE XL3 B 14'  
AC3 Software A AKG 259 ? 12 'BINDING SITE FOR RESIDUE AKG A 259' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  HIS C 116 ? HIS A 171 . ? 1_555 ? 
2  AC1 4  ASP C 118 ? ASP A 173 . ? 1_555 ? 
3  AC1 4  HIS C 181 ? HIS A 236 . ? 1_555 ? 
4  AC1 4  HOH H .   ? HOH A 270 . ? 1_555 ? 
5  AC2 4  CYS C 114 ? CYS A 169 . ? 1_555 ? 
6  AC2 4  DA  A 8   ? DA  B 8   . ? 1_555 ? 
7  AC2 4  DC  A 9   ? DC  B 9   . ? 1_555 ? 
8  AC2 4  DG  B 6   ? DG  C 6   . ? 1_555 ? 
9  AC3 12 LEU C 102 ? LEU A 157 . ? 1_555 ? 
10 AC3 12 ASN C 104 ? ASN A 159 . ? 1_555 ? 
11 AC3 12 TYR C 106 ? TYR A 161 . ? 1_555 ? 
12 AC3 12 HIS C 116 ? HIS A 171 . ? 1_555 ? 
13 AC3 12 ASP C 118 ? ASP A 173 . ? 1_555 ? 
14 AC3 12 PHE C 140 ? PHE A 195 . ? 1_555 ? 
15 AC3 12 HIS C 181 ? HIS A 236 . ? 1_555 ? 
16 AC3 12 ARG C 193 ? ARG A 248 . ? 1_555 ? 
17 AC3 12 ASN C 195 ? ASN A 250 . ? 1_555 ? 
18 AC3 12 THR C 197 ? THR A 252 . ? 1_555 ? 
19 AC3 12 ARG C 199 ? ARG A 254 . ? 1_555 ? 
20 AC3 12 HOH H .   ? HOH A 270 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3BUC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3BUC 
_atom_sites.fract_transf_matrix[1][1]   0.012835 
_atom_sites.fract_transf_matrix[1][2]   0.007410 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014821 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004414 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DC  A 1 1   ? 2.692   -9.380 14.984  1.00 54.64 ? 1   DC  B "O5'" 1 
ATOM   2    C  "C5'" . DC  A 1 1   ? 1.743   -9.106 13.941  1.00 53.55 ? 1   DC  B "C5'" 1 
ATOM   3    C  "C4'" . DC  A 1 1   ? 1.351   -7.630 13.908  1.00 53.13 ? 1   DC  B "C4'" 1 
ATOM   4    O  "O4'" . DC  A 1 1   ? -0.063  -7.485 13.589  1.00 52.18 ? 1   DC  B "O4'" 1 
ATOM   5    C  "C3'" . DC  A 1 1   ? 1.528   -6.834 15.202  1.00 53.07 ? 1   DC  B "C3'" 1 
ATOM   6    O  "O3'" . DC  A 1 1   ? 1.647   -5.442 14.900  1.00 53.71 ? 1   DC  B "O3'" 1 
ATOM   7    C  "C2'" . DC  A 1 1   ? 0.202   -7.124 15.892  1.00 52.37 ? 1   DC  B "C2'" 1 
ATOM   8    C  "C1'" . DC  A 1 1   ? -0.739  -6.925 14.704  1.00 50.37 ? 1   DC  B "C1'" 1 
ATOM   9    N  N1    . DC  A 1 1   ? -2.062  -7.588 14.837  1.00 48.82 ? 1   DC  B N1    1 
ATOM   10   C  C2    . DC  A 1 1   ? -3.207  -6.944 14.341  1.00 47.87 ? 1   DC  B C2    1 
ATOM   11   O  O2    . DC  A 1 1   ? -3.126  -5.831 13.796  1.00 46.86 ? 1   DC  B O2    1 
ATOM   12   N  N3    . DC  A 1 1   ? -4.392  -7.592 14.473  1.00 48.10 ? 1   DC  B N3    1 
ATOM   13   C  C4    . DC  A 1 1   ? -4.466  -8.794 15.059  1.00 48.58 ? 1   DC  B C4    1 
ATOM   14   N  N4    . DC  A 1 1   ? -5.673  -9.363 15.153  1.00 48.69 ? 1   DC  B N4    1 
ATOM   15   C  C5    . DC  A 1 1   ? -3.315  -9.464 15.572  1.00 47.70 ? 1   DC  B C5    1 
ATOM   16   C  C6    . DC  A 1 1   ? -2.146  -8.823 15.438  1.00 48.58 ? 1   DC  B C6    1 
ATOM   17   P  P     . DT  A 1 2   ? 2.109   -4.361 15.999  1.00 54.53 ? 2   DT  B P     1 
ATOM   18   O  OP1   . DT  A 1 2   ? 3.577   -4.235 15.854  1.00 54.60 ? 2   DT  B OP1   1 
ATOM   19   O  OP2   . DT  A 1 2   ? 1.557   -4.730 17.332  1.00 54.46 ? 2   DT  B OP2   1 
ATOM   20   O  "O5'" . DT  A 1 2   ? 1.418   -2.984 15.517  1.00 52.38 ? 2   DT  B "O5'" 1 
ATOM   21   C  "C5'" . DT  A 1 2   ? 0.379   -2.928 14.529  1.00 50.71 ? 2   DT  B "C5'" 1 
ATOM   22   C  "C4'" . DT  A 1 2   ? -0.733  -1.931 14.862  1.00 49.29 ? 2   DT  B "C4'" 1 
ATOM   23   O  "O4'" . DT  A 1 2   ? -2.030  -2.591 14.956  1.00 48.43 ? 2   DT  B "O4'" 1 
ATOM   24   C  "C3'" . DT  A 1 2   ? -0.610  -1.148 16.169  1.00 48.69 ? 2   DT  B "C3'" 1 
ATOM   25   O  "O3'" . DT  A 1 2   ? -1.233  0.126  15.987  1.00 48.42 ? 2   DT  B "O3'" 1 
ATOM   26   C  "C2'" . DT  A 1 2   ? -1.389  -2.016 17.155  1.00 47.74 ? 2   DT  B "C2'" 1 
ATOM   27   C  "C1'" . DT  A 1 2   ? -2.571  -2.419 16.264  1.00 46.36 ? 2   DT  B "C1'" 1 
ATOM   28   N  N1    . DT  A 1 2   ? -3.332  -3.672 16.654  1.00 45.42 ? 2   DT  B N1    1 
ATOM   29   C  C2    . DT  A 1 2   ? -4.661  -3.796 16.269  1.00 44.87 ? 2   DT  B C2    1 
ATOM   30   O  O2    . DT  A 1 2   ? -5.264  -2.943 15.634  1.00 44.48 ? 2   DT  B O2    1 
ATOM   31   N  N3    . DT  A 1 2   ? -5.267  -4.970 16.659  1.00 44.18 ? 2   DT  B N3    1 
ATOM   32   C  C4    . DT  A 1 2   ? -4.692  -6.009 17.372  1.00 44.66 ? 2   DT  B C4    1 
ATOM   33   O  O4    . DT  A 1 2   ? -5.330  -7.015 17.664  1.00 44.59 ? 2   DT  B O4    1 
ATOM   34   C  C5    . DT  A 1 2   ? -3.303  -5.816 17.748  1.00 44.50 ? 2   DT  B C5    1 
ATOM   35   C  C7    . DT  A 1 2   ? -2.554  -6.860 18.531  1.00 44.80 ? 2   DT  B C7    1 
ATOM   36   C  C6    . DT  A 1 2   ? -2.703  -4.677 17.373  1.00 44.57 ? 2   DT  B C6    1 
ATOM   37   P  P     . DG  A 1 3   ? -0.457  1.476  16.348  1.00 47.98 ? 3   DG  B P     1 
ATOM   38   O  OP1   . DG  A 1 3   ? 0.067   2.039  15.081  1.00 48.34 ? 3   DG  B OP1   1 
ATOM   39   O  OP2   . DG  A 1 3   ? 0.444   1.153  17.490  1.00 46.72 ? 3   DG  B OP2   1 
ATOM   40   O  "O5'" . DG  A 1 3   ? -1.620  2.490  16.758  1.00 45.08 ? 3   DG  B "O5'" 1 
ATOM   41   C  "C5'" . DG  A 1 3   ? -1.780  2.776  18.111  1.00 43.07 ? 3   DG  B "C5'" 1 
ATOM   42   C  "C4'" . DG  A 1 3   ? -2.620  3.999  18.384  1.00 41.51 ? 3   DG  B "C4'" 1 
ATOM   43   O  "O4'" . DG  A 1 3   ? -1.780  4.828  19.212  1.00 40.22 ? 3   DG  B "O4'" 1 
ATOM   44   C  "C3'" . DG  A 1 3   ? -3.054  4.845  17.193  1.00 40.72 ? 3   DG  B "C3'" 1 
ATOM   45   O  "O3'" . DG  A 1 3   ? -4.374  4.469  16.816  1.00 41.47 ? 3   DG  B "O3'" 1 
ATOM   46   C  "C2'" . DG  A 1 3   ? -3.052  6.233  17.802  1.00 40.10 ? 3   DG  B "C2'" 1 
ATOM   47   C  "C1'" . DG  A 1 3   ? -1.930  6.166  18.826  1.00 39.46 ? 3   DG  B "C1'" 1 
ATOM   48   N  N9    . DG  A 1 3   ? -0.660  6.695  18.332  1.00 39.39 ? 3   DG  B N9    1 
ATOM   49   C  C8    . DG  A 1 3   ? 0.442   6.043  17.824  1.00 38.93 ? 3   DG  B C8    1 
ATOM   50   N  N7    . DG  A 1 3   ? 1.408   6.857  17.484  1.00 38.68 ? 3   DG  B N7    1 
ATOM   51   C  C5    . DG  A 1 3   ? 0.910   8.121  17.789  1.00 39.01 ? 3   DG  B C5    1 
ATOM   52   C  C6    . DG  A 1 3   ? 1.479   9.412  17.651  1.00 38.88 ? 3   DG  B C6    1 
ATOM   53   O  O6    . DG  A 1 3   ? 2.591   9.728  17.212  1.00 38.92 ? 3   DG  B O6    1 
ATOM   54   N  N1    . DG  A 1 3   ? 0.608   10.409 18.086  1.00 39.05 ? 3   DG  B N1    1 
ATOM   55   C  C2    . DG  A 1 3   ? -0.652  10.195 18.592  1.00 38.95 ? 3   DG  B C2    1 
ATOM   56   N  N2    . DG  A 1 3   ? -1.351  11.271 18.969  1.00 39.36 ? 3   DG  B N2    1 
ATOM   57   N  N3    . DG  A 1 3   ? -1.194  9.004  18.734  1.00 38.30 ? 3   DG  B N3    1 
ATOM   58   C  C4    . DG  A 1 3   ? -0.360  8.029  18.313  1.00 38.94 ? 3   DG  B C4    1 
ATOM   59   P  P     . DT  A 1 4   ? -5.111  5.003  15.489  1.00 42.07 ? 4   DT  B P     1 
ATOM   60   O  OP1   . DT  A 1 4   ? -6.406  4.305  15.338  1.00 42.80 ? 4   DT  B OP1   1 
ATOM   61   O  OP2   . DT  A 1 4   ? -4.153  4.942  14.360  1.00 41.40 ? 4   DT  B OP2   1 
ATOM   62   O  "O5'" . DT  A 1 4   ? -5.454  6.514  15.853  1.00 41.98 ? 4   DT  B "O5'" 1 
ATOM   63   C  "C5'" . DT  A 1 4   ? -6.255  6.858  16.975  1.00 43.89 ? 4   DT  B "C5'" 1 
ATOM   64   C  "C4'" . DT  A 1 4   ? -6.406  8.368  16.991  1.00 46.08 ? 4   DT  B "C4'" 1 
ATOM   65   O  "O4'" . DT  A 1 4   ? -5.125  9.039  17.160  1.00 45.81 ? 4   DT  B "O4'" 1 
ATOM   66   C  "C3'" . DT  A 1 4   ? -6.975  8.911  15.685  1.00 47.81 ? 4   DT  B "C3'" 1 
ATOM   67   O  "O3'" . DT  A 1 4   ? -7.864  9.979  15.961  1.00 50.66 ? 4   DT  B "O3'" 1 
ATOM   68   C  "C2'" . DT  A 1 4   ? -5.750  9.387  14.905  1.00 46.60 ? 4   DT  B "C2'" 1 
ATOM   69   C  "C1'" . DT  A 1 4   ? -4.861  9.880  16.039  1.00 45.21 ? 4   DT  B "C1'" 1 
ATOM   70   N  N1    . DT  A 1 4   ? -3.396  9.850  15.688  1.00 45.00 ? 4   DT  B N1    1 
ATOM   71   C  C2    . DT  A 1 4   ? -2.639  11.009 15.784  1.00 44.64 ? 4   DT  B C2    1 
ATOM   72   O  O2    . DT  A 1 4   ? -3.081  12.087 16.145  1.00 43.89 ? 4   DT  B O2    1 
ATOM   73   N  N3    . DT  A 1 4   ? -1.317  10.855 15.439  1.00 44.47 ? 4   DT  B N3    1 
ATOM   74   C  C4    . DT  A 1 4   ? -0.688  9.697  15.016  1.00 44.04 ? 4   DT  B C4    1 
ATOM   75   O  O4    . DT  A 1 4   ? 0.509   9.680  14.738  1.00 44.08 ? 4   DT  B O4    1 
ATOM   76   C  C5    . DT  A 1 4   ? -1.534  8.527  14.940  1.00 43.92 ? 4   DT  B C5    1 
ATOM   77   C  C7    . DT  A 1 4   ? -0.989  7.196  14.500  1.00 44.21 ? 4   DT  B C7    1 
ATOM   78   C  C6    . DT  A 1 4   ? -2.824  8.661  15.271  1.00 44.03 ? 4   DT  B C6    1 
ATOM   79   P  P     . DA  A 1 5   ? -8.677  10.626 14.745  1.00 53.62 ? 5   DA  B P     1 
ATOM   80   O  OP1   . DA  A 1 5   ? -9.981  11.084 15.307  1.00 52.36 ? 5   DA  B OP1   1 
ATOM   81   O  OP2   . DA  A 1 5   ? -8.585  9.710  13.568  1.00 51.18 ? 5   DA  B OP2   1 
ATOM   82   O  "O5'" . DA  A 1 5   ? -7.774  11.903 14.402  1.00 52.62 ? 5   DA  B "O5'" 1 
ATOM   83   C  "C5'" . DA  A 1 5   ? -7.888  13.128 15.118  1.00 51.58 ? 5   DA  B "C5'" 1 
ATOM   84   C  "C4'" . DA  A 1 5   ? -7.286  14.197 14.225  1.00 51.05 ? 5   DA  B "C4'" 1 
ATOM   85   O  "O4'" . DA  A 1 5   ? -5.848  13.998 14.195  1.00 48.75 ? 5   DA  B "O4'" 1 
ATOM   86   C  "C3'" . DA  A 1 5   ? -7.773  14.097 12.774  1.00 51.51 ? 5   DA  B "C3'" 1 
ATOM   87   O  "O3'" . DA  A 1 5   ? -8.168  15.357 12.197  1.00 54.09 ? 5   DA  B "O3'" 1 
ATOM   88   C  "C2'" . DA  A 1 5   ? -6.589  13.484 12.029  1.00 48.95 ? 5   DA  B "C2'" 1 
ATOM   89   C  "C1'" . DA  A 1 5   ? -5.417  13.986 12.850  1.00 46.51 ? 5   DA  B "C1'" 1 
ATOM   90   N  N9    . DA  A 1 5   ? -4.254  13.124 12.691  1.00 45.76 ? 5   DA  B N9    1 
ATOM   91   C  C8    . DA  A 1 5   ? -4.228  11.756 12.676  1.00 45.22 ? 5   DA  B C8    1 
ATOM   92   N  N7    . DA  A 1 5   ? -3.029  11.258 12.495  1.00 45.06 ? 5   DA  B N7    1 
ATOM   93   C  C5    . DA  A 1 5   ? -2.222  12.373 12.370  1.00 44.27 ? 5   DA  B C5    1 
ATOM   94   C  C6    . DA  A 1 5   ? -0.841  12.526 12.153  1.00 44.98 ? 5   DA  B C6    1 
ATOM   95   N  N6    . DA  A 1 5   ? -0.010  11.490 12.026  1.00 44.93 ? 5   DA  B N6    1 
ATOM   96   N  N1    . DA  A 1 5   ? -0.344  13.785 12.079  1.00 44.99 ? 5   DA  B N1    1 
ATOM   97   C  C2    . DA  A 1 5   ? -1.188  14.817 12.200  1.00 44.89 ? 5   DA  B C2    1 
ATOM   98   N  N3    . DA  A 1 5   ? -2.504  14.794 12.405  1.00 44.18 ? 5   DA  B N3    1 
ATOM   99   C  C4    . DA  A 1 5   ? -2.959  13.533 12.484  1.00 44.46 ? 5   DA  B C4    1 
ATOM   100  P  P     . DT  A 1 6   ? -8.897  15.395 10.751  1.00 56.84 ? 6   DT  B P     1 
ATOM   101  O  OP1   . DT  A 1 6   ? -10.064 16.295 10.947  1.00 56.71 ? 6   DT  B OP1   1 
ATOM   102  O  OP2   . DT  A 1 6   ? -9.085  14.024 10.196  1.00 55.14 ? 6   DT  B OP2   1 
ATOM   103  O  "O5'" . DT  A 1 6   ? -7.802  16.061 9.780   1.00 54.52 ? 6   DT  B "O5'" 1 
ATOM   104  C  "C5'" . DT  A 1 6   ? -7.230  17.325 10.094  1.00 52.61 ? 6   DT  B "C5'" 1 
ATOM   105  C  "C4'" . DT  A 1 6   ? -6.013  17.581 9.225   1.00 50.86 ? 6   DT  B "C4'" 1 
ATOM   106  O  "O4'" . DT  A 1 6   ? -4.940  16.741 9.706   1.00 51.11 ? 6   DT  B "O4'" 1 
ATOM   107  C  "C3'" . DT  A 1 6   ? -6.194  17.249 7.749   1.00 49.85 ? 6   DT  B "C3'" 1 
ATOM   108  O  "O3'" . DT  A 1 6   ? -6.305  18.400 6.924   1.00 47.62 ? 6   DT  B "O3'" 1 
ATOM   109  C  "C2'" . DT  A 1 6   ? -4.884  16.588 7.345   1.00 50.77 ? 6   DT  B "C2'" 1 
ATOM   110  C  "C1'" . DT  A 1 6   ? -4.136  16.288 8.640   1.00 51.29 ? 6   DT  B "C1'" 1 
ATOM   111  N  N1    . DT  A 1 6   ? -3.969  14.827 8.781   1.00 51.15 ? 6   DT  B N1    1 
ATOM   112  C  C2    . DT  A 1 6   ? -2.723  14.229 8.897   1.00 51.19 ? 6   DT  B C2    1 
ATOM   113  O  O2    . DT  A 1 6   ? -1.660  14.831 8.906   1.00 51.39 ? 6   DT  B O2    1 
ATOM   114  N  N3    . DT  A 1 6   ? -2.779  12.859 9.007   1.00 50.60 ? 6   DT  B N3    1 
ATOM   115  C  C4    . DT  A 1 6   ? -3.924  12.064 8.994   1.00 51.52 ? 6   DT  B C4    1 
ATOM   116  O  O4    . DT  A 1 6   ? -3.879  10.842 9.081   1.00 51.95 ? 6   DT  B O4    1 
ATOM   117  C  C5    . DT  A 1 6   ? -5.186  12.757 8.857   1.00 52.50 ? 6   DT  B C5    1 
ATOM   118  C  C7    . DT  A 1 6   ? -6.512  12.030 8.818   1.00 52.06 ? 6   DT  B C7    1 
ATOM   119  C  C6    . DT  A 1 6   ? -5.134  14.086 8.760   1.00 52.13 ? 6   DT  B C6    1 
HETATM 120  C  C2    . MA7 A 1 7   ? -12.329 25.581 5.357   1.00 43.41 ? 7   MA7 B C2    1 
HETATM 121  C  C4    . MA7 A 1 7   ? -10.959 23.750 5.759   1.00 42.73 ? 7   MA7 B C4    1 
HETATM 122  C  C5    . MA7 A 1 7   ? -11.253 23.774 7.113   1.00 42.28 ? 7   MA7 B C5    1 
HETATM 123  C  C6    . MA7 A 1 7   ? -12.114 24.738 7.610   1.00 42.23 ? 7   MA7 B C6    1 
HETATM 124  C  C8    . MA7 A 1 7   ? -9.889  22.157 6.729   1.00 43.10 ? 7   MA7 B C8    1 
HETATM 125  P  P     . MA7 A 1 7   ? -7.175  19.703 7.221   1.00 45.08 ? 7   MA7 B P     1 
HETATM 126  O  OP1   . MA7 A 1 7   ? -6.385  20.607 8.072   1.00 44.67 ? 7   MA7 B OP1   1 
HETATM 127  O  OP2   . MA7 A 1 7   ? -8.536  19.294 7.644   1.00 46.27 ? 7   MA7 B OP2   1 
HETATM 128  O  "O5'" . MA7 A 1 7   ? -7.246  20.287 5.735   1.00 44.00 ? 7   MA7 B "O5'" 1 
HETATM 129  N  N9    . MA7 A 1 7   ? -10.118 22.748 5.556   1.00 42.77 ? 7   MA7 B N9    1 
HETATM 130  N  N3    . MA7 A 1 7   ? -11.498 24.646 4.921   1.00 43.47 ? 7   MA7 B N3    1 
HETATM 131  N  N1    . MA7 A 1 7   ? -12.660 25.656 6.716   1.00 42.78 ? 7   MA7 B N1    1 
HETATM 132  N  N6    . MA7 A 1 7   ? -12.416 24.786 8.905   1.00 42.25 ? 7   MA7 B N6    1 
HETATM 133  N  N7    . MA7 A 1 7   ? -10.583 22.779 7.682   1.00 43.06 ? 7   MA7 B N7    1 
HETATM 134  C  CN    . MA7 A 1 7   ? -13.587 26.705 7.185   1.00 43.12 ? 7   MA7 B CN    1 
HETATM 135  C  "C2'" . MA7 A 1 7   ? -8.093  22.600 4.049   1.00 41.71 ? 7   MA7 B "C2'" 1 
HETATM 136  C  "C5'" . MA7 A 1 7   ? -7.687  19.479 4.657   1.00 41.59 ? 7   MA7 B "C5'" 1 
HETATM 137  C  "C4'" . MA7 A 1 7   ? -8.513  20.302 3.657   1.00 42.12 ? 7   MA7 B "C4'" 1 
HETATM 138  O  "O4'" . MA7 A 1 7   ? -9.699  20.900 4.276   1.00 41.58 ? 7   MA7 B "O4'" 1 
HETATM 139  C  "C1'" . MA7 A 1 7   ? -9.570  22.345 4.255   1.00 42.26 ? 7   MA7 B "C1'" 1 
HETATM 140  C  "C3'" . MA7 A 1 7   ? -7.791  21.492 3.048   1.00 42.07 ? 7   MA7 B "C3'" 1 
HETATM 141  O  "O3'" . MA7 A 1 7   ? -8.515  21.732 1.860   1.00 42.26 ? 7   MA7 B "O3'" 1 
ATOM   142  P  P     . DA  A 1 8   ? -8.021  22.742 0.735   1.00 43.77 ? 8   DA  B P     1 
ATOM   143  O  OP1   . DA  A 1 8   ? -7.618  24.011 1.380   1.00 42.83 ? 8   DA  B OP1   1 
ATOM   144  O  OP2   . DA  A 1 8   ? -9.059  22.718 -0.329  1.00 41.76 ? 8   DA  B OP2   1 
ATOM   145  O  "O5'" . DA  A 1 8   ? -6.701  22.053 0.170   1.00 43.44 ? 8   DA  B "O5'" 1 
ATOM   146  C  "C5'" . DA  A 1 8   ? -5.496  22.780 0.054   1.00 43.91 ? 8   DA  B "C5'" 1 
ATOM   147  C  "C4'" . DA  A 1 8   ? -4.402  21.869 -0.456  1.00 44.29 ? 8   DA  B "C4'" 1 
ATOM   148  O  "O4'" . DA  A 1 8   ? -4.159  20.862 0.549   1.00 44.64 ? 8   DA  B "O4'" 1 
ATOM   149  C  "C3'" . DA  A 1 8   ? -4.779  21.132 -1.728  1.00 44.28 ? 8   DA  B "C3'" 1 
ATOM   150  O  "O3'" . DA  A 1 8   ? -4.051  21.650 -2.787  1.00 44.34 ? 8   DA  B "O3'" 1 
ATOM   151  C  "C2'" . DA  A 1 8   ? -4.350  19.693 -1.514  1.00 44.96 ? 8   DA  B "C2'" 1 
ATOM   152  C  "C1'" . DA  A 1 8   ? -3.909  19.621 -0.068  1.00 46.13 ? 8   DA  B "C1'" 1 
ATOM   153  N  N9    . DA  A 1 8   ? -4.662  18.567 0.589   1.00 46.82 ? 8   DA  B N9    1 
ATOM   154  C  C8    . DA  A 1 8   ? -5.913  18.635 1.134   1.00 47.14 ? 8   DA  B C8    1 
ATOM   155  N  N7    . DA  A 1 8   ? -6.321  17.498 1.643   1.00 47.99 ? 8   DA  B N7    1 
ATOM   156  C  C5    . DA  A 1 8   ? -5.268  16.623 1.408   1.00 47.90 ? 8   DA  B C5    1 
ATOM   157  C  C6    . DA  A 1 8   ? -5.061  15.251 1.694   1.00 46.91 ? 8   DA  B C6    1 
ATOM   158  N  N6    . DA  A 1 8   ? -5.947  14.477 2.316   1.00 46.86 ? 8   DA  B N6    1 
ATOM   159  N  N1    . DA  A 1 8   ? -3.897  14.689 1.313   1.00 46.97 ? 8   DA  B N1    1 
ATOM   160  C  C2    . DA  A 1 8   ? -2.985  15.446 0.683   1.00 47.43 ? 8   DA  B C2    1 
ATOM   161  N  N3    . DA  A 1 8   ? -3.060  16.738 0.352   1.00 47.74 ? 8   DA  B N3    1 
ATOM   162  C  C4    . DA  A 1 8   ? -4.237  17.271 0.749   1.00 47.82 ? 8   DA  B C4    1 
ATOM   163  P  P     . DC  A 1 9   ? -4.422  21.158 -4.250  1.00 45.95 ? 9   DC  B P     1 
ATOM   164  O  OP1   . DC  A 1 9   ? -4.299  22.334 -5.134  1.00 47.43 ? 9   DC  B OP1   1 
ATOM   165  O  OP2   . DC  A 1 9   ? -5.733  20.477 -4.160  1.00 46.23 ? 9   DC  B OP2   1 
ATOM   166  O  "O5'" . DC  A 1 9   ? -3.278  20.097 -4.642  1.00 46.06 ? 9   DC  B "O5'" 1 
ATOM   167  C  "C5'" . DC  A 1 9   ? -1.934  20.296 -4.205  1.00 47.43 ? 9   DC  B "C5'" 1 
ATOM   168  C  "C4'" . DC  A 1 9   ? -1.129  19.009 -4.183  1.00 47.93 ? 9   DC  B "C4'" 1 
ATOM   169  O  "O4'" . DC  A 1 9   ? -1.538  18.193 -3.062  1.00 47.23 ? 9   DC  B "O4'" 1 
ATOM   170  C  "C3'" . DC  A 1 9   ? -1.314  18.127 -5.404  1.00 49.28 ? 9   DC  B "C3'" 1 
ATOM   171  O  "O3'" . DC  A 1 9   ? -0.383  18.544 -6.396  1.00 51.81 ? 9   DC  B "O3'" 1 
ATOM   172  C  "C2'" . DC  A 1 9   ? -0.997  16.747 -4.839  1.00 48.46 ? 9   DC  B "C2'" 1 
ATOM   173  C  "C1'" . DC  A 1 9   ? -1.515  16.819 -3.407  1.00 47.21 ? 9   DC  B "C1'" 1 
ATOM   174  N  N1    . DC  A 1 9   ? -2.888  16.203 -3.170  1.00 47.24 ? 9   DC  B N1    1 
ATOM   175  C  C2    . DC  A 1 9   ? -3.030  14.941 -2.563  1.00 46.79 ? 9   DC  B C2    1 
ATOM   176  O  O2    . DC  A 1 9   ? -2.014  14.330 -2.229  1.00 47.16 ? 9   DC  B O2    1 
ATOM   177  N  N3    . DC  A 1 9   ? -4.270  14.412 -2.345  1.00 46.25 ? 9   DC  B N3    1 
ATOM   178  C  C4    . DC  A 1 9   ? -5.357  15.104 -2.709  1.00 46.89 ? 9   DC  B C4    1 
ATOM   179  N  N4    . DC  A 1 9   ? -6.591  14.599 -2.525  1.00 46.83 ? 9   DC  B N4    1 
ATOM   180  C  C5    . DC  A 1 9   ? -5.236  16.381 -3.333  1.00 47.36 ? 9   DC  B C5    1 
ATOM   181  C  C6    . DC  A 1 9   ? -4.012  16.886 -3.536  1.00 47.19 ? 9   DC  B C6    1 
ATOM   182  P  P     . DT  A 1 10  ? -0.473  18.053 -7.926  1.00 53.96 ? 10  DT  B P     1 
ATOM   183  O  OP1   . DT  A 1 10  ? 0.385   18.933 -8.756  1.00 53.55 ? 10  DT  B OP1   1 
ATOM   184  O  OP2   . DT  A 1 10  ? -1.914  17.912 -8.259  1.00 53.74 ? 10  DT  B OP2   1 
ATOM   185  O  "O5'" . DT  A 1 10  ? 0.211   16.603 -7.892  1.00 52.81 ? 10  DT  B "O5'" 1 
ATOM   186  C  "C5'" . DT  A 1 10  ? 1.530   16.421 -7.377  1.00 52.69 ? 10  DT  B "C5'" 1 
ATOM   187  C  "C4'" . DT  A 1 10  ? 1.808   14.944 -7.126  1.00 52.81 ? 10  DT  B "C4'" 1 
ATOM   188  O  "O4'" . DT  A 1 10  ? 0.828   14.395 -6.199  1.00 52.42 ? 10  DT  B "O4'" 1 
ATOM   189  C  "C3'" . DT  A 1 10  ? 1.765   14.048 -8.367  1.00 52.41 ? 10  DT  B "C3'" 1 
ATOM   190  O  "O3'" . DT  A 1 10  ? 2.721   12.992 -8.251  1.00 52.60 ? 10  DT  B "O3'" 1 
ATOM   191  C  "C2'" . DT  A 1 10  ? 0.346   13.497 -8.321  1.00 52.06 ? 10  DT  B "C2'" 1 
ATOM   192  C  "C1'" . DT  A 1 10  ? 0.179   13.295 -6.820  1.00 51.70 ? 10  DT  B "C1'" 1 
ATOM   193  N  N1    . DT  A 1 10  ? -1.246  13.230 -6.382  1.00 51.43 ? 10  DT  B N1    1 
ATOM   194  C  C2    . DT  A 1 10  ? -1.641  12.197 -5.552  1.00 51.19 ? 10  DT  B C2    1 
ATOM   195  O  O2    . DT  A 1 10  ? -0.883  11.330 -5.151  1.00 50.72 ? 10  DT  B O2    1 
ATOM   196  N  N3    . DT  A 1 10  ? -2.974  12.228 -5.209  1.00 51.11 ? 10  DT  B N3    1 
ATOM   197  C  C4    . DT  A 1 10  ? -3.919  13.162 -5.606  1.00 50.99 ? 10  DT  B C4    1 
ATOM   198  O  O4    . DT  A 1 10  ? -5.084  13.092 -5.237  1.00 50.94 ? 10  DT  B O4    1 
ATOM   199  C  C5    . DT  A 1 10  ? -3.438  14.211 -6.477  1.00 50.82 ? 10  DT  B C5    1 
ATOM   200  C  C7    . DT  A 1 10  ? -4.353  15.286 -6.983  1.00 50.98 ? 10  DT  B C7    1 
ATOM   201  C  C6    . DT  A 1 10  ? -2.144  14.191 -6.818  1.00 51.06 ? 10  DT  B C6    1 
ATOM   202  P  P     . DG  A 1 11  ? 3.027   11.932 -9.430  1.00 52.51 ? 11  DG  B P     1 
ATOM   203  O  OP1   . DG  A 1 11  ? 4.341   12.324 -9.997  1.00 51.87 ? 11  DG  B OP1   1 
ATOM   204  O  OP2   . DG  A 1 11  ? 1.863   11.800 -10.352 1.00 51.86 ? 11  DG  B OP2   1 
ATOM   205  O  "O5'" . DG  A 1 11  ? 3.175   10.555 -8.609  1.00 50.54 ? 11  DG  B "O5'" 1 
ATOM   206  C  "C5'" . DG  A 1 11  ? 2.259   10.188 -7.565  1.00 48.85 ? 11  DG  B "C5'" 1 
ATOM   207  C  "C4'" . DG  A 1 11  ? 1.573   8.838  -7.787  1.00 47.59 ? 11  DG  B "C4'" 1 
ATOM   208  O  "O4'" . DG  A 1 11  ? 0.171   8.951  -7.419  1.00 46.40 ? 11  DG  B "O4'" 1 
ATOM   209  C  "C3'" . DG  A 1 11  ? 1.553   8.247  -9.202  1.00 47.29 ? 11  DG  B "C3'" 1 
ATOM   210  O  "O3'" . DG  A 1 11  ? 1.433   6.811  -9.137  1.00 48.01 ? 11  DG  B "O3'" 1 
ATOM   211  C  "C2'" . DG  A 1 11  ? 0.287   8.865  -9.770  1.00 46.13 ? 11  DG  B "C2'" 1 
ATOM   212  C  "C1'" . DG  A 1 11  ? -0.626  8.686  -8.560  1.00 44.91 ? 11  DG  B "C1'" 1 
ATOM   213  N  N9    . DG  A 1 11  ? -1.787  9.567  -8.565  1.00 44.42 ? 11  DG  B N9    1 
ATOM   214  C  C8    . DG  A 1 11  ? -1.878  10.808 -9.153  1.00 44.25 ? 11  DG  B C8    1 
ATOM   215  N  N7    . DG  A 1 11  ? -3.042  11.372 -9.003  1.00 44.33 ? 11  DG  B N7    1 
ATOM   216  C  C5    . DG  A 1 11  ? -3.766  10.441 -8.272  1.00 44.07 ? 11  DG  B C5    1 
ATOM   217  C  C6    . DG  A 1 11  ? -5.098  10.505 -7.817  1.00 44.15 ? 11  DG  B C6    1 
ATOM   218  O  O6    . DG  A 1 11  ? -5.892  11.434 -7.988  1.00 44.24 ? 11  DG  B O6    1 
ATOM   219  N  N1    . DG  A 1 11  ? -5.474  9.359  -7.113  1.00 44.03 ? 11  DG  B N1    1 
ATOM   220  C  C2    . DG  A 1 11  ? -4.646  8.282  -6.884  1.00 43.97 ? 11  DG  B C2    1 
ATOM   221  N  N2    . DG  A 1 11  ? -5.176  7.272  -6.188  1.00 44.03 ? 11  DG  B N2    1 
ATOM   222  N  N3    . DG  A 1 11  ? -3.388  8.206  -7.308  1.00 43.55 ? 11  DG  B N3    1 
ATOM   223  C  C4    . DG  A 1 11  ? -3.015  9.319  -7.994  1.00 43.92 ? 11  DG  B C4    1 
ATOM   224  P  P     . DC  A 1 12  ? 1.760   5.823  -10.364 1.00 48.48 ? 12  DC  B P     1 
ATOM   225  O  OP1   . DC  A 1 12  ? 1.850   4.471  -9.766  1.00 48.26 ? 12  DC  B OP1   1 
ATOM   226  O  OP2   . DC  A 1 12  ? 2.902   6.376  -11.130 1.00 48.04 ? 12  DC  B OP2   1 
ATOM   227  O  "O5'" . DC  A 1 12  ? 0.453   5.902  -11.308 1.00 48.66 ? 12  DC  B "O5'" 1 
ATOM   228  C  "C5'" . DC  A 1 12  ? -0.476  4.822  -11.473 1.00 47.80 ? 12  DC  B "C5'" 1 
ATOM   229  C  "C4'" . DC  A 1 12  ? -1.382  4.655  -10.256 1.00 47.40 ? 12  DC  B "C4'" 1 
ATOM   230  O  "O4'" . DC  A 1 12  ? -1.987  5.922  -9.889  1.00 46.34 ? 12  DC  B "O4'" 1 
ATOM   231  C  "C3'" . DC  A 1 12  ? -2.546  3.695  -10.458 1.00 47.71 ? 12  DC  B "C3'" 1 
ATOM   232  O  "O3'" . DC  A 1 12  ? -2.756  2.893  -9.289  1.00 48.57 ? 12  DC  B "O3'" 1 
ATOM   233  C  "C2'" . DC  A 1 12  ? -3.732  4.614  -10.753 1.00 46.55 ? 12  DC  B "C2'" 1 
ATOM   234  C  "C1'" . DC  A 1 12  ? -3.398  5.824  -9.897  1.00 44.71 ? 12  DC  B "C1'" 1 
ATOM   235  N  N1    . DC  A 1 12  ? -3.974  7.113  -10.396 1.00 43.72 ? 12  DC  B N1    1 
ATOM   236  C  C2    . DC  A 1 12  ? -5.287  7.485  -10.052 1.00 43.41 ? 12  DC  B C2    1 
ATOM   237  O  O2    . DC  A 1 12  ? -5.973  6.738  -9.340  1.00 42.88 ? 12  DC  B O2    1 
ATOM   238  N  N3    . DC  A 1 12  ? -5.770  8.672  -10.514 1.00 43.36 ? 12  DC  B N3    1 
ATOM   239  C  C4    . DC  A 1 12  ? -5.007  9.461  -11.283 1.00 43.45 ? 12  DC  B C4    1 
ATOM   240  N  N4    . DC  A 1 12  ? -5.522  10.615 -11.718 1.00 43.08 ? 12  DC  B N4    1 
ATOM   241  C  C5    . DC  A 1 12  ? -3.672  9.100  -11.639 1.00 43.10 ? 12  DC  B C5    1 
ATOM   242  C  C6    . DC  A 1 12  ? -3.205  7.933  -11.179 1.00 43.19 ? 12  DC  B C6    1 
ATOM   243  P  P     . DG  A 1 13  ? -3.460  1.453  -9.459  1.00 50.30 ? 13  DG  B P     1 
ATOM   244  O  OP1   . DG  A 1 13  ? -3.514  0.850  -8.102  1.00 50.18 ? 13  DG  B OP1   1 
ATOM   245  O  OP2   . DG  A 1 13  ? -2.844  0.735  -10.608 1.00 49.09 ? 13  DG  B OP2   1 
ATOM   246  O  "O5'" . DG  A 1 13  ? -4.944  1.821  -9.927  1.00 48.93 ? 13  DG  B "O5'" 1 
ATOM   247  C  "C5'" . DG  A 1 13  ? -6.010  0.905  -9.743  1.00 46.51 ? 13  DG  B "C5'" 1 
ATOM   248  C  "C4'" . DG  A 1 13  ? -7.097  1.234  -10.739 1.00 44.15 ? 13  DG  B "C4'" 1 
ATOM   249  O  "O4'" . DG  A 1 13  ? -7.197  2.673  -10.882 1.00 42.98 ? 13  DG  B "O4'" 1 
ATOM   250  C  "C3'" . DG  A 1 13  ? -6.817  0.684  -12.127 1.00 43.24 ? 13  DG  B "C3'" 1 
ATOM   251  O  "O3'" . DG  A 1 13  ? -7.889  -0.153 -12.494 1.00 44.02 ? 13  DG  B "O3'" 1 
ATOM   252  C  "C2'" . DG  A 1 13  ? -6.747  1.919  -13.019 1.00 42.58 ? 13  DG  B "C2'" 1 
ATOM   253  C  "C1'" . DG  A 1 13  ? -7.577  2.912  -12.216 1.00 41.90 ? 13  DG  B "C1'" 1 
ATOM   254  N  N9    . DG  A 1 13  ? -7.353  4.320  -12.536 1.00 41.49 ? 13  DG  B N9    1 
ATOM   255  C  C8    . DG  A 1 13  ? -6.223  4.886  -13.072 1.00 41.28 ? 13  DG  B C8    1 
ATOM   256  N  N7    . DG  A 1 13  ? -6.321  6.172  -13.246 1.00 41.37 ? 13  DG  B N7    1 
ATOM   257  C  C5    . DG  A 1 13  ? -7.597  6.486  -12.803 1.00 41.45 ? 13  DG  B C5    1 
ATOM   258  C  C6    . DG  A 1 13  ? -8.266  7.736  -12.751 1.00 41.22 ? 13  DG  B C6    1 
ATOM   259  O  O6    . DG  A 1 13  ? -7.840  8.842  -13.102 1.00 41.19 ? 13  DG  B O6    1 
ATOM   260  N  N1    . DG  A 1 13  ? -9.551  7.624  -12.228 1.00 41.18 ? 13  DG  B N1    1 
ATOM   261  C  C2    . DG  A 1 13  ? -10.117 6.441  -11.810 1.00 41.45 ? 13  DG  B C2    1 
ATOM   262  N  N2    . DG  A 1 13  ? -11.365 6.523  -11.335 1.00 41.47 ? 13  DG  B N2    1 
ATOM   263  N  N3    . DG  A 1 13  ? -9.503  5.260  -11.853 1.00 41.54 ? 13  DG  B N3    1 
ATOM   264  C  C4    . DG  A 1 13  ? -8.246  5.354  -12.360 1.00 41.47 ? 13  DG  B C4    1 
ATOM   265  O  "O5'" . DT  B 2 1   ? -14.942 16.643 -18.363 1.00 49.49 ? 1   DT  C "O5'" 1 
ATOM   266  C  "C5'" . DT  B 2 1   ? -14.149 15.456 -18.313 1.00 46.86 ? 1   DT  C "C5'" 1 
ATOM   267  C  "C4'" . DT  B 2 1   ? -14.732 14.486 -17.304 1.00 45.76 ? 1   DT  C "C4'" 1 
ATOM   268  O  "O4'" . DT  B 2 1   ? -13.947 13.268 -17.324 1.00 45.72 ? 1   DT  C "O4'" 1 
ATOM   269  C  "C3'" . DT  B 2 1   ? -14.741 14.982 -15.862 1.00 45.21 ? 1   DT  C "C3'" 1 
ATOM   270  O  "O3'" . DT  B 2 1   ? -16.051 14.859 -15.324 1.00 45.03 ? 1   DT  C "O3'" 1 
ATOM   271  C  "C2'" . DT  B 2 1   ? -13.726 14.091 -15.144 1.00 44.91 ? 1   DT  C "C2'" 1 
ATOM   272  C  "C1'" . DT  B 2 1   ? -13.700 12.834 -16.004 1.00 45.17 ? 1   DT  C "C1'" 1 
ATOM   273  N  N1    . DT  B 2 1   ? -12.399 12.106 -16.037 1.00 44.98 ? 1   DT  C N1    1 
ATOM   274  C  C2    . DT  B 2 1   ? -12.325 10.769 -15.664 1.00 44.88 ? 1   DT  C C2    1 
ATOM   275  O  O2    . DT  B 2 1   ? -13.265 10.094 -15.279 1.00 44.93 ? 1   DT  C O2    1 
ATOM   276  N  N3    . DT  B 2 1   ? -11.066 10.230 -15.755 1.00 44.83 ? 1   DT  C N3    1 
ATOM   277  C  C4    . DT  B 2 1   ? -9.909  10.864 -16.173 1.00 44.92 ? 1   DT  C C4    1 
ATOM   278  O  O4    . DT  B 2 1   ? -8.838  10.271 -16.218 1.00 45.39 ? 1   DT  C O4    1 
ATOM   279  C  C5    . DT  B 2 1   ? -10.051 12.255 -16.546 1.00 44.80 ? 1   DT  C C5    1 
ATOM   280  C  C7    . DT  B 2 1   ? -8.872  13.061 -17.013 1.00 44.40 ? 1   DT  C C7    1 
ATOM   281  C  C6    . DT  B 2 1   ? -11.276 12.796 -16.467 1.00 44.89 ? 1   DT  C C6    1 
ATOM   282  P  P     . DC  B 2 2   ? -16.440 15.418 -13.871 1.00 46.34 ? 2   DC  C P     1 
ATOM   283  O  OP1   . DC  B 2 2   ? -17.880 15.752 -13.941 1.00 47.23 ? 2   DC  C OP1   1 
ATOM   284  O  OP2   . DC  B 2 2   ? -15.472 16.440 -13.395 1.00 45.60 ? 2   DC  C OP2   1 
ATOM   285  O  "O5'" . DC  B 2 2   ? -16.244 14.154 -12.920 1.00 45.63 ? 2   DC  C "O5'" 1 
ATOM   286  C  "C5'" . DC  B 2 2   ? -16.753 12.885 -13.298 1.00 44.72 ? 2   DC  C "C5'" 1 
ATOM   287  C  "C4'" . DC  B 2 2   ? -16.440 11.854 -12.232 1.00 44.03 ? 2   DC  C "C4'" 1 
ATOM   288  O  "O4'" . DC  B 2 2   ? -15.198 11.195 -12.576 1.00 43.50 ? 2   DC  C "O4'" 1 
