data_3CB4
# 
_entry.id   3CB4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3CB4         
RCSB  RCSB046562   
WWPDB D_1000046562 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3CB4 
_pdbx_database_status.recvd_initial_deposition_date   2008-02-21 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Evans, R.N.'  1 
'Blaha, G.'    2 
'Bailey, S.'   3 
'Steitz, T.A.' 4 
# 
_citation.id                        primary 
_citation.title                     'The structure of LepA, the ribosomal back translocase.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            105 
_citation.page_first                4673 
_citation.page_last                 4678 
_citation.year                      2008 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18362332 
_citation.pdbx_database_id_DOI      10.1073/pnas.0801308105 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Evans, R.N.'  1 
primary 'Blaha, G.'    2 
primary 'Bailey, S.'   3 
primary 'Steitz, T.A.' 4 
# 
_cell.entry_id           3CB4 
_cell.length_a           97.960 
_cell.length_b           146.243 
_cell.length_c           139.317 
_cell.angle_alpha        90.00 
_cell.angle_beta         100.60 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3CB4 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'GTP-binding protein lepA' 66652.094 6 ? ? ? ? 
2 water   nat water                      18.015    3 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKNIRNFSIIAHIDHGKSTLSDRIIQICGGLSDREMEAQVLDSMDLERERGITIKAQSVTLDYKASDGETYQLNFIDTPG
HVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAMEMDLEVVPVLNKIDLPAADPERVAEEIEDIVGIDATDAVR
CSAKTGVGVQDVLERLVRDIPPPEGDPEGPLQALIIDSWFDNYLGVVSLIRIKNGTLRKGDKVKVMSTGQTYNADRLGIF
TPKQVDRTELKCGEVGWLVCAIKDIHGAPVGDTLTLARNPAEKALPGFKKVKPQVYAGLFPVSSDDYEAFRDALGKLSLN
DASLFYEPESSSALGFGFRCGFLGLLHMEIIQERLEREYDLDLITTAPTVVYEVETTSREVIYVDSPSKLPAVNNIYELR
EPIAECHMLLPQAYLGNVITLCVEKRGVQTNMVYHGNQVALTYEIPMAEVVLDFFDRLKSTSRGYASLDYNFKRFQASDM
VRVDVLINGERVDALALITHRDNSQNRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISR
KKKLLQKQKEGKKRMKQIGNVELPQEAFLAILHVGKDNK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKNIRNFSIIAHIDHGKSTLSDRIIQICGGLSDREMEAQVLDSMDLERERGITIKAQSVTLDYKASDGETYQLNFIDTPG
HVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAMEMDLEVVPVLNKIDLPAADPERVAEEIEDIVGIDATDAVR
CSAKTGVGVQDVLERLVRDIPPPEGDPEGPLQALIIDSWFDNYLGVVSLIRIKNGTLRKGDKVKVMSTGQTYNADRLGIF
TPKQVDRTELKCGEVGWLVCAIKDIHGAPVGDTLTLARNPAEKALPGFKKVKPQVYAGLFPVSSDDYEAFRDALGKLSLN
DASLFYEPESSSALGFGFRCGFLGLLHMEIIQERLEREYDLDLITTAPTVVYEVETTSREVIYVDSPSKLPAVNNIYELR
EPIAECHMLLPQAYLGNVITLCVEKRGVQTNMVYHGNQVALTYEIPMAEVVLDFFDRLKSTSRGYASLDYNFKRFQASDM
VRVDVLINGERVDALALITHRDNSQNRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISR
KKKLLQKQKEGKKRMKQIGNVELPQEAFLAILHVGKDNK
;
_entity_poly.pdbx_strand_id                 D,A,B,C,E,F 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   ASN n 
1 4   ILE n 
1 5   ARG n 
1 6   ASN n 
1 7   PHE n 
1 8   SER n 
1 9   ILE n 
1 10  ILE n 
1 11  ALA n 
1 12  HIS n 
1 13  ILE n 
1 14  ASP n 
1 15  HIS n 
1 16  GLY n 
1 17  LYS n 
1 18  SER n 
1 19  THR n 
1 20  LEU n 
1 21  SER n 
1 22  ASP n 
1 23  ARG n 
1 24  ILE n 
1 25  ILE n 
1 26  GLN n 
1 27  ILE n 
1 28  CYS n 
1 29  GLY n 
1 30  GLY n 
1 31  LEU n 
1 32  SER n 
1 33  ASP n 
1 34  ARG n 
1 35  GLU n 
1 36  MET n 
1 37  GLU n 
1 38  ALA n 
1 39  GLN n 
1 40  VAL n 
1 41  LEU n 
1 42  ASP n 
1 43  SER n 
1 44  MET n 
1 45  ASP n 
1 46  LEU n 
1 47  GLU n 
1 48  ARG n 
1 49  GLU n 
1 50  ARG n 
1 51  GLY n 
1 52  ILE n 
1 53  THR n 
1 54  ILE n 
1 55  LYS n 
1 56  ALA n 
1 57  GLN n 
1 58  SER n 
1 59  VAL n 
1 60  THR n 
1 61  LEU n 
1 62  ASP n 
1 63  TYR n 
1 64  LYS n 
1 65  ALA n 
1 66  SER n 
1 67  ASP n 
1 68  GLY n 
1 69  GLU n 
1 70  THR n 
1 71  TYR n 
1 72  GLN n 
1 73  LEU n 
1 74  ASN n 
1 75  PHE n 
1 76  ILE n 
1 77  ASP n 
1 78  THR n 
1 79  PRO n 
1 80  GLY n 
1 81  HIS n 
1 82  VAL n 
1 83  ASP n 
1 84  PHE n 
1 85  SER n 
1 86  TYR n 
1 87  GLU n 
1 88  VAL n 
1 89  SER n 
1 90  ARG n 
1 91  SER n 
1 92  LEU n 
1 93  ALA n 
1 94  ALA n 
1 95  CYS n 
1 96  GLU n 
1 97  GLY n 
1 98  ALA n 
1 99  LEU n 
1 100 LEU n 
1 101 VAL n 
1 102 VAL n 
1 103 ASP n 
1 104 ALA n 
1 105 GLY n 
1 106 GLN n 
1 107 GLY n 
1 108 VAL n 
1 109 GLU n 
1 110 ALA n 
1 111 GLN n 
1 112 THR n 
1 113 LEU n 
1 114 ALA n 
1 115 ASN n 
1 116 CYS n 
1 117 TYR n 
1 118 THR n 
1 119 ALA n 
1 120 MET n 
1 121 GLU n 
1 122 MET n 
1 123 ASP n 
1 124 LEU n 
1 125 GLU n 
1 126 VAL n 
1 127 VAL n 
1 128 PRO n 
1 129 VAL n 
1 130 LEU n 
1 131 ASN n 
1 132 LYS n 
1 133 ILE n 
1 134 ASP n 
1 135 LEU n 
1 136 PRO n 
1 137 ALA n 
1 138 ALA n 
1 139 ASP n 
1 140 PRO n 
1 141 GLU n 
1 142 ARG n 
1 143 VAL n 
1 144 ALA n 
1 145 GLU n 
1 146 GLU n 
1 147 ILE n 
1 148 GLU n 
1 149 ASP n 
1 150 ILE n 
1 151 VAL n 
1 152 GLY n 
1 153 ILE n 
1 154 ASP n 
1 155 ALA n 
1 156 THR n 
1 157 ASP n 
1 158 ALA n 
1 159 VAL n 
1 160 ARG n 
1 161 CYS n 
1 162 SER n 
1 163 ALA n 
1 164 LYS n 
1 165 THR n 
1 166 GLY n 
1 167 VAL n 
1 168 GLY n 
1 169 VAL n 
1 170 GLN n 
1 171 ASP n 
1 172 VAL n 
1 173 LEU n 
1 174 GLU n 
1 175 ARG n 
1 176 LEU n 
1 177 VAL n 
1 178 ARG n 
1 179 ASP n 
1 180 ILE n 
1 181 PRO n 
1 182 PRO n 
1 183 PRO n 
1 184 GLU n 
1 185 GLY n 
1 186 ASP n 
1 187 PRO n 
1 188 GLU n 
1 189 GLY n 
1 190 PRO n 
1 191 LEU n 
1 192 GLN n 
1 193 ALA n 
1 194 LEU n 
1 195 ILE n 
1 196 ILE n 
1 197 ASP n 
1 198 SER n 
1 199 TRP n 
1 200 PHE n 
1 201 ASP n 
1 202 ASN n 
1 203 TYR n 
1 204 LEU n 
1 205 GLY n 
1 206 VAL n 
1 207 VAL n 
1 208 SER n 
1 209 LEU n 
1 210 ILE n 
1 211 ARG n 
1 212 ILE n 
1 213 LYS n 
1 214 ASN n 
1 215 GLY n 
1 216 THR n 
1 217 LEU n 
1 218 ARG n 
1 219 LYS n 
1 220 GLY n 
1 221 ASP n 
1 222 LYS n 
1 223 VAL n 
1 224 LYS n 
1 225 VAL n 
1 226 MET n 
1 227 SER n 
1 228 THR n 
1 229 GLY n 
1 230 GLN n 
1 231 THR n 
1 232 TYR n 
1 233 ASN n 
1 234 ALA n 
1 235 ASP n 
1 236 ARG n 
1 237 LEU n 
1 238 GLY n 
1 239 ILE n 
1 240 PHE n 
1 241 THR n 
1 242 PRO n 
1 243 LYS n 
1 244 GLN n 
1 245 VAL n 
1 246 ASP n 
1 247 ARG n 
1 248 THR n 
1 249 GLU n 
1 250 LEU n 
1 251 LYS n 
1 252 CYS n 
1 253 GLY n 
1 254 GLU n 
1 255 VAL n 
1 256 GLY n 
1 257 TRP n 
1 258 LEU n 
1 259 VAL n 
1 260 CYS n 
1 261 ALA n 
1 262 ILE n 
1 263 LYS n 
1 264 ASP n 
1 265 ILE n 
1 266 HIS n 
1 267 GLY n 
1 268 ALA n 
1 269 PRO n 
1 270 VAL n 
1 271 GLY n 
1 272 ASP n 
1 273 THR n 
1 274 LEU n 
1 275 THR n 
1 276 LEU n 
1 277 ALA n 
1 278 ARG n 
1 279 ASN n 
1 280 PRO n 
1 281 ALA n 
1 282 GLU n 
1 283 LYS n 
1 284 ALA n 
1 285 LEU n 
1 286 PRO n 
1 287 GLY n 
1 288 PHE n 
1 289 LYS n 
1 290 LYS n 
1 291 VAL n 
1 292 LYS n 
1 293 PRO n 
1 294 GLN n 
1 295 VAL n 
1 296 TYR n 
1 297 ALA n 
1 298 GLY n 
1 299 LEU n 
1 300 PHE n 
1 301 PRO n 
1 302 VAL n 
1 303 SER n 
1 304 SER n 
1 305 ASP n 
1 306 ASP n 
1 307 TYR n 
1 308 GLU n 
1 309 ALA n 
1 310 PHE n 
1 311 ARG n 
1 312 ASP n 
1 313 ALA n 
1 314 LEU n 
1 315 GLY n 
1 316 LYS n 
1 317 LEU n 
1 318 SER n 
1 319 LEU n 
1 320 ASN n 
1 321 ASP n 
1 322 ALA n 
1 323 SER n 
1 324 LEU n 
1 325 PHE n 
1 326 TYR n 
1 327 GLU n 
1 328 PRO n 
1 329 GLU n 
1 330 SER n 
1 331 SER n 
1 332 SER n 
1 333 ALA n 
1 334 LEU n 
1 335 GLY n 
1 336 PHE n 
1 337 GLY n 
1 338 PHE n 
1 339 ARG n 
1 340 CYS n 
1 341 GLY n 
1 342 PHE n 
1 343 LEU n 
1 344 GLY n 
1 345 LEU n 
1 346 LEU n 
1 347 HIS n 
1 348 MET n 
1 349 GLU n 
1 350 ILE n 
1 351 ILE n 
1 352 GLN n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 GLU n 
1 357 ARG n 
1 358 GLU n 
1 359 TYR n 
1 360 ASP n 
1 361 LEU n 
1 362 ASP n 
1 363 LEU n 
1 364 ILE n 
1 365 THR n 
1 366 THR n 
1 367 ALA n 
1 368 PRO n 
1 369 THR n 
1 370 VAL n 
1 371 VAL n 
1 372 TYR n 
1 373 GLU n 
1 374 VAL n 
1 375 GLU n 
1 376 THR n 
1 377 THR n 
1 378 SER n 
1 379 ARG n 
1 380 GLU n 
1 381 VAL n 
1 382 ILE n 
1 383 TYR n 
1 384 VAL n 
1 385 ASP n 
1 386 SER n 
1 387 PRO n 
1 388 SER n 
1 389 LYS n 
1 390 LEU n 
1 391 PRO n 
1 392 ALA n 
1 393 VAL n 
1 394 ASN n 
1 395 ASN n 
1 396 ILE n 
1 397 TYR n 
1 398 GLU n 
1 399 LEU n 
1 400 ARG n 
1 401 GLU n 
1 402 PRO n 
1 403 ILE n 
1 404 ALA n 
1 405 GLU n 
1 406 CYS n 
1 407 HIS n 
1 408 MET n 
1 409 LEU n 
1 410 LEU n 
1 411 PRO n 
1 412 GLN n 
1 413 ALA n 
1 414 TYR n 
1 415 LEU n 
1 416 GLY n 
1 417 ASN n 
1 418 VAL n 
1 419 ILE n 
1 420 THR n 
1 421 LEU n 
1 422 CYS n 
1 423 VAL n 
1 424 GLU n 
1 425 LYS n 
1 426 ARG n 
1 427 GLY n 
1 428 VAL n 
1 429 GLN n 
1 430 THR n 
1 431 ASN n 
1 432 MET n 
1 433 VAL n 
1 434 TYR n 
1 435 HIS n 
1 436 GLY n 
1 437 ASN n 
1 438 GLN n 
1 439 VAL n 
1 440 ALA n 
1 441 LEU n 
1 442 THR n 
1 443 TYR n 
1 444 GLU n 
1 445 ILE n 
1 446 PRO n 
1 447 MET n 
1 448 ALA n 
1 449 GLU n 
1 450 VAL n 
1 451 VAL n 
1 452 LEU n 
1 453 ASP n 
1 454 PHE n 
1 455 PHE n 
1 456 ASP n 
1 457 ARG n 
1 458 LEU n 
1 459 LYS n 
1 460 SER n 
1 461 THR n 
1 462 SER n 
1 463 ARG n 
1 464 GLY n 
1 465 TYR n 
1 466 ALA n 
1 467 SER n 
1 468 LEU n 
1 469 ASP n 
1 470 TYR n 
1 471 ASN n 
1 472 PHE n 
1 473 LYS n 
1 474 ARG n 
1 475 PHE n 
1 476 GLN n 
1 477 ALA n 
1 478 SER n 
1 479 ASP n 
1 480 MET n 
1 481 VAL n 
1 482 ARG n 
1 483 VAL n 
1 484 ASP n 
1 485 VAL n 
1 486 LEU n 
1 487 ILE n 
1 488 ASN n 
1 489 GLY n 
1 490 GLU n 
1 491 ARG n 
1 492 VAL n 
1 493 ASP n 
1 494 ALA n 
1 495 LEU n 
1 496 ALA n 
1 497 LEU n 
1 498 ILE n 
1 499 THR n 
1 500 HIS n 
1 501 ARG n 
1 502 ASP n 
1 503 ASN n 
1 504 SER n 
1 505 GLN n 
1 506 ASN n 
1 507 ARG n 
1 508 GLY n 
1 509 ARG n 
1 510 GLU n 
1 511 LEU n 
1 512 VAL n 
1 513 GLU n 
1 514 LYS n 
1 515 MET n 
1 516 LYS n 
1 517 ASP n 
1 518 LEU n 
1 519 ILE n 
1 520 PRO n 
1 521 ARG n 
1 522 GLN n 
1 523 GLN n 
1 524 PHE n 
1 525 ASP n 
1 526 ILE n 
1 527 ALA n 
1 528 ILE n 
1 529 GLN n 
1 530 ALA n 
1 531 ALA n 
1 532 ILE n 
1 533 GLY n 
1 534 THR n 
1 535 HIS n 
1 536 ILE n 
1 537 ILE n 
1 538 ALA n 
1 539 ARG n 
1 540 SER n 
1 541 THR n 
1 542 VAL n 
1 543 LYS n 
1 544 GLN n 
1 545 LEU n 
1 546 ARG n 
1 547 LYS n 
1 548 ASN n 
1 549 VAL n 
1 550 LEU n 
1 551 ALA n 
1 552 LYS n 
1 553 CYS n 
1 554 TYR n 
1 555 GLY n 
1 556 GLY n 
1 557 ASP n 
1 558 ILE n 
1 559 SER n 
1 560 ARG n 
1 561 LYS n 
1 562 LYS n 
1 563 LYS n 
1 564 LEU n 
1 565 LEU n 
1 566 GLN n 
1 567 LYS n 
1 568 GLN n 
1 569 LYS n 
1 570 GLU n 
1 571 GLY n 
1 572 LYS n 
1 573 LYS n 
1 574 ARG n 
1 575 MET n 
1 576 LYS n 
1 577 GLN n 
1 578 ILE n 
1 579 GLY n 
1 580 ASN n 
1 581 VAL n 
1 582 GLU n 
1 583 LEU n 
1 584 PRO n 
1 585 GLN n 
1 586 GLU n 
1 587 ALA n 
1 588 PHE n 
1 589 LEU n 
1 590 ALA n 
1 591 ILE n 
1 592 LEU n 
1 593 HIS n 
1 594 VAL n 
1 595 GLY n 
1 596 LYS n 
1 597 ASP n 
1 598 ASN n 
1 599 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 lepA 
_entity_src_gen.gene_src_species                   'Escherichia coli' 
_entity_src_gen.gene_src_strain                    K12 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     83333 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LEPA_ECOLI 
_struct_ref.pdbx_db_accession          P60785 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MKNIRNFSIIAHIDHGKSTLSDRIIQICGGLSDREMEAQVLDSMDLERERGITIKAQSVTLDYKASDGETYQLNFIDTPG
HVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAMEMDLEVVPVLNKIDLPAADPERVAEEIEDIVGIDATDAVR
CSAKTGVGVQDVLERLVRDIPPPEGDPEGPLQALIIDSWFDNYLGVVSLIRIKNGTLRKGDKVKVMSTGQTYNADRLGIF
TPKQVDRTELKCGEVGWLVCAIKDIHGAPVGDTLTLARNPAEKALPGFKKVKPQVYAGLFPVSSDDYEAFRDALGKLSLN
DASLFYEPESSSALGFGFRCGFLGLLHMEIIQERLEREYDLDLITTAPTVVYEVETTSREVIYVDSPSKLPAVNNIYELR
EPIAECHMLLPQAYLGNVITLCVEKRGVQTNMVYHGNQVALTYEIPMAEVVLDFFDRLKSTSRGYASLDYNFKRFQASDM
VRVDVLINGERVDALALITHRDNSQNRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISR
KKKLLQKQKEGKKRMKQIGNVELPQEAFLAILHVGKDNK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3CB4 D 1 ? 599 ? P60785 1 ? 599 ? 1 599 
2 1 3CB4 A 1 ? 599 ? P60785 1 ? 599 ? 1 599 
3 1 3CB4 B 1 ? 599 ? P60785 1 ? 599 ? 1 599 
4 1 3CB4 C 1 ? 599 ? P60785 1 ? 599 ? 1 599 
5 1 3CB4 E 1 ? 599 ? P60785 1 ? 599 ? 1 599 
6 1 3CB4 F 1 ? 599 ? P60785 1 ? 599 ? 1 599 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3CB4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.45 
_exptl_crystal.density_percent_sol   49.85 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    
;100 mM Tris-HCl pH 8.0   
10% Peg 2000MME, 100 mM MgCl2, VAPOR DIFFUSION, HANGING DROP, temperature 292K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1   100 ? 1 
2   100 ? 1 
1,2 ?   ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD 'ADSC QUANTUM 315' 2007-09-28 ? 
2 CCD 'ADSC QUANTUM 315' ?          ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M 'Si(111)' 'SINGLE WAVELENGTH' x-ray 
2 1 M 'Si(111)' 'SINGLE WAVELENGTH' x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'NSLS BEAMLINE X25'  NSLS X25   ? 0.979 
2 SYNCHROTRON 'ALS BEAMLINE 8.2.2' ALS  8.2.2 ? 0.979 
# 
_reflns.entry_id                     3CB4 
_reflns.observed_criterion_sigma_F   1 
_reflns.observed_criterion_sigma_I   1 
_reflns.d_resolution_high            2.8 
_reflns.d_resolution_low             50.0 
_reflns.number_all                   92895 
_reflns.number_obs                   88629 
_reflns.percent_possible_obs         94.6 
_reflns.pdbx_Rmerge_I_obs            0.117 
_reflns.pdbx_Rsym_value              0.088 
_reflns.pdbx_netI_over_sigmaI        9.8 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1,2 
# 
_reflns_shell.d_res_high             2.8 
_reflns_shell.d_res_low              2.9 
_reflns_shell.percent_possible_all   64.9 
_reflns_shell.Rmerge_I_obs           0.588 
_reflns_shell.pdbx_Rsym_value        0.494 
_reflns_shell.meanI_over_sigI_obs    1.4 
_reflns_shell.pdbx_redundancy        2.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      6070 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1,2 
# 
_refine.entry_id                                 3CB4 
_refine.ls_number_reflns_obs                     84039 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.0 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    95.38 
_refine.ls_R_factor_obs                          0.24896 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.24644 
_refine.ls_R_factor_R_free                       0.29455 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.2 
_refine.ls_number_reflns_R_free                  4590 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.905 
_refine.correlation_coeff_Fo_to_Fc_free          0.855 
_refine.B_iso_mean                               54.180 
_refine.aniso_B[1][1]                            1.53 
_refine.aniso_B[2][2]                            1.64 
_refine.aniso_B[3][3]                            -3.02 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.42 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SIRAS 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.460 
_refine.overall_SU_ML                            0.396 
_refine.overall_SU_B                             46.615 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        24492 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             3 
_refine_hist.number_atoms_total               24495 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        50.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.007  0.022  ? 24909 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.088  1.975  ? 33762 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.567  5.000  ? 3132  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.681 24.392 ? 1134  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       19.304 15.000 ? 4344  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.504 15.000 ? 180   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.073  0.200  ? 3900  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.002  0.020  ? 18726 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.196  0.200  ? 10787 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.301  0.200  ? 16785 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.122  0.200  ? 678   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.239  0.200  ? 82    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.239  0.200  ? 7     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.206  1.500  ? 16049 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.371  2.000  ? 25320 'X-RAY DIFFRACTION' ? 
r_scbond_it                  0.466  3.000  ? 9790  'X-RAY DIFFRACTION' ? 
r_scangle_it                 0.812  4.500  ? 8442  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.800 
_refine_ls_shell.d_res_low                        2.873 
_refine_ls_shell.number_reflns_R_work             3062 
_refine_ls_shell.R_factor_R_work                  0.401 
_refine_ls_shell.percent_reflns_obs               64.46 
_refine_ls_shell.R_factor_R_free                  0.43 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             163 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3CB4 
_struct.title                     'The Crystal Structure of LepA' 
_struct.pdbx_descriptor           'GTP-binding protein lepA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3CB4 
_struct_keywords.pdbx_keywords   TRANSLATION 
_struct_keywords.text            'GTPAse, OB-fold, GTP-binding, Membrane, Nucleotide-binding, TRANSLATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
;The biological unit is a monomer.  There are 6 biological units in the asymmetric unit (chains A, B, C, D, E, and F).  The 6 biological units are arranged as a trimer of dimers.
;
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 19  ? CYS A 28  ? THR D 19  CYS D 28  1 ? 10 
HELX_P HELX_P2  2  HIS A 81  ? ASP A 83  ? HIS D 81  ASP D 83  5 ? 3  
HELX_P HELX_P3  3  PHE A 84  ? CYS A 95  ? PHE D 84  CYS D 95  1 ? 12 
HELX_P HELX_P4  4  ALA A 110 ? MET A 122 ? ALA D 110 MET D 122 1 ? 13 
HELX_P HELX_P5  5  ASP A 139 ? ILE A 150 ? ASP D 139 ILE D 150 1 ? 12 
HELX_P HELX_P6  6  GLY A 168 ? ILE A 180 ? GLY D 168 ILE D 180 1 ? 13 
HELX_P HELX_P7  7  ASP A 264 ? ALA A 268 ? ASP D 264 ALA D 268 5 ? 5  
HELX_P HELX_P8  8  SER A 303 ? ASP A 305 ? SER D 303 ASP D 305 5 ? 3  
HELX_P HELX_P9  9  ASP A 306 ? LEU A 319 ? ASP D 306 LEU D 319 1 ? 14 
HELX_P HELX_P10 10 GLY A 344 ? GLU A 358 ? GLY D 344 GLU D 358 1 ? 15 
HELX_P HELX_P11 11 SER A 386 ? LEU A 390 ? SER D 386 LEU D 390 5 ? 5  
HELX_P HELX_P12 12 ALA A 392 ? ASN A 394 ? ALA D 392 ASN D 394 5 ? 3  
HELX_P HELX_P13 13 TYR A 414 ? LYS A 425 ? TYR D 414 LYS D 425 1 ? 12 
HELX_P HELX_P14 14 MET A 447 ? LEU A 452 ? MET D 447 LEU D 452 1 ? 6  
HELX_P HELX_P15 15 PHE A 454 ? SER A 462 ? PHE D 454 SER D 462 1 ? 9  
HELX_P HELX_P16 16 ASN A 503 ? ILE A 519 ? ASN D 503 ILE D 519 1 ? 17 
HELX_P HELX_P17 17 THR B 19  ? CYS B 28  ? THR A 19  CYS A 28  1 ? 10 
HELX_P HELX_P18 18 HIS B 81  ? ASP B 83  ? HIS A 81  ASP A 83  5 ? 3  
HELX_P HELX_P19 19 PHE B 84  ? ALA B 94  ? PHE A 84  ALA A 94  1 ? 11 
HELX_P HELX_P20 20 GLU B 109 ? MET B 122 ? GLU A 109 MET A 122 1 ? 14 
HELX_P HELX_P21 21 ASP B 139 ? VAL B 151 ? ASP A 139 VAL A 151 1 ? 13 
HELX_P HELX_P22 22 GLY B 168 ? ILE B 180 ? GLY A 168 ILE A 180 1 ? 13 
HELX_P HELX_P23 23 ASP B 264 ? ALA B 268 ? ASP A 264 ALA A 268 5 ? 5  
HELX_P HELX_P24 24 SER B 303 ? ASP B 305 ? SER A 303 ASP A 305 5 ? 3  
HELX_P HELX_P25 25 ASP B 306 ? LEU B 319 ? ASP A 306 LEU A 319 1 ? 14 
HELX_P HELX_P26 26 GLY B 344 ? GLU B 358 ? GLY A 344 GLU A 358 1 ? 15 
HELX_P HELX_P27 27 SER B 386 ? LEU B 390 ? SER A 386 LEU A 390 5 ? 5  
HELX_P HELX_P28 28 ALA B 392 ? ASN B 394 ? ALA A 392 ASN A 394 5 ? 3  
HELX_P HELX_P29 29 TYR B 414 ? VAL B 423 ? TYR A 414 VAL A 423 1 ? 10 
HELX_P HELX_P30 30 MET B 447 ? LEU B 452 ? MET A 447 LEU A 452 1 ? 6  
HELX_P HELX_P31 31 PHE B 454 ? SER B 462 ? PHE A 454 SER A 462 1 ? 9  
HELX_P HELX_P32 32 ASP B 493 ? ALA B 496 ? ASP A 493 ALA A 496 5 ? 4  
HELX_P HELX_P33 33 ASN B 503 ? ILE B 519 ? ASN A 503 ILE A 519 1 ? 17 
HELX_P HELX_P34 34 THR C 19  ? CYS C 28  ? THR B 19  CYS B 28  1 ? 10 
HELX_P HELX_P35 35 PHE C 84  ? ALA C 94  ? PHE B 84  ALA B 94  1 ? 11 
HELX_P HELX_P36 36 ALA C 110 ? MET C 122 ? ALA B 110 MET B 122 1 ? 13 
HELX_P HELX_P37 37 ASP C 139 ? VAL C 151 ? ASP B 139 VAL B 151 1 ? 13 
HELX_P HELX_P38 38 GLY C 168 ? ILE C 180 ? GLY B 168 ILE B 180 1 ? 13 
HELX_P HELX_P39 39 ASP C 264 ? ALA C 268 ? ASP B 264 ALA B 268 5 ? 5  
HELX_P HELX_P40 40 SER C 303 ? ASP C 305 ? SER B 303 ASP B 305 5 ? 3  
HELX_P HELX_P41 41 ASP C 306 ? LEU C 319 ? ASP B 306 LEU B 319 1 ? 14 
HELX_P HELX_P42 42 GLY C 344 ? GLU C 358 ? GLY B 344 GLU B 358 1 ? 15 
HELX_P HELX_P43 43 SER C 386 ? LEU C 390 ? SER B 386 LEU B 390 5 ? 5  
HELX_P HELX_P44 44 ALA C 392 ? ASN C 394 ? ALA B 392 ASN B 394 5 ? 3  
HELX_P HELX_P45 45 TYR C 414 ? LYS C 425 ? TYR B 414 LYS B 425 1 ? 12 
HELX_P HELX_P46 46 MET C 447 ? LEU C 452 ? MET B 447 LEU B 452 1 ? 6  
HELX_P HELX_P47 47 PHE C 454 ? SER C 462 ? PHE B 454 SER B 462 1 ? 9  
HELX_P HELX_P48 48 ASP C 493 ? ALA C 496 ? ASP B 493 ALA B 496 5 ? 4  
HELX_P HELX_P49 49 ASN C 503 ? ILE C 519 ? ASN B 503 ILE B 519 1 ? 17 
HELX_P HELX_P50 50 THR D 19  ? CYS D 28  ? THR C 19  CYS C 28  1 ? 10 
HELX_P HELX_P51 51 HIS D 81  ? ASP D 83  ? HIS C 81  ASP C 83  5 ? 3  
HELX_P HELX_P52 52 PHE D 84  ? ALA D 93  ? PHE C 84  ALA C 93  1 ? 10 
HELX_P HELX_P53 53 GLU D 109 ? MET D 122 ? GLU C 109 MET C 122 1 ? 14 
HELX_P HELX_P54 54 ASP D 139 ? ILE D 150 ? ASP C 139 ILE C 150 1 ? 12 
HELX_P HELX_P55 55 GLY D 168 ? ILE D 180 ? GLY C 168 ILE C 180 1 ? 13 
HELX_P HELX_P56 56 ASP D 264 ? ALA D 268 ? ASP C 264 ALA C 268 5 ? 5  
HELX_P HELX_P57 57 SER D 303 ? ASP D 305 ? SER C 303 ASP C 305 5 ? 3  
HELX_P HELX_P58 58 ASP D 306 ? LEU D 319 ? ASP C 306 LEU C 319 1 ? 14 
HELX_P HELX_P59 59 GLY D 344 ? GLU D 358 ? GLY C 344 GLU C 358 1 ? 15 
HELX_P HELX_P60 60 SER D 386 ? LEU D 390 ? SER C 386 LEU C 390 5 ? 5  
HELX_P HELX_P61 61 ALA D 392 ? ASN D 394 ? ALA C 392 ASN C 394 5 ? 3  
HELX_P HELX_P62 62 TYR D 414 ? LYS D 425 ? TYR C 414 LYS C 425 1 ? 12 
HELX_P HELX_P63 63 MET D 447 ? LEU D 452 ? MET C 447 LEU C 452 1 ? 6  
HELX_P HELX_P64 64 PHE D 454 ? SER D 462 ? PHE C 454 SER C 462 1 ? 9  
HELX_P HELX_P65 65 ASN D 503 ? ILE D 519 ? ASN C 503 ILE C 519 1 ? 17 
HELX_P HELX_P66 66 THR E 19  ? CYS E 28  ? THR E 19  CYS E 28  1 ? 10 
HELX_P HELX_P67 67 HIS E 81  ? ASP E 83  ? HIS E 81  ASP E 83  5 ? 3  
HELX_P HELX_P68 68 PHE E 84  ? ALA E 93  ? PHE E 84  ALA E 93  1 ? 10 
HELX_P HELX_P69 69 GLU E 109 ? MET E 122 ? GLU E 109 MET E 122 1 ? 14 
HELX_P HELX_P70 70 ASP E 139 ? ILE E 150 ? ASP E 139 ILE E 150 1 ? 12 
HELX_P HELX_P71 71 GLY E 168 ? ILE E 180 ? GLY E 168 ILE E 180 1 ? 13 
HELX_P HELX_P72 72 ASP E 264 ? ALA E 268 ? ASP E 264 ALA E 268 5 ? 5  
HELX_P HELX_P73 73 SER E 303 ? ASP E 305 ? SER E 303 ASP E 305 5 ? 3  
HELX_P HELX_P74 74 ASP E 306 ? ASP E 321 ? ASP E 306 ASP E 321 1 ? 16 
HELX_P HELX_P75 75 GLY E 344 ? GLU E 358 ? GLY E 344 GLU E 358 1 ? 15 
HELX_P HELX_P76 76 SER E 386 ? LEU E 390 ? SER E 386 LEU E 390 5 ? 5  
HELX_P HELX_P77 77 ALA E 392 ? ASN E 394 ? ALA E 392 ASN E 394 5 ? 3  
HELX_P HELX_P78 78 TYR E 414 ? LYS E 425 ? TYR E 414 LYS E 425 1 ? 12 
HELX_P HELX_P79 79 MET E 447 ? LEU E 452 ? MET E 447 LEU E 452 1 ? 6  
HELX_P HELX_P80 80 PHE E 454 ? SER E 462 ? PHE E 454 SER E 462 1 ? 9  
HELX_P HELX_P81 81 ASP E 493 ? ALA E 496 ? ASP E 493 ALA E 496 5 ? 4  
HELX_P HELX_P82 82 ASN E 503 ? ILE E 519 ? ASN E 503 ILE E 519 1 ? 17 
HELX_P HELX_P83 83 THR F 19  ? CYS F 28  ? THR F 19  CYS F 28  1 ? 10 
HELX_P HELX_P84 84 PHE F 84  ? ALA F 93  ? PHE F 84  ALA F 93  1 ? 10 
HELX_P HELX_P85 85 ALA F 110 ? MET F 122 ? ALA F 110 MET F 122 1 ? 13 
HELX_P HELX_P86 86 ASP F 139 ? ILE F 150 ? ASP F 139 ILE F 150 1 ? 12 
HELX_P HELX_P87 87 GLY F 168 ? ILE F 180 ? GLY F 168 ILE F 180 1 ? 13 
HELX_P HELX_P88 88 SER F 303 ? ASP F 305 ? SER F 303 ASP F 305 5 ? 3  
HELX_P HELX_P89 89 ASP F 306 ? LEU F 319 ? ASP F 306 LEU F 319 1 ? 14 
HELX_P HELX_P90 90 GLY F 344 ? GLU F 358 ? GLY F 344 GLU F 358 1 ? 15 
HELX_P HELX_P91 91 SER F 386 ? LEU F 390 ? SER F 386 LEU F 390 5 ? 5  
HELX_P HELX_P92 92 ALA F 392 ? ASN F 394 ? ALA F 392 ASN F 394 5 ? 3  
HELX_P HELX_P93 93 TYR F 414 ? LYS F 425 ? TYR F 414 LYS F 425 1 ? 12 
HELX_P HELX_P94 94 MET F 447 ? LEU F 452 ? MET F 447 LEU F 452 1 ? 6  
HELX_P HELX_P95 95 PHE F 454 ? SER F 462 ? PHE F 454 SER F 462 1 ? 9  
HELX_P HELX_P96 96 ASP F 493 ? ALA F 496 ? ASP F 493 ALA F 496 5 ? 4  
HELX_P HELX_P97 97 ASN F 503 ? ILE F 519 ? ASN F 503 ILE F 519 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 553 SG ? ? ? 1_555 E CYS 553 SG ? ? D CYS 553 E CYS 553 1_555 ? ? ? ? ? ? ? 1.995 ? 
