data_3C5H
# 
_entry.id   3C5H 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3C5H         
RCSB  RCSB046365   
WWPDB D_1000046365 
# 
_pdbx_database_status.entry_id                        3C5H 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2008-01-31 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Shen, L.'                             1  
'Tong, Y.'                             2  
'Tempel, W.'                           3  
'MacKenzie, F.'                        4  
'Arrowsmith, C.H.'                     5  
'Edwards, A.M.'                        6  
'Bountra, C.'                          7  
'Weigelt, J.'                          8  
'Bochkarev, A.'                        9  
'Park, H.'                             10 
'Structural Genomics Consortium (SGC)' 11 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of the Ras homolog domain of human GRLF1 (p190RhoGAP).' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Shen, L.'         1  
primary 'Tong, Y.'         2  
primary 'Tempel, W.'       3  
primary 'MacKenzie, F.'    4  
primary 'Arrowsmith, C.H.' 5  
primary 'Edwards, A.M.'    6  
primary 'Bountra, C.'      7  
primary 'Weigelt, J.'      8  
primary 'Bochkarev, A.'    9  
primary 'Park, H.'         10 
# 
_cell.entry_id           3C5H 
_cell.length_a           108.959 
_cell.length_b           108.959 
_cell.length_c           51.319 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3C5H 
_symmetry.space_group_name_H-M             'I 4' 
_symmetry.Int_Tables_number                79 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glucocorticoid receptor DNA-binding factor 1' 28946.740 1  ? ? 'Ras homolog domain: Residues 13-249' ? 
2 non-polymer syn 'MAGNESIUM ION'                                24.305    2  ? ? ?                                     ? 
3 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER'  522.196   1  ? ? ?                                     ? 
4 non-polymer syn 'UNKNOWN ATOM OR ION'                          ?         5  ? ? ?                                     ? 
5 water       nat water                                          18.015    96 ? ? ?                                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Glucocorticoid receptor repression factor 1, GRF-1, Rho GAP p190A, p190-A' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHSSGRENLYFQGTYNISVVGLSGTEKEKGQCGIGKSCLCNRFVRPSADEFHLDHTSVLSTSDFGGRVVNNDHFL
YWGEVSRSLEDCVECKMHIVEQTEFIDDQTFQPHRSTALQPYIKRAAATKLASAEKLMYFCTDQLGLEQDFEQKQMPDGK
LLVDGFLLGIDVSRGMNRNFDDQLKFVSNLYNQLAKTKKPIVVVLTKCDEGVERYIRDAHTFALSKKNLQVVETSARSNV
NVDLAFSTLVQLIDK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHSSGRENLYFQGTYNISVVGLSGTEKEKGQCGIGKSCLCNRFVRPSADEFHLDHTSVLSTSDFGGRVVNNDHFL
YWGEVSRSLEDCVECKMHIVEQTEFIDDQTFQPHRSTALQPYIKRAAATKLASAEKLMYFCTDQLGLEQDFEQKQMPDGK
LLVDGFLLGIDVSRGMNRNFDDQLKFVSNLYNQLAKTKKPIVVVLTKCDEGVERYIRDAHTFALSKKNLQVVETSARSNV
NVDLAFSTLVQLIDK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  ARG n 
1 12  GLU n 
1 13  ASN n 
1 14  LEU n 
1 15  TYR n 
1 16  PHE n 
1 17  GLN n 
1 18  GLY n 
1 19  THR n 
1 20  TYR n 
1 21  ASN n 
1 22  ILE n 
1 23  SER n 
1 24  VAL n 
1 25  VAL n 
1 26  GLY n 
1 27  LEU n 
1 28  SER n 
1 29  GLY n 
1 30  THR n 
1 31  GLU n 
1 32  LYS n 
1 33  GLU n 
1 34  LYS n 
1 35  GLY n 
1 36  GLN n 
1 37  CYS n 
1 38  GLY n 
1 39  ILE n 
1 40  GLY n 
1 41  LYS n 
1 42  SER n 
1 43  CYS n 
1 44  LEU n 
1 45  CYS n 
1 46  ASN n 
1 47  ARG n 
1 48  PHE n 
1 49  VAL n 
1 50  ARG n 
1 51  PRO n 
1 52  SER n 
1 53  ALA n 
1 54  ASP n 
1 55  GLU n 
1 56  PHE n 
1 57  HIS n 
1 58  LEU n 
1 59  ASP n 
1 60  HIS n 
1 61  THR n 
1 62  SER n 
1 63  VAL n 
1 64  LEU n 
1 65  SER n 
1 66  THR n 
1 67  SER n 
1 68  ASP n 
1 69  PHE n 
1 70  GLY n 
1 71  GLY n 
1 72  ARG n 
1 73  VAL n 
1 74  VAL n 
1 75  ASN n 
1 76  ASN n 
1 77  ASP n 
1 78  HIS n 
1 79  PHE n 
1 80  LEU n 
1 81  TYR n 
1 82  TRP n 
1 83  GLY n 
1 84  GLU n 
1 85  VAL n 
1 86  SER n 
1 87  ARG n 
1 88  SER n 
1 89  LEU n 
1 90  GLU n 
1 91  ASP n 
1 92  CYS n 
1 93  VAL n 
1 94  GLU n 
1 95  CYS n 
1 96  LYS n 
1 97  MET n 
1 98  HIS n 
1 99  ILE n 
1 100 VAL n 
1 101 GLU n 
1 102 GLN n 
1 103 THR n 
1 104 GLU n 
1 105 PHE n 
1 106 ILE n 
1 107 ASP n 
1 108 ASP n 
1 109 GLN n 
1 110 THR n 
1 111 PHE n 
1 112 GLN n 
1 113 PRO n 
1 114 HIS n 
1 115 ARG n 
1 116 SER n 
1 117 THR n 
1 118 ALA n 
1 119 LEU n 
1 120 GLN n 
1 121 PRO n 
1 122 TYR n 
1 123 ILE n 
1 124 LYS n 
1 125 ARG n 
1 126 ALA n 
1 127 ALA n 
1 128 ALA n 
1 129 THR n 
1 130 LYS n 
1 131 LEU n 
1 132 ALA n 
1 133 SER n 
1 134 ALA n 
1 135 GLU n 
1 136 LYS n 
1 137 LEU n 
1 138 MET n 
1 139 TYR n 
1 140 PHE n 
1 141 CYS n 
1 142 THR n 
1 143 ASP n 
1 144 GLN n 
1 145 LEU n 
1 146 GLY n 
1 147 LEU n 
1 148 GLU n 
1 149 GLN n 
1 150 ASP n 
1 151 PHE n 
1 152 GLU n 
1 153 GLN n 
1 154 LYS n 
1 155 GLN n 
1 156 MET n 
1 157 PRO n 
1 158 ASP n 
1 159 GLY n 
1 160 LYS n 
1 161 LEU n 
1 162 LEU n 
1 163 VAL n 
1 164 ASP n 
1 165 GLY n 
1 166 PHE n 
1 167 LEU n 
1 168 LEU n 
1 169 GLY n 
1 170 ILE n 
1 171 ASP n 
1 172 VAL n 
1 173 SER n 
1 174 ARG n 
1 175 GLY n 
1 176 MET n 
1 177 ASN n 
1 178 ARG n 
1 179 ASN n 
1 180 PHE n 
1 181 ASP n 
1 182 ASP n 
1 183 GLN n 
1 184 LEU n 
1 185 LYS n 
1 186 PHE n 
1 187 VAL n 
1 188 SER n 
1 189 ASN n 
1 190 LEU n 
1 191 TYR n 
1 192 ASN n 
1 193 GLN n 
1 194 LEU n 
1 195 ALA n 
1 196 LYS n 
1 197 THR n 
1 198 LYS n 
1 199 LYS n 
1 200 PRO n 
1 201 ILE n 
1 202 VAL n 
1 203 VAL n 
1 204 VAL n 
1 205 LEU n 
1 206 THR n 
1 207 LYS n 
1 208 CYS n 
1 209 ASP n 
1 210 GLU n 
1 211 GLY n 
1 212 VAL n 
1 213 GLU n 
1 214 ARG n 
1 215 TYR n 
1 216 ILE n 
1 217 ARG n 
1 218 ASP n 
1 219 ALA n 
1 220 HIS n 
1 221 THR n 
1 222 PHE n 
1 223 ALA n 
1 224 LEU n 
1 225 SER n 
1 226 LYS n 
1 227 LYS n 
1 228 ASN n 
1 229 LEU n 
1 230 GLN n 
1 231 VAL n 
1 232 VAL n 
1 233 GLU n 
1 234 THR n 
1 235 SER n 
1 236 ALA n 
1 237 ARG n 
1 238 SER n 
1 239 ASN n 
1 240 VAL n 
1 241 ASN n 
1 242 VAL n 
1 243 ASP n 
1 244 LEU n 
1 245 ALA n 
1 246 PHE n 
1 247 SER n 
1 248 THR n 
1 249 LEU n 
1 250 VAL n 
1 251 GLN n 
1 252 LEU n 
1 253 ILE n 
1 254 ASP n 
1 255 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'GRLF1, GRF1, KIAA1722' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21-CodonPlus(DE3)-RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28-mhl 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GRLF1_HUMAN 
_struct_ref.pdbx_db_accession          Q9NRY4 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TYNISVVGLSGTEKEKGQCGIGKSCLCNRFVRPSADEFHLDHTSVLSTSDFGGRVVNNDHFLYWGEVSRSLEDCVECKMH
IVEQTEFIDDQTFQPHRSTALQPYIKRAAATKLASAEKLMYFCTDQLGLEQDFEQKQMPDGKLLVDGFLLGIDVSRGMNR
NFDDQLKFVSNLYNQLAKTKKPIVVVLTKCDEGVERYIRDAHTFALSKKNLQVVETSARSNVNVDLAFSTLVQLIDK
;
_struct_ref.pdbx_align_begin           13 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3C5H 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 19 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 255 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9NRY4 
_struct_ref_seq.db_align_beg                  13 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  249 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       13 
_struct_ref_seq.pdbx_auth_seq_align_end       249 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3C5H MET A 1  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' -5 1  
1 3C5H HIS A 2  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' -4 2  
1 3C5H HIS A 3  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' -3 3  
1 3C5H HIS A 4  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' -2 4  
1 3C5H HIS A 5  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' -1 5  
1 3C5H HIS A 6  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 0  6  
1 3C5H HIS A 7  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1  7  
1 3C5H SER A 8  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 2  8  
1 3C5H SER A 9  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 3  9  
1 3C5H GLY A 10 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 4  10 
1 3C5H ARG A 11 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 5  11 
1 3C5H GLU A 12 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 6  12 
1 3C5H ASN A 13 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 7  13 
1 3C5H LEU A 14 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 8  14 
1 3C5H TYR A 15 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 9  15 
1 3C5H PHE A 16 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 10 16 
1 3C5H GLN A 17 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 11 17 
1 3C5H GLY A 18 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 12 18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                       ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                      ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                      ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                     ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                       ? 'C2 H5 N O2'        75.067  
GNP non-polymer         . 'PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER' ? 'C10 H17 N6 O13 P3' 522.196 
HIS 'L-peptide linking' y HISTIDINE                                     ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                         ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                    ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                       ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                        ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                    ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                               ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                 ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                       ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                        ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                     ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                      ? 'C9 H11 N O3'       181.189 
UNX non-polymer         . 'UNKNOWN ATOM OR ION'                         ? ?                   ?       
VAL 'L-peptide linking' y VALINE                                        ? 'C5 H11 N O2'       117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3C5H 
_exptl.method            'X-RAY DIFFRACTION' 
# 
loop_
_exptl_crystal.id 
_exptl_crystal.density_percent_sol 
_exptl_crystal.density_Matthews 
_exptl_crystal.density_meas 
_exptl_crystal.description 
_exptl_crystal.F_000 
_exptl_crystal.preparation 
1 53.25 2.63 ? ? ? ? 
2 ?     ?    ? ? ? ? 
# 
loop_
_exptl_crystal_grow.crystal_id 
_exptl_crystal_grow.method 
_exptl_crystal_grow.pH 
_exptl_crystal_grow.temp 
_exptl_crystal_grow.pdbx_details 
_exptl_crystal_grow.temp_details 
_exptl_crystal_grow.pdbx_pH_range 
1 ? ? ? 
;Native crystal, used for model refinement: 26% PEG 4000, 0.1M Tris-HCl, 0.2M Magnesium chloride, 0.1mM DTT, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K
;
? . 
2 ? ? ? 
;Seleno-methionine derivative crystal, used for MAD phasing: 33% PEG 4000, 0.1M Tris-HCl, 0.2M Magnesium chloride, 0.1mM DTT, pH 9.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K. A ten-fold excess of GppNHp was added to the protein samples prior to crystallization.
;
? . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 100 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD 'MARMOSAIC 300 mm CCD' 2007-11-29 ? 
2 CCD 'ADSC QUANTUM 315'     2007-12-06 ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.monochromator 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.pdbx_scattering_type 
1 'SINGLE WAVELENGTH' ? 1 M x-ray 
2 MAD                 ? 1 M x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.97926 1.0 
2 0.97931 1.0 
3 0.97945 1.0 
4 0.98166 1.0 
5 0.97243 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_wavelength_list 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
1 SYNCHROTRON 'APS BEAMLINE 23-ID-B' 0.97926                              ? APS 23-ID-B 
2 SYNCHROTRON 'APS BEAMLINE 19-ID'   '0.97931, 0.97945, 0.98166, 0.97243' ? APS 19-ID   
# 
_reflns.entry_id                     3C5H 
_reflns.d_resolution_high            1.800 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   26661 
_reflns.pdbx_Rmerge_I_obs            0.075 
_reflns.pdbx_netI_over_sigmaI        10.900 
_reflns.pdbx_chi_squared             1.527 
_reflns.pdbx_redundancy              6.700 
_reflns.percent_possible_obs         95.100 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1,2 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
1.80 1.86  ? ? ? 0.456 ? ? 0.941 2.70 ? 1690 61.80  ? 1  
1.86 1.94  ? ? ? 0.387 ? ? 1.140 4.10 ? 2491 89.10  ? 2  
1.94 2.03  ? ? ? 0.328 ? ? 1.053 6.10 ? 2796 98.90  ? 3  
2.03 2.13  ? ? ? 0.238 ? ? 1.184 7.30 ? 2788 100.00 ? 4  
2.13 2.27  ? ? ? 0.180 ? ? 1.296 7.50 ? 2797 100.00 ? 5  
2.27 2.44  ? ? ? 0.140 ? ? 1.306 7.60 ? 2791 100.00 ? 6  
2.44 2.69  ? ? ? 0.103 ? ? 1.331 7.60 ? 2775 100.00 ? 7  
2.69 3.08  ? ? ? 0.080 ? ? 1.779 7.60 ? 2811 100.00 ? 8  
3.08 3.88  ? ? ? 0.055 ? ? 2.219 7.50 ? 2839 100.00 ? 9  
3.88 50.00 ? ? ? 0.045 ? ? 2.174 7.40 ? 2883 100.00 ? 10 
# 
_refine.entry_id                                 3C5H 
_refine.ls_d_res_high                            1.800 
_refine.ls_d_res_low                             19.260 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    95.060 
_refine.ls_number_reflns_obs                     26626 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
;Due to considerable non-isomorphism between the phasing and refinement data sets, a preliminary model obtained by the program 'resolve' based on the phasing data was used in molecular replacement with the higher resolution refinement data and the program 'phaser'. Following density modification with 'DM', 'ARP/wARP' was used for autotracing of the higher resolution model. HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS during final refinement. Programs, ARP/wARP, coot, molprobity have also been used in refinement
;
_refine.ls_R_factor_obs                          0.207 
_refine.ls_R_factor_R_work                       0.205 
_refine.ls_wR_factor_R_work                      0.197 
_refine.ls_R_factor_R_free                       0.247 
_refine.ls_wR_factor_R_free                      0.238 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  1352 
_refine.B_iso_mean                               21.063 
_refine.aniso_B[1][1]                            0.020 
_refine.aniso_B[2][2]                            0.020 
_refine.aniso_B[3][3]                            -0.030 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.950 
_refine.correlation_coeff_Fo_to_Fc_free          0.926 
_refine.pdbx_overall_ESU_R                       0.127 
_refine.pdbx_overall_ESU_R_Free                  0.127 
_refine.overall_SU_ML                            0.092 
_refine.overall_SU_B                             2.936 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1799 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         39 
_refine_hist.number_atoms_solvent             96 
_refine_hist.number_atoms_total               1934 
_refine_hist.d_res_high                       1.800 
_refine_hist.d_res_low                        19.260 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         1869 0.017  0.022  ? 'X-RAY DIFFRACTION' ? 
r_bond_other_d           1193 0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      2549 1.465  1.973  ? 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        2938 0.954  3.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   238  6.285  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   81   33.331 25.309 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   306  11.656 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   5    25.159 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           298  0.086  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     2076 0.005  0.020  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       364  0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            352  0.211  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbd_other              1235 0.186  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          916  0.173  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_other            915  0.081  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    94   0.131  0.200  ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      2    0.027  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   9    0.284  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     18   0.229  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 7    0.119  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              1291 2.720  2.000  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_other           477  0.702  2.000  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1876 3.601  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              785  2.861  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             668  3.899  3.000  ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_low 
_refine_ls_shell.d_res_high 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.pdbx_refine_id 
20 1.848  1.800 2089 58.066  1152 0.285 61  0.391 . . . . . 'X-RAY DIFFRACTION' 
20 1.898  1.848 1952 80.738  1501 0.267 75  0.298 . . . . . 'X-RAY DIFFRACTION' 
20 1.952  1.898 1923 94.280  1718 0.249 95  0.344 . . . . . 'X-RAY DIFFRACTION' 
20 2.012  1.952 1875 99.093  1779 0.231 79  0.277 . . . . . 'X-RAY DIFFRACTION' 
20 2.077  2.012 1867 99.946  1772 0.226 94  0.302 . . . . . 'X-RAY DIFFRACTION' 
20 2.149  2.077 1761 100.000 1653 0.208 108 0.237 . . . . . 'X-RAY DIFFRACTION' 
20 2.229  2.149 1698 100.000 1615 0.210 83  0.292 . . . . . 'X-RAY DIFFRACTION' 
20 2.319  2.229 1659 99.879  1567 0.203 90  0.240 . . . . . 'X-RAY DIFFRACTION' 
20 2.420  2.319 1566 100.000 1482 0.211 84  0.257 . . . . . 'X-RAY DIFFRACTION' 
20 2.536  2.420 1528 100.000 1452 0.205 76  0.222 . . . . . 'X-RAY DIFFRACTION' 
20 2.671  2.536 1427 100.000 1348 0.207 79  0.237 . . . . . 'X-RAY DIFFRACTION' 
20 2.829  2.671 1350 100.000 1273 0.209 77  0.217 . . . . . 'X-RAY DIFFRACTION' 
20 3.020  2.829 1296 99.923  1240 0.208 55  0.339 . . . . . 'X-RAY DIFFRACTION' 
20 3.255  3.020 1211 100.000 1145 0.202 66  0.239 . . . . . 'X-RAY DIFFRACTION' 
20 3.556  3.255 1104 99.909  1058 0.196 45  0.242 . . . . . 'X-RAY DIFFRACTION' 
20 3.959  3.556 1001 100.000 948  0.186 53  0.246 . . . . . 'X-RAY DIFFRACTION' 
20 4.540  3.959 913  100.000 870  0.160 43  0.193 . . . . . 'X-RAY DIFFRACTION' 
20 5.484  4.540 764  100.000 726  0.177 38  0.196 . . . . . 'X-RAY DIFFRACTION' 
20 7.459  5.484 628  100.000 602  0.244 26  0.229 . . . . . 'X-RAY DIFFRACTION' 
20 19.263 7.459 399  99.749  373  0.214 25  0.245 . . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3C5H 
_struct.title                     'Crystal structure of the Ras homolog domain of human GRLF1 (p190RhoGAP)' 
_struct.pdbx_descriptor           'Glucocorticoid receptor DNA-binding factor 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3C5H 
_struct_keywords.text            
;ras, gtpase, glucorticoid receptor, Structural Genomics Consortium, SGC, Alternative splicing, Anti-oncogene, Cell cycle, Cytoplasm, DNA-binding, GTPase activation, Nucleus, Phosphoprotein, Repressor, Transcription, Transcription regulation, SIGNALING PROTEIN
;
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'AUTHORS STATE THAT THE BIOLOGICAL UNIT OF THIS PROTEIN IS UNKNOWN.' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 40  ? ARG A 50  ? GLY A 34  ARG A 44  1 ? 11 
HELX_P HELX_P2  2  SER A 65  ? GLY A 70  ? SER A 59  GLY A 64  1 ? 6  
HELX_P HELX_P3  3  ARG A 115 ? LEU A 119 ? ARG A 109 LEU A 113 5 ? 5  
HELX_P HELX_P4  4  PRO A 121 ? ALA A 127 ? PRO A 115 ALA A 121 1 ? 7  
HELX_P HELX_P5  5  CYS A 141 ? LEU A 145 ? CYS A 135 LEU A 139 5 ? 5  
HELX_P HELX_P6  6  LEU A 147 ? PHE A 151 ? LEU A 141 PHE A 145 5 ? 5  
HELX_P HELX_P7  7  MET A 156 ? ASP A 158 ? MET A 150 ASP A 152 5 ? 3  
HELX_P HELX_P8  8  ASN A 179 ? THR A 197 ? ASN A 173 THR A 191 1 ? 19 
HELX_P HELX_P9  9  LYS A 207 ? GLY A 211 ? LYS A 201 GLY A 205 5 ? 5  
HELX_P HELX_P10 10 VAL A 212 ? SER A 225 ? VAL A 206 SER A 219 1 ? 14 
HELX_P HELX_P11 11 ASN A 241 ? LYS A 255 ? ASN A 235 LYS A 249 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A SER 42  OG  ? ? ? 1_555 B MG  . MG  ? ? A SER 36  A MG  302 1_555 ? ? ? ? ? ? ? 2.111 ? 
metalc2  metalc ? ? A GLU 101 OE2 ? ? ? 1_555 B MG  . MG  ? ? A GLU 95  A MG  302 1_555 ? ? ? ? ? ? ? 2.163 ? 
metalc3  metalc ? ? B MG  .   MG  ? ? ? 1_555 D GNP . O2G ? ? A MG  302 A GNP 301 1_555 ? ? ? ? ? ? ? 1.991 ? 
metalc4  metalc ? ? B MG  .   MG  ? ? ? 1_555 J HOH . O   ? ? A MG  302 A HOH 390 1_555 ? ? ? ? ? ? ? 2.096 ? 
metalc5  metalc ? ? B MG  .   MG  ? ? ? 1_555 D GNP . O2B ? ? A MG  302 A GNP 301 1_555 ? ? ? ? ? ? ? 2.090 ? 
metalc6  metalc ? ? B MG  .   MG  ? ? ? 1_555 J HOH . O   ? ? A MG  302 A HOH 389 1_555 ? ? ? ? ? ? ? 2.155 ? 
metalc7  metalc ? ? C MG  .   MG  ? ? ? 1_555 J HOH . O   ? ? A MG  303 A HOH 328 1_555 ? ? ? ? ? ? ? 2.114 ? 
metalc8  metalc ? ? C MG  .   MG  ? ? ? 1_555 J HOH . O   ? ? A MG  303 A HOH 337 1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc9  metalc ? ? C MG  .   MG  ? ? ? 1_555 J HOH . O   ? ? A MG  303 A HOH 318 1_555 ? ? ? ? ? ? ? 1.967 ? 
metalc10 metalc ? ? C MG  .   MG  ? ? ? 1_555 J HOH . O   ? ? A MG  303 A HOH 314 1_555 ? ? ? ? ? ? ? 1.960 ? 
metalc11 metalc ? ? C MG  .   MG  ? ? ? 1_555 J HOH . O   ? ? A MG  303 A HOH 312 1_555 ? ? ? ? ? ? ? 2.123 ? 
metalc12 metalc ? ? C MG  .   MG  ? ? ? 1_555 J HOH . O   ? ? A MG  303 A HOH 323 1_555 ? ? ? ? ? ? ? 2.164 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? parallel      
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 79  ? VAL A 85  ? PHE A 73  VAL A 79  
A 2 MET A 97  ? GLN A 102 ? MET A 91  GLN A 96  
A 3 TYR A 20  ? GLY A 26  ? TYR A 14  GLY A 20  
A 4 GLY A 165 ? ASP A 171 ? GLY A 159 ASP A 165 
A 5 ILE A 201 ? THR A 206 ? ILE A 195 THR A 200 
A 6 VAL A 231 ? GLU A 233 ? VAL A 225 GLU A 227 
B 1 VAL A 63  ? LEU A 64  ? VAL A 57  LEU A 58  
B 2 ILE A 106 ? ASP A 107 ? ILE A 100 ASP A 101 
C 1 LYS A 130 ? ALA A 132 ? LYS A 124 ALA A 126 
C 2 LYS A 160 ? LEU A 162 ? LYS A 154 LEU A 156 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TRP A 82  ? N TRP A 76  O ILE A 99  ? O ILE A 93  
A 2 3 O VAL A 100 ? O VAL A 94  N VAL A 24  ? N VAL A 18  
A 3 4 N VAL A 25  ? N VAL A 19  O GLY A 169 ? O GLY A 163 
A 4 5 N LEU A 168 ? N LEU A 162 O VAL A 202 ? O VAL A 196 
A 5 6 N VAL A 203 ? N VAL A 197 O VAL A 232 ? O VAL A 226 
B 1 2 N LEU A 64  ? N LEU A 58  O ILE A 106 ? O ILE A 100 
C 1 2 N LEU A 131 ? N LEU A 125 O LEU A 161 ? O LEU A 155 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 302'  
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 303'  
AC3 Software ? ? ? ? 26 'BINDING SITE FOR RESIDUE GNP A 301' 
AC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE UNX A 304' 
AC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE UNX A 305' 
AC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE UNX A 307' 
AC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE UNX A 308' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  SER A 42  ? SER A 36  . ? 1_555 ? 
2  AC1 5  GLU A 101 ? GLU A 95  . ? 1_555 ? 
3  AC1 5  GNP D .   ? GNP A 301 . ? 1_555 ? 
4  AC1 5  HOH J .   ? HOH A 389 . ? 1_555 ? 
5  AC1 5  HOH J .   ? HOH A 390 . ? 1_555 ? 
6  AC2 6  HOH J .   ? HOH A 312 . ? 1_555 ? 
7  AC2 6  HOH J .   ? HOH A 314 . ? 1_555 ? 
8  AC2 6  HOH J .   ? HOH A 318 . ? 1_555 ? 
9  AC2 6  HOH J .   ? HOH A 323 . ? 1_555 ? 
10 AC2 6  HOH J .   ? HOH A 328 . ? 1_555 ? 
11 AC2 6  HOH J .   ? HOH A 337 . ? 1_555 ? 
12 AC3 26 LYS A 34  ? LYS A 28  . ? 1_555 ? 
13 AC3 26 GLY A 38  ? GLY A 32  . ? 1_555 ? 
14 AC3 26 ILE A 39  ? ILE A 33  . ? 1_555 ? 
15 AC3 26 GLY A 40  ? GLY A 34  . ? 1_555 ? 
16 AC3 26 LYS A 41  ? LYS A 35  . ? 1_555 ? 
17 AC3 26 SER A 42  ? SER A 36  . ? 1_555 ? 
18 AC3 26 CYS A 43  ? CYS A 37  . ? 1_555 ? 
19 AC3 26 LEU A 58  ? LEU A 52  . ? 1_555 ? 
20 AC3 26 ASP A 59  ? ASP A 53  . ? 1_555 ? 
21 AC3 26 SER A 62  ? SER A 56  . ? 1_555 ? 
22 AC3 26 GLU A 101 ? GLU A 95  . ? 1_555 ? 
23 AC3 26 THR A 103 ? THR A 97  . ? 1_555 ? 
24 AC3 26 LYS A 207 ? LYS A 201 . ? 1_555 ? 
25 AC3 26 ASP A 209 ? ASP A 203 . ? 1_555 ? 
26 AC3 26 SER A 235 ? SER A 229 . ? 1_555 ? 
27 AC3 26 ALA A 236 ? ALA A 230 . ? 1_555 ? 
28 AC3 26 ARG A 237 ? ARG A 231 . ? 1_555 ? 
29 AC3 26 MG  B .   ? MG  A 302 . ? 1_555 ? 
30 AC3 26 HOH J .   ? HOH A 311 . ? 1_555 ? 
31 AC3 26 HOH J .   ? HOH A 316 . ? 1_555 ? 
32 AC3 26 HOH J .   ? HOH A 319 . ? 1_555 ? 
33 AC3 26 HOH J .   ? HOH A 389 . ? 1_555 ? 
34 AC3 26 HOH J .   ? HOH A 390 . ? 1_555 ? 
35 AC3 26 HOH J .   ? HOH A 394 . ? 1_555 ? 
36 AC3 26 HOH J .   ? HOH A 395 . ? 1_555 ? 
37 AC3 26 HOH J .   ? HOH A 396 . ? 1_555 ? 
38 AC4 2  TYR A 122 ? TYR A 116 . ? 1_555 ? 
39 AC4 2  ILE A 123 ? ILE A 117 . ? 1_555 ? 
40 AC5 3  VAL A 49  ? VAL A 43  . ? 1_555 ? 
41 AC5 3  ARG A 50  ? ARG A 44  . ? 1_555 ? 
42 AC5 3  MET A 138 ? MET A 132 . ? 1_555 ? 
43 AC6 3  ASN A 241 ? ASN A 235 . ? 1_555 ? 
44 AC6 3  ASP A 243 ? ASP A 237 . ? 1_555 ? 
45 AC6 3  LEU A 244 ? LEU A 238 . ? 1_555 ? 
46 AC7 2  PHE A 48  ? PHE A 42  . ? 1_555 ? 
47 AC7 2  ASP A 243 ? ASP A 237 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3C5H 
_atom_sites.fract_transf_matrix[1][1]   0.009178 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009178 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019486 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
X  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ARG A 1 11  ? 32.565 36.830 -11.457 1.00 38.79 ? 5   ARG A N     1 
ATOM   2    C  CA    . ARG A 1 11  ? 32.273 36.077 -12.720 1.00 37.21 ? 5   ARG A CA    1 
ATOM   3    C  C     . ARG A 1 11  ? 31.900 34.625 -12.416 1.00 30.92 ? 5   ARG A C     1 
ATOM   4    O  O     . ARG A 1 11  ? 32.376 33.987 -11.429 1.00 28.39 ? 5   ARG A O     1 
ATOM   5    C  CB    . ARG A 1 11  ? 33.424 36.156 -13.721 1.00 39.26 ? 5   ARG A CB    1 
ATOM   6    N  N     . GLU A 1 12  ? 31.019 34.117 -13.264 1.00 24.66 ? 6   GLU A N     1 
ATOM   7    C  CA    . GLU A 1 12  ? 30.280 32.909 -12.984 1.00 25.04 ? 6   GLU A CA    1 
ATOM   8    C  C     . GLU A 1 12  ? 31.182 31.663 -13.043 1.00 20.19 ? 6   GLU A C     1 
ATOM   9    O  O     . GLU A 1 12  ? 30.861 30.652 -12.480 1.00 24.66 ? 6   GLU A O     1 
ATOM   10   C  CB    . GLU A 1 12  ? 29.146 32.745 -13.996 1.00 29.05 ? 6   GLU A CB    1 
ATOM   11   C  CG    . GLU A 1 12  ? 28.206 31.583 -13.706 1.00 32.19 ? 6   GLU A CG    1 
ATOM   12   N  N     . ASN A 1 13  ? 32.269 31.758 -13.792 1.00 24.36 ? 7   ASN A N     1 
ATOM   13   C  CA    . ASN A 1 13  ? 33.146 30.600 -14.023 1.00 24.60 ? 7   ASN A CA    1 
ATOM   14   C  C     . ASN A 1 13  ? 34.110 30.339 -12.852 1.00 26.03 ? 7   ASN A C     1 
ATOM   15   O  O     . ASN A 1 13  ? 34.761 29.289 -12.780 1.00 22.31 ? 7   ASN A O     1 
ATOM   16   C  CB    . ASN A 1 13  ? 33.928 30.808 -15.326 1.00 24.04 ? 7   ASN A CB    1 
ATOM   17   C  CG    . ASN A 1 13  ? 33.081 30.521 -16.578 1.00 27.67 ? 7   ASN A CG    1 
ATOM   18   O  OD1   . ASN A 1 13  ? 31.914 30.161 -16.465 1.00 30.41 ? 7   ASN A OD1   1 
ATOM   19   N  ND2   . ASN A 1 13  ? 33.689 30.654 -17.782 1.00 29.60 ? 7   ASN A ND2   1 
ATOM   20   N  N     . LEU A 1 14  ? 34.210 31.297 -11.936 1.00 25.76 ? 8   LEU A N     1 
ATOM   21   C  CA    . LEU A 1 14  ? 35.119 31.159 -10.797 1.00 26.87 ? 8   LEU A CA    1 
ATOM   22   C  C     . LEU A 1 14  ? 34.551 30.278 -9.678  1.00 24.60 ? 8   LEU A C     1 
ATOM   23   O  O     . LEU A 1 14  ? 33.327 30.146 -9.487  1.00 22.64 ? 8   LEU A O     1 
ATOM   24   C  CB    . LEU A 1 14  ? 35.563 32.547 -10.294 1.00 31.67 ? 8   LEU A CB    1 
ATOM   25   C  CG    . LEU A 1 14  ? 36.239 33.471 -11.323 1.00 32.71 ? 8   LEU A CG    1 
ATOM   26   C  CD1   . LEU A 1 14  ? 36.723 34.747 -10.680 1.00 35.11 ? 8   LEU A CD1   1 
ATOM   27   C  CD2   . LEU A 1 14  ? 37.391 32.789 -12.033 1.00 34.67 ? 8   LEU A CD2   1 
