data_3C4C
# 
_entry.id   3C4C 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3C4C         
RCSB  RCSB046324   
WWPDB D_1000046324 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3C4D 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3C4C 
_pdbx_database_status.recvd_initial_deposition_date   2008-01-29 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, K.Y.J.' 1 
'Wang, W.'      2 
# 
_citation.id                        primary 
_citation.title                     
'Discovery of a selective inhibitor of oncogenic B-Raf kinase with potent antimelanoma activity' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            105 
_citation.page_first                3041 
_citation.page_last                 3046 
_citation.year                      2008 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18287029 
_citation.pdbx_database_id_DOI      10.1073/pnas.0711741105 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tsai, J.'         1  
primary 'Lee, J.T.'        2  
primary 'Wang, W.'         3  
primary 'Zhang, J.'        4  
primary 'Cho, H.'          5  
primary 'Mamo, S.'         6  
primary 'Bremer, R.'       7  
primary 'Gillette, S.'     8  
primary 'Kong, J.'         9  
primary 'Haass, N.K.'      10 
primary 'Sproesser, K.'    11 
primary 'Li, L.'           12 
primary 'Smalley, K.S.'    13 
primary 'Fong, D.'         14 
primary 'Zhu, Y.L.'        15 
primary 'Marimuthu, A.'    16 
primary 'Nguyen, H.'       17 
primary 'Lam, B.'          18 
primary 'Liu, J.'          19 
primary 'Cheung, I.'       20 
primary 'Rice, J.'         21 
primary 'Suzuki, Y.'       22 
primary 'Luu, C.'          23 
primary 'Settachatgul, C.' 24 
primary 'Shellooe, R.'     25 
primary 'Cantwell, J.'     26 
primary 'Kim, S.H.'        27 
primary 'Schlessinger, J.' 28 
primary 'Zhang, K.Y.'      29 
primary 'West, B.L.'       30 
primary 'Powell, B.'       31 
primary 'Habets, G.'       32 
primary 'Zhang, C.'        33 
primary 'Ibrahim, P.N.'    34 
primary 'Hirth, P.'        35 
primary 'Artis, D.R.'      36 
primary 'Herlyn, M.'       37 
primary 'Bollag, G.'       38 
# 
_cell.entry_id           3C4C 
_cell.length_a           51.574 
_cell.length_b           105.502 
_cell.length_c           110.150 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3C4C 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'B-Raf proto-oncogene serine/threonine-protein kinase'                                             31875.529 2   
2.7.11.1 'I543A, I544S, I551K, Q562R, L588N, K630S, F667E, Y673S, A688R, L706S, Q709R, S713E, L716E, S720E, P722S, K723G' 
'KINASE DOMAIN' ? 
2 non-polymer syn 'N-{3-[(5-chloro-1H-pyrrolo[2,3-b]pyridin-3-yl)carbonyl]-2,4-difluorophenyl}propane-1-sulfonamide' 413.826   2   
?        ?                                                                                                                ? ? 
3 water       nat water                                                                                              18.015    153 
?        ?                                                                                                                ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'p94, v-Raf murine sarcoma viral oncogene homolog B1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;RDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKP
QLAIVTQWCEGSSLYHHLHASETKFEMKKLIDIARQTARGMDYLHAKSIIHRDLKSNNIFLHEDNTVKIGDFGLATVKSR
WSGSHQFEQLSGSILWMAPEVIRMQDSNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIEMVGRGSLSPDLSKVRS
NCPKRMKRLMAECLKKKRDERPSFPRILAEIEELARELSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;RDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKP
QLAIVTQWCEGSSLYHHLHASETKFEMKKLIDIARQTARGMDYLHAKSIIHRDLKSNNIFLHEDNTVKIGDFGLATVKSR
WSGSHQFEQLSGSILWMAPEVIRMQDSNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIEMVGRGSLSPDLSKVRS
NCPKRMKRLMAECLKKKRDERPSFPRILAEIEELARELSG
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ARG n 
1 2   ASP n 
1 3   SER n 
1 4   SER n 
1 5   ASP n 
1 6   ASP n 
1 7   TRP n 
1 8   GLU n 
1 9   ILE n 
1 10  PRO n 
1 11  ASP n 
1 12  GLY n 
1 13  GLN n 
1 14  ILE n 
1 15  THR n 
1 16  VAL n 
1 17  GLY n 
1 18  GLN n 
1 19  ARG n 
1 20  ILE n 
1 21  GLY n 
1 22  SER n 
1 23  GLY n 
1 24  SER n 
1 25  PHE n 
1 26  GLY n 
1 27  THR n 
1 28  VAL n 
1 29  TYR n 
1 30  LYS n 
1 31  GLY n 
1 32  LYS n 
1 33  TRP n 
1 34  HIS n 
1 35  GLY n 
1 36  ASP n 
1 37  VAL n 
1 38  ALA n 
1 39  VAL n 
1 40  LYS n 
1 41  MET n 
1 42  LEU n 
1 43  ASN n 
1 44  VAL n 
1 45  THR n 
1 46  ALA n 
1 47  PRO n 
1 48  THR n 
1 49  PRO n 
1 50  GLN n 
1 51  GLN n 
1 52  LEU n 
1 53  GLN n 
1 54  ALA n 
1 55  PHE n 
1 56  LYS n 
1 57  ASN n 
1 58  GLU n 
1 59  VAL n 
1 60  GLY n 
1 61  VAL n 
1 62  LEU n 
1 63  ARG n 
1 64  LYS n 
1 65  THR n 
1 66  ARG n 
1 67  HIS n 
1 68  VAL n 
1 69  ASN n 
1 70  ILE n 
1 71  LEU n 
1 72  LEU n 
1 73  PHE n 
1 74  MET n 
1 75  GLY n 
1 76  TYR n 
1 77  SER n 
1 78  THR n 
1 79  LYS n 
1 80  PRO n 
1 81  GLN n 
1 82  LEU n 
1 83  ALA n 
1 84  ILE n 
1 85  VAL n 
1 86  THR n 
1 87  GLN n 
1 88  TRP n 
1 89  CYS n 
1 90  GLU n 
1 91  GLY n 
1 92  SER n 
1 93  SER n 
1 94  LEU n 
1 95  TYR n 
1 96  HIS n 
1 97  HIS n 
1 98  LEU n 
1 99  HIS n 
1 100 ALA n 
1 101 SER n 
1 102 GLU n 
1 103 THR n 
1 104 LYS n 
1 105 PHE n 
1 106 GLU n 
1 107 MET n 
1 108 LYS n 
1 109 LYS n 
1 110 LEU n 
1 111 ILE n 
1 112 ASP n 
1 113 ILE n 
1 114 ALA n 
1 115 ARG n 
1 116 GLN n 
1 117 THR n 
1 118 ALA n 
1 119 ARG n 
1 120 GLY n 
1 121 MET n 
1 122 ASP n 
1 123 TYR n 
1 124 LEU n 
1 125 HIS n 
1 126 ALA n 
1 127 LYS n 
1 128 SER n 
1 129 ILE n 
1 130 ILE n 
1 131 HIS n 
1 132 ARG n 
1 133 ASP n 
1 134 LEU n 
1 135 LYS n 
1 136 SER n 
1 137 ASN n 
1 138 ASN n 
1 139 ILE n 
1 140 PHE n 
1 141 LEU n 
1 142 HIS n 
1 143 GLU n 
1 144 ASP n 
1 145 ASN n 
1 146 THR n 
1 147 VAL n 
1 148 LYS n 
1 149 ILE n 
1 150 GLY n 
1 151 ASP n 
1 152 PHE n 
1 153 GLY n 
1 154 LEU n 
1 155 ALA n 
1 156 THR n 
1 157 VAL n 
1 158 LYS n 
1 159 SER n 
1 160 ARG n 
1 161 TRP n 
1 162 SER n 
1 163 GLY n 
1 164 SER n 
1 165 HIS n 
1 166 GLN n 
1 167 PHE n 
1 168 GLU n 
1 169 GLN n 
1 170 LEU n 
1 171 SER n 
1 172 GLY n 
1 173 SER n 
1 174 ILE n 
1 175 LEU n 
1 176 TRP n 
1 177 MET n 
1 178 ALA n 
1 179 PRO n 
1 180 GLU n 
1 181 VAL n 
1 182 ILE n 
1 183 ARG n 
1 184 MET n 
1 185 GLN n 
1 186 ASP n 
1 187 SER n 
1 188 ASN n 
1 189 PRO n 
1 190 TYR n 
1 191 SER n 
1 192 PHE n 
1 193 GLN n 
1 194 SER n 
1 195 ASP n 
1 196 VAL n 
1 197 TYR n 
1 198 ALA n 
1 199 PHE n 
1 200 GLY n 
1 201 ILE n 
1 202 VAL n 
1 203 LEU n 
1 204 TYR n 
1 205 GLU n 
1 206 LEU n 
1 207 MET n 
1 208 THR n 
1 209 GLY n 
1 210 GLN n 
1 211 LEU n 
1 212 PRO n 
1 213 TYR n 
1 214 SER n 
1 215 ASN n 
1 216 ILE n 
1 217 ASN n 
1 218 ASN n 
1 219 ARG n 
1 220 ASP n 
1 221 GLN n 
1 222 ILE n 
1 223 ILE n 
1 224 GLU n 
1 225 MET n 
1 226 VAL n 
1 227 GLY n 
1 228 ARG n 
1 229 GLY n 
1 230 SER n 
1 231 LEU n 
1 232 SER n 
1 233 PRO n 
1 234 ASP n 
1 235 LEU n 
1 236 SER n 
1 237 LYS n 
1 238 VAL n 
1 239 ARG n 
1 240 SER n 
1 241 ASN n 
1 242 CYS n 
1 243 PRO n 
1 244 LYS n 
1 245 ARG n 
1 246 MET n 
1 247 LYS n 
1 248 ARG n 
1 249 LEU n 
1 250 MET n 
1 251 ALA n 
1 252 GLU n 
1 253 CYS n 
1 254 LEU n 
1 255 LYS n 
1 256 LYS n 
1 257 LYS n 
1 258 ARG n 
1 259 ASP n 
1 260 GLU n 
1 261 ARG n 
1 262 PRO n 
1 263 SER n 
1 264 PHE n 
1 265 PRO n 
1 266 ARG n 
1 267 ILE n 
1 268 LEU n 
1 269 ALA n 
1 270 GLU n 
1 271 ILE n 
1 272 GLU n 
1 273 GLU n 
1 274 LEU n 
1 275 ALA n 
1 276 ARG n 
1 277 GLU n 
1 278 LEU n 
1 279 SER n 
1 280 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'BRAF, BRAF1, RAFB1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          vector 
_entity_src_gen.pdbx_host_org_vector               pET29a 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BRAF1_HUMAN 
_struct_ref.pdbx_db_accession          P15056 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKP
QLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSR
WSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRS
NCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSL
;
_struct_ref.pdbx_align_begin           444 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3C4C A 1 ? 278 ? P15056 444 ? 721 ? 444 721 
2 1 3C4C B 1 ? 278 ? P15056 444 ? 721 ? 444 721 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3C4C ALA A 100 ? UNP P15056 ILE 543 ENGINEERED       543 1  
1 3C4C SER A 101 ? UNP P15056 ILE 544 ENGINEERED       544 2  
1 3C4C LYS A 108 ? UNP P15056 ILE 551 ENGINEERED       551 3  
1 3C4C ARG A 119 ? UNP P15056 GLN 562 ENGINEERED       562 4  
1 3C4C ASN A 145 ? UNP P15056 LEU 588 ENGINEERED       588 5  
1 3C4C SER A 187 ? UNP P15056 LYS 630 ENGINEERED       630 6  
1 3C4C GLU A 224 ? UNP P15056 PHE 667 ENGINEERED       667 7  
1 3C4C SER A 230 ? UNP P15056 TYR 673 ENGINEERED       673 8  
1 3C4C ARG A 245 ? UNP P15056 ALA 688 ENGINEERED       688 9  
1 3C4C SER A 263 ? UNP P15056 LEU 706 ENGINEERED       706 10 
1 3C4C ARG A 266 ? UNP P15056 GLN 709 ENGINEERED       709 11 
1 3C4C GLU A 270 ? UNP P15056 SER 713 ENGINEERED       713 12 
1 3C4C GLU A 273 ? UNP P15056 LEU 716 ENGINEERED       716 13 
1 3C4C GLU A 277 ? UNP P15056 SER 720 ENGINEERED       720 14 
1 3C4C SER A 279 ? UNP P15056 ?   ?   'EXPRESSION TAG' 722 15 
1 3C4C GLY A 280 ? UNP P15056 ?   ?   'EXPRESSION TAG' 723 16 
2 3C4C ALA B 100 ? UNP P15056 ILE 543 ENGINEERED       543 17 
2 3C4C SER B 101 ? UNP P15056 ILE 544 ENGINEERED       544 18 
2 3C4C LYS B 108 ? UNP P15056 ILE 551 ENGINEERED       551 19 
2 3C4C ARG B 119 ? UNP P15056 GLN 562 ENGINEERED       562 20 
2 3C4C ASN B 145 ? UNP P15056 LEU 588 ENGINEERED       588 21 
2 3C4C SER B 187 ? UNP P15056 LYS 630 ENGINEERED       630 22 
2 3C4C GLU B 224 ? UNP P15056 PHE 667 ENGINEERED       667 23 
2 3C4C SER B 230 ? UNP P15056 TYR 673 ENGINEERED       673 24 
2 3C4C ARG B 245 ? UNP P15056 ALA 688 ENGINEERED       688 25 
2 3C4C SER B 263 ? UNP P15056 LEU 706 ENGINEERED       706 26 
2 3C4C ARG B 266 ? UNP P15056 GLN 709 ENGINEERED       709 27 
2 3C4C GLU B 270 ? UNP P15056 SER 713 ENGINEERED       713 28 
2 3C4C GLU B 273 ? UNP P15056 LEU 716 ENGINEERED       716 29 
2 3C4C GLU B 277 ? UNP P15056 SER 720 ENGINEERED       720 30 
2 3C4C SER B 279 ? UNP P15056 ?   ?   'EXPRESSION TAG' 722 31 
2 3C4C GLY B 280 ? UNP P15056 ?   ?   'EXPRESSION TAG' 723 32 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
324 non-polymer         . 'N-{3-[(5-chloro-1H-pyrrolo[2,3-b]pyridin-3-yl)carbonyl]-2,4-difluorophenyl}propane-1-sulfonamide' ? 
'C17 H14 Cl F2 N3 O3 S' 413.826 
ALA 'L-peptide linking' y ALANINE                                                                                            ? 
'C3 H7 N O2'            89.093  
ARG 'L-peptide linking' y ARGININE                                                                                           ? 
'C6 H15 N4 O2 1'        175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                         ? 
'C4 H8 N2 O3'           132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                    ? 
'C4 H7 N O4'            133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                           ? 
'C3 H7 N O2 S'          121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                                          ? 
'C5 H10 N2 O3'          146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                    ? 
'C5 H9 N O4'            147.129 
GLY 'peptide linking'   y GLYCINE                                                                                            ? 
'C2 H5 N O2'            75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                          ? 
'C6 H10 N3 O2 1'        156.162 
HOH non-polymer         . WATER                                                                                              ? 
'H2 O'                  18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                         ? 
'C6 H13 N O2'           131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                            ? 
'C6 H13 N O2'           131.173 
LYS 'L-peptide linking' y LYSINE                                                                                             ? 
'C6 H15 N2 O2 1'        147.195 
MET 'L-peptide linking' y METHIONINE                                                                                         ? 
'C5 H11 N O2 S'         149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                                      ? 
'C9 H11 N O2'           165.189 
PRO 'L-peptide linking' y PROLINE                                                                                            ? 
'C5 H9 N O2'            115.130 
SER 'L-peptide linking' y SERINE                                                                                             ? 
'C3 H7 N O3'            105.093 
THR 'L-peptide linking' y THREONINE                                                                                          ? 
'C4 H9 N O3'            119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                         ? 
'C11 H12 N2 O2'         204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                           ? 
'C9 H11 N O3'           181.189 
VAL 'L-peptide linking' y VALINE                                                                                             ? 
'C5 H11 N O2'           117.146 
# 
_exptl.entry_id          3C4C 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.35 
_exptl_crystal.density_percent_sol   47.67 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    
'100mM BisTris at pH 6.0, 12.5% 2,5-hexanediol, and 12% PEG3350, VAPOR DIFFUSION, HANGING DROP, temperature 277.0K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           295.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2006-04-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 8.3.1' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   8.3.1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.1 
# 
_reflns.entry_id                     3C4C 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.d_resolution_high            2.57 
_reflns.d_resolution_low             50 
_reflns.number_all                   ? 
_reflns.number_obs                   19778 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.105 
_reflns.pdbx_netI_over_sigmaI        4.9 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.57 
_reflns_shell.d_res_low              2.75 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.562 
_reflns_shell.meanI_over_sigI_obs    1.3 
_reflns_shell.pdbx_redundancy        4.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3C4C 
_refine.ls_number_reflns_obs                     18805 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.00 
_refine.ls_d_res_high                            2.57 
_refine.ls_percent_reflns_obs                    99.72 
_refine.ls_R_factor_obs                          0.26078 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.25859 
_refine.ls_R_factor_R_free                       0.30334 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  952 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.876 
_refine.correlation_coeff_Fo_to_Fc_free          0.842 
_refine.B_iso_mean                               18.647 
_refine.aniso_B[1][1]                            4.04 
_refine.aniso_B[2][2]                            -1.78 
_refine.aniso_B[3][3]                            -2.26 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       1.140 
_refine.pdbx_overall_ESU_R_Free                  0.380 
_refine.overall_SU_ML                            0.369 
_refine.overall_SU_B                             18.129 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4112 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         54 
_refine_hist.number_atoms_solvent             153 
_refine_hist.number_atoms_total               4319 
_refine_hist.d_res_high                       2.57 
_refine_hist.d_res_low                        50.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.021 0.021 ? 4256 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.002 0.020 ? 3859 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      2.059 1.966 ? 5743 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        1.052 3.000 ? 8993 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   9.266 5.000 ? 511  'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.176 0.200 ? 618  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.006 0.020 ? 4669 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.004 0.020 ? 859  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.242 0.200 ? 1187 'X-RAY DIFFRACTION' ? 
r_nbd_other              0.241 0.200 ? 4827 'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.094 0.200 ? 2551 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.266 0.200 ? 135  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.192 0.200 ? 26   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.251 0.200 ? 56   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.212 0.200 ? 4    'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.492 1.500 ? 2560 'X-RAY DIFFRACTION' ? 
r_mcangle_it             0.820 2.000 ? 4133 'X-RAY DIFFRACTION' ? 
r_scbond_it              1.359 3.000 ? 1696 'X-RAY DIFFRACTION' ? 
r_scangle_it             2.053 4.500 ? 1610 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.570 
_refine_ls_shell.d_res_low                        2.637 
_refine_ls_shell.number_reflns_R_work             1369 
_refine_ls_shell.R_factor_R_work                  0.335 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.445 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             67 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3C4C 
_struct.title                     'B-Raf Kinase in Complex with PLX4720' 
_struct.pdbx_descriptor           'B-Raf proto-oncogene serine/threonine-protein kinase (E.C.2.7.11.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3C4C 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;B-RAF, BRAF, RAF, PROTO-ONCOGENE, SERINE/THREONINE KINASE, ATP-binding, Cardiomyopathy, Cytoplasm, Disease mutation, Metal-binding, Nucleotide-binding, Phorbol-ester binding, Phosphoprotein, Polymorphism, Serine/threonine-protein kinase, Transferase, Zinc, Zinc-finger
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLN A 50  ? ARG A 63  ? GLN A 493 ARG A 506 1 ? 14 
HELX_P HELX_P2  2  LEU A 94  ? HIS A 99  ? LEU A 537 HIS A 542 1 ? 6  
HELX_P HELX_P3  3  GLU A 106 ? LYS A 127 ? GLU A 549 LYS A 570 1 ? 22 
HELX_P HELX_P4  4  LYS A 135 ? ASN A 137 ? LYS A 578 ASN A 580 5 ? 3  
HELX_P HELX_P5  5  SER A 173 ? MET A 177 ? SER A 616 MET A 620 5 ? 5  
HELX_P HELX_P6  6  ALA A 178 ? MET A 184 ? ALA A 621 MET A 627 1 ? 7  
HELX_P HELX_P7  7  SER A 191 ? GLY A 209 ? SER A 634 GLY A 652 1 ? 19 
HELX_P HELX_P8  8  ASN A 218 ? ARG A 228 ? ASN A 661 ARG A 671 1 ? 11 
HELX_P HELX_P9  9  PRO A 243 ? LEU A 254 ? PRO A 686 LEU A 697 1 ? 12 
HELX_P HELX_P10 10 SER A 263 ? ARG A 276 ? SER A 706 ARG A 719 1 ? 14 
HELX_P HELX_P11 11 GLN B 50  ? VAL B 61  ? GLN B 493 VAL B 504 1 ? 12 
HELX_P HELX_P12 12 LEU B 62  ? THR B 65  ? LEU B 505 THR B 508 5 ? 4  
HELX_P HELX_P13 13 SER B 93  ? ALA B 100 ? SER B 536 ALA B 543 1 ? 8  
HELX_P HELX_P14 14 GLU B 106 ? LYS B 127 ? GLU B 549 LYS B 570 1 ? 22 
HELX_P HELX_P15 15 LEU B 141 ? ASN B 145 ? LEU B 584 ASN B 588 5 ? 5  
HELX_P HELX_P16 16 SER B 173 ? MET B 177 ? SER B 616 MET B 620 5 ? 5  
HELX_P HELX_P17 17 ALA B 178 ? ARG B 183 ? ALA B 621 ARG B 626 1 ? 6  
HELX_P HELX_P18 18 SER B 191 ? THR B 208 ? SER B 634 THR B 651 1 ? 18 
HELX_P HELX_P19 19 ASN B 218 ? VAL B 226 ? ASN B 661 VAL B 669 1 ? 9  
HELX_P HELX_P20 20 PRO B 243 ? LEU B 254 ? PRO B 686 LEU B 697 1 ? 12 
HELX_P HELX_P21 21 SER B 263 ? LEU B 278 ? SER B 706 LEU B 721 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASN 188 A . ? ASN 631 A PRO 189 A ? PRO 632 A 1 9.04 
2 ARG 276 A . ? ARG 719 A GLU 277 A ? GLU 720 A 1 9.31 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 5 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 15  ? GLY A 21  ? THR A 458 GLY A 464 
A 2 GLY A 26  ? LYS A 32  ? GLY A 469 LYS A 475 
A 3 ASP A 36  ? LEU A 42  ? ASP A 479 LEU A 485 
A 4 ALA A 83  ? THR A 86  ? ALA A 526 THR A 529 
A 5 PHE A 73  ? SER A 77  ? PHE A 516 SER A 520 
B 1 GLY A 91  ? SER A 93  ? GLY A 534 SER A 536 
B 2 ILE A 139 ? HIS A 142 ? ILE A 582 HIS A 585 
B 3 THR A 146 ? ILE A 149 ? THR A 589 ILE A 592 
C 1 THR B 15  ? SER B 22  ? THR B 458 SER B 465 
C 2 THR B 27  ? LYS B 32  ? THR B 470 LYS B 475 
C 3 ASP B 36  ? MET B 41  ? ASP B 479 MET B 484 
C 4 ALA B 83  ? GLN B 87  ? ALA B 526 GLN B 530 
C 5 PHE B 73  ? GLY B 75  ? PHE B 516 GLY B 518 
D 1 ILE B 139 ? PHE B 140 ? ILE B 582 PHE B 583 
D 2 LYS B 148 ? ILE B 149 ? LYS B 591 ILE B 592 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLY A 21  ? N GLY A 464 O VAL A 28  ? O VAL A 471 
A 2 3 N THR A 27  ? N THR A 470 O MET A 41  ? O MET A 484 
A 3 4 N LYS A 40  ? N LYS A 483 O ILE A 84  ? O ILE A 527 
A 4 5 O VAL A 85  ? O VAL A 528 N GLY A 75  ? N GLY A 518 
B 1 2 N SER A 92  ? N SER A 535 O LEU A 141 ? O LEU A 584 
B 2 3 N PHE A 140 ? N PHE A 583 O LYS A 148 ? O LYS A 591 
C 1 2 N GLY B 17  ? N GLY B 460 O LYS B 30  ? O LYS B 473 
C 2 3 N THR B 27  ? N THR B 470 O MET B 41  ? O MET B 484 
C 3 4 N LYS B 40  ? N LYS B 483 O ILE B 84  ? O ILE B 527 
C 4 5 O VAL B 85  ? O VAL B 528 N MET B 74  ? N MET B 517 
D 1 2 N PHE B 140 ? N PHE B 583 O LYS B 148 ? O LYS B 591 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE 324 A 2' 
AC2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE 324 B 3' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 ILE A 20  ? ILE A 463 . ? 1_555 ? 
2  AC1 13 ALA A 38  ? ALA A 481 . ? 1_555 ? 
3  AC1 13 LYS A 40  ? LYS A 483 . ? 1_555 ? 
4  AC1 13 LEU A 62  ? LEU A 505 . ? 1_555 ? 
5  AC1 13 LEU A 71  ? LEU A 514 . ? 1_555 ? 
6  AC1 13 ILE A 84  ? ILE A 527 . ? 1_555 ? 
7  AC1 13 THR A 86  ? THR A 529 . ? 1_555 ? 
8  AC1 13 GLN A 87  ? GLN A 530 . ? 1_555 ? 
9  AC1 13 TRP A 88  ? TRP A 531 . ? 1_555 ? 
10 AC1 13 CYS A 89  ? CYS A 532 . ? 1_555 ? 
11 AC1 13 PHE A 140 ? PHE A 583 . ? 1_555 ? 
12 AC1 13 ASP A 151 ? ASP A 594 . ? 1_555 ? 
13 AC1 13 PHE A 152 ? PHE A 595 . ? 1_555 ? 
14 AC2 12 ILE B 20  ? ILE B 463 . ? 1_555 ? 
15 AC2 12 ALA B 38  ? ALA B 481 . ? 1_555 ? 
16 AC2 12 LYS B 40  ? LYS B 483 . ? 1_555 ? 
17 AC2 12 GLU B 58  ? GLU B 501 . ? 1_555 ? 
18 AC2 12 LEU B 62  ? LEU B 505 . ? 1_555 ? 
19 AC2 12 LEU B 71  ? LEU B 514 . ? 1_555 ? 
20 AC2 12 ILE B 84  ? ILE B 527 . ? 1_555 ? 
21 AC2 12 THR B 86  ? THR B 529 . ? 1_555 ? 
22 AC2 12 GLN B 87  ? GLN B 530 . ? 1_555 ? 
23 AC2 12 CYS B 89  ? CYS B 532 . ? 1_555 ? 
24 AC2 12 PHE B 140 ? PHE B 583 . ? 1_555 ? 
25 AC2 12 ASP B 151 ? ASP B 594 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3C4C 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3C4C 
_atom_sites.fract_transf_matrix[1][1]   0.019390 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009478 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009079 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
F  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N    . ASP A 1 5   ? -14.860 7.407   -9.445  1.00 29.12 ? 448 ASP A N    1 
ATOM   2    C  CA   . ASP A 1 5   ? -16.255 7.546   -9.969  1.00 29.09 ? 448 ASP A CA   1 
ATOM   3    C  C    . ASP A 1 5   ? -16.181 7.640   -11.512 1.00 28.86 ? 448 ASP A C    1 
ATOM   4    O  O    . ASP A 1 5   ? -16.724 6.755   -12.225 1.00 29.12 ? 448 ASP A O    1 
ATOM   5    C  CB   . ASP A 1 5   ? -16.993 8.752   -9.319  1.00 29.15 ? 448 ASP A CB   1 
ATOM   6    C  CG   . ASP A 1 5   ? -16.244 9.349   -8.068  1.00 29.90 ? 448 ASP A CG   1 
ATOM   7    O  OD1  . ASP A 1 5   ? -16.213 8.700   -6.978  1.00 29.39 ? 448 ASP A OD1  1 
ATOM   8    O  OD2  . ASP A 1 5   ? -15.684 10.481  -8.078  1.00 29.74 ? 448 ASP A OD2  1 
ATOM   9    N  N    . ASP A 1 6   ? -15.508 8.710   -11.977 1.00 28.29 ? 449 ASP A N    1 
ATOM   10   C  CA   . ASP A 1 6   ? -14.975 8.901   -13.345 1.00 27.63 ? 449 ASP A CA   1 
ATOM   11   C  C    . ASP A 1 6   ? -13.432 9.069   -13.247 1.00 26.99 ? 449 ASP A C    1 
ATOM   12   O  O    . ASP A 1 6   ? -12.921 9.776   -12.370 1.00 26.00 ? 449 ASP A O    1 
ATOM   13   C  CB   . ASP A 1 6   ? -15.599 10.159  -14.031 1.00 27.50 ? 449 ASP A CB   1 
ATOM   14   C  CG   . ASP A 1 6   ? -16.162 9.877   -15.460 1.00 27.15 ? 449 ASP A CG   1 
ATOM   15   O  OD1  . ASP A 1 6   ? -16.470 10.845  -16.189 1.00 24.52 ? 449 ASP A OD1  1 
ATOM   16   O  OD2  . ASP A 1 6   ? -16.352 8.730   -15.942 1.00 28.43 ? 449 ASP A OD2  1 
ATOM   17   N  N    . TRP A 1 7   ? -12.709 8.405   -14.152 1.00 26.52 ? 450 TRP A N    1 
ATOM   18   C  CA   . TRP A 1 7   ? -11.251 8.286   -14.053 1.00 25.90 ? 450 TRP A CA   1 
ATOM   19   C  C    . TRP A 1 7   ? -10.499 8.971   -15.188 1.00 25.61 ? 450 TRP A C    1 
ATOM   20   O  O    . TRP A 1 7   ? -9.341  8.649   -15.419 1.00 26.30 ? 450 TRP A O    1 
ATOM   21   C  CB   . TRP A 1 7   ? -10.842 6.791   -13.964 1.00 25.96 ? 450 TRP A CB   1 
ATOM   22   C  CG   . TRP A 1 7   ? -11.242 6.176   -12.656 1.00 25.27 ? 450 TRP A CG   1 
ATOM   23   C  CD1  . TRP A 1 7   ? -12.449 5.654   -12.339 1.00 25.05 ? 450 TRP A CD1  1 
ATOM   24   C  CD2  . TRP A 1 7   ? -10.444 6.081   -11.475 1.00 25.39 ? 450 TRP A CD2  1 
ATOM   25   N  NE1  . TRP A 1 7   ? -12.456 5.238   -11.030 1.00 25.56 ? 450 TRP A NE1  1 
ATOM   26   C  CE2  . TRP A 1 7   ? -11.237 5.499   -10.479 1.00 25.28 ? 450 TRP A CE2  1 
ATOM   27   C  CE3  . TRP A 1 7   ? -9.125  6.447   -11.152 1.00 25.77 ? 450 TRP A CE3  1 
ATOM   28   C  CZ2  . TRP A 1 7   ? -10.759 5.246   -9.210  1.00 26.59 ? 450 TRP A CZ2  1 
ATOM   29   C  CZ3  . TRP A 1 7   ? -8.651  6.199   -9.878  1.00 24.27 ? 450 TRP A CZ3  1 
ATOM   30   C  CH2  . TRP A 1 7   ? -9.451  5.592   -8.935  1.00 25.42 ? 450 TRP A CH2  1 
ATOM   31   N  N    . GLU A 1 8   ? -11.112 9.945   -15.865 1.00 25.31 ? 451 GLU A N    1 
ATOM   32   C  CA   . GLU A 1 8   ? -10.444 10.615  -16.999 1.00 24.93 ? 451 GLU A CA   1 
ATOM   33   C  C    . GLU A 1 8   ? -9.334  11.600  -16.585 1.00 24.74 ? 451 GLU A C    1 
ATOM   34   O  O    . GLU A 1 8   ? -9.517  12.401  -15.686 1.00 24.70 ? 451 GLU A O    1 
ATOM   35   C  CB   . GLU A 1 8   ? -11.451 11.313  -17.907 1.00 24.70 ? 451 GLU A CB   1 
ATOM   36   C  CG   . GLU A 1 8   ? -10.865 11.850  -19.214 1.00 24.50 ? 451 GLU A CG   1 
ATOM   37   C  CD   . GLU A 1 8   ? -11.920 12.482  -20.090 1.00 23.62 ? 451 GLU A CD   1 
ATOM   38   O  OE1  . GLU A 1 8   ? -13.081 12.291  -19.740 1.00 25.57 ? 451 GLU A OE1  1 
ATOM   39   O  OE2  . GLU A 1 8   ? -11.620 13.156  -21.099 1.00 20.97 ? 451 GLU A OE2  1 
ATOM   40   N  N    . ILE A 1 9   ? -8.188  11.517  -17.257 1.00 24.48 ? 452 ILE A N    1 
ATOM   41   C  CA   . ILE A 1 9   ? -7.096  12.463  -17.058 1.00 24.46 ? 452 ILE A CA   1 
ATOM   42   C  C    . ILE A 1 9   ? -7.237  13.541  -18.156 1.00 24.28 ? 452 ILE A C    1 
ATOM   43   O  O    . ILE A 1 9   ? -7.058  13.227  -19.340 1.00 24.34 ? 452 ILE A O    1 
ATOM   44   C  CB   . ILE A 1 9   ? -5.674  11.718  -17.076 1.00 24.17 ? 452 ILE A CB   1 
ATOM   45   C  CG1  . ILE A 1 9   ? -5.487  10.818  -15.850 1.00 23.68 ? 452 ILE A CG1  1 
ATOM   46   C  CG2  . ILE A 1 9   ? -4.560  12.684  -17.025 1.00 23.98 ? 452 ILE A CG2  1 
ATOM   47   C  CD1  . ILE A 1 9   ? -4.742  9.553   -16.097 1.00 22.31 ? 452 ILE A CD1  1 
ATOM   48   N  N    . PRO A 1 10  ? -7.576  14.789  -17.778 1.00 24.12 ? 453 PRO A N    1 
ATOM   49   C  CA   . PRO A 1 10  ? -7.760  15.905  -18.745 1.00 23.94 ? 453 PRO A CA   1 
ATOM   50   C  C    . PRO A 1 10  ? -6.541  16.131  -19.568 1.00 23.92 ? 453 PRO A C    1 
ATOM   51   O  O    . PRO A 1 10  ? -5.482  15.879  -19.015 1.00 24.48 ? 453 PRO A O    1 
ATOM   52   C  CB   . PRO A 1 10  ? -7.961  17.140  -17.873 1.00 23.27 ? 453 PRO A CB   1 
ATOM   53   C  CG   . PRO A 1 10  ? -8.276  16.666  -16.545 1.00 24.08 ? 453 PRO A CG   1 
ATOM   54   C  CD   . PRO A 1 10  ? -7.833  15.220  -16.397 1.00 24.21 ? 453 PRO A CD   1 
ATOM   55   N  N    . ASP A 1 11  ? -6.667  16.603  -20.806 1.00 24.25 ? 454 ASP A N    1 
ATOM   56   C  CA   . ASP A 1 11  ? -5.494  16.858  -21.650 1.00 24.48 ? 454 ASP A CA   1 
ATOM   57   C  C    . ASP A 1 11  ? -4.465  17.726  -20.920 1.00 24.73 ? 454 ASP A C    1 
ATOM   58   O  O    . ASP A 1 11  ? -4.814  18.680  -20.211 1.00 24.61 ? 454 ASP A O    1 
ATOM   59   C  CB   . ASP A 1 11  ? -5.862  17.540  -22.983 1.00 24.77 ? 454 ASP A CB   1 
ATOM   60   C  CG   . ASP A 1 11  ? -4.682  17.595  -23.972 1.00 24.07 ? 454 ASP A CG   1 
ATOM   61   O  OD1  . ASP A 1 11  ? -3.843  16.678  -23.950 1.00 25.28 ? 454 ASP A OD1  1 
ATOM   62   O  OD2  . ASP A 1 11  ? -4.499  18.513  -24.799 1.00 22.53 ? 454 ASP A OD2  1 
ATOM   63   N  N    . GLY A 1 12  ? -3.196  17.354  -21.081 1.00 24.83 ? 455 GLY A N    1 
ATOM   64   C  CA   . GLY A 1 12  ? -2.092  18.114  -20.549 1.00 24.80 ? 455 GLY A CA   1 
ATOM   65   C  C    . GLY A 1 12  ? -1.327  17.412  -19.458 1.00 24.54 ? 455 GLY A C    1 
ATOM   66   O  O    . GLY A 1 12  ? -0.124  17.556  -19.418 1.00 24.89 ? 455 GLY A O    1 
ATOM   67   N  N    . GLN A 1 13  ? -2.008  16.659  -18.598 1.00 24.58 ? 456 GLN A N    1 
ATOM   68   C  CA   . GLN A 1 13  ? -1.424  16.171  -17.330 1.00 24.28 ? 456 GLN A CA   1 
ATOM   69   C  C    . GLN A 1 13  ? -0.391  15.076  -17.554 1.00 25.07 ? 456 GLN A C    1 
ATOM   70   O  O    . GLN A 1 13  ? 0.604   14.979  -16.800 1.00 25.77 ? 456 GLN A O    1 
ATOM   71   C  CB   . GLN A 1 13  ? -2.503  15.717  -16.326 1.00 23.82 ? 456 GLN A CB   1 
ATOM   72   C  CG   . GLN A 1 13  ? -3.618  16.761  -16.110 1.00 22.36 ? 456 GLN A CG   1 
ATOM   73   C  CD   . GLN A 1 13  ? -4.557  16.450  -14.993 1.00 20.59 ? 456 GLN A CD   1 
ATOM   74   O  OE1  . GLN A 1 13  ? -4.330  15.554  -14.206 1.00 20.00 ? 456 GLN A OE1  1 
ATOM   75   N  NE2  . GLN A 1 13  ? -5.635  17.211  -14.913 1.00 22.01 ? 456 GLN A NE2  1 
ATOM   76   N  N    . ILE A 1 14  ? -0.563  14.292  -18.614 1.00 25.17 ? 457 ILE A N    1 
ATOM   77   C  CA   . ILE A 1 14  ? 0.439   13.283  -18.938 1.00 25.31 ? 457 ILE A CA   1 
ATOM   78   C  C    . ILE A 1 14  ? 1.568   13.839  -19.847 1.00 25.53 ? 457 ILE A C    1 
ATOM   79   O  O    . ILE A 1 14  ? 1.323   14.386  -20.926 1.00 26.21 ? 457 ILE A O    1 
ATOM   80   C  CB   . ILE A 1 14  ? -0.228  12.073  -19.594 1.00 25.18 ? 457 ILE A CB   1 
ATOM   81   C  CG1  . ILE A 1 14  ? -1.242  11.434  -18.660 1.00 24.75 ? 457 ILE A CG1  1 
ATOM   82   C  CG2  . ILE A 1 14  ? 0.803   11.049  -20.005 1.00 25.58 ? 457 ILE A CG2  1 
ATOM   83   C  CD1  . ILE A 1 14  ? -2.308  10.668  -19.423 1.00 25.28 ? 457 ILE A CD1  1 
ATOM   84   N  N    . THR A 1 15  ? 2.806   13.668  -19.406 1.00 25.33 ? 458 THR A N    1 
ATOM   85   C  CA   . THR A 1 15  ? 3.987   14.030  -20.183 1.00 25.17 ? 458 THR A CA   1 
ATOM   86   C  C    . THR A 1 15  ? 4.509   12.766  -20.824 1.00 24.82 ? 458 THR A C    1 
ATOM   87   O  O    . THR A 1 15  ? 5.222   11.987  -20.197 1.00 24.39 ? 458 THR A O    1 
ATOM   88   C  CB   . THR A 1 15  ? 5.071   14.666  -19.270 1.00 25.09 ? 458 THR A CB   1 
ATOM   89   O  OG1  . THR A 1 15  ? 4.524   15.816  -18.620 1.00 26.06 ? 458 THR A OG1  1 
ATOM   90   C  CG2  . THR A 1 15  ? 6.223   15.228  -20.068 1.00 24.88 ? 458 THR A CG2  1 
ATOM   91   N  N    . VAL A 1 16  ? 4.115   12.560  -22.074 1.00 24.72 ? 459 VAL A N    1 
ATOM   92   C  CA   . VAL A 1 16  ? 4.539   11.405  -22.840 1.00 24.31 ? 459 VAL A CA   1 
ATOM   93   C  C    . VAL A 1 16  ? 5.951   11.627  -23.342 1.00 24.62 ? 459 VAL A C    1 
ATOM   94   O  O    . VAL A 1 16  ? 6.259   12.629  -24.006 1.00 24.20 ? 459 VAL A O    1 
ATOM   95   C  CB   . VAL A 1 16  ? 3.673   11.199  -24.049 1.00 23.85 ? 459 VAL A CB   1 
ATOM   96   C  CG1  . VAL A 1 16  ? 4.083   9.934   -24.775 1.00 24.76 ? 459 VAL A CG1  1 
ATOM   97   C  CG2  . VAL A 1 16  ? 2.248   11.146  -23.647 1.00 25.08 ? 459 VAL A CG2  1 
ATOM   98   N  N    . GLY A 1 17  ? 6.812   10.678  -23.022 1.00 24.88 ? 460 GLY A N    1 
ATOM   99   C  CA   . GLY A 1 17  ? 8.131   10.647  -23.583 1.00 24.97 ? 460 GLY A CA   1 
ATOM   100  C  C    . GLY A 1 17  ? 8.272   9.486   -24.532 1.00 25.10 ? 460 GLY A C    1 
ATOM   101  O  O    . GLY A 1 17  ? 7.819   9.588   -25.673 1.00 25.20 ? 460 GLY A O    1 
ATOM   102  N  N    . GLN A 1 18  ? 8.787   8.369   -24.000 1.00 25.34 ? 461 GLN A N    1 
ATOM   103  C  CA   . GLN A 1 18  ? 9.629   7.375   -24.719 1.00 25.66 ? 461 GLN A CA   1 
ATOM   104  C  C    . GLN A 1 18  ? 8.886   6.164   -25.223 1.00 25.65 ? 461 GLN A C    1 
ATOM   105  O  O    . GLN A 1 18  ? 8.228   5.493   -24.438 1.00 25.70 ? 461 GLN A O    1 
ATOM   106  C  CB   . GLN A 1 18  ? 10.708  6.826   -23.786 1.00 25.38 ? 461 GLN A CB   1 
ATOM   107  C  CG   . GLN A 1 18  ? 11.427  7.893   -22.998 1.00 26.18 ? 461 GLN A CG   1 
ATOM   108  C  CD   . GLN A 1 18  ? 10.590  8.472   -21.867 1.00 25.93 ? 461 GLN A CD   1 
ATOM   109  O  OE1  . GLN A 1 18  ? 10.089  9.590   -21.955 1.00 26.61 ? 461 GLN A OE1  1 
ATOM   110  N  NE2  . GLN A 1 18  ? 10.455  7.722   -20.806 1.00 26.85 ? 461 GLN A NE2  1 
ATOM   111  N  N    . ARG A 1 19  ? 9.033   5.842   -26.502 1.00 25.69 ? 462 ARG A N    1 
ATOM   112  C  CA   . ARG A 1 19  ? 8.243   4.766   -27.089 1.00 25.93 ? 462 ARG A CA   1 
ATOM   113  C  C    . ARG A 1 19  ? 8.834   3.396   -26.798 1.00 26.23 ? 462 ARG A C    1 
ATOM   114  O  O    . ARG A 1 19  ? 9.899   3.037   -27.333 1.00 26.66 ? 462 ARG A O    1 
ATOM   115  C  CB   . ARG A 1 19  ? 8.139   4.962   -28.595 1.00 26.33 ? 462 ARG A CB   1 
ATOM   116  C  CG   . ARG A 1 19  ? 6.953   4.248   -29.229 1.00 25.83 ? 462 ARG A CG   1 
ATOM   117  C  CD   . ARG A 1 19  ? 7.352   3.441   -30.411 1.00 26.62 ? 462 ARG A CD   1 
ATOM   118  N  NE   . ARG A 1 19  ? 6.498   2.279   -30.586 1.00 27.53 ? 462 ARG A NE   1 
ATOM   119  C  CZ   . ARG A 1 19  ? 6.473   1.560   -31.691 1.00 27.42 ? 462 ARG A CZ   1 
ATOM   120  N  NH1  . ARG A 1 19  ? 7.265   1.873   -32.707 1.00 28.25 ? 462 ARG A NH1  1 
ATOM   121  N  NH2  . ARG A 1 19  ? 5.651   0.539   -31.790 1.00 26.93 ? 462 ARG A NH2  1 
ATOM   122  N  N    . ILE A 1 20  ? 8.147   2.626   -25.960 1.00 26.24 ? 463 ILE A N    1 
ATOM   123  C  CA   . ILE A 1 20  ? 8.627   1.306   -25.561 1.00 26.55 ? 463 ILE A CA   1 
ATOM   124  C  C    . ILE A 1 20  ? 8.267   0.229   -26.575 1.00 27.32 ? 463 ILE A C    1 
ATOM   125  O  O    . ILE A 1 20  ? 9.129   -0.577  -26.949 1.00 28.65 ? 463 ILE A O    1 
ATOM   126  C  CB   . ILE A 1 20  ? 8.045   0.892   -24.223 1.00 26.31 ? 463 ILE A CB   1 
ATOM   127  C  CG1  . ILE A 1 20  ? 8.423   1.880   -23.120 1.00 26.67 ? 463 ILE A CG1  1 
ATOM   128  C  CG2  . ILE A 1 20  ? 8.487   -0.507  -23.872 1.00 26.09 ? 463 ILE A CG2  1 
ATOM   129  C  CD1  . ILE A 1 20  ? 9.903   1.907   -22.692 1.00 26.90 ? 463 ILE A CD1  1 
ATOM   130  N  N    . GLY A 1 21  ? 7.003   0.183   -27.005 1.00 27.40 ? 464 GLY A N    1 
ATOM   131  C  CA   . GLY A 1 21  ? 6.534   -0.929  -27.835 1.00 27.20 ? 464 GLY A CA   1 
ATOM   132  C  C    . GLY A 1 21  ? 5.081   -0.861  -28.284 1.00 27.05 ? 464 GLY A C    1 
ATOM   133  O  O    . GLY A 1 21  ? 4.439   0.161   -28.115 1.00 27.12 ? 464 GLY A O    1 
ATOM   134  N  N    . SER A 1 22  ? 4.554   -1.941  -28.859 1.00 27.07 ? 465 SER A N    1 
ATOM   135  C  CA   . SER A 1 22  ? 3.195   -1.897  -29.427 1.00 27.08 ? 465 SER A CA   1 
ATOM   136  C  C    . SER A 1 22  ? 2.357   -3.206  -29.380 1.00 27.19 ? 465 SER A C    1 
ATOM   137  O  O    . SER A 1 22  ? 2.311   -3.902  -28.346 1.00 26.99 ? 465 SER A O    1 
ATOM   138  C  CB   . SER A 1 22  ? 3.286   -1.366  -30.859 1.00 26.97 ? 465 SER A CB   1 
ATOM   139  O  OG   . SER A 1 22  ? 4.252   -2.115  -31.571 1.00 26.64 ? 465 SER A OG   1 
ATOM   140  N  N    . GLY A 1 23  ? 1.700   -3.511  -30.504 1.00 27.29 ? 466 GLY A N    1 
ATOM   141  C  CA   . GLY A 1 23  ? 0.601   -4.453  -30.553 1.00 27.86 ? 466 GLY A CA   1 
ATOM   142  C  C    . GLY A 1 23  ? -0.570  -4.063  -31.467 1.00 28.11 ? 466 GLY A C    1 
ATOM   143  O  O    . GLY A 1 23  ? -0.636  -2.920  -31.947 1.00 27.57 ? 466 GLY A O    1 
ATOM   144  N  N    . SER A 1 24  ? -1.467  -5.051  -31.699 1.00 28.69 ? 467 SER A N    1 
ATOM   145  C  CA   . SER A 1 24  ? -2.770  -4.913  -32.420 1.00 28.68 ? 467 SER A CA   1 
ATOM   146  C  C    . SER A 1 24  ? -3.743  -3.995  -31.632 1.00 28.95 ? 467 SER A C    1 
ATOM   147  O  O    . SER A 1 24  ? -4.407  -3.126  -32.209 1.00 29.56 ? 467 SER A O    1 
ATOM   148  C  CB   . SER A 1 24  ? -3.447  -6.300  -32.628 1.00 28.72 ? 467 SER A CB   1 
ATOM   149  O  OG   . SER A 1 24  ? -3.184  -6.884  -33.903 1.00 27.47 ? 467 SER A OG   1 
ATOM   150  N  N    . PHE A 1 25  ? -3.848  -4.216  -30.326 1.00 28.24 ? 468 PHE A N    1 
ATOM   151  C  CA   . PHE A 1 25  ? -4.287  -3.161  -29.393 1.00 28.14 ? 468 PHE A CA   1 
ATOM   152  C  C    . PHE A 1 25  ? -3.744  -1.714  -29.717 1.00 27.72 ? 468 PHE A C    1 
ATOM   153  O  O    . PHE A 1 25  ? -4.486  -0.844  -30.234 1.00 27.35 ? 468 PHE A O    1 
ATOM   154  C  CB   . PHE A 1 25  ? -3.896  -3.558  -27.940 1.00 28.33 ? 468 PHE A CB   1 
ATOM   155  C  CG   . PHE A 1 25  ? -3.014  -4.807  -27.850 1.00 29.72 ? 468 PHE A CG   1 
ATOM   156  C  CD1  . PHE A 1 25  ? -1.602  -4.712  -27.899 1.00 30.56 ? 468 PHE A CD1  1 
ATOM   157  C  CD2  . PHE A 1 25  ? -3.587  -6.072  -27.746 1.00 28.56 ? 468 PHE A CD2  1 
ATOM   158  C  CE1  . PHE A 1 25  ? -0.798  -5.882  -27.830 1.00 29.87 ? 468 PHE A CE1  1 
ATOM   159  C  CE2  . PHE A 1 25  ? -2.781  -7.218  -27.695 1.00 28.69 ? 468 PHE A CE2  1 
ATOM   160  C  CZ   . PHE A 1 25  ? -1.390  -7.122  -27.725 1.00 28.21 ? 468 PHE A CZ   1 
ATOM   161  N  N    . GLY A 1 26  ? -2.464  -1.465  -29.412 1.00 27.18 ? 469 GLY A N    1 
ATOM   162  C  CA   . GLY A 1 26  ? -1.946  -0.113  -29.434 1.00 26.99 ? 469 GLY A CA   1 
ATOM   163  C  C    . GLY A 1 26  ? -0.439  0.067   -29.377 1.00 27.08 ? 469 GLY A C    1 
ATOM   164  O  O    . GLY A 1 26  ? 0.312   -0.816  -29.798 1.00 27.31 ? 469 GLY A O    1 
ATOM   165  N  N    . THR A 1 27  ? -0.030  1.250   -28.885 1.00 26.98 ? 470 THR A N    1 
ATOM   166  C  CA   . THR A 1 27  ? 1.372   1.692   -28.716 1.00 26.44 ? 470 THR A CA   1 
ATOM   167  C  C    . THR A 1 27  ? 1.625   2.231   -27.302 1.00 26.05 ? 470 THR A C    1 
ATOM   168  O  O    . THR A 1 27  ? 0.893   3.089   -26.854 1.00 26.57 ? 470 THR A O    1 
ATOM   169  C  CB   . THR A 1 27  ? 1.636   2.797   -29.685 1.00 26.19 ? 470 THR A CB   1 
ATOM   170  O  OG1  . THR A 1 27  ? 1.804   2.223   -30.974 1.00 27.12 ? 470 THR A OG1  1 
ATOM   171  C  CG2  . THR A 1 27  ? 2.955   3.489   -29.411 1.00 26.00 ? 470 THR A CG2  1 
ATOM   172  N  N    . VAL A 1 28  ? 2.702   1.788   -26.657 1.00 25.32 ? 471 VAL A N    1 
ATOM   173  C  CA   . VAL A 1 28  ? 2.915   1.931   -25.221 1.00 24.71 ? 471 VAL A CA   1 
ATOM   174  C  C    . VAL A 1 28  ? 4.115   2.825   -24.994 1.00 24.26 ? 471 VAL A C    1 
ATOM   175  O  O    . VAL A 1 28  ? 5.191   2.504   -25.453 1.00 23.99 ? 471 VAL A O    1 
ATOM   176  C  CB   . VAL A 1 28  ? 3.255   0.548   -24.568 1.00 24.82 ? 471 VAL A CB   1 
ATOM   177  C  CG1  . VAL A 1 28  ? 3.738   0.724   -23.155 1.00 26.09 ? 471 VAL A CG1  1 
ATOM   178  C  CG2  . VAL A 1 28  ? 2.078   -0.428  -24.590 1.00 24.36 ? 471 VAL A CG2  1 
ATOM   179  N  N    . TYR A 1 29  ? 3.931   3.902   -24.243 1.00 24.22 ? 472 TYR A N    1 
ATOM   180  C  CA   . TYR A 1 29  ? 4.992   4.834   -23.875 1.00 24.03 ? 472 TYR A CA   1 
ATOM   181  C  C    . TYR A 1 29  ? 5.165   4.890   -22.364 1.00 23.85 ? 472 TYR A C    1 
ATOM   182  O  O    . TYR A 1 29  ? 4.319   4.478   -21.610 1.00 23.29 ? 472 TYR A O    1 
ATOM   183  C  CB   . TYR A 1 29  ? 4.652   6.243   -24.353 1.00 24.20 ? 472 TYR A CB   1 
ATOM   184  C  CG   . TYR A 1 29  ? 4.526   6.387   -25.862 1.00 25.11 ? 472 TYR A CG   1 
ATOM   185  C  CD1  . TYR A 1 29  ? 3.311   6.174   -26.513 1.00 24.29 ? 472 TYR A CD1  1 
ATOM   186  C  CD2  . TYR A 1 29  ? 5.631   6.773   -26.640 1.00 25.44 ? 472 TYR A CD2  1 
ATOM   187  C  CE1  . TYR A 1 29  ? 3.215   6.319   -27.896 1.00 24.89 ? 472 TYR A CE1  1 
ATOM   188  C  CE2  . TYR A 1 29  ? 5.530   6.930   -28.003 1.00 24.42 ? 472 TYR A CE2  1 
ATOM   189  C  CZ   . TYR A 1 29  ? 4.331   6.691   -28.625 1.00 23.91 ? 472 TYR A CZ   1 
ATOM   190  O  OH   . TYR A 1 29  ? 4.262   6.845   -29.973 1.00 23.54 ? 472 TYR A OH   1 
ATOM   191  N  N    . LYS A 1 30  ? 6.302   5.404   -21.930 1.00 24.10 ? 473 LYS A N    1 
ATOM   192  C  CA   . LYS A 1 30  ? 6.538   5.695   -20.525 1.00 23.74 ? 473 LYS A CA   1 
ATOM   193  C  C    . LYS A 1 30  ? 6.049   7.106   -20.358 1.00 23.63 ? 473 LYS A C    1 
ATOM   194  O  O    . LYS A 1 30  ? 5.869   7.845   -21.355 1.00 22.86 ? 473 LYS A O    1 
ATOM   195  C  CB   . LYS A 1 30  ? 8.032   5.607   -20.192 1.00 23.60 ? 473 LYS A CB   1 
ATOM   196  C  CG   . LYS A 1 30  ? 8.363   5.718   -18.708 1.00 23.67 ? 473 LYS A CG   1 
ATOM   197  C  CD   . LYS A 1 30  ? 9.684   5.032   -18.383 1.00 24.30 ? 473 LYS A CD   1 
ATOM   198  C  CE   . LYS A 1 30  ? 10.146  5.306   -16.939 1.00 25.63 ? 473 LYS A CE   1 
ATOM   199  N  NZ   . LYS A 1 30  ? 11.642  5.457   -16.779 1.00 24.51 ? 473 LYS A NZ   1 
ATOM   200  N  N    . GLY A 1 31  ? 5.829   7.495   -19.106 1.00 23.74 ? 474 GLY A N    1 
ATOM   201  C  CA   . GLY A 1 31  ? 5.380   8.847   -18.854 1.00 23.60 ? 474 GLY A CA   1 
ATOM   202  C  C    . GLY A 1 31  ? 5.250   9.308   -17.437 1.00 23.12 ? 474 GLY A C    1 
ATOM   203  O  O    . GLY A 1 31  ? 5.117   8.533   -16.516 1.00 22.16 ? 474 GLY A O    1 
ATOM   204  N  N    . LYS A 1 32  ? 5.238   10.626  -17.311 1.00 23.50 ? 475 LYS A N    1 
ATOM   205  C  CA   . LYS A 1 32  ? 5.105   11.297  -16.029 1.00 23.60 ? 475 LYS A CA   1 
ATOM   206  C  C    . LYS A 1 32  ? 3.639   11.699  -15.748 1.00 23.10 ? 475 LYS A C    1 
ATOM   207  O  O    . LYS A 1 32  ? 3.009   12.443  -16.477 1.00 22.86 ? 475 LYS A O    1 
ATOM   208  C  CB   . LYS A 1 32  ? 6.049   12.519  -15.941 1.00 23.24 ? 475 LYS A CB   1 
ATOM   209  C  CG   . LYS A 1 32  ? 7.484   12.294  -16.446 1.00 24.29 ? 475 LYS A CG   1 
ATOM   210  C  CD   . LYS A 1 32  ? 8.171   11.077  -15.830 1.00 24.99 ? 475 LYS A CD   1 
ATOM   211  C  CE   . LYS A 1 32  ? 8.324   11.200  -14.306 1.00 26.14 ? 475 LYS A CE   1 
ATOM   212  N  NZ   . LYS A 1 32  ? 7.125   10.699  -13.517 1.00 25.79 ? 475 LYS A NZ   1 
ATOM   213  N  N    . TRP A 1 33  ? 3.122   11.192  -14.656 1.00 22.85 ? 476 TRP A N    1 
ATOM   214  C  CA   . TRP A 1 33  ? 1.870   11.636  -14.132 1.00 23.17 ? 476 TRP A CA   1 
ATOM   215  C  C    . TRP A 1 33  ? 1.898   11.226  -12.692 1.00 23.51 ? 476 TRP A C    1 
ATOM   216  O  O    . TRP A 1 33  ? 1.812   10.021  -12.397 1.00 24.40 ? 476 TRP A O    1 
ATOM   217  C  CB   . TRP A 1 33  ? 0.725   10.929  -14.847 1.00 23.34 ? 476 TRP A CB   1 
ATOM   218  C  CG   . TRP A 1 33  ? -0.576  11.440  -14.497 1.00 22.20 ? 476 TRP A CG   1 
ATOM   219  C  CD1  . TRP A 1 33  ? -1.097  12.624  -14.873 1.00 21.73 ? 476 TRP A CD1  1 
ATOM   220  C  CD2  . TRP A 1 33  ? -1.552  10.803  -13.686 1.00 21.12 ? 476 TRP A CD2  1 
ATOM   221  N  NE1  . TRP A 1 33  ? -2.356  12.774  -14.350 1.00 21.63 ? 476 TRP A NE1  1 
ATOM   222  C  CE2  . TRP A 1 33  ? -2.660  11.665  -13.614 1.00 21.45 ? 476 TRP A CE2  1 
ATOM   223  C  CE3  . TRP A 1 33  ? -1.614  9.588   -13.023 1.00 21.08 ? 476 TRP A CE3  1 
ATOM   224  C  CZ2  . TRP A 1 33  ? -3.811  11.348  -12.922 1.00 22.17 ? 476 TRP A CZ2  1 
ATOM   225  C  CZ3  . TRP A 1 33  ? -2.765  9.274   -12.327 1.00 21.90 ? 476 TRP A CZ3  1 
ATOM   226  C  CH2  . TRP A 1 33  ? -3.849  10.141  -12.295 1.00 22.17 ? 476 TRP A CH2  1 
ATOM   227  N  N    . HIS A 1 34  ? 2.056   12.208  -11.807 1.00 23.22 ? 477 HIS A N    1 
ATOM   228  C  CA   . HIS A 1 34  ? 2.127   11.979  -10.357 1.00 23.03 ? 477 HIS A CA   1 
ATOM   229  C  C    . HIS A 1 34  ? 3.058   10.819  -10.037 1.00 22.85 ? 477 HIS A C    1 
ATOM   230  O  O    . HIS A 1 34  ? 2.777   9.984   -9.192  1.00 22.38 ? 477 HIS A O    1 
ATOM   231  C  CB   . HIS A 1 34  ? 0.746   11.756  -9.794  1.00 22.44 ? 477 HIS A CB   1 
ATOM   232  C  CG   . HIS A 1 34  ? -0.188  12.898  -10.033 1.00 22.84 ? 477 HIS A CG   1 
ATOM   233  N  ND1  . HIS A 1 34  ? -0.001  14.141  -9.474  1.00 22.85 ? 477 HIS A ND1  1 
ATOM   234  C  CD2  . HIS A 1 34  ? -1.324  12.985  -10.761 1.00 23.36 ? 477 HIS A CD2  1 
ATOM   235  C  CE1  . HIS A 1 34  ? -0.982  14.943  -9.845  1.00 22.49 ? 477 HIS A CE1  1 
ATOM   236  N  NE2  . HIS A 1 34  ? -1.797  14.267  -10.630 1.00 22.49 ? 477 HIS A NE2  1 
ATOM   237  N  N    . GLY A 1 35  ? 4.185   10.823  -10.729 1.00 23.22 ? 478 GLY A N    1 
ATOM   238  C  CA   . GLY A 1 35  ? 5.126   9.728   -10.728 1.00 23.90 ? 478 GLY A CA   1 
ATOM   239  C  C    . GLY A 1 35  ? 5.120   9.080   -12.099 1.00 24.38 ? 478 GLY A C    1 
ATOM   240  O  O    . GLY A 1 35  ? 4.523   9.604   -13.043 1.00 24.70 ? 478 GLY A O    1 
ATOM   241  N  N    . ASP A 1 36  ? 5.778   7.932   -12.208 1.00 24.40 ? 479 ASP A N    1 
ATOM   242  C  CA   . ASP A 1 36  ? 5.859   7.206   -13.469 1.00 23.98 ? 479 ASP A CA   1 
ATOM   243  C  C    . ASP A 1 36  ? 4.534   6.527   -13.832 1.00 23.58 ? 479 ASP A C    1 
ATOM   244  O  O    . ASP A 1 36  ? 3.753   6.207   -12.962 1.00 23.11 ? 479 ASP A O    1 
ATOM   245  C  CB   . ASP A 1 36  ? 6.988   6.191   -13.392 1.00 23.86 ? 479 ASP A CB   1 
ATOM   246  C  CG   . ASP A 1 36  ? 8.353   6.850   -13.284 1.00 24.12 ? 479 ASP A CG   1 
ATOM   247  O  OD1  . ASP A 1 36  ? 8.460   8.016   -13.686 1.00 26.10 ? 479 ASP A OD1  1 
ATOM   248  O  OD2  . ASP A 1 36  ? 9.376   6.285   -12.840 1.00 22.61 ? 479 ASP A OD2  1 
ATOM   249  N  N    . VAL A 1 37  ? 4.297   6.360   -15.134 1.00 23.50 ? 480 VAL A N    1 
ATOM   250  C  CA   . VAL A 1 37  ? 3.162   5.605   -15.671 1.00 23.72 ? 480 VAL A CA   1 
ATOM   251  C  C    . VAL A 1 37  ? 3.517   5.007   -17.041 1.00 23.90 ? 480 VAL A C    1 
ATOM   252  O  O    . VAL A 1 37  ? 4.610   5.193   -17.558 1.00 23.91 ? 480 VAL A O    1 
ATOM   253  C  CB   . VAL A 1 37  ? 1.808   6.445   -15.819 1.00 23.36 ? 480 VAL A CB   1 
ATOM   254  C  CG1  . VAL A 1 37  ? 1.369   7.036   -14.522 1.00 23.02 ? 480 VAL A CG1  1 
ATOM   255  C  CG2  . VAL A 1 37  ? 1.914   7.533   -16.851 1.00 23.70 ? 480 VAL A CG2  1 
ATOM   256  N  N    . ALA A 1 38  ? 2.563   4.272   -17.598 1.00 24.11 ? 481 ALA A N    1 
ATOM   257  C  CA   . ALA A 1 38  ? 2.642   3.720   -18.933 1.00 24.23 ? 481 ALA A CA   1 
ATOM   258  C  C    . ALA A 1 38  ? 1.392   4.153   -19.669 1.00 24.35 ? 481 ALA A C    1 
ATOM   259  O  O    . ALA A 1 38  ? 0.308   4.196   -19.071 1.00 24.86 ? 481 ALA A O    1 
ATOM   260  C  CB   . ALA A 1 38  ? 2.709   2.215   -18.872 1.00 24.21 ? 481 ALA A CB   1 
ATOM   261  N  N    . VAL A 1 39  ? 1.510   4.493   -20.944 1.00 24.00 ? 482 VAL A N    1 
ATOM   262  C  CA   . VAL A 1 39  ? 0.349   4.972   -21.668 1.00 24.21 ? 482 VAL A CA   1 
ATOM   263  C  C    . VAL A 1 39  ? 0.196   4.211   -22.959 1.00 24.00 ? 482 VAL A C    1 
ATOM   264  O  O    . VAL A 1 39  ? 1.012   4.368   -23.845 1.00 24.25 ? 482 VAL A O    1 
ATOM   265  C  CB   . VAL A 1 39  ? 0.453   6.489   -21.969 1.00 24.70 ? 482 VAL A CB   1 
ATOM   266  C  CG1  . VAL A 1 39  ? -0.930  7.073   -22.429 1.00 23.48 ? 482 VAL A CG1  1 
ATOM   267  C  CG2  . VAL A 1 39  ? 1.015   7.242   -20.760 1.00 24.61 ? 482 VAL A CG2  1 
ATOM   268  N  N    . LYS A 1 40  ? -0.838  3.390   -23.055 1.00 23.60 ? 483 LYS A N    1 
ATOM   269  C  CA   . LYS A 1 40  ? -1.098  2.604   -24.249 1.00 24.02 ? 483 LYS A CA   1 
ATOM   270  C  C    . LYS A 1 40  ? -2.090  3.402   -25.074 1.00 23.80 ? 483 LYS A C    1 
ATOM   271  O  O    . LYS A 1 40  ? -3.277  3.403   -24.792 1.00 23.92 ? 483 LYS A O    1 
ATOM   272  C  CB   . LYS A 1 40  ? -1.657  1.218   -23.866 1.00 24.21 ? 483 LYS A CB   1 
ATOM   273  C  CG   . LYS A 1 40  ? -2.148  0.325   -25.016 1.00 25.07 ? 483 LYS A CG   1 
ATOM   274  C  CD   . LYS A 1 40  ? -2.209  -1.180  -24.594 1.00 26.29 ? 483 LYS A CD   1 
ATOM   275  C  CE   . LYS A 1 40  ? -3.599  -1.820  -24.833 1.00 26.84 ? 483 LYS A CE   1 
ATOM   276  N  NZ   . LYS A 1 40  ? -3.666  -3.312  -24.508 1.00 26.95 ? 483 LYS A NZ   1 
ATOM   277  N  N    . MET A 1 41  ? -1.605  4.094   -26.088 1.00 23.93 ? 484 MET A N    1 
ATOM   278  C  CA   . MET A 1 41  ? -2.472  4.925   -26.946 1.00 24.52 ? 484 MET A CA   1 
ATOM   279  C  C    . MET A 1 41  ? -3.035  4.106   -28.072 1.00 24.61 ? 484 MET A C    1 
ATOM   280  O  O    . MET A 1 41  ? -2.303  3.526   -28.860 1.00 24.76 ? 484 MET A O    1 
ATOM   281  C  CB   . MET A 1 41  ? -1.727  6.106   -27.559 1.00 24.43 ? 484 MET A CB   1 
ATOM   282  C  CG   . MET A 1 41  ? -0.448  6.419   -26.887 1.00 25.01 ? 484 MET A CG   1 
ATOM   283  S  SD   . MET A 1 41  ? -0.504  8.053   -26.460 1.00 27.06 ? 484 MET A SD   1 
ATOM   284  C  CE   . MET A 1 41  ? 0.502   8.664   -27.881 1.00 26.92 ? 484 MET A CE   1 
ATOM   285  N  N    . LEU A 1 42  ? -4.341  4.078   -28.175 1.00 25.01 ? 485 LEU A N    1 
ATOM   286  C  CA   . LEU A 1 42  ? -4.958  3.191   -29.127 1.00 25.66 ? 485 LEU A CA   1 
ATOM   287  C  C    . LEU A 1 42  ? -4.651  3.653   -30.566 1.00 26.27 ? 485 LEU A C    1 
ATOM   288  O  O    . LEU A 1 42  ? -4.280  4.820   -30.796 1.00 26.29 ? 485 LEU A O    1 
ATOM   289  C  CB   . LEU A 1 42  ? -6.465  3.081   -28.848 1.00 25.27 ? 485 LEU A CB   1 
ATOM   290  C  CG   . LEU A 1 42  ? -6.842  1.958   -27.871 1.00 25.13 ? 485 LEU A CG   1 
ATOM   291  C  CD1  . LEU A 1 42  ? -6.342  2.222   -26.455 1.00 23.73 ? 485 LEU A CD1  1 
ATOM   292  C  CD2  . LEU A 1 42  ? -8.380  1.733   -27.889 1.00 26.64 ? 485 LEU A CD2  1 
ATOM   293  N  N    . ASN A 1 43  ? -4.774  2.711   -31.505 1.00 26.63 ? 486 ASN A N    1 
ATOM   294  C  CA   . ASN A 1 43  ? -4.692  2.990   -32.930 1.00 26.88 ? 486 ASN A CA   1 
ATOM   295  C  C    . ASN A 1 43  ? -6.006  3.604   -33.350 1.00 26.85 ? 486 ASN A C    1 
ATOM   296  O  O    . ASN A 1 43  ? -6.851  2.911   -33.912 1.00 26.80 ? 486 ASN A O    1 
ATOM   297  C  CB   . ASN A 1 43  ? -4.419  1.685   -33.718 1.00 27.26 ? 486 ASN A CB   1 
ATOM   298  C  CG   . ASN A 1 43  ? -4.707  1.810   -35.231 1.00 28.49 ? 486 ASN A CG   1 
ATOM   299  O  OD1  . ASN A 1 43  ? -4.422  2.839   -35.855 1.00 30.64 ? 486 ASN A OD1  1 
ATOM   300  N  ND2  . ASN A 1 43  ? -5.283  0.759   -35.814 1.00 28.76 ? 486 ASN A ND2  1 
ATOM   301  N  N    . VAL A 1 44  ? -6.168  4.902   -33.077 1.00 26.82 ? 487 VAL A N    1 
ATOM   302  C  CA   . VAL A 1 44  ? -7.378  5.634   -33.440 1.00 26.98 ? 487 VAL A CA   1 
ATOM   303  C  C    . VAL A 1 44  ? -7.124  7.121   -33.462 1.00 27.38 ? 487 VAL A C    1 
ATOM   304  O  O    . VAL A 1 44  ? -6.636  7.681   -32.486 1.00 27.88 ? 487 VAL A O    1 
ATOM   305  C  CB   . VAL A 1 44  ? -8.561  5.389   -32.453 1.00 26.94 ? 487 VAL A CB   1 
ATOM   306  C  CG1  . VAL A 1 44  ? -9.630  6.526   -32.526 1.00 27.10 ? 487 VAL A CG1  1 
ATOM   307  C  CG2  . VAL A 1 44  ? -9.234  4.041   -32.724 1.00 27.28 ? 487 VAL A CG2  1 
ATOM   308  N  N    . THR A 1 45  ? -7.540  7.763   -34.550 1.00 27.78 ? 488 THR A N    1 
ATOM   309  C  CA   . THR A 1 45  ? -7.395  9.201   -34.731 1.00 27.97 ? 488 THR A CA   1 
ATOM   310  C  C    . THR A 1 45  ? -8.668  9.942   -34.216 1.00 28.08 ? 488 THR A C    1 
ATOM   311  O  O    . THR A 1 45  ? -8.692  10.500  -33.102 1.00 28.15 ? 488 THR A O    1 
ATOM   312  C  CB   . THR A 1 45  ? -7.059  9.527   -36.258 1.00 28.17 ? 488 THR A CB   1 
ATOM   313  O  OG1  . THR A 1 45  ? -6.683  8.336   -36.976 1.00 27.42 ? 488 THR A OG1  1 
ATOM   314  C  CG2  . THR A 1 45  ? -5.810  10.451  -36.399 1.00 28.40 ? 488 THR A CG2  1 
ATOM   315  N  N    . ALA A 1 46  ? -9.725  9.922   -35.019 1.00 28.10 ? 489 ALA A N    1 
ATOM   316  C  CA   . ALA A 1 46  ? -10.953 10.669  -34.719 1.00 28.19 ? 489 ALA A CA   1 
ATOM   317  C  C    . ALA A 1 46  ? -11.940 9.777   -33.966 1.00 28.33 ? 489 ALA A C    1 
ATOM   318  O  O    . ALA A 1 46  ? -12.383 8.746   -34.499 1.00 28.85 ? 489 ALA A O    1 
ATOM   319  C  CB   . ALA A 1 46  ? -11.598 11.188  -36.012 1.00 28.02 ? 489 ALA A CB   1 
ATOM   320  N  N    . PRO A 1 47  ? -12.318 10.167  -32.753 1.00 28.05 ? 490 PRO A N    1 
ATOM   321  C  CA   . PRO A 1 47  ? -13.147 9.279   -31.929 1.00 27.80 ? 490 PRO A CA   1 
ATOM   322  C  C    . PRO A 1 47  ? -14.609 9.367   -32.383 1.00 27.41 ? 490 PRO A C    1 
ATOM   323  O  O    . PRO A 1 47  ? -15.252 10.385  -32.112 1.00 26.73 ? 490 PRO A O    1 
ATOM   324  C  CB   . PRO A 1 47  ? -12.939 9.819   -30.501 1.00 27.90 ? 490 PRO A CB   1 
ATOM   325  C  CG   . PRO A 1 47  ? -12.557 11.332  -30.688 1.00 28.02 ? 490 PRO A CG   1 
ATOM   326  C  CD   . PRO A 1 47  ? -12.050 11.468  -32.098 1.00 28.10 ? 490 PRO A CD   1 
ATOM   327  N  N    . THR A 1 48  ? -15.113 8.345   -33.082 1.00 27.29 ? 491 THR A N    1 
ATOM   328  C  CA   . THR A 1 48  ? -16.519 8.368   -33.527 1.00 27.58 ? 491 THR A CA   1 
ATOM   329  C  C    . THR A 1 48  ? -17.380 8.130   -32.275 1.00 27.64 ? 491 THR A C    1 
ATOM   330  O  O    . THR A 1 48  ? -16.999 7.278   -31.453 1.00 27.26 ? 491 THR A O    1 
ATOM   331  C  CB   . THR A 1 48  ? -16.822 7.313   -34.617 1.00 27.64 ? 491 THR A CB   1 
ATOM   332  O  OG1  . THR A 1 48  ? -16.667 5.990   -34.087 1.00 27.97 ? 491 THR A OG1  1 
ATOM   333  C  CG2  . THR A 1 48  ? -15.812 7.391   -35.808 1.00 27.61 ? 491 THR A CG2  1 
ATOM   334  N  N    . PRO A 1 49  ? -18.483 8.887   -32.096 1.00 27.10 ? 492 PRO A N    1 
ATOM   335  C  CA   . PRO A 1 49  ? -19.207 8.910   -30.816 1.00 26.82 ? 492 PRO A CA   1 
ATOM   336  C  C    . PRO A 1 49  ? -19.586 7.533   -30.303 1.00 26.81 ? 492 PRO A C    1 
ATOM   337  O  O    . PRO A 1 49  ? -19.652 7.363   -29.083 1.00 26.64 ? 492 PRO A O    1 
ATOM   338  C  CB   . PRO A 1 49  ? -20.459 9.731   -31.129 1.00 26.91 ? 492 PRO A CB   1 
ATOM   339  C  CG   . PRO A 1 49  ? -20.071 10.603  -32.256 1.00 27.01 ? 492 PRO A CG   1 
ATOM   340  C  CD   . PRO A 1 49  ? -19.109 9.791   -33.075 1.00 27.15 ? 492 PRO A CD   1 
ATOM   341  N  N    . GLN A 1 50  ? -19.824 6.584   -31.212 1.00 26.76 ? 493 GLN A N    1 
ATOM   342  C  CA   . GLN A 1 50  ? -20.031 5.179   -30.843 1.00 26.74 ? 493 GLN A CA   1 
ATOM   343  C  C    . GLN A 1 50  ? -18.709 4.488   -30.463 1.00 26.85 ? 493 GLN A C    1 
ATOM   344  O  O    . GLN A 1 50  ? -18.720 3.376   -29.913 1.00 26.99 ? 493 GLN A O    1 
ATOM   345  C  CB   . GLN A 1 50  ? -20.762 4.418   -31.968 1.00 26.61 ? 493 GLN A CB   1 
ATOM   346  C  CG   . GLN A 1 50  ? -19.961 4.191   -33.267 1.00 26.73 ? 493 GLN A CG   1 
ATOM   347  C  CD   . GLN A 1 50  ? -20.846 4.118   -34.536 1.00 27.46 ? 493 GLN A CD   1 
ATOM   348  O  OE1  . GLN A 1 50  ? -20.917 5.083   -35.319 1.00 25.66 ? 493 GLN A OE1  1 
ATOM   349  N  NE2  . GLN A 1 50  ? -21.503 2.964   -34.743 1.00 27.04 ? 493 GLN A NE2  1 
ATOM   350  N  N    . GLN A 1 51  ? -17.585 5.140   -30.793 1.00 26.99 ? 494 GLN A N    1 
ATOM   351  C  CA   . GLN A 1 51  ? -16.220 4.690   -30.417 1.00 27.25 ? 494 GLN A CA   1 
ATOM   352  C  C    . GLN A 1 51  ? -15.793 5.132   -29.005 1.00 27.05 ? 494 GLN A C    1 
ATOM   353  O  O    . GLN A 1 51  ? -15.033 4.426   -28.336 1.00 27.31 ? 494 GLN A O    1 
ATOM   354  C  CB   . GLN A 1 51  ? -15.163 5.129   -31.460 1.00 27.29 ? 494 GLN A CB   1 
ATOM   355  C  CG   . GLN A 1 51  ? -14.647 3.957   -32.341 1.00 27.24 ? 494 GLN A CG   1 
ATOM   356  C  CD   . GLN A 1 51  ? -14.164 4.389   -33.720 1.00 25.68 ? 494 GLN A CD   1 
ATOM   357  O  OE1  . GLN A 1 51  ? -13.932 5.568   -33.963 1.00 24.61 ? 494 GLN A OE1  1 
ATOM   358  N  NE2  . GLN A 1 51  ? -14.030 3.432   -34.621 1.00 25.58 ? 494 GLN A NE2  1 
ATOM   359  N  N    . LEU A 1 52  ? -16.287 6.295   -28.579 1.00 26.59 ? 495 LEU A N    1 
ATOM   360  C  CA   . LEU A 1 52  ? -16.277 6.714   -27.180 1.00 26.26 ? 495 LEU A CA   1 
ATOM   361  C  C    . LEU A 1 52  ? -17.164 5.845   -26.292 1.00 26.04 ? 495 LEU A C    1 
ATOM   362  O  O    . LEU A 1 52  ? -17.252 6.087   -25.095 1.00 26.17 ? 495 LEU A O    1 
ATOM   363  C  CB   . LEU A 1 52  ? -16.772 8.165   -27.048 1.00 26.31 ? 495 LEU A CB   1 