ATOM   289  C  "C3'" . DC  B 2 2   ? -16.276 12.412 -10.823 1.00 44.21 ? 2   DC  C "C3'" 1 
ATOM   290  O  "O3'" . DC  B 2 2   ? -17.117 11.684 -9.933  1.00 44.67 ? 2   DC  C "O3'" 1 
ATOM   291  C  "C2'" . DC  B 2 2   ? -14.788 12.239 -10.508 1.00 44.18 ? 2   DC  C "C2'" 1 
ATOM   292  C  "C1'" . DC  B 2 2   ? -14.384 11.095 -11.428 1.00 43.94 ? 2   DC  C "C1'" 1 
ATOM   293  N  N1    . DC  B 2 2   ? -12.961 11.138 -11.883 1.00 44.02 ? 2   DC  C N1    1 
ATOM   294  C  C2    . DC  B 2 2   ? -12.173 9.975  -11.810 1.00 43.03 ? 2   DC  C C2    1 
ATOM   295  O  O2    . DC  B 2 2   ? -12.662 8.935  -11.361 1.00 43.02 ? 2   DC  C O2    1 
ATOM   296  N  N3    . DC  B 2 2   ? -10.885 10.030 -12.231 1.00 42.59 ? 2   DC  C N3    1 
ATOM   297  C  C4    . DC  B 2 2   ? -10.389 11.175 -12.707 1.00 43.30 ? 2   DC  C C4    1 
ATOM   298  N  N4    . DC  B 2 2   ? -9.121  11.185 -13.108 1.00 43.43 ? 2   DC  C N4    1 
ATOM   299  C  C5    . DC  B 2 2   ? -11.167 12.373 -12.790 1.00 43.63 ? 2   DC  C C5    1 
ATOM   300  C  C6    . DC  B 2 2   ? -12.438 12.309 -12.371 1.00 43.78 ? 2   DC  C C6    1 
ATOM   301  P  P     . DG  B 2 3   ? -17.132 11.980 -8.361  1.00 44.75 ? 3   DG  C P     1 
ATOM   302  O  OP1   . DG  B 2 3   ? -18.450 11.571 -7.844  1.00 45.47 ? 3   DG  C OP1   1 
ATOM   303  O  OP2   . DG  B 2 3   ? -16.644 13.354 -8.118  1.00 45.15 ? 3   DG  C OP2   1 
ATOM   304  O  "O5'" . DG  B 2 3   ? -16.055 10.945 -7.813  1.00 45.55 ? 3   DG  C "O5'" 1 
ATOM   305  C  "C5'" . DG  B 2 3   ? -16.323 9.549  -7.906  1.00 47.03 ? 3   DG  C "C5'" 1 
ATOM   306  C  "C4'" . DG  B 2 3   ? -15.152 8.752  -7.364  1.00 48.20 ? 3   DG  C "C4'" 1 
ATOM   307  O  "O4'" . DG  B 2 3   ? -13.970 8.984  -8.169  1.00 48.41 ? 3   DG  C "O4'" 1 
ATOM   308  C  "C3'" . DG  B 2 3   ? -14.725 9.104  -5.948  1.00 48.95 ? 3   DG  C "C3'" 1 
ATOM   309  O  "O3'" . DG  B 2 3   ? -14.302 7.923  -5.321  1.00 50.54 ? 3   DG  C "O3'" 1 
ATOM   310  C  "C2'" . DG  B 2 3   ? -13.547 10.048 -6.148  1.00 48.55 ? 3   DG  C "C2'" 1 
ATOM   311  C  "C1'" . DG  B 2 3   ? -12.902 9.295  -7.299  1.00 48.34 ? 3   DG  C "C1'" 1 
ATOM   312  N  N9    . DG  B 2 3   ? -11.866 10.009 -8.034  1.00 48.44 ? 3   DG  C N9    1 
ATOM   313  C  C8    . DG  B 2 3   ? -11.861 11.326 -8.438  1.00 48.36 ? 3   DG  C C8    1 
ATOM   314  N  N7    . DG  B 2 3   ? -10.780 11.654 -9.089  1.00 48.58 ? 3   DG  C N7    1 
ATOM   315  C  C5    . DG  B 2 3   ? -10.030 10.476 -9.109  1.00 48.14 ? 3   DG  C C5    1 
ATOM   316  C  C6    . DG  B 2 3   ? -8.762  10.210 -9.669  1.00 47.95 ? 3   DG  C C6    1 
ATOM   317  O  O6    . DG  B 2 3   ? -8.036  11.001 -10.276 1.00 48.46 ? 3   DG  C O6    1 
ATOM   318  N  N1    . DG  B 2 3   ? -8.352  8.890  -9.476  1.00 48.10 ? 3   DG  C N1    1 
ATOM   319  C  C2    . DG  B 2 3   ? -9.091  7.936  -8.814  1.00 48.16 ? 3   DG  C C2    1 
ATOM   320  N  N2    . DG  B 2 3   ? -8.553  6.715  -8.718  1.00 48.11 ? 3   DG  C N2    1 
ATOM   321  N  N3    . DG  B 2 3   ? -10.283 8.171  -8.282  1.00 48.27 ? 3   DG  C N3    1 
ATOM   322  C  C4    . DG  B 2 3   ? -10.687 9.455  -8.470  1.00 47.99 ? 3   DG  C C4    1 
ATOM   323  P  P     . DC  B 2 4   ? -14.854 7.670  -3.855  1.00 52.54 ? 4   DC  C P     1 
ATOM   324  O  OP1   . DC  B 2 4   ? -16.288 7.320  -4.029  1.00 51.73 ? 4   DC  C OP1   1 
ATOM   325  O  OP2   . DC  B 2 4   ? -14.410 8.819  -3.025  1.00 52.20 ? 4   DC  C OP2   1 
ATOM   326  O  "O5'" . DC  B 2 4   ? -14.061 6.393  -3.300  1.00 52.61 ? 4   DC  C "O5'" 1 
ATOM   327  C  "C5'" . DC  B 2 4   ? -13.434 5.470  -4.186  1.00 52.59 ? 4   DC  C "C5'" 1 
ATOM   328  C  "C4'" . DC  B 2 4   ? -11.924 5.499  -4.023  1.00 51.90 ? 4   DC  C "C4'" 1 
ATOM   329  O  "O4'" . DC  B 2 4   ? -11.338 6.520  -4.870  1.00 51.18 ? 4   DC  C "O4'" 1 
ATOM   330  C  "C3'" . DC  B 2 4   ? -11.404 5.788  -2.614  1.00 51.90 ? 4   DC  C "C3'" 1 
ATOM   331  O  "O3'" . DC  B 2 4   ? -10.459 4.791  -2.320  1.00 52.58 ? 4   DC  C "O3'" 1 
ATOM   332  C  "C2'" . DC  B 2 4   ? -10.727 7.142  -2.767  1.00 51.16 ? 4   DC  C "C2'" 1 
ATOM   333  C  "C1'" . DC  B 2 4   ? -10.194 6.953  -4.178  1.00 50.34 ? 4   DC  C "C1'" 1 
ATOM   334  N  N1    . DC  B 2 4   ? -9.633  8.165  -4.821  1.00 49.90 ? 4   DC  C N1    1 
ATOM   335  C  C2    . DC  B 2 4   ? -8.365  8.108  -5.427  1.00 49.33 ? 4   DC  C C2    1 
ATOM   336  O  O2    . DC  B 2 4   ? -7.726  7.052  -5.426  1.00 49.21 ? 4   DC  C O2    1 
ATOM   337  N  N3    . DC  B 2 4   ? -7.867  9.229  -6.006  1.00 49.19 ? 4   DC  C N3    1 
ATOM   338  C  C4    . DC  B 2 4   ? -8.583  10.359 -5.990  1.00 49.61 ? 4   DC  C C4    1 
ATOM   339  N  N4    . DC  B 2 4   ? -8.062  11.438 -6.570  1.00 49.58 ? 4   DC  C N4    1 
ATOM   340  C  C5    . DC  B 2 4   ? -9.871  10.440 -5.377  1.00 49.72 ? 4   DC  C C5    1 
ATOM   341  C  C6    . DC  B 2 4   ? -10.353 9.327  -4.811  1.00 49.76 ? 4   DC  C C6    1 
ATOM   342  P  P     . DA  B 2 5   ? -9.860  4.578  -0.854  1.00 53.80 ? 5   DA  C P     1 
ATOM   343  O  OP1   . DA  B 2 5   ? -10.958 4.051  -0.013  1.00 54.04 ? 5   DA  C OP1   1 
ATOM   344  O  OP2   . DA  B 2 5   ? -9.119  5.786  -0.418  1.00 53.57 ? 5   DA  C OP2   1 
ATOM   345  O  "O5'" . DA  B 2 5   ? -8.776  3.425  -1.123  1.00 53.08 ? 5   DA  C "O5'" 1 
ATOM   346  C  "C5'" . DA  B 2 5   ? -7.988  3.419  -2.328  1.00 51.44 ? 5   DA  C "C5'" 1 
ATOM   347  C  "C4'" . DA  B 2 5   ? -6.490  3.522  -2.061  1.00 50.06 ? 5   DA  C "C4'" 1 
ATOM   348  O  "O4'" . DA  B 2 5   ? -5.945  4.700  -2.714  1.00 49.36 ? 5   DA  C "O4'" 1 
ATOM   349  C  "C3'" . DA  B 2 5   ? -6.061  3.628  -0.601  1.00 49.89 ? 5   DA  C "C3'" 1 
ATOM   350  O  "O3'" . DA  B 2 5   ? -4.885  2.855  -0.431  1.00 50.38 ? 5   DA  C "O3'" 1 
ATOM   351  C  "C2'" . DA  B 2 5   ? -5.824  5.127  -0.395  1.00 49.18 ? 5   DA  C "C2'" 1 
ATOM   352  C  "C1'" . DA  B 2 5   ? -5.353  5.585  -1.773  1.00 47.47 ? 5   DA  C "C1'" 1 
ATOM   353  N  N9    . DA  B 2 5   ? -5.748  6.945  -2.143  1.00 46.82 ? 5   DA  C N9    1 
ATOM   354  C  C8    . DA  B 2 5   ? -6.969  7.534  -1.946  1.00 46.54 ? 5   DA  C C8    1 
ATOM   355  N  N7    . DA  B 2 5   ? -7.055  8.764  -2.394  1.00 46.21 ? 5   DA  C N7    1 
ATOM   356  C  C5    . DA  B 2 5   ? -5.801  9.005  -2.921  1.00 45.93 ? 5   DA  C C5    1 
ATOM   357  C  C6    . DA  B 2 5   ? -5.251  10.135 -3.551  1.00 45.91 ? 5   DA  C C6    1 
ATOM   358  N  N6    . DA  B 2 5   ? -5.947  11.259 -3.742  1.00 46.56 ? 5   DA  C N6    1 
ATOM   359  N  N1    . DA  B 2 5   ? -3.970  10.066 -3.972  1.00 45.90 ? 5   DA  C N1    1 
ATOM   360  C  C2    . DA  B 2 5   ? -3.288  8.927  -3.769  1.00 46.47 ? 5   DA  C C2    1 
ATOM   361  N  N3    . DA  B 2 5   ? -3.696  7.792  -3.187  1.00 46.43 ? 5   DA  C N3    1 
ATOM   362  C  C4    . DA  B 2 5   ? -4.979  7.897  -2.780  1.00 46.61 ? 5   DA  C C4    1 
ATOM   363  P  P     . DG  B 2 6   ? -4.108  2.779  0.974   1.00 51.66 ? 6   DG  C P     1 
ATOM   364  O  OP1   . DG  B 2 6   ? -3.475  1.433  1.035   1.00 50.81 ? 6   DG  C OP1   1 
ATOM   365  O  OP2   . DG  B 2 6   ? -4.980  3.260  2.077   1.00 51.17 ? 6   DG  C OP2   1 
ATOM   366  O  "O5'" . DG  B 2 6   ? -2.962  3.875  0.795   1.00 49.65 ? 6   DG  C "O5'" 1 
ATOM   367  C  "C5'" . DG  B 2 6   ? -2.174  3.924  -0.391  1.00 47.47 ? 6   DG  C "C5'" 1 
ATOM   368  C  "C4'" . DG  B 2 6   ? -1.218  5.085  -0.245  1.00 45.42 ? 6   DG  C "C4'" 1 
ATOM   369  O  "O4'" . DG  B 2 6   ? -1.887  6.305  -0.650  1.00 44.26 ? 6   DG  C "O4'" 1 
ATOM   370  C  "C3'" . DG  B 2 6   ? -0.747  5.299  1.190   1.00 44.57 ? 6   DG  C "C3'" 1 
ATOM   371  O  "O3'" . DG  B 2 6   ? 0.661   5.420  1.161   1.00 45.28 ? 6   DG  C "O3'" 1 
ATOM   372  C  "C2'" . DG  B 2 6   ? -1.456  6.572  1.653   1.00 43.00 ? 6   DG  C "C2'" 1 
ATOM   373  C  "C1'" . DG  B 2 6   ? -1.662  7.294  0.329   1.00 41.10 ? 6   DG  C "C1'" 1 
ATOM   374  N  N9    . DG  B 2 6   ? -2.784  8.226  0.288   1.00 40.41 ? 6   DG  C N9    1 
ATOM   375  C  C8    . DG  B 2 6   ? -4.055  8.064  0.791   1.00 40.05 ? 6   DG  C C8    1 
ATOM   376  N  N7    . DG  B 2 6   ? -4.828  9.098  0.584   1.00 39.91 ? 6   DG  C N7    1 
ATOM   377  C  C5    . DG  B 2 6   ? -4.014  9.990  -0.098  1.00 39.58 ? 6   DG  C C5    1 
ATOM   378  C  C6    . DG  B 2 6   ? -4.296  11.282 -0.587  1.00 39.72 ? 6   DG  C C6    1 
ATOM   379  O  O6    . DG  B 2 6   ? -5.366  11.891 -0.505  1.00 39.91 ? 6   DG  C O6    1 
ATOM   380  N  N1    . DG  B 2 6   ? -3.197  11.861 -1.224  1.00 39.82 ? 6   DG  C N1    1 
ATOM   381  C  C2    . DG  B 2 6   ? -1.966  11.248 -1.361  1.00 39.90 ? 6   DG  C C2    1 
ATOM   382  N  N2    . DG  B 2 6   ? -1.010  11.938 -1.997  1.00 39.76 ? 6   DG  C N2    1 
ATOM   383  N  N3    . DG  B 2 6   ? -1.688  10.033 -0.903  1.00 39.32 ? 6   DG  C N3    1 
ATOM   384  C  C4    . DG  B 2 6   ? -2.755  9.469  -0.287  1.00 39.57 ? 6   DG  C C4    1 
ATOM   385  P  P     . DT  B 2 7   ? 1.533   5.483  2.495   1.00 46.29 ? 7   DT  C P     1 
ATOM   386  O  OP1   . DT  B 2 7   ? 2.777   4.731  2.228   1.00 46.78 ? 7   DT  C OP1   1 
ATOM   387  O  OP2   . DT  B 2 7   ? 0.693   5.166  3.676   1.00 46.44 ? 7   DT  C OP2   1 
ATOM   388  O  "O5'" . DT  B 2 7   ? 1.891   7.031  2.557   1.00 46.59 ? 7   DT  C "O5'" 1 
ATOM   389  C  "C5'" . DT  B 2 7   ? 2.085   7.706  1.324   1.00 46.57 ? 7   DT  C "C5'" 1 
ATOM   390  C  "C4'" . DT  B 2 7   ? 1.850   9.178  1.537   1.00 46.01 ? 7   DT  C "C4'" 1 
ATOM   391  O  "O4'" . DT  B 2 7   ? 0.449   9.523  1.400   1.00 44.56 ? 7   DT  C "O4'" 1 
ATOM   392  C  "C3'" . DT  B 2 7   ? 2.260   9.662  2.919   1.00 47.05 ? 7   DT  C "C3'" 1 
ATOM   393  O  "O3'" . DT  B 2 7   ? 3.019   10.797 2.698   1.00 51.18 ? 7   DT  C "O3'" 1 
ATOM   394  C  "C2'" . DT  B 2 7   ? 0.950   10.094 3.557   1.00 45.03 ? 7   DT  C "C2'" 1 
ATOM   395  C  "C1'" . DT  B 2 7   ? 0.252   10.590 2.296   1.00 41.53 ? 7   DT  C "C1'" 1 
ATOM   396  N  N1    . DT  B 2 7   ? -1.179  10.904 2.484   1.00 39.87 ? 7   DT  C N1    1 
ATOM   397  C  C2    . DT  B 2 7   ? -1.656  12.093 1.991   1.00 38.91 ? 7   DT  C C2    1 
ATOM   398  O  O2    . DT  B 2 7   ? -0.966  12.887 1.387   1.00 38.94 ? 7   DT  C O2    1 
ATOM   399  N  N3    . DT  B 2 7   ? -2.986  12.313 2.227   1.00 38.26 ? 7   DT  C N3    1 
ATOM   400  C  C4    . DT  B 2 7   ? -3.862  11.479 2.896   1.00 39.28 ? 7   DT  C C4    1 
ATOM   401  O  O4    . DT  B 2 7   ? -5.037  11.787 3.049   1.00 39.14 ? 7   DT  C O4    1 
ATOM   402  C  C5    . DT  B 2 7   ? -3.292  10.243 3.402   1.00 39.25 ? 7   DT  C C5    1 
ATOM   403  C  C7    . DT  B 2 7   ? -4.118  9.236  4.157   1.00 39.21 ? 7   DT  C C7    1 
ATOM   404  C  C6    . DT  B 2 7   ? -1.993  10.025 3.170   1.00 39.52 ? 7   DT  C C6    1 
ATOM   405  P  P     . DT  B 2 8   ? 4.610   10.784 2.705   1.00 54.15 ? 8   DT  C P     1 
ATOM   406  O  OP1   . DT  B 2 8   ? 5.077   10.110 1.470   1.00 53.17 ? 8   DT  C OP1   1 
ATOM   407  O  OP2   . DT  B 2 8   ? 5.098   10.337 4.036   1.00 53.58 ? 8   DT  C OP2   1 
ATOM   408  O  "O5'" . DT  B 2 8   ? 4.858   12.370 2.593   1.00 55.80 ? 8   DT  C "O5'" 1 
ATOM   409  C  "C5'" . DT  B 2 8   ? 3.854   13.313 3.030   1.00 56.82 ? 8   DT  C "C5'" 1 
ATOM   410  C  "C4'" . DT  B 2 8   ? 4.162   13.970 4.371   1.00 58.13 ? 8   DT  C "C4'" 1 
ATOM   411  O  "O4'" . DT  B 2 8   ? 3.034   13.818 5.265   1.00 58.85 ? 8   DT  C "O4'" 1 
ATOM   412  C  "C3'" . DT  B 2 8   ? 5.385   13.484 5.150   1.00 58.59 ? 8   DT  C "C3'" 1 
ATOM   413  O  "O3'" . DT  B 2 8   ? 6.269   14.585 5.372   1.00 58.51 ? 8   DT  C "O3'" 1 
ATOM   414  C  "C2'" . DT  B 2 8   ? 4.819   12.947 6.470   1.00 59.26 ? 8   DT  C "C2'" 1 
ATOM   415  C  "C1'" . DT  B 2 8   ? 3.499   13.701 6.594   1.00 59.69 ? 8   DT  C "C1'" 1 
ATOM   416  N  N1    . DT  B 2 8   ? 2.374   13.031 7.328   1.00 60.05 ? 8   DT  C N1    1 
ATOM   417  C  C2    . DT  B 2 8   ? 1.531   13.785 8.132   1.00 60.10 ? 8   DT  C C2    1 
ATOM   418  O  O2    . DT  B 2 8   ? 1.659   14.983 8.326   1.00 60.32 ? 8   DT  C O2    1 
ATOM   419  N  N3    . DT  B 2 8   ? 0.519   13.071 8.729   1.00 59.94 ? 8   DT  C N3    1 
ATOM   420  C  C4    . DT  B 2 8   ? 0.263   11.711 8.604   1.00 60.12 ? 8   DT  C C4    1 
ATOM   421  O  O4    . DT  B 2 8   ? -0.676  11.181 9.190   1.00 59.72 ? 8   DT  C O4    1 
ATOM   422  C  C5    . DT  B 2 8   ? 1.174   10.978 7.740   1.00 60.45 ? 8   DT  C C5    1 
ATOM   423  C  C7    . DT  B 2 8   ? 1.021   9.499  7.502   1.00 60.07 ? 8   DT  C C7    1 
ATOM   424  C  C6    . DT  B 2 8   ? 2.163   11.671 7.150   1.00 60.42 ? 8   DT  C C6    1 
ATOM   425  P  P     . DA  B 2 9   ? 7.380   15.059 4.311   1.00 58.41 ? 9   DA  C P     1 
ATOM   426  O  OP1   . DA  B 2 9   ? 6.868   14.968 2.924   1.00 58.44 ? 9   DA  C OP1   1 
ATOM   427  O  OP2   . DA  B 2 9   ? 8.666   14.418 4.663   1.00 58.62 ? 9   DA  C OP2   1 
ATOM   428  O  "O5'" . DA  B 2 9   ? 7.442   16.602 4.697   1.00 58.33 ? 9   DA  C "O5'" 1 
ATOM   429  C  "C5'" . DA  B 2 9   ? 8.032   17.512 3.803   1.00 58.56 ? 9   DA  C "C5'" 1 
ATOM   430  C  "C4'" . DA  B 2 9   ? 8.921   18.454 4.591   1.00 59.04 ? 9   DA  C "C4'" 1 
ATOM   431  O  "O4'" . DA  B 2 9   ? 9.578   19.349 3.663   1.00 59.23 ? 9   DA  C "O4'" 1 
ATOM   432  C  "C3'" . DA  B 2 9   ? 8.205   19.326 5.621   1.00 58.78 ? 9   DA  C "C3'" 1 
ATOM   433  O  "O3'" . DA  B 2 9   ? 8.980   19.401 6.844   1.00 58.37 ? 9   DA  C "O3'" 1 
ATOM   434  C  "C2'" . DA  B 2 9   ? 8.018   20.672 4.905   1.00 59.01 ? 9   DA  C "C2'" 1 
ATOM   435  C  "C1'" . DA  B 2 9   ? 8.973   20.629 3.701   1.00 58.83 ? 9   DA  C "C1'" 1 
ATOM   436  N  N9    . DA  B 2 9   ? 8.457   20.970 2.354   1.00 58.77 ? 9   DA  C N9    1 
ATOM   437  C  C8    . DA  B 2 9   ? 9.038   20.587 1.167   1.00 58.77 ? 9   DA  C C8    1 
ATOM   438  N  N7    . DA  B 2 9   ? 8.436   21.014 0.081   1.00 58.45 ? 9   DA  C N7    1 
ATOM   439  C  C5    . DA  B 2 9   ? 7.375   21.750 0.577   1.00 58.59 ? 9   DA  C C5    1 
ATOM   440  C  C6    . DA  B 2 9   ? 6.345   22.469 -0.072  1.00 58.48 ? 9   DA  C C6    1 
ATOM   441  N  N6    . DA  B 2 9   ? 6.230   22.557 -1.399  1.00 58.52 ? 9   DA  C N6    1 
ATOM   442  N  N1    . DA  B 2 9   ? 5.434   23.099 0.702   1.00 58.69 ? 9   DA  C N1    1 
ATOM   443  C  C2    . DA  B 2 9   ? 5.556   23.012 2.037   1.00 58.59 ? 9   DA  C C2    1 
ATOM   444  N  N3    . DA  B 2 9   ? 6.468   22.362 2.763   1.00 58.30 ? 9   DA  C N3    1 
ATOM   445  C  C4    . DA  B 2 9   ? 7.367   21.740 1.973   1.00 58.61 ? 9   DA  C C4    1 
ATOM   446  P  P     . DT  B 2 10  ? 8.376   18.966 8.278   1.00 58.11 ? 10  DT  C P     1 
ATOM   447  O  OP1   . DT  B 2 10  ? 7.828   20.192 8.894   1.00 58.30 ? 10  DT  C OP1   1 
ATOM   448  O  OP2   . DT  B 2 10  ? 9.396   18.205 9.043   1.00 57.32 ? 10  DT  C OP2   1 
ATOM   449  O  "O5'" . DT  B 2 10  ? 7.162   17.986 7.880   1.00 57.61 ? 10  DT  C "O5'" 1 
ATOM   450  C  "C5'" . DT  B 2 10  ? 6.434   17.280 8.872   1.00 57.28 ? 10  DT  C "C5'" 1 
ATOM   451  C  "C4'" . DT  B 2 10  ? 5.422   18.171 9.588   1.00 57.10 ? 10  DT  C "C4'" 1 
ATOM   452  O  "O4'" . DT  B 2 10  ? 4.188   17.431 9.718   1.00 57.44 ? 10  DT  C "O4'" 1 
ATOM   453  C  "C3'" . DT  B 2 10  ? 5.737   18.613 11.024  1.00 56.42 ? 10  DT  C "C3'" 1 
ATOM   454  O  "O3'" . DT  B 2 10  ? 4.877   19.707 11.417  1.00 54.86 ? 10  DT  C "O3'" 1 
ATOM   455  C  "C2'" . DT  B 2 10  ? 5.381   17.347 11.790  1.00 56.84 ? 10  DT  C "C2'" 1 
ATOM   456  C  "C1'" . DT  B 2 10  ? 4.075   17.005 11.069  1.00 58.22 ? 10  DT  C "C1'" 1 
ATOM   457  N  N1    . DT  B 2 10  ? 3.700   15.570 11.043  1.00 58.60 ? 10  DT  C N1    1 
ATOM   458  C  C2    . DT  B 2 10  ? 2.422   15.256 11.438  1.00 58.62 ? 10  DT  C C2    1 
ATOM   459  O  O2    . DT  B 2 10  ? 1.617   16.091 11.810  1.00 58.83 ? 10  DT  C O2    1 
ATOM   460  N  N3    . DT  B 2 10  ? 2.125   13.921 11.384  1.00 58.28 ? 10  DT  C N3    1 
ATOM   461  C  C4    . DT  B 2 10  ? 2.965   12.903 10.981  1.00 58.55 ? 10  DT  C C4    1 
ATOM   462  O  O4    . DT  B 2 10  ? 2.584   11.741 10.976  1.00 58.86 ? 10  DT  C O4    1 
ATOM   463  C  C5    . DT  B 2 10  ? 4.294   13.300 10.569  1.00 58.91 ? 10  DT  C C5    1 
ATOM   464  C  C7    . DT  B 2 10  ? 5.301   12.284 10.109  1.00 58.69 ? 10  DT  C C7    1 
ATOM   465  C  C6    . DT  B 2 10  ? 4.595   14.604 10.616  1.00 58.98 ? 10  DT  C C6    1 
ATOM   466  P  P     . DA  B 2 11  ? 5.068   20.623 12.731  1.00 53.99 ? 11  DA  C P     1 
ATOM   467  O  OP1   . DA  B 2 11  ? 4.910   22.029 12.284  1.00 53.49 ? 11  DA  C OP1   1 
ATOM   468  O  OP2   . DA  B 2 11  ? 6.274   20.217 13.490  1.00 53.74 ? 11  DA  C OP2   1 
ATOM   469  O  "O5'" . DA  B 2 11  ? 3.822   20.202 13.648  1.00 52.87 ? 11  DA  C "O5'" 1 
ATOM   470  C  "C5'" . DA  B 2 11  ? 2.602   20.958 13.654  1.00 49.75 ? 11  DA  C "C5'" 1 
ATOM   471  C  "C4'" . DA  B 2 11  ? 1.610   20.397 14.657  1.00 46.45 ? 11  DA  C "C4'" 1 
ATOM   472  O  "O4'" . DA  B 2 11  ? 1.422   18.983 14.419  1.00 45.45 ? 11  DA  C "O4'" 1 
ATOM   473  C  "C3'" . DA  B 2 11  ? 2.050   20.493 16.106  1.00 46.24 ? 11  DA  C "C3'" 1 
ATOM   474  O  "O3'" . DA  B 2 11  ? 0.934   20.875 16.893  1.00 46.98 ? 11  DA  C "O3'" 1 
ATOM   475  C  "C2'" . DA  B 2 11  ? 2.550   19.085 16.448  1.00 44.83 ? 11  DA  C "C2'" 1 
ATOM   476  C  "C1'" . DA  B 2 11  ? 1.571   18.264 15.630  1.00 42.82 ? 11  DA  C "C1'" 1 
ATOM   477  N  N9    . DA  B 2 11  ? 1.982   16.895 15.319  1.00 41.79 ? 11  DA  C N9    1 
ATOM   478  C  C8    . DA  B 2 11  ? 3.217   16.464 14.926  1.00 41.30 ? 11  DA  C C8    1 
ATOM   479  N  N7    . DA  B 2 11  ? 3.281   15.172 14.707  1.00 41.02 ? 11  DA  C N7    1 
ATOM   480  C  C5    . DA  B 2 11  ? 1.998   14.724 14.970  1.00 40.90 ? 11  DA  C C5    1 
ATOM   481  C  C6    . DA  B 2 11  ? 1.405   13.444 14.924  1.00 41.15 ? 11  DA  C C6    1 
ATOM   482  N  N6    . DA  B 2 11  ? 2.065   12.331 14.577  1.00 41.14 ? 11  DA  C N6    1 
ATOM   483  N  N1    . DA  B 2 11  ? 0.096   13.351 15.244  1.00 41.06 ? 11  DA  C N1    1 
ATOM   484  C  C2    . DA  B 2 11  ? -0.571  14.458 15.590  1.00 40.97 ? 11  DA  C C2    1 
ATOM   485  N  N3    . DA  B 2 11  ? -0.117  15.707 15.676  1.00 40.77 ? 11  DA  C N3    1 
ATOM   486  C  C4    . DA  B 2 11  ? 1.183   15.776 15.345  1.00 40.96 ? 11  DA  C C4    1 
ATOM   487  P  P     . DC  B 2 12  ? 1.207   21.413 18.369  1.00 48.06 ? 12  DC  C P     1 
ATOM   488  O  OP1   . DC  B 2 12  ? -0.083  21.764 19.017  1.00 47.97 ? 12  DC  C OP1   1 
ATOM   489  O  OP2   . DC  B 2 12  ? 2.272   22.435 18.242  1.00 48.80 ? 12  DC  C OP2   1 
ATOM   490  O  "O5'" . DC  B 2 12  ? 1.834   20.129 19.096  1.00 47.41 ? 12  DC  C "O5'" 1 
ATOM   491  C  "C5'" . DC  B 2 12  ? 1.130   19.444 20.121  1.00 45.58 ? 12  DC  C "C5'" 1 
ATOM   492  C  "C4'" . DC  B 2 12  ? 0.012   18.625 19.508  1.00 43.88 ? 12  DC  C "C4'" 1 
ATOM   493  O  "O4'" . DC  B 2 12  ? 0.568   17.618 18.627  1.00 42.86 ? 12  DC  C "O4'" 1 
ATOM   494  C  "C3'" . DC  B 2 12  ? -0.853  17.876 20.508  1.00 43.84 ? 12  DC  C "C3'" 1 
ATOM   495  O  "O3'" . DC  B 2 12  ? -2.166  17.842 19.992  1.00 45.23 ? 12  DC  C "O3'" 1 
ATOM   496  C  "C2'" . DC  B 2 12  ? -0.235  16.484 20.514  1.00 41.97 ? 12  DC  C "C2'" 1 
ATOM   497  C  "C1'" . DC  B 2 12  ? 0.107   16.345 19.040  1.00 39.87 ? 12  DC  C "C1'" 1 
ATOM   498  N  N1    . DC  B 2 12  ? 1.125   15.299 18.725  1.00 38.53 ? 12  DC  C N1    1 
ATOM   499  C  C2    . DC  B 2 12  ? 0.697   13.967 18.622  1.00 37.14 ? 12  DC  C C2    1 
ATOM   500  O  O2    . DC  B 2 12  ? -0.493  13.697 18.800  1.00 36.55 ? 12  DC  C O2    1 
ATOM   501  N  N3    . DC  B 2 12  ? 1.602   13.005 18.325  1.00 36.89 ? 12  DC  C N3    1 
ATOM   502  C  C4    . DC  B 2 12  ? 2.887   13.322 18.134  1.00 38.21 ? 12  DC  C C4    1 
ATOM   503  N  N4    . DC  B 2 12  ? 3.724   12.315 17.849  1.00 37.88 ? 12  DC  C N4    1 
ATOM   504  C  C5    . DC  B 2 12  ? 3.357   14.677 18.241  1.00 37.43 ? 12  DC  C C5    1 
ATOM   505  C  C6    . DC  B 2 12  ? 2.448   15.623 18.535  1.00 37.84 ? 12  DC  C C6    1 
ATOM   506  P  P     . DA  B 2 13  ? -3.451  17.759 20.943  1.00 47.08 ? 13  DA  C P     1 
ATOM   507  O  OP1   . DA  B 2 13  ? -4.598  17.823 20.007  1.00 46.89 ? 13  DA  C OP1   1 
ATOM   508  O  OP2   . DA  B 2 13  ? -3.310  18.722 22.061  1.00 46.66 ? 13  DA  C OP2   1 
ATOM   509  O  "O5'" . DA  B 2 13  ? -3.409  16.294 21.590  1.00 46.25 ? 13  DA  C "O5'" 1 
ATOM   510  C  "C5'" . DA  B 2 13  ? -4.608  15.752 22.133  1.00 44.77 ? 13  DA  C "C5'" 1 
ATOM   511  C  "C4'" . DA  B 2 13  ? -4.316  14.534 22.986  1.00 43.11 ? 13  DA  C "C4'" 1 
ATOM   512  O  "O4'" . DA  B 2 13  ? -3.218  13.787 22.401  1.00 41.93 ? 13  DA  C "O4'" 1 
ATOM   513  C  "C3'" . DA  B 2 13  ? -3.906  14.857 24.416  1.00 42.87 ? 13  DA  C "C3'" 1 
ATOM   514  O  "O3'" . DA  B 2 13  ? -4.660  14.051 25.317  1.00 43.78 ? 13  DA  C "O3'" 1 
ATOM   515  C  "C2'" . DA  B 2 13  ? -2.425  14.494 24.457  1.00 42.50 ? 13  DA  C "C2'" 1 
ATOM   516  C  "C1'" . DA  B 2 13  ? -2.383  13.352 23.445  1.00 41.57 ? 13  DA  C "C1'" 1 
ATOM   517  N  N9    . DA  B 2 13  ? -1.062  13.007 22.909  1.00 41.57 ? 13  DA  C N9    1 
ATOM   518  C  C8    . DA  B 2 13  ? 0.014   13.840 22.722  1.00 41.33 ? 13  DA  C C8    1 
ATOM   519  N  N7    . DA  B 2 13  ? 1.073   13.240 22.230  1.00 41.25 ? 13  DA  C N7    1 
ATOM   520  C  C5    . DA  B 2 13  ? 0.672   11.918 22.084  1.00 41.36 ? 13  DA  C C5    1 
ATOM   521  C  C6    . DA  B 2 13  ? 1.328   10.764 21.604  1.00 40.80 ? 13  DA  C C6    1 
ATOM   522  N  N6    . DA  B 2 13  ? 2.587   10.759 21.165  1.00 40.82 ? 13  DA  C N6    1 
ATOM   523  N  N1    . DA  B 2 13  ? 0.641   9.606  21.588  1.00 41.23 ? 13  DA  C N1    1 
ATOM   524  C  C2    . DA  B 2 13  ? -0.625  9.599  22.022  1.00 41.12 ? 13  DA  C C2    1 
ATOM   525  N  N3    . DA  B 2 13  ? -1.347  10.614 22.493  1.00 40.69 ? 13  DA  C N3    1 
ATOM   526  C  C4    . DA  B 2 13  ? -0.640  11.757 22.498  1.00 41.17 ? 13  DA  C C4    1 
ATOM   527  N  N     . SER C 3 1   ? -40.567 25.297 2.762   1.00 49.75 ? 56  SER A N     1 
ATOM   528  C  CA    . SER C 3 1   ? -40.117 23.878 2.693   1.00 49.74 ? 56  SER A CA    1 
ATOM   529  C  C     . SER C 3 1   ? -38.609 23.733 2.845   1.00 49.68 ? 56  SER A C     1 
ATOM   530  O  O     . SER C 3 1   ? -37.825 24.407 2.170   1.00 49.78 ? 56  SER A O     1 
ATOM   531  C  CB    . SER C 3 1   ? -40.582 23.205 1.396   1.00 49.73 ? 56  SER A CB    1 
ATOM   532  O  OG    . SER C 3 1   ? -41.800 22.509 1.602   1.00 49.66 ? 56  SER A OG    1 
ATOM   533  N  N     . TRP C 3 2   ? -38.225 22.841 3.751   1.00 49.56 ? 57  TRP A N     1 
ATOM   534  C  CA    . TRP C 3 2   ? -36.837 22.501 3.992   1.00 49.45 ? 57  TRP A CA    1 
ATOM   535  C  C     . TRP C 3 2   ? -36.604 21.049 3.601   1.00 49.40 ? 57  TRP A C     1 
ATOM   536  O  O     . TRP C 3 2   ? -37.336 20.160 4.043   1.00 49.39 ? 57  TRP A O     1 
ATOM   537  C  CB    . TRP C 3 2   ? -36.514 22.660 5.478   1.00 49.44 ? 57  TRP A CB    1 
ATOM   538  C  CG    . TRP C 3 2   ? -36.537 24.067 5.989   1.00 49.51 ? 57  TRP A CG    1 
ATOM   539  C  CD1   . TRP C 3 2   ? -37.614 24.740 6.489   1.00 49.26 ? 57  TRP A CD1   1 
ATOM   540  C  CD2   . TRP C 3 2   ? -35.423 24.966 6.075   1.00 49.04 ? 57  TRP A CD2   1 
ATOM   541  N  NE1   . TRP C 3 2   ? -37.241 26.007 6.873   1.00 49.34 ? 57  TRP A NE1   1 
ATOM   542  C  CE2   . TRP C 3 2   ? -35.902 26.172 6.629   1.00 49.04 ? 57  TRP A CE2   1 
ATOM   543  C  CE3   . TRP C 3 2   ? -34.068 24.871 5.733   1.00 49.32 ? 57  TRP A CE3   1 
ATOM   544  C  CZ2   . TRP C 3 2   ? -35.074 27.278 6.852   1.00 48.81 ? 57  TRP A CZ2   1 
ATOM   545  C  CZ3   . TRP C 3 2   ? -33.243 25.972 5.957   1.00 49.30 ? 57  TRP A CZ3   1 
ATOM   546  C  CH2   . TRP C 3 2   ? -33.754 27.159 6.512   1.00 49.10 ? 57  TRP A CH2   1 
ATOM   547  N  N     . ARG C 3 3   ? -35.596 20.796 2.773   1.00 49.33 ? 58  ARG A N     1 
ATOM   548  C  CA    . ARG C 3 3   ? -35.146 19.427 2.595   1.00 49.34 ? 58  ARG A CA    1 
ATOM   549  C  C     . ARG C 3 3   ? -34.305 19.099 3.823   1.00 49.26 ? 58  ARG A C     1 
ATOM   550  O  O     . ARG C 3 3   ? -33.176 19.573 3.958   1.00 49.28 ? 58  ARG A O     1 
ATOM   551  C  CB    . ARG C 3 3   ? -34.345 19.244 1.301   1.00 49.33 ? 58  ARG A CB    1 
ATOM   552  C  CG    . ARG C 3 3   ? -34.144 17.777 0.927   1.00 49.86 ? 58  ARG A CG    1 
ATOM   553  C  CD    . ARG C 3 3   ? -33.036 17.580 -0.101  1.00 50.49 ? 58  ARG A CD    1 
ATOM   554  N  NE    . ARG C 3 3   ? -32.566 16.194 -0.121  1.00 51.15 ? 58  ARG A NE    1 
ATOM   555  C  CZ    . ARG C 3 3   ? -31.554 15.742 -0.860  1.00 51.27 ? 58  ARG A CZ    1 
ATOM   556  N  NH1   . ARG C 3 3   ? -30.890 16.562 -1.663  1.00 51.12 ? 58  ARG A NH1   1 
ATOM   557  N  NH2   . ARG C 3 3   ? -31.204 14.461 -0.796  1.00 51.26 ? 58  ARG A NH2   1 
ATOM   558  N  N     . HIS C 3 4   ? -34.877 18.326 4.738   1.00 49.16 ? 59  HIS A N     1 
ATOM   559  C  CA    . HIS C 3 4   ? -34.169 17.931 5.946   1.00 49.13 ? 59  HIS A CA    1 
ATOM   560  C  C     . HIS C 3 4   ? -33.237 16.769 5.648   1.00 49.05 ? 59  HIS A C     1 
ATOM   561  O  O     . HIS C 3 4   ? -33.660 15.613 5.613   1.00 49.15 ? 59  HIS A O     1 
ATOM   562  C  CB    . HIS C 3 4   ? -35.150 17.559 7.063   1.00 49.17 ? 59  HIS A CB    1 
ATOM   563  C  CG    . HIS C 3 4   ? -35.788 18.740 7.725   1.00 49.29 ? 59  HIS A CG    1 
ATOM   564  N  ND1   . HIS C 3 4   ? -35.055 19.753 8.305   1.00 49.38 ? 59  HIS A ND1   1 
ATOM   565  C  CD2   . HIS C 3 4   ? -37.090 19.062 7.911   1.00 49.51 ? 59  HIS A CD2   1 
ATOM   566  C  CE1   . HIS C 3 4   ? -35.878 20.655 8.810   1.00 49.40 ? 59  HIS A CE1   1 
ATOM   567  N  NE2   . HIS C 3 4   ? -37.118 20.259 8.587   1.00 49.79 ? 59  HIS A NE2   1 
ATOM   568  N  N     . ILE C 3 5   ? -31.969 17.087 5.413   1.00 48.95 ? 60  ILE A N     1 
ATOM   569  C  CA    . ILE C 3 5   ? -30.953 16.069 5.193   1.00 49.05 ? 60  ILE A CA    1 
ATOM   570  C  C     . ILE C 3 5   ? -30.645 15.402 6.516   1.00 49.04 ? 60  ILE A C     1 
ATOM   571  O  O     . ILE C 3 5   ? -30.178 16.057 7.449   1.00 49.20 ? 60  ILE A O     1 
ATOM   572  C  CB    . ILE C 3 5   ? -29.639 16.667 4.656   1.00 49.15 ? 60  ILE A CB    1 
ATOM   573  C  CG1   . ILE C 3 5   ? -29.885 17.562 3.433   1.00 49.25 ? 60  ILE A CG1   1 
ATOM   574  C  CG2   . ILE C 3 5   ? -28.634 15.553 4.354   1.00 49.58 ? 60  ILE A CG2   1 
ATOM   575  C  CD1   . ILE C 3 5   ? -30.457 16.838 2.235   1.00 49.33 ? 60  ILE A CD1   1 
ATOM   576  N  N     . ARG C 3 6   ? -30.907 14.103 6.605   1.00 48.97 ? 61  ARG A N     1 
ATOM   577  C  CA    . ARG C 3 6   ? -30.629 13.384 7.843   1.00 48.99 ? 61  ARG A CA    1 
ATOM   578  C  C     . ARG C 3 6   ? -30.086 11.975 7.672   1.00 48.75 ? 61  ARG A C     1 
ATOM   579  O  O     . ARG C 3 6   ? -30.450 11.252 6.741   1.00 48.80 ? 61  ARG A O     1 
ATOM   580  C  CB    . ARG C 3 6   ? -31.842 13.402 8.785   1.00 49.12 ? 61  ARG A CB    1 
ATOM   581  C  CG    . ARG C 3 6   ? -31.747 14.481 9.864   1.00 49.43 ? 61  ARG A CG    1 
ATOM   582  C  CD    . ARG C 3 6   ? -32.996 14.534 10.724  1.00 49.24 ? 61  ARG A CD    1 
ATOM   583  N  NE    . ARG C 3 6   ? -33.935 15.558 10.266  1.00 49.59 ? 61  ARG A NE    1 
ATOM   584  C  CZ    . ARG C 3 6   ? -35.211 15.629 10.639  1.00 49.56 ? 61  ARG A CZ    1 
ATOM   585  N  NH1   . ARG C 3 6   ? -35.725 14.730 11.473  1.00 49.12 ? 61  ARG A NH1   1 
ATOM   586  N  NH2   . ARG C 3 6   ? -35.983 16.600 10.169  1.00 49.69 ? 61  ARG A NH2   1 
ATOM   587  N  N     . ALA C 3 7   ? -29.188 11.624 8.589   1.00 48.44 ? 62  ALA A N     1 
ATOM   588  C  CA    . ALA C 3 7   ? -28.621 10.290 8.730   1.00 48.09 ? 62  ALA A CA    1 
ATOM   589  C  C     . ALA C 3 7   ? -27.978 10.216 10.109  1.00 47.88 ? 62  ALA A C     1 
ATOM   590  O  O     . ALA C 3 7   ? -28.061 11.166 10.893  1.00 47.82 ? 62  ALA A O     1 
ATOM   591  C  CB    . ALA C 3 7   ? -27.593 10.011 7.636   1.00 48.08 ? 62  ALA A CB    1 