disulf2 disulf ? ? B CYS 553 SG ? ? ? 1_555 C CYS 553 SG ? ? A CYS 553 B CYS 553 1_555 ? ? ? ? ? ? ? 1.992 ? 
disulf3 disulf ? ? D CYS 553 SG ? ? ? 1_555 F CYS 553 SG ? ? C CYS 553 F CYS 553 1_555 ? ? ? ? ? ? ? 2.002 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 241 A . ? THR 241 D PRO 242 A ? PRO 242 D 1 15.53 
2 THR 241 B . ? THR 241 A PRO 242 B ? PRO 242 A 1 3.37  
3 THR 241 C . ? THR 241 B PRO 242 C ? PRO 242 B 1 12.22 
4 THR 241 D . ? THR 241 C PRO 242 D ? PRO 242 C 1 9.48  
5 THR 241 E . ? THR 241 E PRO 242 E ? PRO 242 E 1 6.30  
6 THR 241 F . ? THR 241 F PRO 242 F ? PRO 242 F 1 8.12  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 6 ? 
B  ? 8 ? 
C  ? 2 ? 
D  ? 4 ? 
E  ? 4 ? 
F  ? 5 ? 
G  ? 4 ? 
H  ? 4 ? 
I  ? 6 ? 
J  ? 8 ? 
K  ? 2 ? 
L  ? 4 ? 
M  ? 4 ? 
N  ? 5 ? 
O  ? 4 ? 
P  ? 3 ? 
Q  ? 4 ? 
R  ? 6 ? 
S  ? 8 ? 
T  ? 2 ? 
U  ? 4 ? 
V  ? 4 ? 
W  ? 5 ? 
X  ? 4 ? 
Y  ? 3 ? 
Z  ? 4 ? 
AA ? 6 ? 
AB ? 8 ? 
AC ? 2 ? 
AD ? 4 ? 
AE ? 4 ? 
AF ? 5 ? 
AG ? 4 ? 
AH ? 4 ? 
AI ? 6 ? 
AJ ? 8 ? 
AK ? 2 ? 
AL ? 4 ? 
AM ? 4 ? 
AN ? 5 ? 
AO ? 4 ? 
AP ? 3 ? 
AQ ? 4 ? 
AR ? 6 ? 
AS ? 8 ? 
AT ? 2 ? 
AU ? 4 ? 
AV ? 4 ? 
AW ? 5 ? 
AX ? 4 ? 
AY ? 3 ? 
AZ ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? parallel      
A  3 4 ? parallel      
A  4 5 ? parallel      
A  5 6 ? parallel      
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
B  4 5 ? anti-parallel 
B  5 6 ? anti-parallel 
B  6 7 ? anti-parallel 
B  7 8 ? anti-parallel 
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
F  4 5 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
H  3 4 ? anti-parallel 
I  1 2 ? anti-parallel 
I  2 3 ? parallel      
I  3 4 ? parallel      
I  4 5 ? parallel      
I  5 6 ? parallel      
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
J  3 4 ? anti-parallel 
J  4 5 ? anti-parallel 
J  5 6 ? anti-parallel 
J  6 7 ? anti-parallel 
J  7 8 ? anti-parallel 
K  1 2 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
L  3 4 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
M  3 4 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
N  4 5 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
O  3 4 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? parallel      
R  3 4 ? parallel      
R  4 5 ? parallel      
R  5 6 ? parallel      
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
S  3 4 ? anti-parallel 
S  4 5 ? anti-parallel 
S  5 6 ? anti-parallel 
S  6 7 ? anti-parallel 
S  7 8 ? anti-parallel 
T  1 2 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
U  3 4 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
V  3 4 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
W  3 4 ? anti-parallel 
W  4 5 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
Y  1 2 ? anti-parallel 
Y  2 3 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
Z  3 4 ? anti-parallel 
AA 1 2 ? anti-parallel 
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AA 4 5 ? parallel      
AA 5 6 ? parallel      
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AB 5 6 ? anti-parallel 
AB 6 7 ? anti-parallel 
AB 7 8 ? anti-parallel 
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AF 4 5 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AH 3 4 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? parallel      
AI 3 4 ? parallel      
AI 4 5 ? parallel      
AI 5 6 ? parallel      
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AJ 4 5 ? anti-parallel 
AJ 5 6 ? anti-parallel 
AJ 6 7 ? anti-parallel 
AJ 7 8 ? anti-parallel 
AK 1 2 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? anti-parallel 
AL 3 4 ? anti-parallel 
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AM 3 4 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? anti-parallel 
AN 4 5 ? anti-parallel 
AO 1 2 ? anti-parallel 
AO 2 3 ? anti-parallel 
AO 3 4 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AQ 3 4 ? anti-parallel 
AR 1 2 ? anti-parallel 
AR 2 3 ? parallel      
AR 3 4 ? parallel      
AR 4 5 ? parallel      
AR 5 6 ? parallel      
AS 1 2 ? anti-parallel 
AS 2 3 ? anti-parallel 
AS 3 4 ? anti-parallel 
AS 4 5 ? anti-parallel 
AS 5 6 ? anti-parallel 
AS 6 7 ? anti-parallel 
AS 7 8 ? anti-parallel 
AT 1 2 ? anti-parallel 
AU 1 2 ? anti-parallel 
AU 2 3 ? anti-parallel 
AU 3 4 ? anti-parallel 
AV 1 2 ? anti-parallel 
AV 2 3 ? anti-parallel 
AV 3 4 ? anti-parallel 
AW 1 2 ? anti-parallel 
AW 2 3 ? anti-parallel 
AW 3 4 ? anti-parallel 
AW 4 5 ? anti-parallel 
AX 1 2 ? anti-parallel 
AX 2 3 ? anti-parallel 
AX 3 4 ? anti-parallel 
AY 1 2 ? anti-parallel 
AY 2 3 ? anti-parallel 
AZ 1 2 ? anti-parallel 
AZ 2 3 ? anti-parallel 
AZ 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 SER A 58  ? LYS A 64  ? SER D 58  LYS D 64  
A  2 THR A 70  ? ASP A 77  ? THR D 70  ASP D 77  
A  3 ILE A 4   ? ILE A 10  ? ILE D 4   ILE D 10  
A  4 GLY A 97  ? ASP A 103 ? GLY D 97  ASP D 103 
A  5 GLU A 125 ? ASN A 131 ? GLU D 125 ASN D 131 
A  6 VAL A 159 ? CYS A 161 ? VAL D 159 CYS D 161 
B  1 THR A 231 ? ASN A 233 ? THR D 231 ASN D 233 
B  2 LYS A 222 ? VAL A 225 ? LYS D 222 VAL D 225 
B  3 THR A 273 ? LEU A 276 ? THR D 273 LEU D 276 
B  4 GLN A 192 ? ASP A 201 ? GLN D 192 ASP D 201 
B  5 GLY A 205 ? ASN A 214 ? GLY D 205 ASN D 214 
B  6 VAL A 255 ? VAL A 259 ? VAL D 255 VAL D 259 
B  7 ARG A 236 ? PHE A 240 ? ARG D 236 PHE D 240 
B  8 GLN A 244 ? ASP A 246 ? GLN D 244 ASP D 246 
C  1 LEU A 217 ? ARG A 218 ? LEU D 217 ARG D 218 
C  2 GLU A 249 ? LEU A 250 ? GLU D 249 LEU D 250 
D  1 PHE A 325 ? SER A 331 ? PHE D 325 SER D 331 
D  2 GLY A 335 ? PHE A 342 ? GLY D 335 PHE D 342 
D  3 VAL A 295 ? PRO A 301 ? VAL D 295 PRO D 301 
D  4 LEU A 363 ? THR A 365 ? LEU D 363 THR D 365 
E  1 PHE A 325 ? SER A 331 ? PHE D 325 SER D 331 
E  2 GLY A 335 ? PHE A 342 ? GLY D 335 PHE D 342 
E  3 VAL A 295 ? PRO A 301 ? VAL D 295 PRO D 301 
E  4 THR A 369 ? VAL A 370 ? THR D 369 VAL D 370 
F  1 VAL A 381 ? VAL A 384 ? VAL D 381 VAL D 384 
F  2 TYR A 372 ? THR A 376 ? TYR D 372 THR D 376 
F  3 ILE A 396 ? PRO A 411 ? ILE D 396 PRO D 411 
F  4 GLN A 438 ? PRO A 446 ? GLN D 438 PRO D 446 
F  5 VAL A 428 ? VAL A 433 ? VAL D 428 VAL D 433 
G  1 VAL A 381 ? VAL A 384 ? VAL D 381 VAL D 384 
G  2 TYR A 372 ? THR A 376 ? TYR D 372 THR D 376 
G  3 ILE A 396 ? PRO A 411 ? ILE D 396 PRO D 411 
G  4 SER A 467 ? ALA A 477 ? SER D 467 ALA D 477 
H  1 GLU A 490 ? HIS A 500 ? GLU D 490 HIS D 500 
H  2 MET A 480 ? ILE A 487 ? MET D 480 ILE D 487 
H  3 ILE A 526 ? ILE A 532 ? ILE D 526 ILE D 532 
H  4 HIS A 535 ? VAL A 542 ? HIS D 535 VAL D 542 
I  1 SER B 58  ? LYS B 64  ? SER A 58  LYS A 64  
I  2 THR B 70  ? ILE B 76  ? THR A 70  ILE A 76  
I  3 ILE B 4   ? ILE B 10  ? ILE A 4   ILE A 10  
I  4 GLY B 97  ? ASP B 103 ? GLY A 97  ASP A 103 
I  5 GLU B 125 ? ASN B 131 ? GLU A 125 ASN A 131 
I  6 VAL B 159 ? CYS B 161 ? VAL A 159 CYS A 161 
J  1 THR B 231 ? ASN B 233 ? THR A 231 ASN A 233 
J  2 LYS B 222 ? VAL B 225 ? LYS A 222 VAL A 225 
J  3 THR B 273 ? LEU B 276 ? THR A 273 LEU A 276 
J  4 GLN B 192 ? ASP B 201 ? GLN A 192 ASP A 201 
J  5 GLY B 205 ? ASN B 214 ? GLY A 205 ASN A 214 
J  6 VAL B 255 ? VAL B 259 ? VAL A 255 VAL A 259 
J  7 ARG B 236 ? PHE B 240 ? ARG A 236 PHE A 240 
J  8 GLN B 244 ? ARG B 247 ? GLN A 244 ARG A 247 
K  1 LEU B 217 ? ARG B 218 ? LEU A 217 ARG A 218 
K  2 GLU B 249 ? LEU B 250 ? GLU A 249 LEU A 250 
L  1 PHE B 325 ? SER B 331 ? PHE A 325 SER A 331 
L  2 GLY B 335 ? PHE B 342 ? GLY A 335 PHE A 342 
L  3 VAL B 295 ? PRO B 301 ? VAL A 295 PRO A 301 
L  4 LEU B 363 ? THR B 365 ? LEU A 363 THR A 365 
M  1 PHE B 325 ? SER B 331 ? PHE A 325 SER A 331 
M  2 GLY B 335 ? PHE B 342 ? GLY A 335 PHE A 342 
M  3 VAL B 295 ? PRO B 301 ? VAL A 295 PRO A 301 
M  4 THR B 369 ? VAL B 370 ? THR A 369 VAL A 370 
N  1 VAL B 381 ? VAL B 384 ? VAL A 381 VAL A 384 
N  2 TYR B 372 ? THR B 376 ? TYR A 372 THR A 376 
N  3 ILE B 396 ? PRO B 411 ? ILE A 396 PRO A 411 
N  4 GLN B 438 ? PRO B 446 ? GLN A 438 PRO A 446 
N  5 VAL B 428 ? HIS B 435 ? VAL A 428 HIS A 435 
O  1 VAL B 381 ? VAL B 384 ? VAL A 381 VAL A 384 
O  2 TYR B 372 ? THR B 376 ? TYR A 372 THR A 376 
O  3 ILE B 396 ? PRO B 411 ? ILE A 396 PRO A 411 
O  4 TYR B 470 ? ALA B 477 ? TYR A 470 ALA A 477 
P  1 GLU B 490 ? ARG B 491 ? GLU A 490 ARG A 491 
P  2 MET B 480 ? ILE B 487 ? MET A 480 ILE A 487 
P  3 LEU B 497 ? HIS B 500 ? LEU A 497 HIS A 500 
Q  1 GLU B 490 ? ARG B 491 ? GLU A 490 ARG A 491 
Q  2 MET B 480 ? ILE B 487 ? MET A 480 ILE A 487 
Q  3 ILE B 526 ? ILE B 532 ? ILE A 526 ILE A 532 
Q  4 HIS B 535 ? VAL B 542 ? HIS A 535 VAL A 542 
R  1 SER C 58  ? LYS C 64  ? SER B 58  LYS B 64  
R  2 THR C 70  ? ASP C 77  ? THR B 70  ASP B 77  
R  3 ILE C 4   ? ILE C 10  ? ILE B 4   ILE B 10  
R  4 GLY C 97  ? ASP C 103 ? GLY B 97  ASP B 103 
R  5 GLU C 125 ? ASN C 131 ? GLU B 125 ASN B 131 
R  6 VAL C 159 ? CYS C 161 ? VAL B 159 CYS B 161 
S  1 THR C 231 ? ASN C 233 ? THR B 231 ASN B 233 
S  2 LYS C 222 ? VAL C 225 ? LYS B 222 VAL B 225 
S  3 THR C 273 ? LEU C 276 ? THR B 273 LEU B 276 
S  4 GLN C 192 ? ASP C 201 ? GLN B 192 ASP B 201 
S  5 GLY C 205 ? ASN C 214 ? GLY B 205 ASN B 214 
S  6 VAL C 255 ? VAL C 259 ? VAL B 255 VAL B 259 
S  7 ARG C 236 ? PHE C 240 ? ARG B 236 PHE B 240 
S  8 GLN C 244 ? ASP C 246 ? GLN B 244 ASP B 246 
T  1 LEU C 217 ? ARG C 218 ? LEU B 217 ARG B 218 
T  2 GLU C 249 ? LEU C 250 ? GLU B 249 LEU B 250 
U  1 PHE C 325 ? SER C 331 ? PHE B 325 SER B 331 
U  2 GLY C 335 ? PHE C 342 ? GLY B 335 PHE B 342 
U  3 VAL C 295 ? PRO C 301 ? VAL B 295 PRO B 301 
U  4 LEU C 363 ? THR C 365 ? LEU B 363 THR B 365 
V  1 PHE C 325 ? SER C 331 ? PHE B 325 SER B 331 
V  2 GLY C 335 ? PHE C 342 ? GLY B 335 PHE B 342 
V  3 VAL C 295 ? PRO C 301 ? VAL B 295 PRO B 301 
V  4 THR C 369 ? VAL C 370 ? THR B 369 VAL B 370 
W  1 VAL C 381 ? VAL C 384 ? VAL B 381 VAL B 384 
W  2 TYR C 372 ? THR C 376 ? TYR B 372 THR B 376 
W  3 ILE C 396 ? PRO C 411 ? ILE B 396 PRO B 411 
W  4 GLN C 438 ? PRO C 446 ? GLN B 438 PRO B 446 
W  5 VAL C 428 ? HIS C 435 ? VAL B 428 HIS B 435 
X  1 VAL C 381 ? VAL C 384 ? VAL B 381 VAL B 384 
X  2 TYR C 372 ? THR C 376 ? TYR B 372 THR B 376 
X  3 ILE C 396 ? PRO C 411 ? ILE B 396 PRO B 411 
X  4 TYR C 470 ? ALA C 477 ? TYR B 470 ALA B 477 
Y  1 GLU C 490 ? ARG C 491 ? GLU B 490 ARG B 491 
Y  2 MET C 480 ? ILE C 487 ? MET B 480 ILE B 487 
Y  3 LEU C 497 ? HIS C 500 ? LEU B 497 HIS B 500 
Z  1 GLU C 490 ? ARG C 491 ? GLU B 490 ARG B 491 
Z  2 MET C 480 ? ILE C 487 ? MET B 480 ILE B 487 
Z  3 ILE C 526 ? ILE C 532 ? ILE B 526 ILE B 532 
Z  4 HIS C 535 ? VAL C 542 ? HIS B 535 VAL B 542 
AA 1 SER D 58  ? LYS D 64  ? SER C 58  LYS C 64  
AA 2 THR D 70  ? ILE D 76  ? THR C 70  ILE C 76  
AA 3 ILE D 4   ? ILE D 10  ? ILE C 4   ILE C 10  
AA 4 GLY D 97  ? ASP D 103 ? GLY C 97  ASP C 103 
AA 5 GLU D 125 ? ASN D 131 ? GLU C 125 ASN C 131 
AA 6 VAL D 159 ? ARG D 160 ? VAL C 159 ARG C 160 
AB 1 THR D 231 ? ASN D 233 ? THR C 231 ASN C 233 
AB 2 LYS D 222 ? VAL D 225 ? LYS C 222 VAL C 225 
AB 3 THR D 273 ? LEU D 276 ? THR C 273 LEU C 276 
AB 4 GLN D 192 ? ASP D 201 ? GLN C 192 ASP C 201 
AB 5 GLY D 205 ? ASN D 214 ? GLY C 205 ASN C 214 
AB 6 VAL D 255 ? VAL D 259 ? VAL C 255 VAL C 259 
AB 7 ARG D 236 ? PHE D 240 ? ARG C 236 PHE C 240 
AB 8 GLN D 244 ? ARG D 247 ? GLN C 244 ARG C 247 
AC 1 LEU D 217 ? ARG D 218 ? LEU C 217 ARG C 218 
AC 2 GLU D 249 ? LEU D 250 ? GLU C 249 LEU C 250 
AD 1 PHE D 325 ? SER D 331 ? PHE C 325 SER C 331 
AD 2 GLY D 335 ? PHE D 342 ? GLY C 335 PHE C 342 
AD 3 VAL D 295 ? PRO D 301 ? VAL C 295 PRO C 301 
AD 4 LEU D 363 ? THR D 365 ? LEU C 363 THR C 365 
AE 1 PHE D 325 ? SER D 331 ? PHE C 325 SER C 331 
AE 2 GLY D 335 ? PHE D 342 ? GLY C 335 PHE C 342 
AE 3 VAL D 295 ? PRO D 301 ? VAL C 295 PRO C 301 
AE 4 THR D 369 ? VAL D 370 ? THR C 369 VAL C 370 
AF 1 VAL D 381 ? VAL D 384 ? VAL C 381 VAL C 384 
AF 2 TYR D 372 ? THR D 376 ? TYR C 372 THR C 376 
AF 3 ILE D 396 ? PRO D 411 ? ILE C 396 PRO C 411 
AF 4 GLN D 438 ? PRO D 446 ? GLN C 438 PRO C 446 
AF 5 VAL D 428 ? TYR D 434 ? VAL C 428 TYR C 434 
AG 1 VAL D 381 ? VAL D 384 ? VAL C 381 VAL C 384 
AG 2 TYR D 372 ? THR D 376 ? TYR C 372 THR C 376 
AG 3 ILE D 396 ? PRO D 411 ? ILE C 396 PRO C 411 
AG 4 SER D 467 ? ALA D 477 ? SER C 467 ALA C 477 
AH 1 GLU D 490 ? HIS D 500 ? GLU C 490 HIS C 500 
AH 2 MET D 480 ? ILE D 487 ? MET C 480 ILE C 487 
AH 3 ILE D 526 ? ILE D 532 ? ILE C 526 ILE C 532 
AH 4 HIS D 535 ? VAL D 542 ? HIS C 535 VAL C 542 
AI 1 SER E 58  ? LYS E 64  ? SER E 58  LYS E 64  
AI 2 THR E 70  ? ASP E 77  ? THR E 70  ASP E 77  
AI 3 ILE E 4   ? ILE E 10  ? ILE E 4   ILE E 10  
AI 4 GLY E 97  ? ASP E 103 ? GLY E 97  ASP E 103 
AI 5 GLU E 125 ? ASN E 131 ? GLU E 125 ASN E 131 
AI 6 VAL E 159 ? CYS E 161 ? VAL E 159 CYS E 161 
AJ 1 THR E 231 ? ASN E 233 ? THR E 231 ASN E 233 
AJ 2 LYS E 222 ? VAL E 225 ? LYS E 222 VAL E 225 
AJ 3 THR E 273 ? LEU E 276 ? THR E 273 LEU E 276 
AJ 4 GLN E 192 ? ASP E 201 ? GLN E 192 ASP E 201 
AJ 5 GLY E 205 ? ASN E 214 ? GLY E 205 ASN E 214 
AJ 6 VAL E 255 ? VAL E 259 ? VAL E 255 VAL E 259 
AJ 7 ARG E 236 ? PHE E 240 ? ARG E 236 PHE E 240 
AJ 8 GLN E 244 ? ASP E 246 ? GLN E 244 ASP E 246 
AK 1 LEU E 217 ? ARG E 218 ? LEU E 217 ARG E 218 
AK 2 GLU E 249 ? LEU E 250 ? GLU E 249 LEU E 250 
AL 1 PHE E 325 ? SER E 331 ? PHE E 325 SER E 331 
AL 2 GLY E 335 ? PHE E 342 ? GLY E 335 PHE E 342 
AL 3 VAL E 295 ? PRO E 301 ? VAL E 295 PRO E 301 
AL 4 LEU E 363 ? THR E 365 ? LEU E 363 THR E 365 
AM 1 PHE E 325 ? SER E 331 ? PHE E 325 SER E 331 
AM 2 GLY E 335 ? PHE E 342 ? GLY E 335 PHE E 342 
AM 3 VAL E 295 ? PRO E 301 ? VAL E 295 PRO E 301 
AM 4 THR E 369 ? VAL E 370 ? THR E 369 VAL E 370 
AN 1 VAL E 381 ? VAL E 384 ? VAL E 381 VAL E 384 
AN 2 TYR E 372 ? THR E 376 ? TYR E 372 THR E 376 
AN 3 ILE E 396 ? PRO E 411 ? ILE E 396 PRO E 411 
AN 4 GLN E 438 ? PRO E 446 ? GLN E 438 PRO E 446 
AN 5 VAL E 428 ? HIS E 435 ? VAL E 428 HIS E 435 
AO 1 VAL E 381 ? VAL E 384 ? VAL E 381 VAL E 384 
AO 2 TYR E 372 ? THR E 376 ? TYR E 372 THR E 376 
AO 3 ILE E 396 ? PRO E 411 ? ILE E 396 PRO E 411 
AO 4 SER E 467 ? ALA E 477 ? SER E 467 ALA E 477 
AP 1 GLU E 490 ? ARG E 491 ? GLU E 490 ARG E 491 
AP 2 MET E 480 ? ILE E 487 ? MET E 480 ILE E 487 
AP 3 LEU E 497 ? HIS E 500 ? LEU E 497 HIS E 500 
AQ 1 GLU E 490 ? ARG E 491 ? GLU E 490 ARG E 491 
AQ 2 MET E 480 ? ILE E 487 ? MET E 480 ILE E 487 
AQ 3 ILE E 526 ? ILE E 532 ? ILE E 526 ILE E 532 
AQ 4 HIS E 535 ? VAL E 542 ? HIS E 535 VAL E 542 
AR 1 SER F 58  ? LYS F 64  ? SER F 58  LYS F 64  
AR 2 THR F 70  ? ASP F 77  ? THR F 70  ASP F 77  
AR 3 ILE F 4   ? ILE F 10  ? ILE F 4   ILE F 10  
AR 4 GLY F 97  ? ASP F 103 ? GLY F 97  ASP F 103 
AR 5 GLU F 125 ? ASN F 131 ? GLU F 125 ASN F 131 
AR 6 VAL F 159 ? ARG F 160 ? VAL F 159 ARG F 160 
AS 1 THR F 231 ? ASN F 233 ? THR F 231 ASN F 233 
AS 2 LYS F 222 ? VAL F 225 ? LYS F 222 VAL F 225 
AS 3 THR F 273 ? LEU F 276 ? THR F 273 LEU F 276 
AS 4 GLN F 192 ? ASP F 201 ? GLN F 192 ASP F 201 
AS 5 GLY F 205 ? ASN F 214 ? GLY F 205 ASN F 214 
AS 6 VAL F 255 ? VAL F 259 ? VAL F 255 VAL F 259 
AS 7 ARG F 236 ? PHE F 240 ? ARG F 236 PHE F 240 
AS 8 GLN F 244 ? ASP F 246 ? GLN F 244 ASP F 246 
AT 1 LEU F 217 ? ARG F 218 ? LEU F 217 ARG F 218 
AT 2 GLU F 249 ? LEU F 250 ? GLU F 249 LEU F 250 
AU 1 PHE F 325 ? SER F 331 ? PHE F 325 SER F 331 
AU 2 GLY F 335 ? PHE F 342 ? GLY F 335 PHE F 342 
AU 3 VAL F 295 ? PRO F 301 ? VAL F 295 PRO F 301 
AU 4 LEU F 363 ? THR F 365 ? LEU F 363 THR F 365 
AV 1 PHE F 325 ? SER F 331 ? PHE F 325 SER F 331 
AV 2 GLY F 335 ? PHE F 342 ? GLY F 335 PHE F 342 
AV 3 VAL F 295 ? PRO F 301 ? VAL F 295 PRO F 301 
AV 4 THR F 369 ? VAL F 370 ? THR F 369 VAL F 370 
AW 1 VAL F 381 ? VAL F 384 ? VAL F 381 VAL F 384 
AW 2 TYR F 372 ? THR F 376 ? TYR F 372 THR F 376 
AW 3 ILE F 396 ? PRO F 411 ? ILE F 396 PRO F 411 
AW 4 GLN F 438 ? PRO F 446 ? GLN F 438 PRO F 446 
AW 5 VAL F 428 ? HIS F 435 ? VAL F 428 HIS F 435 
AX 1 VAL F 381 ? VAL F 384 ? VAL F 381 VAL F 384 
AX 2 TYR F 372 ? THR F 376 ? TYR F 372 THR F 376 
AX 3 ILE F 396 ? PRO F 411 ? ILE F 396 PRO F 411 
AX 4 SER F 467 ? ALA F 477 ? SER F 467 ALA F 477 
AY 1 GLU F 490 ? ARG F 491 ? GLU F 490 ARG F 491 
AY 2 MET F 480 ? ILE F 487 ? MET F 480 ILE F 487 
AY 3 LEU F 497 ? HIS F 500 ? LEU F 497 HIS F 500 
AZ 1 GLU F 490 ? ARG F 491 ? GLU F 490 ARG F 491 
AZ 2 MET F 480 ? ILE F 487 ? MET F 480 ILE F 487 
AZ 3 ILE F 526 ? ILE F 532 ? ILE F 526 ILE F 532 
AZ 4 HIS F 535 ? VAL F 542 ? HIS F 535 VAL F 542 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N LEU A 61  ? N LEU D 61  O LEU A 73  ? O LEU D 73  
A  2 3 O GLN A 72  ? O GLN D 72  N ARG A 5   ? N ARG D 5   
A  3 4 N SER A 8   ? N SER D 8   O LEU A 99  ? O LEU D 99  
A  4 5 N ALA A 98  ? N ALA D 98  O VAL A 127 ? O VAL D 127 
A  5 6 N LEU A 130 ? N LEU D 130 O VAL A 159 ? O VAL D 159 
B  1 2 O TYR A 232 ? O TYR D 232 N VAL A 223 ? N VAL D 223 
B  2 3 N LYS A 224 ? N LYS D 224 O THR A 275 ? O THR D 275 
B  3 4 O LEU A 274 ? O LEU D 274 N ALA A 193 ? N ALA D 193 
B  4 5 N ASP A 197 ? N ASP D 197 O LEU A 209 ? O LEU D 209 
B  5 6 N ILE A 210 ? N ILE D 210 O GLY A 256 ? O GLY D 256 
B  6 7 O VAL A 259 ? O VAL D 259 N ARG A 236 ? N ARG D 236 
B  7 8 N ILE A 239 ? N ILE D 239 O VAL A 245 ? O VAL D 245 
C  1 2 N LEU A 217 ? N LEU D 217 O LEU A 250 ? O LEU D 250 
D  1 2 N GLU A 329 ? N GLU D 329 O GLY A 337 ? O GLY D 337 
D  2 3 O PHE A 338 ? O PHE D 338 N LEU A 299 ? N LEU D 299 
D  3 4 N PHE A 300 ? N PHE D 300 O ILE A 364 ? O ILE D 364 
E  1 2 N GLU A 329 ? N GLU D 329 O GLY A 337 ? O GLY D 337 
E  2 3 O PHE A 338 ? O PHE D 338 N LEU A 299 ? N LEU D 299 
E  3 4 N TYR A 296 ? N TYR D 296 O THR A 369 ? O THR D 369 
F  1 2 O ILE A 382 ? O ILE D 382 N VAL A 374 ? N VAL D 374 
F  2 3 N GLU A 373 ? N GLU D 373 O ARG A 400 ? O ARG D 400 
F  3 4 N MET A 408 ? N MET D 408 O LEU A 441 ? O LEU D 441 
F  4 5 O ALA A 440 ? O ALA D 440 N VAL A 433 ? N VAL D 433 
G  1 2 O ILE A 382 ? O ILE D 382 N VAL A 374 ? N VAL D 374 
G  2 3 N GLU A 373 ? N GLU D 373 O ARG A 400 ? O ARG D 400 
G  3 4 N ILE A 403 ? N ILE D 403 O ARG A 474 ? O ARG D 474 
H  1 2 O THR A 499 ? O THR D 499 N VAL A 481 ? N VAL D 481 
H  2 3 N ASP A 484 ? N ASP D 484 O ALA A 531 ? O ALA D 531 
H  3 4 N ALA A 530 ? N ALA D 530 O ALA A 538 ? O ALA D 538 
I  1 2 N LEU B 61  ? N LEU A 61  O LEU B 73  ? O LEU A 73  
I  2 3 O ASN B 74  ? O ASN A 74  N ARG B 5   ? N ARG A 5   
I  3 4 N SER B 8   ? N SER A 8   O LEU B 99  ? O LEU A 99  
I  4 5 N ALA B 98  ? N ALA A 98  O VAL B 127 ? O VAL A 127 
I  5 6 N LEU B 130 ? N LEU A 130 O CYS B 161 ? O CYS A 161 
J  1 2 O TYR B 232 ? O TYR A 232 N VAL B 223 ? N VAL A 223 
J  2 3 N LYS B 224 ? N LYS A 224 O THR B 275 ? O THR A 275 