ATOM   364  C  CG   . LEU A 1 52  ? -15.801 9.225   -26.521 1.00 26.63 ? 495 LEU A CG   1 
ATOM   365  C  CD1  . LEU A 1 52  ? -14.379 9.014   -27.090 1.00 26.12 ? 495 LEU A CD1  1 
ATOM   366  C  CD2  . LEU A 1 52  ? -16.333 10.636  -26.858 1.00 26.99 ? 495 LEU A CD2  1 
ATOM   367  N  N    . GLN A 1 53  ? -17.874 4.880   -26.860 1.00 25.68 ? 496 GLN A N    1 
ATOM   368  C  CA   . GLN A 1 53  ? -18.590 3.947   -26.024 1.00 25.44 ? 496 GLN A CA   1 
ATOM   369  C  C    . GLN A 1 53  ? -17.903 2.623   -26.033 1.00 24.87 ? 496 GLN A C    1 
ATOM   370  O  O    . GLN A 1 53  ? -17.880 1.962   -25.022 1.00 24.97 ? 496 GLN A O    1 
ATOM   371  C  CB   . GLN A 1 53  ? -20.082 3.825   -26.406 1.00 25.70 ? 496 GLN A CB   1 
ATOM   372  C  CG   . GLN A 1 53  ? -20.987 3.536   -25.188 1.00 26.34 ? 496 GLN A CG   1 
ATOM   373  C  CD   . GLN A 1 53  ? -20.454 4.213   -23.907 1.00 27.25 ? 496 GLN A CD   1 
ATOM   374  O  OE1  . GLN A 1 53  ? -20.231 5.427   -23.901 1.00 29.33 ? 496 GLN A OE1  1 
ATOM   375  N  NE2  . GLN A 1 53  ? -20.226 3.436   -22.854 1.00 26.00 ? 496 GLN A NE2  1 
ATOM   376  N  N    . ALA A 1 54  ? -17.340 2.228   -27.166 1.00 24.75 ? 497 ALA A N    1 
ATOM   377  C  CA   . ALA A 1 54  ? -16.492 1.037   -27.214 1.00 24.80 ? 497 ALA A CA   1 
ATOM   378  C  C    . ALA A 1 54  ? -15.437 1.087   -26.118 1.00 24.70 ? 497 ALA A C    1 
ATOM   379  O  O    . ALA A 1 54  ? -15.150 0.087   -25.470 1.00 24.56 ? 497 ALA A O    1 
ATOM   380  C  CB   . ALA A 1 54  ? -15.821 0.917   -28.567 1.00 24.73 ? 497 ALA A CB   1 
ATOM   381  N  N    . PHE A 1 55  ? -14.886 2.279   -25.916 1.00 24.76 ? 498 PHE A N    1 
ATOM   382  C  CA   . PHE A 1 55  ? -13.766 2.487   -25.024 1.00 24.57 ? 498 PHE A CA   1 
ATOM   383  C  C    . PHE A 1 55  ? -14.210 2.516   -23.575 1.00 24.65 ? 498 PHE A C    1 
ATOM   384  O  O    . PHE A 1 55  ? -13.716 1.739   -22.758 1.00 24.78 ? 498 PHE A O    1 
ATOM   385  C  CB   . PHE A 1 55  ? -13.064 3.799   -25.382 1.00 24.55 ? 498 PHE A CB   1 
ATOM   386  C  CG   . PHE A 1 55  ? -11.768 3.999   -24.672 1.00 23.11 ? 498 PHE A CG   1 
ATOM   387  C  CD1  . PHE A 1 55  ? -10.842 2.981   -24.617 1.00 22.74 ? 498 PHE A CD1  1 
ATOM   388  C  CD2  . PHE A 1 55  ? -11.484 5.189   -24.071 1.00 22.05 ? 498 PHE A CD2  1 
ATOM   389  C  CE1  . PHE A 1 55  ? -9.662  3.146   -23.977 1.00 24.33 ? 498 PHE A CE1  1 
ATOM   390  C  CE2  . PHE A 1 55  ? -10.291 5.373   -23.427 1.00 24.59 ? 498 PHE A CE2  1 
ATOM   391  C  CZ   . PHE A 1 55  ? -9.374  4.352   -23.368 1.00 24.69 ? 498 PHE A CZ   1 
ATOM   392  N  N    . LYS A 1 56  ? -15.143 3.412   -23.272 1.00 24.47 ? 499 LYS A N    1 
ATOM   393  C  CA   . LYS A 1 56  ? -15.712 3.522   -21.940 1.00 24.69 ? 499 LYS A CA   1 
ATOM   394  C  C    . LYS A 1 56  ? -16.505 2.277   -21.479 1.00 25.23 ? 499 LYS A C    1 
ATOM   395  O  O    . LYS A 1 56  ? -16.842 2.189   -20.282 1.00 25.94 ? 499 LYS A O    1 
ATOM   396  C  CB   . LYS A 1 56  ? -16.633 4.736   -21.845 1.00 24.67 ? 499 LYS A CB   1 
ATOM   397  C  CG   . LYS A 1 56  ? -15.989 6.055   -22.119 1.00 24.54 ? 499 LYS A CG   1 
ATOM   398  C  CD   . LYS A 1 56  ? -16.959 7.187   -21.804 1.00 25.21 ? 499 LYS A CD   1 
ATOM   399  C  CE   . LYS A 1 56  ? -16.472 8.527   -22.340 1.00 25.66 ? 499 LYS A CE   1 
ATOM   400  N  NZ   . LYS A 1 56  ? -17.273 9.694   -21.834 1.00 26.16 ? 499 LYS A NZ   1 
ATOM   401  N  N    . ASN A 1 57  ? -16.831 1.341   -22.382 1.00 25.09 ? 500 ASN A N    1 
ATOM   402  C  CA   . ASN A 1 57  ? -17.378 0.044   -21.954 1.00 25.49 ? 500 ASN A CA   1 
ATOM   403  C  C    . ASN A 1 57  ? -16.257 -0.950  -21.633 1.00 25.48 ? 500 ASN A C    1 
ATOM   404  O  O    . ASN A 1 57  ? -16.430 -1.856  -20.819 1.00 25.36 ? 500 ASN A O    1 
ATOM   405  C  CB   . ASN A 1 57  ? -18.357 -0.551  -22.980 1.00 25.71 ? 500 ASN A CB   1 
ATOM   406  C  CG   . ASN A 1 57  ? -19.826 -0.205  -22.671 1.00 26.68 ? 500 ASN A CG   1 
ATOM   407  O  OD1  . ASN A 1 57  ? -20.187 0.970   -22.631 1.00 28.06 ? 500 ASN A OD1  1 
ATOM   408  N  ND2  . ASN A 1 57  ? -20.672 -1.230  -22.465 1.00 26.48 ? 500 ASN A ND2  1 
ATOM   409  N  N    . GLU A 1 58  ? -15.116 -0.766  -22.296 1.00 26.04 ? 501 GLU A N    1 
ATOM   410  C  CA   . GLU A 1 58  ? -13.890 -1.546  -22.061 1.00 26.11 ? 501 GLU A CA   1 
ATOM   411  C  C    . GLU A 1 58  ? -13.149 -1.064  -20.829 1.00 25.73 ? 501 GLU A C    1 
ATOM   412  O  O    . GLU A 1 58  ? -12.329 -1.798  -20.274 1.00 25.99 ? 501 GLU A O    1 
ATOM   413  C  CB   . GLU A 1 58  ? -12.948 -1.462  -23.270 1.00 25.91 ? 501 GLU A CB   1 
ATOM   414  C  CG   . GLU A 1 58  ? -13.328 -2.375  -24.433 1.00 26.82 ? 501 GLU A CG   1 
ATOM   415  C  CD   . GLU A 1 58  ? -13.323 -3.855  -24.063 1.00 29.02 ? 501 GLU A CD   1 
ATOM   416  O  OE1  . GLU A 1 58  ? -12.266 -4.543  -24.212 1.00 29.44 ? 501 GLU A OE1  1 
ATOM   417  O  OE2  . GLU A 1 58  ? -14.390 -4.331  -23.606 1.00 29.62 ? 501 GLU A OE2  1 
ATOM   418  N  N    . VAL A 1 59  ? -13.466 0.155   -20.401 1.00 25.28 ? 502 VAL A N    1 
ATOM   419  C  CA   . VAL A 1 59  ? -12.767 0.834   -19.302 1.00 25.16 ? 502 VAL A CA   1 
ATOM   420  C  C    . VAL A 1 59  ? -13.436 0.449   -17.993 1.00 24.75 ? 502 VAL A C    1 
ATOM   421  O  O    . VAL A 1 59  ? -12.779 0.171   -16.999 1.00 23.70 ? 502 VAL A O    1 
ATOM   422  C  CB   . VAL A 1 59  ? -12.788 2.382   -19.521 1.00 25.03 ? 502 VAL A CB   1 
ATOM   423  C  CG1  . VAL A 1 59  ? -12.678 3.164   -18.215 1.00 25.76 ? 502 VAL A CG1  1 
ATOM   424  C  CG2  . VAL A 1 59  ? -11.696 2.798   -20.469 1.00 24.49 ? 502 VAL A CG2  1 
ATOM   425  N  N    . GLY A 1 60  ? -14.766 0.450   -18.031 1.00 25.41 ? 503 GLY A N    1 
ATOM   426  C  CA   . GLY A 1 60  ? -15.601 -0.042  -16.953 1.00 25.65 ? 503 GLY A CA   1 
ATOM   427  C  C    . GLY A 1 60  ? -15.306 -1.473  -16.539 1.00 25.84 ? 503 GLY A C    1 
ATOM   428  O  O    . GLY A 1 60  ? -15.668 -1.868  -15.432 1.00 26.45 ? 503 GLY A O    1 
ATOM   429  N  N    . VAL A 1 61  ? -14.675 -2.248  -17.422 1.00 25.96 ? 504 VAL A N    1 
ATOM   430  C  CA   . VAL A 1 61  ? -14.192 -3.602  -17.095 1.00 25.84 ? 504 VAL A CA   1 
ATOM   431  C  C    . VAL A 1 61  ? -12.813 -3.524  -16.450 1.00 25.76 ? 504 VAL A C    1 
ATOM   432  O  O    . VAL A 1 61  ? -12.518 -4.258  -15.505 1.00 25.59 ? 504 VAL A O    1 
ATOM   433  C  CB   . VAL A 1 61  ? -14.091 -4.520  -18.353 1.00 25.56 ? 504 VAL A CB   1 
ATOM   434  C  CG1  . VAL A 1 61  ? -13.562 -5.883  -17.977 1.00 24.66 ? 504 VAL A CG1  1 
ATOM   435  C  CG2  . VAL A 1 61  ? -15.445 -4.641  -19.055 1.00 26.12 ? 504 VAL A CG2  1 
ATOM   436  N  N    . LEU A 1 62  ? -11.969 -2.656  -16.990 1.00 25.82 ? 505 LEU A N    1 
ATOM   437  C  CA   . LEU A 1 62  ? -10.627 -2.480  -16.460 1.00 26.36 ? 505 LEU A CA   1 
ATOM   438  C  C    . LEU A 1 62  ? -10.638 -1.979  -15.008 1.00 26.74 ? 505 LEU A C    1 
ATOM   439  O  O    . LEU A 1 62  ? -9.761  -2.333  -14.215 1.00 27.12 ? 505 LEU A O    1 
ATOM   440  C  CB   . LEU A 1 62  ? -9.845  -1.482  -17.315 1.00 26.49 ? 505 LEU A CB   1 
ATOM   441  C  CG   . LEU A 1 62  ? -9.191  -1.880  -18.650 1.00 26.10 ? 505 LEU A CG   1 
ATOM   442  C  CD1  . LEU A 1 62  ? -7.898  -1.073  -18.798 1.00 24.36 ? 505 LEU A CD1  1 
ATOM   443  C  CD2  . LEU A 1 62  ? -8.935  -3.399  -18.816 1.00 25.73 ? 505 LEU A CD2  1 
ATOM   444  N  N    . ARG A 1 63  ? -11.635 -1.171  -14.651 1.00 26.55 ? 506 ARG A N    1 
ATOM   445  C  CA   . ARG A 1 63  ? -11.617 -0.526  -13.351 1.00 26.31 ? 506 ARG A CA   1 
ATOM   446  C  C    . ARG A 1 63  ? -12.349 -1.378  -12.357 1.00 26.11 ? 506 ARG A C    1 
ATOM   447  O  O    . ARG A 1 63  ? -12.815 -0.880  -11.335 1.00 27.07 ? 506 ARG A O    1 
ATOM   448  C  CB   . ARG A 1 63  ? -12.164 0.932   -13.408 1.00 26.28 ? 506 ARG A CB   1 
ATOM   449  C  CG   . ARG A 1 63  ? -13.669 1.148   -13.595 1.00 25.53 ? 506 ARG A CG   1 
ATOM   450  C  CD   . ARG A 1 63  ? -14.004 2.625   -13.755 1.00 26.40 ? 506 ARG A CD   1 
ATOM   451  N  NE   . ARG A 1 63  ? -15.141 3.160   -12.987 1.00 28.25 ? 506 ARG A NE   1 
ATOM   452  C  CZ   . ARG A 1 63  ? -15.332 3.040   -11.657 1.00 29.91 ? 506 ARG A CZ   1 
ATOM   453  N  NH1  . ARG A 1 63  ? -14.486 2.351   -10.890 1.00 31.51 ? 506 ARG A NH1  1 
ATOM   454  N  NH2  . ARG A 1 63  ? -16.395 3.605   -11.079 1.00 29.40 ? 506 ARG A NH2  1 
ATOM   455  N  N    . LYS A 1 64  ? -12.463 -2.667  -12.651 1.00 25.90 ? 507 LYS A N    1 
ATOM   456  C  CA   . LYS A 1 64  ? -13.046 -3.613  -11.696 1.00 25.60 ? 507 LYS A CA   1 
ATOM   457  C  C    . LYS A 1 64  ? -11.969 -4.624  -11.240 1.00 25.20 ? 507 LYS A C    1 
ATOM   458  O  O    . LYS A 1 64  ? -12.275 -5.614  -10.599 1.00 25.47 ? 507 LYS A O    1 
ATOM   459  C  CB   . LYS A 1 64  ? -14.408 -4.176  -12.226 1.00 25.39 ? 507 LYS A CB   1 
ATOM   460  C  CG   . LYS A 1 64  ? -14.466 -5.565  -12.839 1.00 26.22 ? 507 LYS A CG   1 
ATOM   461  C  CD   . LYS A 1 64  ? -15.823 -5.883  -13.609 1.00 26.74 ? 507 LYS A CD   1 
ATOM   462  C  CE   . LYS A 1 64  ? -17.129 -5.332  -12.932 1.00 27.85 ? 507 LYS A CE   1 
ATOM   463  N  NZ   . LYS A 1 64  ? -17.483 -3.866  -13.234 1.00 27.30 ? 507 LYS A NZ   1 
ATOM   464  N  N    . THR A 1 65  ? -10.702 -4.265  -11.508 1.00 25.19 ? 508 THR A N    1 
ATOM   465  C  CA   . THR A 1 65  ? -9.482  -5.000  -11.135 1.00 24.72 ? 508 THR A CA   1 
ATOM   466  C  C    . THR A 1 65  ? -8.618  -4.275  -10.105 1.00 24.87 ? 508 THR A C    1 
ATOM   467  O  O    . THR A 1 65  ? -7.794  -3.436  -10.469 1.00 25.10 ? 508 THR A O    1 
ATOM   468  C  CB   . THR A 1 65  ? -8.554  -5.144  -12.339 1.00 24.35 ? 508 THR A CB   1 
ATOM   469  O  OG1  . THR A 1 65  ? -8.265  -3.845  -12.877 1.00 23.03 ? 508 THR A OG1  1 
ATOM   470  C  CG2  . THR A 1 65  ? -9.200  -5.861  -13.446 1.00 25.06 ? 508 THR A CG2  1 
ATOM   471  N  N    . ARG A 1 66  ? -8.744  -4.637  -8.840  1.00 24.80 ? 509 ARG A N    1 
ATOM   472  C  CA   . ARG A 1 66  ? -7.795  -4.187  -7.836  1.00 24.98 ? 509 ARG A CA   1 
ATOM   473  C  C    . ARG A 1 66  ? -7.119  -5.415  -7.188  1.00 24.98 ? 509 ARG A C    1 
ATOM   474  O  O    . ARG A 1 66  ? -7.802  -6.265  -6.634  1.00 25.24 ? 509 ARG A O    1 
ATOM   475  C  CB   . ARG A 1 66  ? -8.499  -3.291  -6.805  1.00 24.87 ? 509 ARG A CB   1 
ATOM   476  C  CG   . ARG A 1 66  ? -9.316  -2.140  -7.392  1.00 24.44 ? 509 ARG A CG   1 
ATOM   477  C  CD   . ARG A 1 66  ? -10.028 -1.306  -6.341  1.00 24.54 ? 509 ARG A CD   1 
ATOM   478  N  NE   . ARG A 1 66  ? -10.063 0.148   -6.583  1.00 24.05 ? 509 ARG A NE   1 
ATOM   479  C  CZ   . ARG A 1 66  ? -9.318  1.082   -5.962  1.00 22.31 ? 509 ARG A CZ   1 
ATOM   480  N  NH1  . ARG A 1 66  ? -8.391  0.782   -5.055  1.00 20.72 ? 509 ARG A NH1  1 
ATOM   481  N  NH2  . ARG A 1 66  ? -9.514  2.353   -6.270  1.00 22.67 ? 509 ARG A NH2  1 
ATOM   482  N  N    . HIS A 1 67  ? -5.786  -5.486  -7.271  1.00 24.85 ? 510 HIS A N    1 
ATOM   483  C  CA   . HIS A 1 67  ? -5.023  -6.688  -6.924  1.00 24.89 ? 510 HIS A CA   1 
ATOM   484  C  C    . HIS A 1 67  ? -3.524  -6.523  -7.265  1.00 24.97 ? 510 HIS A C    1 
ATOM   485  O  O    . HIS A 1 67  ? -3.188  -5.912  -8.256  1.00 25.76 ? 510 HIS A O    1 
ATOM   486  C  CB   . HIS A 1 67  ? -5.567  -7.886  -7.704  1.00 24.85 ? 510 HIS A CB   1 
ATOM   487  C  CG   . HIS A 1 67  ? -5.015  -9.183  -7.241  1.00 24.58 ? 510 HIS A CG   1 
ATOM   488  N  ND1  . HIS A 1 67  ? -5.798  -10.189 -6.722  1.00 25.82 ? 510 HIS A ND1  1 
ATOM   489  C  CD2  . HIS A 1 67  ? -3.742  -9.622  -7.179  1.00 23.42 ? 510 HIS A CD2  1 
ATOM   490  C  CE1  . HIS A 1 67  ? -5.023  -11.202 -6.377  1.00 26.07 ? 510 HIS A CE1  1 
ATOM   491  N  NE2  . HIS A 1 67  ? -3.770  -10.879 -6.647  1.00 25.47 ? 510 HIS A NE2  1 
ATOM   492  N  N    . VAL A 1 68  ? -2.618  -7.083  -6.478  1.00 24.93 ? 511 VAL A N    1 
ATOM   493  C  CA   . VAL A 1 68  ? -1.184  -6.800  -6.656  1.00 24.74 ? 511 VAL A CA   1 
ATOM   494  C  C    . VAL A 1 68  ? -0.496  -7.466  -7.841  1.00 24.11 ? 511 VAL A C    1 
ATOM   495  O  O    . VAL A 1 68  ? 0.578   -7.062  -8.212  1.00 24.08 ? 511 VAL A O    1 
ATOM   496  C  CB   . VAL A 1 68  ? -0.376  -7.098  -5.348  1.00 25.13 ? 511 VAL A CB   1 
ATOM   497  C  CG1  . VAL A 1 68  ? -0.379  -8.600  -5.000  1.00 25.20 ? 511 VAL A CG1  1 
ATOM   498  C  CG2  . VAL A 1 68  ? 1.053   -6.540  -5.458  1.00 25.06 ? 511 VAL A CG2  1 
ATOM   499  N  N    . ASN A 1 69  ? -1.124  -8.481  -8.414  1.00 24.13 ? 512 ASN A N    1 
ATOM   500  C  CA   . ASN A 1 69  ? -0.661  -9.215  -9.605  1.00 23.64 ? 512 ASN A CA   1 
ATOM   501  C  C    . ASN A 1 69  ? -1.541  -8.976  -10.828 1.00 23.25 ? 512 ASN A C    1 
ATOM   502  O  O    . ASN A 1 69  ? -1.510  -9.732  -11.801 1.00 22.75 ? 512 ASN A O    1 
ATOM   503  C  CB   . ASN A 1 69  ? -0.649  -10.708 -9.328  1.00 23.17 ? 512 ASN A CB   1 
ATOM   504  C  CG   . ASN A 1 69  ? -0.118  -11.027 -7.985  1.00 23.24 ? 512 ASN A CG   1 
ATOM   505  O  OD1  . ASN A 1 69  ? 1.109   -11.217 -7.806  1.00 23.84 ? 512 ASN A OD1  1 
ATOM   506  N  ND2  . ASN A 1 69  ? -1.011  -11.097 -7.012  1.00 20.93 ? 512 ASN A ND2  1 
ATOM   507  N  N    . ILE A 1 70  ? -2.354  -7.941  -10.738 1.00 23.21 ? 513 ILE A N    1 
ATOM   508  C  CA   . ILE A 1 70  ? -3.105  -7.447  -11.859 1.00 23.53 ? 513 ILE A CA   1 
ATOM   509  C  C    . ILE A 1 70  ? -2.656  -6.013  -12.030 1.00 23.85 ? 513 ILE A C    1 
ATOM   510  O  O    . ILE A 1 70  ? -2.921  -5.158  -11.178 1.00 23.36 ? 513 ILE A O    1 
ATOM   511  C  CB   . ILE A 1 70  ? -4.603  -7.521  -11.621 1.00 23.45 ? 513 ILE A CB   1 
ATOM   512  C  CG1  . ILE A 1 70  ? -5.043  -8.957  -11.269 1.00 23.59 ? 513 ILE A CG1  1 
ATOM   513  C  CG2  . ILE A 1 70  ? -5.342  -7.017  -12.865 1.00 24.00 ? 513 ILE A CG2  1 
ATOM   514  C  CD1  . ILE A 1 70  ? -5.280  -9.852  -12.486 1.00 23.13 ? 513 ILE A CD1  1 
ATOM   515  N  N    . LEU A 1 71  ? -1.932  -5.790  -13.132 1.00 24.71 ? 514 LEU A N    1 
ATOM   516  C  CA   . LEU A 1 71  ? -1.423  -4.481  -13.552 1.00 24.79 ? 514 LEU A CA   1 
ATOM   517  C  C    . LEU A 1 71  ? -2.376  -3.405  -13.133 1.00 24.65 ? 514 LEU A C    1 
ATOM   518  O  O    . LEU A 1 71  ? -3.597  -3.561  -13.216 1.00 24.33 ? 514 LEU A O    1 
ATOM   519  C  CB   . LEU A 1 71  ? -1.226  -4.418  -15.065 1.00 24.78 ? 514 LEU A CB   1 
ATOM   520  C  CG   . LEU A 1 71  ? -0.649  -3.125  -15.660 1.00 25.29 ? 514 LEU A CG   1 
ATOM   521  C  CD1  . LEU A 1 71  ? 0.870   -2.916  -15.384 1.00 24.26 ? 514 LEU A CD1  1 
ATOM   522  C  CD2  . LEU A 1 71  ? -0.916  -3.159  -17.136 1.00 25.88 ? 514 LEU A CD2  1 
ATOM   523  N  N    . LEU A 1 72  ? -1.791  -2.314  -12.677 1.00 24.74 ? 515 LEU A N    1 
ATOM   524  C  CA   . LEU A 1 72  ? -2.536  -1.276  -11.995 1.00 25.11 ? 515 LEU A CA   1 
ATOM   525  C  C    . LEU A 1 72  ? -3.150  -0.288  -12.977 1.00 24.82 ? 515 LEU A C    1 
ATOM   526  O  O    . LEU A 1 72  ? -2.432  0.596   -13.465 1.00 24.70 ? 515 LEU A O    1 
ATOM   527  C  CB   . LEU A 1 72  ? -1.579  -0.543  -11.059 1.00 25.23 ? 515 LEU A CB   1 
ATOM   528  C  CG   . LEU A 1 72  ? -2.186  0.463   -10.098 1.00 25.73 ? 515 LEU A CG   1 
ATOM   529  C  CD1  . LEU A 1 72  ? -3.438  -0.112  -9.345  1.00 25.25 ? 515 LEU A CD1  1 
ATOM   530  C  CD2  . LEU A 1 72  ? -1.093  0.903   -9.146  1.00 25.79 ? 515 LEU A CD2  1 
ATOM   531  N  N    . PHE A 1 73  ? -4.438  -0.456  -13.296 1.00 24.05 ? 516 PHE A N    1 
ATOM   532  C  CA   . PHE A 1 73  ? -5.153  0.519   -14.105 1.00 23.98 ? 516 PHE A CA   1 
ATOM   533  C  C    . PHE A 1 73  ? -5.278  1.778   -13.254 1.00 24.30 ? 516 PHE A C    1 
ATOM   534  O  O    . PHE A 1 73  ? -5.553  1.677   -12.063 1.00 24.82 ? 516 PHE A O    1 
ATOM   535  C  CB   . PHE A 1 73  ? -6.557  0.032   -14.453 1.00 24.27 ? 516 PHE A CB   1 
ATOM   536  C  CG   . PHE A 1 73  ? -7.472  1.111   -15.009 1.00 23.34 ? 516 PHE A CG   1 
ATOM   537  C  CD1  . PHE A 1 73  ? -7.323  1.567   -16.332 1.00 22.35 ? 516 PHE A CD1  1 
ATOM   538  C  CD2  . PHE A 1 73  ? -8.480  1.652   -14.220 1.00 22.83 ? 516 PHE A CD2  1 
ATOM   539  C  CE1  . PHE A 1 73  ? -8.152  2.525   -16.851 1.00 22.25 ? 516 PHE A CE1  1 
ATOM   540  C  CE2  . PHE A 1 73  ? -9.330  2.627   -14.724 1.00 22.98 ? 516 PHE A CE2  1 
ATOM   541  C  CZ   . PHE A 1 73  ? -9.180  3.064   -16.035 1.00 23.86 ? 516 PHE A CZ   1 
ATOM   542  N  N    . MET A 1 74  ? -5.097  2.949   -13.860 1.00 23.72 ? 517 MET A N    1 
ATOM   543  C  CA   . MET A 1 74  ? -5.000  4.193   -13.120 1.00 23.25 ? 517 MET A CA   1 
ATOM   544  C  C    . MET A 1 74  ? -5.791  5.319   -13.728 1.00 23.18 ? 517 MET A C    1 
ATOM   545  O  O    . MET A 1 74  ? -6.277  6.175   -13.005 1.00 22.62 ? 517 MET A O    1 
ATOM   546  C  CB   . MET A 1 74  ? -3.561  4.634   -13.069 1.00 23.23 ? 517 MET A CB   1 
ATOM   547  C  CG   . MET A 1 74  ? -2.696  3.769   -12.256 1.00 21.99 ? 517 MET A CG   1 
ATOM   548  S  SD   . MET A 1 74  ? -1.069  4.471   -12.155 1.00 23.13 ? 517 MET A SD   1 
ATOM   549  C  CE   . MET A 1 74  ? -1.401  6.075   -11.310 1.00 22.58 ? 517 MET A CE   1 
ATOM   550  N  N    . GLY A 1 75  ? -5.904  5.338   -15.051 1.00 23.80 ? 518 GLY A N    1 
ATOM   551  C  CA   . GLY A 1 75  ? -6.687  6.369   -15.725 1.00 24.51 ? 518 GLY A CA   1 
ATOM   552  C  C    . GLY A 1 75  ? -6.736  6.302   -17.243 1.00 24.78 ? 518 GLY A C    1 
ATOM   553  O  O    . GLY A 1 75  ? -5.891  5.709   -17.874 1.00 25.07 ? 518 GLY A O    1 
ATOM   554  N  N    . TYR A 1 76  ? -7.733  6.924   -17.842 1.00 25.08 ? 519 TYR A N    1 
ATOM   555  C  CA   . TYR A 1 76  ? -7.810  6.922   -19.280 1.00 25.46 ? 519 TYR A CA   1 
ATOM   556  C  C    . TYR A 1 76  ? -7.918  8.348   -19.769 1.00 25.79 ? 519 TYR A C    1 
ATOM   557  O  O    . TYR A 1 76  ? -8.684  9.131   -19.234 1.00 25.59 ? 519 TYR A O    1 
ATOM   558  C  CB   . TYR A 1 76  ? -9.018  6.103   -19.741 1.00 25.92 ? 519 TYR A CB   1 
ATOM   559  C  CG   . TYR A 1 76  ? -10.356 6.737   -19.438 1.00 26.22 ? 519 TYR A CG   1 
ATOM   560  C  CD1  . TYR A 1 76  ? -10.982 7.549   -20.370 1.00 25.39 ? 519 TYR A CD1  1 
ATOM   561  C  CD2  . TYR A 1 76  ? -10.992 6.529   -18.209 1.00 28.14 ? 519 TYR A CD2  1 
ATOM   562  C  CE1  . TYR A 1 76  ? -12.200 8.135   -20.112 1.00 26.99 ? 519 TYR A CE1  1 
ATOM   563  C  CE2  . TYR A 1 76  ? -12.242 7.130   -17.927 1.00 28.24 ? 519 TYR A CE2  1 
ATOM   564  C  CZ   . TYR A 1 76  ? -12.831 7.934   -18.896 1.00 28.15 ? 519 TYR A CZ   1 
ATOM   565  O  OH   . TYR A 1 76  ? -14.043 8.548   -18.674 1.00 29.23 ? 519 TYR A OH   1 
ATOM   566  N  N    . SER A 1 77  ? -7.125  8.677   -20.784 1.00 26.26 ? 520 SER A N    1 
ATOM   567  C  CA   . SER A 1 77  ? -7.248  9.937   -21.534 1.00 26.15 ? 520 SER A CA   1 
ATOM   568  C  C    . SER A 1 77  ? -8.395  9.905   -22.533 1.00 26.18 ? 520 SER A C    1 
ATOM   569  O  O    . SER A 1 77  ? -9.045  8.876   -22.764 1.00 25.97 ? 520 SER A O    1 
ATOM   570  C  CB   . SER A 1 77  ? -5.968  10.196  -22.318 1.00 25.72 ? 520 SER A CB   1 
ATOM   571  O  OG   . SER A 1 77  ? -4.877  10.332  -21.432 1.00 27.46 ? 520 SER A OG   1 
ATOM   572  N  N    . THR A 1 78  ? -8.619  11.059  -23.139 1.00 26.37 ? 521 THR A N    1 
ATOM   573  C  CA   . THR A 1 78  ? -9.543  11.175  -24.256 1.00 26.09 ? 521 THR A CA   1 
ATOM   574  C  C    . THR A 1 78  ? -9.049  12.137  -25.330 1.00 26.27 ? 521 THR A C    1 
ATOM   575  O  O    . THR A 1 78  ? -9.270  11.898  -26.512 1.00 25.83 ? 521 THR A O    1 
ATOM   576  C  CB   . THR A 1 78  ? -10.916 11.588  -23.698 1.00 25.98 ? 521 THR A CB   1 
ATOM   577  O  OG1  . THR A 1 78  ? -11.879 10.621  -24.091 1.00 26.07 ? 521 THR A OG1  1 
ATOM   578  C  CG2  . THR A 1 78  ? -11.458 12.894  -24.277 1.00 26.10 ? 521 THR A CG2  1 
ATOM   579  N  N    . LYS A 1 79  ? -8.334  13.182  -24.906 1.00 26.81 ? 522 LYS A N    1 
ATOM   580  C  CA   . LYS A 1 79  ? -8.228  14.440  -25.650 1.00 27.23 ? 522 LYS A CA   1 
ATOM   581  C  C    . LYS A 1 79  ? -7.045  14.601  -26.635 1.00 27.36 ? 522 LYS A C    1 
ATOM   582  O  O    . LYS A 1 79  ? -7.206  15.270  -27.689 1.00 27.80 ? 522 LYS A O    1 
ATOM   583  C  CB   . LYS A 1 79  ? -8.249  15.609  -24.656 1.00 27.66 ? 522 LYS A CB   1 
ATOM   584  N  N    . PRO A 1 80  ? -5.864  14.064  -26.303 1.00 26.86 ? 523 PRO A N    1 
ATOM   585  C  CA   . PRO A 1 80  ? -4.798  13.894  -27.314 1.00 26.25 ? 523 PRO A CA   1 
ATOM   586  C  C    . PRO A 1 80  ? -4.982  12.602  -28.114 1.00 25.74 ? 523 PRO A C    1 
ATOM   587  O  O    . PRO A 1 80  ? -4.827  12.617  -29.322 1.00 26.09 ? 523 PRO A O    1 
ATOM   588  C  CB   . PRO A 1 80  ? -3.504  13.871  -26.490 1.00 26.05 ? 523 PRO A CB   1 
ATOM   589  C  CG   . PRO A 1 80  ? -3.897  13.503  -25.114 1.00 26.69 ? 523 PRO A CG   1 
ATOM   590  C  CD   . PRO A 1 80  ? -5.435  13.625  -24.965 1.00 26.76 ? 523 PRO A CD   1 
ATOM   591  N  N    . GLN A 1 81  ? -5.292  11.506  -27.434 1.00 25.17 ? 524 GLN A N    1 
ATOM   592  C  CA   . GLN A 1 81  ? -5.691  10.247  -28.071 1.00 25.01 ? 524 GLN A CA   1 
ATOM   593  C  C    . GLN A 1 81  ? -6.392  9.354   -27.036 1.00 24.49 ? 524 GLN A C    1 
ATOM   594  O  O    . GLN A 1 81  ? -6.089  9.419   -25.845 1.00 24.27 ? 524 GLN A O    1 
ATOM   595  C  CB   . GLN A 1 81  ? -4.470  9.503   -28.612 1.00 24.94 ? 524 GLN A CB   1 
ATOM   596  C  CG   . GLN A 1 81  ? -4.230  9.614   -30.088 1.00 26.14 ? 524 GLN A CG   1 
ATOM   597  C  CD   . GLN A 1 81  ? -2.987  8.831   -30.518 1.00 28.17 ? 524 GLN A CD   1 
ATOM   598  O  OE1  . GLN A 1 81  ? -1.873  9.075   -29.993 1.00 28.64 ? 524 GLN A OE1  1 
ATOM   599  N  NE2  . GLN A 1 81  ? -3.165  7.895   -31.466 1.00 25.98 ? 524 GLN A NE2  1 
ATOM   600  N  N    . LEU A 1 82  ? -7.314  8.510   -27.475 1.00 24.27 ? 525 LEU A N    1 
ATOM   601  C  CA   . LEU A 1 82  ? -7.773  7.427   -26.613 1.00 24.18 ? 525 LEU A CA   1 
ATOM   602  C  C    . LEU A 1 82  ? -6.541  6.754   -26.051 1.00 24.16 ? 525 LEU A C    1 
ATOM   603  O  O    . LEU A 1 82  ? -5.565  6.564   -26.771 1.00 24.44 ? 525 LEU A O    1 
ATOM   604  C  CB   . LEU A 1 82  ? -8.586  6.403   -27.386 1.00 24.12 ? 525 LEU A CB   1 
ATOM   605  C  CG   . LEU A 1 82  ? -9.937  6.804   -27.986 1.00 23.69 ? 525 LEU A CG   1 
ATOM   606  C  CD1  . LEU A 1 82  ? -10.816 5.582   -28.041 1.00 23.53 ? 525 LEU A CD1  1 
ATOM   607  C  CD2  . LEU A 1 82  ? -10.613 7.886   -27.205 1.00 23.20 ? 525 LEU A CD2  1 
ATOM   608  N  N    . ALA A 1 83  ? -6.559  6.445   -24.757 1.00 24.30 ? 526 ALA A N    1 
ATOM   609  C  CA   . ALA A 1 83  ? -5.401  5.844   -24.088 1.00 23.92 ? 526 ALA A CA   1 
ATOM   610  C  C    . ALA A 1 83  ? -5.771  5.344   -22.728 1.00 23.70 ? 526 ALA A C    1 
ATOM   611  O  O    . ALA A 1 83  ? -6.713  5.842   -22.114 1.00 23.63 ? 526 ALA A O    1 
ATOM   612  C  CB   . ALA A 1 83  ? -4.286  6.822   -23.957 1.00 23.97 ? 526 ALA A CB   1 
ATOM   613  N  N    . ILE A 1 84  ? -5.009  4.347   -22.278 1.00 23.66 ? 527 ILE A N    1 
ATOM   614  C  CA   . ILE A 1 84  ? -5.178  3.683   -20.978 1.00 23.23 ? 527 ILE A CA   1 
ATOM   615  C  C    . ILE A 1 84  ? -3.934  4.016   -20.179 1.00 23.29 ? 527 ILE A C    1 
ATOM   616  O  O    . ILE A 1 84  ? -2.825  4.006   -20.727 1.00 23.72 ? 527 ILE A O    1 
ATOM   617  C  CB   . ILE A 1 84  ? -5.290  2.188   -21.202 1.00 23.03 ? 527 ILE A CB   1 
ATOM   618  C  CG1  . ILE A 1 84  ? -6.705  1.858   -21.719 1.00 23.64 ? 527 ILE A CG1  1 
ATOM   619  C  CG2  . ILE A 1 84  ? -4.888  1.423   -19.952 1.00 22.20 ? 527 ILE A CG2  1 
ATOM   620  C  CD1  . ILE A 1 84  ? -6.786  0.608   -22.611 1.00 23.76 ? 527 ILE A CD1  1 
ATOM   621  N  N    . VAL A 1 85  ? -4.091  4.345   -18.909 1.00 23.00 ? 528 VAL A N    1 
ATOM   622  C  CA   . VAL A 1 85  ? -2.924  4.673   -18.085 1.00 23.36 ? 528 VAL A CA   1 
ATOM   623  C  C    . VAL A 1 85  ? -2.826  3.649   -16.978 1.00 22.86 ? 528 VAL A C    1 
ATOM   624  O  O    . VAL A 1 85  ? -3.821  3.144   -16.530 1.00 22.59 ? 528 VAL A O    1 
ATOM   625  C  CB   . VAL A 1 85  ? -2.918  6.143   -17.502 1.00 23.55 ? 528 VAL A CB   1 
ATOM   626  C  CG1  . VAL A 1 85  ? -1.539  6.497   -16.948 1.00 23.19 ? 528 VAL A CG1  1 
ATOM   627  C  CG2  . VAL A 1 85  ? -3.280  7.177   -18.566 1.00 24.40 ? 528 VAL A CG2  1 
ATOM   628  N  N    . THR A 1 86  ? -1.606  3.340   -16.576 1.00 23.25 ? 529 THR A N    1 
ATOM   629  C  CA   . THR A 1 86  ? -1.319  2.366   -15.537 1.00 23.61 ? 529 THR A CA   1 
ATOM   630  C  C    . THR A 1 86  ? 0.014   2.599   -14.816 1.00 23.83 ? 529 THR A C    1 
ATOM   631  O  O    . THR A 1 86  ? 0.816   3.445   -15.191 1.00 23.15 ? 529 THR A O    1 
ATOM   632  C  CB   . THR A 1 86  ? -1.200  0.951   -16.141 1.00 23.76 ? 529 THR A CB   1 
ATOM   633  O  OG1  . THR A 1 86  ? 0.075   0.823   -16.802 1.00 22.19 ? 529 THR A OG1  1 
ATOM   634  C  CG2  . THR A 1 86  ? -2.295  0.668   -17.196 1.00 23.51 ? 529 THR A CG2  1 
ATOM   635  N  N    . GLN A 1 87  ? 0.270   1.758   -13.814 1.00 24.08 ? 530 GLN A N    1 
ATOM   636  C  CA   . GLN A 1 87  ? 1.572   1.726   -13.202 1.00 23.71 ? 530 GLN A CA   1 
ATOM   637  C  C    . GLN A 1 87  ? 2.590   1.469   -14.309 1.00 23.46 ? 530 GLN A C    1 
ATOM   638  O  O    . GLN A 1 87  ? 2.307   0.840   -15.338 1.00 22.59 ? 530 GLN A O    1 
ATOM   639  C  CB   . GLN A 1 87  ? 1.663   0.690   -12.073 1.00 23.63 ? 530 GLN A CB   1 
ATOM   640  C  CG   . GLN A 1 87  ? 1.637   -0.782  -12.493 1.00 24.19 ? 530 GLN A CG   1 
ATOM   641  C  CD   . GLN A 1 87  ? 1.641   -1.729  -11.299 1.00 23.50 ? 530 GLN A CD   1 
ATOM   642  O  OE1  . GLN A 1 87  ? 0.641   -2.415  -11.015 1.00 21.98 ? 530 GLN A OE1  1 
ATOM   643  N  NE2  . GLN A 1 87  ? 2.751   -1.750  -10.587 1.00 22.42 ? 530 GLN A NE2  1 
ATOM   644  N  N    . TRP A 1 88  ? 3.739   2.079   -14.106 1.00 23.56 ? 531 TRP A N    1 
ATOM   645  C  CA   . TRP A 1 88  ? 4.921   1.796   -14.854 1.00 23.71 ? 531 TRP A CA   1 
ATOM   646  C  C    . TRP A 1 88  ? 5.562   0.603   -14.175 1.00 23.71 ? 531 TRP A C    1 
ATOM   647  O  O    . TRP A 1 88  ? 5.585   0.526   -12.942 1.00 24.02 ? 531 TRP A O    1 
ATOM   648  C  CB   . TRP A 1 88  ? 5.870   2.984   -14.802 1.00 23.76 ? 531 TRP A CB   1 
ATOM   649  C  CG   . TRP A 1 88  ? 7.074   2.663   -15.536 1.00 25.12 ? 531 TRP A CG   1 
ATOM   650  C  CD1  . TRP A 1 88  ? 8.325   2.608   -15.051 1.00 25.02 ? 531 TRP A CD1  1 
ATOM   651  C  CD2  . TRP A 1 88  ? 7.144   2.255   -16.911 1.00 25.76 ? 531 TRP A CD2  1 
ATOM   652  N  NE1  . TRP A 1 88  ? 9.186   2.213   -16.043 1.00 26.69 ? 531 TRP A NE1  1 
ATOM   653  C  CE2  . TRP A 1 88  ? 8.478   1.998   -17.198 1.00 26.90 ? 531 TRP A CE2  1 
ATOM   654  C  CE3  . TRP A 1 88  ? 6.202   2.113   -17.936 1.00 25.36 ? 531 TRP A CE3  1 
ATOM   655  C  CZ2  . TRP A 1 88  ? 8.908   1.599   -18.474 1.00 28.30 ? 531 TRP A CZ2  1 
ATOM   656  C  CZ3  . TRP A 1 88  ? 6.621   1.719   -19.186 1.00 26.32 ? 531 TRP A CZ3  1 
ATOM   657  C  CH2  . TRP A 1 88  ? 7.963   1.468   -19.450 1.00 26.86 ? 531 TRP A CH2  1 
ATOM   658  N  N    . CYS A 1 89  ? 6.063   -0.339  -14.958 1.00 23.41 ? 532 CYS A N    1 
ATOM   659  C  CA   . CYS A 1 89  ? 6.659   -1.529  -14.381 1.00 23.51 ? 532 CYS A CA   1 
ATOM   660  C  C    . CYS A 1 89  ? 8.127   -1.435  -14.595 1.00 23.78 ? 532 CYS A C    1 
ATOM   661  O  O    . CYS A 1 89  ? 8.577   -0.666  -15.423 1.00 25.01 ? 532 CYS A O    1 
ATOM   662  C  CB   . CYS A 1 89  ? 6.125   -2.791  -15.027 1.00 23.35 ? 532 CYS A CB   1 
ATOM   663  S  SG   . CYS A 1 89  ? 4.712   -3.382  -14.142 1.00 22.46 ? 532 CYS A SG   1 
ATOM   664  N  N    . GLU A 1 90  ? 8.871   -2.242  -13.870 1.00 23.70 ? 533 GLU A N    1 
ATOM   665  C  CA   . GLU A 1 90  ? 10.313  -2.136  -13.820 1.00 23.80 ? 533 GLU A CA   1 
ATOM   666  C  C    . GLU A 1 90  ? 10.947  -3.477  -14.176 1.00 23.55 ? 533 GLU A C    1 
ATOM   667  O  O    . GLU A 1 90  ? 10.456  -4.522  -13.770 1.00 22.90 ? 533 GLU A O    1 
ATOM   668  C  CB   . GLU A 1 90  ? 10.700  -1.745  -12.411 1.00 23.99 ? 533 GLU A CB   1 
ATOM   669  C  CG   . GLU A 1 90  ? 10.066  -0.451  -11.939 1.00 25.03 ? 533 GLU A CG   1 
ATOM   670  C  CD   . GLU A 1 90  ? 10.982  0.734   -12.174 1.00 26.65 ? 533 GLU A CD   1 
ATOM   671  O  OE1  . GLU A 1 90  ? 10.579  1.709   -12.873 1.00 27.41 ? 533 GLU A OE1  1 
ATOM   672  O  OE2  . GLU A 1 90  ? 12.120  0.677   -11.652 1.00 26.68 ? 533 GLU A OE2  1 
ATOM   673  N  N    . GLY A 1 91  ? 12.024  -3.455  -14.948 1.00 23.47 ? 534 GLY A N    1 
ATOM   674  C  CA   . GLY A 1 91  ? 12.687  -4.688  -15.314 1.00 23.74 ? 534 GLY A CA   1 
ATOM   675  C  C    . GLY A 1 91  ? 12.222  -5.193  -16.656 1.00 24.00 ? 534 GLY A C    1 
ATOM   676  O  O    . GLY A 1 91  ? 12.440  -4.539  -17.665 1.00 24.30 ? 534 GLY A O    1 
ATOM   677  N  N    . SER A 1 92  ? 11.601  -6.361  -16.687 1.00 24.03 ? 535 SER A N    1 
ATOM   678  C  CA   . SER A 1 92  ? 11.158  -6.921  -17.954 1.00 24.35 ? 535 SER A CA   1 
ATOM   679  C  C    . SER A 1 92  ? 10.204  -8.088  -17.721 1.00 24.29 ? 535 SER A C    1 
ATOM   680  O  O    . SER A 1 92  ? 10.035  -8.518  -16.595 1.00 24.42 ? 535 SER A O    1 
ATOM   681  C  CB   . SER A 1 92  ? 12.352  -7.390  -18.761 1.00 24.37 ? 535 SER A CB   1 
ATOM   682  O  OG   . SER A 1 92  ? 12.484  -8.788  -18.603 1.00 25.97 ? 535 SER A OG   1 
ATOM   683  N  N    . SER A 1 93  ? 9.588   -8.607  -18.780 1.00 24.46 ? 536 SER A N    1 
ATOM   684  C  CA   . SER A 1 93  ? 8.472   -9.555  -18.620 1.00 24.25 ? 536 SER A CA   1 
ATOM   685  C  C    . SER A 1 93  ? 8.926   -11.016 -18.431 1.00 24.50 ? 536 SER A C    1 
ATOM   686  O  O    . SER A 1 93  ? 10.110  -11.347 -18.566 1.00 23.80 ? 536 SER A O    1 
ATOM   687  C  CB   . SER A 1 93  ? 7.462   -9.417  -19.774 1.00 24.02 ? 536 SER A CB   1 
ATOM   688  O  OG   . SER A 1 93  ? 7.899   -9.987  -20.982 1.00 22.42 ? 536 SER A OG   1 
ATOM   689  N  N    . LEU A 1 94  ? 7.977   -11.887 -18.112 1.00 24.77 ? 537 LEU A N    1 
ATOM   690  C  CA   . LEU A 1 94  ? 8.331   -13.270 -17.852 1.00 25.20 ? 537 LEU A CA   1 
ATOM   691  C  C    . LEU A 1 94  ? 9.029   -13.860 -19.065 1.00 25.56 ? 537 LEU A C    1 
ATOM   692  O  O    . LEU A 1 94  ? 10.061  -14.506 -18.924 1.00 26.47 ? 537 LEU A O    1 
ATOM   693  C  CB   . LEU A 1 94  ? 7.124   -14.136 -17.462 1.00 25.09 ? 537 LEU A CB   1 
ATOM   694  C  CG   . LEU A 1 94  ? 7.466   -15.601 -17.141 1.00 23.90 ? 537 LEU A CG   1 
ATOM   695  C  CD1  . LEU A 1 94  ? 8.762   -15.699 -16.368 1.00 24.46 ? 537 LEU A CD1  1 
ATOM   696  C  CD2  . LEU A 1 94  ? 6.371   -16.293 -16.361 1.00 23.22 ? 537 LEU A CD2  1 
ATOM   697  N  N    . TYR A 1 95  ? 8.472   -13.618 -20.244 1.00 25.36 ? 538 TYR A N    1 
ATOM   698  C  CA   . TYR A 1 95  ? 9.092   -14.006 -21.504 1.00 25.37 ? 538 TYR A CA   1 
ATOM   699  C  C    . TYR A 1 95  ? 10.555  -13.614 -21.652 1.00 26.01 ? 538 TYR A C    1 
ATOM   700  O  O    . TYR A 1 95  ? 11.427  -14.455 -21.979 1.00 25.98 ? 538 TYR A O    1 
ATOM   701  C  CB   . TYR A 1 95  ? 8.353   -13.336 -22.626 1.00 25.23 ? 538 TYR A CB   1 
ATOM   702  C  CG   . TYR A 1 95  ? 8.565   -13.988 -23.946 1.00 25.75 ? 538 TYR A CG   1 
ATOM   703  C  CD1  . TYR A 1 95  ? 7.696   -14.979 -24.375 1.00 25.30 ? 538 TYR A CD1  1 
ATOM   704  C  CD2  . TYR A 1 95  ? 9.622   -13.620 -24.782 1.00 25.48 ? 538 TYR A CD2  1 
ATOM   705  C  CE1  . TYR A 1 95  ? 7.843   -15.575 -25.583 1.00 25.13 ? 538 TYR A CE1  1 
ATOM   706  C  CE2  . TYR A 1 95  ? 9.774   -14.226 -26.012 1.00 25.44 ? 538 TYR A CE2  1 
ATOM   707  C  CZ   . TYR A 1 95  ? 8.869   -15.204 -26.405 1.00 25.44 ? 538 TYR A CZ   1 
ATOM   708  O  OH   . TYR A 1 95  ? 8.947   -15.851 -27.613 1.00 27.69 ? 538 TYR A OH   1 
ATOM   709  N  N    . HIS A 1 96  ? 10.847  -12.334 -21.444 1.00 26.55 ? 539 HIS A N    1 
ATOM   710  C  CA   . HIS A 1 96  ? 12.230  -11.909 -21.610 1.00 27.27 ? 539 HIS A CA   1 
ATOM   711  C  C    . HIS A 1 96  ? 13.135  -12.748 -20.718 1.00 27.28 ? 539 HIS A C    1 
ATOM   712  O  O    . HIS A 1 96  ? 14.255  -13.057 -21.109 1.00 27.79 ? 539 HIS A O    1 
ATOM   713  C  CB   . HIS A 1 96  ? 12.443  -10.439 -21.287 1.00 27.32 ? 539 HIS A CB   1 
ATOM   714  C  CG   . HIS A 1 96  ? 13.888  -10.042 -21.321 1.00 28.56 ? 539 HIS A CG   1 
ATOM   715  N  ND1  . HIS A 1 96  ? 14.775  -10.367 -20.312 1.00 29.82 ? 539 HIS A ND1  1 
ATOM   716  C  CD2  . HIS A 1 96  ? 14.611  -9.381  -22.259 1.00 29.76 ? 539 HIS A CD2  1 
ATOM   717  C  CE1  . HIS A 1 96  ? 15.975  -9.899  -20.617 1.00 29.98 ? 539 HIS A CE1  1 
ATOM   718  N  NE2  . HIS A 1 96  ? 15.905  -9.304  -21.796 1.00 30.25 ? 539 HIS A NE2  1 
ATOM   719  N  N    . HIS A 1 97  ? 12.646  -13.102 -19.525 1.00 27.09 ? 540 HIS A N    1 
ATOM   720  C  CA   . HIS A 1 97  ? 13.475  -13.776 -18.521 1.00 27.13 ? 540 HIS A CA   1 
ATOM   721  C  C    . HIS A 1 97  ? 13.637  -15.251 -18.831 1.00 26.85 ? 540 HIS A C    1 
ATOM   722  O  O    . HIS A 1 97  ? 14.741  -15.807 -18.732 1.00 26.89 ? 540 HIS A O    1 
ATOM   723  C  CB   . HIS A 1 97  ? 12.933  -13.560 -17.089 1.00 27.10 ? 540 HIS A CB   1 
ATOM   724  C  CG   . HIS A 1 97  ? 13.403  -12.283 -16.458 1.00 27.43 ? 540 HIS A CG   1 
ATOM   725  N  ND1  . HIS A 1 97  ? 12.882  -11.797 -15.281 1.00 28.25 ? 540 HIS A ND1  1 
ATOM   726  C  CD2  . HIS A 1 97  ? 14.343  -11.386 -16.850 1.00 28.15 ? 540 HIS A CD2  1 
ATOM   727  C  CE1  . HIS A 1 97  ? 13.480  -10.658 -14.972 1.00 27.93 ? 540 HIS A CE1  1 
ATOM   728  N  NE2  . HIS A 1 97  ? 14.371  -10.387 -15.908 1.00 27.58 ? 540 HIS A NE2  1 
ATOM   729  N  N    . LEU A 1 98  ? 12.544  -15.865 -19.253 1.00 26.49 ? 541 LEU A N    1 
ATOM   730  C  CA   . LEU A 1 98  ? 12.533  -17.287 -19.507 1.00 26.21 ? 541 LEU A CA   1 
ATOM   731  C  C    . LEU A 1 98  ? 13.191  -17.630 -20.821 1.00 26.04 ? 541 LEU A C    1 
ATOM   732  O  O    . LEU A 1 98  ? 13.434  -18.801 -21.048 1.00 26.46 ? 541 LEU A O    1 
ATOM   733  C  CB   . LEU A 1 98  ? 11.099  -17.854 -19.412 1.00 25.98 ? 541 LEU A CB   1 
ATOM   734  C  CG   . LEU A 1 98  ? 10.804  -18.545 -18.057 1.00 25.97 ? 541 LEU A CG   1 
ATOM   735  C  CD1  . LEU A 1 98  ? 11.477  -17.831 -16.859 1.00 26.31 ? 541 LEU A CD1  1 
ATOM   736  C  CD2  . LEU A 1 98  ? 9.319   -18.708 -17.791 1.00 25.27 ? 541 LEU A CD2  1 
ATOM   737  N  N    . HIS A 1 99  ? 13.525  -16.634 -21.655 1.00 26.10 ? 542 HIS A N    1 
ATOM   738  C  CA   . HIS A 1 99  ? 14.078  -16.889 -23.011 1.00 25.82 ? 542 HIS A CA   1 
ATOM   739  C  C    . HIS A 1 99  ? 15.288  -16.015 -23.480 1.00 26.27 ? 542 HIS A C    1 
ATOM   740  O  O    . HIS A 1 99  ? 16.342  -16.580 -23.809 1.00 27.09 ? 542 HIS A O    1 
ATOM   741  C  CB   . HIS A 1 99  ? 12.956  -16.847 -24.044 1.00 25.32 ? 542 HIS A CB   1 
ATOM   742  C  CG   . HIS A 1 99  ? 11.717  -17.566 -23.606 1.00 24.48 ? 542 HIS A CG   1 
ATOM   743  N  ND1  . HIS A 1 99  ? 11.740  -18.841 -23.089 1.00 24.19 ? 542 HIS A ND1  1 
ATOM   744  C  CD2  . HIS A 1 99  ? 10.425  -17.179 -23.575 1.00 24.29 ? 542 HIS A CD2  1 
ATOM   745  C  CE1  . HIS A 1 99  ? 10.520  -19.220 -22.772 1.00 24.02 ? 542 HIS A CE1  1 
ATOM   746  N  NE2  . HIS A 1 99  ? 9.699   -18.229 -23.062 1.00 25.00 ? 542 HIS A NE2  1 
ATOM   747  N  N    . ALA A 1 100 ? 15.169  -14.682 -23.545 1.00 25.81 ? 543 ALA A N    1 
ATOM   748  C  CA   . ALA A 1 100 ? 16.274  -13.865 -24.076 1.00 25.51 ? 543 ALA A CA   1 
ATOM   749  C  C    . ALA A 1 100 ? 16.961  -13.015 -23.016 1.00 25.60 ? 543 ALA A C    1 
ATOM   750  O  O    . ALA A 1 100 ? 17.336  -11.855 -23.263 1.00 25.08 ? 543 ALA A O    1 
ATOM   751  C  CB   . ALA A 1 100 ? 15.838  -13.023 -25.256 1.00 25.29 ? 543 ALA A CB   1 
ATOM   752  N  N    . SER A 1 101 ? 17.105  -13.612 -21.834 1.00 25.94 ? 544 SER A N    1 
ATOM   753  C  CA   . SER A 1 101 ? 18.148  -13.227 -20.866 1.00 26.16 ? 544 SER A CA   1 
ATOM   754  C  C    . SER A 1 101 ? 19.055  -14.406 -20.463 1.00 26.33 ? 544 SER A C    1 
ATOM   755  O  O    . SER A 1 101 ? 20.257  -14.217 -20.283 1.00 26.68 ? 544 SER A O    1 
ATOM   756  C  CB   . SER A 1 101 ? 17.549  -12.633 -19.590 1.00 26.14 ? 544 SER A CB   1 
ATOM   757  O  OG   . SER A 1 101 ? 18.458  -11.704 -18.992 1.00 26.13 ? 544 SER A OG   1 
ATOM   758  N  N    . GLU A 1 102 ? 18.488  -15.601 -20.300 1.00 26.39 ? 545 GLU A N    1 
ATOM   759  C  CA   . GLU A 1 102 ? 19.215  -16.735 -19.743 1.00 26.92 ? 545 GLU A CA   1 
ATOM   760  C  C    . GLU A 1 102 ? 19.411  -16.542 -18.221 1.00 27.15 ? 545 GLU A C    1 
ATOM   761  O  O    . GLU A 1 102 ? 20.430  -17.000 -17.653 1.00 27.20 ? 545 GLU A O    1 
ATOM   762  C  CB   . GLU A 1 102 ? 20.601  -16.976 -20.435 1.00 27.34 ? 545 GLU A CB   1 
ATOM   763  C  CG   . GLU A 1 102 ? 20.770  -16.615 -21.936 1.00 28.12 ? 545 GLU A CG   1 
ATOM   764  C  CD   . GLU A 1 102 ? 21.780  -15.474 -22.242 1.00 28.39 ? 545 GLU A CD   1 
ATOM   765  O  OE1  . GLU A 1 102 ? 21.773  -14.963 -23.391 1.00 27.90 ? 545 GLU A OE1  1 
ATOM   766  O  OE2  . GLU A 1 102 ? 22.581  -15.068 -21.360 1.00 28.85 ? 545 GLU A OE2  1 
ATOM   767  N  N    . THR A 1 103 ? 18.469  -15.857 -17.555 1.00 27.15 ? 546 THR A N    1 
ATOM   768  C  CA   . THR A 1 103 ? 18.543  -15.698 -16.087 1.00 26.96 ? 546 THR A CA   1 
ATOM   769  C  C    . THR A 1 103 ? 18.243  -17.056 -15.480 1.00 26.68 ? 546 THR A C    1 
ATOM   770  O  O    . THR A 1 103 ? 17.142  -17.599 -15.673 1.00 26.74 ? 546 THR A O    1 
ATOM   771  C  CB   . THR A 1 103 ? 17.511  -14.672 -15.515 1.00 27.12 ? 546 THR A CB   1 
ATOM   772  O  OG1  . THR A 1 103 ? 17.407  -13.521 -16.359 1.00 28.28 ? 546 THR A OG1  1 
ATOM   773  C  CG2  . THR A 1 103 ? 17.949  -14.095 -14.142 1.00 26.75 ? 546 THR A CG2  1 
ATOM   774  N  N    . LYS A 1 104 ? 19.214  -17.621 -14.774 1.00 26.18 ? 547 LYS A N    1 
ATOM   775  C  CA   . LYS A 1 104 ? 18.908  -18.748 -13.901 1.00 25.91 ? 547 LYS A CA   1 
ATOM   776  C  C    . LYS A 1 104 ? 17.849  -18.201 -12.926 1.00 25.75 ? 547 LYS A C    1 
ATOM   777  O  O    . LYS A 1 104 ? 18.031  -17.123 -12.347 1.00 25.53 ? 547 LYS A O    1 
ATOM   778  C  CB   . LYS A 1 104 ? 20.158  -19.284 -13.155 1.00 25.67 ? 547 LYS A CB   1 
ATOM   779  C  CG   . LYS A 1 104 ? 20.268  -20.817 -13.062 1.00 24.80 ? 547 LYS A CG   1 
ATOM   780  C  CD   . LYS A 1 104 ? 21.181  -21.385 -14.149 1.00 24.71 ? 547 LYS A CD   1 
ATOM   781  C  CE   . LYS A 1 104 ? 21.468  -22.879 -13.959 1.00 24.81 ? 547 LYS A CE   1 
ATOM   782  N  NZ   . LYS A 1 104 ? 21.110  -23.691 -15.156 1.00 24.17 ? 547 LYS A NZ   1 
ATOM   783  N  N    . PHE A 1 105 ? 16.711  -18.894 -12.861 1.00 25.41 ? 548 PHE A N    1 
ATOM   784  C  CA   . PHE A 1 105 ? 15.746  -18.775 -11.773 1.00 25.09 ? 548 PHE A CA   1 
ATOM   785  C  C    . PHE A 1 105 ? 15.790  -20.140 -11.076 1.00 24.84 ? 548 PHE A C    1 
ATOM   786  O  O    . PHE A 1 105 ? 15.796  -21.192 -11.723 1.00 24.69 ? 548 PHE A O    1 
ATOM   787  C  CB   . PHE A 1 105 ? 14.299  -18.503 -12.281 1.00 25.30 ? 548 PHE A CB   1 
ATOM   788  C  CG   . PHE A 1 105 ? 13.967  -17.027 -12.618 1.00 24.91 ? 548 PHE A CG   1 
ATOM   789  C  CD1  . PHE A 1 105 ? 13.039  -16.743 -13.632 1.00 24.05 ? 548 PHE A CD1  1 
ATOM   790  C  CD2  . PHE A 1 105 ? 14.537  -15.948 -11.920 1.00 24.96 ? 548 PHE A CD2  1 
ATOM   791  C  CE1  . PHE A 1 105 ? 12.705  -15.430 -13.965 1.00 25.06 ? 548 PHE A CE1  1 
ATOM   792  C  CE2  . PHE A 1 105 ? 14.203  -14.613 -12.248 1.00 25.07 ? 548 PHE A CE2  1 
ATOM   793  C  CZ   . PHE A 1 105 ? 13.282  -14.357 -13.269 1.00 25.02 ? 548 PHE A CZ   1 
ATOM   794  N  N    . GLU A 1 106 ? 15.834  -20.119 -9.755  1.00 24.92 ? 549 GLU A N    1 
ATOM   795  C  CA   . GLU A 1 106 ? 15.791  -21.340 -8.960  1.00 25.05 ? 549 GLU A CA   1 
ATOM   796  C  C    . GLU A 1 106 ? 14.373  -21.897 -8.962  1.00 25.11 ? 549 GLU A C    1 
ATOM   797  O  O    . GLU A 1 106 ? 13.408  -21.170 -9.144  1.00 24.72 ? 549 GLU A O    1 
ATOM   798  C  CB   . GLU A 1 106 ? 16.247  -21.044 -7.524  1.00 24.97 ? 549 GLU A CB   1 
ATOM   799  C  CG   . GLU A 1 106 ? 16.333  -22.242 -6.589  1.00 25.22 ? 549 GLU A CG   1 
ATOM   800  C  CD   . GLU A 1 106 ? 16.694  -21.840 -5.167  1.00 25.32 ? 549 GLU A CD   1 
ATOM   801  O  OE1  . GLU A 1 106 ? 16.920  -22.728 -4.311  1.00 24.53 ? 549 GLU A OE1  1 
ATOM   802  O  OE2  . GLU A 1 106 ? 16.747  -20.624 -4.900  1.00 25.83 ? 549 GLU A OE2  1 
ATOM   803  N  N    . MET A 1 107 ? 14.257  -23.200 -8.763  1.00 25.66 ? 550 MET A N    1 
ATOM   804  C  CA   . MET A 1 107 ? 12.955  -23.831 -8.615  1.00 25.85 ? 550 MET A CA   1 
ATOM   805  C  C    . MET A 1 107 ? 12.079  -22.999 -7.677  1.00 25.88 ? 550 MET A C    1 
ATOM   806  O  O    . MET A 1 107 ? 10.942  -22.707 -8.016  1.00 25.98 ? 550 MET A O    1 
ATOM   807  C  CB   . MET A 1 107 ? 13.113  -25.264 -8.088  1.00 26.00 ? 550 MET A CB   1 
ATOM   808  C  CG   . MET A 1 107 ? 12.072  -26.287 -8.595  1.00 26.66 ? 550 MET A CG   1 
ATOM   809  S  SD   . MET A 1 107 ? 11.175  -25.962 -10.160 1.00 26.52 ? 550 MET A SD   1 
ATOM   810  C  CE   . MET A 1 107 ? 12.397  -26.417 -11.487 1.00 25.89 ? 550 MET A CE   1 
ATOM   811  N  N    . LYS A 1 108 ? 12.613  -22.597 -6.519  1.00 25.87 ? 551 LYS A N    1 
ATOM   812  C  CA   . LYS A 1 108 ? 11.852  -21.776 -5.554  1.00 25.83 ? 551 LYS A CA   1 
ATOM   813  C  C    . LYS A 1 108 ? 11.232  -20.568 -6.221  1.00 25.86 ? 551 LYS A C    1 
ATOM   814  O  O    . LYS A 1 108 ? 10.020  -20.368 -6.145  1.00 26.26 ? 551 LYS A O    1 
ATOM   815  C  CB   . LYS A 1 108 ? 12.727  -21.300 -4.374  1.00 25.79 ? 551 LYS A CB   1 
ATOM   816  C  CG   . LYS A 1 108 ? 11.953  -20.766 -3.144  1.00 24.92 ? 551 LYS A CG   1 
ATOM   817  C  CD   . LYS A 1 108 ? 12.841  -19.834 -2.284  1.00 24.47 ? 551 LYS A CD   1 
ATOM   818  C  CE   . LYS A 1 108 ? 12.475  -19.836 -0.788  1.00 23.82 ? 551 LYS A CE   1 
ATOM   819  N  NZ   . LYS A 1 108 ? 11.609  -18.680 -0.399  1.00 22.19 ? 551 LYS A NZ   1 
ATOM   820  N  N    . LYS A 1 109 ? 12.076  -19.774 -6.877  1.00 26.02 ? 552 LYS A N    1 
ATOM   821  C  CA   . LYS A 1 109 ? 11.661  -18.529 -7.548  1.00 25.98 ? 552 LYS A CA   1 
ATOM   822  C  C    . LYS A 1 109 ? 10.686  -18.759 -8.722  1.00 25.93 ? 552 LYS A C    1 
ATOM   823  O  O    . LYS A 1 109 ? 9.847   -17.909 -8.994  1.00 25.71 ? 552 LYS A O    1 
ATOM   824  C  CB   . LYS A 1 109 ? 12.908  -17.737 -8.020  1.00 26.12 ? 552 LYS A CB   1 
ATOM   825  C  CG   . LYS A 1 109 ? 12.912  -16.243 -7.666  1.00 26.20 ? 552 LYS A CG   1 
ATOM   826  C  CD   . LYS A 1 109 ? 12.030  -15.446 -8.622  1.00 25.78 ? 552 LYS A CD   1 
ATOM   827  C  CE   . LYS A 1 109 ? 11.767  -14.034 -8.120  1.00 26.93 ? 552 LYS A CE   1 
ATOM   828  N  NZ   . LYS A 1 109 ? 10.824  -13.986 -6.947  1.00 27.50 ? 552 LYS A NZ   1 
ATOM   829  N  N    . LEU A 1 110 ? 10.801  -19.904 -9.402  1.00 25.93 ? 553 LEU A N    1 
ATOM   830  C  CA   . LEU A 1 110 ? 9.916   -20.248 -10.528 1.00 26.01 ? 553 LEU A CA   1 
ATOM   831  C  C    . LEU A 1 110 ? 8.514   -20.640 -10.060 1.00 26.20 ? 553 LEU A C    1 
ATOM   832  O  O    . LEU A 1 110 ? 7.510   -20.343 -10.740 1.00 26.26 ? 553 LEU A O    1 
ATOM   833  C  CB   . LEU A 1 110 ? 10.494  -21.407 -11.369 1.00 25.97 ? 553 LEU A CB   1 
ATOM   834  C  CG   . LEU A 1 110 ? 11.029  -21.167 -12.790 1.00 25.54 ? 553 LEU A CG   1 
ATOM   835  C  CD1  . LEU A 1 110 ? 11.241  -19.700 -13.117 1.00 24.60 ? 553 LEU A CD1  1 
ATOM   836  C  CD2  . LEU A 1 110 ? 12.329  -21.947 -13.011 1.00 25.13 ? 553 LEU A CD2  1 
ATOM   837  N  N    . ILE A 1 111 ? 8.431   -21.317 -8.920  1.00 26.04 ? 554 ILE A N    1 
ATOM   838  C  CA   . ILE A 1 111 ? 7.138   -21.777 -8.442  1.00 26.31 ? 554 ILE A CA   1 
ATOM   839  C  C    . ILE A 1 111 ? 6.374   -20.562 -7.998  1.00 26.37 ? 554 ILE A C    1 
ATOM   840  O  O    . ILE A 1 111 ? 5.164   -20.465 -8.207  1.00 26.99 ? 554 ILE A O    1 
ATOM   841  C  CB   . ILE A 1 111 ? 7.264   -22.752 -7.260  1.00 26.53 ? 554 ILE A CB   1 
ATOM   842  C  CG1  . ILE A 1 111 ? 8.000   -24.034 -7.674  1.00 26.28 ? 554 ILE A CG1  1 
ATOM   843  C  CG2  . ILE A 1 111 ? 5.869   -23.095 -6.719  1.00 26.96 ? 554 ILE A CG2  1 
ATOM   844  C  CD1  . ILE A 1 111 ? 8.855   -24.609 -6.590  1.00 25.59 ? 554 ILE A CD1  1 
ATOM   845  N  N    . ASP A 1 112 ? 7.091   -19.630 -7.380  1.00 26.05 ? 555 ASP A N    1 
ATOM   846  C  CA   . ASP A 1 112 ? 6.463   -18.451 -6.828  1.00 25.70 ? 555 ASP A CA   1 
ATOM   847  C  C    . ASP A 1 112 ? 5.830   -17.638 -7.920  1.00 25.65 ? 555 ASP A C    1 
ATOM   848  O  O    . ASP A 1 112 ? 4.701   -17.199 -7.779  1.00 26.07 ? 555 ASP A O    1 
ATOM   849  C  CB   . ASP A 1 112 ? 7.484   -17.601 -6.119  1.00 25.71 ? 555 ASP A CB   1 
ATOM   850  C  CG   . ASP A 1 112 ? 6.919   -16.299 -5.666  1.00 25.55 ? 555 ASP A CG   1 
ATOM   851  O  OD1  . ASP A 1 112 ? 5.752   -16.281 -5.185  1.00 24.91 ? 555 ASP A OD1  1 
ATOM   852  O  OD2  . ASP A 1 112 ? 7.577   -15.241 -5.766  1.00 26.15 ? 555 ASP A OD2  1 
ATOM   853  N  N    . ILE A 1 113 ? 6.568   -17.434 -9.007  1.00 25.50 ? 556 ILE A N    1 
ATOM   854  C  CA   . ILE A 1 113 ? 6.059   -16.752 -10.200 1.00 25.14 ? 556 ILE A CA   1 
ATOM   855  C  C    . ILE A 1 113 ? 4.772   -17.415 -10.721 1.00 25.06 ? 556 ILE A C    1 
ATOM   856  O  O    . ILE A 1 113 ? 3.877   -16.721 -11.184 1.00 24.64 ? 556 ILE A O    1 
ATOM   857  C  CB   . ILE A 1 113 ? 7.153   -16.708 -11.280 1.00 25.03 ? 556 ILE A CB   1 
ATOM   858  C  CG1  . ILE A 1 113 ? 8.279   -15.768 -10.845 1.00 25.18 ? 556 ILE A CG1  1 
ATOM   859  C  CG2  . ILE A 1 113 ? 6.598   -16.219 -12.608 1.00 26.30 ? 556 ILE A CG2  1 
ATOM   860  C  CD1  . ILE A 1 113 ? 9.636   -15.998 -11.539 1.00 25.18 ? 556 ILE A CD1  1 
ATOM   861  N  N    . ALA A 1 114 ? 4.689   -18.748 -10.619 1.00 25.16 ? 557 ALA A N    1 
ATOM   862  C  CA   . ALA A 1 114 ? 3.484   -19.516 -10.981 1.00 25.02 ? 557 ALA A CA   1 
ATOM   863  C  C    . ALA A 1 114 ? 2.366   -19.299 -9.994  1.00 24.69 ? 557 ALA A C    1 
ATOM   864  O  O    . ALA A 1 114 ? 1.210   -19.177 -10.360 1.00 24.56 ? 557 ALA A O    1 
ATOM   865  C  CB   . ALA A 1 114 ? 3.799   -21.000 -11.049 1.00 25.28 ? 557 ALA A CB   1 
ATOM   866  N  N    . ARG A 1 115 ? 2.723   -19.284 -8.726  1.00 24.63 ? 558 ARG A N    1 
ATOM   867  C  CA   . ARG A 1 115 ? 1.793   -18.917 -7.667  1.00 24.68 ? 558 ARG A CA   1 
ATOM   868  C  C    . ARG A 1 115 ? 1.164   -17.539 -7.910  1.00 23.97 ? 558 ARG A C    1 
ATOM   869  O  O    . ARG A 1 115 ? -0.056  -17.404 -8.018  1.00 22.96 ? 558 ARG A O    1 
ATOM   870  C  CB   . ARG A 1 115 ? 2.550   -18.940 -6.339  1.00 25.00 ? 558 ARG A CB   1 
ATOM   871  C  CG   . ARG A 1 115 ? 1.757   -18.467 -5.127  1.00 26.19 ? 558 ARG A CG   1 
ATOM   872  C  CD   . ARG A 1 115 ? 2.183   -19.118 -3.815  1.00 26.70 ? 558 ARG A CD   1 
ATOM   873  N  NE   . ARG A 1 115 ? 3.607   -18.966 -3.529  1.00 27.53 ? 558 ARG A NE   1 
ATOM   874  C  CZ   . ARG A 1 115 ? 4.117   -18.540 -2.381  1.00 28.94 ? 558 ARG A CZ   1 
ATOM   875  N  NH1  . ARG A 1 115 ? 3.339   -18.180 -1.355  1.00 29.05 ? 558 ARG A NH1  1 
ATOM   876  N  NH2  . ARG A 1 115 ? 5.436   -18.465 -2.257  1.00 30.24 ? 558 ARG A NH2  1 
ATOM   877  N  N    . GLN A 1 116 ? 2.022   -16.536 -8.040  1.00 23.89 ? 559 GLN A N    1 
ATOM   878  C  CA   . GLN A 1 116 ? 1.587   -15.166 -8.245  1.00 24.32 ? 559 GLN A CA   1 
ATOM   879  C  C    . GLN A 1 116 ? 0.805   -14.986 -9.514  1.00 24.69 ? 559 GLN A C    1 
ATOM   880  O  O    . GLN A 1 116 ? 0.036   -14.054 -9.599  1.00 25.43 ? 559 GLN A O    1 
ATOM   881  C  CB   . GLN A 1 116 ? 2.768   -14.209 -8.319  1.00 24.41 ? 559 GLN A CB   1 
ATOM   882  C  CG   . GLN A 1 116 ? 3.190   -13.552 -7.022  1.00 24.84 ? 559 GLN A CG   1 
ATOM   883  C  CD   . GLN A 1 116 ? 4.527   -12.853 -7.173  1.00 25.44 ? 559 GLN A CD   1 
ATOM   884  O  OE1  . GLN A 1 116 ? 4.581   -11.695 -7.575  1.00 24.67 ? 559 GLN A OE1  1 
ATOM   885  N  NE2  . GLN A 1 116 ? 5.610   -13.568 -6.882  1.00 25.38 ? 559 GLN A NE2  1 
ATOM   886  N  N    . THR A 1 117 ? 1.024   -15.829 -10.521 1.00 25.03 ? 560 THR A N    1 
ATOM   887  C  CA   . THR A 1 117 ? 0.305   -15.718 -11.805 1.00 24.75 ? 560 THR A CA   1 
ATOM   888  C  C    . THR A 1 117 ? -1.140  -16.211 -11.633 1.00 25.06 ? 560 THR A C    1 
ATOM   889  O  O    . THR A 1 117 ? -2.087  -15.603 -12.082 1.00 25.69 ? 560 THR A O    1 
ATOM   890  C  CB   . THR A 1 117 ? 1.059   -16.536 -12.919 1.00 24.86 ? 560 THR A CB   1 
ATOM   891  O  OG1  . THR A 1 117 ? 2.129   -15.764 -13.473 1.00 22.72 ? 560 THR A OG1  1 
ATOM   892  C  CG2  . THR A 1 117 ? 0.181   -16.829 -14.140 1.00 25.46 ? 560 THR A CG2  1 
ATOM   893  N  N    . ALA A 1 118 ? -1.309  -17.320 -10.947 1.00 25.27 ? 561 ALA A N    1 
ATOM   894  C  CA   . ALA A 1 118 ? -2.618  -17.899 -10.797 1.00 25.12 ? 561 ALA A CA   1 
ATOM   895  C  C    . ALA A 1 118 ? -3.368  -17.136 -9.728  1.00 25.16 ? 561 ALA A C    1 
ATOM   896  O  O    . ALA A 1 118 ? -4.539  -17.429 -9.457  1.00 25.08 ? 561 ALA A O    1 
ATOM   897  C  CB   . ALA A 1 118 ? -2.475  -19.350 -10.414 1.00 25.23 ? 561 ALA A CB   1 
ATOM   898  N  N    . ARG A 1 119 ? -2.674  -16.200 -9.075  1.00 24.87 ? 562 ARG A N    1 
ATOM   899  C  CA   . ARG A 1 119 ? -3.318  -15.313 -8.108  1.00 24.67 ? 562 ARG A CA   1 
ATOM   900  C  C    . ARG A 1 119 ? -4.076  -14.272 -8.893  1.00 23.92 ? 562 ARG A C    1 
ATOM   901  O  O    . ARG A 1 119 ? -5.255  -13.992 -8.627  1.00 22.92 ? 562 ARG A O    1 
ATOM   902  C  CB   . ARG A 1 119 ? -2.291  -14.668 -7.157  1.00 24.80 ? 562 ARG A CB   1 
ATOM   903  C  CG   . ARG A 1 119 ? -1.925  -15.573 -5.979  1.00 25.14 ? 562 ARG A CG   1 
ATOM   904  C  CD   . ARG A 1 119 ? -1.208  -14.871 -4.870  1.00 26.07 ? 562 ARG A CD   1 
ATOM   905  N  NE   . ARG A 1 119 ? -0.161  -15.671 -4.219  1.00 26.24 ? 562 ARG A NE   1 
ATOM   906  C  CZ   . ARG A 1 119 ? 0.734   -15.163 -3.365  1.00 26.68 ? 562 ARG A CZ   1 
ATOM   907  N  NH1  . ARG A 1 119 ? 0.707   -13.864 -3.045  1.00 25.67 ? 562 ARG A NH1  1 
ATOM   908  N  NH2  . ARG A 1 119 ? 1.662   -15.946 -2.828  1.00 27.28 ? 562 ARG A NH2  1 
ATOM   909  N  N    . GLY A 1 120 ? -3.388  -13.743 -9.897  1.00 23.54 ? 563 GLY A N    1 
ATOM   910  C  CA   . GLY A 1 120 ? -3.994  -12.815 -10.825 1.00 23.72 ? 563 GLY A CA   1 
ATOM   911  C  C    . GLY A 1 120 ? -5.241  -13.436 -11.416 1.00 24.16 ? 563 GLY A C    1 
ATOM   912  O  O    . GLY A 1 120 ? -6.342  -12.878 -11.295 1.00 23.99 ? 563 GLY A O    1 
ATOM   913  N  N    . MET A 1 121 ? -5.075  -14.625 -12.003 1.00 23.91 ? 564 MET A N    1 
ATOM   914  C  CA   . MET A 1 121 ? -6.135  -15.268 -12.776 1.00 23.77 ? 564 MET A CA   1 
ATOM   915  C  C    . MET A 1 121 ? -7.389  -15.632 -11.983 1.00 23.35 ? 564 MET A C    1 
ATOM   916  O  O    . MET A 1 121 ? -8.485  -15.550 -12.494 1.00 22.44 ? 564 MET A O    1 
ATOM   917  C  CB   . MET A 1 121 ? -5.565  -16.516 -13.442 1.00 23.92 ? 564 MET A CB   1 
ATOM   918  C  CG   . MET A 1 121 ? -4.452  -16.206 -14.431 1.00 24.82 ? 564 MET A CG   1 
ATOM   919  S  SD   . MET A 1 121 ? -4.926  -14.909 -15.584 1.00 23.22 ? 564 MET A SD   1 
ATOM   920  C  CE   . MET A 1 121 ? -6.458  -15.552 -16.105 1.00 22.67 ? 564 MET A CE   1 
ATOM   921  N  N    . ASP A 1 122 ? -7.229  -16.047 -10.736 1.00 23.86 ? 565 ASP A N    1 
ATOM   922  C  CA   . ASP A 1 122 ? -8.380  -16.443 -9.943  1.00 24.22 ? 565 ASP A CA   1 
ATOM   923  C  C    . ASP A 1 122 ? -9.175  -15.211 -9.590  1.00 24.33 ? 565 ASP A C    1 
ATOM   924  O  O    . ASP A 1 122 ? -10.403 -15.248 -9.540  1.00 24.30 ? 565 ASP A O    1 
ATOM   925  C  CB   . ASP A 1 122 ? -7.979  -17.173 -8.667  1.00 24.38 ? 565 ASP A CB   1 
ATOM   926  C  CG   . ASP A 1 122 ? -9.180  -17.806 -7.956  1.00 24.63 ? 565 ASP A CG   1 
ATOM   927  O  OD1  . ASP A 1 122 ? -10.234 -18.002 -8.594  1.00 22.99 ? 565 ASP A OD1  1 
ATOM   928  O  OD2  . ASP A 1 122 ? -9.156  -18.132 -6.756  1.00 25.56 ? 565 ASP A OD2  1 
ATOM   929  N  N    . TYR A 1 123 ? -8.464  -14.117 -9.338  1.00 24.34 ? 566 TYR A N    1 
ATOM   930  C  CA   . TYR A 1 123 ? -9.122  -12.875 -9.048  1.00 24.13 ? 566 TYR A CA   1 
ATOM   931  C  C    . TYR A 1 123 ? -9.971  -12.464 -10.224 1.00 24.22 ? 566 TYR A C    1 
ATOM   932  O  O    . TYR A 1 123 ? -11.122 -12.114 -10.038 1.00 24.19 ? 566 TYR A O    1 
ATOM   933  C  CB   . TYR A 1 123 ? -8.130  -11.779 -8.708  1.00 24.04 ? 566 TYR A CB   1 
ATOM   934  C  CG   . TYR A 1 123 ? -8.830  -10.469 -8.530  1.00 24.80 ? 566 TYR A CG   1 
ATOM   935  C  CD1  . TYR A 1 123 ? -9.188  -10.007 -7.271  1.00 24.84 ? 566 TYR A CD1  1 
ATOM   936  C  CD2  . TYR A 1 123 ? -9.151  -9.686  -9.625  1.00 25.85 ? 566 TYR A CD2  1 
ATOM   937  C  CE1  . TYR A 1 123 ? -9.836  -8.797  -7.114  1.00 24.55 ? 566 TYR A CE1  1 
ATOM   938  C  CE2  . TYR A 1 123 ? -9.815  -8.484  -9.467  1.00 26.12 ? 566 TYR A CE2  1 
ATOM   939  C  CZ   . TYR A 1 123 ? -10.151 -8.047  -8.218  1.00 24.33 ? 566 TYR A CZ   1 
ATOM   940  O  OH   . TYR A 1 123 ? -10.807 -6.856  -8.097  1.00 24.13 ? 566 TYR A OH   1 
ATOM   941  N  N    . LEU A 1 124 ? -9.407  -12.497 -11.434 1.00 24.72 ? 567 LEU A N    1 
ATOM   942  C  CA   . LEU A 1 124 ? -10.110 -11.994 -12.632 1.00 25.04 ? 567 LEU A CA   1 
ATOM   943  C  C    . LEU A 1 124 ? -11.422 -12.729 -12.882 1.00 25.33 ? 567 LEU A C    1 
ATOM   944  O  O    . LEU A 1 124 ? -12.433 -12.116 -13.260 1.00 25.67 ? 567 LEU A O    1 
ATOM   945  C  CB   . LEU A 1 124 ? -9.248  -12.121 -13.872 1.00 24.99 ? 567 LEU A CB   1 
ATOM   946  C  CG   . LEU A 1 124 ? -8.036  -11.197 -13.931 1.00 25.78 ? 567 LEU A CG   1 
ATOM   947  C  CD1  . LEU A 1 124 ? -7.191  -11.537 -15.170 1.00 25.61 ? 567 LEU A CD1  1 
ATOM   948  C  CD2  . LEU A 1 124 ? -8.502  -9.740  -13.920 1.00 25.98 ? 567 LEU A CD2  1 
ATOM   949  N  N    . HIS A 1 125 ? -11.379 -14.037 -12.650 1.00 25.25 ? 568 HIS A N    1 
ATOM   950  C  CA   . HIS A 1 125 ? -12.520 -14.918 -12.775 1.00 25.22 ? 568 HIS A CA   1 
ATOM   951  C  C    . HIS A 1 125 ? -13.553 -14.713 -11.677 1.00 25.19 ? 568 HIS A C    1 
ATOM   952  O  O    . HIS A 1 125 ? -14.755 -14.700 -11.946 1.00 25.82 ? 568 HIS A O    1 
ATOM   953  C  CB   . HIS A 1 125 ? -12.028 -16.359 -12.758 1.00 25.20 ? 568 HIS A CB   1 
ATOM   954  C  CG   . HIS A 1 125 ? -11.590 -16.840 -14.095 1.00 25.90 ? 568 HIS A CG   1 
ATOM   955  N  ND1  . HIS A 1 125 ? -10.851 -17.989 -14.266 1.00 27.39 ? 568 HIS A ND1  1 
ATOM   956  C  CD2  . HIS A 1 125 ? -11.809 -16.339 -15.332 1.00 25.79 ? 568 HIS A CD2  1 
ATOM   957  C  CE1  . HIS A 1 125 ? -10.623 -18.165 -15.555 1.00 28.06 ? 568 HIS A CE1  1 
ATOM   958  N  NE2  . HIS A 1 125 ? -11.198 -17.181 -16.222 1.00 27.19 ? 568 HIS A NE2  1 
ATOM   959  N  N    . ALA A 1 126 ? -13.100 -14.563 -10.443 1.00 24.71 ? 569 ALA A N    1 
ATOM   960  C  CA   . ALA A 1 126 ? -13.991 -14.192 -9.373  1.00 24.63 ? 569 ALA A CA   1 
ATOM   961  C  C    . ALA A 1 126 ? -14.801 -12.957 -9.800  1.00 24.85 ? 569 ALA A C    1 
ATOM   962  O  O    . ALA A 1 126 ? -15.963 -12.776 -9.393  1.00 25.12 ? 569 ALA A O    1 
ATOM   963  C  CB   . ALA A 1 126 ? -13.190 -13.916 -8.138  1.00 24.54 ? 569 ALA A CB   1 
ATOM   964  N  N    . LYS A 1 127 ? -14.174 -12.133 -10.641 1.00 24.96 ? 570 LYS A N    1 
ATOM   965  C  CA   . LYS A 1 127 ? -14.773 -10.954 -11.254 1.00 24.99 ? 570 LYS A CA   1 
ATOM   966  C  C    . LYS A 1 127 ? -15.451 -11.234 -12.615 1.00 24.91 ? 570 LYS A C    1 
ATOM   967  O  O    . LYS A 1 127 ? -16.043 -10.340 -13.196 1.00 24.69 ? 570 LYS A O    1 
ATOM   968  C  CB   . LYS A 1 127 ? -13.678 -9.884  -11.415 1.00 25.40 ? 570 LYS A CB   1 
ATOM   969  C  CG   . LYS A 1 127 ? -13.134 -9.306  -10.055 1.00 26.36 ? 570 LYS A CG   1 
ATOM   970  C  CD   . LYS A 1 127 ? -14.276 -8.664  -9.180  1.00 25.48 ? 570 LYS A CD   1 
ATOM   971  C  CE   . LYS A 1 127 ? -13.749 -7.763  -8.080  1.00 24.46 ? 570 LYS A CE   1 
ATOM   972  N  NZ   . LYS A 1 127 ? -13.517 -6.389  -8.581  1.00 25.25 ? 570 LYS A NZ   1 
ATOM   973  N  N    . SER A 1 128 ? -15.342 -12.466 -13.109 1.00 24.96 ? 571 SER A N    1 
ATOM   974  C  CA   . SER A 1 128 ? -16.012 -12.960 -14.333 1.00 25.54 ? 571 SER A CA   1 
ATOM   975  C  C    . SER A 1 128 ? -15.400 -12.394 -15.628 1.00 25.93 ? 571 SER A C    1 
ATOM   976  O  O    . SER A 1 128 ? -16.033 -12.351 -16.698 1.00 26.25 ? 571 SER A O    1 
ATOM   977  C  CB   . SER A 1 128 ? -17.542 -12.777 -14.276 1.00 25.63 ? 571 SER A CB   1 
ATOM   978  O  OG   . SER A 1 128 ? -18.123 -13.790 -13.463 1.00 26.15 ? 571 SER A OG   1 
ATOM   979  N  N    . ILE A 1 129 ? -14.127 -12.025 -15.523 1.00 25.72 ? 572 ILE A N    1 
ATOM   980  C  CA   . ILE A 1 129 ? -13.352 -11.545 -16.634 1.00 25.57 ? 572 ILE A CA   1 
ATOM   981  C  C    . ILE A 1 129 ? -12.541 -12.664 -17.317 1.00 25.60 ? 572 ILE A C    1 