ATOM   28   N  N     . TYR A 1 15  ? 35.467 29.620 -8.965  1.00 24.72 ? 9   TYR A N     1 
ATOM   29   C  CA    . TYR A 1 15  ? 35.124 28.753 -7.888  1.00 24.93 ? 9   TYR A CA    1 
ATOM   30   C  C     . TYR A 1 15  ? 34.434 29.529 -6.757  1.00 21.83 ? 9   TYR A C     1 
ATOM   31   O  O     . TYR A 1 15  ? 33.331 29.188 -6.372  1.00 23.50 ? 9   TYR A O     1 
ATOM   32   C  CB    . TYR A 1 15  ? 36.396 28.021 -7.354  1.00 24.94 ? 9   TYR A CB    1 
ATOM   33   C  CG    . TYR A 1 15  ? 36.080 27.038 -6.302  1.00 24.29 ? 9   TYR A CG    1 
ATOM   34   C  CD1   . TYR A 1 15  ? 35.401 25.889 -6.620  1.00 26.20 ? 9   TYR A CD1   1 
ATOM   35   C  CD2   . TYR A 1 15  ? 36.438 27.258 -4.956  1.00 25.97 ? 9   TYR A CD2   1 
ATOM   36   C  CE1   . TYR A 1 15  ? 35.074 24.991 -5.677  1.00 29.56 ? 9   TYR A CE1   1 
ATOM   37   C  CE2   . TYR A 1 15  ? 36.102 26.345 -3.986  1.00 27.29 ? 9   TYR A CE2   1 
ATOM   38   C  CZ    . TYR A 1 15  ? 35.417 25.209 -4.368  1.00 28.57 ? 9   TYR A CZ    1 
ATOM   39   O  OH    . TYR A 1 15  ? 35.060 24.260 -3.465  1.00 33.25 ? 9   TYR A OH    1 
ATOM   40   N  N     . PHE A 1 16  ? 35.141 30.529 -6.219  1.00 26.99 ? 10  PHE A N     1 
ATOM   41   C  CA    . PHE A 1 16  ? 34.624 31.485 -5.197  1.00 31.27 ? 10  PHE A CA    1 
ATOM   42   C  C     . PHE A 1 16  ? 34.463 32.801 -5.882  1.00 30.87 ? 10  PHE A C     1 
ATOM   43   O  O     . PHE A 1 16  ? 35.411 33.294 -6.471  1.00 33.04 ? 10  PHE A O     1 
ATOM   44   C  CB    . PHE A 1 16  ? 35.654 31.749 -4.084  1.00 37.84 ? 10  PHE A CB    1 
ATOM   45   C  CG    . PHE A 1 16  ? 35.824 30.639 -3.117  1.00 39.35 ? 10  PHE A CG    1 
ATOM   46   C  CD1   . PHE A 1 16  ? 34.732 30.073 -2.480  1.00 40.76 ? 10  PHE A CD1   1 
ATOM   47   C  CD2   . PHE A 1 16  ? 37.108 30.174 -2.792  1.00 43.39 ? 10  PHE A CD2   1 
ATOM   48   C  CE1   . PHE A 1 16  ? 34.890 29.048 -1.556  1.00 41.22 ? 10  PHE A CE1   1 
ATOM   49   C  CE2   . PHE A 1 16  ? 37.282 29.139 -1.859  1.00 42.16 ? 10  PHE A CE2   1 
ATOM   50   C  CZ    . PHE A 1 16  ? 36.165 28.576 -1.243  1.00 42.49 ? 10  PHE A CZ    1 
ATOM   51   N  N     . GLN A 1 17  ? 33.292 33.417 -5.797  1.00 29.67 ? 11  GLN A N     1 
ATOM   52   C  CA    . GLN A 1 17  ? 33.153 34.768 -6.309  1.00 26.77 ? 11  GLN A CA    1 
ATOM   53   C  C     . GLN A 1 17  ? 33.831 35.803 -5.383  1.00 30.15 ? 11  GLN A C     1 
ATOM   54   O  O     . GLN A 1 17  ? 34.115 36.897 -5.820  1.00 34.11 ? 11  GLN A O     1 
ATOM   55   C  CB    . GLN A 1 17  ? 31.696 35.131 -6.615  1.00 26.19 ? 11  GLN A CB    1 
ATOM   56   C  CG    . GLN A 1 17  ? 30.686 35.062 -5.448  1.00 24.26 ? 11  GLN A CG    1 
ATOM   57   C  CD    . GLN A 1 17  ? 29.316 35.462 -5.928  1.00 25.09 ? 11  GLN A CD    1 
ATOM   58   O  OE1   . GLN A 1 17  ? 28.737 34.796 -6.773  1.00 20.39 ? 11  GLN A OE1   1 
ATOM   59   N  NE2   . GLN A 1 17  ? 28.807 36.589 -5.438  1.00 25.37 ? 11  GLN A NE2   1 
ATOM   60   N  N     . GLY A 1 18  ? 34.081 35.450 -4.124  1.00 30.43 ? 12  GLY A N     1 
ATOM   61   C  CA    . GLY A 1 18  ? 34.936 36.243 -3.248  1.00 33.92 ? 12  GLY A CA    1 
ATOM   62   C  C     . GLY A 1 18  ? 34.222 37.385 -2.514  1.00 32.52 ? 12  GLY A C     1 
ATOM   63   O  O     . GLY A 1 18  ? 34.528 37.647 -1.351  1.00 35.27 ? 12  GLY A O     1 
ATOM   64   N  N     . THR A 1 19  ? 33.316 38.075 -3.205  1.00 31.09 ? 13  THR A N     1 
ATOM   65   C  CA    . THR A 1 19  ? 32.411 39.050 -2.560  1.00 29.66 ? 13  THR A CA    1 
ATOM   66   C  C     . THR A 1 19  ? 30.948 38.579 -2.633  1.00 26.38 ? 13  THR A C     1 
ATOM   67   O  O     . THR A 1 19  ? 30.515 38.061 -3.660  1.00 24.06 ? 13  THR A O     1 
ATOM   68   C  CB    . THR A 1 19  ? 32.573 40.378 -3.215  1.00 30.31 ? 13  THR A CB    1 
ATOM   69   O  OG1   . THR A 1 19  ? 33.987 40.654 -3.314  1.00 33.88 ? 13  THR A OG1   1 
ATOM   70   C  CG2   . THR A 1 19  ? 31.889 41.472 -2.378  1.00 30.20 ? 13  THR A CG2   1 
ATOM   71   N  N     . TYR A 1 20  ? 30.205 38.753 -1.533  1.00 23.36 ? 14  TYR A N     1 
ATOM   72   C  CA    . TYR A 1 20  ? 28.845 38.195 -1.356  1.00 22.39 ? 14  TYR A CA    1 
ATOM   73   C  C     . TYR A 1 20  ? 27.971 39.310 -0.783  1.00 17.48 ? 14  TYR A C     1 
ATOM   74   O  O     . TYR A 1 20  ? 28.206 39.735 0.314   1.00 18.33 ? 14  TYR A O     1 
ATOM   75   C  CB    . TYR A 1 20  ? 28.863 37.007 -0.406  1.00 22.07 ? 14  TYR A CB    1 
ATOM   76   C  CG    . TYR A 1 20  ? 29.832 35.948 -0.917  1.00 22.40 ? 14  TYR A CG    1 
ATOM   77   C  CD1   . TYR A 1 20  ? 29.389 34.901 -1.722  1.00 22.58 ? 14  TYR A CD1   1 
ATOM   78   C  CD2   . TYR A 1 20  ? 31.205 36.073 -0.669  1.00 23.78 ? 14  TYR A CD2   1 
ATOM   79   C  CE1   . TYR A 1 20  ? 30.298 33.929 -2.222  1.00 22.37 ? 14  TYR A CE1   1 
ATOM   80   C  CE2   . TYR A 1 20  ? 32.120 35.139 -1.195  1.00 25.36 ? 14  TYR A CE2   1 
ATOM   81   C  CZ    . TYR A 1 20  ? 31.659 34.089 -1.961  1.00 21.80 ? 14  TYR A CZ    1 
ATOM   82   O  OH    . TYR A 1 20  ? 32.602 33.204 -2.456  1.00 25.77 ? 14  TYR A OH    1 
ATOM   83   N  N     . ASN A 1 21  ? 27.023 39.765 -1.562  1.00 17.58 ? 15  ASN A N     1 
ATOM   84   C  CA    . ASN A 1 21  ? 26.063 40.781 -1.082  1.00 18.20 ? 15  ASN A CA    1 
ATOM   85   C  C     . ASN A 1 21  ? 24.822 40.066 -0.627  1.00 15.23 ? 15  ASN A C     1 
ATOM   86   O  O     . ASN A 1 21  ? 24.135 39.418 -1.426  1.00 16.57 ? 15  ASN A O     1 
ATOM   87   C  CB    . ASN A 1 21  ? 25.773 41.761 -2.191  1.00 18.28 ? 15  ASN A CB    1 
ATOM   88   C  CG    . ASN A 1 21  ? 27.020 42.419 -2.716  1.00 15.91 ? 15  ASN A CG    1 
ATOM   89   O  OD1   . ASN A 1 21  ? 27.922 42.744 -1.947  1.00 21.31 ? 15  ASN A OD1   1 
ATOM   90   N  ND2   . ASN A 1 21  ? 27.101 42.590 -4.045  1.00 19.85 ? 15  ASN A ND2   1 
ATOM   91   N  N     . ILE A 1 22  ? 24.532 40.173 0.665   1.00 18.59 ? 16  ILE A N     1 
ATOM   92   C  CA    . ILE A 1 22  ? 23.471 39.383 1.297   1.00 15.13 ? 16  ILE A CA    1 
ATOM   93   C  C     . ILE A 1 22  ? 22.387 40.351 1.802   1.00 17.80 ? 16  ILE A C     1 
ATOM   94   O  O     . ILE A 1 22  ? 22.697 41.316 2.512   1.00 17.49 ? 16  ILE A O     1 
ATOM   95   C  CB    . ILE A 1 22  ? 24.039 38.574 2.446   1.00 17.45 ? 16  ILE A CB    1 
ATOM   96   C  CG1   . ILE A 1 22  ? 24.991 37.468 1.889   1.00 17.44 ? 16  ILE A CG1   1 
ATOM   97   C  CG2   . ILE A 1 22  ? 22.953 37.938 3.340   1.00 15.12 ? 16  ILE A CG2   1 
ATOM   98   C  CD1   . ILE A 1 22  ? 25.850 36.823 2.958   1.00 18.01 ? 16  ILE A CD1   1 
ATOM   99   N  N     . SER A 1 23  ? 21.144 40.065 1.425   1.00 17.57 ? 17  SER A N     1 
ATOM   100  C  CA    . SER A 1 23  ? 20.017 40.875 1.833   1.00 17.59 ? 17  SER A CA    1 
ATOM   101  C  C     . SER A 1 23  ? 19.186 40.074 2.824   1.00 15.86 ? 17  SER A C     1 
ATOM   102  O  O     . SER A 1 23  ? 18.716 38.962 2.535   1.00 16.37 ? 17  SER A O     1 
ATOM   103  C  CB    . SER A 1 23  ? 19.226 41.307 0.561   1.00 19.04 ? 17  SER A CB    1 
ATOM   104  O  OG    . SER A 1 23  ? 18.061 41.990 0.895   1.00 18.05 ? 17  SER A OG    1 
ATOM   105  N  N     . VAL A 1 24  ? 18.983 40.668 3.997   1.00 16.47 ? 18  VAL A N     1 
ATOM   106  C  CA    . VAL A 1 24  ? 18.205 40.087 5.062   1.00 15.45 ? 18  VAL A CA    1 
ATOM   107  C  C     . VAL A 1 24  ? 16.795 40.711 5.054   1.00 17.44 ? 18  VAL A C     1 
ATOM   108  O  O     . VAL A 1 24  ? 16.673 41.901 5.173   1.00 15.89 ? 18  VAL A O     1 
ATOM   109  C  CB    . VAL A 1 24  ? 18.878 40.278 6.416   1.00 15.38 ? 18  VAL A CB    1 
ATOM   110  C  CG1   . VAL A 1 24  ? 18.010 39.642 7.539   1.00 15.83 ? 18  VAL A CG1   1 
ATOM   111  C  CG2   . VAL A 1 24  ? 20.305 39.630 6.394   1.00 14.95 ? 18  VAL A CG2   1 
ATOM   112  N  N     . VAL A 1 25  ? 15.789 39.856 4.924   1.00 16.27 ? 19  VAL A N     1 
ATOM   113  C  CA    . VAL A 1 25  ? 14.388 40.229 4.698   1.00 17.78 ? 19  VAL A CA    1 
ATOM   114  C  C     . VAL A 1 25  ? 13.488 39.440 5.640   1.00 17.02 ? 19  VAL A C     1 
ATOM   115  O  O     . VAL A 1 25  ? 13.871 38.438 6.205   1.00 17.13 ? 19  VAL A O     1 
ATOM   116  C  CB    . VAL A 1 25  ? 13.985 39.983 3.226   1.00 13.72 ? 19  VAL A CB    1 
ATOM   117  C  CG1   . VAL A 1 25  ? 14.954 40.702 2.284   1.00 14.35 ? 19  VAL A CG1   1 
ATOM   118  C  CG2   . VAL A 1 25  ? 13.909 38.467 2.929   1.00 16.75 ? 19  VAL A CG2   1 
ATOM   119  N  N     . GLY A 1 26  ? 12.254 39.893 5.811   1.00 14.01 ? 20  GLY A N     1 
ATOM   120  C  CA    . GLY A 1 26  ? 11.304 39.234 6.699   1.00 14.37 ? 20  GLY A CA    1 
ATOM   121  C  C     . GLY A 1 26  ? 10.100 40.164 6.884   1.00 17.49 ? 20  GLY A C     1 
ATOM   122  O  O     . GLY A 1 26  ? 10.112 41.265 6.384   1.00 17.75 ? 20  GLY A O     1 
ATOM   123  N  N     . LEU A 1 27  ? 9.110  39.727 7.642   1.00 19.00 ? 21  LEU A N     1 
ATOM   124  C  CA    . LEU A 1 27  ? 7.950  40.610 7.951   1.00 20.70 ? 21  LEU A CA    1 
ATOM   125  C  C     . LEU A 1 27  ? 8.460  41.978 8.397   1.00 20.53 ? 21  LEU A C     1 
ATOM   126  O  O     . LEU A 1 27  ? 9.366  42.103 9.263   1.00 20.34 ? 21  LEU A O     1 
ATOM   127  C  CB    . LEU A 1 27  ? 7.040  39.943 8.988   1.00 20.36 ? 21  LEU A CB    1 
ATOM   128  C  CG    . LEU A 1 27  ? 5.831  40.740 9.496   1.00 23.82 ? 21  LEU A CG    1 
ATOM   129  C  CD1   . LEU A 1 27  ? 4.918  41.097 8.371   1.00 22.29 ? 21  LEU A CD1   1 
ATOM   130  C  CD2   . LEU A 1 27  ? 5.083  39.892 10.543  1.00 27.67 ? 21  LEU A CD2   1 
ATOM   131  N  N     . SER A 1 28  ? 7.941  43.042 7.764   1.00 19.30 ? 22  SER A N     1 
ATOM   132  C  CA    . SER A 1 28  ? 8.358  44.391 8.112   1.00 19.57 ? 22  SER A CA    1 
ATOM   133  C  C     . SER A 1 28  ? 7.141  45.303 7.865   1.00 18.72 ? 22  SER A C     1 
ATOM   134  O  O     . SER A 1 28  ? 6.263  44.905 7.152   1.00 19.28 ? 22  SER A O     1 
ATOM   135  C  CB    . SER A 1 28  ? 9.566  44.880 7.283   1.00 23.77 ? 22  SER A CB    1 
ATOM   136  O  OG    . SER A 1 28  ? 10.627 43.897 7.225   1.00 22.34 ? 22  SER A OG    1 
ATOM   137  N  N     . GLY A 1 29  ? 7.168  46.471 8.493   1.00 24.08 ? 23  GLY A N     1 
ATOM   138  C  CA    . GLY A 1 29  ? 6.160  47.532 8.283   1.00 30.30 ? 23  GLY A CA    1 
ATOM   139  C  C     . GLY A 1 29  ? 6.065  48.557 9.421   1.00 34.28 ? 23  GLY A C     1 
ATOM   140  O  O     . GLY A 1 29  ? 7.094  49.010 9.996   1.00 32.27 ? 23  GLY A O     1 
ATOM   141  N  N     . THR A 1 30  ? 4.815  48.926 9.735   1.00 34.64 ? 24  THR A N     1 
ATOM   142  C  CA    . THR A 1 30  ? 4.511  49.815 10.853  1.00 32.43 ? 24  THR A CA    1 
ATOM   143  C  C     . THR A 1 30  ? 4.624  49.060 12.190  1.00 32.80 ? 24  THR A C     1 
ATOM   144  O  O     . THR A 1 30  ? 4.506  47.807 12.252  1.00 31.41 ? 24  THR A O     1 
ATOM   145  C  CB    . THR A 1 30  ? 3.103  50.510 10.721  1.00 31.49 ? 24  THR A CB    1 
ATOM   146  O  OG1   . THR A 1 30  ? 2.045  49.544 10.928  1.00 31.73 ? 24  THR A OG1   1 
ATOM   147  C  CG2   . THR A 1 30  ? 2.951  51.207 9.326   1.00 34.64 ? 24  THR A CG2   1 
ATOM   148  N  N     . GLU A 1 31  ? 4.884  49.828 13.250  1.00 31.22 ? 25  GLU A N     1 
ATOM   149  C  CA    . GLU A 1 31  ? 4.850  49.294 14.610  1.00 30.68 ? 25  GLU A CA    1 
ATOM   150  C  C     . GLU A 1 31  ? 3.631  48.390 14.802  1.00 29.56 ? 25  GLU A C     1 
ATOM   151  O  O     . GLU A 1 31  ? 3.765  47.267 15.307  1.00 35.02 ? 25  GLU A O     1 
ATOM   152  C  CB    . GLU A 1 31  ? 4.861  50.427 15.646  1.00 31.34 ? 25  GLU A CB    1 
ATOM   153  C  CG    . GLU A 1 31  ? 6.107  51.280 15.623  1.00 31.85 ? 25  GLU A CG    1 
ATOM   154  N  N     . LYS A 1 32  ? 2.436  48.861 14.386  1.00 31.20 ? 26  LYS A N     1 
ATOM   155  C  CA    . LYS A 1 32  ? 1.182  48.083 14.540  1.00 30.73 ? 26  LYS A CA    1 
ATOM   156  C  C     . LYS A 1 32  ? 1.203  46.734 13.783  1.00 32.19 ? 26  LYS A C     1 
ATOM   157  O  O     . LYS A 1 32  ? 0.817  45.691 14.338  1.00 34.44 ? 26  LYS A O     1 
ATOM   158  C  CB    . LYS A 1 32  ? -0.026 48.937 14.106  1.00 27.65 ? 26  LYS A CB    1 
ATOM   159  N  N     . GLU A 1 33  ? 1.657  46.752 12.516  1.00 34.73 ? 27  GLU A N     1 
ATOM   160  C  CA    . GLU A 1 33  ? 1.818  45.514 11.721  1.00 35.88 ? 27  GLU A CA    1 
ATOM   161  C  C     . GLU A 1 33  ? 2.885  44.578 12.307  1.00 38.15 ? 27  GLU A C     1 
ATOM   162  O  O     . GLU A 1 33  ? 2.871  43.389 12.018  1.00 43.16 ? 27  GLU A O     1 
ATOM   163  C  CB    . GLU A 1 33  ? 2.182  45.827 10.259  1.00 36.08 ? 27  GLU A CB    1 
ATOM   164  C  CG    . GLU A 1 33  ? 1.147  46.690 9.514   1.00 35.09 ? 27  GLU A CG    1 
ATOM   165  C  CD    . GLU A 1 33  ? 1.628  47.171 8.160   1.00 36.61 ? 27  GLU A CD    1 
ATOM   166  O  OE1   . GLU A 1 33  ? 2.827  47.446 7.962   1.00 34.47 ? 27  GLU A OE1   1 
ATOM   167  O  OE2   . GLU A 1 33  ? 0.769  47.315 7.278   1.00 41.94 ? 27  GLU A OE2   1 
ATOM   168  N  N     . LYS A 1 34  ? 3.819  45.125 13.088  1.00 39.44 ? 28  LYS A N     1 
ATOM   169  C  CA    . LYS A 1 34  ? 4.819  44.324 13.824  1.00 38.52 ? 28  LYS A CA    1 
ATOM   170  C  C     . LYS A 1 34  ? 4.456  44.111 15.327  1.00 39.98 ? 28  LYS A C     1 
ATOM   171  O  O     . LYS A 1 34  ? 5.282  43.633 16.122  1.00 39.19 ? 28  LYS A O     1 
ATOM   172  C  CB    . LYS A 1 34  ? 6.198  45.010 13.760  1.00 35.55 ? 28  LYS A CB    1 
ATOM   173  C  CG    . LYS A 1 34  ? 6.793  45.187 12.396  1.00 32.65 ? 28  LYS A CG    1 
ATOM   174  C  CD    . LYS A 1 34  ? 8.133  45.941 12.499  1.00 36.25 ? 28  LYS A CD    1 
ATOM   175  C  CE    . LYS A 1 34  ? 8.008  47.218 13.326  1.00 34.29 ? 28  LYS A CE    1 
ATOM   176  N  NZ    . LYS A 1 34  ? 8.939  48.277 12.967  1.00 34.13 ? 28  LYS A NZ    1 
ATOM   177  N  N     . GLY A 1 35  ? 3.250  44.509 15.736  1.00 40.25 ? 29  GLY A N     1 
ATOM   178  C  CA    . GLY A 1 35  ? 2.876  44.434 17.146  1.00 36.75 ? 29  GLY A CA    1 
ATOM   179  C  C     . GLY A 1 35  ? 3.869  45.104 18.081  1.00 38.96 ? 29  GLY A C     1 
ATOM   180  O  O     . GLY A 1 35  ? 4.062  44.638 19.213  1.00 43.09 ? 29  GLY A O     1 
ATOM   181  N  N     . GLN A 1 36  ? 4.505  46.186 17.610  1.00 31.30 ? 30  GLN A N     1 
ATOM   182  C  CA    . GLN A 1 36  ? 5.602  46.875 18.320  1.00 31.04 ? 30  GLN A CA    1 
ATOM   183  C  C     . GLN A 1 36  ? 6.774  45.958 18.658  1.00 33.77 ? 30  GLN A C     1 
ATOM   184  O  O     . GLN A 1 36  ? 7.453  46.168 19.677  1.00 38.45 ? 30  GLN A O     1 
ATOM   185  C  CB    . GLN A 1 36  ? 5.136  47.576 19.594  1.00 29.95 ? 30  GLN A CB    1 
ATOM   186  N  N     . CYS A 1 37  ? 7.022  44.983 17.769  1.00 37.64 ? 31  CYS A N     1 
ATOM   187  C  CA    . CYS A 1 37  ? 8.088  44.011 17.931  1.00 32.32 ? 31  CYS A CA    1 
ATOM   188  C  C     . CYS A 1 37  ? 8.512  43.410 16.563  1.00 25.68 ? 31  CYS A C     1 
ATOM   189  O  O     . CYS A 1 37  ? 7.842  42.567 15.994  1.00 25.64 ? 31  CYS A O     1 
ATOM   190  C  CB    . CYS A 1 37  ? 7.643  42.925 18.883  1.00 37.79 ? 31  CYS A CB    1 
ATOM   191  S  SG    . CYS A 1 37  ? 8.934  41.859 19.301  1.00 39.71 ? 31  CYS A SG    1 
ATOM   192  N  N     . GLY A 1 38  ? 9.622  43.891 16.049  1.00 24.31 ? 32  GLY A N     1 
ATOM   193  C  CA    . GLY A 1 38  ? 10.146 43.383 14.791  1.00 21.87 ? 32  GLY A CA    1 
ATOM   194  C  C     . GLY A 1 38  ? 10.571 41.930 14.938  1.00 21.88 ? 32  GLY A C     1 
ATOM   195  O  O     . GLY A 1 38  ? 10.690 41.389 16.069  1.00 20.85 ? 32  GLY A O     1 
ATOM   196  N  N     . ILE A 1 39  ? 10.811 41.305 13.797  1.00 20.71 ? 33  ILE A N     1 
ATOM   197  C  CA    . ILE A 1 39  ? 11.053 39.870 13.744  1.00 19.29 ? 33  ILE A CA    1 
ATOM   198  C  C     . ILE A 1 39  ? 12.520 39.447 14.010  1.00 18.12 ? 33  ILE A C     1 
ATOM   199  O  O     . ILE A 1 39  ? 12.781 38.237 14.141  1.00 19.06 ? 33  ILE A O     1 
ATOM   200  C  CB    . ILE A 1 39  ? 10.502 39.242 12.426  1.00 19.74 ? 33  ILE A CB    1 
ATOM   201  C  CG1   . ILE A 1 39  ? 11.328 39.696 11.219  1.00 20.82 ? 33  ILE A CG1   1 
ATOM   202  C  CG2   . ILE A 1 39  ? 8.986  39.543 12.249  1.00 18.79 ? 33  ILE A CG2   1 
ATOM   203  C  CD1   . ILE A 1 39  ? 12.399 38.671 10.776  1.00 18.02 ? 33  ILE A CD1   1 
ATOM   204  N  N     . GLY A 1 40  ? 13.431 40.407 14.139  1.00 17.59 ? 34  GLY A N     1 
ATOM   205  C  CA    . GLY A 1 40  ? 14.829 40.165 14.495  1.00 19.45 ? 34  GLY A CA    1 
ATOM   206  C  C     . GLY A 1 40  ? 15.894 40.454 13.433  1.00 17.96 ? 34  GLY A C     1 
ATOM   207  O  O     . GLY A 1 40  ? 17.036 40.070 13.628  1.00 17.00 ? 34  GLY A O     1 
ATOM   208  N  N     . LYS A 1 41  ? 15.529 41.102 12.300  1.00 16.29 ? 35  LYS A N     1 
ATOM   209  C  CA    . LYS A 1 41  ? 16.481 41.396 11.226  1.00 17.60 ? 35  LYS A CA    1 
ATOM   210  C  C     . LYS A 1 41  ? 17.688 42.177 11.700  1.00 17.67 ? 35  LYS A C     1 
ATOM   211  O  O     . LYS A 1 41  ? 18.844 41.751 11.481  1.00 14.60 ? 35  LYS A O     1 
ATOM   212  C  CB    . LYS A 1 41  ? 15.845 42.169 10.035  1.00 15.43 ? 35  LYS A CB    1 
ATOM   213  C  CG    . LYS A 1 41  ? 14.613 41.535 9.458   1.00 16.93 ? 35  LYS A CG    1 
ATOM   214  C  CD    . LYS A 1 41  ? 14.053 42.339 8.290   1.00 15.10 ? 35  LYS A CD    1 
ATOM   215  C  CE    . LYS A 1 41  ? 13.408 43.622 8.676   1.00 15.01 ? 35  LYS A CE    1 
ATOM   216  N  NZ    . LYS A 1 41  ? 12.235 43.419 9.607   1.00 13.57 ? 35  LYS A NZ    1 
ATOM   217  N  N     . SER A 1 42  ? 17.443 43.311 12.332  1.00 14.73 ? 36  SER A N     1 
ATOM   218  C  CA    . SER A 1 42  ? 18.516 44.220 12.766  1.00 12.87 ? 36  SER A CA    1 
ATOM   219  C  C     . SER A 1 42  ? 19.468 43.563 13.767  1.00 15.82 ? 36  SER A C     1 
ATOM   220  O  O     . SER A 1 42  ? 20.669 43.670 13.623  1.00 18.97 ? 36  SER A O     1 
ATOM   221  C  CB    . SER A 1 42  ? 17.918 45.558 13.347  1.00 14.23 ? 36  SER A CB    1 
ATOM   222  O  OG    . SER A 1 42  ? 17.366 46.351 12.298  1.00 18.62 ? 36  SER A OG    1 
ATOM   223  N  N     . CYS A 1 43  ? 18.923 42.896 14.781  1.00 17.83 ? 37  CYS A N     1 
ATOM   224  C  CA    . CYS A 1 43  ? 19.775 42.244 15.778  1.00 17.95 ? 37  CYS A CA    1 
ATOM   225  C  C     . CYS A 1 43  ? 20.575 41.084 15.164  1.00 14.23 ? 37  CYS A C     1 
ATOM   226  O  O     . CYS A 1 43  ? 21.706 40.840 15.584  1.00 17.87 ? 37  CYS A O     1 
ATOM   227  C  CB    . CYS A 1 43  ? 18.980 41.754 16.965  1.00 17.30 ? 37  CYS A CB    1 
ATOM   228  S  SG    . CYS A 1 43  ? 18.255 43.054 17.947  1.00 21.77 ? 37  CYS A SG    1 
ATOM   229  N  N     . LEU A 1 44  ? 20.005 40.411 14.162  1.00 15.47 ? 38  LEU A N     1 
ATOM   230  C  CA    . LEU A 1 44  ? 20.718 39.335 13.473  1.00 16.12 ? 38  LEU A CA    1 
ATOM   231  C  C     . LEU A 1 44  ? 21.937 39.932 12.734  1.00 18.57 ? 38  LEU A C     1 
ATOM   232  O  O     . LEU A 1 44  ? 23.090 39.467 12.900  1.00 17.39 ? 38  LEU A O     1 
ATOM   233  C  CB    . LEU A 1 44  ? 19.760 38.511 12.577  1.00 17.91 ? 38  LEU A CB    1 
ATOM   234  C  CG    . LEU A 1 44  ? 20.436 37.365 11.765  1.00 17.23 ? 38  LEU A CG    1 
ATOM   235  C  CD1   . LEU A 1 44  ? 20.779 36.206 12.669  1.00 19.91 ? 38  LEU A CD1   1 
ATOM   236  C  CD2   . LEU A 1 44  ? 19.561 36.900 10.585  1.00 16.97 ? 38  LEU A CD2   1 
ATOM   237  N  N     . CYS A 1 45  ? 21.689 41.012 11.979  1.00 16.43 ? 39  CYS A N     1 
ATOM   238  C  CA    . CYS A 1 45  ? 22.719 41.713 11.223  1.00 16.22 ? 39  CYS A CA    1 
ATOM   239  C  C     . CYS A 1 45  ? 23.792 42.275 12.129  1.00 18.07 ? 39  CYS A C     1 
ATOM   240  O  O     . CYS A 1 45  ? 24.969 42.112 11.838  1.00 20.69 ? 39  CYS A O     1 
ATOM   241  C  CB    . CYS A 1 45  ? 22.071 42.809 10.374  1.00 18.52 ? 39  CYS A CB    1 
ATOM   242  S  SG    . CYS A 1 45  ? 21.110 42.142 8.982   1.00 17.43 ? 39  CYS A SG    1 
ATOM   243  N  N     . ASN A 1 46  ? 23.373 42.944 13.204  1.00 18.12 ? 40  ASN A N     1 
ATOM   244  C  CA    . ASN A 1 46  ? 24.266 43.588 14.163  1.00 18.89 ? 40  ASN A CA    1 
ATOM   245  C  C     . ASN A 1 46  ? 25.244 42.552 14.787  1.00 20.76 ? 40  ASN A C     1 
ATOM   246  O  O     . ASN A 1 46  ? 26.459 42.814 14.893  1.00 22.76 ? 40  ASN A O     1 
ATOM   247  C  CB    . ASN A 1 46  ? 23.383 44.234 15.241  1.00 20.66 ? 40  ASN A CB    1 
ATOM   248  C  CG    . ASN A 1 46  ? 24.144 45.072 16.262  1.00 24.26 ? 40  ASN A CG    1 
ATOM   249  O  OD1   . ASN A 1 46  ? 23.512 45.836 16.973  1.00 27.69 ? 40  ASN A OD1   1 
ATOM   250  N  ND2   . ASN A 1 46  ? 25.463 44.925 16.356  1.00 22.06 ? 40  ASN A ND2   1 
ATOM   251  N  N     . ARG A 1 47  ? 24.699 41.400 15.173  1.00 20.45 ? 41  ARG A N     1 
ATOM   252  C  CA    . ARG A 1 47  ? 25.509 40.349 15.812  1.00 22.82 ? 41  ARG A CA    1 
ATOM   253  C  C     . ARG A 1 47  ? 26.451 39.704 14.815  1.00 22.00 ? 41  ARG A C     1 
ATOM   254  O  O     . ARG A 1 47  ? 27.551 39.340 15.171  1.00 23.26 ? 41  ARG A O     1 
ATOM   255  C  CB    . ARG A 1 47  ? 24.640 39.300 16.483  1.00 19.72 ? 41  ARG A CB    1 
ATOM   256  C  CG    . ARG A 1 47  ? 25.452 38.172 17.151  1.00 23.76 ? 41  ARG A CG    1 
ATOM   257  C  CD    . ARG A 1 47  ? 26.154 38.662 18.408  1.00 23.47 ? 41  ARG A CD    1 
ATOM   258  N  NE    . ARG A 1 47  ? 25.223 38.663 19.527  1.00 26.59 ? 41  ARG A NE    1 
ATOM   259  C  CZ    . ARG A 1 47  ? 25.506 39.076 20.763  1.00 29.30 ? 41  ARG A CZ    1 
ATOM   260  N  NH1   . ARG A 1 47  ? 26.678 39.593 21.042  1.00 32.82 ? 41  ARG A NH1   1 
ATOM   261  N  NH2   . ARG A 1 47  ? 24.589 39.006 21.711  1.00 27.11 ? 41  ARG A NH2   1 
ATOM   262  N  N     . PHE A 1 48  ? 26.023 39.570 13.560  1.00 18.80 ? 42  PHE A N     1 
ATOM   263  C  CA    . PHE A 1 48  ? 26.910 39.060 12.525  1.00 21.71 ? 42  PHE A CA    1 
ATOM   264  C  C     . PHE A 1 48  ? 28.072 40.014 12.226  1.00 22.61 ? 42  PHE A C     1 
ATOM   265  O  O     . PHE A 1 48  ? 29.243 39.592 12.236  1.00 23.07 ? 42  PHE A O     1 
ATOM   266  C  CB    . PHE A 1 48  ? 26.164 38.703 11.231  1.00 20.18 ? 42  PHE A CB    1 
ATOM   267  C  CG    . PHE A 1 48  ? 27.075 38.122 10.157  1.00 18.84 ? 42  PHE A CG    1 
ATOM   268  C  CD1   . PHE A 1 48  ? 27.746 36.931 10.395  1.00 20.08 ? 42  PHE A CD1   1 
ATOM   269  C  CD2   . PHE A 1 48  ? 27.300 38.791 8.942   1.00 19.27 ? 42  PHE A CD2   1 
ATOM   270  C  CE1   . PHE A 1 48  ? 28.637 36.407 9.447   1.00 19.73 ? 42  PHE A CE1   1 
ATOM   271  C  CE2   . PHE A 1 48  ? 28.157 38.239 7.964   1.00 19.75 ? 42  PHE A CE2   1 
ATOM   272  C  CZ    . PHE A 1 48  ? 28.823 37.042 8.245   1.00 19.33 ? 42  PHE A CZ    1 
ATOM   273  N  N     . VAL A 1 49  ? 27.776 41.286 12.002  1.00 22.48 ? 43  VAL A N     1 
ATOM   274  C  CA    A VAL A 1 49  ? 28.791 42.256 11.575  0.50 23.94 ? 43  VAL A CA    1 
ATOM   275  C  CA    B VAL A 1 49  ? 28.809 42.251 11.574  0.50 22.43 ? 43  VAL A CA    1 
ATOM   276  C  C     . VAL A 1 49  ? 29.696 42.707 12.748  1.00 25.10 ? 43  VAL A C     1 
ATOM   277  O  O     . VAL A 1 49  ? 30.880 42.949 12.571  1.00 25.17 ? 43  VAL A O     1 
ATOM   278  C  CB    A VAL A 1 49  ? 28.132 43.498 10.869  0.50 24.07 ? 43  VAL A CB    1 
ATOM   279  C  CB    B VAL A 1 49  ? 28.225 43.518 10.811  0.50 22.08 ? 43  VAL A CB    1 
ATOM   280  C  CG1   A VAL A 1 49  ? 29.178 44.514 10.482  0.50 23.39 ? 43  VAL A CG1   1 
ATOM   281  C  CG1   B VAL A 1 49  ? 27.657 43.120 9.440   0.50 22.58 ? 43  VAL A CG1   1 
ATOM   282  C  CG2   A VAL A 1 49  ? 27.339 43.051 9.639   0.50 23.93 ? 43  VAL A CG2   1 
ATOM   283  C  CG2   B VAL A 1 49  ? 27.187 44.250 11.652  0.50 18.62 ? 43  VAL A CG2   1 
ATOM   284  N  N     . ARG A 1 50  ? 29.131 42.806 13.938  1.00 28.68 ? 44  ARG A N     1 
ATOM   285  C  CA    . ARG A 1 50  ? 29.849 43.345 15.103  1.00 29.00 ? 44  ARG A CA    1 
ATOM   286  C  C     . ARG A 1 50  ? 29.379 42.607 16.357  1.00 27.89 ? 44  ARG A C     1 
ATOM   287  O  O     . ARG A 1 50  ? 28.559 43.122 17.098  1.00 30.63 ? 44  ARG A O     1 
ATOM   288  C  CB    . ARG A 1 50  ? 29.603 44.849 15.241  1.00 29.64 ? 44  ARG A CB    1 
ATOM   289  C  CG    . ARG A 1 50  ? 30.310 45.712 14.199  1.00 29.10 ? 44  ARG A CG    1 
ATOM   290  C  CD    . ARG A 1 50  ? 29.961 47.200 14.352  1.00 30.68 ? 44  ARG A CD    1 
ATOM   291  N  NE    . ARG A 1 50  ? 28.560 47.441 14.062  1.00 29.83 ? 44  ARG A NE    1 
ATOM   292  C  CZ    . ARG A 1 50  ? 28.064 47.702 12.853  1.00 29.63 ? 44  ARG A CZ    1 
ATOM   293  N  NH1   . ARG A 1 50  ? 28.837 47.777 11.789  1.00 26.81 ? 44  ARG A NH1   1 
ATOM   294  N  NH2   . ARG A 1 50  ? 26.766 47.873 12.706  1.00 32.44 ? 44  ARG A NH2   1 
ATOM   295  N  N     . PRO A 1 51  ? 29.873 41.368 16.559  1.00 27.30 ? 45  PRO A N     1 
ATOM   296  C  CA    . PRO A 1 51  ? 29.372 40.430 17.571  1.00 30.55 ? 45  PRO A CA    1 
ATOM   297  C  C     . PRO A 1 51  ? 29.790 40.665 19.034  1.00 33.09 ? 45  PRO A C     1 
ATOM   298  O  O     . PRO A 1 51  ? 29.270 40.011 19.913  1.00 33.61 ? 45  PRO A O     1 
ATOM   299  C  CB    . PRO A 1 51  ? 29.927 39.084 17.102  1.00 28.88 ? 45  PRO A CB    1 
ATOM   300  C  CG    . PRO A 1 51  ? 31.088 39.404 16.296  1.00 29.97 ? 45  PRO A CG    1 
ATOM   301  C  CD    . PRO A 1 51  ? 30.932 40.769 15.739  1.00 28.46 ? 45  PRO A CD    1 
ATOM   302  N  N     . SER A 1 52  ? 30.713 41.583 19.269  1.00 36.05 ? 46  SER A N     1 
ATOM   303  C  CA    . SER A 1 52  ? 31.130 41.914 20.628  1.00 40.56 ? 46  SER A CA    1 
ATOM   304  C  C     . SER A 1 52  ? 29.992 42.529 21.422  1.00 43.25 ? 46  SER A C     1 
ATOM   305  O  O     . SER A 1 52  ? 29.206 43.338 20.890  1.00 41.87 ? 46  SER A O     1 
ATOM   306  C  CB    . SER A 1 52  ? 32.296 42.873 20.584  1.00 41.97 ? 46  SER A CB    1 
ATOM   307  O  OG    . SER A 1 52  ? 33.279 42.341 19.723  1.00 44.10 ? 46  SER A OG    1 
ATOM   308  N  N     . ALA A 1 53  ? 29.909 42.125 22.695  1.00 46.14 ? 47  ALA A N     1 
ATOM   309  C  CA    . ALA A 1 53  ? 28.893 42.613 23.636  1.00 46.86 ? 47  ALA A CA    1 
ATOM   310  C  C     . ALA A 1 53  ? 28.828 44.139 23.635  1.00 48.15 ? 47  ALA A C     1 
ATOM   311  O  O     . ALA A 1 53  ? 27.750 44.717 23.732  1.00 50.84 ? 47  ALA A O     1 
ATOM   312  C  CB    . ALA A 1 53  ? 29.196 42.093 25.052  1.00 45.99 ? 47  ALA A CB    1 
ATOM   313  N  N     . ASP A 1 54  ? 29.994 44.773 23.503  1.00 47.64 ? 48  ASP A N     1 
ATOM   314  C  CA    . ASP A 1 54  ? 30.119 46.233 23.493  1.00 47.54 ? 48  ASP A CA    1 
ATOM   315  C  C     . ASP A 1 54  ? 29.492 46.878 22.266  1.00 47.24 ? 48  ASP A C     1 
ATOM   316  O  O     . ASP A 1 54  ? 29.157 48.059 22.299  1.00 49.45 ? 48  ASP A O     1 
ATOM   317  C  CB    . ASP A 1 54  ? 31.596 46.634 23.550  1.00 49.05 ? 48  ASP A CB    1 
ATOM   318  N  N     . GLU A 1 55  ? 29.367 46.112 21.184  1.00 45.59 ? 49  GLU A N     1 
ATOM   319  C  CA    . GLU A 1 55  ? 28.866 46.629 19.905  1.00 43.98 ? 49  GLU A CA    1 
ATOM   320  C  C     . GLU A 1 55  ? 27.497 46.081 19.502  1.00 38.88 ? 49  GLU A C     1 
ATOM   321  O  O     . GLU A 1 55  ? 26.957 46.488 18.469  1.00 34.06 ? 49  GLU A O     1 
ATOM   322  C  CB    . GLU A 1 55  ? 29.894 46.349 18.806  1.00 46.90 ? 49  GLU A CB    1 
ATOM   323  C  CG    . GLU A 1 55  ? 31.106 47.295 18.873  1.00 49.38 ? 49  GLU A CG    1 
ATOM   324  C  CD    . GLU A 1 55  ? 31.952 47.263 17.612  1.00 51.46 ? 49  GLU A CD    1 
ATOM   325  O  OE1   . GLU A 1 55  ? 32.404 46.160 17.219  1.00 54.30 ? 49  GLU A OE1   1 
ATOM   326  O  OE2   . GLU A 1 55  ? 32.166 48.347 17.017  1.00 55.44 ? 49  GLU A OE2   1 
ATOM   327  N  N     . PHE A 1 56  ? 26.945 45.168 20.303  1.00 34.74 ? 50  PHE A N     1 
ATOM   328  C  CA    . PHE A 1 56  ? 25.621 44.598 20.031  1.00 34.67 ? 50  PHE A CA    1 
ATOM   329  C  C     . PHE A 1 56  ? 24.516 45.378 20.753  1.00 36.96 ? 50  PHE A C     1 
ATOM   330  O  O     . PHE A 1 56  ? 24.601 45.579 21.957  1.00 37.04 ? 50  PHE A O     1 
ATOM   331  C  CB    . PHE A 1 56  ? 25.585 43.122 20.441  1.00 34.63 ? 50  PHE A CB    1 
ATOM   332  C  CG    . PHE A 1 56  ? 24.237 42.486 20.261  1.00 35.32 ? 50  PHE A CG    1 
ATOM   333  C  CD1   . PHE A 1 56  ? 23.789 42.125 18.978  1.00 33.96 ? 50  PHE A CD1   1 
ATOM   334  C  CD2   . PHE A 1 56  ? 23.390 42.297 21.352  1.00 33.65 ? 50  PHE A CD2   1 
ATOM   335  C  CE1   . PHE A 1 56  ? 22.541 41.545 18.795  1.00 32.00 ? 50  PHE A CE1   1 
ATOM   336  C  CE2   . PHE A 1 56  ? 22.133 41.720 21.191  1.00 35.68 ? 50  PHE A CE2   1 
ATOM   337  C  CZ    . PHE A 1 56  ? 21.692 41.341 19.903  1.00 34.64 ? 50  PHE A CZ    1 
ATOM   338  N  N     . HIS A 1 57  ? 23.496 45.815 20.004  1.00 34.12 ? 51  HIS A N     1 
ATOM   339  C  CA    . HIS A 1 57  ? 22.338 46.529 20.541  1.00 35.27 ? 51  HIS A CA    1 