ATOM   592  N  N     . GLU C 3 8   ? -27.343 9.085  10.396  1.00 47.68 ? 63  GLU A N     1 
ATOM   593  C  CA    . GLU C 3 8   ? -26.657 8.858  11.660  1.00 47.52 ? 63  GLU A CA    1 
ATOM   594  C  C     . GLU C 3 8   ? -25.657 9.978  11.954  1.00 47.34 ? 63  GLU A C     1 
ATOM   595  O  O     . GLU C 3 8   ? -24.590 10.052 11.335  1.00 47.27 ? 63  GLU A O     1 
ATOM   596  C  CB    . GLU C 3 8   ? -25.936 7.522  11.590  1.00 47.58 ? 63  GLU A CB    1 
ATOM   597  C  CG    . GLU C 3 8   ? -25.722 6.836  12.913  1.00 48.07 ? 63  GLU A CG    1 
ATOM   598  C  CD    . GLU C 3 8   ? -25.035 5.500  12.733  1.00 48.80 ? 63  GLU A CD    1 
ATOM   599  O  OE1   . GLU C 3 8   ? -24.098 5.429  11.906  1.00 49.10 ? 63  GLU A OE1   1 
ATOM   600  O  OE2   . GLU C 3 8   ? -25.432 4.522  13.406  1.00 48.90 ? 63  GLU A OE2   1 
ATOM   601  N  N     . GLY C 3 9   ? -26.022 10.855 12.886  1.00 47.11 ? 64  GLY A N     1 
ATOM   602  C  CA    . GLY C 3 9   ? -25.165 11.973 13.284  1.00 46.68 ? 64  GLY A CA    1 
ATOM   603  C  C     . GLY C 3 9   ? -25.050 13.082 12.253  1.00 46.43 ? 64  GLY A C     1 
ATOM   604  O  O     . GLY C 3 9   ? -24.183 13.954 12.365  1.00 46.49 ? 64  GLY A O     1 
ATOM   605  N  N     . LEU C 3 10  ? -25.919 13.044 11.245  1.00 46.14 ? 65  LEU A N     1 
ATOM   606  C  CA    . LEU C 3 10  ? -25.961 14.069 10.211  1.00 45.79 ? 65  LEU A CA    1 
ATOM   607  C  C     . LEU C 3 10  ? -27.273 14.828 10.324  1.00 45.70 ? 65  LEU A C     1 
ATOM   608  O  O     . LEU C 3 10  ? -28.352 14.248 10.175  1.00 45.65 ? 65  LEU A O     1 
ATOM   609  C  CB    . LEU C 3 10  ? -25.839 13.440 8.819   1.00 45.74 ? 65  LEU A CB    1 
ATOM   610  C  CG    . LEU C 3 10  ? -25.300 14.257 7.632   1.00 45.81 ? 65  LEU A CG    1 
ATOM   611  C  CD1   . LEU C 3 10  ? -25.457 13.454 6.349   1.00 45.56 ? 65  LEU A CD1   1 
ATOM   612  C  CD2   . LEU C 3 10  ? -25.949 15.632 7.471   1.00 45.32 ? 65  LEU A CD2   1 
ATOM   613  N  N     . ASP C 3 11  ? -27.175 16.126 10.589  1.00 45.62 ? 66  ASP A N     1 
ATOM   614  C  CA    . ASP C 3 11  ? -28.354 16.971 10.714  1.00 45.54 ? 66  ASP A CA    1 
ATOM   615  C  C     . ASP C 3 11  ? -28.195 18.267 9.931   1.00 45.49 ? 66  ASP A C     1 
ATOM   616  O  O     . ASP C 3 11  ? -27.514 19.192 10.373  1.00 45.66 ? 66  ASP A O     1 
ATOM   617  C  CB    . ASP C 3 11  ? -28.645 17.273 12.186  1.00 45.53 ? 66  ASP A CB    1 
ATOM   618  C  CG    . ASP C 3 11  ? -29.977 17.973 12.389  1.00 45.48 ? 66  ASP A CG    1 
ATOM   619  O  OD1   . ASP C 3 11  ? -30.328 18.868 11.590  1.00 45.63 ? 66  ASP A OD1   1 
ATOM   620  O  OD2   . ASP C 3 11  ? -30.674 17.632 13.362  1.00 45.21 ? 66  ASP A OD2   1 
ATOM   621  N  N     . SER C 3 12  ? -28.838 18.333 8.772   1.00 45.40 ? 67  SER A N     1 
ATOM   622  C  CA    . SER C 3 12  ? -28.783 19.531 7.948   1.00 45.34 ? 67  SER A CA    1 
ATOM   623  C  C     . SER C 3 12  ? -30.098 19.805 7.244   1.00 45.23 ? 67  SER A C     1 
ATOM   624  O  O     . SER C 3 12  ? -30.966 18.939 7.171   1.00 45.51 ? 67  SER A O     1 
ATOM   625  C  CB    . SER C 3 12  ? -27.637 19.440 6.938   1.00 45.43 ? 67  SER A CB    1 
ATOM   626  O  OG    . SER C 3 12  ? -26.397 19.717 7.567   1.00 45.37 ? 67  SER A OG    1 
ATOM   627  N  N     . SER C 3 13  ? -30.238 21.025 6.738   1.00 45.18 ? 68  SER A N     1 
ATOM   628  C  CA    . SER C 3 13  ? -31.447 21.443 6.042   1.00 45.12 ? 68  SER A CA    1 
ATOM   629  C  C     . SER C 3 13  ? -31.134 22.408 4.900   1.00 44.94 ? 68  SER A C     1 
ATOM   630  O  O     . SER C 3 13  ? -30.235 23.250 5.001   1.00 44.98 ? 68  SER A O     1 
ATOM   631  C  CB    . SER C 3 13  ? -32.455 22.045 7.024   1.00 45.29 ? 68  SER A CB    1 
ATOM   632  O  OG    . SER C 3 13  ? -31.826 22.942 7.924   1.00 45.90 ? 68  SER A OG    1 
ATOM   633  N  N     . TYR C 3 14  ? -31.881 22.265 3.810   1.00 44.73 ? 69  TYR A N     1 
ATOM   634  C  CA    . TYR C 3 14  ? -31.624 23.000 2.580   1.00 44.55 ? 69  TYR A CA    1 
ATOM   635  C  C     . TYR C 3 14  ? -32.896 23.688 2.094   1.00 44.63 ? 69  TYR A C     1 
ATOM   636  O  O     . TYR C 3 14  ? -33.952 23.060 2.004   1.00 44.69 ? 69  TYR A O     1 
ATOM   637  C  CB    . TYR C 3 14  ? -31.080 22.044 1.510   1.00 44.34 ? 69  TYR A CB    1 
ATOM   638  C  CG    . TYR C 3 14  ? -30.927 22.656 0.138   1.00 44.26 ? 69  TYR A CG    1 
ATOM   639  C  CD1   . TYR C 3 14  ? -29.759 23.328 -0.221  1.00 44.63 ? 69  TYR A CD1   1 
ATOM   640  C  CD2   . TYR C 3 14  ? -31.946 22.560 -0.806  1.00 43.93 ? 69  TYR A CD2   1 
ATOM   641  C  CE1   . TYR C 3 14  ? -29.614 23.896 -1.485  1.00 44.53 ? 69  TYR A CE1   1 
ATOM   642  C  CE2   . TYR C 3 14  ? -31.814 23.127 -2.069  1.00 43.69 ? 69  TYR A CE2   1 
ATOM   643  C  CZ    . TYR C 3 14  ? -30.649 23.793 -2.400  1.00 44.22 ? 69  TYR A CZ    1 
ATOM   644  O  OH    . TYR C 3 14  ? -30.516 24.353 -3.649  1.00 44.39 ? 69  TYR A OH    1 
ATOM   645  N  N     . THR C 3 15  ? -32.790 24.979 1.789   1.00 44.65 ? 70  THR A N     1 
ATOM   646  C  CA    . THR C 3 15  ? -33.902 25.728 1.213   1.00 44.69 ? 70  THR A CA    1 
ATOM   647  C  C     . THR C 3 15  ? -33.443 26.792 0.225   1.00 44.78 ? 70  THR A C     1 
ATOM   648  O  O     . THR C 3 15  ? -32.265 27.137 0.172   1.00 44.84 ? 70  THR A O     1 
ATOM   649  C  CB    . THR C 3 15  ? -34.771 26.382 2.297   1.00 44.77 ? 70  THR A CB    1 
ATOM   650  O  OG1   . THR C 3 15  ? -36.010 26.796 1.712   1.00 45.31 ? 70  THR A OG1   1 
ATOM   651  C  CG2   . THR C 3 15  ? -34.072 27.591 2.912   1.00 44.54 ? 70  THR A CG2   1 
ATOM   652  N  N     . VAL C 3 16  ? -34.382 27.320 -0.551  1.00 44.98 ? 71  VAL A N     1 
ATOM   653  C  CA    . VAL C 3 16  ? -34.064 28.391 -1.491  1.00 45.34 ? 71  VAL A CA    1 
ATOM   654  C  C     . VAL C 3 16  ? -34.600 29.735 -0.989  1.00 45.27 ? 71  VAL A C     1 
ATOM   655  O  O     . VAL C 3 16  ? -35.811 29.947 -0.924  1.00 45.35 ? 71  VAL A O     1 
ATOM   656  C  CB    . VAL C 3 16  ? -34.603 28.098 -2.904  1.00 45.41 ? 71  VAL A CB    1 
ATOM   657  C  CG1   . VAL C 3 16  ? -33.938 29.024 -3.919  1.00 46.03 ? 71  VAL A CG1   1 
ATOM   658  C  CG2   . VAL C 3 16  ? -34.354 26.640 -3.280  1.00 45.59 ? 71  VAL A CG2   1 
ATOM   659  N  N     . LEU C 3 17  ? -33.689 30.635 -0.635  1.00 45.03 ? 72  LEU A N     1 
ATOM   660  C  CA    . LEU C 3 17  ? -34.066 31.925 -0.075  1.00 44.72 ? 72  LEU A CA    1 
ATOM   661  C  C     . LEU C 3 17  ? -34.513 32.896 -1.143  1.00 44.65 ? 72  LEU A C     1 
ATOM   662  O  O     . LEU C 3 17  ? -35.488 33.627 -0.955  1.00 44.83 ? 72  LEU A O     1 
ATOM   663  C  CB    . LEU C 3 17  ? -32.890 32.550 0.666   1.00 44.72 ? 72  LEU A CB    1 
ATOM   664  C  CG    . LEU C 3 17  ? -32.261 31.744 1.792   1.00 44.70 ? 72  LEU A CG    1 
ATOM   665  C  CD1   . LEU C 3 17  ? -30.875 32.287 2.065   1.00 44.44 ? 72  LEU A CD1   1 
ATOM   666  C  CD2   . LEU C 3 17  ? -33.133 31.785 3.037   1.00 44.00 ? 72  LEU A CD2   1 
ATOM   667  N  N     . PHE C 3 18  ? -33.788 32.916 -2.258  1.00 44.41 ? 73  PHE A N     1 
ATOM   668  C  CA    . PHE C 3 18  ? -33.997 33.942 -3.267  1.00 44.13 ? 73  PHE A CA    1 
ATOM   669  C  C     . PHE C 3 18  ? -34.332 33.357 -4.617  1.00 44.07 ? 73  PHE A C     1 
ATOM   670  O  O     . PHE C 3 18  ? -33.734 32.371 -5.043  1.00 44.19 ? 73  PHE A O     1 
ATOM   671  C  CB    . PHE C 3 18  ? -32.763 34.836 -3.377  1.00 43.92 ? 73  PHE A CB    1 
ATOM   672  C  CG    . PHE C 3 18  ? -32.234 35.310 -2.047  1.00 43.74 ? 73  PHE A CG    1 
ATOM   673  C  CD1   . PHE C 3 18  ? -32.926 36.270 -1.305  1.00 43.40 ? 73  PHE A CD1   1 
ATOM   674  C  CD2   . PHE C 3 18  ? -31.048 34.798 -1.535  1.00 42.61 ? 73  PHE A CD2   1 
ATOM   675  C  CE1   . PHE C 3 18  ? -32.440 36.712 -0.070  1.00 42.94 ? 73  PHE A CE1   1 
ATOM   676  C  CE2   . PHE C 3 18  ? -30.551 35.231 -0.302  1.00 42.49 ? 73  PHE A CE2   1 
ATOM   677  C  CZ    . PHE C 3 18  ? -31.245 36.193 0.429   1.00 43.36 ? 73  PHE A CZ    1 
ATOM   678  N  N     . GLY C 3 19  ? -35.305 33.970 -5.280  1.00 44.13 ? 74  GLY A N     1 
ATOM   679  C  CA    . GLY C 3 19  ? -35.591 33.682 -6.677  1.00 44.15 ? 74  GLY A CA    1 
ATOM   680  C  C     . GLY C 3 19  ? -34.456 34.186 -7.554  1.00 44.27 ? 74  GLY A C     1 
ATOM   681  O  O     . GLY C 3 19  ? -33.539 34.865 -7.067  1.00 44.01 ? 74  GLY A O     1 
ATOM   682  N  N     . LYS C 3 20  ? -34.530 33.873 -8.848  1.00 44.22 ? 75  LYS A N     1 
ATOM   683  C  CA    . LYS C 3 20  ? -33.434 34.151 -9.776  1.00 44.37 ? 75  LYS A CA    1 
ATOM   684  C  C     . LYS C 3 20  ? -32.995 35.618 -9.827  1.00 43.96 ? 75  LYS A C     1 
ATOM   685  O  O     . LYS C 3 20  ? -31.809 35.915 -9.672  1.00 44.07 ? 75  LYS A O     1 
ATOM   686  C  CB    . LYS C 3 20  ? -33.750 33.643 -11.187 1.00 44.50 ? 75  LYS A CB    1 
ATOM   687  C  CG    . LYS C 3 20  ? -32.545 33.744 -12.113 1.00 45.96 ? 75  LYS A CG    1 
ATOM   688  C  CD    . LYS C 3 20  ? -32.695 32.913 -13.376 1.00 48.13 ? 75  LYS A CD    1 
ATOM   689  C  CE    . LYS C 3 20  ? -31.318 32.600 -13.958 1.00 49.58 ? 75  LYS A CE    1 
ATOM   690  N  NZ    . LYS C 3 20  ? -30.530 33.841 -14.262 1.00 50.84 ? 75  LYS A NZ    1 
ATOM   691  N  N     . ALA C 3 21  ? -33.952 36.517 -10.039 1.00 43.52 ? 76  ALA A N     1 
ATOM   692  C  CA    . ALA C 3 21  ? -33.660 37.932 -10.244 1.00 43.08 ? 76  ALA A CA    1 
ATOM   693  C  C     . ALA C 3 21  ? -32.917 38.560 -9.064  1.00 42.88 ? 76  ALA A C     1 
ATOM   694  O  O     . ALA C 3 21  ? -31.941 39.289 -9.267  1.00 42.66 ? 76  ALA A O     1 
ATOM   695  C  CB    . ALA C 3 21  ? -34.936 38.697 -10.555 1.00 42.95 ? 76  ALA A CB    1 
ATOM   696  N  N     . GLU C 3 22  ? -33.376 38.266 -7.844  1.00 42.65 ? 77  GLU A N     1 
ATOM   697  C  CA    . GLU C 3 22  ? -32.733 38.772 -6.627  1.00 42.41 ? 77  GLU A CA    1 
ATOM   698  C  C     . GLU C 3 22  ? -31.367 38.130 -6.437  1.00 42.43 ? 77  GLU A C     1 
ATOM   699  O  O     . GLU C 3 22  ? -30.381 38.819 -6.185  1.00 42.40 ? 77  GLU A O     1 
ATOM   700  C  CB    . GLU C 3 22  ? -33.605 38.551 -5.379  1.00 42.39 ? 77  GLU A CB    1 
ATOM   701  C  CG    . GLU C 3 22  ? -32.998 39.150 -4.101  1.00 42.15 ? 77  GLU A CG    1 
ATOM   702  C  CD    . GLU C 3 22  ? -33.905 39.106 -2.875  1.00 42.07 ? 77  GLU A CD    1 
ATOM   703  O  OE1   . GLU C 3 22  ? -34.998 38.508 -2.934  1.00 41.99 ? 77  GLU A OE1   1 
ATOM   704  O  OE2   . GLU C 3 22  ? -33.513 39.678 -1.836  1.00 41.51 ? 77  GLU A OE2   1 
ATOM   705  N  N     . ALA C 3 23  ? -31.316 36.811 -6.568  1.00 42.55 ? 78  ALA A N     1 
ATOM   706  C  CA    . ALA C 3 23  ? -30.066 36.073 -6.422  1.00 42.85 ? 78  ALA A CA    1 
ATOM   707  C  C     . ALA C 3 23  ? -28.987 36.564 -7.392  1.00 43.00 ? 78  ALA A C     1 
ATOM   708  O  O     . ALA C 3 23  ? -27.824 36.676 -7.011  1.00 42.91 ? 78  ALA A O     1 
ATOM   709  C  CB    . ALA C 3 23  ? -30.306 34.581 -6.583  1.00 42.76 ? 78  ALA A CB    1 
ATOM   710  N  N     . ASP C 3 24  ? -29.389 36.864 -8.630  1.00 43.35 ? 79  ASP A N     1 
ATOM   711  C  CA    . ASP C 3 24  ? -28.491 37.420 -9.653  1.00 43.69 ? 79  ASP A CA    1 
ATOM   712  C  C     . ASP C 3 24  ? -27.863 38.741 -9.213  1.00 43.90 ? 79  ASP A C     1 
ATOM   713  O  O     . ASP C 3 24  ? -26.641 38.907 -9.268  1.00 44.21 ? 79  ASP A O     1 
ATOM   714  C  CB    . ASP C 3 24  ? -29.240 37.622 -10.979 1.00 43.46 ? 79  ASP A CB    1 
ATOM   715  C  CG    . ASP C 3 24  ? -29.429 36.328 -11.755 1.00 43.56 ? 79  ASP A CG    1 
ATOM   716  O  OD1   . ASP C 3 24  ? -28.916 35.269 -11.330 1.00 44.40 ? 79  ASP A OD1   1 
ATOM   717  O  OD2   . ASP C 3 24  ? -30.094 36.368 -12.806 1.00 43.77 ? 79  ASP A OD2   1 
ATOM   718  N  N     . GLU C 3 25  ? -28.718 39.660 -8.774  1.00 43.95 ? 80  GLU A N     1 
ATOM   719  C  CA    . GLU C 3 25  ? -28.333 40.989 -8.306  1.00 44.29 ? 80  GLU A CA    1 
ATOM   720  C  C     . GLU C 3 25  ? -27.396 40.934 -7.086  1.00 44.27 ? 80  GLU A C     1 
ATOM   721  O  O     . GLU C 3 25  ? -26.410 41.684 -7.018  1.00 44.08 ? 80  GLU A O     1 
ATOM   722  C  CB    . GLU C 3 25  ? -29.615 41.805 -8.048  1.00 44.12 ? 80  GLU A CB    1 
ATOM   723  C  CG    . GLU C 3 25  ? -29.575 42.867 -6.963  1.00 44.17 ? 80  GLU A CG    1 
ATOM   724  C  CD    . GLU C 3 25  ? -30.980 43.330 -6.550  1.00 45.07 ? 80  GLU A CD    1 
ATOM   725  O  OE1   . GLU C 3 25  ? -31.915 43.349 -7.396  1.00 45.13 ? 80  GLU A OE1   1 
ATOM   726  O  OE2   . GLU C 3 25  ? -31.152 43.678 -5.361  1.00 46.08 ? 80  GLU A OE2   1 
ATOM   727  N  N     . ILE C 3 26  ? -27.696 40.034 -6.147  1.00 44.49 ? 81  ILE A N     1 
ATOM   728  C  CA    . ILE C 3 26  ? -26.840 39.802 -4.978  1.00 44.96 ? 81  ILE A CA    1 
ATOM   729  C  C     . ILE C 3 26  ? -25.466 39.271 -5.401  1.00 45.12 ? 81  ILE A C     1 
ATOM   730  O  O     . ILE C 3 26  ? -24.431 39.767 -4.950  1.00 45.10 ? 81  ILE A O     1 
ATOM   731  C  CB    . ILE C 3 26  ? -27.485 38.837 -3.950  1.00 44.86 ? 81  ILE A CB    1 
ATOM   732  C  CG1   . ILE C 3 26  ? -28.741 39.472 -3.345  1.00 45.17 ? 81  ILE A CG1   1 
ATOM   733  C  CG2   . ILE C 3 26  ? -26.498 38.522 -2.836  1.00 44.76 ? 81  ILE A CG2   1 
ATOM   734  C  CD1   . ILE C 3 26  ? -29.599 38.528 -2.497  1.00 45.22 ? 81  ILE A CD1   1 
ATOM   735  N  N     . PHE C 3 27  ? -25.471 38.274 -6.278  1.00 45.39 ? 82  PHE A N     1 
ATOM   736  C  CA    . PHE C 3 27  ? -24.241 37.739 -6.837  1.00 45.81 ? 82  PHE A CA    1 
ATOM   737  C  C     . PHE C 3 27  ? -23.387 38.828 -7.488  1.00 46.07 ? 82  PHE A C     1 
ATOM   738  O  O     . PHE C 3 27  ? -22.194 38.927 -7.208  1.00 45.96 ? 82  PHE A O     1 
ATOM   739  C  CB    . PHE C 3 27  ? -24.554 36.640 -7.848  1.00 45.79 ? 82  PHE A CB    1 
ATOM   740  C  CG    . PHE C 3 27  ? -23.342 36.093 -8.536  1.00 45.80 ? 82  PHE A CG    1 
ATOM   741  C  CD1   . PHE C 3 27  ? -22.360 35.428 -7.815  1.00 45.41 ? 82  PHE A CD1   1 
ATOM   742  C  CD2   . PHE C 3 27  ? -23.187 36.235 -9.907  1.00 46.09 ? 82  PHE A CD2   1 
ATOM   743  C  CE1   . PHE C 3 27  ? -21.240 34.917 -8.448  1.00 45.73 ? 82  PHE A CE1   1 
ATOM   744  C  CE2   . PHE C 3 27  ? -22.063 35.716 -10.551 1.00 46.11 ? 82  PHE A CE2   1 
ATOM   745  C  CZ    . PHE C 3 27  ? -21.092 35.058 -9.819  1.00 45.45 ? 82  PHE A CZ    1 
ATOM   746  N  N     . GLN C 3 28  ? -24.012 39.638 -8.345  1.00 46.34 ? 83  GLN A N     1 
ATOM   747  C  CA    . GLN C 3 28  ? -23.326 40.724 -9.049  1.00 46.85 ? 83  GLN A CA    1 
ATOM   748  C  C     . GLN C 3 28  ? -22.725 41.725 -8.088  1.00 46.70 ? 83  GLN A C     1 
ATOM   749  O  O     . GLN C 3 28  ? -21.652 42.262 -8.339  1.00 46.75 ? 83  GLN A O     1 
ATOM   750  C  CB    . GLN C 3 28  ? -24.270 41.424 -10.022 1.00 46.96 ? 83  GLN A CB    1 
ATOM   751  C  CG    . GLN C 3 28  ? -24.343 40.734 -11.376 1.00 48.77 ? 83  GLN A CG    1 
ATOM   752  C  CD    . GLN C 3 28  ? -25.598 41.078 -12.173 1.00 51.30 ? 83  GLN A CD    1 
ATOM   753  O  OE1   . GLN C 3 28  ? -25.950 40.366 -13.122 1.00 52.26 ? 83  GLN A OE1   1 
ATOM   754  N  NE2   . GLN C 3 28  ? -26.279 42.166 -11.796 1.00 51.71 ? 83  GLN A NE2   1 
ATOM   755  N  N     . GLU C 3 29  ? -23.428 41.957 -6.986  1.00 46.91 ? 84  GLU A N     1 
ATOM   756  C  CA    . GLU C 3 29  ? -22.948 42.813 -5.918  1.00 47.03 ? 84  GLU A CA    1 
ATOM   757  C  C     . GLU C 3 29  ? -21.734 42.176 -5.260  1.00 46.59 ? 84  GLU A C     1 
ATOM   758  O  O     . GLU C 3 29  ? -20.692 42.814 -5.129  1.00 46.76 ? 84  GLU A O     1 
ATOM   759  C  CB    . GLU C 3 29  ? -24.051 43.029 -4.886  1.00 47.35 ? 84  GLU A CB    1 
ATOM   760  C  CG    . GLU C 3 29  ? -23.651 43.926 -3.739  1.00 49.12 ? 84  GLU A CG    1 
ATOM   761  C  CD    . GLU C 3 29  ? -24.280 45.296 -3.820  1.00 52.46 ? 84  GLU A CD    1 
ATOM   762  O  OE1   . GLU C 3 29  ? -23.715 46.166 -4.527  1.00 53.81 ? 84  GLU A OE1   1 
ATOM   763  O  OE2   . GLU C 3 29  ? -25.332 45.504 -3.163  1.00 53.38 ? 84  GLU A OE2   1 
ATOM   764  N  N     . LEU C 3 30  ? -21.873 40.916 -4.856  1.00 46.17 ? 85  LEU A N     1 
ATOM   765  C  CA    . LEU C 3 30  ? -20.767 40.164 -4.259  1.00 45.90 ? 85  LEU A CA    1 
ATOM   766  C  C     . LEU C 3 30  ? -19.513 40.188 -5.139  1.00 45.82 ? 85  LEU A C     1 
ATOM   767  O  O     . LEU C 3 30  ? -18.413 40.435 -4.646  1.00 45.78 ? 85  LEU A O     1 
ATOM   768  C  CB    . LEU C 3 30  ? -21.183 38.716 -3.951  1.00 45.74 ? 85  LEU A CB    1 
ATOM   769  C  CG    . LEU C 3 30  ? -22.234 38.492 -2.855  1.00 45.02 ? 85  LEU A CG    1 
ATOM   770  C  CD1   . LEU C 3 30  ? -22.663 37.045 -2.827  1.00 44.65 ? 85  LEU A CD1   1 
ATOM   771  C  CD2   . LEU C 3 30  ? -21.733 38.921 -1.491  1.00 44.48 ? 85  LEU A CD2   1 
ATOM   772  N  N     . GLU C 3 31  ? -19.689 39.953 -6.436  1.00 45.81 ? 86  GLU A N     1 
ATOM   773  C  CA    . GLU C 3 31  ? -18.583 40.032 -7.388  1.00 46.28 ? 86  GLU A CA    1 
ATOM   774  C  C     . GLU C 3 31  ? -17.981 41.425 -7.430  1.00 46.25 ? 86  GLU A C     1 
ATOM   775  O  O     . GLU C 3 31  ? -16.767 41.577 -7.509  1.00 46.33 ? 86  GLU A O     1 
ATOM   776  C  CB    . GLU C 3 31  ? -19.024 39.614 -8.792  1.00 46.27 ? 86  GLU A CB    1 
ATOM   777  C  CG    . GLU C 3 31  ? -19.298 38.127 -8.941  1.00 47.56 ? 86  GLU A CG    1 
ATOM   778  C  CD    . GLU C 3 31  ? -18.042 37.285 -8.824  1.00 49.05 ? 86  GLU A CD    1 
ATOM   779  O  OE1   . GLU C 3 31  ? -17.537 37.107 -7.692  1.00 49.34 ? 86  GLU A OE1   1 
ATOM   780  O  OE2   . GLU C 3 31  ? -17.562 36.795 -9.869  1.00 49.84 ? 86  GLU A OE2   1 
ATOM   781  N  N     . LYS C 3 32  ? -18.838 42.434 -7.355  1.00 46.20 ? 87  LYS A N     1 
ATOM   782  C  CA    . LYS C 3 32  ? -18.405 43.818 -7.441  1.00 46.45 ? 87  LYS A CA    1 
ATOM   783  C  C     . LYS C 3 32  ? -17.667 44.289 -6.183  1.00 46.50 ? 87  LYS A C     1 
ATOM   784  O  O     . LYS C 3 32  ? -16.732 45.091 -6.273  1.00 46.22 ? 87  LYS A O     1 
ATOM   785  C  CB    . LYS C 3 32  ? -19.620 44.712 -7.714  1.00 46.39 ? 87  LYS A CB    1 
ATOM   786  C  CG    . LYS C 3 32  ? -19.305 46.152 -8.048  1.00 46.53 ? 87  LYS A CG    1 
ATOM   787  C  CD    . LYS C 3 32  ? -20.583 46.865 -8.413  1.00 47.22 ? 87  LYS A CD    1 
ATOM   788  C  CE    . LYS C 3 32  ? -20.421 48.364 -8.403  1.00 47.21 ? 87  LYS A CE    1 
ATOM   789  N  NZ    . LYS C 3 32  ? -21.771 48.987 -8.368  1.00 48.25 ? 87  LYS A NZ    1 
ATOM   790  N  N     . GLU C 3 33  ? -18.080 43.778 -5.023  1.00 46.67 ? 88  GLU A N     1 
ATOM   791  C  CA    . GLU C 3 33  ? -17.682 44.368 -3.736  1.00 46.79 ? 88  GLU A CA    1 
ATOM   792  C  C     . GLU C 3 33  ? -16.682 43.573 -2.904  1.00 46.84 ? 88  GLU A C     1 
ATOM   793  O  O     . GLU C 3 33  ? -15.875 44.170 -2.193  1.00 46.94 ? 88  GLU A O     1 
ATOM   794  C  CB    . GLU C 3 33  ? -18.913 44.681 -2.869  1.00 46.71 ? 88  GLU A CB    1 
ATOM   795  C  CG    . GLU C 3 33  ? -19.927 45.637 -3.497  1.00 46.92 ? 88  GLU A CG    1 
ATOM   796  C  CD    . GLU C 3 33  ? -19.378 47.034 -3.746  1.00 47.17 ? 88  GLU A CD    1 
ATOM   797  O  OE1   . GLU C 3 33  ? -18.612 47.547 -2.902  1.00 47.32 ? 88  GLU A OE1   1 
ATOM   798  O  OE2   . GLU C 3 33  ? -19.730 47.626 -4.789  1.00 47.28 ? 88  GLU A OE2   1 
ATOM   799  N  N     . VAL C 3 34  ? -16.742 42.245 -2.973  1.00 46.82 ? 89  VAL A N     1 
ATOM   800  C  CA    . VAL C 3 34  ? -15.954 41.388 -2.071  1.00 47.02 ? 89  VAL A CA    1 
ATOM   801  C  C     . VAL C 3 34  ? -14.439 41.435 -2.334  1.00 47.09 ? 89  VAL A C     1 
ATOM   802  O  O     . VAL C 3 34  ? -14.008 41.371 -3.485  1.00 47.24 ? 89  VAL A O     1 
ATOM   803  C  CB    . VAL C 3 34  ? -16.450 39.921 -2.113  1.00 47.10 ? 89  VAL A CB    1 
ATOM   804  C  CG1   . VAL C 3 34  ? -15.576 39.026 -1.236  1.00 46.93 ? 89  VAL A CG1   1 
ATOM   805  C  CG2   . VAL C 3 34  ? -17.909 39.841 -1.672  1.00 46.91 ? 89  VAL A CG2   1 
ATOM   806  N  N     . GLU C 3 35  ? -13.647 41.544 -1.262  1.00 47.02 ? 90  GLU A N     1 
ATOM   807  C  CA    . GLU C 3 35  ? -12.175 41.544 -1.353  1.00 46.97 ? 90  GLU A CA    1 
ATOM   808  C  C     . GLU C 3 35  ? -11.516 40.291 -0.771  1.00 46.71 ? 90  GLU A C     1 
ATOM   809  O  O     . GLU C 3 35  ? -11.596 40.038 0.442   1.00 46.77 ? 90  GLU A O     1 
ATOM   810  C  CB    . GLU C 3 35  ? -11.592 42.771 -0.667  1.00 46.98 ? 90  GLU A CB    1 
ATOM   811  C  CG    . GLU C 3 35  ? -11.209 43.873 -1.615  1.00 47.99 ? 90  GLU A CG    1 
ATOM   812  C  CD    . GLU C 3 35  ? -10.798 45.131 -0.885  1.00 49.38 ? 90  GLU A CD    1 
ATOM   813  O  OE1   . GLU C 3 35  ? -11.453 45.469 0.128   1.00 49.42 ? 90  GLU A OE1   1 
ATOM   814  O  OE2   . GLU C 3 35  ? -9.825  45.784 -1.325  1.00 50.26 ? 90  GLU A OE2   1 
ATOM   815  N  N     . TYR C 3 36  ? -10.838 39.535 -1.636  1.00 46.15 ? 91  TYR A N     1 
ATOM   816  C  CA    . TYR C 3 36  ? -10.214 38.264 -1.252  1.00 45.61 ? 91  TYR A CA    1 
ATOM   817  C  C     . TYR C 3 36  ? -8.735  38.391 -0.901  1.00 45.51 ? 91  TYR A C     1 
ATOM   818  O  O     . TYR C 3 36  ? -8.006  39.201 -1.487  1.00 45.62 ? 91  TYR A O     1 
ATOM   819  C  CB    . TYR C 3 36  ? -10.404 37.209 -2.349  1.00 45.28 ? 91  TYR A CB    1 
ATOM   820  C  CG    . TYR C 3 36  ? -11.857 36.872 -2.617  1.00 45.22 ? 91  TYR A CG    1 
ATOM   821  C  CD1   . TYR C 3 36  ? -12.511 35.871 -1.894  1.00 43.86 ? 91  TYR A CD1   1 
ATOM   822  C  CD2   . TYR C 3 36  ? -12.583 37.566 -3.589  1.00 44.78 ? 91  TYR A CD2   1 
ATOM   823  C  CE1   . TYR C 3 36  ? -13.845 35.573 -2.134  1.00 43.81 ? 91  TYR A CE1   1 
ATOM   824  C  CE2   . TYR C 3 36  ? -13.913 37.272 -3.839  1.00 44.14 ? 91  TYR A CE2   1 
ATOM   825  C  CZ    . TYR C 3 36  ? -14.541 36.278 -3.110  1.00 44.50 ? 91  TYR A CZ    1 
ATOM   826  O  OH    . TYR C 3 36  ? -15.869 35.998 -3.366  1.00 44.90 ? 91  TYR A OH    1 
ATOM   827  N  N     . PHE C 3 37  ? -8.312  37.576 0.064   1.00 45.23 ? 92  PHE A N     1 
ATOM   828  C  CA    . PHE C 3 37  ? -6.921  37.478 0.482   1.00 44.95 ? 92  PHE A CA    1 
ATOM   829  C  C     . PHE C 3 37  ? -6.039  36.954 -0.645  1.00 44.96 ? 92  PHE A C     1 
ATOM   830  O  O     . PHE C 3 37  ? -6.509  36.223 -1.527  1.00 44.98 ? 92  PHE A O     1 
ATOM   831  C  CB    . PHE C 3 37  ? -6.792  36.533 1.679   1.00 44.88 ? 92  PHE A CB    1 
ATOM   832  C  CG    . PHE C 3 37  ? -7.537  36.984 2.903   1.00 44.85 ? 92  PHE A CG    1 
ATOM   833  C  CD1   . PHE C 3 37  ? -7.161  38.141 3.580   1.00 44.12 ? 92  PHE A CD1   1 
ATOM   834  C  CD2   . PHE C 3 37  ? -8.598  36.232 3.399   1.00 44.53 ? 92  PHE A CD2   1 
ATOM   835  C  CE1   . PHE C 3 37  ? -7.840  38.549 4.720   1.00 44.08 ? 92  PHE A CE1   1 
ATOM   836  C  CE2   . PHE C 3 37  ? -9.284  36.639 4.541   1.00 44.62 ? 92  PHE A CE2   1 
ATOM   837  C  CZ    . PHE C 3 37  ? -8.901  37.800 5.201   1.00 44.39 ? 92  PHE A CZ    1 
ATOM   838  N  N     . THR C 3 38  ? -4.759  37.322 -0.599  1.00 44.68 ? 93  THR A N     1 
ATOM   839  C  CA    . THR C 3 38  ? -3.761  36.850 -1.563  1.00 44.46 ? 93  THR A CA    1 
ATOM   840  C  C     . THR C 3 38  ? -2.484  36.413 -0.838  1.00 44.28 ? 93  THR A C     1 
ATOM   841  O  O     . THR C 3 38  ? -2.368  36.574 0.383   1.00 44.20 ? 93  THR A O     1 
ATOM   842  C  CB    . THR C 3 38  ? -3.407  37.945 -2.599  1.00 44.47 ? 93  THR A CB    1 
ATOM   843  O  OG1   . THR C 3 38  ? -3.121  39.169 -1.915  1.00 44.72 ? 93  THR A OG1   1 
ATOM   844  C  CG2   . THR C 3 38  ? -4.554  38.181 -3.575  1.00 44.09 ? 93  THR A CG2   1 
ATOM   845  N  N     . GLY C 3 39  ? -1.541  35.852 -1.591  1.00 43.93 ? 94  GLY A N     1 
ATOM   846  C  CA    . GLY C 3 39  ? -0.220  35.505 -1.068  1.00 43.87 ? 94  GLY A CA    1 
ATOM   847  C  C     . GLY C 3 39  ? -0.215  34.725 0.235   1.00 43.75 ? 94  GLY A C     1 
ATOM   848  O  O     . GLY C 3 39  ? -0.810  33.641 0.322   1.00 43.85 ? 94  GLY A O     1 
ATOM   849  N  N     . ALA C 3 40  ? 0.457   35.292 1.241   1.00 43.32 ? 95  ALA A N     1 
ATOM   850  C  CA    . ALA C 3 40  ? 0.601   34.688 2.575   1.00 43.03 ? 95  ALA A CA    1 
ATOM   851  C  C     . ALA C 3 40  ? -0.718  34.266 3.239   1.00 42.97 ? 95  ALA A C     1 
ATOM   852  O  O     . ALA C 3 40  ? -0.766  33.266 3.962   1.00 43.10 ? 95  ALA A O     1 
ATOM   853  C  CB    . ALA C 3 40  ? 1.369   35.630 3.495   1.00 43.03 ? 95  ALA A CB    1 
ATOM   854  N  N     . LEU C 3 41  ? -1.784  35.019 2.994   1.00 42.51 ? 96  LEU A N     1 
ATOM   855  C  CA    . LEU C 3 41  ? -3.058  34.736 3.643   1.00 42.33 ? 96  LEU A CA    1 
ATOM   856  C  C     . LEU C 3 41  ? -3.982  33.874 2.779   1.00 41.97 ? 96  LEU A C     1 
ATOM   857  O  O     . LEU C 3 41  ? -5.190  33.814 3.015   1.00 41.67 ? 96  LEU A O     1 
ATOM   858  C  CB    . LEU C 3 41  ? -3.741  36.038 4.092   1.00 42.41 ? 96  LEU A CB    1 
ATOM   859  C  CG    . LEU C 3 41  ? -2.978  36.852 5.148   1.00 42.43 ? 96  LEU A CG    1 
ATOM   860  C  CD1   . LEU C 3 41  ? -3.497  38.289 5.222   1.00 42.43 ? 96  LEU A CD1   1 
ATOM   861  C  CD2   . LEU C 3 41  ? -3.007  36.186 6.529   1.00 42.15 ? 96  LEU A CD2   1 
ATOM   862  N  N     . ALA C 3 42  ? -3.394  33.195 1.796   1.00 41.51 ? 97  ALA A N     1 
ATOM   863  C  CA    . ALA C 3 42  ? -4.132  32.289 0.922   1.00 41.22 ? 97  ALA A CA    1 
ATOM   864  C  C     . ALA C 3 42  ? -3.416  30.945 0.794   1.00 41.01 ? 97  ALA A C     1 
ATOM   865  O  O     . ALA C 3 42  ? -3.630  30.196 -0.170  1.00 41.50 ? 97  ALA A O     1 
ATOM   866  C  CB    . ALA C 3 42  ? -4.329  32.926 -0.447  1.00 41.23 ? 97  ALA A CB    1 
ATOM   867  N  N     . ARG C 3 43  ? -2.568  30.644 1.775   1.00 40.53 ? 98  ARG A N     1 
ATOM   868  C  CA    . ARG C 3 43  ? -1.799  29.403 1.805   1.00 39.76 ? 98  ARG A CA    1 
ATOM   869  C  C     . ARG C 3 43  ? -2.078  28.624 3.087   1.00 39.41 ? 98  ARG A C     1 
ATOM   870  O  O     . ARG C 3 43  ? -2.064  29.189 4.183   1.00 39.55 ? 98  ARG A O     1 
ATOM   871  C  CB    . ARG C 3 43  ? -0.298  29.699 1.680   1.00 39.83 ? 98  ARG A CB    1 
ATOM   872  C  CG    . ARG C 3 43  ? 0.111   30.239 0.314   1.00 39.69 ? 98  ARG A CG    1 
ATOM   873  C  CD    . ARG C 3 43  ? 1.582   30.639 0.252   1.00 39.58 ? 98  ARG A CD    1 
ATOM   874  N  NE    . ARG C 3 43  ? 2.487   29.516 0.478   1.00 40.02 ? 98  ARG A NE    1 
ATOM   875  C  CZ    . ARG C 3 43  ? 2.717   28.536 -0.396  1.00 40.57 ? 98  ARG A CZ    1 
ATOM   876  N  NH1   . ARG C 3 43  ? 2.096   28.513 -1.570  1.00 41.13 ? 98  ARG A NH1   1 
ATOM   877  N  NH2   . ARG C 3 43  ? 3.560   27.561 -0.089  1.00 40.26 ? 98  ARG A NH2   1 
ATOM   878  N  N     . VAL C 3 44  ? -2.333  27.327 2.951   1.00 38.87 ? 99  VAL A N     1 
ATOM   879  C  CA    . VAL C 3 44  ? -2.607  26.471 4.111   1.00 38.24 ? 99  VAL A CA    1 
ATOM   880  C  C     . VAL C 3 44  ? -1.561  25.382 4.241   1.00 38.05 ? 99  VAL A C     1 
ATOM   881  O  O     . VAL C 3 44  ? -0.863  25.081 3.275   1.00 38.07 ? 99  VAL A O     1 
ATOM   882  C  CB    . VAL C 3 44  ? -4.003  25.808 4.037   1.00 38.39 ? 99  VAL A CB    1 
ATOM   883  C  CG1   . VAL C 3 44  ? -5.118  26.863 4.138   1.00 37.70 ? 99  VAL A CG1   1 
ATOM   884  C  CG2   . VAL C 3 44  ? -4.136  24.944 2.766   1.00 37.44 ? 99  VAL A CG2   1 
ATOM   885  N  N     . GLN C 3 45  ? -1.461  24.803 5.439   1.00 37.80 ? 100 GLN A N     1 
ATOM   886  C  CA    . GLN C 3 45  ? -0.567  23.672 5.702   1.00 37.36 ? 100 GLN A CA    1 
ATOM   887  C  C     . GLN C 3 45  ? -1.357  22.382 5.897   1.00 37.30 ? 100 GLN A C     1 
ATOM   888  O  O     . GLN C 3 45  ? -2.163  22.275 6.815   1.00 37.40 ? 100 GLN A O     1 
ATOM   889  C  CB    . GLN C 3 45  ? 0.312   23.925 6.929   1.00 37.01 ? 100 GLN A CB    1 
ATOM   890  C  CG    . GLN C 3 45  ? 1.576   23.079 6.918   1.00 36.25 ? 100 GLN A CG    1 
ATOM   891  C  CD    . GLN C 3 45  ? 2.320   23.061 8.237   1.00 35.08 ? 100 GLN A CD    1 
ATOM   892  O  OE1   . GLN C 3 45  ? 1.737   23.222 9.311   1.00 34.73 ? 100 GLN A OE1   1 
ATOM   893  N  NE2   . GLN C 3 45  ? 3.620   22.836 8.162   1.00 35.15 ? 100 GLN A NE2   1 