J  3 4 O LEU B 274 ? O LEU A 274 N ALA B 193 ? N ALA A 193 
J  4 5 N ASP B 201 ? N ASP A 201 O GLY B 205 ? O GLY A 205 
J  5 6 N ILE B 210 ? N ILE A 210 O GLY B 256 ? O GLY A 256 
J  6 7 O VAL B 259 ? O VAL A 259 N ARG B 236 ? N ARG A 236 
J  7 8 N LEU B 237 ? N LEU A 237 O ARG B 247 ? O ARG A 247 
K  1 2 N LEU B 217 ? N LEU A 217 O LEU B 250 ? O LEU A 250 
L  1 2 N GLU B 327 ? N GLU A 327 O ARG B 339 ? O ARG A 339 
L  2 3 O PHE B 338 ? O PHE A 338 N LEU B 299 ? N LEU A 299 
L  3 4 N PHE B 300 ? N PHE A 300 O ILE B 364 ? O ILE A 364 
M  1 2 N GLU B 327 ? N GLU A 327 O ARG B 339 ? O ARG A 339 
M  2 3 O PHE B 338 ? O PHE A 338 N LEU B 299 ? N LEU A 299 
M  3 4 N TYR B 296 ? N TYR A 296 O THR B 369 ? O THR A 369 
N  1 2 O ILE B 382 ? O ILE A 382 N VAL B 374 ? N VAL A 374 
N  2 3 N GLU B 375 ? N GLU A 375 O TYR B 397 ? O TYR A 397 
N  3 4 N MET B 408 ? N MET A 408 O LEU B 441 ? O LEU A 441 
N  4 5 O GLN B 438 ? O GLN A 438 N HIS B 435 ? N HIS A 435 
O  1 2 O ILE B 382 ? O ILE A 382 N VAL B 374 ? N VAL A 374 
O  2 3 N GLU B 375 ? N GLU A 375 O TYR B 397 ? O TYR A 397 
O  3 4 N GLU B 401 ? N GLU A 401 O GLN B 476 ? O GLN A 476 
P  1 2 O GLU B 490 ? O GLU A 490 N ILE B 487 ? N ILE A 487 
P  2 3 N VAL B 481 ? N VAL A 481 O THR B 499 ? O THR A 499 
Q  1 2 O GLU B 490 ? O GLU A 490 N ILE B 487 ? N ILE A 487 
Q  2 3 N ASP B 484 ? N ASP A 484 O ALA B 531 ? O ALA A 531 
Q  3 4 N ILE B 526 ? N ILE A 526 O VAL B 542 ? O VAL A 542 
R  1 2 N LEU C 61  ? N LEU B 61  O LEU C 73  ? O LEU B 73  
R  2 3 O ASN C 74  ? O ASN B 74  N ARG C 5   ? N ARG B 5   
R  3 4 N ILE C 10  ? N ILE B 10  O LEU C 99  ? O LEU B 99  
R  4 5 N VAL C 102 ? N VAL B 102 O VAL C 129 ? O VAL B 129 
R  5 6 N LEU C 130 ? N LEU B 130 O CYS C 161 ? O CYS B 161 
S  1 2 O TYR C 232 ? O TYR B 232 N VAL C 223 ? N VAL B 223 
S  2 3 N LYS C 224 ? N LYS B 224 O THR C 275 ? O THR B 275 
S  3 4 O LEU C 274 ? O LEU B 274 N ALA C 193 ? N ALA B 193 
S  4 5 N ASP C 201 ? N ASP B 201 O GLY C 205 ? O GLY B 205 
S  5 6 N ILE C 210 ? N ILE B 210 O GLY C 256 ? O GLY B 256 
S  6 7 O VAL C 259 ? O VAL B 259 N ARG C 236 ? N ARG B 236 
S  7 8 N ILE C 239 ? N ILE B 239 O VAL C 245 ? O VAL B 245 
T  1 2 N LEU C 217 ? N LEU B 217 O LEU C 250 ? O LEU B 250 
U  1 2 N GLU C 327 ? N GLU B 327 O ARG C 339 ? O ARG B 339 
U  2 3 O CYS C 340 ? O CYS B 340 N ALA C 297 ? N ALA B 297 
U  3 4 N PHE C 300 ? N PHE B 300 O ILE C 364 ? O ILE B 364 
V  1 2 N GLU C 327 ? N GLU B 327 O ARG C 339 ? O ARG B 339 
V  2 3 O CYS C 340 ? O CYS B 340 N ALA C 297 ? N ALA B 297 
V  3 4 N TYR C 296 ? N TYR B 296 O THR C 369 ? O THR B 369 
W  1 2 O ILE C 382 ? O ILE B 382 N VAL C 374 ? N VAL B 374 
W  2 3 N GLU C 375 ? N GLU B 375 O GLU C 398 ? O GLU B 398 
W  3 4 N MET C 408 ? N MET B 408 O LEU C 441 ? O LEU B 441 
W  4 5 O GLN C 438 ? O GLN B 438 N HIS C 435 ? N HIS B 435 
X  1 2 O ILE C 382 ? O ILE B 382 N VAL C 374 ? N VAL B 374 
X  2 3 N GLU C 375 ? N GLU B 375 O GLU C 398 ? O GLU B 398 
X  3 4 N ILE C 403 ? N ILE B 403 O ARG C 474 ? O ARG B 474 
Y  1 2 O GLU C 490 ? O GLU B 490 N ILE C 487 ? N ILE B 487 
Y  2 3 N VAL C 481 ? N VAL B 481 O THR C 499 ? O THR B 499 
Z  1 2 O GLU C 490 ? O GLU B 490 N ILE C 487 ? N ILE B 487 
Z  2 3 N ASP C 484 ? N ASP B 484 O ALA C 531 ? O ALA B 531 
Z  3 4 N ALA C 530 ? N ALA B 530 O ALA C 538 ? O ALA B 538 
AA 1 2 N LEU D 61  ? N LEU C 61  O LEU D 73  ? O LEU C 73  
AA 2 3 O ASN D 74  ? O ASN C 74  N PHE D 7   ? N PHE C 7   
AA 3 4 N ILE D 10  ? N ILE C 10  O LEU D 99  ? O LEU C 99  
AA 4 5 N ALA D 98  ? N ALA C 98  O VAL D 127 ? O VAL C 127 
AA 5 6 N LEU D 130 ? N LEU C 130 O VAL D 159 ? O VAL C 159 
AB 1 2 O TYR D 232 ? O TYR C 232 N VAL D 223 ? N VAL C 223 
AB 2 3 N LYS D 224 ? N LYS C 224 O THR D 275 ? O THR C 275 
AB 3 4 O LEU D 274 ? O LEU C 274 N ALA D 193 ? N ALA C 193 
AB 4 5 N ASP D 201 ? N ASP C 201 O GLY D 205 ? O GLY C 205 
AB 5 6 N ILE D 210 ? N ILE C 210 O GLY D 256 ? O GLY C 256 
AB 6 7 O VAL D 259 ? O VAL C 259 N ARG D 236 ? N ARG C 236 
AB 7 8 N LEU D 237 ? N LEU C 237 O ARG D 247 ? O ARG C 247 
AC 1 2 N LEU D 217 ? N LEU C 217 O LEU D 250 ? O LEU C 250 
AD 1 2 N PHE D 325 ? N PHE C 325 O GLY D 341 ? O GLY C 341 
AD 2 3 O PHE D 342 ? O PHE C 342 N VAL D 295 ? N VAL C 295 
AD 3 4 N PHE D 300 ? N PHE C 300 O ILE D 364 ? O ILE C 364 
AE 1 2 N PHE D 325 ? N PHE C 325 O GLY D 341 ? O GLY C 341 
AE 2 3 O PHE D 342 ? O PHE C 342 N VAL D 295 ? N VAL C 295 
AE 3 4 N TYR D 296 ? N TYR C 296 O THR D 369 ? O THR C 369 
AF 1 2 O ILE D 382 ? O ILE C 382 N VAL D 374 ? N VAL C 374 
AF 2 3 N GLU D 373 ? N GLU C 373 O ARG D 400 ? O ARG C 400 
AF 3 4 N MET D 408 ? N MET C 408 O LEU D 441 ? O LEU C 441 
AF 4 5 O ALA D 440 ? O ALA C 440 N VAL D 433 ? N VAL C 433 
AG 1 2 O ILE D 382 ? O ILE C 382 N VAL D 374 ? N VAL C 374 
AG 2 3 N GLU D 373 ? N GLU C 373 O ARG D 400 ? O ARG C 400 
AG 3 4 N GLU D 401 ? N GLU C 401 O GLN D 476 ? O GLN C 476 
AH 1 2 O THR D 499 ? O THR C 499 N VAL D 481 ? N VAL C 481 
AH 2 3 N LEU D 486 ? N LEU C 486 O GLN D 529 ? O GLN C 529 
AH 3 4 N ILE D 532 ? N ILE C 532 O HIS D 535 ? O HIS C 535 
AI 1 2 N TYR E 63  ? N TYR E 63  O TYR E 71  ? O TYR E 71  
AI 2 3 O ASN E 74  ? O ASN E 74  N ARG E 5   ? N ARG E 5   
AI 3 4 N ILE E 10  ? N ILE E 10  O LEU E 99  ? O LEU E 99  
AI 4 5 N ALA E 98  ? N ALA E 98  O VAL E 127 ? O VAL E 127 
AI 5 6 N LEU E 130 ? N LEU E 130 O VAL E 159 ? O VAL E 159 
AJ 1 2 O TYR E 232 ? O TYR E 232 N VAL E 223 ? N VAL E 223 
AJ 2 3 N LYS E 224 ? N LYS E 224 O THR E 275 ? O THR E 275 
AJ 3 4 O LEU E 274 ? O LEU E 274 N ALA E 193 ? N ALA E 193 
AJ 4 5 N ASP E 197 ? N ASP E 197 O LEU E 209 ? O LEU E 209 
AJ 5 6 N ILE E 210 ? N ILE E 210 O GLY E 256 ? O GLY E 256 
AJ 6 7 O VAL E 259 ? O VAL E 259 N ARG E 236 ? N ARG E 236 
AJ 7 8 N ILE E 239 ? N ILE E 239 O VAL E 245 ? O VAL E 245 
AK 1 2 N LEU E 217 ? N LEU E 217 O LEU E 250 ? O LEU E 250 
AL 1 2 N GLU E 327 ? N GLU E 327 O ARG E 339 ? O ARG E 339 
AL 2 3 O PHE E 338 ? O PHE E 338 N LEU E 299 ? N LEU E 299 
AL 3 4 N PHE E 300 ? N PHE E 300 O ILE E 364 ? O ILE E 364 
AM 1 2 N GLU E 327 ? N GLU E 327 O ARG E 339 ? O ARG E 339 
AM 2 3 O PHE E 338 ? O PHE E 338 N LEU E 299 ? N LEU E 299 
AM 3 4 N TYR E 296 ? N TYR E 296 O THR E 369 ? O THR E 369 
AN 1 2 O ILE E 382 ? O ILE E 382 N VAL E 374 ? N VAL E 374 
AN 2 3 N GLU E 373 ? N GLU E 373 O ARG E 400 ? O ARG E 400 
AN 3 4 N MET E 408 ? N MET E 408 O LEU E 441 ? O LEU E 441 
AN 4 5 O ALA E 440 ? O ALA E 440 N VAL E 433 ? N VAL E 433 
AO 1 2 O ILE E 382 ? O ILE E 382 N VAL E 374 ? N VAL E 374 
AO 2 3 N GLU E 373 ? N GLU E 373 O ARG E 400 ? O ARG E 400 
AO 3 4 N ILE E 403 ? N ILE E 403 O ARG E 474 ? O ARG E 474 
AP 1 2 O GLU E 490 ? O GLU E 490 N ILE E 487 ? N ILE E 487 
AP 2 3 N VAL E 481 ? N VAL E 481 O THR E 499 ? O THR E 499 
AQ 1 2 O GLU E 490 ? O GLU E 490 N ILE E 487 ? N ILE E 487 
AQ 2 3 N ASP E 484 ? N ASP E 484 O ALA E 531 ? O ALA E 531 
AQ 3 4 N ALA E 530 ? N ALA E 530 O ALA E 538 ? O ALA E 538 
AR 1 2 N LEU F 61  ? N LEU F 61  O LEU F 73  ? O LEU F 73  
AR 2 3 O GLN F 72  ? O GLN F 72  N ARG F 5   ? N ARG F 5   
AR 3 4 N ILE F 10  ? N ILE F 10  O LEU F 99  ? O LEU F 99  
AR 4 5 N ALA F 98  ? N ALA F 98  O GLU F 125 ? O GLU F 125 
AR 5 6 N LEU F 130 ? N LEU F 130 O VAL F 159 ? O VAL F 159 
AS 1 2 O TYR F 232 ? O TYR F 232 N VAL F 223 ? N VAL F 223 
AS 2 3 N LYS F 224 ? N LYS F 224 O THR F 275 ? O THR F 275 
AS 3 4 O LEU F 274 ? O LEU F 274 N ALA F 193 ? N ALA F 193 
AS 4 5 N GLN F 192 ? N GLN F 192 O LYS F 213 ? O LYS F 213 
AS 5 6 N ILE F 210 ? N ILE F 210 O GLY F 256 ? O GLY F 256 
AS 6 7 O VAL F 259 ? O VAL F 259 N ARG F 236 ? N ARG F 236 
AS 7 8 N ILE F 239 ? N ILE F 239 O VAL F 245 ? O VAL F 245 
AT 1 2 N LEU F 217 ? N LEU F 217 O LEU F 250 ? O LEU F 250 
AU 1 2 N GLU F 329 ? N GLU F 329 O GLY F 337 ? O GLY F 337 
AU 2 3 O PHE F 342 ? O PHE F 342 N VAL F 295 ? N VAL F 295 
AU 3 4 N PHE F 300 ? N PHE F 300 O ILE F 364 ? O ILE F 364 
AV 1 2 N GLU F 329 ? N GLU F 329 O GLY F 337 ? O GLY F 337 
AV 2 3 O PHE F 342 ? O PHE F 342 N VAL F 295 ? N VAL F 295 
AV 3 4 N TYR F 296 ? N TYR F 296 O THR F 369 ? O THR F 369 
AW 1 2 O ILE F 382 ? O ILE F 382 N VAL F 374 ? N VAL F 374 
AW 2 3 N GLU F 375 ? N GLU F 375 O GLU F 398 ? O GLU F 398 
AW 3 4 N MET F 408 ? N MET F 408 O LEU F 441 ? O LEU F 441 
AW 4 5 O ALA F 440 ? O ALA F 440 N VAL F 433 ? N VAL F 433 
AX 1 2 O ILE F 382 ? O ILE F 382 N VAL F 374 ? N VAL F 374 
AX 2 3 N GLU F 375 ? N GLU F 375 O GLU F 398 ? O GLU F 398 
AX 3 4 N ILE F 403 ? N ILE F 403 O ARG F 474 ? O ARG F 474 
AY 1 2 O GLU F 490 ? O GLU F 490 N ILE F 487 ? N ILE F 487 
AY 2 3 N VAL F 483 ? N VAL F 483 O LEU F 497 ? O LEU F 497 
AZ 1 2 O GLU F 490 ? O GLU F 490 N ILE F 487 ? N ILE F 487 
AZ 2 3 N ASP F 484 ? N ASP F 484 O ALA F 531 ? O ALA F 531 
AZ 3 4 N ILE F 528 ? N ILE F 528 O SER F 540 ? O SER F 540 
# 
_database_PDB_matrix.entry_id          3CB4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3CB4 
_atom_sites.fract_transf_matrix[1][1]   0.010208 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001911 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006838 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007303 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . MET A 1 1   ? 45.703  46.363  28.806  1.00 53.66 ? 1   MET D N   1 
ATOM   2     C CA  . MET A 1 1   ? 45.721  46.905  30.195  1.00 53.65 ? 1   MET D CA  1 
ATOM   3     C C   . MET A 1 1   ? 46.946  46.428  30.963  1.00 53.83 ? 1   MET D C   1 
ATOM   4     O O   . MET A 1 1   ? 47.589  47.207  31.670  1.00 53.95 ? 1   MET D O   1 
ATOM   5     C CB  . MET A 1 1   ? 44.449  46.516  30.950  1.00 53.55 ? 1   MET D CB  1 
ATOM   6     C CG  . MET A 1 1   ? 43.167  47.055  30.337  1.00 53.64 ? 1   MET D CG  1 
ATOM   7     S SD  . MET A 1 1   ? 41.729  46.875  31.412  1.00 53.29 ? 1   MET D SD  1 
ATOM   8     C CE  . MET A 1 1   ? 42.069  48.140  32.630  1.00 53.68 ? 1   MET D CE  1 
ATOM   9     N N   . LYS A 1 2   ? 47.270  45.147  30.805  1.00 53.95 ? 2   LYS D N   1 
ATOM   10    C CA  . LYS A 1 2   ? 48.332  44.503  31.577  1.00 54.05 ? 2   LYS D CA  1 
ATOM   11    C C   . LYS A 1 2   ? 49.734  45.057  31.297  1.00 54.08 ? 2   LYS D C   1 
ATOM   12    O O   . LYS A 1 2   ? 50.677  44.798  32.058  1.00 54.06 ? 2   LYS D O   1 
ATOM   13    C CB  . LYS A 1 2   ? 48.281  42.982  31.385  1.00 54.13 ? 2   LYS D CB  1 
ATOM   14    C CG  . LYS A 1 2   ? 47.056  42.331  32.047  1.00 54.29 ? 2   LYS D CG  1 
ATOM   15    C CD  . LYS A 1 2   ? 47.143  40.806  32.077  1.00 54.16 ? 2   LYS D CD  1 
ATOM   16    C CE  . LYS A 1 2   ? 46.729  40.188  30.748  1.00 54.22 ? 2   LYS D CE  1 
ATOM   17    N NZ  . LYS A 1 2   ? 46.549  38.718  30.864  1.00 53.86 ? 2   LYS D NZ  1 
ATOM   18    N N   . ASN A 1 3   ? 49.856  45.831  30.217  1.00 54.02 ? 3   ASN D N   1 
ATOM   19    C CA  . ASN A 1 3   ? 51.114  46.483  29.861  1.00 53.83 ? 3   ASN D CA  1 
ATOM   20    C C   . ASN A 1 3   ? 51.097  47.994  30.082  1.00 53.63 ? 3   ASN D C   1 
ATOM   21    O O   . ASN A 1 3   ? 52.000  48.700  29.630  1.00 53.68 ? 3   ASN D O   1 
ATOM   22    C CB  . ASN A 1 3   ? 51.502  46.163  28.413  1.00 53.99 ? 3   ASN D CB  1 
ATOM   23    C CG  . ASN A 1 3   ? 51.831  44.694  28.204  1.00 54.19 ? 3   ASN D CG  1 
ATOM   24    O OD1 . ASN A 1 3   ? 50.946  43.841  28.245  1.00 54.88 ? 3   ASN D OD1 1 
ATOM   25    N ND2 . ASN A 1 3   ? 53.108  44.394  27.968  1.00 53.84 ? 3   ASN D ND2 1 
ATOM   26    N N   . ILE A 1 4   ? 50.077  48.486  30.777  1.00 53.34 ? 4   ILE D N   1 
ATOM   27    C CA  . ILE A 1 4   ? 49.960  49.917  31.062  1.00 53.19 ? 4   ILE D CA  1 
ATOM   28    C C   . ILE A 1 4   ? 50.420  50.219  32.490  1.00 53.32 ? 4   ILE D C   1 
ATOM   29    O O   . ILE A 1 4   ? 50.169  49.438  33.405  1.00 53.49 ? 4   ILE D O   1 
ATOM   30    C CB  . ILE A 1 4   ? 48.507  50.431  30.841  1.00 53.16 ? 4   ILE D CB  1 
ATOM   31    C CG1 . ILE A 1 4   ? 48.032  50.116  29.420  1.00 52.82 ? 4   ILE D CG1 1 
ATOM   32    C CG2 . ILE A 1 4   ? 48.402  51.929  31.117  1.00 52.99 ? 4   ILE D CG2 1 
ATOM   33    C CD1 . ILE A 1 4   ? 46.570  50.428  29.168  1.00 52.92 ? 4   ILE D CD1 1 
ATOM   34    N N   . ARG A 1 5   ? 51.109  51.345  32.670  1.00 53.33 ? 5   ARG D N   1 
ATOM   35    C CA  . ARG A 1 5   ? 51.510  51.813  34.001  1.00 53.29 ? 5   ARG D CA  1 
ATOM   36    C C   . ARG A 1 5   ? 51.199  53.300  34.154  1.00 53.20 ? 5   ARG D C   1 
ATOM   37    O O   . ARG A 1 5   ? 51.897  54.148  33.598  1.00 53.26 ? 5   ARG D O   1 
ATOM   38    C CB  . ARG A 1 5   ? 53.007  51.571  34.258  1.00 53.27 ? 5   ARG D CB  1 
ATOM   39    C CG  . ARG A 1 5   ? 53.485  50.132  34.093  1.00 53.38 ? 5   ARG D CG  1 
ATOM   40    C CD  . ARG A 1 5   ? 53.140  49.278  35.295  1.00 53.66 ? 5   ARG D CD  1 
ATOM   41    N NE  . ARG A 1 5   ? 53.575  47.889  35.139  1.00 53.97 ? 5   ARG D NE  1 
ATOM   42    C CZ  . ARG A 1 5   ? 52.880  46.939  34.513  1.00 54.08 ? 5   ARG D CZ  1 
ATOM   43    N NH1 . ARG A 1 5   ? 51.703  47.213  33.962  1.00 54.12 ? 5   ARG D NH1 1 
ATOM   44    N NH2 . ARG A 1 5   ? 53.367  45.709  34.432  1.00 53.77 ? 5   ARG D NH2 1 
ATOM   45    N N   . ASN A 1 6   ? 50.144  53.608  34.901  1.00 53.12 ? 6   ASN D N   1 
ATOM   46    C CA  . ASN A 1 6   ? 49.760  54.992  35.160  1.00 53.04 ? 6   ASN D CA  1 
ATOM   47    C C   . ASN A 1 6   ? 50.291  55.448  36.508  1.00 53.03 ? 6   ASN D C   1 
ATOM   48    O O   . ASN A 1 6   ? 49.930  54.890  37.550  1.00 53.07 ? 6   ASN D O   1 
ATOM   49    C CB  . ASN A 1 6   ? 48.240  55.163  35.108  1.00 53.04 ? 6   ASN D CB  1 
ATOM   50    C CG  . ASN A 1 6   ? 47.615  54.492  33.900  1.00 53.16 ? 6   ASN D CG  1 
ATOM   51    O OD1 . ASN A 1 6   ? 48.060  54.678  32.767  1.00 53.40 ? 6   ASN D OD1 1 
ATOM   52    N ND2 . ASN A 1 6   ? 46.573  53.706  34.140  1.00 53.02 ? 6   ASN D ND2 1 
ATOM   53    N N   . PHE A 1 7   ? 51.148  56.465  36.481  1.00 52.94 ? 7   PHE D N   1 
ATOM   54    C CA  . PHE A 1 7   ? 51.812  56.954  37.685  1.00 52.78 ? 7   PHE D CA  1 
ATOM   55    C C   . PHE A 1 7   ? 51.937  58.462  37.655  1.00 52.82 ? 7   PHE D C   1 
ATOM   56    O O   . PHE A 1 7   ? 51.868  59.062  36.594  1.00 52.80 ? 7   PHE D O   1 
ATOM   57    C CB  . PHE A 1 7   ? 53.199  56.327  37.818  1.00 52.74 ? 7   PHE D CB  1 
ATOM   58    C CG  . PHE A 1 7   ? 54.128  56.652  36.680  1.00 52.58 ? 7   PHE D CG  1 
ATOM   59    C CD1 . PHE A 1 7   ? 54.043  55.963  35.475  1.00 52.16 ? 7   PHE D CD1 1 
ATOM   60    C CD2 . PHE A 1 7   ? 55.097  57.639  36.819  1.00 52.56 ? 7   PHE D CD2 1 
ATOM   61    C CE1 . PHE A 1 7   ? 54.899  56.256  34.427  1.00 52.29 ? 7   PHE D CE1 1 
ATOM   62    C CE2 . PHE A 1 7   ? 55.963  57.940  35.775  1.00 52.45 ? 7   PHE D CE2 1 
ATOM   63    C CZ  . PHE A 1 7   ? 55.863  57.247  34.575  1.00 52.54 ? 7   PHE D CZ  1 
ATOM   64    N N   . SER A 1 8   ? 52.106  59.072  38.824  1.00 52.97 ? 8   SER D N   1 
ATOM   65    C CA  . SER A 1 8   ? 52.413  60.500  38.897  1.00 53.20 ? 8   SER D CA  1 
ATOM   66    C C   . SER A 1 8   ? 53.753  60.740  39.590  1.00 53.26 ? 8   SER D C   1 
ATOM   67    O O   . SER A 1 8   ? 54.313  59.833  40.209  1.00 53.30 ? 8   SER D O   1 
ATOM   68    C CB  . SER A 1 8   ? 51.283  61.291  39.566  1.00 53.18 ? 8   SER D CB  1 
ATOM   69    O OG  . SER A 1 8   ? 50.752  60.603  40.680  1.00 53.69 ? 8   SER D OG  1 
ATOM   70    N N   . ILE A 1 9   ? 54.269  61.959  39.467  1.00 53.25 ? 9   ILE D N   1 
ATOM   71    C CA  . ILE A 1 9   ? 55.581  62.291  40.003  1.00 53.28 ? 9   ILE D CA  1 
ATOM   72    C C   . ILE A 1 9   ? 55.442  63.361  41.077  1.00 53.44 ? 9   ILE D C   1 
ATOM   73    O O   . ILE A 1 9   ? 54.819  64.398  40.849  1.00 53.58 ? 9   ILE D O   1 
ATOM   74    C CB  . ILE A 1 9   ? 56.544  62.748  38.875  1.00 53.27 ? 9   ILE D CB  1 
ATOM   75    C CG1 . ILE A 1 9   ? 56.825  61.579  37.928  1.00 53.26 ? 9   ILE D CG1 1 
ATOM   76    C CG2 . ILE A 1 9   ? 57.854  63.297  39.444  1.00 53.17 ? 9   ILE D CG2 1 
ATOM   77    C CD1 . ILE A 1 9   ? 57.371  61.979  36.586  1.00 52.99 ? 9   ILE D CD1 1 
ATOM   78    N N   . ILE A 1 10  ? 56.007  63.091  42.250  1.00 53.61 ? 10  ILE D N   1 
ATOM   79    C CA  . ILE A 1 10  ? 56.031  64.065  43.333  1.00 53.97 ? 10  ILE D CA  1 
ATOM   80    C C   . ILE A 1 10  ? 57.478  64.454  43.633  1.00 54.34 ? 10  ILE D C   1 
ATOM   81    O O   . ILE A 1 10  ? 58.249  63.646  44.153  1.00 54.39 ? 10  ILE D O   1 
ATOM   82    C CB  . ILE A 1 10  ? 55.333  63.544  44.616  1.00 53.94 ? 10  ILE D CB  1 
ATOM   83    C CG1 . ILE A 1 10  ? 54.173  62.603  44.275  1.00 53.66 ? 10  ILE D CG1 1 
ATOM   84    C CG2 . ILE A 1 10  ? 54.847  64.718  45.465  1.00 53.94 ? 10  ILE D CG2 1 
ATOM   85    C CD1 . ILE A 1 10  ? 53.737  61.715  45.420  1.00 53.44 ? 10  ILE D CD1 1 
ATOM   86    N N   . ALA A 1 11  ? 57.834  65.691  43.283  1.00 54.90 ? 11  ALA D N   1 
ATOM   87    C CA  . ALA A 1 11  ? 59.194  66.222  43.458  1.00 55.32 ? 11  ALA D CA  1 
ATOM   88    C C   . ALA A 1 11  ? 59.165  67.696  43.882  1.00 55.61 ? 11  ALA D C   1 
ATOM   89    O O   . ALA A 1 11  ? 58.101  68.223  44.208  1.00 55.53 ? 11  ALA D O   1 
ATOM   90    C CB  . ALA A 1 11  ? 60.005  66.043  42.170  1.00 55.28 ? 11  ALA D CB  1 
ATOM   91    N N   . HIS A 1 12  ? 60.326  68.357  43.872  1.00 56.11 ? 12  HIS D N   1 
ATOM   92    C CA  . HIS A 1 12  ? 60.409  69.768  44.278  1.00 56.53 ? 12  HIS D CA  1 
ATOM   93    C C   . HIS A 1 12  ? 61.149  70.710  43.305  1.00 56.82 ? 12  HIS D C   1 
ATOM   94    O O   . HIS A 1 12  ? 60.515  71.547  42.649  1.00 56.81 ? 12  HIS D O   1 
ATOM   95    C CB  . HIS A 1 12  ? 60.977  69.896  45.694  1.00 56.46 ? 12  HIS D CB  1 
ATOM   96    C CG  . HIS A 1 12  ? 60.822  71.265  46.272  1.00 56.51 ? 12  HIS D CG  1 
ATOM   97    N ND1 . HIS A 1 12  ? 61.790  72.238  46.150  1.00 56.58 ? 12  HIS D ND1 1 
ATOM   98    C CD2 . HIS A 1 12  ? 59.798  71.834  46.951  1.00 56.37 ? 12  HIS D CD2 1 
ATOM   99    C CE1 . HIS A 1 12  ? 61.374  73.345  46.740  1.00 56.52 ? 12  HIS D CE1 1 
ATOM   100   N NE2 . HIS A 1 12  ? 60.169  73.126  47.234  1.00 56.39 ? 12  HIS D NE2 1 
ATOM   101   N N   . ILE A 1 13  ? 62.478  70.590  43.234  1.00 57.13 ? 13  ILE D N   1 
ATOM   102   C CA  . ILE A 1 13  ? 63.297  71.447  42.357  1.00 57.33 ? 13  ILE D CA  1 
ATOM   103   C C   . ILE A 1 13  ? 63.253  70.975  40.898  1.00 57.42 ? 13  ILE D C   1 
ATOM   104   O O   . ILE A 1 13  ? 63.069  71.775  39.977  1.00 57.54 ? 13  ILE D O   1 
ATOM   105   C CB  . ILE A 1 13  ? 64.778  71.576  42.861  1.00 57.36 ? 13  ILE D CB  1 
ATOM   106   C CG1 . ILE A 1 13  ? 65.585  72.532  41.963  1.00 57.39 ? 13  ILE D CG1 1 