ATOM   982  O  O    . ILE A 1 129 ? -11.564 -13.196 -16.770 1.00 25.64 ? 572 ILE A O    1 
ATOM   983  C  CB   . ILE A 1 129 ? -12.437 -10.466 -16.131 1.00 25.63 ? 572 ILE A CB   1 
ATOM   984  C  CG1  . ILE A 1 129 ? -13.259 -9.482  -15.290 1.00 26.80 ? 572 ILE A CG1  1 
ATOM   985  C  CG2  . ILE A 1 129 ? -11.724 -9.800  -17.306 1.00 25.87 ? 572 ILE A CG2  1 
ATOM   986  C  CD1  . ILE A 1 129 ? -12.618 -8.104  -15.090 1.00 28.36 ? 572 ILE A CD1  1 
ATOM   987  N  N    . ILE A 1 130 ? -12.946 -13.015 -18.526 1.00 25.28 ? 573 ILE A N    1 
ATOM   988  C  CA   . ILE A 1 130 ? -12.136 -13.879 -19.324 1.00 25.47 ? 573 ILE A CA   1 
ATOM   989  C  C    . ILE A 1 130 ? -11.017 -12.992 -19.850 1.00 25.75 ? 573 ILE A C    1 
ATOM   990  O  O    . ILE A 1 130 ? -11.286 -11.895 -20.372 1.00 26.48 ? 573 ILE A O    1 
ATOM   991  C  CB   . ILE A 1 130 ? -12.958 -14.510 -20.458 1.00 25.58 ? 573 ILE A CB   1 
ATOM   992  C  CG1  . ILE A 1 130 ? -14.131 -15.331 -19.896 1.00 25.39 ? 573 ILE A CG1  1 
ATOM   993  C  CG2  . ILE A 1 130 ? -12.067 -15.431 -21.306 1.00 26.09 ? 573 ILE A CG2  1 
ATOM   994  C  CD1  . ILE A 1 130 ? -15.486 -15.117 -20.612 1.00 25.93 ? 573 ILE A CD1  1 
ATOM   995  N  N    . HIS A 1 131 ? -9.771  -13.443 -19.674 1.00 25.38 ? 574 HIS A N    1 
ATOM   996  C  CA   . HIS A 1 131 ? -8.601  -12.673 -20.075 1.00 25.01 ? 574 HIS A CA   1 
ATOM   997  C  C    . HIS A 1 131 ? -8.442  -12.683 -21.567 1.00 24.71 ? 574 HIS A C    1 
ATOM   998  O  O    . HIS A 1 131 ? -8.332  -11.639 -22.176 1.00 24.84 ? 574 HIS A O    1 
ATOM   999  C  CB   . HIS A 1 131 ? -7.330  -13.255 -19.456 1.00 25.34 ? 574 HIS A CB   1 
ATOM   1000 C  CG   . HIS A 1 131 ? -6.070  -12.545 -19.878 1.00 25.72 ? 574 HIS A CG   1 
ATOM   1001 N  ND1  . HIS A 1 131 ? -5.681  -12.422 -21.195 1.00 25.33 ? 574 HIS A ND1  1 
ATOM   1002 C  CD2  . HIS A 1 131 ? -5.123  -11.914 -19.149 1.00 25.54 ? 574 HIS A CD2  1 
ATOM   1003 C  CE1  . HIS A 1 131 ? -4.546  -11.754 -21.254 1.00 25.42 ? 574 HIS A CE1  1 
ATOM   1004 N  NE2  . HIS A 1 131 ? -4.191  -11.429 -20.027 1.00 25.77 ? 574 HIS A NE2  1 
ATOM   1005 N  N    . ARG A 1 132 ? -8.331  -13.898 -22.094 1.00 24.71 ? 575 ARG A N    1 
ATOM   1006 C  CA   . ARG A 1 132 ? -8.425  -14.303 -23.514 1.00 24.63 ? 575 ARG A CA   1 
ATOM   1007 C  C    . ARG A 1 132 ? -7.099  -14.576 -24.196 1.00 24.78 ? 575 ARG A C    1 
ATOM   1008 O  O    . ARG A 1 132 ? -7.054  -15.267 -25.205 1.00 24.80 ? 575 ARG A O    1 
ATOM   1009 C  CB   . ARG A 1 132 ? -9.285  -13.384 -24.363 1.00 24.56 ? 575 ARG A CB   1 
ATOM   1010 C  CG   . ARG A 1 132 ? -10.717 -13.287 -23.882 1.00 23.81 ? 575 ARG A CG   1 
ATOM   1011 C  CD   . ARG A 1 132 ? -11.575 -12.528 -24.817 1.00 23.90 ? 575 ARG A CD   1 
ATOM   1012 N  NE   . ARG A 1 132 ? -12.913 -13.090 -24.899 1.00 25.44 ? 575 ARG A NE   1 
ATOM   1013 C  CZ   . ARG A 1 132 ? -13.944 -12.765 -24.110 1.00 26.54 ? 575 ARG A CZ   1 
ATOM   1014 N  NH1  . ARG A 1 132 ? -13.820 -11.866 -23.134 1.00 26.08 ? 575 ARG A NH1  1 
ATOM   1015 N  NH2  . ARG A 1 132 ? -15.126 -13.358 -24.304 1.00 28.18 ? 575 ARG A NH2  1 
ATOM   1016 N  N    . ASP A 1 133 ? -6.023  -14.055 -23.628 1.00 24.99 ? 576 ASP A N    1 
ATOM   1017 C  CA   . ASP A 1 133 ? -4.746  -14.035 -24.312 1.00 25.27 ? 576 ASP A CA   1 
ATOM   1018 C  C    . ASP A 1 133 ? -3.636  -13.967 -23.263 1.00 25.45 ? 576 ASP A C    1 
ATOM   1019 O  O    . ASP A 1 133 ? -2.722  -13.156 -23.361 1.00 26.64 ? 576 ASP A O    1 
ATOM   1020 C  CB   . ASP A 1 133 ? -4.718  -12.830 -25.279 1.00 25.37 ? 576 ASP A CB   1 
ATOM   1021 C  CG   . ASP A 1 133 ? -3.612  -12.908 -26.317 1.00 25.48 ? 576 ASP A CG   1 
ATOM   1022 O  OD1  . ASP A 1 133 ? -2.883  -11.924 -26.491 1.00 27.86 ? 576 ASP A OD1  1 
ATOM   1023 O  OD2  . ASP A 1 133 ? -3.403  -13.880 -27.049 1.00 27.22 ? 576 ASP A OD2  1 
ATOM   1024 N  N    . LEU A 1 134 ? -3.718  -14.800 -22.239 1.00 25.25 ? 577 LEU A N    1 
ATOM   1025 C  CA   . LEU A 1 134 ? -2.654  -14.865 -21.275 1.00 25.18 ? 577 LEU A CA   1 
ATOM   1026 C  C    . LEU A 1 134 ? -1.463  -15.525 -21.898 1.00 25.47 ? 577 LEU A C    1 
ATOM   1027 O  O    . LEU A 1 134 ? -1.600  -16.489 -22.613 1.00 26.58 ? 577 LEU A O    1 
ATOM   1028 C  CB   . LEU A 1 134 ? -3.067  -15.667 -20.070 1.00 25.28 ? 577 LEU A CB   1 
ATOM   1029 C  CG   . LEU A 1 134 ? -1.895  -15.978 -19.125 1.00 25.23 ? 577 LEU A CG   1 
ATOM   1030 C  CD1  . LEU A 1 134 ? -1.612  -14.787 -18.188 1.00 25.12 ? 577 LEU A CD1  1 
ATOM   1031 C  CD2  . LEU A 1 134 ? -2.194  -17.239 -18.355 1.00 24.48 ? 577 LEU A CD2  1 
ATOM   1032 N  N    . LYS A 1 135 ? -0.280  -15.017 -21.603 1.00 25.52 ? 578 LYS A N    1 
ATOM   1033 C  CA   . LYS A 1 135 ? 0.965   -15.633 -22.070 1.00 25.09 ? 578 LYS A CA   1 
ATOM   1034 C  C    . LYS A 1 135 ? 2.139   -14.967 -21.340 1.00 24.76 ? 578 LYS A C    1 
ATOM   1035 O  O    . LYS A 1 135 ? 1.984   -13.897 -20.717 1.00 24.53 ? 578 LYS A O    1 
ATOM   1036 C  CB   . LYS A 1 135 ? 1.110   -15.481 -23.592 1.00 25.01 ? 578 LYS A CB   1 
ATOM   1037 C  CG   . LYS A 1 135 ? 0.631   -14.133 -24.137 1.00 25.09 ? 578 LYS A CG   1 
ATOM   1038 C  CD   . LYS A 1 135 ? 0.871   -14.023 -25.639 1.00 26.39 ? 578 LYS A CD   1 
ATOM   1039 C  CE   . LYS A 1 135 ? 0.029   -12.905 -26.301 1.00 26.13 ? 578 LYS A CE   1 
ATOM   1040 N  NZ   . LYS A 1 135 ? 0.726   -12.284 -27.509 1.00 26.75 ? 578 LYS A NZ   1 
ATOM   1041 N  N    . SER A 1 136 ? 3.312   -15.577 -21.419 1.00 24.25 ? 579 SER A N    1 
ATOM   1042 C  CA   . SER A 1 136 ? 4.464   -15.012 -20.724 1.00 24.27 ? 579 SER A CA   1 
ATOM   1043 C  C    . SER A 1 136 ? 4.833   -13.596 -21.207 1.00 24.66 ? 579 SER A C    1 
ATOM   1044 O  O    . SER A 1 136 ? 5.494   -12.858 -20.474 1.00 25.26 ? 579 SER A O    1 
ATOM   1045 C  CB   . SER A 1 136 ? 5.669   -15.948 -20.774 1.00 23.76 ? 579 SER A CB   1 
ATOM   1046 O  OG   . SER A 1 136 ? 5.937   -16.383 -22.077 1.00 22.15 ? 579 SER A OG   1 
ATOM   1047 N  N    . ASN A 1 137 ? 4.385   -13.199 -22.395 1.00 24.73 ? 580 ASN A N    1 
ATOM   1048 C  CA   . ASN A 1 137 ? 4.744   -11.893 -22.936 1.00 24.95 ? 580 ASN A CA   1 
ATOM   1049 C  C    . ASN A 1 137 ? 3.912   -10.794 -22.237 1.00 25.08 ? 580 ASN A C    1 
ATOM   1050 O  O    . ASN A 1 137 ? 4.413   -9.675  -22.026 1.00 25.20 ? 580 ASN A O    1 
ATOM   1051 C  CB   . ASN A 1 137 ? 4.557   -11.823 -24.469 1.00 25.27 ? 580 ASN A CB   1 
ATOM   1052 C  CG   . ASN A 1 137 ? 5.070   -13.093 -25.235 1.00 25.63 ? 580 ASN A CG   1 
ATOM   1053 O  OD1  . ASN A 1 137 ? 4.746   -14.226 -24.885 1.00 26.55 ? 580 ASN A OD1  1 
ATOM   1054 N  ND2  . ASN A 1 137 ? 5.815   -12.879 -26.314 1.00 24.72 ? 580 ASN A ND2  1 
ATOM   1055 N  N    . ASN A 1 138 ? 2.665   -11.122 -21.863 1.00 24.87 ? 581 ASN A N    1 
ATOM   1056 C  CA   . ASN A 1 138 ? 1.779   -10.212 -21.118 1.00 24.98 ? 581 ASN A CA   1 
ATOM   1057 C  C    . ASN A 1 138 ? 1.693   -10.470 -19.573 1.00 25.09 ? 581 ASN A C    1 
ATOM   1058 O  O    . ASN A 1 138 ? 0.665   -10.187 -18.930 1.00 24.26 ? 581 ASN A O    1 
ATOM   1059 C  CB   . ASN A 1 138 ? 0.370   -10.191 -21.732 1.00 24.90 ? 581 ASN A CB   1 
ATOM   1060 C  CG   . ASN A 1 138 ? 0.359   -9.955  -23.274 1.00 27.04 ? 581 ASN A CG   1 
ATOM   1061 O  OD1  . ASN A 1 138 ? -0.542  -10.483 -23.986 1.00 29.26 ? 581 ASN A OD1  1 
ATOM   1062 N  ND2  . ASN A 1 138 ? 1.321   -9.152  -23.793 1.00 25.57 ? 581 ASN A ND2  1 
ATOM   1063 N  N    . ILE A 1 139 ? 2.790   -10.990 -18.994 1.00 25.65 ? 582 ILE A N    1 
ATOM   1064 C  CA   . ILE A 1 139 ? 3.013   -11.098 -17.532 1.00 25.54 ? 582 ILE A CA   1 
ATOM   1065 C  C    . ILE A 1 139 ? 4.265   -10.287 -17.217 1.00 25.85 ? 582 ILE A C    1 
ATOM   1066 O  O    . ILE A 1 139 ? 5.374   -10.800 -17.389 1.00 25.81 ? 582 ILE A O    1 
ATOM   1067 C  CB   . ILE A 1 139 ? 3.248   -12.567 -17.142 1.00 25.57 ? 582 ILE A CB   1 
ATOM   1068 C  CG1  . ILE A 1 139 ? 1.930   -13.352 -17.092 1.00 25.86 ? 582 ILE A CG1  1 
ATOM   1069 C  CG2  . ILE A 1 139 ? 3.960   -12.708 -15.797 1.00 26.03 ? 582 ILE A CG2  1 
ATOM   1070 C  CD1  . ILE A 1 139 ? 2.103   -14.831 -17.530 1.00 26.25 ? 582 ILE A CD1  1 
ATOM   1071 N  N    . PHE A 1 140 ? 4.133   -9.025  -16.798 1.00 26.37 ? 583 PHE A N    1 
ATOM   1072 C  CA   . PHE A 1 140 ? 5.345   -8.217  -16.569 1.00 26.84 ? 583 PHE A CA   1 
ATOM   1073 C  C    . PHE A 1 140 ? 5.835   -8.453  -15.132 1.00 27.34 ? 583 PHE A C    1 
ATOM   1074 O  O    . PHE A 1 140 ? 5.015   -8.479  -14.194 1.00 28.08 ? 583 PHE A O    1 
ATOM   1075 C  CB   . PHE A 1 140 ? 5.137   -6.723  -16.931 1.00 26.98 ? 583 PHE A CB   1 
ATOM   1076 C  CG   . PHE A 1 140 ? 4.185   -6.499  -18.116 1.00 26.55 ? 583 PHE A CG   1 
ATOM   1077 C  CD1  . PHE A 1 140 ? 2.900   -5.975  -17.915 1.00 26.04 ? 583 PHE A CD1  1 
ATOM   1078 C  CD2  . PHE A 1 140 ? 4.556   -6.836  -19.413 1.00 26.61 ? 583 PHE A CD2  1 
ATOM   1079 C  CE1  . PHE A 1 140 ? 2.005   -5.804  -18.975 1.00 25.52 ? 583 PHE A CE1  1 
ATOM   1080 C  CE2  . PHE A 1 140 ? 3.647   -6.655  -20.497 1.00 27.10 ? 583 PHE A CE2  1 
ATOM   1081 C  CZ   . PHE A 1 140 ? 2.374   -6.139  -20.261 1.00 25.86 ? 583 PHE A CZ   1 
ATOM   1082 N  N    . LEU A 1 141 ? 7.140   -8.721  -14.978 1.00 27.01 ? 584 LEU A N    1 
ATOM   1083 C  CA   . LEU A 1 141 ? 7.755   -8.951  -13.666 1.00 26.83 ? 584 LEU A CA   1 
ATOM   1084 C  C    . LEU A 1 141 ? 8.333   -7.653  -13.088 1.00 27.12 ? 584 LEU A C    1 
ATOM   1085 O  O    . LEU A 1 141 ? 9.535   -7.402  -13.225 1.00 27.87 ? 584 LEU A O    1 
ATOM   1086 C  CB   . LEU A 1 141 ? 8.912   -9.950  -13.758 1.00 26.86 ? 584 LEU A CB   1 
ATOM   1087 C  CG   . LEU A 1 141 ? 8.677   -11.464 -13.841 1.00 26.29 ? 584 LEU A CG   1 
ATOM   1088 C  CD1  . LEU A 1 141 ? 9.925   -12.120 -14.426 1.00 25.69 ? 584 LEU A CD1  1 
ATOM   1089 C  CD2  . LEU A 1 141 ? 8.367   -12.065 -12.478 1.00 25.01 ? 584 LEU A CD2  1 
ATOM   1090 N  N    . HIS A 1 142 ? 7.486   -6.863  -12.428 1.00 26.73 ? 585 HIS A N    1 
ATOM   1091 C  CA   . HIS A 1 142 ? 7.863   -5.626  -11.726 1.00 26.40 ? 585 HIS A CA   1 
ATOM   1092 C  C    . HIS A 1 142 ? 8.872   -5.878  -10.599 1.00 26.11 ? 585 HIS A C    1 
ATOM   1093 O  O    . HIS A 1 142 ? 8.551   -6.456  -9.563  1.00 25.61 ? 585 HIS A O    1 
ATOM   1094 C  CB   . HIS A 1 142 ? 6.559   -4.957  -11.208 1.00 26.91 ? 585 HIS A CB   1 
ATOM   1095 C  CG   . HIS A 1 142 ? 6.741   -3.883  -10.177 1.00 27.22 ? 585 HIS A CG   1 
ATOM   1096 N  ND1  . HIS A 1 142 ? 7.346   -2.673  -10.450 1.00 27.95 ? 585 HIS A ND1  1 
ATOM   1097 C  CD2  . HIS A 1 142 ? 6.333   -3.820  -8.886  1.00 27.55 ? 585 HIS A CD2  1 
ATOM   1098 C  CE1  . HIS A 1 142 ? 7.327   -1.920  -9.364  1.00 28.73 ? 585 HIS A CE1  1 
ATOM   1099 N  NE2  . HIS A 1 142 ? 6.717   -2.591  -8.401  1.00 28.62 ? 585 HIS A NE2  1 
ATOM   1100 N  N    . GLU A 1 143 ? 10.104  -5.439  -10.848 1.00 26.27 ? 586 GLU A N    1 
ATOM   1101 C  CA   . GLU A 1 143 ? 11.244  -5.478  -9.907  1.00 26.15 ? 586 GLU A CA   1 
ATOM   1102 C  C    . GLU A 1 143 ? 11.924  -6.861  -9.855  1.00 25.99 ? 586 GLU A C    1 
ATOM   1103 O  O    . GLU A 1 143 ? 12.874  -7.085  -9.058  1.00 25.58 ? 586 GLU A O    1 
ATOM   1104 C  CB   . GLU A 1 143 ? 10.871  -4.967  -8.485  1.00 26.25 ? 586 GLU A CB   1 
ATOM   1105 C  CG   . GLU A 1 143 ? 10.250  -3.570  -8.400  1.00 26.09 ? 586 GLU A CG   1 
ATOM   1106 C  CD   . GLU A 1 143 ? 10.566  -2.881  -7.073  1.00 25.75 ? 586 GLU A CD   1 
ATOM   1107 O  OE1  . GLU A 1 143 ? 10.678  -3.600  -6.055  1.00 25.90 ? 586 GLU A OE1  1 
ATOM   1108 O  OE2  . GLU A 1 143 ? 10.715  -1.635  -7.038  1.00 23.61 ? 586 GLU A OE2  1 
ATOM   1109 N  N    . ASP A 1 144 ? 11.466  -7.763  -10.732 1.00 25.80 ? 587 ASP A N    1 
ATOM   1110 C  CA   . ASP A 1 144 ? 12.020  -9.117  -10.840 1.00 25.84 ? 587 ASP A CA   1 
ATOM   1111 C  C    . ASP A 1 144 ? 11.579  -9.961  -9.639  1.00 26.00 ? 587 ASP A C    1 
ATOM   1112 O  O    . ASP A 1 144 ? 12.312  -10.879 -9.191  1.00 25.92 ? 587 ASP A O    1 
ATOM   1113 C  CB   . ASP A 1 144 ? 13.563  -9.087  -10.960 1.00 25.66 ? 587 ASP A CB   1 
ATOM   1114 C  CG   . ASP A 1 144 ? 14.075  -7.843  -11.695 1.00 25.62 ? 587 ASP A CG   1 
ATOM   1115 O  OD1  . ASP A 1 144 ? 14.497  -6.896  -10.994 1.00 25.75 ? 587 ASP A OD1  1 
ATOM   1116 O  OD2  . ASP A 1 144 ? 14.074  -7.711  -12.949 1.00 24.02 ? 587 ASP A OD2  1 
ATOM   1117 N  N    . ASN A 1 145 ? 10.389  -9.622  -9.119  1.00 25.79 ? 588 ASN A N    1 
ATOM   1118 C  CA   . ASN A 1 145 ? 9.755   -10.325 -7.991  1.00 25.72 ? 588 ASN A CA   1 
ATOM   1119 C  C    . ASN A 1 145 ? 8.243   -10.406 -8.156  1.00 25.16 ? 588 ASN A C    1 
ATOM   1120 O  O    . ASN A 1 145 ? 7.649   -11.475 -8.020  1.00 24.98 ? 588 ASN A O    1 
ATOM   1121 C  CB   . ASN A 1 145 ? 10.060  -9.634  -6.657  1.00 25.85 ? 588 ASN A CB   1 
ATOM   1122 C  CG   . ASN A 1 145 ? 11.544  -9.324  -6.475  1.00 27.27 ? 588 ASN A CG   1 
ATOM   1123 O  OD1  . ASN A 1 145 ? 12.409  -10.186 -6.726  1.00 29.31 ? 588 ASN A OD1  1 
ATOM   1124 N  ND2  . ASN A 1 145 ? 11.852  -8.094  -6.025  1.00 27.19 ? 588 ASN A ND2  1 
ATOM   1125 N  N    . THR A 1 146 ? 7.630   -9.265  -8.448  1.00 24.79 ? 589 THR A N    1 
ATOM   1126 C  CA   . THR A 1 146 ? 6.179   -9.168  -8.530  1.00 24.86 ? 589 THR A CA   1 
ATOM   1127 C  C    . THR A 1 146 ? 5.582   -9.309  -9.933  1.00 24.36 ? 589 THR A C    1 
ATOM   1128 O  O    . THR A 1 146 ? 5.792   -8.473  -10.820 1.00 24.20 ? 589 THR A O    1 
ATOM   1129 C  CB   . THR A 1 146 ? 5.706   -7.871  -7.918  1.00 24.92 ? 589 THR A CB   1 
ATOM   1130 O  OG1  . THR A 1 146 ? 6.627   -7.459  -6.898  1.00 25.95 ? 589 THR A OG1  1 
ATOM   1131 C  CG2  . THR A 1 146 ? 4.368   -8.109  -7.191  1.00 25.58 ? 589 THR A CG2  1 
ATOM   1132 N  N    . VAL A 1 147 ? 4.843   -10.392 -10.114 1.00 23.87 ? 590 VAL A N    1 
ATOM   1133 C  CA   . VAL A 1 147 ? 4.056   -10.616 -11.311 1.00 23.59 ? 590 VAL A CA   1 
ATOM   1134 C  C    . VAL A 1 147 ? 3.027   -9.503  -11.418 1.00 23.10 ? 590 VAL A C    1 
ATOM   1135 O  O    . VAL A 1 147 ? 2.378   -9.159  -10.450 1.00 22.27 ? 590 VAL A O    1 
ATOM   1136 C  CB   . VAL A 1 147 ? 3.345   -12.020 -11.233 1.00 23.46 ? 590 VAL A CB   1 
ATOM   1137 C  CG1  . VAL A 1 147 ? 2.139   -12.130 -12.132 1.00 22.77 ? 590 VAL A CG1  1 
ATOM   1138 C  CG2  . VAL A 1 147 ? 4.324   -13.121 -11.532 1.00 23.87 ? 590 VAL A CG2  1 
ATOM   1139 N  N    . LYS A 1 148 ? 2.912   -8.937  -12.603 1.00 23.13 ? 591 LYS A N    1 
ATOM   1140 C  CA   . LYS A 1 148 ? 1.779   -8.091  -12.940 1.00 23.43 ? 591 LYS A CA   1 
ATOM   1141 C  C    . LYS A 1 148 ? 1.259   -8.604  -14.262 1.00 23.40 ? 591 LYS A C    1 
ATOM   1142 O  O    . LYS A 1 148 ? 2.027   -8.649  -15.236 1.00 22.86 ? 591 LYS A O    1 
ATOM   1143 C  CB   . LYS A 1 148 ? 2.201   -6.633  -13.064 1.00 23.43 ? 591 LYS A CB   1 
ATOM   1144 C  CG   . LYS A 1 148 ? 2.918   -6.094  -11.847 1.00 23.38 ? 591 LYS A CG   1 
ATOM   1145 C  CD   . LYS A 1 148 ? 1.973   -5.942  -10.665 1.00 23.97 ? 591 LYS A CD   1 
ATOM   1146 C  CE   . LYS A 1 148 ? 2.717   -5.520  -9.420  1.00 24.58 ? 591 LYS A CE   1 
ATOM   1147 N  NZ   . LYS A 1 148 ? 1.825   -4.776  -8.514  1.00 25.51 ? 591 LYS A NZ   1 
ATOM   1148 N  N    . ILE A 1 149 ? -0.010  -9.032  -14.271 1.00 23.45 ? 592 ILE A N    1 
ATOM   1149 C  CA   . ILE A 1 149 ? -0.634  -9.593  -15.471 1.00 23.90 ? 592 ILE A CA   1 
ATOM   1150 C  C    . ILE A 1 149 ? -1.365  -8.498  -16.205 1.00 24.51 ? 592 ILE A C    1 
ATOM   1151 O  O    . ILE A 1 149 ? -2.245  -7.870  -15.647 1.00 23.96 ? 592 ILE A O    1 
ATOM   1152 C  CB   . ILE A 1 149 ? -1.656  -10.699 -15.168 1.00 23.73 ? 592 ILE A CB   1 
ATOM   1153 C  CG1  . ILE A 1 149 ? -0.977  -11.897 -14.506 1.00 23.43 ? 592 ILE A CG1  1 
ATOM   1154 C  CG2  . ILE A 1 149 ? -2.393  -11.104 -16.472 1.00 23.24 ? 592 ILE A CG2  1 
ATOM   1155 C  CD1  . ILE A 1 149 ? -1.897  -13.048 -14.170 1.00 22.65 ? 592 ILE A CD1  1 
ATOM   1156 N  N    . GLY A 1 150 ? -1.009  -8.299  -17.469 1.00 25.48 ? 593 GLY A N    1 
ATOM   1157 C  CA   . GLY A 1 150 ? -1.692  -7.349  -18.314 1.00 26.31 ? 593 GLY A CA   1 
ATOM   1158 C  C    . GLY A 1 150 ? -1.954  -7.766  -19.760 1.00 26.80 ? 593 GLY A C    1 
ATOM   1159 O  O    . GLY A 1 150 ? -1.747  -8.915  -20.166 1.00 26.72 ? 593 GLY A O    1 
ATOM   1160 N  N    . ASP A 1 151 ? -2.389  -6.757  -20.517 1.00 27.01 ? 594 ASP A N    1 
ATOM   1161 C  CA   . ASP A 1 151 ? -2.880  -6.862  -21.872 1.00 27.25 ? 594 ASP A CA   1 
ATOM   1162 C  C    . ASP A 1 151 ? -4.172  -7.689  -21.928 1.00 27.24 ? 594 ASP A C    1 
ATOM   1163 O  O    . ASP A 1 151 ? -4.361  -8.483  -22.837 1.00 27.93 ? 594 ASP A O    1 
ATOM   1164 C  CB   . ASP A 1 151 ? -1.785  -7.415  -22.791 1.00 27.65 ? 594 ASP A CB   1 
ATOM   1165 C  CG   . ASP A 1 151 ? -2.078  -7.190  -24.284 1.00 28.32 ? 594 ASP A CG   1 
ATOM   1166 O  OD1  . ASP A 1 151 ? -1.718  -8.098  -25.089 1.00 27.21 ? 594 ASP A OD1  1 
ATOM   1167 O  OD2  . ASP A 1 151 ? -2.639  -6.147  -24.733 1.00 29.55 ? 594 ASP A OD2  1 
ATOM   1168 N  N    . PHE A 1 152 ? -5.060  -7.505  -20.950 1.00 27.06 ? 595 PHE A N    1 
ATOM   1169 C  CA   . PHE A 1 152 ? -6.427  -8.052  -21.028 1.00 26.65 ? 595 PHE A CA   1 
ATOM   1170 C  C    . PHE A 1 152 ? -7.457  -6.978  -21.366 1.00 26.77 ? 595 PHE A C    1 
ATOM   1171 O  O    . PHE A 1 152 ? -7.141  -5.795  -21.407 1.00 26.58 ? 595 PHE A O    1 
ATOM   1172 C  CB   . PHE A 1 152 ? -6.827  -8.836  -19.751 1.00 26.77 ? 595 PHE A CB   1 
ATOM   1173 C  CG   . PHE A 1 152 ? -6.812  -8.028  -18.469 1.00 25.38 ? 595 PHE A CG   1 
ATOM   1174 C  CD1  . PHE A 1 152 ? -7.965  -7.447  -17.986 1.00 24.26 ? 595 PHE A CD1  1 
ATOM   1175 C  CD2  . PHE A 1 152 ? -5.656  -7.906  -17.733 1.00 25.05 ? 595 PHE A CD2  1 
ATOM   1176 C  CE1  . PHE A 1 152 ? -7.961  -6.743  -16.822 1.00 23.91 ? 595 PHE A CE1  1 
ATOM   1177 C  CE2  . PHE A 1 152 ? -5.647  -7.185  -16.569 1.00 25.46 ? 595 PHE A CE2  1 
ATOM   1178 C  CZ   . PHE A 1 152 ? -6.800  -6.606  -16.114 1.00 24.86 ? 595 PHE A CZ   1 
ATOM   1179 N  N    . GLY A 1 153 ? -8.694  -7.413  -21.623 1.00 27.01 ? 596 GLY A N    1 
ATOM   1180 C  CA   . GLY A 1 153 ? -9.708  -6.571  -22.237 1.00 26.84 ? 596 GLY A CA   1 
ATOM   1181 C  C    . GLY A 1 153 ? -9.574  -6.573  -23.756 1.00 26.51 ? 596 GLY A C    1 
ATOM   1182 O  O    . GLY A 1 153 ? -8.938  -5.694  -24.337 1.00 25.90 ? 596 GLY A O    1 
ATOM   1183 N  N    . SER A 1 171 ? -2.459  -13.469 -37.614 1.00 26.72 ? 614 SER A N    1 
ATOM   1184 C  CA   . SER A 1 171 ? -3.039  -13.942 -36.354 1.00 26.86 ? 614 SER A CA   1 
ATOM   1185 C  C    . SER A 1 171 ? -2.264  -13.300 -35.190 1.00 26.83 ? 614 SER A C    1 
ATOM   1186 O  O    . SER A 1 171 ? -1.604  -12.264 -35.380 1.00 27.38 ? 614 SER A O    1 
ATOM   1187 C  CB   . SER A 1 171 ? -3.035  -15.489 -36.296 1.00 26.88 ? 614 SER A CB   1 
ATOM   1188 O  OG   . SER A 1 171 ? -4.260  -16.088 -36.730 1.00 26.09 ? 614 SER A OG   1 
ATOM   1189 N  N    . GLY A 1 172 ? -2.402  -13.857 -33.989 1.00 26.46 ? 615 GLY A N    1 
ATOM   1190 C  CA   . GLY A 1 172 ? -1.611  -13.441 -32.836 1.00 26.25 ? 615 GLY A CA   1 
ATOM   1191 C  C    . GLY A 1 172 ? -0.870  -14.676 -32.372 1.00 25.90 ? 615 GLY A C    1 
ATOM   1192 O  O    . GLY A 1 172 ? -0.469  -15.465 -33.223 1.00 25.74 ? 615 GLY A O    1 
ATOM   1193 N  N    . SER A 1 173 ? -0.797  -14.896 -31.056 1.00 25.42 ? 616 SER A N    1 
ATOM   1194 C  CA   . SER A 1 173 ? 0.061   -15.938 -30.470 1.00 25.55 ? 616 SER A CA   1 
ATOM   1195 C  C    . SER A 1 173 ? -0.574  -17.328 -30.235 1.00 25.51 ? 616 SER A C    1 
ATOM   1196 O  O    . SER A 1 173 ? -1.083  -17.619 -29.136 1.00 25.89 ? 616 SER A O    1 
ATOM   1197 C  CB   . SER A 1 173 ? 0.616   -15.422 -29.147 1.00 25.64 ? 616 SER A CB   1 
ATOM   1198 O  OG   . SER A 1 173 ? -0.440  -14.863 -28.396 1.00 25.61 ? 616 SER A OG   1 
ATOM   1199 N  N    . ILE A 1 174 ? -0.458  -18.208 -31.223 1.00 24.78 ? 617 ILE A N    1 
ATOM   1200 C  CA   . ILE A 1 174 ? -1.099  -19.523 -31.168 1.00 24.75 ? 617 ILE A CA   1 
ATOM   1201 C  C    . ILE A 1 174 ? -0.566  -20.541 -30.140 1.00 24.33 ? 617 ILE A C    1 
ATOM   1202 O  O    . ILE A 1 174 ? -1.262  -21.510 -29.834 1.00 23.93 ? 617 ILE A O    1 
ATOM   1203 C  CB   . ILE A 1 174 ? -1.067  -20.187 -32.561 1.00 25.13 ? 617 ILE A CB   1 
ATOM   1204 C  CG1  . ILE A 1 174 ? 0.365   -20.348 -33.067 1.00 24.83 ? 617 ILE A CG1  1 
ATOM   1205 C  CG2  . ILE A 1 174 ? -1.916  -19.407 -33.578 1.00 25.71 ? 617 ILE A CG2  1 
ATOM   1206 C  CD1  . ILE A 1 174 ? 0.588   -21.697 -33.667 1.00 25.05 ? 617 ILE A CD1  1 
ATOM   1207 N  N    . LEU A 1 175 ? 0.647   -20.316 -29.626 1.00 24.11 ? 618 LEU A N    1 
ATOM   1208 C  CA   . LEU A 1 175 ? 1.343   -21.245 -28.725 1.00 23.66 ? 618 LEU A CA   1 
ATOM   1209 C  C    . LEU A 1 175 ? 0.674   -21.491 -27.379 1.00 23.60 ? 618 LEU A C    1 
ATOM   1210 O  O    . LEU A 1 175 ? 0.917   -22.522 -26.755 1.00 23.71 ? 618 LEU A O    1 
ATOM   1211 C  CB   . LEU A 1 175 ? 2.764   -20.745 -28.445 1.00 23.83 ? 618 LEU A CB   1 
ATOM   1212 C  CG   . LEU A 1 175 ? 3.923   -20.964 -29.419 1.00 23.88 ? 618 LEU A CG   1 
ATOM   1213 C  CD1  . LEU A 1 175 ? 5.205   -20.488 -28.766 1.00 23.92 ? 618 LEU A CD1  1 
ATOM   1214 C  CD2  . LEU A 1 175 ? 4.088   -22.384 -29.860 1.00 23.58 ? 618 LEU A CD2  1 
ATOM   1215 N  N    . TRP A 1 176 ? -0.125  -20.528 -26.920 1.00 24.21 ? 619 TRP A N    1 
ATOM   1216 C  CA   . TRP A 1 176 ? -0.891  -20.602 -25.646 1.00 24.28 ? 619 TRP A CA   1 
ATOM   1217 C  C    . TRP A 1 176 ? -2.391  -20.860 -25.888 1.00 23.76 ? 619 TRP A C    1 
ATOM   1218 O  O    . TRP A 1 176 ? -3.204  -20.739 -24.972 1.00 23.41 ? 619 TRP A O    1 
ATOM   1219 C  CB   . TRP A 1 176 ? -0.715  -19.299 -24.815 1.00 24.42 ? 619 TRP A CB   1 
ATOM   1220 C  CG   . TRP A 1 176 ? 0.746   -18.993 -24.318 1.00 25.25 ? 619 TRP A CG   1 
ATOM   1221 C  CD1  . TRP A 1 176 ? 1.229   -19.137 -23.040 1.00 24.81 ? 619 TRP A CD1  1 
ATOM   1222 C  CD2  . TRP A 1 176 ? 1.854   -18.485 -25.099 1.00 25.66 ? 619 TRP A CD2  1 
ATOM   1223 N  NE1  . TRP A 1 176 ? 2.550   -18.762 -22.980 1.00 24.33 ? 619 TRP A NE1  1 
ATOM   1224 C  CE2  . TRP A 1 176 ? 2.959   -18.358 -24.229 1.00 25.50 ? 619 TRP A CE2  1 
ATOM   1225 C  CE3  . TRP A 1 176 ? 2.021   -18.115 -26.450 1.00 24.90 ? 619 TRP A CE3  1 
ATOM   1226 C  CZ2  . TRP A 1 176 ? 4.212   -17.883 -24.673 1.00 25.36 ? 619 TRP A CZ2  1 
ATOM   1227 C  CZ3  . TRP A 1 176 ? 3.256   -17.649 -26.877 1.00 23.94 ? 619 TRP A CZ3  1 
ATOM   1228 C  CH2  . TRP A 1 176 ? 4.333   -17.544 -25.998 1.00 24.89 ? 619 TRP A CH2  1 
ATOM   1229 N  N    . MET A 1 177 ? -2.726  -21.242 -27.118 1.00 23.72 ? 620 MET A N    1 
ATOM   1230 C  CA   . MET A 1 177 ? -4.107  -21.370 -27.596 1.00 24.26 ? 620 MET A CA   1 
ATOM   1231 C  C    . MET A 1 177 ? -4.704  -22.797 -27.490 1.00 23.83 ? 620 MET A C    1 
ATOM   1232 O  O    . MET A 1 177 ? -4.325  -23.725 -28.192 1.00 23.74 ? 620 MET A O    1 
ATOM   1233 C  CB   . MET A 1 177 ? -4.157  -20.892 -29.050 1.00 24.52 ? 620 MET A CB   1 
ATOM   1234 C  CG   . MET A 1 177 ? -5.548  -20.487 -29.555 1.00 25.74 ? 620 MET A CG   1 
ATOM   1235 S  SD   . MET A 1 177 ? -5.469  -19.136 -30.791 1.00 27.33 ? 620 MET A SD   1 
ATOM   1236 C  CE   . MET A 1 177 ? -5.954  -19.875 -32.283 1.00 26.03 ? 620 MET A CE   1 
ATOM   1237 N  N    . ALA A 1 178 ? -5.660  -22.960 -26.604 1.00 24.02 ? 621 ALA A N    1 
ATOM   1238 C  CA   . ALA A 1 178 ? -6.352  -24.232 -26.449 1.00 24.08 ? 621 ALA A CA   1 
ATOM   1239 C  C    . ALA A 1 178 ? -6.935  -24.719 -27.784 1.00 23.95 ? 621 ALA A C    1 
ATOM   1240 O  O    . ALA A 1 178 ? -7.390  -23.916 -28.577 1.00 23.98 ? 621 ALA A O    1 
ATOM   1241 C  CB   . ALA A 1 178 ? -7.452  -24.081 -25.435 1.00 23.79 ? 621 ALA A CB   1 
ATOM   1242 N  N    . PRO A 1 179 ? -6.933  -26.024 -28.025 1.00 23.89 ? 622 PRO A N    1 
ATOM   1243 C  CA   . PRO A 1 179 ? -7.440  -26.589 -29.278 1.00 24.07 ? 622 PRO A CA   1 
ATOM   1244 C  C    . PRO A 1 179 ? -8.822  -26.068 -29.700 1.00 24.17 ? 622 PRO A C    1 
ATOM   1245 O  O    . PRO A 1 179 ? -9.105  -25.910 -30.902 1.00 23.97 ? 622 PRO A O    1 
ATOM   1246 C  CB   . PRO A 1 179 ? -7.548  -28.086 -28.964 1.00 24.06 ? 622 PRO A CB   1 
ATOM   1247 C  CG   . PRO A 1 179 ? -6.617  -28.337 -27.892 1.00 23.66 ? 622 PRO A CG   1 
ATOM   1248 C  CD   . PRO A 1 179 ? -6.457  -27.079 -27.119 1.00 24.00 ? 622 PRO A CD   1 
ATOM   1249 N  N    . GLU A 1 180 ? -9.689  -25.824 -28.722 1.00 23.91 ? 623 GLU A N    1 
ATOM   1250 C  CA   . GLU A 1 180 ? -11.030 -25.374 -29.049 1.00 23.61 ? 623 GLU A CA   1 
ATOM   1251 C  C    . GLU A 1 180 ? -10.973 -23.937 -29.522 1.00 23.57 ? 623 GLU A C    1 
ATOM   1252 O  O    . GLU A 1 180 ? -11.703 -23.555 -30.411 1.00 23.61 ? 623 GLU A O    1 
ATOM   1253 C  CB   . GLU A 1 180 ? -12.041 -25.614 -27.908 1.00 23.14 ? 623 GLU A CB   1 
ATOM   1254 C  CG   . GLU A 1 180 ? -11.858 -24.767 -26.674 1.00 21.53 ? 623 GLU A CG   1 
ATOM   1255 C  CD   . GLU A 1 180 ? -11.079 -25.442 -25.594 1.00 20.00 ? 623 GLU A CD   1 
ATOM   1256 O  OE1  . GLU A 1 180 ? -10.639 -26.588 -25.776 1.00 20.00 ? 623 GLU A OE1  1 
ATOM   1257 O  OE2  . GLU A 1 180 ? -10.912 -24.802 -24.553 1.00 20.00 ? 623 GLU A OE2  1 
ATOM   1258 N  N    . VAL A 1 181 ? -10.085 -23.141 -28.964 1.00 23.77 ? 624 VAL A N    1 
ATOM   1259 C  CA   . VAL A 1 181 ? -9.907  -21.817 -29.512 1.00 24.29 ? 624 VAL A CA   1 
ATOM   1260 C  C    . VAL A 1 181 ? -9.315  -21.937 -30.918 1.00 24.79 ? 624 VAL A C    1 
ATOM   1261 O  O    . VAL A 1 181 ? -9.898  -21.397 -31.845 1.00 25.17 ? 624 VAL A O    1 
ATOM   1262 C  CB   . VAL A 1 181 ? -9.073  -20.915 -28.621 1.00 24.45 ? 624 VAL A CB   1 
ATOM   1263 C  CG1  . VAL A 1 181 ? -8.942  -19.551 -29.241 1.00 24.03 ? 624 VAL A CG1  1 
ATOM   1264 C  CG2  . VAL A 1 181 ? -9.713  -20.824 -27.216 1.00 25.17 ? 624 VAL A CG2  1 
ATOM   1265 N  N    . ILE A 1 182 ? -8.218  -22.683 -31.106 1.00 25.20 ? 625 ILE A N    1 
ATOM   1266 C  CA   . ILE A 1 182 ? -7.623  -22.849 -32.455 1.00 25.53 ? 625 ILE A CA   1 
ATOM   1267 C  C    . ILE A 1 182 ? -8.668  -23.176 -33.546 1.00 25.99 ? 625 ILE A C    1 
ATOM   1268 O  O    . ILE A 1 182 ? -8.629  -22.669 -34.675 1.00 25.29 ? 625 ILE A O    1 
ATOM   1269 C  CB   . ILE A 1 182 ? -6.533  -23.919 -32.437 1.00 25.21 ? 625 ILE A CB   1 
ATOM   1270 C  CG1  . ILE A 1 182 ? -5.318  -23.419 -31.665 1.00 25.37 ? 625 ILE A CG1  1 
ATOM   1271 C  CG2  . ILE A 1 182 ? -6.108  -24.239 -33.841 1.00 25.76 ? 625 ILE A CG2  1 
ATOM   1272 C  CD1  . ILE A 1 182 ? -4.024  -24.197 -31.889 1.00 25.24 ? 625 ILE A CD1  1 
ATOM   1273 N  N    . ARG A 1 183 ? -9.620  -24.007 -33.152 1.00 26.84 ? 626 ARG A N    1 
ATOM   1274 C  CA   . ARG A 1 183 ? -10.569 -24.622 -34.044 1.00 27.41 ? 626 ARG A CA   1 
ATOM   1275 C  C    . ARG A 1 183 ? -11.815 -23.794 -33.907 1.00 27.91 ? 626 ARG A C    1 
ATOM   1276 O  O    . ARG A 1 183 ? -12.144 -23.033 -34.826 1.00 28.48 ? 626 ARG A O    1 
ATOM   1277 C  CB   . ARG A 1 183 ? -10.732 -26.081 -33.600 1.00 27.49 ? 626 ARG A CB   1 
ATOM   1278 C  CG   . ARG A 1 183 ? -11.906 -26.860 -34.107 1.00 27.80 ? 626 ARG A CG   1 
ATOM   1279 C  CD   . ARG A 1 183 ? -12.597 -27.717 -32.997 1.00 27.58 ? 626 ARG A CD   1 
ATOM   1280 N  NE   . ARG A 1 183 ? -11.631 -28.517 -32.215 1.00 27.08 ? 626 ARG A NE   1 
ATOM   1281 C  CZ   . ARG A 1 183 ? -11.586 -28.632 -30.872 1.00 25.78 ? 626 ARG A CZ   1 
ATOM   1282 N  NH1  . ARG A 1 183 ? -12.441 -28.006 -30.064 1.00 25.66 ? 626 ARG A NH1  1 
ATOM   1283 N  NH2  . ARG A 1 183 ? -10.654 -29.395 -30.324 1.00 26.24 ? 626 ARG A NH2  1 
ATOM   1284 N  N    . MET A 1 184 ? -12.478 -23.933 -32.751 1.00 28.58 ? 627 MET A N    1 
ATOM   1285 C  CA   . MET A 1 184 ? -13.668 -23.126 -32.305 1.00 28.92 ? 627 MET A CA   1 
ATOM   1286 C  C    . MET A 1 184 ? -14.902 -24.014 -31.972 1.00 29.15 ? 627 MET A C    1 
ATOM   1287 O  O    . MET A 1 184 ? -15.600 -24.515 -32.894 1.00 28.77 ? 627 MET A O    1 
ATOM   1288 C  CB   . MET A 1 184 ? -14.065 -22.004 -33.280 1.00 28.74 ? 627 MET A CB   1 
ATOM   1289 C  CG   . MET A 1 184 ? -15.320 -21.250 -32.881 1.00 29.49 ? 627 MET A CG   1 
ATOM   1290 S  SD   . MET A 1 184 ? -16.694 -21.492 -34.086 1.00 31.93 ? 627 MET A SD   1 
ATOM   1291 C  CE   . MET A 1 184 ? -17.807 -20.115 -33.644 1.00 30.20 ? 627 MET A CE   1 
ATOM   1292 N  N    . GLN A 1 185 ? -15.107 -24.208 -30.650 1.00 29.23 ? 628 GLN A N    1 
ATOM   1293 C  CA   . GLN A 1 185 ? -16.364 -24.720 -30.019 1.00 29.23 ? 628 GLN A CA   1 
ATOM   1294 C  C    . GLN A 1 185 ? -17.710 -24.388 -30.747 1.00 29.23 ? 628 GLN A C    1 
ATOM   1295 O  O    . GLN A 1 185 ? -18.099 -25.203 -31.606 1.00 29.86 ? 628 GLN A O    1 
ATOM   1296 C  CB   . GLN A 1 185 ? -16.395 -24.370 -28.488 1.00 29.29 ? 628 GLN A CB   1 
ATOM   1297 C  CG   . GLN A 1 185 ? -17.787 -24.147 -27.771 1.00 29.30 ? 628 GLN A CG   1 
ATOM   1298 C  CD   . GLN A 1 185 ? -18.385 -25.413 -27.186 1.00 28.75 ? 628 GLN A CD   1 
ATOM   1299 O  OE1  . GLN A 1 185 ? -18.301 -26.476 -27.804 1.00 30.74 ? 628 GLN A OE1  1 
ATOM   1300 N  NE2  . GLN A 1 185 ? -18.997 -25.305 -26.008 1.00 27.11 ? 628 GLN A NE2  1 
ATOM   1301 N  N    . ASP A 1 186 ? -18.385 -23.248 -30.460 1.00 28.47 ? 629 ASP A N    1 
ATOM   1302 C  CA   . ASP A 1 186 ? -19.835 -23.021 -30.835 1.00 28.38 ? 629 ASP A CA   1 
ATOM   1303 C  C    . ASP A 1 186 ? -20.675 -22.374 -29.668 1.00 28.25 ? 629 ASP A C    1 
ATOM   1304 O  O    . ASP A 1 186 ? -21.147 -23.075 -28.752 1.00 27.89 ? 629 ASP A O    1 
ATOM   1305 C  CB   . ASP A 1 186 ? -20.565 -24.330 -31.293 1.00 28.28 ? 629 ASP A CB   1 
ATOM   1306 C  CG   . ASP A 1 186 ? -21.178 -24.243 -32.724 1.00 28.53 ? 629 ASP A CG   1 
ATOM   1307 O  OD1  . ASP A 1 186 ? -21.483 -23.129 -33.231 1.00 27.77 ? 629 ASP A OD1  1 
ATOM   1308 O  OD2  . ASP A 1 186 ? -21.429 -25.280 -33.396 1.00 27.59 ? 629 ASP A OD2  1 
ATOM   1309 N  N    . SER A 1 187 ? -20.870 -21.053 -29.736 1.00 28.09 ? 630 SER A N    1 
ATOM   1310 C  CA   . SER A 1 187 ? -21.395 -20.219 -28.624 1.00 27.99 ? 630 SER A CA   1 
ATOM   1311 C  C    . SER A 1 187 ? -20.306 -19.669 -27.639 1.00 28.02 ? 630 SER A C    1 
ATOM   1312 O  O    . SER A 1 187 ? -20.272 -18.479 -27.354 1.00 27.48 ? 630 SER A O    1 
ATOM   1313 C  CB   . SER A 1 187 ? -22.566 -20.901 -27.907 1.00 27.74 ? 630 SER A CB   1 
ATOM   1314 O  OG   . SER A 1 187 ? -23.517 -21.340 -28.879 1.00 28.14 ? 630 SER A OG   1 
ATOM   1315 N  N    . ASN A 1 188 ? -19.418 -20.513 -27.132 1.00 28.52 ? 631 ASN A N    1 
ATOM   1316 C  CA   . ASN A 1 188 ? -18.123 -20.006 -26.651 1.00 29.01 ? 631 ASN A CA   1 
ATOM   1317 C  C    . ASN A 1 188 ? -17.238 -19.672 -27.891 1.00 28.63 ? 631 ASN A C    1 
ATOM   1318 O  O    . ASN A 1 188 ? -17.771 -18.990 -28.784 1.00 29.51 ? 631 ASN A O    1 
ATOM   1319 C  CB   . ASN A 1 188 ? -17.524 -20.965 -25.635 1.00 29.49 ? 631 ASN A CB   1 
ATOM   1320 C  CG   . ASN A 1 188 ? -18.297 -20.962 -24.322 1.00 30.96 ? 631 ASN A CG   1 
ATOM   1321 O  OD1  . ASN A 1 188 ? -19.072 -20.044 -24.051 1.00 28.17 ? 631 ASN A OD1  1 
ATOM   1322 N  ND2  . ASN A 1 188 ? -18.075 -21.988 -23.498 1.00 32.68 ? 631 ASN A ND2  1 
ATOM   1323 N  N    . PRO A 1 189 ? -15.966 -20.072 -28.035 1.00 27.60 ? 632 PRO A N    1 
ATOM   1324 C  CA   . PRO A 1 189 ? -15.212 -21.011 -27.213 1.00 27.35 ? 632 PRO A CA   1 
ATOM   1325 C  C    . PRO A 1 189 ? -14.391 -20.355 -26.086 1.00 26.77 ? 632 PRO A C    1 
ATOM   1326 O  O    . PRO A 1 189 ? -14.078 -21.073 -25.138 1.00 27.29 ? 632 PRO A O    1 
ATOM   1327 C  CB   . PRO A 1 189 ? -14.225 -21.592 -28.229 1.00 27.43 ? 632 PRO A CB   1 
ATOM   1328 C  CG   . PRO A 1 189 ? -13.840 -20.370 -29.068 1.00 27.76 ? 632 PRO A CG   1 
ATOM   1329 C  CD   . PRO A 1 189 ? -15.124 -19.563 -29.140 1.00 27.82 ? 632 PRO A CD   1 
ATOM   1330 N  N    . TYR A 1 190 ? -14.012 -19.078 -26.207 1.00 25.48 ? 633 TYR A N    1 
ATOM   1331 C  CA   . TYR A 1 190 ? -13.235 -18.400 -25.177 1.00 24.50 ? 633 TYR A CA   1 
ATOM   1332 C  C    . TYR A 1 190 ? -13.960 -18.500 -23.863 1.00 23.95 ? 633 TYR A C    1 
ATOM   1333 O  O    . TYR A 1 190 ? -15.113 -18.091 -23.783 1.00 23.98 ? 633 TYR A O    1 
ATOM   1334 C  CB   . TYR A 1 190 ? -13.031 -16.929 -25.554 1.00 24.22 ? 633 TYR A CB   1 
ATOM   1335 C  CG   . TYR A 1 190 ? -11.915 -16.748 -26.544 1.00 23.90 ? 633 TYR A CG   1 
ATOM   1336 C  CD1  . TYR A 1 190 ? -12.171 -16.465 -27.895 1.00 23.13 ? 633 TYR A CD1  1 
ATOM   1337 C  CD2  . TYR A 1 190 ? -10.597 -16.893 -26.142 1.00 23.57 ? 633 TYR A CD2  1 
ATOM   1338 C  CE1  . TYR A 1 190 ? -11.134 -16.331 -28.803 1.00 22.78 ? 633 TYR A CE1  1 
ATOM   1339 C  CE2  . TYR A 1 190 ? -9.548  -16.748 -27.040 1.00 23.66 ? 633 TYR A CE2  1 
ATOM   1340 C  CZ   . TYR A 1 190 ? -9.813  -16.466 -28.357 1.00 23.47 ? 633 TYR A CZ   1 
ATOM   1341 O  OH   . TYR A 1 190 ? -8.739  -16.341 -29.211 1.00 23.37 ? 633 TYR A OH   1 
ATOM   1342 N  N    . SER A 1 191 ? -13.314 -19.036 -22.835 1.00 23.42 ? 634 SER A N    1 
ATOM   1343 C  CA   . SER A 1 191 ? -13.985 -19.197 -21.533 1.00 23.79 ? 634 SER A CA   1 
ATOM   1344 C  C    . SER A 1 191 ? -13.005 -19.366 -20.397 1.00 24.09 ? 634 SER A C    1 
ATOM   1345 O  O    . SER A 1 191 ? -11.810 -19.429 -20.633 1.00 23.98 ? 634 SER A O    1 
ATOM   1346 C  CB   . SER A 1 191 ? -14.904 -20.420 -21.552 1.00 23.71 ? 634 SER A CB   1 
ATOM   1347 O  OG   . SER A 1 191 ? -14.165 -21.622 -21.390 1.00 23.17 ? 634 SER A OG   1 
ATOM   1348 N  N    . PHE A 1 192 ? -13.507 -19.481 -19.164 1.00 24.69 ? 635 PHE A N    1 
ATOM   1349 C  CA   . PHE A 1 192 ? -12.616 -19.654 -17.995 1.00 25.09 ? 635 PHE A CA   1 
ATOM   1350 C  C    . PHE A 1 192 ? -11.617 -20.798 -18.236 1.00 25.20 ? 635 PHE A C    1 
ATOM   1351 O  O    . PHE A 1 192 ? -10.469 -20.747 -17.787 1.00 25.07 ? 635 PHE A O    1 
ATOM   1352 C  CB   . PHE A 1 192 ? -13.386 -19.962 -16.704 1.00 25.11 ? 635 PHE A CB   1 
ATOM   1353 C  CG   . PHE A 1 192 ? -14.302 -18.859 -16.219 1.00 26.07 ? 635 PHE A CG   1 
ATOM   1354 C  CD1  . PHE A 1 192 ? -15.158 -19.106 -15.137 1.00 26.43 ? 635 PHE A CD1  1 
ATOM   1355 C  CD2  . PHE A 1 192 ? -14.335 -17.594 -16.807 1.00 26.65 ? 635 PHE A CD2  1 
ATOM   1356 C  CE1  . PHE A 1 192 ? -16.028 -18.110 -14.645 1.00 26.14 ? 635 PHE A CE1  1 
ATOM   1357 C  CE2  . PHE A 1 192 ? -15.224 -16.599 -16.318 1.00 26.80 ? 635 PHE A CE2  1 
ATOM   1358 C  CZ   . PHE A 1 192 ? -16.063 -16.865 -15.241 1.00 25.80 ? 635 PHE A CZ   1 
ATOM   1359 N  N    . GLN A 1 193 ? -12.077 -21.827 -18.945 1.00 25.25 ? 636 GLN A N    1 
ATOM   1360 C  CA   . GLN A 1 193 ? -11.267 -22.998 -19.245 1.00 25.07 ? 636 GLN A CA   1 
ATOM   1361 C  C    . GLN A 1 193 ? -10.151 -22.683 -20.230 1.00 24.51 ? 636 GLN A C    1 
ATOM   1362 O  O    . GLN A 1 193 ? -9.031  -23.155 -20.053 1.00 24.02 ? 636 GLN A O    1 
ATOM   1363 C  CB   . GLN A 1 193 ? -12.150 -24.110 -19.833 1.00 25.56 ? 636 GLN A CB   1 
ATOM   1364 C  CG   . GLN A 1 193 ? -13.329 -24.550 -18.968 1.00 26.01 ? 636 GLN A CG   1 
ATOM   1365 C  CD   . GLN A 1 193 ? -14.672 -24.182 -19.579 1.00 26.77 ? 636 GLN A CD   1 
ATOM   1366 O  OE1  . GLN A 1 193 ? -15.199 -24.897 -20.450 1.00 25.87 ? 636 GLN A OE1  1 
ATOM   1367 N  NE2  . GLN A 1 193 ? -15.232 -23.062 -19.123 1.00 27.42 ? 636 GLN A NE2  1 
ATOM   1368 N  N    . SER A 1 194 ? -10.473 -21.938 -21.290 1.00 24.22 ? 637 SER A N    1 
ATOM   1369 C  CA   . SER A 1 194 ? -9.477  -21.519 -22.283 1.00 24.26 ? 637 SER A CA   1 
ATOM   1370 C  C    . SER A 1 194 ? -8.333  -20.779 -21.653 1.00 24.09 ? 637 SER A C    1 
ATOM   1371 O  O    . SER A 1 194 ? -7.189  -20.913 -22.086 1.00 23.46 ? 637 SER A O    1 
ATOM   1372 C  CB   . SER A 1 194 ? -10.082 -20.568 -23.301 1.00 24.37 ? 637 SER A CB   1 
ATOM   1373 O  OG   . SER A 1 194 ? -10.908 -21.255 -24.211 1.00 25.55 ? 637 SER A OG   1 
ATOM   1374 N  N    . ASP A 1 195 ? -8.688  -19.949 -20.664 1.00 24.31 ? 638 ASP A N    1 
ATOM   1375 C  CA   . ASP A 1 195 ? -7.746  -19.222 -19.811 1.00 23.82 ? 638 ASP A CA   1 
ATOM   1376 C  C    . ASP A 1 195 ? -6.885  -20.215 -19.054 1.00 23.58 ? 638 ASP A C    1 
ATOM   1377 O  O    . ASP A 1 195 ? -5.724  -19.977 -18.855 1.00 24.15 ? 638 ASP A O    1 
ATOM   1378 C  CB   . ASP A 1 195 ? -8.508  -18.332 -18.817 1.00 23.86 ? 638 ASP A CB   1 
ATOM   1379 C  CG   . ASP A 1 195 ? -8.650  -16.889 -19.283 1.00 22.97 ? 638 ASP A CG   1 
ATOM   1380 O  OD1  . ASP A 1 195 ? -8.684  -16.641 -20.491 1.00 22.33 ? 638 ASP A OD1  1 
ATOM   1381 O  OD2  . ASP A 1 195 ? -8.756  -15.930 -18.503 1.00 21.33 ? 638 ASP A OD2  1 
ATOM   1382 N  N    . VAL A 1 196 ? -7.472  -21.326 -18.635 1.00 23.67 ? 639 VAL A N    1 
ATOM   1383 C  CA   . VAL A 1 196 ? -6.768  -22.406 -17.925 1.00 23.59 ? 639 VAL A CA   1 
ATOM   1384 C  C    . VAL A 1 196 ? -5.719  -23.175 -18.736 1.00 23.35 ? 639 VAL A C    1 
ATOM   1385 O  O    . VAL A 1 196 ? -4.680  -23.533 -18.182 1.00 23.50 ? 639 VAL A O    1 
ATOM   1386 C  CB   . VAL A 1 196 ? -7.746  -23.463 -17.319 1.00 23.75 ? 639 VAL A CB   1 
ATOM   1387 C  CG1  . VAL A 1 196 ? -6.960  -24.611 -16.710 1.00 23.90 ? 639 VAL A CG1  1 
ATOM   1388 C  CG2  . VAL A 1 196 ? -8.689  -22.830 -16.269 1.00 23.16 ? 639 VAL A CG2  1 
ATOM   1389 N  N    . TYR A 1 197 ? -5.971  -23.457 -20.013 1.00 23.12 ? 640 TYR A N    1 
ATOM   1390 C  CA   . TYR A 1 197 ? -4.945  -24.096 -20.855 1.00 22.98 ? 640 TYR A CA   1 
ATOM   1391 C  C    . TYR A 1 197 ? -3.814  -23.119 -21.083 1.00 22.55 ? 640 TYR A C    1 
ATOM   1392 O  O    . TYR A 1 197 ? -2.653  -23.475 -20.974 1.00 21.54 ? 640 TYR A O    1 
ATOM   1393 C  CB   . TYR A 1 197 ? -5.536  -24.559 -22.181 1.00 23.34 ? 640 TYR A CB   1 
ATOM   1394 C  CG   . TYR A 1 197 ? -4.559  -25.150 -23.215 1.00 24.46 ? 640 TYR A CG   1 
ATOM   1395 C  CD1  . TYR A 1 197 ? -4.483  -26.534 -23.422 1.00 23.46 ? 640 TYR A CD1  1 
ATOM   1396 C  CD2  . TYR A 1 197 ? -3.753  -24.320 -24.029 1.00 24.27 ? 640 TYR A CD2  1 
ATOM   1397 C  CE1  . TYR A 1 197 ? -3.642  -27.067 -24.384 1.00 22.27 ? 640 TYR A CE1  1 
ATOM   1398 C  CE2  . TYR A 1 197 ? -2.893  -24.866 -24.977 1.00 22.74 ? 640 TYR A CE2  1 
ATOM   1399 C  CZ   . TYR A 1 197 ? -2.851  -26.233 -25.142 1.00 22.24 ? 640 TYR A CZ   1 
ATOM   1400 O  OH   . TYR A 1 197 ? -2.023  -26.778 -26.085 1.00 23.40 ? 640 TYR A OH   1 
ATOM   1401 N  N    . ALA A 1 198 ? -4.178  -21.875 -21.376 1.00 22.90 ? 641 ALA A N    1 
ATOM   1402 C  CA   . ALA A 1 198 ? -3.240  -20.763 -21.344 1.00 23.25 ? 641 ALA A CA   1 
ATOM   1403 C  C    . ALA A 1 198 ? -2.368  -20.866 -20.130 1.00 23.50 ? 641 ALA A C    1 
ATOM   1404 O  O    . ALA A 1 198 ? -1.149  -20.892 -20.261 1.00 24.17 ? 641 ALA A O    1 
ATOM   1405 C  CB   . ALA A 1 198 ? -3.953  -19.438 -21.343 1.00 23.38 ? 641 ALA A CB   1 
ATOM   1406 N  N    . PHE A 1 199 ? -2.958  -20.953 -18.947 1.00 23.35 ? 642 PHE A N    1 
ATOM   1407 C  CA   . PHE A 1 199 ? -2.124  -21.030 -17.769 1.00 23.95 ? 642 PHE A CA   1 
ATOM   1408 C  C    . PHE A 1 199 ? -1.146  -22.255 -17.714 1.00 24.08 ? 642 PHE A C    1 
ATOM   1409 O  O    . PHE A 1 199 ? -0.031  -22.137 -17.181 1.00 23.90 ? 642 PHE A O    1 
ATOM   1410 C  CB   . PHE A 1 199 ? -2.947  -20.989 -16.504 1.00 24.19 ? 642 PHE A CB   1 
ATOM   1411 C  CG   . PHE A 1 199 ? -2.121  -21.218 -15.310 1.00 25.06 ? 642 PHE A CG   1 
ATOM   1412 C  CD1  . PHE A 1 199 ? -1.446  -20.154 -14.719 1.00 26.56 ? 642 PHE A CD1  1 
ATOM   1413 C  CD2  . PHE A 1 199 ? -1.908  -22.512 -14.844 1.00 25.59 ? 642 PHE A CD2  1 
ATOM   1414 C  CE1  . PHE A 1 199 ? -0.613  -20.364 -13.610 1.00 27.89 ? 642 PHE A CE1  1 
ATOM   1415 C  CE2  . PHE A 1 199 ? -1.069  -22.753 -13.744 1.00 27.06 ? 642 PHE A CE2  1 
ATOM   1416 C  CZ   . PHE A 1 199 ? -0.410  -21.682 -13.121 1.00 27.69 ? 642 PHE A CZ   1 
ATOM   1417 N  N    . GLY A 1 200 ? -1.559  -23.411 -18.238 1.00 23.67 ? 643 GLY A N    1 
ATOM   1418 C  CA   . GLY A 1 200 ? -0.660  -24.545 -18.376 1.00 23.72 ? 643 GLY A CA   1 
ATOM   1419 C  C    . GLY A 1 200 ? 0.586   -24.311 -19.245 1.00 23.77 ? 643 GLY A C    1 
ATOM   1420 O  O    . GLY A 1 200 ? 1.692   -24.751 -18.932 1.00 23.45 ? 643 GLY A O    1 
ATOM   1421 N  N    . ILE A 1 201 ? 0.407   -23.621 -20.354 1.00 24.04 ? 644 ILE A N    1 
ATOM   1422 C  CA   . ILE A 1 201 ? 1.491   -23.369 -21.288 1.00 24.26 ? 644 ILE A CA   1 
ATOM   1423 C  C    . ILE A 1 201 ? 2.536   -22.469 -20.631 1.00 24.59 ? 644 ILE A C    1 
ATOM   1424 O  O    . ILE A 1 201 ? 3.749   -22.614 -20.859 1.00 24.56 ? 644 ILE A O    1 
ATOM   1425 C  CB   . ILE A 1 201 ? 0.914   -22.749 -22.615 1.00 24.36 ? 644 ILE A CB   1 
ATOM   1426 C  CG1  . ILE A 1 201 ? -0.180  -23.652 -23.220 1.00 23.04 ? 644 ILE A CG1  1 
ATOM   1427 C  CG2  . ILE A 1 201 ? 2.036   -22.436 -23.641 1.00 24.11 ? 644 ILE A CG2  1 
ATOM   1428 C  CD1  . ILE A 1 201 ? 0.189   -25.072 -23.376 1.00 23.05 ? 644 ILE A CD1  1 
ATOM   1429 N  N    . VAL A 1 202 ? 2.055   -21.535 -19.823 1.00 24.74 ? 645 VAL A N    1 
ATOM   1430 C  CA   . VAL A 1 202 ? 2.915   -20.758 -18.929 1.00 24.86 ? 645 VAL A CA   1 
ATOM   1431 C  C    . VAL A 1 202 ? 3.640   -21.709 -17.944 1.00 25.08 ? 645 VAL A C    1 
ATOM   1432 O  O    . VAL A 1 202 ? 4.818   -21.530 -17.615 1.00 25.22 ? 645 VAL A O    1 
ATOM   1433 C  CB   . VAL A 1 202 ? 2.051   -19.689 -18.167 1.00 24.91 ? 645 VAL A CB   1 
ATOM   1434 C  CG1  . VAL A 1 202 ? 2.843   -18.987 -17.069 1.00 24.28 ? 645 VAL A CG1  1 
ATOM   1435 C  CG2  . VAL A 1 202 ? 1.430   -18.680 -19.157 1.00 24.22 ? 645 VAL A CG2  1 
ATOM   1436 N  N    . LEU A 1 203 ? 2.927   -22.717 -17.457 1.00 25.31 ? 646 LEU A N    1 
ATOM   1437 C  CA   . LEU A 1 203 ? 3.534   -23.711 -16.576 1.00 25.35 ? 646 LEU A CA   1 
ATOM   1438 C  C    . LEU A 1 203 ? 4.640   -24.475 -17.257 1.00 25.46 ? 646 LEU A C    1 
ATOM   1439 O  O    . LEU A 1 203 ? 5.662   -24.745 -16.637 1.00 25.51 ? 646 LEU A O    1 
ATOM   1440 C  CB   . LEU A 1 203 ? 2.505   -24.718 -16.086 1.00 25.25 ? 646 LEU A CB   1 
ATOM   1441 C  CG   . LEU A 1 203 ? 1.808   -24.312 -14.809 1.00 25.62 ? 646 LEU A CG   1 
ATOM   1442 C  CD1  . LEU A 1 203 ? 0.790   -25.375 -14.417 1.00 25.92 ? 646 LEU A CD1  1 
ATOM   1443 C  CD2  . LEU A 1 203 ? 2.836   -24.122 -13.725 1.00 26.59 ? 646 LEU A CD2  1 
ATOM   1444 N  N    . TYR A 1 204 ? 4.422   -24.837 -18.522 1.00 25.41 ? 647 TYR A N    1 
ATOM   1445 C  CA   . TYR A 1 204 ? 5.427   -25.538 -19.327 1.00 25.30 ? 647 TYR A CA   1 
ATOM   1446 C  C    . TYR A 1 204 ? 6.662   -24.642 -19.463 1.00 25.34 ? 647 TYR A C    1 
ATOM   1447 O  O    . TYR A 1 204 ? 7.779   -25.031 -19.140 1.00 25.22 ? 647 TYR A O    1 
ATOM   1448 C  CB   . TYR A 1 204 ? 4.848   -25.927 -20.710 1.00 25.16 ? 647 TYR A CB   1 
ATOM   1449 C  CG   . TYR A 1 204 ? 5.808   -26.678 -21.626 1.00 24.67 ? 647 TYR A CG   1 
ATOM   1450 C  CD1  . TYR A 1 204 ? 5.707   -28.054 -21.809 1.00 24.29 ? 647 TYR A CD1  1 
ATOM   1451 C  CD2  . TYR A 1 204 ? 6.801   -26.013 -22.305 1.00 25.54 ? 647 TYR A CD2  1 
ATOM   1452 C  CE1  . TYR A 1 204 ? 6.573   -28.749 -22.634 1.00 24.24 ? 647 TYR A CE1  1 
ATOM   1453 C  CE2  . TYR A 1 204 ? 7.693   -26.700 -23.138 1.00 27.36 ? 647 TYR A CE2  1 
ATOM   1454 C  CZ   . TYR A 1 204 ? 7.575   -28.073 -23.305 1.00 26.36 ? 647 TYR A CZ   1 
ATOM   1455 O  OH   . TYR A 1 204 ? 8.466   -28.718 -24.153 1.00 25.74 ? 647 TYR A OH   1 
ATOM   1456 N  N    . GLU A 1 205 ? 6.446   -23.424 -19.923 1.00 25.36 ? 648 GLU A N    1 
ATOM   1457 C  CA   . GLU A 1 205 ? 7.521   -22.458 -19.993 1.00 25.51 ? 648 GLU A CA   1 
ATOM   1458 C  C    . GLU A 1 205 ? 8.271   -22.358 -18.689 1.00 25.74 ? 648 GLU A C    1 
ATOM   1459 O  O    . GLU A 1 205 ? 9.488   -22.431 -18.687 1.00 25.68 ? 648 GLU A O    1 
ATOM   1460 C  CB   . GLU A 1 205 ? 6.974   -21.081 -20.317 1.00 25.49 ? 648 GLU A CB   1 
ATOM   1461 C  CG   . GLU A 1 205 ? 6.643   -20.880 -21.770 1.00 25.10 ? 648 GLU A CG   1 
ATOM   1462 C  CD   . GLU A 1 205 ? 6.479   -19.419 -22.056 1.00 25.61 ? 648 GLU A CD   1 
ATOM   1463 O  OE1  . GLU A 1 205 ? 7.520   -18.777 -22.381 1.00 22.17 ? 648 GLU A OE1  1 
ATOM   1464 O  OE2  . GLU A 1 205 ? 5.313   -18.931 -21.898 1.00 25.03 ? 648 GLU A OE2  1 
ATOM   1465 N  N    . LEU A 1 206 ? 7.548   -22.155 -17.588 1.00 25.95 ? 649 LEU A N    1 
ATOM   1466 C  CA   . LEU A 1 206 ? 8.195   -22.000 -16.283 1.00 26.25 ? 649 LEU A CA   1 
ATOM   1467 C  C    . LEU A 1 206 ? 8.974   -23.262 -15.921 1.00 26.42 ? 649 LEU A C    1 
ATOM   1468 O  O    . LEU A 1 206 ? 10.164  -23.195 -15.535 1.00 26.48 ? 649 LEU A O    1 
ATOM   1469 C  CB   . LEU A 1 206 ? 7.171   -21.703 -15.175 1.00 26.41 ? 649 LEU A CB   1 
ATOM   1470 C  CG   . LEU A 1 206 ? 6.677   -20.259 -15.030 1.00 25.73 ? 649 LEU A CG   1 
ATOM   1471 C  CD1  . LEU A 1 206 ? 5.292   -20.246 -14.392 1.00 25.65 ? 649 LEU A CD1  1 
ATOM   1472 C  CD2  . LEU A 1 206 ? 7.641   -19.420 -14.224 1.00 24.88 ? 649 LEU A CD2  1 
ATOM   1473 N  N    . MET A 1 207 ? 8.300   -24.407 -16.078 1.00 26.28 ? 650 MET A N    1 
ATOM   1474 C  CA   . MET A 1 207 ? 8.797   -25.688 -15.567 1.00 26.20 ? 650 MET A CA   1 
ATOM   1475 C  C    . MET A 1 207 ? 9.594   -26.481 -16.592 1.00 25.90 ? 650 MET A C    1 
ATOM   1476 O  O    . MET A 1 207 ? 9.959   -27.614 -16.329 1.00 25.38 ? 650 MET A O    1 
ATOM   1477 C  CB   . MET A 1 207 ? 7.639   -26.530 -15.041 1.00 26.21 ? 650 MET A CB   1 
ATOM   1478 C  CG   . MET A 1 207 ? 6.797   -25.795 -14.010 1.00 26.64 ? 650 MET A CG   1 
ATOM   1479 S  SD   . MET A 1 207 ? 7.540   -25.921 -12.421 1.00 27.06 ? 650 MET A SD   1 
ATOM   1480 C  CE   . MET A 1 207 ? 8.007   -24.220 -12.033 1.00 27.30 ? 650 MET A CE   1 
ATOM   1481 N  N    . THR A 1 208 ? 9.839   -25.880 -17.752 1.00 25.87 ? 651 THR A N    1 
ATOM   1482 C  CA   . THR A 1 208 ? 10.839  -26.368 -18.688 1.00 26.26 ? 651 THR A CA   1 
ATOM   1483 C  C    . THR A 1 208 ? 11.788  -25.251 -19.139 1.00 26.36 ? 651 THR A C    1 
ATOM   1484 O  O    . THR A 1 208 ? 12.770  -25.520 -19.831 1.00 26.91 ? 651 THR A O    1 
ATOM   1485 C  CB   . THR A 1 208 ? 10.197  -27.051 -19.934 1.00 26.35 ? 651 THR A CB   1 
ATOM   1486 O  OG1  . THR A 1 208 ? 9.654   -26.072 -20.841 1.00 27.11 ? 651 THR A OG1  1 
ATOM   1487 C  CG2  . THR A 1 208 ? 9.000   -27.907 -19.555 1.00 26.56 ? 651 THR A CG2  1 
ATOM   1488 N  N    . GLY A 1 209 ? 11.527  -24.012 -18.746 1.00 26.07 ? 652 GLY A N    1 
ATOM   1489 C  CA   . GLY A 1 209 ? 12.290  -22.893 -19.272 1.00 26.17 ? 652 GLY A CA   1 
ATOM   1490 C  C    . GLY A 1 209 ? 12.319  -22.826 -20.794 1.00 26.14 ? 652 GLY A C    1 
ATOM   1491 O  O    . GLY A 1 209 ? 13.343  -22.469 -21.375 1.00 26.54 ? 652 GLY A O    1 
ATOM   1492 N  N    . GLN A 1 210 ? 11.192  -23.119 -21.434 1.00 25.95 ? 653 GLN A N    1 
ATOM   1493 C  CA   . GLN A 1 210 ? 11.169  -23.329 -22.872 1.00 25.84 ? 653 GLN A CA   1 
ATOM   1494 C  C    . GLN A 1 210 ? 9.776   -23.167 -23.554 1.00 25.85 ? 653 GLN A C    1 
ATOM   1495 O  O    . GLN A 1 210 ? 8.737   -23.589 -23.021 1.00 25.20 ? 653 GLN A O    1 
ATOM   1496 C  CB   . GLN A 1 210 ? 11.699  -24.735 -23.121 1.00 25.93 ? 653 GLN A CB   1 
ATOM   1497 C  CG   . GLN A 1 210 ? 13.112  -24.802 -23.684 1.00 26.03 ? 653 GLN A CG   1 
ATOM   1498 C  CD   . GLN A 1 210 ? 13.237  -25.900 -24.700 1.00 26.03 ? 653 GLN A CD   1 
ATOM   1499 O  OE1  . GLN A 1 210 ? 13.106  -27.077 -24.346 1.00 28.37 ? 653 GLN A OE1  1 
ATOM   1500 N  NE2  . GLN A 1 210 ? 13.442  -25.537 -25.969 1.00 24.08 ? 653 GLN A NE2  1 
ATOM   1501 N  N    . LEU A 1 211 ? 9.756   -22.557 -24.738 1.00 25.70 ? 654 LEU A N    1 
ATOM   1502 C  CA   . LEU A 1 211 ? 8.530   -22.540 -25.540 1.00 25.56 ? 654 LEU A CA   1 
ATOM   1503 C  C    . LEU A 1 211 ? 8.350   -23.936 -26.120 1.00 25.91 ? 654 LEU A C    1 
ATOM   1504 O  O    . LEU A 1 211 ? 9.344   -24.532 -26.585 1.00 26.80 ? 654 LEU A O    1 
ATOM   1505 C  CB   . LEU A 1 211 ? 8.645   -21.552 -26.694 1.00 25.29 ? 654 LEU A CB   1 
ATOM   1506 C  CG   . LEU A 1 211 ? 8.830   -20.097 -26.310 1.00 24.43 ? 654 LEU A CG   1 
ATOM   1507 C  CD1  . LEU A 1 211 ? 9.210   -19.271 -27.542 1.00 23.32 ? 654 LEU A CD1  1 
ATOM   1508 C  CD2  . LEU A 1 211 ? 7.537   -19.593 -25.643 1.00 24.33 ? 654 LEU A CD2  1 
ATOM   1509 N  N    . PRO A 1 212 ? 7.125   -24.471 -26.108 1.00 25.58 ? 655 PRO A N    1 
ATOM   1510 C  CA   . PRO A 1 212 ? 6.857   -25.795 -26.682 1.00 25.29 ? 655 PRO A CA   1 
ATOM   1511 C  C    . PRO A 1 212 ? 6.749   -25.751 -28.198 1.00 25.19 ? 655 PRO A C    1 
ATOM   1512 O  O    . PRO A 1 212 ? 6.542   -24.664 -28.766 1.00 25.20 ? 655 PRO A O    1 
ATOM   1513 C  CB   . PRO A 1 212 ? 5.517   -26.170 -26.079 1.00 25.06 ? 655 PRO A CB   1 
ATOM   1514 C  CG   . PRO A 1 212 ? 4.878   -24.923 -25.851 1.00 25.71 ? 655 PRO A CG   1 
ATOM   1515 C  CD   . PRO A 1 212 ? 5.907   -23.871 -25.557 1.00 25.40 ? 655 PRO A CD   1 
ATOM   1516 N  N    . TYR A 1 213 ? 6.858   -26.936 -28.809 1.00 24.77 ? 656 TYR A N    1 
ATOM   1517 C  CA   . TYR A 1 213 ? 6.988   -27.142 -30.259 1.00 24.60 ? 656 TYR A CA   1 
ATOM   1518 C  C    . TYR A 1 213 ? 8.245   -26.485 -30.806 1.00 24.90 ? 656 TYR A C    1 
ATOM   1519 O  O    . TYR A 1 213 ? 8.329   -26.139 -31.982 1.00 24.54 ? 656 TYR A O    1 
ATOM   1520 C  CB   . TYR A 1 213 ? 5.717   -26.721 -31.015 1.00 24.50 ? 656 TYR A CB   1 
ATOM   1521 C  CG   . TYR A 1 213 ? 4.485   -26.966 -30.182 1.00 23.71 ? 656 TYR A CG   1 
ATOM   1522 C  CD1  . TYR A 1 213 ? 4.107   -28.247 -29.804 1.00 22.42 ? 656 TYR A CD1  1 
ATOM   1523 C  CD2  . TYR A 1 213 ? 3.763   -25.910 -29.703 1.00 23.43 ? 656 TYR A CD2  1 
ATOM   1524 C  CE1  . TYR A 1 213 ? 3.005   -28.452 -29.017 1.00 22.84 ? 656 TYR A CE1  1 
ATOM   1525 C  CE2  . TYR A 1 213 ? 2.668   -26.089 -28.931 1.00 23.75 ? 656 TYR A CE2  1 
ATOM   1526 C  CZ   . TYR A 1 213 ? 2.273   -27.355 -28.574 1.00 23.40 ? 656 TYR A CZ   1 
ATOM   1527 O  OH   . TYR A 1 213 ? 1.163   -27.470 -27.761 1.00 20.00 ? 656 TYR A OH   1 
ATOM   1528 N  N    . SER A 1 214 ? 9.240   -26.365 -29.936 1.00 25.45 ? 657 SER A N    1 
ATOM   1529 C  CA   . SER A 1 214 ? 10.409  -25.565 -30.224 1.00 25.92 ? 657 SER A CA   1 
ATOM   1530 C  C    . SER A 1 214 ? 11.100  -26.161 -31.432 1.00 26.44 ? 657 SER A C    1 
ATOM   1531 O  O    . SER A 1 214 ? 11.584  -25.428 -32.305 1.00 26.88 ? 657 SER A O    1 
ATOM   1532 C  CB   . SER A 1 214 ? 11.356  -25.461 -29.000 1.00 26.36 ? 657 SER A CB   1 
ATOM   1533 O  OG   . SER A 1 214 ? 11.036  -26.354 -27.918 1.00 26.12 ? 657 SER A OG   1 
ATOM   1534 N  N    . ASN A 1 215 ? 11.109  -27.493 -31.505 1.00 26.96 ? 658 ASN A N    1 
ATOM   1535 C  CA   . ASN A 1 215 ? 11.731  -28.203 -32.630 1.00 27.00 ? 658 ASN A CA   1 
ATOM   1536 C  C    . ASN A 1 215 ? 10.879  -28.194 -33.915 1.00 26.98 ? 658 ASN A C    1 
ATOM   1537 O  O    . ASN A 1 215 ? 11.442  -28.116 -35.018 1.00 27.64 ? 658 ASN A O    1 
ATOM   1538 C  CB   . ASN A 1 215 ? 12.069  -29.645 -32.237 1.00 27.07 ? 658 ASN A CB   1 
ATOM   1539 C  CG   . ASN A 1 215 ? 13.530  -29.994 -32.502 1.00 28.01 ? 658 ASN A CG   1 
ATOM   1540 O  OD1  . ASN A 1 215 ? 14.442  -29.298 -32.044 1.00 28.94 ? 658 ASN A OD1  1 
ATOM   1541 N  ND2  . ASN A 1 215 ? 13.759  -31.076 -33.248 1.00 28.43 ? 658 ASN A ND2  1 
ATOM   1542 N  N    . ILE A 1 216 ? 9.546   -28.303 -33.760 1.00 26.28 ? 659 ILE A N    1 
ATOM   1543 C  CA   . ILE A 1 216 ? 8.566   -28.176 -34.856 1.00 25.28 ? 659 ILE A CA   1 
ATOM   1544 C  C    . ILE A 1 216 ? 8.185   -26.716 -35.070 1.00 25.04 ? 659 ILE A C    1 
ATOM   1545 O  O    . ILE A 1 216 ? 7.207   -26.241 -34.483 1.00 24.77 ? 659 ILE A O    1 
ATOM   1546 C  CB   . ILE A 1 216 ? 7.290   -28.959 -34.521 1.00 24.95 ? 659 ILE A CB   1 
ATOM   1547 C  CG1  . ILE A 1 216 ? 7.618   -30.425 -34.323 1.00 24.91 ? 659 ILE A CG1  1 
ATOM   1548 C  CG2  . ILE A 1 216 ? 6.270   -28.811 -35.624 1.00 24.32 ? 659 ILE A CG2  1 
ATOM   1549 C  CD1  . ILE A 1 216 ? 6.735   -31.093 -33.342 1.00 25.46 ? 659 ILE A CD1  1 
ATOM   1550 N  N    . ASN A 1 217 ? 8.936   -26.010 -35.917 1.00 24.57 ? 660 ASN A N    1 
ATOM   1551 C  CA   . ASN A 1 217 ? 8.767   -24.552 -36.071 1.00 24.00 ? 660 ASN A CA   1 
ATOM   1552 C  C    . ASN A 1 217 ? 7.939   -24.204 -37.331 1.00 23.99 ? 660 ASN A C    1 
ATOM   1553 O  O    . ASN A 1 217 ? 8.476   -23.861 -38.397 1.00 23.68 ? 660 ASN A O    1 
ATOM   1554 C  CB   . ASN A 1 217 ? 10.137  -23.858 -36.041 1.00 23.31 ? 660 ASN A CB   1 
ATOM   1555 C  CG   . ASN A 1 217 ? 10.049  -22.364 -36.208 1.00 21.71 ? 660 ASN A CG   1 
ATOM   1556 O  OD1  . ASN A 1 217 ? 9.331   -21.681 -35.485 1.00 20.00 ? 660 ASN A OD1  1 
ATOM   1557 N  ND2  . ASN A 1 217 ? 10.807  -21.841 -37.155 1.00 20.00 ? 660 ASN A ND2  1 
ATOM   1558 N  N    . ASN A 1 218 ? 6.620   -24.292 -37.174 1.00 23.74 ? 661 ASN A N    1 
ATOM   1559 C  CA   . ASN A 1 218 ? 5.676   -24.168 -38.280 1.00 23.81 ? 661 ASN A CA   1 
ATOM   1560 C  C    . ASN A 1 218 ? 4.256   -23.864 -37.776 1.00 24.08 ? 661 ASN A C    1 
ATOM   1561 O  O    . ASN A 1 218 ? 3.610   -24.706 -37.121 1.00 23.25 ? 661 ASN A O    1 
ATOM   1562 C  CB   . ASN A 1 218 ? 5.699   -25.452 -39.089 1.00 23.72 ? 661 ASN A CB   1 
ATOM   1563 C  CG   . ASN A 1 218 ? 5.061   -25.293 -40.434 1.00 24.28 ? 661 ASN A CG   1 
ATOM   1564 O  OD1  . ASN A 1 218 ? 3.881   -24.978 -40.547 1.00 24.58 ? 661 ASN A OD1  1 
ATOM   1565 N  ND2  . ASN A 1 218 ? 5.844   -25.503 -41.476 1.00 24.88 ? 661 ASN A ND2  1 
ATOM   1566 N  N    . ARG A 1 219 ? 3.774   -22.650 -38.064 1.00 24.84 ? 662 ARG A N    1 
ATOM   1567 C  CA   . ARG A 1 219 ? 2.542   -22.160 -37.417 1.00 25.32 ? 662 ARG A CA   1 
ATOM   1568 C  C    . ARG A 1 219 ? 1.407   -23.023 -37.875 1.00 24.73 ? 662 ARG A C    1 
ATOM   1569 O  O    . ARG A 1 219 ? 0.653   -23.496 -37.059 1.00 24.96 ? 662 ARG A O    1 
ATOM   1570 C  CB   . ARG A 1 219 ? 2.191   -20.696 -37.747 1.00 25.77 ? 662 ARG A CB   1 
ATOM   1571 C  CG   . ARG A 1 219 ? 3.125   -19.631 -37.182 1.00 26.67 ? 662 ARG A CG   1 
ATOM   1572 C  CD   . ARG A 1 219 ? 2.642   -18.919 -35.957 1.00 27.23 ? 662 ARG A CD   1 
ATOM   1573 N  NE   . ARG A 1 219 ? 1.334   -18.302 -36.147 1.00 29.33 ? 662 ARG A NE   1 
ATOM   1574 C  CZ   . ARG A 1 219 ? 1.067   -17.000 -35.994 1.00 29.73 ? 662 ARG A CZ   1 
ATOM   1575 N  NH1  . ARG A 1 219 ? 2.024   -16.112 -35.666 1.00 30.16 ? 662 ARG A NH1  1 
ATOM   1576 N  NH2  . ARG A 1 219 ? -0.175  -16.578 -36.185 1.00 28.50 ? 662 ARG A NH2  1 
ATOM   1577 N  N    . ASP A 1 220 ? 1.301   -23.221 -39.184 1.00 24.27 ? 663 ASP A N    1 
ATOM   1578 C  CA   . ASP A 1 220 ? 0.225   -24.017 -39.765 1.00 24.21 ? 663 ASP A CA   1 
ATOM   1579 C  C    . ASP A 1 220 ? 0.213   -25.432 -39.183 1.00 23.83 ? 663 ASP A C    1 
ATOM   1580 O  O    . ASP A 1 220 ? -0.768  -25.821 -38.576 1.00 24.26 ? 663 ASP A O    1 
ATOM   1581 C  CB   . ASP A 1 220 ? 0.313   -24.027 -41.303 1.00 24.21 ? 663 ASP A CB   1 
ATOM   1582 C  CG   . ASP A 1 220 ? -0.194  -22.723 -41.930 1.00 24.32 ? 663 ASP A CG   1 
ATOM   1583 O  OD1  . ASP A 1 220 ? -0.416  -21.733 -41.175 1.00 22.64 ? 663 ASP A OD1  1 
ATOM   1584 O  OD2  . ASP A 1 220 ? -0.406  -22.603 -43.163 1.00 23.20 ? 663 ASP A OD2  1 
ATOM   1585 N  N    . GLN A 1 221 ? 1.292   -26.183 -39.347 1.00 23.54 ? 664 GLN A N    1 
ATOM   1586 C  CA   . GLN A 1 221 ? 1.488   -27.462 -38.641 1.00 23.71 ? 664 GLN A CA   1 
ATOM   1587 C  C    . GLN A 1 221 ? 0.870   -27.506 -37.212 1.00 24.26 ? 664 GLN A C    1 
ATOM   1588 O  O    . GLN A 1 221 ? 0.097   -28.421 -36.875 1.00 23.93 ? 664 GLN A O    1 
ATOM   1589 C  CB   . GLN A 1 221 ? 2.990   -27.754 -38.534 1.00 23.46 ? 664 GLN A CB   1 
ATOM   1590 C  CG   . GLN A 1 221 ? 3.453   -29.108 -39.009 1.00 23.29 ? 664 GLN A CG   1 
ATOM   1591 C  CD   . GLN A 1 221 ? 4.960   -29.154 -39.166 1.00 24.46 ? 664 GLN A CD   1 
ATOM   1592 O  OE1  . GLN A 1 221 ? 5.640   -29.817 -38.391 1.00 26.51 ? 664 GLN A OE1  1 
ATOM   1593 N  NE2  . GLN A 1 221 ? 5.490   -28.436 -40.153 1.00 24.34 ? 664 GLN A NE2  1 
ATOM   1594 N  N    . ILE A 1 222 ? 1.220   -26.518 -36.383 1.00 24.27 ? 665 ILE A N    1 
ATOM   1595 C  CA   . ILE A 1 222 ? 0.788   -26.492 -34.996 1.00 24.19 ? 665 ILE A CA   1 
ATOM   1596 C  C    . ILE A 1 222 ? -0.717  -26.185 -34.868 1.00 23.90 ? 665 ILE A C    1 
ATOM   1597 O  O    . ILE A 1 222 ? -1.403  -26.788 -34.056 1.00 23.38 ? 665 ILE A O    1 
ATOM   1598 C  CB   . ILE A 1 222 ? 1.664   -25.489 -34.172 1.00 24.51 ? 665 ILE A CB   1 
ATOM   1599 C  CG1  . ILE A 1 222 ? 3.139   -25.910 -34.174 1.00 23.88 ? 665 ILE A CG1  1 
ATOM   1600 C  CG2  . ILE A 1 222 ? 1.164   -25.390 -32.739 1.00 24.47 ? 665 ILE A CG2  1 