ATOM   894  N  N     . VAL C 3 46  ? -1.120  21.408 5.026   1.00 37.18 ? 101 VAL A N     1 
ATOM   895  C  CA    . VAL C 3 46  ? -1.788  20.110 5.105   1.00 37.16 ? 101 VAL A CA    1 
ATOM   896  C  C     . VAL C 3 46  ? -0.801  18.994 4.788   1.00 37.25 ? 101 VAL A C     1 
ATOM   897  O  O     . VAL C 3 46  ? -0.062  19.073 3.802   1.00 37.26 ? 101 VAL A O     1 
ATOM   898  C  CB    . VAL C 3 46  ? -2.993  20.007 4.126   1.00 37.09 ? 101 VAL A CB    1 
ATOM   899  C  CG1   . VAL C 3 46  ? -3.709  18.672 4.299   1.00 36.63 ? 101 VAL A CG1   1 
ATOM   900  C  CG2   . VAL C 3 46  ? -3.970  21.164 4.332   1.00 36.72 ? 101 VAL A CG2   1 
ATOM   901  N  N     . PHE C 3 47  ? -0.803  17.954 5.624   1.00 37.33 ? 102 PHE A N     1 
ATOM   902  C  CA    . PHE C 3 47  ? 0.089   16.803 5.463   1.00 37.29 ? 102 PHE A CA    1 
ATOM   903  C  C     . PHE C 3 47  ? 1.546   17.241 5.314   1.00 37.97 ? 102 PHE A C     1 
ATOM   904  O  O     . PHE C 3 47  ? 2.282   16.729 4.469   1.00 38.31 ? 102 PHE A O     1 
ATOM   905  C  CB    . PHE C 3 47  ? -0.366  15.883 4.306   1.00 36.64 ? 102 PHE A CB    1 
ATOM   906  C  CG    . PHE C 3 47  ? -1.346  14.823 4.729   1.00 35.32 ? 102 PHE A CG    1 
ATOM   907  C  CD1   . PHE C 3 47  ? -0.901  13.572 5.138   1.00 35.08 ? 102 PHE A CD1   1 
ATOM   908  C  CD2   . PHE C 3 47  ? -2.705  15.080 4.750   1.00 34.05 ? 102 PHE A CD2   1 
ATOM   909  C  CE1   . PHE C 3 47  ? -1.800  12.594 5.553   1.00 34.42 ? 102 PHE A CE1   1 
ATOM   910  C  CE2   . PHE C 3 47  ? -3.607  14.106 5.163   1.00 33.50 ? 102 PHE A CE2   1 
ATOM   911  C  CZ    . PHE C 3 47  ? -3.156  12.867 5.566   1.00 34.06 ? 102 PHE A CZ    1 
ATOM   912  N  N     . GLY C 3 48  ? 1.941   18.209 6.135   1.00 38.49 ? 103 GLY A N     1 
ATOM   913  C  CA    . GLY C 3 48  ? 3.326   18.665 6.194   1.00 39.37 ? 103 GLY A CA    1 
ATOM   914  C  C     . GLY C 3 48  ? 3.758   19.621 5.099   1.00 39.92 ? 103 GLY A C     1 
ATOM   915  O  O     . GLY C 3 48  ? 4.928   20.017 5.055   1.00 39.99 ? 103 GLY A O     1 
ATOM   916  N  N     . LYS C 3 49  ? 2.821   19.997 4.227   1.00 40.22 ? 104 LYS A N     1 
ATOM   917  C  CA    . LYS C 3 49  ? 3.117   20.842 3.074   1.00 40.76 ? 104 LYS A CA    1 
ATOM   918  C  C     . LYS C 3 49  ? 2.228   22.078 3.024   1.00 40.94 ? 104 LYS A C     1 
ATOM   919  O  O     . LYS C 3 49  ? 1.065   22.030 3.424   1.00 41.33 ? 104 LYS A O     1 
ATOM   920  C  CB    . LYS C 3 49  ? 2.924   20.065 1.769   1.00 40.93 ? 104 LYS A CB    1 
ATOM   921  C  CG    . LYS C 3 49  ? 3.789   18.835 1.594   1.00 41.86 ? 104 LYS A CG    1 
ATOM   922  C  CD    . LYS C 3 49  ? 4.977   19.100 0.693   1.00 43.38 ? 104 LYS A CD    1 
ATOM   923  C  CE    . LYS C 3 49  ? 5.482   17.796 0.082   1.00 44.27 ? 104 LYS A CE    1 
ATOM   924  N  NZ    . LYS C 3 49  ? 6.893   17.911 -0.380  1.00 44.55 ? 104 LYS A NZ    1 
ATOM   925  N  N     . TRP C 3 50  ? 2.778   23.171 2.496   1.00 40.94 ? 105 TRP A N     1 
ATOM   926  C  CA    . TRP C 3 50  ? 2.043   24.411 2.260   1.00 40.80 ? 105 TRP A CA    1 
ATOM   927  C  C     . TRP C 3 50  ? 1.550   24.484 0.827   1.00 41.15 ? 105 TRP A C     1 
ATOM   928  O  O     . TRP C 3 50  ? 2.284   24.144 -0.095  1.00 41.25 ? 105 TRP A O     1 
ATOM   929  C  CB    . TRP C 3 50  ? 2.938   25.609 2.549   1.00 40.29 ? 105 TRP A CB    1 
ATOM   930  C  CG    . TRP C 3 50  ? 3.300   25.716 3.982   1.00 39.97 ? 105 TRP A CG    1 
ATOM   931  C  CD1   . TRP C 3 50  ? 4.388   25.168 4.591   1.00 39.27 ? 105 TRP A CD1   1 
ATOM   932  C  CD2   . TRP C 3 50  ? 2.565   26.404 5.005   1.00 39.17 ? 105 TRP A CD2   1 
ATOM   933  N  NE1   . TRP C 3 50  ? 4.380   25.473 5.929   1.00 39.06 ? 105 TRP A NE1   1 
ATOM   934  C  CE2   . TRP C 3 50  ? 3.272   26.229 6.212   1.00 38.96 ? 105 TRP A CE2   1 
ATOM   935  C  CE3   . TRP C 3 50  ? 1.377   27.150 5.019   1.00 39.05 ? 105 TRP A CE3   1 
ATOM   936  C  CZ2   . TRP C 3 50  ? 2.835   26.778 7.424   1.00 39.37 ? 105 TRP A CZ2   1 
ATOM   937  C  CZ3   . TRP C 3 50  ? 0.941   27.692 6.223   1.00 39.28 ? 105 TRP A CZ3   1 
ATOM   938  C  CH2   . TRP C 3 50  ? 1.671   27.503 7.409   1.00 39.51 ? 105 TRP A CH2   1 
ATOM   939  N  N     . HIS C 3 51  ? 0.310   24.931 0.638   1.00 41.61 ? 106 HIS A N     1 
ATOM   940  C  CA    . HIS C 3 51  ? -0.269  25.050 -0.700  1.00 42.35 ? 106 HIS A CA    1 
ATOM   941  C  C     . HIS C 3 51  ? -1.063  26.326 -0.815  1.00 42.89 ? 106 HIS A C     1 
ATOM   942  O  O     . HIS C 3 51  ? -1.641  26.781 0.164   1.00 43.15 ? 106 HIS A O     1 
ATOM   943  C  CB    . HIS C 3 51  ? -1.236  23.902 -0.997  1.00 42.24 ? 106 HIS A CB    1 
ATOM   944  C  CG    . HIS C 3 51  ? -0.660  22.542 -0.782  1.00 42.17 ? 106 HIS A CG    1 
ATOM   945  N  ND1   . HIS C 3 51  ? -0.046  21.830 -1.787  1.00 42.26 ? 106 HIS A ND1   1 
ATOM   946  C  CD2   . HIS C 3 51  ? -0.619  21.757 0.320   1.00 42.26 ? 106 HIS A CD2   1 
ATOM   947  C  CE1   . HIS C 3 51  ? 0.359   20.666 -1.312  1.00 43.15 ? 106 HIS A CE1   1 
ATOM   948  N  NE2   . HIS C 3 51  ? 0.022   20.595 -0.036  1.00 42.87 ? 106 HIS A NE2   1 
ATOM   949  N  N     . SER C 3 52  ? -1.113  26.891 -2.017  1.00 43.67 ? 107 SER A N     1 
ATOM   950  C  CA    . SER C 3 52  ? -2.095  27.927 -2.313  1.00 44.42 ? 107 SER A CA    1 
ATOM   951  C  C     . SER C 3 52  ? -3.435  27.232 -2.417  1.00 44.59 ? 107 SER A C     1 
ATOM   952  O  O     . SER C 3 52  ? -3.524  26.156 -3.014  1.00 44.83 ? 107 SER A O     1 
ATOM   953  C  CB    . SER C 3 52  ? -1.777  28.638 -3.627  1.00 44.47 ? 107 SER A CB    1 
ATOM   954  O  OG    . SER C 3 52  ? -0.812  29.657 -3.421  1.00 45.66 ? 107 SER A OG    1 
ATOM   955  N  N     . VAL C 3 53  ? -4.463  27.832 -1.827  1.00 44.38 ? 108 VAL A N     1 
ATOM   956  C  CA    . VAL C 3 53  ? -5.795  27.237 -1.831  1.00 44.34 ? 108 VAL A CA    1 
ATOM   957  C  C     . VAL C 3 53  ? -6.382  27.233 -3.246  1.00 44.21 ? 108 VAL A C     1 
ATOM   958  O  O     . VAL C 3 53  ? -6.244  28.214 -3.968  1.00 44.42 ? 108 VAL A O     1 
ATOM   959  C  CB    . VAL C 3 53  ? -6.736  27.952 -0.833  1.00 44.42 ? 108 VAL A CB    1 
ATOM   960  C  CG1   . VAL C 3 53  ? -6.272  27.699 0.591   1.00 44.18 ? 108 VAL A CG1   1 
ATOM   961  C  CG2   . VAL C 3 53  ? -6.793  29.459 -1.106  1.00 44.77 ? 108 VAL A CG2   1 
ATOM   962  N  N     . PRO C 3 54  ? -7.023  26.125 -3.657  1.00 44.13 ? 109 PRO A N     1 
ATOM   963  C  CA    . PRO C 3 54  ? -7.531  26.065 -5.028  1.00 44.16 ? 109 PRO A CA    1 
ATOM   964  C  C     . PRO C 3 54  ? -8.903  26.749 -5.184  1.00 44.24 ? 109 PRO A C     1 
ATOM   965  O  O     . PRO C 3 54  ? -9.867  26.128 -5.645  1.00 44.12 ? 109 PRO A O     1 
ATOM   966  C  CB    . PRO C 3 54  ? -7.606  24.561 -5.301  1.00 44.12 ? 109 PRO A CB    1 
ATOM   967  C  CG    . PRO C 3 54  ? -7.819  23.940 -3.961  1.00 44.01 ? 109 PRO A CG    1 
ATOM   968  C  CD    . PRO C 3 54  ? -7.312  24.890 -2.907  1.00 44.00 ? 109 PRO A CD    1 
ATOM   969  N  N     . ARG C 3 55  ? -8.952  28.027 -4.805  1.00 44.21 ? 110 ARG A N     1 
ATOM   970  C  CA    . ARG C 3 55  ? -10.154 28.864 -4.808  1.00 44.15 ? 110 ARG A CA    1 
ATOM   971  C  C     . ARG C 3 55  ? -9.720  30.227 -4.272  1.00 44.49 ? 110 ARG A C     1 
ATOM   972  O  O     . ARG C 3 55  ? -8.521  30.477 -4.115  1.00 44.51 ? 110 ARG A O     1 
ATOM   973  C  CB    . ARG C 3 55  ? -11.230 28.270 -3.887  1.00 44.18 ? 110 ARG A CB    1 
ATOM   974  C  CG    . ARG C 3 55  ? -10.847 28.281 -2.399  1.00 43.67 ? 110 ARG A CG    1 
ATOM   975  C  CD    . ARG C 3 55  ? -11.672 27.327 -1.571  1.00 43.32 ? 110 ARG A CD    1 
ATOM   976  N  NE    . ARG C 3 55  ? -11.035 27.064 -0.280  1.00 42.85 ? 110 ARG A NE    1 
ATOM   977  C  CZ    . ARG C 3 55  ? -10.246 26.020 -0.042  1.00 42.65 ? 110 ARG A CZ    1 
ATOM   978  N  NH1   . ARG C 3 55  ? -9.705  25.846 1.155   1.00 41.87 ? 110 ARG A NH1   1 
ATOM   979  N  NH2   . ARG C 3 55  ? -10.007 25.136 -0.999  1.00 42.86 ? 110 ARG A NH2   1 
ATOM   980  N  N     . LYS C 3 56  ? -10.680 31.098 -3.968  1.00 44.62 ? 111 LYS A N     1 
ATOM   981  C  CA    . LYS C 3 56  ? -10.376 32.333 -3.257  1.00 44.90 ? 111 LYS A CA    1 
ATOM   982  C  C     . LYS C 3 56  ? -11.146 32.411 -1.947  1.00 45.16 ? 111 LYS A C     1 
ATOM   983  O  O     . LYS C 3 56  ? -12.271 31.915 -1.866  1.00 45.38 ? 111 LYS A O     1 
ATOM   984  C  CB    . LYS C 3 56  ? -10.680 33.545 -4.130  1.00 45.02 ? 111 LYS A CB    1 
ATOM   985  C  CG    . LYS C 3 56  ? -9.635  33.809 -5.200  1.00 44.42 ? 111 LYS A CG    1 
ATOM   986  C  CD    . LYS C 3 56  ? -9.941  35.099 -5.915  1.00 43.93 ? 111 LYS A CD    1 
ATOM   987  C  CE    . LYS C 3 56  ? -9.118  35.249 -7.167  1.00 43.51 ? 111 LYS A CE    1 
ATOM   988  N  NZ    . LYS C 3 56  ? -9.426  36.561 -7.803  1.00 43.39 ? 111 LYS A NZ    1 
ATOM   989  N  N     . GLN C 3 57  ? -10.541 33.032 -0.931  1.00 45.30 ? 112 GLN A N     1 
ATOM   990  C  CA    . GLN C 3 57  ? -11.150 33.128 0.405   1.00 45.59 ? 112 GLN A CA    1 
ATOM   991  C  C     . GLN C 3 57  ? -11.153 34.548 0.967   1.00 45.65 ? 112 GLN A C     1 
ATOM   992  O  O     . GLN C 3 57  ? -10.189 35.300 0.791   1.00 45.71 ? 112 GLN A O     1 
ATOM   993  C  CB    . GLN C 3 57  ? -10.416 32.231 1.401   1.00 45.51 ? 112 GLN A CB    1 
ATOM   994  C  CG    . GLN C 3 57  ? -10.446 30.758 1.087   1.00 45.64 ? 112 GLN A CG    1 
ATOM   995  C  CD    . GLN C 3 57  ? -9.666  29.937 2.096   1.00 46.23 ? 112 GLN A CD    1 
ATOM   996  O  OE1   . GLN C 3 57  ? -8.621  30.368 2.602   1.00 46.92 ? 112 GLN A OE1   1 
ATOM   997  N  NE2   . GLN C 3 57  ? -10.169 28.741 2.395   1.00 47.45 ? 112 GLN A NE2   1 
ATOM   998  N  N     . ALA C 3 58  ? -12.231 34.900 1.666   1.00 45.59 ? 113 ALA A N     1 
ATOM   999  C  CA    . ALA C 3 58  ? -12.322 36.183 2.362   1.00 45.60 ? 113 ALA A CA    1 
ATOM   1000 C  C     . ALA C 3 58  ? -13.031 35.988 3.689   1.00 45.79 ? 113 ALA A C     1 
ATOM   1001 O  O     . ALA C 3 58  ? -13.816 35.041 3.836   1.00 46.00 ? 113 ALA A O     1 
ATOM   1002 C  CB    . ALA C 3 58  ? -13.059 37.199 1.516   1.00 45.45 ? 113 ALA A CB    1 
ATOM   1003 N  N     . THR C 3 59  ? -12.745 36.867 4.652   1.00 45.67 ? 114 THR A N     1 
ATOM   1004 C  CA    . THR C 3 59  ? -13.433 36.850 5.948   1.00 45.78 ? 114 THR A CA    1 
ATOM   1005 C  C     . THR C 3 59  ? -13.919 38.229 6.401   1.00 45.92 ? 114 THR A C     1 
ATOM   1006 O  O     . THR C 3 59  ? -13.156 39.199 6.438   1.00 45.69 ? 114 THR A O     1 
ATOM   1007 C  CB    . THR C 3 59  ? -12.584 36.210 7.076   1.00 45.69 ? 114 THR A CB    1 
ATOM   1008 O  OG1   . THR C 3 59  ? -11.286 36.811 7.115   1.00 45.77 ? 114 THR A OG1   1 
ATOM   1009 C  CG2   . THR C 3 59  ? -12.442 34.713 6.868   1.00 45.89 ? 114 THR A CG2   1 
ATOM   1010 N  N     . TYR C 3 60  ? -15.205 38.297 6.736   1.00 46.08 ? 115 TYR A N     1 
ATOM   1011 C  CA    . TYR C 3 60  ? -15.821 39.507 7.262   1.00 46.37 ? 115 TYR A CA    1 
ATOM   1012 C  C     . TYR C 3 60  ? -16.511 39.164 8.575   1.00 46.43 ? 115 TYR A C     1 
ATOM   1013 O  O     . TYR C 3 60  ? -17.005 38.045 8.740   1.00 46.49 ? 115 TYR A O     1 
ATOM   1014 C  CB    . TYR C 3 60  ? -16.831 40.085 6.265   1.00 46.38 ? 115 TYR A CB    1 
ATOM   1015 C  CG    . TYR C 3 60  ? -16.236 40.630 4.972   1.00 46.72 ? 115 TYR A CG    1 
ATOM   1016 C  CD1   . TYR C 3 60  ? -16.162 42.013 4.738   1.00 46.91 ? 115 TYR A CD1   1 
ATOM   1017 C  CD2   . TYR C 3 60  ? -15.774 39.768 3.967   1.00 46.27 ? 115 TYR A CD2   1 
ATOM   1018 C  CE1   . TYR C 3 60  ? -15.626 42.518 3.541   1.00 46.73 ? 115 TYR A CE1   1 
ATOM   1019 C  CE2   . TYR C 3 60  ? -15.240 40.261 2.773   1.00 46.11 ? 115 TYR A CE2   1 
ATOM   1020 C  CZ    . TYR C 3 60  ? -15.168 41.634 2.568   1.00 46.50 ? 115 TYR A CZ    1 
ATOM   1021 O  OH    . TYR C 3 60  ? -14.641 42.113 1.390   1.00 46.57 ? 115 TYR A OH    1 
ATOM   1022 N  N     . GLY C 3 61  ? -16.533 40.117 9.507   1.00 46.56 ? 116 GLY A N     1 
ATOM   1023 C  CA    . GLY C 3 61  ? -17.097 39.886 10.838  1.00 46.62 ? 116 GLY A CA    1 
ATOM   1024 C  C     . GLY C 3 61  ? -16.731 40.943 11.862  1.00 46.79 ? 116 GLY A C     1 
ATOM   1025 O  O     . GLY C 3 61  ? -15.945 41.849 11.576  1.00 47.00 ? 116 GLY A O     1 
ATOM   1026 N  N     . ASP C 3 62  ? -17.303 40.824 13.060  1.00 46.70 ? 117 ASP A N     1 
ATOM   1027 C  CA    . ASP C 3 62  ? -17.071 41.786 14.137  1.00 46.63 ? 117 ASP A CA    1 
ATOM   1028 C  C     . ASP C 3 62  ? -15.596 41.851 14.532  1.00 46.75 ? 117 ASP A C     1 
ATOM   1029 O  O     . ASP C 3 62  ? -14.957 40.820 14.744  1.00 46.86 ? 117 ASP A O     1 
ATOM   1030 C  CB    . ASP C 3 62  ? -17.933 41.451 15.364  1.00 46.58 ? 117 ASP A CB    1 
ATOM   1031 C  CG    . ASP C 3 62  ? -19.420 41.450 15.059  1.00 45.91 ? 117 ASP A CG    1 
ATOM   1032 O  OD1   . ASP C 3 62  ? -19.820 41.998 14.015  1.00 45.78 ? 117 ASP A OD1   1 
ATOM   1033 O  OD2   . ASP C 3 62  ? -20.193 40.901 15.871  1.00 45.18 ? 117 ASP A OD2   1 
ATOM   1034 N  N     . ALA C 3 63  ? -15.072 43.071 14.632  1.00 46.92 ? 118 ALA A N     1 
ATOM   1035 C  CA    . ALA C 3 63  ? -13.663 43.324 14.946  1.00 47.00 ? 118 ALA A CA    1 
ATOM   1036 C  C     . ALA C 3 63  ? -13.181 42.561 16.177  1.00 47.02 ? 118 ALA A C     1 
ATOM   1037 O  O     . ALA C 3 63  ? -13.928 42.390 17.144  1.00 47.07 ? 118 ALA A O     1 
ATOM   1038 C  CB    . ALA C 3 63  ? -13.424 44.827 15.126  1.00 46.97 ? 118 ALA A CB    1 
ATOM   1039 N  N     . GLY C 3 64  ? -11.932 42.106 16.131  1.00 47.05 ? 119 GLY A N     1 
ATOM   1040 C  CA    . GLY C 3 64  ? -11.325 41.397 17.255  1.00 47.01 ? 119 GLY A CA    1 
ATOM   1041 C  C     . GLY C 3 64  ? -11.346 39.888 17.103  1.00 47.05 ? 119 GLY A C     1 
ATOM   1042 O  O     . GLY C 3 64  ? -10.530 39.190 17.705  1.00 47.21 ? 119 GLY A O     1 
ATOM   1043 N  N     . LEU C 3 65  ? -12.281 39.381 16.305  1.00 46.91 ? 120 LEU A N     1 
ATOM   1044 C  CA    . LEU C 3 65  ? -12.380 37.946 16.058  1.00 46.86 ? 120 LEU A CA    1 
ATOM   1045 C  C     . LEU C 3 65  ? -11.305 37.503 15.069  1.00 46.75 ? 120 LEU A C     1 
ATOM   1046 O  O     . LEU C 3 65  ? -10.812 38.315 14.291  1.00 47.11 ? 120 LEU A O     1 
ATOM   1047 C  CB    . LEU C 3 65  ? -13.771 37.576 15.519  1.00 46.88 ? 120 LEU A CB    1 
ATOM   1048 C  CG    . LEU C 3 65  ? -15.052 37.916 16.296  1.00 46.91 ? 120 LEU A CG    1 
ATOM   1049 C  CD1   . LEU C 3 65  ? -16.265 37.506 15.474  1.00 46.95 ? 120 LEU A CD1   1 
ATOM   1050 C  CD2   . LEU C 3 65  ? -15.105 37.283 17.689  1.00 46.47 ? 120 LEU A CD2   1 
ATOM   1051 N  N     . THR C 3 66  ? -10.922 36.227 15.132  1.00 46.36 ? 121 THR A N     1 
ATOM   1052 C  CA    . THR C 3 66  ? -10.072 35.598 14.119  1.00 45.78 ? 121 THR A CA    1 
ATOM   1053 C  C     . THR C 3 66  ? -10.531 34.159 13.933  1.00 45.66 ? 121 THR A C     1 
ATOM   1054 O  O     . THR C 3 66  ? -11.014 33.530 14.876  1.00 45.60 ? 121 THR A O     1 
ATOM   1055 C  CB    . THR C 3 66  ? -8.571  35.547 14.504  1.00 45.79 ? 121 THR A CB    1 
ATOM   1056 O  OG1   . THR C 3 66  ? -8.366  34.536 15.494  1.00 45.71 ? 121 THR A OG1   1 
ATOM   1057 C  CG2   . THR C 3 66  ? -8.043  36.893 15.014  1.00 45.65 ? 121 THR A CG2   1 
ATOM   1058 N  N     . TYR C 3 67  ? -10.373 33.644 12.716  1.00 45.41 ? 122 TYR A N     1 
ATOM   1059 C  CA    . TYR C 3 67  ? -10.668 32.249 12.423  1.00 44.92 ? 122 TYR A CA    1 
ATOM   1060 C  C     . TYR C 3 67  ? -9.429  31.544 11.887  1.00 44.85 ? 122 TYR A C     1 
ATOM   1061 O  O     . TYR C 3 67  ? -8.806  32.008 10.929  1.00 44.88 ? 122 TYR A O     1 
ATOM   1062 C  CB    . TYR C 3 67  ? -11.814 32.153 11.424  1.00 44.90 ? 122 TYR A CB    1 
ATOM   1063 C  CG    . TYR C 3 67  ? -12.386 30.764 11.234  1.00 44.64 ? 122 TYR A CG    1 
ATOM   1064 C  CD1   . TYR C 3 67  ? -12.555 29.894 12.316  1.00 44.26 ? 122 TYR A CD1   1 
ATOM   1065 C  CD2   . TYR C 3 67  ? -12.795 30.335 9.976   1.00 44.28 ? 122 TYR A CD2   1 
ATOM   1066 C  CE1   . TYR C 3 67  ? -13.097 28.621 12.140  1.00 44.63 ? 122 TYR A CE1   1 
ATOM   1067 C  CE2   . TYR C 3 67  ? -13.344 29.067 9.789   1.00 44.81 ? 122 TYR A CE2   1 
ATOM   1068 C  CZ    . TYR C 3 67  ? -13.490 28.214 10.871  1.00 45.06 ? 122 TYR A CZ    1 
ATOM   1069 O  OH    . TYR C 3 67  ? -14.025 26.958 10.680  1.00 44.95 ? 122 TYR A OH    1 
ATOM   1070 N  N     . THR C 3 68  ? -9.082  30.422 12.511  1.00 44.57 ? 123 THR A N     1 
ATOM   1071 C  CA    . THR C 3 68  ? -7.891  29.663 12.152  1.00 44.43 ? 123 THR A CA    1 
ATOM   1072 C  C     . THR C 3 68  ? -8.236  28.238 11.694  1.00 44.31 ? 123 THR A C     1 
ATOM   1073 O  O     . THR C 3 68  ? -8.888  27.491 12.414  1.00 44.60 ? 123 THR A O     1 
ATOM   1074 C  CB    . THR C 3 68  ? -6.890  29.633 13.342  1.00 44.43 ? 123 THR A CB    1 
ATOM   1075 O  OG1   . THR C 3 68  ? -6.455  30.967 13.627  1.00 44.66 ? 123 THR A OG1   1 
ATOM   1076 C  CG2   . THR C 3 68  ? -5.668  28.763 13.044  1.00 44.29 ? 123 THR A CG2   1 
ATOM   1077 N  N     . PHE C 3 69  ? -7.810  27.869 10.492  1.00 43.96 ? 124 PHE A N     1 
ATOM   1078 C  CA    . PHE C 3 69  ? -7.868  26.468 10.068  1.00 43.89 ? 124 PHE A CA    1 
ATOM   1079 C  C     . PHE C 3 69  ? -6.640  26.080 9.252   1.00 43.68 ? 124 PHE A C     1 
ATOM   1080 O  O     . PHE C 3 69  ? -6.079  26.907 8.529   1.00 43.62 ? 124 PHE A O     1 
ATOM   1081 C  CB    . PHE C 3 69  ? -9.168  26.145 9.307   1.00 43.80 ? 124 PHE A CB    1 
ATOM   1082 C  CG    . PHE C 3 69  ? -9.393  26.991 8.086   1.00 43.91 ? 124 PHE A CG    1 
ATOM   1083 C  CD1   . PHE C 3 69  ? -10.054 28.210 8.181   1.00 44.21 ? 124 PHE A CD1   1 
ATOM   1084 C  CD2   . PHE C 3 69  ? -8.957  26.565 6.841   1.00 44.12 ? 124 PHE A CD2   1 
ATOM   1085 C  CE1   . PHE C 3 69  ? -10.261 28.998 7.058   1.00 44.19 ? 124 PHE A CE1   1 
ATOM   1086 C  CE2   . PHE C 3 69  ? -9.165  27.343 5.709   1.00 44.21 ? 124 PHE A CE2   1 
ATOM   1087 C  CZ    . PHE C 3 69  ? -9.815  28.561 5.817   1.00 44.23 ? 124 PHE A CZ    1 
ATOM   1088 N  N     . SER C 3 70  ? -6.219  24.826 9.397   1.00 43.54 ? 125 SER A N     1 
ATOM   1089 C  CA    . SER C 3 70  ? -5.128  24.256 8.598   1.00 43.73 ? 125 SER A CA    1 
ATOM   1090 C  C     . SER C 3 70  ? -3.865  25.124 8.585   1.00 43.65 ? 125 SER A C     1 
ATOM   1091 O  O     . SER C 3 70  ? -3.212  25.270 7.550   1.00 43.73 ? 125 SER A O     1 
ATOM   1092 C  CB    . SER C 3 70  ? -5.597  23.992 7.161   1.00 43.60 ? 125 SER A CB    1 
ATOM   1093 O  OG    . SER C 3 70  ? -6.868  23.356 7.135   1.00 44.63 ? 125 SER A OG    1 
ATOM   1094 N  N     . GLY C 3 71  ? -3.536  25.705 9.735   1.00 43.73 ? 126 GLY A N     1 
ATOM   1095 C  CA    . GLY C 3 71  ? -2.314  26.494 9.895   1.00 43.75 ? 126 GLY A CA    1 
ATOM   1096 C  C     . GLY C 3 71  ? -2.407  27.939 9.445   1.00 43.88 ? 126 GLY A C     1 
ATOM   1097 O  O     . GLY C 3 71  ? -1.405  28.651 9.463   1.00 44.04 ? 126 GLY A O     1 
ATOM   1098 N  N     . LEU C 3 72  ? -3.604  28.372 9.050   1.00 43.96 ? 127 LEU A N     1 
ATOM   1099 C  CA    . LEU C 3 72  ? -3.836  29.742 8.589   1.00 44.13 ? 127 LEU A CA    1 
ATOM   1100 C  C     . LEU C 3 72  ? -4.817  30.503 9.492   1.00 44.31 ? 127 LEU A C     1 
ATOM   1101 O  O     . LEU C 3 72  ? -5.858  29.973 9.857   1.00 44.47 ? 127 LEU A O     1 
ATOM   1102 C  CB    . LEU C 3 72  ? -4.350  29.727 7.146   1.00 43.96 ? 127 LEU A CB    1 
ATOM   1103 C  CG    . LEU C 3 72  ? -4.787  31.045 6.500   1.00 43.87 ? 127 LEU A CG    1 
ATOM   1104 C  CD1   . LEU C 3 72  ? -3.591  31.903 6.123   1.00 43.56 ? 127 LEU A CD1   1 
ATOM   1105 C  CD2   . LEU C 3 72  ? -5.644  30.771 5.279   1.00 44.21 ? 127 LEU A CD2   1 
ATOM   1106 N  N     . THR C 3 73  ? -4.474  31.743 9.840   1.00 44.51 ? 128 THR A N     1 
ATOM   1107 C  CA    . THR C 3 73  ? -5.329  32.611 10.655  1.00 44.70 ? 128 THR A CA    1 
ATOM   1108 C  C     . THR C 3 73  ? -5.883  33.757 9.812   1.00 45.09 ? 128 THR A C     1 
ATOM   1109 O  O     . THR C 3 73  ? -5.128  34.431 9.111   1.00 45.31 ? 128 THR A O     1 
ATOM   1110 C  CB    . THR C 3 73  ? -4.546  33.193 11.845  1.00 44.49 ? 128 THR A CB    1 
ATOM   1111 O  OG1   . THR C 3 73  ? -4.126  32.123 12.695  1.00 44.33 ? 128 THR A OG1   1 
ATOM   1112 C  CG2   . THR C 3 73  ? -5.405  34.158 12.657  1.00 44.35 ? 128 THR A CG2   1 
ATOM   1113 N  N     . LEU C 3 74  ? -7.193  33.984 9.883   1.00 45.29 ? 129 LEU A N     1 
ATOM   1114 C  CA    . LEU C 3 74  ? -7.823  35.031 9.080   1.00 45.64 ? 129 LEU A CA    1 
ATOM   1115 C  C     . LEU C 3 74  ? -8.545  36.062 9.937   1.00 45.85 ? 129 LEU A C     1 
ATOM   1116 O  O     . LEU C 3 74  ? -9.396  35.711 10.759  1.00 46.11 ? 129 LEU A O     1 
ATOM   1117 C  CB    . LEU C 3 74  ? -8.774  34.431 8.038   1.00 45.50 ? 129 LEU A CB    1 
ATOM   1118 C  CG    . LEU C 3 74  ? -8.165  33.464 7.014   1.00 46.17 ? 129 LEU A CG    1 
ATOM   1119 C  CD1   . LEU C 3 74  ? -9.242  32.804 6.173   1.00 46.38 ? 129 LEU A CD1   1 
ATOM   1120 C  CD2   . LEU C 3 74  ? -7.155  34.153 6.114   1.00 46.58 ? 129 LEU A CD2   1 
ATOM   1121 N  N     . SER C 3 75  ? -8.194  37.333 9.741   1.00 45.96 ? 130 SER A N     1 
ATOM   1122 C  CA    . SER C 3 75  ? -8.819  38.440 10.466  1.00 46.03 ? 130 SER A CA    1 
ATOM   1123 C  C     . SER C 3 75  ? -9.970  39.033 9.667   1.00 45.97 ? 130 SER A C     1 
ATOM   1124 O  O     . SER C 3 75  ? -9.859  39.207 8.451   1.00 46.01 ? 130 SER A O     1 
ATOM   1125 C  CB    . SER C 3 75  ? -7.793  39.525 10.791  1.00 46.03 ? 130 SER A CB    1 
ATOM   1126 O  OG    . SER C 3 75  ? -6.832  39.042 11.715  1.00 46.28 ? 130 SER A OG    1 
ATOM   1127 N  N     . PRO C 3 76  ? -11.080 39.357 10.348  1.00 45.93 ? 131 PRO A N     1 
ATOM   1128 C  CA    . PRO C 3 76  ? -12.248 39.836 9.631   1.00 46.01 ? 131 PRO A CA    1 
ATOM   1129 C  C     . PRO C 3 76  ? -12.056 41.264 9.130   1.00 46.06 ? 131 PRO A C     1 
ATOM   1130 O  O     . PRO C 3 76  ? -11.456 42.099 9.811   1.00 45.81 ? 131 PRO A O     1 
ATOM   1131 C  CB    . PRO C 3 76  ? -13.352 39.780 10.687  1.00 45.95 ? 131 PRO A CB    1 
ATOM   1132 C  CG    . PRO C 3 76  ? -12.633 39.996 11.979  1.00 45.93 ? 131 PRO A CG    1 
ATOM   1133 C  CD    . PRO C 3 76  ? -11.305 39.316 11.804  1.00 45.95 ? 131 PRO A CD    1 
ATOM   1134 N  N     . LYS C 3 77  ? -12.536 41.511 7.919   1.00 46.18 ? 132 LYS A N     1 
ATOM   1135 C  CA    . LYS C 3 77  ? -12.696 42.856 7.410   1.00 46.32 ? 132 LYS A CA    1 
ATOM   1136 C  C     . LYS C 3 77  ? -14.051 43.338 7.924   1.00 46.26 ? 132 LYS A C     1 
ATOM   1137 O  O     . LYS C 3 77  ? -14.964 42.525 8.105   1.00 46.29 ? 132 LYS A O     1 
ATOM   1138 C  CB    . LYS C 3 77  ? -12.673 42.837 5.881   1.00 46.50 ? 132 LYS A CB    1 
ATOM   1139 C  CG    . LYS C 3 77  ? -11.317 42.504 5.286   1.00 46.53 ? 132 LYS A CG    1 
ATOM   1140 C  CD    . LYS C 3 77  ? -11.464 41.801 3.948   1.00 46.90 ? 132 LYS A CD    1 
ATOM   1141 C  CE    . LYS C 3 77  ? -10.243 42.023 3.061   1.00 47.38 ? 132 LYS A CE    1 
ATOM   1142 N  NZ    . LYS C 3 77  ? -8.952  41.664 3.718   1.00 47.19 ? 132 LYS A NZ    1 
ATOM   1143 N  N     . PRO C 3 78  ? -14.184 44.647 8.201   1.00 46.12 ? 133 PRO A N     1 
ATOM   1144 C  CA    . PRO C 3 78  ? -15.477 45.187 8.634   1.00 46.06 ? 133 PRO A CA    1 
ATOM   1145 C  C     . PRO C 3 78  ? -16.611 44.890 7.646   1.00 46.04 ? 133 PRO A C     1 
ATOM   1146 O  O     . PRO C 3 78  ? -16.415 44.977 6.434   1.00 46.17 ? 133 PRO A O     1 
ATOM   1147 C  CB    . PRO C 3 78  ? -15.217 46.695 8.712   1.00 45.98 ? 133 PRO A CB    1 
ATOM   1148 C  CG    . PRO C 3 78  ? -13.750 46.813 8.941   1.00 46.00 ? 133 PRO A CG    1 
ATOM   1149 C  CD    . PRO C 3 78  ? -13.137 45.684 8.164   1.00 46.19 ? 133 PRO A CD    1 
ATOM   1150 N  N     . TRP C 3 79  ? -17.778 44.535 8.182   1.00 45.93 ? 134 TRP A N     1 
ATOM   1151 C  CA    . TRP C 3 79  ? -18.988 44.259 7.411   1.00 45.84 ? 134 TRP A CA    1 
ATOM   1152 C  C     . TRP C 3 79  ? -19.258 45.272 6.306   1.00 46.04 ? 134 TRP A C     1 
ATOM   1153 O  O     . TRP C 3 79  ? -18.921 46.448 6.441   1.00 46.13 ? 134 TRP A O     1 
ATOM   1154 C  CB    . TRP C 3 79  ? -20.194 44.255 8.345   1.00 45.85 ? 134 TRP A CB    1 
ATOM   1155 C  CG    . TRP C 3 79  ? -20.154 43.208 9.409   1.00 45.95 ? 134 TRP A CG    1 
ATOM   1156 C  CD1   . TRP C 3 79  ? -19.744 43.367 10.702  1.00 45.63 ? 134 TRP A CD1   1 
ATOM   1157 C  CD2   . TRP C 3 79  ? -20.552 41.836 9.278   1.00 46.03 ? 134 TRP A CD2   1 
ATOM   1158 N  NE1   . TRP C 3 79  ? -19.856 42.178 11.382  1.00 45.70 ? 134 TRP A NE1   1 
ATOM   1159 C  CE2   . TRP C 3 79  ? -20.351 41.222 10.533  1.00 45.83 ? 134 TRP A CE2   1 
ATOM   1160 C  CE3   . TRP C 3 79  ? -21.058 41.065 8.220   1.00 45.91 ? 134 TRP A CE3   1 
ATOM   1161 C  CZ2   . TRP C 3 79  ? -20.635 39.872 10.762  1.00 45.82 ? 134 TRP A CZ2   1 
ATOM   1162 C  CZ3   . TRP C 3 79  ? -21.344 39.722 8.448   1.00 45.73 ? 134 TRP A CZ3   1 
ATOM   1163 C  CH2   . TRP C 3 79  ? -21.128 39.141 9.710   1.00 45.70 ? 134 TRP A CH2   1 
ATOM   1164 N  N     . ILE C 3 80  ? -19.872 44.810 5.218   1.00 46.21 ? 135 ILE A N     1 
ATOM   1165 C  CA    . ILE C 3 80  ? -20.329 45.697 4.144   1.00 46.43 ? 135 ILE A CA    1 
ATOM   1166 C  C     . ILE C 3 80  ? -21.825 45.476 3.891   1.00 46.68 ? 135 ILE A C     1 
ATOM   1167 O  O     . ILE C 3 80  ? -22.334 44.383 4.157   1.00 46.77 ? 135 ILE A O     1 
ATOM   1168 C  CB    . ILE C 3 80  ? -19.492 45.547 2.829   1.00 46.54 ? 135 ILE A CB    1 
ATOM   1169 C  CG1   . ILE C 3 80  ? -19.582 44.125 2.254   1.00 46.64 ? 135 ILE A CG1   1 
ATOM   1170 C  CG2   . ILE C 3 80  ? -18.039 45.972 3.055   1.00 46.23 ? 135 ILE A CG2   1 
ATOM   1171 C  CD1   . ILE C 3 80  ? -18.879 43.949 0.905   1.00 46.36 ? 135 ILE A CD1   1 
ATOM   1172 N  N     . PRO C 3 81  ? -22.539 46.518 3.408   1.00 46.89 ? 136 PRO A N     1 
ATOM   1173 C  CA    . PRO C 3 81  ? -23.987 46.457 3.197   1.00 46.98 ? 136 PRO A CA    1 
ATOM   1174 C  C     . PRO C 3 81  ? -24.518 45.101 2.712   1.00 47.21 ? 136 PRO A C     1 
ATOM   1175 O  O     . PRO C 3 81  ? -25.411 44.533 3.346   1.00 47.18 ? 136 PRO A O     1 
ATOM   1176 C  CB    . PRO C 3 81  ? -24.223 47.549 2.149   1.00 46.96 ? 136 PRO A CB    1 
ATOM   1177 C  CG    . PRO C 3 81  ? -23.197 48.584 2.474   1.00 46.74 ? 136 PRO A CG    1 
ATOM   1178 C  CD    . PRO C 3 81  ? -22.004 47.854 3.059   1.00 46.96 ? 136 PRO A CD    1 
ATOM   1179 N  N     . VAL C 3 82  ? -23.957 44.588 1.617   1.00 47.45 ? 137 VAL A N     1 
ATOM   1180 C  CA    . VAL C 3 82  ? -24.443 43.352 0.998   1.00 47.67 ? 137 VAL A CA    1 
ATOM   1181 C  C     . VAL C 3 82  ? -24.363 42.108 1.903   1.00 48.03 ? 137 VAL A C     1 
ATOM   1182 O  O     . VAL C 3 82  ? -25.253 41.250 1.863   1.00 48.00 ? 137 VAL A O     1 
ATOM   1183 C  CB    . VAL C 3 82  ? -23.763 43.087 -0.376  1.00 47.76 ? 137 VAL A CB    1 
ATOM   1184 C  CG1   . VAL C 3 82  ? -22.252 42.876 -0.233  1.00 47.35 ? 137 VAL A CG1   1 
ATOM   1185 C  CG2   . VAL C 3 82  ? -24.415 41.905 -1.087  1.00 47.71 ? 137 VAL A CG2   1 
ATOM   1186 N  N     . LEU C 3 83  ? -23.313 42.011 2.719   1.00 48.21 ? 138 LEU A N     1 
ATOM   1187 C  CA    . LEU C 3 83  ? -23.165 40.855 3.613   1.00 48.35 ? 138 LEU A CA    1 
ATOM   1188 C  C     . LEU C 3 83  ? -24.114 40.926 4.803   1.00 48.64 ? 138 LEU A C     1 
ATOM   1189 O  O     . LEU C 3 83  ? -24.664 39.906 5.221   1.00 48.87 ? 138 LEU A O     1 
ATOM   1190 C  CB    . LEU C 3 83  ? -21.716 40.680 4.072   1.00 48.01 ? 138 LEU A CB    1 
ATOM   1191 C  CG    . LEU C 3 83  ? -20.712 40.471 2.936   1.00 47.91 ? 138 LEU A CG    1 
ATOM   1192 C  CD1   . LEU C 3 83  ? -19.288 40.370 3.445   1.00 47.28 ? 138 LEU A CD1   1 
ATOM   1193 C  CD2   . LEU C 3 83  ? -21.067 39.249 2.118   1.00 47.44 ? 138 LEU A CD2   1 
ATOM   1194 N  N     . GLU C 3 84  ? -24.313 42.131 5.331   1.00 48.74 ? 139 GLU A N     1 
ATOM   1195 C  CA    . GLU C 3 84  ? -25.247 42.347 6.427   1.00 49.16 ? 139 GLU A CA    1 
ATOM   1196 C  C     . GLU C 3 84  ? -26.667 42.069 5.957   1.00 49.25 ? 139 GLU A C     1 