ATOM   107   C CG2 . ILE A 1 13  ? 65.450  70.197  42.981  1.00 57.45 ? 13  ILE D CG2 1 
ATOM   108   C CD1 . ILE A 1 13  ? 66.933  72.966  42.532  1.00 57.30 ? 13  ILE D CD1 1 
ATOM   109   N N   . SER A 1 18  ? 67.281  69.702  34.214  1.00 60.54 ? 18  SER D N   1 
ATOM   110   C CA  . SER A 1 18  ? 66.212  68.846  33.710  1.00 60.53 ? 18  SER D CA  1 
ATOM   111   C C   . SER A 1 18  ? 65.535  68.114  34.861  1.00 60.46 ? 18  SER D C   1 
ATOM   112   O O   . SER A 1 18  ? 66.200  67.446  35.654  1.00 60.59 ? 18  SER D O   1 
ATOM   113   C CB  . SER A 1 18  ? 66.761  67.813  32.717  1.00 60.45 ? 18  SER D CB  1 
ATOM   114   O OG  . SER A 1 18  ? 67.722  68.374  31.844  1.00 60.77 ? 18  SER D OG  1 
ATOM   115   N N   . THR A 1 19  ? 64.214  68.242  34.952  1.00 60.32 ? 19  THR D N   1 
ATOM   116   C CA  . THR A 1 19  ? 63.430  67.448  35.900  1.00 60.21 ? 19  THR D CA  1 
ATOM   117   C C   . THR A 1 19  ? 63.345  65.999  35.420  1.00 59.95 ? 19  THR D C   1 
ATOM   118   O O   . THR A 1 19  ? 63.487  65.727  34.223  1.00 59.95 ? 19  THR D O   1 
ATOM   119   C CB  . THR A 1 19  ? 62.007  68.011  36.076  1.00 60.29 ? 19  THR D CB  1 
ATOM   120   O OG1 . THR A 1 19  ? 61.401  68.195  34.789  1.00 60.40 ? 19  THR D OG1 1 
ATOM   121   C CG2 . THR A 1 19  ? 62.047  69.343  36.818  1.00 60.41 ? 19  THR D CG2 1 
ATOM   122   N N   . LEU A 1 20  ? 63.113  65.073  36.348  1.00 59.61 ? 20  LEU D N   1 
ATOM   123   C CA  . LEU A 1 20  ? 63.035  63.654  36.001  1.00 59.32 ? 20  LEU D CA  1 
ATOM   124   C C   . LEU A 1 20  ? 61.974  63.403  34.933  1.00 59.19 ? 20  LEU D C   1 
ATOM   125   O O   . LEU A 1 20  ? 62.124  62.510  34.098  1.00 59.21 ? 20  LEU D O   1 
ATOM   126   C CB  . LEU A 1 20  ? 62.772  62.787  37.238  1.00 59.34 ? 20  LEU D CB  1 
ATOM   127   C CG  . LEU A 1 20  ? 62.978  61.278  37.033  1.00 59.30 ? 20  LEU D CG  1 
ATOM   128   C CD1 . LEU A 1 20  ? 64.458  60.924  36.987  1.00 59.28 ? 20  LEU D CD1 1 
ATOM   129   C CD2 . LEU A 1 20  ? 62.266  60.463  38.097  1.00 59.10 ? 20  LEU D CD2 1 
ATOM   130   N N   . SER A 1 21  ? 60.912  64.205  34.966  1.00 58.99 ? 21  SER D N   1 
ATOM   131   C CA  . SER A 1 21  ? 59.867  64.177  33.948  1.00 58.72 ? 21  SER D CA  1 
ATOM   132   C C   . SER A 1 21  ? 60.455  64.291  32.539  1.00 58.47 ? 21  SER D C   1 
ATOM   133   O O   . SER A 1 21  ? 60.154  63.474  31.672  1.00 58.44 ? 21  SER D O   1 
ATOM   134   C CB  . SER A 1 21  ? 58.855  65.296  34.208  1.00 58.78 ? 21  SER D CB  1 
ATOM   135   O OG  . SER A 1 21  ? 58.106  65.602  33.044  1.00 59.00 ? 21  SER D OG  1 
ATOM   136   N N   . ASP A 1 22  ? 61.309  65.290  32.330  1.00 58.20 ? 22  ASP D N   1 
ATOM   137   C CA  . ASP A 1 22  ? 61.916  65.529  31.020  1.00 58.04 ? 22  ASP D CA  1 
ATOM   138   C C   . ASP A 1 22  ? 62.909  64.443  30.588  1.00 57.78 ? 22  ASP D C   1 
ATOM   139   O O   . ASP A 1 22  ? 62.954  64.082  29.412  1.00 57.80 ? 22  ASP D O   1 
ATOM   140   C CB  . ASP A 1 22  ? 62.578  66.911  30.969  1.00 58.11 ? 22  ASP D CB  1 
ATOM   141   C CG  . ASP A 1 22  ? 61.565  68.047  30.953  1.00 58.62 ? 22  ASP D CG  1 
ATOM   142   O OD1 . ASP A 1 22  ? 60.526  67.949  31.650  1.00 59.42 ? 22  ASP D OD1 1 
ATOM   143   O OD2 . ASP A 1 22  ? 61.812  69.046  30.243  1.00 58.88 ? 22  ASP D OD2 1 
ATOM   144   N N   . ARG A 1 23  ? 63.699  63.927  31.527  1.00 57.38 ? 23  ARG D N   1 
ATOM   145   C CA  . ARG A 1 23  ? 64.667  62.878  31.202  1.00 57.06 ? 23  ARG D CA  1 
ATOM   146   C C   . ARG A 1 23  ? 64.004  61.549  30.819  1.00 56.96 ? 23  ARG D C   1 
ATOM   147   O O   . ARG A 1 23  ? 64.527  60.816  29.971  1.00 56.95 ? 23  ARG D O   1 
ATOM   148   C CB  . ARG A 1 23  ? 65.682  62.669  32.331  1.00 57.08 ? 23  ARG D CB  1 
ATOM   149   C CG  . ARG A 1 23  ? 66.807  63.697  32.366  1.00 56.67 ? 23  ARG D CG  1 
ATOM   150   C CD  . ARG A 1 23  ? 66.821  64.463  33.667  1.00 56.24 ? 23  ARG D CD  1 
ATOM   151   N NE  . ARG A 1 23  ? 67.300  63.629  34.765  1.00 55.73 ? 23  ARG D NE  1 
ATOM   152   C CZ  . ARG A 1 23  ? 67.038  63.849  36.050  1.00 55.36 ? 23  ARG D CZ  1 
ATOM   153   N NH1 . ARG A 1 23  ? 66.297  64.885  36.419  1.00 55.25 ? 23  ARG D NH1 1 
ATOM   154   N NH2 . ARG A 1 23  ? 67.519  63.026  36.967  1.00 54.67 ? 23  ARG D NH2 1 
ATOM   155   N N   . ILE A 1 24  ? 62.864  61.244  31.443  1.00 56.72 ? 24  ILE D N   1 
ATOM   156   C CA  . ILE A 1 24  ? 62.070  60.066  31.079  1.00 56.45 ? 24  ILE D CA  1 
ATOM   157   C C   . ILE A 1 24  ? 61.644  60.162  29.614  1.00 56.38 ? 24  ILE D C   1 
ATOM   158   O O   . ILE A 1 24  ? 61.866  59.232  28.831  1.00 56.41 ? 24  ILE D O   1 
ATOM   159   C CB  . ILE A 1 24  ? 60.826  59.893  31.986  1.00 56.35 ? 24  ILE D CB  1 
ATOM   160   C CG1 . ILE A 1 24  ? 61.250  59.493  33.400  1.00 56.42 ? 24  ILE D CG1 1 
ATOM   161   C CG2 . ILE A 1 24  ? 59.876  58.844  31.410  1.00 56.13 ? 24  ILE D CG2 1 
ATOM   162   C CD1 . ILE A 1 24  ? 60.112  59.438  34.404  1.00 56.47 ? 24  ILE D CD1 1 
ATOM   163   N N   . ILE A 1 25  ? 61.060  61.306  29.255  1.00 56.15 ? 25  ILE D N   1 
ATOM   164   C CA  . ILE A 1 25  ? 60.615  61.583  27.889  1.00 55.97 ? 25  ILE D CA  1 
ATOM   165   C C   . ILE A 1 25  ? 61.711  61.309  26.854  1.00 55.90 ? 25  ILE D C   1 
ATOM   166   O O   . ILE A 1 25  ? 61.432  60.762  25.790  1.00 55.95 ? 25  ILE D O   1 
ATOM   167   C CB  . ILE A 1 25  ? 60.088  63.034  27.755  1.00 55.90 ? 25  ILE D CB  1 
ATOM   168   C CG1 . ILE A 1 25  ? 58.852  63.234  28.639  1.00 55.88 ? 25  ILE D CG1 1 
ATOM   169   C CG2 . ILE A 1 25  ? 59.747  63.361  26.306  1.00 55.99 ? 25  ILE D CG2 1 
ATOM   170   C CD1 . ILE A 1 25  ? 58.574  64.684  28.993  1.00 56.15 ? 25  ILE D CD1 1 
ATOM   171   N N   . GLN A 1 26  ? 62.950  61.673  27.182  1.00 55.91 ? 26  GLN D N   1 
ATOM   172   C CA  . GLN A 1 26  ? 64.081  61.528  26.263  1.00 56.01 ? 26  GLN D CA  1 
ATOM   173   C C   . GLN A 1 26  ? 64.477  60.082  26.004  1.00 56.13 ? 26  GLN D C   1 
ATOM   174   O O   . GLN A 1 26  ? 64.852  59.733  24.885  1.00 56.15 ? 26  GLN D O   1 
ATOM   175   C CB  . GLN A 1 26  ? 65.292  62.316  26.759  1.00 55.99 ? 26  GLN D CB  1 
ATOM   176   C CG  . GLN A 1 26  ? 65.248  63.790  26.407  1.00 56.17 ? 26  GLN D CG  1 
ATOM   177   C CD  . GLN A 1 26  ? 66.259  64.600  27.185  1.00 56.55 ? 26  GLN D CD  1 
ATOM   178   O OE1 . GLN A 1 26  ? 67.470  64.452  27.006  1.00 56.83 ? 26  GLN D OE1 1 
ATOM   179   N NE2 . GLN A 1 26  ? 65.766  65.471  28.056  1.00 56.56 ? 26  GLN D NE2 1 
ATOM   180   N N   . ILE A 1 27  ? 64.402  59.247  27.036  1.00 56.38 ? 27  ILE D N   1 
ATOM   181   C CA  . ILE A 1 27  ? 64.743  57.830  26.890  1.00 56.65 ? 27  ILE D CA  1 
ATOM   182   C C   . ILE A 1 27  ? 63.567  57.022  26.310  1.00 56.79 ? 27  ILE D C   1 
ATOM   183   O O   . ILE A 1 27  ? 63.676  55.813  26.082  1.00 56.81 ? 27  ILE D O   1 
ATOM   184   C CB  . ILE A 1 27  ? 65.299  57.210  28.210  1.00 56.53 ? 27  ILE D CB  1 
ATOM   185   C CG1 . ILE A 1 27  ? 64.180  56.917  29.205  1.00 56.62 ? 27  ILE D CG1 1 
ATOM   186   C CG2 . ILE A 1 27  ? 66.340  58.125  28.840  1.00 56.35 ? 27  ILE D CG2 1 
ATOM   187   C CD1 . ILE A 1 27  ? 64.651  56.162  30.424  1.00 56.95 ? 27  ILE D CD1 1 
ATOM   188   N N   . CYS A 1 28  ? 62.449  57.709  26.079  1.00 56.97 ? 28  CYS D N   1 
ATOM   189   C CA  . CYS A 1 28  ? 61.316  57.153  25.343  1.00 57.32 ? 28  CYS D CA  1 
ATOM   190   C C   . CYS A 1 28  ? 61.037  58.024  24.111  1.00 57.54 ? 28  CYS D C   1 
ATOM   191   O O   . CYS A 1 28  ? 61.976  58.521  23.485  1.00 57.52 ? 28  CYS D O   1 
ATOM   192   C CB  . CYS A 1 28  ? 60.092  57.047  26.250  1.00 57.31 ? 28  CYS D CB  1 
ATOM   193   S SG  . CYS A 1 28  ? 60.340  55.961  27.679  1.00 57.77 ? 28  CYS D SG  1 
ATOM   194   N N   . GLY A 1 29  ? 59.762  58.206  23.762  1.00 57.77 ? 29  GLY D N   1 
ATOM   195   C CA  . GLY A 1 29  ? 59.362  59.088  22.654  1.00 58.01 ? 29  GLY D CA  1 
ATOM   196   C C   . GLY A 1 29  ? 60.481  59.912  22.030  1.00 58.09 ? 29  GLY D C   1 
ATOM   197   O O   . GLY A 1 29  ? 61.029  59.534  20.989  1.00 58.25 ? 29  GLY D O   1 
ATOM   198   N N   . GLY A 1 30  ? 60.825  61.032  22.668  1.00 58.10 ? 30  GLY D N   1 
ATOM   199   C CA  . GLY A 1 30  ? 61.908  61.899  22.189  1.00 58.07 ? 30  GLY D CA  1 
ATOM   200   C C   . GLY A 1 30  ? 61.798  63.335  22.666  1.00 57.96 ? 30  GLY D C   1 
ATOM   201   O O   . GLY A 1 30  ? 60.746  63.963  22.536  1.00 57.94 ? 30  GLY D O   1 
ATOM   202   N N   . GLN A 1 57  ? 52.253  68.486  31.262  1.00 61.41 ? 57  GLN D N   1 
ATOM   203   C CA  . GLN A 1 57  ? 51.142  68.281  32.188  1.00 61.36 ? 57  GLN D CA  1 
ATOM   204   C C   . GLN A 1 57  ? 50.770  66.796  32.312  1.00 61.08 ? 57  GLN D C   1 
ATOM   205   O O   . GLN A 1 57  ? 50.580  66.287  33.422  1.00 61.18 ? 57  GLN D O   1 
ATOM   206   C CB  . GLN A 1 57  ? 49.927  69.101  31.751  1.00 61.47 ? 57  GLN D CB  1 
ATOM   207   C CG  . GLN A 1 57  ? 48.880  69.290  32.842  1.00 62.08 ? 57  GLN D CG  1 
ATOM   208   C CD  . GLN A 1 57  ? 47.457  69.319  32.298  1.00 62.84 ? 57  GLN D CD  1 
ATOM   209   O OE1 . GLN A 1 57  ? 46.553  68.719  32.882  1.00 63.13 ? 57  GLN D OE1 1 
ATOM   210   N NE2 . GLN A 1 57  ? 47.252  70.011  31.175  1.00 62.74 ? 57  GLN D NE2 1 
ATOM   211   N N   . SER A 1 58  ? 50.652  66.121  31.168  1.00 60.62 ? 58  SER D N   1 
ATOM   212   C CA  . SER A 1 58  ? 50.453  64.669  31.112  1.00 60.04 ? 58  SER D CA  1 
ATOM   213   C C   . SER A 1 58  ? 51.115  64.096  29.860  1.00 59.50 ? 58  SER D C   1 
ATOM   214   O O   . SER A 1 58  ? 51.065  64.705  28.791  1.00 59.29 ? 58  SER D O   1 
ATOM   215   C CB  . SER A 1 58  ? 48.964  64.311  31.128  1.00 60.15 ? 58  SER D CB  1 
ATOM   216   O OG  . SER A 1 58  ? 48.420  64.294  29.817  1.00 60.20 ? 58  SER D OG  1 
ATOM   217   N N   . VAL A 1 59  ? 51.734  62.927  29.996  1.00 58.93 ? 59  VAL D N   1 
ATOM   218   C CA  . VAL A 1 59  ? 52.464  62.318  28.886  1.00 58.35 ? 59  VAL D CA  1 
ATOM   219   C C   . VAL A 1 59  ? 52.164  60.823  28.763  1.00 57.85 ? 59  VAL D C   1 
ATOM   220   O O   . VAL A 1 59  ? 51.936  60.140  29.761  1.00 57.87 ? 59  VAL D O   1 
ATOM   221   C CB  . VAL A 1 59  ? 54.005  62.547  28.999  1.00 58.36 ? 59  VAL D CB  1 
ATOM   222   C CG1 . VAL A 1 59  ? 54.667  62.444  27.631  1.00 58.36 ? 59  VAL D CG1 1 
ATOM   223   C CG2 . VAL A 1 59  ? 54.318  63.914  29.599  1.00 58.56 ? 59  VAL D CG2 1 
ATOM   224   N N   . THR A 1 60  ? 52.150  60.341  27.523  1.00 57.28 ? 60  THR D N   1 
ATOM   225   C CA  . THR A 1 60  ? 52.024  58.924  27.201  1.00 56.71 ? 60  THR D CA  1 
ATOM   226   C C   . THR A 1 60  ? 53.259  58.485  26.414  1.00 56.44 ? 60  THR D C   1 
ATOM   227   O O   . THR A 1 60  ? 53.617  59.103  25.410  1.00 56.40 ? 60  THR D O   1 
ATOM   228   C CB  . THR A 1 60  ? 50.762  58.662  26.367  1.00 56.62 ? 60  THR D CB  1 
ATOM   229   O OG1 . THR A 1 60  ? 49.616  59.133  27.084  1.00 56.55 ? 60  THR D OG1 1 
ATOM   230   C CG2 . THR A 1 60  ? 50.599  57.174  26.067  1.00 56.72 ? 60  THR D CG2 1 
ATOM   231   N N   . LEU A 1 61  ? 53.910  57.421  26.873  1.00 56.14 ? 61  LEU D N   1 
ATOM   232   C CA  . LEU A 1 61  ? 55.163  56.975  26.267  1.00 55.92 ? 61  LEU D CA  1 
ATOM   233   C C   . LEU A 1 61  ? 55.266  55.462  26.184  1.00 55.71 ? 61  LEU D C   1 
ATOM   234   O O   . LEU A 1 61  ? 54.678  54.745  26.993  1.00 55.81 ? 61  LEU D O   1 
ATOM   235   C CB  . LEU A 1 61  ? 56.363  57.514  27.056  1.00 56.02 ? 61  LEU D CB  1 
ATOM   236   C CG  . LEU A 1 61  ? 56.610  59.024  27.121  1.00 55.80 ? 61  LEU D CG  1 
ATOM   237   C CD1 . LEU A 1 61  ? 57.446  59.356  28.347  1.00 55.69 ? 61  LEU D CD1 1 
ATOM   238   C CD2 . LEU A 1 61  ? 57.264  59.539  25.844  1.00 55.26 ? 61  LEU D CD2 1 
ATOM   239   N N   . ASP A 1 62  ? 56.024  54.989  25.201  1.00 55.49 ? 62  ASP D N   1 
ATOM   240   C CA  . ASP A 1 62  ? 56.313  53.570  25.049  1.00 55.34 ? 62  ASP D CA  1 
ATOM   241   C C   . ASP A 1 62  ? 57.672  53.235  25.643  1.00 55.20 ? 62  ASP D C   1 
ATOM   242   O O   . ASP A 1 62  ? 58.585  54.063  25.634  1.00 55.30 ? 62  ASP D O   1 
ATOM   243   C CB  . ASP A 1 62  ? 56.291  53.176  23.574  1.00 55.35 ? 62  ASP D CB  1 
ATOM   244   C CG  . ASP A 1 62  ? 54.887  53.061  23.020  1.00 55.71 ? 62  ASP D CG  1 
ATOM   245   O OD1 . ASP A 1 62  ? 53.979  52.602  23.752  1.00 55.90 ? 62  ASP D OD1 1 
ATOM   246   O OD2 . ASP A 1 62  ? 54.696  53.421  21.839  1.00 56.16 ? 62  ASP D OD2 1 
ATOM   247   N N   . TYR A 1 63  ? 57.802  52.014  26.150  1.00 54.93 ? 63  TYR D N   1 
ATOM   248   C CA  . TYR A 1 63  ? 59.067  51.548  26.687  1.00 54.72 ? 63  TYR D CA  1 
ATOM   249   C C   . TYR A 1 63  ? 59.252  50.040  26.512  1.00 54.76 ? 63  TYR D C   1 
ATOM   250   O O   . TYR A 1 63  ? 58.520  49.246  27.103  1.00 54.78 ? 63  TYR D O   1 
ATOM   251   C CB  . TYR A 1 63  ? 59.203  51.951  28.160  1.00 54.65 ? 63  TYR D CB  1 
ATOM   252   C CG  . TYR A 1 63  ? 60.457  51.428  28.810  1.00 54.52 ? 63  TYR D CG  1 
ATOM   253   C CD1 . TYR A 1 63  ? 61.709  51.871  28.396  1.00 54.65 ? 63  TYR D CD1 1 
ATOM   254   C CD2 . TYR A 1 63  ? 60.394  50.484  29.832  1.00 54.31 ? 63  TYR D CD2 1 
ATOM   255   C CE1 . TYR A 1 63  ? 62.870  51.390  28.979  1.00 54.60 ? 63  TYR D CE1 1 
ATOM   256   C CE2 . TYR A 1 63  ? 61.550  49.997  30.422  1.00 54.58 ? 63  TYR D CE2 1 
ATOM   257   C CZ  . TYR A 1 63  ? 62.785  50.455  29.986  1.00 54.41 ? 63  TYR D CZ  1 
ATOM   258   O OH  . TYR A 1 63  ? 63.941  49.986  30.555  1.00 54.46 ? 63  TYR D OH  1 
ATOM   259   N N   . LYS A 1 64  ? 60.223  49.657  25.683  1.00 54.81 ? 64  LYS D N   1 
ATOM   260   C CA  . LYS A 1 64  ? 60.661  48.266  25.594  1.00 54.82 ? 64  LYS D CA  1 
ATOM   261   C C   . LYS A 1 64  ? 61.519  47.967  26.810  1.00 54.63 ? 64  LYS D C   1 
ATOM   262   O O   . LYS A 1 64  ? 62.609  48.524  26.958  1.00 54.64 ? 64  LYS D O   1 
ATOM   263   C CB  . LYS A 1 64  ? 61.458  48.012  24.312  1.00 54.71 ? 64  LYS D CB  1 
ATOM   264   C CG  . LYS A 1 64  ? 60.615  47.554  23.128  1.00 55.13 ? 64  LYS D CG  1 
ATOM   265   C CD  . LYS A 1 64  ? 61.387  47.626  21.801  1.00 55.33 ? 64  LYS D CD  1 
ATOM   266   C CE  . LYS A 1 64  ? 62.261  46.395  21.559  1.00 56.28 ? 64  LYS D CE  1 
ATOM   267   N NZ  . LYS A 1 64  ? 61.455  45.186  21.207  1.00 56.68 ? 64  LYS D NZ  1 
ATOM   268   N N   . ALA A 1 65  ? 61.014  47.105  27.689  1.00 54.56 ? 65  ALA D N   1 
ATOM   269   C CA  . ALA A 1 65  ? 61.725  46.747  28.917  1.00 54.48 ? 65  ALA D CA  1 
ATOM   270   C C   . ALA A 1 65  ? 62.736  45.625  28.679  1.00 54.44 ? 65  ALA D C   1 
ATOM   271   O O   . ALA A 1 65  ? 62.835  45.097  27.568  1.00 54.40 ? 65  ALA D O   1 
ATOM   272   C CB  . ALA A 1 65  ? 60.738  46.369  30.010  1.00 54.35 ? 65  ALA D CB  1 
ATOM   273   N N   . SER A 1 66  ? 63.485  45.270  29.722  1.00 54.43 ? 66  SER D N   1 
ATOM   274   C CA  . SER A 1 66  ? 64.474  44.192  29.642  1.00 54.42 ? 66  SER D CA  1 
ATOM   275   C C   . SER A 1 66  ? 63.835  42.829  29.356  1.00 54.38 ? 66  SER D C   1 
ATOM   276   O O   . SER A 1 66  ? 64.500  41.927  28.845  1.00 54.44 ? 66  SER D O   1 
ATOM   277   C CB  . SER A 1 66  ? 65.297  44.121  30.925  1.00 54.42 ? 66  SER D CB  1 
ATOM   278   O OG  . SER A 1 66  ? 64.514  43.622  31.992  1.00 54.45 ? 66  SER D OG  1 
ATOM   279   N N   . ASP A 1 67  ? 62.551  42.690  29.687  1.00 54.34 ? 67  ASP D N   1 
ATOM   280   C CA  . ASP A 1 67  ? 61.777  41.494  29.346  1.00 54.29 ? 67  ASP D CA  1 
ATOM   281   C C   . ASP A 1 67  ? 61.481  41.414  27.844  1.00 54.26 ? 67  ASP D C   1 
ATOM   282   O O   . ASP A 1 67  ? 61.029  40.381  27.345  1.00 54.26 ? 67  ASP D O   1 
ATOM   283   C CB  . ASP A 1 67  ? 60.470  41.443  30.151  1.00 54.27 ? 67  ASP D CB  1 
ATOM   284   C CG  . ASP A 1 67  ? 59.482  42.540  29.759  1.00 54.41 ? 67  ASP D CG  1 
ATOM   285   O OD1 . ASP A 1 67  ? 59.854  43.449  28.984  1.00 54.48 ? 67  ASP D OD1 1 
ATOM   286   O OD2 . ASP A 1 67  ? 58.324  42.491  30.231  1.00 54.31 ? 67  ASP D OD2 1 
ATOM   287   N N   . GLY A 1 68  ? 61.729  42.519  27.140  1.00 54.23 ? 68  GLY D N   1 
ATOM   288   C CA  . GLY A 1 68  ? 61.528  42.597  25.695  1.00 54.14 ? 68  GLY D CA  1 
ATOM   289   C C   . GLY A 1 68  ? 60.139  43.066  25.308  1.00 54.08 ? 68  GLY D C   1 
ATOM   290   O O   . GLY A 1 68  ? 59.783  43.064  24.129  1.00 54.10 ? 68  GLY D O   1 
ATOM   291   N N   . GLU A 1 69  ? 59.357  43.480  26.302  1.00 54.01 ? 69  GLU D N   1 
ATOM   292   C CA  . GLU A 1 69  ? 57.970  43.866  26.079  1.00 53.97 ? 69  GLU D CA  1 
ATOM   293   C C   . GLU A 1 69  ? 57.786  45.381  26.103  1.00 53.93 ? 69  GLU D C   1 
ATOM   294   O O   . GLU A 1 69  ? 58.488  46.085  26.834  1.00 53.93 ? 69  GLU D O   1 
ATOM   295   C CB  . GLU A 1 69  ? 57.084  43.213  27.128  1.00 53.91 ? 69  GLU D CB  1 
ATOM   296   C CG  . GLU A 1 69  ? 55.774  42.712  26.582  1.00 54.30 ? 69  GLU D CG  1 
ATOM   297   C CD  . GLU A 1 69  ? 55.270  41.514  27.347  1.00 54.89 ? 69  GLU D CD  1 
ATOM   298   O OE1 . GLU A 1 69  ? 54.970  41.659  28.552  1.00 55.52 ? 69  GLU D OE1 1 
ATOM   299   O OE2 . GLU A 1 69  ? 55.177  40.424  26.744  1.00 54.82 ? 69  GLU D OE2 1 
ATOM   300   N N   . THR A 1 70  ? 56.843  45.872  25.298  1.00 53.85 ? 70  THR D N   1 
ATOM   301   C CA  . THR A 1 70  ? 56.525  47.305  25.244  1.00 53.75 ? 70  THR D CA  1 
ATOM   302   C C   . THR A 1 70  ? 55.417  47.693  26.234  1.00 53.81 ? 70  THR D C   1 
ATOM   303   O O   . THR A 1 70  ? 54.319  47.125  26.221  1.00 53.73 ? 70  THR D O   1 
ATOM   304   C CB  . THR A 1 70  ? 56.159  47.751  23.813  1.00 53.69 ? 70  THR D CB  1 
ATOM   305   O OG1 . THR A 1 70  ? 57.258  47.472  22.941  1.00 53.67 ? 70  THR D OG1 1 
ATOM   306   C CG2 . THR A 1 70  ? 55.847  49.247  23.762  1.00 53.31 ? 70  THR D CG2 1 
ATOM   307   N N   . TYR A 1 71  ? 55.726  48.663  27.090  1.00 53.83 ? 71  TYR D N   1 
ATOM   308   C CA  . TYR A 1 71  ? 54.790  49.147  28.097  1.00 53.86 ? 71  TYR D CA  1 
ATOM   309   C C   . TYR A 1 71  ? 54.363  50.577  27.786  1.00 54.01 ? 71  TYR D C   1 
ATOM   310   O O   . TYR A 1 71  ? 55.202  51.443  27.526  1.00 53.99 ? 71  TYR D O   1 
ATOM   311   C CB  . TYR A 1 71  ? 55.406  49.055  29.505  1.00 53.76 ? 71  TYR D CB  1 
ATOM   312   C CG  . TYR A 1 71  ? 55.631  47.630  29.987  1.00 53.68 ? 71  TYR D CG  1 
ATOM   313   C CD1 . TYR A 1 71  ? 56.794  46.936  29.651  1.00 53.47 ? 71  TYR D CD1 1 
ATOM   314   C CD2 . TYR A 1 71  ? 54.678  46.977  30.773  1.00 53.36 ? 71  TYR D CD2 1 