ATOM   340  C  C     . HIS A 1 57  ? 21.098 45.727 20.306  1.00 32.80 ? 51  HIS A C     1 
ATOM   341  O  O     . HIS A 1 57  ? 20.866 45.245 19.198  1.00 30.61 ? 51  HIS A O     1 
ATOM   342  C  CB    . HIS A 1 57  ? 22.123 47.892 19.873  1.00 38.84 ? 51  HIS A CB    1 
ATOM   343  C  CG    . HIS A 1 57  ? 23.316 48.783 19.902  1.00 42.51 ? 51  HIS A CG    1 
ATOM   344  N  ND1   . HIS A 1 57  ? 24.266 48.781 18.907  1.00 45.83 ? 51  HIS A ND1   1 
ATOM   345  C  CD2   . HIS A 1 57  ? 23.709 49.717 20.795  1.00 46.65 ? 51  HIS A CD2   1 
ATOM   346  C  CE1   . HIS A 1 57  ? 25.204 49.663 19.193  1.00 46.29 ? 51  HIS A CE1   1 
ATOM   347  N  NE2   . HIS A 1 57  ? 24.887 50.251 20.330  1.00 48.26 ? 51  HIS A NE2   1 
ATOM   348  N  N     . LEU A 1 58  ? 20.277 45.629 21.340  1.00 30.05 ? 52  LEU A N     1 
ATOM   349  C  CA    . LEU A 1 58  ? 19.048 44.892 21.289  1.00 33.14 ? 52  LEU A CA    1 
ATOM   350  C  C     . LEU A 1 58  ? 17.953 45.794 20.703  1.00 32.62 ? 52  LEU A C     1 
ATOM   351  O  O     . LEU A 1 58  ? 16.937 45.292 20.238  1.00 34.62 ? 52  LEU A O     1 
ATOM   352  C  CB    . LEU A 1 58  ? 18.668 44.427 22.705  1.00 37.23 ? 52  LEU A CB    1 
ATOM   353  C  CG    . LEU A 1 58  ? 18.232 42.987 23.027  1.00 40.22 ? 52  LEU A CG    1 
ATOM   354  C  CD1   . LEU A 1 58  ? 18.884 41.897 22.156  1.00 41.13 ? 52  LEU A CD1   1 
ATOM   355  C  CD2   . LEU A 1 58  ? 18.525 42.751 24.529  1.00 39.84 ? 52  LEU A CD2   1 
ATOM   356  N  N     . ASP A 1 59  ? 18.177 47.118 20.709  1.00 30.07 ? 53  ASP A N     1 
ATOM   357  C  CA    . ASP A 1 59  ? 17.127 48.082 20.379  1.00 31.13 ? 53  ASP A CA    1 
ATOM   358  C  C     . ASP A 1 59  ? 17.510 48.910 19.167  1.00 25.96 ? 53  ASP A C     1 
ATOM   359  O  O     . ASP A 1 59  ? 18.442 49.732 19.220  1.00 27.56 ? 53  ASP A O     1 
ATOM   360  C  CB    . ASP A 1 59  ? 16.831 49.017 21.582  1.00 37.67 ? 53  ASP A CB    1 
ATOM   361  C  CG    . ASP A 1 59  ? 16.118 48.292 22.747  1.00 40.98 ? 53  ASP A CG    1 
ATOM   362  O  OD1   . ASP A 1 59  ? 15.289 47.374 22.503  1.00 44.09 ? 53  ASP A OD1   1 
ATOM   363  O  OD2   . ASP A 1 59  ? 16.369 48.661 23.918  1.00 46.68 ? 53  ASP A OD2   1 
ATOM   364  N  N     . HIS A 1 60  ? 16.754 48.694 18.090  1.00 23.89 ? 54  HIS A N     1 
ATOM   365  C  CA    . HIS A 1 60  ? 16.947 49.342 16.783  1.00 20.42 ? 54  HIS A CA    1 
ATOM   366  C  C     . HIS A 1 60  ? 15.581 49.758 16.245  1.00 22.32 ? 54  HIS A C     1 
ATOM   367  O  O     . HIS A 1 60  ? 14.895 49.014 15.528  1.00 20.39 ? 54  HIS A O     1 
ATOM   368  C  CB    . HIS A 1 60  ? 17.592 48.365 15.785  1.00 19.48 ? 54  HIS A CB    1 
ATOM   369  C  CG    . HIS A 1 60  ? 19.017 48.054 16.080  1.00 13.69 ? 54  HIS A CG    1 
ATOM   370  N  ND1   . HIS A 1 60  ? 20.038 48.946 15.845  1.00 18.98 ? 54  HIS A ND1   1 
ATOM   371  C  CD2   . HIS A 1 60  ? 19.594 46.936 16.582  1.00 17.48 ? 54  HIS A CD2   1 
ATOM   372  C  CE1   . HIS A 1 60  ? 21.186 48.385 16.182  1.00 19.32 ? 54  HIS A CE1   1 
ATOM   373  N  NE2   . HIS A 1 60  ? 20.937 47.162 16.624  1.00 17.80 ? 54  HIS A NE2   1 
ATOM   374  N  N     . THR A 1 61  ? 15.152 50.952 16.643  1.00 21.10 ? 55  THR A N     1 
ATOM   375  C  CA    . THR A 1 61  ? 13.828 51.434 16.231  1.00 20.10 ? 55  THR A CA    1 
ATOM   376  C  C     . THR A 1 61  ? 13.754 51.724 14.710  1.00 16.67 ? 55  THR A C     1 
ATOM   377  O  O     . THR A 1 61  ? 14.736 52.103 14.106  1.00 20.95 ? 55  THR A O     1 
ATOM   378  C  CB    . THR A 1 61  ? 13.395 52.711 17.022  1.00 20.61 ? 55  THR A CB    1 
ATOM   379  O  OG1   . THR A 1 61  ? 12.017 52.967 16.732  1.00 20.57 ? 55  THR A OG1   1 
ATOM   380  C  CG2   . THR A 1 61  ? 14.241 53.859 16.631  1.00 20.86 ? 55  THR A CG2   1 
ATOM   381  N  N     . SER A 1 62  ? 12.600 51.496 14.125  1.00 16.19 ? 56  SER A N     1 
ATOM   382  C  CA    . SER A 1 62  ? 12.356 51.794 12.717  1.00 15.77 ? 56  SER A CA    1 
ATOM   383  C  C     . SER A 1 62  ? 11.377 52.960 12.601  1.00 19.56 ? 56  SER A C     1 
ATOM   384  O  O     . SER A 1 62  ? 10.954 53.287 11.518  1.00 19.11 ? 56  SER A O     1 
ATOM   385  C  CB    . SER A 1 62  ? 11.841 50.550 11.974  1.00 16.04 ? 56  SER A CB    1 
ATOM   386  O  OG    . SER A 1 62  ? 12.838 49.502 12.045  1.00 18.29 ? 56  SER A OG    1 
ATOM   387  N  N     . VAL A 1 63  ? 11.081 53.586 13.733  1.00 19.54 ? 57  VAL A N     1 
ATOM   388  C  CA    . VAL A 1 63  ? 10.257 54.816 13.766  1.00 21.38 ? 57  VAL A CA    1 
ATOM   389  C  C     . VAL A 1 63  ? 11.215 56.009 13.778  1.00 17.56 ? 57  VAL A C     1 
ATOM   390  O  O     . VAL A 1 63  ? 11.892 56.262 14.773  1.00 21.77 ? 57  VAL A O     1 
ATOM   391  C  CB    . VAL A 1 63  ? 9.343  54.816 15.009  1.00 21.47 ? 57  VAL A CB    1 
ATOM   392  C  CG1   . VAL A 1 63  ? 8.408  56.060 14.995  1.00 26.88 ? 57  VAL A CG1   1 
ATOM   393  C  CG2   . VAL A 1 63  ? 8.528  53.571 15.034  1.00 19.61 ? 57  VAL A CG2   1 
ATOM   394  N  N     . LEU A 1 64  ? 11.264 56.742 12.661  1.00 20.92 ? 58  LEU A N     1 
ATOM   395  C  CA    . LEU A 1 64  ? 12.287 57.750 12.385  1.00 22.07 ? 58  LEU A CA    1 
ATOM   396  C  C     . LEU A 1 64  ? 11.688 59.100 12.017  1.00 20.85 ? 58  LEU A C     1 
ATOM   397  O  O     . LEU A 1 64  ? 10.659 59.171 11.349  1.00 23.40 ? 58  LEU A O     1 
ATOM   398  C  CB    . LEU A 1 64  ? 13.115 57.315 11.153  1.00 22.86 ? 58  LEU A CB    1 
ATOM   399  C  CG    . LEU A 1 64  ? 13.860 55.964 11.186  1.00 22.29 ? 58  LEU A CG    1 
ATOM   400  C  CD1   . LEU A 1 64  ? 14.682 55.877 9.878   1.00 24.91 ? 58  LEU A CD1   1 
ATOM   401  C  CD2   . LEU A 1 64  ? 14.762 55.810 12.374  1.00 22.51 ? 58  LEU A CD2   1 
ATOM   402  N  N     . SER A 1 65  ? 12.367 60.162 12.402  1.00 19.34 ? 59  SER A N     1 
ATOM   403  C  CA    . SER A 1 65  ? 12.012 61.501 11.955  1.00 23.12 ? 59  SER A CA    1 
ATOM   404  C  C     . SER A 1 65  ? 12.348 61.674 10.489  1.00 25.66 ? 59  SER A C     1 
ATOM   405  O  O     . SER A 1 65  ? 13.184 60.956 9.956   1.00 18.10 ? 59  SER A O     1 
ATOM   406  C  CB    . SER A 1 65  ? 12.799 62.538 12.751  1.00 23.99 ? 59  SER A CB    1 
ATOM   407  O  OG    . SER A 1 65  ? 14.175 62.461 12.472  1.00 22.08 ? 59  SER A OG    1 
ATOM   408  N  N     . THR A 1 66  ? 11.724 62.646 9.838   1.00 23.66 ? 60  THR A N     1 
ATOM   409  C  CA    . THR A 1 66  ? 12.057 62.951 8.450   1.00 26.73 ? 60  THR A CA    1 
ATOM   410  C  C     . THR A 1 66  ? 13.545 63.283 8.293   1.00 23.54 ? 60  THR A C     1 
ATOM   411  O  O     . THR A 1 66  ? 14.200 62.868 7.322   1.00 21.20 ? 60  THR A O     1 
ATOM   412  C  CB    . THR A 1 66  ? 11.192 64.082 7.892   1.00 31.02 ? 60  THR A CB    1 
ATOM   413  O  OG1   . THR A 1 66  ? 11.444 65.263 8.633   1.00 34.74 ? 60  THR A OG1   1 
ATOM   414  C  CG2   . THR A 1 66  ? 9.728  63.702 8.013   1.00 28.54 ? 60  THR A CG2   1 
ATOM   415  N  N     . SER A 1 67  ? 14.106 63.976 9.270   1.00 23.47 ? 61  SER A N     1 
ATOM   416  C  CA    . SER A 1 67  ? 15.525 64.284 9.233   1.00 24.26 ? 61  SER A CA    1 
ATOM   417  C  C     . SER A 1 67  ? 16.425 63.019 9.282   1.00 22.54 ? 61  SER A C     1 
ATOM   418  O  O     . SER A 1 67  ? 17.398 62.937 8.528   1.00 23.10 ? 61  SER A O     1 
ATOM   419  C  CB    . SER A 1 67  ? 15.869 65.228 10.373  1.00 26.93 ? 61  SER A CB    1 
ATOM   420  O  OG    . SER A 1 67  ? 17.166 65.695 10.224  1.00 32.41 ? 61  SER A OG    1 
ATOM   421  N  N     . ASP A 1 68  ? 16.061 62.056 10.138  1.00 22.11 ? 62  ASP A N     1 
ATOM   422  C  CA    . ASP A 1 68  ? 16.796 60.757 10.320  1.00 21.24 ? 62  ASP A CA    1 
ATOM   423  C  C     . ASP A 1 68  ? 16.713 60.028 8.957   1.00 22.99 ? 62  ASP A C     1 
ATOM   424  O  O     . ASP A 1 68  ? 17.691 59.518 8.432   1.00 26.49 ? 62  ASP A O     1 
ATOM   425  C  CB    . ASP A 1 68  ? 16.119 59.797 11.342  1.00 22.91 ? 62  ASP A CB    1 
ATOM   426  C  CG    . ASP A 1 68  ? 16.246 60.198 12.853  1.00 31.34 ? 62  ASP A CG    1 
ATOM   427  O  OD1   . ASP A 1 68  ? 17.225 60.827 13.251  1.00 30.38 ? 62  ASP A OD1   1 
ATOM   428  O  OD2   . ASP A 1 68  ? 15.305 59.812 13.648  1.00 31.52 ? 62  ASP A OD2   1 
ATOM   429  N  N     . PHE A 1 69  ? 15.507 59.980 8.404   1.00 19.32 ? 63  PHE A N     1 
ATOM   430  C  CA    . PHE A 1 69  ? 15.268 59.248 7.144   1.00 20.08 ? 63  PHE A CA    1 
ATOM   431  C  C     . PHE A 1 69  ? 16.073 59.824 5.989   1.00 22.89 ? 63  PHE A C     1 
ATOM   432  O  O     . PHE A 1 69  ? 16.540 59.075 5.139   1.00 20.58 ? 63  PHE A O     1 
ATOM   433  C  CB    . PHE A 1 69  ? 13.779 59.204 6.835   1.00 19.05 ? 63  PHE A CB    1 
ATOM   434  C  CG    . PHE A 1 69  ? 13.430 58.456 5.602   1.00 20.99 ? 63  PHE A CG    1 
ATOM   435  C  CD1   . PHE A 1 69  ? 13.346 57.053 5.611   1.00 22.41 ? 63  PHE A CD1   1 
ATOM   436  C  CD2   . PHE A 1 69  ? 13.169 59.137 4.420   1.00 23.36 ? 63  PHE A CD2   1 
ATOM   437  C  CE1   . PHE A 1 69  ? 13.021 56.365 4.480   1.00 21.97 ? 63  PHE A CE1   1 
ATOM   438  C  CE2   . PHE A 1 69  ? 12.828 58.437 3.255   1.00 24.44 ? 63  PHE A CE2   1 
ATOM   439  C  CZ    . PHE A 1 69  ? 12.743 57.044 3.289   1.00 22.15 ? 63  PHE A CZ    1 
ATOM   440  N  N     . GLY A 1 70  ? 16.283 61.141 5.985   1.00 24.20 ? 64  GLY A N     1 
ATOM   441  C  CA    . GLY A 1 70  ? 17.035 61.803 4.923   1.00 22.36 ? 64  GLY A CA    1 
ATOM   442  C  C     . GLY A 1 70  ? 18.518 61.938 5.150   1.00 22.44 ? 64  GLY A C     1 
ATOM   443  O  O     . GLY A 1 70  ? 19.210 62.494 4.316   1.00 23.29 ? 64  GLY A O     1 
ATOM   444  N  N     . GLY A 1 71  ? 19.020 61.453 6.279   1.00 23.01 ? 65  GLY A N     1 
ATOM   445  C  CA    . GLY A 1 71  ? 20.461 61.473 6.545   1.00 22.50 ? 65  GLY A CA    1 
ATOM   446  C  C     . GLY A 1 71  ? 21.173 60.503 5.628   1.00 22.94 ? 65  GLY A C     1 
ATOM   447  O  O     . GLY A 1 71  ? 20.540 59.780 4.848   1.00 21.37 ? 65  GLY A O     1 
ATOM   448  N  N     . ARG A 1 72  ? 22.487 60.470 5.721   1.00 24.64 ? 66  ARG A N     1 
ATOM   449  C  CA    . ARG A 1 72  ? 23.288 59.650 4.804   1.00 27.17 ? 66  ARG A CA    1 
ATOM   450  C  C     . ARG A 1 72  ? 23.295 58.140 5.178   1.00 24.32 ? 66  ARG A C     1 
ATOM   451  O  O     . ARG A 1 72  ? 23.555 57.316 4.322   1.00 26.62 ? 66  ARG A O     1 
ATOM   452  C  CB    . ARG A 1 72  ? 24.708 60.194 4.696   1.00 30.09 ? 66  ARG A CB    1 
ATOM   453  C  CG    . ARG A 1 72  ? 24.778 61.485 3.912   1.00 34.85 ? 66  ARG A CG    1 
ATOM   454  C  CD    . ARG A 1 72  ? 26.190 61.949 3.640   1.00 37.15 ? 66  ARG A CD    1 
ATOM   455  N  NE    . ARG A 1 72  ? 26.957 60.931 2.923   1.00 40.65 ? 66  ARG A NE    1 
ATOM   456  C  CZ    . ARG A 1 72  ? 28.173 60.501 3.269   1.00 42.29 ? 66  ARG A CZ    1 
ATOM   457  N  NH1   . ARG A 1 72  ? 28.821 61.031 4.318   1.00 45.30 ? 66  ARG A NH1   1 
ATOM   458  N  NH2   . ARG A 1 72  ? 28.768 59.551 2.549   1.00 38.64 ? 66  ARG A NH2   1 
ATOM   459  N  N     . VAL A 1 73  ? 23.008 57.803 6.445   1.00 21.26 ? 67  VAL A N     1 
ATOM   460  C  CA    . VAL A 1 73  ? 22.908 56.411 6.863   1.00 23.53 ? 67  VAL A CA    1 
ATOM   461  C  C     . VAL A 1 73  ? 21.634 55.715 6.289   1.00 19.81 ? 67  VAL A C     1 
ATOM   462  O  O     . VAL A 1 73  ? 21.718 54.678 5.605   1.00 21.04 ? 67  VAL A O     1 
ATOM   463  C  CB    . VAL A 1 73  ? 23.009 56.293 8.405   1.00 22.58 ? 67  VAL A CB    1 
ATOM   464  C  CG1   . VAL A 1 73  ? 22.682 54.899 8.843   1.00 17.50 ? 67  VAL A CG1   1 
ATOM   465  C  CG2   . VAL A 1 73  ? 24.387 56.687 8.889   1.00 21.74 ? 67  VAL A CG2   1 
ATOM   466  N  N     . VAL A 1 74  ? 20.466 56.300 6.523   1.00 18.13 ? 68  VAL A N     1 
ATOM   467  C  CA    . VAL A 1 74  ? 19.200 55.772 5.969   1.00 18.33 ? 68  VAL A CA    1 
ATOM   468  C  C     . VAL A 1 74  ? 19.085 56.142 4.478   1.00 19.56 ? 68  VAL A C     1 
ATOM   469  O  O     . VAL A 1 74  ? 18.653 55.342 3.675   1.00 15.25 ? 68  VAL A O     1 
ATOM   470  C  CB    . VAL A 1 74  ? 17.966 56.243 6.803   1.00 19.71 ? 68  VAL A CB    1 
ATOM   471  C  CG1   . VAL A 1 74  ? 16.639 55.686 6.214   1.00 16.08 ? 68  VAL A CG1   1 
ATOM   472  C  CG2   . VAL A 1 74  ? 18.133 55.855 8.294   1.00 19.85 ? 68  VAL A CG2   1 
ATOM   473  N  N     . ASN A 1 75  ? 19.481 57.373 4.133   1.00 19.93 ? 69  ASN A N     1 
ATOM   474  C  CA    . ASN A 1 75  ? 19.667 57.817 2.758   1.00 19.95 ? 69  ASN A CA    1 
ATOM   475  C  C     . ASN A 1 75  ? 18.427 57.757 1.904   1.00 22.18 ? 69  ASN A C     1 
ATOM   476  O  O     . ASN A 1 75  ? 18.489 57.400 0.712   1.00 20.11 ? 69  ASN A O     1 
ATOM   477  C  CB    . ASN A 1 75  ? 20.823 57.017 2.103   1.00 24.45 ? 69  ASN A CB    1 
ATOM   478  C  CG    . ASN A 1 75  ? 21.644 57.839 1.191   1.00 22.59 ? 69  ASN A CG    1 
ATOM   479  O  OD1   . ASN A 1 75  ? 21.940 58.980 1.489   1.00 24.86 ? 69  ASN A OD1   1 
ATOM   480  N  ND2   . ASN A 1 75  ? 22.025 57.279 0.056   1.00 20.21 ? 69  ASN A ND2   1 
ATOM   481  N  N     . ASN A 1 76  ? 17.282 58.100 2.504   1.00 18.72 ? 70  ASN A N     1 
ATOM   482  C  CA    . ASN A 1 76  ? 15.989 57.945 1.869   1.00 19.45 ? 70  ASN A CA    1 
ATOM   483  C  C     . ASN A 1 76  ? 15.609 56.517 1.418   1.00 18.44 ? 70  ASN A C     1 
ATOM   484  O  O     . ASN A 1 76  ? 14.747 56.358 0.562   1.00 18.38 ? 70  ASN A O     1 
ATOM   485  C  CB    . ASN A 1 76  ? 15.888 58.947 0.701   1.00 23.37 ? 70  ASN A CB    1 
ATOM   486  C  CG    . ASN A 1 76  ? 16.053 60.396 1.179   1.00 27.77 ? 70  ASN A CG    1 
ATOM   487  O  OD1   . ASN A 1 76  ? 17.006 61.073 0.842   1.00 35.65 ? 70  ASN A OD1   1 
ATOM   488  N  ND2   . ASN A 1 76  ? 15.156 60.822 2.012   1.00 29.95 ? 70  ASN A ND2   1 
ATOM   489  N  N     . ASP A 1 77  ? 16.236 55.489 1.994   1.00 19.04 ? 71  ASP A N     1 
ATOM   490  C  CA    . ASP A 1 77  ? 15.973 54.078 1.646   1.00 18.23 ? 71  ASP A CA    1 
ATOM   491  C  C     . ASP A 1 77  ? 15.176 53.380 2.746   1.00 13.81 ? 71  ASP A C     1 
ATOM   492  O  O     . ASP A 1 77  ? 15.194 53.812 3.905   1.00 18.76 ? 71  ASP A O     1 
ATOM   493  C  CB    . ASP A 1 77  ? 17.296 53.268 1.475   1.00 17.69 ? 71  ASP A CB    1 
ATOM   494  C  CG    . ASP A 1 77  ? 18.312 53.943 0.581   1.00 19.19 ? 71  ASP A CG    1 
ATOM   495  O  OD1   . ASP A 1 77  ? 17.925 54.440 -0.475  1.00 18.60 ? 71  ASP A OD1   1 
ATOM   496  O  OD2   . ASP A 1 77  ? 19.503 53.947 0.928   1.00 17.88 ? 71  ASP A OD2   1 
ATOM   497  N  N     . HIS A 1 78  ? 14.478 52.310 2.395   1.00 16.10 ? 72  HIS A N     1 
ATOM   498  C  CA    . HIS A 1 78  ? 13.912 51.405 3.373   1.00 15.50 ? 72  HIS A CA    1 
ATOM   499  C  C     . HIS A 1 78  ? 14.836 50.176 3.607   1.00 17.13 ? 72  HIS A C     1 
ATOM   500  O  O     . HIS A 1 78  ? 14.370 49.111 3.998   1.00 15.95 ? 72  HIS A O     1 
ATOM   501  C  CB    . HIS A 1 78  ? 12.494 51.000 3.005   1.00 14.24 ? 72  HIS A CB    1 
ATOM   502  C  CG    . HIS A 1 78  ? 11.515 52.146 3.186   1.00 15.35 ? 72  HIS A CG    1 
ATOM   503  N  ND1   . HIS A 1 78  ? 10.934 52.423 4.400   1.00 16.34 ? 72  HIS A ND1   1 
ATOM   504  C  CD2   . HIS A 1 78  ? 11.155 53.158 2.359   1.00 19.51 ? 72  HIS A CD2   1 
ATOM   505  C  CE1   . HIS A 1 78  ? 10.186 53.516 4.295   1.00 21.11 ? 72  HIS A CE1   1 
ATOM   506  N  NE2   . HIS A 1 78  ? 10.297 53.982 3.065   1.00 19.28 ? 72  HIS A NE2   1 
ATOM   507  N  N     . PHE A 1 79  ? 16.135 50.368 3.383   1.00 16.57 ? 73  PHE A N     1 
ATOM   508  C  CA    . PHE A 1 79  ? 17.124 49.368 3.782   1.00 14.32 ? 73  PHE A CA    1 
ATOM   509  C  C     . PHE A 1 79  ? 18.302 50.042 4.467   1.00 14.03 ? 73  PHE A C     1 
ATOM   510  O  O     . PHE A 1 79  ? 18.545 51.267 4.278   1.00 17.17 ? 73  PHE A O     1 
ATOM   511  C  CB    . PHE A 1 79  ? 17.585 48.489 2.559   1.00 14.77 ? 73  PHE A CB    1 
ATOM   512  C  CG    . PHE A 1 79  ? 18.448 49.201 1.518   1.00 18.00 ? 73  PHE A CG    1 
ATOM   513  C  CD1   . PHE A 1 79  ? 19.835 49.105 1.552   1.00 20.38 ? 73  PHE A CD1   1 
ATOM   514  C  CD2   . PHE A 1 79  ? 17.867 49.901 0.478   1.00 19.55 ? 73  PHE A CD2   1 
ATOM   515  C  CE1   . PHE A 1 79  ? 20.632 49.761 0.597   1.00 19.85 ? 73  PHE A CE1   1 
ATOM   516  C  CE2   . PHE A 1 79  ? 18.636 50.530 -0.486  1.00 20.07 ? 73  PHE A CE2   1 
ATOM   517  C  CZ    . PHE A 1 79  ? 20.017 50.470 -0.429  1.00 18.93 ? 73  PHE A CZ    1 
ATOM   518  N  N     . LEU A 1 80  ? 19.034 49.227 5.236   1.00 15.72 ? 74  LEU A N     1 
ATOM   519  C  CA    . LEU A 1 80  ? 20.217 49.645 5.960   1.00 14.87 ? 74  LEU A CA    1 
ATOM   520  C  C     . LEU A 1 80  ? 21.405 48.879 5.451   1.00 15.79 ? 74  LEU A C     1 
ATOM   521  O  O     . LEU A 1 80  ? 21.270 47.710 5.166   1.00 17.97 ? 74  LEU A O     1 
ATOM   522  C  CB    . LEU A 1 80  ? 20.042 49.304 7.428   1.00 12.97 ? 74  LEU A CB    1 
ATOM   523  C  CG    . LEU A 1 80  ? 18.959 50.139 8.127   1.00 14.88 ? 74  LEU A CG    1 
ATOM   524  C  CD1   . LEU A 1 80  ? 18.849 49.667 9.579   1.00 16.04 ? 74  LEU A CD1   1 
ATOM   525  C  CD2   . LEU A 1 80  ? 19.251 51.682 7.993   1.00 15.65 ? 74  LEU A CD2   1 
ATOM   526  N  N     . TYR A 1 81  ? 22.549 49.549 5.358   1.00 18.55 ? 75  TYR A N     1 
ATOM   527  C  CA    . TYR A 1 81  ? 23.812 48.907 5.051   1.00 18.53 ? 75  TYR A CA    1 
ATOM   528  C  C     . TYR A 1 81  ? 24.515 48.664 6.363   1.00 18.56 ? 75  TYR A C     1 
ATOM   529  O  O     . TYR A 1 81  ? 24.960 49.601 7.015   1.00 17.51 ? 75  TYR A O     1 
ATOM   530  C  CB    . TYR A 1 81  ? 24.672 49.755 4.133   1.00 18.80 ? 75  TYR A CB    1 
ATOM   531  C  CG    . TYR A 1 81  ? 26.070 49.158 3.896   1.00 21.16 ? 75  TYR A CG    1 
ATOM   532  C  CD1   . TYR A 1 81  ? 26.218 47.853 3.438   1.00 21.12 ? 75  TYR A CD1   1 
ATOM   533  C  CD2   . TYR A 1 81  ? 27.231 49.898 4.169   1.00 18.42 ? 75  TYR A CD2   1 
ATOM   534  C  CE1   . TYR A 1 81  ? 27.475 47.298 3.245   1.00 18.86 ? 75  TYR A CE1   1 
ATOM   535  C  CE2   . TYR A 1 81  ? 28.493 49.363 3.944   1.00 20.94 ? 75  TYR A CE2   1 
ATOM   536  C  CZ    . TYR A 1 81  ? 28.613 48.050 3.479   1.00 19.29 ? 75  TYR A CZ    1 
ATOM   537  O  OH    . TYR A 1 81  ? 29.884 47.483 3.260   1.00 22.34 ? 75  TYR A OH    1 
ATOM   538  N  N     . TRP A 1 82  ? 24.610 47.399 6.744   1.00 17.43 ? 76  TRP A N     1 
ATOM   539  C  CA    . TRP A 1 82  ? 25.185 47.019 8.041   1.00 19.74 ? 76  TRP A CA    1 
ATOM   540  C  C     . TRP A 1 82  ? 26.694 46.892 8.049   1.00 20.85 ? 76  TRP A C     1 
ATOM   541  O  O     . TRP A 1 82  ? 27.290 46.901 9.128   1.00 18.97 ? 76  TRP A O     1 
ATOM   542  C  CB    . TRP A 1 82  ? 24.567 45.733 8.512   1.00 18.33 ? 76  TRP A CB    1 
ATOM   543  C  CG    . TRP A 1 82  ? 23.256 45.956 9.175   1.00 18.29 ? 76  TRP A CG    1 
ATOM   544  C  CD1   . TRP A 1 82  ? 22.014 45.831 8.605   1.00 18.14 ? 76  TRP A CD1   1 
ATOM   545  C  CD2   . TRP A 1 82  ? 23.032 46.263 10.572  1.00 18.16 ? 76  TRP A CD2   1 
ATOM   546  N  NE1   . TRP A 1 82  ? 21.044 46.073 9.549   1.00 16.67 ? 76  TRP A NE1   1 
ATOM   547  C  CE2   . TRP A 1 82  ? 21.634 46.329 10.763  1.00 16.95 ? 76  TRP A CE2   1 
ATOM   548  C  CE3   . TRP A 1 82  ? 23.885 46.469 11.682  1.00 18.45 ? 76  TRP A CE3   1 
ATOM   549  C  CZ2   . TRP A 1 82  ? 21.046 46.624 12.027  1.00 16.97 ? 76  TRP A CZ2   1 
ATOM   550  C  CZ3   . TRP A 1 82  ? 23.303 46.734 12.943  1.00 18.35 ? 76  TRP A CZ3   1 
ATOM   551  C  CH2   . TRP A 1 82  ? 21.899 46.812 13.097  1.00 16.43 ? 76  TRP A CH2   1 
ATOM   552  N  N     . GLY A 1 83  ? 27.299 46.800 6.860   1.00 23.03 ? 77  GLY A N     1 
ATOM   553  C  CA    . GLY A 1 83  ? 28.736 46.866 6.720   1.00 25.27 ? 77  GLY A CA    1 
ATOM   554  C  C     . GLY A 1 83  ? 29.326 45.640 6.065   1.00 23.98 ? 77  GLY A C     1 
ATOM   555  O  O     . GLY A 1 83  ? 28.622 44.845 5.456   1.00 18.70 ? 77  GLY A O     1 
ATOM   556  N  N     . GLU A 1 84  ? 30.625 45.491 6.231   1.00 28.86 ? 78  GLU A N     1 
ATOM   557  C  CA    . GLU A 1 84  ? 31.405 44.452 5.543   1.00 32.07 ? 78  GLU A CA    1 
ATOM   558  C  C     . GLU A 1 84  ? 31.981 43.458 6.567   1.00 32.98 ? 78  GLU A C     1 
ATOM   559  O  O     . GLU A 1 84  ? 32.495 43.854 7.615   1.00 31.90 ? 78  GLU A O     1 
ATOM   560  C  CB    . GLU A 1 84  ? 32.503 45.133 4.732   1.00 33.48 ? 78  GLU A CB    1 
ATOM   561  C  CG    . GLU A 1 84  ? 33.515 44.212 4.084   1.00 38.27 ? 78  GLU A CG    1 
ATOM   562  C  CD    . GLU A 1 84  ? 34.755 44.963 3.598   1.00 40.23 ? 78  GLU A CD    1 
ATOM   563  O  OE1   . GLU A 1 84  ? 35.869 44.440 3.828   1.00 48.29 ? 78  GLU A OE1   1 
ATOM   564  O  OE2   . GLU A 1 84  ? 34.633 46.060 3.011   1.00 42.59 ? 78  GLU A OE2   1 
ATOM   565  N  N     . VAL A 1 85  ? 31.881 42.167 6.284   1.00 30.41 ? 79  VAL A N     1 
ATOM   566  C  CA    . VAL A 1 85  ? 32.466 41.157 7.164   1.00 32.51 ? 79  VAL A CA    1 
ATOM   567  C  C     . VAL A 1 85  ? 33.583 40.488 6.366   1.00 34.69 ? 79  VAL A C     1 
ATOM   568  O  O     . VAL A 1 85  ? 33.375 40.093 5.229   1.00 30.81 ? 79  VAL A O     1 
ATOM   569  C  CB    . VAL A 1 85  ? 31.443 40.107 7.621   1.00 34.01 ? 79  VAL A CB    1 
ATOM   570  C  CG1   . VAL A 1 85  ? 32.150 38.896 8.282   1.00 32.70 ? 79  VAL A CG1   1 
ATOM   571  C  CG2   . VAL A 1 85  ? 30.402 40.717 8.552   1.00 35.41 ? 79  VAL A CG2   1 
ATOM   572  N  N     . SER A 1 86  ? 34.758 40.381 6.979   1.00 41.95 ? 80  SER A N     1 
ATOM   573  C  CA    . SER A 1 86  ? 35.980 39.946 6.299   1.00 44.59 ? 80  SER A CA    1 
ATOM   574  C  C     . SER A 1 86  ? 36.736 38.915 7.137   1.00 46.01 ? 80  SER A C     1 
ATOM   575  O  O     . SER A 1 86  ? 36.372 38.662 8.288   1.00 46.57 ? 80  SER A O     1 
ATOM   576  C  CB    . SER A 1 86  ? 36.878 41.160 6.055   1.00 47.51 ? 80  SER A CB    1 
ATOM   577  O  OG    . SER A 1 86  ? 38.034 40.796 5.329   1.00 50.87 ? 80  SER A OG    1 
ATOM   578  N  N     . LYS A 1 96  ? 34.832 38.643 1.276   1.00 31.51 ? 90  LYS A N     1 
ATOM   579  C  CA    . LYS A 1 96  ? 34.080 39.817 1.776   1.00 28.93 ? 90  LYS A CA    1 
ATOM   580  C  C     . LYS A 1 96  ? 32.547 39.654 1.611   1.00 25.09 ? 90  LYS A C     1 
ATOM   581  O  O     . LYS A 1 96  ? 32.057 39.385 0.527   1.00 23.53 ? 90  LYS A O     1 
ATOM   582  C  CB    . LYS A 1 96  ? 34.531 41.105 1.088   1.00 26.50 ? 90  LYS A CB    1 
ATOM   583  N  N     . MET A 1 97  ? 31.831 39.902 2.693   1.00 27.44 ? 91  MET A N     1 
ATOM   584  C  CA    . MET A 1 97  ? 30.378 39.864 2.707   1.00 27.95 ? 91  MET A CA    1 
ATOM   585  C  C     . MET A 1 97  ? 29.861 41.283 3.026   1.00 24.33 ? 91  MET A C     1 
ATOM   586  O  O     . MET A 1 97  ? 30.337 41.925 3.949   1.00 27.55 ? 91  MET A O     1 
ATOM   587  C  CB    . MET A 1 97  ? 29.908 38.854 3.736   1.00 26.87 ? 91  MET A CB    1 
ATOM   588  C  CG    . MET A 1 97  ? 30.279 37.412 3.388   1.00 29.86 ? 91  MET A CG    1 
ATOM   589  S  SD    . MET A 1 97  ? 29.930 36.346 4.770   1.00 39.05 ? 91  MET A SD    1 
ATOM   590  C  CE    . MET A 1 97  ? 31.469 36.574 5.678   1.00 41.03 ? 91  MET A CE    1 
ATOM   591  N  N     . HIS A 1 98  ? 28.946 41.778 2.214   1.00 20.72 ? 92  HIS A N     1 
ATOM   592  C  CA    . HIS A 1 98  ? 28.306 43.080 2.465   1.00 22.12 ? 92  HIS A CA    1 
ATOM   593  C  C     . HIS A 1 98  ? 26.881 42.795 2.861   1.00 19.36 ? 92  HIS A C     1 
ATOM   594  O  O     . HIS A 1 98  ? 26.160 42.056 2.143   1.00 16.97 ? 92  HIS A O     1 
ATOM   595  C  CB    . HIS A 1 98  ? 28.401 43.974 1.230   1.00 23.06 ? 92  HIS A CB    1 
ATOM   596  C  CG    . HIS A 1 98  ? 29.797 44.417 0.913   1.00 26.13 ? 92  HIS A CG    1 
ATOM   597  N  ND1   . HIS A 1 98  ? 30.440 45.422 1.612   1.00 29.99 ? 92  HIS A ND1   1 
ATOM   598  C  CD2   . HIS A 1 98  ? 30.685 43.974 -0.006  1.00 29.72 ? 92  HIS A CD2   1 
ATOM   599  C  CE1   . HIS A 1 98  ? 31.656 45.583 1.123   1.00 31.85 ? 92  HIS A CE1   1 
ATOM   600  N  NE2   . HIS A 1 98  ? 31.826 44.722 0.137   1.00 28.49 ? 92  HIS A NE2   1 
ATOM   601  N  N     . ILE A 1 99  ? 26.428 43.367 3.992   1.00 17.63 ? 93  ILE A N     1 
ATOM   602  C  CA    . ILE A 1 99  ? 25.178 42.949 4.587   1.00 15.47 ? 93  ILE A CA    1 
ATOM   603  C  C     . ILE A 1 99  ? 24.147 44.122 4.553   1.00 17.71 ? 93  ILE A C     1 
ATOM   604  O  O     . ILE A 1 99  ? 24.467 45.236 5.007   1.00 16.60 ? 93  ILE A O     1 
ATOM   605  C  CB    . ILE A 1 99  ? 25.362 42.494 6.047   1.00 18.76 ? 93  ILE A CB    1 
ATOM   606  C  CG1   . ILE A 1 99  ? 26.463 41.418 6.159   1.00 23.32 ? 93  ILE A CG1   1 
ATOM   607  C  CG2   . ILE A 1 99  ? 24.031 42.032 6.640   1.00 19.32 ? 93  ILE A CG2   1 
ATOM   608  C  CD1   . ILE A 1 99  ? 26.200 40.172 5.347   1.00 19.69 ? 93  ILE A CD1   1 
ATOM   609  N  N     . VAL A 1 100 ? 22.981 43.866 3.960   1.00 17.15 ? 94  VAL A N     1 
ATOM   610  C  CA    A VAL A 1 100 ? 21.874 44.831 3.960   0.50 15.96 ? 94  VAL A CA    1 
ATOM   611  C  CA    B VAL A 1 100 ? 21.875 44.828 3.967   0.50 16.22 ? 94  VAL A CA    1 
ATOM   612  C  C     . VAL A 1 100 ? 20.647 44.209 4.652   1.00 13.76 ? 94  VAL A C     1 
ATOM   613  O  O     . VAL A 1 100 ? 20.379 42.976 4.571   1.00 15.99 ? 94  VAL A O     1 
ATOM   614  C  CB    A VAL A 1 100 ? 21.551 45.375 2.511   0.50 16.53 ? 94  VAL A CB    1 
ATOM   615  C  CB    B VAL A 1 100 ? 21.523 45.391 2.529   0.50 17.14 ? 94  VAL A CB    1 
ATOM   616  C  CG1   A VAL A 1 100 ? 20.072 45.819 2.389   0.50 16.96 ? 94  VAL A CG1   1 
ATOM   617  C  CG1   B VAL A 1 100 ? 22.777 45.936 1.805   0.50 19.40 ? 94  VAL A CG1   1 
ATOM   618  C  CG2   A VAL A 1 100 ? 22.515 46.563 2.117   0.50 13.53 ? 94  VAL A CG2   1 
ATOM   619  C  CG2   B VAL A 1 100 ? 20.797 44.364 1.676   0.50 13.06 ? 94  VAL A CG2   1 
ATOM   620  N  N     . GLU A 1 101 ? 19.897 45.051 5.354   1.00 15.84 ? 95  GLU A N     1 
ATOM   621  C  CA    . GLU A 1 101 ? 18.631 44.681 5.932   1.00 14.55 ? 95  GLU A CA    1 
ATOM   622  C  C     . GLU A 1 101 ? 17.532 45.437 5.181   1.00 15.01 ? 95  GLU A C     1 
ATOM   623  O  O     . GLU A 1 101 ? 17.561 46.676 5.125   1.00 15.35 ? 95  GLU A O     1 
ATOM   624  C  CB    . GLU A 1 101 ? 18.584 45.041 7.417   1.00 15.57 ? 95  GLU A CB    1 
ATOM   625  C  CG    . GLU A 1 101 ? 17.192 45.071 7.994   1.00 16.51 ? 95  GLU A CG    1 
ATOM   626  C  CD    . GLU A 1 101 ? 17.118 45.613 9.397   1.00 17.06 ? 95  GLU A CD    1 
ATOM   627  O  OE1   . GLU A 1 101 ? 18.170 45.930 9.986   1.00 17.14 ? 95  GLU A OE1   1 
ATOM   628  O  OE2   . GLU A 1 101 ? 15.973 45.756 9.886   1.00 16.59 ? 95  GLU A OE2   1 
ATOM   629  N  N     . GLN A 1 102 ? 16.576 44.690 4.608   1.00 14.41 ? 96  GLN A N     1 
ATOM   630  C  CA    . GLN A 1 102 ? 15.393 45.298 3.978   1.00 17.62 ? 96  GLN A CA    1 
ATOM   631  C  C     . GLN A 1 102 ? 14.317 45.413 5.043   1.00 15.93 ? 96  GLN A C     1 
ATOM   632  O  O     . GLN A 1 102 ? 13.814 44.392 5.569   1.00 14.94 ? 96  GLN A O     1 
ATOM   633  C  CB    . GLN A 1 102 ? 14.871 44.486 2.795   1.00 16.29 ? 96  GLN A CB    1 
ATOM   634  C  CG    . GLN A 1 102 ? 15.792 44.566 1.601   1.00 14.22 ? 96  GLN A CG    1 
ATOM   635  C  CD    . GLN A 1 102 ? 15.620 45.814 0.749   1.00 17.53 ? 96  GLN A CD    1 
ATOM   636  O  OE1   . GLN A 1 102 ? 14.948 46.797 1.145   1.00 16.04 ? 96  GLN A OE1   1 
ATOM   637  N  NE2   . GLN A 1 102 ? 16.240 45.804 -0.443  1.00 15.18 ? 96  GLN A NE2   1 
ATOM   638  N  N     . THR A 1 103 ? 13.894 46.646 5.300   1.00 15.39 ? 97  THR A N     1 
ATOM   639  C  CA    . THR A 1 103 ? 12.905 46.856 6.331   1.00 13.49 ? 97  THR A CA    1 
ATOM   640  C  C     . THR A 1 103 ? 11.848 47.918 5.920   1.00 16.99 ? 97  THR A C     1 
ATOM   641  O  O     . THR A 1 103 ? 11.601 48.122 4.739   1.00 14.60 ? 97  THR A O     1 
ATOM   642  C  CB    . THR A 1 103 ? 13.603 47.174 7.649   1.00 14.93 ? 97  THR A CB    1 
ATOM   643  O  OG1   . THR A 1 103 ? 12.642 47.211 8.694   1.00 19.34 ? 97  THR A OG1   1 
ATOM   644  C  CG2   . THR A 1 103 ? 14.409 48.446 7.599   1.00 12.85 ? 97  THR A CG2   1 
ATOM   645  N  N     . GLU A 1 104 ? 11.240 48.578 6.887   1.00 15.92 ? 98  GLU A N     1 
ATOM   646  C  CA    . GLU A 1 104 ? 10.311 49.673 6.542   1.00 15.53 ? 98  GLU A CA    1 
ATOM   647  C  C     . GLU A 1 104 ? 10.326 50.700 7.671   1.00 15.62 ? 98  GLU A C     1 
ATOM   648  O  O     . GLU A 1 104 ? 10.163 50.351 8.848   1.00 19.36 ? 98  GLU A O     1 
ATOM   649  C  CB    . GLU A 1 104 ? 8.909  49.117 6.344   1.00 17.61 ? 98  GLU A CB    1 
ATOM   650  C  CG    . GLU A 1 104 ? 7.932  50.228 5.909   1.00 19.17 ? 98  GLU A CG    1 
ATOM   651  C  CD    . GLU A 1 104 ? 6.691  49.686 5.280   1.00 19.60 ? 98  GLU A CD    1 