ATOM   1601 C  CD1  . ILE A 1 222 ? 4.062   -24.934 -33.452 1.00 22.97 ? 665 ILE A CD1  1 
ATOM   1602 N  N    . ILE A 1 223 ? -1.225  -25.261 -35.675 1.00 24.10 ? 666 ILE A N    1 
ATOM   1603 C  CA   . ILE A 1 223 ? -2.645  -24.861 -35.636 1.00 24.27 ? 666 ILE A CA   1 
ATOM   1604 C  C    . ILE A 1 223 ? -3.508  -26.066 -35.989 1.00 24.20 ? 666 ILE A C    1 
ATOM   1605 O  O    . ILE A 1 223 ? -4.529  -26.371 -35.344 1.00 23.38 ? 666 ILE A O    1 
ATOM   1606 C  CB   . ILE A 1 223 ? -2.918  -23.688 -36.655 1.00 24.12 ? 666 ILE A CB   1 
ATOM   1607 C  CG1  . ILE A 1 223 ? -2.355  -22.373 -36.153 1.00 23.69 ? 666 ILE A CG1  1 
ATOM   1608 C  CG2  . ILE A 1 223 ? -4.409  -23.473 -36.902 1.00 24.79 ? 666 ILE A CG2  1 
ATOM   1609 C  CD1  . ILE A 1 223 ? -2.206  -21.355 -37.228 1.00 23.81 ? 666 ILE A CD1  1 
ATOM   1610 N  N    . GLU A 1 224 ? -3.081  -26.737 -37.049 1.00 24.55 ? 667 GLU A N    1 
ATOM   1611 C  CA   . GLU A 1 224 ? -3.790  -27.908 -37.561 1.00 25.31 ? 667 GLU A CA   1 
ATOM   1612 C  C    . GLU A 1 224 ? -3.663  -29.129 -36.629 1.00 25.23 ? 667 GLU A C    1 
ATOM   1613 O  O    . GLU A 1 224 ? -4.663  -29.834 -36.430 1.00 25.43 ? 667 GLU A O    1 
ATOM   1614 C  CB   . GLU A 1 224 ? -3.342  -28.211 -39.005 1.00 25.34 ? 667 GLU A CB   1 
ATOM   1615 C  CG   . GLU A 1 224 ? -2.926  -29.636 -39.302 1.00 26.13 ? 667 GLU A CG   1 
ATOM   1616 C  CD   . GLU A 1 224 ? -3.614  -30.163 -40.530 1.00 28.33 ? 667 GLU A CD   1 
ATOM   1617 O  OE1  . GLU A 1 224 ? -3.249  -29.744 -41.656 1.00 29.58 ? 667 GLU A OE1  1 
ATOM   1618 O  OE2  . GLU A 1 224 ? -4.543  -30.983 -40.362 1.00 30.88 ? 667 GLU A OE2  1 
ATOM   1619 N  N    . MET A 1 225 ? -2.465  -29.335 -36.046 1.00 24.89 ? 668 MET A N    1 
ATOM   1620 C  CA   . MET A 1 225 ? -2.126  -30.551 -35.266 1.00 24.46 ? 668 MET A CA   1 
ATOM   1621 C  C    . MET A 1 225 ? -2.530  -30.530 -33.797 1.00 24.27 ? 668 MET A C    1 
ATOM   1622 O  O    . MET A 1 225 ? -2.730  -31.589 -33.216 1.00 23.95 ? 668 MET A O    1 
ATOM   1623 C  CB   . MET A 1 225 ? -0.623  -30.851 -35.336 1.00 24.19 ? 668 MET A CB   1 
ATOM   1624 C  CG   . MET A 1 225 ? -0.141  -31.213 -36.704 1.00 23.84 ? 668 MET A CG   1 
ATOM   1625 S  SD   . MET A 1 225 ? 1.440   -32.028 -36.720 1.00 22.10 ? 668 MET A SD   1 
ATOM   1626 C  CE   . MET A 1 225 ? 2.399   -30.923 -35.824 1.00 24.60 ? 668 MET A CE   1 
ATOM   1627 N  N    . VAL A 1 226 ? -2.601  -29.342 -33.194 1.00 24.31 ? 669 VAL A N    1 
ATOM   1628 C  CA   . VAL A 1 226 ? -3.036  -29.184 -31.800 1.00 24.35 ? 669 VAL A CA   1 
ATOM   1629 C  C    . VAL A 1 226 ? -4.564  -29.108 -31.675 1.00 24.22 ? 669 VAL A C    1 
ATOM   1630 O  O    . VAL A 1 226 ? -5.132  -29.565 -30.681 1.00 24.45 ? 669 VAL A O    1 
ATOM   1631 C  CB   . VAL A 1 226 ? -2.457  -27.930 -31.161 1.00 24.48 ? 669 VAL A CB   1 
ATOM   1632 C  CG1  . VAL A 1 226 ? -3.075  -27.706 -29.793 1.00 25.02 ? 669 VAL A CG1  1 
ATOM   1633 C  CG2  . VAL A 1 226 ? -0.955  -28.034 -31.046 1.00 24.44 ? 669 VAL A CG2  1 
ATOM   1634 N  N    . GLY A 1 227 ? -5.214  -28.525 -32.680 1.00 23.94 ? 670 GLY A N    1 
ATOM   1635 C  CA   . GLY A 1 227 ? -6.659  -28.439 -32.736 1.00 23.63 ? 670 GLY A CA   1 
ATOM   1636 C  C    . GLY A 1 227 ? -7.319  -29.753 -33.061 1.00 23.37 ? 670 GLY A C    1 
ATOM   1637 O  O    . GLY A 1 227 ? -8.462  -29.962 -32.681 1.00 23.42 ? 670 GLY A O    1 
ATOM   1638 N  N    . ARG A 1 228 ? -6.602  -30.615 -33.779 1.00 23.02 ? 671 ARG A N    1 
ATOM   1639 C  CA   . ARG A 1 228 ? -7.068  -31.954 -34.115 1.00 22.89 ? 671 ARG A CA   1 
ATOM   1640 C  C    . ARG A 1 228 ? -6.753  -32.963 -33.045 1.00 22.61 ? 671 ARG A C    1 
ATOM   1641 O  O    . ARG A 1 228 ? -7.137  -34.113 -33.190 1.00 22.32 ? 671 ARG A O    1 
ATOM   1642 C  CB   . ARG A 1 228 ? -6.483  -32.440 -35.450 1.00 23.05 ? 671 ARG A CB   1 
ATOM   1643 C  CG   . ARG A 1 228 ? -5.026  -32.891 -35.423 1.00 23.31 ? 671 ARG A CG   1 
ATOM   1644 C  CD   . ARG A 1 228 ? -4.409  -33.039 -36.826 1.00 23.89 ? 671 ARG A CD   1 
ATOM   1645 N  NE   . ARG A 1 228 ? -3.319  -34.019 -36.950 1.00 23.29 ? 671 ARG A NE   1 
ATOM   1646 C  CZ   . ARG A 1 228 ? -2.792  -34.402 -38.123 1.00 23.97 ? 671 ARG A CZ   1 
ATOM   1647 N  NH1  . ARG A 1 228 ? -3.242  -33.904 -39.275 1.00 22.97 ? 671 ARG A NH1  1 
ATOM   1648 N  NH2  . ARG A 1 228 ? -1.818  -35.304 -38.159 1.00 23.50 ? 671 ARG A NH2  1 
ATOM   1649 N  N    . GLY A 1 229 ? -6.043  -32.539 -31.995 1.00 22.77 ? 672 GLY A N    1 
ATOM   1650 C  CA   . GLY A 1 229 ? -5.820  -33.343 -30.791 1.00 22.91 ? 672 GLY A CA   1 
ATOM   1651 C  C    . GLY A 1 229 ? -4.641  -34.312 -30.826 1.00 22.85 ? 672 GLY A C    1 
ATOM   1652 O  O    . GLY A 1 229 ? -4.669  -35.373 -30.200 1.00 22.40 ? 672 GLY A O    1 
ATOM   1653 N  N    . SER A 1 230 ? -3.600  -33.940 -31.559 1.00 22.83 ? 673 SER A N    1 
ATOM   1654 C  CA   . SER A 1 230 ? -2.563  -34.892 -31.918 1.00 22.87 ? 673 SER A CA   1 
ATOM   1655 C  C    . SER A 1 230 ? -1.136  -34.421 -31.679 1.00 22.82 ? 673 SER A C    1 
ATOM   1656 O  O    . SER A 1 230 ? -0.181  -35.185 -31.905 1.00 22.58 ? 673 SER A O    1 
ATOM   1657 C  CB   . SER A 1 230 ? -2.782  -35.389 -33.360 1.00 22.78 ? 673 SER A CB   1 
ATOM   1658 O  OG   . SER A 1 230 ? -2.388  -34.479 -34.349 1.00 22.31 ? 673 SER A OG   1 
ATOM   1659 N  N    . LEU A 1 231 ? -1.018  -33.181 -31.204 1.00 22.84 ? 674 LEU A N    1 
ATOM   1660 C  CA   . LEU A 1 231 ? 0.227   -32.599 -30.733 1.00 22.74 ? 674 LEU A CA   1 
ATOM   1661 C  C    . LEU A 1 231 ? -0.058  -31.889 -29.431 1.00 22.57 ? 674 LEU A C    1 
ATOM   1662 O  O    . LEU A 1 231 ? -0.971  -31.072 -29.330 1.00 22.50 ? 674 LEU A O    1 
ATOM   1663 C  CB   . LEU A 1 231 ? 0.755   -31.592 -31.744 1.00 22.89 ? 674 LEU A CB   1 
ATOM   1664 C  CG   . LEU A 1 231 ? 2.266   -31.364 -31.977 1.00 23.62 ? 674 LEU A CG   1 
ATOM   1665 C  CD1  . LEU A 1 231 ? 2.454   -29.878 -32.233 1.00 24.91 ? 674 LEU A CD1  1 
ATOM   1666 C  CD2  . LEU A 1 231 ? 3.217   -31.824 -30.891 1.00 22.78 ? 674 LEU A CD2  1 
ATOM   1667 N  N    . SER A 1 232 ? 0.699   -32.226 -28.416 1.00 22.47 ? 675 SER A N    1 
ATOM   1668 C  CA   . SER A 1 232 ? 0.545   -31.559 -27.145 1.00 22.88 ? 675 SER A CA   1 
ATOM   1669 C  C    . SER A 1 232 ? 1.910   -31.460 -26.554 1.00 23.27 ? 675 SER A C    1 
ATOM   1670 O  O    . SER A 1 232 ? 2.814   -32.163 -26.997 1.00 23.63 ? 675 SER A O    1 
ATOM   1671 C  CB   . SER A 1 232 ? -0.427  -32.317 -26.224 1.00 22.76 ? 675 SER A CB   1 
ATOM   1672 O  OG   . SER A 1 232 ? -0.063  -33.668 -26.051 1.00 21.95 ? 675 SER A OG   1 
ATOM   1673 N  N    . PRO A 1 233 ? 2.107   -30.574 -25.586 1.00 23.61 ? 676 PRO A N    1 
ATOM   1674 C  CA   . PRO A 1 233 ? 3.482   -30.314 -25.149 1.00 23.77 ? 676 PRO A CA   1 
ATOM   1675 C  C    . PRO A 1 233 ? 4.211   -31.568 -24.663 1.00 23.87 ? 676 PRO A C    1 
ATOM   1676 O  O    . PRO A 1 233 ? 3.621   -32.502 -24.107 1.00 23.46 ? 676 PRO A O    1 
ATOM   1677 C  CB   . PRO A 1 233 ? 3.318   -29.232 -24.080 1.00 23.62 ? 676 PRO A CB   1 
ATOM   1678 C  CG   . PRO A 1 233 ? 2.008   -28.574 -24.458 1.00 23.72 ? 676 PRO A CG   1 
ATOM   1679 C  CD   . PRO A 1 233 ? 1.131   -29.721 -24.881 1.00 23.12 ? 676 PRO A CD   1 
ATOM   1680 N  N    . ASP A 1 234 ? 5.506   -31.567 -24.951 1.00 24.38 ? 677 ASP A N    1 
ATOM   1681 C  CA   . ASP A 1 234 ? 6.445   -32.617 -24.582 1.00 24.84 ? 677 ASP A CA   1 
ATOM   1682 C  C    . ASP A 1 234 ? 6.957   -32.339 -23.178 1.00 25.04 ? 677 ASP A C    1 
ATOM   1683 O  O    . ASP A 1 234 ? 7.752   -31.422 -22.977 1.00 25.15 ? 677 ASP A O    1 
ATOM   1684 C  CB   . ASP A 1 234 ? 7.615   -32.603 -25.589 1.00 24.97 ? 677 ASP A CB   1 
ATOM   1685 C  CG   . ASP A 1 234 ? 8.626   -33.716 -25.370 1.00 25.26 ? 677 ASP A CG   1 
ATOM   1686 O  OD1  . ASP A 1 234 ? 8.547   -34.467 -24.367 1.00 25.40 ? 677 ASP A OD1  1 
ATOM   1687 O  OD2  . ASP A 1 234 ? 9.553   -33.910 -26.189 1.00 25.92 ? 677 ASP A OD2  1 
ATOM   1688 N  N    . LEU A 1 235 ? 6.543   -33.176 -22.226 1.00 25.19 ? 678 LEU A N    1 
ATOM   1689 C  CA   . LEU A 1 235 ? 6.839   -32.979 -20.799 1.00 25.08 ? 678 LEU A CA   1 
ATOM   1690 C  C    . LEU A 1 235 ? 8.134   -33.652 -20.317 1.00 24.88 ? 678 LEU A C    1 
ATOM   1691 O  O    . LEU A 1 235 ? 8.389   -33.716 -19.118 1.00 24.73 ? 678 LEU A O    1 
ATOM   1692 C  CB   . LEU A 1 235 ? 5.653   -33.486 -19.965 1.00 25.06 ? 678 LEU A CB   1 
ATOM   1693 C  CG   . LEU A 1 235 ? 4.313   -33.152 -20.622 1.00 24.86 ? 678 LEU A CG   1 
ATOM   1694 C  CD1  . LEU A 1 235 ? 3.132   -33.571 -19.775 1.00 25.12 ? 678 LEU A CD1  1 
ATOM   1695 C  CD2  . LEU A 1 235 ? 4.265   -31.683 -20.904 1.00 24.79 ? 678 LEU A CD2  1 
ATOM   1696 N  N    . SER A 1 236 ? 8.936   -34.164 -21.243 1.00 24.93 ? 679 SER A N    1 
ATOM   1697 C  CA   . SER A 1 236 ? 10.220  -34.790 -20.902 1.00 25.16 ? 679 SER A CA   1 
ATOM   1698 C  C    . SER A 1 236 ? 11.338  -33.736 -20.845 1.00 25.47 ? 679 SER A C    1 
ATOM   1699 O  O    . SER A 1 236 ? 12.450  -34.009 -20.368 1.00 24.92 ? 679 SER A O    1 
ATOM   1700 C  CB   . SER A 1 236 ? 10.573  -35.855 -21.929 1.00 24.94 ? 679 SER A CB   1 
ATOM   1701 O  OG   . SER A 1 236 ? 11.129  -35.250 -23.071 1.00 24.52 ? 679 SER A OG   1 
ATOM   1702 N  N    . LYS A 1 237 ? 11.003  -32.527 -21.324 1.00 25.86 ? 680 LYS A N    1 
ATOM   1703 C  CA   . LYS A 1 237 ? 11.915  -31.384 -21.373 1.00 25.46 ? 680 LYS A CA   1 
ATOM   1704 C  C    . LYS A 1 237 ? 11.806  -30.506 -20.129 1.00 25.57 ? 680 LYS A C    1 
ATOM   1705 O  O    . LYS A 1 237 ? 12.504  -29.491 -20.024 1.00 25.89 ? 680 LYS A O    1 
ATOM   1706 C  CB   . LYS A 1 237 ? 11.646  -30.561 -22.636 1.00 25.40 ? 680 LYS A CB   1 
ATOM   1707 C  CG   . LYS A 1 237 ? 12.120  -31.239 -23.940 1.00 25.53 ? 680 LYS A CG   1 
ATOM   1708 C  CD   . LYS A 1 237 ? 11.302  -30.783 -25.161 1.00 25.70 ? 680 LYS A CD   1 
ATOM   1709 C  CE   . LYS A 1 237 ? 12.152  -30.669 -26.440 1.00 25.56 ? 680 LYS A CE   1 
ATOM   1710 N  NZ   . LYS A 1 237 ? 12.577  -29.254 -26.699 1.00 24.97 ? 680 LYS A NZ   1 
ATOM   1711 N  N    . VAL A 1 238 ? 10.936  -30.885 -19.188 1.00 25.57 ? 681 VAL A N    1 
ATOM   1712 C  CA   . VAL A 1 238 ? 10.932  -30.270 -17.862 1.00 25.40 ? 681 VAL A CA   1 
ATOM   1713 C  C    . VAL A 1 238 ? 12.276  -30.598 -17.180 1.00 25.84 ? 681 VAL A C    1 
ATOM   1714 O  O    . VAL A 1 238 ? 12.763  -31.753 -17.229 1.00 26.06 ? 681 VAL A O    1 
ATOM   1715 C  CB   . VAL A 1 238 ? 9.744   -30.732 -16.950 1.00 25.17 ? 681 VAL A CB   1 
ATOM   1716 C  CG1  . VAL A 1 238 ? 8.422   -30.700 -17.679 1.00 25.25 ? 681 VAL A CG1  1 
ATOM   1717 C  CG2  . VAL A 1 238 ? 9.975   -32.113 -16.366 1.00 25.60 ? 681 VAL A CG2  1 
ATOM   1718 N  N    . ARG A 1 239 ? 12.883  -29.580 -16.573 1.00 25.62 ? 682 ARG A N    1 
ATOM   1719 C  CA   . ARG A 1 239 ? 14.117  -29.755 -15.832 1.00 25.45 ? 682 ARG A CA   1 
ATOM   1720 C  C    . ARG A 1 239 ? 13.904  -30.848 -14.794 1.00 25.52 ? 682 ARG A C    1 
ATOM   1721 O  O    . ARG A 1 239 ? 12.915  -30.840 -14.060 1.00 25.19 ? 682 ARG A O    1 
ATOM   1722 C  CB   . ARG A 1 239 ? 14.495  -28.460 -15.123 1.00 25.43 ? 682 ARG A CB   1 
ATOM   1723 C  CG   . ARG A 1 239 ? 14.805  -27.279 -16.035 1.00 25.20 ? 682 ARG A CG   1 
ATOM   1724 C  CD   . ARG A 1 239 ? 14.294  -25.964 -15.469 1.00 25.64 ? 682 ARG A CD   1 
ATOM   1725 N  NE   . ARG A 1 239 ? 15.284  -24.879 -15.410 1.00 25.69 ? 682 ARG A NE   1 
ATOM   1726 C  CZ   . ARG A 1 239 ? 16.402  -24.857 -14.676 1.00 24.55 ? 682 ARG A CZ   1 
ATOM   1727 N  NH1  . ARG A 1 239 ? 16.765  -25.893 -13.926 1.00 25.04 ? 682 ARG A NH1  1 
ATOM   1728 N  NH2  . ARG A 1 239 ? 17.179  -23.784 -14.717 1.00 24.02 ? 682 ARG A NH2  1 
ATOM   1729 N  N    . SER A 1 240 ? 14.840  -31.783 -14.731 1.00 25.82 ? 683 SER A N    1 
ATOM   1730 C  CA   . SER A 1 240 ? 14.729  -32.946 -13.847 1.00 26.03 ? 683 SER A CA   1 
ATOM   1731 C  C    . SER A 1 240 ? 14.373  -32.636 -12.377 1.00 26.03 ? 683 SER A C    1 
ATOM   1732 O  O    . SER A 1 240 ? 14.043  -33.557 -11.626 1.00 25.67 ? 683 SER A O    1 
ATOM   1733 C  CB   . SER A 1 240 ? 16.042  -33.720 -13.875 1.00 26.07 ? 683 SER A CB   1 
ATOM   1734 O  OG   . SER A 1 240 ? 17.084  -32.886 -13.391 1.00 26.56 ? 683 SER A OG   1 
ATOM   1735 N  N    . ASN A 1 241 ? 14.454  -31.362 -11.972 1.00 26.13 ? 684 ASN A N    1 
ATOM   1736 C  CA   . ASN A 1 241 ? 14.195  -30.962 -10.578 1.00 26.15 ? 684 ASN A CA   1 
ATOM   1737 C  C    . ASN A 1 241 ? 12.866  -30.214 -10.286 1.00 26.00 ? 684 ASN A C    1 
ATOM   1738 O  O    . ASN A 1 241 ? 12.690  -29.681 -9.201  1.00 26.23 ? 684 ASN A O    1 
ATOM   1739 C  CB   . ASN A 1 241 ? 15.422  -30.215 -10.001 1.00 26.13 ? 684 ASN A CB   1 
ATOM   1740 C  CG   . ASN A 1 241 ? 15.668  -28.846 -10.644 1.00 27.01 ? 684 ASN A CG   1 
ATOM   1741 O  OD1  . ASN A 1 241 ? 15.273  -28.595 -11.776 1.00 27.98 ? 684 ASN A OD1  1 
ATOM   1742 N  ND2  . ASN A 1 241 ? 16.347  -27.955 -9.907  1.00 27.89 ? 684 ASN A ND2  1 
ATOM   1743 N  N    . CYS A 1 242 ? 11.932  -30.200 -11.235 1.00 26.14 ? 685 CYS A N    1 
ATOM   1744 C  CA   . CYS A 1 242 ? 10.545  -29.764 -10.981 1.00 25.98 ? 685 CYS A CA   1 
ATOM   1745 C  C    . CYS A 1 242 ? 9.907   -30.744 -9.996  1.00 25.88 ? 685 CYS A C    1 
ATOM   1746 O  O    . CYS A 1 242 ? 10.147  -31.938 -10.112 1.00 26.54 ? 685 CYS A O    1 
ATOM   1747 C  CB   . CYS A 1 242 ? 9.744   -29.752 -12.308 1.00 26.08 ? 685 CYS A CB   1 
ATOM   1748 S  SG   . CYS A 1 242 ? 7.952   -29.359 -12.271 1.00 25.15 ? 685 CYS A SG   1 
ATOM   1749 N  N    . PRO A 1 243 ? 9.122   -30.274 -9.027  1.00 25.74 ? 686 PRO A N    1 
ATOM   1750 C  CA   . PRO A 1 243 ? 8.321   -31.187 -8.196  1.00 25.81 ? 686 PRO A CA   1 
ATOM   1751 C  C    . PRO A 1 243 ? 7.350   -32.025 -9.040  1.00 25.78 ? 686 PRO A C    1 
ATOM   1752 O  O    . PRO A 1 243 ? 6.980   -31.591 -10.115 1.00 25.85 ? 686 PRO A O    1 
ATOM   1753 C  CB   . PRO A 1 243 ? 7.536   -30.251 -7.256  1.00 25.79 ? 686 PRO A CB   1 
ATOM   1754 C  CG   . PRO A 1 243 ? 7.812   -28.854 -7.686  1.00 25.52 ? 686 PRO A CG   1 
ATOM   1755 C  CD   . PRO A 1 243 ? 8.951   -28.865 -8.633  1.00 25.88 ? 686 PRO A CD   1 
ATOM   1756 N  N    . LYS A 1 244 ? 6.954   -33.203 -8.570  1.00 25.85 ? 687 LYS A N    1 
ATOM   1757 C  CA   . LYS A 1 244 ? 5.997   -34.031 -9.315  1.00 26.07 ? 687 LYS A CA   1 
ATOM   1758 C  C    . LYS A 1 244 ? 4.537   -33.595 -9.055  1.00 26.12 ? 687 LYS A C    1 
ATOM   1759 O  O    . LYS A 1 244 ? 3.598   -34.064 -9.732  1.00 25.97 ? 687 LYS A O    1 
ATOM   1760 C  CB   . LYS A 1 244 ? 6.186   -35.532 -8.998  1.00 26.15 ? 687 LYS A CB   1 
ATOM   1761 C  CG   . LYS A 1 244 ? 7.064   -36.301 -10.012 1.00 26.13 ? 687 LYS A CG   1 
ATOM   1762 C  CD   . LYS A 1 244 ? 6.408   -36.449 -11.410 1.00 25.23 ? 687 LYS A CD   1 
ATOM   1763 C  CE   . LYS A 1 244 ? 7.453   -36.694 -12.481 1.00 24.81 ? 687 LYS A CE   1 
ATOM   1764 N  NZ   . LYS A 1 244 ? 8.454   -35.599 -12.527 1.00 24.91 ? 687 LYS A NZ   1 
ATOM   1765 N  N    . ARG A 1 245 ? 4.355   -32.713 -8.070  1.00 25.89 ? 688 ARG A N    1 
ATOM   1766 C  CA   . ARG A 1 245 ? 3.058   -32.108 -7.820  1.00 25.74 ? 688 ARG A CA   1 
ATOM   1767 C  C    . ARG A 1 245 ? 2.804   -31.076 -8.898  1.00 25.69 ? 688 ARG A C    1 
ATOM   1768 O  O    . ARG A 1 245 ? 1.690   -30.945 -9.392  1.00 25.87 ? 688 ARG A O    1 
ATOM   1769 C  CB   . ARG A 1 245 ? 3.042   -31.452 -6.441  1.00 25.61 ? 688 ARG A CB   1 
ATOM   1770 C  CG   . ARG A 1 245 ? 3.109   -32.460 -5.310  1.00 25.78 ? 688 ARG A CG   1 
ATOM   1771 C  CD   . ARG A 1 245 ? 1.801   -32.639 -4.534  1.00 26.43 ? 688 ARG A CD   1 
ATOM   1772 N  NE   . ARG A 1 245 ? 1.861   -31.932 -3.253  1.00 27.35 ? 688 ARG A NE   1 
ATOM   1773 C  CZ   . ARG A 1 245 ? 0.854   -31.274 -2.677  1.00 27.80 ? 688 ARG A CZ   1 
ATOM   1774 N  NH1  . ARG A 1 245 ? -0.354  -31.214 -3.237  1.00 27.68 ? 688 ARG A NH1  1 
ATOM   1775 N  NH2  . ARG A 1 245 ? 1.061   -30.671 -1.509  1.00 28.70 ? 688 ARG A NH2  1 
ATOM   1776 N  N    . MET A 1 246 ? 3.868   -30.369 -9.265  1.00 25.65 ? 689 MET A N    1 
ATOM   1777 C  CA   . MET A 1 246 ? 3.800   -29.215 -10.150 1.00 26.02 ? 689 MET A CA   1 
ATOM   1778 C  C    . MET A 1 246 ? 3.690   -29.680 -11.591 1.00 26.00 ? 689 MET A C    1 
ATOM   1779 O  O    . MET A 1 246 ? 3.069   -29.020 -12.440 1.00 25.54 ? 689 MET A O    1 
ATOM   1780 C  CB   . MET A 1 246 ? 5.052   -28.345 -9.926  1.00 26.22 ? 689 MET A CB   1 
ATOM   1781 C  CG   . MET A 1 246 ? 5.190   -27.079 -10.768 1.00 26.50 ? 689 MET A CG   1 
ATOM   1782 S  SD   . MET A 1 246 ? 3.698   -26.171 -11.150 1.00 27.46 ? 689 MET A SD   1 
ATOM   1783 C  CE   . MET A 1 246 ? 4.207   -24.451 -10.812 1.00 27.07 ? 689 MET A CE   1 
ATOM   1784 N  N    . LYS A 1 247 ? 4.277   -30.849 -11.834 1.00 26.06 ? 690 LYS A N    1 
ATOM   1785 C  CA   . LYS A 1 247 ? 4.244   -31.510 -13.134 1.00 26.15 ? 690 LYS A CA   1 
ATOM   1786 C  C    . LYS A 1 247 ? 2.858   -32.109 -13.454 1.00 26.25 ? 690 LYS A C    1 
ATOM   1787 O  O    . LYS A 1 247 ? 2.430   -32.129 -14.621 1.00 26.53 ? 690 LYS A O    1 
ATOM   1788 C  CB   . LYS A 1 247 ? 5.330   -32.595 -13.190 1.00 25.89 ? 690 LYS A CB   1 
ATOM   1789 C  CG   . LYS A 1 247 ? 6.203   -32.516 -14.444 1.00 26.52 ? 690 LYS A CG   1 
ATOM   1790 C  CD   . LYS A 1 247 ? 6.550   -33.891 -15.032 1.00 26.79 ? 690 LYS A CD   1 
ATOM   1791 C  CE   . LYS A 1 247 ? 5.309   -34.726 -15.357 1.00 27.13 ? 690 LYS A CE   1 
ATOM   1792 N  NZ   . LYS A 1 247 ? 5.005   -35.739 -14.273 1.00 27.91 ? 690 LYS A NZ   1 
ATOM   1793 N  N    . ARG A 1 248 ? 2.165   -32.592 -12.419 1.00 26.07 ? 691 ARG A N    1 
ATOM   1794 C  CA   . ARG A 1 248 ? 0.856   -33.217 -12.589 1.00 25.87 ? 691 ARG A CA   1 
ATOM   1795 C  C    . ARG A 1 248 ? -0.173  -32.121 -12.673 1.00 26.01 ? 691 ARG A C    1 
ATOM   1796 O  O    . ARG A 1 248 ? -1.097  -32.193 -13.474 1.00 26.27 ? 691 ARG A O    1 
ATOM   1797 C  CB   . ARG A 1 248 ? 0.548   -34.220 -11.465 1.00 25.52 ? 691 ARG A CB   1 
ATOM   1798 C  CG   . ARG A 1 248 ? 1.128   -35.617 -11.771 1.00 25.46 ? 691 ARG A CG   1 
ATOM   1799 C  CD   . ARG A 1 248 ? 0.746   -36.710 -10.800 1.00 25.66 ? 691 ARG A CD   1 
ATOM   1800 N  NE   . ARG A 1 248 ? 1.022   -36.302 -9.428  1.00 25.91 ? 691 ARG A NE   1 
ATOM   1801 C  CZ   . ARG A 1 248 ? 0.928   -37.093 -8.370  1.00 26.73 ? 691 ARG A CZ   1 
ATOM   1802 N  NH1  . ARG A 1 248 ? 0.562   -38.369 -8.493  1.00 26.22 ? 691 ARG A NH1  1 
ATOM   1803 N  NH2  . ARG A 1 248 ? 1.215   -36.603 -7.166  1.00 27.70 ? 691 ARG A NH2  1 
ATOM   1804 N  N    . LEU A 1 249 ? 0.010   -31.087 -11.857 1.00 26.22 ? 692 LEU A N    1 
ATOM   1805 C  CA   . LEU A 1 249 ? -0.779  -29.863 -11.980 1.00 26.05 ? 692 LEU A CA   1 
ATOM   1806 C  C    . LEU A 1 249 ? -0.761  -29.348 -13.440 1.00 25.91 ? 692 LEU A C    1 
ATOM   1807 O  O    . LEU A 1 249 ? -1.806  -29.035 -14.017 1.00 25.32 ? 692 LEU A O    1 
ATOM   1808 C  CB   . LEU A 1 249 ? -0.253  -28.784 -11.023 1.00 25.74 ? 692 LEU A CB   1 
ATOM   1809 C  CG   . LEU A 1 249 ? -0.991  -27.437 -11.151 1.00 25.59 ? 692 LEU A CG   1 
ATOM   1810 C  CD1  . LEU A 1 249 ? -2.403  -27.448 -10.533 1.00 24.63 ? 692 LEU A CD1  1 
ATOM   1811 C  CD2  . LEU A 1 249 ? -0.144  -26.324 -10.568 1.00 25.79 ? 692 LEU A CD2  1 
ATOM   1812 N  N    . MET A 1 250 ? 0.432   -29.264 -14.018 1.00 25.76 ? 693 MET A N    1 
ATOM   1813 C  CA   . MET A 1 250 ? 0.569   -28.810 -15.379 1.00 25.74 ? 693 MET A CA   1 
ATOM   1814 C  C    . MET A 1 250 ? -0.380  -29.639 -16.242 1.00 25.87 ? 693 MET A C    1 
ATOM   1815 O  O    . MET A 1 250 ? -1.370  -29.114 -16.750 1.00 25.78 ? 693 MET A O    1 
ATOM   1816 C  CB   . MET A 1 250 ? 2.021   -28.953 -15.828 1.00 25.86 ? 693 MET A CB   1 
ATOM   1817 C  CG   . MET A 1 250 ? 2.341   -28.342 -17.183 1.00 26.49 ? 693 MET A CG   1 
ATOM   1818 S  SD   . MET A 1 250 ? 4.121   -28.450 -17.625 1.00 27.70 ? 693 MET A SD   1 
ATOM   1819 C  CE   . MET A 1 250 ? 4.368   -30.361 -17.585 1.00 27.75 ? 693 MET A CE   1 
ATOM   1820 N  N    . ALA A 1 251 ? -0.134  -30.947 -16.335 1.00 25.85 ? 694 ALA A N    1 
ATOM   1821 C  CA   . ALA A 1 251 ? -0.784  -31.783 -17.353 1.00 25.79 ? 694 ALA A CA   1 
ATOM   1822 C  C    . ALA A 1 251 ? -2.315  -31.842 -17.227 1.00 25.89 ? 694 ALA A C    1 
ATOM   1823 O  O    . ALA A 1 251 ? -3.022  -32.278 -18.158 1.00 25.86 ? 694 ALA A O    1 
ATOM   1824 C  CB   . ALA A 1 251 ? -0.171  -33.185 -17.363 1.00 25.70 ? 694 ALA A CB   1 
ATOM   1825 N  N    . GLU A 1 252 ? -2.816  -31.395 -16.078 1.00 26.16 ? 695 GLU A N    1 
ATOM   1826 C  CA   . GLU A 1 252 ? -4.254  -31.261 -15.841 1.00 26.36 ? 695 GLU A CA   1 
ATOM   1827 C  C    . GLU A 1 252 ? -4.741  -30.069 -16.641 1.00 26.43 ? 695 GLU A C    1 
ATOM   1828 O  O    . GLU A 1 252 ? -5.742  -30.151 -17.369 1.00 27.05 ? 695 GLU A O    1 
ATOM   1829 C  CB   . GLU A 1 252 ? -4.552  -31.047 -14.347 1.00 26.34 ? 695 GLU A CB   1 
ATOM   1830 C  CG   . GLU A 1 252 ? -4.015  -32.146 -13.441 1.00 26.48 ? 695 GLU A CG   1 
ATOM   1831 C  CD   . GLU A 1 252 ? -4.782  -33.439 -13.594 1.00 28.43 ? 695 GLU A CD   1 
ATOM   1832 O  OE1  . GLU A 1 252 ? -4.320  -34.317 -14.368 1.00 30.36 ? 695 GLU A OE1  1 
ATOM   1833 O  OE2  . GLU A 1 252 ? -5.857  -33.567 -12.954 1.00 28.68 ? 695 GLU A OE2  1 
ATOM   1834 N  N    . CYS A 1 253 ? -4.015  -28.965 -16.511 1.00 26.01 ? 696 CYS A N    1 
ATOM   1835 C  CA   . CYS A 1 253 ? -4.379  -27.735 -17.186 1.00 26.06 ? 696 CYS A CA   1 
ATOM   1836 C  C    . CYS A 1 253 ? -4.290  -27.851 -18.709 1.00 26.23 ? 696 CYS A C    1 
ATOM   1837 O  O    . CYS A 1 253 ? -5.135  -27.299 -19.420 1.00 26.27 ? 696 CYS A O    1 
ATOM   1838 C  CB   . CYS A 1 253 ? -3.556  -26.559 -16.643 1.00 26.03 ? 696 CYS A CB   1 
ATOM   1839 S  SG   . CYS A 1 253 ? -4.062  -26.089 -14.962 1.00 25.61 ? 696 CYS A SG   1 
ATOM   1840 N  N    . LEU A 1 254 ? -3.315  -28.621 -19.199 1.00 26.14 ? 697 LEU A N    1 
ATOM   1841 C  CA   . LEU A 1 254 ? -3.074  -28.777 -20.638 1.00 25.54 ? 697 LEU A CA   1 
ATOM   1842 C  C    . LEU A 1 254 ? -4.030  -29.777 -21.272 1.00 25.13 ? 697 LEU A C    1 
ATOM   1843 O  O    . LEU A 1 254 ? -3.780  -30.268 -22.364 1.00 24.45 ? 697 LEU A O    1 
ATOM   1844 C  CB   . LEU A 1 254 ? -1.624  -29.228 -20.883 1.00 25.61 ? 697 LEU A CB   1 
ATOM   1845 C  CG   . LEU A 1 254 ? -0.475  -28.400 -20.284 1.00 24.83 ? 697 LEU A CG   1 
ATOM   1846 C  CD1  . LEU A 1 254 ? 0.895   -29.014 -20.624 1.00 22.86 ? 697 LEU A CD1  1 
ATOM   1847 C  CD2  . LEU A 1 254 ? -0.585  -26.986 -20.802 1.00 24.55 ? 697 LEU A CD2  1 
ATOM   1848 N  N    . LYS A 1 255 ? -5.136  -30.068 -20.603 1.00 25.39 ? 698 LYS A N    1 
ATOM   1849 C  CA   . LYS A 1 255 ? -6.042  -31.108 -21.086 1.00 25.81 ? 698 LYS A CA   1 
ATOM   1850 C  C    . LYS A 1 255 ? -6.792  -30.632 -22.321 1.00 25.71 ? 698 LYS A C    1 
ATOM   1851 O  O    . LYS A 1 255 ? -7.275  -29.529 -22.366 1.00 25.41 ? 698 LYS A O    1 
ATOM   1852 C  CB   . LYS A 1 255 ? -7.022  -31.543 -19.991 1.00 25.87 ? 698 LYS A CB   1 
ATOM   1853 C  CG   . LYS A 1 255 ? -6.544  -32.734 -19.177 1.00 25.83 ? 698 LYS A CG   1 
ATOM   1854 C  CD   . LYS A 1 255 ? -7.399  -33.975 -19.448 1.00 25.70 ? 698 LYS A CD   1 
ATOM   1855 C  CE   . LYS A 1 255 ? -6.953  -35.150 -18.597 1.00 25.73 ? 698 LYS A CE   1 
ATOM   1856 N  NZ   . LYS A 1 255 ? -6.241  -34.699 -17.358 1.00 26.54 ? 698 LYS A NZ   1 
ATOM   1857 N  N    . LYS A 1 256 ? -6.870  -31.490 -23.321 1.00 26.04 ? 699 LYS A N    1 
ATOM   1858 C  CA   . LYS A 1 256 ? -7.359  -31.107 -24.633 1.00 26.39 ? 699 LYS A CA   1 
ATOM   1859 C  C    . LYS A 1 256 ? -8.868  -30.998 -24.577 1.00 26.68 ? 699 LYS A C    1 
ATOM   1860 O  O    . LYS A 1 256 ? -9.450  -30.120 -25.203 1.00 27.24 ? 699 LYS A O    1 
ATOM   1861 C  CB   . LYS A 1 256 ? -6.941  -32.157 -25.679 1.00 26.85 ? 699 LYS A CB   1 
ATOM   1862 C  CG   . LYS A 1 256 ? -5.400  -32.393 -25.810 1.00 26.82 ? 699 LYS A CG   1 
ATOM   1863 C  CD   . LYS A 1 256 ? -5.063  -33.450 -26.875 1.00 25.72 ? 699 LYS A CD   1 
ATOM   1864 C  CE   . LYS A 1 256 ? -3.774  -34.194 -26.544 1.00 25.23 ? 699 LYS A CE   1 
ATOM   1865 N  NZ   . LYS A 1 256 ? -3.208  -34.868 -27.746 1.00 25.20 ? 699 LYS A NZ   1 
ATOM   1866 N  N    . LYS A 1 257 ? -9.486  -31.932 -23.855 1.00 26.63 ? 700 LYS A N    1 
ATOM   1867 C  CA   . LYS A 1 257 ? -10.871 -31.824 -23.440 1.00 26.44 ? 700 LYS A CA   1 
ATOM   1868 C  C    . LYS A 1 257 ? -10.907 -30.681 -22.447 1.00 26.81 ? 700 LYS A C    1 
ATOM   1869 O  O    . LYS A 1 257 ? -10.164 -30.676 -21.463 1.00 26.92 ? 700 LYS A O    1 
ATOM   1870 C  CB   . LYS A 1 257 ? -11.335 -33.100 -22.744 1.00 26.28 ? 700 LYS A CB   1 
ATOM   1871 C  CG   . LYS A 1 257 ? -11.692 -34.252 -23.682 1.00 26.00 ? 700 LYS A CG   1 
ATOM   1872 C  CD   . LYS A 1 257 ? -10.918 -35.522 -23.352 1.00 25.71 ? 700 LYS A CD   1 
ATOM   1873 C  CE   . LYS A 1 257 ? -10.680 -36.385 -24.562 1.00 25.47 ? 700 LYS A CE   1 
ATOM   1874 N  NZ   . LYS A 1 257 ? -9.774  -37.511 -24.220 1.00 26.08 ? 700 LYS A NZ   1 
ATOM   1875 N  N    . ARG A 1 258 ? -11.774 -29.713 -22.703 1.00 26.93 ? 701 ARG A N    1 
ATOM   1876 C  CA   . ARG A 1 258 ? -11.741 -28.483 -21.956 1.00 26.65 ? 701 ARG A CA   1 
ATOM   1877 C  C    . ARG A 1 258 ? -12.303 -28.618 -20.557 1.00 26.95 ? 701 ARG A C    1 
ATOM   1878 O  O    . ARG A 1 258 ? -11.729 -28.045 -19.651 1.00 28.08 ? 701 ARG A O    1 
ATOM   1879 C  CB   . ARG A 1 258 ? -12.420 -27.346 -22.722 1.00 26.56 ? 701 ARG A CB   1 
ATOM   1880 C  CG   . ARG A 1 258 ? -13.932 -27.321 -22.745 1.00 25.46 ? 701 ARG A CG   1 
ATOM   1881 C  CD   . ARG A 1 258 ? -14.452 -26.350 -23.770 1.00 24.38 ? 701 ARG A CD   1 
ATOM   1882 N  NE   . ARG A 1 258 ? -15.785 -25.871 -23.450 1.00 25.38 ? 701 ARG A NE   1 
ATOM   1883 C  CZ   . ARG A 1 258 ? -16.389 -24.820 -24.024 1.00 26.93 ? 701 ARG A CZ   1 
ATOM   1884 N  NH1  . ARG A 1 258 ? -15.794 -24.089 -24.961 1.00 28.36 ? 701 ARG A NH1  1 
ATOM   1885 N  NH2  . ARG A 1 258 ? -17.615 -24.489 -23.654 1.00 27.96 ? 701 ARG A NH2  1 
ATOM   1886 N  N    . ASP A 1 259 ? -13.370 -29.391 -20.361 1.00 26.98 ? 702 ASP A N    1 
ATOM   1887 C  CA   . ASP A 1 259 ? -14.098 -29.433 -19.069 1.00 27.05 ? 702 ASP A CA   1 
ATOM   1888 C  C    . ASP A 1 259 ? -13.612 -30.476 -18.058 1.00 26.74 ? 702 ASP A C    1 
ATOM   1889 O  O    . ASP A 1 259 ? -14.001 -30.470 -16.882 1.00 26.65 ? 702 ASP A O    1 
ATOM   1890 C  CB   . ASP A 1 259 ? -15.575 -29.596 -19.353 1.00 27.38 ? 702 ASP A CB   1 
ATOM   1891 C  CG   . ASP A 1 259 ? -16.090 -28.499 -20.270 1.00 29.05 ? 702 ASP A CG   1 
ATOM   1892 O  OD1  . ASP A 1 259 ? -15.977 -27.290 -19.880 1.00 27.77 ? 702 ASP A OD1  1 
ATOM   1893 O  OD2  . ASP A 1 259 ? -16.568 -28.764 -21.411 1.00 30.25 ? 702 ASP A OD2  1 
ATOM   1894 N  N    . GLU A 1 260 ? -12.752 -31.365 -18.544 1.00 26.63 ? 703 GLU A N    1 
ATOM   1895 C  CA   . GLU A 1 260 ? -11.805 -32.094 -17.707 1.00 26.25 ? 703 GLU A CA   1 
ATOM   1896 C  C    . GLU A 1 260 ? -10.742 -31.161 -17.068 1.00 26.16 ? 703 GLU A C    1 
ATOM   1897 O  O    . GLU A 1 260 ? -10.051 -31.555 -16.138 1.00 26.38 ? 703 GLU A O    1 
ATOM   1898 C  CB   . GLU A 1 260 ? -11.117 -33.181 -18.535 1.00 25.99 ? 703 GLU A CB   1 
ATOM   1899 C  CG   . GLU A 1 260 ? -12.091 -34.148 -19.205 1.00 25.28 ? 703 GLU A CG   1 
ATOM   1900 C  CD   . GLU A 1 260 ? -11.391 -35.314 -19.876 1.00 24.36 ? 703 GLU A CD   1 
ATOM   1901 O  OE1  . GLU A 1 260 ? -11.821 -36.464 -19.689 1.00 25.07 ? 703 GLU A OE1  1 
ATOM   1902 O  OE2  . GLU A 1 260 ? -10.401 -35.096 -20.589 1.00 23.97 ? 703 GLU A OE2  1 
ATOM   1903 N  N    . ARG A 1 261 ? -10.605 -29.931 -17.555 1.00 26.14 ? 704 ARG A N    1 
ATOM   1904 C  CA   . ARG A 1 261 ? -9.630  -28.994 -16.978 1.00 26.11 ? 704 ARG A CA   1 
ATOM   1905 C  C    . ARG A 1 261 ? -10.047 -28.517 -15.587 1.00 26.11 ? 704 ARG A C    1 
ATOM   1906 O  O    . ARG A 1 261 ? -11.254 -28.477 -15.231 1.00 25.92 ? 704 ARG A O    1 
ATOM   1907 C  CB   . ARG A 1 261 ? -9.401  -27.775 -17.872 1.00 25.80 ? 704 ARG A CB   1 
ATOM   1908 C  CG   . ARG A 1 261 ? -8.452  -28.057 -19.012 1.00 26.59 ? 704 ARG A CG   1 
ATOM   1909 C  CD   . ARG A 1 261 ? -8.184  -26.861 -19.907 1.00 26.99 ? 704 ARG A CD   1 
ATOM   1910 N  NE   . ARG A 1 261 ? -8.048  -27.227 -21.323 1.00 26.08 ? 704 ARG A NE   1 
ATOM   1911 C  CZ   . ARG A 1 261 ? -8.542  -26.525 -22.336 1.00 25.29 ? 704 ARG A CZ   1 
ATOM   1912 N  NH1  . ARG A 1 261 ? -9.172  -25.385 -22.125 1.00 25.29 ? 704 ARG A NH1  1 
ATOM   1913 N  NH2  . ARG A 1 261 ? -8.377  -26.949 -23.582 1.00 25.39 ? 704 ARG A NH2  1 
ATOM   1914 N  N    . PRO A 1 262 ? -9.041  -28.150 -14.806 1.00 25.58 ? 705 PRO A N    1 
ATOM   1915 C  CA   . PRO A 1 262 ? -9.277  -27.607 -13.478 1.00 25.63 ? 705 PRO A CA   1 
ATOM   1916 C  C    . PRO A 1 262 ? -9.652  -26.139 -13.633 1.00 25.70 ? 705 PRO A C    1 
ATOM   1917 O  O    . PRO A 1 262 ? -9.130  -25.461 -14.516 1.00 25.13 ? 705 PRO A O    1 
ATOM   1918 C  CB   . PRO A 1 262 ? -7.918  -27.763 -12.799 1.00 25.68 ? 705 PRO A CB   1 
ATOM   1919 C  CG   . PRO A 1 262 ? -6.941  -27.613 -13.910 1.00 25.68 ? 705 PRO A CG   1 
ATOM   1920 C  CD   . PRO A 1 262 ? -7.607  -28.198 -15.134 1.00 25.41 ? 705 PRO A CD   1 
ATOM   1921 N  N    . SER A 1 263 ? -10.585 -25.667 -12.814 1.00 25.89 ? 706 SER A N    1 
ATOM   1922 C  CA   . SER A 1 263 ? -10.923 -24.259 -12.799 1.00 25.87 ? 706 SER A CA   1 
ATOM   1923 C  C    . SER A 1 263 ? -10.070 -23.660 -11.669 1.00 26.01 ? 706 SER A C    1 
ATOM   1924 O  O    . SER A 1 263 ? -9.305  -24.383 -11.019 1.00 25.65 ? 706 SER A O    1 
ATOM   1925 C  CB   . SER A 1 263 ? -12.422 -24.076 -12.627 1.00 25.64 ? 706 SER A CB   1 
ATOM   1926 O  OG   . SER A 1 263 ? -12.771 -24.171 -11.270 1.00 26.79 ? 706 SER A OG   1 
ATOM   1927 N  N    . PHE A 1 264 ? -10.173 -22.353 -11.435 1.00 26.19 ? 707 PHE A N    1 
ATOM   1928 C  CA   . PHE A 1 264 ? -9.066  -21.645 -10.796 1.00 26.02 ? 707 PHE A CA   1 
ATOM   1929 C  C    . PHE A 1 264 ? -8.928  -21.725 -9.237  1.00 26.02 ? 707 PHE A C    1 
ATOM   1930 O  O    . PHE A 1 264 ? -7.800  -21.861 -8.748  1.00 25.48 ? 707 PHE A O    1 
ATOM   1931 C  CB   . PHE A 1 264 ? -8.958  -20.206 -11.351 1.00 26.18 ? 707 PHE A CB   1 
ATOM   1932 C  CG   . PHE A 1 264 ? -7.836  -20.038 -12.356 1.00 25.26 ? 707 PHE A CG   1 
ATOM   1933 C  CD1  . PHE A 1 264 ? -6.508  -20.070 -11.941 1.00 23.49 ? 707 PHE A CD1  1 
ATOM   1934 C  CD2  . PHE A 1 264 ? -8.105  -19.887 -13.714 1.00 25.41 ? 707 PHE A CD2  1 
ATOM   1935 C  CE1  . PHE A 1 264 ? -5.476  -19.952 -12.851 1.00 24.16 ? 707 PHE A CE1  1 
ATOM   1936 C  CE2  . PHE A 1 264 ? -7.051  -19.760 -14.653 1.00 24.76 ? 707 PHE A CE2  1 
ATOM   1937 C  CZ   . PHE A 1 264 ? -5.747  -19.788 -14.219 1.00 24.23 ? 707 PHE A CZ   1 
ATOM   1938 N  N    . PRO A 1 265 ? -10.014 -21.653 -8.454  1.00 26.00 ? 708 PRO A N    1 
ATOM   1939 C  CA   . PRO A 1 265 ? -9.911  -21.990 -7.018  1.00 25.65 ? 708 PRO A CA   1 
ATOM   1940 C  C    . PRO A 1 265 ? -8.988  -23.187 -6.749  1.00 25.45 ? 708 PRO A C    1 
ATOM   1941 O  O    . PRO A 1 265 ? -7.985  -22.994 -6.057  1.00 25.13 ? 708 PRO A O    1 
ATOM   1942 C  CB   . PRO A 1 265 ? -11.362 -22.263 -6.603  1.00 25.46 ? 708 PRO A CB   1 
ATOM   1943 C  CG   . PRO A 1 265 ? -12.164 -21.312 -7.462  1.00 25.66 ? 708 PRO A CG   1 
ATOM   1944 C  CD   . PRO A 1 265 ? -11.383 -21.212 -8.806  1.00 26.21 ? 708 PRO A CD   1 
ATOM   1945 N  N    . ARG A 1 266 ? -9.265  -24.362 -7.316  1.00 25.21 ? 709 ARG A N    1 
ATOM   1946 C  CA   . ARG A 1 266 ? -8.407  -25.525 -7.048  1.00 25.44 ? 709 ARG A CA   1 
ATOM   1947 C  C    . ARG A 1 266 ? -6.977  -25.446 -7.644  1.00 25.29 ? 709 ARG A C    1 
ATOM   1948 O  O    . ARG A 1 266 ? -6.043  -26.050 -7.106  1.00 25.30 ? 709 ARG A O    1 
ATOM   1949 C  CB   . ARG A 1 266 ? -9.114  -26.856 -7.396  1.00 25.71 ? 709 ARG A CB   1 
ATOM   1950 C  CG   . ARG A 1 266 ? -9.175  -27.240 -8.874  1.00 26.23 ? 709 ARG A CG   1 
ATOM   1951 C  CD   . ARG A 1 266 ? -9.566  -28.702 -9.130  1.00 26.64 ? 709 ARG A CD   1 
ATOM   1952 N  NE   . ARG A 1 266 ? -10.736 -29.082 -8.336  1.00 27.80 ? 709 ARG A NE   1 
ATOM   1953 C  CZ   . ARG A 1 266 ? -11.716 -29.901 -8.739  1.00 27.98 ? 709 ARG A CZ   1 
ATOM   1954 N  NH1  . ARG A 1 266 ? -11.709 -30.469 -9.946  1.00 27.03 ? 709 ARG A NH1  1 
ATOM   1955 N  NH2  . ARG A 1 266 ? -12.724 -30.152 -7.908  1.00 28.58 ? 709 ARG A NH2  1 
ATOM   1956 N  N    . ILE A 1 267 ? -6.802  -24.699 -8.728  1.00 25.22 ? 710 ILE A N    1 
ATOM   1957 C  CA   . ILE A 1 267 ? -5.463  -24.438 -9.266  1.00 25.20 ? 710 ILE A CA   1 
ATOM   1958 C  C    . ILE A 1 267 ? -4.591  -23.639 -8.271  1.00 25.22 ? 710 ILE A C    1 
ATOM   1959 O  O    . ILE A 1 267 ? -3.376  -23.883 -8.127  1.00 24.64 ? 710 ILE A O    1 
ATOM   1960 C  CB   . ILE A 1 267 ? -5.569  -23.685 -10.601 1.00 25.08 ? 710 ILE A CB   1 
ATOM   1961 C  CG1  . ILE A 1 267 ? -6.161  -24.614 -11.661 1.00 25.48 ? 710 ILE A CG1  1 
ATOM   1962 C  CG2  . ILE A 1 267 ? -4.185  -23.166 -11.020 1.00 24.90 ? 710 ILE A CG2  1 
ATOM   1963 C  CD1  . ILE A 1 267 ? -6.382  -23.979 -13.024 1.00 26.06 ? 710 ILE A CD1  1 
ATOM   1964 N  N    . LEU A 1 268 ? -5.248  -22.690 -7.605  1.00 25.30 ? 711 LEU A N    1 
ATOM   1965 C  CA   . LEU A 1 268 ? -4.644  -21.817 -6.608  1.00 25.38 ? 711 LEU A CA   1 
ATOM   1966 C  C    . LEU A 1 268 ? -4.497  -22.550 -5.282  1.00 25.31 ? 711 LEU A C    1 
ATOM   1967 O  O    . LEU A 1 268 ? -3.653  -22.201 -4.476  1.00 25.26 ? 711 LEU A O    1 
ATOM   1968 C  CB   . LEU A 1 268 ? -5.512  -20.561 -6.447  1.00 25.61 ? 711 LEU A CB   1 
ATOM   1969 C  CG   . LEU A 1 268 ? -5.154  -19.496 -5.405  1.00 25.36 ? 711 LEU A CG   1 
ATOM   1970 C  CD1  . LEU A 1 268 ? -3.750  -18.922 -5.646  1.00 25.12 ? 711 LEU A CD1  1 
ATOM   1971 C  CD2  . LEU A 1 268 ? -6.236  -18.402 -5.401  1.00 24.92 ? 711 LEU A CD2  1 
ATOM   1972 N  N    . ALA A 1 269 ? -5.302  -23.579 -5.059  1.00 25.44 ? 712 ALA A N    1 
ATOM   1973 C  CA   . ALA A 1 269 ? -5.066  -24.460 -3.919  1.00 25.55 ? 712 ALA A CA   1 
ATOM   1974 C  C    . ALA A 1 269 ? -3.725  -25.196 -4.096  1.00 25.76 ? 712 ALA A C    1 
ATOM   1975 O  O    . ALA A 1 269 ? -2.740  -24.820 -3.450  1.00 25.43 ? 712 ALA A O    1 
ATOM   1976 C  CB   . ALA A 1 269 ? -6.222  -25.440 -3.730  1.00 25.46 ? 712 ALA A CB   1 
ATOM   1977 N  N    . GLU A 1 270 ? -3.688  -26.193 -4.996  1.00 25.88 ? 713 GLU A N    1 
ATOM   1978 C  CA   . GLU A 1 270 ? -2.492  -27.035 -5.240  1.00 26.17 ? 713 GLU A CA   1 
ATOM   1979 C  C    . GLU A 1 270 ? -1.142  -26.289 -5.213  1.00 26.27 ? 713 GLU A C    1 
ATOM   1980 O  O    . GLU A 1 270 ? -0.182  -26.755 -4.594  1.00 26.21 ? 713 GLU A O    1 
ATOM   1981 C  CB   . GLU A 1 270 ? -2.591  -27.775 -6.597  1.00 26.27 ? 713 GLU A CB   1 
ATOM   1982 C  CG   . GLU A 1 270 ? -2.662  -29.301 -6.539  1.00 26.84 ? 713 GLU A CG   1 
ATOM   1983 C  CD   . GLU A 1 270 ? -1.423  -29.972 -5.949  1.00 27.78 ? 713 GLU A CD   1 
ATOM   1984 O  OE1  . GLU A 1 270 ? -0.769  -29.361 -5.075  1.00 26.21 ? 713 GLU A OE1  1 
ATOM   1985 O  OE2  . GLU A 1 270 ? -1.118  -31.142 -6.337  1.00 28.71 ? 713 GLU A OE2  1 
ATOM   1986 N  N    . ILE A 1 271 ? -1.061  -25.152 -5.900  1.00 26.24 ? 714 ILE A N    1 
ATOM   1987 C  CA   . ILE A 1 271 ? 0.213   -24.446 -6.041  1.00 26.41 ? 714 ILE A CA   1 
ATOM   1988 C  C    . ILE A 1 271 ? 0.732   -23.868 -4.716  1.00 26.69 ? 714 ILE A C    1 
ATOM   1989 O  O    . ILE A 1 271 ? 1.900   -24.064 -4.363  1.00 26.87 ? 714 ILE A O    1 
ATOM   1990 C  CB   . ILE A 1 271 ? 0.106   -23.324 -7.070  1.00 26.22 ? 714 ILE A CB   1 
ATOM   1991 C  CG1  . ILE A 1 271 ? -0.200  -23.900 -8.449  1.00 25.74 ? 714 ILE A CG1  1 
ATOM   1992 C  CG2  . ILE A 1 271 ? 1.412   -22.517 -7.108  1.00 26.24 ? 714 ILE A CG2  1 
ATOM   1993 C  CD1  . ILE A 1 271 ? -0.833  -22.900 -9.397  1.00 25.56 ? 714 ILE A CD1  1 
ATOM   1994 N  N    . GLU A 1 272 ? -0.119  -23.137 -4.001  1.00 26.63 ? 715 GLU A N    1 
ATOM   1995 C  CA   . GLU A 1 272 ? 0.300   -22.551 -2.730  1.00 26.63 ? 715 GLU A CA   1 
ATOM   1996 C  C    . GLU A 1 272 ? 0.551   -23.672 -1.771  1.00 26.80 ? 715 GLU A C    1 
ATOM   1997 O  O    . GLU A 1 272 ? 1.513   -23.637 -1.028  1.00 27.43 ? 715 GLU A O    1 
ATOM   1998 C  CB   . GLU A 1 272 ? -0.742  -21.576 -2.159  1.00 26.60 ? 715 GLU A CB   1 
ATOM   1999 C  CG   . GLU A 1 272 ? -0.470  -20.127 -2.528  1.00 25.94 ? 715 GLU A CG   1 
ATOM   2000 C  CD   . GLU A 1 272 ? -1.593  -19.196 -2.172  1.00 26.25 ? 715 GLU A CD   1 
ATOM   2001 O  OE1  . GLU A 1 272 ? -1.777  -18.173 -2.865  1.00 25.71 ? 715 GLU A OE1  1 
ATOM   2002 O  OE2  . GLU A 1 272 ? -2.278  -19.477 -1.177  1.00 28.12 ? 715 GLU A OE2  1 
ATOM   2003 N  N    . GLU A 1 273 ? -0.305  -24.688 -1.840  1.00 27.04 ? 716 GLU A N    1 
ATOM   2004 C  CA   . GLU A 1 273 ? -0.314  -25.820 -0.909  1.00 26.79 ? 716 GLU A CA   1 
ATOM   2005 C  C    . GLU A 1 273 ? 0.787   -26.864 -1.175  1.00 26.67 ? 716 GLU A C    1 
ATOM   2006 O  O    . GLU A 1 273 ? 1.020   -27.738 -0.351  1.00 26.59 ? 716 GLU A O    1 
ATOM   2007 C  CB   . GLU A 1 273 ? -1.692  -26.488 -0.974  1.00 26.86 ? 716 GLU A CB   1 
ATOM   2008 C  CG   . GLU A 1 273 ? -2.050  -27.365 0.215   1.00 26.39 ? 716 GLU A CG   1 
ATOM   2009 C  CD   . GLU A 1 273 ? -2.484  -28.748 -0.201  1.00 26.29 ? 716 GLU A CD   1 
ATOM   2010 O  OE1  . GLU A 1 273 ? -2.153  -29.718 0.517   1.00 28.41 ? 716 GLU A OE1  1 
ATOM   2011 O  OE2  . GLU A 1 273 ? -3.157  -28.873 -1.246  1.00 26.13 ? 716 GLU A OE2  1 
ATOM   2012 N  N    . LEU A 1 274 ? 1.436   -26.785 -2.330  1.00 26.76 ? 717 LEU A N    1 
ATOM   2013 C  CA   . LEU A 1 274 ? 2.643   -27.567 -2.596  1.00 27.04 ? 717 LEU A CA   1 
ATOM   2014 C  C    . LEU A 1 274 ? 3.879   -26.711 -2.343  1.00 27.20 ? 717 LEU A C    1 
ATOM   2015 O  O    . LEU A 1 274 ? 4.959   -27.246 -2.088  1.00 27.45 ? 717 LEU A O    1 
ATOM   2016 C  CB   . LEU A 1 274 ? 2.674   -28.090 -4.042  1.00 27.16 ? 717 LEU A CB   1 
ATOM   2017 C  CG   . LEU A 1 274 ? 3.136   -27.141 -5.170  1.00 27.49 ? 717 LEU A CG   1 
ATOM   2018 C  CD1  . LEU A 1 274 ? 4.680   -27.130 -5.351  1.00 27.27 ? 717 LEU A CD1  1 
ATOM   2019 C  CD2  . LEU A 1 274 ? 2.455   -27.503 -6.502  1.00 27.95 ? 717 LEU A CD2  1 
ATOM   2020 N  N    . ALA A 1 275 ? 3.717   -25.388 -2.437  1.00 27.20 ? 718 ALA A N    1 
ATOM   2021 C  CA   . ALA A 1 275 ? 4.818   -24.441 -2.274  1.00 27.23 ? 718 ALA A CA   1 
ATOM   2022 C  C    . ALA A 1 275 ? 5.566   -24.699 -0.975  1.00 27.42 ? 718 ALA A C    1 
ATOM   2023 O  O    . ALA A 1 275 ? 6.746   -24.374 -0.859  1.00 27.72 ? 718 ALA A O    1 
ATOM   2024 C  CB   . ALA A 1 275 ? 4.305   -23.008 -2.313  1.00 27.41 ? 718 ALA A CB   1 
ATOM   2025 N  N    . ARG A 1 276 ? 4.866   -25.265 0.005   1.00 27.32 ? 719 ARG A N    1 
ATOM   2026 C  CA   . ARG A 1 276 ? 5.518   -25.917 1.120   1.00 27.27 ? 719 ARG A CA   1 
ATOM   2027 C  C    . ARG A 1 276 ? 5.531   -27.448 0.854   1.00 27.62 ? 719 ARG A C    1 
ATOM   2028 O  O    . ARG A 1 276 ? 4.454   -28.049 0.767   1.00 27.71 ? 719 ARG A O    1 
ATOM   2029 C  CB   . ARG A 1 276 ? 4.855   -25.534 2.469   1.00 27.30 ? 719 ARG A CB   1 
ATOM   2030 C  CG   . ARG A 1 276 ? 3.317   -25.655 2.571   1.00 27.08 ? 719 ARG A CG   1 
ATOM   2031 C  CD   . ARG A 1 276 ? 2.808   -26.832 3.448   1.00 26.97 ? 719 ARG A CD   1 
ATOM   2032 N  NE   . ARG A 1 276 ? 1.798   -27.636 2.741   1.00 26.61 ? 719 ARG A NE   1 
ATOM   2033 C  CZ   . ARG A 1 276 ? 1.394   -28.862 3.094   1.00 26.53 ? 719 ARG A CZ   1 
ATOM   2034 N  NH1  . ARG A 1 276 ? 1.885   -29.487 4.176   1.00 25.84 ? 719 ARG A NH1  1 
ATOM   2035 N  NH2  . ARG A 1 276 ? 0.471   -29.467 2.354   1.00 26.07 ? 719 ARG A NH2  1 
ATOM   2036 N  N    . GLU A 1 277 ? 6.683   -28.128 0.716   1.00 27.87 ? 720 GLU A N    1 
ATOM   2037 C  CA   . GLU A 1 277 ? 8.087   -27.691 0.955   1.00 27.88 ? 720 GLU A CA   1 
ATOM   2038 C  C    . GLU A 1 277 ? 8.410   -26.253 1.438   1.00 28.23 ? 720 GLU A C    1 
ATOM   2039 O  O    . GLU A 1 277 ? 7.673   -25.672 2.241   1.00 28.78 ? 720 GLU A O    1 
ATOM   2040 C  CB   . GLU A 1 277 ? 8.965   -28.111 -0.256  1.00 27.81 ? 720 GLU A CB   1 
ATOM   2041 C  CG   . GLU A 1 277 ? 9.316   -27.028 -1.273  1.00 27.33 ? 720 GLU A CG   1 
ATOM   2042 C  CD   . GLU A 1 277 ? 8.982   -27.414 -2.687  1.00 27.65 ? 720 GLU A CD   1 
ATOM   2043 O  OE1  . GLU A 1 277 ? 7.804   -27.249 -3.055  1.00 28.38 ? 720 GLU A OE1  1 
ATOM   2044 O  OE2  . GLU A 1 277 ? 9.891   -27.857 -3.426  1.00 27.95 ? 720 GLU A OE2  1 
ATOM   2045 N  N    . LEU A 1 278 ? 9.578   -25.737 1.052   1.00 28.34 ? 721 LEU A N    1 
ATOM   2046 C  CA   . LEU A 1 278 ? 9.959   -24.338 1.276   1.00 28.03 ? 721 LEU A CA   1 
ATOM   2047 C  C    . LEU A 1 278 ? 11.157  -24.034 0.338   1.00 28.06 ? 721 LEU A C    1 
ATOM   2048 O  O    . LEU A 1 278 ? 10.953  -23.853 -0.863  1.00 27.94 ? 721 LEU A O    1 
ATOM   2049 C  CB   . LEU A 1 278 ? 10.252  -24.085 2.781   1.00 27.79 ? 721 LEU A CB   1 
ATOM   2050 C  CG   . LEU A 1 278 ? 10.090  -22.688 3.415   1.00 27.53 ? 721 LEU A CG   1 
ATOM   2051 C  CD1  . LEU A 1 278 ? 9.155   -21.749 2.636   1.00 27.28 ? 721 LEU A CD1  1 
ATOM   2052 C  CD2  . LEU A 1 278 ? 9.639   -22.818 4.889   1.00 27.13 ? 721 LEU A CD2  1 
ATOM   2053 N  N    . SER A 1 279 ? 12.390  -24.052 0.857   1.00 28.18 ? 722 SER A N    1 
ATOM   2054 C  CA   . SER A 1 279 ? 13.590  -23.699 0.078   1.00 28.09 ? 722 SER A CA   1 
ATOM   2055 C  C    . SER A 1 279 ? 14.044  -24.860 -0.829  1.00 28.11 ? 722 SER A C    1 
ATOM   2056 O  O    . SER A 1 279 ? 14.296  -24.710 -2.032  1.00 28.19 ? 722 SER A O    1 
ATOM   2057 C  CB   . SER A 1 279 ? 14.733  -23.274 1.021   1.00 28.04 ? 722 SER A CB   1 
ATOM   2058 O  OG   . SER A 1 279 ? 15.178  -21.959 0.720   1.00 28.09 ? 722 SER A OG   1 
ATOM   2059 N  N    . ASP B 1 5   ? -20.494 -1.649  -10.082 1.00 26.61 ? 448 ASP B N    1 
ATOM   2060 C  CA   . ASP B 1 5   ? -19.517 -0.945  -9.198  1.00 27.12 ? 448 ASP B CA   1 
ATOM   2061 C  C    . ASP B 1 5   ? -19.624 -1.512  -7.796  1.00 27.17 ? 448 ASP B C    1 
ATOM   2062 O  O    . ASP B 1 5   ? -19.777 -0.757  -6.824  1.00 27.79 ? 448 ASP B O    1 
ATOM   2063 C  CB   . ASP B 1 5   ? -19.763 0.578   -9.153  1.00 26.92 ? 448 ASP B CB   1 
ATOM   2064 C  CG   . ASP B 1 5   ? -19.993 1.191   -10.540 1.00 27.74 ? 448 ASP B CG   1 
ATOM   2065 O  OD1  . ASP B 1 5   ? -20.736 0.587   -11.363 1.00 25.17 ? 448 ASP B OD1  1 
ATOM   2066 O  OD2  . ASP B 1 5   ? -19.462 2.288   -10.885 1.00 28.85 ? 448 ASP B OD2  1 
ATOM   2067 N  N    . ASP B 1 6   ? -19.543 -2.837  -7.685  1.00 27.11 ? 449 ASP B N    1 
ATOM   2068 C  CA   . ASP B 1 6   ? -19.600 -3.493  -6.376  1.00 27.08 ? 449 ASP B CA   1 
ATOM   2069 C  C    . ASP B 1 6   ? -18.189 -3.816  -5.875  1.00 26.96 ? 449 ASP B C    1 
ATOM   2070 O  O    . ASP B 1 6   ? -17.486 -4.636  -6.451  1.00 27.00 ? 449 ASP B O    1 
ATOM   2071 C  CB   . ASP B 1 6   ? -20.475 -4.761  -6.426  1.00 27.13 ? 449 ASP B CB   1 
ATOM   2072 C  CG   . ASP B 1 6   ? -21.914 -4.514  -5.922  1.00 27.95 ? 449 ASP B CG   1 
ATOM   2073 O  OD1  . ASP B 1 6   ? -22.790 -5.390  -6.133  1.00 27.52 ? 449 ASP B OD1  1 
ATOM   2074 O  OD2  . ASP B 1 6   ? -22.261 -3.475  -5.302  1.00 28.94 ? 449 ASP B OD2  1 
ATOM   2075 N  N    . TRP B 1 7   ? -17.767 -3.131  -4.817  1.00 26.99 ? 450 TRP B N    1 
ATOM   2076 C  CA   . TRP B 1 7   ? -16.546 -3.490  -4.100  1.00 26.85 ? 450 TRP B CA   1 
ATOM   2077 C  C    . TRP B 1 7   ? -16.952 -4.147  -2.803  1.00 26.58 ? 450 TRP B C    1 
ATOM   2078 O  O    . TRP B 1 7   ? -16.135 -4.307  -1.906  1.00 26.30 ? 450 TRP B O    1 
ATOM   2079 C  CB   . TRP B 1 7   ? -15.692 -2.249  -3.841  1.00 27.17 ? 450 TRP B CB   1 
ATOM   2080 C  CG   . TRP B 1 7   ? -15.326 -1.557  -5.108  1.00 27.65 ? 450 TRP B CG   1 
ATOM   2081 C  CD1  . TRP B 1 7   ? -15.881 -0.415  -5.613  1.00 28.15 ? 450 TRP B CD1  1 
ATOM   2082 C  CD2  . TRP B 1 7   ? -14.364 -1.991  -6.066  1.00 27.46 ? 450 TRP B CD2  1 
ATOM   2083 N  NE1  . TRP B 1 7   ? -15.300 -0.095  -6.816  1.00 28.30 ? 450 TRP B NE1  1 
ATOM   2084 C  CE2  . TRP B 1 7   ? -14.362 -1.051  -7.117  1.00 28.50 ? 450 TRP B CE2  1 
ATOM   2085 C  CE3  . TRP B 1 7   ? -13.481 -3.070  -6.134  1.00 27.09 ? 450 TRP B CE3  1 
ATOM   2086 C  CZ2  . TRP B 1 7   ? -13.506 -1.159  -8.217  1.00 27.99 ? 450 TRP B CZ2  1 
ATOM   2087 C  CZ3  . TRP B 1 7   ? -12.647 -3.179  -7.219  1.00 26.91 ? 450 TRP B CZ3  1 
ATOM   2088 C  CH2  . TRP B 1 7   ? -12.659 -2.226  -8.244  1.00 27.52 ? 450 TRP B CH2  1 
ATOM   2089 N  N    . GLU B 1 8   ? -18.239 -4.504  -2.720  1.00 26.64 ? 451 GLU B N    1 
ATOM   2090 C  CA   . GLU B 1 8   ? -18.781 -5.297  -1.616  1.00 26.44 ? 451 GLU B CA   1 
ATOM   2091 C  C    . GLU B 1 8   ? -18.295 -6.717  -1.811  1.00 26.40 ? 451 GLU B C    1 
ATOM   2092 O  O    . GLU B 1 8   ? -18.555 -7.328  -2.849  1.00 26.51 ? 451 GLU B O    1 
ATOM   2093 C  CB   . GLU B 1 8   ? -20.333 -5.271  -1.565  1.00 26.28 ? 451 GLU B CB   1 
ATOM   2094 C  CG   . GLU B 1 8   ? -20.939 -5.172  -0.156  1.00 25.53 ? 451 GLU B CG   1 
ATOM   2095 C  CD   . GLU B 1 8   ? -21.802 -6.363  0.258   1.00 25.22 ? 451 GLU B CD   1 
ATOM   2096 O  OE1  . GLU B 1 8   ? -22.551 -6.246  1.257   1.00 24.75 ? 451 GLU B OE1  1 
ATOM   2097 O  OE2  . GLU B 1 8   ? -21.734 -7.430  -0.386  1.00 26.36 ? 451 GLU B OE2  1 
ATOM   2098 N  N    . ILE B 1 9   ? -17.558 -7.203  -0.816  1.00 26.29 ? 452 ILE B N    1 
ATOM   2099 C  CA   . ILE B 1 9   ? -17.119 -8.584  -0.744  1.00 26.07 ? 452 ILE B CA   1 
ATOM   2100 C  C    . ILE B 1 9   ? -18.090 -9.346  0.158   1.00 26.37 ? 452 ILE B C    1 
ATOM   2101 O  O    . ILE B 1 9   ? -18.059 -9.163  1.392   1.00 26.35 ? 452 ILE B O    1 
ATOM   2102 C  CB   . ILE B 1 9   ? -15.689 -8.640  -0.184  1.00 25.80 ? 452 ILE B CB   1 
ATOM   2103 C  CG1  . ILE B 1 9   ? -14.746 -7.930  -1.161  1.00 25.36 ? 452 ILE B CG1  1 
ATOM   2104 C  CG2  . ILE B 1 9   ? -15.264 -10.083 0.083   1.00 25.46 ? 452 ILE B CG2  1 
ATOM   2105 C  CD1  . ILE B 1 9   ? -13.318 -7.795  -0.667  1.00 25.31 ? 452 ILE B CD1  1 
ATOM   2106 N  N    . PRO B 1 10  ? -18.965 -10.171 -0.443  1.00 26.45 ? 453 PRO B N    1 
ATOM   2107 C  CA   . PRO B 1 10  ? -19.840 -11.059 0.336   1.00 26.38 ? 453 PRO B CA   1 
ATOM   2108 C  C    . PRO B 1 10  ? -19.050 -11.824 1.394   1.00 26.45 ? 453 PRO B C    1 
ATOM   2109 O  O    . PRO B 1 10  ? -17.996 -12.406 1.080   1.00 26.46 ? 453 PRO B O    1 
ATOM   2110 C  CB   . PRO B 1 10  ? -20.395 -12.024 -0.712  1.00 26.40 ? 453 PRO B CB   1 
ATOM   2111 C  CG   . PRO B 1 10  ? -20.339 -11.285 -1.999  1.00 26.20 ? 453 PRO B CG   1 
ATOM   2112 C  CD   . PRO B 1 10  ? -19.201 -10.313 -1.893  1.00 26.31 ? 453 PRO B CD   1 
ATOM   2113 N  N    . ASP B 1 11  ? -19.539 -11.770 2.633   1.00 26.30 ? 454 ASP B N    1 
ATOM   2114 C  CA   . ASP B 1 11  ? -18.931 -12.487 3.744   1.00 26.13 ? 454 ASP B CA   1 
ATOM   2115 C  C    . ASP B 1 11  ? -18.980 -13.954 3.351   1.00 25.96 ? 454 ASP B C    1 
ATOM   2116 O  O    . ASP B 1 11  ? -20.017 -14.438 2.884   1.00 26.09 ? 454 ASP B O    1 
ATOM   2117 C  CB   . ASP B 1 11  ? -19.675 -12.168 5.068   1.00 26.17 ? 454 ASP B CB   1 
ATOM   2118 C  CG   . ASP B 1 11  ? -19.906 -13.405 5.966   1.00 26.76 ? 454 ASP B CG   1 
ATOM   2119 O  OD1  . ASP B 1 11  ? -18.917 -14.081 6.330   1.00 28.87 ? 454 ASP B OD1  1 
ATOM   2120 O  OD2  . ASP B 1 11  ? -21.035 -13.764 6.390   1.00 25.74 ? 454 ASP B OD2  1 
ATOM   2121 N  N    . GLY B 1 12  ? -17.852 -14.645 3.487   1.00 25.70 ? 455 GLY B N    1 
ATOM   2122 C  CA   . GLY B 1 12  ? -17.789 -16.057 3.145   1.00 25.53 ? 455 GLY B CA   1 
ATOM   2123 C  C    . GLY B 1 12  ? -16.580 -16.382 2.307   1.00 25.39 ? 455 GLY B C    1 
ATOM   2124 O  O    . GLY B 1 12  ? -15.907 -17.380 2.545   1.00 25.28 ? 455 GLY B O    1 
ATOM   2125 N  N    . GLN B 1 13  ? -16.296 -15.532 1.325   1.00 25.40 ? 456 GLN B N    1 
ATOM   2126 C  CA   . GLN B 1 13  ? -15.085 -15.681 0.519   1.00 25.34 ? 456 GLN B CA   1 
ATOM   2127 C  C    . GLN B 1 13  ? -13.808 -15.487 1.355   1.00 24.98 ? 456 GLN B C    1 
ATOM   2128 O  O    . GLN B 1 13  ? -12.766 -16.027 1.012   1.00 24.82 ? 456 GLN B O    1 
ATOM   2129 C  CB   . GLN B 1 13  ? -15.095 -14.717 -0.689  1.00 25.61 ? 456 GLN B CB   1 
ATOM   2130 C  CG   . GLN B 1 13  ? -16.095 -15.089 -1.820  1.00 25.50 ? 456 GLN B CG   1 
ATOM   2131 C  CD   . GLN B 1 13  ? -16.620 -13.876 -2.609  1.00 25.90 ? 456 GLN B CD   1 
ATOM   2132 O  OE1  . GLN B 1 13  ? -16.701 -12.767 -2.087  1.00 26.02 ? 456 GLN B OE1  1 
ATOM   2133 N  NE2  . GLN B 1 13  ? -16.985 -14.099 -3.863  1.00 26.71 ? 456 GLN B NE2  1 
ATOM   2134 N  N    . ILE B 1 14  ? -13.891 -14.774 2.475   1.00 24.79 ? 457 ILE B N    1 
ATOM   2135 C  CA   . ILE B 1 14  ? -12.673 -14.369 3.183   1.00 24.83 ? 457 ILE B CA   1 
ATOM   2136 C  C    . ILE B 1 14  ? -12.208 -15.305 4.314   1.00 24.85 ? 457 ILE B C    1 
ATOM   2137 O  O    . ILE B 1 14  ? -12.962 -15.630 5.237   1.00 24.76 ? 457 ILE B O    1 
ATOM   2138 C  CB   . ILE B 1 14  ? -12.772 -12.915 3.714   1.00 24.93 ? 457 ILE B CB   1 
ATOM   2139 C  CG1  . ILE B 1 14  ? -14.138 -12.276 3.412   1.00 25.08 ? 457 ILE B CG1  1 
ATOM   2140 C  CG2  . ILE B 1 14  ? -11.629 -12.086 3.137   1.00 24.36 ? 457 ILE B CG2  1 
ATOM   2141 C  CD1  . ILE B 1 14  ? -14.245 -10.803 3.860   1.00 25.51 ? 457 ILE B CD1  1 
ATOM   2142 N  N    . THR B 1 15  ? -10.957 -15.747 4.208   1.00 24.77 ? 458 THR B N    1 
ATOM   2143 C  CA   . THR B 1 15  ? -10.270 -16.424 5.299   1.00 24.71 ? 458 THR B CA   1 
ATOM   2144 C  C    . THR B 1 15  ? -9.593  -15.294 6.013   1.00 24.56 ? 458 THR B C    1 
ATOM   2145 O  O    . THR B 1 15  ? -9.377  -14.259 5.396   1.00 24.93 ? 458 THR B O    1 
ATOM   2146 C  CB   . THR B 1 15  ? -9.244  -17.467 4.767   1.00 24.73 ? 458 THR B CB   1 
ATOM   2147 O  OG1  . THR B 1 15  ? -9.870  -18.750 4.666   1.00 24.93 ? 458 THR B OG1  1 
ATOM   2148 C  CG2  . THR B 1 15  ? -8.100  -17.732 5.753   1.00 24.49 ? 458 THR B CG2  1 
ATOM   2149 N  N    . VAL B 1 16  ? -9.304  -15.484 7.306   1.00 24.73 ? 459 VAL B N    1 
ATOM   2150 C  CA   . VAL B 1 16  ? -8.595  -14.511 8.171   1.00 24.51 ? 459 VAL B CA   1 
ATOM   2151 C  C    . VAL B 1 16  ? -7.516  -15.207 9.003   1.00 24.41 ? 459 VAL B C    1 
ATOM   2152 O  O    . VAL B 1 16  ? -7.677  -16.368 9.386   1.00 24.58 ? 459 VAL B O    1 
ATOM   2153 C  CB   . VAL B 1 16  ? -9.546  -13.777 9.160   1.00 24.41 ? 459 VAL B CB   1 
ATOM   2154 C  CG1  . VAL B 1 16  ? -9.238  -12.300 9.168   1.00 24.81 ? 459 VAL B CG1  1 
ATOM   2155 C  CG2  . VAL B 1 16  ? -11.020 -14.000 8.820   1.00 24.30 ? 459 VAL B CG2  1 
ATOM   2156 N  N    . GLY B 1 17  ? -6.455  -14.478 9.337   1.00 24.47 ? 460 GLY B N    1 
ATOM   2157 C  CA   . GLY B 1 17  ? -5.233  -15.075 9.862   1.00 24.77 ? 460 GLY B CA   1 
ATOM   2158 C  C    . GLY B 1 17  ? -4.594  -14.440 11.097  1.00 24.97 ? 460 GLY B C    1 
ATOM   2159 O  O    . GLY B 1 17  ? -5.281  -13.890 11.967  1.00 24.81 ? 460 GLY B O    1 
ATOM   2160 N  N    . GLN B 1 18  ? -3.265  -14.552 11.169  1.00 25.18 ? 461 GLN B N    1 
ATOM   2161 C  CA   . GLN B 1 18  ? -2.464  -14.022 12.276  1.00 25.50 ? 461 GLN B CA   1 
ATOM   2162 C  C    . GLN B 1 18  ? -2.640  -12.509 12.488  1.00 25.61 ? 461 GLN B C    1 
ATOM   2163 O  O    . GLN B 1 18  ? -2.431  -11.711 11.575  1.00 25.36 ? 461 GLN B O    1 
ATOM   2164 C  CB   . GLN B 1 18  ? -0.975  -14.367 12.062  1.00 25.65 ? 461 GLN B CB   1 
ATOM   2165 C  CG   . GLN B 1 18  ? 0.042   -13.318 12.576  1.00 26.10 ? 461 GLN B CG   1 
ATOM   2166 C  CD   . GLN B 1 18  ? 1.293   -13.199 11.708  1.00 26.86 ? 461 GLN B CD   1 
ATOM   2167 O  OE1  . GLN B 1 18  ? 1.500   -13.990 10.781  1.00 27.45 ? 461 GLN B OE1  1 
ATOM   2168 N  NE2  . GLN B 1 18  ? 2.125   -12.206 12.003  1.00 27.56 ? 461 GLN B NE2  1 
ATOM   2169 N  N    . ARG B 1 19  ? -3.030  -12.138 13.706  1.00 26.08 ? 462 ARG B N    1 
ATOM   2170 C  CA   . ARG B 1 19  ? -3.104  -10.734 14.135  1.00 26.44 ? 462 ARG B CA   1 
ATOM   2171 C  C    . ARG B 1 19  ? -1.730  -10.119 14.043  1.00 26.56 ? 462 ARG B C    1 
ATOM   2172 O  O    . ARG B 1 19  ? -0.725  -10.803 14.303  1.00 26.41 ? 462 ARG B O    1 
ATOM   2173 C  CB   . ARG B 1 19  ? -3.574  -10.628 15.606  1.00 26.52 ? 462 ARG B CB   1 
ATOM   2174 C  CG   . ARG B 1 19  ? -4.011  -9.213  16.066  1.00 26.48 ? 462 ARG B CG   1 
ATOM   2175 C  CD   . ARG B 1 19  ? -4.198  -9.060  17.605  1.00 26.31 ? 462 ARG B CD   1 
ATOM   2176 N  NE   . ARG B 1 19  ? -5.552  -9.404  18.064  1.00 25.66 ? 462 ARG B NE   1 
ATOM   2177 C  CZ   . ARG B 1 19  ? -5.910  -10.557 18.643  1.00 25.61 ? 462 ARG B CZ   1 
ATOM   2178 N  NH1  . ARG B 1 19  ? -5.032  -11.532 18.865  1.00 25.59 ? 462 ARG B NH1  1 
ATOM   2179 N  NH2  . ARG B 1 19  ? -7.170  -10.741 19.014  1.00 25.28 ? 462 ARG B NH2  1 
ATOM   2180 N  N    . ILE B 1 20  ? -1.688  -8.834  13.694  1.00 26.74 ? 463 ILE B N    1 
ATOM   2181 C  CA   . ILE B 1 20  ? -0.436  -8.066  13.711  1.00 27.00 ? 463 ILE B CA   1 
ATOM   2182 C  C    . ILE B 1 20  ? -0.496  -7.033  14.863  1.00 27.24 ? 463 ILE B C    1 
ATOM   2183 O  O    . ILE B 1 20  ? -0.133  -7.354  16.012  1.00 27.51 ? 463 ILE B O    1 
ATOM   2184 C  CB   . ILE B 1 20  ? -0.159  -7.420  12.326  1.00 26.99 ? 463 ILE B CB   1 
ATOM   2185 C  CG1  . ILE B 1 20  ? -0.284  -8.465  11.189  1.00 26.96 ? 463 ILE B CG1  1 
ATOM   2186 C  CG2  . ILE B 1 20  ? 1.205   -6.737  12.329  1.00 27.18 ? 463 ILE B CG2  1 
ATOM   2187 C  CD1  . ILE B 1 20  ? 0.964   -9.340  10.928  1.00 26.43 ? 463 ILE B CD1  1 
ATOM   2188 N  N    . GLY B 1 21  ? -0.986  -5.825  14.575  1.00 27.35 ? 464 GLY B N    1 
ATOM   2189 C  CA   . GLY B 1 21  ? -1.308  -4.849  15.606  1.00 27.47 ? 464 GLY B CA   1 
ATOM   2190 C  C    . GLY B 1 21  ? -2.782  -4.444  15.561  1.00 27.58 ? 464 GLY B C    1 
ATOM   2191 O  O    . GLY B 1 21  ? -3.667  -5.274  15.301  1.00 27.68 ? 464 GLY B O    1 
ATOM   2192 N  N    . SER B 1 22  ? -3.038  -3.156  15.793  1.00 27.67 ? 465 SER B N    1 
ATOM   2193 C  CA   . SER B 1 22  ? -4.398  -2.617  15.887  1.00 27.71 ? 465 SER B CA   1 
ATOM   2194 C  C    . SER B 1 22  ? -4.647  -1.482  14.866  1.00 27.75 ? 465 SER B C    1 
ATOM   2195 O  O    . SER B 1 22  ? -3.815  -1.216  13.990  1.00 27.74 ? 465 SER B O    1 
ATOM   2196 C  CB   . SER B 1 22  ? -4.671  -2.160  17.332  1.00 27.72 ? 465 SER B CB   1 
ATOM   2197 O  OG   . SER B 1 22  ? -5.911  -2.656  17.809  1.00 27.43 ? 465 SER B OG   1 
ATOM   2198 N  N    . GLY B 1 23  ? -5.791  -0.815  14.983  1.00 27.89 ? 466 GLY B N    1 
ATOM   2199 C  CA   . GLY B 1 23  ? -6.335  -0.084  13.851  1.00 28.04 ? 466 GLY B CA   1 
ATOM   2200 C  C    . GLY B 1 23  ? -7.315  1.030   14.157  1.00 28.24 ? 466 GLY B C    1 
ATOM   2201 O  O    . GLY B 1 23  ? -7.465  1.482   15.309  1.00 28.30 ? 466 GLY B O    1 
ATOM   2202 N  N    . SER B 1 24  ? -7.979  1.474   13.089  1.00 28.44 ? 467 SER B N    1 
ATOM   2203 C  CA   . SER B 1 24  ? -8.748  2.722   13.098  1.00 28.81 ? 467 SER B CA   1 
ATOM   2204 C  C    . SER B 1 24  ? -10.174 2.536   13.620  1.00 28.67 ? 467 SER B C    1 
ATOM   2205 O  O    . SER B 1 24  ? -10.970 3.474   13.650  1.00 28.74 ? 467 SER B O    1 
ATOM   2206 C  CB   . SER B 1 24  ? -8.771  3.351   11.698  1.00 28.99 ? 467 SER B CB   1 
ATOM   2207 O  OG   . SER B 1 24  ? -9.420  4.617   11.746  1.00 30.21 ? 467 SER B OG   1 
ATOM   2208 N  N    . PHE B 1 25  ? -10.490 1.312   14.015  1.00 28.63 ? 468 PHE B N    1 
ATOM   2209 C  CA   . PHE B 1 25  ? -11.684 1.035   14.790  1.00 28.50 ? 468 PHE B CA   1 
ATOM   2210 C  C    . PHE B 1 25  ? -11.291 -0.019  15.859  1.00 28.62 ? 468 PHE B C    1 
ATOM   2211 O  O    . PHE B 1 25  ? -11.323 0.243   17.083  1.00 28.14 ? 468 PHE B O    1 
ATOM   2212 C  CB   . PHE B 1 25  ? -12.845 0.566   13.877  1.00 28.63 ? 468 PHE B CB   1 
ATOM   2213 C  CG   . PHE B 1 25  ? -12.493 0.444   12.394  1.00 28.56 ? 468 PHE B CG   1 
ATOM   2214 C  CD1  . PHE B 1 25  ? -11.717 -0.625  11.926  1.00 28.39 ? 468 PHE B CD1  1 
ATOM   2215 C  CD2  . PHE B 1 25  ? -12.979 1.368   11.461  1.00 29.28 ? 468 PHE B CD2  1 
ATOM   2216 C  CE1  . PHE B 1 25  ? -11.407 -0.761  10.557  1.00 27.91 ? 468 PHE B CE1  1 
ATOM   2217 C  CE2  . PHE B 1 25  ? -12.650 1.253   10.080  1.00 28.95 ? 468 PHE B CE2  1 
ATOM   2218 C  CZ   . PHE B 1 25  ? -11.861 0.183   9.635   1.00 28.16 ? 468 PHE B CZ   1 