ATOM   1197 O  O     . GLU C 3 84  ? -27.469 41.478 6.681   1.00 49.37 ? 139 GLU A O     1 
ATOM   1198 C  CB    . GLU C 3 84  ? -25.132 43.773 6.970   1.00 49.26 ? 139 GLU A CB    1 
ATOM   1199 C  CG    . GLU C 3 84  ? -23.700 44.199 7.277   1.00 50.25 ? 139 GLU A CG    1 
ATOM   1200 C  CD    . GLU C 3 84  ? -23.606 45.189 8.425   1.00 51.77 ? 139 GLU A CD    1 
ATOM   1201 O  OE1   . GLU C 3 84  ? -23.093 46.310 8.207   1.00 52.18 ? 139 GLU A OE1   1 
ATOM   1202 O  OE2   . GLU C 3 84  ? -24.039 44.844 9.548   1.00 52.43 ? 139 GLU A OE2   1 
ATOM   1203 N  N     . ARG C 3 85  ? -26.962 42.485 4.731   1.00 49.25 ? 140 ARG A N     1 
ATOM   1204 C  CA    . ARG C 3 85  ? -28.240 42.202 4.096   1.00 49.15 ? 140 ARG A CA    1 
ATOM   1205 C  C     . ARG C 3 85  ? -28.519 40.692 4.097   1.00 48.95 ? 140 ARG A C     1 
ATOM   1206 O  O     . ARG C 3 85  ? -29.622 40.259 4.427   1.00 49.07 ? 140 ARG A O     1 
ATOM   1207 C  CB    . ARG C 3 85  ? -28.233 42.771 2.676   1.00 49.24 ? 140 ARG A CB    1 
ATOM   1208 C  CG    . ARG C 3 85  ? -29.494 42.544 1.873   1.00 49.22 ? 140 ARG A CG    1 
ATOM   1209 C  CD    . ARG C 3 85  ? -29.162 42.591 0.388   1.00 48.74 ? 140 ARG A CD    1 
ATOM   1210 N  NE    . ARG C 3 85  ? -30.219 42.000 -0.428  1.00 48.02 ? 140 ARG A NE    1 
ATOM   1211 C  CZ    . ARG C 3 85  ? -30.448 42.315 -1.701  1.00 47.64 ? 140 ARG A CZ    1 
ATOM   1212 N  NH1   . ARG C 3 85  ? -29.690 43.224 -2.306  1.00 47.23 ? 140 ARG A NH1   1 
ATOM   1213 N  NH2   . ARG C 3 85  ? -31.438 41.731 -2.369  1.00 46.87 ? 140 ARG A NH2   1 
ATOM   1214 N  N     . ILE C 3 86  ? -27.505 39.902 3.759   1.00 48.83 ? 141 ILE A N     1 
ATOM   1215 C  CA    . ILE C 3 86  ? -27.633 38.440 3.718   1.00 48.67 ? 141 ILE A CA    1 
ATOM   1216 C  C     . ILE C 3 86  ? -27.659 37.814 5.115   1.00 48.81 ? 141 ILE A C     1 
ATOM   1217 O  O     . ILE C 3 86  ? -28.483 36.933 5.392   1.00 48.77 ? 141 ILE A O     1 
ATOM   1218 C  CB    . ILE C 3 86  ? -26.522 37.791 2.882   1.00 48.47 ? 141 ILE A CB    1 
ATOM   1219 C  CG1   . ILE C 3 86  ? -26.549 38.339 1.453   1.00 48.16 ? 141 ILE A CG1   1 
ATOM   1220 C  CG2   . ILE C 3 86  ? -26.688 36.274 2.865   1.00 48.66 ? 141 ILE A CG2   1 
ATOM   1221 C  CD1   . ILE C 3 86  ? -25.317 37.992 0.636   1.00 47.58 ? 141 ILE A CD1   1 
ATOM   1222 N  N     . ARG C 3 87  ? -26.759 38.269 5.987   1.00 48.78 ? 142 ARG A N     1 
ATOM   1223 C  CA    . ARG C 3 87  ? -26.760 37.849 7.386   1.00 48.92 ? 142 ARG A CA    1 
ATOM   1224 C  C     . ARG C 3 87  ? -28.126 38.118 8.018   1.00 48.83 ? 142 ARG A C     1 
ATOM   1225 O  O     . ARG C 3 87  ? -28.779 37.191 8.497   1.00 48.80 ? 142 ARG A O     1 
ATOM   1226 C  CB    . ARG C 3 87  ? -25.657 38.567 8.176   1.00 49.05 ? 142 ARG A CB    1 
ATOM   1227 C  CG    . ARG C 3 87  ? -25.557 38.157 9.646   1.00 49.40 ? 142 ARG A CG    1 
ATOM   1228 C  CD    . ARG C 3 87  ? -24.737 39.155 10.451  1.00 49.88 ? 142 ARG A CD    1 
ATOM   1229 N  NE    . ARG C 3 87  ? -25.404 40.451 10.543  1.00 51.13 ? 142 ARG A NE    1 
ATOM   1230 C  CZ    . ARG C 3 87  ? -24.815 41.585 10.917  1.00 51.48 ? 142 ARG A CZ    1 
ATOM   1231 N  NH1   . ARG C 3 87  ? -23.526 41.609 11.238  1.00 51.45 ? 142 ARG A NH1   1 
ATOM   1232 N  NH2   . ARG C 3 87  ? -25.519 42.706 10.961  1.00 51.04 ? 142 ARG A NH2   1 
ATOM   1233 N  N     . ASP C 3 88  ? -28.553 39.382 7.991   1.00 48.73 ? 143 ASP A N     1 
ATOM   1234 C  CA    . ASP C 3 88  ? -29.824 39.798 8.588   1.00 48.82 ? 143 ASP A CA    1 
ATOM   1235 C  C     . ASP C 3 88  ? -30.980 38.961 8.074   1.00 48.60 ? 143 ASP A C     1 
ATOM   1236 O  O     . ASP C 3 88  ? -31.870 38.599 8.841   1.00 48.56 ? 143 ASP A O     1 
ATOM   1237 C  CB    . ASP C 3 88  ? -30.113 41.286 8.327   1.00 48.97 ? 143 ASP A CB    1 
ATOM   1238 C  CG    . ASP C 3 88  ? -29.155 42.219 9.061   1.00 49.46 ? 143 ASP A CG    1 
ATOM   1239 O  OD1   . ASP C 3 88  ? -28.245 41.737 9.772   1.00 50.32 ? 143 ASP A OD1   1 
ATOM   1240 O  OD2   . ASP C 3 88  ? -29.311 43.449 8.917   1.00 50.06 ? 143 ASP A OD2   1 
ATOM   1241 N  N     . HIS C 3 89  ? -30.964 38.650 6.780   1.00 48.45 ? 144 HIS A N     1 
ATOM   1242 C  CA    . HIS C 3 89  ? -32.025 37.838 6.213   1.00 48.27 ? 144 HIS A CA    1 
ATOM   1243 C  C     . HIS C 3 89  ? -31.968 36.423 6.766   1.00 48.15 ? 144 HIS A C     1 
ATOM   1244 O  O     . HIS C 3 89  ? -32.959 35.940 7.323   1.00 48.41 ? 144 HIS A O     1 
ATOM   1245 C  CB    . HIS C 3 89  ? -31.998 37.814 4.686   1.00 48.32 ? 144 HIS A CB    1 
ATOM   1246 C  CG    . HIS C 3 89  ? -33.143 37.051 4.089   1.00 48.42 ? 144 HIS A CG    1 
ATOM   1247 N  ND1   . HIS C 3 89  ? -34.433 37.538 4.075   1.00 48.52 ? 144 HIS A ND1   1 
ATOM   1248 C  CD2   . HIS C 3 89  ? -33.197 35.826 3.514   1.00 48.12 ? 144 HIS A CD2   1 
ATOM   1249 C  CE1   . HIS C 3 89  ? -35.229 36.652 3.503   1.00 48.50 ? 144 HIS A CE1   1 
ATOM   1250 N  NE2   . HIS C 3 89  ? -34.505 35.603 3.155   1.00 48.29 ? 144 HIS A NE2   1 
ATOM   1251 N  N     . VAL C 3 90  ? -30.812 35.773 6.623   1.00 47.67 ? 145 VAL A N     1 
ATOM   1252 C  CA    . VAL C 3 90  ? -30.616 34.415 7.127   1.00 47.39 ? 145 VAL A CA    1 
ATOM   1253 C  C     . VAL C 3 90  ? -31.040 34.330 8.590   1.00 47.38 ? 145 VAL A C     1 
ATOM   1254 O  O     . VAL C 3 90  ? -31.761 33.407 8.981   1.00 47.45 ? 145 VAL A O     1 
ATOM   1255 C  CB    . VAL C 3 90  ? -29.154 33.937 6.939   1.00 47.48 ? 145 VAL A CB    1 
ATOM   1256 C  CG1   . VAL C 3 90  ? -28.839 32.742 7.828   1.00 47.37 ? 145 VAL A CG1   1 
ATOM   1257 C  CG2   . VAL C 3 90  ? -28.894 33.592 5.481   1.00 47.09 ? 145 VAL A CG2   1 
ATOM   1258 N  N     . SER C 3 91  ? -30.619 35.319 9.374   1.00 47.21 ? 146 SER A N     1 
ATOM   1259 C  CA    . SER C 3 91  ? -30.996 35.427 10.779  1.00 47.33 ? 146 SER A CA    1 
ATOM   1260 C  C     . SER C 3 91  ? -32.505 35.480 10.972  1.00 47.21 ? 146 SER A C     1 
ATOM   1261 O  O     . SER C 3 91  ? -33.033 34.890 11.914  1.00 47.19 ? 146 SER A O     1 
ATOM   1262 C  CB    . SER C 3 91  ? -30.352 36.660 11.415  1.00 47.36 ? 146 SER A CB    1 
ATOM   1263 O  OG    . SER C 3 91  ? -28.947 36.496 11.518  1.00 48.37 ? 146 SER A OG    1 
ATOM   1264 N  N     . GLY C 3 92  ? -33.189 36.190 10.078  1.00 47.16 ? 147 GLY A N     1 
ATOM   1265 C  CA    . GLY C 3 92  ? -34.642 36.285 10.124  1.00 47.18 ? 147 GLY A CA    1 
ATOM   1266 C  C     . GLY C 3 92  ? -35.295 34.927 9.949   1.00 47.17 ? 147 GLY A C     1 
ATOM   1267 O  O     . GLY C 3 92  ? -36.155 34.542 10.735  1.00 47.26 ? 147 GLY A O     1 
ATOM   1268 N  N     . VAL C 3 93  ? -34.858 34.196 8.927   1.00 47.15 ? 148 VAL A N     1 
ATOM   1269 C  CA    . VAL C 3 93  ? -35.444 32.907 8.560   1.00 47.21 ? 148 VAL A CA    1 
ATOM   1270 C  C     . VAL C 3 93  ? -35.132 31.782 9.557   1.00 47.29 ? 148 VAL A C     1 
ATOM   1271 O  O     . VAL C 3 93  ? -35.871 30.803 9.639   1.00 47.57 ? 148 VAL A O     1 
ATOM   1272 C  CB    . VAL C 3 93  ? -35.001 32.502 7.128   1.00 47.31 ? 148 VAL A CB    1 
ATOM   1273 C  CG1   . VAL C 3 93  ? -35.450 31.086 6.767   1.00 47.46 ? 148 VAL A CG1   1 
ATOM   1274 C  CG2   . VAL C 3 93  ? -35.528 33.501 6.110   1.00 47.38 ? 148 VAL A CG2   1 
ATOM   1275 N  N     . THR C 3 94  ? -34.057 31.930 10.325  1.00 47.37 ? 149 THR A N     1 
ATOM   1276 C  CA    . THR C 3 94  ? -33.572 30.847 11.185  1.00 47.29 ? 149 THR A CA    1 
ATOM   1277 C  C     . THR C 3 94  ? -33.710 31.125 12.674  1.00 47.46 ? 149 THR A C     1 
ATOM   1278 O  O     . THR C 3 94  ? -33.608 30.206 13.486  1.00 47.46 ? 149 THR A O     1 
ATOM   1279 C  CB    . THR C 3 94  ? -32.086 30.568 10.933  1.00 47.22 ? 149 THR A CB    1 
ATOM   1280 O  OG1   . THR C 3 94  ? -31.344 31.775 11.144  1.00 47.05 ? 149 THR A OG1   1 
ATOM   1281 C  CG2   . THR C 3 94  ? -31.853 30.057 9.517   1.00 46.93 ? 149 THR A CG2   1 
ATOM   1282 N  N     . GLY C 3 95  ? -33.912 32.392 13.032  1.00 47.75 ? 150 GLY A N     1 
ATOM   1283 C  CA    . GLY C 3 95  ? -33.904 32.814 14.434  1.00 47.97 ? 150 GLY A CA    1 
ATOM   1284 C  C     . GLY C 3 95  ? -32.507 32.747 15.033  1.00 48.18 ? 150 GLY A C     1 
ATOM   1285 O  O     . GLY C 3 95  ? -32.320 33.010 16.221  1.00 48.38 ? 150 GLY A O     1 
ATOM   1286 N  N     . GLN C 3 96  ? -31.532 32.394 14.198  1.00 48.23 ? 151 GLN A N     1 
ATOM   1287 C  CA    . GLN C 3 96  ? -30.136 32.240 14.602  1.00 48.51 ? 151 GLN A CA    1 
ATOM   1288 C  C     . GLN C 3 96  ? -29.354 33.532 14.383  1.00 48.46 ? 151 GLN A C     1 
ATOM   1289 O  O     . GLN C 3 96  ? -29.776 34.398 13.618  1.00 48.66 ? 151 GLN A O     1 
ATOM   1290 C  CB    . GLN C 3 96  ? -29.485 31.108 13.803  1.00 48.64 ? 151 GLN A CB    1 
ATOM   1291 C  CG    . GLN C 3 96  ? -30.209 29.771 13.902  1.00 49.11 ? 151 GLN A CG    1 
ATOM   1292 C  CD    . GLN C 3 96  ? -30.033 29.110 15.252  1.00 50.02 ? 151 GLN A CD    1 
ATOM   1293 O  OE1   . GLN C 3 96  ? -29.013 29.295 15.922  1.00 50.68 ? 151 GLN A OE1   1 
ATOM   1294 N  NE2   . GLN C 3 96  ? -31.026 28.327 15.660  1.00 50.04 ? 151 GLN A NE2   1 
ATOM   1295 N  N     . THR C 3 97  ? -28.210 33.662 15.043  1.00 48.19 ? 152 THR A N     1 
ATOM   1296 C  CA    . THR C 3 97  ? -27.442 34.900 14.956  1.00 48.02 ? 152 THR A CA    1 
ATOM   1297 C  C     . THR C 3 97  ? -25.966 34.637 14.638  1.00 47.85 ? 152 THR A C     1 
ATOM   1298 O  O     . THR C 3 97  ? -25.419 33.605 15.027  1.00 48.03 ? 152 THR A O     1 
ATOM   1299 C  CB    . THR C 3 97  ? -27.661 35.791 16.212  1.00 48.07 ? 152 THR A CB    1 
ATOM   1300 O  OG1   . THR C 3 97  ? -26.928 37.012 16.075  1.00 48.30 ? 152 THR A OG1   1 
ATOM   1301 C  CG2   . THR C 3 97  ? -27.258 35.072 17.502  1.00 48.14 ? 152 THR A CG2   1 
ATOM   1302 N  N     . PHE C 3 98  ? -25.342 35.551 13.893  1.00 47.49 ? 153 PHE A N     1 
ATOM   1303 C  CA    . PHE C 3 98  ? -23.989 35.331 13.359  1.00 47.10 ? 153 PHE A CA    1 
ATOM   1304 C  C     . PHE C 3 98  ? -23.102 36.563 13.472  1.00 47.04 ? 153 PHE A C     1 
ATOM   1305 O  O     . PHE C 3 98  ? -23.575 37.691 13.337  1.00 47.12 ? 153 PHE A O     1 
ATOM   1306 C  CB    . PHE C 3 98  ? -24.053 34.890 11.892  1.00 46.84 ? 153 PHE A CB    1 
ATOM   1307 C  CG    . PHE C 3 98  ? -24.985 33.744 11.646  1.00 46.61 ? 153 PHE A CG    1 
ATOM   1308 C  CD1   . PHE C 3 98  ? -24.520 32.436 11.673  1.00 46.59 ? 153 PHE A CD1   1 
ATOM   1309 C  CD2   . PHE C 3 98  ? -26.335 33.969 11.395  1.00 46.29 ? 153 PHE A CD2   1 
ATOM   1310 C  CE1   . PHE C 3 98  ? -25.389 31.364 11.449  1.00 46.29 ? 153 PHE A CE1   1 
ATOM   1311 C  CE2   . PHE C 3 98  ? -27.206 32.907 11.173  1.00 46.45 ? 153 PHE A CE2   1 
ATOM   1312 C  CZ    . PHE C 3 98  ? -26.731 31.603 11.197  1.00 45.94 ? 153 PHE A CZ    1 
ATOM   1313 N  N     . ASN C 3 99  ? -21.810 36.334 13.696  1.00 47.00 ? 154 ASN A N     1 
ATOM   1314 C  CA    . ASN C 3 99  ? -20.840 37.419 13.865  1.00 46.95 ? 154 ASN A CA    1 
ATOM   1315 C  C     . ASN C 3 99  ? -19.638 37.330 12.910  1.00 46.90 ? 154 ASN A C     1 
ATOM   1316 O  O     . ASN C 3 99  ? -18.678 38.092 13.030  1.00 46.90 ? 154 ASN A O     1 
ATOM   1317 C  CB    . ASN C 3 99  ? -20.361 37.465 15.321  1.00 46.86 ? 154 ASN A CB    1 
ATOM   1318 C  CG    . ASN C 3 99  ? -19.686 36.169 15.764  1.00 47.15 ? 154 ASN A CG    1 
ATOM   1319 O  OD1   . ASN C 3 99  ? -19.691 35.164 15.048  1.00 47.29 ? 154 ASN A OD1   1 
ATOM   1320 N  ND2   . ASN C 3 99  ? -19.097 36.194 16.955  1.00 47.16 ? 154 ASN A ND2   1 
ATOM   1321 N  N     . PHE C 3 100 ? -19.710 36.403 11.961  1.00 46.87 ? 155 PHE A N     1 
ATOM   1322 C  CA    . PHE C 3 100 ? -18.578 36.091 11.095  1.00 46.97 ? 155 PHE A CA    1 
ATOM   1323 C  C     . PHE C 3 100 ? -19.061 35.441 9.813   1.00 46.83 ? 155 PHE A C     1 
ATOM   1324 O  O     . PHE C 3 100 ? -20.082 34.742 9.808   1.00 46.95 ? 155 PHE A O     1 
ATOM   1325 C  CB    . PHE C 3 100 ? -17.653 35.112 11.812  1.00 47.19 ? 155 PHE A CB    1 
ATOM   1326 C  CG    . PHE C 3 100 ? -16.253 35.080 11.276  1.00 47.47 ? 155 PHE A CG    1 
ATOM   1327 C  CD1   . PHE C 3 100 ? -15.301 35.987 11.735  1.00 47.43 ? 155 PHE A CD1   1 
ATOM   1328 C  CD2   . PHE C 3 100 ? -15.872 34.119 10.344  1.00 48.57 ? 155 PHE A CD2   1 
ATOM   1329 C  CE1   . PHE C 3 100 ? -13.996 35.956 11.261  1.00 47.65 ? 155 PHE A CE1   1 
ATOM   1330 C  CE2   . PHE C 3 100 ? -14.564 34.074 9.862   1.00 48.47 ? 155 PHE A CE2   1 
ATOM   1331 C  CZ    . PHE C 3 100 ? -13.625 34.999 10.325  1.00 48.22 ? 155 PHE A CZ    1 
ATOM   1332 N  N     . VAL C 3 101 ? -18.333 35.677 8.727   1.00 46.49 ? 156 VAL A N     1 
ATOM   1333 C  CA    . VAL C 3 101 ? -18.583 34.969 7.474   1.00 46.14 ? 156 VAL A CA    1 
ATOM   1334 C  C     . VAL C 3 101 ? -17.276 34.672 6.739   1.00 46.22 ? 156 VAL A C     1 
ATOM   1335 O  O     . VAL C 3 101 ? -16.437 35.550 6.557   1.00 46.28 ? 156 VAL A O     1 
ATOM   1336 C  CB    . VAL C 3 101 ? -19.615 35.699 6.567   1.00 45.97 ? 156 VAL A CB    1 
ATOM   1337 C  CG1   . VAL C 3 101 ? -19.125 37.094 6.146   1.00 45.69 ? 156 VAL A CG1   1 
ATOM   1338 C  CG2   . VAL C 3 101 ? -19.974 34.840 5.360   1.00 45.42 ? 156 VAL A CG2   1 
ATOM   1339 N  N     . LEU C 3 102 ? -17.096 33.414 6.362   1.00 46.41 ? 157 LEU A N     1 
ATOM   1340 C  CA    . LEU C 3 102 ? -16.018 33.037 5.471   1.00 46.33 ? 157 LEU A CA    1 
ATOM   1341 C  C     . LEU C 3 102 ? -16.625 32.934 4.089   1.00 46.16 ? 157 LEU A C     1 
ATOM   1342 O  O     . LEU C 3 102 ? -17.675 32.308 3.911   1.00 46.60 ? 157 LEU A O     1 
ATOM   1343 C  CB    . LEU C 3 102 ? -15.394 31.707 5.892   1.00 46.39 ? 157 LEU A CB    1 
ATOM   1344 C  CG    . LEU C 3 102 ? -14.408 31.051 4.919   1.00 47.07 ? 157 LEU A CG    1 
ATOM   1345 C  CD1   . LEU C 3 102 ? -13.042 31.716 4.963   1.00 47.44 ? 157 LEU A CD1   1 
ATOM   1346 C  CD2   . LEU C 3 102 ? -14.275 29.578 5.228   1.00 47.82 ? 157 LEU A CD2   1 
ATOM   1347 N  N     . ILE C 3 103 ? -15.980 33.576 3.123   1.00 45.93 ? 158 ILE A N     1 
ATOM   1348 C  CA    . ILE C 3 103 ? -16.438 33.544 1.748   1.00 45.82 ? 158 ILE A CA    1 
ATOM   1349 C  C     . ILE C 3 103 ? -15.472 32.741 0.893   1.00 45.90 ? 158 ILE A C     1 
ATOM   1350 O  O     . ILE C 3 103 ? -14.270 32.983 0.896   1.00 46.37 ? 158 ILE A O     1 
ATOM   1351 C  CB    . ILE C 3 103 ? -16.606 34.960 1.169   1.00 45.75 ? 158 ILE A CB    1 
ATOM   1352 C  CG1   . ILE C 3 103 ? -17.632 35.743 1.991   1.00 46.00 ? 158 ILE A CG1   1 
ATOM   1353 C  CG2   . ILE C 3 103 ? -17.053 34.888 -0.285  1.00 45.80 ? 158 ILE A CG2   1 
ATOM   1354 C  CD1   . ILE C 3 103 ? -17.551 37.249 1.827   1.00 45.77 ? 158 ILE A CD1   1 
ATOM   1355 N  N     . ASN C 3 104 ? -16.011 31.784 0.157   1.00 45.93 ? 159 ASN A N     1 
ATOM   1356 C  CA    . ASN C 3 104 ? -15.226 31.011 -0.779  1.00 46.05 ? 159 ASN A CA    1 
ATOM   1357 C  C     . ASN C 3 104 ? -15.739 31.229 -2.188  1.00 45.85 ? 159 ASN A C     1 
ATOM   1358 O  O     . ASN C 3 104 ? -16.934 31.059 -2.441  1.00 46.02 ? 159 ASN A O     1 
ATOM   1359 C  CB    . ASN C 3 104 ? -15.291 29.531 -0.417  1.00 46.26 ? 159 ASN A CB    1 
ATOM   1360 C  CG    . ASN C 3 104 ? -14.373 29.176 0.733   1.00 47.09 ? 159 ASN A CG    1 
ATOM   1361 O  OD1   . ASN C 3 104 ? -13.167 28.988 0.546   1.00 48.73 ? 159 ASN A OD1   1 
ATOM   1362 N  ND2   . ASN C 3 104 ? -14.935 29.070 1.928   1.00 47.61 ? 159 ASN A ND2   1 
ATOM   1363 N  N     . ARG C 3 105 ? -14.840 31.619 -3.095  1.00 45.50 ? 160 ARG A N     1 
ATOM   1364 C  CA    . ARG C 3 105 ? -15.190 31.805 -4.504  1.00 44.96 ? 160 ARG A CA    1 
ATOM   1365 C  C     . ARG C 3 105 ? -14.448 30.832 -5.410  1.00 45.28 ? 160 ARG A C     1 
ATOM   1366 O  O     . ARG C 3 105 ? -13.217 30.845 -5.486  1.00 45.42 ? 160 ARG A O     1 
ATOM   1367 C  CB    . ARG C 3 105 ? -14.916 33.235 -4.953  1.00 44.56 ? 160 ARG A CB    1 
ATOM   1368 C  CG    . ARG C 3 105 ? -15.282 33.489 -6.397  1.00 43.62 ? 160 ARG A CG    1 
ATOM   1369 C  CD    . ARG C 3 105 ? -14.925 34.895 -6.808  1.00 41.66 ? 160 ARG A CD    1 
ATOM   1370 N  NE    . ARG C 3 105 ? -15.393 35.224 -8.154  1.00 40.49 ? 160 ARG A NE    1 
ATOM   1371 C  CZ    . ARG C 3 105 ? -14.798 34.830 -9.278  1.00 39.56 ? 160 ARG A CZ    1 
ATOM   1372 N  NH1   . ARG C 3 105 ? -13.713 34.064 -9.231  1.00 38.13 ? 160 ARG A NH1   1 
ATOM   1373 N  NH2   . ARG C 3 105 ? -15.295 35.195 -10.456 1.00 38.29 ? 160 ARG A NH2   1 
ATOM   1374 N  N     . TYR C 3 106 ? -15.213 30.010 -6.116  1.00 45.39 ? 161 TYR A N     1 
ATOM   1375 C  CA    . TYR C 3 106 ? -14.658 28.992 -6.992  1.00 45.49 ? 161 TYR A CA    1 
ATOM   1376 C  C     . TYR C 3 106 ? -14.830 29.440 -8.428  1.00 45.59 ? 161 TYR A C     1 
ATOM   1377 O  O     . TYR C 3 106 ? -15.929 29.362 -8.959  1.00 45.85 ? 161 TYR A O     1 
ATOM   1378 C  CB    . TYR C 3 106 ? -15.391 27.670 -6.760  1.00 45.33 ? 161 TYR A CB    1 
ATOM   1379 C  CG    . TYR C 3 106 ? -15.478 27.293 -5.303  1.00 45.35 ? 161 TYR A CG    1 
ATOM   1380 C  CD1   . TYR C 3 106 ? -14.542 26.432 -4.736  1.00 45.55 ? 161 TYR A CD1   1 
ATOM   1381 C  CD2   . TYR C 3 106 ? -16.480 27.819 -4.480  1.00 45.42 ? 161 TYR A CD2   1 
ATOM   1382 C  CE1   . TYR C 3 106 ? -14.603 26.091 -3.394  1.00 45.35 ? 161 TYR A CE1   1 
ATOM   1383 C  CE2   . TYR C 3 106 ? -16.550 27.482 -3.132  1.00 45.00 ? 161 TYR A CE2   1 
ATOM   1384 C  CZ    . TYR C 3 106 ? -15.606 26.617 -2.600  1.00 45.17 ? 161 TYR A CZ    1 
ATOM   1385 O  OH    . TYR C 3 106 ? -15.653 26.264 -1.275  1.00 45.34 ? 161 TYR A OH    1 
ATOM   1386 N  N     . LYS C 3 107 ? -13.755 29.909 -9.060  1.00 45.86 ? 162 LYS A N     1 
ATOM   1387 C  CA    . LYS C 3 107 ? -13.882 30.575 -10.366 1.00 46.21 ? 162 LYS A CA    1 
ATOM   1388 C  C     . LYS C 3 107 ? -14.559 29.707 -11.430 1.00 46.39 ? 162 LYS A C     1 
ATOM   1389 O  O     . LYS C 3 107 ? -15.236 30.221 -12.326 1.00 46.63 ? 162 LYS A O     1 
ATOM   1390 C  CB    . LYS C 3 107 ? -12.541 31.134 -10.860 1.00 46.17 ? 162 LYS A CB    1 
ATOM   1391 C  CG    . LYS C 3 107 ? -11.509 30.106 -11.292 1.00 46.87 ? 162 LYS A CG    1 
ATOM   1392 C  CD    . LYS C 3 107 ? -10.503 30.709 -12.269 1.00 48.06 ? 162 LYS A CD    1 
ATOM   1393 C  CE    . LYS C 3 107 ? -9.231  29.870 -12.375 1.00 49.57 ? 162 LYS A CE    1 
ATOM   1394 N  NZ    . LYS C 3 107 ? -9.512  28.425 -12.651 1.00 50.94 ? 162 LYS A NZ    1 
ATOM   1395 N  N     . ASP C 3 108 ? -14.369 28.395 -11.311 1.00 46.46 ? 163 ASP A N     1 
ATOM   1396 C  CA    . ASP C 3 108 ? -15.014 27.401 -12.166 1.00 46.56 ? 163 ASP A CA    1 
ATOM   1397 C  C     . ASP C 3 108 ? -14.902 26.032 -11.509 1.00 46.60 ? 163 ASP A C     1 
ATOM   1398 O  O     . ASP C 3 108 ? -14.344 25.911 -10.414 1.00 46.66 ? 163 ASP A O     1 
ATOM   1399 C  CB    . ASP C 3 108 ? -14.401 27.378 -13.579 1.00 46.54 ? 163 ASP A CB    1 
ATOM   1400 C  CG    . ASP C 3 108 ? -12.913 27.053 -13.585 1.00 46.64 ? 163 ASP A CG    1 
ATOM   1401 O  OD1   . ASP C 3 108 ? -12.368 26.582 -12.562 1.00 46.07 ? 163 ASP A OD1   1 
ATOM   1402 O  OD2   . ASP C 3 108 ? -12.285 27.266 -14.643 1.00 47.70 ? 163 ASP A OD2   1 
ATOM   1403 N  N     . GLY C 3 109 ? -15.411 25.009 -12.190 1.00 46.48 ? 164 GLY A N     1 
ATOM   1404 C  CA    . GLY C 3 109 ? -15.382 23.637 -11.684 1.00 46.83 ? 164 GLY A CA    1 
ATOM   1405 C  C     . GLY C 3 109 ? -14.037 23.079 -11.228 1.00 47.03 ? 164 GLY A C     1 
ATOM   1406 O  O     . GLY C 3 109 ? -13.992 22.053 -10.551 1.00 47.26 ? 164 GLY A O     1 
ATOM   1407 N  N     . SER C 3 110 ? -12.942 23.739 -11.593 1.00 47.03 ? 165 SER A N     1 
ATOM   1408 C  CA    . SER C 3 110 ? -11.609 23.255 -11.232 1.00 47.10 ? 165 SER A CA    1 
ATOM   1409 C  C     . SER C 3 110 ? -11.162 23.793 -9.879  1.00 46.78 ? 165 SER A C     1 
ATOM   1410 O  O     . SER C 3 110 ? -10.240 23.261 -9.266  1.00 46.73 ? 165 SER A O     1 
ATOM   1411 C  CB    . SER C 3 110 ? -10.589 23.587 -12.319 1.00 47.09 ? 165 SER A CB    1 
ATOM   1412 O  OG    . SER C 3 110 ? -10.836 22.786 -13.465 1.00 48.34 ? 165 SER A OG    1 
ATOM   1413 N  N     . ASP C 3 111 ? -11.817 24.851 -9.423  1.00 46.38 ? 166 ASP A N     1 
ATOM   1414 C  CA    . ASP C 3 111 ? -11.650 25.282 -8.055  1.00 46.16 ? 166 ASP A CA    1 
ATOM   1415 C  C     . ASP C 3 111 ? -12.529 24.403 -7.175  1.00 46.00 ? 166 ASP A C     1 
ATOM   1416 O  O     . ASP C 3 111 ? -13.628 24.000 -7.583  1.00 45.90 ? 166 ASP A O     1 
ATOM   1417 C  CB    . ASP C 3 111 ? -12.002 26.756 -7.908  1.00 46.18 ? 166 ASP A CB    1 
ATOM   1418 C  CG    . ASP C 3 111 ? -10.834 27.677 -8.244  1.00 46.68 ? 166 ASP A CG    1 
ATOM   1419 O  OD1   . ASP C 3 111 ? -9.727  27.184 -8.571  1.00 46.63 ? 166 ASP A OD1   1 
ATOM   1420 O  OD2   . ASP C 3 111 ? -11.025 28.908 -8.165  1.00 46.36 ? 166 ASP A OD2   1 
ATOM   1421 N  N     . HIS C 3 112 ? -12.035 24.092 -5.980  1.00 45.71 ? 167 HIS A N     1 
ATOM   1422 C  CA    . HIS C 3 112 ? -12.687 23.134 -5.098  1.00 45.27 ? 167 HIS A CA    1 
ATOM   1423 C  C     . HIS C 3 112 ? -12.240 23.340 -3.665  1.00 45.24 ? 167 HIS A C     1 
ATOM   1424 O  O     . HIS C 3 112 ? -11.412 24.207 -3.381  1.00 45.28 ? 167 HIS A O     1 
ATOM   1425 C  CB    . HIS C 3 112 ? -12.341 21.709 -5.533  1.00 45.15 ? 167 HIS A CB    1 
ATOM   1426 C  CG    . HIS C 3 112 ? -10.876 21.402 -5.485  1.00 45.72 ? 167 HIS A CG    1 
ATOM   1427 N  ND1   . HIS C 3 112 ? -10.014 21.727 -6.511  1.00 46.77 ? 167 HIS A ND1   1 
ATOM   1428 C  CD2   . HIS C 3 112 ? -10.117 20.804 -4.534  1.00 45.15 ? 167 HIS A CD2   1 
ATOM   1429 C  CE1   . HIS C 3 112 ? -8.790  21.334 -6.199  1.00 46.08 ? 167 HIS A CE1   1 
ATOM   1430 N  NE2   . HIS C 3 112 ? -8.824  20.782 -5.000  1.00 45.19 ? 167 HIS A NE2   1 
ATOM   1431 N  N     . ILE C 3 113 ? -12.789 22.529 -2.766  1.00 44.99 ? 168 ILE A N     1 
ATOM   1432 C  CA    . ILE C 3 113 ? -12.325 22.476 -1.392  1.00 44.73 ? 168 ILE A CA    1 
ATOM   1433 C  C     . ILE C 3 113 ? -12.331 21.026 -0.931  1.00 44.86 ? 168 ILE A C     1 
ATOM   1434 O  O     . ILE C 3 113 ? -13.326 20.313 -1.074  1.00 44.77 ? 168 ILE A O     1 
ATOM   1435 C  CB    . ILE C 3 113 ? -13.126 23.427 -0.453  1.00 44.64 ? 168 ILE A CB    1 
ATOM   1436 C  CG1   . ILE C 3 113 ? -12.488 23.484 0.939   1.00 44.58 ? 168 ILE A CG1   1 
ATOM   1437 C  CG2   . ILE C 3 113 ? -14.618 23.048 -0.380  1.00 45.02 ? 168 ILE A CG2   1 
ATOM   1438 C  CD1   . ILE C 3 113 ? -12.870 24.725 1.740   1.00 43.83 ? 168 ILE A CD1   1 
ATOM   1439 N  N     . CYS C 3 114 ? -11.189 20.595 -0.410  1.00 44.96 ? 169 CYS A N     1 
ATOM   1440 C  CA    . CYS C 3 114 ? -10.981 19.214 -0.015  1.00 45.06 ? 169 CYS A CA    1 
ATOM   1441 C  C     . CYS C 3 114 ? -11.775 18.803 1.202   1.00 45.11 ? 169 CYS A C     1 
ATOM   1442 O  O     . CYS C 3 114 ? -12.157 19.632 2.036   1.00 45.03 ? 169 CYS A O     1 
ATOM   1443 C  CB    . CYS C 3 114 ? -9.506  18.968 0.252   1.00 45.19 ? 169 CYS A CB    1 
ATOM   1444 S  SG    . CYS C 3 114 ? -8.559  18.926 -1.244  1.00 45.98 ? 169 CYS A SG    1 
ATOM   1445 N  N     . GLU C 3 115 ? -11.987 17.497 1.298   1.00 45.26 ? 170 GLU A N     1 
ATOM   1446 C  CA    . GLU C 3 115 ? -12.745 16.904 2.370   1.00 45.67 ? 170 GLU A CA    1 
ATOM   1447 C  C     . GLU C 3 115 ? -12.208 17.348 3.731   1.00 46.03 ? 170 GLU A C     1 
ATOM   1448 O  O     . GLU C 3 115 ? -11.011 17.231 4.008   1.00 46.13 ? 170 GLU A O     1 
ATOM   1449 C  CB    . GLU C 3 115 ? -12.731 15.387 2.220   1.00 45.60 ? 170 GLU A CB    1 
ATOM   1450 C  CG    . GLU C 3 115 ? -13.364 14.656 3.366   1.00 46.28 ? 170 GLU A CG    1 
ATOM   1451 C  CD    . GLU C 3 115 ? -13.930 13.326 2.964   1.00 46.74 ? 170 GLU A CD    1 
ATOM   1452 O  OE1   . GLU C 3 115 ? -14.993 13.308 2.322   1.00 48.02 ? 170 GLU A OE1   1 
ATOM   1453 O  OE2   . GLU C 3 115 ? -13.324 12.293 3.306   1.00 48.18 ? 170 GLU A OE2   1 
ATOM   1454 N  N     . HIS C 3 116 ? -13.094 17.885 4.565   1.00 46.31 ? 171 HIS A N     1 
ATOM   1455 C  CA    . HIS C 3 116 ? -12.707 18.323 5.898   1.00 46.61 ? 171 HIS A CA    1 
ATOM   1456 C  C     . HIS C 3 116 ? -13.876 18.389 6.866   1.00 47.03 ? 171 HIS A C     1 
ATOM   1457 O  O     . HIS C 3 116 ? -15.035 18.202 6.481   1.00 47.13 ? 171 HIS A O     1 
ATOM   1458 C  CB    . HIS C 3 116 ? -12.062 19.698 5.821   1.00 46.49 ? 171 HIS A CB    1 
ATOM   1459 C  CG    . HIS C 3 116 ? -13.023 20.801 5.504   1.00 46.38 ? 171 HIS A CG    1 
ATOM   1460 N  ND1   . HIS C 3 116 ? -13.405 21.107 4.216   1.00 46.08 ? 171 HIS A ND1   1 
ATOM   1461 C  CD2   . HIS C 3 116 ? -13.668 21.680 6.309   1.00 45.90 ? 171 HIS A CD2   1 
ATOM   1462 C  CE1   . HIS C 3 116 ? -14.243 22.129 4.242   1.00 46.14 ? 171 HIS A CE1   1 
ATOM   1463 N  NE2   . HIS C 3 116 ? -14.421 22.493 5.500   1.00 45.79 ? 171 HIS A NE2   1 
ATOM   1464 N  N     . ARG C 3 117 ? -13.555 18.671 8.125   1.00 47.38 ? 172 ARG A N     1 
ATOM   1465 C  CA    . ARG C 3 117 ? -14.560 18.999 9.124   1.00 47.82 ? 172 ARG A CA    1 
ATOM   1466 C  C     . ARG C 3 117 ? -14.343 20.424 9.595   1.00 48.05 ? 172 ARG A C     1 
ATOM   1467 O  O     . ARG C 3 117 ? -13.217 20.917 9.597   1.00 48.12 ? 172 ARG A O     1 
ATOM   1468 C  CB    . ARG C 3 117 ? -14.482 18.038 10.306  1.00 48.01 ? 172 ARG A CB    1 
ATOM   1469 C  CG    . ARG C 3 117 ? -14.589 16.580 9.903   1.00 48.88 ? 172 ARG A CG    1 
ATOM   1470 C  CD    . ARG C 3 117 ? -14.894 15.672 11.075  1.00 50.09 ? 172 ARG A CD    1 
ATOM   1471 N  NE    . ARG C 3 117 ? -13.691 15.231 11.773  1.00 51.13 ? 172 ARG A NE    1 
ATOM   1472 C  CZ    . ARG C 3 117 ? -13.403 15.540 13.034  1.00 51.92 ? 172 ARG A CZ    1 
ATOM   1473 N  NH1   . ARG C 3 117 ? -14.236 16.300 13.739  1.00 52.51 ? 172 ARG A NH1   1 
ATOM   1474 N  NH2   . ARG C 3 117 ? -12.283 15.088 13.591  1.00 51.49 ? 172 ARG A NH2   1 
ATOM   1475 N  N     . ASP C 3 118 ? -15.429 21.088 9.972   1.00 48.52 ? 173 ASP A N     1 
ATOM   1476 C  CA    . ASP C 3 118 ? -15.350 22.389 10.618  1.00 48.93 ? 173 ASP A CA    1 
ATOM   1477 C  C     . ASP C 3 118 ? -15.370 22.181 12.129  1.00 49.23 ? 173 ASP A C     1 
ATOM   1478 O  O     . ASP C 3 118 ? -16.368 22.432 12.804  1.00 49.17 ? 173 ASP A O     1 
ATOM   1479 C  CB    . ASP C 3 118 ? -16.485 23.299 10.151  1.00 49.01 ? 173 ASP A CB    1 
ATOM   1480 C  CG    . ASP C 3 118 ? -16.242 23.870 8.762   1.00 49.53 ? 173 ASP A CG    1 
ATOM   1481 O  OD1   . ASP C 3 118 ? -16.218 25.108 8.633   1.00 50.61 ? 173 ASP A OD1   1 
ATOM   1482 O  OD2   . ASP C 3 118 ? -16.069 23.098 7.793   1.00 50.11 ? 173 ASP A OD2   1 
ATOM   1483 N  N     . ASP C 3 119 ? -14.237 21.710 12.638  1.00 49.75 ? 174 ASP A N     1 
ATOM   1484 C  CA    . ASP C 3 119 ? -14.094 21.262 14.024  1.00 50.28 ? 174 ASP A CA    1 
ATOM   1485 C  C     . ASP C 3 119 ? -13.351 22.272 14.908  1.00 50.37 ? 174 ASP A C     1 
ATOM   1486 O  O     . ASP C 3 119 ? -12.991 21.959 16.052  1.00 50.41 ? 174 ASP A O     1 
ATOM   1487 C  CB    . ASP C 3 119 ? -13.365 19.902 14.054  1.00 50.46 ? 174 ASP A CB    1 
ATOM   1488 C  CG    . ASP C 3 119 ? -12.023 19.916 13.282  1.00 51.19 ? 174 ASP A CG    1 
ATOM   1489 O  OD1   . ASP C 3 119 ? -11.711 20.921 12.596  1.00 51.42 ? 174 ASP A OD1   1 
ATOM   1490 O  OD2   . ASP C 3 119 ? -11.279 18.907 13.356  1.00 51.64 ? 174 ASP A OD2   1 
ATOM   1491 N  N     . GLU C 3 120 ? -13.130 23.476 14.381  1.00 50.37 ? 175 GLU A N     1 
ATOM   1492 C  CA    . GLU C 3 120 ? -12.273 24.467 15.038  1.00 50.44 ? 175 GLU A CA    1 
ATOM   1493 C  C     . GLU C 3 120 ? -12.839 24.958 16.363  1.00 50.62 ? 175 GLU A C     1 
ATOM   1494 O  O     . GLU C 3 120 ? -14.050 25.150 16.513  1.00 50.70 ? 175 GLU A O     1 
ATOM   1495 C  CB    . GLU C 3 120 ? -11.971 25.651 14.114  1.00 50.40 ? 175 GLU A CB    1 
ATOM   1496 C  CG    . GLU C 3 120 ? -11.120 25.296 12.894  1.00 50.24 ? 175 GLU A CG    1 
ATOM   1497 C  CD    . GLU C 3 120 ? -11.893 24.528 11.829  1.00 50.95 ? 175 GLU A CD    1 
ATOM   1498 O  OE1   . GLU C 3 120 ? -13.134 24.698 11.746  1.00 50.16 ? 175 GLU A OE1   1 
ATOM   1499 O  OE2   . GLU C 3 120 ? -11.258 23.754 11.071  1.00 51.38 ? 175 GLU A OE2   1 