ATOM   652  O  OE1   . GLU A 1 104 ? 6.768  49.137 4.152   1.00 19.32 ? 98  GLU A OE1   1 
ATOM   653  O  OE2   . GLU A 1 104 ? 5.630  49.824 5.909   1.00 24.57 ? 98  GLU A OE2   1 
ATOM   654  N  N     . PHE A 1 105 ? 10.617 51.935 7.316   1.00 18.01 ? 99  PHE A N     1 
ATOM   655  C  CA    . PHE A 1 105 ? 10.750 53.032 8.264   1.00 16.14 ? 99  PHE A CA    1 
ATOM   656  C  C     . PHE A 1 105 ? 9.489  53.849 8.254   1.00 19.05 ? 99  PHE A C     1 
ATOM   657  O  O     . PHE A 1 105 ? 8.930  54.152 7.183   1.00 16.72 ? 99  PHE A O     1 
ATOM   658  C  CB    . PHE A 1 105 ? 11.965 53.908 7.917   1.00 15.58 ? 99  PHE A CB    1 
ATOM   659  C  CG    . PHE A 1 105 ? 13.269 53.161 8.073   1.00 14.68 ? 99  PHE A CG    1 
ATOM   660  C  CD1   . PHE A 1 105 ? 13.577 52.619 9.298   1.00 14.28 ? 99  PHE A CD1   1 
ATOM   661  C  CD2   . PHE A 1 105 ? 14.137 52.999 7.012   1.00 17.64 ? 99  PHE A CD2   1 
ATOM   662  C  CE1   . PHE A 1 105 ? 14.763 51.875 9.496   1.00 17.44 ? 99  PHE A CE1   1 
ATOM   663  C  CE2   . PHE A 1 105 ? 15.334 52.270 7.182   1.00 16.27 ? 99  PHE A CE2   1 
ATOM   664  C  CZ    . PHE A 1 105 ? 15.635 51.719 8.400   1.00 14.91 ? 99  PHE A CZ    1 
ATOM   665  N  N     . ILE A 1 106 ? 9.042  54.184 9.441   1.00 18.90 ? 100 ILE A N     1 
ATOM   666  C  CA    A ILE A 1 106 ? 7.809  54.972 9.553   0.50 16.86 ? 100 ILE A CA    1 
ATOM   667  C  CA    B ILE A 1 106 ? 7.796  54.944 9.637   0.50 19.79 ? 100 ILE A CA    1 
ATOM   668  C  C     . ILE A 1 106 ? 8.109  56.324 10.193  1.00 20.18 ? 100 ILE A C     1 
ATOM   669  O  O     . ILE A 1 106 ? 9.061  56.468 10.932  1.00 18.36 ? 100 ILE A O     1 
ATOM   670  C  CB    A ILE A 1 106 ? 6.703  54.189 10.277  0.50 16.17 ? 100 ILE A CB    1 
ATOM   671  C  CB    B ILE A 1 106 ? 6.926  54.210 10.628  0.50 22.40 ? 100 ILE A CB    1 
ATOM   672  C  CG1   A ILE A 1 106 ? 7.171  53.782 11.677  0.50 17.99 ? 100 ILE A CG1   1 
ATOM   673  C  CG1   B ILE A 1 106 ? 6.611  52.829 10.125  0.50 24.30 ? 100 ILE A CG1   1 
ATOM   674  C  CG2   A ILE A 1 106 ? 6.261  52.984 9.418   0.50 16.60 ? 100 ILE A CG2   1 
ATOM   675  C  CG2   B ILE A 1 106 ? 5.614  54.908 10.859  0.50 24.05 ? 100 ILE A CG2   1 
ATOM   676  C  CD1   A ILE A 1 106 ? 6.061  53.314 12.599  0.50 14.37 ? 100 ILE A CD1   1 
ATOM   677  C  CD1   B ILE A 1 106 ? 5.984  52.068 11.155  0.50 26.26 ? 100 ILE A CD1   1 
ATOM   678  N  N     . ASP A 1 107 ? 7.289  57.328 9.853   1.00 21.50 ? 101 ASP A N     1 
ATOM   679  C  CA    . ASP A 1 107 ? 7.463  58.682 10.365  1.00 26.92 ? 101 ASP A CA    1 
ATOM   680  C  C     . ASP A 1 107 ? 7.096  58.765 11.866  1.00 27.16 ? 101 ASP A C     1 
ATOM   681  O  O     . ASP A 1 107 ? 6.114  58.150 12.297  1.00 33.22 ? 101 ASP A O     1 
ATOM   682  C  CB    . ASP A 1 107 ? 6.600  59.662 9.573   1.00 29.06 ? 101 ASP A CB    1 
ATOM   683  C  CG    . ASP A 1 107 ? 6.720  61.073 10.108  1.00 26.55 ? 101 ASP A CG    1 
ATOM   684  O  OD1   . ASP A 1 107 ? 7.490  61.826 9.521   1.00 32.95 ? 101 ASP A OD1   1 
ATOM   685  O  OD2   . ASP A 1 107 ? 6.076  61.415 11.148  1.00 31.80 ? 101 ASP A OD2   1 
ATOM   686  N  N     . ASP A 1 108 ? 7.862  59.528 12.645  1.00 29.55 ? 102 ASP A N     1 
ATOM   687  C  CA    . ASP A 1 108 ? 7.727  59.496 14.118  1.00 29.84 ? 102 ASP A CA    1 
ATOM   688  C  C     . ASP A 1 108 ? 6.584  60.393 14.645  1.00 36.73 ? 102 ASP A C     1 
ATOM   689  O  O     . ASP A 1 108 ? 6.366  60.462 15.871  1.00 41.53 ? 102 ASP A O     1 
ATOM   690  C  CB    . ASP A 1 108 ? 9.029  59.806 14.845  1.00 31.82 ? 102 ASP A CB    1 
ATOM   691  C  CG    . ASP A 1 108 ? 9.535  61.183 14.587  1.00 29.22 ? 102 ASP A CG    1 
ATOM   692  O  OD1   . ASP A 1 108 ? 8.983  61.863 13.690  1.00 34.82 ? 102 ASP A OD1   1 
ATOM   693  O  OD2   . ASP A 1 108 ? 10.507 61.575 15.270  1.00 34.07 ? 102 ASP A OD2   1 
ATOM   694  N  N     . GLN A 1 109 ? 5.855  61.026 13.722  1.00 34.99 ? 103 GLN A N     1 
ATOM   695  C  CA    . GLN A 1 109 ? 4.649  61.803 14.060  1.00 39.96 ? 103 GLN A CA    1 
ATOM   696  C  C     . GLN A 1 109 ? 3.361  61.242 13.419  1.00 41.29 ? 103 GLN A C     1 
ATOM   697  O  O     . GLN A 1 109 ? 2.336  61.071 14.134  1.00 39.46 ? 103 GLN A O     1 
ATOM   698  C  CB    . GLN A 1 109 ? 4.849  63.259 13.646  1.00 43.39 ? 103 GLN A CB    1 
ATOM   699  C  CG    . GLN A 1 109 ? 6.027  63.939 14.352  1.00 46.29 ? 103 GLN A CG    1 
ATOM   700  C  CD    . GLN A 1 109 ? 6.442  65.233 13.696  1.00 48.57 ? 103 GLN A CD    1 
ATOM   701  O  OE1   . GLN A 1 109 ? 6.382  65.386 12.459  1.00 53.74 ? 103 GLN A OE1   1 
ATOM   702  N  NE2   . GLN A 1 109 ? 6.894  66.180 14.515  1.00 54.55 ? 103 GLN A NE2   1 
ATOM   703  N  N     . THR A 1 110 ? 3.414  60.950 12.097  1.00 38.63 ? 104 THR A N     1 
ATOM   704  C  CA    . THR A 1 110 ? 2.253  60.417 11.321  1.00 37.78 ? 104 THR A CA    1 
ATOM   705  C  C     . THR A 1 110 ? 2.081  58.887 11.356  1.00 36.12 ? 104 THR A C     1 
ATOM   706  O  O     . THR A 1 110 ? 0.985  58.370 11.088  1.00 34.40 ? 104 THR A O     1 
ATOM   707  C  CB    . THR A 1 110 ? 2.285  60.865 9.837   1.00 37.72 ? 104 THR A CB    1 
ATOM   708  O  OG1   . THR A 1 110 ? 3.158  60.015 9.055   1.00 41.07 ? 104 THR A OG1   1 
ATOM   709  C  CG2   . THR A 1 110 ? 2.736  62.316 9.732   1.00 40.93 ? 104 THR A CG2   1 
ATOM   710  N  N     . PHE A 1 111 ? 3.167  58.193 11.676  1.00 37.16 ? 105 PHE A N     1 
ATOM   711  C  CA    . PHE A 1 111 ? 3.210  56.739 11.786  1.00 39.21 ? 105 PHE A CA    1 
ATOM   712  C  C     . PHE A 1 111 ? 2.805  56.023 10.503  1.00 34.89 ? 105 PHE A C     1 
ATOM   713  O  O     . PHE A 1 111 ? 2.295  54.900 10.539  1.00 39.74 ? 105 PHE A O     1 
ATOM   714  C  CB    . PHE A 1 111 ? 2.394  56.250 12.992  1.00 45.33 ? 105 PHE A CB    1 
ATOM   715  C  CG    . PHE A 1 111 ? 2.980  56.666 14.299  1.00 47.19 ? 105 PHE A CG    1 
ATOM   716  C  CD1   . PHE A 1 111 ? 4.228  56.194 14.689  1.00 49.02 ? 105 PHE A CD1   1 
ATOM   717  C  CD2   . PHE A 1 111 ? 2.308  57.539 15.133  1.00 50.17 ? 105 PHE A CD2   1 
ATOM   718  C  CE1   . PHE A 1 111 ? 4.799  56.588 15.887  1.00 48.74 ? 105 PHE A CE1   1 
ATOM   719  C  CE2   . PHE A 1 111 ? 2.870  57.937 16.331  1.00 50.23 ? 105 PHE A CE2   1 
ATOM   720  C  CZ    . PHE A 1 111 ? 4.126  57.458 16.705  1.00 49.24 ? 105 PHE A CZ    1 
ATOM   721  N  N     . GLN A 1 112 ? 3.049  56.664 9.367   1.00 27.94 ? 106 GLN A N     1 
ATOM   722  C  CA    . GLN A 1 112 ? 2.860  56.005 8.099   1.00 25.00 ? 106 GLN A CA    1 
ATOM   723  C  C     . GLN A 1 112 ? 4.265  55.819 7.516   1.00 17.94 ? 106 GLN A C     1 
ATOM   724  O  O     . GLN A 1 112 ? 5.237  56.505 7.887   1.00 20.57 ? 106 GLN A O     1 
ATOM   725  C  CB    . GLN A 1 112 ? 1.906  56.797 7.156   1.00 29.73 ? 106 GLN A CB    1 
ATOM   726  C  CG    . GLN A 1 112 ? 0.308  56.492 7.343   1.00 26.67 ? 106 GLN A CG    1 
ATOM   727  C  CD    . GLN A 1 112 ? -0.595 57.394 6.443   1.00 33.97 ? 106 GLN A CD    1 
ATOM   728  O  OE1   . GLN A 1 112 ? -1.010 58.504 6.837   1.00 45.95 ? 106 GLN A OE1   1 
ATOM   729  N  NE2   . GLN A 1 112 ? -0.924 56.901 5.255   1.00 32.07 ? 106 GLN A NE2   1 
ATOM   730  N  N     . PRO A 1 113 ? 4.395  54.900 6.594   1.00 17.21 ? 107 PRO A N     1 
ATOM   731  C  CA    . PRO A 1 113 ? 5.745  54.747 6.031   1.00 19.84 ? 107 PRO A CA    1 
ATOM   732  C  C     . PRO A 1 113 ? 6.328  56.018 5.390   1.00 21.62 ? 107 PRO A C     1 
ATOM   733  O  O     . PRO A 1 113 ? 5.636  56.697 4.646   1.00 20.06 ? 107 PRO A O     1 
ATOM   734  C  CB    . PRO A 1 113 ? 5.558  53.650 4.982   1.00 19.54 ? 107 PRO A CB    1 
ATOM   735  C  CG    . PRO A 1 113 ? 4.438  52.882 5.443   1.00 20.16 ? 107 PRO A CG    1 
ATOM   736  C  CD    . PRO A 1 113 ? 3.453  53.918 6.040   1.00 21.14 ? 107 PRO A CD    1 
ATOM   737  N  N     . HIS A 1 114 ? 7.603  56.310 5.639   1.00 19.13 ? 108 HIS A N     1 
ATOM   738  C  CA    . HIS A 1 114 ? 8.303  57.366 4.904   1.00 22.22 ? 108 HIS A CA    1 
ATOM   739  C  C     . HIS A 1 114 ? 8.160  57.188 3.383   1.00 26.16 ? 108 HIS A C     1 
ATOM   740  O  O     . HIS A 1 114 ? 8.423  56.109 2.849   1.00 21.30 ? 108 HIS A O     1 
ATOM   741  C  CB    . HIS A 1 114 ? 9.771  57.443 5.282   1.00 20.99 ? 108 HIS A CB    1 
ATOM   742  C  CG    . HIS A 1 114 ? 10.011 58.088 6.610   1.00 22.52 ? 108 HIS A CG    1 
ATOM   743  N  ND1   . HIS A 1 114 ? 9.963  59.455 6.804   1.00 24.08 ? 108 HIS A ND1   1 
ATOM   744  C  CD2   . HIS A 1 114 ? 10.248 57.545 7.823   1.00 22.12 ? 108 HIS A CD2   1 
ATOM   745  C  CE1   . HIS A 1 114 ? 10.180 59.721 8.075   1.00 25.32 ? 108 HIS A CE1   1 
ATOM   746  N  NE2   . HIS A 1 114 ? 10.358 58.577 8.715   1.00 22.79 ? 108 HIS A NE2   1 
ATOM   747  N  N     . ARG A 1 115 ? 7.750  58.261 2.705   1.00 27.27 ? 109 ARG A N     1 
ATOM   748  C  CA    . ARG A 1 115 ? 7.431  58.240 1.247   1.00 26.14 ? 109 ARG A CA    1 
ATOM   749  C  C     . ARG A 1 115 ? 6.318  57.283 0.800   1.00 27.84 ? 109 ARG A C     1 
ATOM   750  O  O     . ARG A 1 115 ? 6.348  56.756 -0.331  1.00 30.36 ? 109 ARG A O     1 
ATOM   751  C  CB    . ARG A 1 115 ? 8.690  58.003 0.450   1.00 28.29 ? 109 ARG A CB    1 
ATOM   752  C  CG    . ARG A 1 115 ? 9.789  58.954 0.818   1.00 29.33 ? 109 ARG A CG    1 
ATOM   753  N  N     . SER A 1 116 ? 5.307  57.108 1.657   1.00 26.14 ? 110 SER A N     1 
ATOM   754  C  CA    . SER A 1 116 ? 4.324  56.052 1.510   1.00 31.51 ? 110 SER A CA    1 
ATOM   755  C  C     . SER A 1 116 ? 3.726  55.924 0.107   1.00 34.86 ? 110 SER A C     1 
ATOM   756  O  O     . SER A 1 116 ? 3.671  54.837 -0.444  1.00 38.02 ? 110 SER A O     1 
ATOM   757  C  CB    . SER A 1 116 ? 3.194  56.187 2.553   1.00 35.49 ? 110 SER A CB    1 
ATOM   758  O  OG    . SER A 1 116 ? 2.760  57.531 2.688   1.00 40.34 ? 110 SER A OG    1 
ATOM   759  N  N     . THR A 1 117 ? 3.268  57.035 -0.444  1.00 36.69 ? 111 THR A N     1 
ATOM   760  C  CA    . THR A 1 117 ? 2.610  57.040 -1.755  1.00 40.87 ? 111 THR A CA    1 
ATOM   761  C  C     . THR A 1 117 ? 3.574  56.621 -2.883  1.00 42.35 ? 111 THR A C     1 
ATOM   762  O  O     . THR A 1 117 ? 3.162  55.993 -3.871  1.00 45.61 ? 111 THR A O     1 
ATOM   763  C  CB    . THR A 1 117 ? 2.029  58.430 -2.039  1.00 40.56 ? 111 THR A CB    1 
ATOM   764  O  OG1   . THR A 1 117 ? 3.073  59.412 -1.994  1.00 41.79 ? 111 THR A OG1   1 
ATOM   765  C  CG2   . THR A 1 117 ? 0.983  58.778 -0.994  1.00 45.02 ? 111 THR A CG2   1 
ATOM   766  N  N     . ALA A 1 118 ? 4.856  56.947 -2.705  1.00 41.88 ? 112 ALA A N     1 
ATOM   767  C  CA    . ALA A 1 118 ? 5.912  56.586 -3.659  1.00 39.94 ? 112 ALA A CA    1 
ATOM   768  C  C     . ALA A 1 118 ? 6.397  55.121 -3.570  1.00 39.38 ? 112 ALA A C     1 
ATOM   769  O  O     . ALA A 1 118 ? 7.049  54.644 -4.493  1.00 39.64 ? 112 ALA A O     1 
ATOM   770  C  CB    . ALA A 1 118 ? 7.094  57.534 -3.496  1.00 39.55 ? 112 ALA A CB    1 
ATOM   771  N  N     . LEU A 1 119 ? 6.070  54.413 -2.487  1.00 35.56 ? 113 LEU A N     1 
ATOM   772  C  CA    . LEU A 1 119 ? 6.674  53.093 -2.197  1.00 35.94 ? 113 LEU A CA    1 
ATOM   773  C  C     . LEU A 1 119 ? 6.029  51.919 -2.890  1.00 35.19 ? 113 LEU A C     1 
ATOM   774  O  O     . LEU A 1 119 ? 4.802  51.838 -2.948  1.00 37.34 ? 113 LEU A O     1 
ATOM   775  C  CB    . LEU A 1 119 ? 6.584  52.788 -0.692  1.00 35.19 ? 113 LEU A CB    1 
ATOM   776  C  CG    . LEU A 1 119 ? 7.470  53.586 0.227   1.00 33.69 ? 113 LEU A CG    1 
ATOM   777  C  CD1   . LEU A 1 119 ? 7.306  53.026 1.672   1.00 27.25 ? 113 LEU A CD1   1 
ATOM   778  C  CD2   . LEU A 1 119 ? 8.908  53.540 -0.264  1.00 31.05 ? 113 LEU A CD2   1 
ATOM   779  N  N     . GLN A 1 120 ? 6.850  50.985 -3.372  1.00 33.48 ? 114 GLN A N     1 
ATOM   780  C  CA    . GLN A 1 120 ? 6.382  49.623 -3.691  1.00 35.47 ? 114 GLN A CA    1 
ATOM   781  C  C     . GLN A 1 120 ? 5.999  48.934 -2.372  1.00 30.52 ? 114 GLN A C     1 
ATOM   782  O  O     . GLN A 1 120 ? 6.504  49.308 -1.326  1.00 28.37 ? 114 GLN A O     1 
ATOM   783  C  CB    . GLN A 1 120 ? 7.487  48.804 -4.378  1.00 37.92 ? 114 GLN A CB    1 
ATOM   784  C  CG    . GLN A 1 120 ? 7.644  49.046 -5.867  1.00 43.10 ? 114 GLN A CG    1 
ATOM   785  C  CD    . GLN A 1 120 ? 8.572  48.021 -6.549  1.00 44.15 ? 114 GLN A CD    1 
ATOM   786  O  OE1   . GLN A 1 120 ? 9.784  47.971 -6.282  1.00 47.42 ? 114 GLN A OE1   1 
ATOM   787  N  NE2   . GLN A 1 120 ? 8.000  47.200 -7.432  1.00 45.92 ? 114 GLN A NE2   1 
ATOM   788  N  N     . PRO A 1 121 ? 5.094  47.941 -2.406  1.00 27.66 ? 115 PRO A N     1 
ATOM   789  C  CA    . PRO A 1 121 ? 4.916  47.236 -1.152  1.00 27.69 ? 115 PRO A CA    1 
ATOM   790  C  C     . PRO A 1 121 ? 6.219  46.505 -0.763  1.00 21.99 ? 115 PRO A C     1 
ATOM   791  O  O     . PRO A 1 121 ? 6.996  46.128 -1.624  1.00 21.90 ? 115 PRO A O     1 
ATOM   792  C  CB    . PRO A 1 121 ? 3.794  46.234 -1.456  1.00 28.61 ? 115 PRO A CB    1 
ATOM   793  C  CG    . PRO A 1 121 ? 3.752  46.140 -2.915  1.00 32.03 ? 115 PRO A CG    1 
ATOM   794  C  CD    . PRO A 1 121 ? 4.219  47.429 -3.460  1.00 31.50 ? 115 PRO A CD    1 
ATOM   795  N  N     . TYR A 1 122 ? 6.384  46.278 0.526   1.00 23.21 ? 116 TYR A N     1 
ATOM   796  C  CA    . TYR A 1 122 ? 7.606  45.678 1.077   1.00 22.13 ? 116 TYR A CA    1 
ATOM   797  C  C     . TYR A 1 122 ? 8.021  44.406 0.320   1.00 22.00 ? 116 TYR A C     1 
ATOM   798  O  O     . TYR A 1 122 ? 9.174  44.253 0.005   1.00 23.48 ? 116 TYR A O     1 
ATOM   799  C  CB    . TYR A 1 122 ? 7.429  45.374 2.575   1.00 20.41 ? 116 TYR A CB    1 
ATOM   800  C  CG    . TYR A 1 122 ? 8.650  44.661 3.145   1.00 17.06 ? 116 TYR A CG    1 
ATOM   801  C  CD1   . TYR A 1 122 ? 9.781  45.379 3.521   1.00 16.47 ? 116 TYR A CD1   1 
ATOM   802  C  CD2   . TYR A 1 122 ? 8.699  43.257 3.183   1.00 19.85 ? 116 TYR A CD2   1 
ATOM   803  C  CE1   . TYR A 1 122 ? 10.943 44.726 4.024   1.00 18.89 ? 116 TYR A CE1   1 
ATOM   804  C  CE2   . TYR A 1 122 ? 9.854  42.578 3.666   1.00 17.99 ? 116 TYR A CE2   1 
ATOM   805  C  CZ    . TYR A 1 122 ? 10.971 43.345 4.070   1.00 17.50 ? 116 TYR A CZ    1 
ATOM   806  O  OH    . TYR A 1 122 ? 12.099 42.731 4.513   1.00 16.58 ? 116 TYR A OH    1 
ATOM   807  N  N     . ILE A 1 123 ? 7.091  43.486 0.073   1.00 25.10 ? 117 ILE A N     1 
ATOM   808  C  CA    . ILE A 1 123 ? 7.423  42.207 -0.544  1.00 29.12 ? 117 ILE A CA    1 
ATOM   809  C  C     . ILE A 1 123 ? 8.123  42.353 -1.911  1.00 27.33 ? 117 ILE A C     1 
ATOM   810  O  O     . ILE A 1 123 ? 9.042  41.607 -2.251  1.00 27.23 ? 117 ILE A O     1 
ATOM   811  C  CB    . ILE A 1 123 ? 6.163  41.311 -0.641  1.00 30.95 ? 117 ILE A CB    1 
ATOM   812  C  CG1   . ILE A 1 123 ? 5.813  40.770 0.752   1.00 26.96 ? 117 ILE A CG1   1 
ATOM   813  C  CG2   . ILE A 1 123 ? 6.401  40.157 -1.595  1.00 32.81 ? 117 ILE A CG2   1 
ATOM   814  C  CD1   . ILE A 1 123 ? 4.567  39.935 0.798   1.00 34.16 ? 117 ILE A CD1   1 
ATOM   815  N  N     . LYS A 1 124 ? 7.713  43.354 -2.668  1.00 25.60 ? 118 LYS A N     1 
ATOM   816  C  CA    . LYS A 1 124 ? 8.352  43.664 -3.932  1.00 29.16 ? 118 LYS A CA    1 
ATOM   817  C  C     . LYS A 1 124 ? 9.664  44.399 -3.759  1.00 25.85 ? 118 LYS A C     1 
ATOM   818  O  O     . LYS A 1 124 ? 10.663 44.045 -4.374  1.00 25.67 ? 118 LYS A O     1 
ATOM   819  C  CB    . LYS A 1 124 ? 7.396  44.469 -4.805  1.00 34.07 ? 118 LYS A CB    1 
ATOM   820  C  CG    . LYS A 1 124 ? 6.175  43.642 -5.233  1.00 36.93 ? 118 LYS A CG    1 
ATOM   821  C  CD    . LYS A 1 124 ? 5.686  44.070 -6.621  1.00 39.71 ? 118 LYS A CD    1 
ATOM   822  C  CE    . LYS A 1 124 ? 4.415  43.349 -6.992  1.00 39.76 ? 118 LYS A CE    1 
ATOM   823  N  NZ    . LYS A 1 124 ? 3.777  43.932 -8.228  1.00 42.37 ? 118 LYS A NZ    1 
ATOM   824  N  N     . ARG A 1 125 ? 9.655  45.412 -2.905  1.00 20.43 ? 119 ARG A N     1 
ATOM   825  C  CA    . ARG A 1 125 ? 10.821 46.173 -2.545  1.00 23.05 ? 119 ARG A CA    1 
ATOM   826  C  C     . ARG A 1 125 ? 11.943 45.264 -2.008  1.00 16.94 ? 119 ARG A C     1 
ATOM   827  O  O     . ARG A 1 125 ? 13.095 45.388 -2.410  1.00 19.61 ? 119 ARG A O     1 
ATOM   828  C  CB    . ARG A 1 125 ? 10.393 47.169 -1.445  1.00 26.43 ? 119 ARG A CB    1 
ATOM   829  C  CG    . ARG A 1 125 ? 11.169 48.373 -1.340  1.00 29.12 ? 119 ARG A CG    1 
ATOM   830  C  CD    . ARG A 1 125 ? 10.468 49.433 -0.497  1.00 21.35 ? 119 ARG A CD    1 
ATOM   831  N  NE    . ARG A 1 125 ? 10.380 49.112 0.933   1.00 21.48 ? 119 ARG A NE    1 
ATOM   832  C  CZ    . ARG A 1 125 ? 9.260  49.112 1.658   1.00 20.61 ? 119 ARG A CZ    1 
ATOM   833  N  NH1   . ARG A 1 125 ? 8.075  49.367 1.098   1.00 20.70 ? 119 ARG A NH1   1 
ATOM   834  N  NH2   . ARG A 1 125 ? 9.316  48.845 2.948   1.00 19.11 ? 119 ARG A NH2   1 
ATOM   835  N  N     . ALA A 1 126 ? 11.573 44.374 -1.097  1.00 18.01 ? 120 ALA A N     1 
ATOM   836  C  CA    . ALA A 1 126 ? 12.555 43.512 -0.372  1.00 18.72 ? 120 ALA A CA    1 
ATOM   837  C  C     . ALA A 1 126 ? 13.246 42.523 -1.301  1.00 16.67 ? 120 ALA A C     1 
ATOM   838  O  O     . ALA A 1 126 ? 14.366 42.083 -1.021  1.00 18.31 ? 120 ALA A O     1 
ATOM   839  C  CB    . ALA A 1 126 ? 11.869 42.762 0.761   1.00 16.11 ? 120 ALA A CB    1 
ATOM   840  N  N     . ALA A 1 127 ? 12.577 42.173 -2.415  1.00 17.36 ? 121 ALA A N     1 
ATOM   841  C  CA    . ALA A 1 127 ? 13.070 41.193 -3.409  1.00 18.64 ? 121 ALA A CA    1 
ATOM   842  C  C     . ALA A 1 127 ? 13.964 41.836 -4.459  1.00 19.53 ? 121 ALA A C     1 
ATOM   843  O  O     . ALA A 1 127 ? 14.500 41.147 -5.341  1.00 19.72 ? 121 ALA A O     1 
ATOM   844  C  CB    . ALA A 1 127 ? 11.889 40.460 -4.073  1.00 18.31 ? 121 ALA A CB    1 
ATOM   845  N  N     . ALA A 1 128 ? 14.203 43.141 -4.329  1.00 18.83 ? 122 ALA A N     1 
ATOM   846  C  CA    . ALA A 1 128 ? 15.095 43.867 -5.242  1.00 18.12 ? 122 ALA A CA    1 
ATOM   847  C  C     . ALA A 1 128 ? 16.521 43.278 -5.227  1.00 20.73 ? 122 ALA A C     1 
ATOM   848  O  O     . ALA A 1 128 ? 17.085 42.942 -4.172  1.00 18.10 ? 122 ALA A O     1 
ATOM   849  C  CB    . ALA A 1 128 ? 15.115 45.382 -4.910  1.00 22.91 ? 122 ALA A CB    1 
ATOM   850  N  N     . THR A 1 129 ? 17.115 43.156 -6.412  1.00 21.54 ? 123 THR A N     1 
ATOM   851  C  CA    . THR A 1 129 ? 18.469 42.649 -6.487  1.00 20.45 ? 123 THR A CA    1 
ATOM   852  C  C     . THR A 1 129 ? 19.491 43.695 -6.912  1.00 21.22 ? 123 THR A C     1 
ATOM   853  O  O     . THR A 1 129 ? 20.657 43.396 -6.936  1.00 25.64 ? 123 THR A O     1 
ATOM   854  C  CB    . THR A 1 129 ? 18.538 41.438 -7.396  1.00 23.99 ? 123 THR A CB    1 
ATOM   855  O  OG1   . THR A 1 129 ? 18.109 41.833 -8.690  1.00 23.83 ? 123 THR A OG1   1 
ATOM   856  C  CG2   . THR A 1 129 ? 17.623 40.326 -6.881  1.00 23.36 ? 123 THR A CG2   1 
ATOM   857  N  N     . LYS A 1 130 ? 19.057 44.900 -7.285  1.00 21.70 ? 124 LYS A N     1 
ATOM   858  C  CA    . LYS A 1 130 ? 20.000 45.978 -7.567  1.00 22.88 ? 124 LYS A CA    1 
ATOM   859  C  C     . LYS A 1 130 ? 19.676 47.100 -6.620  1.00 25.40 ? 124 LYS A C     1 
ATOM   860  O  O     . LYS A 1 130 ? 18.576 47.672 -6.690  1.00 27.88 ? 124 LYS A O     1 
ATOM   861  C  CB    . LYS A 1 130 ? 19.885 46.485 -9.003  1.00 25.65 ? 124 LYS A CB    1 
ATOM   862  C  CG    . LYS A 1 130 ? 20.722 47.783 -9.267  1.00 30.01 ? 124 LYS A CG    1 
ATOM   863  N  N     . LEU A 1 131 ? 20.612 47.382 -5.727  1.00 24.08 ? 125 LEU A N     1 
ATOM   864  C  CA    . LEU A 1 131 ? 20.410 48.344 -4.636  1.00 23.53 ? 125 LEU A CA    1 
ATOM   865  C  C     . LEU A 1 131 ? 21.423 49.464 -4.742  1.00 26.39 ? 125 LEU A C     1 
ATOM   866  O  O     . LEU A 1 131 ? 22.497 49.410 -4.153  1.00 30.79 ? 125 LEU A O     1 
ATOM   867  C  CB    . LEU A 1 131 ? 20.574 47.676 -3.281  1.00 20.75 ? 125 LEU A CB    1 
ATOM   868  C  CG    . LEU A 1 131 ? 19.742 46.457 -2.962  1.00 21.02 ? 125 LEU A CG    1 
ATOM   869  C  CD1   . LEU A 1 131 ? 19.944 46.037 -1.509  1.00 23.01 ? 125 LEU A CD1   1 
ATOM   870  C  CD2   . LEU A 1 131 ? 18.297 46.730 -3.270  1.00 22.69 ? 125 LEU A CD2   1 
ATOM   871  N  N     . ALA A 1 132 ? 21.029 50.509 -5.433  1.00 24.60 ? 126 ALA A N     1 
ATOM   872  C  CA    . ALA A 1 132 ? 21.872 51.667 -5.610  1.00 28.38 ? 126 ALA A CA    1 
ATOM   873  C  C     . ALA A 1 132 ? 21.427 52.628 -4.566  1.00 32.44 ? 126 ALA A C     1 
ATOM   874  O  O     . ALA A 1 132 ? 20.236 53.036 -4.528  1.00 33.27 ? 126 ALA A O     1 
ATOM   875  C  CB    . ALA A 1 132 ? 21.692 52.264 -6.966  1.00 27.33 ? 126 ALA A CB    1 
ATOM   876  N  N     . SER A 1 133 ? 22.345 52.945 -3.673  1.00 29.35 ? 127 SER A N     1 
ATOM   877  C  CA    . SER A 1 133 ? 22.159 54.114 -2.829  1.00 33.07 ? 127 SER A CA    1 
ATOM   878  C  C     . SER A 1 133 ? 23.512 54.806 -2.678  1.00 33.56 ? 127 SER A C     1 
ATOM   879  O  O     . SER A 1 133 ? 24.337 54.374 -1.909  1.00 31.39 ? 127 SER A O     1 
ATOM   880  C  CB    . SER A 1 133 ? 21.555 53.701 -1.500  1.00 30.93 ? 127 SER A CB    1 
ATOM   881  O  OG    . SER A 1 133 ? 21.013 54.802 -0.842  1.00 23.08 ? 127 SER A OG    1 
ATOM   882  N  N     . ALA A 1 134 ? 23.724 55.856 -3.479  1.00 32.96 ? 128 ALA A N     1 
ATOM   883  C  CA    . ALA A 1 134 ? 25.004 56.492 -3.563  1.00 30.05 ? 128 ALA A CA    1 
ATOM   884  C  C     . ALA A 1 134 ? 25.334 57.223 -2.274  1.00 26.70 ? 128 ALA A C     1 
ATOM   885  O  O     . ALA A 1 134 ? 24.508 57.936 -1.708  1.00 22.88 ? 128 ALA A O     1 
ATOM   886  C  CB    . ALA A 1 134 ? 25.072 57.440 -4.772  1.00 32.34 ? 128 ALA A CB    1 
ATOM   887  N  N     . GLU A 1 135 ? 26.554 56.965 -1.813  1.00 25.31 ? 129 GLU A N     1 
ATOM   888  C  CA    . GLU A 1 135 ? 27.147 57.579 -0.642  1.00 26.39 ? 129 GLU A CA    1 
ATOM   889  C  C     . GLU A 1 135 ? 26.436 57.228 0.648   1.00 22.78 ? 129 GLU A C     1 
ATOM   890  O  O     . GLU A 1 135 ? 26.514 57.960 1.639   1.00 25.56 ? 129 GLU A O     1 
ATOM   891  C  CB    . GLU A 1 135 ? 27.278 59.089 -0.855  1.00 30.61 ? 129 GLU A CB    1 
ATOM   892  C  CG    . GLU A 1 135 ? 28.340 59.380 -1.959  1.00 31.87 ? 129 GLU A CG    1 
ATOM   893  C  CD    . GLU A 1 135 ? 28.597 60.845 -2.223  1.00 31.65 ? 129 GLU A CD    1 
ATOM   894  O  OE1   . GLU A 1 135 ? 28.013 61.712 -1.534  1.00 38.13 ? 129 GLU A OE1   1 
ATOM   895  O  OE2   . GLU A 1 135 ? 29.412 61.122 -3.122  1.00 34.33 ? 129 GLU A OE2   1 
ATOM   896  N  N     . LYS A 1 136 ? 25.750 56.083 0.636   1.00 21.87 ? 130 LYS A N     1 
ATOM   897  C  CA    . LYS A 1 136 ? 25.126 55.559 1.826   1.00 19.92 ? 130 LYS A CA    1 
ATOM   898  C  C     . LYS A 1 136 ? 26.208 55.147 2.821   1.00 18.29 ? 130 LYS A C     1 
ATOM   899  O  O     . LYS A 1 136 ? 27.163 54.459 2.479   1.00 22.38 ? 130 LYS A O     1 
ATOM   900  C  CB    . LYS A 1 136 ? 24.217 54.372 1.475   1.00 22.27 ? 130 LYS A CB    1 
ATOM   901  C  CG    . LYS A 1 136 ? 23.269 53.915 2.569   1.00 19.69 ? 130 LYS A CG    1 
ATOM   902  C  CD    . LYS A 1 136 ? 22.497 52.701 2.118   1.00 17.32 ? 130 LYS A CD    1 
ATOM   903  C  CE    . LYS A 1 136 ? 21.495 52.242 3.146   1.00 17.39 ? 130 LYS A CE    1 
ATOM   904  N  NZ    . LYS A 1 136 ? 20.404 53.275 3.376   1.00 17.32 ? 130 LYS A NZ    1 
ATOM   905  N  N     . LEU A 1 137 ? 26.021 55.538 4.070   1.00 19.98 ? 131 LEU A N     1 
ATOM   906  C  CA    . LEU A 1 137 ? 26.920 55.176 5.136   1.00 20.25 ? 131 LEU A CA    1 
ATOM   907  C  C     . LEU A 1 137 ? 26.445 53.936 5.893   1.00 22.12 ? 131 LEU A C     1 
ATOM   908  O  O     . LEU A 1 137 ? 25.255 53.661 6.000   1.00 21.62 ? 131 LEU A O     1 
ATOM   909  C  CB    . LEU A 1 137 ? 27.070 56.359 6.110   1.00 22.19 ? 131 LEU A CB    1 
ATOM   910  C  CG    . LEU A 1 137 ? 27.774 57.610 5.616   1.00 24.74 ? 131 LEU A CG    1 
ATOM   911  C  CD1   . LEU A 1 137 ? 27.804 58.634 6.795   1.00 28.56 ? 131 LEU A CD1   1 
ATOM   912  C  CD2   . LEU A 1 137 ? 29.150 57.270 5.101   1.00 27.68 ? 131 LEU A CD2   1 
ATOM   913  N  N     . MET A 1 138 ? 27.408 53.208 6.451   1.00 21.15 ? 132 MET A N     1 
ATOM   914  C  CA    . MET A 1 138 ? 27.131 52.045 7.259   1.00 23.12 ? 132 MET A CA    1 
ATOM   915  C  C     . MET A 1 138 ? 26.359 52.451 8.537   1.00 22.77 ? 132 MET A C     1 
ATOM   916  O  O     . MET A 1 138 ? 26.652 53.490 9.155   1.00 22.24 ? 132 MET A O     1 
ATOM   917  C  CB    . MET A 1 138 ? 28.458 51.364 7.619   1.00 23.00 ? 132 MET A CB    1 
ATOM   918  C  CG    . MET A 1 138 ? 28.344 50.127 8.466   1.00 26.58 ? 132 MET A CG    1 
ATOM   919  S  SD    . MET A 1 138 ? 29.977 49.376 8.750   1.00 28.46 ? 132 MET A SD    1 
ATOM   920  C  CE    . MET A 1 138 ? 30.475 50.270 10.203  1.00 32.20 ? 132 MET A CE    1 
ATOM   921  N  N     . TYR A 1 139 ? 25.375 51.639 8.895   1.00 17.85 ? 133 TYR A N     1 
ATOM   922  C  CA    . TYR A 1 139 ? 24.554 51.855 10.093  1.00 21.41 ? 133 TYR A CA    1 
ATOM   923  C  C     . TYR A 1 139 ? 25.123 51.154 11.323  1.00 24.13 ? 133 TYR A C     1 
ATOM   924  O  O     . TYR A 1 139 ? 25.439 49.961 11.254  1.00 20.31 ? 133 TYR A O     1 
ATOM   925  C  CB    . TYR A 1 139 ? 23.159 51.326 9.809   1.00 19.29 ? 133 TYR A CB    1 
ATOM   926  C  CG    . TYR A 1 139 ? 22.207 51.283 10.967  1.00 17.65 ? 133 TYR A CG    1 
ATOM   927  C  CD1   . TYR A 1 139 ? 21.345 52.343 11.234  1.00 20.42 ? 133 TYR A CD1   1 
ATOM   928  C  CD2   . TYR A 1 139 ? 22.120 50.155 11.761  1.00 18.86 ? 133 TYR A CD2   1 
ATOM   929  C  CE1   . TYR A 1 139 ? 20.457 52.290 12.293  1.00 18.94 ? 133 TYR A CE1   1 
ATOM   930  C  CE2   . TYR A 1 139 ? 21.257 50.094 12.809  1.00 18.99 ? 133 TYR A CE2   1 
ATOM   931  C  CZ    . TYR A 1 139 ? 20.392 51.170 13.058  1.00 18.85 ? 133 TYR A CZ    1 
ATOM   932  O  OH    . TYR A 1 139 ? 19.541 51.030 14.104  1.00 19.76 ? 133 TYR A OH    1 
ATOM   933  N  N     . PHE A 1 140 ? 25.209 51.897 12.441  1.00 21.30 ? 134 PHE A N     1 
ATOM   934  C  CA    . PHE A 1 140 ? 25.515 51.352 13.779  1.00 21.58 ? 134 PHE A CA    1 
ATOM   935  C  C     . PHE A 1 140 ? 24.308 51.264 14.663  1.00 23.69 ? 134 PHE A C     1 
ATOM   936  O  O     . PHE A 1 140 ? 24.009 50.200 15.206  1.00 27.26 ? 134 PHE A O     1 
ATOM   937  C  CB    . PHE A 1 140 ? 26.564 52.198 14.481  1.00 26.11 ? 134 PHE A CB    1 
ATOM   938  C  CG    . PHE A 1 140 ? 27.910 52.079 13.891  1.00 26.17 ? 134 PHE A CG    1 
ATOM   939  C  CD1   . PHE A 1 140 ? 28.797 51.105 14.350  1.00 31.93 ? 134 PHE A CD1   1 
ATOM   940  C  CD2   . PHE A 1 140 ? 28.300 52.911 12.851  1.00 28.37 ? 134 PHE A CD2   1 
ATOM   941  C  CE1   . PHE A 1 140 ? 30.070 50.989 13.790  1.00 27.68 ? 134 PHE A CE1   1 
ATOM   942  C  CE2   . PHE A 1 140 ? 29.551 52.803 12.285  1.00 30.91 ? 134 PHE A CE2   1 
ATOM   943  C  CZ    . PHE A 1 140 ? 30.440 51.827 12.754  1.00 28.98 ? 134 PHE A CZ    1 
ATOM   944  N  N     . CYS A 1 141 ? 23.603 52.392 14.801  1.00 26.88 ? 135 CYS A N     1 
ATOM   945  C  CA    . CYS A 1 141 ? 22.437 52.512 15.691  1.00 27.98 ? 135 CYS A CA    1 
ATOM   946  C  C     . CYS A 1 141 ? 21.638 53.794 15.397  1.00 26.71 ? 135 CYS A C     1 
ATOM   947  O  O     . CYS A 1 141 ? 22.109 54.693 14.720  1.00 23.10 ? 135 CYS A O     1 
ATOM   948  C  CB    . CYS A 1 141 ? 22.894 52.519 17.151  1.00 31.08 ? 135 CYS A CB    1 
ATOM   949  S  SG    . CYS A 1 141 ? 24.086 53.804 17.469  1.00 34.81 ? 135 CYS A SG    1 
ATOM   950  N  N     . THR A 1 142 ? 20.417 53.873 15.911  1.00 27.23 ? 136 THR A N     1 
ATOM   951  C  CA    . THR A 1 142 ? 19.568 55.050 15.632  1.00 31.90 ? 136 THR A CA    1 
ATOM   952  C  C     . THR A 1 142 ? 20.146 56.375 16.275  1.00 30.24 ? 136 THR A C     1 
ATOM   953  O  O     . THR A 1 142 ? 19.874 57.484 15.780  1.00 27.70 ? 136 THR A O     1 
ATOM   954  C  CB    . THR A 1 142 ? 18.114 54.767 16.011  1.00 31.99 ? 136 THR A CB    1 
ATOM   955  O  OG1   . THR A 1 142 ? 18.048 54.283 17.357  1.00 30.89 ? 136 THR A OG1   1 
ATOM   956  C  CG2   . THR A 1 142 ? 17.501 53.668 15.051  1.00 29.27 ? 136 THR A CG2   1 
ATOM   957  N  N     . ASP A 1 143 ? 20.953 56.227 17.336  1.00 32.83 ? 137 ASP A N     1 
ATOM   958  C  CA    . ASP A 1 143 ? 21.758 57.336 17.949  1.00 36.98 ? 137 ASP A CA    1 
ATOM   959  C  C     . ASP A 1 143 ? 22.662 58.046 16.954  1.00 36.90 ? 137 ASP A C     1 
ATOM   960  O  O     . ASP A 1 143 ? 22.878 59.266 17.014  1.00 37.86 ? 137 ASP A O     1 
ATOM   961  C  CB    . ASP A 1 143 ? 22.689 56.782 19.043  1.00 39.50 ? 137 ASP A CB    1 
ATOM   962  C  CG    . ASP A 1 143 ? 21.966 56.450 20.319  1.00 45.09 ? 137 ASP A CG    1 