ATOM   2219 N  N    . GLY B 1 26  ? -10.900 -1.196  15.355  1.00 28.76 ? 469 GLY B N    1 
ATOM   2220 C  CA   . GLY B 1 26  ? -10.238 -2.242  16.125  1.00 28.61 ? 469 GLY B CA   1 
ATOM   2221 C  C    . GLY B 1 26  ? -9.010  -2.815  15.393  1.00 28.35 ? 469 GLY B C    1 
ATOM   2222 O  O    . GLY B 1 26  ? -8.034  -2.091  15.126  1.00 28.00 ? 469 GLY B O    1 
ATOM   2223 N  N    . THR B 1 27  ? -9.099  -4.102  15.024  1.00 27.88 ? 470 THR B N    1 
ATOM   2224 C  CA   . THR B 1 27  ? -7.929  -4.947  14.718  1.00 27.32 ? 470 THR B CA   1 
ATOM   2225 C  C    . THR B 1 27  ? -7.692  -5.317  13.227  1.00 27.03 ? 470 THR B C    1 
ATOM   2226 O  O    . THR B 1 27  ? -8.641  -5.497  12.460  1.00 26.39 ? 470 THR B O    1 
ATOM   2227 C  CB   . THR B 1 27  ? -8.029  -6.244  15.567  1.00 27.31 ? 470 THR B CB   1 
ATOM   2228 O  OG1  . THR B 1 27  ? -9.408  -6.651  15.711  1.00 26.87 ? 470 THR B OG1  1 
ATOM   2229 C  CG2  . THR B 1 27  ? -7.544  -5.998  17.015  1.00 27.22 ? 470 THR B CG2  1 
ATOM   2230 N  N    . VAL B 1 28  ? -6.406  -5.427  12.858  1.00 26.76 ? 471 VAL B N    1 
ATOM   2231 C  CA   . VAL B 1 28  ? -5.958  -5.947  11.554  1.00 26.54 ? 471 VAL B CA   1 
ATOM   2232 C  C    . VAL B 1 28  ? -5.351  -7.343  11.623  1.00 26.25 ? 471 VAL B C    1 
ATOM   2233 O  O    . VAL B 1 28  ? -4.271  -7.552  12.188  1.00 26.09 ? 471 VAL B O    1 
ATOM   2234 C  CB   . VAL B 1 28  ? -4.862  -5.077  10.852  1.00 26.78 ? 471 VAL B CB   1 
ATOM   2235 C  CG1  . VAL B 1 28  ? -5.492  -4.136  9.856   1.00 26.90 ? 471 VAL B CG1  1 
ATOM   2236 C  CG2  . VAL B 1 28  ? -3.958  -4.320  11.865  1.00 27.23 ? 471 VAL B CG2  1 
ATOM   2237 N  N    . TYR B 1 29  ? -6.048  -8.283  10.996  1.00 26.10 ? 472 TYR B N    1 
ATOM   2238 C  CA   . TYR B 1 29  ? -5.548  -9.624  10.768  1.00 25.71 ? 472 TYR B CA   1 
ATOM   2239 C  C    . TYR B 1 29  ? -5.253  -9.788  9.287   1.00 25.56 ? 472 TYR B C    1 
ATOM   2240 O  O    . TYR B 1 29  ? -6.069  -9.397  8.447   1.00 25.06 ? 472 TYR B O    1 
ATOM   2241 C  CB   . TYR B 1 29  ? -6.593  -10.649 11.211  1.00 25.57 ? 472 TYR B CB   1 
ATOM   2242 C  CG   . TYR B 1 29  ? -7.001  -10.444 12.639  1.00 25.39 ? 472 TYR B CG   1 
ATOM   2243 C  CD1  . TYR B 1 29  ? -7.935  -9.479  12.970  1.00 25.40 ? 472 TYR B CD1  1 
ATOM   2244 C  CD2  . TYR B 1 29  ? -6.430  -11.181 13.666  1.00 25.09 ? 472 TYR B CD2  1 
ATOM   2245 C  CE1  . TYR B 1 29  ? -8.307  -9.265  14.264  1.00 25.03 ? 472 TYR B CE1  1 
ATOM   2246 C  CE2  . TYR B 1 29  ? -6.798  -10.965 14.978  1.00 24.78 ? 472 TYR B CE2  1 
ATOM   2247 C  CZ   . TYR B 1 29  ? -7.731  -10.003 15.263  1.00 24.69 ? 472 TYR B CZ   1 
ATOM   2248 O  OH   . TYR B 1 29  ? -8.101  -9.776  16.551  1.00 25.10 ? 472 TYR B OH   1 
ATOM   2249 N  N    . LYS B 1 30  ? -4.065  -10.331 8.990   1.00 25.64 ? 473 LYS B N    1 
ATOM   2250 C  CA   . LYS B 1 30  ? -3.743  -10.963 7.694   1.00 25.35 ? 473 LYS B CA   1 
ATOM   2251 C  C    . LYS B 1 30  ? -4.874  -11.904 7.269   1.00 25.31 ? 473 LYS B C    1 
ATOM   2252 O  O    . LYS B 1 30  ? -5.737  -12.242 8.076   1.00 25.50 ? 473 LYS B O    1 
ATOM   2253 C  CB   . LYS B 1 30  ? -2.444  -11.761 7.817   1.00 25.02 ? 473 LYS B CB   1 
ATOM   2254 C  CG   . LYS B 1 30  ? -1.868  -12.247 6.519   1.00 24.62 ? 473 LYS B CG   1 
ATOM   2255 C  CD   . LYS B 1 30  ? -0.391  -12.543 6.664   1.00 24.92 ? 473 LYS B CD   1 
ATOM   2256 C  CE   . LYS B 1 30  ? 0.285   -12.763 5.325   1.00 25.21 ? 473 LYS B CE   1 
ATOM   2257 N  NZ   . LYS B 1 30  ? 1.760   -12.551 5.409   1.00 25.41 ? 473 LYS B NZ   1 
ATOM   2258 N  N    . GLY B 1 31  ? -4.886  -12.305 6.002   1.00 25.33 ? 474 GLY B N    1 
ATOM   2259 C  CA   . GLY B 1 31  ? -5.952  -13.149 5.472   1.00 25.01 ? 474 GLY B CA   1 
ATOM   2260 C  C    . GLY B 1 31  ? -5.611  -13.818 4.154   1.00 24.82 ? 474 GLY B C    1 
ATOM   2261 O  O    . GLY B 1 31  ? -4.474  -13.771 3.678   1.00 24.45 ? 474 GLY B O    1 
ATOM   2262 N  N    . LYS B 1 32  ? -6.615  -14.465 3.580   1.00 24.77 ? 475 LYS B N    1 
ATOM   2263 C  CA   . LYS B 1 32  ? -6.482  -15.171 2.318   1.00 24.94 ? 475 LYS B CA   1 
ATOM   2264 C  C    . LYS B 1 32  ? -7.757  -14.923 1.534   1.00 24.91 ? 475 LYS B C    1 
ATOM   2265 O  O    . LYS B 1 32  ? -8.822  -15.432 1.871   1.00 25.06 ? 475 LYS B O    1 
ATOM   2266 C  CB   . LYS B 1 32  ? -6.272  -16.681 2.525   1.00 25.19 ? 475 LYS B CB   1 
ATOM   2267 C  CG   . LYS B 1 32  ? -4.805  -17.123 2.753   1.00 25.96 ? 475 LYS B CG   1 
ATOM   2268 C  CD   . LYS B 1 32  ? -4.121  -17.692 1.486   1.00 26.63 ? 475 LYS B CD   1 
ATOM   2269 C  CE   . LYS B 1 32  ? -2.627  -18.040 1.724   1.00 26.70 ? 475 LYS B CE   1 
ATOM   2270 N  NZ   . LYS B 1 32  ? -1.703  -17.629 0.610   1.00 25.88 ? 475 LYS B NZ   1 
ATOM   2271 N  N    . TRP B 1 33  ? -7.643  -14.073 0.525   1.00 24.87 ? 476 TRP B N    1 
ATOM   2272 C  CA   . TRP B 1 33  ? -8.685  -13.882 -0.451  1.00 24.65 ? 476 TRP B CA   1 
ATOM   2273 C  C    . TRP B 1 33  ? -8.022  -13.598 -1.819  1.00 24.47 ? 476 TRP B C    1 
ATOM   2274 O  O    . TRP B 1 33  ? -7.524  -12.499 -2.086  1.00 24.43 ? 476 TRP B O    1 
ATOM   2275 C  CB   . TRP B 1 33  ? -9.578  -12.760 0.023   1.00 24.68 ? 476 TRP B CB   1 
ATOM   2276 C  CG   . TRP B 1 33  ? -10.692 -12.444 -0.872  1.00 24.94 ? 476 TRP B CG   1 
ATOM   2277 C  CD1  . TRP B 1 33  ? -11.886 -13.107 -0.980  1.00 24.96 ? 476 TRP B CD1  1 
ATOM   2278 C  CD2  . TRP B 1 33  ? -10.753 -11.349 -1.780  1.00 24.41 ? 476 TRP B CD2  1 
ATOM   2279 N  NE1  . TRP B 1 33  ? -12.683 -12.488 -1.915  1.00 25.14 ? 476 TRP B NE1  1 
ATOM   2280 C  CE2  . TRP B 1 33  ? -12.012 -11.402 -2.420  1.00 24.95 ? 476 TRP B CE2  1 
ATOM   2281 C  CE3  . TRP B 1 33  ? -9.866  -10.327 -2.128  1.00 24.34 ? 476 TRP B CE3  1 
ATOM   2282 C  CZ2  . TRP B 1 33  ? -12.399 -10.473 -3.397  1.00 25.56 ? 476 TRP B CZ2  1 
ATOM   2283 C  CZ3  . TRP B 1 33  ? -10.250 -9.399  -3.094  1.00 25.13 ? 476 TRP B CZ3  1 
ATOM   2284 C  CH2  . TRP B 1 33  ? -11.505 -9.483  -3.722  1.00 25.26 ? 476 TRP B CH2  1 
ATOM   2285 N  N    . HIS B 1 34  ? -8.010  -14.643 -2.649  1.00 24.19 ? 477 HIS B N    1 
ATOM   2286 C  CA   . HIS B 1 34  ? -7.379  -14.682 -3.972  1.00 23.77 ? 477 HIS B CA   1 
ATOM   2287 C  C    . HIS B 1 34  ? -5.880  -14.470 -3.895  1.00 23.68 ? 477 HIS B C    1 
ATOM   2288 O  O    . HIS B 1 34  ? -5.271  -13.944 -4.825  1.00 23.55 ? 477 HIS B O    1 
ATOM   2289 C  CB   . HIS B 1 34  ? -8.066  -13.729 -4.940  1.00 23.55 ? 477 HIS B CB   1 
ATOM   2290 C  CG   . HIS B 1 34  ? -9.478  -14.119 -5.242  1.00 23.05 ? 477 HIS B CG   1 
ATOM   2291 N  ND1  . HIS B 1 34  ? -9.805  -15.330 -5.814  1.00 22.57 ? 477 HIS B ND1  1 
ATOM   2292 C  CD2  . HIS B 1 34  ? -10.648 -13.470 -5.037  1.00 22.21 ? 477 HIS B CD2  1 
ATOM   2293 C  CE1  . HIS B 1 34  ? -11.116 -15.405 -5.957  1.00 22.59 ? 477 HIS B CE1  1 
ATOM   2294 N  NE2  . HIS B 1 34  ? -11.650 -14.289 -5.494  1.00 22.42 ? 477 HIS B NE2  1 
ATOM   2295 N  N    . GLY B 1 35  ? -5.306  -14.972 -2.801  1.00 23.51 ? 478 GLY B N    1 
ATOM   2296 C  CA   . GLY B 1 35  ? -3.953  -14.669 -2.375  1.00 23.64 ? 478 GLY B CA   1 
ATOM   2297 C  C    . GLY B 1 35  ? -4.017  -13.934 -1.045  1.00 23.76 ? 478 GLY B C    1 
ATOM   2298 O  O    . GLY B 1 35  ? -5.078  -13.764 -0.476  1.00 23.52 ? 478 GLY B O    1 
ATOM   2299 N  N    . ASP B 1 36  ? -2.880  -13.464 -0.562  1.00 24.03 ? 479 ASP B N    1 
ATOM   2300 C  CA   . ASP B 1 36  ? -2.834  -12.716 0.689   1.00 24.29 ? 479 ASP B CA   1 
ATOM   2301 C  C    . ASP B 1 36  ? -3.616  -11.367 0.676   1.00 24.83 ? 479 ASP B C    1 
ATOM   2302 O  O    . ASP B 1 36  ? -3.602  -10.620 -0.312  1.00 24.40 ? 479 ASP B O    1 
ATOM   2303 C  CB   . ASP B 1 36  ? -1.378  -12.444 1.088   1.00 24.18 ? 479 ASP B CB   1 
ATOM   2304 C  CG   . ASP B 1 36  ? -0.524  -13.685 1.082   1.00 23.13 ? 479 ASP B CG   1 
ATOM   2305 O  OD1  . ASP B 1 36  ? -0.846  -14.650 1.802   1.00 22.77 ? 479 ASP B OD1  1 
ATOM   2306 O  OD2  . ASP B 1 36  ? 0.499   -13.775 0.386   1.00 22.73 ? 479 ASP B OD2  1 
ATOM   2307 N  N    . VAL B 1 37  ? -4.291  -11.084 1.794   1.00 25.26 ? 480 VAL B N    1 
ATOM   2308 C  CA   . VAL B 1 37  ? -4.886  -9.771  2.063   1.00 25.67 ? 480 VAL B CA   1 
ATOM   2309 C  C    . VAL B 1 37  ? -4.512  -9.277  3.476   1.00 26.02 ? 480 VAL B C    1 
ATOM   2310 O  O    . VAL B 1 37  ? -3.729  -9.922  4.181   1.00 26.21 ? 480 VAL B O    1 
ATOM   2311 C  CB   . VAL B 1 37  ? -6.440  -9.779  1.921   1.00 25.56 ? 480 VAL B CB   1 
ATOM   2312 C  CG1  . VAL B 1 37  ? -6.822  -9.967  0.504   1.00 25.56 ? 480 VAL B CG1  1 
ATOM   2313 C  CG2  . VAL B 1 37  ? -7.075  -10.847 2.794   1.00 25.30 ? 480 VAL B CG2  1 
ATOM   2314 N  N    . ALA B 1 38  ? -5.054  -8.112  3.843   1.00 26.04 ? 481 ALA B N    1 
ATOM   2315 C  CA   . ALA B 1 38  ? -5.072  -7.595  5.212   1.00 25.92 ? 481 ALA B CA   1 
ATOM   2316 C  C    . ALA B 1 38  ? -6.482  -7.053  5.483   1.00 26.24 ? 481 ALA B C    1 
ATOM   2317 O  O    . ALA B 1 38  ? -6.895  -6.088  4.839   1.00 26.60 ? 481 ALA B O    1 
ATOM   2318 C  CB   . ALA B 1 38  ? -4.058  -6.478  5.358   1.00 25.75 ? 481 ALA B CB   1 
ATOM   2319 N  N    . VAL B 1 39  ? -7.239  -7.663  6.399   1.00 26.30 ? 482 VAL B N    1 
ATOM   2320 C  CA   . VAL B 1 39  ? -8.567  -7.128  6.753   1.00 26.30 ? 482 VAL B CA   1 
ATOM   2321 C  C    . VAL B 1 39  ? -8.490  -6.318  8.054   1.00 26.54 ? 482 VAL B C    1 
ATOM   2322 O  O    . VAL B 1 39  ? -7.994  -6.817  9.065   1.00 26.48 ? 482 VAL B O    1 
ATOM   2323 C  CB   . VAL B 1 39  ? -9.666  -8.235  6.886   1.00 26.21 ? 482 VAL B CB   1 
ATOM   2324 C  CG1  . VAL B 1 39  ? -11.045 -7.636  6.685   1.00 26.11 ? 482 VAL B CG1  1 
ATOM   2325 C  CG2  . VAL B 1 39  ? -9.463  -9.347  5.889   1.00 25.74 ? 482 VAL B CG2  1 
ATOM   2326 N  N    . LYS B 1 40  ? -8.969  -5.072  8.015   1.00 26.71 ? 483 LYS B N    1 
ATOM   2327 C  CA   . LYS B 1 40  ? -9.014  -4.199  9.195   1.00 26.86 ? 483 LYS B CA   1 
ATOM   2328 C  C    . LYS B 1 40  ? -10.434 -4.320  9.711   1.00 27.16 ? 483 LYS B C    1 
ATOM   2329 O  O    . LYS B 1 40  ? -11.339 -3.673  9.188   1.00 27.73 ? 483 LYS B O    1 
ATOM   2330 C  CB   . LYS B 1 40  ? -8.678  -2.734  8.846   1.00 26.71 ? 483 LYS B CB   1 
ATOM   2331 C  CG   . LYS B 1 40  ? -8.060  -1.906  10.008  1.00 26.57 ? 483 LYS B CG   1 
ATOM   2332 C  CD   . LYS B 1 40  ? -8.559  -0.424  10.097  1.00 26.85 ? 483 LYS B CD   1 
ATOM   2333 C  CE   . LYS B 1 40  ? -7.580  0.670   9.552   1.00 26.70 ? 483 LYS B CE   1 
ATOM   2334 N  NZ   . LYS B 1 40  ? -6.446  1.076   10.430  1.00 25.93 ? 483 LYS B NZ   1 
ATOM   2335 N  N    . MET B 1 41  ? -10.633 -5.165  10.718  1.00 26.96 ? 484 MET B N    1 
ATOM   2336 C  CA   . MET B 1 41  ? -11.973 -5.542  11.127  1.00 26.89 ? 484 MET B CA   1 
ATOM   2337 C  C    . MET B 1 41  ? -12.288 -5.106  12.540  1.00 27.00 ? 484 MET B C    1 
ATOM   2338 O  O    . MET B 1 41  ? -11.402 -4.748  13.314  1.00 27.16 ? 484 MET B O    1 
ATOM   2339 C  CB   . MET B 1 41  ? -12.162 -7.062  10.996  1.00 26.92 ? 484 MET B CB   1 
ATOM   2340 C  CG   . MET B 1 41  ? -11.348 -7.910  11.995  1.00 26.58 ? 484 MET B CG   1 
ATOM   2341 S  SD   . MET B 1 41  ? -10.727 -9.417  11.253  1.00 26.17 ? 484 MET B SD   1 
ATOM   2342 C  CE   . MET B 1 41  ? -12.264 -10.080 10.519  1.00 25.87 ? 484 MET B CE   1 
ATOM   2343 N  N    . LEU B 1 42  ? -13.574 -5.188  12.860  1.00 26.91 ? 485 LEU B N    1 
ATOM   2344 C  CA   . LEU B 1 42  ? -14.098 -4.766  14.139  1.00 26.69 ? 485 LEU B CA   1 
ATOM   2345 C  C    . LEU B 1 42  ? -14.285 -5.967  15.037  1.00 26.61 ? 485 LEU B C    1 
ATOM   2346 O  O    . LEU B 1 42  ? -13.919 -7.094  14.701  1.00 26.93 ? 485 LEU B O    1 
ATOM   2347 C  CB   . LEU B 1 42  ? -15.448 -4.046  13.940  1.00 26.69 ? 485 LEU B CB   1 
ATOM   2348 C  CG   . LEU B 1 42  ? -15.385 -2.518  13.831  1.00 26.38 ? 485 LEU B CG   1 
ATOM   2349 C  CD1  . LEU B 1 42  ? -14.719 -1.918  15.066  1.00 25.65 ? 485 LEU B CD1  1 
ATOM   2350 C  CD2  . LEU B 1 42  ? -14.661 -2.115  12.555  1.00 25.67 ? 485 LEU B CD2  1 
ATOM   2351 N  N    . ASN B 1 43  ? -14.848 -5.688  16.200  1.00 26.38 ? 486 ASN B N    1 
ATOM   2352 C  CA   . ASN B 1 43  ? -15.358 -6.696  17.098  1.00 26.09 ? 486 ASN B CA   1 
ATOM   2353 C  C    . ASN B 1 43  ? -16.439 -5.976  17.909  1.00 25.82 ? 486 ASN B C    1 
ATOM   2354 O  O    . ASN B 1 43  ? -16.309 -5.808  19.129  1.00 25.78 ? 486 ASN B O    1 
ATOM   2355 C  CB   . ASN B 1 43  ? -14.218 -7.214  17.960  1.00 26.09 ? 486 ASN B CB   1 
ATOM   2356 C  CG   . ASN B 1 43  ? -13.266 -6.104  18.362  1.00 27.07 ? 486 ASN B CG   1 
ATOM   2357 O  OD1  . ASN B 1 43  ? -12.272 -5.821  17.667  1.00 29.19 ? 486 ASN B OD1  1 
ATOM   2358 N  ND2  . ASN B 1 43  ? -13.595 -5.422  19.458  1.00 27.18 ? 486 ASN B ND2  1 
ATOM   2359 N  N    . VAL B 1 44  ? -17.483 -5.522  17.205  1.00 25.46 ? 487 VAL B N    1 
ATOM   2360 C  CA   . VAL B 1 44  ? -18.565 -4.719  17.798  1.00 25.53 ? 487 VAL B CA   1 
ATOM   2361 C  C    . VAL B 1 44  ? -19.969 -5.319  17.526  1.00 25.54 ? 487 VAL B C    1 
ATOM   2362 O  O    . VAL B 1 44  ? -20.409 -5.342  16.388  1.00 25.85 ? 487 VAL B O    1 
ATOM   2363 C  CB   . VAL B 1 44  ? -18.499 -3.221  17.335  1.00 25.42 ? 487 VAL B CB   1 
ATOM   2364 C  CG1  . VAL B 1 44  ? -17.214 -2.553  17.834  1.00 25.16 ? 487 VAL B CG1  1 
ATOM   2365 C  CG2  . VAL B 1 44  ? -18.634 -3.075  15.824  1.00 25.31 ? 487 VAL B CG2  1 
ATOM   2366 N  N    . THR B 1 45  ? -20.664 -5.799  18.568  1.00 25.54 ? 488 THR B N    1 
ATOM   2367 C  CA   . THR B 1 45  ? -21.952 -6.500  18.399  1.00 25.39 ? 488 THR B CA   1 
ATOM   2368 C  C    . THR B 1 45  ? -22.756 -5.890  17.245  1.00 25.51 ? 488 THR B C    1 
ATOM   2369 O  O    . THR B 1 45  ? -23.009 -6.564  16.240  1.00 25.49 ? 488 THR B O    1 
ATOM   2370 C  CB   . THR B 1 45  ? -22.770 -6.537  19.732  1.00 25.30 ? 488 THR B CB   1 
ATOM   2371 O  OG1  . THR B 1 45  ? -22.346 -7.647  20.533  1.00 25.03 ? 488 THR B OG1  1 
ATOM   2372 C  CG2  . THR B 1 45  ? -24.253 -6.847  19.500  1.00 25.12 ? 488 THR B CG2  1 
ATOM   2373 N  N    . ALA B 1 46  ? -23.150 -4.625  17.393  1.00 25.55 ? 489 ALA B N    1 
ATOM   2374 C  CA   . ALA B 1 46  ? -23.642 -3.815  16.270  1.00 25.64 ? 489 ALA B CA   1 
ATOM   2375 C  C    . ALA B 1 46  ? -22.969 -2.431  16.308  1.00 25.73 ? 489 ALA B C    1 
ATOM   2376 O  O    . ALA B 1 46  ? -23.005 -1.779  17.355  1.00 26.29 ? 489 ALA B O    1 
ATOM   2377 C  CB   . ALA B 1 46  ? -25.163 -3.675  16.329  1.00 25.48 ? 489 ALA B CB   1 
ATOM   2378 N  N    . PRO B 1 47  ? -22.381 -1.960  15.203  1.00 25.48 ? 490 PRO B N    1 
ATOM   2379 C  CA   . PRO B 1 47  ? -21.648 -0.687  15.244  1.00 25.44 ? 490 PRO B CA   1 
ATOM   2380 C  C    . PRO B 1 47  ? -22.597 0.508   15.390  1.00 25.43 ? 490 PRO B C    1 
ATOM   2381 O  O    . PRO B 1 47  ? -23.762 0.407   14.980  1.00 25.39 ? 490 PRO B O    1 
ATOM   2382 C  CB   . PRO B 1 47  ? -20.899 -0.643  13.898  1.00 25.59 ? 490 PRO B CB   1 
ATOM   2383 C  CG   . PRO B 1 47  ? -21.288 -1.881  13.119  1.00 25.26 ? 490 PRO B CG   1 
ATOM   2384 C  CD   . PRO B 1 47  ? -22.397 -2.544  13.848  1.00 25.50 ? 490 PRO B CD   1 
ATOM   2385 N  N    . THR B 1 48  ? -22.102 1.613   15.954  1.00 25.30 ? 491 THR B N    1 
ATOM   2386 C  CA   . THR B 1 48  ? -22.947 2.782   16.276  1.00 25.07 ? 491 THR B CA   1 
ATOM   2387 C  C    . THR B 1 48  ? -23.312 3.539   14.988  1.00 24.83 ? 491 THR B C    1 
ATOM   2388 O  O    . THR B 1 48  ? -22.723 3.267   13.950  1.00 24.42 ? 491 THR B O    1 
ATOM   2389 C  CB   . THR B 1 48  ? -22.280 3.755   17.350  1.00 25.09 ? 491 THR B CB   1 
ATOM   2390 O  OG1  . THR B 1 48  ? -21.676 4.882   16.709  1.00 25.04 ? 491 THR B OG1  1 
ATOM   2391 C  CG2  . THR B 1 48  ? -21.108 3.122   18.130  1.00 24.82 ? 491 THR B CG2  1 
ATOM   2392 N  N    . PRO B 1 49  ? -24.281 4.460   15.038  1.00 24.75 ? 492 PRO B N    1 
ATOM   2393 C  CA   . PRO B 1 49  ? -24.640 5.266   13.858  1.00 24.73 ? 492 PRO B CA   1 
ATOM   2394 C  C    . PRO B 1 49  ? -23.496 6.145   13.347  1.00 24.63 ? 492 PRO B C    1 
ATOM   2395 O  O    . PRO B 1 49  ? -23.383 6.385   12.131  1.00 23.82 ? 492 PRO B O    1 
ATOM   2396 C  CB   . PRO B 1 49  ? -25.811 6.129   14.359  1.00 24.78 ? 492 PRO B CB   1 
ATOM   2397 C  CG   . PRO B 1 49  ? -26.350 5.403   15.541  1.00 24.82 ? 492 PRO B CG   1 
ATOM   2398 C  CD   . PRO B 1 49  ? -25.136 4.792   16.191  1.00 24.91 ? 492 PRO B CD   1 
ATOM   2399 N  N    . GLN B 1 50  ? -22.666 6.598   14.292  1.00 24.86 ? 493 GLN B N    1 
ATOM   2400 C  CA   . GLN B 1 50  ? -21.457 7.386   14.007  1.00 25.06 ? 493 GLN B CA   1 
ATOM   2401 C  C    . GLN B 1 50  ? -20.214 6.504   13.664  1.00 25.45 ? 493 GLN B C    1 
ATOM   2402 O  O    . GLN B 1 50  ? -19.224 6.999   13.102  1.00 25.74 ? 493 GLN B O    1 
ATOM   2403 C  CB   . GLN B 1 50  ? -21.132 8.392   15.138  1.00 24.80 ? 493 GLN B CB   1 
ATOM   2404 C  CG   . GLN B 1 50  ? -21.849 8.238   16.488  1.00 24.59 ? 493 GLN B CG   1 
ATOM   2405 C  CD   . GLN B 1 50  ? -20.953 7.668   17.575  1.00 24.37 ? 493 GLN B CD   1 
ATOM   2406 O  OE1  . GLN B 1 50  ? -21.054 6.490   17.918  1.00 23.68 ? 493 GLN B OE1  1 
ATOM   2407 N  NE2  . GLN B 1 50  ? -20.077 8.504   18.121  1.00 24.05 ? 493 GLN B NE2  1 
ATOM   2408 N  N    . GLN B 1 51  ? -20.270 5.216   14.004  1.00 25.70 ? 494 GLN B N    1 
ATOM   2409 C  CA   . GLN B 1 51  ? -19.302 4.225   13.514  1.00 26.01 ? 494 GLN B CA   1 
ATOM   2410 C  C    . GLN B 1 51  ? -19.697 3.730   12.096  1.00 25.86 ? 494 GLN B C    1 
ATOM   2411 O  O    . GLN B 1 51  ? -18.889 3.111   11.397  1.00 25.63 ? 494 GLN B O    1 
ATOM   2412 C  CB   . GLN B 1 51  ? -19.179 3.040   14.501  1.00 26.24 ? 494 GLN B CB   1 
ATOM   2413 C  CG   . GLN B 1 51  ? -17.743 2.758   15.045  1.00 26.75 ? 494 GLN B CG   1 
ATOM   2414 C  CD   . GLN B 1 51  ? -17.577 1.308   15.548  1.00 27.18 ? 494 GLN B CD   1 
ATOM   2415 O  OE1  . GLN B 1 51  ? -17.865 0.988   16.725  1.00 25.63 ? 494 GLN B OE1  1 
ATOM   2416 N  NE2  . GLN B 1 51  ? -17.128 0.430   14.649  1.00 26.36 ? 494 GLN B NE2  1 
ATOM   2417 N  N    . LEU B 1 52  ? -20.932 4.041   11.686  1.00 25.74 ? 495 LEU B N    1 
ATOM   2418 C  CA   . LEU B 1 52  ? -21.476 3.698   10.361  1.00 25.68 ? 495 LEU B CA   1 
ATOM   2419 C  C    . LEU B 1 52  ? -21.144 4.794   9.355   1.00 25.44 ? 495 LEU B C    1 
ATOM   2420 O  O    . LEU B 1 52  ? -21.672 4.792   8.246   1.00 25.34 ? 495 LEU B O    1 
ATOM   2421 C  CB   . LEU B 1 52  ? -23.011 3.547   10.444  1.00 25.82 ? 495 LEU B CB   1 
ATOM   2422 C  CG   . LEU B 1 52  ? -23.872 2.622   9.549   1.00 25.56 ? 495 LEU B CG   1 
ATOM   2423 C  CD1  . LEU B 1 52  ? -23.077 1.680   8.663   1.00 25.65 ? 495 LEU B CD1  1 
ATOM   2424 C  CD2  . LEU B 1 52  ? -24.840 1.833   10.438  1.00 24.98 ? 495 LEU B CD2  1 
ATOM   2425 N  N    . GLN B 1 53  ? -20.314 5.746   9.773   1.00 25.11 ? 496 GLN B N    1 
ATOM   2426 C  CA   . GLN B 1 53  ? -19.812 6.786   8.902   1.00 25.16 ? 496 GLN B CA   1 
ATOM   2427 C  C    . GLN B 1 53  ? -18.293 6.796   8.847   1.00 25.31 ? 496 GLN B C    1 
ATOM   2428 O  O    . GLN B 1 53  ? -17.732 7.218   7.839   1.00 25.38 ? 496 GLN B O    1 
ATOM   2429 C  CB   . GLN B 1 53  ? -20.299 8.146   9.376   1.00 25.22 ? 496 GLN B CB   1 
ATOM   2430 C  CG   . GLN B 1 53  ? -21.694 8.482   8.936   1.00 25.27 ? 496 GLN B CG   1 
ATOM   2431 C  CD   . GLN B 1 53  ? -21.764 8.818   7.483   1.00 25.56 ? 496 GLN B CD   1 
ATOM   2432 O  OE1  . GLN B 1 53  ? -20.740 8.820   6.790   1.00 27.13 ? 496 GLN B OE1  1 
ATOM   2433 N  NE2  . GLN B 1 53  ? -22.970 9.105   7.000   1.00 25.55 ? 496 GLN B NE2  1 
ATOM   2434 N  N    . ALA B 1 54  ? -17.618 6.380   9.921   1.00 25.57 ? 497 ALA B N    1 
ATOM   2435 C  CA   . ALA B 1 54  ? -16.145 6.278   9.894   1.00 25.80 ? 497 ALA B CA   1 
ATOM   2436 C  C    . ALA B 1 54  ? -15.774 5.388   8.724   1.00 25.81 ? 497 ALA B C    1 
ATOM   2437 O  O    . ALA B 1 54  ? -14.960 5.744   7.885   1.00 25.67 ? 497 ALA B O    1 
ATOM   2438 C  CB   . ALA B 1 54  ? -15.613 5.687   11.188  1.00 25.90 ? 497 ALA B CB   1 
ATOM   2439 N  N    . PHE B 1 55  ? -16.427 4.228   8.707   1.00 25.81 ? 498 PHE B N    1 
ATOM   2440 C  CA   . PHE B 1 55  ? -16.509 3.317   7.577   1.00 25.48 ? 498 PHE B CA   1 
ATOM   2441 C  C    . PHE B 1 55  ? -16.783 4.008   6.226   1.00 25.52 ? 498 PHE B C    1 
ATOM   2442 O  O    . PHE B 1 55  ? -15.881 4.091   5.384   1.00 24.96 ? 498 PHE B O    1 
ATOM   2443 C  CB   . PHE B 1 55  ? -17.631 2.328   7.898   1.00 25.41 ? 498 PHE B CB   1 
ATOM   2444 C  CG   . PHE B 1 55  ? -17.715 1.173   6.966   1.00 24.94 ? 498 PHE B CG   1 
ATOM   2445 C  CD1  . PHE B 1 55  ? -16.958 0.042   7.192   1.00 24.76 ? 498 PHE B CD1  1 
ATOM   2446 C  CD2  . PHE B 1 55  ? -18.565 1.203   5.882   1.00 23.85 ? 498 PHE B CD2  1 
ATOM   2447 C  CE1  . PHE B 1 55  ? -17.052 -1.038  6.367   1.00 23.88 ? 498 PHE B CE1  1 
ATOM   2448 C  CE2  . PHE B 1 55  ? -18.655 0.133   5.055   1.00 23.74 ? 498 PHE B CE2  1 
ATOM   2449 C  CZ   . PHE B 1 55  ? -17.895 -0.997  5.303   1.00 24.19 ? 498 PHE B CZ   1 
ATOM   2450 N  N    . LYS B 1 56  ? -18.018 4.504   6.049   1.00 25.69 ? 499 LYS B N    1 
ATOM   2451 C  CA   . LYS B 1 56  ? -18.501 5.049   4.772   1.00 26.01 ? 499 LYS B CA   1 
ATOM   2452 C  C    . LYS B 1 56  ? -17.464 5.989   4.161   1.00 26.37 ? 499 LYS B C    1 
ATOM   2453 O  O    . LYS B 1 56  ? -16.847 5.655   3.147   1.00 26.66 ? 499 LYS B O    1 
ATOM   2454 C  CB   . LYS B 1 56  ? -19.820 5.830   4.946   1.00 25.86 ? 499 LYS B CB   1 
ATOM   2455 C  CG   . LYS B 1 56  ? -21.098 4.993   4.990   1.00 26.22 ? 499 LYS B CG   1 
ATOM   2456 C  CD   . LYS B 1 56  ? -22.317 5.882   5.381   1.00 26.28 ? 499 LYS B CD   1 
ATOM   2457 C  CE   . LYS B 1 56  ? -23.697 5.268   5.042   1.00 25.03 ? 499 LYS B CE   1 
ATOM   2458 N  NZ   . LYS B 1 56  ? -24.830 6.163   5.479   1.00 24.23 ? 499 LYS B NZ   1 
ATOM   2459 N  N    . ASN B 1 57  ? -17.284 7.150   4.796   1.00 26.48 ? 500 ASN B N    1 
ATOM   2460 C  CA   . ASN B 1 57  ? -16.420 8.202   4.293   1.00 26.71 ? 500 ASN B CA   1 
ATOM   2461 C  C    . ASN B 1 57  ? -15.066 7.632   3.843   1.00 27.00 ? 500 ASN B C    1 
ATOM   2462 O  O    . ASN B 1 57  ? -14.642 7.866   2.719   1.00 26.69 ? 500 ASN B O    1 
ATOM   2463 C  CB   . ASN B 1 57  ? -16.244 9.306   5.359   1.00 26.69 ? 500 ASN B CB   1 
ATOM   2464 C  CG   . ASN B 1 57  ? -17.407 10.342  5.364   1.00 27.67 ? 500 ASN B CG   1 
ATOM   2465 O  OD1  . ASN B 1 57  ? -18.400 10.201  4.625   1.00 28.84 ? 500 ASN B OD1  1 
ATOM   2466 N  ND2  . ASN B 1 57  ? -17.277 11.391  6.208   1.00 26.41 ? 500 ASN B ND2  1 
ATOM   2467 N  N    . GLU B 1 58  ? -14.438 6.853   4.727   1.00 27.30 ? 501 GLU B N    1 
ATOM   2468 C  CA   . GLU B 1 58  ? -13.138 6.201   4.505   1.00 27.24 ? 501 GLU B CA   1 
ATOM   2469 C  C    . GLU B 1 58  ? -13.164 5.157   3.358   1.00 27.40 ? 501 GLU B C    1 
ATOM   2470 O  O    . GLU B 1 58  ? -12.103 4.696   2.884   1.00 27.12 ? 501 GLU B O    1 
ATOM   2471 C  CB   . GLU B 1 58  ? -12.676 5.538   5.825   1.00 27.40 ? 501 GLU B CB   1 
ATOM   2472 C  CG   . GLU B 1 58  ? -12.059 6.518   6.849   1.00 28.53 ? 501 GLU B CG   1 
ATOM   2473 C  CD   . GLU B 1 58  ? -12.312 6.230   8.356   1.00 29.09 ? 501 GLU B CD   1 
ATOM   2474 O  OE1  . GLU B 1 58  ? -12.053 5.098   8.863   1.00 30.25 ? 501 GLU B OE1  1 
ATOM   2475 O  OE2  . GLU B 1 58  ? -12.729 7.183   9.068   1.00 27.73 ? 501 GLU B OE2  1 
ATOM   2476 N  N    . VAL B 1 59  ? -14.372 4.771   2.931   1.00 27.06 ? 502 VAL B N    1 
ATOM   2477 C  CA   . VAL B 1 59  ? -14.538 3.858   1.792   1.00 26.93 ? 502 VAL B CA   1 
ATOM   2478 C  C    . VAL B 1 59  ? -14.951 4.558   0.499   1.00 27.00 ? 502 VAL B C    1 
ATOM   2479 O  O    . VAL B 1 59  ? -14.913 3.957   -0.584  1.00 27.25 ? 502 VAL B O    1 
ATOM   2480 C  CB   . VAL B 1 59  ? -15.515 2.717   2.118   1.00 26.68 ? 502 VAL B CB   1 
ATOM   2481 C  CG1  . VAL B 1 59  ? -16.746 2.691   1.166   1.00 25.89 ? 502 VAL B CG1  1 
ATOM   2482 C  CG2  . VAL B 1 59  ? -14.741 1.387   2.106   1.00 26.49 ? 502 VAL B CG2  1 
ATOM   2483 N  N    . GLY B 1 60  ? -15.379 5.806   0.616   1.00 26.61 ? 503 GLY B N    1 
ATOM   2484 C  CA   . GLY B 1 60  ? -15.572 6.632   -0.542  1.00 26.36 ? 503 GLY B CA   1 
ATOM   2485 C  C    . GLY B 1 60  ? -14.182 6.997   -0.985  1.00 26.30 ? 503 GLY B C    1 
ATOM   2486 O  O    . GLY B 1 60  ? -13.815 6.783   -2.136  1.00 26.37 ? 503 GLY B O    1 
ATOM   2487 N  N    . VAL B 1 61  ? -13.401 7.512   -0.041  1.00 26.10 ? 504 VAL B N    1 
ATOM   2488 C  CA   . VAL B 1 61  ? -12.094 8.101   -0.326  1.00 26.20 ? 504 VAL B CA   1 
ATOM   2489 C  C    . VAL B 1 61  ? -11.082 7.055   -0.739  1.00 26.42 ? 504 VAL B C    1 
ATOM   2490 O  O    . VAL B 1 61  ? -10.170 7.343   -1.508  1.00 26.30 ? 504 VAL B O    1 
ATOM   2491 C  CB   . VAL B 1 61  ? -11.521 8.915   0.869   1.00 26.10 ? 504 VAL B CB   1 
ATOM   2492 C  CG1  . VAL B 1 61  ? -12.500 10.011  1.284   1.00 26.99 ? 504 VAL B CG1  1 
ATOM   2493 C  CG2  . VAL B 1 61  ? -11.163 8.023   2.061   1.00 25.58 ? 504 VAL B CG2  1 
ATOM   2494 N  N    . LEU B 1 62  ? -11.240 5.839   -0.233  1.00 26.88 ? 505 LEU B N    1 
ATOM   2495 C  CA   . LEU B 1 62  ? -10.365 4.752   -0.654  1.00 26.76 ? 505 LEU B CA   1 
ATOM   2496 C  C    . LEU B 1 62  ? -10.702 4.297   -2.069  1.00 26.51 ? 505 LEU B C    1 
ATOM   2497 O  O    . LEU B 1 62  ? -9.800  4.001   -2.848  1.00 26.21 ? 505 LEU B O    1 
ATOM   2498 C  CB   . LEU B 1 62  ? -10.456 3.578   0.315   1.00 26.96 ? 505 LEU B CB   1 
ATOM   2499 C  CG   . LEU B 1 62  ? -9.496  3.667   1.510   1.00 27.26 ? 505 LEU B CG   1 
ATOM   2500 C  CD1  . LEU B 1 62  ? -9.711  2.449   2.395   1.00 27.16 ? 505 LEU B CD1  1 
ATOM   2501 C  CD2  . LEU B 1 62  ? -8.042  3.779   1.083   1.00 27.22 ? 505 LEU B CD2  1 
ATOM   2502 N  N    . ARG B 1 63  ? -11.988 4.266   -2.415  1.00 26.17 ? 506 ARG B N    1 
ATOM   2503 C  CA   . ARG B 1 63  ? -12.392 3.798   -3.744  1.00 26.28 ? 506 ARG B CA   1 
ATOM   2504 C  C    . ARG B 1 63  ? -12.073 4.799   -4.880  1.00 26.60 ? 506 ARG B C    1 
ATOM   2505 O  O    . ARG B 1 63  ? -12.439 4.545   -6.051  1.00 26.90 ? 506 ARG B O    1 
ATOM   2506 C  CB   . ARG B 1 63  ? -13.864 3.367   -3.761  1.00 26.16 ? 506 ARG B CB   1 
ATOM   2507 C  CG   . ARG B 1 63  ? -14.884 4.462   -3.623  1.00 26.36 ? 506 ARG B CG   1 
ATOM   2508 C  CD   . ARG B 1 63  ? -16.301 4.002   -3.959  1.00 27.44 ? 506 ARG B CD   1 
ATOM   2509 N  NE   . ARG B 1 63  ? -16.568 4.119   -5.402  1.00 28.31 ? 506 ARG B NE   1 
ATOM   2510 C  CZ   . ARG B 1 63  ? -17.272 3.252   -6.141  1.00 26.90 ? 506 ARG B CZ   1 
ATOM   2511 N  NH1  . ARG B 1 63  ? -17.444 3.480   -7.441  1.00 25.88 ? 506 ARG B NH1  1 
ATOM   2512 N  NH2  . ARG B 1 63  ? -17.809 2.169   -5.596  1.00 27.54 ? 506 ARG B NH2  1 
ATOM   2513 N  N    . LYS B 1 64  ? -11.375 5.898   -4.523  1.00 26.12 ? 507 LYS B N    1 
ATOM   2514 C  CA   . LYS B 1 64  ? -10.955 6.957   -5.446  1.00 25.79 ? 507 LYS B CA   1 
ATOM   2515 C  C    . LYS B 1 64  ? -9.428  7.044   -5.671  1.00 25.30 ? 507 LYS B C    1 
ATOM   2516 O  O    . LYS B 1 64  ? -8.945  8.011   -6.269  1.00 24.99 ? 507 LYS B O    1 
ATOM   2517 C  CB   . LYS B 1 64  ? -11.413 8.310   -4.928  1.00 25.75 ? 507 LYS B CB   1 
ATOM   2518 C  CG   . LYS B 1 64  ? -12.902 8.450   -4.770  1.00 27.22 ? 507 LYS B CG   1 
ATOM   2519 C  CD   . LYS B 1 64  ? -13.318 9.662   -3.895  1.00 28.39 ? 507 LYS B CD   1 
ATOM   2520 C  CE   . LYS B 1 64  ? -12.257 10.762  -3.851  1.00 28.97 ? 507 LYS B CE   1 
ATOM   2521 N  NZ   . LYS B 1 64  ? -11.871 11.230  -5.239  1.00 31.36 ? 507 LYS B NZ   1 
ATOM   2522 N  N    . THR B 1 65  ? -8.686  6.031   -5.236  1.00 24.81 ? 508 THR B N    1 
ATOM   2523 C  CA   . THR B 1 65  ? -7.238  6.016   -5.401  1.00 24.54 ? 508 THR B CA   1 
ATOM   2524 C  C    . THR B 1 65  ? -6.733  4.763   -6.136  1.00 24.35 ? 508 THR B C    1 
ATOM   2525 O  O    . THR B 1 65  ? -7.284  3.692   -5.967  1.00 23.96 ? 508 THR B O    1 
ATOM   2526 C  CB   . THR B 1 65  ? -6.559  6.186   -4.020  1.00 24.60 ? 508 THR B CB   1 
ATOM   2527 O  OG1  . THR B 1 65  ? -6.596  4.952   -3.265  1.00 23.54 ? 508 THR B OG1  1 
ATOM   2528 C  CG2  . THR B 1 65  ? -7.347  7.215   -3.190  1.00 24.49 ? 508 THR B CG2  1 
ATOM   2529 N  N    . ARG B 1 66  ? -5.688  4.934   -6.956  1.00 24.09 ? 509 ARG B N    1 
ATOM   2530 C  CA   . ARG B 1 66  ? -5.099  3.875   -7.784  1.00 24.15 ? 509 ARG B CA   1 
ATOM   2531 C  C    . ARG B 1 66  ? -3.718  4.378   -8.124  1.00 23.97 ? 509 ARG B C    1 
ATOM   2532 O  O    . ARG B 1 66  ? -3.488  4.929   -9.197  1.00 24.31 ? 509 ARG B O    1 
ATOM   2533 C  CB   . ARG B 1 66  ? -5.858  3.611   -9.097  1.00 24.00 ? 509 ARG B CB   1 
ATOM   2534 C  CG   . ARG B 1 66  ? -7.270  2.998   -8.974  1.00 24.65 ? 509 ARG B CG   1 
ATOM   2535 C  CD   . ARG B 1 66  ? -8.021  2.842   -10.307 1.00 23.59 ? 509 ARG B CD   1 
ATOM   2536 N  NE   . ARG B 1 66  ? -9.032  1.794   -10.255 1.00 23.88 ? 509 ARG B NE   1 
ATOM   2537 C  CZ   . ARG B 1 66  ? -8.796  0.480   -10.196 1.00 22.43 ? 509 ARG B CZ   1 
ATOM   2538 N  NH1  . ARG B 1 66  ? -7.560  0.004   -10.183 1.00 21.63 ? 509 ARG B NH1  1 
ATOM   2539 N  NH2  . ARG B 1 66  ? -9.823  -0.364  -10.166 1.00 22.01 ? 509 ARG B NH2  1 
ATOM   2540 N  N    . HIS B 1 67  ? -2.810  4.235   -7.174  1.00 23.66 ? 510 HIS B N    1 
ATOM   2541 C  CA   . HIS B 1 67  ? -1.454  4.699   -7.344  1.00 23.11 ? 510 HIS B CA   1 
ATOM   2542 C  C    . HIS B 1 67  ? -0.601  3.713   -6.632  1.00 23.17 ? 510 HIS B C    1 
ATOM   2543 O  O    . HIS B 1 67  ? -1.013  3.205   -5.598  1.00 22.30 ? 510 HIS B O    1 
ATOM   2544 C  CB   . HIS B 1 67  ? -1.279  6.084   -6.738  1.00 22.89 ? 510 HIS B CB   1 
ATOM   2545 C  CG   . HIS B 1 67  ? -0.024  6.773   -7.154  1.00 20.88 ? 510 HIS B CG   1 
ATOM   2546 N  ND1  . HIS B 1 67  ? 1.117   6.762   -6.388  1.00 21.48 ? 510 HIS B ND1  1 
ATOM   2547 C  CD2  . HIS B 1 67  ? 0.258   7.527   -8.234  1.00 20.67 ? 510 HIS B CD2  1 
ATOM   2548 C  CE1  . HIS B 1 67  ? 2.059   7.460   -6.995  1.00 21.64 ? 510 HIS B CE1  1 
ATOM   2549 N  NE2  . HIS B 1 67  ? 1.559   7.944   -8.113  1.00 20.47 ? 510 HIS B NE2  1 
ATOM   2550 N  N    . VAL B 1 68  ? 0.584   3.456   -7.199  1.00 23.56 ? 511 VAL B N    1 
ATOM   2551 C  CA   . VAL B 1 68  ? 1.510   2.448   -6.682  1.00 23.71 ? 511 VAL B CA   1 
ATOM   2552 C  C    . VAL B 1 68  ? 1.957   2.826   -5.279  1.00 23.55 ? 511 VAL B C    1 
ATOM   2553 O  O    . VAL B 1 68  ? 2.010   1.978   -4.365  1.00 23.00 ? 511 VAL B O    1 
ATOM   2554 C  CB   . VAL B 1 68  ? 2.739   2.269   -7.619  1.00 24.01 ? 511 VAL B CB   1 
ATOM   2555 C  CG1  . VAL B 1 68  ? 3.668   3.480   -7.575  1.00 24.42 ? 511 VAL B CG1  1 
ATOM   2556 C  CG2  . VAL B 1 68  ? 3.486   0.998   -7.285  1.00 23.84 ? 511 VAL B CG2  1 
ATOM   2557 N  N    . ASN B 1 69  ? 2.238   4.115   -5.114  1.00 23.16 ? 512 ASN B N    1 
ATOM   2558 C  CA   . ASN B 1 69  ? 2.679   4.637   -3.840  1.00 23.24 ? 512 ASN B CA   1 
ATOM   2559 C  C    . ASN B 1 69  ? 1.575   4.898   -2.815  1.00 23.12 ? 512 ASN B C    1 
ATOM   2560 O  O    . ASN B 1 69  ? 1.882   5.396   -1.744  1.00 22.90 ? 512 ASN B O    1 
ATOM   2561 C  CB   . ASN B 1 69  ? 3.527   5.880   -4.062  1.00 23.05 ? 512 ASN B CB   1 
ATOM   2562 C  CG   . ASN B 1 69  ? 4.913   5.543   -4.466  1.00 23.07 ? 512 ASN B CG   1 
ATOM   2563 O  OD1  . ASN B 1 69  ? 5.406   5.972   -5.523  1.00 23.86 ? 512 ASN B OD1  1 
ATOM   2564 N  ND2  . ASN B 1 69  ? 5.568   4.744   -3.635  1.00 23.95 ? 512 ASN B ND2  1 
ATOM   2565 N  N    . ILE B 1 70  ? 0.316   4.584   -3.146  1.00 23.35 ? 513 ILE B N    1 
ATOM   2566 C  CA   . ILE B 1 70  ? -0.782  4.508   -2.158  1.00 23.57 ? 513 ILE B CA   1 
ATOM   2567 C  C    . ILE B 1 70  ? -1.210  3.045   -1.968  1.00 23.69 ? 513 ILE B C    1 
ATOM   2568 O  O    . ILE B 1 70  ? -1.195  2.246   -2.920  1.00 23.62 ? 513 ILE B O    1 
ATOM   2569 C  CB   . ILE B 1 70  ? -2.042  5.341   -2.585  1.00 23.70 ? 513 ILE B CB   1 
ATOM   2570 C  CG1  . ILE B 1 70  ? -1.684  6.782   -2.927  1.00 23.99 ? 513 ILE B CG1  1 
ATOM   2571 C  CG2  . ILE B 1 70  ? -3.152  5.310   -1.493  1.00 22.53 ? 513 ILE B CG2  1 
ATOM   2572 C  CD1  . ILE B 1 70  ? -1.267  7.640   -1.736  1.00 24.16 ? 513 ILE B CD1  1 
ATOM   2573 N  N    . LEU B 1 71  ? -1.646  2.722   -0.755  1.00 23.67 ? 514 LEU B N    1 
ATOM   2574 C  CA   . LEU B 1 71  ? -1.975  1.358   -0.401  1.00 23.89 ? 514 LEU B CA   1 
ATOM   2575 C  C    . LEU B 1 71  ? -3.191  0.970   -1.196  1.00 23.71 ? 514 LEU B C    1 
ATOM   2576 O  O    . LEU B 1 71  ? -3.923  1.843   -1.617  1.00 23.60 ? 514 LEU B O    1 
ATOM   2577 C  CB   . LEU B 1 71  ? -2.193  1.214   1.100   1.00 24.31 ? 514 LEU B CB   1 
ATOM   2578 C  CG   . LEU B 1 71  ? -3.496  0.598   1.635   1.00 25.20 ? 514 LEU B CG   1 
ATOM   2579 C  CD1  . LEU B 1 71  ? -3.218  -0.173  2.931   1.00 25.09 ? 514 LEU B CD1  1 
ATOM   2580 C  CD2  . LEU B 1 71  ? -4.570  1.687   1.835   1.00 25.32 ? 514 LEU B CD2  1 
ATOM   2581 N  N    . LEU B 1 72  ? -3.387  -0.331  -1.414  1.00 23.51 ? 515 LEU B N    1 
ATOM   2582 C  CA   . LEU B 1 72  ? -4.365  -0.804  -2.376  1.00 23.56 ? 515 LEU B CA   1 
ATOM   2583 C  C    . LEU B 1 72  ? -5.670  -1.249  -1.730  1.00 24.08 ? 515 LEU B C    1 
ATOM   2584 O  O    . LEU B 1 72  ? -5.747  -2.315  -1.095  1.00 24.15 ? 515 LEU B O    1 
ATOM   2585 C  CB   . LEU B 1 72  ? -3.786  -1.932  -3.218  1.00 23.54 ? 515 LEU B CB   1 
ATOM   2586 C  CG   . LEU B 1 72  ? -4.645  -2.350  -4.403  1.00 23.21 ? 515 LEU B CG   1 
ATOM   2587 C  CD1  . LEU B 1 72  ? -5.078  -1.175  -5.246  1.00 23.22 ? 515 LEU B CD1  1 
ATOM   2588 C  CD2  . LEU B 1 72  ? -3.873  -3.314  -5.231  1.00 23.77 ? 515 LEU B CD2  1 
ATOM   2589 N  N    . PHE B 1 73  ? -6.700  -0.421  -1.895  1.00 24.26 ? 516 PHE B N    1 
ATOM   2590 C  CA   . PHE B 1 73  ? -8.049  -0.785  -1.488  1.00 24.38 ? 516 PHE B CA   1 
ATOM   2591 C  C    . PHE B 1 73  ? -8.512  -1.927  -2.405  1.00 24.46 ? 516 PHE B C    1 
ATOM   2592 O  O    . PHE B 1 73  ? -8.557  -1.748  -3.613  1.00 23.68 ? 516 PHE B O    1 
ATOM   2593 C  CB   . PHE B 1 73  ? -8.961  0.438   -1.588  1.00 24.35 ? 516 PHE B CB   1 
ATOM   2594 C  CG   . PHE B 1 73  ? -10.415 0.148   -1.329  1.00 24.21 ? 516 PHE B CG   1 
ATOM   2595 C  CD1  . PHE B 1 73  ? -10.824 -0.360  -0.106  1.00 24.85 ? 516 PHE B CD1  1 
ATOM   2596 C  CD2  . PHE B 1 73  ? -11.371 0.415   -2.296  1.00 23.16 ? 516 PHE B CD2  1 
ATOM   2597 C  CE1  . PHE B 1 73  ? -12.160 -0.623  0.138   1.00 24.89 ? 516 PHE B CE1  1 
ATOM   2598 C  CE2  . PHE B 1 73  ? -12.696 0.161   -2.068  1.00 23.73 ? 516 PHE B CE2  1 
ATOM   2599 C  CZ   . PHE B 1 73  ? -13.100 -0.368  -0.851  1.00 24.92 ? 516 PHE B CZ   1 
ATOM   2600 N  N    . MET B 1 74  ? -8.776  -3.104  -1.822  1.00 24.78 ? 517 MET B N    1 
ATOM   2601 C  CA   . MET B 1 74  ? -9.210  -4.307  -2.558  1.00 24.94 ? 517 MET B CA   1 
ATOM   2602 C  C    . MET B 1 74  ? -10.716 -4.536  -2.506  1.00 25.19 ? 517 MET B C    1 
ATOM   2603 O  O    . MET B 1 74  ? -11.244 -5.207  -3.392  1.00 25.88 ? 517 MET B O    1 
ATOM   2604 C  CB   . MET B 1 74  ? -8.513  -5.583  -2.038  1.00 24.96 ? 517 MET B CB   1 
ATOM   2605 C  CG   . MET B 1 74  ? -6.966  -5.511  -1.846  1.00 25.72 ? 517 MET B CG   1 
ATOM   2606 S  SD   . MET B 1 74  ? -6.000  -6.687  -2.898  1.00 28.36 ? 517 MET B SD   1 
ATOM   2607 C  CE   . MET B 1 74  ? -4.889  -7.450  -1.835  1.00 25.96 ? 517 MET B CE   1 
ATOM   2608 N  N    . GLY B 1 75  ? -11.394 -4.010  -1.470  1.00 25.70 ? 518 GLY B N    1 
ATOM   2609 C  CA   . GLY B 1 75  ? -12.844 -4.176  -1.242  1.00 25.60 ? 518 GLY B CA   1 
ATOM   2610 C  C    . GLY B 1 75  ? -13.312 -3.851  0.187   1.00 25.80 ? 518 GLY B C    1 
ATOM   2611 O  O    . GLY B 1 75  ? -12.527 -3.347  0.988   1.00 25.97 ? 518 GLY B O    1 
ATOM   2612 N  N    . TYR B 1 76  ? -14.568 -4.155  0.528   1.00 25.83 ? 519 TYR B N    1 
ATOM   2613 C  CA   . TYR B 1 76  ? -15.140 -3.745  1.823   1.00 26.01 ? 519 TYR B CA   1 
ATOM   2614 C  C    . TYR B 1 76  ? -16.322 -4.601  2.340   1.00 26.27 ? 519 TYR B C    1 
ATOM   2615 O  O    . TYR B 1 76  ? -17.294 -4.824  1.628   1.00 26.46 ? 519 TYR B O    1 
ATOM   2616 C  CB   . TYR B 1 76  ? -15.570 -2.273  1.770   1.00 26.08 ? 519 TYR B CB   1 
ATOM   2617 C  CG   . TYR B 1 76  ? -16.903 -1.989  1.068   1.00 26.18 ? 519 TYR B CG   1 
ATOM   2618 C  CD1  . TYR B 1 76  ? -18.125 -2.205  1.715   1.00 25.23 ? 519 TYR B CD1  1 
ATOM   2619 C  CD2  . TYR B 1 76  ? -16.937 -1.468  -0.231  1.00 26.06 ? 519 TYR B CD2  1 
ATOM   2620 C  CE1  . TYR B 1 76  ? -19.341 -1.944  1.071   1.00 25.51 ? 519 TYR B CE1  1 
ATOM   2621 C  CE2  . TYR B 1 76  ? -18.154 -1.200  -0.876  1.00 25.84 ? 519 TYR B CE2  1 
ATOM   2622 C  CZ   . TYR B 1 76  ? -19.348 -1.438  -0.220  1.00 24.91 ? 519 TYR B CZ   1 
ATOM   2623 O  OH   . TYR B 1 76  ? -20.545 -1.179  -0.848  1.00 22.90 ? 519 TYR B OH   1 
ATOM   2624 N  N    . SER B 1 77  ? -16.242 -5.024  3.603   1.00 26.30 ? 520 SER B N    1 
ATOM   2625 C  CA   . SER B 1 77  ? -17.192 -5.950  4.212   1.00 26.14 ? 520 SER B CA   1 
ATOM   2626 C  C    . SER B 1 77  ? -18.197 -5.174  5.060   1.00 26.69 ? 520 SER B C    1 
ATOM   2627 O  O    . SER B 1 77  ? -17.774 -4.459  5.989   1.00 27.49 ? 520 SER B O    1 
ATOM   2628 C  CB   . SER B 1 77  ? -16.438 -6.930  5.141   1.00 25.96 ? 520 SER B CB   1 
ATOM   2629 O  OG   . SER B 1 77  ? -16.486 -8.285  4.721   1.00 25.68 ? 520 SER B OG   1 
ATOM   2630 N  N    . THR B 1 78  ? -19.497 -5.269  4.739   1.00 26.49 ? 521 THR B N    1 
ATOM   2631 C  CA   . THR B 1 78  ? -20.548 -5.170  5.774   1.00 26.47 ? 521 THR B CA   1 
ATOM   2632 C  C    . THR B 1 78  ? -20.924 -6.633  5.975   1.00 26.64 ? 521 THR B C    1 
ATOM   2633 O  O    . THR B 1 78  ? -20.377 -7.500  5.281   1.00 26.74 ? 521 THR B O    1 
ATOM   2634 C  CB   . THR B 1 78  ? -21.827 -4.347  5.360   1.00 26.37 ? 521 THR B CB   1 
ATOM   2635 O  OG1  . THR B 1 78  ? -21.861 -4.121  3.948   1.00 26.74 ? 521 THR B OG1  1 
ATOM   2636 C  CG2  . THR B 1 78  ? -21.838 -2.941  5.959   1.00 26.19 ? 521 THR B CG2  1 
ATOM   2637 N  N    . LYS B 1 79  ? -21.836 -6.899  6.912   1.00 26.68 ? 522 LYS B N    1 
ATOM   2638 C  CA   . LYS B 1 79  ? -22.506 -8.210  7.070   1.00 26.70 ? 522 LYS B CA   1 
ATOM   2639 C  C    . LYS B 1 79  ? -22.131 -8.934  8.378   1.00 26.91 ? 522 LYS B C    1 
ATOM   2640 O  O    . LYS B 1 79  ? -22.978 -9.029  9.258   1.00 26.75 ? 522 LYS B O    1 
ATOM   2641 C  CB   . LYS B 1 79  ? -22.358 -9.133  5.810   1.00 26.64 ? 522 LYS B CB   1 
ATOM   2642 N  N    . PRO B 1 80  ? -20.892 -9.415  8.551   1.00 27.27 ? 523 PRO B N    1 
ATOM   2643 C  CA   . PRO B 1 80  ? -20.455 -9.822  9.895   1.00 27.35 ? 523 PRO B CA   1 
ATOM   2644 C  C    . PRO B 1 80  ? -19.988 -8.550  10.637  1.00 27.37 ? 523 PRO B C    1 
ATOM   2645 O  O    . PRO B 1 80  ? -20.739 -7.557  10.672  1.00 27.44 ? 523 PRO B O    1 
ATOM   2646 C  CB   . PRO B 1 80  ? -19.315 -10.834 9.615   1.00 27.44 ? 523 PRO B CB   1 
ATOM   2647 C  CG   . PRO B 1 80  ? -18.889 -10.615 8.174   1.00 27.08 ? 523 PRO B CG   1 
ATOM   2648 C  CD   . PRO B 1 80  ? -19.813 -9.604  7.559   1.00 27.14 ? 523 PRO B CD   1 
ATOM   2649 N  N    . GLN B 1 81  ? -18.795 -8.573  11.226  1.00 27.05 ? 524 GLN B N    1 
ATOM   2650 C  CA   . GLN B 1 81  ? -18.089 -7.335  11.540  1.00 26.80 ? 524 GLN B CA   1 
ATOM   2651 C  C    . GLN B 1 81  ? -18.095 -6.381  10.324  1.00 26.72 ? 524 GLN B C    1 
ATOM   2652 O  O    . GLN B 1 81  ? -18.481 -6.776  9.198   1.00 26.88 ? 524 GLN B O    1 
ATOM   2653 C  CB   . GLN B 1 81  ? -16.625 -7.619  11.944  1.00 26.72 ? 524 GLN B CB   1 
ATOM   2654 C  CG   . GLN B 1 81  ? -16.411 -8.691  13.009  1.00 25.81 ? 524 GLN B CG   1 
ATOM   2655 C  CD   . GLN B 1 81  ? -17.050 -8.330  14.318  1.00 25.29 ? 524 GLN B CD   1 
ATOM   2656 O  OE1  . GLN B 1 81  ? -17.832 -7.379  14.393  1.00 24.84 ? 524 GLN B OE1  1 
ATOM   2657 N  NE2  . GLN B 1 81  ? -16.714 -9.067  15.362  1.00 25.29 ? 524 GLN B NE2  1 
ATOM   2658 N  N    . LEU B 1 82  ? -17.689 -5.132  10.569  1.00 26.22 ? 525 LEU B N    1 
ATOM   2659 C  CA   . LEU B 1 82  ? -17.347 -4.205  9.490   1.00 25.89 ? 525 LEU B CA   1 
ATOM   2660 C  C    . LEU B 1 82  ? -15.851 -4.252  9.247   1.00 25.80 ? 525 LEU B C    1 
ATOM   2661 O  O    . LEU B 1 82  ? -15.074 -4.507  10.171  1.00 25.29 ? 525 LEU B O    1 
ATOM   2662 C  CB   . LEU B 1 82  ? -17.754 -2.780  9.830   1.00 25.73 ? 525 LEU B CB   1 
ATOM   2663 C  CG   . LEU B 1 82  ? -19.243 -2.478  9.993   1.00 25.44 ? 525 LEU B CG   1 
ATOM   2664 C  CD1  . LEU B 1 82  ? -19.554 -1.127  9.347   1.00 25.28 ? 525 LEU B CD1  1 
ATOM   2665 C  CD2  . LEU B 1 82  ? -20.150 -3.563  9.437   1.00 25.40 ? 525 LEU B CD2  1 
ATOM   2666 N  N    . ALA B 1 83  ? -15.458 -3.997  7.998   1.00 25.96 ? 526 ALA B N    1 
ATOM   2667 C  CA   . ALA B 1 83  ? -14.078 -4.203  7.574   1.00 26.06 ? 526 ALA B CA   1 
ATOM   2668 C  C    . ALA B 1 83  ? -13.607 -3.366  6.368   1.00 26.24 ? 526 ALA B C    1 
ATOM   2669 O  O    . ALA B 1 83  ? -14.410 -2.778  5.635   1.00 26.50 ? 526 ALA B O    1 
ATOM   2670 C  CB   . ALA B 1 83  ? -13.854 -5.680  7.299   1.00 25.88 ? 526 ALA B CB   1 
ATOM   2671 N  N    . ILE B 1 84  ? -12.280 -3.355  6.197   1.00 26.06 ? 527 ILE B N    1 
ATOM   2672 C  CA   . ILE B 1 84  ? -11.574 -2.703  5.095   1.00 25.88 ? 527 ILE B CA   1 
ATOM   2673 C  C    . ILE B 1 84  ? -10.487 -3.664  4.578   1.00 25.68 ? 527 ILE B C    1 
ATOM   2674 O  O    . ILE B 1 84  ? -9.575  -4.052  5.318   1.00 25.55 ? 527 ILE B O    1 
ATOM   2675 C  CB   . ILE B 1 84  ? -10.945 -1.331  5.563   1.00 25.96 ? 527 ILE B CB   1 
ATOM   2676 C  CG1  . ILE B 1 84  ? -12.053 -0.308  5.814   1.00 26.39 ? 527 ILE B CG1  1 
ATOM   2677 C  CG2  . ILE B 1 84  ? -10.013 -0.758  4.514   1.00 25.62 ? 527 ILE B CG2  1 
ATOM   2678 C  CD1  . ILE B 1 84  ? -11.587 1.103   6.166   1.00 26.10 ? 527 ILE B CD1  1 
ATOM   2679 N  N    . VAL B 1 85  ? -10.570 -4.021  3.298   1.00 25.39 ? 528 VAL B N    1 
ATOM   2680 C  CA   . VAL B 1 85  ? -9.684  -5.026  2.709   1.00 25.11 ? 528 VAL B CA   1 
ATOM   2681 C  C    . VAL B 1 85  ? -8.552  -4.345  1.913   1.00 24.64 ? 528 VAL B C    1 
ATOM   2682 O  O    . VAL B 1 85  ? -8.827  -3.472  1.093   1.00 24.41 ? 528 VAL B O    1 
ATOM   2683 C  CB   . VAL B 1 85  ? -10.509 -5.998  1.805   1.00 25.20 ? 528 VAL B CB   1 
ATOM   2684 C  CG1  . VAL B 1 85  ? -9.773  -7.347  1.597   1.00 25.30 ? 528 VAL B CG1  1 
ATOM   2685 C  CG2  . VAL B 1 85  ? -11.891 -6.251  2.413   1.00 25.58 ? 528 VAL B CG2  1 
ATOM   2686 N  N    . THR B 1 86  ? -7.294  -4.715  2.163   1.00 24.26 ? 529 THR B N    1 
ATOM   2687 C  CA   . THR B 1 86  ? -6.180  -4.209  1.349   1.00 24.70 ? 529 THR B CA   1 
ATOM   2688 C  C    . THR B 1 86  ? -5.098  -5.242  1.012   1.00 24.83 ? 529 THR B C    1 
ATOM   2689 O  O    . THR B 1 86  ? -5.148  -6.384  1.456   1.00 24.52 ? 529 THR B O    1 
ATOM   2690 C  CB   . THR B 1 86  ? -5.486  -2.961  2.005   1.00 24.85 ? 529 THR B CB   1 
ATOM   2691 O  OG1  . THR B 1 86  ? -4.590  -3.376  3.047   1.00 23.91 ? 529 THR B OG1  1 
ATOM   2692 C  CG2  . THR B 1 86  ? -6.497  -2.012  2.685   1.00 25.06 ? 529 THR B CG2  1 
ATOM   2693 N  N    . GLN B 1 87  ? -4.122  -4.804  0.210   1.00 25.14 ? 530 GLN B N    1 
ATOM   2694 C  CA   . GLN B 1 87  ? -2.940  -5.611  -0.145  1.00 25.16 ? 530 GLN B CA   1 
ATOM   2695 C  C    . GLN B 1 87  ? -2.213  -6.075  1.064   1.00 24.89 ? 530 GLN B C    1 
ATOM   2696 O  O    . GLN B 1 87  ? -2.038  -5.329  2.007   1.00 24.65 ? 530 GLN B O    1 
ATOM   2697 C  CB   . GLN B 1 87  ? -1.945  -4.852  -1.055  1.00 25.07 ? 530 GLN B CB   1 
ATOM   2698 C  CG   . GLN B 1 87  ? -1.683  -3.397  -0.676  1.00 25.48 ? 530 GLN B CG   1 
ATOM   2699 C  CD   . GLN B 1 87  ? -0.901  -2.644  -1.746  1.00 25.54 ? 530 GLN B CD   1 
ATOM   2700 O  OE1  . GLN B 1 87  ? -0.993  -1.408  -1.865  1.00 20.26 ? 530 GLN B OE1  1 
ATOM   2701 N  NE2  . GLN B 1 87  ? -0.115  -3.392  -2.518  1.00 25.90 ? 530 GLN B NE2  1 
ATOM   2702 N  N    . TRP B 1 88  ? -1.774  -7.316  1.035   1.00 25.36 ? 531 TRP B N    1 
ATOM   2703 C  CA   . TRP B 1 88  ? -0.894  -7.751  2.080   1.00 25.87 ? 531 TRP B CA   1 
ATOM   2704 C  C    . TRP B 1 88  ? 0.484   -7.232  1.762   1.00 25.95 ? 531 TRP B C    1 
ATOM   2705 O  O    . TRP B 1 88  ? 1.112   -7.609  0.769   1.00 25.98 ? 531 TRP B O    1 
ATOM   2706 C  CB   . TRP B 1 88  ? -0.831  -9.248  2.268   1.00 26.03 ? 531 TRP B CB   1 
ATOM   2707 C  CG   . TRP B 1 88  ? 0.085   -9.481  3.389   1.00 26.88 ? 531 TRP B CG   1 
ATOM   2708 C  CD1  . TRP B 1 88  ? 1.393   -9.883  3.327   1.00 27.49 ? 531 TRP B CD1  1 
ATOM   2709 C  CD2  . TRP B 1 88  ? -0.197  -9.230  4.760   1.00 27.80 ? 531 TRP B CD2  1 
ATOM   2710 N  NE1  . TRP B 1 88  ? 1.924   -9.942  4.592   1.00 28.24 ? 531 TRP B NE1  1 
ATOM   2711 C  CE2  . TRP B 1 88  ? 0.966   -9.545  5.494   1.00 28.55 ? 531 TRP B CE2  1 
ATOM   2712 C  CE3  . TRP B 1 88  ? -1.337  -8.813  5.458   1.00 27.97 ? 531 TRP B CE3  1 
ATOM   2713 C  CZ2  . TRP B 1 88  ? 1.025   -9.437  6.890   1.00 28.18 ? 531 TRP B CZ2  1 
ATOM   2714 C  CZ3  . TRP B 1 88  ? -1.280  -8.708  6.848   1.00 28.08 ? 531 TRP B CZ3  1 
ATOM   2715 C  CH2  . TRP B 1 88  ? -0.106  -9.010  7.542   1.00 28.06 ? 531 TRP B CH2  1 
ATOM   2716 N  N    . CYS B 1 89  ? 0.944   -6.368  2.644   1.00 26.17 ? 532 CYS B N    1 
ATOM   2717 C  CA   . CYS B 1 89  ? 2.168   -5.653  2.444   1.00 26.12 ? 532 CYS B CA   1 
ATOM   2718 C  C    . CYS B 1 89  ? 3.276   -6.423  3.086   1.00 26.18 ? 532 CYS B C    1 
ATOM   2719 O  O    . CYS B 1 89  ? 3.029   -7.246  3.965   1.00 25.95 ? 532 CYS B O    1 
ATOM   2720 C  CB   . CYS B 1 89  ? 2.059   -4.310  3.119   1.00 26.27 ? 532 CYS B CB   1 
ATOM   2721 S  SG   . CYS B 1 89  ? 2.306   -3.001  1.975   1.00 26.70 ? 532 CYS B SG   1 
ATOM   2722 N  N    . GLU B 1 90  ? 4.497   -6.119  2.668   1.00 26.33 ? 533 GLU B N    1 
ATOM   2723 C  CA   . GLU B 1 90  ? 5.675   -6.799  3.171   1.00 26.34 ? 533 GLU B CA   1 
ATOM   2724 C  C    . GLU B 1 90  ? 6.569   -5.872  3.949   1.00 26.57 ? 533 GLU B C    1 
ATOM   2725 O  O    . GLU B 1 90  ? 6.412   -4.651  3.928   1.00 27.54 ? 533 GLU B O    1 
ATOM   2726 C  CB   . GLU B 1 90  ? 6.434   -7.442  2.013   1.00 26.44 ? 533 GLU B CB   1 
ATOM   2727 C  CG   . GLU B 1 90  ? 5.846   -8.768  1.548   1.00 25.89 ? 533 GLU B CG   1 
ATOM   2728 C  CD   . GLU B 1 90  ? 5.684   -9.752  2.682   1.00 25.53 ? 533 GLU B CD   1 
ATOM   2729 O  OE1  . GLU B 1 90  ? 6.703   -10.325 3.132   1.00 26.09 ? 533 GLU B OE1  1 
ATOM   2730 O  OE2  . GLU B 1 90  ? 4.537   -9.924  3.144   1.00 25.52 ? 533 GLU B OE2  1 
ATOM   2731 N  N    . GLY B 1 91  ? 7.490   -6.465  4.686   1.00 26.79 ? 534 GLY B N    1 
ATOM   2732 C  CA   . GLY B 1 91  ? 8.415   -5.700  5.499   1.00 27.00 ? 534 GLY B CA   1 
ATOM   2733 C  C    . GLY B 1 91  ? 7.799   -4.919  6.649   1.00 27.16 ? 534 GLY B C    1 
ATOM   2734 O  O    . GLY B 1 91  ? 6.687   -5.184  7.116   1.00 27.31 ? 534 GLY B O    1 
ATOM   2735 N  N    . SER B 1 92  ? 8.573   -3.944  7.107   1.00 27.27 ? 535 SER B N    1 
ATOM   2736 C  CA   . SER B 1 92  ? 8.223   -3.097  8.235   1.00 26.71 ? 535 SER B CA   1 
ATOM   2737 C  C    . SER B 1 92  ? 8.137   -1.657  7.748   1.00 26.59 ? 535 SER B C    1 
ATOM   2738 O  O    . SER B 1 92  ? 8.666   -1.330  6.678   1.00 26.58 ? 535 SER B O    1 
ATOM   2739 C  CB   . SER B 1 92  ? 9.288   -3.213  9.318   1.00 26.74 ? 535 SER B CB   1 
ATOM   2740 O  OG   . SER B 1 92  ? 10.560  -2.826  8.828   1.00 26.63 ? 535 SER B OG   1 
ATOM   2741 N  N    . SER B 1 93  ? 7.489   -0.809  8.556   1.00 26.13 ? 536 SER B N    1 
ATOM   2742 C  CA   . SER B 1 93  ? 7.195   0.581   8.207   1.00 25.47 ? 536 SER B CA   1 
ATOM   2743 C  C    . SER B 1 93  ? 8.428   1.481   8.195   1.00 25.30 ? 536 SER B C    1 
ATOM   2744 O  O    . SER B 1 93  ? 9.530   1.062   8.542   1.00 24.79 ? 536 SER B O    1 
ATOM   2745 C  CB   . SER B 1 93  ? 6.148   1.162   9.170   1.00 25.58 ? 536 SER B CB   1 
ATOM   2746 O  OG   . SER B 1 93  ? 6.693   2.199   9.973   1.00 25.17 ? 536 SER B OG   1 
ATOM   2747 N  N    . LEU B 1 94  ? 8.218   2.735   7.797   1.00 25.43 ? 537 LEU B N    1 
ATOM   2748 C  CA   . LEU B 1 94  ? 9.306   3.698   7.655   1.00 25.28 ? 537 LEU B CA   1 
ATOM   2749 C  C    . LEU B 1 94  ? 9.770   4.113   9.025   1.00 25.09 ? 537 LEU B C    1 
ATOM   2750 O  O    . LEU B 1 94  ? 10.959  4.190   9.272   1.00 25.35 ? 537 LEU B O    1 
ATOM   2751 C  CB   . LEU B 1 94  ? 8.870   4.934   6.858   1.00 25.11 ? 537 LEU B CB   1 
ATOM   2752 C  CG   . LEU B 1 94  ? 10.001  5.951   6.705   1.00 24.82 ? 537 LEU B CG   1 
ATOM   2753 C  CD1  . LEU B 1 94  ? 11.202  5.350   5.937   1.00 24.34 ? 537 LEU B CD1  1 
ATOM   2754 C  CD2  . LEU B 1 94  ? 9.490   7.228   6.073   1.00 24.16 ? 537 LEU B CD2  1 
ATOM   2755 N  N    . TYR B 1 95  ? 8.826   4.378   9.912   1.00 25.32 ? 538 TYR B N    1 
ATOM   2756 C  CA   . TYR B 1 95  ? 9.134   4.585   11.332  1.00 25.91 ? 538 TYR B CA   1 
ATOM   2757 C  C    . TYR B 1 95  ? 10.160  3.585   11.840  1.00 25.80 ? 538 TYR B C    1 
ATOM   2758 O  O    . TYR B 1 95  ? 11.197  3.966   12.385  1.00 25.15 ? 538 TYR B O    1 
ATOM   2759 C  CB   . TYR B 1 95  ? 7.871   4.440   12.195  1.00 26.03 ? 538 TYR B CB   1 
ATOM   2760 C  CG   . TYR B 1 95  ? 8.084   4.790   13.654  1.00 27.37 ? 538 TYR B CG   1 
ATOM   2761 C  CD1  . TYR B 1 95  ? 8.938   5.843   14.036  1.00 28.03 ? 538 TYR B CD1  1 
ATOM   2762 C  CD2  . TYR B 1 95  ? 7.421   4.078   14.669  1.00 28.38 ? 538 TYR B CD2  1 
ATOM   2763 C  CE1  . TYR B 1 95  ? 9.129   6.167   15.381  1.00 27.62 ? 538 TYR B CE1  1 
ATOM   2764 C  CE2  . TYR B 1 95  ? 7.602   4.405   16.020  1.00 27.85 ? 538 TYR B CE2  1 
ATOM   2765 C  CZ   . TYR B 1 95  ? 8.454   5.455   16.363  1.00 27.34 ? 538 TYR B CZ   1 
ATOM   2766 O  OH   . TYR B 1 95  ? 8.645   5.786   17.685  1.00 27.31 ? 538 TYR B OH   1 
ATOM   2767 N  N    . HIS B 1 96  ? 9.835   2.308   11.627  1.00 26.07 ? 539 HIS B N    1 
ATOM   2768 C  CA   . HIS B 1 96  ? 10.669  1.181   12.012  1.00 26.13 ? 539 HIS B CA   1 
ATOM   2769 C  C    . HIS B 1 96  ? 12.094  1.358   11.521  1.00 26.31 ? 539 HIS B C    1 
ATOM   2770 O  O    . HIS B 1 96  ? 13.007  1.426   12.326  1.00 27.05 ? 539 HIS B O    1 
ATOM   2771 C  CB   . HIS B 1 96  ? 10.082  -0.121  11.466  1.00 26.18 ? 539 HIS B CB   1 
ATOM   2772 C  CG   . HIS B 1 96  ? 10.546  -1.337  12.194  1.00 26.59 ? 539 HIS B CG   1 
ATOM   2773 N  ND1  . HIS B 1 96  ? 11.702  -2.007  11.860  1.00 26.60 ? 539 HIS B ND1  1 
ATOM   2774 C  CD2  . HIS B 1 96  ? 10.013  -2.003  13.247  1.00 26.94 ? 539 HIS B CD2  1 
ATOM   2775 C  CE1  . HIS B 1 96  ? 11.865  -3.031  12.682  1.00 26.34 ? 539 HIS B CE1  1 
ATOM   2776 N  NE2  . HIS B 1 96  ? 10.853  -3.052  13.530  1.00 25.85 ? 539 HIS B NE2  1 
ATOM   2777 N  N    . HIS B 1 97  ? 12.280  1.492   10.216  1.00 26.21 ? 540 HIS B N    1 
ATOM   2778 C  CA   . HIS B 1 97  ? 13.615  1.426   9.621   1.00 26.49 ? 540 HIS B CA   1 
ATOM   2779 C  C    . HIS B 1 97  ? 14.590  2.523   10.086  1.00 26.57 ? 540 HIS B C    1 
ATOM   2780 O  O    . HIS B 1 97  ? 15.811  2.349   10.066  1.00 26.69 ? 540 HIS B O    1 
ATOM   2781 C  CB   . HIS B 1 97  ? 13.503  1.410   8.087   1.00 26.85 ? 540 HIS B CB   1 
ATOM   2782 C  CG   . HIS B 1 97  ? 13.341  0.034   7.504   1.00 27.21 ? 540 HIS B CG   1 
ATOM   2783 N  ND1  . HIS B 1 97  ? 14.393  -0.675  6.964   1.00 27.45 ? 540 HIS B ND1  1 
ATOM   2784 C  CD2  . HIS B 1 97  ? 12.253  -0.768  7.396   1.00 27.59 ? 540 HIS B CD2  1 
ATOM   2785 C  CE1  . HIS B 1 97  ? 13.960  -1.850  6.540   1.00 27.32 ? 540 HIS B CE1  1 
ATOM   2786 N  NE2  . HIS B 1 97  ? 12.666  -1.934  6.795   1.00 27.55 ? 540 HIS B NE2  1 
ATOM   2787 N  N    . LEU B 1 98  ? 14.048  3.638   10.542  1.00 26.66 ? 541 LEU B N    1 
ATOM   2788 C  CA   . LEU B 1 98  ? 14.872  4.767   10.958  1.00 26.53 ? 541 LEU B CA   1 
ATOM   2789 C  C    . LEU B 1 98  ? 15.125  4.781   12.458  1.00 26.54 ? 541 LEU B C    1 
ATOM   2790 O  O    . LEU B 1 98  ? 16.186  5.217   12.904  1.00 26.29 ? 541 LEU B O    1 
ATOM   2791 C  CB   . LEU B 1 98  ? 14.164  6.083   10.581  1.00 26.57 ? 541 LEU B CB   1 
ATOM   2792 C  CG   . LEU B 1 98  ? 14.119  6.521   9.109   1.00 26.07 ? 541 LEU B CG   1 
ATOM   2793 C  CD1  . LEU B 1 98  ? 14.370  5.378   8.111   1.00 26.05 ? 541 LEU B CD1  1 
ATOM   2794 C  CD2  . LEU B 1 98  ? 12.792  7.195   8.823   1.00 26.05 ? 541 LEU B CD2  1 
ATOM   2795 N  N    . HIS B 1 99  ? 14.137  4.305   13.219  1.00 26.67 ? 542 HIS B N    1 
ATOM   2796 C  CA   . HIS B 1 99  ? 13.973  4.671   14.624  1.00 26.67 ? 542 HIS B CA   1 
ATOM   2797 C  C    . HIS B 1 99  ? 13.842  3.530   15.592  1.00 26.81 ? 542 HIS B C    1 
ATOM   2798 O  O    . HIS B 1 99  ? 14.302  3.647   16.736  1.00 26.87 ? 542 HIS B O    1 
ATOM   2799 C  CB   . HIS B 1 99  ? 12.726  5.528   14.780  1.00 26.67 ? 542 HIS B CB   1 
ATOM   2800 C  CG   . HIS B 1 99  ? 12.863  6.885   14.180  1.00 27.28 ? 542 HIS B CG   1 
ATOM   2801 N  ND1  . HIS B 1 99  ? 11.777  7.621   13.740  1.00 27.11 ? 542 HIS B ND1  1 
ATOM   2802 C  CD2  . HIS B 1 99  ? 13.964  7.639   13.942  1.00 26.35 ? 542 HIS B CD2  1 
ATOM   2803 C  CE1  . HIS B 1 99  ? 12.210  8.767   13.244  1.00 26.86 ? 542 HIS B CE1  1 
ATOM   2804 N  NE2  . HIS B 1 99  ? 13.530  8.800   13.351  1.00 27.66 ? 542 HIS B NE2  1 
ATOM   2805 N  N    . ALA B 1 100 ? 13.152  2.466   15.174  1.00 27.09 ? 543 ALA B N    1 
ATOM   2806 C  CA   . ALA B 1 100 ? 12.977  1.264   16.008  1.00 27.14 ? 543 ALA B CA   1 
ATOM   2807 C  C    . ALA B 1 100 ? 13.829  0.090   15.522  1.00 26.96 ? 543 ALA B C    1 
ATOM   2808 O  O    . ALA B 1 100 ? 13.823  -0.972  16.138  1.00 27.20 ? 543 ALA B O    1 
ATOM   2809 C  CB   . ALA B 1 100 ? 11.472  0.858   16.095  1.00 27.01 ? 543 ALA B CB   1 
ATOM   2810 N  N    . SER B 1 101 ? 14.571  0.294   14.438  1.00 26.98 ? 544 SER B N    1 
ATOM   2811 C  CA   . SER B 1 101 ? 15.324  -0.789  13.786  1.00 27.18 ? 544 SER B CA   1 
ATOM   2812 C  C    . SER B 1 101 ? 16.751  -0.360  13.453  1.00 27.17 ? 544 SER B C    1 
ATOM   2813 O  O    . SER B 1 101 ? 17.143  0.780   13.688  1.00 27.58 ? 544 SER B O    1 
ATOM   2814 C  CB   . SER B 1 101 ? 14.593  -1.262  12.519  1.00 27.15 ? 544 SER B CB   1 
ATOM   2815 O  OG   . SER B 1 101 ? 15.408  -2.044  11.656  1.00 27.18 ? 544 SER B OG   1 
ATOM   2816 N  N    . GLU B 1 102 ? 17.518  -1.282  12.896  1.00 26.91 ? 545 GLU B N    1 
ATOM   2817 C  CA   . GLU B 1 102 ? 18.955  -1.111  12.801  1.00 26.88 ? 545 GLU B CA   1 
ATOM   2818 C  C    . GLU B 1 102 ? 19.471  -0.020  11.856  1.00 26.84 ? 545 GLU B C    1 
ATOM   2819 O  O    . GLU B 1 102 ? 20.314  0.789   12.266  1.00 26.57 ? 545 GLU B O    1 
ATOM   2820 C  CB   . GLU B 1 102 ? 19.606  -2.459  12.427  1.00 27.05 ? 545 GLU B CB   1 
ATOM   2821 C  CG   . GLU B 1 102 ? 19.018  -3.151  11.197  1.00 26.90 ? 545 GLU B CG   1 
ATOM   2822 C  CD   . GLU B 1 102 ? 20.059  -3.846  10.315  1.00 27.34 ? 545 GLU B CD   1 
ATOM   2823 O  OE1  . GLU B 1 102 ? 19.673  -4.381  9.245   1.00 26.80 ? 545 GLU B OE1  1 
ATOM   2824 O  OE2  . GLU B 1 102 ? 21.261  -3.862  10.677  1.00 27.00 ? 545 GLU B OE2  1 
ATOM   2825 N  N    . THR B 1 103 ? 18.940  0.023   10.627  1.00 26.90 ? 546 THR B N    1 
ATOM   2826 C  CA   . THR B 1 103 ? 19.772  0.319   9.448   1.00 26.84 ? 546 THR B CA   1 
ATOM   2827 C  C    . THR B 1 103 ? 19.911  1.747   8.915   1.00 27.16 ? 546 THR B C    1 
ATOM   2828 O  O    . THR B 1 103 ? 18.977  2.309   8.308   1.00 27.89 ? 546 THR B O    1 
ATOM   2829 C  CB   . THR B 1 103 ? 19.362  -0.583  8.270   1.00 26.83 ? 546 THR B CB   1 
ATOM   2830 O  OG1  . THR B 1 103 ? 18.980  -1.879  8.749   1.00 26.77 ? 546 THR B OG1  1 
ATOM   2831 C  CG2  . THR B 1 103 ? 20.570  -0.868  7.363   1.00 26.64 ? 546 THR B CG2  1 
ATOM   2832 N  N    . LYS B 1 104 ? 21.114  2.293   9.128   1.00 27.09 ? 547 LYS B N    1 
ATOM   2833 C  CA   . LYS B 1 104 ? 21.678  3.402   8.337   1.00 26.94 ? 547 LYS B CA   1 
ATOM   2834 C  C    . LYS B 1 104 ? 21.465  3.191   6.807   1.00 26.63 ? 547 LYS B C    1 
ATOM   2835 O  O    . LYS B 1 104 ? 22.232  2.488   6.143   1.00 26.51 ? 547 LYS B O    1 
ATOM   2836 C  CB   . LYS B 1 104 ? 23.202  3.532   8.643   1.00 27.02 ? 547 LYS B CB   1 
ATOM   2837 C  CG   . LYS B 1 104 ? 23.620  4.634   9.662   1.00 26.84 ? 547 LYS B CG   1 