ATOM   1500 N  N     . ARG C 3 121 ? -11.927 25.147 17.312  1.00 50.66 ? 176 ARG A N     1 
ATOM   1501 C  CA    . ARG C 3 121 ? -12.222 25.539 18.689  1.00 50.74 ? 176 ARG A CA    1 
ATOM   1502 C  C     . ARG C 3 121 ? -13.031 26.827 18.846  1.00 50.49 ? 176 ARG A C     1 
ATOM   1503 O  O     . ARG C 3 121 ? -13.913 26.903 19.704  1.00 50.52 ? 176 ARG A O     1 
ATOM   1504 C  CB    . ARG C 3 121 ? -10.908 25.665 19.464  1.00 50.80 ? 176 ARG A CB    1 
ATOM   1505 C  CG    . ARG C 3 121 ? -9.719  26.108 18.594  1.00 51.36 ? 176 ARG A CG    1 
ATOM   1506 C  CD    . ARG C 3 121 ? -8.457  26.394 19.401  1.00 51.41 ? 176 ARG A CD    1 
ATOM   1507 N  NE    . ARG C 3 121 ? -8.132  25.309 20.325  1.00 52.80 ? 176 ARG A NE    1 
ATOM   1508 C  CZ    . ARG C 3 121 ? -8.387  25.332 21.632  1.00 53.36 ? 176 ARG A CZ    1 
ATOM   1509 N  NH1   . ARG C 3 121 ? -8.968  26.391 22.189  1.00 53.78 ? 176 ARG A NH1   1 
ATOM   1510 N  NH2   . ARG C 3 121 ? -8.056  24.293 22.387  1.00 53.59 ? 176 ARG A NH2   1 
ATOM   1511 N  N     . GLU C 3 122 ? -12.730 27.831 18.025  1.00 50.24 ? 177 GLU A N     1 
ATOM   1512 C  CA    . GLU C 3 122 ? -13.322 29.164 18.189  1.00 50.11 ? 177 GLU A CA    1 
ATOM   1513 C  C     . GLU C 3 122 ? -14.804 29.300 17.782  1.00 49.95 ? 177 GLU A C     1 
ATOM   1514 O  O     . GLU C 3 122 ? -15.398 30.366 17.965  1.00 50.05 ? 177 GLU A O     1 
ATOM   1515 C  CB    . GLU C 3 122 ? -12.448 30.261 17.545  1.00 50.13 ? 177 GLU A CB    1 
ATOM   1516 C  CG    . GLU C 3 122 ? -12.147 30.095 16.053  1.00 50.71 ? 177 GLU A CG    1 
ATOM   1517 C  CD    . GLU C 3 122 ? -10.778 29.480 15.775  1.00 51.44 ? 177 GLU A CD    1 
ATOM   1518 O  OE1   . GLU C 3 122 ? -10.408 28.483 16.436  1.00 51.51 ? 177 GLU A OE1   1 
ATOM   1519 O  OE2   . GLU C 3 122 ? -10.074 29.992 14.877  1.00 51.86 ? 177 GLU A OE2   1 
ATOM   1520 N  N     . LEU C 3 123 ? -15.400 28.231 17.251  1.00 49.57 ? 178 LEU A N     1 
ATOM   1521 C  CA    . LEU C 3 123 ? -16.842 28.218 16.988  1.00 49.32 ? 178 LEU A CA    1 
ATOM   1522 C  C     . LEU C 3 123 ? -17.571 27.938 18.286  1.00 49.20 ? 178 LEU A C     1 
ATOM   1523 O  O     . LEU C 3 123 ? -17.180 27.037 19.026  1.00 49.38 ? 178 LEU A O     1 
ATOM   1524 C  CB    . LEU C 3 123 ? -17.223 27.128 15.986  1.00 49.24 ? 178 LEU A CB    1 
ATOM   1525 C  CG    . LEU C 3 123 ? -16.403 26.917 14.719  1.00 49.30 ? 178 LEU A CG    1 
ATOM   1526 C  CD1   . LEU C 3 123 ? -16.587 25.491 14.235  1.00 49.25 ? 178 LEU A CD1   1 
ATOM   1527 C  CD2   . LEU C 3 123 ? -16.774 27.924 13.639  1.00 49.61 ? 178 LEU A CD2   1 
ATOM   1528 N  N     . ALA C 3 124 ? -18.629 28.699 18.561  1.00 48.94 ? 179 ALA A N     1 
ATOM   1529 C  CA    . ALA C 3 124 ? -19.479 28.433 19.720  1.00 48.71 ? 179 ALA A CA    1 
ATOM   1530 C  C     . ALA C 3 124 ? -20.057 27.018 19.614  1.00 48.54 ? 179 ALA A C     1 
ATOM   1531 O  O     . ALA C 3 124 ? -20.487 26.607 18.531  1.00 48.44 ? 179 ALA A O     1 
ATOM   1532 C  CB    . ALA C 3 124 ? -20.591 29.467 19.825  1.00 48.65 ? 179 ALA A CB    1 
ATOM   1533 N  N     . PRO C 3 125 ? -20.047 26.262 20.728  1.00 48.38 ? 180 PRO A N     1 
ATOM   1534 C  CA    . PRO C 3 125 ? -20.539 24.885 20.694  1.00 48.21 ? 180 PRO A CA    1 
ATOM   1535 C  C     . PRO C 3 125 ? -22.051 24.825 20.491  1.00 47.98 ? 180 PRO A C     1 
ATOM   1536 O  O     . PRO C 3 125 ? -22.787 25.634 21.062  1.00 47.81 ? 180 PRO A O     1 
ATOM   1537 C  CB    . PRO C 3 125 ? -20.161 24.337 22.079  1.00 48.27 ? 180 PRO A CB    1 
ATOM   1538 C  CG    . PRO C 3 125 ? -19.180 25.323 22.648  1.00 48.39 ? 180 PRO A CG    1 
ATOM   1539 C  CD    . PRO C 3 125 ? -19.578 26.636 22.072  1.00 48.38 ? 180 PRO A CD    1 
ATOM   1540 N  N     . GLY C 3 126 ? -22.495 23.878 19.667  1.00 47.83 ? 181 GLY A N     1 
ATOM   1541 C  CA    . GLY C 3 126 ? -23.916 23.688 19.377  1.00 47.55 ? 181 GLY A CA    1 
ATOM   1542 C  C     . GLY C 3 126 ? -24.405 24.493 18.186  1.00 47.37 ? 181 GLY A C     1 
ATOM   1543 O  O     . GLY C 3 126 ? -25.134 23.975 17.335  1.00 47.43 ? 181 GLY A O     1 
ATOM   1544 N  N     . SER C 3 127 ? -23.989 25.758 18.124  1.00 47.06 ? 182 SER A N     1 
ATOM   1545 C  CA    . SER C 3 127 ? -24.505 26.719 17.151  1.00 46.68 ? 182 SER A CA    1 
ATOM   1546 C  C     . SER C 3 127 ? -24.194 26.330 15.704  1.00 46.34 ? 182 SER A C     1 
ATOM   1547 O  O     . SER C 3 127 ? -23.107 25.837 15.410  1.00 46.28 ? 182 SER A O     1 
ATOM   1548 C  CB    . SER C 3 127 ? -23.980 28.123 17.457  1.00 46.76 ? 182 SER A CB    1 
ATOM   1549 O  OG    . SER C 3 127 ? -22.566 28.148 17.423  1.00 47.08 ? 182 SER A OG    1 
ATOM   1550 N  N     . PRO C 3 128 ? -25.165 26.544 14.799  1.00 45.99 ? 183 PRO A N     1 
ATOM   1551 C  CA    . PRO C 3 128 ? -25.051 26.132 13.401  1.00 45.65 ? 183 PRO A CA    1 
ATOM   1552 C  C     . PRO C 3 128 ? -24.133 26.983 12.512  1.00 45.44 ? 183 PRO A C     1 
ATOM   1553 O  O     . PRO C 3 128 ? -23.692 28.068 12.907  1.00 45.35 ? 183 PRO A O     1 
ATOM   1554 C  CB    . PRO C 3 128 ? -26.494 26.226 12.901  1.00 45.59 ? 183 PRO A CB    1 
ATOM   1555 C  CG    . PRO C 3 128 ? -27.102 27.300 13.732  1.00 45.76 ? 183 PRO A CG    1 
ATOM   1556 C  CD    . PRO C 3 128 ? -26.471 27.172 15.084  1.00 45.87 ? 183 PRO A CD    1 
ATOM   1557 N  N     . ILE C 3 129 ? -23.861 26.448 11.321  1.00 45.12 ? 184 ILE A N     1 
ATOM   1558 C  CA    . ILE C 3 129 ? -23.182 27.128 10.227  1.00 44.99 ? 184 ILE A CA    1 
ATOM   1559 C  C     . ILE C 3 129 ? -24.216 27.348 9.124   1.00 44.91 ? 184 ILE A C     1 
ATOM   1560 O  O     . ILE C 3 129 ? -24.987 26.438 8.789   1.00 45.00 ? 184 ILE A O     1 
ATOM   1561 C  CB    . ILE C 3 129 ? -22.067 26.232 9.633   1.00 45.13 ? 184 ILE A CB    1 
ATOM   1562 C  CG1   . ILE C 3 129 ? -21.133 25.695 10.730  1.00 45.51 ? 184 ILE A CG1   1 
ATOM   1563 C  CG2   . ILE C 3 129 ? -21.314 26.945 8.498   1.00 44.97 ? 184 ILE A CG2   1 
ATOM   1564 C  CD1   . ILE C 3 129 ? -19.944 26.585 11.062  1.00 46.15 ? 184 ILE A CD1   1 
ATOM   1565 N  N     . ALA C 3 130 ? -24.224 28.550 8.552   1.00 44.61 ? 185 ALA A N     1 
ATOM   1566 C  CA    . ALA C 3 130 ? -25.177 28.904 7.504   1.00 44.03 ? 185 ALA A CA    1 
ATOM   1567 C  C     . ALA C 3 130 ? -24.460 29.062 6.167   1.00 43.76 ? 185 ALA A C     1 
ATOM   1568 O  O     . ALA C 3 130 ? -23.667 29.989 5.982   1.00 43.69 ? 185 ALA A O     1 
ATOM   1569 C  CB    . ALA C 3 130 ? -25.922 30.178 7.880   1.00 43.92 ? 185 ALA A CB    1 
ATOM   1570 N  N     . SER C 3 131 ? -24.733 28.146 5.242   1.00 43.47 ? 186 SER A N     1 
ATOM   1571 C  CA    . SER C 3 131 ? -24.040 28.138 3.955   1.00 43.08 ? 186 SER A CA    1 
ATOM   1572 C  C     . SER C 3 131 ? -24.940 28.627 2.839   1.00 43.00 ? 186 SER A C     1 
ATOM   1573 O  O     . SER C 3 131 ? -25.894 27.952 2.443   1.00 43.22 ? 186 SER A O     1 
ATOM   1574 C  CB    . SER C 3 131 ? -23.485 26.760 3.623   1.00 42.85 ? 186 SER A CB    1 
ATOM   1575 O  OG    . SER C 3 131 ? -22.922 26.774 2.324   1.00 42.60 ? 186 SER A OG    1 
ATOM   1576 N  N     . VAL C 3 132 ? -24.622 29.812 2.340   1.00 42.79 ? 187 VAL A N     1 
ATOM   1577 C  CA    . VAL C 3 132 ? -25.428 30.468 1.331   1.00 42.61 ? 187 VAL A CA    1 
ATOM   1578 C  C     . VAL C 3 132 ? -24.597 30.496 0.066   1.00 42.62 ? 187 VAL A C     1 
ATOM   1579 O  O     . VAL C 3 132 ? -23.406 30.797 0.116   1.00 42.78 ? 187 VAL A O     1 
ATOM   1580 C  CB    . VAL C 3 132 ? -25.808 31.910 1.768   1.00 42.70 ? 187 VAL A CB    1 
ATOM   1581 C  CG1   . VAL C 3 132 ? -26.853 32.507 0.828   1.00 42.55 ? 187 VAL A CG1   1 
ATOM   1582 C  CG2   . VAL C 3 132 ? -26.333 31.913 3.199   1.00 42.03 ? 187 VAL A CG2   1 
ATOM   1583 N  N     . SER C 3 133 ? -25.223 30.169 -1.059  1.00 42.71 ? 188 SER A N     1 
ATOM   1584 C  CA    . SER C 3 133 ? -24.509 29.989 -2.317  1.00 42.88 ? 188 SER A CA    1 
ATOM   1585 C  C     . SER C 3 133 ? -25.090 30.820 -3.448  1.00 42.98 ? 188 SER A C     1 
ATOM   1586 O  O     . SER C 3 133 ? -26.311 30.975 -3.548  1.00 43.03 ? 188 SER A O     1 
ATOM   1587 C  CB    . SER C 3 133 ? -24.500 28.515 -2.700  1.00 42.77 ? 188 SER A CB    1 
ATOM   1588 O  OG    . SER C 3 133 ? -23.835 27.770 -1.697  1.00 43.89 ? 188 SER A OG    1 
ATOM   1589 N  N     . PHE C 3 134 ? -24.202 31.351 -4.291  1.00 43.02 ? 189 PHE A N     1 
ATOM   1590 C  CA    . PHE C 3 134 ? -24.592 32.124 -5.475  1.00 43.20 ? 189 PHE A CA    1 
ATOM   1591 C  C     . PHE C 3 134 ? -23.776 31.743 -6.704  1.00 43.28 ? 189 PHE A C     1 
ATOM   1592 O  O     . PHE C 3 134 ? -22.650 31.253 -6.589  1.00 43.11 ? 189 PHE A O     1 
ATOM   1593 C  CB    . PHE C 3 134 ? -24.450 33.623 -5.216  1.00 43.16 ? 189 PHE A CB    1 
ATOM   1594 C  CG    . PHE C 3 134 ? -25.291 34.119 -4.088  1.00 43.23 ? 189 PHE A CG    1 
ATOM   1595 C  CD1   . PHE C 3 134 ? -26.582 34.593 -4.323  1.00 44.18 ? 189 PHE A CD1   1 
ATOM   1596 C  CD2   . PHE C 3 134 ? -24.800 34.114 -2.790  1.00 42.90 ? 189 PHE A CD2   1 
ATOM   1597 C  CE1   . PHE C 3 134 ? -27.382 35.055 -3.270  1.00 44.18 ? 189 PHE A CE1   1 
ATOM   1598 C  CE2   . PHE C 3 134 ? -25.577 34.570 -1.737  1.00 44.24 ? 189 PHE A CE2   1 
ATOM   1599 C  CZ    . PHE C 3 134 ? -26.880 35.044 -1.972  1.00 43.91 ? 189 PHE A CZ    1 
ATOM   1600 N  N     . GLY C 3 135 ? -24.352 31.982 -7.877  1.00 43.43 ? 190 GLY A N     1 
ATOM   1601 C  CA    . GLY C 3 135 ? -23.693 31.671 -9.135  1.00 43.68 ? 190 GLY A CA    1 
ATOM   1602 C  C     . GLY C 3 135 ? -23.950 30.247 -9.574  1.00 43.93 ? 190 GLY A C     1 
ATOM   1603 O  O     . GLY C 3 135 ? -25.049 29.713 -9.400  1.00 44.04 ? 190 GLY A O     1 
ATOM   1604 N  N     . ALA C 3 136 ? -22.927 29.634 -10.147 1.00 44.15 ? 191 ALA A N     1 
ATOM   1605 C  CA    . ALA C 3 136 ? -23.026 28.269 -10.638 1.00 44.59 ? 191 ALA A CA    1 
ATOM   1606 C  C     . ALA C 3 136 ? -23.411 27.285 -9.529  1.00 44.88 ? 191 ALA A C     1 
ATOM   1607 O  O     . ALA C 3 136 ? -22.927 27.369 -8.392  1.00 45.30 ? 191 ALA A O     1 
ATOM   1608 C  CB    . ALA C 3 136 ? -21.712 27.851 -11.302 1.00 44.37 ? 191 ALA A CB    1 
ATOM   1609 N  N     . SER C 3 137 ? -24.302 26.366 -9.871  1.00 44.91 ? 192 SER A N     1 
ATOM   1610 C  CA    . SER C 3 137 ? -24.668 25.281 -8.987  1.00 45.25 ? 192 SER A CA    1 
ATOM   1611 C  C     . SER C 3 137 ? -23.459 24.359 -8.863  1.00 45.28 ? 192 SER A C     1 
ATOM   1612 O  O     . SER C 3 137 ? -22.799 24.063 -9.862  1.00 45.84 ? 192 SER A O     1 
ATOM   1613 C  CB    . SER C 3 137 ? -25.861 24.525 -9.586  1.00 45.36 ? 192 SER A CB    1 
ATOM   1614 O  OG    . SER C 3 137 ? -26.509 23.706 -8.631  1.00 45.70 ? 192 SER A OG    1 
ATOM   1615 N  N     . ARG C 3 138 ? -23.144 23.922 -7.650  1.00 45.07 ? 193 ARG A N     1 
ATOM   1616 C  CA    . ARG C 3 138 ? -22.056 22.950 -7.466  1.00 44.76 ? 193 ARG A CA    1 
ATOM   1617 C  C     . ARG C 3 138 ? -22.450 21.854 -6.492  1.00 44.56 ? 193 ARG A C     1 
ATOM   1618 O  O     . ARG C 3 138 ? -23.236 22.076 -5.572  1.00 44.42 ? 193 ARG A O     1 
ATOM   1619 C  CB    . ARG C 3 138 ? -20.761 23.629 -6.993  1.00 44.68 ? 193 ARG A CB    1 
ATOM   1620 C  CG    . ARG C 3 138 ? -20.022 24.454 -8.054  1.00 44.98 ? 193 ARG A CG    1 
ATOM   1621 C  CD    . ARG C 3 138 ? -19.229 23.604 -9.045  1.00 44.86 ? 193 ARG A CD    1 
ATOM   1622 N  NE    . ARG C 3 138 ? -18.127 22.866 -8.429  1.00 45.16 ? 193 ARG A NE    1 
ATOM   1623 C  CZ    . ARG C 3 138 ? -16.919 23.372 -8.196  1.00 45.67 ? 193 ARG A CZ    1 
ATOM   1624 N  NH1   . ARG C 3 138 ? -16.652 24.631 -8.515  1.00 46.74 ? 193 ARG A NH1   1 
ATOM   1625 N  NH2   . ARG C 3 138 ? -15.974 22.623 -7.641  1.00 44.66 ? 193 ARG A NH2   1 
ATOM   1626 N  N     . ASP C 3 139 ? -21.895 20.668 -6.698  1.00 44.68 ? 194 ASP A N     1 
ATOM   1627 C  CA    . ASP C 3 139 ? -22.168 19.544 -5.820  1.00 44.91 ? 194 ASP A CA    1 
ATOM   1628 C  C     . ASP C 3 139 ? -21.440 19.666 -4.494  1.00 44.71 ? 194 ASP A C     1 
ATOM   1629 O  O     . ASP C 3 139 ? -20.255 19.998 -4.441  1.00 44.74 ? 194 ASP A O     1 
ATOM   1630 C  CB    . ASP C 3 139 ? -21.806 18.226 -6.497  1.00 45.14 ? 194 ASP A CB    1 
ATOM   1631 C  CG    . ASP C 3 139 ? -22.709 17.912 -7.660  1.00 46.30 ? 194 ASP A CG    1 
ATOM   1632 O  OD1   . ASP C 3 139 ? -23.946 17.904 -7.469  1.00 48.08 ? 194 ASP A OD1   1 
ATOM   1633 O  OD2   . ASP C 3 139 ? -22.182 17.667 -8.765  1.00 47.99 ? 194 ASP A OD2   1 
ATOM   1634 N  N     . PHE C 3 140 ? -22.184 19.399 -3.429  1.00 44.57 ? 195 PHE A N     1 
ATOM   1635 C  CA    . PHE C 3 140 ? -21.662 19.364 -2.080  1.00 44.29 ? 195 PHE A CA    1 
ATOM   1636 C  C     . PHE C 3 140 ? -21.762 17.923 -1.586  1.00 44.43 ? 195 PHE A C     1 
ATOM   1637 O  O     . PHE C 3 140 ? -22.810 17.284 -1.733  1.00 44.61 ? 195 PHE A O     1 
ATOM   1638 C  CB    . PHE C 3 140 ? -22.495 20.283 -1.198  1.00 43.99 ? 195 PHE A CB    1 
ATOM   1639 C  CG    . PHE C 3 140 ? -21.845 20.624 0.103   1.00 43.34 ? 195 PHE A CG    1 
ATOM   1640 C  CD1   . PHE C 3 140 ? -20.739 21.454 0.141   1.00 42.14 ? 195 PHE A CD1   1 
ATOM   1641 C  CD2   . PHE C 3 140 ? -22.348 20.121 1.293   1.00 43.17 ? 195 PHE A CD2   1 
ATOM   1642 C  CE1   . PHE C 3 140 ? -20.137 21.779 1.343   1.00 42.67 ? 195 PHE A CE1   1 
ATOM   1643 C  CE2   . PHE C 3 140 ? -21.751 20.442 2.501   1.00 43.26 ? 195 PHE A CE2   1 
ATOM   1644 C  CZ    . PHE C 3 140 ? -20.642 21.277 2.523   1.00 42.96 ? 195 PHE A CZ    1 
ATOM   1645 N  N     . VAL C 3 141 ? -20.681 17.404 -1.018  1.00 44.35 ? 196 VAL A N     1 
ATOM   1646 C  CA    . VAL C 3 141 ? -20.654 15.994 -0.654  1.00 44.93 ? 196 VAL A CA    1 
ATOM   1647 C  C     . VAL C 3 141 ? -20.370 15.769 0.826   1.00 45.30 ? 196 VAL A C     1 
ATOM   1648 O  O     . VAL C 3 141 ? -19.365 16.231 1.349   1.00 45.37 ? 196 VAL A O     1 
ATOM   1649 C  CB    . VAL C 3 141 ? -19.651 15.183 -1.532  1.00 44.93 ? 196 VAL A CB    1 
ATOM   1650 C  CG1   . VAL C 3 141 ? -19.660 13.719 -1.144  1.00 44.46 ? 196 VAL A CG1   1 
ATOM   1651 C  CG2   . VAL C 3 141 ? -19.982 15.323 -3.013  1.00 44.50 ? 196 VAL A CG2   1 
ATOM   1652 N  N     . PHE C 3 142 ? -21.281 15.052 1.475   1.00 46.02 ? 197 PHE A N     1 
ATOM   1653 C  CA    . PHE C 3 142 ? -21.135 14.622 2.856   1.00 46.97 ? 197 PHE A CA    1 
ATOM   1654 C  C     . PHE C 3 142 ? -20.670 13.167 2.915   1.00 47.75 ? 197 PHE A C     1 
ATOM   1655 O  O     . PHE C 3 142 ? -21.312 12.279 2.350   1.00 47.62 ? 197 PHE A O     1 
ATOM   1656 C  CB    . PHE C 3 142 ? -22.478 14.714 3.579   1.00 46.92 ? 197 PHE A CB    1 
ATOM   1657 C  CG    . PHE C 3 142 ? -22.843 16.094 4.032   1.00 46.86 ? 197 PHE A CG    1 
ATOM   1658 C  CD1   . PHE C 3 142 ? -22.192 16.685 5.108   1.00 46.76 ? 197 PHE A CD1   1 
ATOM   1659 C  CD2   . PHE C 3 142 ? -23.873 16.788 3.412   1.00 46.92 ? 197 PHE A CD2   1 
ATOM   1660 C  CE1   . PHE C 3 142 ? -22.544 17.953 5.545   1.00 46.91 ? 197 PHE A CE1   1 
ATOM   1661 C  CE2   . PHE C 3 142 ? -24.232 18.061 3.841   1.00 47.01 ? 197 PHE A CE2   1 
ATOM   1662 C  CZ    . PHE C 3 142 ? -23.565 18.643 4.909   1.00 47.11 ? 197 PHE A CZ    1 
ATOM   1663 N  N     . ARG C 3 143 ? -19.565 12.930 3.615   1.00 48.83 ? 198 ARG A N     1 
ATOM   1664 C  CA    . ARG C 3 143 ? -19.023 11.585 3.784   1.00 50.16 ? 198 ARG A CA    1 
ATOM   1665 C  C     . ARG C 3 143 ? -18.827 11.298 5.269   1.00 50.47 ? 198 ARG A C     1 
ATOM   1666 O  O     . ARG C 3 143 ? -18.281 12.131 5.998   1.00 50.59 ? 198 ARG A O     1 
ATOM   1667 C  CB    . ARG C 3 143 ? -17.698 11.452 3.033   1.00 50.02 ? 198 ARG A CB    1 
ATOM   1668 C  CG    . ARG C 3 143 ? -17.107 10.049 3.022   1.00 51.08 ? 198 ARG A CG    1 
ATOM   1669 C  CD    . ARG C 3 143 ? -15.742 10.025 2.346   1.00 51.47 ? 198 ARG A CD    1 
ATOM   1670 N  NE    . ARG C 3 143 ? -15.799 10.508 0.967   1.00 55.30 ? 198 ARG A NE    1 
ATOM   1671 C  CZ    . ARG C 3 143 ? -14.962 10.138 -0.001  1.00 56.69 ? 198 ARG A CZ    1 
ATOM   1672 N  NH1   . ARG C 3 143 ? -13.985 9.267  0.242   1.00 56.99 ? 198 ARG A NH1   1 
ATOM   1673 N  NH2   . ARG C 3 143 ? -15.109 10.639 -1.222  1.00 57.61 ? 198 ARG A NH2   1 
ATOM   1674 N  N     . HIS C 3 144 ? -19.286 10.131 5.716   1.00 51.16 ? 199 HIS A N     1 
ATOM   1675 C  CA    . HIS C 3 144 ? -19.161 9.756  7.122   1.00 51.91 ? 199 HIS A CA    1 
ATOM   1676 C  C     . HIS C 3 144 ? -17.710 9.432  7.479   1.00 52.55 ? 199 HIS A C     1 
ATOM   1677 O  O     . HIS C 3 144 ? -16.987 8.834  6.675   1.00 52.68 ? 199 HIS A O     1 
ATOM   1678 C  CB    . HIS C 3 144 ? -20.070 8.579  7.468   1.00 51.73 ? 199 HIS A CB    1 
ATOM   1679 C  CG    . HIS C 3 144 ? -20.144 8.302  8.935   1.00 51.63 ? 199 HIS A CG    1 
ATOM   1680 N  ND1   . HIS C 3 144 ? -19.265 7.457  9.578   1.00 51.49 ? 199 HIS A ND1   1 
ATOM   1681 C  CD2   . HIS C 3 144 ? -20.972 8.784  9.892   1.00 51.46 ? 199 HIS A CD2   1 
ATOM   1682 C  CE1   . HIS C 3 144 ? -19.559 7.418  10.865  1.00 51.59 ? 199 HIS A CE1   1 
ATOM   1683 N  NE2   . HIS C 3 144 ? -20.590 8.214  11.081  1.00 51.66 ? 199 HIS A NE2   1 
ATOM   1684 N  N     . LYS C 3 145 ? -17.294 9.819  8.686   1.00 53.24 ? 200 LYS A N     1 
ATOM   1685 C  CA    . LYS C 3 145 ? -15.882 9.718  9.079   1.00 53.90 ? 200 LYS A CA    1 
ATOM   1686 C  C     . LYS C 3 145 ? -15.319 8.288  9.091   1.00 54.23 ? 200 LYS A C     1 
ATOM   1687 O  O     . LYS C 3 145 ? -14.179 8.066  8.675   1.00 54.29 ? 200 LYS A O     1 
ATOM   1688 C  CB    . LYS C 3 145 ? -15.596 10.466 10.400  1.00 53.94 ? 200 LYS A CB    1 
ATOM   1689 C  CG    . LYS C 3 145 ? -16.026 9.787  11.702  1.00 54.09 ? 200 LYS A CG    1 
ATOM   1690 C  CD    . LYS C 3 145 ? -15.303 10.432 12.888  1.00 53.98 ? 200 LYS A CD    1 
ATOM   1691 C  CE    . LYS C 3 145 ? -15.418 9.598  14.156  1.00 54.16 ? 200 LYS A CE    1 
ATOM   1692 N  NZ    . LYS C 3 145 ? -16.776 9.682  14.756  1.00 54.26 ? 200 LYS A NZ    1 
ATOM   1693 N  N     . ASP C 3 146 ? -16.122 7.328  9.541   1.00 54.71 ? 201 ASP A N     1 
ATOM   1694 C  CA    . ASP C 3 146 ? -15.673 5.939  9.641   1.00 55.28 ? 201 ASP A CA    1 
ATOM   1695 C  C     . ASP C 3 146 ? -16.001 5.113  8.394   1.00 55.73 ? 201 ASP A C     1 
ATOM   1696 O  O     . ASP C 3 146 ? -15.957 3.881  8.434   1.00 55.83 ? 201 ASP A O     1 
ATOM   1697 C  CB    . ASP C 3 146 ? -16.262 5.267  10.886  1.00 55.17 ? 201 ASP A CB    1 
ATOM   1698 C  CG    . ASP C 3 146 ? -15.919 6.000  12.165  1.00 55.07 ? 201 ASP A CG    1 
ATOM   1699 O  OD1   . ASP C 3 146 ? -14.723 6.289  12.391  1.00 54.92 ? 201 ASP A OD1   1 
ATOM   1700 O  OD2   . ASP C 3 146 ? -16.850 6.281  12.949  1.00 54.94 ? 201 ASP A OD2   1 
ATOM   1701 N  N     . SER C 3 147 ? -16.318 5.791  7.292   1.00 56.32 ? 202 SER A N     1 
ATOM   1702 C  CA    . SER C 3 147 ? -16.641 5.107  6.035   1.00 56.82 ? 202 SER A CA    1 
ATOM   1703 C  C     . SER C 3 147 ? -15.406 4.833  5.159   1.00 57.19 ? 202 SER A C     1 
ATOM   1704 O  O     . SER C 3 147 ? -15.424 3.939  4.305   1.00 57.41 ? 202 SER A O     1 
ATOM   1705 C  CB    . SER C 3 147 ? -17.730 5.865  5.251   1.00 56.85 ? 202 SER A CB    1 
ATOM   1706 O  OG    . SER C 3 147 ? -17.327 7.181  4.901   1.00 56.57 ? 202 SER A OG    1 
ATOM   1707 N  N     . ARG C 3 148 ? -14.331 5.579  5.410   1.00 57.49 ? 203 ARG A N     1 
ATOM   1708 C  CA    . ARG C 3 148 ? -13.164 5.620  4.526   1.00 57.77 ? 203 ARG A CA    1 
ATOM   1709 C  C     . ARG C 3 148 ? -12.015 4.720  4.977   1.00 57.76 ? 203 ARG A C     1 
ATOM   1710 O  O     . ARG C 3 148 ? -12.020 4.188  6.089   1.00 57.83 ? 203 ARG A O     1 
ATOM   1711 C  CB    . ARG C 3 148 ? -12.672 7.059  4.414   1.00 57.91 ? 203 ARG A CB    1 
ATOM   1712 C  CG    . ARG C 3 148 ? -13.791 8.081  4.565   1.00 58.80 ? 203 ARG A CG    1 
ATOM   1713 C  CD    . ARG C 3 148 ? -13.265 9.483  4.806   1.00 60.35 ? 203 ARG A CD    1 
ATOM   1714 N  NE    . ARG C 3 148 ? -12.539 9.606  6.068   1.00 61.47 ? 203 ARG A NE    1 
ATOM   1715 C  CZ    . ARG C 3 148 ? -12.112 10.760 6.577   1.00 62.36 ? 203 ARG A CZ    1 
ATOM   1716 N  NH1   . ARG C 3 148 ? -12.345 11.905 5.939   1.00 62.19 ? 203 ARG A NH1   1 
ATOM   1717 N  NH2   . ARG C 3 148 ? -11.455 10.771 7.732   1.00 62.47 ? 203 ARG A NH2   1 
ATOM   1718 N  N     . PRO C 3 152 ? -11.361 0.618  5.992   1.00 55.01 ? 207 PRO A N     1 
ATOM   1719 C  CA    . PRO C 3 152 ? -12.647 1.281  6.198   1.00 54.97 ? 207 PRO A CA    1 
ATOM   1720 C  C     . PRO C 3 152 ? -13.541 0.503  7.165   1.00 54.82 ? 207 PRO A C     1 
ATOM   1721 O  O     . PRO C 3 152 ? -13.828 -0.676 6.938   1.00 54.81 ? 207 PRO A O     1 
ATOM   1722 C  CB    . PRO C 3 152 ? -13.245 1.317  4.790   1.00 55.02 ? 207 PRO A CB    1 
ATOM   1723 C  CG    . PRO C 3 152 ? -12.048 1.434  3.894   1.00 55.08 ? 207 PRO A CG    1 
ATOM   1724 C  CD    . PRO C 3 152 ? -10.897 0.733  4.597   1.00 55.06 ? 207 PRO A CD    1 
ATOM   1725 N  N     . SER C 3 153 ? -13.975 1.176  8.231   1.00 54.64 ? 208 SER A N     1 
ATOM   1726 C  CA    . SER C 3 153 ? -14.656 0.520  9.351   1.00 54.35 ? 208 SER A CA    1 
ATOM   1727 C  C     . SER C 3 153 ? -16.178 0.406  9.187   1.00 54.15 ? 208 SER A C     1 
ATOM   1728 O  O     . SER C 3 153 ? -16.784 -0.568 9.650   1.00 54.10 ? 208 SER A O     1 
ATOM   1729 C  CB    . SER C 3 153 ? -14.313 1.235  10.666  1.00 54.36 ? 208 SER A CB    1 
ATOM   1730 O  OG    . SER C 3 153 ? -14.694 0.464  11.791  1.00 54.25 ? 208 SER A OG    1 
ATOM   1731 N  N     . ARG C 3 154 ? -16.789 1.392  8.528   1.00 53.80 ? 209 ARG A N     1 
ATOM   1732 C  CA    . ARG C 3 154 ? -18.253 1.485  8.457   1.00 53.45 ? 209 ARG A CA    1 
ATOM   1733 C  C     . ARG C 3 154 ? -18.776 1.806  7.046   1.00 53.06 ? 209 ARG A C     1 
ATOM   1734 O  O     . ARG C 3 154 ? -18.441 2.842  6.464   1.00 53.02 ? 209 ARG A O     1 
ATOM   1735 C  CB    . ARG C 3 154 ? -18.766 2.496  9.496   1.00 53.55 ? 209 ARG A CB    1 
ATOM   1736 C  CG    . ARG C 3 154 ? -18.416 2.121  10.949  1.00 53.63 ? 209 ARG A CG    1 
ATOM   1737 C  CD    . ARG C 3 154 ? -18.745 3.228  11.947  1.00 53.54 ? 209 ARG A CD    1 
ATOM   1738 N  NE    . ARG C 3 154 ? -20.111 3.715  11.789  1.00 53.52 ? 209 ARG A NE    1 
ATOM   1739 C  CZ    . ARG C 3 154 ? -21.191 3.080  12.233  1.00 53.65 ? 209 ARG A CZ    1 
ATOM   1740 N  NH1   . ARG C 3 154 ? -21.083 1.921  12.877  1.00 53.74 ? 209 ARG A NH1   1 
ATOM   1741 N  NH2   . ARG C 3 154 ? -22.388 3.605  12.029  1.00 53.65 ? 209 ARG A NH2   1 
ATOM   1742 N  N     . ARG C 3 155 ? -19.618 0.911  6.525   1.00 52.53 ? 210 ARG A N     1 
ATOM   1743 C  CA    . ARG C 3 155 ? -20.078 0.935  5.124   1.00 51.92 ? 210 ARG A CA    1 
ATOM   1744 C  C     . ARG C 3 155 ? -21.098 2.046  4.788   1.00 51.57 ? 210 ARG A C     1 
ATOM   1745 O  O     . ARG C 3 155 ? -21.716 2.028  3.719   1.00 51.49 ? 210 ARG A O     1 
ATOM   1746 C  CB    . ARG C 3 155 ? -20.640 -0.443 4.727   1.00 51.89 ? 210 ARG A CB    1 
ATOM   1747 C  CG    . ARG C 3 155 ? -19.649 -1.612 4.806   1.00 51.61 ? 210 ARG A CG    1 
ATOM   1748 C  CD    . ARG C 3 155 ? -19.607 -2.238 6.198   1.00 51.51 ? 210 ARG A CD    1 
ATOM   1749 N  NE    . ARG C 3 155 ? -18.655 -3.347 6.280   1.00 51.64 ? 210 ARG A NE    1 
ATOM   1750 C  CZ    . ARG C 3 155 ? -18.986 -4.637 6.232   1.00 51.99 ? 210 ARG A CZ    1 
ATOM   1751 N  NH1   . ARG C 3 155 ? -20.257 -5.005 6.106   1.00 51.95 ? 210 ARG A NH1   1 
ATOM   1752 N  NH2   . ARG C 3 155 ? -18.044 -5.569 6.314   1.00 52.09 ? 210 ARG A NH2   1 
ATOM   1753 N  N     . VAL C 3 156 ? -21.252 3.008  5.697   1.00 51.10 ? 211 VAL A N     1 
ATOM   1754 C  CA    . VAL C 3 156 ? -22.214 4.108  5.555   1.00 50.65 ? 211 VAL A CA    1 
ATOM   1755 C  C     . VAL C 3 156 ? -22.029 4.876  4.236   1.00 50.19 ? 211 VAL A C     1 
ATOM   1756 O  O     . VAL C 3 156 ? -20.905 5.210  3.851   1.00 50.13 ? 211 VAL A O     1 
ATOM   1757 C  CB    . VAL C 3 156 ? -22.149 5.083  6.772   1.00 50.75 ? 211 VAL A CB    1 
ATOM   1758 C  CG1   . VAL C 3 156 ? -23.240 6.154  6.687   1.00 50.68 ? 211 VAL A CG1   1 
ATOM   1759 C  CG2   . VAL C 3 156 ? -22.273 4.306  8.086   1.00 50.76 ? 211 VAL A CG2   1 
ATOM   1760 N  N     . ALA C 3 157 ? -23.146 5.136  3.557   1.00 49.48 ? 212 ALA A N     1 
ATOM   1761 C  CA    . ALA C 3 157 ? -23.137 5.765  2.244   1.00 48.81 ? 212 ALA A CA    1 
ATOM   1762 C  C     . ALA C 3 157 ? -22.849 7.266  2.296   1.00 48.43 ? 212 ALA A C     1 
ATOM   1763 O  O     . ALA C 3 157 ? -22.863 7.892  3.359   1.00 48.49 ? 212 ALA A O     1 
ATOM   1764 C  CB    . ALA C 3 157 ? -24.452 5.492  1.516   1.00 48.74 ? 212 ALA A CB    1 
ATOM   1765 N  N     . VAL C 3 158 ? -22.575 7.822  1.124   1.00 47.79 ? 213 VAL A N     1 
ATOM   1766 C  CA    . VAL C 3 158 ? -22.314 9.238  0.956   1.00 47.15 ? 213 VAL A CA    1 
ATOM   1767 C  C     . VAL C 3 158 ? -23.627 9.960  0.667   1.00 46.80 ? 213 VAL A C     1 
ATOM   1768 O  O     . VAL C 3 158 ? -24.551 9.378  0.099   1.00 46.90 ? 213 VAL A O     1 
ATOM   1769 C  CB    . VAL C 3 158 ? -21.288 9.442  -0.185  1.00 47.08 ? 213 VAL A CB    1 
ATOM   1770 C  CG1   . VAL C 3 158 ? -21.482 10.759 -0.903  1.00 46.76 ? 213 VAL A CG1   1 
ATOM   1771 C  CG2   . VAL C 3 158 ? -19.869 9.308  0.355   1.00 47.41 ? 213 VAL A CG2   1 
ATOM   1772 N  N     . VAL C 3 159 ? -23.708 11.217 1.084   1.00 46.39 ? 214 VAL A N     1 
ATOM   1773 C  CA    . VAL C 3 159 ? -24.846 12.074 0.772   1.00 46.03 ? 214 VAL A CA    1 
ATOM   1774 C  C     . VAL C 3 159 ? -24.344 13.245 -0.055  1.00 46.08 ? 214 VAL A C     1 
ATOM   1775 O  O     . VAL C 3 159 ? -23.419 13.954 0.352   1.00 46.02 ? 214 VAL A O     1 
ATOM   1776 C  CB    . VAL C 3 159 ? -25.530 12.601 2.050   1.00 45.99 ? 214 VAL A CB    1 
ATOM   1777 C  CG1   . VAL C 3 159 ? -26.653 13.569 1.704   1.00 45.84 ? 214 VAL A CG1   1 
ATOM   1778 C  CG2   . VAL C 3 159 ? -26.054 11.446 2.895   1.00 45.70 ? 214 VAL A CG2   1 
ATOM   1779 N  N     . ARG C 3 160 ? -24.950 13.440 -1.222  1.00 46.06 ? 215 ARG A N     1 
ATOM   1780 C  CA    . ARG C 3 160 ? -24.544 14.514 -2.126  1.00 46.20 ? 215 ARG A CA    1 
ATOM   1781 C  C     . ARG C 3 160 ? -25.728 15.297 -2.678  1.00 45.72 ? 215 ARG A C     1 
ATOM   1782 O  O     . ARG C 3 160 ? -26.738 14.719 -3.073  1.00 45.70 ? 215 ARG A O     1 
ATOM   1783 C  CB    . ARG C 3 160 ? -23.679 13.972 -3.272  1.00 46.27 ? 215 ARG A CB    1 
ATOM   1784 C  CG    . ARG C 3 160 ? -24.261 12.773 -4.014  1.00 46.70 ? 215 ARG A CG    1 
ATOM   1785 C  CD    . ARG C 3 160 ? -23.385 12.371 -5.192  1.00 47.03 ? 215 ARG A CD    1 
ATOM   1786 N  NE    . ARG C 3 160 ? -22.129 11.756 -4.764  1.00 48.22 ? 215 ARG A NE    1 
ATOM   1787 C  CZ    . ARG C 3 160 ? -21.936 10.443 -4.659  1.00 49.34 ? 215 ARG A CZ    1 
ATOM   1788 N  NH1   . ARG C 3 160 ? -22.918 9.596  -4.946  1.00 49.61 ? 215 ARG A NH1   1 
ATOM   1789 N  NH2   . ARG C 3 160 ? -20.760 9.974  -4.263  1.00 49.77 ? 215 ARG A NH2   1 
ATOM   1790 N  N     . LEU C 3 161 ? -25.598 16.616 -2.706  1.00 45.26 ? 216 LEU A N     1 
ATOM   1791 C  CA    . LEU C 3 161 ? -26.653 17.450 -3.247  1.00 44.97 ? 216 LEU A CA    1 
ATOM   1792 C  C     . LEU C 3 161 ? -26.091 18.665 -3.966  1.00 44.67 ? 216 LEU A C     1 
ATOM   1793 O  O     . LEU C 3 161 ? -25.034 19.172 -3.592  1.00 44.44 ? 216 LEU A O     1 
ATOM   1794 C  CB    . LEU C 3 161 ? -27.624 17.881 -2.142  1.00 45.12 ? 216 LEU A CB    1 
ATOM   1795 C  CG    . LEU C 3 161 ? -27.229 18.999 -1.179  1.00 45.20 ? 216 LEU A CG    1 
ATOM   1796 C  CD1   . LEU C 3 161 ? -28.498 19.575 -0.580  1.00 46.23 ? 216 LEU A CD1   1 
ATOM   1797 C  CD2   . LEU C 3 161 ? -26.268 18.526 -0.090  1.00 44.58 ? 216 LEU A CD2   1 
ATOM   1798 N  N     . PRO C 3 162 ? -26.796 19.130 -5.015  1.00 44.56 ? 217 PRO A N     1 
ATOM   1799 C  CA    . PRO C 3 162 ? -26.390 20.379 -5.650  1.00 44.23 ? 217 PRO A CA    1 
ATOM   1800 C  C     . PRO C 3 162 ? -26.717 21.508 -4.702  1.00 43.98 ? 217 PRO A C     1 
ATOM   1801 O  O     . PRO C 3 162 ? -27.767 21.471 -4.065  1.00 43.99 ? 217 PRO A O     1 
ATOM   1802 C  CB    . PRO C 3 162 ? -27.303 20.470 -6.880  1.00 44.18 ? 217 PRO A CB    1 