ATOM   963  O  OD1   . ASP A 1 143 ? 20.744 56.731 20.409  1.00 47.10 ? 137 ASP A OD1   1 
ATOM   964  O  OD2   . ASP A 1 143 ? 22.627 55.912 21.245  1.00 46.98 ? 137 ASP A OD2   1 
ATOM   965  N  N     . GLN A 1 144 ? 23.219 57.245 16.058  1.00 35.46 ? 138 GLN A N     1 
ATOM   966  C  CA    . GLN A 1 144 ? 24.079 57.734 15.020  1.00 32.83 ? 138 GLN A CA    1 
ATOM   967  C  C     . GLN A 1 144 ? 23.336 58.713 14.126  1.00 33.46 ? 138 GLN A C     1 
ATOM   968  O  O     . GLN A 1 144 ? 23.950 59.634 13.611  1.00 36.45 ? 138 GLN A O     1 
ATOM   969  C  CB    . GLN A 1 144 ? 24.608 56.530 14.206  1.00 31.43 ? 138 GLN A CB    1 
ATOM   970  C  CG    . GLN A 1 144 ? 25.483 56.841 12.981  1.00 30.52 ? 138 GLN A CG    1 
ATOM   971  C  CD    . GLN A 1 144 ? 25.600 55.636 12.096  1.00 32.10 ? 138 GLN A CD    1 
ATOM   972  O  OE1   . GLN A 1 144 ? 24.783 54.690 12.206  1.00 25.86 ? 138 GLN A OE1   1 
ATOM   973  N  NE2   . GLN A 1 144 ? 26.596 55.647 11.197  1.00 31.43 ? 138 GLN A NE2   1 
ATOM   974  N  N     . LEU A 1 145 ? 22.021 58.520 13.938  1.00 30.82 ? 139 LEU A N     1 
ATOM   975  C  CA    . LEU A 1 145 ? 21.317 59.164 12.832  1.00 31.02 ? 139 LEU A CA    1 
ATOM   976  C  C     . LEU A 1 145 ? 21.206 60.679 13.087  1.00 35.69 ? 139 LEU A C     1 
ATOM   977  O  O     . LEU A 1 145 ? 20.929 61.117 14.211  1.00 34.00 ? 139 LEU A O     1 
ATOM   978  C  CB    . LEU A 1 145 ? 19.945 58.501 12.575  1.00 29.61 ? 139 LEU A CB    1 
ATOM   979  C  CG    . LEU A 1 145 ? 19.908 56.970 12.411  1.00 27.97 ? 139 LEU A CG    1 
ATOM   980  C  CD1   . LEU A 1 145 ? 18.502 56.468 12.274  1.00 26.31 ? 139 LEU A CD1   1 
ATOM   981  C  CD2   . LEU A 1 145 ? 20.783 56.533 11.198  1.00 26.98 ? 139 LEU A CD2   1 
ATOM   982  N  N     . GLY A 1 146 ? 21.493 61.460 12.051  1.00 40.41 ? 140 GLY A N     1 
ATOM   983  C  CA    . GLY A 1 146 ? 21.639 62.923 12.184  1.00 44.25 ? 140 GLY A CA    1 
ATOM   984  C  C     . GLY A 1 146 ? 22.773 63.365 13.107  1.00 46.65 ? 140 GLY A C     1 
ATOM   985  O  O     . GLY A 1 146 ? 22.806 64.518 13.550  1.00 50.10 ? 140 GLY A O     1 
ATOM   986  N  N     . LEU A 1 147 ? 23.687 62.438 13.407  1.00 47.19 ? 141 LEU A N     1 
ATOM   987  C  CA    . LEU A 1 147 ? 24.822 62.666 14.307  1.00 46.60 ? 141 LEU A CA    1 
ATOM   988  C  C     . LEU A 1 147 ? 25.968 61.773 13.819  1.00 46.82 ? 141 LEU A C     1 
ATOM   989  O  O     . LEU A 1 147 ? 26.693 61.165 14.615  1.00 46.39 ? 141 LEU A O     1 
ATOM   990  C  CB    . LEU A 1 147 ? 24.469 62.294 15.761  1.00 44.90 ? 141 LEU A CB    1 
ATOM   991  C  CG    . LEU A 1 147 ? 23.299 63.005 16.455  1.00 44.23 ? 141 LEU A CG    1 
ATOM   992  C  CD1   . LEU A 1 147 ? 23.077 62.434 17.843  1.00 42.50 ? 141 LEU A CD1   1 
ATOM   993  C  CD2   . LEU A 1 147 ? 23.562 64.501 16.499  1.00 43.66 ? 141 LEU A CD2   1 
ATOM   994  N  N     . GLU A 1 148 ? 26.106 61.695 12.498  1.00 48.24 ? 142 GLU A N     1 
ATOM   995  C  CA    . GLU A 1 148 ? 26.886 60.632 11.856  1.00 46.77 ? 142 GLU A CA    1 
ATOM   996  C  C     . GLU A 1 148 ? 28.399 60.927 11.939  1.00 49.75 ? 142 GLU A C     1 
ATOM   997  O  O     . GLU A 1 148 ? 29.236 60.007 11.989  1.00 45.82 ? 142 GLU A O     1 
ATOM   998  C  CB    . GLU A 1 148 ? 26.347 60.400 10.437  1.00 45.59 ? 142 GLU A CB    1 
ATOM   999  C  CG    . GLU A 1 148 ? 24.879 59.824 10.497  1.00 43.93 ? 142 GLU A CG    1 
ATOM   1000 C  CD    . GLU A 1 148 ? 23.938 60.252 9.339   1.00 42.93 ? 142 GLU A CD    1 
ATOM   1001 O  OE1   . GLU A 1 148 ? 24.419 60.886 8.362   1.00 45.42 ? 142 GLU A OE1   1 
ATOM   1002 O  OE2   . GLU A 1 148 ? 22.713 59.955 9.419   1.00 27.46 ? 142 GLU A OE2   1 
ATOM   1003 N  N     . GLN A 1 149 ? 28.730 62.217 12.031  1.00 53.32 ? 143 GLN A N     1 
ATOM   1004 C  CA    . GLN A 1 149 ? 30.087 62.655 12.390  1.00 55.00 ? 143 GLN A CA    1 
ATOM   1005 C  C     . GLN A 1 149 ? 30.597 62.002 13.690  1.00 55.58 ? 143 GLN A C     1 
ATOM   1006 O  O     . GLN A 1 149 ? 31.797 61.825 13.849  1.00 58.25 ? 143 GLN A O     1 
ATOM   1007 C  CB    . GLN A 1 149 ? 30.140 64.184 12.511  1.00 55.34 ? 143 GLN A CB    1 
ATOM   1008 N  N     . ASP A 1 150 ? 29.685 61.629 14.596  1.00 55.50 ? 144 ASP A N     1 
ATOM   1009 C  CA    . ASP A 1 150 ? 30.047 60.971 15.869  1.00 54.50 ? 144 ASP A CA    1 
ATOM   1010 C  C     . ASP A 1 150 ? 30.460 59.500 15.735  1.00 53.76 ? 144 ASP A C     1 
ATOM   1011 O  O     . ASP A 1 150 ? 30.956 58.903 16.694  1.00 50.88 ? 144 ASP A O     1 
ATOM   1012 C  CB    . ASP A 1 150 ? 28.885 61.075 16.879  1.00 55.28 ? 144 ASP A CB    1 
ATOM   1013 N  N     . PHE A 1 151 ? 30.223 58.909 14.565  1.00 53.51 ? 145 PHE A N     1 
ATOM   1014 C  CA    . PHE A 1 151 ? 30.577 57.512 14.321  1.00 51.90 ? 145 PHE A CA    1 
ATOM   1015 C  C     . PHE A 1 151 ? 31.516 57.408 13.142  1.00 52.28 ? 145 PHE A C     1 
ATOM   1016 O  O     . PHE A 1 151 ? 31.696 58.362 12.373  1.00 52.97 ? 145 PHE A O     1 
ATOM   1017 C  CB    . PHE A 1 151 ? 29.326 56.669 14.032  1.00 50.93 ? 145 PHE A CB    1 
ATOM   1018 C  CG    . PHE A 1 151 ? 28.517 56.343 15.247  1.00 50.22 ? 145 PHE A CG    1 
ATOM   1019 C  CD1   . PHE A 1 151 ? 28.606 55.087 15.840  1.00 50.08 ? 145 PHE A CD1   1 
ATOM   1020 C  CD2   . PHE A 1 151 ? 27.664 57.295 15.812  1.00 51.33 ? 145 PHE A CD2   1 
ATOM   1021 C  CE1   . PHE A 1 151 ? 27.857 54.785 16.973  1.00 51.18 ? 145 PHE A CE1   1 
ATOM   1022 C  CE2   . PHE A 1 151 ? 26.905 56.995 16.945  1.00 49.24 ? 145 PHE A CE2   1 
ATOM   1023 C  CZ    . PHE A 1 151 ? 27.005 55.748 17.523  1.00 50.57 ? 145 PHE A CZ    1 
ATOM   1024 N  N     . GLU A 1 152 ? 32.108 56.229 13.012  1.00 50.22 ? 146 GLU A N     1 
ATOM   1025 C  CA    . GLU A 1 152 ? 32.880 55.865 11.847  1.00 50.17 ? 146 GLU A CA    1 
ATOM   1026 C  C     . GLU A 1 152 ? 31.989 56.000 10.610  1.00 47.93 ? 146 GLU A C     1 
ATOM   1027 O  O     . GLU A 1 152 ? 30.810 55.611 10.640  1.00 45.55 ? 146 GLU A O     1 
ATOM   1028 C  CB    . GLU A 1 152 ? 33.355 54.420 12.021  1.00 51.63 ? 146 GLU A CB    1 
ATOM   1029 C  CG    . GLU A 1 152 ? 34.096 53.794 10.847  1.00 53.93 ? 146 GLU A CG    1 
ATOM   1030 C  CD    . GLU A 1 152 ? 34.497 52.353 11.145  1.00 55.47 ? 146 GLU A CD    1 
ATOM   1031 O  OE1   . GLU A 1 152 ? 34.340 51.489 10.256  1.00 56.86 ? 146 GLU A OE1   1 
ATOM   1032 O  OE2   . GLU A 1 152 ? 34.956 52.087 12.286  1.00 60.21 ? 146 GLU A OE2   1 
ATOM   1033 N  N     . GLN A 1 153 ? 32.550 56.568 9.539   1.00 45.98 ? 147 GLN A N     1 
ATOM   1034 C  CA    . GLN A 1 153 ? 31.827 56.797 8.284   1.00 42.34 ? 147 GLN A CA    1 
ATOM   1035 C  C     . GLN A 1 153 ? 32.374 55.914 7.162   1.00 40.23 ? 147 GLN A C     1 
ATOM   1036 O  O     . GLN A 1 153 ? 33.236 56.322 6.391   1.00 39.21 ? 147 GLN A O     1 
ATOM   1037 C  CB    . GLN A 1 153 ? 31.891 58.273 7.895   1.00 44.07 ? 147 GLN A CB    1 
ATOM   1038 C  CG    . GLN A 1 153 ? 31.089 59.164 8.854   1.00 44.65 ? 147 GLN A CG    1 
ATOM   1039 C  CD    . GLN A 1 153 ? 31.231 60.635 8.559   1.00 46.44 ? 147 GLN A CD    1 
ATOM   1040 O  OE1   . GLN A 1 153 ? 31.548 61.428 9.453   1.00 50.74 ? 147 GLN A OE1   1 
ATOM   1041 N  NE2   . GLN A 1 153 ? 30.986 61.018 7.313   1.00 42.82 ? 147 GLN A NE2   1 
ATOM   1042 N  N     . LYS A 1 154 ? 31.845 54.703 7.081   1.00 36.58 ? 148 LYS A N     1 
ATOM   1043 C  CA    . LYS A 1 154 ? 32.161 53.770 6.013   1.00 35.81 ? 148 LYS A CA    1 
ATOM   1044 C  C     . LYS A 1 154 ? 31.016 53.748 5.011   1.00 32.41 ? 148 LYS A C     1 
ATOM   1045 O  O     . LYS A 1 154 ? 29.886 53.489 5.379   1.00 27.05 ? 148 LYS A O     1 
ATOM   1046 C  CB    . LYS A 1 154 ? 32.366 52.379 6.593   1.00 38.46 ? 148 LYS A CB    1 
ATOM   1047 C  CG    . LYS A 1 154 ? 32.892 51.351 5.580   1.00 40.74 ? 148 LYS A CG    1 
ATOM   1048 C  CD    . LYS A 1 154 ? 32.386 49.937 5.903   1.00 41.67 ? 148 LYS A CD    1 
ATOM   1049 C  CE    . LYS A 1 154 ? 32.646 48.963 4.730   1.00 42.52 ? 148 LYS A CE    1 
ATOM   1050 N  NZ    . LYS A 1 154 ? 31.922 49.345 3.456   1.00 43.45 ? 148 LYS A NZ    1 
ATOM   1051 N  N     . GLN A 1 155 ? 31.342 54.015 3.744   1.00 30.13 ? 149 GLN A N     1 
ATOM   1052 C  CA    . GLN A 1 155 ? 30.377 54.057 2.648   1.00 31.01 ? 149 GLN A CA    1 
ATOM   1053 C  C     . GLN A 1 155 ? 30.095 52.654 2.076   1.00 30.86 ? 149 GLN A C     1 
ATOM   1054 O  O     . GLN A 1 155 ? 30.995 51.814 1.991   1.00 30.91 ? 149 GLN A O     1 
ATOM   1055 C  CB    . GLN A 1 155 ? 30.888 54.977 1.530   1.00 34.85 ? 149 GLN A CB    1 
ATOM   1056 C  CG    . GLN A 1 155 ? 30.740 56.488 1.835   1.00 37.87 ? 149 GLN A CG    1 
ATOM   1057 C  CD    . GLN A 1 155 ? 30.964 57.386 0.609   1.00 39.35 ? 149 GLN A CD    1 
ATOM   1058 O  OE1   . GLN A 1 155 ? 31.015 56.921 -0.543  1.00 42.27 ? 149 GLN A OE1   1 
ATOM   1059 N  NE2   . GLN A 1 155 ? 31.112 58.681 0.861   1.00 41.46 ? 149 GLN A NE2   1 
ATOM   1060 N  N     . MET A 1 156 ? 28.843 52.407 1.708   1.00 27.82 ? 150 MET A N     1 
ATOM   1061 C  CA    . MET A 1 156 ? 28.456 51.212 0.949   1.00 30.08 ? 150 MET A CA    1 
ATOM   1062 C  C     . MET A 1 156 ? 29.264 51.152 -0.373  1.00 30.66 ? 150 MET A C     1 
ATOM   1063 O  O     . MET A 1 156 ? 29.395 52.149 -1.055  1.00 33.65 ? 150 MET A O     1 
ATOM   1064 C  CB    . MET A 1 156 ? 26.955 51.258 0.647   1.00 28.83 ? 150 MET A CB    1 
ATOM   1065 C  CG    . MET A 1 156 ? 26.371 49.941 0.184   1.00 30.86 ? 150 MET A CG    1 
ATOM   1066 S  SD    . MET A 1 156 ? 24.620 49.985 -0.137  1.00 30.47 ? 150 MET A SD    1 
ATOM   1067 C  CE    . MET A 1 156 ? 24.512 51.057 -1.551  1.00 33.93 ? 150 MET A CE    1 
ATOM   1068 N  N     . PRO A 1 157 ? 29.819 49.981 -0.729  1.00 31.36 ? 151 PRO A N     1 
ATOM   1069 C  CA    . PRO A 1 157 ? 30.705 49.946 -1.915  1.00 33.79 ? 151 PRO A CA    1 
ATOM   1070 C  C     . PRO A 1 157 ? 30.031 50.341 -3.219  1.00 39.83 ? 151 PRO A C     1 
ATOM   1071 O  O     . PRO A 1 157 ? 28.912 49.841 -3.529  1.00 41.14 ? 151 PRO A O     1 
ATOM   1072 C  CB    . PRO A 1 157 ? 31.169 48.490 -1.973  1.00 32.70 ? 151 PRO A CB    1 
ATOM   1073 C  CG    . PRO A 1 157 ? 30.210 47.745 -1.227  1.00 32.52 ? 151 PRO A CG    1 
ATOM   1074 C  CD    . PRO A 1 157 ? 29.718 48.667 -0.109  1.00 31.46 ? 151 PRO A CD    1 
ATOM   1075 N  N     . ASP A 1 158 ? 30.696 51.257 -3.947  1.00 39.69 ? 152 ASP A N     1 
ATOM   1076 C  CA    . ASP A 1 158 ? 30.309 51.701 -5.307  1.00 38.92 ? 152 ASP A CA    1 
ATOM   1077 C  C     . ASP A 1 158 ? 28.965 52.419 -5.364  1.00 39.72 ? 152 ASP A C     1 
ATOM   1078 O  O     . ASP A 1 158 ? 28.455 52.663 -6.465  1.00 31.88 ? 152 ASP A O     1 
ATOM   1079 C  CB    . ASP A 1 158 ? 30.281 50.524 -6.303  1.00 42.85 ? 152 ASP A CB    1 
ATOM   1080 C  CG    . ASP A 1 158 ? 31.550 49.622 -6.228  1.00 45.12 ? 152 ASP A CG    1 
ATOM   1081 O  OD1   . ASP A 1 158 ? 32.677 50.152 -6.100  1.00 46.45 ? 152 ASP A OD1   1 
ATOM   1082 O  OD2   . ASP A 1 158 ? 31.408 48.376 -6.312  1.00 48.96 ? 152 ASP A OD2   1 
ATOM   1083 N  N     . GLY A 1 159 ? 28.397 52.733 -4.178  1.00 42.01 ? 153 GLY A N     1 
ATOM   1084 C  CA    . GLY A 1 159 ? 26.996 53.254 -4.018  1.00 38.11 ? 153 GLY A CA    1 
ATOM   1085 C  C     . GLY A 1 159 ? 25.888 52.296 -4.454  1.00 37.98 ? 153 GLY A C     1 
ATOM   1086 O  O     . GLY A 1 159 ? 24.687 52.672 -4.503  1.00 33.26 ? 153 GLY A O     1 
ATOM   1087 N  N     . LYS A 1 160 ? 26.294 51.049 -4.743  1.00 37.48 ? 154 LYS A N     1 
ATOM   1088 C  CA    . LYS A 1 160 ? 25.451 50.048 -5.395  1.00 37.41 ? 154 LYS A CA    1 
ATOM   1089 C  C     . LYS A 1 160 ? 25.842 48.616 -4.947  1.00 39.40 ? 154 LYS A C     1 
ATOM   1090 O  O     . LYS A 1 160 ? 27.044 48.308 -4.794  1.00 38.87 ? 154 LYS A O     1 
ATOM   1091 C  CB    . LYS A 1 160 ? 25.566 50.184 -6.930  1.00 37.70 ? 154 LYS A CB    1 
ATOM   1092 C  CG    . LYS A 1 160 ? 24.722 49.169 -7.706  1.00 37.20 ? 154 LYS A CG    1 
ATOM   1093 C  CD    . LYS A 1 160 ? 24.455 49.618 -9.127  1.00 38.73 ? 154 LYS A CD    1 
ATOM   1094 N  N     . LEU A 1 161 ? 24.832 47.765 -4.711  1.00 34.72 ? 155 LEU A N     1 
ATOM   1095 C  CA    . LEU A 1 161 ? 25.057 46.356 -4.435  1.00 30.04 ? 155 LEU A CA    1 
ATOM   1096 C  C     . LEU A 1 161 ? 24.158 45.510 -5.348  1.00 28.22 ? 155 LEU A C     1 
ATOM   1097 O  O     . LEU A 1 161 ? 22.955 45.741 -5.435  1.00 25.34 ? 155 LEU A O     1 
ATOM   1098 C  CB    . LEU A 1 161 ? 24.809 45.989 -2.947  1.00 31.42 ? 155 LEU A CB    1 
ATOM   1099 C  CG    . LEU A 1 161 ? 25.798 46.411 -1.840  1.00 31.62 ? 155 LEU A CG    1 
ATOM   1100 C  CD1   . LEU A 1 161 ? 25.266 45.966 -0.448  1.00 31.01 ? 155 LEU A CD1   1 
ATOM   1101 C  CD2   . LEU A 1 161 ? 27.219 45.908 -2.043  1.00 31.87 ? 155 LEU A CD2   1 
ATOM   1102 N  N     . LEU A 1 162 ? 24.766 44.535 -6.026  1.00 24.21 ? 156 LEU A N     1 
ATOM   1103 C  CA    . LEU A 1 162 ? 24.025 43.522 -6.734  1.00 22.97 ? 156 LEU A CA    1 
ATOM   1104 C  C     . LEU A 1 162 ? 23.894 42.314 -5.800  1.00 22.42 ? 156 LEU A C     1 
ATOM   1105 O  O     . LEU A 1 162 ? 24.886 41.687 -5.447  1.00 21.34 ? 156 LEU A O     1 
ATOM   1106 C  CB    . LEU A 1 162 ? 24.747 43.163 -8.019  1.00 27.39 ? 156 LEU A CB    1 
ATOM   1107 C  CG    . LEU A 1 162 ? 24.890 44.290 -9.064  1.00 31.57 ? 156 LEU A CG    1 
ATOM   1108 C  CD1   . LEU A 1 162 ? 25.437 43.691 -10.356 1.00 35.51 ? 156 LEU A CD1   1 
ATOM   1109 C  CD2   . LEU A 1 162 ? 23.584 44.987 -9.333  1.00 34.87 ? 156 LEU A CD2   1 
ATOM   1110 N  N     . VAL A 1 163 ? 22.661 42.056 -5.348  1.00 20.56 ? 157 VAL A N     1 
ATOM   1111 C  CA    . VAL A 1 163 ? 22.352 41.035 -4.308  1.00 18.83 ? 157 VAL A CA    1 
ATOM   1112 C  C     . VAL A 1 163 ? 22.665 39.638 -4.855  1.00 19.89 ? 157 VAL A C     1 
ATOM   1113 O  O     . VAL A 1 163 ? 22.226 39.291 -5.959  1.00 18.56 ? 157 VAL A O     1 
ATOM   1114 C  CB    . VAL A 1 163 ? 20.868 41.118 -3.895  1.00 21.61 ? 157 VAL A CB    1 
ATOM   1115 C  CG1   . VAL A 1 163 ? 20.450 40.023 -2.946  1.00 17.48 ? 157 VAL A CG1   1 
ATOM   1116 C  CG2   . VAL A 1 163 ? 20.575 42.530 -3.259  1.00 18.21 ? 157 VAL A CG2   1 
ATOM   1117 N  N     . ASP A 1 164 ? 23.436 38.881 -4.089  1.00 16.21 ? 158 ASP A N     1 
ATOM   1118 C  CA    . ASP A 1 164 ? 23.792 37.492 -4.452  1.00 17.85 ? 158 ASP A CA    1 
ATOM   1119 C  C     . ASP A 1 164 ? 22.840 36.451 -3.816  1.00 19.27 ? 158 ASP A C     1 
ATOM   1120 O  O     . ASP A 1 164 ? 22.675 35.373 -4.318  1.00 17.06 ? 158 ASP A O     1 
ATOM   1121 C  CB    . ASP A 1 164 ? 25.212 37.222 -4.039  1.00 18.51 ? 158 ASP A CB    1 
ATOM   1122 C  CG    . ASP A 1 164 ? 26.222 38.069 -4.832  1.00 18.92 ? 158 ASP A CG    1 
ATOM   1123 O  OD1   . ASP A 1 164 ? 26.176 37.989 -6.075  1.00 21.27 ? 158 ASP A OD1   1 
ATOM   1124 O  OD2   . ASP A 1 164 ? 27.006 38.838 -4.219  1.00 20.58 ? 158 ASP A OD2   1 
ATOM   1125 N  N     . GLY A 1 165 ? 22.231 36.795 -2.683  1.00 17.24 ? 159 GLY A N     1 
ATOM   1126 C  CA    . GLY A 1 165 ? 21.364 35.871 -1.954  1.00 17.57 ? 159 GLY A CA    1 
ATOM   1127 C  C     . GLY A 1 165 ? 20.577 36.564 -0.844  1.00 16.50 ? 159 GLY A C     1 
ATOM   1128 O  O     . GLY A 1 165 ? 20.915 37.669 -0.463  1.00 14.50 ? 159 GLY A O     1 
ATOM   1129 N  N     . PHE A 1 166 ? 19.583 35.852 -0.306  1.00 15.05 ? 160 PHE A N     1 
ATOM   1130 C  CA    . PHE A 1 166 ? 18.685 36.333 0.727   1.00 15.87 ? 160 PHE A CA    1 
ATOM   1131 C  C     . PHE A 1 166 ? 18.662 35.424 1.947   1.00 16.69 ? 160 PHE A C     1 
ATOM   1132 O  O     . PHE A 1 166 ? 18.614 34.179 1.813   1.00 18.47 ? 160 PHE A O     1 
ATOM   1133 C  CB    . PHE A 1 166 ? 17.251 36.357 0.182   1.00 17.37 ? 160 PHE A CB    1 
ATOM   1134 C  CG    . PHE A 1 166 ? 17.042 37.307 -0.973  1.00 14.95 ? 160 PHE A CG    1 
ATOM   1135 C  CD1   . PHE A 1 166 ? 16.828 38.661 -0.735  1.00 17.33 ? 160 PHE A CD1   1 
ATOM   1136 C  CD2   . PHE A 1 166 ? 17.026 36.841 -2.281  1.00 16.24 ? 160 PHE A CD2   1 
ATOM   1137 C  CE1   . PHE A 1 166 ? 16.636 39.530 -1.761  1.00 16.90 ? 160 PHE A CE1   1 
ATOM   1138 C  CE2   . PHE A 1 166 ? 16.829 37.702 -3.332  1.00 16.49 ? 160 PHE A CE2   1 
ATOM   1139 C  CZ    . PHE A 1 166 ? 16.641 39.052 -3.084  1.00 16.63 ? 160 PHE A CZ    1 
ATOM   1140 N  N     . LEU A 1 167 ? 18.622 36.043 3.149   1.00 12.77 ? 161 LEU A N     1 
ATOM   1141 C  CA    . LEU A 1 167 ? 18.234 35.339 4.345   1.00 12.15 ? 161 LEU A CA    1 
ATOM   1142 C  C     . LEU A 1 167 ? 16.782 35.713 4.606   1.00 14.19 ? 161 LEU A C     1 
ATOM   1143 O  O     . LEU A 1 167 ? 16.476 36.893 4.704   1.00 15.84 ? 161 LEU A O     1 
ATOM   1144 C  CB    . LEU A 1 167 ? 19.097 35.742 5.548   1.00 13.05 ? 161 LEU A CB    1 
ATOM   1145 C  CG    . LEU A 1 167 ? 20.581 35.319 5.542   1.00 15.26 ? 161 LEU A CG    1 
ATOM   1146 C  CD1   . LEU A 1 167 ? 21.201 35.610 6.917   1.00 15.46 ? 161 LEU A CD1   1 
ATOM   1147 C  CD2   . LEU A 1 167 ? 20.785 33.827 5.134   1.00 13.42 ? 161 LEU A CD2   1 
ATOM   1148 N  N     . LEU A 1 168 ? 15.900 34.707 4.698   1.00 16.13 ? 162 LEU A N     1 
ATOM   1149 C  CA    . LEU A 1 168 ? 14.473 34.950 4.932   1.00 17.62 ? 162 LEU A CA    1 
ATOM   1150 C  C     . LEU A 1 168 ? 14.145 34.675 6.401   1.00 17.02 ? 162 LEU A C     1 
ATOM   1151 O  O     . LEU A 1 168 ? 14.056 33.514 6.818   1.00 18.39 ? 162 LEU A O     1 
ATOM   1152 C  CB    . LEU A 1 168 ? 13.622 34.050 4.015   1.00 18.55 ? 162 LEU A CB    1 
ATOM   1153 C  CG    . LEU A 1 168 ? 12.095 34.122 4.210   1.00 18.92 ? 162 LEU A CG    1 
ATOM   1154 C  CD1   . LEU A 1 168 ? 11.543 35.575 4.186   1.00 20.28 ? 162 LEU A CD1   1 
ATOM   1155 C  CD2   . LEU A 1 168 ? 11.372 33.173 3.195   1.00 17.56 ? 162 LEU A CD2   1 
ATOM   1156 N  N     . GLY A 1 169 ? 14.007 35.747 7.174   1.00 16.76 ? 163 GLY A N     1 
ATOM   1157 C  CA    . GLY A 1 169 ? 13.813 35.667 8.605   1.00 16.15 ? 163 GLY A CA    1 
ATOM   1158 C  C     . GLY A 1 169 ? 12.386 35.319 9.018   1.00 18.27 ? 163 GLY A C     1 
ATOM   1159 O  O     . GLY A 1 169 ? 11.379 35.803 8.416   1.00 21.43 ? 163 GLY A O     1 
ATOM   1160 N  N     . ILE A 1 170 ? 12.270 34.456 10.015  1.00 16.30 ? 164 ILE A N     1 
ATOM   1161 C  CA    . ILE A 1 170 ? 10.975 34.093 10.641  1.00 14.64 ? 164 ILE A CA    1 
ATOM   1162 C  C     . ILE A 1 170 ? 11.114 34.092 12.184  1.00 19.67 ? 164 ILE A C     1 
ATOM   1163 O  O     . ILE A 1 170 ? 11.879 33.325 12.776  1.00 16.60 ? 164 ILE A O     1 
ATOM   1164 C  CB    . ILE A 1 170 ? 10.430 32.749 10.161  1.00 15.93 ? 164 ILE A CB    1 
ATOM   1165 C  CG1   . ILE A 1 170 ? 10.446 32.634 8.622   1.00 18.42 ? 164 ILE A CG1   1 
ATOM   1166 C  CG2   . ILE A 1 170 ? 8.998  32.462 10.726  1.00 19.20 ? 164 ILE A CG2   1 
ATOM   1167 C  CD1   . ILE A 1 170 ? 10.181 31.237 8.121   1.00 19.94 ? 164 ILE A CD1   1 
ATOM   1168 N  N     . ASP A 1 171 ? 10.400 34.974 12.840  1.00 18.26 ? 165 ASP A N     1 
ATOM   1169 C  CA    . ASP A 1 171 ? 10.412 35.048 14.277  1.00 19.69 ? 165 ASP A CA    1 
ATOM   1170 C  C     . ASP A 1 171 ? 9.583  33.896 14.841  1.00 22.20 ? 165 ASP A C     1 
ATOM   1171 O  O     . ASP A 1 171 ? 8.399  33.845 14.633  1.00 22.15 ? 165 ASP A O     1 
ATOM   1172 C  CB    . ASP A 1 171 ? 9.871  36.411 14.726  1.00 22.04 ? 165 ASP A CB    1 
ATOM   1173 C  CG    . ASP A 1 171 ? 9.829  36.577 16.226  1.00 21.74 ? 165 ASP A CG    1 
ATOM   1174 O  OD1   . ASP A 1 171 ? 10.260 35.688 17.005  1.00 22.83 ? 165 ASP A OD1   1 
ATOM   1175 O  OD2   . ASP A 1 171 ? 9.365  37.658 16.644  1.00 22.19 ? 165 ASP A OD2   1 
ATOM   1176 N  N     . VAL A 1 172 ? 10.215 32.983 15.590  1.00 18.01 ? 166 VAL A N     1 
ATOM   1177 C  CA    . VAL A 1 172 ? 9.505  31.796 16.092  1.00 20.71 ? 166 VAL A CA    1 
ATOM   1178 C  C     . VAL A 1 172 ? 9.333  31.828 17.619  1.00 22.01 ? 166 VAL A C     1 
ATOM   1179 O  O     . VAL A 1 172 ? 9.013  30.805 18.253  1.00 20.07 ? 166 VAL A O     1 
ATOM   1180 C  CB    . VAL A 1 172 ? 10.233 30.464 15.658  1.00 23.20 ? 166 VAL A CB    1 
ATOM   1181 C  CG1   . VAL A 1 172 ? 10.095 30.243 14.149  1.00 20.54 ? 166 VAL A CG1   1 
ATOM   1182 C  CG2   . VAL A 1 172 ? 11.718 30.470 16.110  1.00 20.08 ? 166 VAL A CG2   1 
ATOM   1183 N  N     . SER A 1 173 ? 9.516  33.007 18.198  1.00 24.30 ? 167 SER A N     1 
ATOM   1184 C  CA    . SER A 1 173 ? 9.483  33.197 19.641  1.00 23.90 ? 167 SER A CA    1 
ATOM   1185 C  C     . SER A 1 173 ? 8.024  33.360 20.124  1.00 30.77 ? 167 SER A C     1 
ATOM   1186 O  O     . SER A 1 173 ? 7.140  33.795 19.353  1.00 27.60 ? 167 SER A O     1 
ATOM   1187 C  CB    . SER A 1 173 ? 10.359 34.394 20.051  1.00 24.15 ? 167 SER A CB    1 
ATOM   1188 O  OG    . SER A 1 173 ? 9.761  35.644 19.738  1.00 26.24 ? 167 SER A OG    1 
ATOM   1189 N  N     . ARG A 1 174 ? 7.787  32.943 21.374  1.00 33.00 ? 168 ARG A N     1 
ATOM   1190 C  CA    . ARG A 1 174 ? 6.510  33.161 22.090  1.00 35.91 ? 168 ARG A CA    1 
ATOM   1191 C  C     . ARG A 1 174 ? 6.304  34.633 22.453  1.00 39.88 ? 168 ARG A C     1 
ATOM   1192 O  O     . ARG A 1 174 ? 7.288  35.366 22.587  1.00 44.63 ? 168 ARG A O     1 
ATOM   1193 C  CB    . ARG A 1 174 ? 6.458  32.308 23.366  1.00 38.19 ? 168 ARG A CB    1 
ATOM   1194 C  CG    . ARG A 1 174 ? 7.464  32.691 24.462  1.00 38.80 ? 168 ARG A CG    1 
ATOM   1195 C  CD    . ARG A 1 174 ? 7.582  31.580 25.500  1.00 38.74 ? 168 ARG A CD    1 
ATOM   1196 N  NE    . ARG A 1 174 ? 8.582  31.869 26.536  1.00 38.08 ? 168 ARG A NE    1 
ATOM   1197 C  CZ    . ARG A 1 174 ? 8.404  32.693 27.575  1.00 39.90 ? 168 ARG A CZ    1 
ATOM   1198 N  NH1   . ARG A 1 174 ? 7.255  33.369 27.745  1.00 36.71 ? 168 ARG A NH1   1 
ATOM   1199 N  NH2   . ARG A 1 174 ? 9.392  32.850 28.458  1.00 41.04 ? 168 ARG A NH2   1 
ATOM   1200 N  N     . ASN A 1 179 ? 1.066  37.414 16.166  1.00 32.20 ? 173 ASN A N     1 
ATOM   1201 C  CA    . ASN A 1 179 ? 0.218  36.560 15.338  1.00 32.31 ? 173 ASN A CA    1 
ATOM   1202 C  C     . ASN A 1 179 ? 1.017  35.743 14.329  1.00 30.26 ? 173 ASN A C     1 
ATOM   1203 O  O     . ASN A 1 179 ? 1.241  36.181 13.190  1.00 29.68 ? 173 ASN A O     1 
ATOM   1204 C  CB    . ASN A 1 179 ? -0.806 37.402 14.596  1.00 35.68 ? 173 ASN A CB    1 
ATOM   1205 C  CG    . ASN A 1 179 ? -1.923 36.565 13.970  1.00 38.59 ? 173 ASN A CG    1 
ATOM   1206 O  OD1   . ASN A 1 179 ? -1.710 35.456 13.443  1.00 35.98 ? 173 ASN A OD1   1 
ATOM   1207 N  ND2   . ASN A 1 179 ? -3.138 37.122 14.002  1.00 46.20 ? 173 ASN A ND2   1 
ATOM   1208 N  N     . PHE A 1 180 ? 1.430  34.548 14.741  1.00 27.25 ? 174 PHE A N     1 
ATOM   1209 C  CA    . PHE A 1 180 ? 2.396  33.754 13.955  1.00 28.17 ? 174 PHE A CA    1 
ATOM   1210 C  C     . PHE A 1 180 ? 1.882  33.300 12.595  1.00 28.90 ? 174 PHE A C     1 
ATOM   1211 O  O     . PHE A 1 180 ? 2.600  33.356 11.613  1.00 26.09 ? 174 PHE A O     1 
ATOM   1212 C  CB    . PHE A 1 180 ? 2.902  32.537 14.755  1.00 28.18 ? 174 PHE A CB    1 
ATOM   1213 C  CG    . PHE A 1 180 ? 3.908  31.724 14.001  1.00 25.44 ? 174 PHE A CG    1 
ATOM   1214 C  CD1   . PHE A 1 180 ? 5.247  32.128 13.965  1.00 28.04 ? 174 PHE A CD1   1 
ATOM   1215 C  CD2   . PHE A 1 180 ? 3.505  30.619 13.249  1.00 25.36 ? 174 PHE A CD2   1 
ATOM   1216 C  CE1   . PHE A 1 180 ? 6.175  31.405 13.222  1.00 26.28 ? 174 PHE A CE1   1 
ATOM   1217 C  CE2   . PHE A 1 180 ? 4.422  29.883 12.516  1.00 28.24 ? 174 PHE A CE2   1 
ATOM   1218 C  CZ    . PHE A 1 180 ? 5.757  30.266 12.505  1.00 28.02 ? 174 PHE A CZ    1 
ATOM   1219 N  N     . ASP A 1 181 ? 0.630  32.870 12.515  1.00 30.09 ? 175 ASP A N     1 
ATOM   1220 C  CA    . ASP A 1 181 ? 0.114  32.355 11.250  1.00 32.56 ? 175 ASP A CA    1 
ATOM   1221 C  C     . ASP A 1 181 ? 0.033  33.430 10.168  1.00 27.01 ? 175 ASP A C     1 
ATOM   1222 O  O     . ASP A 1 181 ? 0.244  33.136 9.007   1.00 26.94 ? 175 ASP A O     1 
ATOM   1223 C  CB    . ASP A 1 181 ? -1.258 31.695 11.422  1.00 37.23 ? 175 ASP A CB    1 
ATOM   1224 C  CG    . ASP A 1 181 ? -1.194 30.394 12.230  1.00 41.68 ? 175 ASP A CG    1 
ATOM   1225 O  OD1   . ASP A 1 181 ? -0.112 29.762 12.357  1.00 43.83 ? 175 ASP A OD1   1 
ATOM   1226 O  OD2   . ASP A 1 181 ? -2.252 30.010 12.752  1.00 47.23 ? 175 ASP A OD2   1 
ATOM   1227 N  N     . ASP A 1 182 ? -0.292 34.659 10.542  1.00 26.98 ? 176 ASP A N     1 
ATOM   1228 C  CA    . ASP A 1 182 ? -0.230 35.760 9.583   1.00 27.17 ? 176 ASP A CA    1 
ATOM   1229 C  C     . ASP A 1 182 ? 1.213  36.063 9.193   1.00 25.93 ? 176 ASP A C     1 
ATOM   1230 O  O     . ASP A 1 182 ? 1.467  36.432 8.065   1.00 22.90 ? 176 ASP A O     1 
ATOM   1231 C  CB    . ASP A 1 182 ? -0.859 37.018 10.144  1.00 30.75 ? 176 ASP A CB    1 
ATOM   1232 C  CG    . ASP A 1 182 ? -2.372 36.921 10.236  1.00 34.01 ? 176 ASP A CG    1 
ATOM   1233 O  OD1   . ASP A 1 182 ? -2.965 35.994 9.619   1.00 37.17 ? 176 ASP A OD1   1 
ATOM   1234 O  OD2   . ASP A 1 182 ? -2.937 37.790 10.932  1.00 35.85 ? 176 ASP A OD2   1 
ATOM   1235 N  N     . GLN A 1 183 ? 2.160  35.916 10.124  1.00 26.97 ? 177 GLN A N     1 
ATOM   1236 C  CA    . GLN A 1 183 ? 3.577  36.094 9.766   1.00 24.21 ? 177 GLN A CA    1 
ATOM   1237 C  C     . GLN A 1 183 ? 3.948  35.119 8.669   1.00 25.19 ? 177 GLN A C     1 
ATOM   1238 O  O     . GLN A 1 183 ? 4.570  35.517 7.685   1.00 23.37 ? 177 GLN A O     1 
ATOM   1239 C  CB    . GLN A 1 183 ? 4.516  35.917 10.960  1.00 24.65 ? 177 GLN A CB    1 
ATOM   1240 C  CG    . GLN A 1 183 ? 5.990  36.013 10.540  1.00 25.85 ? 177 GLN A CG    1 
ATOM   1241 C  CD    . GLN A 1 183 ? 6.994  35.783 11.647  1.00 22.54 ? 177 GLN A CD    1 
ATOM   1242 O  OE1   . GLN A 1 183 ? 8.131  36.224 11.538  1.00 21.22 ? 177 GLN A OE1   1 
ATOM   1243 N  NE2   . GLN A 1 183 ? 6.595  35.085 12.701  1.00 19.84 ? 177 GLN A NE2   1 
ATOM   1244 N  N     . LEU A 1 184 ? 3.595  33.841 8.850   1.00 27.22 ? 178 LEU A N     1 
ATOM   1245 C  CA    . LEU A 1 184 ? 3.997  32.785 7.921   1.00 28.61 ? 178 LEU A CA    1 
ATOM   1246 C  C     . LEU A 1 184 ? 3.341  32.978 6.557   1.00 27.34 ? 178 LEU A C     1 
ATOM   1247 O  O     . LEU A 1 184 ? 3.945  32.697 5.526   1.00 25.10 ? 178 LEU A O     1 
ATOM   1248 C  CB    . LEU A 1 184 ? 3.696  31.384 8.513   1.00 31.09 ? 178 LEU A CB    1 
ATOM   1249 C  CG    . LEU A 1 184 ? 4.407  30.163 7.908   1.00 30.38 ? 178 LEU A CG    1 
ATOM   1250 C  CD1   . LEU A 1 184 ? 5.913  30.367 7.840   1.00 31.07 ? 178 LEU A CD1   1 
ATOM   1251 C  CD2   . LEU A 1 184 ? 4.081  28.874 8.701   1.00 30.26 ? 178 LEU A CD2   1 
ATOM   1252 N  N     . LYS A 1 185 ? 2.105  33.490 6.550   1.00 25.12 ? 179 LYS A N     1 
ATOM   1253 C  CA    . LYS A 1 185 ? 1.427  33.859 5.284   1.00 25.76 ? 179 LYS A CA    1 
ATOM   1254 C  C     . LYS A 1 185 ? 2.222  34.933 4.523   1.00 21.84 ? 179 LYS A C     1 
ATOM   1255 O  O     . LYS A 1 185 ? 2.455  34.825 3.312   1.00 28.70 ? 179 LYS A O     1 
ATOM   1256 C  CB    . LYS A 1 185 ? 0.013  34.394 5.593   1.00 26.88 ? 179 LYS A CB    1 
ATOM   1257 N  N     . PHE A 1 186 ? 2.628  35.958 5.237   1.00 20.74 ? 180 PHE A N     1 
ATOM   1258 C  CA    . PHE A 1 186 ? 3.472  37.019 4.687   1.00 24.67 ? 180 PHE A CA    1 
ATOM   1259 C  C     . PHE A 1 186 ? 4.817  36.484 4.159   1.00 25.59 ? 180 PHE A C     1 
ATOM   1260 O  O     . PHE A 1 186 ? 5.278  36.869 3.058   1.00 22.30 ? 180 PHE A O     1 
ATOM   1261 C  CB    . PHE A 1 186 ? 3.707  38.059 5.778   1.00 24.51 ? 180 PHE A CB    1 
ATOM   1262 C  CG    . PHE A 1 186 ? 4.435  39.327 5.308   1.00 28.94 ? 180 PHE A CG    1 
ATOM   1263 C  CD1   . PHE A 1 186 ? 3.732  40.512 5.095   1.00 29.04 ? 180 PHE A CD1   1 
ATOM   1264 C  CD2   . PHE A 1 186 ? 5.826  39.339 5.133   1.00 26.16 ? 180 PHE A CD2   1 
ATOM   1265 C  CE1   . PHE A 1 186 ? 4.385  41.672 4.692   1.00 31.09 ? 180 PHE A CE1   1 
ATOM   1266 C  CE2   . PHE A 1 186 ? 6.487  40.502 4.727   1.00 24.36 ? 180 PHE A CE2   1 
ATOM   1267 C  CZ    . PHE A 1 186 ? 5.781  41.665 4.512   1.00 27.38 ? 180 PHE A CZ    1 
ATOM   1268 N  N     . VAL A 1 187 ? 5.449  35.633 4.974   1.00 22.13 ? 181 VAL A N     1 
ATOM   1269 C  CA    . VAL A 1 187 ? 6.705  34.955 4.602   1.00 24.10 ? 181 VAL A CA    1 
ATOM   1270 C  C     . VAL A 1 187 ? 6.516  34.138 3.323   1.00 22.29 ? 181 VAL A C     1 
ATOM   1271 O  O     . VAL A 1 187 ? 7.368  34.149 2.407   1.00 21.80 ? 181 VAL A O     1 
ATOM   1272 C  CB    . VAL A 1 187 ? 7.200  34.116 5.801   1.00 22.05 ? 181 VAL A CB    1 
ATOM   1273 C  CG1   . VAL A 1 187 ? 8.268  33.060 5.376   1.00 25.25 ? 181 VAL A CG1   1 
ATOM   1274 C  CG2   . VAL A 1 187 ? 7.744  35.066 6.846   1.00 20.60 ? 181 VAL A CG2   1 