ATOM   2838 C  CD   . LYS B 1 104 ? 24.813  5.473   9.142   1.00 26.29 ? 547 LYS B CD   1 
ATOM   2839 C  CE   . LYS B 1 104 ? 25.109  6.720   9.987   1.00 25.73 ? 547 LYS B CE   1 
ATOM   2840 N  NZ   . LYS B 1 104 ? 24.969  7.996   9.182   1.00 24.29 ? 547 LYS B NZ   1 
ATOM   2841 N  N    . PHE B 1 105 ? 20.415  3.798   6.264   1.00 26.58 ? 548 PHE B N    1 
ATOM   2842 C  CA   . PHE B 1 105 ? 20.144  3.761   4.820   1.00 26.28 ? 548 PHE B CA   1 
ATOM   2843 C  C    . PHE B 1 105 ? 21.162  4.638   4.057   1.00 26.04 ? 548 PHE B C    1 
ATOM   2844 O  O    . PHE B 1 105 ? 21.649  5.652   4.586   1.00 25.80 ? 548 PHE B O    1 
ATOM   2845 C  CB   . PHE B 1 105 ? 18.705  4.265   4.519   1.00 26.15 ? 548 PHE B CB   1 
ATOM   2846 C  CG   . PHE B 1 105 ? 17.638  3.192   4.572   1.00 25.76 ? 548 PHE B CG   1 
ATOM   2847 C  CD1  . PHE B 1 105 ? 16.393  3.474   5.108   1.00 25.58 ? 548 PHE B CD1  1 
ATOM   2848 C  CD2  . PHE B 1 105 ? 17.868  1.917   4.075   1.00 25.32 ? 548 PHE B CD2  1 
ATOM   2849 C  CE1  . PHE B 1 105 ? 15.406  2.510   5.156   1.00 25.44 ? 548 PHE B CE1  1 
ATOM   2850 C  CE2  . PHE B 1 105 ? 16.885  0.954   4.124   1.00 24.96 ? 548 PHE B CE2  1 
ATOM   2851 C  CZ   . PHE B 1 105 ? 15.656  1.249   4.659   1.00 25.56 ? 548 PHE B CZ   1 
ATOM   2852 N  N    . GLU B 1 106 ? 21.465  4.257   2.814   1.00 25.57 ? 549 GLU B N    1 
ATOM   2853 C  CA   . GLU B 1 106 ? 22.285  5.101   1.935   1.00 25.41 ? 549 GLU B CA   1 
ATOM   2854 C  C    . GLU B 1 106 ? 21.496  6.390   1.595   1.00 25.24 ? 549 GLU B C    1 
ATOM   2855 O  O    . GLU B 1 106 ? 20.257  6.390   1.554   1.00 25.30 ? 549 GLU B O    1 
ATOM   2856 C  CB   . GLU B 1 106 ? 22.708  4.370   0.638   1.00 25.63 ? 549 GLU B CB   1 
ATOM   2857 C  CG   . GLU B 1 106 ? 22.705  2.827   0.628   1.00 25.76 ? 549 GLU B CG   1 
ATOM   2858 C  CD   . GLU B 1 106 ? 24.052  2.187   0.965   1.00 25.43 ? 549 GLU B CD   1 
ATOM   2859 O  OE1  . GLU B 1 106 ? 24.968  2.880   1.447   1.00 25.60 ? 549 GLU B OE1  1 
ATOM   2860 O  OE2  . GLU B 1 106 ? 24.200  0.967   0.745   1.00 25.49 ? 549 GLU B OE2  1 
ATOM   2861 N  N    . MET B 1 107 ? 22.207  7.489   1.354   1.00 24.96 ? 550 MET B N    1 
ATOM   2862 C  CA   . MET B 1 107 ? 21.573  8.786   1.046   1.00 24.39 ? 550 MET B CA   1 
ATOM   2863 C  C    . MET B 1 107 ? 20.982  8.891   -0.367  1.00 24.25 ? 550 MET B C    1 
ATOM   2864 O  O    . MET B 1 107 ? 20.430  9.915   -0.730  1.00 24.22 ? 550 MET B O    1 
ATOM   2865 C  CB   . MET B 1 107 ? 22.603  9.893   1.270   1.00 24.37 ? 550 MET B CB   1 
ATOM   2866 C  CG   . MET B 1 107 ? 22.161  11.325  1.019   1.00 24.38 ? 550 MET B CG   1 
ATOM   2867 S  SD   . MET B 1 107 ? 20.723  11.853  1.897   1.00 25.05 ? 550 MET B SD   1 
ATOM   2868 C  CE   . MET B 1 107 ? 21.137  11.373  3.549   1.00 25.06 ? 550 MET B CE   1 
ATOM   2869 N  N    . LYS B 1 108 ? 21.098  7.856   -1.182  1.00 24.30 ? 551 LYS B N    1 
ATOM   2870 C  CA   . LYS B 1 108 ? 20.379  7.839   -2.453  1.00 24.51 ? 551 LYS B CA   1 
ATOM   2871 C  C    . LYS B 1 108 ? 18.978  7.227   -2.253  1.00 24.64 ? 551 LYS B C    1 
ATOM   2872 O  O    . LYS B 1 108 ? 17.986  7.693   -2.827  1.00 24.70 ? 551 LYS B O    1 
ATOM   2873 C  CB   . LYS B 1 108 ? 21.187  7.118   -3.552  1.00 24.45 ? 551 LYS B CB   1 
ATOM   2874 C  CG   . LYS B 1 108 ? 21.666  5.694   -3.234  1.00 24.64 ? 551 LYS B CG   1 
ATOM   2875 C  CD   . LYS B 1 108 ? 22.196  4.944   -4.490  1.00 25.19 ? 551 LYS B CD   1 
ATOM   2876 C  CE   . LYS B 1 108 ? 21.352  5.217   -5.773  1.00 24.83 ? 551 LYS B CE   1 
ATOM   2877 N  NZ   . LYS B 1 108 ? 21.503  4.191   -6.842  1.00 23.13 ? 551 LYS B NZ   1 
ATOM   2878 N  N    . LYS B 1 109 ? 18.920  6.180   -1.433  1.00 24.64 ? 552 LYS B N    1 
ATOM   2879 C  CA   . LYS B 1 109 ? 17.688  5.527   -1.083  1.00 24.26 ? 552 LYS B CA   1 
ATOM   2880 C  C    . LYS B 1 109 ? 16.833  6.565   -0.433  1.00 24.53 ? 552 LYS B C    1 
ATOM   2881 O  O    . LYS B 1 109 ? 15.704  6.779   -0.862  1.00 24.49 ? 552 LYS B O    1 
ATOM   2882 C  CB   . LYS B 1 109 ? 17.934  4.374   -0.112  1.00 24.35 ? 552 LYS B CB   1 
ATOM   2883 C  CG   . LYS B 1 109 ? 16.678  3.595   0.299   1.00 24.64 ? 552 LYS B CG   1 
ATOM   2884 C  CD   . LYS B 1 109 ? 16.825  2.067   0.183   1.00 24.74 ? 552 LYS B CD   1 
ATOM   2885 C  CE   . LYS B 1 109 ? 15.437  1.398   0.178   1.00 24.25 ? 552 LYS B CE   1 
ATOM   2886 N  NZ   . LYS B 1 109 ? 15.494  -0.078  -0.119  1.00 23.79 ? 552 LYS B NZ   1 
ATOM   2887 N  N    . LEU B 1 110 ? 17.350  7.238   0.589   1.00 24.41 ? 553 LEU B N    1 
ATOM   2888 C  CA   . LEU B 1 110 ? 16.497  8.171   1.329   1.00 24.50 ? 553 LEU B CA   1 
ATOM   2889 C  C    . LEU B 1 110 ? 15.847  9.116   0.341   1.00 24.71 ? 553 LEU B C    1 
ATOM   2890 O  O    . LEU B 1 110 ? 14.635  9.184   0.283   1.00 25.26 ? 553 LEU B O    1 
ATOM   2891 C  CB   . LEU B 1 110 ? 17.252  8.935   2.404   1.00 24.28 ? 553 LEU B CB   1 
ATOM   2892 C  CG   . LEU B 1 110 ? 17.777  8.026   3.522   1.00 24.75 ? 553 LEU B CG   1 
ATOM   2893 C  CD1  . LEU B 1 110 ? 18.963  8.662   4.273   1.00 23.94 ? 553 LEU B CD1  1 
ATOM   2894 C  CD2  . LEU B 1 110 ? 16.639  7.614   4.471   1.00 24.25 ? 553 LEU B CD2  1 
ATOM   2895 N  N    . ILE B 1 111 ? 16.644  9.792   -0.479  1.00 25.10 ? 554 ILE B N    1 
ATOM   2896 C  CA   . ILE B 1 111 ? 16.101  10.678  -1.506  1.00 25.17 ? 554 ILE B CA   1 
ATOM   2897 C  C    . ILE B 1 111 ? 15.013  9.973   -2.291  1.00 25.67 ? 554 ILE B C    1 
ATOM   2898 O  O    . ILE B 1 111 ? 14.002  10.582  -2.639  1.00 26.46 ? 554 ILE B O    1 
ATOM   2899 C  CB   . ILE B 1 111 ? 17.171  11.149  -2.507  1.00 25.17 ? 554 ILE B CB   1 
ATOM   2900 C  CG1  . ILE B 1 111 ? 18.293  11.899  -1.807  1.00 24.62 ? 554 ILE B CG1  1 
ATOM   2901 C  CG2  . ILE B 1 111 ? 16.540  12.049  -3.568  1.00 24.84 ? 554 ILE B CG2  1 
ATOM   2902 C  CD1  . ILE B 1 111 ? 17.858  13.166  -1.158  1.00 24.79 ? 554 ILE B CD1  1 
ATOM   2903 N  N    . ASP B 1 112 ? 15.223  8.702   -2.600  1.00 25.49 ? 555 ASP B N    1 
ATOM   2904 C  CA   . ASP B 1 112 ? 14.207  7.933   -3.306  1.00 25.37 ? 555 ASP B CA   1 
ATOM   2905 C  C    . ASP B 1 112 ? 12.914  7.710   -2.495  1.00 25.18 ? 555 ASP B C    1 
ATOM   2906 O  O    . ASP B 1 112 ? 11.832  7.912   -3.015  1.00 25.41 ? 555 ASP B O    1 
ATOM   2907 C  CB   . ASP B 1 112 ? 14.781  6.608   -3.802  1.00 25.45 ? 555 ASP B CB   1 
ATOM   2908 C  CG   . ASP B 1 112 ? 13.825  5.880   -4.665  1.00 24.87 ? 555 ASP B CG   1 
ATOM   2909 O  OD1  . ASP B 1 112 ? 13.733  6.228   -5.866  1.00 22.66 ? 555 ASP B OD1  1 
ATOM   2910 O  OD2  . ASP B 1 112 ? 13.096  4.985   -4.185  1.00 25.54 ? 555 ASP B OD2  1 
ATOM   2911 N  N    . ILE B 1 113 ? 13.021  7.316   -1.233  1.00 25.12 ? 556 ILE B N    1 
ATOM   2912 C  CA   . ILE B 1 113 ? 11.848  7.144   -0.367  1.00 24.54 ? 556 ILE B CA   1 
ATOM   2913 C  C    . ILE B 1 113 ? 11.130  8.451   -0.272  1.00 24.06 ? 556 ILE B C    1 
ATOM   2914 O  O    . ILE B 1 113 ? 9.896   8.501   -0.243  1.00 23.70 ? 556 ILE B O    1 
ATOM   2915 C  CB   . ILE B 1 113 ? 12.243  6.718   1.046   1.00 24.86 ? 556 ILE B CB   1 
ATOM   2916 C  CG1  . ILE B 1 113 ? 13.257  5.549   0.997   1.00 25.65 ? 556 ILE B CG1  1 
ATOM   2917 C  CG2  . ILE B 1 113 ? 10.976  6.331   1.869   1.00 24.09 ? 556 ILE B CG2  1 
ATOM   2918 C  CD1  . ILE B 1 113 ? 13.941  5.252   2.328   1.00 26.30 ? 556 ILE B CD1  1 
ATOM   2919 N  N    . ALA B 1 114 ? 11.919  9.513   -0.211  1.00 23.48 ? 557 ALA B N    1 
ATOM   2920 C  CA   . ALA B 1 114 ? 11.378  10.861  -0.168  1.00 23.60 ? 557 ALA B CA   1 
ATOM   2921 C  C    . ALA B 1 114 ? 10.520  11.171  -1.422  1.00 23.10 ? 557 ALA B C    1 
ATOM   2922 O  O    . ALA B 1 114 ? 9.488   11.819  -1.320  1.00 22.47 ? 557 ALA B O    1 
ATOM   2923 C  CB   . ALA B 1 114 ? 12.527  11.877  0.006   1.00 23.44 ? 557 ALA B CB   1 
ATOM   2924 N  N    . ARG B 1 115 ? 10.967  10.652  -2.567  1.00 23.10 ? 558 ARG B N    1 
ATOM   2925 C  CA   . ARG B 1 115 ? 10.398  10.897  -3.890  1.00 23.36 ? 558 ARG B CA   1 
ATOM   2926 C  C    . ARG B 1 115 ? 9.128   10.102  -4.131  1.00 23.69 ? 558 ARG B C    1 
ATOM   2927 O  O    . ARG B 1 115 ? 8.098   10.644  -4.536  1.00 23.41 ? 558 ARG B O    1 
ATOM   2928 C  CB   . ARG B 1 115 ? 11.446  10.560  -4.944  1.00 23.52 ? 558 ARG B CB   1 
ATOM   2929 C  CG   . ARG B 1 115 ? 10.965  9.914   -6.227  1.00 24.20 ? 558 ARG B CG   1 
ATOM   2930 C  CD   . ARG B 1 115 ? 11.891  10.181  -7.403  1.00 24.38 ? 558 ARG B CD   1 
ATOM   2931 N  NE   . ARG B 1 115 ? 12.705  9.030   -7.761  1.00 25.71 ? 558 ARG B NE   1 
ATOM   2932 C  CZ   . ARG B 1 115 ? 13.303  8.857   -8.949  1.00 25.31 ? 558 ARG B CZ   1 
ATOM   2933 N  NH1  . ARG B 1 115 ? 13.195  9.759   -9.929  1.00 24.79 ? 558 ARG B NH1  1 
ATOM   2934 N  NH2  . ARG B 1 115 ? 14.010  7.755   -9.160  1.00 25.05 ? 558 ARG B NH2  1 
ATOM   2935 N  N    . GLN B 1 116 ? 9.214   8.803   -3.886  1.00 23.92 ? 559 GLN B N    1 
ATOM   2936 C  CA   . GLN B 1 116 ? 8.040   7.927   -3.867  1.00 23.44 ? 559 GLN B CA   1 
ATOM   2937 C  C    . GLN B 1 116 ? 6.945   8.487   -2.977  1.00 23.13 ? 559 GLN B C    1 
ATOM   2938 O  O    . GLN B 1 116 ? 5.775   8.425   -3.322  1.00 23.07 ? 559 GLN B O    1 
ATOM   2939 C  CB   . GLN B 1 116 ? 8.423   6.540   -3.360  1.00 23.11 ? 559 GLN B CB   1 
ATOM   2940 C  CG   . GLN B 1 116 ? 9.458   5.850   -4.191  1.00 22.71 ? 559 GLN B CG   1 
ATOM   2941 C  CD   . GLN B 1 116 ? 9.567   4.400   -3.875  1.00 21.41 ? 559 GLN B CD   1 
ATOM   2942 O  OE1  . GLN B 1 116 ? 8.587   3.674   -3.967  1.00 21.47 ? 559 GLN B OE1  1 
ATOM   2943 N  NE2  . GLN B 1 116 ? 10.758  3.961   -3.513  1.00 21.05 ? 559 GLN B NE2  1 
ATOM   2944 N  N    . THR B 1 117 ? 7.327   9.027   -1.829  1.00 23.21 ? 560 THR B N    1 
ATOM   2945 C  CA   . THR B 1 117 ? 6.345   9.507   -0.868  1.00 23.25 ? 560 THR B CA   1 
ATOM   2946 C  C    . THR B 1 117 ? 5.717   10.790  -1.384  1.00 23.52 ? 560 THR B C    1 
ATOM   2947 O  O    . THR B 1 117 ? 4.492   10.973  -1.258  1.00 23.84 ? 560 THR B O    1 
ATOM   2948 C  CB   . THR B 1 117 ? 6.945   9.722   0.519   1.00 23.15 ? 560 THR B CB   1 
ATOM   2949 O  OG1  . THR B 1 117 ? 7.523   8.499   1.006   1.00 21.94 ? 560 THR B OG1  1 
ATOM   2950 C  CG2  . THR B 1 117 ? 5.847   10.042  1.503   1.00 22.90 ? 560 THR B CG2  1 
ATOM   2951 N  N    . ALA B 1 118 ? 6.534   11.654  -1.982  1.00 23.47 ? 561 ALA B N    1 
ATOM   2952 C  CA   . ALA B 1 118 ? 6.021   12.863  -2.604  1.00 23.84 ? 561 ALA B CA   1 
ATOM   2953 C  C    . ALA B 1 118 ? 5.202   12.538  -3.841  1.00 24.52 ? 561 ALA B C    1 
ATOM   2954 O  O    . ALA B 1 118 ? 4.239   13.262  -4.140  1.00 25.30 ? 561 ALA B O    1 
ATOM   2955 C  CB   . ALA B 1 118 ? 7.116   13.817  -2.942  1.00 24.05 ? 561 ALA B CB   1 
ATOM   2956 N  N    . ARG B 1 119 ? 5.527   11.449  -4.546  1.00 24.41 ? 562 ARG B N    1 
ATOM   2957 C  CA   . ARG B 1 119 ? 4.677   11.005  -5.656  1.00 24.04 ? 562 ARG B CA   1 
ATOM   2958 C  C    . ARG B 1 119 ? 3.271   10.703  -5.127  1.00 23.91 ? 562 ARG B C    1 
ATOM   2959 O  O    . ARG B 1 119 ? 2.271   11.242  -5.597  1.00 23.24 ? 562 ARG B O    1 
ATOM   2960 C  CB   . ARG B 1 119 ? 5.253   9.779   -6.350  1.00 24.04 ? 562 ARG B CB   1 
ATOM   2961 C  CG   . ARG B 1 119 ? 6.315   10.104  -7.422  1.00 24.45 ? 562 ARG B CG   1 
ATOM   2962 C  CD   . ARG B 1 119 ? 7.233   8.939   -7.764  1.00 23.48 ? 562 ARG B CD   1 
ATOM   2963 N  NE   . ARG B 1 119 ? 8.346   9.336   -8.626  1.00 24.13 ? 562 ARG B NE   1 
ATOM   2964 C  CZ   . ARG B 1 119 ? 9.224   8.484   -9.160  1.00 23.36 ? 562 ARG B CZ   1 
ATOM   2965 N  NH1  . ARG B 1 119 ? 9.132   7.190   -8.937  1.00 24.87 ? 562 ARG B NH1  1 
ATOM   2966 N  NH2  . ARG B 1 119 ? 10.209  8.920   -9.910  1.00 23.22 ? 562 ARG B NH2  1 
ATOM   2967 N  N    . GLY B 1 120 ? 3.216   9.866   -4.108  1.00 24.02 ? 563 GLY B N    1 
ATOM   2968 C  CA   . GLY B 1 120 ? 1.950   9.463   -3.523  1.00 23.98 ? 563 GLY B CA   1 
ATOM   2969 C  C    . GLY B 1 120 ? 1.169   10.592  -2.894  1.00 23.55 ? 563 GLY B C    1 
ATOM   2970 O  O    . GLY B 1 120 ? -0.044  10.656  -3.038  1.00 23.16 ? 563 GLY B O    1 
ATOM   2971 N  N    . MET B 1 121 ? 1.866   11.462  -2.177  1.00 23.60 ? 564 MET B N    1 
ATOM   2972 C  CA   . MET B 1 121 ? 1.218   12.574  -1.500  1.00 23.87 ? 564 MET B CA   1 
ATOM   2973 C  C    . MET B 1 121 ? 0.670   13.549  -2.530  1.00 23.83 ? 564 MET B C    1 
ATOM   2974 O  O    . MET B 1 121 ? -0.361  14.173  -2.339  1.00 24.35 ? 564 MET B O    1 
ATOM   2975 C  CB   . MET B 1 121 ? 2.206   13.309  -0.595  1.00 23.92 ? 564 MET B CB   1 
ATOM   2976 C  CG   . MET B 1 121 ? 2.154   12.943  0.886   1.00 23.67 ? 564 MET B CG   1 
ATOM   2977 S  SD   . MET B 1 121 ? 0.600   12.333  1.427   1.00 20.83 ? 564 MET B SD   1 
ATOM   2978 C  CE   . MET B 1 121 ? -0.404  13.685  1.256   1.00 22.80 ? 564 MET B CE   1 
ATOM   2979 N  N    . ASP B 1 122 ? 1.366   13.655  -3.641  1.00 23.65 ? 565 ASP B N    1 
ATOM   2980 C  CA   . ASP B 1 122 ? 0.961   14.549  -4.696  1.00 23.33 ? 565 ASP B CA   1 
ATOM   2981 C  C    . ASP B 1 122 ? -0.293  14.053  -5.397  1.00 22.81 ? 565 ASP B C    1 
ATOM   2982 O  O    . ASP B 1 122 ? -1.064  14.862  -5.891  1.00 22.25 ? 565 ASP B O    1 
ATOM   2983 C  CB   . ASP B 1 122 ? 2.139   14.726  -5.661  1.00 23.54 ? 565 ASP B CB   1 
ATOM   2984 C  CG   . ASP B 1 122 ? 1.816   15.598  -6.836  1.00 23.23 ? 565 ASP B CG   1 
ATOM   2985 O  OD1  . ASP B 1 122 ? 2.013   16.845  -6.775  1.00 20.85 ? 565 ASP B OD1  1 
ATOM   2986 O  OD2  . ASP B 1 122 ? 1.380   15.077  -7.877  1.00 23.96 ? 565 ASP B OD2  1 
ATOM   2987 N  N    . TYR B 1 123 ? -0.493  12.732  -5.406  1.00 22.84 ? 566 TYR B N    1 
ATOM   2988 C  CA   . TYR B 1 123 ? -1.608  12.072  -6.096  1.00 22.86 ? 566 TYR B CA   1 
ATOM   2989 C  C    . TYR B 1 123 ? -2.921  12.300  -5.354  1.00 23.00 ? 566 TYR B C    1 
ATOM   2990 O  O    . TYR B 1 123 ? -3.970  12.501  -5.968  1.00 22.35 ? 566 TYR B O    1 
ATOM   2991 C  CB   . TYR B 1 123 ? -1.326  10.553  -6.263  1.00 22.79 ? 566 TYR B CB   1 
ATOM   2992 C  CG   . TYR B 1 123 ? -2.498  9.738   -6.819  1.00 22.72 ? 566 TYR B CG   1 
ATOM   2993 C  CD1  . TYR B 1 123 ? -2.757  9.675   -8.178  1.00 21.75 ? 566 TYR B CD1  1 
ATOM   2994 C  CD2  . TYR B 1 123 ? -3.345  9.056   -5.971  1.00 22.75 ? 566 TYR B CD2  1 
ATOM   2995 C  CE1  . TYR B 1 123 ? -3.825  8.976   -8.659  1.00 22.61 ? 566 TYR B CE1  1 
ATOM   2996 C  CE2  . TYR B 1 123 ? -4.415  8.344   -6.442  1.00 22.84 ? 566 TYR B CE2  1 
ATOM   2997 C  CZ   . TYR B 1 123 ? -4.657  8.299   -7.783  1.00 23.59 ? 566 TYR B CZ   1 
ATOM   2998 O  OH   . TYR B 1 123 ? -5.728  7.554   -8.240  1.00 22.80 ? 566 TYR B OH   1 
ATOM   2999 N  N    . LEU B 1 124 ? -2.849  12.271  -4.028  1.00 23.73 ? 567 LEU B N    1 
ATOM   3000 C  CA   . LEU B 1 124 ? -4.021  12.506  -3.174  1.00 24.41 ? 567 LEU B CA   1 
ATOM   3001 C  C    . LEU B 1 124 ? -4.462  13.950  -3.277  1.00 24.32 ? 567 LEU B C    1 
ATOM   3002 O  O    . LEU B 1 124 ? -5.637  14.233  -3.412  1.00 24.29 ? 567 LEU B O    1 
ATOM   3003 C  CB   . LEU B 1 124 ? -3.725  12.150  -1.711  1.00 24.49 ? 567 LEU B CB   1 
ATOM   3004 C  CG   . LEU B 1 124 ? -3.271  10.707  -1.428  1.00 25.05 ? 567 LEU B CG   1 
ATOM   3005 C  CD1  . LEU B 1 124 ? -2.656  10.588  -0.017  1.00 25.48 ? 567 LEU B CD1  1 
ATOM   3006 C  CD2  . LEU B 1 124 ? -4.431  9.716   -1.587  1.00 24.85 ? 567 LEU B CD2  1 
ATOM   3007 N  N    . HIS B 1 125 ? -3.519  14.875  -3.228  1.00 24.76 ? 568 HIS B N    1 
ATOM   3008 C  CA   . HIS B 1 125 ? -3.871  16.287  -3.397  1.00 25.27 ? 568 HIS B CA   1 
ATOM   3009 C  C    . HIS B 1 125 ? -4.451  16.537  -4.796  1.00 25.22 ? 568 HIS B C    1 
ATOM   3010 O  O    . HIS B 1 125 ? -5.234  17.441  -4.953  1.00 26.04 ? 568 HIS B O    1 
ATOM   3011 C  CB   . HIS B 1 125 ? -2.664  17.195  -3.136  1.00 25.62 ? 568 HIS B CB   1 
ATOM   3012 C  CG   . HIS B 1 125 ? -2.237  17.245  -1.697  1.00 26.42 ? 568 HIS B CG   1 
ATOM   3013 N  ND1  . HIS B 1 125 ? -1.501  18.288  -1.174  1.00 27.47 ? 568 HIS B ND1  1 
ATOM   3014 C  CD2  . HIS B 1 125 ? -2.450  16.385  -0.673  1.00 26.29 ? 568 HIS B CD2  1 
ATOM   3015 C  CE1  . HIS B 1 125 ? -1.294  18.070  0.113   1.00 27.87 ? 568 HIS B CE1  1 
ATOM   3016 N  NE2  . HIS B 1 125 ? -1.857  16.921  0.441   1.00 26.45 ? 568 HIS B NE2  1 
ATOM   3017 N  N    . ALA B 1 126 ? -4.088  15.727  -5.791  1.00 24.72 ? 569 ALA B N    1 
ATOM   3018 C  CA   . ALA B 1 126 ? -4.594  15.876  -7.157  1.00 24.64 ? 569 ALA B CA   1 
ATOM   3019 C  C    . ALA B 1 126 ? -6.050  15.453  -7.283  1.00 24.57 ? 569 ALA B C    1 
ATOM   3020 O  O    . ALA B 1 126 ? -6.799  15.945  -8.132  1.00 24.63 ? 569 ALA B O    1 
ATOM   3021 C  CB   . ALA B 1 126 ? -3.749  15.066  -8.136  1.00 24.58 ? 569 ALA B CB   1 
ATOM   3022 N  N    . LYS B 1 127 ? -6.454  14.517  -6.453  1.00 24.84 ? 570 LYS B N    1 
ATOM   3023 C  CA   . LYS B 1 127 ? -7.828  14.070  -6.477  1.00 24.87 ? 570 LYS B CA   1 
ATOM   3024 C  C    . LYS B 1 127 ? -8.636  14.764  -5.373  1.00 24.77 ? 570 LYS B C    1 
ATOM   3025 O  O    . LYS B 1 127 ? -9.803  14.441  -5.188  1.00 25.10 ? 570 LYS B O    1 
ATOM   3026 C  CB   . LYS B 1 127 ? -7.884  12.534  -6.397  1.00 25.04 ? 570 LYS B CB   1 
ATOM   3027 C  CG   . LYS B 1 127 ? -7.423  11.787  -7.716  1.00 25.28 ? 570 LYS B CG   1 
ATOM   3028 C  CD   . LYS B 1 127 ? -8.573  11.436  -8.733  1.00 25.07 ? 570 LYS B CD   1 
ATOM   3029 C  CE   . LYS B 1 127 ? -8.093  10.636  -9.990  1.00 24.77 ? 570 LYS B CE   1 
ATOM   3030 N  NZ   . LYS B 1 127 ? -7.823  11.449  -11.258 1.00 23.08 ? 570 LYS B NZ   1 
ATOM   3031 N  N    . SER B 1 128 ? -8.015  15.723  -4.662  1.00 24.70 ? 571 SER B N    1 
ATOM   3032 C  CA   . SER B 1 128 ? -8.700  16.625  -3.705  1.00 24.27 ? 571 SER B CA   1 
ATOM   3033 C  C    . SER B 1 128 ? -8.923  15.977  -2.350  1.00 24.21 ? 571 SER B C    1 
ATOM   3034 O  O    . SER B 1 128 ? -10.018 16.032  -1.790  1.00 24.18 ? 571 SER B O    1 
ATOM   3035 C  CB   . SER B 1 128 ? -10.047 17.116  -4.244  1.00 24.09 ? 571 SER B CB   1 
ATOM   3036 O  OG   . SER B 1 128 ? -9.971  17.449  -5.605  1.00 23.06 ? 571 SER B OG   1 
ATOM   3037 N  N    . ILE B 1 129 ? -7.863  15.372  -1.837  1.00 23.93 ? 572 ILE B N    1 
ATOM   3038 C  CA   . ILE B 1 129 ? -7.904  14.566  -0.640  1.00 23.73 ? 572 ILE B CA   1 
ATOM   3039 C  C    . ILE B 1 129 ? -6.847  15.049  0.321   1.00 23.92 ? 572 ILE B C    1 
ATOM   3040 O  O    . ILE B 1 129 ? -5.662  15.055  -0.013  1.00 23.37 ? 572 ILE B O    1 
ATOM   3041 C  CB   . ILE B 1 129 ? -7.549  13.130  -1.005  1.00 23.92 ? 572 ILE B CB   1 
ATOM   3042 C  CG1  . ILE B 1 129 ? -8.654  12.509  -1.842  1.00 23.27 ? 572 ILE B CG1  1 
ATOM   3043 C  CG2  . ILE B 1 129 ? -7.221  12.288  0.261   1.00 24.20 ? 572 ILE B CG2  1 
ATOM   3044 C  CD1  . ILE B 1 129 ? -8.444  11.062  -2.088  1.00 23.12 ? 572 ILE B CD1  1 
ATOM   3045 N  N    . ILE B 1 130 ? -7.246  15.376  1.542   1.00 24.38 ? 573 ILE B N    1 
ATOM   3046 C  CA   . ILE B 1 130 ? -6.258  15.619  2.583   1.00 24.68 ? 573 ILE B CA   1 
ATOM   3047 C  C    . ILE B 1 130 ? -6.140  14.382  3.491   1.00 24.76 ? 573 ILE B C    1 
ATOM   3048 O  O    . ILE B 1 130 ? -7.125  13.885  4.021   1.00 25.03 ? 573 ILE B O    1 
ATOM   3049 C  CB   . ILE B 1 130 ? -6.527  16.914  3.388   1.00 24.86 ? 573 ILE B CB   1 
ATOM   3050 C  CG1  . ILE B 1 130 ? -7.299  17.965  2.572   1.00 24.22 ? 573 ILE B CG1  1 
ATOM   3051 C  CG2  . ILE B 1 130 ? -5.167  17.520  3.844   1.00 25.29 ? 573 ILE B CG2  1 
ATOM   3052 C  CD1  . ILE B 1 130 ? -7.959  19.024  3.421   1.00 23.36 ? 573 ILE B CD1  1 
ATOM   3053 N  N    . HIS B 1 131 ? -4.924  13.864  3.610   1.00 24.51 ? 574 HIS B N    1 
ATOM   3054 C  CA   . HIS B 1 131 ? -4.642  12.703  4.433   1.00 24.60 ? 574 HIS B CA   1 
ATOM   3055 C  C    . HIS B 1 131 ? -4.902  12.985  5.907   1.00 24.91 ? 574 HIS B C    1 
ATOM   3056 O  O    . HIS B 1 131 ? -5.303  12.104  6.661   1.00 24.78 ? 574 HIS B O    1 
ATOM   3057 C  CB   . HIS B 1 131 ? -3.181  12.338  4.246   1.00 24.83 ? 574 HIS B CB   1 
ATOM   3058 C  CG   . HIS B 1 131 ? -2.815  10.992  4.775   1.00 24.56 ? 574 HIS B CG   1 
ATOM   3059 N  ND1  . HIS B 1 131 ? -2.319  10.802  6.044   1.00 23.04 ? 574 HIS B ND1  1 
ATOM   3060 C  CD2  . HIS B 1 131 ? -2.852  9.772   4.196   1.00 24.21 ? 574 HIS B CD2  1 
ATOM   3061 C  CE1  . HIS B 1 131 ? -2.069  9.520   6.225   1.00 23.48 ? 574 HIS B CE1  1 
ATOM   3062 N  NE2  . HIS B 1 131 ? -2.387  8.874   5.120   1.00 24.32 ? 574 HIS B NE2  1 
ATOM   3063 N  N    . ARG B 1 132 ? -4.624  14.218  6.307   1.00 25.18 ? 575 ARG B N    1 
ATOM   3064 C  CA   . ARG B 1 132 ? -4.843  14.703  7.661   1.00 25.32 ? 575 ARG B CA   1 
ATOM   3065 C  C    . ARG B 1 132 ? -3.896  14.129  8.728   1.00 25.42 ? 575 ARG B C    1 
ATOM   3066 O  O    . ARG B 1 132 ? -3.977  14.540  9.868   1.00 25.70 ? 575 ARG B O    1 
ATOM   3067 C  CB   . ARG B 1 132 ? -6.321  14.519  8.076   1.00 25.49 ? 575 ARG B CB   1 
ATOM   3068 C  CG   . ARG B 1 132 ? -7.266  15.649  7.603   1.00 25.95 ? 575 ARG B CG   1 
ATOM   3069 C  CD   . ARG B 1 132 ? -8.497  15.214  6.771   1.00 27.12 ? 575 ARG B CD   1 
ATOM   3070 N  NE   . ARG B 1 132 ? -9.711  15.087  7.582   1.00 28.14 ? 575 ARG B NE   1 
ATOM   3071 C  CZ   . ARG B 1 132 ? -10.413 16.111  8.099   1.00 28.44 ? 575 ARG B CZ   1 
ATOM   3072 N  NH1  . ARG B 1 132 ? -10.043 17.373  7.875   1.00 27.34 ? 575 ARG B NH1  1 
ATOM   3073 N  NH2  . ARG B 1 132 ? -11.515 15.875  8.833   1.00 27.75 ? 575 ARG B NH2  1 
ATOM   3074 N  N    . ASP B 1 133 ? -2.979  13.218  8.387   1.00 25.44 ? 576 ASP B N    1 
ATOM   3075 C  CA   . ASP B 1 133 ? -2.193  12.515  9.423   1.00 25.10 ? 576 ASP B CA   1 
ATOM   3076 C  C    . ASP B 1 133 ? -1.130  11.653  8.780   1.00 25.18 ? 576 ASP B C    1 
ATOM   3077 O  O    . ASP B 1 133 ? -1.049  10.447  9.044   1.00 24.75 ? 576 ASP B O    1 
ATOM   3078 C  CB   . ASP B 1 133 ? -3.119  11.641  10.288  1.00 25.30 ? 576 ASP B CB   1 
ATOM   3079 C  CG   . ASP B 1 133 ? -2.397  10.908  11.426  1.00 24.95 ? 576 ASP B CG   1 
ATOM   3080 O  OD1  . ASP B 1 133 ? -2.236  9.666   11.363  1.00 24.23 ? 576 ASP B OD1  1 
ATOM   3081 O  OD2  . ASP B 1 133 ? -2.018  11.481  12.451  1.00 24.73 ? 576 ASP B OD2  1 
ATOM   3082 N  N    . LEU B 1 134 ? -0.324  12.280  7.920   1.00 25.31 ? 577 LEU B N    1 
ATOM   3083 C  CA   . LEU B 1 134 ? 0.852   11.635  7.349   1.00 25.07 ? 577 LEU B CA   1 
ATOM   3084 C  C    . LEU B 1 134 ? 1.881   11.551  8.432   1.00 24.95 ? 577 LEU B C    1 
ATOM   3085 O  O    . LEU B 1 134 ? 1.994   12.474  9.223   1.00 24.88 ? 577 LEU B O    1 
ATOM   3086 C  CB   . LEU B 1 134 ? 1.407   12.471  6.208   1.00 25.31 ? 577 LEU B CB   1 
ATOM   3087 C  CG   . LEU B 1 134 ? 2.803   12.120  5.674   1.00 25.64 ? 577 LEU B CG   1 
ATOM   3088 C  CD1  . LEU B 1 134 ? 2.843   10.680  5.135   1.00 26.17 ? 577 LEU B CD1  1 
ATOM   3089 C  CD2  . LEU B 1 134 ? 3.159   13.100  4.590   1.00 24.17 ? 577 LEU B CD2  1 
ATOM   3090 N  N    . LYS B 1 135 ? 2.641   10.460  8.457   1.00 25.28 ? 578 LYS B N    1 
ATOM   3091 C  CA   . LYS B 1 135 ? 3.748   10.274  9.425   1.00 25.14 ? 578 LYS B CA   1 
ATOM   3092 C  C    . LYS B 1 135 ? 4.540   9.028   9.069   1.00 25.34 ? 578 LYS B C    1 
ATOM   3093 O  O    . LYS B 1 135 ? 4.046   8.196   8.307   1.00 25.78 ? 578 LYS B O    1 
ATOM   3094 C  CB   . LYS B 1 135 ? 3.201   10.112  10.831  1.00 24.94 ? 578 LYS B CB   1 
ATOM   3095 C  CG   . LYS B 1 135 ? 2.041   9.138   10.904  1.00 24.41 ? 578 LYS B CG   1 
ATOM   3096 C  CD   . LYS B 1 135 ? 0.901   9.682   11.728  1.00 23.89 ? 578 LYS B CD   1 
ATOM   3097 C  CE   . LYS B 1 135 ? 0.904   9.088   13.103  1.00 23.69 ? 578 LYS B CE   1 
ATOM   3098 N  NZ   . LYS B 1 135 ? -0.271  9.526   13.860  1.00 22.98 ? 578 LYS B NZ   1 
ATOM   3099 N  N    . SER B 1 136 ? 5.741   8.863   9.625   1.00 25.37 ? 579 SER B N    1 
ATOM   3100 C  CA   . SER B 1 136 ? 6.587   7.726   9.246   1.00 25.33 ? 579 SER B CA   1 
ATOM   3101 C  C    . SER B 1 136 ? 5.844   6.401   9.368   1.00 25.90 ? 579 SER B C    1 
ATOM   3102 O  O    . SER B 1 136 ? 5.900   5.561   8.475   1.00 26.84 ? 579 SER B O    1 
ATOM   3103 C  CB   . SER B 1 136 ? 7.838   7.659   10.089  1.00 24.98 ? 579 SER B CB   1 
ATOM   3104 O  OG   . SER B 1 136 ? 7.498   7.473   11.442  1.00 25.51 ? 579 SER B OG   1 
ATOM   3105 N  N    . ASN B 1 137 ? 5.134   6.221   10.468  1.00 26.02 ? 580 ASN B N    1 
ATOM   3106 C  CA   . ASN B 1 137 ? 4.412   4.977   10.734  1.00 25.98 ? 580 ASN B CA   1 
ATOM   3107 C  C    . ASN B 1 137 ? 3.436   4.668   9.613   1.00 25.80 ? 580 ASN B C    1 
ATOM   3108 O  O    . ASN B 1 137 ? 3.343   3.542   9.148   1.00 26.02 ? 580 ASN B O    1 
ATOM   3109 C  CB   . ASN B 1 137 ? 3.713   5.083   12.075  1.00 25.78 ? 580 ASN B CB   1 
ATOM   3110 C  CG   . ASN B 1 137 ? 4.346   6.137   12.939  1.00 26.67 ? 580 ASN B CG   1 
ATOM   3111 O  OD1  . ASN B 1 137 ? 3.961   7.321   12.871  1.00 28.77 ? 580 ASN B OD1  1 
ATOM   3112 N  ND2  . ASN B 1 137 ? 5.381   5.751   13.694  1.00 25.15 ? 580 ASN B ND2  1 
ATOM   3113 N  N    . ASN B 1 138 ? 2.747   5.693   9.151   1.00 25.87 ? 581 ASN B N    1 
ATOM   3114 C  CA   . ASN B 1 138 ? 1.815   5.566   8.028   1.00 25.80 ? 581 ASN B CA   1 
ATOM   3115 C  C    . ASN B 1 138 ? 2.475   5.335   6.635   1.00 25.69 ? 581 ASN B C    1 
ATOM   3116 O  O    . ASN B 1 138 ? 1.776   5.118   5.640   1.00 26.30 ? 581 ASN B O    1 
ATOM   3117 C  CB   . ASN B 1 138 ? 0.865   6.799   7.998   1.00 25.79 ? 581 ASN B CB   1 
ATOM   3118 C  CG   . ASN B 1 138 ? -0.304  6.673   8.975   1.00 24.43 ? 581 ASN B CG   1 
ATOM   3119 O  OD1  . ASN B 1 138 ? -0.639  5.572   9.384   1.00 26.67 ? 581 ASN B OD1  1 
ATOM   3120 N  ND2  . ASN B 1 138 ? -0.939  7.789   9.320   1.00 20.11 ? 581 ASN B ND2  1 
ATOM   3121 N  N    . ILE B 1 139 ? 3.796   5.364   6.554   1.00 25.04 ? 582 ILE B N    1 
ATOM   3122 C  CA   . ILE B 1 139 ? 4.485   5.041   5.314   1.00 24.79 ? 582 ILE B CA   1 
ATOM   3123 C  C    . ILE B 1 139 ? 4.990   3.592   5.406   1.00 24.81 ? 582 ILE B C    1 
ATOM   3124 O  O    . ILE B 1 139 ? 5.938   3.324   6.139   1.00 24.28 ? 582 ILE B O    1 
ATOM   3125 C  CB   . ILE B 1 139 ? 5.650   6.063   5.088   1.00 24.72 ? 582 ILE B CB   1 
ATOM   3126 C  CG1  . ILE B 1 139 ? 5.091   7.450   4.776   1.00 24.67 ? 582 ILE B CG1  1 
ATOM   3127 C  CG2  . ILE B 1 139 ? 6.555   5.665   3.947   1.00 24.52 ? 582 ILE B CG2  1 
ATOM   3128 C  CD1  . ILE B 1 139 ? 6.116   8.583   4.949   1.00 24.17 ? 582 ILE B CD1  1 
ATOM   3129 N  N    . PHE B 1 140 ? 4.354   2.672   4.670   1.00 25.07 ? 583 PHE B N    1 
ATOM   3130 C  CA   . PHE B 1 140 ? 4.784   1.259   4.598   1.00 25.57 ? 583 PHE B CA   1 
ATOM   3131 C  C    . PHE B 1 140 ? 5.955   1.040   3.586   1.00 26.24 ? 583 PHE B C    1 
ATOM   3132 O  O    . PHE B 1 140 ? 5.955   1.573   2.470   1.00 27.04 ? 583 PHE B O    1 
ATOM   3133 C  CB   . PHE B 1 140 ? 3.596   0.359   4.237   1.00 25.38 ? 583 PHE B CB   1 
ATOM   3134 C  CG   . PHE B 1 140 ? 3.274   -0.674  5.279   1.00 25.64 ? 583 PHE B CG   1 
ATOM   3135 C  CD1  . PHE B 1 140 ? 2.598   -0.319  6.440   1.00 27.08 ? 583 PHE B CD1  1 
ATOM   3136 C  CD2  . PHE B 1 140 ? 3.619   -2.000  5.096   1.00 25.94 ? 583 PHE B CD2  1 
ATOM   3137 C  CE1  . PHE B 1 140 ? 2.298   -1.265  7.419   1.00 26.80 ? 583 PHE B CE1  1 
ATOM   3138 C  CE2  . PHE B 1 140 ? 3.316   -2.964  6.075   1.00 26.77 ? 583 PHE B CE2  1 
ATOM   3139 C  CZ   . PHE B 1 140 ? 2.663   -2.585  7.235   1.00 26.76 ? 583 PHE B CZ   1 
ATOM   3140 N  N    . LEU B 1 141 ? 6.962   0.260   3.949   1.00 26.34 ? 584 LEU B N    1 
ATOM   3141 C  CA   . LEU B 1 141 ? 8.080   0.075   3.031   1.00 26.58 ? 584 LEU B CA   1 
ATOM   3142 C  C    . LEU B 1 141 ? 8.028   -1.317  2.370   1.00 27.04 ? 584 LEU B C    1 
ATOM   3143 O  O    . LEU B 1 141 ? 9.046   -2.049  2.344   1.00 27.29 ? 584 LEU B O    1 
ATOM   3144 C  CB   . LEU B 1 141 ? 9.411   0.335   3.762   1.00 26.54 ? 584 LEU B CB   1 
ATOM   3145 C  CG   . LEU B 1 141 ? 10.340  1.359   3.108   1.00 26.69 ? 584 LEU B CG   1 
ATOM   3146 C  CD1  . LEU B 1 141 ? 11.502  1.625   4.012   1.00 27.14 ? 584 LEU B CD1  1 
ATOM   3147 C  CD2  . LEU B 1 141 ? 10.853  0.883   1.733   1.00 26.94 ? 584 LEU B CD2  1 
ATOM   3148 N  N    . HIS B 1 142 ? 6.844   -1.664  1.830   1.00 27.11 ? 585 HIS B N    1 
ATOM   3149 C  CA   . HIS B 1 142 ? 6.603   -2.938  1.092   1.00 27.05 ? 585 HIS B CA   1 
ATOM   3150 C  C    . HIS B 1 142 ? 7.811   -3.538  0.350   1.00 26.64 ? 585 HIS B C    1 
ATOM   3151 O  O    . HIS B 1 142 ? 8.407   -2.867  -0.483  1.00 25.77 ? 585 HIS B O    1 
ATOM   3152 C  CB   . HIS B 1 142 ? 5.473   -2.792  0.059   1.00 26.91 ? 585 HIS B CB   1 
ATOM   3153 C  CG   . HIS B 1 142 ? 5.447   -3.902  -0.956  1.00 28.47 ? 585 HIS B CG   1 
ATOM   3154 N  ND1  . HIS B 1 142 ? 4.953   -5.163  -0.675  1.00 29.70 ? 585 HIS B ND1  1 
ATOM   3155 C  CD2  . HIS B 1 142 ? 5.894   -3.953  -2.238  1.00 29.43 ? 585 HIS B CD2  1 
ATOM   3156 C  CE1  . HIS B 1 142 ? 5.086   -5.935  -1.742  1.00 29.92 ? 585 HIS B CE1  1 
ATOM   3157 N  NE2  . HIS B 1 142 ? 5.653   -5.226  -2.704  1.00 29.93 ? 585 HIS B NE2  1 
ATOM   3158 N  N    . GLU B 1 143 ? 8.110   -4.817  0.632   1.00 26.74 ? 586 GLU B N    1 
ATOM   3159 C  CA   . GLU B 1 143 ? 9.263   -5.545  0.064   1.00 26.89 ? 586 GLU B CA   1 
ATOM   3160 C  C    . GLU B 1 143 ? 10.564  -4.783  0.374   1.00 26.85 ? 586 GLU B C    1 
ATOM   3161 O  O    . GLU B 1 143 ? 11.478  -4.698  -0.469  1.00 26.74 ? 586 GLU B O    1 
ATOM   3162 C  CB   . GLU B 1 143 ? 9.088   -5.821  -1.450  1.00 27.00 ? 586 GLU B CB   1 
ATOM   3163 C  CG   . GLU B 1 143 ? 10.133  -6.760  -2.072  1.00 27.81 ? 586 GLU B CG   1 
ATOM   3164 C  CD   . GLU B 1 143 ? 9.569   -7.688  -3.163  1.00 29.15 ? 586 GLU B CD   1 
ATOM   3165 O  OE1  . GLU B 1 143 ? 8.795   -7.200  -4.035  1.00 30.01 ? 586 GLU B OE1  1 
ATOM   3166 O  OE2  . GLU B 1 143 ? 9.907   -8.906  -3.156  1.00 28.47 ? 586 GLU B OE2  1 
ATOM   3167 N  N    . ASP B 1 144 ? 10.612  -4.227  1.594   1.00 26.77 ? 587 ASP B N    1 
ATOM   3168 C  CA   . ASP B 1 144 ? 11.769  -3.500  2.120   1.00 26.78 ? 587 ASP B CA   1 
ATOM   3169 C  C    . ASP B 1 144 ? 12.212  -2.305  1.231   1.00 26.87 ? 587 ASP B C    1 
ATOM   3170 O  O    . ASP B 1 144 ? 13.267  -1.730  1.473   1.00 27.18 ? 587 ASP B O    1 
ATOM   3171 C  CB   . ASP B 1 144 ? 12.964  -4.498  2.345   1.00 26.89 ? 587 ASP B CB   1 
ATOM   3172 C  CG   . ASP B 1 144 ? 13.060  -5.050  3.799   1.00 26.05 ? 587 ASP B CG   1 
ATOM   3173 O  OD1  . ASP B 1 144 ? 13.484  -6.205  3.976   1.00 25.77 ? 587 ASP B OD1  1 
ATOM   3174 O  OD2  . ASP B 1 144 ? 12.761  -4.416  4.829   1.00 26.30 ? 587 ASP B OD2  1 
ATOM   3175 N  N    . ASN B 1 145 ? 11.421  -1.907  0.225   1.00 26.95 ? 588 ASN B N    1 
ATOM   3176 C  CA   . ASN B 1 145 ? 11.945  -1.039  -0.856  1.00 26.72 ? 588 ASN B CA   1 
ATOM   3177 C  C    . ASN B 1 145 ? 11.004  -0.056  -1.614  1.00 26.47 ? 588 ASN B C    1 
ATOM   3178 O  O    . ASN B 1 145 ? 11.471  0.679   -2.489  1.00 26.83 ? 588 ASN B O    1 
ATOM   3179 C  CB   . ASN B 1 145 ? 12.635  -1.928  -1.893  1.00 26.53 ? 588 ASN B CB   1 
ATOM   3180 C  CG   . ASN B 1 145 ? 13.794  -1.238  -2.583  1.00 27.53 ? 588 ASN B CG   1 
ATOM   3181 O  OD1  . ASN B 1 145 ? 14.839  -1.851  -2.828  1.00 31.13 ? 588 ASN B OD1  1 
ATOM   3182 N  ND2  . ASN B 1 145 ? 13.619  0.026   -2.922  1.00 27.79 ? 588 ASN B ND2  1 
ATOM   3183 N  N    . THR B 1 146 ? 9.702   -0.048  -1.339  1.00 26.07 ? 589 THR B N    1 
ATOM   3184 C  CA   . THR B 1 146 ? 8.790   0.872   -2.047  1.00 25.46 ? 589 THR B CA   1 
ATOM   3185 C  C    . THR B 1 146 ? 7.635   1.284   -1.163  1.00 25.17 ? 589 THR B C    1 
ATOM   3186 O  O    . THR B 1 146 ? 7.060   0.470   -0.439  1.00 25.00 ? 589 THR B O    1 
ATOM   3187 C  CB   . THR B 1 146 ? 8.245   0.307   -3.394  1.00 25.43 ? 589 THR B CB   1 
ATOM   3188 O  OG1  . THR B 1 146 ? 7.597   -0.956  -3.187  1.00 26.06 ? 589 THR B OG1  1 
ATOM   3189 C  CG2  . THR B 1 146 ? 9.359   0.018   -4.399  1.00 24.79 ? 589 THR B CG2  1 
ATOM   3190 N  N    . VAL B 1 147 ? 7.300   2.569   -1.276  1.00 24.99 ? 590 VAL B N    1 
ATOM   3191 C  CA   . VAL B 1 147 ? 6.445   3.302   -0.343  1.00 24.47 ? 590 VAL B CA   1 
ATOM   3192 C  C    . VAL B 1 147 ? 4.953   3.023   -0.588  1.00 24.24 ? 590 VAL B C    1 
ATOM   3193 O  O    . VAL B 1 147 ? 4.555   2.770   -1.712  1.00 23.12 ? 590 VAL B O    1 
ATOM   3194 C  CB   . VAL B 1 147 ? 6.777   4.822   -0.454  1.00 24.10 ? 590 VAL B CB   1 
ATOM   3195 C  CG1  . VAL B 1 147 ? 5.656   5.702   -0.036  1.00 24.43 ? 590 VAL B CG1  1 
ATOM   3196 C  CG2  . VAL B 1 147 ? 7.964   5.132   0.363   1.00 24.18 ? 590 VAL B CG2  1 
ATOM   3197 N  N    . LYS B 1 148 ? 4.164   3.072   0.497   1.00 24.40 ? 591 LYS B N    1 
ATOM   3198 C  CA   . LYS B 1 148 ? 2.709   2.891   0.491   1.00 24.74 ? 591 LYS B CA   1 
ATOM   3199 C  C    . LYS B 1 148 ? 2.046   3.765   1.559   1.00 24.93 ? 591 LYS B C    1 
ATOM   3200 O  O    . LYS B 1 148 ? 2.051   3.405   2.718   1.00 25.61 ? 591 LYS B O    1 
ATOM   3201 C  CB   . LYS B 1 148 ? 2.328   1.429   0.776   1.00 24.73 ? 591 LYS B CB   1 
ATOM   3202 C  CG   . LYS B 1 148 ? 2.912   0.401   -0.189  1.00 24.70 ? 591 LYS B CG   1 
ATOM   3203 C  CD   . LYS B 1 148 ? 2.253   0.439   -1.544  1.00 24.24 ? 591 LYS B CD   1 
ATOM   3204 C  CE   . LYS B 1 148 ? 2.984   -0.482  -2.513  1.00 24.81 ? 591 LYS B CE   1 
ATOM   3205 N  NZ   . LYS B 1 148 ? 2.348   -0.534  -3.854  1.00 24.54 ? 591 LYS B NZ   1 
ATOM   3206 N  N    . ILE B 1 149 ? 1.456   4.893   1.190   1.00 24.99 ? 592 ILE B N    1 
ATOM   3207 C  CA   . ILE B 1 149 ? 0.870   5.771   2.196   1.00 25.24 ? 592 ILE B CA   1 
ATOM   3208 C  C    . ILE B 1 149 ? -0.530  5.278   2.528   1.00 25.40 ? 592 ILE B C    1 
ATOM   3209 O  O    . ILE B 1 149 ? -1.251  4.876   1.633   1.00 25.51 ? 592 ILE B O    1 
ATOM   3210 C  CB   . ILE B 1 149 ? 0.812   7.232   1.724   1.00 25.14 ? 592 ILE B CB   1 
ATOM   3211 C  CG1  . ILE B 1 149 ? 2.166   7.697   1.199   1.00 24.03 ? 592 ILE B CG1  1 
ATOM   3212 C  CG2  . ILE B 1 149 ? 0.395   8.123   2.886   1.00 25.38 ? 592 ILE B CG2  1 
ATOM   3213 C  CD1  . ILE B 1 149 ? 2.116   9.083   0.552   1.00 22.85 ? 592 ILE B CD1  1 
ATOM   3214 N  N    . GLY B 1 150 ? -0.894  5.294   3.812   1.00 25.55 ? 593 GLY B N    1 
ATOM   3215 C  CA   . GLY B 1 150 ? -2.223  4.878   4.279   1.00 25.79 ? 593 GLY B CA   1 
ATOM   3216 C  C    . GLY B 1 150 ? -2.521  5.497   5.643   1.00 26.15 ? 593 GLY B C    1 
ATOM   3217 O  O    . GLY B 1 150 ? -1.597  6.041   6.237   1.00 26.79 ? 593 GLY B O    1 
ATOM   3218 N  N    . ASP B 1 151 ? -3.759  5.465   6.147   1.00 26.01 ? 594 ASP B N    1 
ATOM   3219 C  CA   . ASP B 1 151 ? -4.019  6.018   7.487   1.00 26.11 ? 594 ASP B CA   1 
ATOM   3220 C  C    . ASP B 1 151 ? -3.755  4.945   8.585   1.00 26.70 ? 594 ASP B C    1 
ATOM   3221 O  O    . ASP B 1 151 ? -3.449  3.794   8.259   1.00 26.80 ? 594 ASP B O    1 
ATOM   3222 C  CB   . ASP B 1 151 ? -5.440  6.614   7.575   1.00 26.31 ? 594 ASP B CB   1 
ATOM   3223 C  CG   . ASP B 1 151 ? -5.554  7.793   8.590   1.00 25.27 ? 594 ASP B CG   1 
ATOM   3224 O  OD1  . ASP B 1 151 ? -5.993  7.569   9.747   1.00 24.12 ? 594 ASP B OD1  1 
ATOM   3225 O  OD2  . ASP B 1 151 ? -5.263  8.977   8.313   1.00 22.44 ? 594 ASP B OD2  1 
ATOM   3226 N  N    . PHE B 1 152 ? -3.809  5.363   9.863   1.00 27.14 ? 595 PHE B N    1 
ATOM   3227 C  CA   . PHE B 1 152 ? -3.738  4.491   11.070  1.00 27.51 ? 595 PHE B CA   1 
ATOM   3228 C  C    . PHE B 1 152 ? -2.954  3.186   10.854  1.00 28.34 ? 595 PHE B C    1 
ATOM   3229 O  O    . PHE B 1 152 ? -3.301  2.125   11.419  1.00 29.37 ? 595 PHE B O    1 
ATOM   3230 C  CB   . PHE B 1 152 ? -5.168  4.156   11.586  1.00 27.59 ? 595 PHE B CB   1 
ATOM   3231 C  CG   . PHE B 1 152 ? -5.377  4.316   13.090  1.00 26.54 ? 595 PHE B CG   1 
ATOM   3232 C  CD1  . PHE B 1 152 ? -5.875  5.509   13.617  1.00 27.16 ? 595 PHE B CD1  1 
ATOM   3233 C  CD2  . PHE B 1 152 ? -5.145  3.261   13.963  1.00 26.12 ? 595 PHE B CD2  1 
ATOM   3234 C  CE1  . PHE B 1 152 ? -6.101  5.657   15.000  1.00 26.80 ? 595 PHE B CE1  1 
ATOM   3235 C  CE2  . PHE B 1 152 ? -5.380  3.398   15.352  1.00 26.23 ? 595 PHE B CE2  1 
ATOM   3236 C  CZ   . PHE B 1 152 ? -5.859  4.590   15.863  1.00 26.58 ? 595 PHE B CZ   1 
ATOM   3237 N  N    . SER B 1 171 ? -3.086  13.342  20.045  1.00 29.44 ? 614 SER B N    1 
ATOM   3238 C  CA   . SER B 1 171 ? -2.095  12.399  20.555  1.00 29.19 ? 614 SER B CA   1 
ATOM   3239 C  C    . SER B 1 171 ? -1.889  11.290  19.523  1.00 28.98 ? 614 SER B C    1 
ATOM   3240 O  O    . SER B 1 171 ? -2.059  10.110  19.827  1.00 29.44 ? 614 SER B O    1 
ATOM   3241 C  CB   . SER B 1 171 ? -2.517  11.799  21.920  1.00 29.23 ? 614 SER B CB   1 
ATOM   3242 O  OG   . SER B 1 171 ? -3.370  12.652  22.689  1.00 30.11 ? 614 SER B OG   1 
ATOM   3243 N  N    . GLY B 1 172 ? -1.535  11.669  18.300  1.00 28.56 ? 615 GLY B N    1 
ATOM   3244 C  CA   . GLY B 1 172 ? -1.324  10.693  17.241  1.00 28.31 ? 615 GLY B CA   1 
ATOM   3245 C  C    . GLY B 1 172 ? -1.035  11.290  15.863  1.00 28.15 ? 615 GLY B C    1 
ATOM   3246 O  O    . GLY B 1 172 ? -1.973  11.553  15.089  1.00 27.91 ? 615 GLY B O    1 
ATOM   3247 N  N    . SER B 1 173 ? 0.229   11.638  15.605  1.00 27.86 ? 616 SER B N    1 
ATOM   3248 C  CA   . SER B 1 173 ? 1.143   12.092  16.666  1.00 27.68 ? 616 SER B CA   1 
ATOM   3249 C  C    . SER B 1 173 ? 1.232   13.603  16.465  1.00 27.64 ? 616 SER B C    1 
ATOM   3250 O  O    . SER B 1 173 ? 1.054   14.139  15.350  1.00 27.45 ? 616 SER B O    1 
ATOM   3251 C  CB   . SER B 1 173 ? 2.555   11.444  16.623  1.00 27.77 ? 616 SER B CB   1 
ATOM   3252 O  OG   . SER B 1 173 ? 2.742   10.428  17.610  1.00 25.94 ? 616 SER B OG   1 
ATOM   3253 N  N    . ILE B 1 174 ? 1.495   14.274  17.569  1.00 27.57 ? 617 ILE B N    1 
ATOM   3254 C  CA   . ILE B 1 174 ? 1.627   15.724  17.585  1.00 27.41 ? 617 ILE B CA   1 
ATOM   3255 C  C    . ILE B 1 174 ? 2.926   16.187  16.873  1.00 26.85 ? 617 ILE B C    1 
ATOM   3256 O  O    . ILE B 1 174 ? 2.959   17.273  16.302  1.00 26.62 ? 617 ILE B O    1 
ATOM   3257 C  CB   . ILE B 1 174 ? 1.475   16.257  19.061  1.00 27.59 ? 617 ILE B CB   1 
ATOM   3258 C  CG1  . ILE B 1 174 ? 2.140   17.629  19.251  1.00 27.84 ? 617 ILE B CG1  1 
ATOM   3259 C  CG2  . ILE B 1 174 ? 1.958   15.206  20.143  1.00 27.42 ? 617 ILE B CG2  1 
ATOM   3260 C  CD1  . ILE B 1 174 ? 1.174   18.778  19.170  1.00 27.53 ? 617 ILE B CD1  1 
ATOM   3261 N  N    . LEU B 1 175 ? 3.966   15.360  16.843  1.00 26.17 ? 618 LEU B N    1 
ATOM   3262 C  CA   . LEU B 1 175 ? 5.224   15.810  16.234  1.00 26.02 ? 618 LEU B CA   1 
ATOM   3263 C  C    . LEU B 1 175 ? 5.061   16.217  14.753  1.00 25.94 ? 618 LEU B C    1 
ATOM   3264 O  O    . LEU B 1 175 ? 5.787   17.065  14.256  1.00 25.56 ? 618 LEU B O    1 
ATOM   3265 C  CB   . LEU B 1 175 ? 6.316   14.755  16.355  1.00 25.84 ? 618 LEU B CB   1 
ATOM   3266 C  CG   . LEU B 1 175 ? 6.407   14.045  17.692  1.00 25.55 ? 618 LEU B CG   1 
ATOM   3267 C  CD1  . LEU B 1 175 ? 7.569   13.079  17.697  1.00 25.74 ? 618 LEU B CD1  1 
ATOM   3268 C  CD2  . LEU B 1 175 ? 6.548   15.084  18.776  1.00 26.26 ? 618 LEU B CD2  1 
ATOM   3269 N  N    . TRP B 1 176 ? 4.086   15.620  14.071  1.00 26.08 ? 619 TRP B N    1 
ATOM   3270 C  CA   . TRP B 1 176 ? 3.814   15.901  12.664  1.00 25.74 ? 619 TRP B CA   1 
ATOM   3271 C  C    . TRP B 1 176 ? 2.598   16.832  12.561  1.00 25.87 ? 619 TRP B C    1 
ATOM   3272 O  O    . TRP B 1 176 ? 1.949   16.885  11.513  1.00 25.46 ? 619 TRP B O    1 
ATOM   3273 C  CB   . TRP B 1 176 ? 3.491   14.602  11.907  1.00 25.71 ? 619 TRP B CB   1 
ATOM   3274 C  CG   . TRP B 1 176 ? 4.571   13.570  11.790  1.00 24.60 ? 619 TRP B CG   1 
ATOM   3275 C  CD1  . TRP B 1 176 ? 5.261   13.252  10.664  1.00 25.26 ? 619 TRP B CD1  1 
ATOM   3276 C  CD2  . TRP B 1 176 ? 5.046   12.682  12.810  1.00 24.15 ? 619 TRP B CD2  1 
ATOM   3277 N  NE1  . TRP B 1 176 ? 6.155   12.238  10.916  1.00 25.32 ? 619 TRP B NE1  1 
ATOM   3278 C  CE2  . TRP B 1 176 ? 6.055   11.885  12.238  1.00 25.43 ? 619 TRP B CE2  1 
ATOM   3279 C  CE3  . TRP B 1 176 ? 4.727   12.478  14.151  1.00 22.99 ? 619 TRP B CE3  1 
ATOM   3280 C  CZ2  . TRP B 1 176 ? 6.725   10.896  12.965  1.00 24.75 ? 619 TRP B CZ2  1 
ATOM   3281 C  CZ3  . TRP B 1 176 ? 5.394   11.515  14.854  1.00 21.92 ? 619 TRP B CZ3  1 
ATOM   3282 C  CH2  . TRP B 1 176 ? 6.372   10.742  14.272  1.00 23.28 ? 619 TRP B CH2  1 
ATOM   3283 N  N    . MET B 1 177 ? 2.289   17.563  13.635  1.00 25.69 ? 620 MET B N    1 
ATOM   3284 C  CA   . MET B 1 177 ? 1.178   18.525  13.617  1.00 26.03 ? 620 MET B CA   1 
ATOM   3285 C  C    . MET B 1 177 ? 1.698   19.945  13.343  1.00 26.07 ? 620 MET B C    1 
ATOM   3286 O  O    . MET B 1 177 ? 2.596   20.434  14.039  1.00 26.41 ? 620 MET B O    1 
ATOM   3287 C  CB   . MET B 1 177 ? 0.381   18.481  14.938  1.00 26.25 ? 620 MET B CB   1 
ATOM   3288 C  CG   . MET B 1 177 ? -1.152  18.303  14.769  1.00 25.56 ? 620 MET B CG   1 
ATOM   3289 S  SD   . MET B 1 177 ? -2.116  17.962  16.318  1.00 24.98 ? 620 MET B SD   1 
ATOM   3290 C  CE   . MET B 1 177 ? -1.840  16.101  16.406  1.00 24.44 ? 620 MET B CE   1 
ATOM   3291 N  N    . ALA B 1 178 ? 1.143   20.592  12.318  1.00 25.77 ? 621 ALA B N    1 
ATOM   3292 C  CA   . ALA B 1 178 ? 1.581   21.924  11.927  1.00 25.67 ? 621 ALA B CA   1 
ATOM   3293 C  C    . ALA B 1 178 ? 1.051   22.870  12.966  1.00 25.77 ? 621 ALA B C    1 
ATOM   3294 O  O    . ALA B 1 178 ? 0.051   22.555  13.568  1.00 26.03 ? 621 ALA B O    1 
ATOM   3295 C  CB   . ALA B 1 178 ? 1.050   22.270  10.582  1.00 25.82 ? 621 ALA B CB   1 
ATOM   3296 N  N    . PRO B 1 179 ? 1.712   24.001  13.216  1.00 25.93 ? 622 PRO B N    1 
ATOM   3297 C  CA   . PRO B 1 179 ? 1.301   24.887  14.307  1.00 25.78 ? 622 PRO B CA   1 
ATOM   3298 C  C    . PRO B 1 179 ? -0.211  25.052  14.373  1.00 26.08 ? 622 PRO B C    1 
ATOM   3299 O  O    . PRO B 1 179 ? -0.777  24.759  15.411  1.00 26.10 ? 622 PRO B O    1 
ATOM   3300 C  CB   . PRO B 1 179 ? 1.990   26.225  13.977  1.00 25.65 ? 622 PRO B CB   1 
ATOM   3301 C  CG   . PRO B 1 179 ? 3.180   25.887  13.174  1.00 25.60 ? 622 PRO B CG   1 
ATOM   3302 C  CD   . PRO B 1 179 ? 2.898   24.525  12.512  1.00 26.36 ? 622 PRO B CD   1 
ATOM   3303 N  N    . GLU B 1 180 ? -0.847  25.471  13.278  1.00 26.37 ? 623 GLU B N    1 
ATOM   3304 C  CA   . GLU B 1 180 ? -2.284  25.782  13.272  1.00 26.29 ? 623 GLU B CA   1 
ATOM   3305 C  C    . GLU B 1 180 ? -3.203  24.557  13.408  1.00 26.22 ? 623 GLU B C    1 
ATOM   3306 O  O    . GLU B 1 180 ? -4.404  24.688  13.667  1.00 26.35 ? 623 GLU B O    1 
ATOM   3307 C  CB   . GLU B 1 180 ? -2.663  26.576  12.021  1.00 26.47 ? 623 GLU B CB   1 
ATOM   3308 C  CG   . GLU B 1 180 ? -2.901  25.726  10.776  1.00 27.55 ? 623 GLU B CG   1 
ATOM   3309 C  CD   . GLU B 1 180 ? -1.617  25.328  10.081  1.00 28.79 ? 623 GLU B CD   1 
ATOM   3310 O  OE1  . GLU B 1 180 ? -0.633  26.143  10.057  1.00 29.97 ? 623 GLU B OE1  1 
ATOM   3311 O  OE2  . GLU B 1 180 ? -1.606  24.191  9.559   1.00 28.80 ? 623 GLU B OE2  1 
ATOM   3312 N  N    . VAL B 1 181 ? -2.657  23.372  13.206  1.00 26.19 ? 624 VAL B N    1 
ATOM   3313 C  CA   . VAL B 1 181 ? -3.327  22.170  13.680  1.00 26.32 ? 624 VAL B CA   1 
ATOM   3314 C  C    . VAL B 1 181 ? -3.324  22.212  15.228  1.00 26.43 ? 624 VAL B C    1 
ATOM   3315 O  O    . VAL B 1 181 ? -4.347  21.972  15.852  1.00 27.09 ? 624 VAL B O    1 
ATOM   3316 C  CB   . VAL B 1 181 ? -2.667  20.843  13.161  1.00 26.08 ? 624 VAL B CB   1 
ATOM   3317 C  CG1  . VAL B 1 181 ? -3.602  19.651  13.385  1.00 25.93 ? 624 VAL B CG1  1 
ATOM   3318 C  CG2  . VAL B 1 181 ? -2.310  20.908  11.698  1.00 26.33 ? 624 VAL B CG2  1 
ATOM   3319 N  N    . ILE B 1 182 ? -2.180  22.522  15.830  1.00 26.13 ? 625 ILE B N    1 
ATOM   3320 C  CA   . ILE B 1 182 ? -2.033  22.587  17.289  1.00 26.47 ? 625 ILE B CA   1 
ATOM   3321 C  C    . ILE B 1 182 ? -2.921  23.625  18.047  1.00 26.95 ? 625 ILE B C    1 
ATOM   3322 O  O    . ILE B 1 182 ? -3.675  23.269  18.972  1.00 27.19 ? 625 ILE B O    1 
ATOM   3323 C  CB   . ILE B 1 182 ? -0.554  22.852  17.627  1.00 26.37 ? 625 ILE B CB   1 
ATOM   3324 C  CG1  . ILE B 1 182 ? 0.238   21.553  17.558  1.00 26.07 ? 625 ILE B CG1  1 
ATOM   3325 C  CG2  . ILE B 1 182 ? -0.419  23.513  19.003  1.00 27.18 ? 625 ILE B CG2  1 
ATOM   3326 C  CD1  . ILE B 1 182 ? 1.749   21.755  17.592  1.00 25.24 ? 625 ILE B CD1  1 
ATOM   3327 N  N    . ARG B 1 183 ? -2.801  24.903  17.692  1.00 27.00 ? 626 ARG B N    1 
ATOM   3328 C  CA   . ARG B 1 183 ? -3.539  25.948  18.381  1.00 27.12 ? 626 ARG B CA   1 
ATOM   3329 C  C    . ARG B 1 183 ? -4.937  26.241  17.758  1.00 27.72 ? 626 ARG B C    1 
ATOM   3330 O  O    . ARG B 1 183 ? -5.744  26.978  18.344  1.00 27.35 ? 626 ARG B O    1 
ATOM   3331 C  CB   . ARG B 1 183 ? -2.676  27.200  18.559  1.00 27.36 ? 626 ARG B CB   1 
ATOM   3332 C  CG   . ARG B 1 183 ? -1.697  27.534  17.470  1.00 27.14 ? 626 ARG B CG   1 
ATOM   3333 C  CD   . ARG B 1 183 ? -2.341  28.255  16.301  1.00 27.46 ? 626 ARG B CD   1 
ATOM   3334 N  NE   . ARG B 1 183 ? -1.321  28.772  15.389  1.00 28.37 ? 626 ARG B NE   1 
ATOM   3335 C  CZ   . ARG B 1 183 ? -1.531  29.137  14.120  1.00 27.75 ? 626 ARG B CZ   1 
ATOM   3336 N  NH1  . ARG B 1 183 ? -2.745  29.066  13.589  1.00 26.85 ? 626 ARG B NH1  1 
ATOM   3337 N  NH2  . ARG B 1 183 ? -0.508  29.595  13.381  1.00 27.60 ? 626 ARG B NH2  1 
ATOM   3338 N  N    . MET B 1 184 ? -5.196  25.638  16.582  1.00 28.38 ? 627 MET B N    1 
ATOM   3339 C  CA   . MET B 1 184 ? -6.540  25.414  15.972  1.00 28.38 ? 627 MET B CA   1 
ATOM   3340 C  C    . MET B 1 184 ? -7.288  26.643  15.423  1.00 28.37 ? 627 MET B C    1 
ATOM   3341 O  O    . MET B 1 184 ? -7.286  26.850  14.204  1.00 29.18 ? 627 MET B O    1 
ATOM   3342 C  CB   . MET B 1 184 ? -7.444  24.578  16.902  1.00 28.65 ? 627 MET B CB   1 
ATOM   3343 C  CG   . MET B 1 184 ? -7.294  23.042  16.712  1.00 29.32 ? 627 MET B CG   1 
ATOM   3344 S  SD   . MET B 1 184 ? -6.902  22.111  18.264  1.00 30.97 ? 627 MET B SD   1 
ATOM   3345 C  CE   . MET B 1 184 ? -6.251  20.492  17.608  1.00 28.46 ? 627 MET B CE   1 
ATOM   3346 N  N    . GLN B 1 185 ? -7.952  27.404  16.297  1.00 27.87 ? 628 GLN B N    1 
ATOM   3347 C  CA   . GLN B 1 185 ? -8.633  28.684  15.966  1.00 27.84 ? 628 GLN B CA   1 
ATOM   3348 C  C    . GLN B 1 185 ? -9.903  28.647  15.073  1.00 28.01 ? 628 GLN B C    1 
ATOM   3349 O  O    . GLN B 1 185 ? -11.018 28.863  15.585  1.00 28.36 ? 628 GLN B O    1 
ATOM   3350 C  CB   . GLN B 1 185 ? -7.636  29.740  15.452  1.00 28.05 ? 628 GLN B CB   1 
ATOM   3351 C  CG   . GLN B 1 185 ? -7.232  30.798  16.506  1.00 27.47 ? 628 GLN B CG   1 
ATOM   3352 C  CD   . GLN B 1 185 ? -6.081  30.365  17.405  1.00 27.37 ? 628 GLN B CD   1 
ATOM   3353 O  OE1  . GLN B 1 185 ? -5.385  29.404  17.103  1.00 28.34 ? 628 GLN B OE1  1 
ATOM   3354 N  NE2  . GLN B 1 185 ? -5.874  31.088  18.507  1.00 27.77 ? 628 GLN B NE2  1 
ATOM   3355 N  N    . ASP B 1 186 ? -9.764  28.405  13.765  1.00 27.91 ? 629 ASP B N    1 
ATOM   3356 C  CA   . ASP B 1 186 ? -10.942 28.353  12.855  1.00 27.56 ? 629 ASP B CA   1 
ATOM   3357 C  C    . ASP B 1 186 ? -11.404 26.913  12.609  1.00 27.62 ? 629 ASP B C    1 
ATOM   3358 O  O    . ASP B 1 186 ? -10.695 25.979  12.984  1.00 27.41 ? 629 ASP B O    1 
ATOM   3359 C  CB   . ASP B 1 186 ? -10.601 29.049  11.530  1.00 27.51 ? 629 ASP B CB   1 
ATOM   3360 C  CG   . ASP B 1 186 ? -11.804 29.725  10.876  1.00 27.22 ? 629 ASP B CG   1 
ATOM   3361 O  OD1  . ASP B 1 186 ? -12.228 30.827  11.329  1.00 26.23 ? 629 ASP B OD1  1 
ATOM   3362 O  OD2  . ASP B 1 186 ? -12.361 29.223  9.872   1.00 26.97 ? 629 ASP B OD2  1 
ATOM   3363 N  N    . SER B 1 187 ? -12.579 26.744  11.978  1.00 28.07 ? 630 SER B N    1 
ATOM   3364 C  CA   . SER B 1 187 ? -13.228 25.423  11.782  1.00 28.26 ? 630 SER B CA   1 
ATOM   3365 C  C    . SER B 1 187 ? -12.187 24.346  11.430  1.00 28.57 ? 630 SER B C    1 
ATOM   3366 O  O    . SER B 1 187 ? -11.617 23.742  12.353  1.00 29.31 ? 630 SER B O    1 
ATOM   3367 C  CB   . SER B 1 187 ? -14.390 25.487  10.750  1.00 28.57 ? 630 SER B CB   1 
ATOM   3368 O  OG   . SER B 1 187 ? -15.361 24.433  10.921  1.00 29.05 ? 630 SER B OG   1 
ATOM   3369 N  N    . ASN B 1 188 ? -11.889 24.103  10.148  1.00 28.21 ? 631 ASN B N    1 
ATOM   3370 C  CA   . ASN B 1 188 ? -10.800 23.166  9.844   1.00 27.90 ? 631 ASN B CA   1 
ATOM   3371 C  C    . ASN B 1 188 ? -9.448  23.865  9.626   1.00 27.57 ? 631 ASN B C    1 
ATOM   3372 O  O    . ASN B 1 188 ? -9.286  24.687  8.724   1.00 27.26 ? 631 ASN B O    1 
ATOM   3373 C  CB   . ASN B 1 188 ? -11.142 22.246  8.660   1.00 28.05 ? 631 ASN B CB   1 
ATOM   3374 C  CG   . ASN B 1 188 ? -10.641 20.803  8.855   1.00 27.40 ? 631 ASN B CG   1 
ATOM   3375 O  OD1  . ASN B 1 188 ? -10.481 20.060  7.879   1.00 27.77 ? 631 ASN B OD1  1 
ATOM   3376 N  ND2  . ASN B 1 188 ? -10.409 20.404  10.100  1.00 24.90 ? 631 ASN B ND2  1 
ATOM   3377 N  N    . PRO B 1 189 ? -8.483  23.542  10.481  1.00 27.36 ? 632 PRO B N    1 
ATOM   3378 C  CA   . PRO B 1 189 ? -7.075  23.883  10.217  1.00 26.83 ? 632 PRO B CA   1 
ATOM   3379 C  C    . PRO B 1 189 ? -6.421  22.912  9.254   1.00 26.50 ? 632 PRO B C    1 
ATOM   3380 O  O    . PRO B 1 189 ? -5.400  23.245  8.651   1.00 26.76 ? 632 PRO B O    1 
ATOM   3381 C  CB   . PRO B 1 189 ? -6.421  23.721  11.581  1.00 27.07 ? 632 PRO B CB   1 
ATOM   3382 C  CG   . PRO B 1 189 ? -7.230  22.627  12.250  1.00 27.76 ? 632 PRO B CG   1 
ATOM   3383 C  CD   . PRO B 1 189 ? -8.655  22.841  11.773  1.00 27.32 ? 632 PRO B CD   1 
ATOM   3384 N  N    . TYR B 1 190 ? -6.994  21.716  9.124   1.00 25.91 ? 633 TYR B N    1 
ATOM   3385 C  CA   . TYR B 1 190 ? -6.391  20.672  8.316   1.00 25.00 ? 633 TYR B CA   1 
ATOM   3386 C  C    . TYR B 1 190 ? -6.541  20.974  6.836   1.00 24.73 ? 633 TYR B C    1 
ATOM   3387 O  O    . TYR B 1 190 ? -7.472  20.538  6.193   1.00 25.35 ? 633 TYR B O    1 
ATOM   3388 C  CB   . TYR B 1 190 ? -7.038  19.335  8.626   1.00 24.53 ? 633 TYR B CB   1 
ATOM   3389 C  CG   . TYR B 1 190 ? -6.613  18.646  9.916   1.00 23.99 ? 633 TYR B CG   1 
ATOM   3390 C  CD1  . TYR B 1 190 ? -7.129  19.024  11.171  1.00 23.64 ? 633 TYR B CD1  1 
ATOM   3391 C  CD2  . TYR B 1 190 ? -5.742  17.569  9.879   1.00 23.06 ? 633 TYR B CD2  1 
ATOM   3392 C  CE1  . TYR B 1 190 ? -6.757  18.326  12.339  1.00 22.39 ? 633 TYR B CE1  1 
ATOM   3393 C  CE2  . TYR B 1 190 ? -5.373  16.894  11.027  1.00 22.00 ? 633 TYR B CE2  1 
ATOM   3394 C  CZ   . TYR B 1 190 ? -5.871  17.258  12.231  1.00 21.57 ? 633 TYR B CZ   1 
ATOM   3395 O  OH   . TYR B 1 190 ? -5.447  16.520  13.297  1.00 20.93 ? 633 TYR B OH   1 
ATOM   3396 N  N    . SER B 1 191 ? -5.589  21.711  6.308   1.00 24.53 ? 634 SER B N    1 
ATOM   3397 C  CA   . SER B 1 191 ? -5.479  22.012  4.894   1.00 24.52 ? 634 SER B CA   1 
ATOM   3398 C  C    . SER B 1 191 ? -4.549  21.029  4.148   1.00 25.05 ? 634 SER B C    1 
ATOM   3399 O  O    . SER B 1 191 ? -3.842  20.195  4.770   1.00 24.86 ? 634 SER B O    1 
ATOM   3400 C  CB   . SER B 1 191 ? -4.847  23.398  4.772   1.00 25.00 ? 634 SER B CB   1 
ATOM   3401 O  OG   . SER B 1 191 ? -3.556  23.455  5.424   1.00 24.16 ? 634 SER B OG   1 
ATOM   3402 N  N    . PHE B 1 192 ? -4.534  21.144  2.812   1.00 25.09 ? 635 PHE B N    1 
ATOM   3403 C  CA   . PHE B 1 192 ? -3.451  20.601  1.998   1.00 24.89 ? 635 PHE B CA   1 
ATOM   3404 C  C    . PHE B 1 192 ? -2.194  21.081  2.675   1.00 25.09 ? 635 PHE B C    1 
ATOM   3405 O  O    . PHE B 1 192 ? -1.298  20.298  2.956   1.00 25.62 ? 635 PHE B O    1 
ATOM   3406 C  CB   . PHE B 1 192 ? -3.468  21.151  0.565   1.00 24.89 ? 635 PHE B CB   1 
ATOM   3407 C  CG   . PHE B 1 192 ? -4.598  20.619  -0.310  1.00 25.16 ? 635 PHE B CG   1 
ATOM   3408 C  CD1  . PHE B 1 192 ? -5.416  21.500  -1.020  1.00 26.19 ? 635 PHE B CD1  1 
ATOM   3409 C  CD2  . PHE B 1 192 ? -4.814  19.265  -0.454  1.00 25.74 ? 635 PHE B CD2  1 
ATOM   3410 C  CE1  . PHE B 1 192 ? -6.447  21.037  -1.841  1.00 27.03 ? 635 PHE B CE1  1 
ATOM   3411 C  CE2  . PHE B 1 192 ? -5.850  18.790  -1.268  1.00 26.78 ? 635 PHE B CE2  1 
ATOM   3412 C  CZ   . PHE B 1 192 ? -6.666  19.678  -1.967  1.00 26.62 ? 635 PHE B CZ   1 
ATOM   3413 N  N    . GLN B 1 193 ? -2.156  22.385  2.960   1.00 25.33 ? 636 GLN B N    1 
ATOM   3414 C  CA   . GLN B 1 193 ? -1.018  23.058  3.612   1.00 25.59 ? 636 GLN B CA   1 
ATOM   3415 C  C    . GLN B 1 193 ? -0.409  22.351  4.851   1.00 25.55 ? 636 GLN B C    1 
ATOM   3416 O  O    . GLN B 1 193 ? 0.779   22.444  5.103   1.00 25.06 ? 636 GLN B O    1 
ATOM   3417 C  CB   . GLN B 1 193 ? -1.418  24.477  4.050   1.00 25.87 ? 636 GLN B CB   1 
ATOM   3418 C  CG   . GLN B 1 193 ? -2.244  25.284  3.069   1.00 25.87 ? 636 GLN B CG   1 
ATOM   3419 C  CD   . GLN B 1 193 ? -1.501  25.463  1.804   1.00 26.20 ? 636 GLN B CD   1 
ATOM   3420 O  OE1  . GLN B 1 193 ? -0.281  25.710  1.833   1.00 29.08 ? 636 GLN B OE1  1 
ATOM   3421 N  NE2  . GLN B 1 193 ? -2.188  25.314  0.682   1.00 25.05 ? 636 GLN B NE2  1 
ATOM   3422 N  N    . SER B 1 194 ? -1.242  21.710  5.660   1.00 25.80 ? 637 SER B N    1 
ATOM   3423 C  CA   . SER B 1 194 ? -0.777  21.111  6.906   1.00 25.41 ? 637 SER B CA   1 
ATOM   3424 C  C    . SER B 1 194 ? -0.201  19.756  6.585   1.00 24.82 ? 637 SER B C    1 
ATOM   3425 O  O    . SER B 1 194 ? 0.745   19.330  7.223   1.00 24.58 ? 637 SER B O    1 
ATOM   3426 C  CB   . SER B 1 194 ? -1.919  21.012  7.933   1.00 25.26 ? 637 SER B CB   1 
ATOM   3427 O  OG   . SER B 1 194 ? -2.331  19.665  8.126   1.00 26.06 ? 637 SER B OG   1 
ATOM   3428 N  N    . ASP B 1 195 ? -0.806  19.070  5.619   1.00 24.77 ? 638 ASP B N    1 
ATOM   3429 C  CA   . ASP B 1 195 ? -0.255  17.823  5.063   1.00 24.87 ? 638 ASP B CA   1 
ATOM   3430 C  C    . ASP B 1 195 ? 1.150   18.020  4.558   1.00 24.40 ? 638 ASP B C    1 
ATOM   3431 O  O    . ASP B 1 195 ? 1.972   17.149  4.687   1.00 24.35 ? 638 ASP B O    1 
ATOM   3432 C  CB   . ASP B 1 195 ? -1.066  17.346  3.867   1.00 25.15 ? 638 ASP B CB   1 
ATOM   3433 C  CG   . ASP B 1 195 ? -1.884  16.125  4.158   1.00 25.90 ? 638 ASP B CG   1 
ATOM   3434 O  OD1  . ASP B 1 195 ? -2.295  15.910  5.328   1.00 25.55 ? 638 ASP B OD1  1 
ATOM   3435 O  OD2  . ASP B 1 195 ? -2.161  15.333  3.234   1.00 26.73 ? 638 ASP B OD2  1 
ATOM   3436 N  N    . VAL B 1 196 ? 1.408   19.156  3.941   1.00 24.17 ? 639 VAL B N    1 
ATOM   3437 C  CA   . VAL B 1 196 ? 2.764   19.494  3.547   1.00 24.17 ? 639 VAL B CA   1 
ATOM   3438 C  C    . VAL B 1 196 ? 3.667   19.575  4.763   1.00 23.85 ? 639 VAL B C    1 
ATOM   3439 O  O    . VAL B 1 196 ? 4.765   19.049  4.745   1.00 24.21 ? 639 VAL B O    1 
ATOM   3440 C  CB   . VAL B 1 196 ? 2.819   20.830  2.788   1.00 24.19 ? 639 VAL B CB   1 
ATOM   3441 C  CG1  . VAL B 1 196 ? 4.270   21.350  2.721   1.00 23.76 ? 639 VAL B CG1  1 
ATOM   3442 C  CG2  . VAL B 1 196 ? 2.166   20.668  1.389   1.00 24.50 ? 639 VAL B CG2  1 
ATOM   3443 N  N    . TYR B 1 197 ? 3.217   20.247  5.814   1.00 23.58 ? 640 TYR B N    1 
ATOM   3444 C  CA   . TYR B 1 197 ? 4.016   20.340  7.021   1.00 23.33 ? 640 TYR B CA   1 
ATOM   3445 C  C    . TYR B 1 197 ? 4.349   18.937  7.492   1.00 22.92 ? 640 TYR B C    1 
ATOM   3446 O  O    . TYR B 1 197 ? 5.531   18.645  7.736   1.00 22.29 ? 640 TYR B O    1 
ATOM   3447 C  CB   . TYR B 1 197 ? 3.363   21.181  8.132   1.00 23.17 ? 640 TYR B CB   1 
ATOM   3448 C  CG   . TYR B 1 197 ? 4.209   21.224  9.394   1.00 23.88 ? 640 TYR B CG   1 
ATOM   3449 C  CD1  . TYR B 1 197 ? 4.938   22.366  9.745   1.00 24.33 ? 640 TYR B CD1  1 
ATOM   3450 C  CD2  . TYR B 1 197 ? 4.313   20.104  10.227  1.00 24.28 ? 640 TYR B CD2  1 
ATOM   3451 C  CE1  . TYR B 1 197 ? 5.717   22.385  10.886  1.00 24.47 ? 640 TYR B CE1  1 
ATOM   3452 C  CE2  . TYR B 1 197 ? 5.095   20.123  11.371  1.00 24.68 ? 640 TYR B CE2  1 
ATOM   3453 C  CZ   . TYR B 1 197 ? 5.790   21.256  11.693  1.00 24.91 ? 640 TYR B CZ   1 
ATOM   3454 O  OH   . TYR B 1 197 ? 6.568   21.248  12.824  1.00 27.03 ? 640 TYR B OH   1 
ATOM   3455 N  N    . ALA B 1 198 ? 3.350   18.052  7.569   1.00 22.56 ? 641 ALA B N    1 