ATOM   315   C CE1 . TYR A 1 71  ? 57.003  45.629  30.079  1.00 53.46 ? 71  TYR D CE1 1 
ATOM   316   C CE2 . TYR A 1 71  ? 54.877  45.666  31.206  1.00 53.36 ? 71  TYR D CE2 1 
ATOM   317   C CZ  . TYR A 1 71  ? 56.044  45.000  30.853  1.00 53.62 ? 71  TYR D CZ  1 
ATOM   318   O OH  . TYR A 1 71  ? 56.262  43.706  31.272  1.00 53.50 ? 71  TYR D OH  1 
ATOM   319   N N   . GLN A 1 72  ? 53.053  50.809  27.788  1.00 54.24 ? 72  GLN D N   1 
ATOM   320   C CA  . GLN A 1 72  ? 52.502  52.154  27.661  1.00 54.28 ? 72  GLN D CA  1 
ATOM   321   C C   . GLN A 1 72  ? 52.525  52.808  29.034  1.00 54.41 ? 72  GLN D C   1 
ATOM   322   O O   . GLN A 1 72  ? 51.836  52.363  29.956  1.00 54.48 ? 72  GLN D O   1 
ATOM   323   C CB  . GLN A 1 72  ? 51.071  52.115  27.114  1.00 54.31 ? 72  GLN D CB  1 
ATOM   324   C CG  . GLN A 1 72  ? 50.444  53.495  26.924  1.00 54.52 ? 72  GLN D CG  1 
ATOM   325   C CD  . GLN A 1 72  ? 48.932  53.466  26.777  1.00 54.19 ? 72  GLN D CD  1 
ATOM   326   O OE1 . GLN A 1 72  ? 48.237  52.730  27.471  1.00 53.89 ? 72  GLN D OE1 1 
ATOM   327   N NE2 . GLN A 1 72  ? 48.417  54.295  25.883  1.00 54.71 ? 72  GLN D NE2 1 
ATOM   328   N N   . LEU A 1 73  ? 53.336  53.851  29.172  1.00 54.50 ? 73  LEU D N   1 
ATOM   329   C CA  . LEU A 1 73  ? 53.454  54.568  30.437  1.00 54.64 ? 73  LEU D CA  1 
ATOM   330   C C   . LEU A 1 73  ? 52.694  55.885  30.355  1.00 54.87 ? 73  LEU D C   1 
ATOM   331   O O   . LEU A 1 73  ? 53.020  56.750  29.536  1.00 54.92 ? 73  LEU D O   1 
ATOM   332   C CB  . LEU A 1 73  ? 54.925  54.824  30.788  1.00 54.47 ? 73  LEU D CB  1 
ATOM   333   C CG  . LEU A 1 73  ? 55.967  53.749  30.466  1.00 54.11 ? 73  LEU D CG  1 
ATOM   334   C CD1 . LEU A 1 73  ? 57.354  54.256  30.803  1.00 54.04 ? 73  LEU D CD1 1 
ATOM   335   C CD2 . LEU A 1 73  ? 55.686  52.447  31.194  1.00 54.11 ? 73  LEU D CD2 1 
ATOM   336   N N   . ASN A 1 74  ? 51.667  56.023  31.188  1.00 55.14 ? 74  ASN D N   1 
ATOM   337   C CA  . ASN A 1 74  ? 50.891  57.255  31.257  1.00 55.38 ? 74  ASN D CA  1 
ATOM   338   C C   . ASN A 1 74  ? 51.151  57.950  32.578  1.00 55.77 ? 74  ASN D C   1 
ATOM   339   O O   . ASN A 1 74  ? 50.802  57.425  33.638  1.00 55.60 ? 74  ASN D O   1 
ATOM   340   C CB  . ASN A 1 74  ? 49.398  56.972  31.093  1.00 55.22 ? 74  ASN D CB  1 
ATOM   341   C CG  . ASN A 1 74  ? 49.058  56.412  29.733  1.00 54.77 ? 74  ASN D CG  1 
ATOM   342   O OD1 . ASN A 1 74  ? 48.997  57.139  28.750  1.00 54.24 ? 74  ASN D OD1 1 
ATOM   343   N ND2 . ASN A 1 74  ? 48.825  55.111  29.673  1.00 54.87 ? 74  ASN D ND2 1 
ATOM   344   N N   . PHE A 1 75  ? 51.777  59.122  32.520  1.00 56.37 ? 75  PHE D N   1 
ATOM   345   C CA  . PHE A 1 75  ? 52.077  59.842  33.747  1.00 57.10 ? 75  PHE D CA  1 
ATOM   346   C C   . PHE A 1 75  ? 51.543  61.264  33.817  1.00 57.62 ? 75  PHE D C   1 
ATOM   347   O O   . PHE A 1 75  ? 51.507  61.983  32.813  1.00 57.65 ? 75  PHE D O   1 
ATOM   348   C CB  . PHE A 1 75  ? 53.567  59.734  34.111  1.00 57.21 ? 75  PHE D CB  1 
ATOM   349   C CG  . PHE A 1 75  ? 54.423  60.856  33.608  1.00 57.36 ? 75  PHE D CG  1 
ATOM   350   C CD1 . PHE A 1 75  ? 55.276  60.656  32.533  1.00 57.77 ? 75  PHE D CD1 1 
ATOM   351   C CD2 . PHE A 1 75  ? 54.420  62.099  34.247  1.00 57.77 ? 75  PHE D CD2 1 
ATOM   352   C CE1 . PHE A 1 75  ? 56.091  61.689  32.070  1.00 58.27 ? 75  PHE D CE1 1 
ATOM   353   C CE2 . PHE A 1 75  ? 55.222  63.140  33.792  1.00 57.85 ? 75  PHE D CE2 1 
ATOM   354   C CZ  . PHE A 1 75  ? 56.064  62.934  32.704  1.00 57.96 ? 75  PHE D CZ  1 
ATOM   355   N N   . ILE A 1 76  ? 51.135  61.652  35.024  1.00 58.34 ? 76  ILE D N   1 
ATOM   356   C CA  . ILE A 1 76  ? 50.533  62.957  35.287  1.00 59.13 ? 76  ILE D CA  1 
ATOM   357   C C   . ILE A 1 76  ? 51.426  63.781  36.211  1.00 59.74 ? 76  ILE D C   1 
ATOM   358   O O   . ILE A 1 76  ? 52.003  63.251  37.166  1.00 59.80 ? 76  ILE D O   1 
ATOM   359   C CB  . ILE A 1 76  ? 49.114  62.827  35.923  1.00 59.09 ? 76  ILE D CB  1 
ATOM   360   C CG1 . ILE A 1 76  ? 48.161  62.038  35.017  1.00 59.02 ? 76  ILE D CG1 1 
ATOM   361   C CG2 . ILE A 1 76  ? 48.510  64.201  36.213  1.00 59.18 ? 76  ILE D CG2 1 
ATOM   362   C CD1 . ILE A 1 76  ? 48.070  60.560  35.330  1.00 58.81 ? 76  ILE D CD1 1 
ATOM   363   N N   . ASP A 1 77  ? 51.538  65.075  35.912  1.00 60.49 ? 77  ASP D N   1 
ATOM   364   C CA  . ASP A 1 77  ? 52.271  66.014  36.757  1.00 61.11 ? 77  ASP D CA  1 
ATOM   365   C C   . ASP A 1 77  ? 51.481  66.301  38.036  1.00 61.39 ? 77  ASP D C   1 
ATOM   366   O O   . ASP A 1 77  ? 50.246  66.239  38.047  1.00 61.39 ? 77  ASP D O   1 
ATOM   367   C CB  . ASP A 1 77  ? 52.551  67.313  35.994  1.00 61.25 ? 77  ASP D CB  1 
ATOM   368   C CG  . ASP A 1 77  ? 53.852  67.980  36.423  1.00 61.72 ? 77  ASP D CG  1 
ATOM   369   O OD1 . ASP A 1 77  ? 54.440  67.555  37.443  1.00 62.15 ? 77  ASP D OD1 1 
ATOM   370   O OD2 . ASP A 1 77  ? 54.290  68.930  35.734  1.00 61.74 ? 77  ASP D OD2 1 
ATOM   371   N N   . THR A 1 78  ? 52.198  66.607  39.113  1.00 61.75 ? 78  THR D N   1 
ATOM   372   C CA  . THR A 1 78  ? 51.563  66.843  40.407  1.00 62.13 ? 78  THR D CA  1 
ATOM   373   C C   . THR A 1 78  ? 52.057  68.140  41.059  1.00 62.21 ? 78  THR D C   1 
ATOM   374   O O   . THR A 1 78  ? 53.140  68.161  41.667  1.00 62.30 ? 78  THR D O   1 
ATOM   375   C CB  . THR A 1 78  ? 51.749  65.629  41.358  1.00 62.14 ? 78  THR D CB  1 
ATOM   376   O OG1 . THR A 1 78  ? 51.192  64.460  40.747  1.00 62.52 ? 78  THR D OG1 1 
ATOM   377   C CG2 . THR A 1 78  ? 51.058  65.857  42.701  1.00 62.50 ? 78  THR D CG2 1 
ATOM   378   N N   . PRO A 1 79  ? 51.272  69.233  40.915  1.00 62.18 ? 79  PRO D N   1 
ATOM   379   C CA  . PRO A 1 79  ? 51.542  70.449  41.687  1.00 62.12 ? 79  PRO D CA  1 
ATOM   380   C C   . PRO A 1 79  ? 51.482  70.134  43.184  1.00 61.94 ? 79  PRO D C   1 
ATOM   381   O O   . PRO A 1 79  ? 50.546  69.470  43.642  1.00 62.06 ? 79  PRO D O   1 
ATOM   382   C CB  . PRO A 1 79  ? 50.407  71.405  41.270  1.00 62.18 ? 79  PRO D CB  1 
ATOM   383   C CG  . PRO A 1 79  ? 49.364  70.540  40.631  1.00 62.11 ? 79  PRO D CG  1 
ATOM   384   C CD  . PRO A 1 79  ? 50.112  69.396  40.018  1.00 62.20 ? 79  PRO D CD  1 
ATOM   385   N N   . GLY A 1 80  ? 52.487  70.590  43.928  1.00 61.59 ? 80  GLY D N   1 
ATOM   386   C CA  . GLY A 1 80  ? 52.619  70.237  45.334  1.00 61.03 ? 80  GLY D CA  1 
ATOM   387   C C   . GLY A 1 80  ? 52.112  71.271  46.317  1.00 60.72 ? 80  GLY D C   1 
ATOM   388   O O   . GLY A 1 80  ? 52.888  71.786  47.119  1.00 60.83 ? 80  GLY D O   1 
ATOM   389   N N   . HIS A 1 81  ? 50.817  71.586  46.260  1.00 60.33 ? 81  HIS D N   1 
ATOM   390   C CA  . HIS A 1 81  ? 50.205  72.397  47.316  1.00 59.85 ? 81  HIS D CA  1 
ATOM   391   C C   . HIS A 1 81  ? 48.761  72.060  47.675  1.00 59.46 ? 81  HIS D C   1 
ATOM   392   O O   . HIS A 1 81  ? 47.945  71.746  46.807  1.00 59.40 ? 81  HIS D O   1 
ATOM   393   C CB  . HIS A 1 81  ? 50.333  73.898  47.058  1.00 59.87 ? 81  HIS D CB  1 
ATOM   394   C CG  . HIS A 1 81  ? 50.340  74.701  48.321  1.00 60.39 ? 81  HIS D CG  1 
ATOM   395   N ND1 . HIS A 1 81  ? 51.492  75.246  48.850  1.00 60.67 ? 81  HIS D ND1 1 
ATOM   396   C CD2 . HIS A 1 81  ? 49.347  74.994  49.196  1.00 60.62 ? 81  HIS D CD2 1 
ATOM   397   C CE1 . HIS A 1 81  ? 51.204  75.863  49.982  1.00 60.66 ? 81  HIS D CE1 1 
ATOM   398   N NE2 . HIS A 1 81  ? 49.909  75.723  50.216  1.00 60.89 ? 81  HIS D NE2 1 
ATOM   399   N N   . VAL A 1 82  ? 48.473  72.157  48.975  1.00 58.99 ? 82  VAL D N   1 
ATOM   400   C CA  . VAL A 1 82  ? 47.170  71.818  49.569  1.00 58.44 ? 82  VAL D CA  1 
ATOM   401   C C   . VAL A 1 82  ? 46.031  72.821  49.318  1.00 57.92 ? 82  VAL D C   1 
ATOM   402   O O   . VAL A 1 82  ? 44.911  72.620  49.803  1.00 57.92 ? 82  VAL D O   1 
ATOM   403   C CB  . VAL A 1 82  ? 47.279  71.545  51.100  1.00 58.45 ? 82  VAL D CB  1 
ATOM   404   C CG1 . VAL A 1 82  ? 47.721  70.106  51.364  1.00 58.34 ? 82  VAL D CG1 1 
ATOM   405   C CG2 . VAL A 1 82  ? 48.205  72.557  51.770  1.00 58.48 ? 82  VAL D CG2 1 
ATOM   406   N N   . ASP A 1 83  ? 46.305  73.894  48.578  1.00 57.17 ? 83  ASP D N   1 
ATOM   407   C CA  . ASP A 1 83  ? 45.220  74.716  48.041  1.00 56.50 ? 83  ASP D CA  1 
ATOM   408   C C   . ASP A 1 83  ? 44.549  73.967  46.888  1.00 56.10 ? 83  ASP D C   1 
ATOM   409   O O   . ASP A 1 83  ? 43.356  74.144  46.632  1.00 56.11 ? 83  ASP D O   1 
ATOM   410   C CB  . ASP A 1 83  ? 45.715  76.097  47.597  1.00 56.46 ? 83  ASP D CB  1 
ATOM   411   C CG  . ASP A 1 83  ? 45.609  77.147  48.700  1.00 55.91 ? 83  ASP D CG  1 
ATOM   412   O OD1 . ASP A 1 83  ? 45.154  76.817  49.814  1.00 55.24 ? 83  ASP D OD1 1 
ATOM   413   O OD2 . ASP A 1 83  ? 45.978  78.314  48.448  1.00 55.36 ? 83  ASP D OD2 1 
ATOM   414   N N   . PHE A 1 84  ? 45.328  73.126  46.209  1.00 55.51 ? 84  PHE D N   1 
ATOM   415   C CA  . PHE A 1 84  ? 44.806  72.212  45.195  1.00 54.98 ? 84  PHE D CA  1 
ATOM   416   C C   . PHE A 1 84  ? 44.712  70.788  45.754  1.00 54.53 ? 84  PHE D C   1 
ATOM   417   O O   . PHE A 1 84  ? 44.899  69.809  45.027  1.00 54.47 ? 84  PHE D O   1 
ATOM   418   C CB  . PHE A 1 84  ? 45.682  72.228  43.935  1.00 55.12 ? 84  PHE D CB  1 
ATOM   419   C CG  . PHE A 1 84  ? 46.156  73.595  43.535  1.00 55.14 ? 84  PHE D CG  1 
ATOM   420   C CD1 . PHE A 1 84  ? 47.513  73.900  43.554  1.00 55.47 ? 84  PHE D CD1 1 
ATOM   421   C CD2 . PHE A 1 84  ? 45.249  74.576  43.139  1.00 55.22 ? 84  PHE D CD2 1 
ATOM   422   C CE1 . PHE A 1 84  ? 47.965  75.163  43.186  1.00 55.74 ? 84  PHE D CE1 1 
ATOM   423   C CE2 . PHE A 1 84  ? 45.687  75.845  42.772  1.00 55.49 ? 84  PHE D CE2 1 
ATOM   424   C CZ  . PHE A 1 84  ? 47.048  76.140  42.795  1.00 55.71 ? 84  PHE D CZ  1 
ATOM   425   N N   . SER A 1 85  ? 44.416  70.690  47.050  1.00 53.92 ? 85  SER D N   1 
ATOM   426   C CA  . SER A 1 85  ? 44.249  69.414  47.750  1.00 53.26 ? 85  SER D CA  1 
ATOM   427   C C   . SER A 1 85  ? 43.412  68.428  46.923  1.00 52.81 ? 85  SER D C   1 
ATOM   428   O O   . SER A 1 85  ? 43.822  67.289  46.695  1.00 52.67 ? 85  SER D O   1 
ATOM   429   C CB  . SER A 1 85  ? 43.590  69.662  49.114  1.00 53.31 ? 85  SER D CB  1 
ATOM   430   O OG  . SER A 1 85  ? 43.988  68.706  50.080  1.00 53.33 ? 85  SER D OG  1 
ATOM   431   N N   . TYR A 1 86  ? 42.252  68.900  46.465  1.00 52.28 ? 86  TYR D N   1 
ATOM   432   C CA  . TYR A 1 86  ? 41.314  68.123  45.655  1.00 51.65 ? 86  TYR D CA  1 
ATOM   433   C C   . TYR A 1 86  ? 41.866  67.734  44.282  1.00 51.34 ? 86  TYR D C   1 
ATOM   434   O O   . TYR A 1 86  ? 41.888  66.552  43.931  1.00 51.26 ? 86  TYR D O   1 
ATOM   435   C CB  . TYR A 1 86  ? 40.013  68.907  45.489  1.00 51.52 ? 86  TYR D CB  1 
ATOM   436   C CG  . TYR A 1 86  ? 38.966  68.223  44.644  1.00 51.30 ? 86  TYR D CG  1 
ATOM   437   C CD1 . TYR A 1 86  ? 38.377  67.032  45.060  1.00 51.48 ? 86  TYR D CD1 1 
ATOM   438   C CD2 . TYR A 1 86  ? 38.547  68.779  43.438  1.00 50.96 ? 86  TYR D CD2 1 
ATOM   439   C CE1 . TYR A 1 86  ? 37.411  66.404  44.290  1.00 51.51 ? 86  TYR D CE1 1 
ATOM   440   C CE2 . TYR A 1 86  ? 37.578  68.162  42.663  1.00 51.02 ? 86  TYR D CE2 1 
ATOM   441   C CZ  . TYR A 1 86  ? 37.015  66.973  43.095  1.00 51.36 ? 86  TYR D CZ  1 
ATOM   442   O OH  . TYR A 1 86  ? 36.052  66.348  42.339  1.00 51.42 ? 86  TYR D OH  1 
ATOM   443   N N   . GLU A 1 87  ? 42.300  68.734  43.515  1.00 50.91 ? 87  GLU D N   1 
ATOM   444   C CA  . GLU A 1 87  ? 42.874  68.526  42.183  1.00 50.54 ? 87  GLU D CA  1 
ATOM   445   C C   . GLU A 1 87  ? 43.979  67.473  42.184  1.00 50.08 ? 87  GLU D C   1 
ATOM   446   O O   . GLU A 1 87  ? 44.034  66.622  41.299  1.00 49.86 ? 87  GLU D O   1 
ATOM   447   C CB  . GLU A 1 87  ? 43.426  69.840  41.624  1.00 50.59 ? 87  GLU D CB  1 
ATOM   448   C CG  . GLU A 1 87  ? 42.372  70.862  41.227  1.00 50.76 ? 87  GLU D CG  1 
ATOM   449   C CD  . GLU A 1 87  ? 42.947  71.995  40.393  1.00 50.82 ? 87  GLU D CD  1 
ATOM   450   O OE1 . GLU A 1 87  ? 44.128  71.905  39.991  1.00 51.19 ? 87  GLU D OE1 1 
ATOM   451   O OE2 . GLU A 1 87  ? 42.218  72.977  40.135  1.00 51.30 ? 87  GLU D OE2 1 
ATOM   452   N N   . VAL A 1 88  ? 44.854  67.545  43.183  1.00 49.74 ? 88  VAL D N   1 
ATOM   453   C CA  . VAL A 1 88  ? 45.920  66.570  43.363  1.00 49.50 ? 88  VAL D CA  1 
ATOM   454   C C   . VAL A 1 88  ? 45.332  65.175  43.572  1.00 49.34 ? 88  VAL D C   1 
ATOM   455   O O   . VAL A 1 88  ? 45.738  64.226  42.900  1.00 49.37 ? 88  VAL D O   1 
ATOM   456   C CB  . VAL A 1 88  ? 46.847  66.944  44.546  1.00 49.48 ? 88  VAL D CB  1 
ATOM   457   C CG1 . VAL A 1 88  ? 47.885  65.857  44.786  1.00 49.60 ? 88  VAL D CG1 1 
ATOM   458   C CG2 . VAL A 1 88  ? 47.536  68.273  44.286  1.00 49.51 ? 88  VAL D CG2 1 
ATOM   459   N N   . SER A 1 89  ? 44.367  65.063  44.486  1.00 49.06 ? 89  SER D N   1 
ATOM   460   C CA  . SER A 1 89  ? 43.748  63.774  44.804  1.00 48.71 ? 89  SER D CA  1 
ATOM   461   C C   . SER A 1 89  ? 43.038  63.164  43.598  1.00 48.49 ? 89  SER D C   1 
ATOM   462   O O   . SER A 1 89  ? 42.924  61.946  43.501  1.00 48.46 ? 89  SER D O   1 
ATOM   463   C CB  . SER A 1 89  ? 42.806  63.881  46.012  1.00 48.62 ? 89  SER D CB  1 
ATOM   464   O OG  . SER A 1 89  ? 41.593  64.532  45.685  1.00 48.45 ? 89  SER D OG  1 
ATOM   465   N N   . ARG A 1 90  ? 42.583  64.014  42.681  1.00 48.45 ? 90  ARG D N   1 
ATOM   466   C CA  . ARG A 1 90  ? 41.973  63.557  41.425  1.00 48.46 ? 90  ARG D CA  1 
ATOM   467   C C   . ARG A 1 90  ? 43.011  63.024  40.438  1.00 48.45 ? 90  ARG D C   1 
ATOM   468   O O   . ARG A 1 90  ? 42.794  61.987  39.808  1.00 48.42 ? 90  ARG D O   1 
ATOM   469   C CB  . ARG A 1 90  ? 41.120  64.659  40.776  1.00 48.42 ? 90  ARG D CB  1 
ATOM   470   C CG  . ARG A 1 90  ? 39.918  65.132  41.604  1.00 48.28 ? 90  ARG D CG  1 
ATOM   471   C CD  . ARG A 1 90  ? 39.074  63.967  42.118  1.00 48.02 ? 90  ARG D CD  1 
ATOM   472   N NE  . ARG A 1 90  ? 39.646  63.368  43.323  1.00 47.40 ? 90  ARG D NE  1 
ATOM   473   C CZ  . ARG A 1 90  ? 39.496  62.097  43.680  1.00 46.86 ? 90  ARG D CZ  1 
ATOM   474   N NH1 . ARG A 1 90  ? 38.791  61.268  42.926  1.00 46.97 ? 90  ARG D NH1 1 
ATOM   475   N NH2 . ARG A 1 90  ? 40.060  61.654  44.792  1.00 46.57 ? 90  ARG D NH2 1 
ATOM   476   N N   . SER A 1 91  ? 44.131  63.739  40.310  1.00 48.41 ? 91  SER D N   1 
ATOM   477   C CA  . SER A 1 91  ? 45.264  63.285  39.504  1.00 48.47 ? 91  SER D CA  1 
ATOM   478   C C   . SER A 1 91  ? 45.833  61.962  40.015  1.00 48.47 ? 91  SER D C   1 
ATOM   479   O O   . SER A 1 91  ? 46.294  61.137  39.227  1.00 48.51 ? 91  SER D O   1 
ATOM   480   C CB  . SER A 1 91  ? 46.370  64.342  39.472  1.00 48.53 ? 91  SER D CB  1 
ATOM   481   O OG  . SER A 1 91  ? 46.121  65.320  38.476  1.00 48.70 ? 91  SER D OG  1 
ATOM   482   N N   . LEU A 1 92  ? 45.795  61.774  41.334  1.00 48.46 ? 92  LEU D N   1 
ATOM   483   C CA  . LEU A 1 92  ? 46.307  60.563  41.972  1.00 48.33 ? 92  LEU D CA  1 
ATOM   484   C C   . LEU A 1 92  ? 45.359  59.399  41.763  1.00 48.52 ? 92  LEU D C   1 
ATOM   485   O O   . LEU A 1 92  ? 45.796  58.255  41.655  1.00 48.57 ? 92  LEU D O   1 
ATOM   486   C CB  . LEU A 1 92  ? 46.541  60.787  43.469  1.00 48.12 ? 92  LEU D CB  1 
ATOM   487   C CG  . LEU A 1 92  ? 47.760  61.614  43.887  1.00 47.73 ? 92  LEU D CG  1 
ATOM   488   C CD1 . LEU A 1 92  ? 47.626  62.063  45.328  1.00 47.31 ? 92  LEU D CD1 1 
ATOM   489   C CD2 . LEU A 1 92  ? 49.069  60.851  43.678  1.00 47.21 ? 92  LEU D CD2 1 
ATOM   490   N N   . ALA A 1 93  ? 44.064  59.703  41.699  1.00 48.86 ? 93  ALA D N   1 
ATOM   491   C CA  . ALA A 1 93  ? 43.030  58.693  41.480  1.00 49.19 ? 93  ALA D CA  1 
ATOM   492   C C   . ALA A 1 93  ? 43.132  58.078  40.087  1.00 49.50 ? 93  ALA D C   1 
ATOM   493   O O   . ALA A 1 93  ? 42.651  56.972  39.854  1.00 49.55 ? 93  ALA D O   1 
ATOM   494   C CB  . ALA A 1 93  ? 41.649  59.287  41.709  1.00 49.12 ? 93  ALA D CB  1 
ATOM   495   N N   . ALA A 1 94  ? 43.767  58.804  39.171  1.00 49.94 ? 94  ALA D N   1 
ATOM   496   C CA  . ALA A 1 94  ? 44.037  58.303  37.828  1.00 50.38 ? 94  ALA D CA  1 
ATOM   497   C C   . ALA A 1 94  ? 45.130  57.238  37.836  1.00 50.68 ? 94  ALA D C   1 
ATOM   498   O O   . ALA A 1 94  ? 45.117  56.327  37.006  1.00 50.85 ? 94  ALA D O   1 
ATOM   499   C CB  . ALA A 1 94  ? 44.424  59.447  36.905  1.00 50.34 ? 94  ALA D CB  1 
ATOM   500   N N   . CYS A 1 95  ? 46.055  57.350  38.791  1.00 50.93 ? 95  CYS D N   1 
ATOM   501   C CA  . CYS A 1 95  ? 47.271  56.528  38.829  1.00 51.19 ? 95  CYS D CA  1 
ATOM   502   C C   . CYS A 1 95  ? 47.159  55.278  39.703  1.00 51.22 ? 95  CYS D C   1 
ATOM   503   O O   . CYS A 1 95  ? 46.327  55.223  40.607  1.00 51.38 ? 95  CYS D O   1 
ATOM   504   C CB  . CYS A 1 95  ? 48.445  57.376  39.319  1.00 51.21 ? 95  CYS D CB  1 
ATOM   505   S SG  . CYS A 1 95  ? 48.683  58.907  38.405  1.00 51.57 ? 95  CYS D SG  1 
ATOM   506   N N   . GLU A 1 96  ? 48.008  54.287  39.426  1.00 51.22 ? 96  GLU D N   1 
ATOM   507   C CA  . GLU A 1 96  ? 48.139  53.092  40.269  1.00 51.26 ? 96  GLU D CA  1 
ATOM   508   C C   . GLU A 1 96  ? 49.389  53.162  41.135  1.00 51.20 ? 96  GLU D C   1 
ATOM   509   O O   . GLU A 1 96  ? 49.550  52.385  42.080  1.00 51.41 ? 96  GLU D O   1 
ATOM   510   C CB  . GLU A 1 96  ? 48.185  51.819  39.422  1.00 51.39 ? 96  GLU D CB  1 
ATOM   511   C CG  . GLU A 1 96  ? 46.825  51.258  39.040  1.00 51.86 ? 96  GLU D CG  1 
ATOM   512   C CD  . GLU A 1 96  ? 46.116  52.095  37.990  1.00 52.80 ? 96  GLU D CD  1 
ATOM   513   O OE1 . GLU A 1 96  ? 46.737  52.440  36.955  1.00 52.72 ? 96  GLU D OE1 1 
ATOM   514   O OE2 . GLU A 1 96  ? 44.925  52.406  38.206  1.00 53.13 ? 96  GLU D OE2 1 
ATOM   515   N N   . GLY A 1 97  ? 50.279  54.086  40.795  1.00 51.00 ? 97  GLY D N   1 
ATOM   516   C CA  . GLY A 1 97  ? 51.492  54.310  41.561  1.00 50.82 ? 97  GLY D CA  1 
ATOM   517   C C   . GLY A 1 97  ? 51.967  55.742  41.443  1.00 50.74 ? 97  GLY D C   1 
ATOM   518   O O   . GLY A 1 97  ? 51.336  56.564  40.773  1.00 50.78 ? 97  GLY D O   1 
ATOM   519   N N   . ALA A 1 98  ? 53.081  56.040  42.103  1.00 50.57 ? 98  ALA D N   1 
ATOM   520   C CA  . ALA A 1 98  ? 53.690  57.365  42.043  1.00 50.40 ? 98  ALA D CA  1 
ATOM   521   C C   . ALA A 1 98  ? 55.190  57.271  42.292  1.00 50.23 ? 98  ALA D C   1 
ATOM   522   O O   . ALA A 1 98  ? 55.649  56.381  43.011  1.00 50.31 ? 98  ALA D O   1 
ATOM   523   C CB  . ALA A 1 98  ? 53.039  58.299  43.057  1.00 50.36 ? 98  ALA D CB  1 