ATOM   1275 N  N     . SER A 1 188 ? 5.395  33.427 3.225   1.00 20.86 ? 182 SER A N     1 
ATOM   1276 C  CA    . SER A 1 188 ? 5.136  32.675 2.015   1.00 24.96 ? 182 SER A CA    1 
ATOM   1277 C  C     . SER A 1 188 ? 5.021  33.597 0.775   1.00 22.97 ? 182 SER A C     1 
ATOM   1278 O  O     . SER A 1 188 ? 5.559  33.280 -0.258  1.00 23.30 ? 182 SER A O     1 
ATOM   1279 C  CB    . SER A 1 188 ? 3.887  31.799 2.161   1.00 27.25 ? 182 SER A CB    1 
ATOM   1280 O  OG    . SER A 1 188 ? 3.752  30.987 1.011   1.00 32.34 ? 182 SER A OG    1 
ATOM   1281 N  N     . ASN A 1 189 ? 4.341  34.739 0.901   1.00 23.44 ? 183 ASN A N     1 
ATOM   1282 C  CA    . ASN A 1 189 ? 4.205  35.671 -0.212  1.00 23.99 ? 183 ASN A CA    1 
ATOM   1283 C  C     . ASN A 1 189 ? 5.557  36.322 -0.545  1.00 21.40 ? 183 ASN A C     1 
ATOM   1284 O  O     . ASN A 1 189 ? 5.904  36.492 -1.720  1.00 20.09 ? 183 ASN A O     1 
ATOM   1285 C  CB    . ASN A 1 189 ? 3.156  36.759 0.093   1.00 25.48 ? 183 ASN A CB    1 
ATOM   1286 C  CG    . ASN A 1 189 ? 1.746  36.201 0.178   1.00 29.68 ? 183 ASN A CG    1 
ATOM   1287 O  OD1   . ASN A 1 189 ? 1.429  35.186 -0.443  1.00 30.67 ? 183 ASN A OD1   1 
ATOM   1288 N  ND2   . ASN A 1 189 ? 0.885  36.877 0.934   1.00 31.93 ? 183 ASN A ND2   1 
ATOM   1289 N  N     . LEU A 1 190 ? 6.309  36.666 0.497   1.00 17.98 ? 184 LEU A N     1 
ATOM   1290 C  CA    . LEU A 1 190 ? 7.672  37.211 0.311   1.00 17.09 ? 184 LEU A CA    1 
ATOM   1291 C  C     . LEU A 1 190 ? 8.584  36.185 -0.375  1.00 16.31 ? 184 LEU A C     1 
ATOM   1292 O  O     . LEU A 1 190 ? 9.354  36.538 -1.285  1.00 16.34 ? 184 LEU A O     1 
ATOM   1293 C  CB    . LEU A 1 190 ? 8.257  37.622 1.668   1.00 16.82 ? 184 LEU A CB    1 
ATOM   1294 C  CG    . LEU A 1 190 ? 9.655  38.169 1.773   1.00 15.52 ? 184 LEU A CG    1 
ATOM   1295 C  CD1   . LEU A 1 190 ? 9.848  39.396 0.886   1.00 18.55 ? 184 LEU A CD1   1 
ATOM   1296 C  CD2   . LEU A 1 190 ? 10.022 38.461 3.262   1.00 13.73 ? 184 LEU A CD2   1 
ATOM   1297 N  N     . TYR A 1 191 ? 8.482  34.922 0.043   1.00 18.91 ? 185 TYR A N     1 
ATOM   1298 C  CA    . TYR A 1 191 ? 9.300  33.852 -0.534  1.00 19.79 ? 185 TYR A CA    1 
ATOM   1299 C  C     . TYR A 1 191 ? 9.054  33.763 -2.039  1.00 21.15 ? 185 TYR A C     1 
ATOM   1300 O  O     . TYR A 1 191 ? 9.987  33.642 -2.810  1.00 21.48 ? 185 TYR A O     1 
ATOM   1301 C  CB    . TYR A 1 191 ? 9.020  32.484 0.089   1.00 24.05 ? 185 TYR A CB    1 
ATOM   1302 C  CG    . TYR A 1 191 ? 9.802  31.397 -0.621  1.00 23.76 ? 185 TYR A CG    1 
ATOM   1303 C  CD1   . TYR A 1 191 ? 11.125 31.125 -0.267  1.00 25.32 ? 185 TYR A CD1   1 
ATOM   1304 C  CD2   . TYR A 1 191 ? 9.237  30.685 -1.684  1.00 27.38 ? 185 TYR A CD2   1 
ATOM   1305 C  CE1   . TYR A 1 191 ? 11.866 30.171 -0.929  1.00 23.99 ? 185 TYR A CE1   1 
ATOM   1306 C  CE2   . TYR A 1 191 ? 9.966  29.728 -2.373  1.00 27.83 ? 185 TYR A CE2   1 
ATOM   1307 C  CZ    . TYR A 1 191 ? 11.276 29.465 -1.990  1.00 27.77 ? 185 TYR A CZ    1 
ATOM   1308 O  OH    . TYR A 1 191 ? 11.998 28.507 -2.660  1.00 30.75 ? 185 TYR A OH    1 
ATOM   1309 N  N     . ASN A 1 192 ? 7.792  33.804 -2.444  1.00 22.84 ? 186 ASN A N     1 
ATOM   1310 C  CA    . ASN A 1 192 ? 7.469  33.709 -3.874  1.00 26.75 ? 186 ASN A CA    1 
ATOM   1311 C  C     . ASN A 1 192 ? 8.169  34.803 -4.668  1.00 25.01 ? 186 ASN A C     1 
ATOM   1312 O  O     . ASN A 1 192 ? 8.771  34.507 -5.705  1.00 22.35 ? 186 ASN A O     1 
ATOM   1313 C  CB    . ASN A 1 192 ? 5.962  33.740 -4.119  1.00 29.62 ? 186 ASN A CB    1 
ATOM   1314 C  CG    . ASN A 1 192 ? 5.256  32.531 -3.531  1.00 34.73 ? 186 ASN A CG    1 
ATOM   1315 O  OD1   . ASN A 1 192 ? 5.855  31.469 -3.372  1.00 38.07 ? 186 ASN A OD1   1 
ATOM   1316 N  ND2   . ASN A 1 192 ? 3.984  32.691 -3.199  1.00 40.45 ? 186 ASN A ND2   1 
ATOM   1317 N  N     . GLN A 1 193 ? 8.135  36.048 -4.156  1.00 20.93 ? 187 GLN A N     1 
ATOM   1318 C  CA    . GLN A 1 193 ? 8.846  37.152 -4.794  1.00 21.55 ? 187 GLN A CA    1 
ATOM   1319 C  C     . GLN A 1 193 ? 10.368 36.911 -4.862  1.00 20.63 ? 187 GLN A C     1 
ATOM   1320 O  O     . GLN A 1 193 ? 10.980 37.198 -5.900  1.00 18.94 ? 187 GLN A O     1 
ATOM   1321 C  CB    . GLN A 1 193 ? 8.575  38.520 -4.133  1.00 22.61 ? 187 GLN A CB    1 
ATOM   1322 C  CG    . GLN A 1 193 ? 7.242  39.136 -4.427  1.00 29.73 ? 187 GLN A CG    1 
ATOM   1323 C  CD    . GLN A 1 193 ? 6.959  39.232 -5.910  1.00 28.54 ? 187 GLN A CD    1 
ATOM   1324 O  OE1   . GLN A 1 193 ? 7.648  39.932 -6.646  1.00 27.96 ? 187 GLN A OE1   1 
ATOM   1325 N  NE2   . GLN A 1 193 ? 5.978  38.482 -6.356  1.00 37.20 ? 187 GLN A NE2   1 
ATOM   1326 N  N     . LEU A 1 194 ? 10.965 36.424 -3.765  1.00 17.56 ? 188 LEU A N     1 
ATOM   1327 C  CA    . LEU A 1 194 ? 12.380 36.085 -3.758  1.00 20.44 ? 188 LEU A CA    1 
ATOM   1328 C  C     . LEU A 1 194 ? 12.700 34.995 -4.769  1.00 18.40 ? 188 LEU A C     1 
ATOM   1329 O  O     . LEU A 1 194 ? 13.708 35.087 -5.457  1.00 18.13 ? 188 LEU A O     1 
ATOM   1330 C  CB    . LEU A 1 194 ? 12.882 35.628 -2.366  1.00 17.03 ? 188 LEU A CB    1 
ATOM   1331 C  CG    . LEU A 1 194 ? 12.642 36.564 -1.171  1.00 16.25 ? 188 LEU A CG    1 
ATOM   1332 C  CD1   . LEU A 1 194 ? 13.201 35.909 0.156   1.00 13.86 ? 188 LEU A CD1   1 
ATOM   1333 C  CD2   . LEU A 1 194 ? 13.247 37.938 -1.383  1.00 14.46 ? 188 LEU A CD2   1 
ATOM   1334 N  N     . ALA A 1 195 ? 11.867 33.952 -4.828  1.00 19.49 ? 189 ALA A N     1 
ATOM   1335 C  CA    . ALA A 1 195 ? 12.116 32.777 -5.712  1.00 20.67 ? 189 ALA A CA    1 
ATOM   1336 C  C     . ALA A 1 195 ? 12.108 33.183 -7.192  1.00 22.83 ? 189 ALA A C     1 
ATOM   1337 O  O     . ALA A 1 195 ? 12.852 32.624 -7.993  1.00 22.75 ? 189 ALA A O     1 
ATOM   1338 C  CB    . ALA A 1 195 ? 11.056 31.687 -5.458  1.00 22.31 ? 189 ALA A CB    1 
ATOM   1339 N  N     . LYS A 1 196 ? 11.275 34.176 -7.531  1.00 22.38 ? 190 LYS A N     1 
ATOM   1340 C  CA    . LYS A 1 196 ? 11.231 34.736 -8.897  1.00 25.55 ? 190 LYS A CA    1 
ATOM   1341 C  C     . LYS A 1 196 ? 12.597 35.309 -9.327  1.00 23.57 ? 190 LYS A C     1 
ATOM   1342 O  O     . LYS A 1 196 ? 12.879 35.347 -10.519 1.00 26.29 ? 190 LYS A O     1 
ATOM   1343 C  CB    . LYS A 1 196 ? 10.135 35.804 -9.050  1.00 26.42 ? 190 LYS A CB    1 
ATOM   1344 C  CG    . LYS A 1 196 ? 8.657  35.289 -8.985  1.00 24.89 ? 190 LYS A CG    1 
ATOM   1345 C  CD    . LYS A 1 196 ? 7.620  36.440 -8.989  1.00 28.35 ? 190 LYS A CD    1 
ATOM   1346 C  CE    . LYS A 1 196 ? 6.168  35.921 -9.241  1.00 32.20 ? 190 LYS A CE    1 
ATOM   1347 N  NZ    . LYS A 1 196 ? 5.881  34.723 -8.419  1.00 40.41 ? 190 LYS A NZ    1 
ATOM   1348 N  N     . THR A 1 197 ? 13.432 35.751 -8.362  1.00 19.96 ? 191 THR A N     1 
ATOM   1349 C  CA    . THR A 1 197 ? 14.765 36.308 -8.668  1.00 22.04 ? 191 THR A CA    1 
ATOM   1350 C  C     . THR A 1 197 ? 15.740 35.259 -9.081  1.00 18.87 ? 191 THR A C     1 
ATOM   1351 O  O     . THR A 1 197 ? 16.756 35.594 -9.646  1.00 21.27 ? 191 THR A O     1 
ATOM   1352 C  CB    . THR A 1 197 ? 15.426 37.066 -7.471  1.00 20.71 ? 191 THR A CB    1 
ATOM   1353 O  OG1   . THR A 1 197 ? 15.804 36.125 -6.439  1.00 21.63 ? 191 THR A OG1   1 
ATOM   1354 C  CG2   . THR A 1 197 ? 14.469 38.122 -6.939  1.00 17.70 ? 191 THR A CG2   1 
ATOM   1355 N  N     . LYS A 1 198 ? 15.428 34.018 -8.724  1.00 24.43 ? 192 LYS A N     1 
ATOM   1356 C  CA    . LYS A 1 198 ? 16.301 32.851 -8.851  1.00 28.52 ? 192 LYS A CA    1 
ATOM   1357 C  C     . LYS A 1 198 ? 17.611 32.947 -8.051  1.00 27.72 ? 192 LYS A C     1 
ATOM   1358 O  O     . LYS A 1 198 ? 18.517 32.150 -8.241  1.00 24.23 ? 192 LYS A O     1 
ATOM   1359 C  CB    . LYS A 1 198 ? 16.549 32.510 -10.336 1.00 34.04 ? 192 LYS A CB    1 
ATOM   1360 C  CG    . LYS A 1 198 ? 15.269 32.158 -11.111 1.00 35.29 ? 192 LYS A CG    1 
ATOM   1361 C  CD    . LYS A 1 198 ? 15.582 31.881 -12.588 1.00 38.45 ? 192 LYS A CD    1 
ATOM   1362 C  CE    . LYS A 1 198 ? 14.388 31.259 -13.308 1.00 40.78 ? 192 LYS A CE    1 
ATOM   1363 N  NZ    . LYS A 1 198 ? 14.678 30.879 -14.741 1.00 43.65 ? 192 LYS A NZ    1 
ATOM   1364 N  N     . LYS A 1 199 ? 17.686 33.894 -7.124  1.00 24.24 ? 193 LYS A N     1 
ATOM   1365 C  CA    . LYS A 1 199 ? 18.805 33.986 -6.198  1.00 20.78 ? 193 LYS A CA    1 
ATOM   1366 C  C     . LYS A 1 199 ? 18.643 32.982 -5.051  1.00 20.22 ? 193 LYS A C     1 
ATOM   1367 O  O     . LYS A 1 199 ? 17.522 32.676 -4.645  1.00 20.80 ? 193 LYS A O     1 
ATOM   1368 C  CB    . LYS A 1 199 ? 18.940 35.390 -5.619  1.00 23.09 ? 193 LYS A CB    1 
ATOM   1369 C  CG    . LYS A 1 199 ? 19.118 36.493 -6.636  1.00 22.07 ? 193 LYS A CG    1 
ATOM   1370 C  CD    . LYS A 1 199 ? 20.456 36.500 -7.291  1.00 25.61 ? 193 LYS A CD    1 
ATOM   1371 C  CE    . LYS A 1 199 ? 20.579 37.718 -8.189  1.00 26.21 ? 193 LYS A CE    1 
ATOM   1372 N  NZ    . LYS A 1 199 ? 21.733 37.625 -9.081  1.00 28.31 ? 193 LYS A NZ    1 
ATOM   1373 N  N     . PRO A 1 200 ? 19.770 32.441 -4.537  1.00 19.17 ? 194 PRO A N     1 
ATOM   1374 C  CA    . PRO A 1 200 ? 19.726 31.515 -3.399  1.00 20.80 ? 194 PRO A CA    1 
ATOM   1375 C  C     . PRO A 1 200 ? 19.060 32.155 -2.171  1.00 18.59 ? 194 PRO A C     1 
ATOM   1376 O  O     . PRO A 1 200 ? 19.287 33.350 -1.926  1.00 17.12 ? 194 PRO A O     1 
ATOM   1377 C  CB    . PRO A 1 200 ? 21.197 31.285 -3.075  1.00 23.31 ? 194 PRO A CB    1 
ATOM   1378 C  CG    . PRO A 1 200 ? 21.929 31.604 -4.285  1.00 24.49 ? 194 PRO A CG    1 
ATOM   1379 C  CD    . PRO A 1 200 ? 21.136 32.615 -5.049  1.00 22.38 ? 194 PRO A CD    1 
ATOM   1380 N  N     . ILE A 1 201 ? 18.250 31.361 -1.472  1.00 17.56 ? 195 ILE A N     1 
ATOM   1381 C  CA    . ILE A 1 201 ? 17.583 31.762 -0.250  1.00 16.57 ? 195 ILE A CA    1 
ATOM   1382 C  C     . ILE A 1 201 ? 17.796 30.705 0.864   1.00 19.09 ? 195 ILE A C     1 
ATOM   1383 O  O     . ILE A 1 201 ? 17.709 29.486 0.608   1.00 19.32 ? 195 ILE A O     1 
ATOM   1384 C  CB    . ILE A 1 201 ? 16.056 31.901 -0.483  1.00 19.96 ? 195 ILE A CB    1 
ATOM   1385 C  CG1   . ILE A 1 201 ? 15.743 32.797 -1.703  1.00 18.64 ? 195 ILE A CG1   1 
ATOM   1386 C  CG2   . ILE A 1 201 ? 15.321 32.357 0.826   1.00 17.04 ? 195 ILE A CG2   1 
ATOM   1387 C  CD1   . ILE A 1 201 ? 14.420 32.389 -2.425  1.00 19.88 ? 195 ILE A CD1   1 
ATOM   1388 N  N     . VAL A 1 202 ? 18.110 31.191 2.058   1.00 15.91 ? 196 VAL A N     1 
ATOM   1389 C  CA    . VAL A 1 202 ? 18.129 30.410 3.289   1.00 16.35 ? 196 VAL A CA    1 
ATOM   1390 C  C     . VAL A 1 202 ? 17.110 31.000 4.283   1.00 16.18 ? 196 VAL A C     1 
ATOM   1391 O  O     . VAL A 1 202 ? 17.084 32.215 4.487   1.00 18.11 ? 196 VAL A O     1 
ATOM   1392 C  CB    . VAL A 1 202 ? 19.525 30.438 3.922   1.00 15.85 ? 196 VAL A CB    1 
ATOM   1393 C  CG1   . VAL A 1 202 ? 19.486 29.755 5.304   1.00 16.57 ? 196 VAL A CG1   1 
ATOM   1394 C  CG2   . VAL A 1 202 ? 20.575 29.822 2.920   1.00 16.44 ? 196 VAL A CG2   1 
ATOM   1395 N  N     . VAL A 1 203 ? 16.291 30.129 4.856   1.00 16.94 ? 197 VAL A N     1 
ATOM   1396 C  CA    . VAL A 1 203 ? 15.324 30.512 5.889   1.00 20.22 ? 197 VAL A CA    1 
ATOM   1397 C  C     . VAL A 1 203 ? 16.112 30.562 7.211   1.00 17.73 ? 197 VAL A C     1 
ATOM   1398 O  O     . VAL A 1 203 ? 16.873 29.623 7.541   1.00 17.61 ? 197 VAL A O     1 
ATOM   1399 C  CB    . VAL A 1 203 ? 14.114 29.539 5.961   1.00 18.38 ? 197 VAL A CB    1 
ATOM   1400 C  CG1   . VAL A 1 203 ? 13.202 29.783 7.229   1.00 19.43 ? 197 VAL A CG1   1 
ATOM   1401 C  CG2   . VAL A 1 203 ? 13.256 29.645 4.671   1.00 21.67 ? 197 VAL A CG2   1 
ATOM   1402 N  N     . VAL A 1 204 ? 15.948 31.656 7.945   1.00 15.46 ? 198 VAL A N     1 
ATOM   1403 C  CA    . VAL A 1 204 ? 16.588 31.827 9.238   1.00 17.81 ? 198 VAL A CA    1 
ATOM   1404 C  C     . VAL A 1 204 ? 15.501 31.980 10.307  1.00 20.55 ? 198 VAL A C     1 
ATOM   1405 O  O     . VAL A 1 204 ? 14.689 32.922 10.251  1.00 17.23 ? 198 VAL A O     1 
ATOM   1406 C  CB    . VAL A 1 204 ? 17.559 33.059 9.234   1.00 18.13 ? 198 VAL A CB    1 
ATOM   1407 C  CG1   . VAL A 1 204 ? 18.172 33.283 10.609  1.00 16.63 ? 198 VAL A CG1   1 
ATOM   1408 C  CG2   . VAL A 1 204 ? 18.639 32.884 8.161   1.00 19.20 ? 198 VAL A CG2   1 
ATOM   1409 N  N     . LEU A 1 205 ? 15.462 31.055 11.266  1.00 18.21 ? 199 LEU A N     1 
ATOM   1410 C  CA    . LEU A 1 205 ? 14.539 31.204 12.360  1.00 18.17 ? 199 LEU A CA    1 
ATOM   1411 C  C     . LEU A 1 205 ? 15.204 32.060 13.411  1.00 21.24 ? 199 LEU A C     1 
ATOM   1412 O  O     . LEU A 1 205 ? 16.339 31.809 13.840  1.00 19.91 ? 199 LEU A O     1 
ATOM   1413 C  CB    . LEU A 1 205 ? 14.045 29.856 12.919  1.00 18.77 ? 199 LEU A CB    1 
ATOM   1414 C  CG    . LEU A 1 205 ? 13.570 28.766 11.972  1.00 20.78 ? 199 LEU A CG    1 
ATOM   1415 C  CD1   . LEU A 1 205 ? 12.985 27.613 12.791  1.00 17.31 ? 199 LEU A CD1   1 
ATOM   1416 C  CD2   . LEU A 1 205 ? 12.536 29.263 10.948  1.00 18.52 ? 199 LEU A CD2   1 
ATOM   1417 N  N     . THR A 1 206 ? 14.523 33.125 13.803  1.00 15.94 ? 200 THR A N     1 
ATOM   1418 C  CA    . THR A 1 206 ? 15.077 34.076 14.743  1.00 15.55 ? 200 THR A CA    1 
ATOM   1419 C  C     . THR A 1 206 ? 14.423 33.978 16.160  1.00 15.09 ? 200 THR A C     1 
ATOM   1420 O  O     . THR A 1 206 ? 13.294 33.486 16.346  1.00 16.33 ? 200 THR A O     1 
ATOM   1421 C  CB    . THR A 1 206 ? 14.933 35.535 14.229  1.00 20.63 ? 200 THR A CB    1 
ATOM   1422 O  OG1   . THR A 1 206 ? 13.556 35.807 13.985  1.00 18.89 ? 200 THR A OG1   1 
ATOM   1423 C  CG2   . THR A 1 206 ? 15.764 35.774 12.926  1.00 19.17 ? 200 THR A CG2   1 
ATOM   1424 N  N     . LYS A 1 207 ? 15.195 34.452 17.134  1.00 18.72 ? 201 LYS A N     1 
ATOM   1425 C  CA    . LYS A 1 207 ? 14.837 34.501 18.540  1.00 18.99 ? 201 LYS A CA    1 
ATOM   1426 C  C     . LYS A 1 207 ? 14.548 33.112 19.081  1.00 17.57 ? 201 LYS A C     1 
ATOM   1427 O  O     . LYS A 1 207 ? 13.656 32.922 19.902  1.00 20.16 ? 201 LYS A O     1 
ATOM   1428 C  CB    . LYS A 1 207 ? 13.609 35.433 18.756  1.00 18.73 ? 201 LYS A CB    1 
ATOM   1429 C  CG    . LYS A 1 207 ? 13.661 36.703 17.942  1.00 16.86 ? 201 LYS A CG    1 
ATOM   1430 C  CD    . LYS A 1 207 ? 12.591 37.672 18.444  1.00 19.49 ? 201 LYS A CD    1 
ATOM   1431 C  CE    . LYS A 1 207 ? 12.392 38.823 17.545  1.00 19.49 ? 201 LYS A CE    1 
ATOM   1432 N  NZ    . LYS A 1 207 ? 11.120 39.534 17.961  1.00 21.43 ? 201 LYS A NZ    1 
ATOM   1433 N  N     . CYS A 1 208 ? 15.382 32.123 18.686  1.00 20.59 ? 202 CYS A N     1 
ATOM   1434 C  CA    . CYS A 1 208 ? 15.125 30.742 19.071  1.00 21.14 ? 202 CYS A CA    1 
ATOM   1435 C  C     . CYS A 1 208 ? 15.431 30.499 20.539  1.00 23.39 ? 202 CYS A C     1 
ATOM   1436 O  O     . CYS A 1 208 ? 14.992 29.500 21.084  1.00 23.46 ? 202 CYS A O     1 
ATOM   1437 C  CB    . CYS A 1 208 ? 15.898 29.746 18.186  1.00 19.60 ? 202 CYS A CB    1 
ATOM   1438 S  SG    . CYS A 1 208 ? 15.272 29.623 16.554  1.00 20.93 ? 202 CYS A SG    1 
ATOM   1439 N  N     . ASP A 1 209 ? 16.152 31.415 21.173  1.00 24.18 ? 203 ASP A N     1 
ATOM   1440 C  CA    . ASP A 1 209 ? 16.289 31.385 22.655  1.00 27.82 ? 203 ASP A CA    1 
ATOM   1441 C  C     . ASP A 1 209 ? 14.949 31.450 23.398  1.00 28.14 ? 203 ASP A C     1 
ATOM   1442 O  O     . ASP A 1 209 ? 14.873 31.066 24.592  1.00 27.98 ? 203 ASP A O     1 
ATOM   1443 C  CB    . ASP A 1 209 ? 17.196 32.507 23.156  1.00 25.27 ? 203 ASP A CB    1 
ATOM   1444 C  CG    . ASP A 1 209 ? 16.708 33.884 22.728  1.00 30.63 ? 203 ASP A CG    1 
ATOM   1445 O  OD1   . ASP A 1 209 ? 16.768 34.139 21.506  1.00 27.88 ? 203 ASP A OD1   1 
ATOM   1446 O  OD2   . ASP A 1 209 ? 16.251 34.691 23.588  1.00 24.93 ? 203 ASP A OD2   1 
ATOM   1447 N  N     . GLU A 1 210 ? 13.912 31.964 22.727  1.00 27.02 ? 204 GLU A N     1 
ATOM   1448 C  CA    . GLU A 1 210 ? 12.538 31.965 23.247  1.00 27.80 ? 204 GLU A CA    1 
ATOM   1449 C  C     . GLU A 1 210 ? 11.613 31.235 22.322  1.00 26.32 ? 204 GLU A C     1 
ATOM   1450 O  O     . GLU A 1 210 ? 10.404 31.531 22.232  1.00 26.52 ? 204 GLU A O     1 
ATOM   1451 C  CB    . GLU A 1 210 ? 12.047 33.412 23.462  1.00 31.54 ? 204 GLU A CB    1 
ATOM   1452 C  CG    . GLU A 1 210 ? 12.797 34.193 24.534  1.00 34.63 ? 204 GLU A CG    1 
ATOM   1453 C  CD    . GLU A 1 210 ? 12.515 33.693 25.939  1.00 41.11 ? 204 GLU A CD    1 
ATOM   1454 O  OE1   . GLU A 1 210 ? 11.571 32.885 26.137  1.00 43.94 ? 204 GLU A OE1   1 
ATOM   1455 O  OE2   . GLU A 1 210 ? 13.252 34.105 26.855  1.00 45.25 ? 204 GLU A OE2   1 
ATOM   1456 N  N     . GLY A 1 211 ? 12.153 30.252 21.610  1.00 24.33 ? 205 GLY A N     1 
ATOM   1457 C  CA    . GLY A 1 211 ? 11.418 29.617 20.542  1.00 25.15 ? 205 GLY A CA    1 
ATOM   1458 C  C     . GLY A 1 211 ? 10.229 28.807 21.030  1.00 28.94 ? 205 GLY A C     1 
ATOM   1459 O  O     . GLY A 1 211 ? 10.255 28.238 22.138  1.00 31.58 ? 205 GLY A O     1 
ATOM   1460 N  N     . VAL A 1 212 ? 9.189  28.786 20.208  1.00 26.98 ? 206 VAL A N     1 
ATOM   1461 C  CA    . VAL A 1 212 ? 7.996  27.943 20.385  1.00 29.16 ? 206 VAL A CA    1 
ATOM   1462 C  C     . VAL A 1 212 ? 8.077  26.749 19.456  1.00 30.24 ? 206 VAL A C     1 
ATOM   1463 O  O     . VAL A 1 212 ? 8.243  26.911 18.257  1.00 27.05 ? 206 VAL A O     1 
ATOM   1464 C  CB    . VAL A 1 212 ? 6.713  28.740 20.019  1.00 29.16 ? 206 VAL A CB    1 
ATOM   1465 C  CG1   . VAL A 1 212 ? 5.479  27.829 19.969  1.00 32.48 ? 206 VAL A CG1   1 
ATOM   1466 C  CG2   . VAL A 1 212 ? 6.523  29.903 20.989  1.00 30.18 ? 206 VAL A CG2   1 
ATOM   1467 N  N     . GLU A 1 213 ? 7.931  25.535 19.985  1.00 30.87 ? 207 GLU A N     1 
ATOM   1468 C  CA    . GLU A 1 213 ? 8.101  24.359 19.129  1.00 30.38 ? 207 GLU A CA    1 
ATOM   1469 C  C     . GLU A 1 213 ? 7.077  24.309 17.983  1.00 27.21 ? 207 GLU A C     1 
ATOM   1470 O  O     . GLU A 1 213 ? 7.412  23.879 16.888  1.00 28.42 ? 207 GLU A O     1 
ATOM   1471 C  CB    . GLU A 1 213 ? 8.149  23.045 19.945  1.00 32.34 ? 207 GLU A CB    1 
ATOM   1472 C  CG    . GLU A 1 213 ? 6.835  22.482 20.366  1.00 37.69 ? 207 GLU A CG    1 
ATOM   1473 N  N     . ARG A 1 214 ? 5.840  24.748 18.226  1.00 30.79 ? 208 ARG A N     1 
ATOM   1474 C  CA    . ARG A 1 214 ? 4.789  24.728 17.179  1.00 28.02 ? 208 ARG A CA    1 
ATOM   1475 C  C     . ARG A 1 214 ? 5.171  25.669 16.026  1.00 26.37 ? 208 ARG A C     1 
ATOM   1476 O  O     . ARG A 1 214 ? 4.920  25.377 14.864  1.00 27.04 ? 208 ARG A O     1 
ATOM   1477 C  CB    . ARG A 1 214 ? 3.430  25.170 17.770  1.00 30.10 ? 208 ARG A CB    1 
ATOM   1478 C  CG    . ARG A 1 214 ? 2.262  25.155 16.784  1.00 33.39 ? 208 ARG A CG    1 
ATOM   1479 N  N     . TYR A 1 215 ? 5.751  26.809 16.375  1.00 26.05 ? 209 TYR A N     1 
ATOM   1480 C  CA    . TYR A 1 215 ? 6.190  27.797 15.382  1.00 23.80 ? 209 TYR A CA    1 
ATOM   1481 C  C     . TYR A 1 215 ? 7.391  27.256 14.599  1.00 24.71 ? 209 TYR A C     1 
ATOM   1482 O  O     . TYR A 1 215 ? 7.421  27.295 13.370  1.00 23.98 ? 209 TYR A O     1 
ATOM   1483 C  CB    . TYR A 1 215 ? 6.526  29.105 16.058  1.00 27.41 ? 209 TYR A CB    1 
ATOM   1484 C  CG    . TYR A 1 215 ? 5.346  29.838 16.729  1.00 25.58 ? 209 TYR A CG    1 
ATOM   1485 C  CD1   . TYR A 1 215 ? 4.035  29.398 16.588  1.00 26.89 ? 209 TYR A CD1   1 
ATOM   1486 C  CD2   . TYR A 1 215 ? 5.570  30.966 17.486  1.00 27.48 ? 209 TYR A CD2   1 
ATOM   1487 C  CE1   . TYR A 1 215 ? 2.975  30.088 17.193  1.00 28.13 ? 209 TYR A CE1   1 
ATOM   1488 C  CE2   . TYR A 1 215 ? 4.511  31.667 18.095  1.00 28.49 ? 209 TYR A CE2   1 
ATOM   1489 C  CZ    . TYR A 1 215 ? 3.225  31.206 17.932  1.00 26.69 ? 209 TYR A CZ    1 
ATOM   1490 O  OH    . TYR A 1 215 ? 2.176  31.879 18.519  1.00 29.98 ? 209 TYR A OH    1 
ATOM   1491 N  N     . ILE A 1 216 ? 8.376  26.727 15.319  1.00 22.98 ? 210 ILE A N     1 
ATOM   1492 C  CA    . ILE A 1 216 ? 9.557  26.126 14.675  1.00 25.19 ? 210 ILE A CA    1 
ATOM   1493 C  C     . ILE A 1 216 ? 9.133  25.030 13.703  1.00 23.15 ? 210 ILE A C     1 
ATOM   1494 O  O     . ILE A 1 216 ? 9.565  25.003 12.549  1.00 25.27 ? 210 ILE A O     1 
ATOM   1495 C  CB    . ILE A 1 216 ? 10.555 25.584 15.723  1.00 24.44 ? 210 ILE A CB    1 
ATOM   1496 C  CG1   . ILE A 1 216 ? 11.114 26.749 16.517  1.00 24.84 ? 210 ILE A CG1   1 
ATOM   1497 C  CG2   . ILE A 1 216 ? 11.695 24.757 15.056  1.00 22.57 ? 210 ILE A CG2   1 
ATOM   1498 C  CD1   . ILE A 1 216 ? 11.891 26.335 17.762  1.00 23.61 ? 210 ILE A CD1   1 
ATOM   1499 N  N     . ARG A 1 217 ? 8.258  24.134 14.168  1.00 27.51 ? 211 ARG A N     1 
ATOM   1500 C  CA    . ARG A 1 217 ? 7.734  23.059 13.336  1.00 27.60 ? 211 ARG A CA    1 
ATOM   1501 C  C     . ARG A 1 217 ? 7.000  23.557 12.084  1.00 25.95 ? 211 ARG A C     1 
ATOM   1502 O  O     . ARG A 1 217 ? 7.209  23.049 10.995  1.00 26.26 ? 211 ARG A O     1 
ATOM   1503 C  CB    . ARG A 1 217 ? 6.801  22.159 14.165  1.00 31.44 ? 211 ARG A CB    1 
ATOM   1504 C  CG    . ARG A 1 217 ? 6.043  21.128 13.340  1.00 33.25 ? 211 ARG A CG    1 
ATOM   1505 N  N     . ASP A 1 218 ? 6.120  24.535 12.251  1.00 28.01 ? 212 ASP A N     1 
ATOM   1506 C  CA    . ASP A 1 218 ? 5.425  25.119 11.107  1.00 27.72 ? 212 ASP A CA    1 
ATOM   1507 C  C     . ASP A 1 218 ? 6.384  25.769 10.092  1.00 24.24 ? 212 ASP A C     1 
ATOM   1508 O  O     . ASP A 1 218 ? 6.171  25.649 8.885   1.00 25.45 ? 212 ASP A O     1 
ATOM   1509 C  CB    . ASP A 1 218 ? 4.366  26.134 11.590  1.00 32.18 ? 212 ASP A CB    1 
ATOM   1510 C  CG    . ASP A 1 218 ? 3.106  25.451 12.152  1.00 36.32 ? 212 ASP A CG    1 
ATOM   1511 O  OD1   . ASP A 1 218 ? 3.060  24.205 12.153  1.00 36.18 ? 212 ASP A OD1   1 
ATOM   1512 O  OD2   . ASP A 1 218 ? 2.172  26.159 12.604  1.00 36.02 ? 212 ASP A OD2   1 
ATOM   1513 N  N     . ALA A 1 219 ? 7.442  26.421 10.577  1.00 23.75 ? 213 ALA A N     1 
ATOM   1514 C  CA    . ALA A 1 219 ? 8.438  27.059 9.693   1.00 26.16 ? 213 ALA A CA    1 
ATOM   1515 C  C     . ALA A 1 219 ? 9.182  25.998 8.889   1.00 23.92 ? 213 ALA A C     1 
ATOM   1516 O  O     . ALA A 1 219 ? 9.408  26.136 7.666   1.00 24.66 ? 213 ALA A O     1 
ATOM   1517 C  CB    . ALA A 1 219 ? 9.413  27.926 10.509  1.00 20.71 ? 213 ALA A CB    1 
ATOM   1518 N  N     . HIS A 1 220 ? 9.513  24.900 9.564   1.00 26.29 ? 214 HIS A N     1 
ATOM   1519 C  CA    . HIS A 1 220 ? 10.176 23.786 8.906   1.00 25.32 ? 214 HIS A CA    1 
ATOM   1520 C  C     . HIS A 1 220 ? 9.264  23.164 7.854   1.00 27.51 ? 214 HIS A C     1 
ATOM   1521 O  O     . HIS A 1 220 ? 9.719  22.864 6.757   1.00 28.82 ? 214 HIS A O     1 
ATOM   1522 C  CB    . HIS A 1 220 ? 10.670 22.744 9.927   1.00 27.98 ? 214 HIS A CB    1 
ATOM   1523 C  CG    . HIS A 1 220 ? 11.989 23.075 10.539  1.00 26.23 ? 214 HIS A CG    1 
ATOM   1524 N  ND1   . HIS A 1 220 ? 13.188 22.745 9.945   1.00 26.49 ? 214 HIS A ND1   1 
ATOM   1525 C  CD2   . HIS A 1 220 ? 12.304 23.679 11.707  1.00 25.68 ? 214 HIS A CD2   1 
ATOM   1526 C  CE1   . HIS A 1 220 ? 14.182 23.144 10.714  1.00 28.40 ? 214 HIS A CE1   1 
ATOM   1527 N  NE2   . HIS A 1 220 ? 13.673 23.730 11.782  1.00 27.64 ? 214 HIS A NE2   1 
ATOM   1528 N  N     . THR A 1 221 ? 7.981  22.997 8.175   1.00 26.17 ? 215 THR A N     1 
ATOM   1529 C  CA    . THR A 1 221 ? 7.011  22.471 7.199   1.00 28.47 ? 215 THR A CA    1 
ATOM   1530 C  C     . THR A 1 221 ? 6.919  23.345 5.972   1.00 27.21 ? 215 THR A C     1 
ATOM   1531 O  O     . THR A 1 221 ? 6.918  22.838 4.853   1.00 27.41 ? 215 THR A O     1 
ATOM   1532 C  CB    . THR A 1 221 ? 5.621  22.323 7.796   1.00 31.03 ? 215 THR A CB    1 
ATOM   1533 O  OG1   . THR A 1 221 ? 5.693  21.412 8.897   1.00 33.96 ? 215 THR A OG1   1 
ATOM   1534 C  CG2   . THR A 1 221 ? 4.641  21.784 6.736   1.00 33.72 ? 215 THR A CG2   1 
ATOM   1535 N  N     . PHE A 1 222 ? 6.871  24.656 6.171   1.00 28.53 ? 216 PHE A N     1 
ATOM   1536 C  CA    . PHE A 1 222 ? 6.909  25.594 5.044   1.00 28.43 ? 216 PHE A CA    1 
ATOM   1537 C  C     . PHE A 1 222 ? 8.168  25.391 4.176   1.00 27.78 ? 216 PHE A C     1 
ATOM   1538 O  O     . PHE A 1 222 ? 8.072  25.315 2.960   1.00 29.63 ? 216 PHE A O     1 
ATOM   1539 C  CB    . PHE A 1 222 ? 6.792  27.049 5.538   1.00 29.15 ? 216 PHE A CB    1 
ATOM   1540 C  CG    . PHE A 1 222 ? 7.259  28.071 4.536   1.00 27.83 ? 216 PHE A CG    1 
ATOM   1541 C  CD1   . PHE A 1 222 ? 6.464  28.419 3.454   1.00 26.97 ? 216 PHE A CD1   1 
ATOM   1542 C  CD2   . PHE A 1 222 ? 8.499  28.692 4.683   1.00 27.48 ? 216 PHE A CD2   1 
ATOM   1543 C  CE1   . PHE A 1 222 ? 6.919  29.343 2.533   1.00 28.57 ? 216 PHE A CE1   1 
ATOM   1544 C  CE2   . PHE A 1 222 ? 8.943  29.626 3.776   1.00 30.39 ? 216 PHE A CE2   1 
ATOM   1545 C  CZ    . PHE A 1 222 ? 8.158  29.959 2.705   1.00 29.33 ? 216 PHE A CZ    1 
ATOM   1546 N  N     . ALA A 1 223 ? 9.352  25.292 4.787   1.00 27.26 ? 217 ALA A N     1 
ATOM   1547 C  CA    . ALA A 1 223 ? 10.593 25.193 4.001   1.00 27.39 ? 217 ALA A CA    1 
ATOM   1548 C  C     . ALA A 1 223 ? 10.684 23.845 3.292   1.00 28.87 ? 217 ALA A C     1 
ATOM   1549 O  O     . ALA A 1 223 ? 11.219 23.762 2.176   1.00 33.43 ? 217 ALA A O     1 
ATOM   1550 C  CB    . ALA A 1 223 ? 11.857 25.462 4.877   1.00 26.74 ? 217 ALA A CB    1 
ATOM   1551 N  N     . LEU A 1 224 ? 10.155 22.795 3.926   1.00 34.30 ? 218 LEU A N     1 
ATOM   1552 C  CA    . LEU A 1 224 ? 10.076 21.467 3.301   1.00 37.49 ? 218 LEU A CA    1 
ATOM   1553 C  C     . LEU A 1 224 ? 9.096  21.416 2.116   1.00 37.81 ? 218 LEU A C     1 
ATOM   1554 O  O     . LEU A 1 224 ? 9.207  20.539 1.265   1.00 39.78 ? 218 LEU A O     1 
ATOM   1555 C  CB    . LEU A 1 224 ? 9.686  20.401 4.323   1.00 40.89 ? 218 LEU A CB    1 
ATOM   1556 C  CG    . LEU A 1 224 ? 10.728 20.167 5.411   1.00 41.87 ? 218 LEU A CG    1 
ATOM   1557 C  CD1   . LEU A 1 224 ? 10.063 19.580 6.610   1.00 44.26 ? 218 LEU A CD1   1 
ATOM   1558 C  CD2   . LEU A 1 224 ? 11.874 19.280 4.913   1.00 43.61 ? 218 LEU A CD2   1 
ATOM   1559 N  N     . SER A 1 225 ? 8.146  22.343 2.054   1.00 33.78 ? 219 SER A N     1 
ATOM   1560 C  CA    . SER A 1 225 ? 7.240  22.413 0.914   1.00 36.37 ? 219 SER A CA    1 
ATOM   1561 C  C     . SER A 1 225 ? 7.925  22.965 -0.330  1.00 38.85 ? 219 SER A C     1 
ATOM   1562 O  O     . SER A 1 225 ? 7.355  22.902 -1.418  1.00 41.17 ? 219 SER A O     1 
ATOM   1563 C  CB    . SER A 1 225 ? 6.010  23.251 1.250   1.00 36.81 ? 219 SER A CB    1 
ATOM   1564 O  OG    . SER A 1 225 ? 6.300  24.626 1.282   1.00 36.47 ? 219 SER A OG    1 
ATOM   1565 N  N     . LYS A 1 226 ? 9.133  23.520 -0.165  1.00 38.33 ? 220 LYS A N     1 
ATOM   1566 C  CA    . LYS A 1 226 ? 9.877  24.125 -1.257  1.00 37.12 ? 220 LYS A CA    1 
ATOM   1567 C  C     . LYS A 1 226 ? 11.020 23.230 -1.658  1.00 39.06 ? 220 LYS A C     1 
ATOM   1568 O  O     . LYS A 1 226 ? 11.346 22.276 -0.968  1.00 40.26 ? 220 LYS A O     1 
ATOM   1569 C  CB    . LYS A 1 226 ? 10.436 25.503 -0.847  1.00 35.95 ? 220 LYS A CB    1 
ATOM   1570 C  CG    . LYS A 1 226 ? 9.424  26.452 -0.230  1.00 35.74 ? 220 LYS A CG    1 
ATOM   1571 C  CD    . LYS A 1 226 ? 8.262  26.745 -1.182  1.00 33.65 ? 220 LYS A CD    1 
ATOM   1572 C  CE    . LYS A 1 226 ? 7.144  27.476 -0.476  1.00 34.93 ? 220 LYS A CE    1 
ATOM   1573 N  NZ    . LYS A 1 226 ? 5.934  27.605 -1.355  1.00 36.25 ? 220 LYS A NZ    1 
ATOM   1574 N  N     . LYS A 1 227 ? 11.641 23.578 -2.780  1.00 42.32 ? 221 LYS A N     1 
ATOM   1575 C  CA    . LYS A 1 227 ? 12.738 22.821 -3.346  1.00 43.09 ? 221 LYS A CA    1 
ATOM   1576 C  C     . LYS A 1 227 ? 14.044 23.247 -2.692  1.00 42.18 ? 221 LYS A C     1 
ATOM   1577 O  O     . LYS A 1 227 ? 14.458 24.400 -2.815  1.00 43.78 ? 221 LYS A O     1 
ATOM   1578 C  CB    . LYS A 1 227 ? 12.804 23.043 -4.865  1.00 45.26 ? 221 LYS A CB    1 
ATOM   1579 N  N     . ASN A 1 228 ? 14.657 22.299 -1.986  1.00 39.58 ? 222 ASN A N     1 
ATOM   1580 C  CA    . ASN A 1 228 ? 15.979 22.455 -1.340  1.00 40.39 ? 222 ASN A CA    1 
ATOM   1581 C  C     . ASN A 1 228 ? 16.169 23.746 -0.512  1.00 39.30 ? 222 ASN A C     1 
ATOM   1582 O  O     . ASN A 1 228 ? 17.180 24.409 -0.639  1.00 41.68 ? 222 ASN A O     1 
ATOM   1583 C  CB    . ASN A 1 228 ? 17.100 22.308 -2.393  1.00 43.15 ? 222 ASN A CB    1 
ATOM   1584 N  N     . LEU A 1 229 ? 15.178 24.096 0.322   1.00 36.58 ? 223 LEU A N     1 
ATOM   1585 C  CA    . LEU A 1 229 ? 15.240 25.317 1.144   1.00 32.10 ? 223 LEU A CA    1 
ATOM   1586 C  C     . LEU A 1 229 ? 15.725 24.965 2.544   1.00 28.37 ? 223 LEU A C     1 