ATOM   3456 C  CA   . ALA B 1 198 ? 3.626   16.679  7.996   1.00 22.74 ? 641 ALA B CA   1 
ATOM   3457 C  C    . ALA B 1 198 ? 4.788   16.103  7.187   1.00 23.25 ? 641 ALA B C    1 
ATOM   3458 O  O    . ALA B 1 198 ? 5.650   15.401  7.723   1.00 24.07 ? 641 ALA B O    1 
ATOM   3459 C  CB   . ALA B 1 198 ? 2.432   15.821  7.874   1.00 22.45 ? 641 ALA B CB   1 
ATOM   3460 N  N    . PHE B 1 199 ? 4.838   16.444  5.907   1.00 23.25 ? 642 PHE B N    1 
ATOM   3461 C  CA   . PHE B 1 199 ? 5.806   15.887  4.990   1.00 23.38 ? 642 PHE B CA   1 
ATOM   3462 C  C    . PHE B 1 199 ? 7.233   16.371  5.296   1.00 23.83 ? 642 PHE B C    1 
ATOM   3463 O  O    . PHE B 1 199 ? 8.228   15.654  5.088   1.00 23.57 ? 642 PHE B O    1 
ATOM   3464 C  CB   . PHE B 1 199 ? 5.371   16.235  3.569   1.00 23.39 ? 642 PHE B CB   1 
ATOM   3465 C  CG   . PHE B 1 199 ? 6.281   15.711  2.531   1.00 23.44 ? 642 PHE B CG   1 
ATOM   3466 C  CD1  . PHE B 1 199 ? 6.314   14.363  2.266   1.00 22.55 ? 642 PHE B CD1  1 
ATOM   3467 C  CD2  . PHE B 1 199 ? 7.114   16.570  1.828   1.00 22.36 ? 642 PHE B CD2  1 
ATOM   3468 C  CE1  . PHE B 1 199 ? 7.166   13.867  1.333   1.00 23.42 ? 642 PHE B CE1  1 
ATOM   3469 C  CE2  . PHE B 1 199 ? 7.955   16.084  0.895   1.00 23.68 ? 642 PHE B CE2  1 
ATOM   3470 C  CZ   . PHE B 1 199 ? 7.998   14.711  0.650   1.00 24.18 ? 642 PHE B CZ   1 
ATOM   3471 N  N    . GLY B 1 200 ? 7.325   17.603  5.786   1.00 24.23 ? 643 GLY B N    1 
ATOM   3472 C  CA   . GLY B 1 200 ? 8.575   18.155  6.287   1.00 23.97 ? 643 GLY B CA   1 
ATOM   3473 C  C    . GLY B 1 200 ? 9.119   17.289  7.387   1.00 23.74 ? 643 GLY B C    1 
ATOM   3474 O  O    . GLY B 1 200 ? 10.239  16.834  7.316   1.00 24.39 ? 643 GLY B O    1 
ATOM   3475 N  N    . ILE B 1 201 ? 8.311   17.017  8.393   1.00 23.80 ? 644 ILE B N    1 
ATOM   3476 C  CA   . ILE B 1 201 ? 8.767   16.163  9.489   1.00 23.67 ? 644 ILE B CA   1 
ATOM   3477 C  C    . ILE B 1 201 ? 9.205   14.787  8.992   1.00 23.28 ? 644 ILE B C    1 
ATOM   3478 O  O    . ILE B 1 201 ? 10.190  14.251  9.465   1.00 22.92 ? 644 ILE B O    1 
ATOM   3479 C  CB   . ILE B 1 201 ? 7.690   16.083  10.609  1.00 23.52 ? 644 ILE B CB   1 
ATOM   3480 C  CG1  . ILE B 1 201 ? 7.470   17.468  11.239  1.00 23.30 ? 644 ILE B CG1  1 
ATOM   3481 C  CG2  . ILE B 1 201 ? 8.074   15.082  11.681  1.00 23.41 ? 644 ILE B CG2  1 
ATOM   3482 C  CD1  . ILE B 1 201 ? 8.688   18.098  11.838  1.00 23.42 ? 644 ILE B CD1  1 
ATOM   3483 N  N    . VAL B 1 202 ? 8.501   14.239  8.010   1.00 23.65 ? 645 VAL B N    1 
ATOM   3484 C  CA   . VAL B 1 202 ? 8.851   12.924  7.463   1.00 23.68 ? 645 VAL B CA   1 
ATOM   3485 C  C    . VAL B 1 202 ? 10.239  13.019  6.870   1.00 23.37 ? 645 VAL B C    1 
ATOM   3486 O  O    . VAL B 1 202 ? 11.081  12.169  7.132   1.00 22.83 ? 645 VAL B O    1 
ATOM   3487 C  CB   . VAL B 1 202 ? 7.808   12.424  6.396   1.00 23.96 ? 645 VAL B CB   1 
ATOM   3488 C  CG1  . VAL B 1 202 ? 8.378   11.291  5.500   1.00 24.38 ? 645 VAL B CG1  1 
ATOM   3489 C  CG2  . VAL B 1 202 ? 6.510   11.977  7.060   1.00 23.94 ? 645 VAL B CG2  1 
ATOM   3490 N  N    . LEU B 1 203 ? 10.459  14.073  6.083   1.00 23.48 ? 646 LEU B N    1 
ATOM   3491 C  CA   . LEU B 1 203 ? 11.756  14.359  5.449   1.00 23.51 ? 646 LEU B CA   1 
ATOM   3492 C  C    . LEU B 1 203 ? 12.874  14.506  6.469   1.00 23.31 ? 646 LEU B C    1 
ATOM   3493 O  O    . LEU B 1 203 ? 14.026  14.096  6.235   1.00 22.54 ? 646 LEU B O    1 
ATOM   3494 C  CB   . LEU B 1 203 ? 11.684  15.678  4.687   1.00 23.51 ? 646 LEU B CB   1 
ATOM   3495 C  CG   . LEU B 1 203 ? 11.067  15.749  3.316   1.00 23.83 ? 646 LEU B CG   1 
ATOM   3496 C  CD1  . LEU B 1 203 ? 11.371  17.115  2.789   1.00 24.54 ? 646 LEU B CD1  1 
ATOM   3497 C  CD2  . LEU B 1 203 ? 11.611  14.694  2.406   1.00 24.64 ? 646 LEU B CD2  1 
ATOM   3498 N  N    . TYR B 1 204 ? 12.516  15.164  7.571   1.00 23.57 ? 647 TYR B N    1 
ATOM   3499 C  CA   . TYR B 1 204 ? 13.377  15.326  8.727   1.00 23.80 ? 647 TYR B CA   1 
ATOM   3500 C  C    . TYR B 1 204 ? 13.668  13.953  9.378   1.00 23.45 ? 647 TYR B C    1 
ATOM   3501 O  O    . TYR B 1 204 ? 14.793  13.677  9.795   1.00 23.45 ? 647 TYR B O    1 
ATOM   3502 C  CB   . TYR B 1 204 ? 12.746  16.317  9.720   1.00 23.94 ? 647 TYR B CB   1 
ATOM   3503 C  CG   . TYR B 1 204 ? 13.653  16.600  10.884  1.00 24.77 ? 647 TYR B CG   1 
ATOM   3504 C  CD1  . TYR B 1 204 ? 14.699  17.535  10.780  1.00 24.86 ? 647 TYR B CD1  1 
ATOM   3505 C  CD2  . TYR B 1 204 ? 13.520  15.881  12.079  1.00 24.35 ? 647 TYR B CD2  1 
ATOM   3506 C  CE1  . TYR B 1 204 ? 15.580  17.763  11.863  1.00 23.90 ? 647 TYR B CE1  1 
ATOM   3507 C  CE2  . TYR B 1 204 ? 14.390  16.095  13.142  1.00 24.32 ? 647 TYR B CE2  1 
ATOM   3508 C  CZ   . TYR B 1 204 ? 15.409  17.029  13.028  1.00 22.52 ? 647 TYR B CZ   1 
ATOM   3509 O  OH   . TYR B 1 204 ? 16.201  17.222  14.092  1.00 20.00 ? 647 TYR B OH   1 
ATOM   3510 N  N    . GLU B 1 205 ? 12.671  13.084  9.419   1.00 23.14 ? 648 GLU B N    1 
ATOM   3511 C  CA   . GLU B 1 205 ? 12.892  11.692  9.792   1.00 23.30 ? 648 GLU B CA   1 
ATOM   3512 C  C    . GLU B 1 205 ? 13.824  10.936  8.836   1.00 23.14 ? 648 GLU B C    1 
ATOM   3513 O  O    . GLU B 1 205 ? 14.339  9.898   9.195   1.00 22.30 ? 648 GLU B O    1 
ATOM   3514 C  CB   . GLU B 1 205 ? 11.567  10.949  9.877   1.00 23.20 ? 648 GLU B CB   1 
ATOM   3515 C  CG   . GLU B 1 205 ? 10.701  11.381  11.036  1.00 23.90 ? 648 GLU B CG   1 
ATOM   3516 C  CD   . GLU B 1 205 ? 9.448   10.550  11.133  1.00 23.69 ? 648 GLU B CD   1 
ATOM   3517 O  OE1  . GLU B 1 205 ? 9.370   9.622   11.966  1.00 23.75 ? 648 GLU B OE1  1 
ATOM   3518 O  OE2  . GLU B 1 205 ? 8.543   10.812  10.341  1.00 24.26 ? 648 GLU B OE2  1 
ATOM   3519 N  N    . LEU B 1 206 ? 14.010  11.440  7.615   1.00 23.66 ? 649 LEU B N    1 
ATOM   3520 C  CA   . LEU B 1 206 ? 14.931  10.832  6.653   1.00 23.80 ? 649 LEU B CA   1 
ATOM   3521 C  C    . LEU B 1 206 ? 16.314  11.433  6.720   1.00 23.92 ? 649 LEU B C    1 
ATOM   3522 O  O    . LEU B 1 206 ? 17.267  10.690  6.873   1.00 23.92 ? 649 LEU B O    1 
ATOM   3523 C  CB   . LEU B 1 206 ? 14.427  10.918  5.216   1.00 23.67 ? 649 LEU B CB   1 
ATOM   3524 C  CG   . LEU B 1 206 ? 13.111  10.206  4.881   1.00 24.62 ? 649 LEU B CG   1 
ATOM   3525 C  CD1  . LEU B 1 206 ? 12.629  10.672  3.476   1.00 25.10 ? 649 LEU B CD1  1 
ATOM   3526 C  CD2  . LEU B 1 206 ? 13.232  8.689   4.949   1.00 24.93 ? 649 LEU B CD2  1 
ATOM   3527 N  N    . MET B 1 207 ? 16.454  12.750  6.605   1.00 24.19 ? 650 MET B N    1 
ATOM   3528 C  CA   . MET B 1 207 ? 17.810  13.314  6.446   1.00 24.53 ? 650 MET B CA   1 
ATOM   3529 C  C    . MET B 1 207 ? 18.571  13.458  7.759   1.00 24.52 ? 650 MET B C    1 
ATOM   3530 O  O    . MET B 1 207 ? 19.752  13.701  7.727   1.00 24.72 ? 650 MET B O    1 
ATOM   3531 C  CB   . MET B 1 207 ? 17.813  14.650  5.701   1.00 24.64 ? 650 MET B CB   1 
ATOM   3532 C  CG   . MET B 1 207 ? 17.043  14.656  4.389   1.00 25.26 ? 650 MET B CG   1 
ATOM   3533 S  SD   . MET B 1 207 ? 17.814  13.706  3.117   1.00 26.49 ? 650 MET B SD   1 
ATOM   3534 C  CE   . MET B 1 207 ? 16.740  12.270  2.989   1.00 24.53 ? 650 MET B CE   1 
ATOM   3535 N  N    . THR B 1 208 ? 17.894  13.303  8.896   1.00 24.89 ? 651 THR B N    1 
ATOM   3536 C  CA   . THR B 1 208 ? 18.547  13.126  10.214  1.00 24.96 ? 651 THR B CA   1 
ATOM   3537 C  C    . THR B 1 208 ? 18.553  11.654  10.677  1.00 24.96 ? 651 THR B C    1 
ATOM   3538 O  O    . THR B 1 208 ? 19.475  11.217  11.372  1.00 24.29 ? 651 THR B O    1 
ATOM   3539 C  CB   . THR B 1 208 ? 17.849  13.993  11.317  1.00 25.19 ? 651 THR B CB   1 
ATOM   3540 O  OG1  . THR B 1 208 ? 16.621  13.385  11.781  1.00 23.79 ? 651 THR B OG1  1 
ATOM   3541 C  CG2  . THR B 1 208 ? 17.403  15.324  10.761  1.00 25.87 ? 651 THR B CG2  1 
ATOM   3542 N  N    . GLY B 1 209 ? 17.508  10.913  10.291  1.00 25.16 ? 652 GLY B N    1 
ATOM   3543 C  CA   . GLY B 1 209 ? 17.205  9.609   10.863  1.00 25.19 ? 652 GLY B CA   1 
ATOM   3544 C  C    . GLY B 1 209 ? 16.771  9.722   12.319  1.00 25.17 ? 652 GLY B C    1 
ATOM   3545 O  O    . GLY B 1 209 ? 17.199  8.920   13.152  1.00 25.87 ? 652 GLY B O    1 
ATOM   3546 N  N    . GLN B 1 210 ? 15.949  10.721  12.631  1.00 24.99 ? 653 GLN B N    1 
ATOM   3547 C  CA   . GLN B 1 210 ? 15.573  11.031  14.016  1.00 25.07 ? 653 GLN B CA   1 
ATOM   3548 C  C    . GLN B 1 210 ? 14.240  11.723  14.033  1.00 25.27 ? 653 GLN B C    1 
ATOM   3549 O  O    . GLN B 1 210 ? 13.906  12.438  13.099  1.00 25.76 ? 653 GLN B O    1 
ATOM   3550 C  CB   . GLN B 1 210 ? 16.585  11.966  14.667  1.00 25.06 ? 653 GLN B CB   1 
ATOM   3551 C  CG   . GLN B 1 210 ? 17.627  11.270  15.544  1.00 25.58 ? 653 GLN B CG   1 
ATOM   3552 C  CD   . GLN B 1 210 ? 18.606  12.245  16.191  1.00 24.59 ? 653 GLN B CD   1 
ATOM   3553 O  OE1  . GLN B 1 210 ? 18.617  12.384  17.406  1.00 23.60 ? 653 GLN B OE1  1 
ATOM   3554 N  NE2  . GLN B 1 210 ? 19.410  12.922  15.379  1.00 22.70 ? 653 GLN B NE2  1 
ATOM   3555 N  N    . LEU B 1 211 ? 13.460  11.503  15.082  1.00 25.44 ? 654 LEU B N    1 
ATOM   3556 C  CA   . LEU B 1 211 ? 12.223  12.249  15.252  1.00 25.48 ? 654 LEU B CA   1 
ATOM   3557 C  C    . LEU B 1 211 ? 12.636  13.628  15.741  1.00 25.25 ? 654 LEU B C    1 
ATOM   3558 O  O    . LEU B 1 211 ? 13.702  13.779  16.327  1.00 25.44 ? 654 LEU B O    1 
ATOM   3559 C  CB   . LEU B 1 211 ? 11.298  11.586  16.275  1.00 25.62 ? 654 LEU B CB   1 
ATOM   3560 C  CG   . LEU B 1 211 ? 10.554  10.299  15.886  1.00 26.03 ? 654 LEU B CG   1 
ATOM   3561 C  CD1  . LEU B 1 211 ? 9.907   9.655   17.139  1.00 25.80 ? 654 LEU B CD1  1 
ATOM   3562 C  CD2  . LEU B 1 211 ? 9.497   10.546  14.814  1.00 24.54 ? 654 LEU B CD2  1 
ATOM   3563 N  N    . PRO B 1 212 ? 11.818  14.637  15.507  1.00 24.86 ? 655 PRO B N    1 
ATOM   3564 C  CA   . PRO B 1 212 ? 12.094  15.949  16.064  1.00 24.98 ? 655 PRO B CA   1 
ATOM   3565 C  C    . PRO B 1 212 ? 11.779  16.031  17.584  1.00 25.32 ? 655 PRO B C    1 
ATOM   3566 O  O    . PRO B 1 212 ? 10.812  15.428  18.097  1.00 25.24 ? 655 PRO B O    1 
ATOM   3567 C  CB   . PRO B 1 212 ? 11.182  16.856  15.253  1.00 24.70 ? 655 PRO B CB   1 
ATOM   3568 C  CG   . PRO B 1 212 ? 10.032  16.017  14.924  1.00 24.93 ? 655 PRO B CG   1 
ATOM   3569 C  CD   . PRO B 1 212 ? 10.568  14.630  14.740  1.00 25.14 ? 655 PRO B CD   1 
ATOM   3570 N  N    . TYR B 1 213 ? 12.658  16.767  18.274  1.00 25.51 ? 656 TYR B N    1 
ATOM   3571 C  CA   . TYR B 1 213 ? 12.475  17.291  19.632  1.00 25.18 ? 656 TYR B CA   1 
ATOM   3572 C  C    . TYR B 1 213 ? 13.037  16.348  20.677  1.00 25.43 ? 656 TYR B C    1 
ATOM   3573 O  O    . TYR B 1 213 ? 12.374  16.029  21.655  1.00 25.96 ? 656 TYR B O    1 
ATOM   3574 C  CB   . TYR B 1 213 ? 11.023  17.678  19.895  1.00 25.11 ? 656 TYR B CB   1 
ATOM   3575 C  CG   . TYR B 1 213 ? 10.402  18.463  18.751  1.00 24.53 ? 656 TYR B CG   1 
ATOM   3576 C  CD1  . TYR B 1 213 ? 11.057  19.565  18.201  1.00 23.82 ? 656 TYR B CD1  1 
ATOM   3577 C  CD2  . TYR B 1 213 ? 9.167   18.081  18.205  1.00 24.46 ? 656 TYR B CD2  1 
ATOM   3578 C  CE1  . TYR B 1 213 ? 10.492  20.274  17.138  1.00 25.10 ? 656 TYR B CE1  1 
ATOM   3579 C  CE2  . TYR B 1 213 ? 8.581   18.785  17.148  1.00 24.12 ? 656 TYR B CE2  1 
ATOM   3580 C  CZ   . TYR B 1 213 ? 9.240   19.884  16.619  1.00 24.69 ? 656 TYR B CZ   1 
ATOM   3581 O  OH   . TYR B 1 213 ? 8.677   20.581  15.567  1.00 23.76 ? 656 TYR B OH   1 
ATOM   3582 N  N    . SER B 1 214 ? 14.298  15.945  20.460  1.00 25.66 ? 657 SER B N    1 
ATOM   3583 C  CA   . SER B 1 214 ? 15.034  14.968  21.277  1.00 25.31 ? 657 SER B CA   1 
ATOM   3584 C  C    . SER B 1 214 ? 15.505  15.569  22.584  1.00 25.59 ? 657 SER B C    1 
ATOM   3585 O  O    . SER B 1 214 ? 16.310  14.949  23.305  1.00 25.73 ? 657 SER B O    1 
ATOM   3586 C  CB   . SER B 1 214 ? 16.270  14.453  20.532  1.00 25.31 ? 657 SER B CB   1 
ATOM   3587 O  OG   . SER B 1 214 ? 16.193  14.614  19.116  1.00 26.24 ? 657 SER B OG   1 
ATOM   3588 N  N    . ASN B 1 215 ? 15.032  16.792  22.856  1.00 25.59 ? 658 ASN B N    1 
ATOM   3589 C  CA   . ASN B 1 215 ? 15.277  17.525  24.098  1.00 25.31 ? 658 ASN B CA   1 
ATOM   3590 C  C    . ASN B 1 215 ? 14.001  17.895  24.830  1.00 25.14 ? 658 ASN B C    1 
ATOM   3591 O  O    . ASN B 1 215 ? 14.025  18.190  26.017  1.00 25.03 ? 658 ASN B O    1 
ATOM   3592 C  CB   . ASN B 1 215 ? 16.064  18.784  23.771  1.00 25.11 ? 658 ASN B CB   1 
ATOM   3593 C  CG   . ASN B 1 215 ? 17.408  18.463  23.138  1.00 24.98 ? 658 ASN B CG   1 
ATOM   3594 O  OD1  . ASN B 1 215 ? 18.405  18.273  23.836  1.00 23.63 ? 658 ASN B OD1  1 
ATOM   3595 N  ND2  . ASN B 1 215 ? 17.434  18.375  21.807  1.00 26.32 ? 658 ASN B ND2  1 
ATOM   3596 N  N    . ILE B 1 216 ? 12.892  17.885  24.104  1.00 25.13 ? 659 ILE B N    1 
ATOM   3597 C  CA   . ILE B 1 216 ? 11.591  18.148  24.672  1.00 25.51 ? 659 ILE B CA   1 
ATOM   3598 C  C    . ILE B 1 216 ? 10.827  16.841  24.714  1.00 25.95 ? 659 ILE B C    1 
ATOM   3599 O  O    . ILE B 1 216 ? 10.045  16.529  23.814  1.00 25.83 ? 659 ILE B O    1 
ATOM   3600 C  CB   . ILE B 1 216 ? 10.834  19.189  23.838  1.00 25.45 ? 659 ILE B CB   1 
ATOM   3601 C  CG1  . ILE B 1 216 ? 11.642  20.493  23.732  1.00 25.53 ? 659 ILE B CG1  1 
ATOM   3602 C  CG2  . ILE B 1 216 ? 9.453   19.457  24.452  1.00 25.37 ? 659 ILE B CG2  1 
ATOM   3603 C  CD1  . ILE B 1 216 ? 12.090  21.097  25.094  1.00 25.44 ? 659 ILE B CD1  1 
ATOM   3604 N  N    . ASN B 1 217 ? 11.062  16.083  25.777  1.00 26.34 ? 660 ASN B N    1 
ATOM   3605 C  CA   . ASN B 1 217 ? 10.416  14.783  25.963  1.00 26.93 ? 660 ASN B CA   1 
ATOM   3606 C  C    . ASN B 1 217 ? 9.069   14.922  26.714  1.00 27.10 ? 660 ASN B C    1 
ATOM   3607 O  O    . ASN B 1 217 ? 8.244   13.990  26.727  1.00 27.24 ? 660 ASN B O    1 
ATOM   3608 C  CB   . ASN B 1 217 ? 11.376  13.843  26.687  1.00 27.12 ? 660 ASN B CB   1 
ATOM   3609 C  CG   . ASN B 1 217 ? 12.340  14.597  27.598  1.00 28.05 ? 660 ASN B CG   1 
ATOM   3610 O  OD1  . ASN B 1 217 ? 11.923  15.185  28.606  1.00 30.00 ? 660 ASN B OD1  1 
ATOM   3611 N  ND2  . ASN B 1 217 ? 13.623  14.625  27.224  1.00 28.39 ? 660 ASN B ND2  1 
ATOM   3612 N  N    . ASN B 1 218 ? 8.861   16.096  27.321  1.00 26.91 ? 661 ASN B N    1 
ATOM   3613 C  CA   . ASN B 1 218 ? 7.560   16.495  27.845  1.00 26.78 ? 661 ASN B CA   1 
ATOM   3614 C  C    . ASN B 1 218 ? 6.574   16.809  26.718  1.00 26.46 ? 661 ASN B C    1 
ATOM   3615 O  O    . ASN B 1 218 ? 6.924   17.478  25.756  1.00 26.09 ? 661 ASN B O    1 
ATOM   3616 C  CB   . ASN B 1 218 ? 7.704   17.724  28.751  1.00 26.69 ? 661 ASN B CB   1 
ATOM   3617 C  CG   . ASN B 1 218 ? 6.516   17.910  29.681  1.00 27.21 ? 661 ASN B CG   1 
ATOM   3618 O  OD1  . ASN B 1 218 ? 6.148   19.037  30.020  1.00 27.88 ? 661 ASN B OD1  1 
ATOM   3619 N  ND2  . ASN B 1 218 ? 5.906   16.799  30.098  1.00 28.15 ? 661 ASN B ND2  1 
ATOM   3620 N  N    . ARG B 1 219 ? 5.336   16.345  26.856  1.00 26.54 ? 662 ARG B N    1 
ATOM   3621 C  CA   . ARG B 1 219 ? 4.333   16.484  25.788  1.00 26.59 ? 662 ARG B CA   1 
ATOM   3622 C  C    . ARG B 1 219 ? 3.739   17.896  25.736  1.00 26.50 ? 662 ARG B C    1 
ATOM   3623 O  O    . ARG B 1 219 ? 3.460   18.426  24.668  1.00 26.62 ? 662 ARG B O    1 
ATOM   3624 C  CB   . ARG B 1 219 ? 3.210   15.445  25.965  1.00 26.52 ? 662 ARG B CB   1 
ATOM   3625 C  CG   . ARG B 1 219 ? 1.928   15.729  25.184  1.00 26.33 ? 662 ARG B CG   1 
ATOM   3626 C  CD   . ARG B 1 219 ? 0.679   15.038  25.757  1.00 26.32 ? 662 ARG B CD   1 
ATOM   3627 N  NE   . ARG B 1 219 ? -0.490  15.239  24.891  1.00 26.15 ? 662 ARG B NE   1 
ATOM   3628 C  CZ   . ARG B 1 219 ? -0.723  14.608  23.728  1.00 26.71 ? 662 ARG B CZ   1 
ATOM   3629 N  NH1  . ARG B 1 219 ? 0.114   13.685  23.240  1.00 26.35 ? 662 ARG B NH1  1 
ATOM   3630 N  NH2  . ARG B 1 219 ? -1.825  14.904  23.043  1.00 27.74 ? 662 ARG B NH2  1 
ATOM   3631 N  N    . ASP B 1 220 ? 3.543   18.508  26.890  1.00 26.25 ? 663 ASP B N    1 
ATOM   3632 C  CA   . ASP B 1 220 ? 2.779   19.742  26.922  1.00 26.28 ? 663 ASP B CA   1 
ATOM   3633 C  C    . ASP B 1 220 ? 3.611   20.953  26.492  1.00 26.07 ? 663 ASP B C    1 
ATOM   3634 O  O    . ASP B 1 220 ? 3.059   22.027  26.216  1.00 25.75 ? 663 ASP B O    1 
ATOM   3635 C  CB   . ASP B 1 220 ? 2.158   19.940  28.312  1.00 26.74 ? 663 ASP B CB   1 
ATOM   3636 C  CG   . ASP B 1 220 ? 0.736   19.388  28.401  1.00 26.85 ? 663 ASP B CG   1 
ATOM   3637 O  OD1  . ASP B 1 220 ? -0.156  19.970  27.746  1.00 27.13 ? 663 ASP B OD1  1 
ATOM   3638 O  OD2  . ASP B 1 220 ? 0.428   18.381  29.083  1.00 27.33 ? 663 ASP B OD2  1 
ATOM   3639 N  N    . GLN B 1 221 ? 4.931   20.771  26.420  1.00 25.92 ? 664 GLN B N    1 
ATOM   3640 C  CA   . GLN B 1 221 ? 5.845   21.825  25.947  1.00 25.62 ? 664 GLN B CA   1 
ATOM   3641 C  C    . GLN B 1 221 ? 5.949   21.898  24.415  1.00 25.53 ? 664 GLN B C    1 
ATOM   3642 O  O    . GLN B 1 221 ? 6.201   22.966  23.875  1.00 25.36 ? 664 GLN B O    1 
ATOM   3643 C  CB   . GLN B 1 221 ? 7.250   21.625  26.494  1.00 25.39 ? 664 GLN B CB   1 
ATOM   3644 C  CG   . GLN B 1 221 ? 7.369   21.475  27.975  1.00 25.34 ? 664 GLN B CG   1 
ATOM   3645 C  CD   . GLN B 1 221 ? 8.718   20.928  28.355  1.00 25.81 ? 664 GLN B CD   1 
ATOM   3646 O  OE1  . GLN B 1 221 ? 9.649   20.953  27.547  1.00 25.91 ? 664 GLN B OE1  1 
ATOM   3647 N  NE2  . GLN B 1 221 ? 8.837   20.427  29.578  1.00 26.73 ? 664 GLN B NE2  1 
ATOM   3648 N  N    . ILE B 1 222 ? 5.803   20.769  23.721  1.00 25.54 ? 665 ILE B N    1 
ATOM   3649 C  CA   . ILE B 1 222 ? 5.865   20.778  22.268  1.00 25.55 ? 665 ILE B CA   1 
ATOM   3650 C  C    . ILE B 1 222 ? 4.660   21.583  21.804  1.00 25.60 ? 665 ILE B C    1 
ATOM   3651 O  O    . ILE B 1 222 ? 4.795   22.461  20.955  1.00 25.75 ? 665 ILE B O    1 
ATOM   3652 C  CB   . ILE B 1 222 ? 5.875   19.326  21.652  1.00 25.64 ? 665 ILE B CB   1 
ATOM   3653 C  CG1  . ILE B 1 222 ? 7.098   18.536  22.120  1.00 25.44 ? 665 ILE B CG1  1 
ATOM   3654 C  CG2  . ILE B 1 222 ? 5.882   19.352  20.105  1.00 25.15 ? 665 ILE B CG2  1 
ATOM   3655 C  CD1  . ILE B 1 222 ? 6.889   17.030  22.125  1.00 25.57 ? 665 ILE B CD1  1 
ATOM   3656 N  N    . ILE B 1 223 ? 3.494   21.325  22.401  1.00 25.77 ? 666 ILE B N    1 
ATOM   3657 C  CA   . ILE B 1 223 ? 2.220   21.941  21.947  1.00 25.80 ? 666 ILE B CA   1 
ATOM   3658 C  C    . ILE B 1 223 ? 2.210   23.467  22.173  1.00 26.11 ? 666 ILE B C    1 
ATOM   3659 O  O    . ILE B 1 223 ? 1.537   24.244  21.461  1.00 25.99 ? 666 ILE B O    1 
ATOM   3660 C  CB   . ILE B 1 223 ? 1.004   21.254  22.651  1.00 25.31 ? 666 ILE B CB   1 
ATOM   3661 C  CG1  . ILE B 1 223 ? 0.992   19.768  22.301  1.00 24.64 ? 666 ILE B CG1  1 
ATOM   3662 C  CG2  . ILE B 1 223 ? -0.320  21.879  22.227  1.00 24.83 ? 666 ILE B CG2  1 
ATOM   3663 C  CD1  . ILE B 1 223 ? 0.992   18.882  23.471  1.00 24.51 ? 666 ILE B CD1  1 
ATOM   3664 N  N    . GLU B 1 224 ? 2.987   23.871  23.170  1.00 26.06 ? 667 GLU B N    1 
ATOM   3665 C  CA   . GLU B 1 224 ? 3.111   25.259  23.550  1.00 25.99 ? 667 GLU B CA   1 
ATOM   3666 C  C    . GLU B 1 224 ? 4.085   25.953  22.569  1.00 26.05 ? 667 GLU B C    1 
ATOM   3667 O  O    . GLU B 1 224 ? 3.674   26.821  21.797  1.00 26.10 ? 667 GLU B O    1 
ATOM   3668 C  CB   . GLU B 1 224 ? 3.550   25.302  25.024  1.00 25.90 ? 667 GLU B CB   1 
ATOM   3669 C  CG   . GLU B 1 224 ? 4.147   26.593  25.523  1.00 26.02 ? 667 GLU B CG   1 
ATOM   3670 C  CD   . GLU B 1 224 ? 3.118   27.687  25.632  1.00 25.47 ? 667 GLU B CD   1 
ATOM   3671 O  OE1  . GLU B 1 224 ? 2.477   27.960  24.599  1.00 25.63 ? 667 GLU B OE1  1 
ATOM   3672 O  OE2  . GLU B 1 224 ? 2.975   28.270  26.732  1.00 23.92 ? 667 GLU B OE2  1 
ATOM   3673 N  N    . MET B 1 225 ? 5.356   25.543  22.575  1.00 25.67 ? 668 MET B N    1 
ATOM   3674 C  CA   . MET B 1 225 ? 6.369   26.138  21.702  1.00 25.60 ? 668 MET B CA   1 
ATOM   3675 C  C    . MET B 1 225 ? 6.007   26.079  20.191  1.00 25.62 ? 668 MET B C    1 
ATOM   3676 O  O    . MET B 1 225 ? 5.844   27.147  19.576  1.00 25.38 ? 668 MET B O    1 
ATOM   3677 C  CB   . MET B 1 225 ? 7.746   25.493  21.946  1.00 25.81 ? 668 MET B CB   1 
ATOM   3678 C  CG   . MET B 1 225 ? 8.578   26.121  23.083  1.00 25.99 ? 668 MET B CG   1 
ATOM   3679 S  SD   . MET B 1 225 ? 9.127   24.902  24.290  1.00 25.19 ? 668 MET B SD   1 
ATOM   3680 C  CE   . MET B 1 225 ? 10.852  25.476  24.616  1.00 26.08 ? 668 MET B CE   1 
ATOM   3681 N  N    . VAL B 1 226 ? 5.898   24.857  19.613  1.00 25.14 ? 669 VAL B N    1 
ATOM   3682 C  CA   . VAL B 1 226 ? 5.512   24.650  18.190  1.00 24.51 ? 669 VAL B CA   1 
ATOM   3683 C  C    . VAL B 1 226 ? 4.279   25.446  17.847  1.00 24.23 ? 669 VAL B C    1 
ATOM   3684 O  O    . VAL B 1 226 ? 4.232   26.115  16.806  1.00 23.35 ? 669 VAL B O    1 
ATOM   3685 C  CB   . VAL B 1 226 ? 5.152   23.168  17.807  1.00 24.32 ? 669 VAL B CB   1 
ATOM   3686 C  CG1  . VAL B 1 226 ? 4.853   23.070  16.314  1.00 23.42 ? 669 VAL B CG1  1 
ATOM   3687 C  CG2  . VAL B 1 226 ? 6.257   22.180  18.149  1.00 24.72 ? 669 VAL B CG2  1 
ATOM   3688 N  N    . GLY B 1 227 ? 3.288   25.333  18.742  1.00 24.31 ? 670 GLY B N    1 
ATOM   3689 C  CA   . GLY B 1 227 ? 2.006   25.994  18.618  1.00 24.52 ? 670 GLY B CA   1 
ATOM   3690 C  C    . GLY B 1 227 ? 2.114   27.502  18.543  1.00 24.85 ? 670 GLY B C    1 
ATOM   3691 O  O    . GLY B 1 227 ? 1.492   28.121  17.664  1.00 25.23 ? 670 GLY B O    1 
ATOM   3692 N  N    . ARG B 1 228 ? 2.940   28.070  19.432  1.00 24.80 ? 671 ARG B N    1 
ATOM   3693 C  CA   . ARG B 1 228 ? 3.022   29.513  19.686  1.00 24.81 ? 671 ARG B CA   1 
ATOM   3694 C  C    . ARG B 1 228 ? 3.854   30.224  18.645  1.00 24.66 ? 671 ARG B C    1 
ATOM   3695 O  O    . ARG B 1 228 ? 4.110   31.424  18.769  1.00 24.43 ? 671 ARG B O    1 
ATOM   3696 C  CB   . ARG B 1 228 ? 3.657   29.756  21.066  1.00 24.89 ? 671 ARG B CB   1 
ATOM   3697 C  CG   . ARG B 1 228 ? 3.321   31.083  21.763  1.00 25.64 ? 671 ARG B CG   1 
ATOM   3698 C  CD   . ARG B 1 228 ? 3.788   31.159  23.263  1.00 26.77 ? 671 ARG B CD   1 
ATOM   3699 N  NE   . ARG B 1 228 ? 5.266   31.172  23.375  1.00 28.11 ? 671 ARG B NE   1 
ATOM   3700 C  CZ   . ARG B 1 228 ? 6.029   30.283  24.036  1.00 27.45 ? 671 ARG B CZ   1 
ATOM   3701 N  NH1  . ARG B 1 228 ? 5.496   29.277  24.715  1.00 26.20 ? 671 ARG B NH1  1 
ATOM   3702 N  NH2  . ARG B 1 228 ? 7.353   30.417  24.020  1.00 28.05 ? 671 ARG B NH2  1 
ATOM   3703 N  N    . GLY B 1 229 ? 4.261   29.477  17.618  1.00 24.67 ? 672 GLY B N    1 
ATOM   3704 C  CA   . GLY B 1 229 ? 5.343   29.863  16.737  1.00 24.81 ? 672 GLY B CA   1 
ATOM   3705 C  C    . GLY B 1 229 ? 6.577   30.063  17.576  1.00 24.79 ? 672 GLY B C    1 
ATOM   3706 O  O    . GLY B 1 229 ? 6.875   31.204  17.909  1.00 25.14 ? 672 GLY B O    1 
ATOM   3707 N  N    . SER B 1 230 ? 7.261   28.980  17.952  1.00 24.96 ? 673 SER B N    1 
ATOM   3708 C  CA   . SER B 1 230 ? 8.467   29.084  18.800  1.00 25.45 ? 673 SER B CA   1 
ATOM   3709 C  C    . SER B 1 230 ? 9.534   28.013  18.526  1.00 25.39 ? 673 SER B C    1 
ATOM   3710 O  O    . SER B 1 230 ? 10.640  28.365  18.131  1.00 25.56 ? 673 SER B O    1 
ATOM   3711 C  CB   . SER B 1 230 ? 8.100   29.112  20.287  1.00 25.68 ? 673 SER B CB   1 
ATOM   3712 O  OG   . SER B 1 230 ? 6.695   29.256  20.464  1.00 25.84 ? 673 SER B OG   1 
ATOM   3713 N  N    . LEU B 1 231 ? 9.220   26.732  18.726  1.00 25.21 ? 674 LEU B N    1 
ATOM   3714 C  CA   . LEU B 1 231 ? 10.177  25.658  18.409  1.00 25.35 ? 674 LEU B CA   1 
ATOM   3715 C  C    . LEU B 1 231 ? 10.166  25.336  16.927  1.00 25.59 ? 674 LEU B C    1 
ATOM   3716 O  O    . LEU B 1 231 ? 9.116   25.378  16.271  1.00 26.29 ? 674 LEU B O    1 
ATOM   3717 C  CB   . LEU B 1 231 ? 9.888   24.352  19.169  1.00 25.25 ? 674 LEU B CB   1 
ATOM   3718 C  CG   . LEU B 1 231 ? 11.072  23.778  19.969  1.00 25.53 ? 674 LEU B CG   1 
ATOM   3719 C  CD1  . LEU B 1 231 ? 10.636  22.528  20.695  1.00 26.14 ? 674 LEU B CD1  1 
ATOM   3720 C  CD2  . LEU B 1 231 ? 12.311  23.470  19.119  1.00 24.49 ? 674 LEU B CD2  1 
ATOM   3721 N  N    . SER B 1 232 ? 11.335  24.995  16.405  1.00 25.31 ? 675 SER B N    1 
ATOM   3722 C  CA   . SER B 1 232 ? 11.452  24.478  15.050  1.00 25.11 ? 675 SER B CA   1 
ATOM   3723 C  C    . SER B 1 232 ? 12.476  23.320  15.024  1.00 24.79 ? 675 SER B C    1 
ATOM   3724 O  O    . SER B 1 232 ? 13.463  23.338  15.771  1.00 24.92 ? 675 SER B O    1 
ATOM   3725 C  CB   . SER B 1 232 ? 11.844  25.635  14.112  1.00 25.17 ? 675 SER B CB   1 
ATOM   3726 O  OG   . SER B 1 232 ? 12.590  25.199  12.979  1.00 25.85 ? 675 SER B OG   1 
ATOM   3727 N  N    . PRO B 1 233 ? 12.305  22.340  14.152  1.00 24.15 ? 676 PRO B N    1 
ATOM   3728 C  CA   . PRO B 1 233 ? 13.175  21.174  14.219  1.00 24.44 ? 676 PRO B CA   1 
ATOM   3729 C  C    . PRO B 1 233 ? 14.655  21.558  13.953  1.00 24.50 ? 676 PRO B C    1 
ATOM   3730 O  O    . PRO B 1 233 ? 14.933  22.503  13.188  1.00 24.17 ? 676 PRO B O    1 
ATOM   3731 C  CB   . PRO B 1 233 ? 12.588  20.238  13.129  1.00 24.81 ? 676 PRO B CB   1 
ATOM   3732 C  CG   . PRO B 1 233 ? 11.247  20.800  12.811  1.00 24.17 ? 676 PRO B CG   1 
ATOM   3733 C  CD   . PRO B 1 233 ? 11.411  22.273  12.987  1.00 23.97 ? 676 PRO B CD   1 
ATOM   3734 N  N    . ASP B 1 234 ? 15.582  20.833  14.599  1.00 24.77 ? 677 ASP B N    1 
ATOM   3735 C  CA   . ASP B 1 234 ? 17.025  21.171  14.605  1.00 24.54 ? 677 ASP B CA   1 
ATOM   3736 C  C    . ASP B 1 234 ? 17.638  20.773  13.279  1.00 24.59 ? 677 ASP B C    1 
ATOM   3737 O  O    . ASP B 1 234 ? 18.175  19.671  13.137  1.00 24.33 ? 677 ASP B O    1 
ATOM   3738 C  CB   . ASP B 1 234 ? 17.761  20.474  15.762  1.00 24.39 ? 677 ASP B CB   1 
ATOM   3739 C  CG   . ASP B 1 234 ? 19.236  20.912  15.893  1.00 25.27 ? 677 ASP B CG   1 
ATOM   3740 O  OD1  . ASP B 1 234 ? 19.779  21.503  14.937  1.00 26.51 ? 677 ASP B OD1  1 
ATOM   3741 O  OD2  . ASP B 1 234 ? 19.941  20.711  16.917  1.00 23.19 ? 677 ASP B OD2  1 
ATOM   3742 N  N    . LEU B 1 235 ? 17.553  21.685  12.314  1.00 24.55 ? 678 LEU B N    1 
ATOM   3743 C  CA   . LEU B 1 235 ? 18.047  21.435  10.973  1.00 24.78 ? 678 LEU B CA   1 
ATOM   3744 C  C    . LEU B 1 235 ? 19.575  21.356  10.857  1.00 24.83 ? 678 LEU B C    1 
ATOM   3745 O  O    . LEU B 1 235 ? 20.073  21.166  9.766   1.00 24.12 ? 678 LEU B O    1 
ATOM   3746 C  CB   . LEU B 1 235 ? 17.541  22.504  10.017  1.00 24.89 ? 678 LEU B CB   1 
ATOM   3747 C  CG   . LEU B 1 235 ? 16.029  22.517  9.836   1.00 25.00 ? 678 LEU B CG   1 
ATOM   3748 C  CD1  . LEU B 1 235 ? 15.632  23.827  9.168   1.00 24.89 ? 678 LEU B CD1  1 
ATOM   3749 C  CD2  . LEU B 1 235 ? 15.551  21.307  9.027   1.00 25.00 ? 678 LEU B CD2  1 
ATOM   3750 N  N    . SER B 1 236 ? 20.314  21.533  11.949  1.00 25.06 ? 679 SER B N    1 
ATOM   3751 C  CA   . SER B 1 236 ? 21.745  21.212  11.935  1.00 25.69 ? 679 SER B CA   1 
ATOM   3752 C  C    . SER B 1 236 ? 21.968  19.709  12.169  1.00 25.74 ? 679 SER B C    1 
ATOM   3753 O  O    . SER B 1 236 ? 22.983  19.147  11.743  1.00 26.26 ? 679 SER B O    1 
ATOM   3754 C  CB   . SER B 1 236 ? 22.549  22.079  12.920  1.00 25.61 ? 679 SER B CB   1 
ATOM   3755 O  OG   . SER B 1 236 ? 23.275  21.281  13.845  1.00 26.57 ? 679 SER B OG   1 
ATOM   3756 N  N    . LYS B 1 237 ? 21.021  19.048  12.812  1.00 25.66 ? 680 LYS B N    1 
ATOM   3757 C  CA   . LYS B 1 237 ? 21.099  17.598  12.946  1.00 25.90 ? 680 LYS B CA   1 
ATOM   3758 C  C    . LYS B 1 237 ? 21.125  16.823  11.583  1.00 25.72 ? 680 LYS B C    1 
ATOM   3759 O  O    . LYS B 1 237 ? 21.636  15.699  11.522  1.00 25.83 ? 680 LYS B O    1 
ATOM   3760 C  CB   . LYS B 1 237 ? 20.013  17.080  13.917  1.00 25.99 ? 680 LYS B CB   1 
ATOM   3761 C  CG   . LYS B 1 237 ? 20.382  17.316  15.420  1.00 25.91 ? 680 LYS B CG   1 
ATOM   3762 C  CD   . LYS B 1 237 ? 19.265  16.880  16.422  1.00 25.57 ? 680 LYS B CD   1 
ATOM   3763 C  CE   . LYS B 1 237 ? 19.446  17.534  17.809  1.00 25.31 ? 680 LYS B CE   1 
ATOM   3764 N  NZ   . LYS B 1 237 ? 18.960  16.695  18.970  1.00 25.09 ? 680 LYS B NZ   1 
ATOM   3765 N  N    . VAL B 1 238 ? 20.636  17.419  10.497  1.00 25.41 ? 681 VAL B N    1 
ATOM   3766 C  CA   . VAL B 1 238 ? 20.783  16.789  9.161   1.00 25.31 ? 681 VAL B CA   1 
ATOM   3767 C  C    . VAL B 1 238 ? 22.184  16.265  8.802   1.00 25.30 ? 681 VAL B C    1 
ATOM   3768 O  O    . VAL B 1 238 ? 23.195  16.904  9.084   1.00 25.52 ? 681 VAL B O    1 
ATOM   3769 C  CB   . VAL B 1 238 ? 20.450  17.723  7.982   1.00 25.28 ? 681 VAL B CB   1 
ATOM   3770 C  CG1  . VAL B 1 238 ? 19.215  17.232  7.230   1.00 25.33 ? 681 VAL B CG1  1 
ATOM   3771 C  CG2  . VAL B 1 238 ? 20.301  19.131  8.426   1.00 25.51 ? 681 VAL B CG2  1 
ATOM   3772 N  N    . ARG B 1 239 ? 22.195  15.123  8.119   1.00 25.04 ? 682 ARG B N    1 
ATOM   3773 C  CA   . ARG B 1 239 ? 23.376  14.498  7.541   1.00 24.99 ? 682 ARG B CA   1 
ATOM   3774 C  C    . ARG B 1 239 ? 24.290  15.437  6.740   1.00 24.77 ? 682 ARG B C    1 
ATOM   3775 O  O    . ARG B 1 239 ? 23.847  16.408  6.114   1.00 24.40 ? 682 ARG B O    1 
ATOM   3776 C  CB   . ARG B 1 239 ? 22.928  13.362  6.594   1.00 25.24 ? 682 ARG B CB   1 
ATOM   3777 C  CG   . ARG B 1 239 ? 22.447  12.073  7.263   1.00 25.09 ? 682 ARG B CG   1 
ATOM   3778 C  CD   . ARG B 1 239 ? 23.322  10.854  6.949   1.00 25.35 ? 682 ARG B CD   1 
ATOM   3779 N  NE   . ARG B 1 239 ? 22.633  9.598   7.250   1.00 25.55 ? 682 ARG B NE   1 
ATOM   3780 C  CZ   . ARG B 1 239 ? 22.525  8.538   6.438   1.00 25.56 ? 682 ARG B CZ   1 
ATOM   3781 N  NH1  . ARG B 1 239 ? 23.081  8.512   5.224   1.00 24.37 ? 682 ARG B NH1  1 
ATOM   3782 N  NH2  . ARG B 1 239 ? 21.848  7.473   6.863   1.00 26.37 ? 682 ARG B NH2  1 
ATOM   3783 N  N    . SER B 1 240 ? 25.572  15.092  6.717   1.00 24.71 ? 683 SER B N    1 
ATOM   3784 C  CA   . SER B 1 240 ? 26.541  15.847  5.935   1.00 24.66 ? 683 SER B CA   1 
ATOM   3785 C  C    . SER B 1 240 ? 26.524  15.481  4.462   1.00 24.37 ? 683 SER B C    1 
ATOM   3786 O  O    . SER B 1 240 ? 27.130  16.222  3.678   1.00 24.40 ? 683 SER B O    1 
ATOM   3787 C  CB   . SER B 1 240 ? 27.962  15.656  6.453   1.00 24.74 ? 683 SER B CB   1 
ATOM   3788 O  OG   . SER B 1 240 ? 28.767  15.092  5.425   1.00 25.15 ? 683 SER B OG   1 
ATOM   3789 N  N    . ASN B 1 241 ? 25.888  14.351  4.089   1.00 23.89 ? 684 ASN B N    1 
ATOM   3790 C  CA   . ASN B 1 241 ? 25.656  14.037  2.652   1.00 23.66 ? 684 ASN B CA   1 
ATOM   3791 C  C    . ASN B 1 241 ? 24.377  14.643  2.120   1.00 23.84 ? 684 ASN B C    1 
ATOM   3792 O  O    . ASN B 1 241 ? 24.324  15.032  0.962   1.00 23.17 ? 684 ASN B O    1 
ATOM   3793 C  CB   . ASN B 1 241 ? 25.732  12.542  2.210   1.00 23.14 ? 684 ASN B CB   1 
ATOM   3794 C  CG   . ASN B 1 241 ? 25.460  11.537  3.313   1.00 22.56 ? 684 ASN B CG   1 
ATOM   3795 O  OD1  . ASN B 1 241 ? 25.394  11.879  4.488   1.00 23.06 ? 684 ASN B OD1  1 
ATOM   3796 N  ND2  . ASN B 1 241 ? 25.338  10.259  2.926   1.00 20.54 ? 684 ASN B ND2  1 
ATOM   3797 N  N    . CYS B 1 242 ? 23.350  14.707  2.964   1.00 24.87 ? 685 CYS B N    1 
ATOM   3798 C  CA   . CYS B 1 242 ? 22.041  15.207  2.542   1.00 25.55 ? 685 CYS B CA   1 
ATOM   3799 C  C    . CYS B 1 242 ? 22.335  16.453  1.731   1.00 25.47 ? 685 CYS B C    1 
ATOM   3800 O  O    . CYS B 1 242 ? 23.042  17.333  2.241   1.00 26.07 ? 685 CYS B O    1 
ATOM   3801 C  CB   . CYS B 1 242 ? 21.142  15.538  3.734   1.00 25.53 ? 685 CYS B CB   1 
ATOM   3802 S  SG   . CYS B 1 242 ? 19.781  16.664  3.310   1.00 26.91 ? 685 CYS B SG   1 
ATOM   3803 N  N    . PRO B 1 243 ? 21.863  16.518  0.476   1.00 25.07 ? 686 PRO B N    1 
ATOM   3804 C  CA   . PRO B 1 243 ? 22.184  17.653  -0.384  1.00 24.59 ? 686 PRO B CA   1 
ATOM   3805 C  C    . PRO B 1 243 ? 21.536  18.857  0.191   1.00 24.45 ? 686 PRO B C    1 
ATOM   3806 O  O    . PRO B 1 243 ? 20.555  18.699  0.924   1.00 24.64 ? 686 PRO B O    1 
ATOM   3807 C  CB   . PRO B 1 243 ? 21.546  17.275  -1.709  1.00 24.72 ? 686 PRO B CB   1 
ATOM   3808 C  CG   . PRO B 1 243 ? 21.365  15.810  -1.632  1.00 24.80 ? 686 PRO B CG   1 
ATOM   3809 C  CD   . PRO B 1 243 ? 20.995  15.551  -0.226  1.00 24.97 ? 686 PRO B CD   1 
ATOM   3810 N  N    . LYS B 1 244 ? 22.053  20.034  -0.102  1.00 24.46 ? 687 LYS B N    1 
ATOM   3811 C  CA   . LYS B 1 244 ? 21.439  21.228  0.458   1.00 25.17 ? 687 LYS B CA   1 
ATOM   3812 C  C    . LYS B 1 244 ? 20.050  21.511  -0.162  1.00 25.43 ? 687 LYS B C    1 
ATOM   3813 O  O    . LYS B 1 244 ? 19.173  22.075  0.502   1.00 25.68 ? 687 LYS B O    1 
ATOM   3814 C  CB   . LYS B 1 244 ? 22.369  22.421  0.347   1.00 25.06 ? 687 LYS B CB   1 
ATOM   3815 C  CG   . LYS B 1 244 ? 23.627  22.271  1.218   1.00 26.02 ? 687 LYS B CG   1 
ATOM   3816 C  CD   . LYS B 1 244 ? 24.636  23.413  1.028   1.00 26.81 ? 687 LYS B CD   1 
ATOM   3817 C  CE   . LYS B 1 244 ? 23.969  24.820  1.038   1.00 28.04 ? 687 LYS B CE   1 
ATOM   3818 N  NZ   . LYS B 1 244 ? 22.854  25.027  0.051   1.00 26.99 ? 687 LYS B NZ   1 
ATOM   3819 N  N    . ARG B 1 245 ? 19.837  21.087  -1.404  1.00 25.35 ? 688 ARG B N    1 
ATOM   3820 C  CA   . ARG B 1 245 ? 18.525  21.219  -2.025  1.00 25.79 ? 688 ARG B CA   1 
ATOM   3821 C  C    . ARG B 1 245 ? 17.367  20.701  -1.106  1.00 25.93 ? 688 ARG B C    1 
ATOM   3822 O  O    . ARG B 1 245 ? 16.379  21.407  -0.892  1.00 25.56 ? 688 ARG B O    1 
ATOM   3823 C  CB   . ARG B 1 245 ? 18.493  20.531  -3.409  1.00 25.77 ? 688 ARG B CB   1 
ATOM   3824 C  CG   . ARG B 1 245 ? 18.398  21.490  -4.600  1.00 25.61 ? 688 ARG B CG   1 
ATOM   3825 C  CD   . ARG B 1 245 ? 18.557  20.827  -5.969  1.00 25.35 ? 688 ARG B CD   1 
ATOM   3826 N  NE   . ARG B 1 245 ? 18.090  21.664  -7.072  1.00 26.97 ? 688 ARG B NE   1 
ATOM   3827 C  CZ   . ARG B 1 245 ? 17.794  21.228  -8.312  1.00 27.85 ? 688 ARG B CZ   1 
ATOM   3828 N  NH1  . ARG B 1 245 ? 17.914  19.941  -8.643  1.00 27.66 ? 688 ARG B NH1  1 
ATOM   3829 N  NH2  . ARG B 1 245 ? 17.376  22.100  -9.238  1.00 27.93 ? 688 ARG B NH2  1 
ATOM   3830 N  N    . MET B 1 246 ? 17.507  19.488  -0.569  1.00 26.24 ? 689 MET B N    1 
ATOM   3831 C  CA   . MET B 1 246 ? 16.483  18.876  0.324   1.00 26.47 ? 689 MET B CA   1 
ATOM   3832 C  C    . MET B 1 246 ? 16.319  19.721  1.626   1.00 26.47 ? 689 MET B C    1 
ATOM   3833 O  O    . MET B 1 246 ? 15.195  20.050  2.058   1.00 26.32 ? 689 MET B O    1 
ATOM   3834 C  CB   . MET B 1 246 ? 16.852  17.396  0.616   1.00 26.01 ? 689 MET B CB   1 
ATOM   3835 C  CG   . MET B 1 246 ? 15.823  16.562  1.341   1.00 26.12 ? 689 MET B CG   1 
ATOM   3836 S  SD   . MET B 1 246 ? 14.278  16.114  0.421   1.00 29.41 ? 689 MET B SD   1 
ATOM   3837 C  CE   . MET B 1 246 ? 14.858  14.952  -0.822  1.00 26.33 ? 689 MET B CE   1 
ATOM   3838 N  N    . LYS B 1 247 ? 17.449  20.118  2.208   1.00 26.10 ? 690 LYS B N    1 
ATOM   3839 C  CA   . LYS B 1 247 ? 17.452  20.974  3.390   1.00 25.69 ? 690 LYS B CA   1 
ATOM   3840 C  C    . LYS B 1 247 ? 16.622  22.240  3.227   1.00 25.57 ? 690 LYS B C    1 
ATOM   3841 O  O    . LYS B 1 247 ? 16.105  22.731  4.225   1.00 25.99 ? 690 LYS B O    1 
ATOM   3842 C  CB   . LYS B 1 247 ? 18.884  21.383  3.743   1.00 25.93 ? 690 LYS B CB   1 
ATOM   3843 C  CG   . LYS B 1 247 ? 19.146  21.582  5.217   1.00 25.92 ? 690 LYS B CG   1 
ATOM   3844 C  CD   . LYS B 1 247 ? 20.624  21.824  5.494   1.00 25.19 ? 690 LYS B CD   1 
ATOM   3845 C  CE   . LYS B 1 247 ? 20.810  22.619  6.813   1.00 26.68 ? 690 LYS B CE   1 
ATOM   3846 N  NZ   . LYS B 1 247 ? 22.206  22.535  7.453   1.00 26.53 ? 690 LYS B NZ   1 
ATOM   3847 N  N    . ARG B 1 248 ? 16.525  22.764  1.996   1.00 24.90 ? 691 ARG B N    1 
ATOM   3848 C  CA   . ARG B 1 248 ? 15.977  24.093  1.703   1.00 24.76 ? 691 ARG B CA   1 
ATOM   3849 C  C    . ARG B 1 248 ? 14.478  23.963  1.428   1.00 24.93 ? 691 ARG B C    1 
ATOM   3850 O  O    . ARG B 1 248 ? 13.653  24.812  1.798   1.00 24.82 ? 691 ARG B O    1 
ATOM   3851 C  CB   . ARG B 1 248 ? 16.699  24.691  0.472   1.00 25.00 ? 691 ARG B CB   1 
ATOM   3852 C  CG   . ARG B 1 248 ? 17.353  26.139  0.647   1.00 26.27 ? 691 ARG B CG   1 
ATOM   3853 C  CD   . ARG B 1 248 ? 16.688  27.354  -0.139  1.00 25.89 ? 691 ARG B CD   1 
ATOM   3854 N  NE   . ARG B 1 248 ? 16.680  27.201  -1.609  1.00 26.41 ? 691 ARG B NE   1 
ATOM   3855 C  CZ   . ARG B 1 248 ? 15.709  26.587  -2.325  1.00 25.80 ? 691 ARG B CZ   1 
ATOM   3856 N  NH1  . ARG B 1 248 ? 14.645  26.052  -1.725  1.00 25.20 ? 691 ARG B NH1  1 
ATOM   3857 N  NH2  . ARG B 1 248 ? 15.799  26.506  -3.653  1.00 25.27 ? 691 ARG B NH2  1 
ATOM   3858 N  N    . LEU B 1 249 ? 14.144  22.874  0.750   1.00 24.89 ? 692 LEU B N    1 
ATOM   3859 C  CA   . LEU B 1 249 ? 12.786  22.378  0.643   1.00 24.51 ? 692 LEU B CA   1 
ATOM   3860 C  C    . LEU B 1 249 ? 12.156  22.042  1.991   1.00 24.52 ? 692 LEU B C    1 
ATOM   3861 O  O    . LEU B 1 249 ? 10.968  22.224  2.189   1.00 24.56 ? 692 LEU B O    1 
ATOM   3862 C  CB   . LEU B 1 249 ? 12.822  21.105  -0.172  1.00 24.40 ? 692 LEU B CB   1 
ATOM   3863 C  CG   . LEU B 1 249 ? 11.484  20.591  -0.645  1.00 24.13 ? 692 LEU B CG   1 
ATOM   3864 C  CD1  . LEU B 1 249 ? 10.952  21.534  -1.704  1.00 22.87 ? 692 LEU B CD1  1 
ATOM   3865 C  CD2  . LEU B 1 249 ? 11.663  19.158  -1.148  1.00 23.95 ? 692 LEU B CD2  1 
ATOM   3866 N  N    . MET B 1 250 ? 12.965  21.531  2.912   1.00 25.00 ? 693 MET B N    1 
ATOM   3867 C  CA   . MET B 1 250 ? 12.460  20.960  4.155   1.00 24.65 ? 693 MET B CA   1 
ATOM   3868 C  C    . MET B 1 250 ? 11.992  22.079  5.014   1.00 24.32 ? 693 MET B C    1 
ATOM   3869 O  O    . MET B 1 250 ? 10.874  22.041  5.465   1.00 24.30 ? 693 MET B O    1 
ATOM   3870 C  CB   . MET B 1 250 ? 13.532  20.153  4.854   1.00 24.71 ? 693 MET B CB   1 
ATOM   3871 C  CG   . MET B 1 250 ? 12.998  19.075  5.753   1.00 25.21 ? 693 MET B CG   1 
ATOM   3872 S  SD   . MET B 1 250 ? 14.339  18.508  6.835   1.00 26.66 ? 693 MET B SD   1 
ATOM   3873 C  CE   . MET B 1 250 ? 15.479  17.674  5.619   1.00 23.57 ? 693 MET B CE   1 
ATOM   3874 N  N    . ALA B 1 251 ? 12.814  23.106  5.189   1.00 24.50 ? 694 ALA B N    1 
ATOM   3875 C  CA   . ALA B 1 251 ? 12.377  24.312  5.890   1.00 25.06 ? 694 ALA B CA   1 
ATOM   3876 C  C    . ALA B 1 251 ? 11.225  25.001  5.178   1.00 25.71 ? 694 ALA B C    1 
ATOM   3877 O  O    . ALA B 1 251 ? 10.362  25.605  5.819   1.00 25.91 ? 694 ALA B O    1 
ATOM   3878 C  CB   . ALA B 1 251 ? 13.508  25.270  6.071   1.00 25.30 ? 694 ALA B CB   1 
ATOM   3879 N  N    . GLU B 1 252 ? 11.194  24.910  3.851   1.00 26.51 ? 695 GLU B N    1 
ATOM   3880 C  CA   . GLU B 1 252 ? 10.066  25.465  3.085   1.00 26.57 ? 695 GLU B CA   1 
ATOM   3881 C  C    . GLU B 1 252 ? 8.779   24.723  3.438   1.00 26.50 ? 695 GLU B C    1 
ATOM   3882 O  O    . GLU B 1 252 ? 7.698   25.311  3.470   1.00 27.19 ? 695 GLU B O    1 
ATOM   3883 C  CB   . GLU B 1 252 ? 10.336  25.413  1.566   1.00 26.81 ? 695 GLU B CB   1 
ATOM   3884 C  CG   . GLU B 1 252 ? 11.150  26.597  1.013   1.00 27.36 ? 695 GLU B CG   1 
ATOM   3885 C  CD   . GLU B 1 252 ? 10.285  27.690  0.369   1.00 29.29 ? 695 GLU B CD   1 
ATOM   3886 O  OE1  . GLU B 1 252 ? 10.060  27.595  -0.861  1.00 30.58 ? 695 GLU B OE1  1 
ATOM   3887 O  OE2  . GLU B 1 252 ? 9.828   28.646  1.076   1.00 29.22 ? 695 GLU B OE2  1 
ATOM   3888 N  N    . CYS B 1 253 ? 8.879   23.431  3.715   1.00 25.92 ? 696 CYS B N    1 
ATOM   3889 C  CA   . CYS B 1 253 ? 7.695   22.669  4.107   1.00 25.60 ? 696 CYS B CA   1 
ATOM   3890 C  C    . CYS B 1 253 ? 7.251   22.974  5.550   1.00 25.21 ? 696 CYS B C    1 
ATOM   3891 O  O    . CYS B 1 253 ? 6.096   22.830  5.875   1.00 24.63 ? 696 CYS B O    1 
ATOM   3892 C  CB   . CYS B 1 253 ? 7.961   21.167  3.933   1.00 25.51 ? 696 CYS B CB   1 
ATOM   3893 S  SG   . CYS B 1 253 ? 8.136   20.638  2.212   1.00 25.09 ? 696 CYS B SG   1 
ATOM   3894 N  N    . LEU B 1 254 ? 8.193   23.389  6.401   1.00 25.21 ? 697 LEU B N    1 
ATOM   3895 C  CA   . LEU B 1 254 ? 7.972   23.586  7.845   1.00 24.56 ? 697 LEU B CA   1 
ATOM   3896 C  C    . LEU B 1 254 ? 7.661   25.031  8.183   1.00 24.27 ? 697 LEU B C    1 
ATOM   3897 O  O    . LEU B 1 254 ? 7.605   25.404  9.345   1.00 24.35 ? 697 LEU B O    1 
ATOM   3898 C  CB   . LEU B 1 254 ? 9.214   23.155  8.658   1.00 24.26 ? 697 LEU B CB   1 
ATOM   3899 C  CG   . LEU B 1 254 ? 9.764   21.747  8.440   1.00 23.26 ? 697 LEU B CG   1 
ATOM   3900 C  CD1  . LEU B 1 254 ? 11.106  21.675  9.096   1.00 24.79 ? 697 LEU B CD1  1 
ATOM   3901 C  CD2  . LEU B 1 254 ? 8.884   20.655  8.978   1.00 22.79 ? 697 LEU B CD2  1 
ATOM   3902 N  N    . LYS B 1 255 ? 7.441   25.862  7.183   1.00 24.45 ? 698 LYS B N    1 
ATOM   3903 C  CA   . LYS B 1 255 ? 7.139   27.250  7.477   1.00 24.46 ? 698 LYS B CA   1 
ATOM   3904 C  C    . LYS B 1 255 ? 5.993   27.342  8.463   1.00 24.29 ? 698 LYS B C    1 
ATOM   3905 O  O    . LYS B 1 255 ? 4.989   26.643  8.322   1.00 24.18 ? 698 LYS B O    1 
ATOM   3906 C  CB   . LYS B 1 255 ? 6.883   28.049  6.198   1.00 24.30 ? 698 LYS B CB   1 
ATOM   3907 C  CG   . LYS B 1 255 ? 8.213   28.512  5.554   1.00 25.00 ? 698 LYS B CG   1 
ATOM   3908 C  CD   . LYS B 1 255 ? 8.939   29.596  6.398   1.00 24.45 ? 698 LYS B CD   1 
ATOM   3909 C  CE   . LYS B 1 255 ? 9.758   30.518  5.515   1.00 24.80 ? 698 LYS B CE   1 
ATOM   3910 N  NZ   . LYS B 1 255 ? 10.377  29.748  4.362   1.00 25.77 ? 698 LYS B NZ   1 
ATOM   3911 N  N    . LYS B 1 256 ? 6.208   28.149  9.501   1.00 24.51 ? 699 LYS B N    1 
ATOM   3912 C  CA   . LYS B 1 256 ? 5.180   28.480  10.483  1.00 24.75 ? 699 LYS B CA   1 
ATOM   3913 C  C    . LYS B 1 256 ? 3.929   29.110  9.828   1.00 24.78 ? 699 LYS B C    1 
ATOM   3914 O  O    . LYS B 1 256 ? 2.810   28.842  10.240  1.00 24.63 ? 699 LYS B O    1 
ATOM   3915 C  CB   . LYS B 1 256 ? 5.758   29.427  11.543  1.00 24.85 ? 699 LYS B CB   1 
ATOM   3916 C  CG   . LYS B 1 256 ? 5.967   28.806  12.926  1.00 25.42 ? 699 LYS B CG   1 
ATOM   3917 C  CD   . LYS B 1 256 ? 7.360   28.191  13.084  1.00 26.20 ? 699 LYS B CD   1 
ATOM   3918 C  CE   . LYS B 1 256 ? 7.619   27.758  14.540  1.00 26.59 ? 699 LYS B CE   1 
ATOM   3919 N  NZ   . LYS B 1 256 ? 6.539   26.902  15.154  1.00 26.79 ? 699 LYS B NZ   1 
ATOM   3920 N  N    . LYS B 1 257 ? 4.133   29.944  8.817   1.00 25.28 ? 700 LYS B N    1 
ATOM   3921 C  CA   . LYS B 1 257 ? 3.027   30.556  8.077   1.00 26.01 ? 700 LYS B CA   1 
ATOM   3922 C  C    . LYS B 1 257 ? 2.557   29.606  6.992   1.00 26.23 ? 700 LYS B C    1 
ATOM   3923 O  O    . LYS B 1 257 ? 3.372   28.954  6.348   1.00 26.58 ? 700 LYS B O    1 
ATOM   3924 C  CB   . LYS B 1 257 ? 3.442   31.891  7.436   1.00 26.15 ? 700 LYS B CB   1 
ATOM   3925 C  CG   . LYS B 1 257 ? 4.091   32.924  8.424   1.00 27.18 ? 700 LYS B CG   1 
ATOM   3926 C  CD   . LYS B 1 257 ? 3.266   34.233  8.571   1.00 27.30 ? 700 LYS B CD   1 
ATOM   3927 C  CE   . LYS B 1 257 ? 3.967   35.433  7.962   1.00 26.88 ? 700 LYS B CE   1 
ATOM   3928 N  NZ   . LYS B 1 257 ? 3.068   36.615  8.004   1.00 27.17 ? 700 LYS B NZ   1 
ATOM   3929 N  N    . ARG B 1 258 ? 1.245   29.546  6.766   1.00 26.44 ? 701 ARG B N    1 
ATOM   3930 C  CA   . ARG B 1 258 ? 0.674   28.550  5.851   1.00 26.43 ? 701 ARG B CA   1 
ATOM   3931 C  C    . ARG B 1 258 ? 0.898   28.868  4.366   1.00 26.56 ? 701 ARG B C    1 
ATOM   3932 O  O    . ARG B 1 258 ? 1.259   27.980  3.603   1.00 27.48 ? 701 ARG B O    1 
ATOM   3933 C  CB   . ARG B 1 258 ? -0.803  28.360  6.129   1.00 26.54 ? 701 ARG B CB   1 
ATOM   3934 C  CG   . ARG B 1 258 ? -1.123  28.418  7.595   1.00 27.25 ? 701 ARG B CG   1 
ATOM   3935 C  CD   . ARG B 1 258 ? -2.377  27.698  7.973   1.00 27.99 ? 701 ARG B CD   1 
ATOM   3936 N  NE   . ARG B 1 258 ? -3.603  28.206  7.355   1.00 27.83 ? 701 ARG B NE   1 
ATOM   3937 C  CZ   . ARG B 1 258 ? -4.581  27.417  6.890   1.00 29.48 ? 701 ARG B CZ   1 
ATOM   3938 N  NH1  . ARG B 1 258 ? -4.457  26.082  6.938   1.00 29.11 ? 701 ARG B NH1  1 
ATOM   3939 N  NH2  . ARG B 1 258 ? -5.688  27.955  6.354   1.00 30.27 ? 701 ARG B NH2  1 
ATOM   3940 N  N    . ASP B 1 259 ? 0.701   30.121  3.962   1.00 26.56 ? 702 ASP B N    1 
ATOM   3941 C  CA   . ASP B 1 259 ? 0.990   30.588  2.588   1.00 26.42 ? 702 ASP B CA   1 
ATOM   3942 C  C    . ASP B 1 259 ? 2.463   30.454  2.170   1.00 26.29 ? 702 ASP B C    1 
ATOM   3943 O  O    . ASP B 1 259 ? 2.790   30.571  0.972   1.00 26.04 ? 702 ASP B O    1 
ATOM   3944 C  CB   . ASP B 1 259 ? 0.669   32.087  2.438   1.00 26.73 ? 702 ASP B CB   1 
ATOM   3945 C  CG   . ASP B 1 259 ? -0.804  32.423  2.602   1.00 26.66 ? 702 ASP B CG   1 
ATOM   3946 O  OD1  . ASP B 1 259 ? -1.679  31.507  2.614   1.00 28.04 ? 702 ASP B OD1  1 
ATOM   3947 O  OD2  . ASP B 1 259 ? -1.158  33.618  2.723   1.00 25.12 ? 702 ASP B OD2  1 
ATOM   3948 N  N    . GLU B 1 260 ? 3.353   30.265  3.146   1.00 25.82 ? 703 GLU B N    1 
ATOM   3949 C  CA   . GLU B 1 260 ? 4.776   30.160  2.851   1.00 25.70 ? 703 GLU B CA   1 
ATOM   3950 C  C    . GLU B 1 260 ? 5.227   28.691  2.630   1.00 25.56 ? 703 GLU B C    1 
ATOM   3951 O  O    . GLU B 1 260 ? 6.428   28.441  2.408   1.00 25.45 ? 703 GLU B O    1 
ATOM   3952 C  CB   . GLU B 1 260 ? 5.605   30.888  3.943   1.00 25.86 ? 703 GLU B CB   1 
ATOM   3953 C  CG   . GLU B 1 260 ? 5.778   32.403  3.698   1.00 26.22 ? 703 GLU B CG   1 
ATOM   3954 C  CD   . GLU B 1 260 ? 6.112   33.271  4.944   1.00 26.53 ? 703 GLU B CD   1 
ATOM   3955 O  OE1  . GLU B 1 260 ? 6.536   32.759  6.018   1.00 25.17 ? 703 GLU B OE1  1 
ATOM   3956 O  OE2  . GLU B 1 260 ? 5.957   34.516  4.829   1.00 26.55 ? 703 GLU B OE2  1 
ATOM   3957 N  N    . ARG B 1 261 ? 4.284   27.737  2.670   1.00 25.00 ? 704 ARG B N    1 
ATOM   3958 C  CA   . ARG B 1 261 ? 4.580   26.327  2.352   1.00 25.02 ? 704 ARG B CA   1 
ATOM   3959 C  C    . ARG B 1 261 ? 4.074   26.031  0.944   1.00 25.04 ? 704 ARG B C    1 
ATOM   3960 O  O    . ARG B 1 261 ? 2.937   26.397  0.618   1.00 25.55 ? 704 ARG B O    1 
ATOM   3961 C  CB   . ARG B 1 261 ? 3.916   25.334  3.345   1.00 24.85 ? 704 ARG B CB   1 
ATOM   3962 C  CG   . ARG B 1 261 ? 4.263   25.537  4.845   1.00 24.74 ? 704 ARG B CG   1 
ATOM   3963 C  CD   . ARG B 1 261 ? 3.555   24.576  5.842   1.00 25.11 ? 704 ARG B CD   1 
ATOM   3964 N  NE   . ARG B 1 261 ? 2.100   24.784  5.955   1.00 24.30 ? 704 ARG B NE   1 
ATOM   3965 C  CZ   . ARG B 1 261 ? 1.398   24.884  7.091   1.00 22.59 ? 704 ARG B CZ   1 
ATOM   3966 N  NH1  . ARG B 1 261 ? 1.934   24.813  8.302   1.00 20.78 ? 704 ARG B NH1  1 
ATOM   3967 N  NH2  . ARG B 1 261 ? 0.108   25.076  6.999   1.00 24.74 ? 704 ARG B NH2  1 
ATOM   3968 N  N    . PRO B 1 262 ? 4.888   25.359  0.125   1.00 24.86 ? 705 PRO B N    1 
ATOM   3969 C  CA   . PRO B 1 262 ? 4.501   24.994  -1.246  1.00 24.98 ? 705 PRO B CA   1 
ATOM   3970 C  C    . PRO B 1 262 ? 3.549   23.840  -1.314  1.00 25.40 ? 705 PRO B C    1 
ATOM   3971 O  O    . PRO B 1 262 ? 3.400   23.073  -0.369  1.00 25.59 ? 705 PRO B O    1 
ATOM   3972 C  CB   . PRO B 1 262 ? 5.798   24.505  -1.865  1.00 25.23 ? 705 PRO B CB   1 
ATOM   3973 C  CG   . PRO B 1 262 ? 6.625   24.051  -0.723  1.00 24.78 ? 705 PRO B CG   1 
ATOM   3974 C  CD   . PRO B 1 262 ? 6.238   24.882  0.455   1.00 24.56 ? 705 PRO B CD   1 
ATOM   3975 N  N    . SER B 1 263 ? 2.924   23.689  -2.468  1.00 25.62 ? 706 SER B N    1 
ATOM   3976 C  CA   . SER B 1 263 ? 2.085   22.529  -2.715  1.00 25.06 ? 706 SER B CA   1 
ATOM   3977 C  C    . SER B 1 263 ? 2.949   21.435  -3.317  1.00 24.28 ? 706 SER B C    1 
ATOM   3978 O  O    . SER B 1 263 ? 4.148   21.646  -3.521  1.00 24.25 ? 706 SER B O    1 
ATOM   3979 C  CB   . SER B 1 263 ? 0.918   22.917  -3.595  1.00 25.14 ? 706 SER B CB   1 
ATOM   3980 O  OG   . SER B 1 263 ? -0.094  23.421  -2.756  1.00 26.63 ? 706 SER B OG   1 
ATOM   3981 N  N    . PHE B 1 264 ? 2.355   20.271  -3.558  1.00 23.64 ? 707 PHE B N    1 
ATOM   3982 C  CA   . PHE B 1 264 ? 3.117   19.057  -3.804  1.00 23.65 ? 707 PHE B CA   1 
ATOM   3983 C  C    . PHE B 1 264 ? 3.652   18.919  -5.185  1.00 23.51 ? 707 PHE B C    1 
ATOM   3984 O  O    . PHE B 1 264 ? 4.626   18.206  -5.358  1.00 23.68 ? 707 PHE B O    1 
ATOM   3985 C  CB   . PHE B 1 264 ? 2.367   17.785  -3.413  1.00 23.30 ? 707 PHE B CB   1 
ATOM   3986 C  CG   . PHE B 1 264 ? 2.723   17.267  -2.031  1.00 24.39 ? 707 PHE B CG   1 
ATOM   3987 C  CD1  . PHE B 1 264 ? 3.790   16.404  -1.840  1.00 24.18 ? 707 PHE B CD1  1 
ATOM   3988 C  CD2  . PHE B 1 264 ? 1.979   17.644  -0.911  1.00 26.09 ? 707 PHE B CD2  1 
ATOM   3989 C  CE1  . PHE B 1 264 ? 4.098   15.930  -0.584  1.00 22.89 ? 707 PHE B CE1  1 
ATOM   3990 C  CE2  . PHE B 1 264 ? 2.300   17.165  0.354   1.00 24.48 ? 707 PHE B CE2  1 
ATOM   3991 C  CZ   . PHE B 1 264 ? 3.353   16.320  0.508   1.00 23.46 ? 707 PHE B CZ   1 
ATOM   3992 N  N    . PRO B 1 265 ? 3.058   19.552  -6.178  1.00 23.55 ? 708 PRO B N    1 
ATOM   3993 C  CA   . PRO B 1 265 ? 3.686   19.610  -7.508  1.00 23.94 ? 708 PRO B CA   1 
ATOM   3994 C  C    . PRO B 1 265 ? 5.071   20.278  -7.518  1.00 23.97 ? 708 PRO B C    1 
ATOM   3995 O  O    . PRO B 1 265 ? 5.945   19.865  -8.250  1.00 23.58 ? 708 PRO B O    1 
ATOM   3996 C  CB   . PRO B 1 265 ? 2.681   20.398  -8.321  1.00 23.52 ? 708 PRO B CB   1 
ATOM   3997 C  CG   . PRO B 1 265 ? 1.440   20.074  -7.675  1.00 24.10 ? 708 PRO B CG   1 
ATOM   3998 C  CD   . PRO B 1 265 ? 1.743   20.172  -6.197  1.00 23.55 ? 708 PRO B CD   1 
ATOM   3999 N  N    . ARG B 1 266 ? 5.263   21.282  -6.685  1.00 24.69 ? 709 ARG B N    1 
ATOM   4000 C  CA   . ARG B 1 266 ? 6.559   21.915  -6.546  1.00 25.51 ? 709 ARG B CA   1 
ATOM   4001 C  C    . ARG B 1 266 ? 7.517   21.111  -5.665  1.00 25.76 ? 709 ARG B C    1 
ATOM   4002 O  O    . ARG B 1 266 ? 8.728   21.112  -5.914  1.00 26.52 ? 709 ARG B O    1 
ATOM   4003 C  CB   . ARG B 1 266 ? 6.414   23.341  -6.005  1.00 25.85 ? 709 ARG B CB   1 
ATOM   4004 C  CG   . ARG B 1 266 ? 7.305   24.390  -6.735  1.00 27.30 ? 709 ARG B CG   1 
ATOM   4005 C  CD   . ARG B 1 266 ? 8.775   24.420  -6.279  1.00 27.45 ? 709 ARG B CD   1 
ATOM   4006 N  NE   . ARG B 1 266 ? 8.953   25.162  -5.025  1.00 28.14 ? 709 ARG B NE   1 
ATOM   4007 C  CZ   . ARG B 1 266 ? 9.964   24.987  -4.171  1.00 27.27 ? 709 ARG B CZ   1 
ATOM   4008 N  NH1  . ARG B 1 266 ? 10.908  24.089  -4.430  1.00 28.46 ? 709 ARG B NH1  1 
ATOM   4009 N  NH2  . ARG B 1 266 ? 10.029  25.708  -3.058  1.00 25.42 ? 709 ARG B NH2  1 
ATOM   4010 N  N    . ILE B 1 267 ? 6.999   20.441  -4.635  1.00 25.63 ? 710 ILE B N    1 
ATOM   4011 C  CA   . ILE B 1 267 ? 7.834   19.583  -3.792  1.00 24.98 ? 710 ILE B CA   1 
ATOM   4012 C  C    . ILE B 1 267 ? 8.381   18.494  -4.687  1.00 24.66 ? 710 ILE B C    1 
ATOM   4013 O  O    . ILE B 1 267 ? 9.569   18.440  -4.924  1.00 24.29 ? 710 ILE B O    1 
ATOM   4014 C  CB   . ILE B 1 267 ? 7.038   18.992  -2.596  1.00 25.09 ? 710 ILE B CB   1 
ATOM   4015 C  CG1  . ILE B 1 267 ? 6.632   20.110  -1.632  1.00 24.42 ? 710 ILE B CG1  1 
ATOM   4016 C  CG2  . ILE B 1 267 ? 7.869   17.944  -1.820  1.00 25.01 ? 710 ILE B CG2  1 
ATOM   4017 C  CD1  . ILE B 1 267 ? 5.604   19.686  -0.652  1.00 24.07 ? 710 ILE B CD1  1 
ATOM   4018 N  N    . LEU B 1 268 ? 7.507   17.660  -5.234  1.00 24.60 ? 711 LEU B N    1 
ATOM   4019 C  CA   . LEU B 1 268 ? 7.952   16.567  -6.090  1.00 24.61 ? 711 LEU B CA   1 
ATOM   4020 C  C    . LEU B 1 268 ? 8.877   17.085  -7.183  1.00 25.26 ? 711 LEU B C    1 
ATOM   4021 O  O    . LEU B 1 268 ? 10.002  16.610  -7.334  1.00 26.06 ? 711 LEU B O    1 
ATOM   4022 C  CB   . LEU B 1 268 ? 6.766   15.839  -6.700  1.00 24.46 ? 711 LEU B CB   1 
ATOM   4023 C  CG   . LEU B 1 268 ? 7.087   14.669  -7.618  1.00 23.52 ? 711 LEU B CG   1 
ATOM   4024 C  CD1  . LEU B 1 268 ? 7.982   13.716  -6.935  1.00 23.70 ? 711 LEU B CD1  1 
ATOM   4025 C  CD2  . LEU B 1 268 ? 5.799   13.980  -8.035  1.00 24.71 ? 711 LEU B CD2  1 
ATOM   4026 N  N    . ALA B 1 269 ? 8.431   18.081  -7.928  1.00 25.30 ? 712 ALA B N    1 
ATOM   4027 C  CA   . ALA B 1 269 ? 9.244   18.605  -9.003  1.00 25.50 ? 712 ALA B CA   1 
ATOM   4028 C  C    . ALA B 1 269 ? 10.721  18.760  -8.624  1.00 25.67 ? 712 ALA B C    1 
ATOM   4029 O  O    . ALA B 1 269 ? 11.582  18.394  -9.438  1.00 26.25 ? 712 ALA B O    1 
ATOM   4030 C  CB   . ALA B 1 269 ? 8.690   19.899  -9.489  1.00 26.00 ? 712 ALA B CB   1 
ATOM   4031 N  N    . GLU B 1 270 ? 11.025  19.283  -7.427  1.00 25.35 ? 713 GLU B N    1 
ATOM   4032 C  CA   . GLU B 1 270 ? 12.430  19.312  -6.949  1.00 25.56 ? 713 GLU B CA   1 
ATOM   4033 C  C    . GLU B 1 270 ? 12.944  17.906  -6.643  1.00 25.85 ? 713 GLU B C    1 
ATOM   4034 O  O    . GLU B 1 270 ? 13.939  17.475  -7.234  1.00 26.60 ? 713 GLU B O    1 
ATOM   4035 C  CB   . GLU B 1 270 ? 12.676  20.194  -5.703  1.00 25.20 ? 713 GLU B CB   1 
ATOM   4036 C  CG   . GLU B 1 270 ? 12.936  21.663  -5.990  1.00 25.49 ? 713 GLU B CG   1 
ATOM   4037 C  CD   . GLU B 1 270 ? 14.419  22.027  -6.114  1.00 26.70 ? 713 GLU B CD   1 
ATOM   4038 O  OE1  . GLU B 1 270 ? 14.966  22.592  -5.123  1.00 26.89 ? 713 GLU B OE1  1 
ATOM   4039 O  OE2  . GLU B 1 270 ? 15.031  21.791  -7.203  1.00 24.58 ? 713 GLU B OE2  1 
ATOM   4040 N  N    . ILE B 1 271 ? 12.302  17.188  -5.721  1.00 25.57 ? 714 ILE B N    1 
ATOM   4041 C  CA   . ILE B 1 271 ? 12.880  15.936  -5.257  1.00 25.33 ? 714 ILE B CA   1 
ATOM   4042 C  C    . ILE B 1 271 ? 13.374  15.177  -6.498  1.00 25.74 ? 714 ILE B C    1 
ATOM   4043 O  O    . ILE B 1 271 ? 14.568  14.975  -6.651  1.00 25.78 ? 714 ILE B O    1 
ATOM   4044 C  CB   . ILE B 1 271 ? 11.875  15.130  -4.422  1.00 25.12 ? 714 ILE B CB   1 
ATOM   4045 C  CG1  . ILE B 1 271 ? 11.645  15.790  -3.060  1.00 24.74 ? 714 ILE B CG1  1 
ATOM   4046 C  CG2  . ILE B 1 271 ? 12.395  13.760  -4.192  1.00 25.20 ? 714 ILE B CG2  1 
ATOM   4047 C  CD1  . ILE B 1 271 ? 10.396  15.265  -2.318  1.00 24.81 ? 714 ILE B CD1  1 
ATOM   4048 N  N    . GLU B 1 272 ? 12.441  14.828  -7.394  1.00 26.28 ? 715 GLU B N    1 
ATOM   4049 C  CA   . GLU B 1 272 ? 12.688  14.175  -8.715  1.00 26.62 ? 715 GLU B CA   1 
ATOM   4050 C  C    . GLU B 1 272 ? 13.896  14.661  -9.513  1.00 27.04 ? 715 GLU B C    1 
ATOM   4051 O  O    . GLU B 1 272 ? 14.449  13.891  -10.313 1.00 26.99 ? 715 GLU B O    1 
ATOM   4052 C  CB   . GLU B 1 272 ? 11.474  14.373  -9.643  1.00 26.38 ? 715 GLU B CB   1 
ATOM   4053 C  CG   . GLU B 1 272 ? 11.088  13.152  -10.442 1.00 26.18 ? 715 GLU B CG   1 
ATOM   4054 C  CD   . GLU B 1 272 ? 9.884   12.451  -9.842  1.00 26.85 ? 715 GLU B CD   1 
ATOM   4055 O  OE1  . GLU B 1 272 ? 8.835   12.304  -10.523 1.00 26.60 ? 715 GLU B OE1  1 
ATOM   4056 O  OE2  . GLU B 1 272 ? 9.982   12.044  -8.670  1.00 26.90 ? 715 GLU B OE2  1 
ATOM   4057 N  N    . GLU B 1 273 ? 14.216  15.953  -9.364  1.00 27.03 ? 716 GLU B N    1 
ATOM   4058 C  CA   . GLU B 1 273 ? 15.358  16.570  -10.015 1.00 27.00 ? 716 GLU B CA   1 
ATOM   4059 C  C    . GLU B 1 273 ? 16.627  16.112  -9.315  1.00 26.83 ? 716 GLU B C    1 
ATOM   4060 O  O    . GLU B 1 273 ? 17.519  15.655  -9.987  1.00 27.27 ? 716 GLU B O    1 
ATOM   4061 C  CB   . GLU B 1 273 ? 15.252  18.110  -10.047 1.00 27.13 ? 716 GLU B CB   1 
ATOM   4062 C  CG   . GLU B 1 273 ? 14.967  18.731  -11.424 1.00 28.13 ? 716 GLU B CG   1 
ATOM   4063 C  CD   . GLU B 1 273 ? 16.089  18.567  -12.478 1.00 29.68 ? 716 GLU B CD   1 
ATOM   4064 O  OE1  . GLU B 1 273 ? 16.024  17.580  -13.259 1.00 30.28 ? 716 GLU B OE1  1 
ATOM   4065 O  OE2  . GLU B 1 273 ? 17.016  19.433  -12.577 1.00 29.40 ? 716 GLU B OE2  1 
ATOM   4066 N  N    . LEU B 1 274 ? 16.710  16.212  -7.987  1.00 26.63 ? 717 LEU B N    1 
ATOM   4067 C  CA   . LEU B 1 274 ? 17.875  15.684  -7.238  1.00 26.71 ? 717 LEU B CA   1 
ATOM   4068 C  C    . LEU B 1 274 ? 18.307  14.264  -7.603  1.00 26.81 ? 717 LEU B C    1 
ATOM   4069 O  O    . LEU B 1 274 ? 19.489  13.995  -7.874  1.00 26.85 ? 717 LEU B O    1 
ATOM   4070 C  CB   . LEU B 1 274 ? 17.597  15.594  -5.750  1.00 26.55 ? 717 LEU B CB   1 
ATOM   4071 C  CG   . LEU B 1 274 ? 17.167  16.798  -4.971  1.00 26.67 ? 717 LEU B CG   1 
ATOM   4072 C  CD1  . LEU B 1 274 ? 17.529  16.544  -3.531  1.00 26.63 ? 717 LEU B CD1  1 
ATOM   4073 C  CD2  . LEU B 1 274 ? 17.840  17.984  -5.497  1.00 26.51 ? 717 LEU B CD2  1 