ATOM   524   N N   . LEU A 1 99  ? 55.951  58.181  41.694  1.00 49.92 ? 99  LEU D N   1 
ATOM   525   C CA  . LEU A 1 99  ? 57.385  58.247  41.952  1.00 49.74 ? 99  LEU D CA  1 
ATOM   526   C C   . LEU A 1 99  ? 57.670  59.357  42.952  1.00 49.80 ? 99  LEU D C   1 
ATOM   527   O O   . LEU A 1 99  ? 57.276  60.505  42.746  1.00 49.94 ? 99  LEU D O   1 
ATOM   528   C CB  . LEU A 1 99  ? 58.188  58.475  40.662  1.00 49.60 ? 99  LEU D CB  1 
ATOM   529   C CG  . LEU A 1 99  ? 58.002  57.594  39.419  1.00 49.13 ? 99  LEU D CG  1 
ATOM   530   C CD1 . LEU A 1 99  ? 59.061  57.928  38.400  1.00 48.91 ? 99  LEU D CD1 1 
ATOM   531   C CD2 . LEU A 1 99  ? 58.050  56.117  39.736  1.00 49.37 ? 99  LEU D CD2 1 
ATOM   532   N N   . LEU A 1 100 ? 58.328  59.008  44.051  1.00 49.76 ? 100 LEU D N   1 
ATOM   533   C CA  . LEU A 1 100 ? 58.807  60.015  44.979  1.00 49.74 ? 100 LEU D CA  1 
ATOM   534   C C   . LEU A 1 100 ? 60.245  60.332  44.593  1.00 49.84 ? 100 LEU D C   1 
ATOM   535   O O   . LEU A 1 100 ? 61.155  59.528  44.829  1.00 50.04 ? 100 LEU D O   1 
ATOM   536   C CB  . LEU A 1 100 ? 58.705  59.531  46.429  1.00 49.64 ? 100 LEU D CB  1 
ATOM   537   C CG  . LEU A 1 100 ? 59.097  60.523  47.529  1.00 49.52 ? 100 LEU D CG  1 
ATOM   538   C CD1 . LEU A 1 100 ? 58.234  61.781  47.497  1.00 49.52 ? 100 LEU D CD1 1 
ATOM   539   C CD2 . LEU A 1 100 ? 59.001  59.858  48.883  1.00 49.75 ? 100 LEU D CD2 1 
ATOM   540   N N   . VAL A 1 101 ? 60.435  61.495  43.976  1.00 49.67 ? 101 VAL D N   1 
ATOM   541   C CA  . VAL A 1 101 ? 61.742  61.904  43.474  1.00 49.66 ? 101 VAL D CA  1 
ATOM   542   C C   . VAL A 1 101 ? 62.397  62.863  44.463  1.00 49.71 ? 101 VAL D C   1 
ATOM   543   O O   . VAL A 1 101 ? 61.950  64.002  44.632  1.00 49.82 ? 101 VAL D O   1 
ATOM   544   C CB  . VAL A 1 101 ? 61.629  62.553  42.075  1.00 49.67 ? 101 VAL D CB  1 
ATOM   545   C CG1 . VAL A 1 101 ? 63.004  62.868  41.502  1.00 49.42 ? 101 VAL D CG1 1 
ATOM   546   C CG2 . VAL A 1 101 ? 60.859  61.641  41.134  1.00 49.87 ? 101 VAL D CG2 1 
ATOM   547   N N   . VAL A 1 102 ? 63.452  62.394  45.120  1.00 49.65 ? 102 VAL D N   1 
ATOM   548   C CA  . VAL A 1 102 ? 64.122  63.186  46.143  1.00 49.73 ? 102 VAL D CA  1 
ATOM   549   C C   . VAL A 1 102 ? 65.546  63.545  45.725  1.00 49.89 ? 102 VAL D C   1 
ATOM   550   O O   . VAL A 1 102 ? 66.330  62.674  45.343  1.00 49.70 ? 102 VAL D O   1 
ATOM   551   C CB  . VAL A 1 102 ? 64.139  62.463  47.519  1.00 49.66 ? 102 VAL D CB  1 
ATOM   552   C CG1 . VAL A 1 102 ? 64.614  63.405  48.612  1.00 49.49 ? 102 VAL D CG1 1 
ATOM   553   C CG2 . VAL A 1 102 ? 62.760  61.918  47.866  1.00 49.60 ? 102 VAL D CG2 1 
ATOM   554   N N   . ASP A 1 103 ? 65.857  64.838  45.794  1.00 50.22 ? 103 ASP D N   1 
ATOM   555   C CA  . ASP A 1 103 ? 67.211  65.330  45.598  1.00 50.66 ? 103 ASP D CA  1 
ATOM   556   C C   . ASP A 1 103 ? 68.108  64.742  46.681  1.00 50.94 ? 103 ASP D C   1 
ATOM   557   O O   . ASP A 1 103 ? 67.904  64.986  47.871  1.00 50.97 ? 103 ASP D O   1 
ATOM   558   C CB  . ASP A 1 103 ? 67.231  66.861  45.658  1.00 50.72 ? 103 ASP D CB  1 
ATOM   559   C CG  . ASP A 1 103 ? 68.578  67.460  45.252  1.00 51.24 ? 103 ASP D CG  1 
ATOM   560   O OD1 . ASP A 1 103 ? 69.622  66.780  45.374  1.00 51.58 ? 103 ASP D OD1 1 
ATOM   561   O OD2 . ASP A 1 103 ? 68.594  68.631  44.813  1.00 51.71 ? 103 ASP D OD2 1 
ATOM   562   N N   . ALA A 1 104 ? 69.098  63.962  46.255  1.00 51.40 ? 104 ALA D N   1 
ATOM   563   C CA  . ALA A 1 104 ? 70.040  63.315  47.165  1.00 51.84 ? 104 ALA D CA  1 
ATOM   564   C C   . ALA A 1 104 ? 70.812  64.329  48.009  1.00 52.30 ? 104 ALA D C   1 
ATOM   565   O O   . ALA A 1 104 ? 71.377  63.981  49.047  1.00 52.37 ? 104 ALA D O   1 
ATOM   566   C CB  . ALA A 1 104 ? 70.996  62.424  46.386  1.00 51.70 ? 104 ALA D CB  1 
ATOM   567   N N   . GLY A 1 105 ? 70.826  65.581  47.557  1.00 52.85 ? 105 GLY D N   1 
ATOM   568   C CA  . GLY A 1 105 ? 71.480  66.671  48.274  1.00 53.49 ? 105 GLY D CA  1 
ATOM   569   C C   . GLY A 1 105 ? 70.611  67.301  49.347  1.00 53.97 ? 105 GLY D C   1 
ATOM   570   O O   . GLY A 1 105 ? 71.040  67.447  50.495  1.00 54.08 ? 105 GLY D O   1 
ATOM   571   N N   . GLN A 1 106 ? 69.387  67.669  48.975  1.00 54.41 ? 106 GLN D N   1 
ATOM   572   C CA  . GLN A 1 106 ? 68.472  68.356  49.885  1.00 54.91 ? 106 GLN D CA  1 
ATOM   573   C C   . GLN A 1 106 ? 67.852  67.399  50.899  1.00 55.15 ? 106 GLN D C   1 
ATOM   574   O O   . GLN A 1 106 ? 68.208  67.415  52.079  1.00 55.19 ? 106 GLN D O   1 
ATOM   575   C CB  . GLN A 1 106 ? 67.364  69.091  49.110  1.00 54.93 ? 106 GLN D CB  1 
ATOM   576   C CG  . GLN A 1 106 ? 67.829  69.920  47.908  1.00 55.36 ? 106 GLN D CG  1 
ATOM   577   C CD  . GLN A 1 106 ? 68.760  71.069  48.283  1.00 55.77 ? 106 GLN D CD  1 
ATOM   578   O OE1 . GLN A 1 106 ? 68.330  72.219  48.395  1.00 56.08 ? 106 GLN D OE1 1 
ATOM   579   N NE2 . GLN A 1 106 ? 70.041  70.761  48.473  1.00 55.65 ? 106 GLN D NE2 1 
ATOM   580   N N   . GLY A 1 107 ? 66.939  66.559  50.420  1.00 55.43 ? 107 GLY D N   1 
ATOM   581   C CA  . GLY A 1 107 ? 66.112  65.725  51.284  1.00 55.82 ? 107 GLY D CA  1 
ATOM   582   C C   . GLY A 1 107 ? 64.639  65.980  51.017  1.00 56.13 ? 107 GLY D C   1 
ATOM   583   O O   . GLY A 1 107 ? 64.272  66.520  49.968  1.00 56.27 ? 107 GLY D O   1 
ATOM   584   N N   . VAL A 1 108 ? 63.792  65.599  51.966  1.00 56.29 ? 108 VAL D N   1 
ATOM   585   C CA  . VAL A 1 108 ? 62.347  65.703  51.785  1.00 56.57 ? 108 VAL D CA  1 
ATOM   586   C C   . VAL A 1 108 ? 61.759  66.884  52.570  1.00 56.68 ? 108 VAL D C   1 
ATOM   587   O O   . VAL A 1 108 ? 62.129  67.115  53.721  1.00 56.75 ? 108 VAL D O   1 
ATOM   588   C CB  . VAL A 1 108 ? 61.634  64.345  52.106  1.00 56.63 ? 108 VAL D CB  1 
ATOM   589   C CG1 . VAL A 1 108 ? 61.816  63.938  53.560  1.00 56.49 ? 108 VAL D CG1 1 
ATOM   590   C CG2 . VAL A 1 108 ? 60.158  64.391  51.732  1.00 56.92 ? 108 VAL D CG2 1 
ATOM   591   N N   . GLU A 1 109 ? 60.857  67.630  51.930  1.00 56.82 ? 109 GLU D N   1 
ATOM   592   C CA  . GLU A 1 109 ? 60.217  68.803  52.542  1.00 56.89 ? 109 GLU D CA  1 
ATOM   593   C C   . GLU A 1 109 ? 58.687  68.756  52.436  1.00 56.90 ? 109 GLU D C   1 
ATOM   594   O O   . GLU A 1 109 ? 58.145  68.137  51.521  1.00 56.81 ? 109 GLU D O   1 
ATOM   595   C CB  . GLU A 1 109 ? 60.804  70.110  51.984  1.00 56.95 ? 109 GLU D CB  1 
ATOM   596   C CG  . GLU A 1 109 ? 61.291  70.039  50.526  1.00 57.11 ? 109 GLU D CG  1 
ATOM   597   C CD  . GLU A 1 109 ? 62.588  70.816  50.284  1.00 57.25 ? 109 GLU D CD  1 
ATOM   598   O OE1 . GLU A 1 109 ? 62.820  71.849  50.959  1.00 57.21 ? 109 GLU D OE1 1 
ATOM   599   O OE2 . GLU A 1 109 ? 63.379  70.391  49.412  1.00 56.78 ? 109 GLU D OE2 1 
ATOM   600   N N   . ALA A 1 110 ? 58.012  69.434  53.370  1.00 57.01 ? 110 ALA D N   1 
ATOM   601   C CA  . ALA A 1 110 ? 56.582  69.209  53.687  1.00 57.14 ? 110 ALA D CA  1 
ATOM   602   C C   . ALA A 1 110 ? 55.567  69.186  52.541  1.00 57.22 ? 110 ALA D C   1 
ATOM   603   O O   . ALA A 1 110 ? 54.557  68.480  52.634  1.00 57.19 ? 110 ALA D O   1 
ATOM   604   C CB  . ALA A 1 110 ? 56.111  70.168  54.786  1.00 57.12 ? 110 ALA D CB  1 
ATOM   605   N N   . GLN A 1 111 ? 55.815  69.959  51.483  1.00 57.38 ? 111 GLN D N   1 
ATOM   606   C CA  . GLN A 1 111 ? 54.907  69.988  50.325  1.00 57.43 ? 111 GLN D CA  1 
ATOM   607   C C   . GLN A 1 111 ? 54.868  68.646  49.588  1.00 57.27 ? 111 GLN D C   1 
ATOM   608   O O   . GLN A 1 111 ? 53.800  68.198  49.166  1.00 57.22 ? 111 GLN D O   1 
ATOM   609   C CB  . GLN A 1 111 ? 55.219  71.147  49.360  1.00 57.49 ? 111 GLN D CB  1 
ATOM   610   C CG  . GLN A 1 111 ? 56.627  71.175  48.763  1.00 57.83 ? 111 GLN D CG  1 
ATOM   611   C CD  . GLN A 1 111 ? 57.633  71.851  49.677  1.00 58.39 ? 111 GLN D CD  1 
ATOM   612   O OE1 . GLN A 1 111 ? 58.110  71.257  50.642  1.00 58.54 ? 111 GLN D OE1 1 
ATOM   613   N NE2 . GLN A 1 111 ? 57.962  73.103  49.373  1.00 58.43 ? 111 GLN D NE2 1 
ATOM   614   N N   . THR A 1 112 ? 56.029  68.003  49.461  1.00 57.07 ? 112 THR D N   1 
ATOM   615   C CA  . THR A 1 112 ? 56.109  66.680  48.841  1.00 56.97 ? 112 THR D CA  1 
ATOM   616   C C   . THR A 1 112 ? 55.621  65.576  49.786  1.00 56.79 ? 112 THR D C   1 
ATOM   617   O O   . THR A 1 112 ? 55.556  64.407  49.403  1.00 56.75 ? 112 THR D O   1 
ATOM   618   C CB  . THR A 1 112 ? 57.541  66.343  48.325  1.00 56.94 ? 112 THR D CB  1 
ATOM   619   O OG1 . THR A 1 112 ? 58.402  66.032  49.428  1.00 57.12 ? 112 THR D OG1 1 
ATOM   620   C CG2 . THR A 1 112 ? 58.127  67.501  47.521  1.00 57.00 ? 112 THR D CG2 1 
ATOM   621   N N   . LEU A 1 113 ? 55.272  65.956  51.012  1.00 56.63 ? 113 LEU D N   1 
ATOM   622   C CA  . LEU A 1 113 ? 54.834  64.993  52.019  1.00 56.54 ? 113 LEU D CA  1 
ATOM   623   C C   . LEU A 1 113 ? 53.319  64.832  52.060  1.00 56.40 ? 113 LEU D C   1 
ATOM   624   O O   . LEU A 1 113 ? 52.818  63.709  52.106  1.00 56.37 ? 113 LEU D O   1 
ATOM   625   C CB  . LEU A 1 113 ? 55.382  65.363  53.402  1.00 56.56 ? 113 LEU D CB  1 
ATOM   626   C CG  . LEU A 1 113 ? 56.891  65.172  53.606  1.00 56.70 ? 113 LEU D CG  1 
ATOM   627   C CD1 . LEU A 1 113 ? 57.359  65.845  54.889  1.00 56.83 ? 113 LEU D CD1 1 
ATOM   628   C CD2 . LEU A 1 113 ? 57.254  63.691  53.618  1.00 56.75 ? 113 LEU D CD2 1 
ATOM   629   N N   . ALA A 1 114 ? 52.597  65.953  52.039  1.00 56.25 ? 114 ALA D N   1 
ATOM   630   C CA  . ALA A 1 114 ? 51.132  65.944  52.065  1.00 56.06 ? 114 ALA D CA  1 
ATOM   631   C C   . ALA A 1 114 ? 50.569  65.125  50.910  1.00 55.91 ? 114 ALA D C   1 
ATOM   632   O O   . ALA A 1 114 ? 49.610  64.366  51.078  1.00 55.96 ? 114 ALA D O   1 
ATOM   633   C CB  . ALA A 1 114 ? 50.594  67.357  52.016  1.00 56.02 ? 114 ALA D CB  1 
ATOM   634   N N   . ASN A 1 115 ? 51.182  65.287  49.742  1.00 55.67 ? 115 ASN D N   1 
ATOM   635   C CA  . ASN A 1 115 ? 50.812  64.536  48.557  1.00 55.48 ? 115 ASN D CA  1 
ATOM   636   C C   . ASN A 1 115 ? 51.257  63.083  48.658  1.00 55.40 ? 115 ASN D C   1 
ATOM   637   O O   . ASN A 1 115 ? 50.666  62.199  48.047  1.00 55.29 ? 115 ASN D O   1 
ATOM   638   C CB  . ASN A 1 115 ? 51.415  65.189  47.315  1.00 55.44 ? 115 ASN D CB  1 
ATOM   639   C CG  . ASN A 1 115 ? 50.929  66.612  47.105  1.00 55.37 ? 115 ASN D CG  1 
ATOM   640   O OD1 . ASN A 1 115 ? 50.179  67.160  47.914  1.00 55.56 ? 115 ASN D OD1 1 
ATOM   641   N ND2 . ASN A 1 115 ? 51.359  67.218  46.008  1.00 55.66 ? 115 ASN D ND2 1 
ATOM   642   N N   . CYS A 1 116 ? 52.302  62.849  49.441  1.00 55.49 ? 116 CYS D N   1 
ATOM   643   C CA  . CYS A 1 116 ? 52.856  61.517  49.611  1.00 55.53 ? 116 CYS D CA  1 
ATOM   644   C C   . CYS A 1 116 ? 52.043  60.695  50.607  1.00 55.64 ? 116 CYS D C   1 
ATOM   645   O O   . CYS A 1 116 ? 51.874  59.492  50.422  1.00 55.60 ? 116 CYS D O   1 
ATOM   646   C CB  . CYS A 1 116 ? 54.310  61.608  50.061  1.00 55.51 ? 116 CYS D CB  1 
ATOM   647   S SG  . CYS A 1 116 ? 55.279  60.154  49.685  1.00 55.66 ? 116 CYS D SG  1 
ATOM   648   N N   . TYR A 1 117 ? 51.547  61.343  51.662  1.00 55.79 ? 117 TYR D N   1 
ATOM   649   C CA  . TYR A 1 117 ? 50.672  60.675  52.624  1.00 55.92 ? 117 TYR D CA  1 
ATOM   650   C C   . TYR A 1 117 ? 49.321  60.341  52.000  1.00 55.81 ? 117 TYR D C   1 
ATOM   651   O O   . TYR A 1 117 ? 48.819  59.231  52.179  1.00 55.81 ? 117 TYR D O   1 
ATOM   652   C CB  . TYR A 1 117 ? 50.477  61.509  53.896  1.00 56.19 ? 117 TYR D CB  1 
ATOM   653   C CG  . TYR A 1 117 ? 51.759  61.887  54.615  1.00 56.75 ? 117 TYR D CG  1 
ATOM   654   C CD1 . TYR A 1 117 ? 51.956  63.189  55.077  1.00 57.02 ? 117 TYR D CD1 1 
ATOM   655   C CD2 . TYR A 1 117 ? 52.776  60.947  54.834  1.00 57.09 ? 117 TYR D CD2 1 
ATOM   656   C CE1 . TYR A 1 117 ? 53.127  63.551  55.736  1.00 57.12 ? 117 TYR D CE1 1 
ATOM   657   C CE2 . TYR A 1 117 ? 53.954  61.300  55.491  1.00 56.87 ? 117 TYR D CE2 1 
ATOM   658   C CZ  . TYR A 1 117 ? 54.119  62.605  55.939  1.00 56.86 ? 117 TYR D CZ  1 
ATOM   659   O OH  . TYR A 1 117 ? 55.272  62.974  56.592  1.00 56.80 ? 117 TYR D OH  1 
ATOM   660   N N   . THR A 1 118 ? 48.744  61.293  51.265  1.00 55.68 ? 118 THR D N   1 
ATOM   661   C CA  . THR A 1 118 ? 47.480  61.057  50.554  1.00 55.57 ? 118 THR D CA  1 
ATOM   662   C C   . THR A 1 118 ? 47.651  60.017  49.447  1.00 55.44 ? 118 THR D C   1 
ATOM   663   O O   . THR A 1 118 ? 46.716  59.273  49.144  1.00 55.40 ? 118 THR D O   1 
ATOM   664   C CB  . THR A 1 118 ? 46.840  62.357  49.983  1.00 55.55 ? 118 THR D CB  1 
ATOM   665   O OG1 . THR A 1 118 ? 47.849  63.185  49.399  1.00 55.38 ? 118 THR D OG1 1 
ATOM   666   C CG2 . THR A 1 118 ? 46.119  63.142  51.083  1.00 55.71 ? 118 THR D CG2 1 
ATOM   667   N N   . ALA A 1 119 ? 48.851  59.962  48.867  1.00 55.29 ? 119 ALA D N   1 
ATOM   668   C CA  . ALA A 1 119 ? 49.179  58.966  47.847  1.00 55.22 ? 119 ALA D CA  1 
ATOM   669   C C   . ALA A 1 119 ? 49.101  57.562  48.414  1.00 55.21 ? 119 ALA D C   1 
ATOM   670   O O   . ALA A 1 119 ? 48.798  56.619  47.692  1.00 55.43 ? 119 ALA D O   1 
ATOM   671   C CB  . ALA A 1 119 ? 50.565  59.214  47.262  1.00 55.13 ? 119 ALA D CB  1 
ATOM   672   N N   . MET A 1 120 ? 49.381  57.433  49.707  1.00 55.22 ? 120 MET D N   1 
ATOM   673   C CA  . MET A 1 120 ? 49.389  56.134  50.376  1.00 55.10 ? 120 MET D CA  1 
ATOM   674   C C   . MET A 1 120 ? 48.041  55.819  51.018  1.00 55.19 ? 120 MET D C   1 
ATOM   675   O O   . MET A 1 120 ? 47.619  54.663  51.031  1.00 55.24 ? 120 MET D O   1 
ATOM   676   C CB  . MET A 1 120 ? 50.522  56.060  51.402  1.00 55.10 ? 120 MET D CB  1 
ATOM   677   C CG  . MET A 1 120 ? 51.898  56.344  50.806  1.00 54.80 ? 120 MET D CG  1 
ATOM   678   S SD  . MET A 1 120 ? 53.255  56.280  51.985  1.00 54.87 ? 120 MET D SD  1 
ATOM   679   C CE  . MET A 1 120 ? 52.872  57.631  53.102  1.00 55.43 ? 120 MET D CE  1 
ATOM   680   N N   . GLU A 1 121 ? 47.366  56.851  51.526  1.00 55.19 ? 121 GLU D N   1 
ATOM   681   C CA  . GLU A 1 121 ? 46.003  56.717  52.052  1.00 55.35 ? 121 GLU D CA  1 
ATOM   682   C C   . GLU A 1 121 ? 45.022  56.250  50.973  1.00 55.25 ? 121 GLU D C   1 
ATOM   683   O O   . GLU A 1 121 ? 43.918  55.804  51.282  1.00 55.41 ? 121 GLU D O   1 
ATOM   684   C CB  . GLU A 1 121 ? 45.533  58.021  52.704  1.00 55.33 ? 121 GLU D CB  1 
ATOM   685   C CG  . GLU A 1 121 ? 46.163  58.281  54.077  1.00 55.66 ? 121 GLU D CG  1 
ATOM   686   C CD  . GLU A 1 121 ? 45.950  59.702  54.587  1.00 55.78 ? 121 GLU D CD  1 
ATOM   687   O OE1 . GLU A 1 121 ? 46.027  60.659  53.780  1.00 56.20 ? 121 GLU D OE1 1 
ATOM   688   O OE2 . GLU A 1 121 ? 45.717  59.862  55.807  1.00 56.33 ? 121 GLU D OE2 1 
ATOM   689   N N   . MET A 1 122 ? 45.433  56.387  49.715  1.00 55.20 ? 122 MET D N   1 
ATOM   690   C CA  . MET A 1 122 ? 44.853  55.654  48.596  1.00 55.16 ? 122 MET D CA  1 
ATOM   691   C C   . MET A 1 122 ? 45.901  54.613  48.233  1.00 55.22 ? 122 MET D C   1 
ATOM   692   O O   . MET A 1 122 ? 47.091  54.920  48.204  1.00 55.35 ? 122 MET D O   1 
ATOM   693   C CB  . MET A 1 122 ? 44.624  56.569  47.392  1.00 55.17 ? 122 MET D CB  1 
ATOM   694   C CG  . MET A 1 122 ? 43.961  57.915  47.690  1.00 55.28 ? 122 MET D CG  1 
ATOM   695   S SD  . MET A 1 122 ? 43.959  59.031  46.260  1.00 55.10 ? 122 MET D SD  1 
ATOM   696   C CE  . MET A 1 122 ? 42.775  58.223  45.187  1.00 54.97 ? 122 MET D CE  1 
ATOM   697   N N   . ASP A 1 123 ? 45.483  53.383  47.960  1.00 55.18 ? 123 ASP D N   1 
ATOM   698   C CA  . ASP A 1 123 ? 46.446  52.318  47.669  1.00 55.04 ? 123 ASP D CA  1 
ATOM   699   C C   . ASP A 1 123 ? 47.176  52.506  46.338  1.00 54.88 ? 123 ASP D C   1 
ATOM   700   O O   . ASP A 1 123 ? 46.754  51.986  45.300  1.00 55.05 ? 123 ASP D O   1 
ATOM   701   C CB  . ASP A 1 123 ? 45.781  50.950  47.749  1.00 55.03 ? 123 ASP D CB  1 
ATOM   702   C CG  . ASP A 1 123 ? 45.598  50.494  49.168  1.00 55.59 ? 123 ASP D CG  1 
ATOM   703   O OD1 . ASP A 1 123 ? 46.607  50.095  49.788  1.00 56.44 ? 123 ASP D OD1 1 
ATOM   704   O OD2 . ASP A 1 123 ? 44.454  50.544  49.670  1.00 55.79 ? 123 ASP D OD2 1 
ATOM   705   N N   . LEU A 1 124 ? 48.265  53.274  46.384  1.00 54.44 ? 124 LEU D N   1 
ATOM   706   C CA  . LEU A 1 124 ? 49.148  53.460  45.233  1.00 53.91 ? 124 LEU D CA  1 
ATOM   707   C C   . LEU A 1 124 ? 50.559  53.042  45.615  1.00 53.52 ? 124 LEU D C   1 
ATOM   708   O O   . LEU A 1 124 ? 50.976  53.226  46.757  1.00 53.47 ? 124 LEU D O   1 
ATOM   709   C CB  . LEU A 1 124 ? 49.163  54.920  44.750  1.00 53.86 ? 124 LEU D CB  1 
ATOM   710   C CG  . LEU A 1 124 ? 47.918  55.791  44.513  1.00 53.66 ? 124 LEU D CG  1 
ATOM   711   C CD1 . LEU A 1 124 ? 48.316  56.989  43.661  1.00 53.52 ? 124 LEU D CD1 1 
ATOM   712   C CD2 . LEU A 1 124 ? 46.748  55.058  43.866  1.00 53.37 ? 124 LEU D CD2 1 
ATOM   713   N N   . GLU A 1 125 ? 51.288  52.476  44.658  1.00 53.09 ? 125 GLU D N   1 
ATOM   714   C CA  . GLU A 1 125 ? 52.670  52.074  44.887  1.00 52.65 ? 125 GLU D CA  1 
ATOM   715   C C   . GLU A 1 125 ? 53.619  53.258  44.768  1.00 52.42 ? 125 GLU D C   1 
ATOM   716   O O   . GLU A 1 125 ? 53.840  53.792  43.677  1.00 52.33 ? 125 GLU D O   1 
ATOM   717   C CB  . GLU A 1 125 ? 53.079  50.957  43.927  1.00 52.61 ? 125 GLU D CB  1 
ATOM   718   C CG  . GLU A 1 125 ? 52.803  49.563  44.463  1.00 52.68 ? 125 GLU D CG  1 
ATOM   719   C CD  . GLU A 1 125 ? 53.893  49.053  45.395  1.00 52.51 ? 125 GLU D CD  1 
ATOM   720   O OE1 . GLU A 1 125 ? 55.024  49.592  45.372  1.00 52.00 ? 125 GLU D OE1 1 
ATOM   721   O OE2 . GLU A 1 125 ? 53.612  48.096  46.145  1.00 52.28 ? 125 GLU D OE2 1 
ATOM   722   N N   . VAL A 1 126 ? 54.175  53.667  45.902  1.00 52.06 ? 126 VAL D N   1 
ATOM   723   C CA  . VAL A 1 126 ? 55.132  54.763  45.923  1.00 51.64 ? 126 VAL D CA  1 
ATOM   724   C C   . VAL A 1 126 ? 56.539  54.220  45.661  1.00 51.35 ? 126 VAL D C   1 
ATOM   725   O O   . VAL A 1 126 ? 57.065  53.414  46.431  1.00 51.22 ? 126 VAL D O   1 
ATOM   726   C CB  . VAL A 1 126 ? 55.047  55.581  47.240  1.00 51.65 ? 126 VAL D CB  1 
ATOM   727   C CG1 . VAL A 1 126 ? 56.073  56.703  47.249  1.00 51.77 ? 126 VAL D CG1 1 
ATOM   728   C CG2 . VAL A 1 126 ? 53.647  56.157  47.418  1.00 51.22 ? 126 VAL D CG2 1 
ATOM   729   N N   . VAL A 1 127 ? 57.119  54.652  44.544  1.00 51.18 ? 127 VAL D N   1 
ATOM   730   C CA  . VAL A 1 127 ? 58.467  54.248  44.139  1.00 50.91 ? 127 VAL D CA  1 
ATOM   731   C C   . VAL A 1 127 ? 59.472  55.338  44.514  1.00 50.77 ? 127 VAL D C   1 