ATOM   1803 C  CG    . PRO C 3 162 ? -27.952 19.126 -7.015  1.00 44.16 ? 217 PRO A CG    1 
ATOM   1804 C  CD    . PRO C 3 162 ? -27.990 18.545 -5.654  1.00 44.25 ? 217 PRO A CD    1 
ATOM   1805 N  N     . LEU C 3 163 ? -25.821 22.480 -4.571  1.00 43.82 ? 218 LEU A N     1 
ATOM   1806 C  CA    . LEU C 3 163 ? -26.179 23.731 -3.902  1.00 43.78 ? 218 LEU A CA    1 
ATOM   1807 C  C     . LEU C 3 163 ? -26.475 24.774 -4.969  1.00 43.65 ? 218 LEU A C     1 
ATOM   1808 O  O     . LEU C 3 163 ? -25.595 25.167 -5.737  1.00 43.91 ? 218 LEU A O     1 
ATOM   1809 C  CB    . LEU C 3 163 ? -25.086 24.203 -2.941  1.00 43.71 ? 218 LEU A CB    1 
ATOM   1810 C  CG    . LEU C 3 163 ? -24.755 23.295 -1.750  1.00 43.66 ? 218 LEU A CG    1 
ATOM   1811 C  CD1   . LEU C 3 163 ? -23.591 23.878 -0.934  1.00 42.15 ? 218 LEU A CD1   1 
ATOM   1812 C  CD2   . LEU C 3 163 ? -25.981 23.045 -0.863  1.00 42.77 ? 218 LEU A CD2   1 
ATOM   1813 N  N     . ALA C 3 164 ? -27.730 25.195 -5.029  1.00 43.35 ? 219 ALA A N     1 
ATOM   1814 C  CA    . ALA C 3 164 ? -28.187 26.059 -6.102  1.00 43.15 ? 219 ALA A CA    1 
ATOM   1815 C  C     . ALA C 3 164 ? -27.967 27.532 -5.807  1.00 43.03 ? 219 ALA A C     1 
ATOM   1816 O  O     . ALA C 3 164 ? -27.903 27.955 -4.654  1.00 43.03 ? 219 ALA A O     1 
ATOM   1817 C  CB    . ALA C 3 164 ? -29.657 25.792 -6.420  1.00 42.69 ? 219 ALA A CB    1 
ATOM   1818 N  N     . HIS C 3 165 ? -27.838 28.292 -6.888  1.00 43.07 ? 220 HIS A N     1 
ATOM   1819 C  CA    . HIS C 3 165 ? -27.902 29.738 -6.888  1.00 43.12 ? 220 HIS A CA    1 
ATOM   1820 C  C     . HIS C 3 165 ? -29.020 30.202 -5.963  1.00 43.13 ? 220 HIS A C     1 
ATOM   1821 O  O     . HIS C 3 165 ? -30.183 29.872 -6.179  1.00 43.06 ? 220 HIS A O     1 
ATOM   1822 C  CB    . HIS C 3 165 ? -28.180 30.186 -8.324  1.00 43.21 ? 220 HIS A CB    1 
ATOM   1823 C  CG    . HIS C 3 165 ? -28.133 31.667 -8.533  1.00 43.85 ? 220 HIS A CG    1 
ATOM   1824 N  ND1   . HIS C 3 165 ? -27.081 32.450 -8.105  1.00 44.72 ? 220 HIS A ND1   1 
ATOM   1825 C  CD2   . HIS C 3 165 ? -28.990 32.501 -9.168  1.00 43.50 ? 220 HIS A CD2   1 
ATOM   1826 C  CE1   . HIS C 3 165 ? -27.306 33.707 -8.447  1.00 44.56 ? 220 HIS A CE1   1 
ATOM   1827 N  NE2   . HIS C 3 165 ? -28.453 33.764 -9.099  1.00 43.59 ? 220 HIS A NE2   1 
ATOM   1828 N  N     . GLY C 3 166 ? -28.657 30.937 -4.917  1.00 43.22 ? 221 GLY A N     1 
ATOM   1829 C  CA    . GLY C 3 166 ? -29.639 31.499 -3.986  1.00 43.31 ? 221 GLY A CA    1 
ATOM   1830 C  C     . GLY C 3 166 ? -30.117 30.546 -2.904  1.00 43.51 ? 221 GLY A C     1 
ATOM   1831 O  O     . GLY C 3 166 ? -31.167 30.769 -2.294  1.00 43.58 ? 221 GLY A O     1 
ATOM   1832 N  N     . SER C 3 167 ? -29.347 29.488 -2.656  1.00 43.71 ? 222 SER A N     1 
ATOM   1833 C  CA    . SER C 3 167 ? -29.732 28.475 -1.676  1.00 43.75 ? 222 SER A CA    1 
ATOM   1834 C  C     . SER C 3 167 ? -29.104 28.688 -0.307  1.00 43.57 ? 222 SER A C     1 
ATOM   1835 O  O     . SER C 3 167 ? -28.106 29.392 -0.167  1.00 43.33 ? 222 SER A O     1 
ATOM   1836 C  CB    . SER C 3 167 ? -29.390 27.079 -2.187  1.00 43.75 ? 222 SER A CB    1 
ATOM   1837 O  OG    . SER C 3 167 ? -27.988 26.884 -2.228  1.00 45.14 ? 222 SER A OG    1 
ATOM   1838 N  N     . LEU C 3 168 ? -29.713 28.071 0.699   1.00 43.75 ? 223 LEU A N     1 
ATOM   1839 C  CA    . LEU C 3 168 ? -29.196 28.095 2.055   1.00 44.08 ? 223 LEU A CA    1 
ATOM   1840 C  C     . LEU C 3 168 ? -29.113 26.680 2.601   1.00 44.73 ? 223 LEU A C     1 
ATOM   1841 O  O     . LEU C 3 168 ? -30.133 25.976 2.704   1.00 45.05 ? 223 LEU A O     1 
ATOM   1842 C  CB    . LEU C 3 168 ? -30.082 28.949 2.961   1.00 43.87 ? 223 LEU A CB    1 
ATOM   1843 C  CG    . LEU C 3 168 ? -29.984 28.764 4.483   1.00 43.87 ? 223 LEU A CG    1 
ATOM   1844 C  CD1   . LEU C 3 168 ? -28.582 29.051 5.028   1.00 44.31 ? 223 LEU A CD1   1 
ATOM   1845 C  CD2   . LEU C 3 168 ? -31.016 29.621 5.200   1.00 43.90 ? 223 LEU A CD2   1 
ATOM   1846 N  N     . LEU C 3 169 ? -27.899 26.272 2.959   1.00 45.03 ? 224 LEU A N     1 
ATOM   1847 C  CA    . LEU C 3 169 ? -27.686 24.988 3.613   1.00 45.34 ? 224 LEU A CA    1 
ATOM   1848 C  C     . LEU C 3 169 ? -27.296 25.212 5.067   1.00 45.82 ? 224 LEU A C     1 
ATOM   1849 O  O     . LEU C 3 169 ? -26.241 25.783 5.351   1.00 45.79 ? 224 LEU A O     1 
ATOM   1850 C  CB    . LEU C 3 169 ? -26.601 24.191 2.884   1.00 45.05 ? 224 LEU A CB    1 
ATOM   1851 C  CG    . LEU C 3 169 ? -26.240 22.835 3.488   1.00 44.48 ? 224 LEU A CG    1 
ATOM   1852 C  CD1   . LEU C 3 169 ? -27.316 21.796 3.167   1.00 44.46 ? 224 LEU A CD1   1 
ATOM   1853 C  CD2   . LEU C 3 169 ? -24.870 22.378 3.001   1.00 43.12 ? 224 LEU A CD2   1 
ATOM   1854 N  N     . MET C 3 170 ? -28.161 24.783 5.980   1.00 46.49 ? 225 MET A N     1 
ATOM   1855 C  CA    . MET C 3 170 ? -27.865 24.852 7.411   1.00 47.26 ? 225 MET A CA    1 
ATOM   1856 C  C     . MET C 3 170 ? -27.081 23.618 7.820   1.00 47.99 ? 225 MET A C     1 
ATOM   1857 O  O     . MET C 3 170 ? -27.447 22.500 7.457   1.00 48.11 ? 225 MET A O     1 
ATOM   1858 C  CB    . MET C 3 170 ? -29.150 24.928 8.243   1.00 47.18 ? 225 MET A CB    1 
ATOM   1859 C  CG    . MET C 3 170 ? -29.898 26.243 8.153   1.00 46.92 ? 225 MET A CG    1 
ATOM   1860 S  SD    . MET C 3 170 ? -28.882 27.659 8.616   1.00 47.53 ? 225 MET A SD    1 
ATOM   1861 C  CE    . MET C 3 170 ? -28.848 27.504 10.393  1.00 47.06 ? 225 MET A CE    1 
ATOM   1862 N  N     . MET C 3 171 ? -26.005 23.820 8.573   1.00 48.79 ? 226 MET A N     1 
ATOM   1863 C  CA    . MET C 3 171 ? -25.260 22.699 9.126   1.00 49.71 ? 226 MET A CA    1 
ATOM   1864 C  C     . MET C 3 171 ? -25.282 22.737 10.640  1.00 50.24 ? 226 MET A C     1 
ATOM   1865 O  O     . MET C 3 171 ? -24.610 23.552 11.270  1.00 50.19 ? 226 MET A O     1 
ATOM   1866 C  CB    . MET C 3 171 ? -23.841 22.659 8.578   1.00 49.64 ? 226 MET A CB    1 
ATOM   1867 C  CG    . MET C 3 171 ? -23.786 22.123 7.163   1.00 49.93 ? 226 MET A CG    1 
ATOM   1868 S  SD    . MET C 3 171 ? -22.187 22.370 6.384   1.00 50.39 ? 226 MET A SD    1 
ATOM   1869 C  CE    . MET C 3 171 ? -22.297 24.086 5.889   1.00 50.15 ? 226 MET A CE    1 
ATOM   1870 N  N     . ASN C 3 172 ? -26.080 21.843 11.211  1.00 51.14 ? 227 ASN A N     1 
ATOM   1871 C  CA    . ASN C 3 172 ? -26.351 21.842 12.638  1.00 52.11 ? 227 ASN A CA    1 
ATOM   1872 C  C     . ASN C 3 172 ? -25.369 20.959 13.394  1.00 52.55 ? 227 ASN A C     1 
ATOM   1873 O  O     . ASN C 3 172 ? -24.300 20.629 12.879  1.00 52.63 ? 227 ASN A O     1 
ATOM   1874 C  CB    . ASN C 3 172 ? -27.795 21.397 12.885  1.00 52.25 ? 227 ASN A CB    1 
ATOM   1875 C  CG    . ASN C 3 172 ? -28.787 22.099 11.963  1.00 52.93 ? 227 ASN A CG    1 
ATOM   1876 O  OD1   . ASN C 3 172 ? -29.157 23.254 12.190  1.00 53.49 ? 227 ASN A OD1   1 
ATOM   1877 N  ND2   . ASN C 3 172 ? -29.220 21.399 10.917  1.00 53.51 ? 227 ASN A ND2   1 
ATOM   1878 N  N     . HIS C 3 173 ? -25.729 20.604 14.624  1.00 53.18 ? 228 HIS A N     1 
ATOM   1879 C  CA    . HIS C 3 173 ? -24.945 19.687 15.444  1.00 53.87 ? 228 HIS A CA    1 
ATOM   1880 C  C     . HIS C 3 173 ? -25.675 18.333 15.473  1.00 54.12 ? 228 HIS A C     1 
ATOM   1881 O  O     . HIS C 3 173 ? -26.910 18.307 15.521  1.00 54.10 ? 228 HIS A O     1 
ATOM   1882 C  CB    . HIS C 3 173 ? -24.782 20.262 16.859  1.00 54.01 ? 228 HIS A CB    1 
ATOM   1883 C  CG    . HIS C 3 173 ? -23.446 19.989 17.484  1.00 54.84 ? 228 HIS A CG    1 
ATOM   1884 N  ND1   . HIS C 3 173 ? -22.252 20.321 16.874  1.00 55.70 ? 228 HIS A ND1   1 
ATOM   1885 C  CD2   . HIS C 3 173 ? -23.117 19.437 18.678  1.00 55.08 ? 228 HIS A CD2   1 
ATOM   1886 C  CE1   . HIS C 3 173 ? -21.247 19.970 17.658  1.00 55.75 ? 228 HIS A CE1   1 
ATOM   1887 N  NE2   . HIS C 3 173 ? -21.745 19.433 18.759  1.00 55.51 ? 228 HIS A NE2   1 
ATOM   1888 N  N     . PRO C 3 174 ? -24.927 17.204 15.445  1.00 54.41 ? 229 PRO A N     1 
ATOM   1889 C  CA    . PRO C 3 174 ? -23.468 17.051 15.467  1.00 54.64 ? 229 PRO A CA    1 
ATOM   1890 C  C     . PRO C 3 174 ? -22.821 16.906 14.081  1.00 54.82 ? 229 PRO A C     1 
ATOM   1891 O  O     . PRO C 3 174 ? -21.724 16.350 13.971  1.00 54.76 ? 229 PRO A O     1 
ATOM   1892 C  CB    . PRO C 3 174 ? -23.281 15.755 16.272  1.00 54.73 ? 229 PRO A CB    1 
ATOM   1893 C  CG    . PRO C 3 174 ? -24.584 14.973 16.084  1.00 54.58 ? 229 PRO A CG    1 
ATOM   1894 C  CD    . PRO C 3 174 ? -25.586 15.886 15.399  1.00 54.42 ? 229 PRO A CD    1 
ATOM   1895 N  N     . THR C 3 175 ? -23.494 17.413 13.047  1.00 55.07 ? 230 THR A N     1 
ATOM   1896 C  CA    . THR C 3 175 ? -23.058 17.267 11.651  1.00 55.37 ? 230 THR A CA    1 
ATOM   1897 C  C     . THR C 3 175 ? -21.528 17.346 11.488  1.00 55.40 ? 230 THR A C     1 
ATOM   1898 O  O     . THR C 3 175 ? -20.907 16.428 10.937  1.00 55.58 ? 230 THR A O     1 
ATOM   1899 C  CB    . THR C 3 175 ? -23.758 18.309 10.722  1.00 55.46 ? 230 THR A CB    1 
ATOM   1900 O  OG1   . THR C 3 175 ? -25.150 18.397 11.053  1.00 55.86 ? 230 THR A OG1   1 
ATOM   1901 C  CG2   . THR C 3 175 ? -23.613 17.930 9.256   1.00 55.50 ? 230 THR A CG2   1 
ATOM   1902 N  N     . ASN C 3 176 ? -20.932 18.430 11.992  1.00 55.28 ? 231 ASN A N     1 
ATOM   1903 C  CA    . ASN C 3 176 ? -19.488 18.674 11.866  1.00 54.92 ? 231 ASN A CA    1 
ATOM   1904 C  C     . ASN C 3 176 ? -18.593 17.902 12.849  1.00 54.55 ? 231 ASN A C     1 
ATOM   1905 O  O     . ASN C 3 176 ? -17.366 18.073 12.848  1.00 54.72 ? 231 ASN A O     1 
ATOM   1906 C  CB    . ASN C 3 176 ? -19.183 20.181 11.922  1.00 55.03 ? 231 ASN A CB    1 
ATOM   1907 C  CG    . ASN C 3 176 ? -18.997 20.798 10.539  1.00 55.06 ? 231 ASN A CG    1 
ATOM   1908 O  OD1   . ASN C 3 176 ? -19.666 21.771 10.183  1.00 54.71 ? 231 ASN A OD1   1 
ATOM   1909 N  ND2   . ASN C 3 176 ? -18.078 20.237 9.759   1.00 54.89 ? 231 ASN A ND2   1 
ATOM   1910 N  N     . THR C 3 177 ? -19.200 17.050 13.672  1.00 53.82 ? 232 THR A N     1 
ATOM   1911 C  CA    . THR C 3 177 ? -18.444 16.214 14.603  1.00 53.29 ? 232 THR A CA    1 
ATOM   1912 C  C     . THR C 3 177 ? -18.265 14.787 14.050  1.00 52.85 ? 232 THR A C     1 
ATOM   1913 O  O     . THR C 3 177 ? -17.336 14.070 14.442  1.00 52.77 ? 232 THR A O     1 
ATOM   1914 C  CB    . THR C 3 177 ? -19.109 16.193 16.009  1.00 53.30 ? 232 THR A CB    1 
ATOM   1915 O  OG1   . THR C 3 177 ? -19.572 17.509 16.339  1.00 53.23 ? 232 THR A OG1   1 
ATOM   1916 C  CG2   . THR C 3 177 ? -18.121 15.731 17.078  1.00 53.40 ? 232 THR A CG2   1 
ATOM   1917 N  N     . HIS C 3 178 ? -19.143 14.397 13.124  1.00 52.17 ? 233 HIS A N     1 
ATOM   1918 C  CA    . HIS C 3 178 ? -19.163 13.032 12.593  1.00 51.49 ? 233 HIS A CA    1 
ATOM   1919 C  C     . HIS C 3 178 ? -18.946 12.938 11.081  1.00 50.94 ? 233 HIS A C     1 
ATOM   1920 O  O     . HIS C 3 178 ? -18.441 11.927 10.586  1.00 50.87 ? 233 HIS A O     1 
ATOM   1921 C  CB    . HIS C 3 178 ? -20.479 12.339 12.960  1.00 51.64 ? 233 HIS A CB    1 
ATOM   1922 C  CG    . HIS C 3 178 ? -20.629 12.047 14.421  1.00 51.85 ? 233 HIS A CG    1 
ATOM   1923 N  ND1   . HIS C 3 178 ? -19.909 11.060 15.062  1.00 52.06 ? 233 HIS A ND1   1 
ATOM   1924 C  CD2   . HIS C 3 178 ? -21.429 12.600 15.363  1.00 52.14 ? 233 HIS A CD2   1 
ATOM   1925 C  CE1   . HIS C 3 178 ? -20.254 11.024 16.337  1.00 52.11 ? 233 HIS A CE1   1 
ATOM   1926 N  NE2   . HIS C 3 178 ? -21.175 11.947 16.546  1.00 52.27 ? 233 HIS A NE2   1 
ATOM   1927 N  N     . TRP C 3 179 ? -19.333 13.981 10.353  1.00 50.15 ? 234 TRP A N     1 
ATOM   1928 C  CA    . TRP C 3 179 ? -19.285 13.950 8.893   1.00 49.46 ? 234 TRP A CA    1 
ATOM   1929 C  C     . TRP C 3 179 ? -18.308 14.951 8.290   1.00 48.96 ? 234 TRP A C     1 
ATOM   1930 O  O     . TRP C 3 179 ? -18.199 16.088 8.750   1.00 48.98 ? 234 TRP A O     1 
ATOM   1931 C  CB    . TRP C 3 179 ? -20.682 14.163 8.307   1.00 49.39 ? 234 TRP A CB    1 
ATOM   1932 C  CG    . TRP C 3 179 ? -21.603 12.992 8.508   1.00 49.30 ? 234 TRP A CG    1 
ATOM   1933 C  CD1   . TRP C 3 179 ? -22.132 12.559 9.691   1.00 49.14 ? 234 TRP A CD1   1 
ATOM   1934 C  CD2   . TRP C 3 179 ? -22.112 12.115 7.495   1.00 49.13 ? 234 TRP A CD2   1 
ATOM   1935 N  NE1   . TRP C 3 179 ? -22.935 11.464 9.478   1.00 49.22 ? 234 TRP A NE1   1 
ATOM   1936 C  CE2   . TRP C 3 179 ? -22.943 11.171 8.140   1.00 49.21 ? 234 TRP A CE2   1 
ATOM   1937 C  CE3   . TRP C 3 179 ? -21.953 12.037 6.105   1.00 49.03 ? 234 TRP A CE3   1 
ATOM   1938 C  CZ2   . TRP C 3 179 ? -23.608 10.156 7.443   1.00 49.28 ? 234 TRP A CZ2   1 
ATOM   1939 C  CZ3   . TRP C 3 179 ? -22.612 11.026 5.412   1.00 49.07 ? 234 TRP A CZ3   1 
ATOM   1940 C  CH2   . TRP C 3 179 ? -23.430 10.100 6.084   1.00 49.29 ? 234 TRP A CH2   1 
ATOM   1941 N  N     . TYR C 3 180 ? -17.598 14.507 7.259   1.00 48.30 ? 235 TYR A N     1 
ATOM   1942 C  CA    . TYR C 3 180 ? -16.729 15.373 6.479   1.00 47.75 ? 235 TYR A CA    1 
ATOM   1943 C  C     . TYR C 3 180 ? -17.506 15.905 5.291   1.00 47.21 ? 235 TYR A C     1 
ATOM   1944 O  O     . TYR C 3 180 ? -18.431 15.253 4.807   1.00 47.01 ? 235 TYR A O     1 
ATOM   1945 C  CB    . TYR C 3 180 ? -15.523 14.589 5.971   1.00 47.91 ? 235 TYR A CB    1 
ATOM   1946 C  CG    . TYR C 3 180 ? -14.490 14.248 7.025   1.00 48.34 ? 235 TYR A CG    1 
ATOM   1947 C  CD1   . TYR C 3 180 ? -13.261 14.910 7.064   1.00 48.34 ? 235 TYR A CD1   1 
ATOM   1948 C  CD2   . TYR C 3 180 ? -14.732 13.253 7.971   1.00 48.72 ? 235 TYR A CD2   1 
ATOM   1949 C  CE1   . TYR C 3 180 ? -12.302 14.596 8.023   1.00 48.80 ? 235 TYR A CE1   1 
ATOM   1950 C  CE2   . TYR C 3 180 ? -13.781 12.933 8.937   1.00 49.20 ? 235 TYR A CE2   1 
ATOM   1951 C  CZ    . TYR C 3 180 ? -12.570 13.606 8.959   1.00 48.95 ? 235 TYR A CZ    1 
ATOM   1952 O  OH    . TYR C 3 180 ? -11.635 13.280 9.919   1.00 48.52 ? 235 TYR A OH    1 
ATOM   1953 N  N     . HIS C 3 181 ? -17.140 17.092 4.822   1.00 46.59 ? 236 HIS A N     1 
ATOM   1954 C  CA    . HIS C 3 181 ? -17.720 17.609 3.591   1.00 46.09 ? 236 HIS A CA    1 
ATOM   1955 C  C     . HIS C 3 181 ? -16.663 18.114 2.620   1.00 45.98 ? 236 HIS A C     1 
ATOM   1956 O  O     . HIS C 3 181 ? -15.513 18.348 2.997   1.00 45.78 ? 236 HIS A O     1 
ATOM   1957 C  CB    . HIS C 3 181 ? -18.779 18.672 3.873   1.00 45.86 ? 236 HIS A CB    1 
ATOM   1958 C  CG    . HIS C 3 181 ? -18.288 19.812 4.704   1.00 45.85 ? 236 HIS A CG    1 
ATOM   1959 N  ND1   . HIS C 3 181 ? -18.421 19.841 6.075   1.00 45.68 ? 236 HIS A ND1   1 
ATOM   1960 C  CD2   . HIS C 3 181 ? -17.666 20.964 4.361   1.00 45.91 ? 236 HIS A CD2   1 
ATOM   1961 C  CE1   . HIS C 3 181 ? -17.898 20.961 6.541   1.00 45.55 ? 236 HIS A CE1   1 
ATOM   1962 N  NE2   . HIS C 3 181 ? -17.434 21.661 5.521   1.00 45.42 ? 236 HIS A NE2   1 
ATOM   1963 N  N     . SER C 3 182 ? -17.069 18.269 1.363   1.00 45.93 ? 237 SER A N     1 
ATOM   1964 C  CA    . SER C 3 182 ? -16.193 18.771 0.309   1.00 45.77 ? 237 SER A CA    1 
ATOM   1965 C  C     . SER C 3 182 ? -17.007 19.359 -0.839  1.00 45.63 ? 237 SER A C     1 
ATOM   1966 O  O     . SER C 3 182 ? -18.197 19.086 -0.967  1.00 45.43 ? 237 SER A O     1 
ATOM   1967 C  CB    . SER C 3 182 ? -15.304 17.645 -0.216  1.00 45.58 ? 237 SER A CB    1 
ATOM   1968 O  OG    . SER C 3 182 ? -16.086 16.513 -0.544  1.00 46.10 ? 237 SER A OG    1 
ATOM   1969 N  N     . LEU C 3 183 ? -16.361 20.188 -1.654  1.00 45.72 ? 238 LEU A N     1 
ATOM   1970 C  CA    . LEU C 3 183 ? -16.928 20.618 -2.927  1.00 45.68 ? 238 LEU A CA    1 
ATOM   1971 C  C     . LEU C 3 183 ? -15.993 20.086 -4.006  1.00 45.71 ? 238 LEU A C     1 
ATOM   1972 O  O     . LEU C 3 183 ? -14.982 20.715 -4.309  1.00 46.02 ? 238 LEU A O     1 
ATOM   1973 C  CB    . LEU C 3 183 ? -17.035 22.150 -3.002  1.00 45.36 ? 238 LEU A CB    1 
ATOM   1974 C  CG    . LEU C 3 183 ? -17.983 22.739 -4.054  1.00 44.76 ? 238 LEU A CG    1 
ATOM   1975 C  CD1   . LEU C 3 183 ? -19.409 22.857 -3.516  1.00 43.17 ? 238 LEU A CD1   1 
ATOM   1976 C  CD2   . LEU C 3 183 ? -17.492 24.095 -4.534  1.00 43.92 ? 238 LEU A CD2   1 
ATOM   1977 N  N     . PRO C 3 184 ? -16.312 18.912 -4.572  1.00 45.60 ? 239 PRO A N     1 
ATOM   1978 C  CA    . PRO C 3 184 ? -15.362 18.274 -5.483  1.00 45.63 ? 239 PRO A CA    1 
ATOM   1979 C  C     . PRO C 3 184 ? -15.225 18.997 -6.817  1.00 45.85 ? 239 PRO A C     1 
ATOM   1980 O  O     . PRO C 3 184 ? -16.081 19.809 -7.191  1.00 45.93 ? 239 PRO A O     1 
ATOM   1981 C  CB    . PRO C 3 184 ? -15.943 16.869 -5.688  1.00 45.28 ? 239 PRO A CB    1 
ATOM   1982 C  CG    . PRO C 3 184 ? -17.387 17.005 -5.402  1.00 45.51 ? 239 PRO A CG    1 
ATOM   1983 C  CD    . PRO C 3 184 ? -17.551 18.128 -4.416  1.00 45.58 ? 239 PRO A CD    1 
ATOM   1984 N  N     . VAL C 3 185 ? -14.134 18.698 -7.516  1.00 46.18 ? 240 VAL A N     1 
ATOM   1985 C  CA    . VAL C 3 185 ? -13.903 19.207 -8.862  1.00 45.98 ? 240 VAL A CA    1 
ATOM   1986 C  C     . VAL C 3 185 ? -15.038 18.770 -9.792  1.00 46.25 ? 240 VAL A C     1 
ATOM   1987 O  O     . VAL C 3 185 ? -15.499 17.629 -9.738  1.00 46.11 ? 240 VAL A O     1 
ATOM   1988 C  CB    . VAL C 3 185 ? -12.522 18.755 -9.393  1.00 45.85 ? 240 VAL A CB    1 
ATOM   1989 C  CG1   . VAL C 3 185 ? -12.366 19.067 -10.881 1.00 45.14 ? 240 VAL A CG1   1 
ATOM   1990 C  CG2   . VAL C 3 185 ? -11.410 19.412 -8.571  1.00 45.04 ? 240 VAL A CG2   1 
ATOM   1991 N  N     . ARG C 3 186 ? -15.512 19.706 -10.605 1.00 46.53 ? 241 ARG A N     1 
ATOM   1992 C  CA    . ARG C 3 186 ? -16.542 19.424 -11.584 1.00 46.90 ? 241 ARG A CA    1 
ATOM   1993 C  C     . ARG C 3 186 ? -16.149 20.070 -12.910 1.00 47.35 ? 241 ARG A C     1 
ATOM   1994 O  O     . ARG C 3 186 ? -16.668 21.127 -13.291 1.00 47.88 ? 241 ARG A O     1 
ATOM   1995 C  CB    . ARG C 3 186 ? -17.907 19.928 -11.098 1.00 46.77 ? 241 ARG A CB    1 
ATOM   1996 C  CG    . ARG C 3 186 ? -18.547 19.088 -9.998  1.00 46.56 ? 241 ARG A CG    1 
ATOM   1997 C  CD    . ARG C 3 186 ? -19.080 17.771 -10.526 1.00 45.29 ? 241 ARG A CD    1 
ATOM   1998 N  NE    . ARG C 3 186 ? -19.640 16.943 -9.463  1.00 44.88 ? 241 ARG A NE    1 
ATOM   1999 C  CZ    . ARG C 3 186 ? -18.986 15.965 -8.838  1.00 45.48 ? 241 ARG A CZ    1 
ATOM   2000 N  NH1   . ARG C 3 186 ? -17.727 15.675 -9.157  1.00 45.54 ? 241 ARG A NH1   1 
ATOM   2001 N  NH2   . ARG C 3 186 ? -19.595 15.269 -7.887  1.00 45.13 ? 241 ARG A NH2   1 
ATOM   2002 N  N     . LYS C 3 187 ? -15.244 19.409 -13.623 1.00 47.44 ? 242 LYS A N     1 
ATOM   2003 C  CA    . LYS C 3 187 ? -14.646 19.970 -14.831 1.00 47.67 ? 242 LYS A CA    1 
ATOM   2004 C  C     . LYS C 3 187 ? -15.608 20.680 -15.802 1.00 47.67 ? 242 LYS A C     1 
ATOM   2005 O  O     . LYS C 3 187 ? -15.230 21.678 -16.414 1.00 48.03 ? 242 LYS A O     1 
ATOM   2006 C  CB    . LYS C 3 187 ? -13.799 18.919 -15.557 1.00 47.73 ? 242 LYS A CB    1 
ATOM   2007 C  CG    . LYS C 3 187 ? -12.373 18.781 -15.007 1.00 47.98 ? 242 LYS A CG    1 
ATOM   2008 C  CD    . LYS C 3 187 ? -11.459 19.885 -15.545 1.00 48.81 ? 242 LYS A CD    1 
ATOM   2009 C  CE    . LYS C 3 187 ? -10.002 19.667 -15.164 1.00 48.73 ? 242 LYS A CE    1 
ATOM   2010 N  NZ    . LYS C 3 187 ? -9.750  20.094 -13.764 1.00 48.61 ? 242 LYS A NZ    1 
ATOM   2011 N  N     . LYS C 3 188 ? -16.839 20.186 -15.926 1.00 47.42 ? 243 LYS A N     1 
ATOM   2012 C  CA    . LYS C 3 188 ? -17.791 20.739 -16.899 1.00 47.31 ? 243 LYS A CA    1 
ATOM   2013 C  C     . LYS C 3 188 ? -18.408 22.071 -16.468 1.00 47.26 ? 243 LYS A C     1 
ATOM   2014 O  O     . LYS C 3 188 ? -19.047 22.749 -17.274 1.00 47.22 ? 243 LYS A O     1 
ATOM   2015 C  CB    . LYS C 3 188 ? -18.903 19.735 -17.216 1.00 47.42 ? 243 LYS A CB    1 
ATOM   2016 C  CG    . LYS C 3 188 ? -18.445 18.483 -17.924 1.00 47.70 ? 243 LYS A CG    1 
ATOM   2017 C  CD    . LYS C 3 188 ? -19.379 17.325 -17.615 1.00 48.67 ? 243 LYS A CD    1 
ATOM   2018 C  CE    . LYS C 3 188 ? -18.693 15.989 -17.880 1.00 49.32 ? 243 LYS A CE    1 
ATOM   2019 N  NZ    . LYS C 3 188 ? -19.299 14.885 -17.080 1.00 49.71 ? 243 LYS A NZ    1 
ATOM   2020 N  N     . VAL C 3 189 ? -18.228 22.445 -15.203 1.00 47.17 ? 244 VAL A N     1 
ATOM   2021 C  CA    . VAL C 3 189 ? -18.735 23.728 -14.723 1.00 47.04 ? 244 VAL A CA    1 
ATOM   2022 C  C     . VAL C 3 189 ? -17.780 24.834 -15.162 1.00 46.93 ? 244 VAL A C     1 
ATOM   2023 O  O     . VAL C 3 189 ? -16.598 24.794 -14.844 1.00 47.04 ? 244 VAL A O     1 
ATOM   2024 C  CB    . VAL C 3 189 ? -18.936 23.734 -13.182 1.00 47.07 ? 244 VAL A CB    1 
ATOM   2025 C  CG1   . VAL C 3 189 ? -19.417 25.102 -12.698 1.00 46.72 ? 244 VAL A CG1   1 
ATOM   2026 C  CG2   . VAL C 3 189 ? -19.940 22.663 -12.778 1.00 46.94 ? 244 VAL A CG2   1 
ATOM   2027 N  N     . LEU C 3 190 ? -18.294 25.809 -15.905 1.00 46.94 ? 245 LEU A N     1 
ATOM   2028 C  CA    . LEU C 3 190 ? -17.459 26.899 -16.420 1.00 46.87 ? 245 LEU A CA    1 
ATOM   2029 C  C     . LEU C 3 190 ? -17.679 28.243 -15.706 1.00 46.85 ? 245 LEU A C     1 
ATOM   2030 O  O     . LEU C 3 190 ? -16.867 29.163 -15.832 1.00 46.86 ? 245 LEU A O     1 
ATOM   2031 C  CB    . LEU C 3 190 ? -17.673 27.064 -17.930 1.00 46.84 ? 245 LEU A CB    1 
ATOM   2032 C  CG    . LEU C 3 190 ? -17.279 25.921 -18.881 1.00 46.92 ? 245 LEU A CG    1 
ATOM   2033 C  CD1   . LEU C 3 190 ? -17.751 26.222 -20.312 1.00 45.86 ? 245 LEU A CD1   1 
ATOM   2034 C  CD2   . LEU C 3 190 ? -15.778 25.633 -18.851 1.00 45.41 ? 245 LEU A CD2   1 
ATOM   2035 N  N     . ALA C 3 191 ? -18.773 28.359 -14.961 1.00 46.70 ? 246 ALA A N     1 
ATOM   2036 C  CA    . ALA C 3 191 ? -19.130 29.629 -14.317 1.00 46.81 ? 246 ALA A CA    1 
ATOM   2037 C  C     . ALA C 3 191 ? -18.663 29.704 -12.853 1.00 46.67 ? 246 ALA A C     1 
ATOM   2038 O  O     . ALA C 3 191 ? -18.529 28.670 -12.187 1.00 46.95 ? 246 ALA A O     1 
ATOM   2039 C  CB    . ALA C 3 191 ? -20.645 29.882 -14.429 1.00 46.71 ? 246 ALA A CB    1 
ATOM   2040 N  N     . PRO C 3 192 ? -18.402 30.927 -12.350 1.00 46.36 ? 247 PRO A N     1 
ATOM   2041 C  CA    . PRO C 3 192 ? -17.978 31.063 -10.955 1.00 46.03 ? 247 PRO A CA    1 
ATOM   2042 C  C     . PRO C 3 192 ? -19.115 30.836 -9.949  1.00 45.85 ? 247 PRO A C     1 
ATOM   2043 O  O     . PRO C 3 192 ? -20.290 31.004 -10.282 1.00 45.95 ? 247 PRO A O     1 
ATOM   2044 C  CB    . PRO C 3 192 ? -17.487 32.509 -10.885 1.00 46.12 ? 247 PRO A CB    1 
ATOM   2045 C  CG    . PRO C 3 192 ? -18.296 33.220 -11.920 1.00 46.04 ? 247 PRO A CG    1 
ATOM   2046 C  CD    . PRO C 3 192 ? -18.478 32.233 -13.037 1.00 46.13 ? 247 PRO A CD    1 
ATOM   2047 N  N     . ARG C 3 193 ? -18.745 30.443 -8.732  1.00 45.61 ? 248 ARG A N     1 
ATOM   2048 C  CA    . ARG C 3 193 ? -19.680 30.278 -7.619  1.00 45.39 ? 248 ARG A CA    1 
ATOM   2049 C  C     . ARG C 3 193 ? -19.112 30.989 -6.395  1.00 45.14 ? 248 ARG A C     1 
ATOM   2050 O  O     . ARG C 3 193 ? -17.907 30.928 -6.153  1.00 45.49 ? 248 ARG A O     1 
ATOM   2051 C  CB    . ARG C 3 193 ? -19.912 28.787 -7.311  1.00 45.23 ? 248 ARG A CB    1 
ATOM   2052 C  CG    . ARG C 3 193 ? -20.660 28.521 -6.003  1.00 45.51 ? 248 ARG A CG    1 
ATOM   2053 C  CD    . ARG C 3 193 ? -20.778 27.037 -5.702  1.00 45.43 ? 248 ARG A CD    1 
ATOM   2054 N  NE    . ARG C 3 193 ? -21.506 26.779 -4.458  1.00 44.69 ? 248 ARG A NE    1 
ATOM   2055 C  CZ    . ARG C 3 193 ? -20.927 26.492 -3.294  1.00 44.62 ? 248 ARG A CZ    1 
ATOM   2056 N  NH1   . ARG C 3 193 ? -19.605 26.414 -3.199  1.00 45.04 ? 248 ARG A NH1   1 
ATOM   2057 N  NH2   . ARG C 3 193 ? -21.669 26.272 -2.220  1.00 44.20 ? 248 ARG A NH2   1 
ATOM   2058 N  N     . VAL C 3 194 ? -19.974 31.668 -5.640  1.00 44.78 ? 249 VAL A N     1 
ATOM   2059 C  CA    . VAL C 3 194 ? -19.571 32.335 -4.402  1.00 44.48 ? 249 VAL A CA    1 
ATOM   2060 C  C     . VAL C 3 194 ? -20.353 31.737 -3.250  1.00 44.49 ? 249 VAL A C     1 
ATOM   2061 O  O     . VAL C 3 194 ? -21.588 31.675 -3.277  1.00 44.65 ? 249 VAL A O     1 
ATOM   2062 C  CB    . VAL C 3 194 ? -19.795 33.873 -4.467  1.00 44.58 ? 249 VAL A CB    1 
ATOM   2063 C  CG1   . VAL C 3 194 ? -19.613 34.518 -3.099  1.00 44.40 ? 249 VAL A CG1   1 
ATOM   2064 C  CG2   . VAL C 3 194 ? -18.845 34.510 -5.466  1.00 44.20 ? 249 VAL A CG2   1 
ATOM   2065 N  N     . ASN C 3 195 ? -19.633 31.280 -2.239  1.00 44.37 ? 250 ASN A N     1 
ATOM   2066 C  CA    . ASN C 3 195 ? -20.279 30.675 -1.096  1.00 44.51 ? 250 ASN A CA    1 
ATOM   2067 C  C     . ASN C 3 195 ? -19.972 31.457 0.156   1.00 44.62 ? 250 ASN A C     1 
ATOM   2068 O  O     . ASN C 3 195 ? -18.853 31.937 0.330   1.00 44.48 ? 250 ASN A O     1 
ATOM   2069 C  CB    . ASN C 3 195 ? -19.849 29.223 -0.921  1.00 44.56 ? 250 ASN A CB    1 
ATOM   2070 C  CG    . ASN C 3 195 ? -20.422 28.604 0.333   1.00 45.21 ? 250 ASN A CG    1 
ATOM   2071 O  OD1   . ASN C 3 195 ? -21.600 28.240 0.380   1.00 47.79 ? 250 ASN A OD1   1 
ATOM   2072 N  ND2   . ASN C 3 195 ? -19.601 28.492 1.360   1.00 45.32 ? 250 ASN A ND2   1 
ATOM   2073 N  N     . LEU C 3 196 ? -20.973 31.573 1.024   1.00 44.68 ? 251 LEU A N     1 
ATOM   2074 C  CA    . LEU C 3 196 ? -20.832 32.292 2.277   1.00 44.80 ? 251 LEU A CA    1 
ATOM   2075 C  C     . LEU C 3 196 ? -21.197 31.381 3.439   1.00 44.98 ? 251 LEU A C     1 
ATOM   2076 O  O     . LEU C 3 196 ? -22.336 30.903 3.536   1.00 44.95 ? 251 LEU A O     1 
ATOM   2077 C  CB    . LEU C 3 196 ? -21.723 33.534 2.282   1.00 44.82 ? 251 LEU A CB    1 
ATOM   2078 C  CG    . LEU C 3 196 ? -21.448 34.604 1.224   1.00 45.16 ? 251 LEU A CG    1 
ATOM   2079 C  CD1   . LEU C 3 196 ? -22.282 34.372 -0.016  1.00 45.63 ? 251 LEU A CD1   1 
ATOM   2080 C  CD2   . LEU C 3 196 ? -21.755 35.964 1.784   1.00 45.50 ? 251 LEU A CD2   1 
ATOM   2081 N  N     . THR C 3 197 ? -20.228 31.125 4.311   1.00 44.92 ? 252 THR A N     1 
ATOM   2082 C  CA    . THR C 3 197 ? -20.501 30.349 5.511   1.00 45.04 ? 252 THR A CA    1 
ATOM   2083 C  C     . THR C 3 197 ? -20.521 31.271 6.722   1.00 45.18 ? 252 THR A C     1 
ATOM   2084 O  O     . THR C 3 197 ? -19.474 31.673 7.246   1.00 45.48 ? 252 THR A O     1 
ATOM   2085 C  CB    . THR C 3 197 ? -19.507 29.189 5.703   1.00 45.01 ? 252 THR A CB    1 
ATOM   2086 O  OG1   . THR C 3 197 ? -18.166 29.675 5.557   1.00 45.85 ? 252 THR A OG1   1 
ATOM   2087 C  CG2   . THR C 3 197 ? -19.760 28.100 4.675   1.00 44.59 ? 252 THR A CG2   1 
ATOM   2088 N  N     . PHE C 3 198 ? -21.729 31.643 7.128   1.00 45.05 ? 253 PHE A N     1 
ATOM   2089 C  CA    . PHE C 3 198 ? -21.925 32.458 8.310   1.00 44.99 ? 253 PHE A CA    1 
ATOM   2090 C  C     . PHE C 3 198 ? -21.727 31.593 9.536   1.00 45.28 ? 253 PHE A C     1 
ATOM   2091 O  O     . PHE C 3 198 ? -22.266 30.485 9.623   1.00 45.23 ? 253 PHE A O     1 
ATOM   2092 C  CB    . PHE C 3 198 ? -23.325 33.059 8.325   1.00 44.81 ? 253 PHE A CB    1 
ATOM   2093 C  CG    . PHE C 3 198 ? -23.547 34.092 7.271   1.00 44.53 ? 253 PHE A CG    1 
ATOM   2094 C  CD1   . PHE C 3 198 ? -23.195 35.419 7.498   1.00 44.20 ? 253 PHE A CD1   1 
ATOM   2095 C  CD2   . PHE C 3 198 ? -24.113 33.743 6.050   1.00 44.29 ? 253 PHE A CD2   1 
ATOM   2096 C  CE1   . PHE C 3 198 ? -23.396 36.386 6.521   1.00 44.14 ? 253 PHE A CE1   1 
ATOM   2097 C  CE2   . PHE C 3 198 ? -24.321 34.702 5.066   1.00 44.53 ? 253 PHE A CE2   1 
ATOM   2098 C  CZ    . PHE C 3 198 ? -23.959 36.029 5.302   1.00 44.46 ? 253 PHE A CZ    1 
ATOM   2099 N  N     . ARG C 3 199 ? -20.952 32.109 10.482  1.00 45.58 ? 254 ARG A N     1 
ATOM   2100 C  CA    . ARG C 3 199 ? -20.566 31.350 11.661  1.00 46.07 ? 254 ARG A CA    1 
ATOM   2101 C  C     . ARG C 3 199 ? -20.740 32.168 12.943  1.00 46.33 ? 254 ARG A C     1 
ATOM   2102 O  O     . ARG C 3 199 ? -20.934 33.394 12.900  1.00 46.36 ? 254 ARG A O     1 
ATOM   2103 C  CB    . ARG C 3 199 ? -19.119 30.858 11.512  1.00 46.13 ? 254 ARG A CB    1 
ATOM   2104 C  CG    . ARG C 3 199 ? -18.876 30.037 10.239  1.00 46.95 ? 254 ARG A CG    1 