ATOM   4074 N  N    . ALA B 1 275 ? 17.341  13.356  -7.533  1.00 26.65 ? 718 ALA B N    1 
ATOM   4075 C  CA   . ALA B 1 275 ? 17.600  11.938  -7.654  1.00 26.59 ? 718 ALA B CA   1 
ATOM   4076 C  C    . ALA B 1 275 ? 18.114  11.656  -9.046  1.00 26.59 ? 718 ALA B C    1 
ATOM   4077 O  O    . ALA B 1 275 ? 18.970  10.796  -9.213  1.00 27.05 ? 718 ALA B O    1 
ATOM   4078 C  CB   . ALA B 1 275 ? 16.327  11.137  -7.358  1.00 26.81 ? 718 ALA B CB   1 
ATOM   4079 N  N    . ARG B 1 276 ? 17.616  12.402  -10.034 1.00 26.75 ? 719 ARG B N    1 
ATOM   4080 C  CA   . ARG B 1 276 ? 18.155  12.350  -11.408 1.00 27.15 ? 719 ARG B CA   1 
ATOM   4081 C  C    . ARG B 1 276 ? 19.152  13.508  -11.730 1.00 27.45 ? 719 ARG B C    1 
ATOM   4082 O  O    . ARG B 1 276 ? 19.705  13.576  -12.856 1.00 27.77 ? 719 ARG B O    1 
ATOM   4083 C  CB   . ARG B 1 276 ? 17.016  12.246  -12.444 1.00 26.94 ? 719 ARG B CB   1 
ATOM   4084 C  CG   . ARG B 1 276 ? 16.888  13.415  -13.390 1.00 26.99 ? 719 ARG B CG   1 
ATOM   4085 C  CD   . ARG B 1 276 ? 15.671  13.370  -14.298 1.00 27.38 ? 719 ARG B CD   1 
ATOM   4086 N  NE   . ARG B 1 276 ? 14.873  14.572  -14.074 1.00 27.49 ? 719 ARG B NE   1 
ATOM   4087 C  CZ   . ARG B 1 276 ? 13.630  14.599  -13.616 1.00 27.07 ? 719 ARG B CZ   1 
ATOM   4088 N  NH1  . ARG B 1 276 ? 12.959  13.477  -13.356 1.00 26.65 ? 719 ARG B NH1  1 
ATOM   4089 N  NH2  . ARG B 1 276 ? 13.045  15.775  -13.432 1.00 27.85 ? 719 ARG B NH2  1 
ATOM   4090 N  N    . GLU B 1 277 ? 19.375  14.387  -10.740 1.00 27.36 ? 720 GLU B N    1 
ATOM   4091 C  CA   . GLU B 1 277 ? 20.453  15.389  -10.760 1.00 27.30 ? 720 GLU B CA   1 
ATOM   4092 C  C    . GLU B 1 277 ? 21.683  14.721  -10.164 1.00 27.28 ? 720 GLU B C    1 
ATOM   4093 O  O    . GLU B 1 277 ? 22.535  14.224  -10.910 1.00 27.11 ? 720 GLU B O    1 
ATOM   4094 C  CB   . GLU B 1 277 ? 20.082  16.665  -9.973  1.00 27.29 ? 720 GLU B CB   1 
ATOM   4095 C  CG   . GLU B 1 277 ? 21.249  17.542  -9.507  1.00 27.14 ? 720 GLU B CG   1 
ATOM   4096 C  CD   . GLU B 1 277 ? 20.821  18.965  -9.194  1.00 27.37 ? 720 GLU B CD   1 
ATOM   4097 O  OE1  . GLU B 1 277 ? 20.824  19.352  -7.999  1.00 27.44 ? 720 GLU B OE1  1 
ATOM   4098 O  OE2  . GLU B 1 277 ? 20.471  19.697  -10.147 1.00 27.50 ? 720 GLU B OE2  1 
ATOM   4099 N  N    . LEU B 1 278 ? 21.763  14.703  -8.828  1.00 27.22 ? 721 LEU B N    1 
ATOM   4100 C  CA   . LEU B 1 278 ? 22.855  14.019  -8.127  1.00 27.36 ? 721 LEU B CA   1 
ATOM   4101 C  C    . LEU B 1 278 ? 22.571  12.499  -8.175  1.00 27.49 ? 721 LEU B C    1 
ATOM   4102 O  O    . LEU B 1 278 ? 21.581  11.971  -7.587  1.00 27.23 ? 721 LEU B O    1 
ATOM   4103 C  CB   . LEU B 1 278 ? 23.053  14.543  -6.684  1.00 27.36 ? 721 LEU B CB   1 
ATOM   4104 C  CG   . LEU B 1 278 ? 24.378  15.203  -6.222  1.00 26.89 ? 721 LEU B CG   1 
ATOM   4105 C  CD1  . LEU B 1 278 ? 25.283  15.772  -7.333  1.00 26.21 ? 721 LEU B CD1  1 
ATOM   4106 C  CD2  . LEU B 1 278 ? 24.039  16.313  -5.208  1.00 26.89 ? 721 LEU B CD2  1 
ATOM   4107 N  N    . SER B 1 279 ? 23.475  11.830  -8.893  1.00 27.11 ? 722 SER B N    1 
ATOM   4108 C  CA   . SER B 1 279 ? 23.270  10.485  -9.426  1.00 26.85 ? 722 SER B CA   1 
ATOM   4109 C  C    . SER B 1 279 ? 24.506  10.101  -10.232 1.00 26.65 ? 722 SER B C    1 
ATOM   4110 O  O    . SER B 1 279 ? 25.180  10.958  -10.818 1.00 26.11 ? 722 SER B O    1 
ATOM   4111 C  CB   . SER B 1 279 ? 22.018  10.411  -10.330 1.00 26.92 ? 722 SER B CB   1 
ATOM   4112 O  OG   . SER B 1 279 ? 22.234  9.600   -11.489 1.00 26.53 ? 722 SER B OG   1 
HETATM 4113 O  O24  . 324 C 2 .   ? -4.930  -2.656  -21.392 1.00 26.69 ? 2   324 A O24  1 
HETATM 4114 S  S22  . 324 C 2 .   ? -4.463  -3.437  -20.260 1.00 28.22 ? 2   324 A S22  1 
HETATM 4115 O  O23  . 324 C 2 .   ? -5.205  -4.660  -20.332 1.00 26.24 ? 2   324 A O23  1 
HETATM 4116 C  C25  . 324 C 2 .   ? -4.777  -2.714  -18.785 1.00 27.74 ? 2   324 A C25  1 
HETATM 4117 C  C26  . 324 C 2 .   ? -5.175  -3.690  -17.669 1.00 27.89 ? 2   324 A C26  1 
HETATM 4118 C  C27  . 324 C 2 .   ? -5.062  -3.016  -16.304 1.00 26.96 ? 2   324 A C27  1 
HETATM 4119 N  N21  . 324 C 2 .   ? -2.856  -3.597  -20.259 1.00 24.74 ? 2   324 A N21  1 
HETATM 4120 C  C17  . 324 C 2 .   ? -2.011  -2.560  -20.421 1.00 24.35 ? 2   324 A C17  1 
HETATM 4121 C  C18  . 324 C 2 .   ? -0.566  -2.831  -20.527 1.00 24.82 ? 2   324 A C18  1 
HETATM 4122 F  F20  . 324 C 2 .   ? 0.017   -4.026  -20.426 1.00 25.57 ? 2   324 A F20  1 
HETATM 4123 C  C16  . 324 C 2 .   ? -2.424  -1.230  -20.541 1.00 24.89 ? 2   324 A C16  1 
HETATM 4124 C  C15  . 324 C 2 .   ? -1.549  -0.161  -20.745 1.00 24.00 ? 2   324 A C15  1 
HETATM 4125 C  C14  . 324 C 2 .   ? -0.195  -0.364  -20.832 1.00 24.24 ? 2   324 A C14  1 
HETATM 4126 F  F19  . 324 C 2 .   ? 0.635   0.646   -21.017 1.00 25.48 ? 2   324 A F19  1 
HETATM 4127 C  C13  . 324 C 2 .   ? 0.328   -1.721  -20.733 1.00 24.85 ? 2   324 A C13  1 
HETATM 4128 C  C11  . 324 C 2 .   ? 1.742   -2.093  -20.798 1.00 26.04 ? 2   324 A C11  1 
HETATM 4129 O  O12  . 324 C 2 .   ? 2.098   -2.749  -21.765 1.00 29.91 ? 2   324 A O12  1 
HETATM 4130 C  C9   . 324 C 2 .   ? 2.532   -1.725  -19.605 1.00 25.02 ? 2   324 A C9   1 
HETATM 4131 C  C8   . 324 C 2 .   ? 2.043   -1.331  -18.343 1.00 24.90 ? 2   324 A C8   1 
HETATM 4132 C  C2   . 324 C 2 .   ? 4.020   -1.750  -19.544 1.00 24.78 ? 2   324 A C2   1 
HETATM 4133 C  C1   . 324 C 2 .   ? 5.087   -2.039  -20.377 1.00 24.30 ? 2   324 A C1   1 
HETATM 4134 C  C3   . 324 C 2 .   ? 4.255   -1.347  -18.193 1.00 24.44 ? 2   324 A C3   1 
HETATM 4135 N  N7   . 324 C 2 .   ? 3.094   -1.093  -17.503 1.00 24.68 ? 2   324 A N7   1 
HETATM 4136 N  N4   . 324 C 2 .   ? 5.502   -1.228  -17.724 1.00 24.13 ? 2   324 A N4   1 
HETATM 4137 C  C5   . 324 C 2 .   ? 6.544   -1.502  -18.504 1.00 24.11 ? 2   324 A C5   1 
HETATM 4138 C  C6   . 324 C 2 .   ? 6.388   -1.911  -19.826 1.00 24.15 ? 2   324 A C6   1 
HETATM 4139 CL CL10 . 324 C 2 .   ? 7.848   -2.216  -20.702 1.00 22.09 ? 2   324 A CL10 1 
HETATM 4140 O  O24  . 324 D 2 .   ? -7.336  2.310   4.154   0.60 24.76 ? 3   324 B O24  1 
HETATM 4141 S  S22  . 324 D 2 .   ? -7.085  2.775   5.485   0.60 25.03 ? 3   324 B S22  1 
HETATM 4142 O  O23  . 324 D 2 .   ? -6.849  4.192   5.478   0.60 26.13 ? 3   324 B O23  1 
HETATM 4143 C  C25  . 324 D 2 .   ? -8.366  2.378   6.456   0.60 24.30 ? 3   324 B C25  1 
HETATM 4144 C  C26  . 324 D 2 .   ? -8.956  3.582   7.148   0.60 24.12 ? 3   324 B C26  1 
HETATM 4145 C  C27  . 324 D 2 .   ? -9.892  4.270   6.206   0.60 23.63 ? 3   324 B C27  1 
HETATM 4146 N  N21  . 324 D 2 .   ? -5.765  2.073   6.061   0.60 25.50 ? 3   324 B N21  1 
HETATM 4147 C  C17  . 324 D 2 .   ? -5.696  0.733   6.263   0.60 25.77 ? 3   324 B C17  1 
HETATM 4148 C  C18  . 324 D 2 .   ? -4.465  0.153   6.862   0.60 26.47 ? 3   324 B C18  1 
HETATM 4149 F  F20  . 324 D 2 .   ? -3.381  0.882   7.214   0.60 27.30 ? 3   324 B F20  1 
HETATM 4150 C  C16  . 324 D 2 .   ? -6.755  -0.121  5.929   0.60 25.65 ? 3   324 B C16  1 
HETATM 4151 C  C15  . 324 D 2 .   ? -6.727  -1.494  6.119   0.60 26.19 ? 3   324 B C15  1 
HETATM 4152 C  C14  . 324 D 2 .   ? -5.624  -2.121  6.664   0.60 26.72 ? 3   324 B C14  1 
HETATM 4153 F  F19  . 324 D 2 .   ? -5.623  -3.456  6.832   0.60 27.84 ? 3   324 B F19  1 
HETATM 4154 C  C13  . 324 D 2 .   ? -4.458  -1.304  7.063   0.60 26.26 ? 3   324 B C13  1 
HETATM 4155 C  C11  . 324 D 2 .   ? -3.266  -1.951  7.639   0.60 25.52 ? 3   324 B C11  1 
HETATM 4156 O  O12  . 324 D 2 .   ? -3.001  -1.749  8.813   0.60 23.94 ? 3   324 B O12  1 
HETATM 4157 C  C9   . 324 D 2 .   ? -2.505  -2.806  6.685   0.60 25.32 ? 3   324 B C9   1 
HETATM 4158 C  C8   . 324 D 2 .   ? -2.684  -3.117  5.325   0.60 25.37 ? 3   324 B C8   1 
HETATM 4159 C  C2   . 324 D 2 .   ? -1.310  -3.531  7.129   0.60 25.96 ? 3   324 B C2   1 
HETATM 4160 C  C1   . 324 D 2 .   ? -0.661  -3.615  8.331   0.60 26.57 ? 3   324 B C1   1 
HETATM 4161 C  C3   . 324 D 2 .   ? -0.863  -4.237  5.959   0.60 25.86 ? 3   324 B C3   1 
HETATM 4162 N  N7   . 324 D 2 .   ? -1.696  -3.976  4.895   0.60 25.81 ? 3   324 B N7   1 
HETATM 4163 N  N4   . 324 D 2 .   ? 0.238   -5.021  6.011   0.60 25.82 ? 3   324 B N4   1 
HETATM 4164 C  C5   . 324 D 2 .   ? 0.892   -5.117  7.190   0.60 26.45 ? 3   324 B C5   1 
HETATM 4165 C  C6   . 324 D 2 .   ? 0.452   -4.431  8.346   0.60 26.73 ? 3   324 B C6   1 
HETATM 4166 CL CL10 . 324 D 2 .   ? 1.251   -4.521  9.840   0.60 29.14 ? 3   324 B CL10 1 
HETATM 4167 O  O    . HOH E 3 .   ? 17.338  -18.708 -18.095 1.00 22.41 ? 724 HOH A O    1 
HETATM 4168 O  O    . HOH E 3 .   ? -11.458 -5.378  -26.838 1.00 26.96 ? 725 HOH A O    1 
HETATM 4169 O  O    . HOH E 3 .   ? -19.815 5.875   -12.665 1.00 30.81 ? 726 HOH A O    1 
HETATM 4170 O  O    . HOH E 3 .   ? 5.265   -1.442  -6.142  1.00 20.00 ? 727 HOH A O    1 
HETATM 4171 O  O    . HOH E 3 .   ? 11.536  1.091   -16.056 1.00 26.94 ? 728 HOH A O    1 
HETATM 4172 O  O    . HOH E 3 .   ? 3.952   15.235  -15.443 1.00 23.96 ? 729 HOH A O    1 
HETATM 4173 O  O    . HOH E 3 .   ? -15.363 -30.128 -22.769 1.00 24.85 ? 730 HOH A O    1 
HETATM 4174 O  O    . HOH E 3 .   ? -1.109  13.729  -22.248 1.00 20.32 ? 731 HOH A O    1 
HETATM 4175 O  O    . HOH E 3 .   ? -7.430  -31.291 -11.841 1.00 20.00 ? 732 HOH A O    1 
HETATM 4176 O  O    . HOH E 3 .   ? 3.501   -30.556 0.664   1.00 20.00 ? 733 HOH A O    1 
HETATM 4177 O  O    . HOH E 3 .   ? -11.809 -21.373 -13.544 1.00 23.57 ? 734 HOH A O    1 
HETATM 4178 O  O    . HOH E 3 .   ? -12.181 2.048   -9.219  1.00 20.00 ? 735 HOH A O    1 
HETATM 4179 O  O    . HOH E 3 .   ? -16.143 -17.148 -26.935 1.00 27.64 ? 736 HOH A O    1 
HETATM 4180 O  O    . HOH E 3 .   ? -18.865 7.645   -14.086 1.00 23.12 ? 737 HOH A O    1 
HETATM 4181 O  O    . HOH E 3 .   ? -12.914 1.600   -29.219 1.00 24.14 ? 738 HOH A O    1 
HETATM 4182 O  O    . HOH E 3 .   ? 8.787   -5.602  -15.933 1.00 27.77 ? 739 HOH A O    1 
HETATM 4183 O  O    . HOH E 3 .   ? -3.236  -38.119 -31.132 1.00 20.00 ? 740 HOH A O    1 
HETATM 4184 O  O    . HOH E 3 .   ? 19.291  -10.356 -16.810 1.00 29.27 ? 741 HOH A O    1 
HETATM 4185 O  O    . HOH E 3 .   ? -0.668  -35.502 -27.957 1.00 23.20 ? 742 HOH A O    1 
HETATM 4186 O  O    . HOH E 3 .   ? -19.073 2.219   -19.038 1.00 21.77 ? 743 HOH A O    1 
HETATM 4187 O  O    . HOH E 3 .   ? 21.884  -15.598 -16.868 1.00 20.00 ? 744 HOH A O    1 
HETATM 4188 O  O    . HOH E 3 .   ? 5.065   5.895   -9.964  1.00 20.00 ? 745 HOH A O    1 
HETATM 4189 O  O    . HOH E 3 .   ? 7.102   -29.298 -26.734 1.00 20.00 ? 746 HOH A O    1 
HETATM 4190 O  O    . HOH E 3 .   ? -5.752  -20.830 -24.441 1.00 20.00 ? 747 HOH A O    1 
HETATM 4191 O  O    . HOH E 3 .   ? -5.179  -16.872 -22.391 1.00 20.00 ? 748 HOH A O    1 
HETATM 4192 O  O    . HOH E 3 .   ? -4.390  14.453  -11.327 1.00 21.21 ? 749 HOH A O    1 
HETATM 4193 O  O    . HOH E 3 .   ? -3.722  12.933  -21.341 1.00 23.98 ? 750 HOH A O    1 
HETATM 4194 O  O    . HOH E 3 .   ? 16.203  -21.043 -15.195 1.00 21.43 ? 751 HOH A O    1 
HETATM 4195 O  O    . HOH E 3 .   ? 0.997   -11.489 -4.039  1.00 23.94 ? 752 HOH A O    1 
HETATM 4196 O  O    . HOH E 3 .   ? 16.710  -17.850 -21.369 1.00 24.91 ? 753 HOH A O    1 
HETATM 4197 O  O    . HOH E 3 .   ? 1.056   -32.555 -23.444 1.00 22.02 ? 754 HOH A O    1 
HETATM 4198 O  O    . HOH E 3 .   ? 10.632  1.809   -29.550 1.00 25.39 ? 755 HOH A O    1 
HETATM 4199 O  O    . HOH E 3 .   ? 8.310   -20.542 -4.023  1.00 29.37 ? 756 HOH A O    1 
HETATM 4200 O  O    . HOH E 3 .   ? 13.479  0.170   -9.618  1.00 26.77 ? 757 HOH A O    1 
HETATM 4201 O  O    . HOH E 3 .   ? 10.638  8.147   -27.845 1.00 26.87 ? 758 HOH A O    1 
HETATM 4202 O  O    . HOH E 3 .   ? 16.072  -6.994  -19.665 1.00 20.00 ? 759 HOH A O    1 
HETATM 4203 O  O    . HOH E 3 .   ? -8.373  -17.984 -23.806 1.00 20.97 ? 760 HOH A O    1 
HETATM 4204 O  O    . HOH E 3 .   ? -12.417 -28.832 -25.679 1.00 20.00 ? 761 HOH A O    1 
HETATM 4205 O  O    . HOH E 3 .   ? -15.326 -11.664 -19.773 1.00 23.01 ? 762 HOH A O    1 
HETATM 4206 O  O    . HOH E 3 .   ? 11.772  -32.605 -32.533 1.00 20.00 ? 763 HOH A O    1 
HETATM 4207 O  O    . HOH E 3 .   ? 11.971  -5.649  -4.665  1.00 27.65 ? 764 HOH A O    1 
HETATM 4208 O  O    . HOH E 3 .   ? -17.170 -3.407  -23.145 1.00 31.40 ? 765 HOH A O    1 
HETATM 4209 O  O    . HOH E 3 .   ? 5.899   3.006   -11.195 1.00 29.64 ? 766 HOH A O    1 
HETATM 4210 O  O    . HOH E 3 .   ? 0.162   -25.261 -27.505 1.00 26.61 ? 767 HOH A O    1 
HETATM 4211 O  O    . HOH E 3 .   ? 8.382   9.145   -18.998 1.00 35.59 ? 768 HOH A O    1 
HETATM 4212 O  O    . HOH E 3 .   ? -19.423 7.755   -24.714 1.00 24.72 ? 769 HOH A O    1 
HETATM 4213 O  O    . HOH E 3 .   ? -15.896 12.787  -18.653 1.00 20.00 ? 770 HOH A O    1 
HETATM 4214 O  O    . HOH E 3 .   ? 2.134   15.295  -12.527 1.00 20.91 ? 771 HOH A O    1 
HETATM 4215 O  O    . HOH E 3 .   ? 0.608   -13.229 -36.711 1.00 21.31 ? 772 HOH A O    1 
HETATM 4216 O  O    . HOH E 3 .   ? 11.516  -27.068 -37.426 1.00 25.33 ? 773 HOH A O    1 
HETATM 4217 O  O    . HOH E 3 .   ? -16.910 -9.066  -14.504 1.00 24.46 ? 774 HOH A O    1 
HETATM 4218 O  O    . HOH E 3 .   ? 15.403  -27.815 -7.272  1.00 23.78 ? 775 HOH A O    1 
HETATM 4219 O  O    . HOH E 3 .   ? -14.892 6.917   -15.836 1.00 20.00 ? 776 HOH A O    1 
HETATM 4220 O  O    . HOH E 3 .   ? -0.191  -3.161  -8.828  1.00 28.31 ? 777 HOH A O    1 
HETATM 4221 O  O    . HOH E 3 .   ? 12.724  3.811   -18.004 1.00 26.14 ? 778 HOH A O    1 
HETATM 4222 O  O    . HOH E 3 .   ? -12.979 -23.194 -23.560 1.00 20.00 ? 779 HOH A O    1 
HETATM 4223 O  O    . HOH E 3 .   ? -18.429 -9.955  -11.383 1.00 28.45 ? 780 HOH A O    1 
HETATM 4224 O  O    . HOH E 3 .   ? -15.802 11.198  -30.339 1.00 21.23 ? 781 HOH A O    1 
HETATM 4225 O  O    . HOH E 3 .   ? -12.098 -28.017 -11.161 1.00 20.00 ? 782 HOH A O    1 
HETATM 4226 O  O    . HOH E 3 .   ? 15.488  -8.366  -16.011 1.00 25.30 ? 783 HOH A O    1 
HETATM 4227 O  O    . HOH E 3 .   ? 6.664   10.850  -27.827 1.00 24.55 ? 784 HOH A O    1 
HETATM 4228 O  O    . HOH E 3 .   ? -17.401 -26.842 -33.706 1.00 21.84 ? 785 HOH A O    1 
HETATM 4229 O  O    . HOH E 3 .   ? -5.801  -34.466 -22.782 1.00 20.90 ? 786 HOH A O    1 
HETATM 4230 O  O    . HOH E 3 .   ? -8.281  12.262  -36.111 1.00 20.00 ? 787 HOH A O    1 
HETATM 4231 O  O    . HOH E 3 .   ? -18.069 -18.479 -31.297 1.00 23.73 ? 788 HOH A O    1 
HETATM 4232 O  O    . HOH E 3 .   ? 14.712  -27.798 -28.419 1.00 20.00 ? 789 HOH A O    1 
HETATM 4233 O  O    . HOH E 3 .   ? 20.189  -9.766  -20.652 1.00 20.00 ? 790 HOH A O    1 
HETATM 4234 O  O    . HOH E 3 .   ? 7.424   -13.092 -28.596 1.00 22.16 ? 791 HOH A O    1 
HETATM 4235 O  O    . HOH E 3 .   ? 12.731  4.202   -14.708 1.00 24.38 ? 792 HOH A O    1 
HETATM 4236 O  O    . HOH E 3 .   ? -18.602 4.939   -9.709  1.00 24.04 ? 793 HOH A O    1 
HETATM 4237 O  O    . HOH E 3 .   ? 6.303   -5.157  -5.767  1.00 21.40 ? 794 HOH A O    1 
HETATM 4238 O  O    . HOH E 3 .   ? 15.250  -5.997  -21.953 1.00 25.89 ? 795 HOH A O    1 
HETATM 4239 O  O    . HOH E 3 .   ? 10.264  -24.802 -40.086 1.00 22.86 ? 796 HOH A O    1 
HETATM 4240 O  O    . HOH E 3 .   ? -14.547 5.232   -8.063  1.00 22.21 ? 797 HOH A O    1 
HETATM 4241 O  O    . HOH E 3 .   ? 0.220   -4.067  -23.757 1.00 25.21 ? 798 HOH A O    1 
HETATM 4242 O  O    . HOH E 3 .   ? 8.593   -18.050 -3.044  1.00 26.25 ? 799 HOH A O    1 
HETATM 4243 O  O    . HOH E 3 .   ? -4.777  -17.781 -1.607  1.00 22.65 ? 800 HOH A O    1 
HETATM 4244 O  O    . HOH E 3 .   ? -10.428 -31.273 -12.941 1.00 28.07 ? 801 HOH A O    1 
HETATM 4245 O  O    . HOH E 3 .   ? 6.241   13.270  -12.346 1.00 20.00 ? 802 HOH A O    1 
HETATM 4246 O  O    . HOH E 3 .   ? -8.756  -1.642  -25.449 1.00 25.36 ? 803 HOH A O    1 
HETATM 4247 O  O    . HOH E 3 .   ? -15.161 -22.753 -15.553 1.00 28.50 ? 804 HOH A O    1 
HETATM 4248 O  O    . HOH E 3 .   ? 15.845  -4.104  -17.701 1.00 25.62 ? 805 HOH A O    1 
HETATM 4249 O  O    . HOH E 3 .   ? 3.033   -17.728 1.995   1.00 25.86 ? 806 HOH A O    1 
HETATM 4250 O  O    . HOH E 3 .   ? 7.511   -36.997 -19.806 1.00 20.08 ? 807 HOH A O    1 
HETATM 4251 O  O    . HOH E 3 .   ? -7.348  -32.946 -39.501 1.00 23.11 ? 808 HOH A O    1 
HETATM 4252 O  O    . HOH E 3 .   ? -1.178  2.747   -32.260 1.00 26.04 ? 809 HOH A O    1 
HETATM 4253 O  O    . HOH E 3 .   ? 15.395  -31.610 -28.764 1.00 31.39 ? 810 HOH A O    1 
HETATM 4254 O  O    . HOH F 3 .   ? 2.428   -3.585  -5.291  1.00 27.57 ? 6   HOH B O    1 
HETATM 4255 O  O    . HOH F 3 .   ? -2.564  17.392  8.830   1.00 20.00 ? 71  HOH B O    1 
HETATM 4256 O  O    . HOH F 3 .   ? 7.182   -12.949 3.268   1.00 20.00 ? 72  HOH B O    1 
HETATM 4257 O  O    . HOH F 3 .   ? -11.052 8.318   -8.175  1.00 25.13 ? 73  HOH B O    1 
HETATM 4258 O  O    . HOH F 3 .   ? -7.572  28.880  11.265  1.00 21.33 ? 74  HOH B O    1 
HETATM 4259 O  O    . HOH F 3 .   ? -19.066 1.875   -2.773  1.00 28.33 ? 75  HOH B O    1 
HETATM 4260 O  O    . HOH F 3 .   ? 1.550   -11.476 -0.373  1.00 20.00 ? 76  HOH B O    1 
HETATM 4261 O  O    . HOH F 3 .   ? -0.666  -0.091  -4.341  1.00 20.00 ? 77  HOH B O    1 
HETATM 4262 O  O    . HOH F 3 .   ? 16.155  12.323  23.421  1.00 20.00 ? 78  HOH B O    1 
HETATM 4263 O  O    . HOH F 3 .   ? -0.882  20.289  -2.492  1.00 20.00 ? 79  HOH B O    1 
HETATM 4264 O  O    . HOH F 3 .   ? 6.568   19.413  14.442  1.00 20.00 ? 80  HOH B O    1 
HETATM 4265 O  O    . HOH F 3 .   ? -7.096  32.362  20.129  1.00 20.00 ? 81  HOH B O    1 
HETATM 4266 O  O    . HOH F 3 .   ? -20.353 -7.580  -4.718  1.00 20.00 ? 82  HOH B O    1 
HETATM 4267 O  O    . HOH F 3 .   ? 10.925  28.491  15.567  1.00 20.00 ? 83  HOH B O    1 
HETATM 4268 O  O    . HOH F 3 .   ? -13.625 -12.765 -4.924  1.00 20.00 ? 84  HOH B O    1 
HETATM 4269 O  O    . HOH F 3 .   ? 11.227  26.414  8.364   1.00 22.20 ? 85  HOH B O    1 
HETATM 4270 O  O    . HOH F 3 .   ? 2.668   30.905  27.312  1.00 23.38 ? 86  HOH B O    1 
HETATM 4271 O  O    . HOH F 3 .   ? 0.927   27.726  22.127  1.00 20.00 ? 87  HOH B O    1 
HETATM 4272 O  O    . HOH F 3 .   ? -0.960  16.947  -6.748  1.00 27.17 ? 88  HOH B O    1 
HETATM 4273 O  O    . HOH F 3 .   ? 14.228  0.840   -4.877  1.00 29.40 ? 89  HOH B O    1 
HETATM 4274 O  O    . HOH F 3 .   ? 27.285  12.702  -9.365  1.00 20.00 ? 90  HOH B O    1 
HETATM 4275 O  O    . HOH F 3 .   ? 19.006  24.931  -2.276  1.00 24.23 ? 91  HOH B O    1 
HETATM 4276 O  O    . HOH F 3 .   ? 26.154  2.496   4.904   1.00 22.05 ? 92  HOH B O    1 
HETATM 4277 O  O    . HOH F 3 .   ? -24.931 9.318   5.203   1.00 20.00 ? 93  HOH B O    1 
HETATM 4278 O  O    . HOH F 3 .   ? -3.774  29.833  4.061   1.00 23.54 ? 94  HOH B O    1 
HETATM 4279 O  O    . HOH F 3 .   ? -13.570 -18.078 3.162   1.00 21.67 ? 95  HOH B O    1 
HETATM 4280 O  O    . HOH F 3 .   ? 10.757  -5.417  11.614  1.00 28.75 ? 96  HOH B O    1 
HETATM 4281 O  O    . HOH F 3 .   ? 5.017   17.080  -9.466  1.00 24.93 ? 97  HOH B O    1 
HETATM 4282 O  O    . HOH F 3 .   ? 2.606   8.038   15.659  1.00 20.00 ? 98  HOH B O    1 
HETATM 4283 O  O    . HOH F 3 .   ? 8.846   33.719  3.641   1.00 20.00 ? 99  HOH B O    1 
HETATM 4284 O  O    . HOH F 3 .   ? 1.238   18.089  10.209  1.00 20.00 ? 100 HOH B O    1 
HETATM 4285 O  O    . HOH F 3 .   ? 14.309  18.851  16.792  1.00 20.00 ? 101 HOH B O    1 
HETATM 4286 O  O    . HOH F 3 .   ? 16.997  8.500   -9.012  1.00 20.00 ? 102 HOH B O    1 
HETATM 4287 O  O    . HOH F 3 .   ? -6.218  9.606   5.111   1.00 28.08 ? 103 HOH B O    1 
HETATM 4288 O  O    . HOH F 3 .   ? 14.342  -4.366  10.633  1.00 20.00 ? 104 HOH B O    1 
HETATM 4289 O  O    . HOH F 3 .   ? -15.199 -6.457  -5.033  1.00 24.28 ? 105 HOH B O    1 
HETATM 4290 O  O    . HOH F 3 .   ? -22.959 -13.973 1.955   1.00 22.26 ? 106 HOH B O    1 
HETATM 4291 O  O    . HOH F 3 .   ? -17.082 -13.956 -6.146  1.00 20.00 ? 107 HOH B O    1 
HETATM 4292 O  O    . HOH F 3 .   ? 17.732  6.022   11.164  1.00 26.67 ? 108 HOH B O    1 
HETATM 4293 O  O    . HOH F 3 .   ? 19.608  2.642   -8.477  1.00 20.00 ? 109 HOH B O    1 
HETATM 4294 O  O    . HOH F 3 .   ? 7.369   7.349   18.832  1.00 20.00 ? 110 HOH B O    1 
HETATM 4295 O  O    . HOH F 3 .   ? 15.337  18.623  19.963  1.00 22.03 ? 111 HOH B O    1 
HETATM 4296 O  O    . HOH F 3 .   ? 8.498   32.617  22.960  1.00 25.91 ? 112 HOH B O    1 
HETATM 4297 O  O    . HOH F 3 .   ? 1.690   9.895   19.450  1.00 22.92 ? 113 HOH B O    1 
HETATM 4298 O  O    . HOH F 3 .   ? 12.414  -9.150  -2.893  1.00 25.34 ? 114 HOH B O    1 
HETATM 4299 O  O    . HOH F 3 .   ? 13.939  10.202  17.892  1.00 26.80 ? 115 HOH B O    1 
HETATM 4300 O  O    . HOH F 3 .   ? 24.804  13.153  -12.272 1.00 20.96 ? 116 HOH B O    1 
HETATM 4301 O  O    . HOH F 3 .   ? 9.309   -10.037 -0.763  1.00 24.56 ? 117 HOH B O    1 
HETATM 4302 O  O    . HOH F 3 .   ? 12.594  21.539  27.941  1.00 20.76 ? 118 HOH B O    1 
HETATM 4303 O  O    . HOH F 3 .   ? 6.998   4.857   -7.697  1.00 22.79 ? 119 HOH B O    1 
HETATM 4304 O  O    . HOH F 3 .   ? -1.067  -0.476  14.355  1.00 20.00 ? 120 HOH B O    1 
HETATM 4305 O  O    . HOH F 3 .   ? 17.801  8.614   -5.211  1.00 20.00 ? 121 HOH B O    1 
HETATM 4306 O  O    . HOH F 3 .   ? 1.970   6.732   -10.423 1.00 22.29 ? 123 HOH B O    1 
HETATM 4307 O  O    . HOH F 3 .   ? 18.726  20.323  19.352  1.00 23.02 ? 125 HOH B O    1 
HETATM 4308 O  O    . HOH F 3 .   ? 12.006  13.254  19.979  1.00 24.66 ? 134 HOH B O    1 
HETATM 4309 O  O    . HOH F 3 .   ? 20.609  -7.340  10.344  1.00 24.56 ? 135 HOH B O    1 
HETATM 4310 O  O    . HOH F 3 .   ? 2.580   11.840  22.744  1.00 20.00 ? 136 HOH B O    1 
HETATM 4311 O  O    . HOH F 3 .   ? -11.985 13.671  -0.488  1.00 26.14 ? 139 HOH B O    1 
HETATM 4312 O  O    . HOH F 3 .   ? -12.804 -10.389 14.311  1.00 25.71 ? 140 HOH B O    1 
HETATM 4313 O  O    . HOH F 3 .   ? -11.368 21.090  14.303  1.00 26.28 ? 142 HOH B O    1 
HETATM 4314 O  O    . HOH F 3 .   ? 13.205  9.978   -13.196 1.00 27.67 ? 143 HOH B O    1 
HETATM 4315 O  O    . HOH F 3 .   ? 14.561  -3.245  -6.297  1.00 20.21 ? 145 HOH B O    1 
HETATM 4316 O  O    . HOH F 3 .   ? -10.451 -16.923 -2.065  1.00 20.00 ? 146 HOH B O    1 
HETATM 4317 O  O    . HOH F 3 .   ? -6.739  -14.588 16.360  1.00 22.22 ? 147 HOH B O    1 
HETATM 4318 O  O    . HOH F 3 .   ? 26.504  19.623  2.518   1.00 21.61 ? 149 HOH B O    1 
HETATM 4319 O  O    . HOH F 3 .   ? -9.060  7.977   8.487   1.00 25.04 ? 151 HOH B O    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ARG 1   444 ?   ?   ?   A . n 
A 1 2   ASP 2   445 ?   ?   ?   A . n 
A 1 3   SER 3   446 ?   ?   ?   A . n 
A 1 4   SER 4   447 ?   ?   ?   A . n 
A 1 5   ASP 5   448 448 ASP ASP A . n 
A 1 6   ASP 6   449 449 ASP ASP A . n 
A 1 7   TRP 7   450 450 TRP TRP A . n 
A 1 8   GLU 8   451 451 GLU GLU A . n 
A 1 9   ILE 9   452 452 ILE ILE A . n 
A 1 10  PRO 10  453 453 PRO PRO A . n 
A 1 11  ASP 11  454 454 ASP ASP A . n 
A 1 12  GLY 12  455 455 GLY GLY A . n 
A 1 13  GLN 13  456 456 GLN GLN A . n 
A 1 14  ILE 14  457 457 ILE ILE A . n 
A 1 15  THR 15  458 458 THR THR A . n 
A 1 16  VAL 16  459 459 VAL VAL A . n 
A 1 17  GLY 17  460 460 GLY GLY A . n 
A 1 18  GLN 18  461 461 GLN GLN A . n 
A 1 19  ARG 19  462 462 ARG ARG A . n 
A 1 20  ILE 20  463 463 ILE ILE A . n 
A 1 21  GLY 21  464 464 GLY GLY A . n 
A 1 22  SER 22  465 465 SER SER A . n 
A 1 23  GLY 23  466 466 GLY GLY A . n 
A 1 24  SER 24  467 467 SER SER A . n 
A 1 25  PHE 25  468 468 PHE PHE A . n 
A 1 26  GLY 26  469 469 GLY GLY A . n 
A 1 27  THR 27  470 470 THR THR A . n 
A 1 28  VAL 28  471 471 VAL VAL A . n 
A 1 29  TYR 29  472 472 TYR TYR A . n 
A 1 30  LYS 30  473 473 LYS LYS A . n 
A 1 31  GLY 31  474 474 GLY GLY A . n 
A 1 32  LYS 32  475 475 LYS LYS A . n 
A 1 33  TRP 33  476 476 TRP TRP A . n 
A 1 34  HIS 34  477 477 HIS HIS A . n 
A 1 35  GLY 35  478 478 GLY GLY A . n 
A 1 36  ASP 36  479 479 ASP ASP A . n 
A 1 37  VAL 37  480 480 VAL VAL A . n 
A 1 38  ALA 38  481 481 ALA ALA A . n 
A 1 39  VAL 39  482 482 VAL VAL A . n 
A 1 40  LYS 40  483 483 LYS LYS A . n 
A 1 41  MET 41  484 484 MET MET A . n 
A 1 42  LEU 42  485 485 LEU LEU A . n 
A 1 43  ASN 43  486 486 ASN ASN A . n 
A 1 44  VAL 44  487 487 VAL VAL A . n 
A 1 45  THR 45  488 488 THR THR A . n 
A 1 46  ALA 46  489 489 ALA ALA A . n 
A 1 47  PRO 47  490 490 PRO PRO A . n 
A 1 48  THR 48  491 491 THR THR A . n 
A 1 49  PRO 49  492 492 PRO PRO A . n 
A 1 50  GLN 50  493 493 GLN GLN A . n 
A 1 51  GLN 51  494 494 GLN GLN A . n 
A 1 52  LEU 52  495 495 LEU LEU A . n 
A 1 53  GLN 53  496 496 GLN GLN A . n 
A 1 54  ALA 54  497 497 ALA ALA A . n 
A 1 55  PHE 55  498 498 PHE PHE A . n 
A 1 56  LYS 56  499 499 LYS LYS A . n 
A 1 57  ASN 57  500 500 ASN ASN A . n 
A 1 58  GLU 58  501 501 GLU GLU A . n 
A 1 59  VAL 59  502 502 VAL VAL A . n 
A 1 60  GLY 60  503 503 GLY GLY A . n 
A 1 61  VAL 61  504 504 VAL VAL A . n 
A 1 62  LEU 62  505 505 LEU LEU A . n 
A 1 63  ARG 63  506 506 ARG ARG A . n 
A 1 64  LYS 64  507 507 LYS LYS A . n 
A 1 65  THR 65  508 508 THR THR A . n 
A 1 66  ARG 66  509 509 ARG ARG A . n 
A 1 67  HIS 67  510 510 HIS HIS A . n 
A 1 68  VAL 68  511 511 VAL VAL A . n 
A 1 69  ASN 69  512 512 ASN ASN A . n 
A 1 70  ILE 70  513 513 ILE ILE A . n 
A 1 71  LEU 71  514 514 LEU LEU A . n 
A 1 72  LEU 72  515 515 LEU LEU A . n 
A 1 73  PHE 73  516 516 PHE PHE A . n 
A 1 74  MET 74  517 517 MET MET A . n 
A 1 75  GLY 75  518 518 GLY GLY A . n 
A 1 76  TYR 76  519 519 TYR TYR A . n 
A 1 77  SER 77  520 520 SER SER A . n 
A 1 78  THR 78  521 521 THR THR A . n 
A 1 79  LYS 79  522 522 LYS ALA A . n 
A 1 80  PRO 80  523 523 PRO PRO A . n 
A 1 81  GLN 81  524 524 GLN GLN A . n 
A 1 82  LEU 82  525 525 LEU LEU A . n 
A 1 83  ALA 83  526 526 ALA ALA A . n 
A 1 84  ILE 84  527 527 ILE ILE A . n 
A 1 85  VAL 85  528 528 VAL VAL A . n 
A 1 86  THR 86  529 529 THR THR A . n 
A 1 87  GLN 87  530 530 GLN GLN A . n 
A 1 88  TRP 88  531 531 TRP TRP A . n 
A 1 89  CYS 89  532 532 CYS CYS A . n 
A 1 90  GLU 90  533 533 GLU GLU A . n 
A 1 91  GLY 91  534 534 GLY GLY A . n 
A 1 92  SER 92  535 535 SER SER A . n 
A 1 93  SER 93  536 536 SER SER A . n 
A 1 94  LEU 94  537 537 LEU LEU A . n 
A 1 95  TYR 95  538 538 TYR TYR A . n 
A 1 96  HIS 96  539 539 HIS HIS A . n 
A 1 97  HIS 97  540 540 HIS HIS A . n 
A 1 98  LEU 98  541 541 LEU LEU A . n 
A 1 99  HIS 99  542 542 HIS HIS A . n 
A 1 100 ALA 100 543 543 ALA ALA A . n 
A 1 101 SER 101 544 544 SER SER A . n 
A 1 102 GLU 102 545 545 GLU GLU A . n 
A 1 103 THR 103 546 546 THR THR A . n 
A 1 104 LYS 104 547 547 LYS LYS A . n 
A 1 105 PHE 105 548 548 PHE PHE A . n 
A 1 106 GLU 106 549 549 GLU GLU A . n 
A 1 107 MET 107 550 550 MET MET A . n 
A 1 108 LYS 108 551 551 LYS LYS A . n 
A 1 109 LYS 109 552 552 LYS LYS A . n 
A 1 110 LEU 110 553 553 LEU LEU A . n 
A 1 111 ILE 111 554 554 ILE ILE A . n 
A 1 112 ASP 112 555 555 ASP ASP A . n 
A 1 113 ILE 113 556 556 ILE ILE A . n 
A 1 114 ALA 114 557 557 ALA ALA A . n 
A 1 115 ARG 115 558 558 ARG ARG A . n 
A 1 116 GLN 116 559 559 GLN GLN A . n 
A 1 117 THR 117 560 560 THR THR A . n 
A 1 118 ALA 118 561 561 ALA ALA A . n 
A 1 119 ARG 119 562 562 ARG ARG A . n 
A 1 120 GLY 120 563 563 GLY GLY A . n 
A 1 121 MET 121 564 564 MET MET A . n 
A 1 122 ASP 122 565 565 ASP ASP A . n 
A 1 123 TYR 123 566 566 TYR TYR A . n 
A 1 124 LEU 124 567 567 LEU LEU A . n 
A 1 125 HIS 125 568 568 HIS HIS A . n 
A 1 126 ALA 126 569 569 ALA ALA A . n 
A 1 127 LYS 127 570 570 LYS LYS A . n 
A 1 128 SER 128 571 571 SER SER A . n 
A 1 129 ILE 129 572 572 ILE ILE A . n 
A 1 130 ILE 130 573 573 ILE ILE A . n 
A 1 131 HIS 131 574 574 HIS HIS A . n 
A 1 132 ARG 132 575 575 ARG ARG A . n 
A 1 133 ASP 133 576 576 ASP ASP A . n 
A 1 134 LEU 134 577 577 LEU LEU A . n 
A 1 135 LYS 135 578 578 LYS LYS A . n 
A 1 136 SER 136 579 579 SER SER A . n 
A 1 137 ASN 137 580 580 ASN ASN A . n 
A 1 138 ASN 138 581 581 ASN ASN A . n 
A 1 139 ILE 139 582 582 ILE ILE A . n 
A 1 140 PHE 140 583 583 PHE PHE A . n 
A 1 141 LEU 141 584 584 LEU LEU A . n 
A 1 142 HIS 142 585 585 HIS HIS A . n 
A 1 143 GLU 143 586 586 GLU GLU A . n 
A 1 144 ASP 144 587 587 ASP ASP A . n 
A 1 145 ASN 145 588 588 ASN ASN A . n 
A 1 146 THR 146 589 589 THR THR A . n 
A 1 147 VAL 147 590 590 VAL VAL A . n 
A 1 148 LYS 148 591 591 LYS LYS A . n 
A 1 149 ILE 149 592 592 ILE ILE A . n 
A 1 150 GLY 150 593 593 GLY GLY A . n 
A 1 151 ASP 151 594 594 ASP ASP A . n 
A 1 152 PHE 152 595 595 PHE PHE A . n 
A 1 153 GLY 153 596 596 GLY GLY A . n 
A 1 154 LEU 154 597 ?   ?   ?   A . n 
A 1 155 ALA 155 598 ?   ?   ?   A . n 
A 1 156 THR 156 599 ?   ?   ?   A . n 
A 1 157 VAL 157 600 ?   ?   ?   A . n 
A 1 158 LYS 158 601 ?   ?   ?   A . n 
A 1 159 SER 159 602 ?   ?   ?   A . n 
A 1 160 ARG 160 603 ?   ?   ?   A . n 
A 1 161 TRP 161 604 ?   ?   ?   A . n 
A 1 162 SER 162 605 ?   ?   ?   A . n 
A 1 163 GLY 163 606 ?   ?   ?   A . n 
A 1 164 SER 164 607 ?   ?   ?   A . n 
A 1 165 HIS 165 608 ?   ?   ?   A . n 
A 1 166 GLN 166 609 ?   ?   ?   A . n 
A 1 167 PHE 167 610 ?   ?   ?   A . n 
A 1 168 GLU 168 611 ?   ?   ?   A . n 
A 1 169 GLN 169 612 ?   ?   ?   A . n 
A 1 170 LEU 170 613 ?   ?   ?   A . n 
A 1 171 SER 171 614 614 SER SER A . n 
A 1 172 GLY 172 615 615 GLY GLY A . n 
A 1 173 SER 173 616 616 SER SER A . n 
A 1 174 ILE 174 617 617 ILE ILE A . n 
A 1 175 LEU 175 618 618 LEU LEU A . n 
A 1 176 TRP 176 619 619 TRP TRP A . n 
A 1 177 MET 177 620 620 MET MET A . n 
A 1 178 ALA 178 621 621 ALA ALA A . n 
A 1 179 PRO 179 622 622 PRO PRO A . n 
A 1 180 GLU 180 623 623 GLU GLU A . n 
A 1 181 VAL 181 624 624 VAL VAL A . n 
A 1 182 ILE 182 625 625 ILE ILE A . n 
A 1 183 ARG 183 626 626 ARG ARG A . n 
A 1 184 MET 184 627 627 MET MET A . n 
A 1 185 GLN 185 628 628 GLN GLN A . n 
A 1 186 ASP 186 629 629 ASP ASP A . n 
A 1 187 SER 187 630 630 SER SER A . n 
A 1 188 ASN 188 631 631 ASN ASN A . n 
A 1 189 PRO 189 632 632 PRO PRO A . n 
A 1 190 TYR 190 633 633 TYR TYR A . n 
A 1 191 SER 191 634 634 SER SER A . n 
A 1 192 PHE 192 635 635 PHE PHE A . n 
A 1 193 GLN 193 636 636 GLN GLN A . n 
A 1 194 SER 194 637 637 SER SER A . n 
A 1 195 ASP 195 638 638 ASP ASP A . n 
A 1 196 VAL 196 639 639 VAL VAL A . n 
A 1 197 TYR 197 640 640 TYR TYR A . n 
A 1 198 ALA 198 641 641 ALA ALA A . n 
A 1 199 PHE 199 642 642 PHE PHE A . n 
A 1 200 GLY 200 643 643 GLY GLY A . n 
A 1 201 ILE 201 644 644 ILE ILE A . n 
A 1 202 VAL 202 645 645 VAL VAL A . n 
A 1 203 LEU 203 646 646 LEU LEU A . n 
A 1 204 TYR 204 647 647 TYR TYR A . n 
A 1 205 GLU 205 648 648 GLU GLU A . n 
A 1 206 LEU 206 649 649 LEU LEU A . n 
A 1 207 MET 207 650 650 MET MET A . n 
A 1 208 THR 208 651 651 THR THR A . n 
A 1 209 GLY 209 652 652 GLY GLY A . n 
A 1 210 GLN 210 653 653 GLN GLN A . n 
A 1 211 LEU 211 654 654 LEU LEU A . n 
A 1 212 PRO 212 655 655 PRO PRO A . n 
A 1 213 TYR 213 656 656 TYR TYR A . n 
A 1 214 SER 214 657 657 SER SER A . n 
A 1 215 ASN 215 658 658 ASN ASN A . n 
A 1 216 ILE 216 659 659 ILE ILE A . n 
A 1 217 ASN 217 660 660 ASN ASN A . n 
A 1 218 ASN 218 661 661 ASN ASN A . n 
A 1 219 ARG 219 662 662 ARG ARG A . n 
A 1 220 ASP 220 663 663 ASP ASP A . n 
A 1 221 GLN 221 664 664 GLN GLN A . n 
A 1 222 ILE 222 665 665 ILE ILE A . n 
A 1 223 ILE 223 666 666 ILE ILE A . n 
A 1 224 GLU 224 667 667 GLU GLU A . n 
A 1 225 MET 225 668 668 MET MET A . n 
A 1 226 VAL 226 669 669 VAL VAL A . n 
A 1 227 GLY 227 670 670 GLY GLY A . n 
A 1 228 ARG 228 671 671 ARG ARG A . n 
A 1 229 GLY 229 672 672 GLY GLY A . n 
A 1 230 SER 230 673 673 SER SER A . n 
A 1 231 LEU 231 674 674 LEU LEU A . n 
A 1 232 SER 232 675 675 SER SER A . n 
A 1 233 PRO 233 676 676 PRO PRO A . n 
A 1 234 ASP 234 677 677 ASP ASP A . n 
A 1 235 LEU 235 678 678 LEU LEU A . n 
A 1 236 SER 236 679 679 SER SER A . n 
A 1 237 LYS 237 680 680 LYS LYS A . n 
A 1 238 VAL 238 681 681 VAL VAL A . n 
A 1 239 ARG 239 682 682 ARG ARG A . n 
A 1 240 SER 240 683 683 SER SER A . n 
A 1 241 ASN 241 684 684 ASN ASN A . n 
A 1 242 CYS 242 685 685 CYS CYS A . n 
A 1 243 PRO 243 686 686 PRO PRO A . n 
A 1 244 LYS 244 687 687 LYS LYS A . n 
A 1 245 ARG 245 688 688 ARG ARG A . n 
A 1 246 MET 246 689 689 MET MET A . n 
A 1 247 LYS 247 690 690 LYS LYS A . n 
A 1 248 ARG 248 691 691 ARG ARG A . n 
A 1 249 LEU 249 692 692 LEU LEU A . n 
A 1 250 MET 250 693 693 MET MET A . n 
A 1 251 ALA 251 694 694 ALA ALA A . n 
A 1 252 GLU 252 695 695 GLU GLU A . n 
A 1 253 CYS 253 696 696 CYS CYS A . n 
A 1 254 LEU 254 697 697 LEU LEU A . n 
A 1 255 LYS 255 698 698 LYS LYS A . n 
A 1 256 LYS 256 699 699 LYS LYS A . n 
A 1 257 LYS 257 700 700 LYS LYS A . n 
A 1 258 ARG 258 701 701 ARG ARG A . n 
A 1 259 ASP 259 702 702 ASP ASP A . n 
A 1 260 GLU 260 703 703 GLU GLU A . n 
A 1 261 ARG 261 704 704 ARG ARG A . n 
A 1 262 PRO 262 705 705 PRO PRO A . n 
A 1 263 SER 263 706 706 SER SER A . n 
A 1 264 PHE 264 707 707 PHE PHE A . n 
A 1 265 PRO 265 708 708 PRO PRO A . n 
A 1 266 ARG 266 709 709 ARG ARG A . n 
A 1 267 ILE 267 710 710 ILE ILE A . n 
A 1 268 LEU 268 711 711 LEU LEU A . n 
A 1 269 ALA 269 712 712 ALA ALA A . n 
A 1 270 GLU 270 713 713 GLU GLU A . n 
A 1 271 ILE 271 714 714 ILE ILE A . n 
A 1 272 GLU 272 715 715 GLU GLU A . n 
A 1 273 GLU 273 716 716 GLU GLU A . n 
A 1 274 LEU 274 717 717 LEU LEU A . n 
A 1 275 ALA 275 718 718 ALA ALA A . n 
A 1 276 ARG 276 719 719 ARG ARG A . n 
A 1 277 GLU 277 720 720 GLU GLU A . n 
A 1 278 LEU 278 721 721 LEU LEU A . n 
A 1 279 SER 279 722 722 SER SER A . n 
A 1 280 GLY 280 723 ?   ?   ?   A . n 
B 1 1   ARG 1   444 ?   ?   ?   B . n 
B 1 2   ASP 2   445 ?   ?   ?   B . n 
B 1 3   SER 3   446 ?   ?   ?   B . n 
B 1 4   SER 4   447 ?   ?   ?   B . n 
B 1 5   ASP 5   448 448 ASP ASP B . n 
B 1 6   ASP 6   449 449 ASP ASP B . n 
B 1 7   TRP 7   450 450 TRP TRP B . n 
B 1 8   GLU 8   451 451 GLU GLU B . n 
B 1 9   ILE 9   452 452 ILE ILE B . n 
B 1 10  PRO 10  453 453 PRO PRO B . n 
B 1 11  ASP 11  454 454 ASP ASP B . n 
B 1 12  GLY 12  455 455 GLY GLY B . n 
B 1 13  GLN 13  456 456 GLN GLN B . n 
B 1 14  ILE 14  457 457 ILE ILE B . n 
B 1 15  THR 15  458 458 THR THR B . n 
B 1 16  VAL 16  459 459 VAL VAL B . n 
B 1 17  GLY 17  460 460 GLY GLY B . n 
B 1 18  GLN 18  461 461 GLN GLN B . n 
B 1 19  ARG 19  462 462 ARG ARG B . n 
B 1 20  ILE 20  463 463 ILE ILE B . n 
B 1 21  GLY 21  464 464 GLY GLY B . n 
B 1 22  SER 22  465 465 SER SER B . n 
B 1 23  GLY 23  466 466 GLY GLY B . n 
B 1 24  SER 24  467 467 SER SER B . n 
B 1 25  PHE 25  468 468 PHE PHE B . n 
B 1 26  GLY 26  469 469 GLY GLY B . n 
B 1 27  THR 27  470 470 THR THR B . n 
B 1 28  VAL 28  471 471 VAL VAL B . n 
B 1 29  TYR 29  472 472 TYR TYR B . n 
B 1 30  LYS 30  473 473 LYS LYS B . n 
B 1 31  GLY 31  474 474 GLY GLY B . n 
B 1 32  LYS 32  475 475 LYS LYS B . n 
B 1 33  TRP 33  476 476 TRP TRP B . n 
B 1 34  HIS 34  477 477 HIS HIS B . n 
B 1 35  GLY 35  478 478 GLY GLY B . n 
B 1 36  ASP 36  479 479 ASP ASP B . n 
B 1 37  VAL 37  480 480 VAL VAL B . n 
B 1 38  ALA 38  481 481 ALA ALA B . n 
B 1 39  VAL 39  482 482 VAL VAL B . n 
B 1 40  LYS 40  483 483 LYS LYS B . n 
B 1 41  MET 41  484 484 MET MET B . n 
B 1 42  LEU 42  485 485 LEU LEU B . n 
B 1 43  ASN 43  486 486 ASN ASN B . n 
B 1 44  VAL 44  487 487 VAL VAL B . n 
B 1 45  THR 45  488 488 THR THR B . n 
B 1 46  ALA 46  489 489 ALA ALA B . n 
B 1 47  PRO 47  490 490 PRO PRO B . n 
B 1 48  THR 48  491 491 THR THR B . n 
B 1 49  PRO 49  492 492 PRO PRO B . n 
B 1 50  GLN 50  493 493 GLN GLN B . n 
B 1 51  GLN 51  494 494 GLN GLN B . n 
B 1 52  LEU 52  495 495 LEU LEU B . n 
B 1 53  GLN 53  496 496 GLN GLN B . n 
B 1 54  ALA 54  497 497 ALA ALA B . n 
B 1 55  PHE 55  498 498 PHE PHE B . n 
B 1 56  LYS 56  499 499 LYS LYS B . n 
B 1 57  ASN 57  500 500 ASN ASN B . n 
B 1 58  GLU 58  501 501 GLU GLU B . n 
B 1 59  VAL 59  502 502 VAL VAL B . n 
B 1 60  GLY 60  503 503 GLY GLY B . n 
B 1 61  VAL 61  504 504 VAL VAL B . n 
B 1 62  LEU 62  505 505 LEU LEU B . n 
B 1 63  ARG 63  506 506 ARG ARG B . n 
B 1 64  LYS 64  507 507 LYS LYS B . n 
B 1 65  THR 65  508 508 THR THR B . n 
B 1 66  ARG 66  509 509 ARG ARG B . n 
B 1 67  HIS 67  510 510 HIS HIS B . n 
B 1 68  VAL 68  511 511 VAL VAL B . n 
B 1 69  ASN 69  512 512 ASN ASN B . n 
B 1 70  ILE 70  513 513 ILE ILE B . n 
B 1 71  LEU 71  514 514 LEU LEU B . n 
B 1 72  LEU 72  515 515 LEU LEU B . n 
B 1 73  PHE 73  516 516 PHE PHE B . n 
B 1 74  MET 74  517 517 MET MET B . n 
B 1 75  GLY 75  518 518 GLY GLY B . n 
B 1 76  TYR 76  519 519 TYR TYR B . n 
B 1 77  SER 77  520 520 SER SER B . n 
B 1 78  THR 78  521 521 THR THR B . n 
B 1 79  LYS 79  522 522 LYS ALA B . n 
B 1 80  PRO 80  523 523 PRO PRO B . n 
B 1 81  GLN 81  524 524 GLN GLN B . n 
B 1 82  LEU 82  525 525 LEU LEU B . n 
B 1 83  ALA 83  526 526 ALA ALA B . n 
B 1 84  ILE 84  527 527 ILE ILE B . n 
B 1 85  VAL 85  528 528 VAL VAL B . n 
B 1 86  THR 86  529 529 THR THR B . n 
B 1 87  GLN 87  530 530 GLN GLN B . n 
B 1 88  TRP 88  531 531 TRP TRP B . n 
B 1 89  CYS 89  532 532 CYS CYS B . n 
B 1 90  GLU 90  533 533 GLU GLU B . n 
B 1 91  GLY 91  534 534 GLY GLY B . n 
B 1 92  SER 92  535 535 SER SER B . n 
B 1 93  SER 93  536 536 SER SER B . n 
B 1 94  LEU 94  537 537 LEU LEU B . n 
B 1 95  TYR 95  538 538 TYR TYR B . n 
B 1 96  HIS 96  539 539 HIS HIS B . n 
B 1 97  HIS 97  540 540 HIS HIS B . n 
B 1 98  LEU 98  541 541 LEU LEU B . n 
B 1 99  HIS 99  542 542 HIS HIS B . n 
B 1 100 ALA 100 543 543 ALA ALA B . n 
B 1 101 SER 101 544 544 SER SER B . n 
B 1 102 GLU 102 545 545 GLU GLU B . n 
B 1 103 THR 103 546 546 THR THR B . n 
B 1 104 LYS 104 547 547 LYS LYS B . n 
B 1 105 PHE 105 548 548 PHE PHE B . n 
B 1 106 GLU 106 549 549 GLU GLU B . n 
B 1 107 MET 107 550 550 MET MET B . n 
B 1 108 LYS 108 551 551 LYS LYS B . n 
B 1 109 LYS 109 552 552 LYS LYS B . n 
B 1 110 LEU 110 553 553 LEU LEU B . n 
B 1 111 ILE 111 554 554 ILE ILE B . n 
B 1 112 ASP 112 555 555 ASP ASP B . n 
B 1 113 ILE 113 556 556 ILE ILE B . n 
B 1 114 ALA 114 557 557 ALA ALA B . n 
B 1 115 ARG 115 558 558 ARG ARG B . n 
B 1 116 GLN 116 559 559 GLN GLN B . n 
B 1 117 THR 117 560 560 THR THR B . n 
B 1 118 ALA 118 561 561 ALA ALA B . n 
B 1 119 ARG 119 562 562 ARG ARG B . n 
B 1 120 GLY 120 563 563 GLY GLY B . n 
B 1 121 MET 121 564 564 MET MET B . n 
B 1 122 ASP 122 565 565 ASP ASP B . n 
B 1 123 TYR 123 566 566 TYR TYR B . n 
B 1 124 LEU 124 567 567 LEU LEU B . n 
B 1 125 HIS 125 568 568 HIS HIS B . n 
B 1 126 ALA 126 569 569 ALA ALA B . n 
B 1 127 LYS 127 570 570 LYS LYS B . n 
B 1 128 SER 128 571 571 SER SER B . n 
B 1 129 ILE 129 572 572 ILE ILE B . n 
B 1 130 ILE 130 573 573 ILE ILE B . n 
B 1 131 HIS 131 574 574 HIS HIS B . n 
B 1 132 ARG 132 575 575 ARG ARG B . n 
B 1 133 ASP 133 576 576 ASP ASP B . n 
B 1 134 LEU 134 577 577 LEU LEU B . n 
B 1 135 LYS 135 578 578 LYS LYS B . n 
B 1 136 SER 136 579 579 SER SER B . n 
B 1 137 ASN 137 580 580 ASN ASN B . n 
B 1 138 ASN 138 581 581 ASN ASN B . n 
B 1 139 ILE 139 582 582 ILE ILE B . n 
B 1 140 PHE 140 583 583 PHE PHE B . n 
B 1 141 LEU 141 584 584 LEU LEU B . n 
B 1 142 HIS 142 585 585 HIS HIS B . n 
B 1 143 GLU 143 586 586 GLU GLU B . n 
B 1 144 ASP 144 587 587 ASP ASP B . n 
B 1 145 ASN 145 588 588 ASN ASN B . n 
B 1 146 THR 146 589 589 THR THR B . n 
B 1 147 VAL 147 590 590 VAL VAL B . n 
B 1 148 LYS 148 591 591 LYS LYS B . n 
B 1 149 ILE 149 592 592 ILE ILE B . n 
B 1 150 GLY 150 593 593 GLY GLY B . n 
B 1 151 ASP 151 594 594 ASP ASP B . n 
B 1 152 PHE 152 595 595 PHE PHE B . n 
B 1 153 GLY 153 596 ?   ?   ?   B . n 
B 1 154 LEU 154 597 ?   ?   ?   B . n 
B 1 155 ALA 155 598 ?   ?   ?   B . n 
B 1 156 THR 156 599 ?   ?   ?   B . n 
B 1 157 VAL 157 600 ?   ?   ?   B . n 
B 1 158 LYS 158 601 ?   ?   ?   B . n 
B 1 159 SER 159 602 ?   ?   ?   B . n 
B 1 160 ARG 160 603 ?   ?   ?   B . n 
B 1 161 TRP 161 604 ?   ?   ?   B . n 
B 1 162 SER 162 605 ?   ?   ?   B . n 
B 1 163 GLY 163 606 ?   ?   ?   B . n 
B 1 164 SER 164 607 ?   ?   ?   B . n 
B 1 165 HIS 165 608 ?   ?   ?   B . n 
B 1 166 GLN 166 609 ?   ?   ?   B . n 
B 1 167 PHE 167 610 ?   ?   ?   B . n 
B 1 168 GLU 168 611 ?   ?   ?   B . n 
B 1 169 GLN 169 612 ?   ?   ?   B . n 
B 1 170 LEU 170 613 ?   ?   ?   B . n 
B 1 171 SER 171 614 614 SER SER B . n 
B 1 172 GLY 172 615 615 GLY GLY B . n 
B 1 173 SER 173 616 616 SER SER B . n 
B 1 174 ILE 174 617 617 ILE ILE B . n 
B 1 175 LEU 175 618 618 LEU LEU B . n 
B 1 176 TRP 176 619 619 TRP TRP B . n 
B 1 177 MET 177 620 620 MET MET B . n 
B 1 178 ALA 178 621 621 ALA ALA B . n 
B 1 179 PRO 179 622 622 PRO PRO B . n 
B 1 180 GLU 180 623 623 GLU GLU B . n 
B 1 181 VAL 181 624 624 VAL VAL B . n 
B 1 182 ILE 182 625 625 ILE ILE B . n 
B 1 183 ARG 183 626 626 ARG ARG B . n 
B 1 184 MET 184 627 627 MET MET B . n 
B 1 185 GLN 185 628 628 GLN GLN B . n 
B 1 186 ASP 186 629 629 ASP ASP B . n 
B 1 187 SER 187 630 630 SER SER B . n 
B 1 188 ASN 188 631 631 ASN ASN B . n 
B 1 189 PRO 189 632 632 PRO PRO B . n 
B 1 190 TYR 190 633 633 TYR TYR B . n 
B 1 191 SER 191 634 634 SER SER B . n 
B 1 192 PHE 192 635 635 PHE PHE B . n 
B 1 193 GLN 193 636 636 GLN GLN B . n 
B 1 194 SER 194 637 637 SER SER B . n 
B 1 195 ASP 195 638 638 ASP ASP B . n 
B 1 196 VAL 196 639 639 VAL VAL B . n 
B 1 197 TYR 197 640 640 TYR TYR B . n 
B 1 198 ALA 198 641 641 ALA ALA B . n 
B 1 199 PHE 199 642 642 PHE PHE B . n 
B 1 200 GLY 200 643 643 GLY GLY B . n 
B 1 201 ILE 201 644 644 ILE ILE B . n 
B 1 202 VAL 202 645 645 VAL VAL B . n 
B 1 203 LEU 203 646 646 LEU LEU B . n 
B 1 204 TYR 204 647 647 TYR TYR B . n 
B 1 205 GLU 205 648 648 GLU GLU B . n 
B 1 206 LEU 206 649 649 LEU LEU B . n 
B 1 207 MET 207 650 650 MET MET B . n 
B 1 208 THR 208 651 651 THR THR B . n 
B 1 209 GLY 209 652 652 GLY GLY B . n 
B 1 210 GLN 210 653 653 GLN GLN B . n 
B 1 211 LEU 211 654 654 LEU LEU B . n 
B 1 212 PRO 212 655 655 PRO PRO B . n 
B 1 213 TYR 213 656 656 TYR TYR B . n 
B 1 214 SER 214 657 657 SER SER B . n 
B 1 215 ASN 215 658 658 ASN ASN B . n 
B 1 216 ILE 216 659 659 ILE ILE B . n 
B 1 217 ASN 217 660 660 ASN ASN B . n 
B 1 218 ASN 218 661 661 ASN ASN B . n 
B 1 219 ARG 219 662 662 ARG ARG B . n 
B 1 220 ASP 220 663 663 ASP ASP B . n 
B 1 221 GLN 221 664 664 GLN GLN B . n 
B 1 222 ILE 222 665 665 ILE ILE B . n 
B 1 223 ILE 223 666 666 ILE ILE B . n 
B 1 224 GLU 224 667 667 GLU GLU B . n 
B 1 225 MET 225 668 668 MET MET B . n 
B 1 226 VAL 226 669 669 VAL VAL B . n 
B 1 227 GLY 227 670 670 GLY GLY B . n 
B 1 228 ARG 228 671 671 ARG ARG B . n 
B 1 229 GLY 229 672 672 GLY GLY B . n 
B 1 230 SER 230 673 673 SER SER B . n 
B 1 231 LEU 231 674 674 LEU LEU B . n 
B 1 232 SER 232 675 675 SER SER B . n 
B 1 233 PRO 233 676 676 PRO PRO B . n 
B 1 234 ASP 234 677 677 ASP ASP B . n 
B 1 235 LEU 235 678 678 LEU LEU B . n 
B 1 236 SER 236 679 679 SER SER B . n 
B 1 237 LYS 237 680 680 LYS LYS B . n 
B 1 238 VAL 238 681 681 VAL VAL B . n 
B 1 239 ARG 239 682 682 ARG ARG B . n 
B 1 240 SER 240 683 683 SER SER B . n 
B 1 241 ASN 241 684 684 ASN ASN B . n 
B 1 242 CYS 242 685 685 CYS CYS B . n 
B 1 243 PRO 243 686 686 PRO PRO B . n 
B 1 244 LYS 244 687 687 LYS LYS B . n 
B 1 245 ARG 245 688 688 ARG ARG B . n 
B 1 246 MET 246 689 689 MET MET B . n 
B 1 247 LYS 247 690 690 LYS LYS B . n 
B 1 248 ARG 248 691 691 ARG ARG B . n 
B 1 249 LEU 249 692 692 LEU LEU B . n 
B 1 250 MET 250 693 693 MET MET B . n 
B 1 251 ALA 251 694 694 ALA ALA B . n 
B 1 252 GLU 252 695 695 GLU GLU B . n 
B 1 253 CYS 253 696 696 CYS CYS B . n 
B 1 254 LEU 254 697 697 LEU LEU B . n 
B 1 255 LYS 255 698 698 LYS LYS B . n 
B 1 256 LYS 256 699 699 LYS LYS B . n 
B 1 257 LYS 257 700 700 LYS LYS B . n 
B 1 258 ARG 258 701 701 ARG ARG B . n 
B 1 259 ASP 259 702 702 ASP ASP B . n 
B 1 260 GLU 260 703 703 GLU GLU B . n 
B 1 261 ARG 261 704 704 ARG ARG B . n 
B 1 262 PRO 262 705 705 PRO PRO B . n 
B 1 263 SER 263 706 706 SER SER B . n 
B 1 264 PHE 264 707 707 PHE PHE B . n 
B 1 265 PRO 265 708 708 PRO PRO B . n 
B 1 266 ARG 266 709 709 ARG ARG B . n 
B 1 267 ILE 267 710 710 ILE ILE B . n 
B 1 268 LEU 268 711 711 LEU LEU B . n 
B 1 269 ALA 269 712 712 ALA ALA B . n 
B 1 270 GLU 270 713 713 GLU GLU B . n 
B 1 271 ILE 271 714 714 ILE ILE B . n 
B 1 272 GLU 272 715 715 GLU GLU B . n 
B 1 273 GLU 273 716 716 GLU GLU B . n 
B 1 274 LEU 274 717 717 LEU LEU B . n 
B 1 275 ALA 275 718 718 ALA ALA B . n 
B 1 276 ARG 276 719 719 ARG ARG B . n 
B 1 277 GLU 277 720 720 GLU GLU B . n 
B 1 278 LEU 278 721 721 LEU LEU B . n 
B 1 279 SER 279 722 722 SER SER B . n 
B 1 280 GLY 280 723 ?   ?   ?   B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E 
2 1 B,D,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-02-26 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 2.5836  -5.3578  -8.0920  0.1748 0.1911 0.2075 -0.0983 -0.0153 0.0792  -0.2455 -0.0339 -0.3436 -0.0184 0.2767  -0.2164 
-0.1047 -0.0387 0.0707  -0.0423 0.1486  0.0639 0.0645  0.0237  -0.0439 'X-RAY DIFFRACTION' 
2 ? refined -1.1772 -13.0010 -19.1599 0.0625 0.0643 0.0235 -0.0188 0.0051  0.0151  0.5850  4.6276  1.1435  0.3178  -0.2012 1.9138  
0.0559  0.1121  -0.0357 0.4615  -0.0378 0.0774 0.3936  0.1474  -0.0181 'X-RAY DIFFRACTION' 
3 ? refined 1.6042  8.9765   5.8909   0.0544 0.1686 0.0647 0.0159  0.0550  -0.0224 2.5513  2.6796  2.5383  1.7203  1.3431  1.1888  
0.0896  -0.4150 0.0959  0.2938  -0.2770 0.1175 0.6634  -0.0802 0.1873  'X-RAY DIFFRACTION' 
4 ? refined 0.7445  -2.8304  -10.3181 0.1886 0.1885 0.1885 0.0002  -0.0001 -0.0001 -0.7377 1.0995  -0.3357 0.1917  0.1605  0.2983  
-0.0215 -0.0666 -0.1505 -0.5351 0.3874  0.1973 -0.4128 0.1589  -0.3658 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1  1 B 134 F 55  B 151 F 66  ? 'X-RAY DIFFRACTION' ? 
2  2 A 449 A 6   A 596 A 153 ? 'X-RAY DIFFRACTION' ? 
3  2 A 614 A 171 A 722 A 279 ? 'X-RAY DIFFRACTION' ? 
4  2 A 2   C 1   A 2   C 1   ? 'X-RAY DIFFRACTION' ? 
5  2 A 724 E 1   A 787 E 64  ? 'X-RAY DIFFRACTION' ? 
6  3 B 449 B 6   B 595 B 152 ? 'X-RAY DIFFRACTION' ? 
7  3 B 614 B 171 B 722 B 279 ? 'X-RAY DIFFRACTION' ? 
8  3 B 3   D 1   B 3   D 1   ? 'X-RAY DIFFRACTION' ? 
9  3 A 788 E 65  A 810 E 87  ? 'X-RAY DIFFRACTION' ? 
10 4 B 118 F 49  B 125 F 54  ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC  refinement        5.1.25 ? 1 
Blu-Ice 'data collection' .      ? 2 
MOSFLM  'data reduction'  .      ? 3 
SCALA   'data scaling'    .      ? 4 
CCP4    phasing           .      ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   B TRP 619 ? ? O   B HOH 100 ? ? 1.91 
2 1 O   A LYS 570 ? ? O   A HOH 774 ? ? 2.02 
3 1 O   A PRO 490 ? ? O   A HOH 781 ? ? 2.03 
4 1 OG1 B THR 491 ? ? OE1 B GLN 493 ? ? 2.11 
5 1 O   A GLU 545 ? ? O   A HOH 744 ? ? 2.17 
6 1 OG  B SER 616 ? ? O   B HOH 113 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 449 ? ? CG A ASP 449 ? ? OD2 A ASP 449 ? ? 124.71 118.30 6.41 0.90 N 
2 1 CB A ASP 454 ? ? CG A ASP 454 ? ? OD2 A ASP 454 ? ? 124.30 118.30 6.00 0.90 N 
3 1 CB A ASP 479 ? ? CG A ASP 479 ? ? OD2 A ASP 479 ? ? 124.35 118.30 6.05 0.90 N 
4 1 CB A ASP 576 ? ? CG A ASP 576 ? ? OD2 A ASP 576 ? ? 124.67 118.30 6.37 0.90 N 
5 1 CB A ASP 587 ? ? CG A ASP 587 ? ? OD2 A ASP 587 ? ? 124.16 118.30 5.86 0.90 N 
6 1 CB B ASP 454 ? ? CG B ASP 454 ? ? OD2 B ASP 454 ? ? 123.92 118.30 5.62 0.90 N 
7 1 CB B ASP 587 ? ? CG B ASP 587 ? ? OD2 B ASP 587 ? ? 125.20 118.30 6.90 0.90 N 
8 1 CB B ASP 677 ? ? CG B ASP 677 ? ? OD2 B ASP 677 ? ? 123.95 118.30 5.65 0.90 N 
9 1 NE B ARG 704 ? ? CZ B ARG 704 ? ? NH1 B ARG 704 ? ? 123.97 120.30 3.67 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 465 ? ? -148.04 -135.55 
2  1 PHE A 468 ? ? -38.38  -75.75  
3  1 THR A 488 ? ? -91.81  -78.17  
4  1 HIS A 510 ? ? 173.81  144.99  
5  1 LEU A 514 ? ? -32.41  139.67  
6  1 MET A 517 ? ? -135.99 -32.74  
7  1 THR A 521 ? ? -141.73 -33.08  
8  1 HIS A 542 ? ? -136.78 -59.13  
9  1 GLU A 545 ? ? 73.38   30.68   
10 1 ARG A 575 ? ? 102.26  -19.82  
11 1 ASP A 576 ? ? -155.53 47.09   
12 1 GLU A 586 ? ? 80.81   5.43    
13 1 ASN A 588 ? ? -143.33 -49.64  
14 1 ARG A 626 ? ? -99.73  -71.69  
15 1 MET A 627 ? ? 123.31  101.97  
16 1 GLN A 628 ? ? -30.37  -89.22  
17 1 ASP A 629 ? ? 135.99  98.88   
18 1 SER A 630 ? ? 87.99   -49.97  
19 1 ASN A 631 ? ? -74.87  -131.50 
20 1 ASN A 661 ? ? -161.90 111.93  
21 1 SER A 683 ? ? -49.84  -12.79  
22 1 ALA A 712 ? ? -64.72  -74.38  
23 1 GLU A 720 ? ? -0.09   -149.62 
24 1 LEU A 721 ? ? -163.50 -99.98  
25 1 ILE B 463 ? ? -110.10 -90.64  
26 1 PHE B 468 ? ? -139.78 -63.23  
27 1 LYS B 473 ? ? -46.15  164.80  
28 1 ASN B 486 ? ? -154.25 62.98   
29 1 PHE B 498 ? ? -44.13  -71.48  
30 1 ARG B 509 ? ? -160.42 79.36   
31 1 LYS B 522 ? ? 113.33  -68.86  
32 1 PRO B 523 ? ? -82.94  -129.40 
33 1 GLN B 524 ? ? -47.36  168.57  
34 1 LYS B 547 ? ? -44.62  96.50   
35 1 SER B 571 ? ? 81.26   47.94   
36 1 ARG B 575 ? ? 70.63   -1.96   
37 1 ASP B 576 ? ? -173.95 53.53   
38 1 LEU B 584 ? ? -105.24 49.65   
39 1 HIS B 585 ? ? -29.58  126.35  
40 1 ASP B 587 ? ? 56.68   10.50   
41 1 ASN B 588 ? ? -151.29 -3.73   
42 1 MET B 627 ? ? 71.19   -81.23  
43 1 GLN B 628 ? ? 68.86   -73.52  
44 1 SER B 630 ? ? -40.03  -90.93  
45 1 TYR B 656 ? ? 92.91   50.87   
46 1 SER B 673 ? ? -147.49 -62.18  
47 1 ARG B 682 ? ? -47.35  151.62  
48 1 GLU B 715 ? ? -39.91  -32.05  
49 1 GLU B 720 ? ? -88.22  -82.82  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 GLY A 460 ? ? GLN A 461 ? ? -148.00 
2 1 SER B 520 ? ? THR B 521 ? ? 149.05  
3 1 GLU B 545 ? ? THR B 546 ? ? -140.88 
4 1 GLY B 615 ? ? SER B 616 ? ? -30.46  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 522 ? CG ? A LYS 79 CG 
2 1 Y 1 A LYS 522 ? CD ? A LYS 79 CD 
3 1 Y 1 A LYS 522 ? CE ? A LYS 79 CE 
4 1 Y 1 A LYS 522 ? NZ ? A LYS 79 NZ 
5 1 Y 1 B LYS 522 ? CG ? B LYS 79 CG 
6 1 Y 1 B LYS 522 ? CD ? B LYS 79 CD 
7 1 Y 1 B LYS 522 ? CE ? B LYS 79 CE 
8 1 Y 1 B LYS 522 ? NZ ? B LYS 79 NZ 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ARG 444 ? A ARG 1   
2  1 Y 1 A ASP 445 ? A ASP 2   
3  1 Y 1 A SER 446 ? A SER 3   
4  1 Y 1 A SER 447 ? A SER 4   
5  1 Y 1 A LEU 597 ? A LEU 154 
6  1 Y 1 A ALA 598 ? A ALA 155 
7  1 Y 1 A THR 599 ? A THR 156 
8  1 Y 1 A VAL 600 ? A VAL 157 
9  1 Y 1 A LYS 601 ? A LYS 158 
10 1 Y 1 A SER 602 ? A SER 159 
11 1 Y 1 A ARG 603 ? A ARG 160 
12 1 Y 1 A TRP 604 ? A TRP 161 
13 1 Y 1 A SER 605 ? A SER 162 
14 1 Y 1 A GLY 606 ? A GLY 163 
15 1 Y 1 A SER 607 ? A SER 164 
16 1 Y 1 A HIS 608 ? A HIS 165 
17 1 Y 1 A GLN 609 ? A GLN 166 
18 1 Y 1 A PHE 610 ? A PHE 167 
19 1 Y 1 A GLU 611 ? A GLU 168 
20 1 Y 1 A GLN 612 ? A GLN 169 
21 1 Y 1 A LEU 613 ? A LEU 170 
22 1 Y 1 A GLY 723 ? A GLY 280 
23 1 Y 1 B ARG 444 ? B ARG 1   
24 1 Y 1 B ASP 445 ? B ASP 2   
25 1 Y 1 B SER 446 ? B SER 3   
26 1 Y 1 B SER 447 ? B SER 4   
27 1 Y 1 B GLY 596 ? B GLY 153 
28 1 Y 1 B LEU 597 ? B LEU 154 
29 1 Y 1 B ALA 598 ? B ALA 155 
30 1 Y 1 B THR 599 ? B THR 156 
31 1 Y 1 B VAL 600 ? B VAL 157 
32 1 Y 1 B LYS 601 ? B LYS 158 
33 1 Y 1 B SER 602 ? B SER 159 
34 1 Y 1 B ARG 603 ? B ARG 160 
35 1 Y 1 B TRP 604 ? B TRP 161 
36 1 Y 1 B SER 605 ? B SER 162 
37 1 Y 1 B GLY 606 ? B GLY 163 
38 1 Y 1 B SER 607 ? B SER 164 
39 1 Y 1 B HIS 608 ? B HIS 165 
40 1 Y 1 B GLN 609 ? B GLN 166 
41 1 Y 1 B PHE 610 ? B PHE 167 
42 1 Y 1 B GLU 611 ? B GLU 168 
43 1 Y 1 B GLN 612 ? B GLN 169 
44 1 Y 1 B LEU 613 ? B LEU 170 
45 1 Y 1 B GLY 723 ? B GLY 280 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'N-{3-[(5-chloro-1H-pyrrolo[2,3-b]pyridin-3-yl)carbonyl]-2,4-difluorophenyl}propane-1-sulfonamide' 324 
3 water                                                                                              HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 324 1  2   2   324 LIG A . 
D 2 324 1  3   3   324 LIG B . 
E 3 HOH 1  724 1   HOH HOH A . 
E 3 HOH 2  725 2   HOH HOH A . 
E 3 HOH 3  726 3   HOH HOH A . 
E 3 HOH 4  727 4   HOH HOH A . 
E 3 HOH 5  728 5   HOH HOH A . 
E 3 HOH 6  729 7   HOH HOH A . 
E 3 HOH 7  730 8   HOH HOH A . 
E 3 HOH 8  731 9   HOH HOH A . 
E 3 HOH 9  732 10  HOH HOH A . 
E 3 HOH 10 733 11  HOH HOH A . 
E 3 HOH 11 734 12  HOH HOH A . 
E 3 HOH 12 735 13  HOH HOH A . 
E 3 HOH 13 736 14  HOH HOH A . 
E 3 HOH 14 737 15  HOH HOH A . 
E 3 HOH 15 738 16  HOH HOH A . 
E 3 HOH 16 739 17  HOH HOH A . 
E 3 HOH 17 740 18  HOH HOH A . 
E 3 HOH 18 741 19  HOH HOH A . 
E 3 HOH 19 742 20  HOH HOH A . 
E 3 HOH 20 743 21  HOH HOH A . 
E 3 HOH 21 744 22  HOH HOH A . 
E 3 HOH 22 745 23  HOH HOH A . 
E 3 HOH 23 746 24  HOH HOH A . 
E 3 HOH 24 747 25  HOH HOH A . 
E 3 HOH 25 748 26  HOH HOH A . 
E 3 HOH 26 749 27  HOH HOH A . 
E 3 HOH 27 750 28  HOH HOH A . 
E 3 HOH 28 751 29  HOH HOH A . 
E 3 HOH 29 752 30  HOH HOH A . 
E 3 HOH 30 753 31  HOH HOH A . 
E 3 HOH 31 754 32  HOH HOH A . 
E 3 HOH 32 755 33  HOH HOH A . 
E 3 HOH 33 756 34  HOH HOH A . 
E 3 HOH 34 757 35  HOH HOH A . 
E 3 HOH 35 758 36  HOH HOH A . 
E 3 HOH 36 759 37  HOH HOH A . 
E 3 HOH 37 760 38  HOH HOH A . 
E 3 HOH 38 761 39  HOH HOH A . 
E 3 HOH 39 762 40  HOH HOH A . 
E 3 HOH 40 763 41  HOH HOH A . 
E 3 HOH 41 764 42  HOH HOH A . 
E 3 HOH 42 765 43  HOH HOH A . 
E 3 HOH 43 766 44  HOH HOH A . 
E 3 HOH 44 767 45  HOH HOH A . 
E 3 HOH 45 768 46  HOH HOH A . 
E 3 HOH 46 769 47  HOH HOH A . 
E 3 HOH 47 770 48  HOH HOH A . 
E 3 HOH 48 771 49  HOH HOH A . 
E 3 HOH 49 772 50  HOH HOH A . 
E 3 HOH 50 773 51  HOH HOH A . 
E 3 HOH 51 774 52  HOH HOH A . 
E 3 HOH 52 775 53  HOH HOH A . 
E 3 HOH 53 776 54  HOH HOH A . 
E 3 HOH 54 777 55  HOH HOH A . 
E 3 HOH 55 778 56  HOH HOH A . 
E 3 HOH 56 779 57  HOH HOH A . 
E 3 HOH 57 780 58  HOH HOH A . 
E 3 HOH 58 781 59  HOH HOH A . 
E 3 HOH 59 782 60  HOH HOH A . 
E 3 HOH 60 783 61  HOH HOH A . 
E 3 HOH 61 784 62  HOH HOH A . 
E 3 HOH 62 785 63  HOH HOH A . 
E 3 HOH 63 786 64  HOH HOH A . 
E 3 HOH 64 787 65  HOH HOH A . 
E 3 HOH 65 788 66  HOH HOH A . 
E 3 HOH 66 789 67  HOH HOH A . 
E 3 HOH 67 790 68  HOH HOH A . 
E 3 HOH 68 791 69  HOH HOH A . 
E 3 HOH 69 792 70  HOH HOH A . 
E 3 HOH 70 793 122 HOH HOH A . 
E 3 HOH 71 794 124 HOH HOH A . 
E 3 HOH 72 795 126 HOH HOH A . 
E 3 HOH 73 796 127 HOH HOH A . 
E 3 HOH 74 797 128 HOH HOH A . 
E 3 HOH 75 798 129 HOH HOH A . 
E 3 HOH 76 799 130 HOH HOH A . 
E 3 HOH 77 800 131 HOH HOH A . 
E 3 HOH 78 801 132 HOH HOH A . 
E 3 HOH 79 802 133 HOH HOH A . 
E 3 HOH 80 803 137 HOH HOH A . 
E 3 HOH 81 804 138 HOH HOH A . 
E 3 HOH 82 805 141 HOH HOH A . 
E 3 HOH 83 806 144 HOH HOH A . 
E 3 HOH 84 807 148 HOH HOH A . 
E 3 HOH 85 808 150 HOH HOH A . 
E 3 HOH 86 809 152 HOH HOH A . 
E 3 HOH 87 810 153 HOH HOH A . 
F 3 HOH 1  6   6   HOH HOH B . 
F 3 HOH 2  71  71  HOH HOH B . 
F 3 HOH 3  72  72  HOH HOH B . 
F 3 HOH 4  73  73  HOH HOH B . 
F 3 HOH 5  74  74  HOH HOH B . 
F 3 HOH 6  75  75  HOH HOH B . 
F 3 HOH 7  76  76  HOH HOH B . 
F 3 HOH 8  77  77  HOH HOH B . 
F 3 HOH 9  78  78  HOH HOH B . 
F 3 HOH 10 79  79  HOH HOH B . 
F 3 HOH 11 80  80  HOH HOH B . 
F 3 HOH 12 81  81  HOH HOH B . 
F 3 HOH 13 82  82  HOH HOH B . 
F 3 HOH 14 83  83  HOH HOH B . 
F 3 HOH 15 84  84  HOH HOH B . 
F 3 HOH 16 85  85  HOH HOH B . 
F 3 HOH 17 86  86  HOH HOH B . 
F 3 HOH 18 87  87  HOH HOH B . 
F 3 HOH 19 88  88  HOH HOH B . 
F 3 HOH 20 89  89  HOH HOH B . 
F 3 HOH 21 90  90  HOH HOH B . 
F 3 HOH 22 91  91  HOH HOH B . 
F 3 HOH 23 92  92  HOH HOH B . 
F 3 HOH 24 93  93  HOH HOH B . 
F 3 HOH 25 94  94  HOH HOH B . 
F 3 HOH 26 95  95  HOH HOH B . 
F 3 HOH 27 96  96  HOH HOH B . 
F 3 HOH 28 97  97  HOH HOH B . 
F 3 HOH 29 98  98  HOH HOH B . 
F 3 HOH 30 99  99  HOH HOH B . 
F 3 HOH 31 100 100 HOH HOH B . 
F 3 HOH 32 101 101 HOH HOH B . 
F 3 HOH 33 102 102 HOH HOH B . 
F 3 HOH 34 103 103 HOH HOH B . 
F 3 HOH 35 104 104 HOH HOH B . 
F 3 HOH 36 105 105 HOH HOH B . 
F 3 HOH 37 106 106 HOH HOH B . 
F 3 HOH 38 107 107 HOH HOH B . 
F 3 HOH 39 108 108 HOH HOH B . 
F 3 HOH 40 109 109 HOH HOH B . 
F 3 HOH 41 110 110 HOH HOH B . 
F 3 HOH 42 111 111 HOH HOH B . 
F 3 HOH 43 112 112 HOH HOH B . 
F 3 HOH 44 113 113 HOH HOH B . 
F 3 HOH 45 114 114 HOH HOH B . 
F 3 HOH 46 115 115 HOH HOH B . 
F 3 HOH 47 116 116 HOH HOH B . 
F 3 HOH 48 117 117 HOH HOH B . 
F 3 HOH 49 118 118 HOH HOH B . 
F 3 HOH 50 119 119 HOH HOH B . 
F 3 HOH 51 120 120 HOH HOH B . 
F 3 HOH 52 121 121 HOH HOH B . 
F 3 HOH 53 123 123 HOH HOH B . 
F 3 HOH 54 125 125 HOH HOH B . 
F 3 HOH 55 134 134 HOH HOH B . 
F 3 HOH 56 135 135 HOH HOH B . 
F 3 HOH 57 136 136 HOH HOH B . 
F 3 HOH 58 139 139 HOH HOH B . 
F 3 HOH 59 140 140 HOH HOH B . 
F 3 HOH 60 142 142 HOH HOH B . 
F 3 HOH 61 143 143 HOH HOH B . 
F 3 HOH 62 145 145 HOH HOH B . 
F 3 HOH 63 146 146 HOH HOH B . 
F 3 HOH 64 147 147 HOH HOH B . 
F 3 HOH 65 149 149 HOH HOH B . 
F 3 HOH 66 151 151 HOH HOH B . 
#