ATOM   1587 O  O     . LEU A 1 229 ? 15.016 24.330 3.286   1.00 31.35 ? 223 LEU A O     1 
ATOM   1588 C  CB    . LEU A 1 229 ? 13.864 25.974 1.214   1.00 30.19 ? 223 LEU A CB    1 
ATOM   1589 C  CG    . LEU A 1 229 ? 13.750 27.365 1.839   1.00 30.76 ? 223 LEU A CG    1 
ATOM   1590 C  CD1   . LEU A 1 229 ? 14.840 28.325 1.331   1.00 29.94 ? 223 LEU A CD1   1 
ATOM   1591 C  CD2   . LEU A 1 229 ? 12.366 27.929 1.575   1.00 28.86 ? 223 LEU A CD2   1 
ATOM   1592 N  N     . GLN A 1 230 ? 16.927 25.408 2.901   1.00 22.76 ? 224 GLN A N     1 
ATOM   1593 C  CA    . GLN A 1 230 ? 17.501 25.105 4.191   1.00 24.80 ? 224 GLN A CA    1 
ATOM   1594 C  C     . GLN A 1 230 ? 16.983 26.071 5.232   1.00 24.62 ? 224 GLN A C     1 
ATOM   1595 O  O     . GLN A 1 230 ? 16.632 27.193 4.908   1.00 21.15 ? 224 GLN A O     1 
ATOM   1596 C  CB    . GLN A 1 230 ? 19.003 25.197 4.166   1.00 26.48 ? 224 GLN A CB    1 
ATOM   1597 C  CG    . GLN A 1 230 ? 19.681 24.247 3.265   1.00 31.50 ? 224 GLN A CG    1 
ATOM   1598 C  CD    . GLN A 1 230 ? 21.175 24.390 3.401   1.00 35.35 ? 224 GLN A CD    1 
ATOM   1599 O  OE1   . GLN A 1 230 ? 21.848 24.910 2.503   1.00 37.48 ? 224 GLN A OE1   1 
ATOM   1600 N  NE2   . GLN A 1 230 ? 21.694 24.025 4.582   1.00 35.40 ? 224 GLN A NE2   1 
ATOM   1601 N  N     . VAL A 1 231 ? 16.970 25.607 6.469   1.00 20.42 ? 225 VAL A N     1 
ATOM   1602 C  CA    . VAL A 1 231 ? 16.534 26.371 7.652   1.00 21.64 ? 225 VAL A CA    1 
ATOM   1603 C  C     . VAL A 1 231 ? 17.663 26.342 8.665   1.00 23.40 ? 225 VAL A C     1 
ATOM   1604 O  O     . VAL A 1 231 ? 18.089 25.250 9.068   1.00 24.64 ? 225 VAL A O     1 
ATOM   1605 C  CB    . VAL A 1 231 ? 15.272 25.721 8.299   1.00 22.54 ? 225 VAL A CB    1 
ATOM   1606 C  CG1   . VAL A 1 231 ? 14.827 26.472 9.573   1.00 18.44 ? 225 VAL A CG1   1 
ATOM   1607 C  CG2   . VAL A 1 231 ? 14.137 25.608 7.302   1.00 19.05 ? 225 VAL A CG2   1 
ATOM   1608 N  N     . VAL A 1 232 ? 18.168 27.518 9.056   1.00 17.75 ? 226 VAL A N     1 
ATOM   1609 C  CA    . VAL A 1 232 ? 19.154 27.671 10.141  1.00 17.69 ? 226 VAL A CA    1 
ATOM   1610 C  C     . VAL A 1 232 ? 18.470 28.323 11.343  1.00 22.24 ? 226 VAL A C     1 
ATOM   1611 O  O     . VAL A 1 232 ? 17.813 29.366 11.221  1.00 19.03 ? 226 VAL A O     1 
ATOM   1612 C  CB    . VAL A 1 232 ? 20.404 28.456 9.677   1.00 17.06 ? 226 VAL A CB    1 
ATOM   1613 C  CG1   . VAL A 1 232 ? 21.406 28.710 10.844  1.00 19.35 ? 226 VAL A CG1   1 
ATOM   1614 C  CG2   . VAL A 1 232 ? 21.072 27.731 8.476   1.00 18.38 ? 226 VAL A CG2   1 
ATOM   1615 N  N     . GLU A 1 233 ? 18.589 27.681 12.512  1.00 18.38 ? 227 GLU A N     1 
ATOM   1616 C  CA    . GLU A 1 233 ? 17.911 28.147 13.727  1.00 19.56 ? 227 GLU A CA    1 
ATOM   1617 C  C     . GLU A 1 233 ? 18.853 29.034 14.512  1.00 22.14 ? 227 GLU A C     1 
ATOM   1618 O  O     . GLU A 1 233 ? 19.940 28.592 14.911  1.00 18.85 ? 227 GLU A O     1 
ATOM   1619 C  CB    . GLU A 1 233 ? 17.421 26.966 14.555  1.00 20.88 ? 227 GLU A CB    1 
ATOM   1620 C  CG    . GLU A 1 233 ? 16.503 26.057 13.789  1.00 22.32 ? 227 GLU A CG    1 
ATOM   1621 C  CD    . GLU A 1 233 ? 15.850 25.028 14.650  1.00 20.93 ? 227 GLU A CD    1 
ATOM   1622 O  OE1   . GLU A 1 233 ? 16.279 24.868 15.817  1.00 21.18 ? 227 GLU A OE1   1 
ATOM   1623 O  OE2   . GLU A 1 233 ? 14.912 24.384 14.179  1.00 26.23 ? 227 GLU A OE2   1 
ATOM   1624 N  N     . THR A 1 234 ? 18.456 30.305 14.709  1.00 16.98 ? 228 THR A N     1 
ATOM   1625 C  CA    . THR A 1 234 ? 19.363 31.307 15.300  1.00 17.59 ? 228 THR A CA    1 
ATOM   1626 C  C     . THR A 1 234 ? 18.833 32.009 16.583  1.00 20.32 ? 228 THR A C     1 
ATOM   1627 O  O     . THR A 1 234 ? 17.629 32.073 16.849  1.00 18.50 ? 228 THR A O     1 
ATOM   1628 C  CB    . THR A 1 234 ? 19.760 32.431 14.309  1.00 20.06 ? 228 THR A CB    1 
ATOM   1629 O  OG1   . THR A 1 234 ? 18.671 33.361 14.149  1.00 21.19 ? 228 THR A OG1   1 
ATOM   1630 C  CG2   . THR A 1 234 ? 20.212 31.881 12.924  1.00 19.57 ? 228 THR A CG2   1 
ATOM   1631 N  N     . SER A 1 235 ? 19.781 32.553 17.336  1.00 21.28 ? 229 SER A N     1 
ATOM   1632 C  CA    . SER A 1 235 ? 19.503 33.594 18.339  1.00 20.85 ? 229 SER A CA    1 
ATOM   1633 C  C     . SER A 1 235 ? 20.578 34.664 18.291  1.00 21.17 ? 229 SER A C     1 
ATOM   1634 O  O     . SER A 1 235 ? 21.774 34.425 18.616  1.00 17.22 ? 229 SER A O     1 
ATOM   1635 C  CB    . SER A 1 235 ? 19.415 33.024 19.747  1.00 19.60 ? 229 SER A CB    1 
ATOM   1636 O  OG    . SER A 1 235 ? 19.271 34.095 20.667  1.00 19.95 ? 229 SER A OG    1 
ATOM   1637 N  N     . ALA A 1 236 ? 20.177 35.860 17.882  1.00 19.56 ? 230 ALA A N     1 
ATOM   1638 C  CA    . ALA A 1 236 ? 21.073 37.005 17.903  1.00 21.04 ? 230 ALA A CA    1 
ATOM   1639 C  C     . ALA A 1 236 ? 21.376 37.345 19.367  1.00 19.00 ? 230 ALA A C     1 
ATOM   1640 O  O     . ALA A 1 236 ? 22.522 37.737 19.685  1.00 23.42 ? 230 ALA A O     1 
ATOM   1641 C  CB    . ALA A 1 236 ? 20.424 38.238 17.185  1.00 19.33 ? 230 ALA A CB    1 
ATOM   1642 N  N     . ARG A 1 237 ? 20.366 37.186 20.244  1.00 23.51 ? 231 ARG A N     1 
ATOM   1643 C  CA    . ARG A 1 237 ? 20.484 37.548 21.669  1.00 26.53 ? 231 ARG A CA    1 
ATOM   1644 C  C     . ARG A 1 237 ? 21.523 36.656 22.383  1.00 26.75 ? 231 ARG A C     1 
ATOM   1645 O  O     . ARG A 1 237 ? 22.473 37.166 22.990  1.00 25.50 ? 231 ARG A O     1 
ATOM   1646 C  CB    . ARG A 1 237 ? 19.134 37.471 22.388  1.00 28.43 ? 231 ARG A CB    1 
ATOM   1647 C  CG    . ARG A 1 237 ? 19.147 38.134 23.786  1.00 31.93 ? 231 ARG A CG    1 
ATOM   1648 C  CD    . ARG A 1 237 ? 17.849 37.878 24.534  1.00 35.27 ? 231 ARG A CD    1 
ATOM   1649 N  NE    . ARG A 1 237 ? 17.680 38.810 25.653  1.00 42.07 ? 231 ARG A NE    1 
ATOM   1650 N  N     . SER A 1 238 ? 21.370 35.348 22.242  1.00 27.64 ? 232 SER A N     1 
ATOM   1651 C  CA    . SER A 1 238 ? 22.313 34.356 22.836  1.00 28.76 ? 232 SER A CA    1 
ATOM   1652 C  C     . SER A 1 238 ? 23.544 34.038 21.975  1.00 31.61 ? 232 SER A C     1 
ATOM   1653 O  O     . SER A 1 238 ? 24.416 33.281 22.402  1.00 30.52 ? 232 SER A O     1 
ATOM   1654 C  CB    . SER A 1 238 ? 21.577 33.047 23.113  1.00 29.79 ? 232 SER A CB    1 
ATOM   1655 O  OG    . SER A 1 238 ? 20.440 33.249 23.925  1.00 33.60 ? 232 SER A OG    1 
ATOM   1656 N  N     . ASN A 1 239 ? 23.604 34.601 20.764  1.00 28.65 ? 233 ASN A N     1 
ATOM   1657 C  CA    . ASN A 1 239 ? 24.696 34.428 19.813  1.00 29.43 ? 233 ASN A CA    1 
ATOM   1658 C  C     . ASN A 1 239 ? 24.897 32.972 19.471  1.00 31.01 ? 233 ASN A C     1 
ATOM   1659 O  O     . ASN A 1 239 ? 25.954 32.381 19.738  1.00 33.16 ? 233 ASN A O     1 
ATOM   1660 C  CB    . ASN A 1 239 ? 25.980 35.063 20.306  1.00 34.64 ? 233 ASN A CB    1 
ATOM   1661 C  CG    . ASN A 1 239 ? 27.027 35.183 19.219  1.00 34.53 ? 233 ASN A CG    1 
ATOM   1662 O  OD1   . ASN A 1 239 ? 26.732 35.091 18.037  1.00 32.13 ? 233 ASN A OD1   1 
ATOM   1663 N  ND2   . ASN A 1 239 ? 28.267 35.414 19.626  1.00 37.56 ? 233 ASN A ND2   1 
ATOM   1664 N  N     . VAL A 1 240 ? 23.850 32.397 18.897  1.00 24.90 ? 234 VAL A N     1 
ATOM   1665 C  CA    . VAL A 1 240 ? 23.839 31.026 18.426  1.00 23.84 ? 234 VAL A CA    1 
ATOM   1666 C  C     . VAL A 1 240 ? 23.524 31.001 16.927  1.00 23.86 ? 234 VAL A C     1 
ATOM   1667 O  O     . VAL A 1 240 ? 22.491 31.563 16.500  1.00 18.40 ? 234 VAL A O     1 
ATOM   1668 C  CB    . VAL A 1 240 ? 22.759 30.236 19.112  1.00 20.71 ? 234 VAL A CB    1 
ATOM   1669 C  CG1   . VAL A 1 240 ? 22.546 28.853 18.428  1.00 24.21 ? 234 VAL A CG1   1 
ATOM   1670 C  CG2   . VAL A 1 240 ? 23.046 30.084 20.626  1.00 26.72 ? 234 VAL A CG2   1 
ATOM   1671 N  N     . ASN A 1 241 ? 24.397 30.338 16.161  1.00 20.00 ? 235 ASN A N     1 
ATOM   1672 C  CA    . ASN A 1 241 ? 24.197 29.999 14.752  1.00 19.88 ? 235 ASN A CA    1 
ATOM   1673 C  C     . ASN A 1 241 ? 24.063 31.235 13.833  1.00 19.32 ? 235 ASN A C     1 
ATOM   1674 O  O     . ASN A 1 241 ? 23.575 31.111 12.707  1.00 21.93 ? 235 ASN A O     1 
ATOM   1675 C  CB    . ASN A 1 241 ? 22.988 29.077 14.571  1.00 21.92 ? 235 ASN A CB    1 
ATOM   1676 C  CG    . ASN A 1 241 ? 23.244 27.647 15.009  1.00 23.98 ? 235 ASN A CG    1 
ATOM   1677 O  OD1   . ASN A 1 241 ? 24.385 27.217 15.170  1.00 19.48 ? 235 ASN A OD1   1 
ATOM   1678 N  ND2   . ASN A 1 241 ? 22.184 26.907 15.181  1.00 16.87 ? 235 ASN A ND2   1 
ATOM   1679 N  N     . VAL A 1 242 ? 24.575 32.384 14.281  1.00 21.79 ? 236 VAL A N     1 
ATOM   1680 C  CA    . VAL A 1 242 ? 24.501 33.619 13.486  1.00 21.25 ? 236 VAL A CA    1 
ATOM   1681 C  C     . VAL A 1 242 ? 25.460 33.499 12.308  1.00 22.08 ? 236 VAL A C     1 
ATOM   1682 O  O     . VAL A 1 242 ? 25.052 33.632 11.153  1.00 18.69 ? 236 VAL A O     1 
ATOM   1683 C  CB    . VAL A 1 242 ? 24.763 34.893 14.380  1.00 21.96 ? 236 VAL A CB    1 
ATOM   1684 C  CG1   . VAL A 1 242 ? 24.837 36.173 13.525  1.00 23.24 ? 236 VAL A CG1   1 
ATOM   1685 C  CG2   . VAL A 1 242 ? 23.694 34.972 15.485  1.00 24.69 ? 236 VAL A CG2   1 
ATOM   1686 N  N     . ASP A 1 243 ? 26.742 33.209 12.573  1.00 22.80 ? 237 ASP A N     1 
ATOM   1687 C  CA    . ASP A 1 243 ? 27.716 32.984 11.476  1.00 23.03 ? 237 ASP A CA    1 
ATOM   1688 C  C     . ASP A 1 243 ? 27.258 31.845 10.534  1.00 20.01 ? 237 ASP A C     1 
ATOM   1689 O  O     . ASP A 1 243 ? 27.388 31.955 9.307   1.00 20.55 ? 237 ASP A O     1 
ATOM   1690 C  CB    . ASP A 1 243 ? 29.119 32.672 12.055  1.00 25.51 ? 237 ASP A CB    1 
ATOM   1691 C  CG    . ASP A 1 243 ? 29.819 33.906 12.654  1.00 32.37 ? 237 ASP A CG    1 
ATOM   1692 O  OD1   . ASP A 1 243 ? 29.231 35.030 12.721  1.00 32.28 ? 237 ASP A OD1   1 
ATOM   1693 O  OD2   . ASP A 1 243 ? 30.985 33.753 13.079  1.00 36.61 ? 237 ASP A OD2   1 
ATOM   1694 N  N     . LEU A 1 244 ? 26.717 30.770 11.117  1.00 21.35 ? 238 LEU A N     1 
ATOM   1695 C  CA    . LEU A 1 244 ? 26.265 29.617 10.357  1.00 21.22 ? 238 LEU A CA    1 
ATOM   1696 C  C     . LEU A 1 244 ? 25.191 30.005 9.308   1.00 23.35 ? 238 LEU A C     1 
ATOM   1697 O  O     . LEU A 1 244 ? 25.195 29.530 8.159   1.00 20.60 ? 238 LEU A O     1 
ATOM   1698 C  CB    . LEU A 1 244 ? 25.738 28.520 11.264  1.00 23.34 ? 238 LEU A CB    1 
ATOM   1699 C  CG    . LEU A 1 244 ? 25.226 27.254 10.537  1.00 21.96 ? 238 LEU A CG    1 
ATOM   1700 C  CD1   . LEU A 1 244 ? 26.351 26.659 9.618   1.00 21.24 ? 238 LEU A CD1   1 
ATOM   1701 C  CD2   . LEU A 1 244 ? 24.672 26.225 11.542  1.00 20.14 ? 238 LEU A CD2   1 
ATOM   1702 N  N     . ALA A 1 245 ? 24.284 30.879 9.711   1.00 20.67 ? 239 ALA A N     1 
ATOM   1703 C  CA    . ALA A 1 245 ? 23.192 31.314 8.805   1.00 16.72 ? 239 ALA A CA    1 
ATOM   1704 C  C     . ALA A 1 245 ? 23.795 31.937 7.572   1.00 15.74 ? 239 ALA A C     1 
ATOM   1705 O  O     . ALA A 1 245 ? 23.439 31.602 6.473   1.00 19.64 ? 239 ALA A O     1 
ATOM   1706 C  CB    . ALA A 1 245 ? 22.272 32.309 9.523   1.00 17.91 ? 239 ALA A CB    1 
ATOM   1707 N  N     . PHE A 1 246 ? 24.749 32.838 7.775   1.00 17.13 ? 240 PHE A N     1 
ATOM   1708 C  CA    . PHE A 1 246 ? 25.357 33.560 6.700   1.00 17.81 ? 240 PHE A CA    1 
ATOM   1709 C  C     . PHE A 1 246 ? 26.275 32.623 5.901   1.00 18.15 ? 240 PHE A C     1 
ATOM   1710 O  O     . PHE A 1 246 ? 26.273 32.666 4.688   1.00 18.10 ? 240 PHE A O     1 
ATOM   1711 C  CB    . PHE A 1 246 ? 26.107 34.774 7.230   1.00 17.87 ? 240 PHE A CB    1 
ATOM   1712 C  CG    . PHE A 1 246 ? 25.178 35.927 7.676   1.00 19.11 ? 240 PHE A CG    1 
ATOM   1713 C  CD1   . PHE A 1 246 ? 24.809 36.958 6.785   1.00 18.31 ? 240 PHE A CD1   1 
ATOM   1714 C  CD2   . PHE A 1 246 ? 24.665 35.959 8.960   1.00 16.52 ? 240 PHE A CD2   1 
ATOM   1715 C  CE1   . PHE A 1 246 ? 23.951 37.971 7.195   1.00 18.40 ? 240 PHE A CE1   1 
ATOM   1716 C  CE2   . PHE A 1 246 ? 23.777 36.983 9.370   1.00 19.38 ? 240 PHE A CE2   1 
ATOM   1717 C  CZ    . PHE A 1 246 ? 23.437 37.979 8.492   1.00 17.34 ? 240 PHE A CZ    1 
ATOM   1718 N  N     . SER A 1 247 ? 27.032 31.774 6.580   1.00 20.43 ? 241 SER A N     1 
ATOM   1719 C  CA    . SER A 1 247 ? 27.990 30.903 5.848   1.00 22.08 ? 241 SER A CA    1 
ATOM   1720 C  C     . SER A 1 247 ? 27.255 29.938 4.965   1.00 18.18 ? 241 SER A C     1 
ATOM   1721 O  O     . SER A 1 247 ? 27.697 29.642 3.841   1.00 20.71 ? 241 SER A O     1 
ATOM   1722 C  CB    . SER A 1 247 ? 28.925 30.161 6.813   1.00 23.59 ? 241 SER A CB    1 
ATOM   1723 O  OG    . SER A 1 247 ? 28.195 29.483 7.798   1.00 29.48 ? 241 SER A OG    1 
ATOM   1724 N  N     . THR A 1 248 ? 26.124 29.438 5.481   1.00 20.01 ? 242 THR A N     1 
ATOM   1725 C  CA    . THR A 1 248 ? 25.228 28.527 4.747   1.00 20.50 ? 242 THR A CA    1 
ATOM   1726 C  C     . THR A 1 248 ? 24.792 29.162 3.420   1.00 17.28 ? 242 THR A C     1 
ATOM   1727 O  O     . THR A 1 248 ? 24.827 28.528 2.369   1.00 16.91 ? 242 THR A O     1 
ATOM   1728 C  CB    . THR A 1 248 ? 24.004 28.140 5.629   1.00 18.84 ? 242 THR A CB    1 
ATOM   1729 O  OG1   . THR A 1 248 ? 24.458 27.418 6.792   1.00 20.37 ? 242 THR A OG1   1 
ATOM   1730 C  CG2   . THR A 1 248 ? 22.929 27.306 4.837   1.00 21.21 ? 242 THR A CG2   1 
ATOM   1731 N  N     . LEU A 1 249 ? 24.389 30.429 3.464   1.00 18.45 ? 243 LEU A N     1 
ATOM   1732 C  CA    . LEU A 1 249 ? 24.046 31.137 2.261   1.00 17.59 ? 243 LEU A CA    1 
ATOM   1733 C  C     . LEU A 1 249 ? 25.231 31.339 1.278   1.00 16.96 ? 243 LEU A C     1 
ATOM   1734 O  O     . LEU A 1 249 ? 25.056 31.175 0.075   1.00 17.27 ? 243 LEU A O     1 
ATOM   1735 C  CB    . LEU A 1 249 ? 23.397 32.491 2.599   1.00 18.95 ? 243 LEU A CB    1 
ATOM   1736 C  CG    . LEU A 1 249 ? 22.927 33.321 1.401   1.00 20.90 ? 243 LEU A CG    1 
ATOM   1737 C  CD1   . LEU A 1 249 ? 21.862 32.650 0.509   1.00 21.95 ? 243 LEU A CD1   1 
ATOM   1738 C  CD2   . LEU A 1 249 ? 22.436 34.746 1.961   1.00 17.04 ? 243 LEU A CD2   1 
ATOM   1739 N  N     . VAL A 1 250 ? 26.390 31.718 1.812   1.00 21.31 ? 244 VAL A N     1 
ATOM   1740 C  CA    . VAL A 1 250 ? 27.586 31.955 1.015   1.00 21.62 ? 244 VAL A CA    1 
ATOM   1741 C  C     . VAL A 1 250 ? 27.925 30.635 0.235   1.00 20.97 ? 244 VAL A C     1 
ATOM   1742 O  O     . VAL A 1 250 ? 28.170 30.661 -0.951  1.00 21.30 ? 244 VAL A O     1 
ATOM   1743 C  CB    . VAL A 1 250 ? 28.770 32.455 1.920   1.00 22.19 ? 244 VAL A CB    1 
ATOM   1744 C  CG1   . VAL A 1 250 ? 30.162 32.296 1.185   1.00 22.96 ? 244 VAL A CG1   1 
ATOM   1745 C  CG2   . VAL A 1 250 ? 28.536 33.925 2.349   1.00 23.48 ? 244 VAL A CG2   1 
ATOM   1746 N  N     . GLN A 1 251 ? 27.861 29.510 0.935   1.00 24.58 ? 245 GLN A N     1 
ATOM   1747 C  CA    A GLN A 1 251 ? 28.073 28.192 0.326   0.50 23.56 ? 245 GLN A CA    1 
ATOM   1748 C  CA    B GLN A 1 251 ? 28.075 28.190 0.334   0.50 22.62 ? 245 GLN A CA    1 
ATOM   1749 C  C     . GLN A 1 251 ? 27.098 27.952 -0.815  1.00 23.32 ? 245 GLN A C     1 
ATOM   1750 O  O     . GLN A 1 251 ? 27.500 27.550 -1.904  1.00 20.00 ? 245 GLN A O     1 
ATOM   1751 C  CB    A GLN A 1 251 ? 27.957 27.073 1.372   0.50 23.94 ? 245 GLN A CB    1 
ATOM   1752 C  CB    B GLN A 1 251 ? 27.989 27.085 1.415   0.50 22.03 ? 245 GLN A CB    1 
ATOM   1753 C  CG    A GLN A 1 251 ? 28.162 25.681 0.783   0.50 26.53 ? 245 GLN A CG    1 
ATOM   1754 C  CG    B GLN A 1 251 ? 29.217 27.078 2.336   0.50 23.52 ? 245 GLN A CG    1 
ATOM   1755 C  CD    A GLN A 1 251 ? 28.450 24.613 1.826   0.50 29.12 ? 245 GLN A CD    1 
ATOM   1756 C  CD    B GLN A 1 251 ? 29.044 26.297 3.638   0.50 26.29 ? 245 GLN A CD    1 
ATOM   1757 O  OE1   A GLN A 1 251 ? 28.775 24.914 2.979   0.50 31.84 ? 245 GLN A OE1   1 
ATOM   1758 O  OE1   B GLN A 1 251 ? 28.134 25.485 3.789   0.50 30.75 ? 245 GLN A OE1   1 
ATOM   1759 N  NE2   A GLN A 1 251 ? 28.360 23.356 1.413   0.50 29.90 ? 245 GLN A NE2   1 
ATOM   1760 N  NE2   B GLN A 1 251 ? 29.938 26.551 4.591   0.50 29.69 ? 245 GLN A NE2   1 
ATOM   1761 N  N     . LEU A 1 252 ? 25.812 28.255 -0.589  1.00 21.38 ? 246 LEU A N     1 
ATOM   1762 C  CA    A LEU A 1 252 ? 24.777 28.084 -1.628  0.50 21.85 ? 246 LEU A CA    1 
ATOM   1763 C  CA    B LEU A 1 252 ? 24.775 28.089 -1.609  0.50 21.09 ? 246 LEU A CA    1 
ATOM   1764 C  C     . LEU A 1 252 ? 25.011 29.006 -2.811  1.00 21.87 ? 246 LEU A C     1 
ATOM   1765 O  O     . LEU A 1 252 ? 24.775 28.623 -3.955  1.00 20.47 ? 246 LEU A O     1 
ATOM   1766 C  CB    A LEU A 1 252 ? 23.361 28.333 -1.069  0.50 22.35 ? 246 LEU A CB    1 
ATOM   1767 C  CB    B LEU A 1 252 ? 23.403 28.380 -0.983  0.50 21.49 ? 246 LEU A CB    1 
ATOM   1768 C  CG    A LEU A 1 252 ? 22.708 27.181 -0.300  0.50 22.54 ? 246 LEU A CG    1 
ATOM   1769 C  CG    B LEU A 1 252 ? 22.156 27.990 -1.763  0.50 20.55 ? 246 LEU A CG    1 
ATOM   1770 C  CD1   A LEU A 1 252 ? 21.388 27.642 0.337   0.50 21.38 ? 246 LEU A CD1   1 
ATOM   1771 C  CD1   B LEU A 1 252 ? 22.170 26.500 -2.144  0.50 22.35 ? 246 LEU A CD1   1 
ATOM   1772 C  CD2   A LEU A 1 252 ? 22.514 25.957 -1.199  0.50 19.25 ? 246 LEU A CD2   1 
ATOM   1773 C  CD2   B LEU A 1 252 ? 20.918 28.337 -0.947  0.50 18.33 ? 246 LEU A CD2   1 
ATOM   1774 N  N     . ILE A 1 253 ? 25.470 30.233 -2.546  1.00 17.90 ? 247 ILE A N     1 
ATOM   1775 C  CA    . ILE A 1 253 ? 25.742 31.195 -3.611  1.00 17.36 ? 247 ILE A CA    1 
ATOM   1776 C  C     . ILE A 1 253 ? 26.788 30.641 -4.606  1.00 18.49 ? 247 ILE A C     1 
ATOM   1777 O  O     . ILE A 1 253 ? 26.679 30.859 -5.795  1.00 20.95 ? 247 ILE A O     1 
ATOM   1778 C  CB    . ILE A 1 253 ? 26.211 32.557 -3.057  1.00 16.91 ? 247 ILE A CB    1 
ATOM   1779 C  CG1   . ILE A 1 253 ? 24.987 33.351 -2.482  1.00 15.52 ? 247 ILE A CG1   1 
ATOM   1780 C  CG2   . ILE A 1 253 ? 26.894 33.378 -4.130  1.00 20.86 ? 247 ILE A CG2   1 
ATOM   1781 C  CD1   . ILE A 1 253 ? 25.402 34.419 -1.452  1.00 15.35 ? 247 ILE A CD1   1 
ATOM   1782 N  N     . ASP A 1 254 ? 27.796 29.959 -4.080  1.00 21.26 ? 248 ASP A N     1 
ATOM   1783 C  CA    . ASP A 1 254 ? 28.930 29.498 -4.901  1.00 21.52 ? 248 ASP A CA    1 
ATOM   1784 C  C     . ASP A 1 254 ? 28.665 28.170 -5.587  1.00 23.23 ? 248 ASP A C     1 
ATOM   1785 O  O     . ASP A 1 254 ? 29.438 27.785 -6.470  1.00 26.81 ? 248 ASP A O     1 
ATOM   1786 C  CB    . ASP A 1 254 ? 30.217 29.396 -4.078  1.00 21.05 ? 248 ASP A CB    1 
ATOM   1787 C  CG    . ASP A 1 254 ? 30.904 30.729 -3.875  1.00 21.24 ? 248 ASP A CG    1 
ATOM   1788 O  OD1   . ASP A 1 254 ? 30.819 31.640 -4.725  1.00 20.67 ? 248 ASP A OD1   1 
ATOM   1789 O  OD2   . ASP A 1 254 ? 31.552 30.826 -2.830  1.00 22.59 ? 248 ASP A OD2   1 
ATOM   1790 N  N     . LYS A 1 255 ? 27.597 27.469 -5.245  1.00 25.21 ? 249 LYS A N     1 
ATOM   1791 C  CA    . LYS A 1 255 ? 27.295 26.223 -5.943  1.00 31.47 ? 249 LYS A CA    1 
ATOM   1792 C  C     . LYS A 1 255 ? 27.304 26.354 -7.478  1.00 33.65 ? 249 LYS A C     1 
ATOM   1793 O  O     . LYS A 1 255 ? 26.849 27.347 -8.062  1.00 33.39 ? 249 LYS A O     1 
ATOM   1794 C  CB    . LYS A 1 255 ? 25.959 25.638 -5.484  1.00 33.90 ? 249 LYS A CB    1 
ATOM   1795 C  CG    . LYS A 1 255 ? 25.953 25.118 -4.093  1.00 37.69 ? 249 LYS A CG    1 
ATOM   1796 C  CD    . LYS A 1 255 ? 27.092 24.178 -3.820  1.00 40.52 ? 249 LYS A CD    1 
ATOM   1797 C  CE    . LYS A 1 255 ? 26.961 23.527 -2.479  1.00 42.62 ? 249 LYS A CE    1 
ATOM   1798 N  NZ    . LYS A 1 255 ? 28.182 22.765 -2.150  1.00 45.46 ? 249 LYS A NZ    1 
ATOM   1799 O  OXT   . LYS A 1 255 ? 27.789 25.440 -8.175  1.00 31.19 ? 249 LYS A OXT   1 
HETATM 1800 MG MG    . MG  B 2 .   ? 15.312 46.459 11.822  1.00 19.12 ? 302 MG  A MG    1 
HETATM 1801 MG MG    . MG  C 2 .   ? 29.671 31.019 -8.699  1.00 22.40 ? 303 MG  A MG    1 
HETATM 1802 P  PG    . GNP D 3 .   ? 12.116 46.116 11.892  1.00 16.89 ? 301 GNP A PG    1 
HETATM 1803 O  O1G   . GNP D 3 .   ? 11.022 45.453 11.107  1.00 13.70 ? 301 GNP A O1G   1 
HETATM 1804 O  O2G   . GNP D 3 .   ? 13.413 46.512 11.226  1.00 19.64 ? 301 GNP A O2G   1 
HETATM 1805 O  O3G   . GNP D 3 .   ? 11.493 47.267 12.728  1.00 19.93 ? 301 GNP A O3G   1 
HETATM 1806 N  N3B   . GNP D 3 .   ? 12.457 45.049 13.045  1.00 12.78 ? 301 GNP A N3B   1 
HETATM 1807 P  PB    . GNP D 3 .   ? 13.596 43.884 12.949  1.00 15.75 ? 301 GNP A PB    1 
HETATM 1808 O  O1B   . GNP D 3 .   ? 13.095 42.761 12.207  1.00 16.37 ? 301 GNP A O1B   1 
HETATM 1809 O  O2B   . GNP D 3 .   ? 14.823 44.566 12.561  1.00 15.47 ? 301 GNP A O2B   1 
HETATM 1810 O  O3A   . GNP D 3 .   ? 13.731 43.393 14.457  1.00 15.44 ? 301 GNP A O3A   1 
HETATM 1811 P  PA    . GNP D 3 .   ? 14.833 43.728 15.531  1.00 18.32 ? 301 GNP A PA    1 
HETATM 1812 O  O1A   . GNP D 3 .   ? 16.110 43.031 15.172  1.00 15.63 ? 301 GNP A O1A   1 
HETATM 1813 O  O2A   . GNP D 3 .   ? 15.013 45.170 15.774  1.00 18.13 ? 301 GNP A O2A   1 
HETATM 1814 O  "O5'" . GNP D 3 .   ? 14.285 43.019 16.807  1.00 20.07 ? 301 GNP A "O5'" 1 
HETATM 1815 C  "C5'" . GNP D 3 .   ? 13.057 43.465 17.414  1.00 22.81 ? 301 GNP A "C5'" 1 
HETATM 1816 C  "C4'" . GNP D 3 .   ? 13.174 43.136 18.887  1.00 26.40 ? 301 GNP A "C4'" 1 
HETATM 1817 O  "O4'" . GNP D 3 .   ? 13.127 41.687 19.023  1.00 22.96 ? 301 GNP A "O4'" 1 
HETATM 1818 C  "C3'" . GNP D 3 .   ? 14.507 43.543 19.504  1.00 27.17 ? 301 GNP A "C3'" 1 
HETATM 1819 O  "O3'" . GNP D 3 .   ? 14.502 44.897 19.991  1.00 32.48 ? 301 GNP A "O3'" 1 
HETATM 1820 C  "C2'" . GNP D 3 .   ? 14.660 42.581 20.649  1.00 30.11 ? 301 GNP A "C2'" 1 
HETATM 1821 O  "O2'" . GNP D 3 .   ? 13.866 43.011 21.756  1.00 34.49 ? 301 GNP A "O2'" 1 
HETATM 1822 C  "C1'" . GNP D 3 .   ? 14.080 41.315 20.033  1.00 23.05 ? 301 GNP A "C1'" 1 
HETATM 1823 N  N9    . GNP D 3 .   ? 15.077 40.351 19.526  1.00 22.68 ? 301 GNP A N9    1 
HETATM 1824 C  C8    . GNP D 3 .   ? 15.894 40.407 18.403  1.00 23.16 ? 301 GNP A C8    1 
HETATM 1825 N  N7    . GNP D 3 .   ? 16.649 39.328 18.260  1.00 20.38 ? 301 GNP A N7    1 
HETATM 1826 C  C5    . GNP D 3 .   ? 16.313 38.533 19.349  1.00 20.69 ? 301 GNP A C5    1 
HETATM 1827 C  C6    . GNP D 3 .   ? 16.774 37.246 19.745  1.00 23.44 ? 301 GNP A C6    1 
HETATM 1828 O  O6    . GNP D 3 .   ? 17.625 36.521 19.182  1.00 20.59 ? 301 GNP A O6    1 
HETATM 1829 N  N1    . GNP D 3 .   ? 16.136 36.779 20.904  1.00 22.04 ? 301 GNP A N1    1 
HETATM 1830 C  C2    . GNP D 3 .   ? 15.186 37.477 21.632  1.00 25.63 ? 301 GNP A C2    1 
HETATM 1831 N  N2    . GNP D 3 .   ? 14.671 36.904 22.742  1.00 22.91 ? 301 GNP A N2    1 
HETATM 1832 N  N3    . GNP D 3 .   ? 14.763 38.680 21.258  1.00 24.38 ? 301 GNP A N3    1 
HETATM 1833 C  C4    . GNP D 3 .   ? 15.364 39.160 20.133  1.00 23.30 ? 301 GNP A C4    1 
HETATM 1834 X  UNK   . UNX E 4 .   ? 4.006  43.913 1.653   0.01 2.00  ? 304 UNX A UNK   1 
HETATM 1835 X  UNK   . UNX F 4 .   ? 31.749 47.060 11.184  0.01 2.00  ? 305 UNX A UNK   1 
HETATM 1836 X  UNK   . UNX G 4 .   ? 3.064  47.935 3.810   0.01 2.00  ? 306 UNX A UNK   1 
HETATM 1837 X  UNK   . UNX H 4 .   ? 27.688 30.029 13.920  0.01 2.00  ? 307 UNX A UNK   1 
HETATM 1838 X  UNK   . UNX I 4 .   ? 31.762 37.636 12.028  0.01 31.12 ? 308 UNX A UNK   1 
HETATM 1839 O  O     . HOH J 5 .   ? 17.910 35.519 16.079  1.00 17.94 ? 309 HOH A O     1 
HETATM 1840 O  O     . HOH J 5 .   ? 22.862 52.290 6.217   1.00 18.37 ? 310 HOH A O     1 
HETATM 1841 O  O     . HOH J 5 .   ? 9.771  43.028 11.619  1.00 19.90 ? 311 HOH A O     1 
HETATM 1842 O  O     . HOH J 5 .   ? 30.773 29.514 -7.685  1.00 17.66 ? 312 HOH A O     1 
HETATM 1843 O  O     . HOH J 5 .   ? 12.429 47.467 2.145   1.00 16.79 ? 313 HOH A O     1 
HETATM 1844 O  O     . HOH J 5 .   ? 27.985 30.191 -8.140  1.00 17.44 ? 314 HOH A O     1 
HETATM 1845 O  O     . HOH J 5 .   ? 20.268 58.659 8.185   1.00 21.03 ? 315 HOH A O     1 
HETATM 1846 O  O     . HOH J 5 .   ? 17.275 38.113 15.688  1.00 17.81 ? 316 HOH A O     1 
HETATM 1847 O  O     . HOH J 5 .   ? 16.066 45.213 -8.614  1.00 21.34 ? 317 HOH A O     1 
HETATM 1848 O  O     . HOH J 5 .   ? 31.305 31.927 -9.312  1.00 17.55 ? 318 HOH A O     1 
HETATM 1849 O  O     . HOH J 5 .   ? 12.095 47.915 15.301  1.00 21.07 ? 319 HOH A O     1 
HETATM 1850 O  O     . HOH J 5 .   ? 2.002  25.855 21.424  1.00 24.43 ? 320 HOH A O     1 
HETATM 1851 O  O     . HOH J 5 .   ? 4.629  24.781 20.962  1.00 29.88 ? 321 HOH A O     1 
HETATM 1852 O  O     . HOH J 5 .   ? 14.731 47.608 -2.551  1.00 25.43 ? 322 HOH A O     1 
HETATM 1853 O  O     . HOH J 5 .   ? 29.596 32.267 -6.933  1.00 18.85 ? 323 HOH A O     1 
HETATM 1854 O  O     . HOH J 5 .   ? 16.747 50.445 12.803  1.00 19.79 ? 324 HOH A O     1 
HETATM 1855 O  O     . HOH J 5 .   ? 18.504 27.033 1.168   1.00 23.43 ? 325 HOH A O     1 
HETATM 1856 O  O     . HOH J 5 .   ? 29.763 44.671 -3.401  1.00 34.18 ? 326 HOH A O     1 
HETATM 1857 O  O     . HOH J 5 .   ? 23.673 34.328 -6.590  1.00 21.95 ? 327 HOH A O     1 
HETATM 1858 O  O     . HOH J 5 .   ? 29.387 29.801 -10.403 1.00 20.22 ? 328 HOH A O     1 
HETATM 1859 O  O     . HOH J 5 .   ? 27.643 44.680 -6.477  1.00 26.94 ? 329 HOH A O     1 
HETATM 1860 O  O     . HOH J 5 .   ? 17.428 28.598 -2.472  1.00 28.01 ? 330 HOH A O     1 
HETATM 1861 O  O     . HOH J 5 .   ? 26.510 40.144 -7.389  1.00 32.65 ? 331 HOH A O     1 
HETATM 1862 O  O     . HOH J 5 .   ? 10.389 50.142 15.347  1.00 25.71 ? 332 HOH A O     1 
HETATM 1863 O  O     . HOH J 5 .   ? 28.892 40.018 -5.528  1.00 28.61 ? 333 HOH A O     1 
HETATM 1864 O  O     . HOH J 5 .   ? 9.160  63.231 11.232  1.00 31.50 ? 334 HOH A O     1 
HETATM 1865 O  O     . HOH J 5 .   ? 9.967  51.408 -3.351  1.00 24.99 ? 335 HOH A O     1 
HETATM 1866 O  O     . HOH J 5 .   ? 24.649 25.863 2.125   1.00 29.74 ? 336 HOH A O     1 
HETATM 1867 O  O     . HOH J 5 .   ? 28.529 32.555 -9.763  1.00 24.63 ? 337 HOH A O     1 
HETATM 1868 O  O     . HOH J 5 .   ? 22.527 27.943 -5.050  1.00 36.14 ? 338 HOH A O     1 
HETATM 1869 O  O     . HOH J 5 .   ? 28.338 36.306 15.181  1.00 32.36 ? 339 HOH A O     1 
HETATM 1870 O  O     . HOH J 5 .   ? 12.776 65.888 11.311  1.00 27.74 ? 340 HOH A O     1 
HETATM 1871 O  O     . HOH J 5 .   ? 13.713 21.990 15.273  1.00 32.20 ? 341 HOH A O     1 
HETATM 1872 O  O     . HOH J 5 .   ? 11.432 34.213 -12.544 1.00 28.24 ? 342 HOH A O     1 
HETATM 1873 O  O     . HOH J 5 .   ? 24.488 31.806 -7.000  1.00 25.86 ? 343 HOH A O     1 
HETATM 1874 O  O     . HOH J 5 .   ? 11.228 39.742 21.038  1.00 32.08 ? 344 HOH A O     1 
HETATM 1875 O  O     . HOH J 5 .   ? 0.763  38.982 3.281   1.00 46.38 ? 345 HOH A O     1 
HETATM 1876 O  O     . HOH J 5 .   ? 19.788 51.787 17.533  1.00 34.81 ? 346 HOH A O     1 
HETATM 1877 O  O     . HOH J 5 .   ? 14.056 30.163 -7.249  1.00 37.80 ? 347 HOH A O     1 
HETATM 1878 O  O     . HOH J 5 .   ? 7.066  58.760 18.083  1.00 34.76 ? 348 HOH A O     1 
HETATM 1879 O  O     . HOH J 5 .   ? 14.191 49.056 -0.357  1.00 27.29 ? 349 HOH A O     1 
HETATM 1880 O  O     . HOH J 5 .   ? -0.051 30.097 7.945   1.00 39.72 ? 350 HOH A O     1 
HETATM 1881 O  O     . HOH J 5 .   ? -1.221 32.150 15.204  1.00 30.42 ? 351 HOH A O     1 
HETATM 1882 O  O     . HOH J 5 .   ? 15.903 47.912 -7.614  1.00 43.96 ? 352 HOH A O     1 
HETATM 1883 O  O     . HOH J 5 .   ? 31.496 29.159 -0.966  1.00 32.80 ? 353 HOH A O     1 
HETATM 1884 O  O     . HOH J 5 .   ? 29.564 25.948 -2.275  1.00 36.29 ? 354 HOH A O     1 
HETATM 1885 O  O     . HOH J 5 .   ? 34.540 54.213 3.090   1.00 43.24 ? 355 HOH A O     1 
HETATM 1886 O  O     . HOH J 5 .   ? 13.318 22.375 0.795   1.00 41.66 ? 356 HOH A O     1 
HETATM 1887 O  O     . HOH J 5 .   ? 25.043 24.352 -0.283  1.00 36.06 ? 357 HOH A O     1 
HETATM 1888 O  O     . HOH J 5 .   ? 10.977 39.278 -7.600  1.00 29.04 ? 358 HOH A O     1 
HETATM 1889 O  O     . HOH J 5 .   ? 16.877 52.360 18.427  1.00 31.63 ? 359 HOH A O     1 
HETATM 1890 O  O     . HOH J 5 .   ? 27.952 50.906 17.888  1.00 44.46 ? 360 HOH A O     1 
HETATM 1891 O  O     . HOH J 5 .   ? 13.023 41.355 -7.616  1.00 26.09 ? 361 HOH A O     1 
HETATM 1892 O  O     . HOH J 5 .   ? 29.305 54.626 8.642   1.00 34.44 ? 362 HOH A O     1 
HETATM 1893 O  O     . HOH J 5 .   ? 10.693 46.055 17.235  1.00 34.93 ? 363 HOH A O     1 
HETATM 1894 O  O     . HOH J 5 .   ? 35.434 57.727 9.582   1.00 51.12 ? 364 HOH A O     1 
HETATM 1895 O  O     . HOH J 5 .   ? 35.189 41.311 9.889   1.00 32.16 ? 365 HOH A O     1 
HETATM 1896 O  O     . HOH J 5 .   ? 17.496 22.618 6.785   1.00 28.51 ? 366 HOH A O     1 
HETATM 1897 O  O     . HOH J 5 .   ? 32.542 43.600 17.380  1.00 35.31 ? 367 HOH A O     1 