ATOM   732   O O   . VAL A 1 127 ? 59.441  56.433  43.943  1.00 50.78 ? 127 VAL D O   1 
ATOM   733   C CB  . VAL A 1 127 ? 58.560  53.959  42.618  1.00 50.70 ? 127 VAL D CB  1 
ATOM   734   C CG1 . VAL A 1 127 ? 59.954  53.463  42.250  1.00 50.57 ? 127 VAL D CG1 1 
ATOM   735   C CG2 . VAL A 1 127 ? 57.509  52.944  42.194  1.00 50.58 ? 127 VAL D CG2 1 
ATOM   736   N N   . PRO A 1 128 ? 60.359  55.043  45.484  1.00 50.55 ? 128 PRO D N   1 
ATOM   737   C CA  . PRO A 1 128 ? 61.375  56.005  45.900  1.00 50.50 ? 128 PRO D CA  1 
ATOM   738   C C   . PRO A 1 128 ? 62.501  56.136  44.870  1.00 50.57 ? 128 PRO D C   1 
ATOM   739   O O   . PRO A 1 128 ? 63.062  55.127  44.425  1.00 50.56 ? 128 PRO D O   1 
ATOM   740   C CB  . PRO A 1 128 ? 61.896  55.419  47.210  1.00 50.37 ? 128 PRO D CB  1 
ATOM   741   C CG  . PRO A 1 128 ? 61.669  53.959  47.080  1.00 50.56 ? 128 PRO D CG  1 
ATOM   742   C CD  . PRO A 1 128 ? 60.441  53.783  46.244  1.00 50.46 ? 128 PRO D CD  1 
ATOM   743   N N   . VAL A 1 129 ? 62.805  57.376  44.492  1.00 50.54 ? 129 VAL D N   1 
ATOM   744   C CA  . VAL A 1 129 ? 63.859  57.665  43.523  1.00 50.61 ? 129 VAL D CA  1 
ATOM   745   C C   . VAL A 1 129 ? 64.812  58.729  44.063  1.00 50.72 ? 129 VAL D C   1 
ATOM   746   O O   . VAL A 1 129 ? 64.406  59.861  44.340  1.00 50.63 ? 129 VAL D O   1 
ATOM   747   C CB  . VAL A 1 129 ? 63.280  58.122  42.151  1.00 50.65 ? 129 VAL D CB  1 
ATOM   748   C CG1 . VAL A 1 129 ? 64.387  58.649  41.235  1.00 50.31 ? 129 VAL D CG1 1 
ATOM   749   C CG2 . VAL A 1 129 ? 62.524  56.984  41.475  1.00 50.50 ? 129 VAL D CG2 1 
ATOM   750   N N   . LEU A 1 130 ? 66.079  58.349  44.205  1.00 50.89 ? 130 LEU D N   1 
ATOM   751   C CA  . LEU A 1 130 ? 67.130  59.270  44.628  1.00 51.08 ? 130 LEU D CA  1 
ATOM   752   C C   . LEU A 1 130 ? 67.718  59.986  43.411  1.00 51.28 ? 130 LEU D C   1 
ATOM   753   O O   . LEU A 1 130 ? 68.374  59.369  42.568  1.00 51.47 ? 130 LEU D O   1 
ATOM   754   C CB  . LEU A 1 130 ? 68.216  58.521  45.413  1.00 50.91 ? 130 LEU D CB  1 
ATOM   755   C CG  . LEU A 1 130 ? 67.759  57.751  46.660  1.00 50.94 ? 130 LEU D CG  1 
ATOM   756   C CD1 . LEU A 1 130 ? 68.776  56.688  47.064  1.00 50.69 ? 130 LEU D CD1 1 
ATOM   757   C CD2 . LEU A 1 130 ? 67.448  58.681  47.833  1.00 50.43 ? 130 LEU D CD2 1 
ATOM   758   N N   . ASN A 1 131 ? 67.473  61.289  43.318  1.00 51.40 ? 131 ASN D N   1 
ATOM   759   C CA  . ASN A 1 131 ? 67.874  62.056  42.142  1.00 51.53 ? 131 ASN D CA  1 
ATOM   760   C C   . ASN A 1 131 ? 69.140  62.887  42.353  1.00 51.71 ? 131 ASN D C   1 
ATOM   761   O O   . ASN A 1 131 ? 69.479  63.247  43.487  1.00 51.69 ? 131 ASN D O   1 
ATOM   762   C CB  . ASN A 1 131 ? 66.721  62.953  41.670  1.00 51.43 ? 131 ASN D CB  1 
ATOM   763   C CG  . ASN A 1 131 ? 66.745  63.204  40.169  1.00 51.44 ? 131 ASN D CG  1 
ATOM   764   O OD1 . ASN A 1 131 ? 66.111  64.134  39.675  1.00 51.36 ? 131 ASN D OD1 1 
ATOM   765   N ND2 . ASN A 1 131 ? 67.472  62.371  39.439  1.00 51.54 ? 131 ASN D ND2 1 
ATOM   766   N N   . LYS A 1 132 ? 69.826  63.175  41.246  1.00 51.86 ? 132 LYS D N   1 
ATOM   767   C CA  . LYS A 1 132 ? 70.980  64.079  41.209  1.00 52.01 ? 132 LYS D CA  1 
ATOM   768   C C   . LYS A 1 132 ? 72.165  63.604  42.060  1.00 52.19 ? 132 LYS D C   1 
ATOM   769   O O   . LYS A 1 132 ? 72.769  64.392  42.797  1.00 52.22 ? 132 LYS D O   1 
ATOM   770   C CB  . LYS A 1 132 ? 70.570  65.513  41.592  1.00 52.02 ? 132 LYS D CB  1 
ATOM   771   C CG  . LYS A 1 132 ? 69.440  66.112  40.758  1.00 51.96 ? 132 LYS D CG  1 
ATOM   772   C CD  . LYS A 1 132 ? 69.181  67.562  41.155  1.00 51.92 ? 132 LYS D CD  1 
ATOM   773   C CE  . LYS A 1 132 ? 67.838  68.069  40.639  1.00 51.57 ? 132 LYS D CE  1 
ATOM   774   N NZ  . LYS A 1 132 ? 67.811  68.259  39.164  1.00 51.05 ? 132 LYS D NZ  1 
ATOM   775   N N   . ILE A 1 133 ? 72.503  62.321  41.943  1.00 52.40 ? 133 ILE D N   1 
ATOM   776   C CA  . ILE A 1 133 ? 73.614  61.734  42.708  1.00 52.68 ? 133 ILE D CA  1 
ATOM   777   C C   . ILE A 1 133 ? 75.007  62.232  42.287  1.00 52.93 ? 133 ILE D C   1 
ATOM   778   O O   . ILE A 1 133 ? 75.981  62.070  43.024  1.00 52.94 ? 133 ILE D O   1 
ATOM   779   C CB  . ILE A 1 133 ? 73.576  60.178  42.709  1.00 52.61 ? 133 ILE D CB  1 
ATOM   780   C CG1 . ILE A 1 133 ? 73.119  59.624  41.355  1.00 52.52 ? 133 ILE D CG1 1 
ATOM   781   C CG2 . ILE A 1 133 ? 72.656  59.670  43.812  1.00 52.58 ? 133 ILE D CG2 1 
ATOM   782   C CD1 . ILE A 1 133 ? 74.185  59.585  40.279  1.00 52.16 ? 133 ILE D CD1 1 
ATOM   783   N N   . ASP A 1 134 ? 75.085  62.847  41.111  1.00 53.29 ? 134 ASP D N   1 
ATOM   784   C CA  . ASP A 1 134 ? 76.333  63.392  40.593  1.00 53.68 ? 134 ASP D CA  1 
ATOM   785   C C   . ASP A 1 134 ? 76.845  64.579  41.399  1.00 53.99 ? 134 ASP D C   1 
ATOM   786   O O   . ASP A 1 134 ? 78.055  64.730  41.579  1.00 54.09 ? 134 ASP D O   1 
ATOM   787   C CB  . ASP A 1 134 ? 76.164  63.815  39.133  1.00 53.66 ? 134 ASP D CB  1 
ATOM   788   C CG  . ASP A 1 134 ? 76.276  62.656  38.168  1.00 53.66 ? 134 ASP D CG  1 
ATOM   789   O OD1 . ASP A 1 134 ? 76.585  61.528  38.600  1.00 54.01 ? 134 ASP D OD1 1 
ATOM   790   O OD2 . ASP A 1 134 ? 76.063  62.879  36.963  1.00 54.02 ? 134 ASP D OD2 1 
ATOM   791   N N   . LEU A 1 135 ? 75.921  65.411  41.877  1.00 54.35 ? 135 LEU D N   1 
ATOM   792   C CA  . LEU A 1 135 ? 76.261  66.675  42.541  1.00 54.72 ? 135 LEU D CA  1 
ATOM   793   C C   . LEU A 1 135 ? 77.149  66.477  43.777  1.00 55.04 ? 135 LEU D C   1 
ATOM   794   O O   . LEU A 1 135 ? 76.996  65.484  44.493  1.00 54.95 ? 135 LEU D O   1 
ATOM   795   C CB  . LEU A 1 135 ? 74.990  67.463  42.896  1.00 54.66 ? 135 LEU D CB  1 
ATOM   796   C CG  . LEU A 1 135 ? 74.012  67.833  41.769  1.00 54.51 ? 135 LEU D CG  1 
ATOM   797   C CD1 . LEU A 1 135 ? 72.729  68.420  42.337  1.00 54.52 ? 135 LEU D CD1 1 
ATOM   798   C CD2 . LEU A 1 135 ? 74.631  68.790  40.753  1.00 54.38 ? 135 LEU D CD2 1 
ATOM   799   N N   . PRO A 1 136 ? 78.089  67.418  44.020  1.00 55.45 ? 136 PRO D N   1 
ATOM   800   C CA  . PRO A 1 136 ? 79.050  67.314  45.129  1.00 55.79 ? 136 PRO D CA  1 
ATOM   801   C C   . PRO A 1 136 ? 78.423  67.311  46.529  1.00 56.13 ? 136 PRO D C   1 
ATOM   802   O O   . PRO A 1 136 ? 79.075  66.897  47.488  1.00 56.15 ? 136 PRO D O   1 
ATOM   803   C CB  . PRO A 1 136 ? 79.934  68.557  44.950  1.00 55.75 ? 136 PRO D CB  1 
ATOM   804   C CG  . PRO A 1 136 ? 79.109  69.509  44.160  1.00 55.62 ? 136 PRO D CG  1 
ATOM   805   C CD  . PRO A 1 136 ? 78.301  68.650  43.236  1.00 55.49 ? 136 PRO D CD  1 
ATOM   806   N N   . ALA A 1 137 ? 77.177  67.766  46.642  1.00 56.57 ? 137 ALA D N   1 
ATOM   807   C CA  . ALA A 1 137 ? 76.494  67.825  47.934  1.00 56.96 ? 137 ALA D CA  1 
ATOM   808   C C   . ALA A 1 137 ? 75.449  66.717  48.110  1.00 57.25 ? 137 ALA D C   1 
ATOM   809   O O   . ALA A 1 137 ? 74.592  66.803  48.992  1.00 57.34 ? 137 ALA D O   1 
ATOM   810   C CB  . ALA A 1 137 ? 75.863  69.206  48.135  1.00 56.91 ? 137 ALA D CB  1 
ATOM   811   N N   . ALA A 1 138 ? 75.536  65.674  47.284  1.00 57.59 ? 138 ALA D N   1 
ATOM   812   C CA  . ALA A 1 138 ? 74.604  64.543  47.352  1.00 57.98 ? 138 ALA D CA  1 
ATOM   813   C C   . ALA A 1 138 ? 74.924  63.604  48.512  1.00 58.25 ? 138 ALA D C   1 
ATOM   814   O O   . ALA A 1 138 ? 76.093  63.368  48.825  1.00 58.23 ? 138 ALA D O   1 
ATOM   815   C CB  . ALA A 1 138 ? 74.597  63.774  46.037  1.00 57.95 ? 138 ALA D CB  1 
ATOM   816   N N   . ASP A 1 139 ? 73.876  63.070  49.138  1.00 58.65 ? 139 ASP D N   1 
ATOM   817   C CA  . ASP A 1 139 ? 74.019  62.160  50.278  1.00 59.09 ? 139 ASP D CA  1 
ATOM   818   C C   . ASP A 1 139 ? 72.945  61.062  50.262  1.00 59.35 ? 139 ASP D C   1 
ATOM   819   O O   . ASP A 1 139 ? 71.952  61.151  50.992  1.00 59.35 ? 139 ASP D O   1 
ATOM   820   C CB  . ASP A 1 139 ? 73.979  62.940  51.599  1.00 59.05 ? 139 ASP D CB  1 
ATOM   821   C CG  . ASP A 1 139 ? 74.569  62.159  52.764  1.00 59.06 ? 139 ASP D CG  1 
ATOM   822   O OD1 . ASP A 1 139 ? 74.757  60.927  52.647  1.00 59.08 ? 139 ASP D OD1 1 
ATOM   823   O OD2 . ASP A 1 139 ? 74.841  62.786  53.810  1.00 59.12 ? 139 ASP D OD2 1 
ATOM   824   N N   . PRO A 1 140 ? 73.159  60.011  49.444  1.00 59.60 ? 140 PRO D N   1 
ATOM   825   C CA  . PRO A 1 140 ? 72.175  58.948  49.214  1.00 59.85 ? 140 PRO D CA  1 
ATOM   826   C C   . PRO A 1 140 ? 71.713  58.206  50.476  1.00 60.13 ? 140 PRO D C   1 
ATOM   827   O O   . PRO A 1 140 ? 70.508  58.023  50.659  1.00 60.22 ? 140 PRO D O   1 
ATOM   828   C CB  . PRO A 1 140 ? 72.911  57.991  48.267  1.00 59.87 ? 140 PRO D CB  1 
ATOM   829   C CG  . PRO A 1 140 ? 73.944  58.831  47.608  1.00 59.71 ? 140 PRO D CG  1 
ATOM   830   C CD  . PRO A 1 140 ? 74.393  59.776  48.673  1.00 59.59 ? 140 PRO D CD  1 
ATOM   831   N N   . GLU A 1 141 ? 72.651  57.790  51.329  1.00 60.35 ? 141 GLU D N   1 
ATOM   832   C CA  . GLU A 1 141 ? 72.321  56.997  52.523  1.00 60.54 ? 141 GLU D CA  1 
ATOM   833   C C   . GLU A 1 141 ? 71.546  57.775  53.585  1.00 60.45 ? 141 GLU D C   1 
ATOM   834   O O   . GLU A 1 141 ? 70.678  57.214  54.259  1.00 60.40 ? 141 GLU D O   1 
ATOM   835   C CB  . GLU A 1 141 ? 73.575  56.372  53.146  1.00 60.66 ? 141 GLU D CB  1 
ATOM   836   C CG  . GLU A 1 141 ? 74.025  55.070  52.492  1.00 61.40 ? 141 GLU D CG  1 
ATOM   837   C CD  . GLU A 1 141 ? 74.834  55.284  51.217  1.00 62.53 ? 141 GLU D CD  1 
ATOM   838   O OE1 . GLU A 1 141 ? 75.618  56.261  51.157  1.00 62.96 ? 141 GLU D OE1 1 
ATOM   839   O OE2 . GLU A 1 141 ? 74.694  54.463  50.280  1.00 62.70 ? 141 GLU D OE2 1 
ATOM   840   N N   . ARG A 1 142 ? 71.870  59.060  53.727  1.00 60.36 ? 142 ARG D N   1 
ATOM   841   C CA  . ARG A 1 142 ? 71.210  59.933  54.698  1.00 60.28 ? 142 ARG D CA  1 
ATOM   842   C C   . ARG A 1 142 ? 69.775  60.217  54.274  1.00 60.07 ? 142 ARG D C   1 
ATOM   843   O O   . ARG A 1 142 ? 68.877  60.307  55.114  1.00 60.17 ? 142 ARG D O   1 
ATOM   844   C CB  . ARG A 1 142 ? 71.972  61.252  54.843  1.00 60.37 ? 142 ARG D CB  1 
ATOM   845   C CG  . ARG A 1 142 ? 71.500  62.143  55.993  1.00 60.65 ? 142 ARG D CG  1 
ATOM   846   C CD  . ARG A 1 142 ? 71.197  63.563  55.514  1.00 61.03 ? 142 ARG D CD  1 
ATOM   847   N NE  . ARG A 1 142 ? 72.374  64.249  54.973  1.00 61.14 ? 142 ARG D NE  1 
ATOM   848   C CZ  . ARG A 1 142 ? 72.330  65.195  54.034  1.00 61.12 ? 142 ARG D CZ  1 
ATOM   849   N NH1 . ARG A 1 142 ? 71.167  65.576  53.504  1.00 60.95 ? 142 ARG D NH1 1 
ATOM   850   N NH2 . ARG A 1 142 ? 73.458  65.754  53.613  1.00 61.27 ? 142 ARG D NH2 1 
ATOM   851   N N   . VAL A 1 143 ? 69.577  60.360  52.967  1.00 59.79 ? 143 VAL D N   1 
ATOM   852   C CA  . VAL A 1 143 ? 68.266  60.659  52.398  1.00 59.51 ? 143 VAL D CA  1 
ATOM   853   C C   . VAL A 1 143 ? 67.382  59.407  52.357  1.00 59.41 ? 143 VAL D C   1 
ATOM   854   O O   . VAL A 1 143 ? 66.180  59.488  52.613  1.00 59.39 ? 143 VAL D O   1 
ATOM   855   C CB  . VAL A 1 143 ? 68.392  61.319  50.997  1.00 59.47 ? 143 VAL D CB  1 
ATOM   856   C CG1 . VAL A 1 143 ? 67.032  61.484  50.344  1.00 59.43 ? 143 VAL D CG1 1 
ATOM   857   C CG2 . VAL A 1 143 ? 69.081  62.674  51.109  1.00 59.28 ? 143 VAL D CG2 1 
ATOM   858   N N   . ALA A 1 144 ? 67.983  58.256  52.048  1.00 59.25 ? 144 ALA D N   1 
ATOM   859   C CA  . ALA A 1 144 ? 67.275  56.971  52.088  1.00 59.10 ? 144 ALA D CA  1 
ATOM   860   C C   . ALA A 1 144 ? 66.755  56.683  53.495  1.00 59.03 ? 144 ALA D C   1 
ATOM   861   O O   . ALA A 1 144 ? 65.685  56.094  53.663  1.00 58.90 ? 144 ALA D O   1 
ATOM   862   C CB  . ALA A 1 144 ? 68.176  55.842  51.607  1.00 59.08 ? 144 ALA D CB  1 
ATOM   863   N N   . GLU A 1 145 ? 67.525  57.105  54.496  1.00 59.02 ? 145 GLU D N   1 
ATOM   864   C CA  . GLU A 1 145 ? 67.097  57.050  55.889  1.00 59.08 ? 145 GLU D CA  1 
ATOM   865   C C   . GLU A 1 145 ? 65.965  58.040  56.155  1.00 59.03 ? 145 GLU D C   1 
ATOM   866   O O   . GLU A 1 145 ? 65.041  57.728  56.900  1.00 58.98 ? 145 GLU D O   1 
ATOM   867   C CB  . GLU A 1 145 ? 68.270  57.325  56.832  1.00 59.04 ? 145 GLU D CB  1 
ATOM   868   C CG  . GLU A 1 145 ? 69.264  56.182  56.931  1.00 59.21 ? 145 GLU D CG  1 
ATOM   869   C CD  . GLU A 1 145 ? 70.470  56.528  57.785  1.00 59.25 ? 145 GLU D CD  1 
ATOM   870   O OE1 . GLU A 1 145 ? 71.610  56.441  57.274  1.00 59.24 ? 145 GLU D OE1 1 
ATOM   871   O OE2 . GLU A 1 145 ? 70.277  56.890  58.966  1.00 59.55 ? 145 GLU D OE2 1 
ATOM   872   N N   . GLU A 1 146 ? 66.044  59.221  55.538  1.00 59.02 ? 146 GLU D N   1 
ATOM   873   C CA  . GLU A 1 146 ? 65.018  60.264  55.679  1.00 58.98 ? 146 GLU D CA  1 
ATOM   874   C C   . GLU A 1 146 ? 63.677  59.857  55.069  1.00 58.88 ? 146 GLU D C   1 
ATOM   875   O O   . GLU A 1 146 ? 62.624  60.104  55.659  1.00 58.92 ? 146 GLU D O   1 
ATOM   876   C CB  . GLU A 1 146 ? 65.483  61.580  55.053  1.00 59.00 ? 146 GLU D CB  1 
ATOM   877   C CG  . GLU A 1 146 ? 66.391  62.428  55.927  1.00 59.02 ? 146 GLU D CG  1 
ATOM   878   C CD  . GLU A 1 146 ? 66.742  63.755  55.274  1.00 58.96 ? 146 GLU D CD  1 
ATOM   879   O OE1 . GLU A 1 146 ? 65.837  64.403  54.702  1.00 58.89 ? 146 GLU D OE1 1 
ATOM   880   O OE2 . GLU A 1 146 ? 67.923  64.152  55.332  1.00 58.92 ? 146 GLU D OE2 1 
ATOM   881   N N   . ILE A 1 147 ? 63.724  59.247  53.886  1.00 58.75 ? 147 ILE D N   1 
ATOM   882   C CA  . ILE A 1 147 ? 62.532  58.721  53.223  1.00 58.72 ? 147 ILE D CA  1 
ATOM   883   C C   . ILE A 1 147 ? 61.874  57.664  54.112  1.00 58.96 ? 147 ILE D C   1 
ATOM   884   O O   . ILE A 1 147 ? 60.653  57.637  54.269  1.00 58.99 ? 147 ILE D O   1 
ATOM   885   C CB  . ILE A 1 147 ? 62.878  58.121  51.834  1.00 58.63 ? 147 ILE D CB  1 
ATOM   886   C CG1 . ILE A 1 147 ? 63.440  59.203  50.905  1.00 58.37 ? 147 ILE D CG1 1 
ATOM   887   C CG2 . ILE A 1 147 ? 61.658  57.462  51.200  1.00 58.51 ? 147 ILE D CG2 1 
ATOM   888   C CD1 . ILE A 1 147 ? 64.204  58.666  49.718  1.00 57.69 ? 147 ILE D CD1 1 
ATOM   889   N N   . GLU A 1 148 ? 62.705  56.815  54.709  1.00 59.22 ? 148 GLU D N   1 
ATOM   890   C CA  . GLU A 1 148 ? 62.253  55.741  55.586  1.00 59.41 ? 148 GLU D CA  1 
ATOM   891   C C   . GLU A 1 148 ? 61.826  56.285  56.949  1.00 59.33 ? 148 GLU D C   1 
ATOM   892   O O   . GLU A 1 148 ? 60.971  55.702  57.619  1.00 59.27 ? 148 GLU D O   1 
ATOM   893   C CB  . GLU A 1 148 ? 63.380  54.724  55.754  1.00 59.53 ? 148 GLU D CB  1 
ATOM   894   C CG  . GLU A 1 148 ? 62.927  53.280  55.861  1.00 60.24 ? 148 GLU D CG  1 
ATOM   895   C CD  . GLU A 1 148 ? 63.996  52.303  55.391  1.00 61.23 ? 148 GLU D CD  1 
ATOM   896   O OE1 . GLU A 1 148 ? 64.371  51.407  56.184  1.00 61.45 ? 148 GLU D OE1 1 
ATOM   897   O OE2 . GLU A 1 148 ? 64.461  52.435  54.232  1.00 61.14 ? 148 GLU D OE2 1 
ATOM   898   N N   . ASP A 1 149 ? 62.425  57.409  57.341  1.00 59.30 ? 149 ASP D N   1 
ATOM   899   C CA  . ASP A 1 149 ? 62.210  58.014  58.655  1.00 59.21 ? 149 ASP D CA  1 
ATOM   900   C C   . ASP A 1 149 ? 60.926  58.839  58.685  1.00 59.21 ? 149 ASP D C   1 
ATOM   901   O O   . ASP A 1 149 ? 60.087  58.665  59.572  1.00 59.16 ? 149 ASP D O   1 
ATOM   902   C CB  . ASP A 1 149 ? 63.401  58.909  59.016  1.00 59.16 ? 149 ASP D CB  1 
ATOM   903   C CG  . ASP A 1 149 ? 63.886  58.695  60.431  1.00 59.22 ? 149 ASP D CG  1 
ATOM   904   O OD1 . ASP A 1 149 ? 64.367  57.580  60.731  1.00 59.29 ? 149 ASP D OD1 1 
ATOM   905   O OD2 . ASP A 1 149 ? 63.805  59.645  61.238  1.00 59.24 ? 149 ASP D OD2 1 
ATOM   906   N N   . ILE A 1 150 ? 60.786  59.729  57.702  1.00 59.21 ? 150 ILE D N   1 
ATOM   907   C CA  . ILE A 1 150 ? 59.689  60.697  57.651  1.00 59.15 ? 150 ILE D CA  1 
ATOM   908   C C   . ILE A 1 150 ? 58.476  60.152  56.890  1.00 59.15 ? 150 ILE D C   1 
ATOM   909   O O   . ILE A 1 150 ? 57.367  60.139  57.425  1.00 59.19 ? 150 ILE D O   1 
ATOM   910   C CB  . ILE A 1 150 ? 60.155  62.053  57.052  1.00 59.13 ? 150 ILE D CB  1 
ATOM   911   C CG1 . ILE A 1 150 ? 61.387  62.570  57.805  1.00 59.21 ? 150 ILE D CG1 1 
ATOM   912   C CG2 . ILE A 1 150 ? 59.028  63.084  57.094  1.00 59.00 ? 150 ILE D CG2 1 
ATOM   913   C CD1 . ILE A 1 150 ? 62.215  63.597  57.050  1.00 59.40 ? 150 ILE D CD1 1 
ATOM   914   N N   . VAL A 1 151 ? 58.693  59.705  55.654  1.00 59.11 ? 151 VAL D N   1 
ATOM   915   C CA  . VAL A 1 151 ? 57.620  59.148  54.822  1.00 59.12 ? 151 VAL D CA  1 
ATOM   916   C C   . VAL A 1 151 ? 57.230  57.750  55.302  1.00 59.05 ? 151 VAL D C   1 
ATOM   917   O O   . VAL A 1 151 ? 56.054  57.378  55.275  1.00 58.96 ? 151 VAL D O   1 
ATOM   918   C CB  . VAL A 1 151 ? 58.030  59.072  53.327  1.00 59.18 ? 151 VAL D CB  1 
ATOM   919   C CG1 . VAL A 1 151 ? 56.889  58.524  52.475  1.00 59.47 ? 151 VAL D CG1 1 
ATOM   920   C CG2 . VAL A 1 151 ? 58.472  60.431  52.809  1.00 59.13 ? 151 VAL D CG2 1 
ATOM   921   N N   . GLY A 1 152 ? 58.228  56.986  55.741  1.00 59.08 ? 152 GLY D N   1 
ATOM   922   C CA  . GLY A 1 152 ? 58.024  55.607  56.176  1.00 58.97 ? 152 GLY D CA  1 
ATOM   923   C C   . GLY A 1 152 ? 57.895  54.665  54.997  1.00 58.90 ? 152 GLY D C   1 
ATOM   924   O O   . GLY A 1 152 ? 57.047  53.772  55.003  1.00 58.88 ? 152 GLY D O   1 
ATOM   925   N N   . ILE A 1 153 ? 58.733  54.879  53.981  1.00 58.84 ? 153 ILE D N   1 
ATOM   926   C CA  . ILE A 1 153 ? 58.755  54.040  52.779  1.00 58.74 ? 153 ILE D CA  1 
ATOM   927   C C   . ILE A 1 153 ? 60.017  53.177  52.719  1.00 58.68 ? 153 ILE D C   1 
ATOM   928   O O   . ILE A 1 153 ? 61.110  53.632  53.077  1.00 58.70 ? 153 ILE D O   1 
ATOM   929   C CB  . ILE A 1 153 ? 58.556  54.885  51.473  1.00 58.79 ? 153 ILE D CB  1 
ATOM   930   C CG1 . ILE A 1 153 ? 57.151  54.681  50.896  1.00 58.92 ? 153 ILE D CG1 1 
ATOM   931   C CG2 . ILE A 1 153 ? 59.550  54.499  50.379  1.00 58.60 ? 153 ILE D CG2 1 
ATOM   932   C CD1 . ILE A 1 153 ? 56.035  54.720  51.909  1.00 59.12 ? 153 ILE D CD1 1 
ATOM   933   N N   . ASP A 1 154 ? 59.841  51.926  52.288  1.00 58.53 ? 154 ASP D N   1 
ATOM   934   C CA  . ASP A 1 154 ? 60.947  50.995  52.058  1.00 58.40 ? 154 ASP D CA  1 
ATOM   935   C C   . ASP A 1 154 ? 61.894  51.589  51.011  1.00 58.29 ? 154 ASP D C   1 
ATOM   936   O O   . ASP A 1 154 ? 61.597  51.575  49.813  1.00 58.29 ? 154 ASP D O   1 
ATOM   937   C CB  . ASP A 1 154 ? 60.396  49.635  51.599  1.00 58.35 ? 154 ASP D CB  1 
ATOM   938   C CG  . ASP A 1 154 ? 61.440  48.524  51.628  1.00 58.25 ? 154 ASP D CG  1 
ATOM   939   O OD1 . ASP A 1 154 ? 62.527  48.715  52.221  1.00 58.38 ? 154 ASP D OD1 1 
ATOM   940   O OD2 . ASP A 1 154 ? 61.160  47.447  51.058  1.00 57.68 ? 154 ASP D OD2 1 