ATOM   2105 C  CD    . ARG C 3 199 ? -17.452 30.184 9.697   1.00 48.35 ? 254 ARG A CD    1 
ATOM   2106 N  NE    . ARG C 3 199 ? -17.253 29.472 8.428   1.00 48.66 ? 254 ARG A NE    1 
ATOM   2107 C  CZ    . ARG C 3 199 ? -16.950 28.178 8.324   1.00 48.40 ? 254 ARG A CZ    1 
ATOM   2108 N  NH1   . ARG C 3 199 ? -16.815 27.431 9.412   1.00 48.07 ? 254 ARG A NH1   1 
ATOM   2109 N  NH2   . ARG C 3 199 ? -16.786 27.629 7.128   1.00 48.53 ? 254 ARG A NH2   1 
ATOM   2110 N  N     . LYS C 3 200 ? -20.689 31.472 14.077  1.00 46.62 ? 255 LYS A N     1 
ATOM   2111 C  CA    . LYS C 3 200 ? -20.704 32.103 15.390  1.00 46.82 ? 255 LYS A CA    1 
ATOM   2112 C  C     . LYS C 3 200 ? -19.371 31.824 16.099  1.00 46.93 ? 255 LYS A C     1 
ATOM   2113 O  O     . LYS C 3 200 ? -19.161 30.729 16.627  1.00 47.09 ? 255 LYS A O     1 
ATOM   2114 C  CB    . LYS C 3 200 ? -21.903 31.603 16.202  1.00 46.74 ? 255 LYS A CB    1 
ATOM   2115 C  CG    . LYS C 3 200 ? -22.030 32.224 17.583  1.00 47.30 ? 255 LYS A CG    1 
ATOM   2116 C  CD    . LYS C 3 200 ? -23.476 32.221 18.076  1.00 47.85 ? 255 LYS A CD    1 
ATOM   2117 C  CE    . LYS C 3 200 ? -24.153 33.559 17.793  1.00 48.14 ? 255 LYS A CE    1 
ATOM   2118 N  NZ    . LYS C 3 200 ? -23.679 34.648 18.710  1.00 48.78 ? 255 LYS A NZ    1 
ATOM   2119 N  N     . ILE C 3 201 ? -18.480 32.821 16.088  1.00 47.02 ? 256 ILE A N     1 
ATOM   2120 C  CA    . ILE C 3 201 ? -17.117 32.702 16.643  1.00 47.10 ? 256 ILE A CA    1 
ATOM   2121 C  C     . ILE C 3 201 ? -17.002 33.312 18.045  1.00 47.18 ? 256 ILE A C     1 
ATOM   2122 O  O     . ILE C 3 201 ? -17.716 34.261 18.371  1.00 47.14 ? 256 ILE A O     1 
ATOM   2123 C  CB    . ILE C 3 201 ? -16.059 33.389 15.721  1.00 47.08 ? 256 ILE A CB    1 
ATOM   2124 C  CG1   . ILE C 3 201 ? -16.130 32.862 14.278  1.00 47.32 ? 256 ILE A CG1   1 
ATOM   2125 C  CG2   . ILE C 3 201 ? -14.649 33.251 16.292  1.00 47.07 ? 256 ILE A CG2   1 
ATOM   2126 C  CD1   . ILE C 3 201 ? -15.471 31.496 14.026  1.00 47.47 ? 256 ILE A CD1   1 
ATOM   2127 N  N     . LEU C 3 202 ? -16.093 32.773 18.860  1.00 47.34 ? 257 LEU A N     1 
ATOM   2128 C  CA    . LEU C 3 202 ? -15.810 33.329 20.188  1.00 47.51 ? 257 LEU A CA    1 
ATOM   2129 C  C     . LEU C 3 202 ? -14.334 33.287 20.603  1.00 47.71 ? 257 LEU A C     1 
ATOM   2130 O  O     . LEU C 3 202 ? -13.637 32.304 20.346  1.00 47.74 ? 257 LEU A O     1 
ATOM   2131 C  CB    . LEU C 3 202 ? -16.679 32.656 21.259  1.00 47.52 ? 257 LEU A CB    1 
ATOM   2132 C  CG    . LEU C 3 202 ? -17.054 31.167 21.197  1.00 47.47 ? 257 LEU A CG    1 
ATOM   2133 C  CD1   . LEU C 3 202 ? -15.853 30.230 21.297  1.00 47.11 ? 257 LEU A CD1   1 
ATOM   2134 C  CD2   . LEU C 3 202 ? -18.050 30.862 22.307  1.00 47.51 ? 257 LEU A CD2   1 
ATOM   2135 N  N     . LEU C 3 203 ? -13.879 34.381 21.224  1.00 47.95 ? 258 LEU A N     1 
ATOM   2136 C  CA    . LEU C 3 203 ? -12.604 34.470 21.975  1.00 48.11 ? 258 LEU A CA    1 
ATOM   2137 C  C     . LEU C 3 203 ? -12.378 35.921 22.396  1.00 48.17 ? 258 LEU A C     1 
ATOM   2138 O  O     . LEU C 3 203 ? -11.678 36.209 23.368  1.00 48.33 ? 258 LEU A O     1 
ATOM   2139 C  CB    . LEU C 3 203 ? -11.388 33.964 21.175  1.00 48.13 ? 258 LEU A CB    1 
ATOM   2140 C  CG    . LEU C 3 203 ? -10.327 33.077 21.865  1.00 48.29 ? 258 LEU A CG    1 
ATOM   2141 C  CD1   . LEU C 3 203 ? -9.380  32.482 20.810  1.00 48.59 ? 258 LEU A CD1   1 
ATOM   2142 C  CD2   . LEU C 3 203 ? -9.514  33.775 22.981  1.00 48.12 ? 258 LEU A CD2   1 
ATOM   2143 O  OXT   . LEU C 3 203 ? -12.896 36.849 21.771  1.00 48.25 ? 258 LEU A OXT   1 
HETATM 2144 C  CA    . XL3 D 4 .   ? -7.163  14.220 -1.220  1.00 46.65 ? 14  XL3 B CA    1 
HETATM 2145 C  CB    . XL3 D 4 .   ? -7.872  15.382 -0.513  1.00 46.73 ? 14  XL3 B CB    1 
HETATM 2146 C  CC    . XL3 D 4 .   ? -9.214  15.754 -1.141  1.00 45.96 ? 14  XL3 B CC    1 
HETATM 2147 S  SG    . XL3 D 4 .   ? -9.069  17.220 -2.228  1.00 45.49 ? 14  XL3 B SG    1 
HETATM 2148 MN MN    . MN  E 5 .   ? -16.284 23.464 5.790   1.00 42.13 ? 1   MN  A MN    1 
HETATM 2149 C  C1    . AKG F 6 .   ? -16.141 25.902 4.342   1.00 47.43 ? 259 AKG A C1    1 
HETATM 2150 O  O1    . AKG F 6 .   ? -15.704 25.325 5.365   1.00 48.11 ? 259 AKG A O1    1 
HETATM 2151 O  O2    . AKG F 6 .   ? -16.017 27.128 4.163   1.00 48.34 ? 259 AKG A O2    1 
HETATM 2152 C  C2    . AKG F 6 .   ? -16.822 25.110 3.329   1.00 46.67 ? 259 AKG A C2    1 
HETATM 2153 O  O5    . AKG F 6 .   ? -16.939 23.906 3.519   1.00 45.11 ? 259 AKG A O5    1 
HETATM 2154 C  C3    . AKG F 6 .   ? -17.351 25.810 2.089   1.00 45.72 ? 259 AKG A C3    1 
HETATM 2155 C  C4    . AKG F 6 .   ? -18.354 24.945 1.330   1.00 46.50 ? 259 AKG A C4    1 
HETATM 2156 C  C5    . AKG F 6 .   ? -18.853 25.599 0.056   1.00 46.47 ? 259 AKG A C5    1 
HETATM 2157 O  O3    . AKG F 6 .   ? -20.026 25.376 -0.297  1.00 46.63 ? 259 AKG A O3    1 
HETATM 2158 O  O4    . AKG F 6 .   ? -18.101 26.326 -0.624  1.00 46.19 ? 259 AKG A O4    1 
HETATM 2159 O  O     . HOH G 7 .   ? -2.321  17.543 16.022  1.00 47.36 ? 20  HOH C O     1 
HETATM 2160 O  O     . HOH G 7 .   ? 0.757   8.892  -1.547  1.00 66.58 ? 27  HOH C O     1 
HETATM 2161 O  O     . HOH G 7 .   ? 4.178   9.652  5.870   1.00 65.64 ? 28  HOH C O     1 
HETATM 2162 O  O     . HOH G 7 .   ? 4.484   11.471 -0.120  1.00 52.41 ? 29  HOH C O     1 
HETATM 2163 O  O     . HOH G 7 .   ? -20.475 14.902 -12.138 1.00 62.77 ? 32  HOH C O     1 
HETATM 2164 O  O     . HOH H 7 .   ? -31.515 12.719 3.735   1.00 56.90 ? 260 HOH A O     1 
HETATM 2165 O  O     . HOH H 7 .   ? -23.888 27.274 -5.696  1.00 43.96 ? 261 HOH A O     1 
HETATM 2166 O  O     . HOH H 7 .   ? -18.857 37.358 -12.166 1.00 45.78 ? 262 HOH A O     1 
HETATM 2167 O  O     . HOH H 7 .   ? -10.611 40.600 -4.398  1.00 60.97 ? 263 HOH A O     1 
HETATM 2168 O  O     . HOH H 7 .   ? -7.592  33.564 -0.914  1.00 39.45 ? 264 HOH A O     1 
HETATM 2169 O  O     . HOH H 7 .   ? -0.150  31.105 4.825   1.00 37.58 ? 265 HOH A O     1 
HETATM 2170 O  O     . HOH H 7 .   ? 0.173   23.187 -4.058  1.00 57.83 ? 266 HOH A O     1 
HETATM 2171 O  O     . HOH H 7 .   ? -14.732 34.517 -13.546 1.00 45.16 ? 267 HOH A O     1 
HETATM 2172 O  O     . HOH H 7 .   ? -18.124 18.513 -14.401 1.00 54.63 ? 268 HOH A O     1 
HETATM 2173 O  O     . HOH H 7 .   ? -12.794 23.788 -15.660 1.00 43.39 ? 269 HOH A O     1 
HETATM 2174 O  O     . HOH H 7 .   ? -17.870 24.304 6.308   1.00 64.44 ? 270 HOH A O     1 
HETATM 2175 O  O     . HOH H 7 .   ? -32.224 18.789 -2.900  1.00 43.73 ? 271 HOH A O     1 
HETATM 2176 O  O     . HOH H 7 .   ? -25.406 37.768 -12.679 1.00 72.39 ? 272 HOH A O     1 
HETATM 2177 O  O     . HOH H 7 .   ? -16.750 49.859 -3.698  1.00 62.99 ? 273 HOH A O     1 
HETATM 2178 O  O     . HOH H 7 .   ? 2.500   26.565 -3.737  1.00 48.03 ? 274 HOH A O     1 
HETATM 2179 O  O     . HOH H 7 .   ? -6.742  32.461 -3.120  1.00 45.10 ? 275 HOH A O     1 
HETATM 2180 O  O     . HOH H 7 .   ? -7.464  28.914 -8.593  1.00 44.17 ? 276 HOH A O     1 
HETATM 2181 O  O     . HOH H 7 .   ? -21.587 20.584 -9.850  1.00 48.36 ? 277 HOH A O     1 
HETATM 2182 O  O     . HOH H 7 .   ? -21.181 26.442 -15.967 1.00 47.32 ? 278 HOH A O     1 
HETATM 2183 O  O     . HOH H 7 .   ? -21.720 20.969 13.457  1.00 53.80 ? 279 HOH A O     1 
HETATM 2184 O  O     . HOH H 7 .   ? -16.672 45.008 15.232  1.00 55.61 ? 280 HOH A O     1 
HETATM 2185 O  O     . HOH H 7 .   ? -25.627 25.921 -12.670 1.00 44.03 ? 281 HOH A O     1 
HETATM 2186 O  O     . HOH H 7 .   ? -35.827 36.909 -7.469  1.00 49.43 ? 282 HOH A O     1 
HETATM 2187 O  O     . HOH H 7 .   ? -11.117 45.805 2.730   1.00 68.69 ? 283 HOH A O     1 
HETATM 2188 O  O     . HOH H 7 .   ? -1.457  33.069 9.071   1.00 57.28 ? 284 HOH A O     1 
HETATM 2189 O  O     . HOH H 7 .   ? -33.400 15.242 2.834   1.00 67.86 ? 285 HOH A O     1 
HETATM 2190 O  O     . HOH H 7 .   ? -30.261 12.115 1.778   1.00 56.24 ? 286 HOH A O     1 
HETATM 2191 O  O     . HOH H 7 .   ? -19.483 21.504 14.977  1.00 64.16 ? 287 HOH A O     1 
HETATM 2192 O  O     . HOH H 7 .   ? -7.221  36.234 -4.101  1.00 56.71 ? 288 HOH A O     1 
HETATM 2193 O  O     . HOH H 7 .   ? -22.634 22.661 -16.077 1.00 61.06 ? 289 HOH A O     1 
HETATM 2194 O  O     . HOH H 7 .   ? -14.612 42.834 -10.528 1.00 53.26 ? 290 HOH A O     1 
HETATM 2195 O  O     . HOH H 7 .   ? -9.295  31.295 -8.409  1.00 41.97 ? 291 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DC  1   1   1   DC  C   B . n 
A 1 2   DT  2   2   2   DT  T   B . n 
A 1 3   DG  3   3   3   DG  G   B . n 
A 1 4   DT  4   4   4   DT  T   B . n 
A 1 5   DA  5   5   5   DA  A   B . n 
A 1 6   DT  6   6   6   DT  T   B . n 
A 1 7   MA7 7   7   7   MA7 MA7 B . n 
A 1 8   DA  8   8   8   DA  A   B . n 
A 1 9   DC  9   9   9   DC  C   B . n 
A 1 10  DT  10  10  10  DT  T   B . n 
A 1 11  DG  11  11  11  DG  G   B . n 
A 1 12  DC  12  12  12  DC  C   B . n 
A 1 13  DG  13  13  13  DG  G   B . n 
B 2 1   DT  1   1   1   DT  T   C . n 
B 2 2   DC  2   2   2   DC  C   C . n 
B 2 3   DG  3   3   3   DG  G   C . n 
B 2 4   DC  4   4   4   DC  C   C . n 
B 2 5   DA  5   5   5   DA  A   C . n 
B 2 6   DG  6   6   6   DG  G   C . n 
B 2 7   DT  7   7   7   DT  T   C . n 
B 2 8   DT  8   8   8   DT  T   C . n 
B 2 9   DA  9   9   9   DA  A   C . n 
B 2 10  DT  10  10  10  DT  T   C . n 
B 2 11  DA  11  11  11  DA  A   C . n 
B 2 12  DC  12  12  12  DC  C   C . n 
B 2 13  DA  13  13  13  DA  A   C . n 
C 3 1   SER 1   56  56  SER SER A . n 
C 3 2   TRP 2   57  57  TRP TRP A . n 
C 3 3   ARG 3   58  58  ARG ARG A . n 
C 3 4   HIS 4   59  59  HIS HIS A . n 
C 3 5   ILE 5   60  60  ILE ILE A . n 
C 3 6   ARG 6   61  61  ARG ARG A . n 
C 3 7   ALA 7   62  62  ALA ALA A . n 
C 3 8   GLU 8   63  63  GLU GLU A . n 
C 3 9   GLY 9   64  64  GLY GLY A . n 
C 3 10  LEU 10  65  65  LEU LEU A . n 
C 3 11  ASP 11  66  66  ASP ASP A . n 
C 3 12  SER 12  67  67  SER SER A . n 
C 3 13  SER 13  68  68  SER SER A . n 
C 3 14  TYR 14  69  69  TYR TYR A . n 
C 3 15  THR 15  70  70  THR THR A . n 
C 3 16  VAL 16  71  71  VAL VAL A . n 
C 3 17  LEU 17  72  72  LEU LEU A . n 
C 3 18  PHE 18  73  73  PHE PHE A . n 
C 3 19  GLY 19  74  74  GLY GLY A . n 
C 3 20  LYS 20  75  75  LYS LYS A . n 
C 3 21  ALA 21  76  76  ALA ALA A . n 
C 3 22  GLU 22  77  77  GLU GLU A . n 
C 3 23  ALA 23  78  78  ALA ALA A . n 
C 3 24  ASP 24  79  79  ASP ASP A . n 
C 3 25  GLU 25  80  80  GLU GLU A . n 
C 3 26  ILE 26  81  81  ILE ILE A . n 
C 3 27  PHE 27  82  82  PHE PHE A . n 
C 3 28  GLN 28  83  83  GLN GLN A . n 
C 3 29  GLU 29  84  84  GLU GLU A . n 
C 3 30  LEU 30  85  85  LEU LEU A . n 
C 3 31  GLU 31  86  86  GLU GLU A . n 
C 3 32  LYS 32  87  87  LYS LYS A . n 
C 3 33  GLU 33  88  88  GLU GLU A . n 
C 3 34  VAL 34  89  89  VAL VAL A . n 
C 3 35  GLU 35  90  90  GLU GLU A . n 
C 3 36  TYR 36  91  91  TYR TYR A . n 
C 3 37  PHE 37  92  92  PHE PHE A . n 
C 3 38  THR 38  93  93  THR THR A . n 
C 3 39  GLY 39  94  94  GLY GLY A . n 
C 3 40  ALA 40  95  95  ALA ALA A . n 
C 3 41  LEU 41  96  96  LEU LEU A . n 
C 3 42  ALA 42  97  97  ALA ALA A . n 
C 3 43  ARG 43  98  98  ARG ARG A . n 
C 3 44  VAL 44  99  99  VAL VAL A . n 
C 3 45  GLN 45  100 100 GLN GLN A . n 
C 3 46  VAL 46  101 101 VAL VAL A . n 
C 3 47  PHE 47  102 102 PHE PHE A . n 
C 3 48  GLY 48  103 103 GLY GLY A . n 
C 3 49  LYS 49  104 104 LYS LYS A . n 
C 3 50  TRP 50  105 105 TRP TRP A . n 
C 3 51  HIS 51  106 106 HIS HIS A . n 
C 3 52  SER 52  107 107 SER SER A . n 
C 3 53  VAL 53  108 108 VAL VAL A . n 
C 3 54  PRO 54  109 109 PRO PRO A . n 
C 3 55  ARG 55  110 110 ARG ARG A . n 
C 3 56  LYS 56  111 111 LYS LYS A . n 
C 3 57  GLN 57  112 112 GLN GLN A . n 
C 3 58  ALA 58  113 113 ALA ALA A . n 
C 3 59  THR 59  114 114 THR THR A . n 
C 3 60  TYR 60  115 115 TYR TYR A . n 
C 3 61  GLY 61  116 116 GLY GLY A . n 
C 3 62  ASP 62  117 117 ASP ASP A . n 
C 3 63  ALA 63  118 118 ALA ALA A . n 
C 3 64  GLY 64  119 119 GLY GLY A . n 
C 3 65  LEU 65  120 120 LEU LEU A . n 
C 3 66  THR 66  121 121 THR THR A . n 
C 3 67  TYR 67  122 122 TYR TYR A . n 
C 3 68  THR 68  123 123 THR THR A . n 
C 3 69  PHE 69  124 124 PHE PHE A . n 
C 3 70  SER 70  125 125 SER SER A . n 
C 3 71  GLY 71  126 126 GLY GLY A . n 
C 3 72  LEU 72  127 127 LEU LEU A . n 
C 3 73  THR 73  128 128 THR THR A . n 
C 3 74  LEU 74  129 129 LEU LEU A . n 
C 3 75  SER 75  130 130 SER SER A . n 
C 3 76  PRO 76  131 131 PRO PRO A . n 
C 3 77  LYS 77  132 132 LYS LYS A . n 
C 3 78  PRO 78  133 133 PRO PRO A . n 
C 3 79  TRP 79  134 134 TRP TRP A . n 
C 3 80  ILE 80  135 135 ILE ILE A . n 
C 3 81  PRO 81  136 136 PRO PRO A . n 
C 3 82  VAL 82  137 137 VAL VAL A . n 
C 3 83  LEU 83  138 138 LEU LEU A . n 
C 3 84  GLU 84  139 139 GLU GLU A . n 
C 3 85  ARG 85  140 140 ARG ARG A . n 
C 3 86  ILE 86  141 141 ILE ILE A . n 
C 3 87  ARG 87  142 142 ARG ARG A . n 
C 3 88  ASP 88  143 143 ASP ASP A . n 
C 3 89  HIS 89  144 144 HIS HIS A . n 
C 3 90  VAL 90  145 145 VAL VAL A . n 
C 3 91  SER 91  146 146 SER SER A . n 
C 3 92  GLY 92  147 147 GLY GLY A . n 
C 3 93  VAL 93  148 148 VAL VAL A . n 
C 3 94  THR 94  149 149 THR THR A . n 
C 3 95  GLY 95  150 150 GLY GLY A . n 
C 3 96  GLN 96  151 151 GLN GLN A . n 
C 3 97  THR 97  152 152 THR THR A . n 
C 3 98  PHE 98  153 153 PHE PHE A . n 
C 3 99  ASN 99  154 154 ASN ASN A . n 
C 3 100 PHE 100 155 155 PHE PHE A . n 
C 3 101 VAL 101 156 156 VAL VAL A . n 
C 3 102 LEU 102 157 157 LEU LEU A . n 
C 3 103 ILE 103 158 158 ILE ILE A . n 
C 3 104 ASN 104 159 159 ASN ASN A . n 
C 3 105 ARG 105 160 160 ARG ARG A . n 
C 3 106 TYR 106 161 161 TYR TYR A . n 
C 3 107 LYS 107 162 162 LYS LYS A . n 
C 3 108 ASP 108 163 163 ASP ASP A . n 
C 3 109 GLY 109 164 164 GLY GLY A . n 
C 3 110 SER 110 165 165 SER SER A . n 
C 3 111 ASP 111 166 166 ASP ASP A . n 
C 3 112 HIS 112 167 167 HIS HIS A . n 
C 3 113 ILE 113 168 168 ILE ILE A . n 
C 3 114 CYS 114 169 169 CYS CYS A . n 
C 3 115 GLU 115 170 170 GLU GLU A . n 
C 3 116 HIS 116 171 171 HIS HIS A . n 
C 3 117 ARG 117 172 172 ARG ARG A . n 
C 3 118 ASP 118 173 173 ASP ASP A . n 
C 3 119 ASP 119 174 174 ASP ASP A . n 
C 3 120 GLU 120 175 175 GLU GLU A . n 
C 3 121 ARG 121 176 176 ARG ARG A . n 
C 3 122 GLU 122 177 177 GLU GLU A . n 
C 3 123 LEU 123 178 178 LEU LEU A . n 
C 3 124 ALA 124 179 179 ALA ALA A . n 
C 3 125 PRO 125 180 180 PRO PRO A . n 
C 3 126 GLY 126 181 181 GLY GLY A . n 
C 3 127 SER 127 182 182 SER SER A . n 
C 3 128 PRO 128 183 183 PRO PRO A . n 
C 3 129 ILE 129 184 184 ILE ILE A . n 
C 3 130 ALA 130 185 185 ALA ALA A . n 
C 3 131 SER 131 186 186 SER SER A . n 
C 3 132 VAL 132 187 187 VAL VAL A . n 
C 3 133 SER 133 188 188 SER SER A . n 
C 3 134 PHE 134 189 189 PHE PHE A . n 
C 3 135 GLY 135 190 190 GLY GLY A . n 
C 3 136 ALA 136 191 191 ALA ALA A . n 
C 3 137 SER 137 192 192 SER SER A . n 
C 3 138 ARG 138 193 193 ARG ARG A . n 
C 3 139 ASP 139 194 194 ASP ASP A . n 
C 3 140 PHE 140 195 195 PHE PHE A . n 
C 3 141 VAL 141 196 196 VAL VAL A . n 
C 3 142 PHE 142 197 197 PHE PHE A . n 
C 3 143 ARG 143 198 198 ARG ARG A . n 
C 3 144 HIS 144 199 199 HIS HIS A . n 
C 3 145 LYS 145 200 200 LYS LYS A . n 
C 3 146 ASP 146 201 201 ASP ASP A . n 
C 3 147 SER 147 202 202 SER SER A . n 
C 3 148 ARG 148 203 203 ARG ARG A . n 
C 3 149 GLY 149 204 ?   ?   ?   A . n 
C 3 150 LYS 150 205 ?   ?   ?   A . n 
C 3 151 SER 151 206 ?   ?   ?   A . n 
C 3 152 PRO 152 207 207 PRO PRO A . n 
C 3 153 SER 153 208 208 SER SER A . n 
C 3 154 ARG 154 209 209 ARG ARG A . n 
C 3 155 ARG 155 210 210 ARG ARG A . n 
C 3 156 VAL 156 211 211 VAL VAL A . n 
C 3 157 ALA 157 212 212 ALA ALA A . n 
C 3 158 VAL 158 213 213 VAL VAL A . n 
C 3 159 VAL 159 214 214 VAL VAL A . n 
C 3 160 ARG 160 215 215 ARG ARG A . n 
C 3 161 LEU 161 216 216 LEU LEU A . n 
C 3 162 PRO 162 217 217 PRO PRO A . n 
C 3 163 LEU 163 218 218 LEU LEU A . n 
C 3 164 ALA 164 219 219 ALA ALA A . n 
C 3 165 HIS 165 220 220 HIS HIS A . n 
C 3 166 GLY 166 221 221 GLY GLY A . n 
C 3 167 SER 167 222 222 SER SER A . n 
C 3 168 LEU 168 223 223 LEU LEU A . n 
C 3 169 LEU 169 224 224 LEU LEU A . n 
C 3 170 MET 170 225 225 MET MET A . n 
C 3 171 MET 171 226 226 MET MET A . n 
C 3 172 ASN 172 227 227 ASN ASN A . n 
C 3 173 HIS 173 228 228 HIS HIS A . n 
C 3 174 PRO 174 229 229 PRO PRO A . n 
C 3 175 THR 175 230 230 THR THR A . n 
C 3 176 ASN 176 231 231 ASN ASN A . n 
C 3 177 THR 177 232 232 THR THR A . n 
C 3 178 HIS 178 233 233 HIS HIS A . n 
C 3 179 TRP 179 234 234 TRP TRP A . n 
C 3 180 TYR 180 235 235 TYR TYR A . n 
C 3 181 HIS 181 236 236 HIS HIS A . n 
C 3 182 SER 182 237 237 SER SER A . n 
C 3 183 LEU 183 238 238 LEU LEU A . n 
C 3 184 PRO 184 239 239 PRO PRO A . n 
C 3 185 VAL 185 240 240 VAL VAL A . n 
C 3 186 ARG 186 241 241 ARG ARG A . n 
C 3 187 LYS 187 242 242 LYS LYS A . n 
C 3 188 LYS 188 243 243 LYS LYS A . n 
C 3 189 VAL 189 244 244 VAL VAL A . n 
C 3 190 LEU 190 245 245 LEU LEU A . n 
C 3 191 ALA 191 246 246 ALA ALA A . n 
C 3 192 PRO 192 247 247 PRO PRO A . n 
C 3 193 ARG 193 248 248 ARG ARG A . n 
C 3 194 VAL 194 249 249 VAL VAL A . n 
C 3 195 ASN 195 250 250 ASN ASN A . n 
C 3 196 LEU 196 251 251 LEU LEU A . n 
C 3 197 THR 197 252 252 THR THR A . n 
C 3 198 PHE 198 253 253 PHE PHE A . n 
C 3 199 ARG 199 254 254 ARG ARG A . n 
C 3 200 LYS 200 255 255 LYS LYS A . n 
C 3 201 ILE 201 256 256 ILE ILE A . n 
C 3 202 LEU 202 257 257 LEU LEU A . n 
C 3 203 LEU 203 258 258 LEU LEU A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 XL3 1  14  1  XL3 XL3 B . 
E 5 MN  1  1   1  MN  MN  A . 
F 6 AKG 1  259 1  AKG AKG A . 
G 7 HOH 1  20  20 HOH HOH C . 
G 7 HOH 2  27  27 HOH HOH C . 
G 7 HOH 3  28  28 HOH HOH C . 
G 7 HOH 4  29  29 HOH HOH C . 
G 7 HOH 5  32  32 HOH HOH C . 
H 7 HOH 1  260 1  HOH HOH A . 
H 7 HOH 2  261 2  HOH HOH A . 
H 7 HOH 3  262 3  HOH HOH A . 
H 7 HOH 4  263 4  HOH HOH A . 
H 7 HOH 5  264 5  HOH HOH A . 
H 7 HOH 6  265 6  HOH HOH A . 
H 7 HOH 7  266 7  HOH HOH A . 
H 7 HOH 8  267 8  HOH HOH A . 
H 7 HOH 9  268 9  HOH HOH A . 
H 7 HOH 10 269 10 HOH HOH A . 
H 7 HOH 11 270 11 HOH HOH A . 
H 7 HOH 12 271 12 HOH HOH A . 
H 7 HOH 13 272 13 HOH HOH A . 
H 7 HOH 14 273 14 HOH HOH A . 
H 7 HOH 15 274 15 HOH HOH A . 
H 7 HOH 16 275 16 HOH HOH A . 
H 7 HOH 17 276 17 HOH HOH A . 
H 7 HOH 18 277 18 HOH HOH A . 
H 7 HOH 19 278 19 HOH HOH A . 
H 7 HOH 20 279 21 HOH HOH A . 
H 7 HOH 21 280 22 HOH HOH A . 
H 7 HOH 22 281 23 HOH HOH A . 
H 7 HOH 23 282 24 HOH HOH A . 
H 7 HOH 24 283 25 HOH HOH A . 
H 7 HOH 25 284 26 HOH HOH A . 
H 7 HOH 26 285 30 HOH HOH A . 
H 7 HOH 27 286 31 HOH HOH A . 
H 7 HOH 28 287 33 HOH HOH A . 
H 7 HOH 29 288 34 HOH HOH A . 
H 7 HOH 30 289 35 HOH HOH A . 
H 7 HOH 31 290 36 HOH HOH A . 
H 7 HOH 32 291 37 HOH HOH A . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    MA7 
_pdbx_struct_mod_residue.label_seq_id     7 
_pdbx_struct_mod_residue.auth_asym_id     B 
_pdbx_struct_mod_residue.auth_comp_id     MA7 
_pdbx_struct_mod_residue.auth_seq_id      7 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   DA 
_pdbx_struct_mod_residue.details          "1N-METHYLADENOSINE-5'-MONOPHOSPHATE" 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_assembly_prop.biol_id   1 
_pdbx_struct_assembly_prop.type      'ABSA (A^2)' 
_pdbx_struct_assembly_prop.value     4390 
_pdbx_struct_assembly_prop.details   ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 OD2 ? C ASP 118 ? A ASP 173 ? 1_555 MN ? E MN . ? A MN 1 ? 1_555 O5 ? F AKG . ? A AKG 259 ? 1_555 170.2 ? 
2 OD2 ? C ASP 118 ? A ASP 173 ? 1_555 MN ? E MN . ? A MN 1 ? 1_555 O1 ? F AKG . ? A AKG 259 ? 1_555 110.2 ? 
3 O5  ? F AKG .   ? A AKG 259 ? 1_555 MN ? E MN . ? A MN 1 ? 1_555 O1 ? F AKG . ? A AKG 259 ? 1_555 72.9  ? 
4 OD2 ? C ASP 118 ? A ASP 173 ? 1_555 MN ? E MN . ? A MN 1 ? 1_555 O  ? H HOH . ? A HOH 270 ? 1_555 84.2  ? 
5 O5  ? F AKG .   ? A AKG 259 ? 1_555 MN ? E MN . ? A MN 1 ? 1_555 O  ? H HOH . ? A HOH 270 ? 1_555 87.0  ? 
6 O1  ? F AKG .   ? A AKG 259 ? 1_555 MN ? E MN . ? A MN 1 ? 1_555 O  ? H HOH . ? A HOH 270 ? 1_555 83.5  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-04-22 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2021-10-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Database references'       
4 3 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' database_2             
2 3 'Structure model' pdbx_struct_conn_angle 
3 3 'Structure model' struct_conn            
4 3 'Structure model' struct_conn_type       
5 3 'Structure model' struct_ref_seq_dif     
6 3 'Structure model' struct_site            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_database_2.pdbx_DOI'                        
2  3 'Structure model' '_database_2.pdbx_database_accession'         
3  3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
4  3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
5  3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
6  3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
7  3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
8  3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
9  3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
13 3 'Structure model' '_pdbx_struct_conn_angle.value'               
14 3 'Structure model' '_struct_conn.conn_type_id'                   
15 3 'Structure model' '_struct_conn.id'                             
16 3 'Structure model' '_struct_conn.pdbx_dist_value'                
17 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
18 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
19 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
20 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
21 3 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
22 3 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
23 3 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
24 3 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
25 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
26 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
27 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
28 3 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
29 3 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
30 3 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
31 3 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
32 3 'Structure model' '_struct_conn_type.id'                        
33 3 'Structure model' '_struct_ref_seq_dif.details'                 
34 3 'Structure model' '_struct_site.pdbx_auth_asym_id'              
35 3 'Structure model' '_struct_site.pdbx_auth_comp_id'              
36 3 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined -19.0414 27.1585 3.4167 -0.1212 -0.0837 -0.0185 -0.0357 0.0399  -0.0588 6.4997 3.4984 3.1932  -1.5488 0.6638 0.7269  
0.1904 -0.5740 -0.1145 0.5211  -0.0572 0.2472  0.2025 -0.1954 -0.1332 'X-RAY DIFFRACTION' 
2 ? refined -3.8017  9.9477  3.8102 0.0048  0.2572  -0.0493 -0.0683 -0.2019 -0.1794 0.2860 9.8193 0.4765  -1.2984 0.1182 -1.8321 
0.3441 0.2799  -0.3341 -0.2940 -0.1925 0.0755  0.3857 0.2216  -0.1515 'X-RAY DIFFRACTION' 
3 ? refined -3.1399  12.5084 2.9153 0.3191  -0.0019 0.0123  0.1154  -0.1596 -0.1138 3.6146 2.8326 26.6515 -0.9134 9.2848 0.3537  
1.3441 0.4104  -0.7444 0.0585  -0.0685 -0.3923 1.3151 1.0749  -1.2756 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 56 C 1 A 258 C 203 ? 'X-RAY DIFFRACTION' ? 
2 2 B 1  A 1 B 13  A 13  ? 'X-RAY DIFFRACTION' ? 
3 3 C 1  B 1 C 13  B 13  ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement       5.2.0019 ? 1 
HKL-2000 'data reduction' .        ? 2 
HKL-2000 'data scaling'   .        ? 3 
PHASES   phasing          .        ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OP2 C DT 8 ? ? O C HOH 28 ? ? 2.16 
2 1 OP1 C DT 8 ? ? O C HOH 29 ? ? 2.18 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" B DG 3  ? ? "C1'" B DG 3  ? ? N9    B DG 3  ? ? 110.23 108.30 1.93  0.30 N 
2 1 "O4'" B DT 4  ? ? "C1'" B DT 4  ? ? N1    B DT 4  ? ? 110.57 108.30 2.27  0.30 N 
3 1 "O4'" B DA 5  ? ? "C1'" B DA 5  ? ? N9    B DA 5  ? ? 110.65 108.30 2.35  0.30 N 
4 1 "O4'" B DA 8  ? ? "C1'" B DA 8  ? ? N9    B DA 8  ? ? 110.44 108.30 2.14  0.30 N 
5 1 "C3'" C DG 3  ? ? "C2'" C DG 3  ? ? "C1'" C DG 3  ? ? 96.93  102.40 -5.47 0.80 N 
6 1 "O4'" C DC 4  ? ? "C1'" C DC 4  ? ? N1    C DC 4  ? ? 110.27 108.30 1.97  0.30 N 
7 1 "O4'" C DT 7  ? ? "C1'" C DT 7  ? ? N1    C DT 7  ? ? 112.20 108.30 3.90  0.30 N 
8 1 "O4'" C DC 12 ? ? "C1'" C DC 12 ? ? N1    C DC 12 ? ? 110.27 108.30 1.97  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 63  ? ? -53.40 105.08  
2 1 ARG A 110 ? ? 179.00 -169.05 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 204 ? C GLY 149 
2 1 Y 1 A LYS 205 ? C LYS 150 
3 1 Y 1 A SER 206 ? C SER 151 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
3BUC 'double helix'        
3BUC 'b-form double helix' 
3BUC 'bulge loop'          
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 3  1_555 B DC 12 1_555 -0.170 -0.214 0.270  -5.739  -11.546 2.442   1  B_DG3:DC12_C B 3  ? C 12 ? 19 1 
1 A DT 4  1_555 B DA 11 1_555 0.026  -0.080 -0.376 4.210   -1.504  2.535   2  B_DT4:DA11_C B 4  ? C 11 ? 20 1 
1 A DA 5  1_555 B DT 10 1_555 -0.406 -0.448 -0.049 7.334   9.402   2.138   3  B_DA5:DT10_C B 5  ? C 10 ? 20 1 
1 A DT 6  1_555 B DT 8  1_555 1.964  -1.808 0.718  42.533  -7.803  5.227   4  B_DT6:DT8_C  B 6  ? C 8  ? 16 1 
1 A DA 8  1_555 B DT 7  1_555 0.029  -0.198 -0.037 -14.952 4.803   3.818   5  B_DA8:DT7_C  B 8  ? C 7  ? 20 1 
1 A DC 9  1_555 B DG 6  1_555 1.273  -0.235 0.308  -0.990  -18.747 10.592  6  B_DC9:DG6_C  B 9  ? C 6  ? ?  1 
1 A DT 10 1_555 B DA 5  1_555 -0.062 -0.340 -0.267 8.845   -11.505 -8.252  7  B_DT10:DA5_C B 10 ? C 5  ? 20 1 
1 A DG 11 1_555 B DC 4  1_555 0.106  -0.380 0.053  -4.128  -10.777 -4.125  8  B_DG11:DC4_C B 11 ? C 4  ? 19 1 
1 A DC 12 1_555 B DG 3  1_555 0.665  -0.335 0.164  -8.656  -9.463  1.336   9  B_DC12:DG3_C B 12 ? C 3  ? 19 1 
1 A DG 13 1_555 B DC 2  1_555 -0.274 -0.310 0.148  6.920   0.989   -3.023  10 B_DG13:DC2_C B 13 ? C 2  ? 19 1 
1 A DC 1  1_555 A DG 13 8_555 0.370  3.326  -1.072 15.497  -14.007 66.928  11 B_DC1:DG13_B B 1  ? B 13 ? ?  ? 
1 A DC 1  1_555 A DG 13 1_555 -0.370 3.326  1.072  -15.497 -14.007 -66.928 12 B_DC1:DG13_B B 1  ? B 13 ? ?  ? 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 3  1_555 B DC 12 1_555 A DT 4  1_555 B DA 11 1_555 -0.846 -1.056 3.083 5.525  0.403   27.096 -2.300 2.998  2.841 0.848   
-11.638 27.646 1 BB_DG3DT4:DA11DC12_CC B 3  ? C 12 ? B 4  ? C 11 ? 
1 A DT 4  1_555 B DA 11 1_555 A DA 5  1_555 B DT 10 1_555 0.269  -0.585 3.261 -4.562 6.213   33.556 -1.936 -1.150 3.046 10.588  
7.775   34.405 2 BB_DT4DA5:DT10DA11_CC B 4  ? C 11 ? B 5  ? C 10 ? 
1 A DA 5  1_555 B DT 10 1_555 A DT 6  1_555 B DT 8  1_555 0.696  0.604  2.461 -2.703 0.034   50.973 0.700  -0.948 2.423 0.039   
3.139   51.040 3 BB_DA5DT6:DT8DT10_CC  B 5  ? C 10 ? B 6  ? C 8  ? 
1 A DA 8  1_555 B DT 7  1_555 A DC 9  1_555 B DG 6  1_555 -0.566 -0.386 3.351 4.819  -10.285 33.269 0.950  1.683  3.215 -17.346 
-8.127  35.103 4 BB_DA8DC9:DG6DT7_CC   B 8  ? C 7  ? B 9  ? C 6  ? 
1 A DC 9  1_555 B DG 6  1_555 A DT 10 1_555 B DA 5  1_555 -0.984 -0.023 3.001 5.311  6.238   23.563 -1.706 3.686  2.626 14.717  
-12.530 24.928 5 BB_DC9DT10:DA5DG6_CC  B 9  ? C 6  ? B 10 ? C 5  ? 
1 A DT 10 1_555 B DA 5  1_555 A DG 11 1_555 B DC 4  1_555 0.833  -0.303 3.649 1.109  8.927   40.476 -1.488 -1.046 3.528 12.714  
-1.579  41.422 6 BB_DT10DG11:DC4DA5_CC B 10 ? C 5  ? B 11 ? C 4  ? 
1 A DG 11 1_555 B DC 4  1_555 A DC 12 1_555 B DG 3  1_555 0.894  -0.391 3.316 1.325  -1.539  33.529 -0.419 -1.325 3.361 -2.665  
-2.294  33.589 7 BB_DG11DC12:DG3DC4_CC B 11 ? C 4  ? B 12 ? C 3  ? 
1 A DC 12 1_555 B DG 3  1_555 A DG 13 1_555 B DC 2  1_555 -0.546 -0.350 2.858 1.625  10.696  25.810 -2.884 1.459  2.480 22.716  
-3.452  27.950 8 BB_DC12DG13:DC2DG3_CC B 12 ? C 3  ? B 13 ? C 2  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 propane-1-thiol      XL3 
5 'MANGANESE (II) ION' MN  
6 '2-OXOGLUTARIC ACID' AKG 
7 water                HOH 
#