HETATM 1898 O  O     . HOH J 5 .   ? 15.582 63.934 14.118  1.00 41.04 ? 368 HOH A O     1 
HETATM 1899 O  O     . HOH J 5 .   ? 15.803 30.877 -5.345  1.00 46.72 ? 369 HOH A O     1 
HETATM 1900 O  O     . HOH J 5 .   ? 2.432  38.674 12.192  1.00 38.54 ? 370 HOH A O     1 
HETATM 1901 O  O     . HOH J 5 .   ? 28.634 57.794 10.625  1.00 39.10 ? 371 HOH A O     1 
HETATM 1902 O  O     . HOH J 5 .   ? 22.061 40.671 -8.498  1.00 40.64 ? 372 HOH A O     1 
HETATM 1903 O  O     . HOH J 5 .   ? 2.574  45.591 -6.641  1.00 45.75 ? 373 HOH A O     1 
HETATM 1904 O  O     . HOH J 5 .   ? 3.596  25.167 7.553   1.00 37.85 ? 374 HOH A O     1 
HETATM 1905 O  O     . HOH J 5 .   ? 5.372  30.203 -1.053  1.00 40.57 ? 375 HOH A O     1 
HETATM 1906 O  O     . HOH J 5 .   ? 20.414 42.290 -10.319 1.00 38.13 ? 376 HOH A O     1 
HETATM 1907 O  O     . HOH J 5 .   ? 18.616 64.616 7.001   1.00 37.67 ? 377 HOH A O     1 
HETATM 1908 O  O     . HOH J 5 .   ? 20.778 54.162 19.446  1.00 44.48 ? 378 HOH A O     1 
HETATM 1909 O  O     . HOH J 5 .   ? 25.548 43.353 24.447  1.00 47.02 ? 379 HOH A O     1 
HETATM 1910 O  O     . HOH J 5 .   ? 25.691 32.268 -9.879  1.00 31.93 ? 380 HOH A O     1 
HETATM 1911 O  O     . HOH J 5 .   ? 0.618  33.612 17.178  1.00 30.65 ? 381 HOH A O     1 
HETATM 1912 O  O     . HOH J 5 .   ? 3.383  25.470 4.658   1.00 47.72 ? 382 HOH A O     1 
HETATM 1913 O  O     . HOH J 5 .   ? 1.098  39.931 10.000  1.00 47.89 ? 383 HOH A O     1 
HETATM 1914 O  O     . HOH J 5 .   ? 1.300  30.071 5.158   1.00 47.77 ? 384 HOH A O     1 
HETATM 1915 O  O     . HOH J 5 .   ? 20.498 39.304 -11.249 1.00 42.20 ? 385 HOH A O     1 
HETATM 1916 O  O     . HOH J 5 .   ? 10.604 33.870 31.169  1.00 41.45 ? 386 HOH A O     1 
HETATM 1917 O  O     . HOH J 5 .   ? 4.157  37.054 -3.599  1.00 32.56 ? 387 HOH A O     1 
HETATM 1918 O  O     . HOH J 5 .   ? 30.396 29.636 -18.267 1.00 30.89 ? 388 HOH A O     1 
HETATM 1919 O  O     . HOH J 5 .   ? 14.798 47.061 13.826  1.00 15.53 ? 389 HOH A O     1 
HETATM 1920 O  O     . HOH J 5 .   ? 15.403 48.485 11.291  1.00 20.85 ? 390 HOH A O     1 
HETATM 1921 O  O     . HOH J 5 .   ? 16.903 43.182 -1.547  1.00 20.01 ? 391 HOH A O     1 
HETATM 1922 O  O     . HOH J 5 .   ? 8.590  50.512 11.162  1.00 28.28 ? 392 HOH A O     1 
HETATM 1923 O  O     . HOH J 5 .   ? 9.175  37.229 9.040   1.00 16.78 ? 393 HOH A O     1 
HETATM 1924 O  O     . HOH J 5 .   ? 9.583  47.546 9.766   1.00 28.84 ? 394 HOH A O     1 
HETATM 1925 O  O     . HOH J 5 .   ? 14.577 46.545 17.839  1.00 33.98 ? 395 HOH A O     1 
HETATM 1926 O  O     . HOH J 5 .   ? 13.162 38.536 24.721  1.00 44.65 ? 396 HOH A O     1 
HETATM 1927 O  O     . HOH J 5 .   ? 9.133  35.922 27.328  1.00 40.24 ? 397 HOH A O     1 
HETATM 1928 O  O     . HOH J 5 .   ? 14.159 51.784 -0.407  1.00 20.63 ? 398 HOH A O     1 
HETATM 1929 O  O     . HOH J 5 .   ? 12.053 52.753 -1.473  1.00 29.18 ? 399 HOH A O     1 
HETATM 1930 O  O     . HOH J 5 .   ? 25.489 48.227 15.343  1.00 34.56 ? 400 HOH A O     1 
HETATM 1931 O  O     . HOH J 5 .   ? 27.948 48.352 16.783  1.00 38.68 ? 401 HOH A O     1 
HETATM 1932 O  O     . HOH J 5 .   ? 24.502 54.138 -7.003  1.00 31.85 ? 402 HOH A O     1 
HETATM 1933 O  O     . HOH J 5 .   ? 29.109 47.094 -4.875  1.00 37.58 ? 403 HOH A O     1 
HETATM 1934 O  O     . HOH J 5 .   ? 14.932 28.137 -2.847  1.00 38.89 ? 404 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -5  ?   ?   ?   A . n 
A 1 2   HIS 2   -4  ?   ?   ?   A . n 
A 1 3   HIS 3   -3  ?   ?   ?   A . n 
A 1 4   HIS 4   -2  ?   ?   ?   A . n 
A 1 5   HIS 5   -1  ?   ?   ?   A . n 
A 1 6   HIS 6   0   ?   ?   ?   A . n 
A 1 7   HIS 7   1   ?   ?   ?   A . n 
A 1 8   SER 8   2   ?   ?   ?   A . n 
A 1 9   SER 9   3   ?   ?   ?   A . n 
A 1 10  GLY 10  4   ?   ?   ?   A . n 
A 1 11  ARG 11  5   5   ARG ARG A . n 
A 1 12  GLU 12  6   6   GLU GLU A . n 
A 1 13  ASN 13  7   7   ASN ASN A . n 
A 1 14  LEU 14  8   8   LEU LEU A . n 
A 1 15  TYR 15  9   9   TYR TYR A . n 
A 1 16  PHE 16  10  10  PHE PHE A . n 
A 1 17  GLN 17  11  11  GLN GLN A . n 
A 1 18  GLY 18  12  12  GLY GLY A . n 
A 1 19  THR 19  13  13  THR THR A . n 
A 1 20  TYR 20  14  14  TYR TYR A . n 
A 1 21  ASN 21  15  15  ASN ASN A . n 
A 1 22  ILE 22  16  16  ILE ILE A . n 
A 1 23  SER 23  17  17  SER SER A . n 
A 1 24  VAL 24  18  18  VAL VAL A . n 
A 1 25  VAL 25  19  19  VAL VAL A . n 
A 1 26  GLY 26  20  20  GLY GLY A . n 
A 1 27  LEU 27  21  21  LEU LEU A . n 
A 1 28  SER 28  22  22  SER SER A . n 
A 1 29  GLY 29  23  23  GLY GLY A . n 
A 1 30  THR 30  24  24  THR THR A . n 
A 1 31  GLU 31  25  25  GLU GLU A . n 
A 1 32  LYS 32  26  26  LYS LYS A . n 
A 1 33  GLU 33  27  27  GLU GLU A . n 
A 1 34  LYS 34  28  28  LYS LYS A . n 
A 1 35  GLY 35  29  29  GLY GLY A . n 
A 1 36  GLN 36  30  30  GLN GLN A . n 
A 1 37  CYS 37  31  31  CYS CYS A . n 
A 1 38  GLY 38  32  32  GLY GLY A . n 
A 1 39  ILE 39  33  33  ILE ILE A . n 
A 1 40  GLY 40  34  34  GLY GLY A . n 
A 1 41  LYS 41  35  35  LYS LYS A . n 
A 1 42  SER 42  36  36  SER SER A . n 
A 1 43  CYS 43  37  37  CYS CYS A . n 
A 1 44  LEU 44  38  38  LEU LEU A . n 
A 1 45  CYS 45  39  39  CYS CYS A . n 
A 1 46  ASN 46  40  40  ASN ASN A . n 
A 1 47  ARG 47  41  41  ARG ARG A . n 
A 1 48  PHE 48  42  42  PHE PHE A . n 
A 1 49  VAL 49  43  43  VAL VAL A . n 
A 1 50  ARG 50  44  44  ARG ARG A . n 
A 1 51  PRO 51  45  45  PRO PRO A . n 
A 1 52  SER 52  46  46  SER SER A . n 
A 1 53  ALA 53  47  47  ALA ALA A . n 
A 1 54  ASP 54  48  48  ASP ASP A . n 
A 1 55  GLU 55  49  49  GLU GLU A . n 
A 1 56  PHE 56  50  50  PHE PHE A . n 
A 1 57  HIS 57  51  51  HIS HIS A . n 
A 1 58  LEU 58  52  52  LEU LEU A . n 
A 1 59  ASP 59  53  53  ASP ASP A . n 
A 1 60  HIS 60  54  54  HIS HIS A . n 
A 1 61  THR 61  55  55  THR THR A . n 
A 1 62  SER 62  56  56  SER SER A . n 
A 1 63  VAL 63  57  57  VAL VAL A . n 
A 1 64  LEU 64  58  58  LEU LEU A . n 
A 1 65  SER 65  59  59  SER SER A . n 
A 1 66  THR 66  60  60  THR THR A . n 
A 1 67  SER 67  61  61  SER SER A . n 
A 1 68  ASP 68  62  62  ASP ASP A . n 
A 1 69  PHE 69  63  63  PHE PHE A . n 
A 1 70  GLY 70  64  64  GLY GLY A . n 
A 1 71  GLY 71  65  65  GLY GLY A . n 
A 1 72  ARG 72  66  66  ARG ARG A . n 
A 1 73  VAL 73  67  67  VAL VAL A . n 
A 1 74  VAL 74  68  68  VAL VAL A . n 
A 1 75  ASN 75  69  69  ASN ASN A . n 
A 1 76  ASN 76  70  70  ASN ASN A . n 
A 1 77  ASP 77  71  71  ASP ASP A . n 
A 1 78  HIS 78  72  72  HIS HIS A . n 
A 1 79  PHE 79  73  73  PHE PHE A . n 
A 1 80  LEU 80  74  74  LEU LEU A . n 
A 1 81  TYR 81  75  75  TYR TYR A . n 
A 1 82  TRP 82  76  76  TRP TRP A . n 
A 1 83  GLY 83  77  77  GLY GLY A . n 
A 1 84  GLU 84  78  78  GLU GLU A . n 
A 1 85  VAL 85  79  79  VAL VAL A . n 
A 1 86  SER 86  80  80  SER SER A . n 
A 1 87  ARG 87  81  ?   ?   ?   A . n 
A 1 88  SER 88  82  ?   ?   ?   A . n 
A 1 89  LEU 89  83  ?   ?   ?   A . n 
A 1 90  GLU 90  84  ?   ?   ?   A . n 
A 1 91  ASP 91  85  ?   ?   ?   A . n 
A 1 92  CYS 92  86  ?   ?   ?   A . n 
A 1 93  VAL 93  87  ?   ?   ?   A . n 
A 1 94  GLU 94  88  ?   ?   ?   A . n 
A 1 95  CYS 95  89  ?   ?   ?   A . n 
A 1 96  LYS 96  90  90  LYS LYS A . n 
A 1 97  MET 97  91  91  MET MET A . n 
A 1 98  HIS 98  92  92  HIS HIS A . n 
A 1 99  ILE 99  93  93  ILE ILE A . n 
A 1 100 VAL 100 94  94  VAL VAL A . n 
A 1 101 GLU 101 95  95  GLU GLU A . n 
A 1 102 GLN 102 96  96  GLN GLN A . n 
A 1 103 THR 103 97  97  THR THR A . n 
A 1 104 GLU 104 98  98  GLU GLU A . n 
A 1 105 PHE 105 99  99  PHE PHE A . n 
A 1 106 ILE 106 100 100 ILE ILE A . n 
A 1 107 ASP 107 101 101 ASP ASP A . n 
A 1 108 ASP 108 102 102 ASP ASP A . n 
A 1 109 GLN 109 103 103 GLN GLN A . n 
A 1 110 THR 110 104 104 THR THR A . n 
A 1 111 PHE 111 105 105 PHE PHE A . n 
A 1 112 GLN 112 106 106 GLN GLN A . n 
A 1 113 PRO 113 107 107 PRO PRO A . n 
A 1 114 HIS 114 108 108 HIS HIS A . n 
A 1 115 ARG 115 109 109 ARG ARG A . n 
A 1 116 SER 116 110 110 SER SER A . n 
A 1 117 THR 117 111 111 THR THR A . n 
A 1 118 ALA 118 112 112 ALA ALA A . n 
A 1 119 LEU 119 113 113 LEU LEU A . n 
A 1 120 GLN 120 114 114 GLN GLN A . n 
A 1 121 PRO 121 115 115 PRO PRO A . n 
A 1 122 TYR 122 116 116 TYR TYR A . n 
A 1 123 ILE 123 117 117 ILE ILE A . n 
A 1 124 LYS 124 118 118 LYS LYS A . n 
A 1 125 ARG 125 119 119 ARG ARG A . n 
A 1 126 ALA 126 120 120 ALA ALA A . n 
A 1 127 ALA 127 121 121 ALA ALA A . n 
A 1 128 ALA 128 122 122 ALA ALA A . n 
A 1 129 THR 129 123 123 THR THR A . n 
A 1 130 LYS 130 124 124 LYS LYS A . n 
A 1 131 LEU 131 125 125 LEU LEU A . n 
A 1 132 ALA 132 126 126 ALA ALA A . n 
A 1 133 SER 133 127 127 SER SER A . n 
A 1 134 ALA 134 128 128 ALA ALA A . n 
A 1 135 GLU 135 129 129 GLU GLU A . n 
A 1 136 LYS 136 130 130 LYS LYS A . n 
A 1 137 LEU 137 131 131 LEU LEU A . n 
A 1 138 MET 138 132 132 MET MET A . n 
A 1 139 TYR 139 133 133 TYR TYR A . n 
A 1 140 PHE 140 134 134 PHE PHE A . n 
A 1 141 CYS 141 135 135 CYS CYS A . n 
A 1 142 THR 142 136 136 THR THR A . n 
A 1 143 ASP 143 137 137 ASP ASP A . n 
A 1 144 GLN 144 138 138 GLN GLN A . n 
A 1 145 LEU 145 139 139 LEU LEU A . n 
A 1 146 GLY 146 140 140 GLY GLY A . n 
A 1 147 LEU 147 141 141 LEU LEU A . n 
A 1 148 GLU 148 142 142 GLU GLU A . n 
A 1 149 GLN 149 143 143 GLN GLN A . n 
A 1 150 ASP 150 144 144 ASP ASP A . n 
A 1 151 PHE 151 145 145 PHE PHE A . n 
A 1 152 GLU 152 146 146 GLU GLU A . n 
A 1 153 GLN 153 147 147 GLN GLN A . n 
A 1 154 LYS 154 148 148 LYS LYS A . n 
A 1 155 GLN 155 149 149 GLN GLN A . n 
A 1 156 MET 156 150 150 MET MET A . n 
A 1 157 PRO 157 151 151 PRO PRO A . n 
A 1 158 ASP 158 152 152 ASP ASP A . n 
A 1 159 GLY 159 153 153 GLY GLY A . n 
A 1 160 LYS 160 154 154 LYS LYS A . n 
A 1 161 LEU 161 155 155 LEU LEU A . n 
A 1 162 LEU 162 156 156 LEU LEU A . n 
A 1 163 VAL 163 157 157 VAL VAL A . n 
A 1 164 ASP 164 158 158 ASP ASP A . n 
A 1 165 GLY 165 159 159 GLY GLY A . n 
A 1 166 PHE 166 160 160 PHE PHE A . n 
A 1 167 LEU 167 161 161 LEU LEU A . n 
A 1 168 LEU 168 162 162 LEU LEU A . n 
A 1 169 GLY 169 163 163 GLY GLY A . n 
A 1 170 ILE 170 164 164 ILE ILE A . n 
A 1 171 ASP 171 165 165 ASP ASP A . n 
A 1 172 VAL 172 166 166 VAL VAL A . n 
A 1 173 SER 173 167 167 SER SER A . n 
A 1 174 ARG 174 168 168 ARG ARG A . n 
A 1 175 GLY 175 169 ?   ?   ?   A . n 
A 1 176 MET 176 170 ?   ?   ?   A . n 
A 1 177 ASN 177 171 ?   ?   ?   A . n 
A 1 178 ARG 178 172 ?   ?   ?   A . n 
A 1 179 ASN 179 173 173 ASN ASN A . n 
A 1 180 PHE 180 174 174 PHE PHE A . n 
A 1 181 ASP 181 175 175 ASP ASP A . n 
A 1 182 ASP 182 176 176 ASP ASP A . n 
A 1 183 GLN 183 177 177 GLN GLN A . n 
A 1 184 LEU 184 178 178 LEU LEU A . n 
A 1 185 LYS 185 179 179 LYS LYS A . n 
A 1 186 PHE 186 180 180 PHE PHE A . n 
A 1 187 VAL 187 181 181 VAL VAL A . n 
A 1 188 SER 188 182 182 SER SER A . n 
A 1 189 ASN 189 183 183 ASN ASN A . n 
A 1 190 LEU 190 184 184 LEU LEU A . n 
A 1 191 TYR 191 185 185 TYR TYR A . n 
A 1 192 ASN 192 186 186 ASN ASN A . n 
A 1 193 GLN 193 187 187 GLN GLN A . n 
A 1 194 LEU 194 188 188 LEU LEU A . n 
A 1 195 ALA 195 189 189 ALA ALA A . n 
A 1 196 LYS 196 190 190 LYS LYS A . n 
A 1 197 THR 197 191 191 THR THR A . n 
A 1 198 LYS 198 192 192 LYS LYS A . n 
A 1 199 LYS 199 193 193 LYS LYS A . n 
A 1 200 PRO 200 194 194 PRO PRO A . n 
A 1 201 ILE 201 195 195 ILE ILE A . n 
A 1 202 VAL 202 196 196 VAL VAL A . n 
A 1 203 VAL 203 197 197 VAL VAL A . n 
A 1 204 VAL 204 198 198 VAL VAL A . n 
A 1 205 LEU 205 199 199 LEU LEU A . n 
A 1 206 THR 206 200 200 THR THR A . n 
A 1 207 LYS 207 201 201 LYS LYS A . n 
A 1 208 CYS 208 202 202 CYS CYS A . n 
A 1 209 ASP 209 203 203 ASP ASP A . n 
A 1 210 GLU 210 204 204 GLU GLU A . n 
A 1 211 GLY 211 205 205 GLY GLY A . n 
A 1 212 VAL 212 206 206 VAL VAL A . n 
A 1 213 GLU 213 207 207 GLU GLU A . n 
A 1 214 ARG 214 208 208 ARG ARG A . n 
A 1 215 TYR 215 209 209 TYR TYR A . n 
A 1 216 ILE 216 210 210 ILE ILE A . n 
A 1 217 ARG 217 211 211 ARG ARG A . n 
A 1 218 ASP 218 212 212 ASP ASP A . n 
A 1 219 ALA 219 213 213 ALA ALA A . n 
A 1 220 HIS 220 214 214 HIS HIS A . n 
A 1 221 THR 221 215 215 THR THR A . n 
A 1 222 PHE 222 216 216 PHE PHE A . n 
A 1 223 ALA 223 217 217 ALA ALA A . n 
A 1 224 LEU 224 218 218 LEU LEU A . n 
A 1 225 SER 225 219 219 SER SER A . n 
A 1 226 LYS 226 220 220 LYS LYS A . n 
A 1 227 LYS 227 221 221 LYS LYS A . n 
A 1 228 ASN 228 222 222 ASN ASN A . n 
A 1 229 LEU 229 223 223 LEU LEU A . n 
A 1 230 GLN 230 224 224 GLN GLN A . n 
A 1 231 VAL 231 225 225 VAL VAL A . n 
A 1 232 VAL 232 226 226 VAL VAL A . n 
A 1 233 GLU 233 227 227 GLU GLU A . n 
A 1 234 THR 234 228 228 THR THR A . n 
A 1 235 SER 235 229 229 SER SER A . n 
A 1 236 ALA 236 230 230 ALA ALA A . n 
A 1 237 ARG 237 231 231 ARG ARG A . n 
A 1 238 SER 238 232 232 SER SER A . n 
A 1 239 ASN 239 233 233 ASN ASN A . n 
A 1 240 VAL 240 234 234 VAL VAL A . n 
A 1 241 ASN 241 235 235 ASN ASN A . n 
A 1 242 VAL 242 236 236 VAL VAL A . n 
A 1 243 ASP 243 237 237 ASP ASP A . n 
A 1 244 LEU 244 238 238 LEU LEU A . n 
A 1 245 ALA 245 239 239 ALA ALA A . n 
A 1 246 PHE 246 240 240 PHE PHE A . n 
A 1 247 SER 247 241 241 SER SER A . n 
A 1 248 THR 248 242 242 THR THR A . n 
A 1 249 LEU 249 243 243 LEU LEU A . n 
A 1 250 VAL 250 244 244 VAL VAL A . n 
A 1 251 GLN 251 245 245 GLN GLN A . n 
A 1 252 LEU 252 246 246 LEU LEU A . n 
A 1 253 ILE 253 247 247 ILE ILE A . n 
A 1 254 ASP 254 248 248 ASP ASP A . n 
A 1 255 LYS 255 249 249 LYS LYS A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1  302 302 MG  MG  A . 
C 2 MG  1  303 303 MG  MG  A . 
D 3 GNP 1  301 301 GNP GNP A . 
E 4 UNX 1  304 304 UNX UNX A . 
F 4 UNX 1  305 305 UNX UNX A . 
G 4 UNX 1  306 306 UNX UNX A . 
H 4 UNX 1  307 307 UNX UNX A . 
I 4 UNX 1  308 308 UNX UNX A . 
J 5 HOH 1  309 1   HOH HOH A . 
J 5 HOH 2  310 2   HOH HOH A . 
J 5 HOH 3  311 3   HOH HOH A . 
J 5 HOH 4  312 4   HOH HOH A . 
J 5 HOH 5  313 5   HOH HOH A . 
J 5 HOH 6  314 6   HOH HOH A . 
J 5 HOH 7  315 7   HOH HOH A . 
J 5 HOH 8  316 8   HOH HOH A . 
J 5 HOH 9  317 9   HOH HOH A . 
J 5 HOH 10 318 10  HOH HOH A . 
J 5 HOH 11 319 11  HOH HOH A . 
J 5 HOH 12 320 12  HOH HOH A . 
J 5 HOH 13 321 13  HOH HOH A . 
J 5 HOH 14 322 14  HOH HOH A . 
J 5 HOH 15 323 15  HOH HOH A . 
J 5 HOH 16 324 16  HOH HOH A . 
J 5 HOH 17 325 17  HOH HOH A . 
J 5 HOH 18 326 18  HOH HOH A . 
J 5 HOH 19 327 19  HOH HOH A . 
J 5 HOH 20 328 20  HOH HOH A . 
J 5 HOH 21 329 21  HOH HOH A . 
J 5 HOH 22 330 22  HOH HOH A . 
J 5 HOH 23 331 23  HOH HOH A . 
J 5 HOH 24 332 24  HOH HOH A . 
J 5 HOH 25 333 25  HOH HOH A . 
J 5 HOH 26 334 26  HOH HOH A . 
J 5 HOH 27 335 27  HOH HOH A . 
J 5 HOH 28 336 28  HOH HOH A . 
J 5 HOH 29 337 29  HOH HOH A . 
J 5 HOH 30 338 30  HOH HOH A . 
J 5 HOH 31 339 31  HOH HOH A . 
J 5 HOH 32 340 32  HOH HOH A . 
J 5 HOH 33 341 33  HOH HOH A . 
J 5 HOH 34 342 34  HOH HOH A . 
J 5 HOH 35 343 35  HOH HOH A . 
J 5 HOH 36 344 36  HOH HOH A . 
J 5 HOH 37 345 37  HOH HOH A . 
J 5 HOH 38 346 38  HOH HOH A . 
J 5 HOH 39 347 39  HOH HOH A . 
J 5 HOH 40 348 40  HOH HOH A . 
J 5 HOH 41 349 41  HOH HOH A . 
J 5 HOH 42 350 42  HOH HOH A . 
J 5 HOH 43 351 43  HOH HOH A . 
J 5 HOH 44 352 44  HOH HOH A . 
J 5 HOH 45 353 45  HOH HOH A . 
J 5 HOH 46 354 46  HOH HOH A . 
J 5 HOH 47 355 47  HOH HOH A . 
J 5 HOH 48 356 48  HOH HOH A . 
J 5 HOH 49 357 49  HOH HOH A . 
J 5 HOH 50 358 50  HOH HOH A . 
J 5 HOH 51 359 51  HOH HOH A . 
J 5 HOH 52 360 52  HOH HOH A . 
J 5 HOH 53 361 53  HOH HOH A . 
J 5 HOH 54 362 54  HOH HOH A . 
J 5 HOH 55 363 55  HOH HOH A . 
J 5 HOH 56 364 56  HOH HOH A . 
J 5 HOH 57 365 57  HOH HOH A . 
J 5 HOH 58 366 58  HOH HOH A . 
J 5 HOH 59 367 59  HOH HOH A . 
J 5 HOH 60 368 60  HOH HOH A . 
J 5 HOH 61 369 61  HOH HOH A . 
J 5 HOH 62 370 62  HOH HOH A . 
J 5 HOH 63 371 63  HOH HOH A . 
J 5 HOH 64 372 64  HOH HOH A . 
J 5 HOH 65 373 65  HOH HOH A . 
J 5 HOH 66 374 66  HOH HOH A . 
J 5 HOH 67 375 67  HOH HOH A . 
J 5 HOH 68 376 68  HOH HOH A . 
J 5 HOH 69 377 69  HOH HOH A . 
J 5 HOH 70 378 70  HOH HOH A . 
J 5 HOH 71 379 71  HOH HOH A . 
J 5 HOH 72 380 72  HOH HOH A . 
J 5 HOH 73 381 73  HOH HOH A . 
J 5 HOH 74 382 74  HOH HOH A . 
J 5 HOH 75 383 75  HOH HOH A . 
J 5 HOH 76 384 76  HOH HOH A . 
J 5 HOH 77 385 77  HOH HOH A . 
J 5 HOH 78 386 78  HOH HOH A . 
J 5 HOH 79 387 79  HOH HOH A . 
J 5 HOH 80 388 80  HOH HOH A . 
J 5 HOH 81 389 81  HOH HOH A . 
J 5 HOH 82 390 82  HOH HOH A . 
J 5 HOH 83 391 83  HOH HOH A . 
J 5 HOH 84 392 84  HOH HOH A . 
J 5 HOH 85 393 85  HOH HOH A . 
J 5 HOH 86 394 86  HOH HOH A . 
J 5 HOH 87 395 87  HOH HOH A . 
J 5 HOH 88 396 88  HOH HOH A . 
J 5 HOH 89 397 89  HOH HOH A . 
J 5 HOH 90 398 90  HOH HOH A . 
J 5 HOH 91 399 91  HOH HOH A . 
J 5 HOH 92 400 92  HOH HOH A . 
J 5 HOH 93 401 93  HOH HOH A . 
J 5 HOH 94 402 94  HOH HOH A . 
J 5 HOH 95 403 95  HOH HOH A . 
J 5 HOH 96 404 96  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OG  ? A SER 42  ? A SER 36  ? 1_555 MG ? B MG . ? A MG 302 ? 1_555 OE2 ? A GLU 101 ? A GLU 95  ? 1_555 83.6  ? 
2  OG  ? A SER 42  ? A SER 36  ? 1_555 MG ? B MG . ? A MG 302 ? 1_555 O2G ? D GNP .   ? A GNP 301 ? 1_555 175.4 ? 
3  OE2 ? A GLU 101 ? A GLU 95  ? 1_555 MG ? B MG . ? A MG 302 ? 1_555 O2G ? D GNP .   ? A GNP 301 ? 1_555 91.8  ? 
4  OG  ? A SER 42  ? A SER 36  ? 1_555 MG ? B MG . ? A MG 302 ? 1_555 O   ? J HOH .   ? A HOH 390 ? 1_555 93.7  ? 
5  OE2 ? A GLU 101 ? A GLU 95  ? 1_555 MG ? B MG . ? A MG 302 ? 1_555 O   ? J HOH .   ? A HOH 390 ? 1_555 94.3  ? 
6  O2G ? D GNP .   ? A GNP 301 ? 1_555 MG ? B MG . ? A MG 302 ? 1_555 O   ? J HOH .   ? A HOH 390 ? 1_555 86.6  ? 
7  OG  ? A SER 42  ? A SER 36  ? 1_555 MG ? B MG . ? A MG 302 ? 1_555 O2B ? D GNP .   ? A GNP 301 ? 1_555 95.8  ? 
8  OE2 ? A GLU 101 ? A GLU 95  ? 1_555 MG ? B MG . ? A MG 302 ? 1_555 O2B ? D GNP .   ? A GNP 301 ? 1_555 95.4  ? 
9  O2G ? D GNP .   ? A GNP 301 ? 1_555 MG ? B MG . ? A MG 302 ? 1_555 O2B ? D GNP .   ? A GNP 301 ? 1_555 84.7  ? 
10 O   ? J HOH .   ? A HOH 390 ? 1_555 MG ? B MG . ? A MG 302 ? 1_555 O2B ? D GNP .   ? A GNP 301 ? 1_555 167.2 ? 
11 OG  ? A SER 42  ? A SER 36  ? 1_555 MG ? B MG . ? A MG 302 ? 1_555 O   ? J HOH .   ? A HOH 389 ? 1_555 92.1  ? 
12 OE2 ? A GLU 101 ? A GLU 95  ? 1_555 MG ? B MG . ? A MG 302 ? 1_555 O   ? J HOH .   ? A HOH 389 ? 1_555 174.9 ? 
13 O2G ? D GNP .   ? A GNP 301 ? 1_555 MG ? B MG . ? A MG 302 ? 1_555 O   ? J HOH .   ? A HOH 389 ? 1_555 92.5  ? 
14 O   ? J HOH .   ? A HOH 390 ? 1_555 MG ? B MG . ? A MG 302 ? 1_555 O   ? J HOH .   ? A HOH 389 ? 1_555 88.6  ? 
15 O2B ? D GNP .   ? A GNP 301 ? 1_555 MG ? B MG . ? A MG 302 ? 1_555 O   ? J HOH .   ? A HOH 389 ? 1_555 82.4  ? 
16 O   ? J HOH .   ? A HOH 328 ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? J HOH .   ? A HOH 337 ? 1_555 86.7  ? 
17 O   ? J HOH .   ? A HOH 328 ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? J HOH .   ? A HOH 318 ? 1_555 97.3  ? 
18 O   ? J HOH .   ? A HOH 337 ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? J HOH .   ? A HOH 318 ? 1_555 87.6  ? 
19 O   ? J HOH .   ? A HOH 328 ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? J HOH .   ? A HOH 314 ? 1_555 82.6  ? 
20 O   ? J HOH .   ? A HOH 337 ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? J HOH .   ? A HOH 314 ? 1_555 89.2  ? 
21 O   ? J HOH .   ? A HOH 318 ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? J HOH .   ? A HOH 314 ? 1_555 176.8 ? 
22 O   ? J HOH .   ? A HOH 328 ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? J HOH .   ? A HOH 312 ? 1_555 92.7  ? 
23 O   ? J HOH .   ? A HOH 337 ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? J HOH .   ? A HOH 312 ? 1_555 179.3 ? 
24 O   ? J HOH .   ? A HOH 318 ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? J HOH .   ? A HOH 312 ? 1_555 92.6  ? 
25 O   ? J HOH .   ? A HOH 314 ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? J HOH .   ? A HOH 312 ? 1_555 90.6  ? 
26 O   ? J HOH .   ? A HOH 328 ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? J HOH .   ? A HOH 323 ? 1_555 170.3 ? 
27 O   ? J HOH .   ? A HOH 337 ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? J HOH .   ? A HOH 323 ? 1_555 88.5  ? 
28 O   ? J HOH .   ? A HOH 318 ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? J HOH .   ? A HOH 323 ? 1_555 91.0  ? 
29 O   ? J HOH .   ? A HOH 314 ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? J HOH .   ? A HOH 323 ? 1_555 88.9  ? 
30 O   ? J HOH .   ? A HOH 312 ? 1_555 MG ? C MG . ? A MG 303 ? 1_555 O   ? J HOH .   ? A HOH 323 ? 1_555 92.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-02-12 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-10-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_phasing_MAD_set_site.id 
_pdbx_phasing_MAD_set_site.atom_type_symbol 
_pdbx_phasing_MAD_set_site.occupancy 
_pdbx_phasing_MAD_set_site.fract_x 
_pdbx_phasing_MAD_set_site.fract_y 
_pdbx_phasing_MAD_set_site.fract_z 
_pdbx_phasing_MAD_set_site.b_iso 
1 Se 0.872 0.052 0.277 0.000 60.000 
2 Se 0.707 0.727 0.448 0.331 60.000 
3 Se 0.584 0.333 0.277 0.405 60.000 
# 
loop_
_pdbx_phasing_MAD_shell.d_res_low 
_pdbx_phasing_MAD_shell.d_res_high 
_pdbx_phasing_MAD_shell.reflns 
_pdbx_phasing_MAD_shell.fom 
30.00 10.49 329  0.750 
10.49 6.73  567  0.810 
6.73  5.29  711  0.800 
5.29  4.50  825  0.800 
4.50  3.98  935  0.760 
3.98  3.61  1020 0.720 
3.61  3.32  1116 0.630 
3.32  3.10  1176 0.560 
# 
_pdbx_phasing_dm.entry_id          3C5H 
_pdbx_phasing_dm.fom_acentric      0.610 
_pdbx_phasing_dm.fom_centric       0.620 
_pdbx_phasing_dm.fom               0.610 
_pdbx_phasing_dm.reflns_acentric   9456 
_pdbx_phasing_dm.reflns_centric    722 
_pdbx_phasing_dm.reflns            10178 
# 
loop_
_pdbx_phasing_dm_shell.d_res_high 
_pdbx_phasing_dm_shell.d_res_low 
_pdbx_phasing_dm_shell.delta_phi_final 
_pdbx_phasing_dm_shell.delta_phi_initial 
_pdbx_phasing_dm_shell.fom_acentric 
_pdbx_phasing_dm_shell.fom_centric 
_pdbx_phasing_dm_shell.fom 
_pdbx_phasing_dm_shell.reflns_acentric 
_pdbx_phasing_dm_shell.reflns_centric 
_pdbx_phasing_dm_shell.reflns 
7.400 28.739 ? ? 0.950 0.960 0.950 368  81  449  
4.600 7.400  ? ? 0.940 0.860 0.930 1239 150 1389 
3.700 4.600  ? ? 0.920 0.880 0.920 1581 128 1709 
3.300 3.700  ? ? 0.830 0.620 0.820 1613 116 1729 
2.800 3.300  ? ? 0.450 0.280 0.440 2854 172 3026 
2.600 2.800  ? ? 0.120 0.080 0.120 1801 75  1876 
# 
_phasing.method   mad 
# 
_phasing_MAD.entry_id          3C5H 
_phasing_MAD.pdbx_d_res_high   3.00 
_phasing_MAD.pdbx_d_res_low    30.00 
_phasing_MAD.pdbx_reflns       6679 
_phasing_MAD.pdbx_fom          0.710 
# 
_phasing_MAD_clust.id           1 
_phasing_MAD_clust.expt_id      '4 wavelength' 
_phasing_MAD_clust.number_set   ? 
# 
_phasing_MAD_expt.id         '4 wavelength' 
_phasing_MAD_expt.mean_fom   ? 
# 
loop_
_phasing_MAD_set.clust_id 
_phasing_MAD_set.expt_id 
_phasing_MAD_set.set_id 
_phasing_MAD_set.wavelength 
_phasing_MAD_set.pdbx_f_prime_refined 
_phasing_MAD_set.pdbx_f_double_prime_refined 
1 '4 wavelength' 1 0.9793 -8.17  5.56 
1 '4 wavelength' 2 0.9794 -10.47 3.58 
1 '4 wavelength' 3 0.9817 -6.61  0.73 
1 '4 wavelength' 4 0.9724 -3.56  3.09 
# 
loop_
_phasing_set.id 
_phasing_set.pdbx_d_res_high 
_phasing_set.pdbx_d_res_low 
1 . . 
2 . . 
3 . . 
4 . . 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .               ?                    package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK   .               ?                    package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
SOLVE       2.13            26-Jan-2007          package 'Tom Terwilliger'    terwilliger@LANL.gov     phasing           
http://www.solve.lanl.gov/                       ?          ? 3 
RESOLVE     2.13            01-Feb-2007          package 'Terwilliger, T. C'  terwilliger@LANL.gov     phasing           
http://www.solve.lanl.gov/                       ?          ? 4 
REFMAC      refmac_5.3.0037 24/04/2001           program 'Murshudov, G.N.'    ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html                  Fortran_77 ? 5 
PDB_EXTRACT 3.005           'September 10, 2007' package PDB                  sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 6 
ADSC        Quantum         ?                    ?       ?                    ?                        'data collection' ? ? ? 7 
MAR345      CCD             ?                    ?       ?                    ?                        'data collection' ? ? ? 8 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 THR A 97  ? ? -139.63 -153.89 
2 1 LEU A 141 ? ? -149.18 39.85   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 5   ? CG  ? A ARG 11  CG  
2  1 Y 1 A ARG 5   ? CD  ? A ARG 11  CD  
3  1 Y 1 A ARG 5   ? NE  ? A ARG 11  NE  
4  1 Y 1 A ARG 5   ? CZ  ? A ARG 11  CZ  
5  1 Y 1 A ARG 5   ? NH1 ? A ARG 11  NH1 
6  1 Y 1 A ARG 5   ? NH2 ? A ARG 11  NH2 
7  1 Y 1 A GLU 6   ? CD  ? A GLU 12  CD  
8  1 Y 1 A GLU 6   ? OE1 ? A GLU 12  OE1 
9  1 Y 1 A GLU 6   ? OE2 ? A GLU 12  OE2 
10 1 Y 1 A GLU 25  ? CD  ? A GLU 31  CD  
11 1 Y 1 A GLU 25  ? OE1 ? A GLU 31  OE1 
12 1 Y 1 A GLU 25  ? OE2 ? A GLU 31  OE2 
13 1 Y 1 A LYS 26  ? CG  ? A LYS 32  CG  
14 1 Y 1 A LYS 26  ? CD  ? A LYS 32  CD  
15 1 Y 1 A LYS 26  ? CE  ? A LYS 32  CE  
16 1 Y 1 A LYS 26  ? NZ  ? A LYS 32  NZ  
17 1 Y 1 A GLN 30  ? CG  ? A GLN 36  CG  
18 1 Y 1 A GLN 30  ? CD  ? A GLN 36  CD  
19 1 Y 1 A GLN 30  ? OE1 ? A GLN 36  OE1 
20 1 Y 1 A GLN 30  ? NE2 ? A GLN 36  NE2 
21 1 Y 1 A ASP 48  ? CG  ? A ASP 54  CG  
22 1 Y 1 A ASP 48  ? OD1 ? A ASP 54  OD1 
23 1 Y 1 A ASP 48  ? OD2 ? A ASP 54  OD2 
24 1 Y 1 A LYS 90  ? CG  ? A LYS 96  CG  
25 1 Y 1 A LYS 90  ? CD  ? A LYS 96  CD  
26 1 Y 1 A LYS 90  ? CE  ? A LYS 96  CE  
27 1 Y 1 A LYS 90  ? NZ  ? A LYS 96  NZ  
28 1 Y 1 A ARG 109 ? CD  ? A ARG 115 CD  
29 1 Y 1 A ARG 109 ? NE  ? A ARG 115 NE  
30 1 Y 1 A ARG 109 ? CZ  ? A ARG 115 CZ  
31 1 Y 1 A ARG 109 ? NH1 ? A ARG 115 NH1 
32 1 Y 1 A ARG 109 ? NH2 ? A ARG 115 NH2 
33 1 Y 1 A LYS 124 ? CD  ? A LYS 130 CD  
34 1 Y 1 A LYS 124 ? CE  ? A LYS 130 CE  
35 1 Y 1 A LYS 124 ? NZ  ? A LYS 130 NZ  
36 1 Y 1 A GLN 143 ? CG  ? A GLN 149 CG  
37 1 Y 1 A GLN 143 ? CD  ? A GLN 149 CD  
38 1 Y 1 A GLN 143 ? OE1 ? A GLN 149 OE1 
39 1 Y 1 A GLN 143 ? NE2 ? A GLN 149 NE2 
40 1 Y 1 A ASP 144 ? CG  ? A ASP 150 CG  
41 1 Y 1 A ASP 144 ? OD1 ? A ASP 150 OD1 
42 1 Y 1 A ASP 144 ? OD2 ? A ASP 150 OD2 
43 1 Y 1 A LYS 154 ? CE  ? A LYS 160 CE  
44 1 Y 1 A LYS 154 ? NZ  ? A LYS 160 NZ  
45 1 Y 1 A LYS 179 ? CG  ? A LYS 185 CG  
46 1 Y 1 A LYS 179 ? CD  ? A LYS 185 CD  
47 1 Y 1 A LYS 179 ? CE  ? A LYS 185 CE  
48 1 Y 1 A LYS 179 ? NZ  ? A LYS 185 NZ  
49 1 Y 1 A GLU 207 ? CD  ? A GLU 213 CD  
50 1 Y 1 A GLU 207 ? OE1 ? A GLU 213 OE1 
51 1 Y 1 A GLU 207 ? OE2 ? A GLU 213 OE2 
52 1 Y 1 A ARG 208 ? CD  ? A ARG 214 CD  
53 1 Y 1 A ARG 208 ? NE  ? A ARG 214 NE  
54 1 Y 1 A ARG 208 ? CZ  ? A ARG 214 CZ  
55 1 Y 1 A ARG 208 ? NH1 ? A ARG 214 NH1 
56 1 Y 1 A ARG 208 ? NH2 ? A ARG 214 NH2 
57 1 Y 1 A ARG 211 ? CD  ? A ARG 217 CD  
58 1 Y 1 A ARG 211 ? NE  ? A ARG 217 NE  
59 1 Y 1 A ARG 211 ? CZ  ? A ARG 217 CZ  
60 1 Y 1 A ARG 211 ? NH1 ? A ARG 217 NH1 
61 1 Y 1 A ARG 211 ? NH2 ? A ARG 217 NH2 
62 1 Y 1 A LYS 221 ? CG  ? A LYS 227 CG  
63 1 Y 1 A LYS 221 ? CD  ? A LYS 227 CD  
64 1 Y 1 A LYS 221 ? CE  ? A LYS 227 CE  
65 1 Y 1 A LYS 221 ? NZ  ? A LYS 227 NZ  
66 1 Y 1 A ASN 222 ? CG  ? A ASN 228 CG  
67 1 Y 1 A ASN 222 ? OD1 ? A ASN 228 OD1 
68 1 Y 1 A ASN 222 ? ND2 ? A ASN 228 ND2 
69 1 Y 1 A ARG 231 ? CZ  ? A ARG 237 CZ  
70 1 Y 1 A ARG 231 ? NH1 ? A ARG 237 NH1 
71 1 Y 1 A ARG 231 ? NH2 ? A ARG 237 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -5  ? A MET 1   
2  1 Y 1 A HIS -4  ? A HIS 2   
3  1 Y 1 A HIS -3  ? A HIS 3   
4  1 Y 1 A HIS -2  ? A HIS 4   
5  1 Y 1 A HIS -1  ? A HIS 5   
6  1 Y 1 A HIS 0   ? A HIS 6   
7  1 Y 1 A HIS 1   ? A HIS 7   
8  1 Y 1 A SER 2   ? A SER 8   
9  1 Y 1 A SER 3   ? A SER 9   
10 1 Y 1 A GLY 4   ? A GLY 10  
11 1 Y 1 A ARG 81  ? A ARG 87  
12 1 Y 1 A SER 82  ? A SER 88  
13 1 Y 1 A LEU 83  ? A LEU 89  
14 1 Y 1 A GLU 84  ? A GLU 90  
15 1 Y 1 A ASP 85  ? A ASP 91  
16 1 Y 1 A CYS 86  ? A CYS 92  
17 1 Y 1 A VAL 87  ? A VAL 93  
18 1 Y 1 A GLU 88  ? A GLU 94  
19 1 Y 1 A CYS 89  ? A CYS 95  
20 1 Y 1 A GLY 169 ? A GLY 175 
21 1 Y 1 A MET 170 ? A MET 176 
22 1 Y 1 A ASN 171 ? A ASN 177 
23 1 Y 1 A ARG 172 ? A ARG 178 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'                               MG  
3 'PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER' GNP 
4 'UNKNOWN ATOM OR ION'                         UNX 
5 water                                         HOH 
#