ATOM   941   N N   . ALA A 1 155 ? 63.024  52.122  51.470  1.00 58.11 ? 155 ALA D N   1 
ATOM   942   C CA  . ALA A 1 155 ? 63.892  52.928  50.608  1.00 58.00 ? 155 ALA D CA  1 
ATOM   943   C C   . ALA A 1 155 ? 65.288  52.342  50.350  1.00 57.89 ? 155 ALA D C   1 
ATOM   944   O O   . ALA A 1 155 ? 66.034  52.860  49.516  1.00 57.83 ? 155 ALA D O   1 
ATOM   945   C CB  . ALA A 1 155 ? 63.999  54.350  51.158  1.00 57.98 ? 155 ALA D CB  1 
ATOM   946   N N   . THR A 1 156 ? 65.635  51.267  51.054  1.00 57.75 ? 156 THR D N   1 
ATOM   947   C CA  . THR A 1 156 ? 66.975  50.668  50.940  1.00 57.49 ? 156 THR D CA  1 
ATOM   948   C C   . THR A 1 156 ? 67.344  50.224  49.512  1.00 57.24 ? 156 THR D C   1 
ATOM   949   O O   . THR A 1 156 ? 68.517  50.259  49.132  1.00 57.14 ? 156 THR D O   1 
ATOM   950   C CB  . THR A 1 156 ? 67.187  49.500  51.953  1.00 57.55 ? 156 THR D CB  1 
ATOM   951   O OG1 . THR A 1 156 ? 65.992  48.709  52.051  1.00 57.57 ? 156 THR D OG1 1 
ATOM   952   C CG2 . THR A 1 156 ? 67.548  50.046  53.337  1.00 57.24 ? 156 THR D CG2 1 
ATOM   953   N N   . ASP A 1 157 ? 66.339  49.834  48.727  1.00 56.90 ? 157 ASP D N   1 
ATOM   954   C CA  . ASP A 1 157 ? 66.558  49.328  47.372  1.00 56.53 ? 157 ASP D CA  1 
ATOM   955   C C   . ASP A 1 157 ? 66.293  50.400  46.304  1.00 56.25 ? 157 ASP D C   1 
ATOM   956   O O   . ASP A 1 157 ? 66.192  50.090  45.112  1.00 56.35 ? 157 ASP D O   1 
ATOM   957   C CB  . ASP A 1 157 ? 65.682  48.089  47.128  1.00 56.58 ? 157 ASP D CB  1 
ATOM   958   C CG  . ASP A 1 157 ? 66.176  47.230  45.965  1.00 56.94 ? 157 ASP D CG  1 
ATOM   959   O OD1 . ASP A 1 157 ? 67.384  46.895  45.928  1.00 57.13 ? 157 ASP D OD1 1 
ATOM   960   O OD2 . ASP A 1 157 ? 65.348  46.879  45.091  1.00 56.85 ? 157 ASP D OD2 1 
ATOM   961   N N   . ALA A 1 158 ? 66.199  51.659  46.731  1.00 55.74 ? 158 ALA D N   1 
ATOM   962   C CA  . ALA A 1 158 ? 65.834  52.760  45.835  1.00 55.07 ? 158 ALA D CA  1 
ATOM   963   C C   . ALA A 1 158 ? 66.827  52.968  44.695  1.00 54.64 ? 158 ALA D C   1 
ATOM   964   O O   . ALA A 1 158 ? 68.045  52.914  44.891  1.00 54.46 ? 158 ALA D O   1 
ATOM   965   C CB  . ALA A 1 158 ? 65.642  54.054  46.619  1.00 55.14 ? 158 ALA D CB  1 
ATOM   966   N N   . VAL A 1 159 ? 66.277  53.205  43.506  1.00 54.13 ? 159 VAL D N   1 
ATOM   967   C CA  . VAL A 1 159 ? 67.059  53.494  42.308  1.00 53.60 ? 159 VAL D CA  1 
ATOM   968   C C   . VAL A 1 159 ? 67.641  54.899  42.403  1.00 53.25 ? 159 VAL D C   1 
ATOM   969   O O   . VAL A 1 159 ? 66.938  55.843  42.776  1.00 53.24 ? 159 VAL D O   1 
ATOM   970   C CB  . VAL A 1 159 ? 66.189  53.408  41.029  1.00 53.68 ? 159 VAL D CB  1 
ATOM   971   C CG1 . VAL A 1 159 ? 67.041  53.623  39.781  1.00 53.64 ? 159 VAL D CG1 1 
ATOM   972   C CG2 . VAL A 1 159 ? 65.447  52.074  40.955  1.00 53.62 ? 159 VAL D CG2 1 
ATOM   973   N N   . ARG A 1 160 ? 68.924  55.031  42.071  1.00 52.68 ? 160 ARG D N   1 
ATOM   974   C CA  . ARG A 1 160 ? 69.566  56.342  42.026  1.00 52.17 ? 160 ARG D CA  1 
ATOM   975   C C   . ARG A 1 160 ? 69.975  56.721  40.612  1.00 51.92 ? 160 ARG D C   1 
ATOM   976   O O   . ARG A 1 160 ? 70.385  55.866  39.825  1.00 52.00 ? 160 ARG D O   1 
ATOM   977   C CB  . ARG A 1 160 ? 70.736  56.455  43.018  1.00 52.15 ? 160 ARG D CB  1 
ATOM   978   C CG  . ARG A 1 160 ? 71.438  55.153  43.392  1.00 51.98 ? 160 ARG D CG  1 
ATOM   979   C CD  . ARG A 1 160 ? 71.341  54.946  44.897  1.00 51.68 ? 160 ARG D CD  1 
ATOM   980   N NE  . ARG A 1 160 ? 72.614  54.601  45.523  1.00 51.76 ? 160 ARG D NE  1 
ATOM   981   C CZ  . ARG A 1 160 ? 72.811  54.537  46.840  1.00 51.92 ? 160 ARG D CZ  1 
ATOM   982   N NH1 . ARG A 1 160 ? 71.817  54.787  47.685  1.00 51.85 ? 160 ARG D NH1 1 
ATOM   983   N NH2 . ARG A 1 160 ? 74.007  54.219  47.318  1.00 51.88 ? 160 ARG D NH2 1 
ATOM   984   N N   . CYS A 1 161 ? 69.844  58.008  40.292  1.00 51.50 ? 161 CYS D N   1 
ATOM   985   C CA  . CYS A 1 161 ? 70.048  58.482  38.926  1.00 51.09 ? 161 CYS D CA  1 
ATOM   986   C C   . CYS A 1 161 ? 70.591  59.909  38.819  1.00 50.95 ? 161 CYS D C   1 
ATOM   987   O O   . CYS A 1 161 ? 70.520  60.692  39.772  1.00 50.94 ? 161 CYS D O   1 
ATOM   988   C CB  . CYS A 1 161 ? 68.757  58.331  38.113  1.00 51.12 ? 161 CYS D CB  1 
ATOM   989   S SG  . CYS A 1 161 ? 67.317  59.096  38.848  1.00 50.39 ? 161 CYS D SG  1 
ATOM   990   N N   . SER A 1 162 ? 71.123  60.230  37.639  1.00 50.68 ? 162 SER D N   1 
ATOM   991   C CA  . SER A 1 162 ? 71.817  61.490  37.389  1.00 50.41 ? 162 SER D CA  1 
ATOM   992   C C   . SER A 1 162 ? 71.051  62.421  36.451  1.00 50.28 ? 162 SER D C   1 
ATOM   993   O O   . SER A 1 162 ? 70.518  61.990  35.430  1.00 50.30 ? 162 SER D O   1 
ATOM   994   C CB  . SER A 1 162 ? 73.204  61.207  36.808  1.00 50.37 ? 162 SER D CB  1 
ATOM   995   O OG  . SER A 1 162 ? 73.686  62.315  36.067  1.00 50.13 ? 162 SER D OG  1 
ATOM   996   N N   . ALA A 1 163 ? 71.015  63.702  36.804  1.00 49.99 ? 163 ALA D N   1 
ATOM   997   C CA  . ALA A 1 163 ? 70.430  64.721  35.944  1.00 49.78 ? 163 ALA D CA  1 
ATOM   998   C C   . ALA A 1 163 ? 71.427  65.152  34.870  1.00 49.70 ? 163 ALA D C   1 
ATOM   999   O O   . ALA A 1 163 ? 71.039  65.661  33.816  1.00 49.47 ? 163 ALA D O   1 
ATOM   1000  C CB  . ALA A 1 163 ? 69.985  65.914  36.769  1.00 49.81 ? 163 ALA D CB  1 
ATOM   1001  N N   . LYS A 1 164 ? 72.711  64.940  35.151  1.00 49.63 ? 164 LYS D N   1 
ATOM   1002  C CA  . LYS A 1 164 ? 73.785  65.309  34.234  1.00 49.58 ? 164 LYS D CA  1 
ATOM   1003  C C   . LYS A 1 164 ? 73.914  64.325  33.071  1.00 49.49 ? 164 LYS D C   1 
ATOM   1004  O O   . LYS A 1 164 ? 74.057  64.739  31.917  1.00 49.42 ? 164 LYS D O   1 
ATOM   1005  C CB  . LYS A 1 164 ? 75.118  65.426  34.980  1.00 49.56 ? 164 LYS D CB  1 
ATOM   1006  C CG  . LYS A 1 164 ? 75.212  66.617  35.926  1.00 49.64 ? 164 LYS D CG  1 
ATOM   1007  C CD  . LYS A 1 164 ? 76.601  66.713  36.541  1.00 49.64 ? 164 LYS D CD  1 
ATOM   1008  C CE  . LYS A 1 164 ? 76.691  67.857  37.534  1.00 49.66 ? 164 LYS D CE  1 
ATOM   1009  N NZ  . LYS A 1 164 ? 78.004  67.866  38.243  1.00 49.66 ? 164 LYS D NZ  1 
ATOM   1010  N N   . THR A 1 165 ? 73.856  63.030  33.382  1.00 49.31 ? 165 THR D N   1 
ATOM   1011  C CA  . THR A 1 165 ? 74.063  61.980  32.381  1.00 49.25 ? 165 THR D CA  1 
ATOM   1012  C C   . THR A 1 165 ? 72.771  61.272  31.967  1.00 49.27 ? 165 THR D C   1 
ATOM   1013  O O   . THR A 1 165 ? 72.627  60.865  30.814  1.00 49.28 ? 165 THR D O   1 
ATOM   1014  C CB  . THR A 1 165 ? 75.094  60.927  32.851  1.00 49.17 ? 165 THR D CB  1 
ATOM   1015  O OG1 . THR A 1 165 ? 74.645  60.315  34.064  1.00 49.31 ? 165 THR D OG1 1 
ATOM   1016  C CG2 . THR A 1 165 ? 76.454  61.566  33.086  1.00 49.24 ? 165 THR D CG2 1 
ATOM   1017  N N   . GLY A 1 166 ? 71.842  61.123  32.907  1.00 49.24 ? 166 GLY D N   1 
ATOM   1018  C CA  . GLY A 1 166 ? 70.591  60.415  32.647  1.00 49.18 ? 166 GLY D CA  1 
ATOM   1019  C C   . GLY A 1 166 ? 70.672  58.937  32.975  1.00 49.22 ? 166 GLY D C   1 
ATOM   1020  O O   . GLY A 1 166 ? 69.713  58.193  32.758  1.00 48.90 ? 166 GLY D O   1 
ATOM   1021  N N   . VAL A 1 167 ? 71.824  58.511  33.493  1.00 49.42 ? 167 VAL D N   1 
ATOM   1022  C CA  . VAL A 1 167 ? 72.022  57.117  33.892  1.00 49.69 ? 167 VAL D CA  1 
ATOM   1023  C C   . VAL A 1 167 ? 71.084  56.749  35.041  1.00 49.80 ? 167 VAL D C   1 
ATOM   1024  O O   . VAL A 1 167 ? 70.775  57.584  35.890  1.00 49.64 ? 167 VAL D O   1 
ATOM   1025  C CB  . VAL A 1 167 ? 73.502  56.801  34.270  1.00 49.69 ? 167 VAL D CB  1 
ATOM   1026  C CG1 . VAL A 1 167 ? 74.436  57.150  33.121  1.00 49.58 ? 167 VAL D CG1 1 
ATOM   1027  C CG2 . VAL A 1 167 ? 73.927  57.518  35.554  1.00 49.95 ? 167 VAL D CG2 1 
ATOM   1028  N N   . GLY A 1 168 ? 70.618  55.505  35.046  1.00 50.00 ? 168 GLY D N   1 
ATOM   1029  C CA  . GLY A 1 168 ? 69.717  55.033  36.089  1.00 50.24 ? 168 GLY D CA  1 
ATOM   1030  C C   . GLY A 1 168 ? 68.272  55.464  35.908  1.00 50.41 ? 168 GLY D C   1 
ATOM   1031  O O   . GLY A 1 168 ? 67.390  54.982  36.623  1.00 50.54 ? 168 GLY D O   1 
ATOM   1032  N N   . VAL A 1 169 ? 68.023  56.374  34.966  1.00 50.46 ? 169 VAL D N   1 
ATOM   1033  C CA  . VAL A 1 169 ? 66.654  56.804  34.661  1.00 50.58 ? 169 VAL D CA  1 
ATOM   1034  C C   . VAL A 1 169 ? 65.918  55.683  33.934  1.00 50.64 ? 169 VAL D C   1 
ATOM   1035  O O   . VAL A 1 169 ? 64.707  55.519  34.092  1.00 50.86 ? 169 VAL D O   1 
ATOM   1036  C CB  . VAL A 1 169 ? 66.604  58.121  33.853  1.00 50.57 ? 169 VAL D CB  1 
ATOM   1037  C CG1 . VAL A 1 169 ? 65.173  58.466  33.460  1.00 50.36 ? 169 VAL D CG1 1 
ATOM   1038  C CG2 . VAL A 1 169 ? 67.209  59.260  34.662  1.00 50.61 ? 169 VAL D CG2 1 
ATOM   1039  N N   . GLN A 1 170 ? 66.658  54.905  33.153  1.00 50.63 ? 170 GLN D N   1 
ATOM   1040  C CA  . GLN A 1 170 ? 66.122  53.672  32.601  1.00 50.73 ? 170 GLN D CA  1 
ATOM   1041  C C   . GLN A 1 170 ? 65.853  52.669  33.729  1.00 50.88 ? 170 GLN D C   1 
ATOM   1042  O O   . GLN A 1 170 ? 64.854  51.951  33.703  1.00 50.85 ? 170 GLN D O   1 
ATOM   1043  C CB  . GLN A 1 170 ? 67.074  53.080  31.566  1.00 50.70 ? 170 GLN D CB  1 
ATOM   1044  C CG  . GLN A 1 170 ? 66.424  52.037  30.673  1.00 50.31 ? 170 GLN D CG  1 
ATOM   1045  C CD  . GLN A 1 170 ? 67.423  51.092  30.043  1.00 50.11 ? 170 GLN D CD  1 
ATOM   1046  O OE1 . GLN A 1 170 ? 68.581  51.019  30.458  1.00 50.16 ? 170 GLN D OE1 1 
ATOM   1047  N NE2 . GLN A 1 170 ? 66.976  50.354  29.035  1.00 50.31 ? 170 GLN D NE2 1 
ATOM   1048  N N   . ASP A 1 171 ? 66.744  52.640  34.718  1.00 51.02 ? 171 ASP D N   1 
ATOM   1049  C CA  . ASP A 1 171 ? 66.576  51.800  35.904  1.00 51.10 ? 171 ASP D CA  1 
ATOM   1050  C C   . ASP A 1 171 ? 65.372  52.211  36.758  1.00 51.20 ? 171 ASP D C   1 
ATOM   1051  O O   . ASP A 1 171 ? 64.782  51.370  37.444  1.00 51.34 ? 171 ASP D O   1 
ATOM   1052  C CB  . ASP A 1 171 ? 67.857  51.794  36.746  1.00 50.99 ? 171 ASP D CB  1 
ATOM   1053  C CG  . ASP A 1 171 ? 68.961  50.967  36.122  1.00 51.01 ? 171 ASP D CG  1 
ATOM   1054  O OD1 . ASP A 1 171 ? 68.746  50.419  35.019  1.00 51.68 ? 171 ASP D OD1 1 
ATOM   1055  O OD2 . ASP A 1 171 ? 70.043  50.860  36.734  1.00 50.18 ? 171 ASP D OD2 1 
ATOM   1056  N N   . VAL A 1 172 ? 65.023  53.497  36.718  1.00 51.18 ? 172 VAL D N   1 
ATOM   1057  C CA  . VAL A 1 172 ? 63.821  54.005  37.383  1.00 51.22 ? 172 VAL D CA  1 
ATOM   1058  C C   . VAL A 1 172 ? 62.586  53.448  36.685  1.00 51.17 ? 172 VAL D C   1 
ATOM   1059  O O   . VAL A 1 172 ? 61.624  53.031  37.326  1.00 50.93 ? 172 VAL D O   1 
ATOM   1060  C CB  . VAL A 1 172 ? 63.767  55.549  37.353  1.00 51.21 ? 172 VAL D CB  1 
ATOM   1061  C CG1 . VAL A 1 172 ? 62.381  56.058  37.741  1.00 51.27 ? 172 VAL D CG1 1 
ATOM   1062  C CG2 . VAL A 1 172 ? 64.824  56.134  38.266  1.00 51.28 ? 172 VAL D CG2 1 
ATOM   1063  N N   . LEU A 1 173 ? 62.648  53.440  35.358  1.00 51.36 ? 173 LEU D N   1 
ATOM   1064  C CA  . LEU A 1 173 ? 61.560  52.979  34.509  1.00 51.45 ? 173 LEU D CA  1 
ATOM   1065  C C   . LEU A 1 173 ? 61.373  51.463  34.626  1.00 51.56 ? 173 LEU D C   1 
ATOM   1066  O O   . LEU A 1 173 ? 60.250  50.962  34.581  1.00 51.46 ? 173 LEU D O   1 
ATOM   1067  C CB  . LEU A 1 173 ? 61.858  53.378  33.062  1.00 51.39 ? 173 LEU D CB  1 
ATOM   1068  C CG  . LEU A 1 173 ? 60.878  54.289  32.321  1.00 51.42 ? 173 LEU D CG  1 
ATOM   1069  C CD1 . LEU A 1 173 ? 60.602  55.577  33.094  1.00 51.25 ? 173 LEU D CD1 1 
ATOM   1070  C CD2 . LEU A 1 173 ? 61.424  54.605  30.942  1.00 51.18 ? 173 LEU D CD2 1 
ATOM   1071  N N   . GLU A 1 174 ? 62.487  50.749  34.784  1.00 51.86 ? 174 GLU D N   1 
ATOM   1072  C CA  . GLU A 1 174 ? 62.483  49.296  34.950  1.00 52.04 ? 174 GLU D CA  1 
ATOM   1073  C C   . GLU A 1 174 ? 61.793  48.910  36.252  1.00 52.26 ? 174 GLU D C   1 
ATOM   1074  O O   . GLU A 1 174 ? 60.927  48.029  36.264  1.00 52.40 ? 174 GLU D O   1 
ATOM   1075  C CB  . GLU A 1 174 ? 63.911  48.745  34.923  1.00 51.94 ? 174 GLU D CB  1 
ATOM   1076  C CG  . GLU A 1 174 ? 64.522  48.653  33.535  1.00 51.75 ? 174 GLU D CG  1 
ATOM   1077  C CD  . GLU A 1 174 ? 64.185  47.357  32.829  1.00 51.84 ? 174 GLU D CD  1 
ATOM   1078  O OE1 . GLU A 1 174 ? 64.527  46.281  33.362  1.00 51.70 ? 174 GLU D OE1 1 
ATOM   1079  O OE2 . GLU A 1 174 ? 63.590  47.412  31.734  1.00 52.11 ? 174 GLU D OE2 1 
ATOM   1080  N N   . ARG A 1 175 ? 62.177  49.581  37.337  1.00 52.38 ? 175 ARG D N   1 
ATOM   1081  C CA  . ARG A 1 175 ? 61.554  49.384  38.640  1.00 52.49 ? 175 ARG D CA  1 
ATOM   1082  C C   . ARG A 1 175 ? 60.045  49.657  38.584  1.00 52.71 ? 175 ARG D C   1 
ATOM   1083  O O   . ARG A 1 175 ? 59.231  48.796  38.932  1.00 52.77 ? 175 ARG D O   1 
ATOM   1084  C CB  . ARG A 1 175 ? 62.216  50.286  39.683  1.00 52.28 ? 175 ARG D CB  1 
ATOM   1085  C CG  . ARG A 1 175 ? 61.710  50.061  41.103  1.00 52.15 ? 175 ARG D CG  1 
ATOM   1086  C CD  . ARG A 1 175 ? 62.075  48.671  41.615  1.00 50.86 ? 175 ARG D CD  1 
ATOM   1087  N NE  . ARG A 1 175 ? 63.511  48.425  41.512  1.00 50.28 ? 175 ARG D NE  1 
ATOM   1088  C CZ  . ARG A 1 175 ? 64.410  48.851  42.395  1.00 50.29 ? 175 ARG D CZ  1 
ATOM   1089  N NH1 . ARG A 1 175 ? 65.694  48.582  42.211  1.00 49.96 ? 175 ARG D NH1 1 
ATOM   1090  N NH2 . ARG A 1 175 ? 64.030  49.545  43.465  1.00 50.30 ? 175 ARG D NH2 1 
ATOM   1091  N N   . LEU A 1 176 ? 59.702  50.868  38.148  1.00 52.78 ? 176 LEU D N   1 
ATOM   1092  C CA  . LEU A 1 176 ? 58.330  51.317  37.927  1.00 52.85 ? 176 LEU D CA  1 
ATOM   1093  C C   . LEU A 1 176 ? 57.428  50.196  37.425  1.00 52.91 ? 176 LEU D C   1 
ATOM   1094  O O   . LEU A 1 176 ? 56.444  49.838  38.078  1.00 52.92 ? 176 LEU D O   1 
ATOM   1095  C CB  . LEU A 1 176 ? 58.362  52.454  36.904  1.00 52.95 ? 176 LEU D CB  1 
ATOM   1096  C CG  . LEU A 1 176 ? 57.237  53.468  36.737  1.00 53.03 ? 176 LEU D CG  1 
ATOM   1097  C CD1 . LEU A 1 176 ? 57.828  54.743  36.171  1.00 52.34 ? 176 LEU D CD1 1 
ATOM   1098  C CD2 . LEU A 1 176 ? 56.130  52.936  35.837  1.00 53.69 ? 176 LEU D CD2 1 
ATOM   1099  N N   . VAL A 1 177 ? 57.788  49.648  36.264  1.00 53.03 ? 177 VAL D N   1 
ATOM   1100  C CA  . VAL A 1 177 ? 57.048  48.564  35.602  1.00 53.12 ? 177 VAL D CA  1 
ATOM   1101  C C   . VAL A 1 177 ? 56.795  47.362  36.525  1.00 52.98 ? 177 VAL D C   1 
ATOM   1102  O O   . VAL A 1 177 ? 55.675  46.855  36.604  1.00 53.14 ? 177 VAL D O   1 
ATOM   1103  C CB  . VAL A 1 177 ? 57.775  48.110  34.299  1.00 53.11 ? 177 VAL D CB  1 
ATOM   1104  C CG1 . VAL A 1 177 ? 57.143  46.852  33.718  1.00 53.16 ? 177 VAL D CG1 1 
ATOM   1105  C CG2 . VAL A 1 177 ? 57.763  49.229  33.268  1.00 53.08 ? 177 VAL D CG2 1 
ATOM   1106  N N   . ARG A 1 178 ? 57.844  46.940  37.226  1.00 52.76 ? 178 ARG D N   1 
ATOM   1107  C CA  . ARG A 1 178 ? 57.812  45.786  38.123  1.00 52.49 ? 178 ARG D CA  1 
ATOM   1108  C C   . ARG A 1 178 ? 56.906  45.977  39.346  1.00 52.45 ? 178 ARG D C   1 
ATOM   1109  O O   . ARG A 1 178 ? 56.246  45.036  39.779  1.00 52.49 ? 178 ARG D O   1 
ATOM   1110  C CB  . ARG A 1 178 ? 59.245  45.471  38.578  1.00 52.44 ? 178 ARG D CB  1 
ATOM   1111  C CG  . ARG A 1 178 ? 59.427  44.172  39.337  1.00 51.61 ? 178 ARG D CG  1 
ATOM   1112  C CD  . ARG A 1 178 ? 60.834  44.080  39.892  1.00 50.58 ? 178 ARG D CD  1 
ATOM   1113  N NE  . ARG A 1 178 ? 61.012  44.893  41.095  1.00 50.29 ? 178 ARG D NE  1 
ATOM   1114  C CZ  . ARG A 1 178 ? 62.163  45.032  41.751  1.00 49.97 ? 178 ARG D CZ  1 
ATOM   1115  N NH1 . ARG A 1 178 ? 63.258  44.415  41.322  1.00 50.14 ? 178 ARG D NH1 1 
ATOM   1116  N NH2 . ARG A 1 178 ? 62.222  45.788  42.839  1.00 49.53 ? 178 ARG D NH2 1 
ATOM   1117  N N   . ASP A 1 179 ? 56.870  47.193  39.889  1.00 52.42 ? 179 ASP D N   1 
ATOM   1118  C CA  . ASP A 1 179 ? 56.244  47.434  41.195  1.00 52.39 ? 179 ASP D CA  1 
ATOM   1119  C C   . ASP A 1 179 ? 54.864  48.086  41.171  1.00 52.32 ? 179 ASP D C   1 
ATOM   1120  O O   . ASP A 1 179 ? 54.010  47.724  41.969  1.00 52.36 ? 179 ASP D O   1 
ATOM   1121  C CB  . ASP A 1 179 ? 57.183  48.229  42.105  1.00 52.37 ? 179 ASP D CB  1 
ATOM   1122  C CG  . ASP A 1 179 ? 58.414  47.441  42.504  1.00 52.32 ? 179 ASP D CG  1 
ATOM   1123  O OD1 . ASP A 1 179 ? 58.514  46.239  42.161  1.00 51.56 ? 179 ASP D OD1 1 
ATOM   1124  O OD2 . ASP A 1 179 ? 59.284  48.034  43.170  1.00 52.74 ? 179 ASP D OD2 1 
ATOM   1125  N N   . ILE A 1 180 ? 54.653  49.056  40.286  1.00 52.33 ? 180 ILE D N   1 
ATOM   1126  C CA  . ILE A 1 180 ? 53.330  49.646  40.112  1.00 52.35 ? 180 ILE D CA  1 
ATOM   1127  C C   . ILE A 1 180 ? 52.468  48.683  39.299  1.00 52.39 ? 180 ILE D C   1 
ATOM   1128  O O   . ILE A 1 180 ? 52.861  48.284  38.203  1.00 52.47 ? 180 ILE D O   1 
ATOM   1129  C CB  . ILE A 1 180 ? 53.396  51.011  39.399  1.00 52.45 ? 180 ILE D CB  1 
ATOM   1130  C CG1 . ILE A 1 180 ? 54.193  52.014  40.239  1.00 52.64 ? 180 ILE D CG1 1 
ATOM   1131  C CG2 . ILE A 1 180 ? 51.984  51.542  39.104  1.00 52.50 ? 180 ILE D CG2 1 
ATOM   1132  C CD1 . ILE A 1 180 ? 54.601  53.274  39.489  1.00 52.82 ? 180 ILE D CD1 1 
ATOM   1133  N N   . PRO A 1 181 ? 51.298  48.292  39.839  1.00 52.37 ? 181 PRO D N   1 
ATOM   1134  C CA  . PRO A 1 181 ? 50.401  47.384  39.124  1.00 52.41 ? 181 PRO D CA  1 
ATOM   1135  C C   . PRO A 1 181 ? 49.772  48.012  37.873  1.00 52.58 ? 181 PRO D C   1 
ATOM   1136  O O   . PRO A 1 181 ? 49.688  49.241  37.776  1.00 52.44 ? 181 PRO D O   1 
ATOM   1137  C CB  . PRO A 1 181 ? 49.314  47.076  40.161  1.00 52.28 ? 181 PRO D CB  1 
ATOM   1138  C CG  . PRO A 1 181 ? 49.324  48.230  41.078  1.00 52.24 ? 181 PRO D CG  1 
ATOM   1139  C CD  . PRO A 1 181 ? 50.754  48.669  41.157  1.00 52.41 ? 181 PRO D CD  1 
ATOM   1140  N N   . PRO A 1 182 ? 49.340  47.169  36.914  1.00 52.77 ? 182 PRO D N   1 
ATOM   1141  C CA  . PRO A 1 182 ? 48.562  47.645  35.773  1.00 52.85 ? 182 PRO D CA  1 
ATOM   1142  C C   . PRO A 1 182 ? 47.145  48.036  36.200  1.00 52.92 ? 182 PRO D C   1 
ATOM   1143  O O   . PRO A 1 182 ? 46.682  47.589  37.252  1.00 52.82 ? 182 PRO D O   1 
ATOM   1144  C CB  . PRO A 1 182 ? 48.513  46.422  34.854  1.00 52.86 ? 182 PRO D CB  1 
ATOM   1145  C CG  . PRO A 1 182 ? 48.638  45.259  35.774  1.00 52.84 ? 182 PRO D CG  1 
ATOM   1146  C CD  . PRO A 1 182 ? 49.573  45.713  36.852  1.00 52.76 ? 182 PRO D CD  1 
ATOM   1147  N N   . PRO A 1 183 ? 46.457  48.863  35.388  1.00 53.04 ? 183 PRO D N   1 
ATOM   1148  C CA  . PRO A 1 183 ? 45.078  49.254  35.673  1.00 53.15 ? 183 PRO D CA  1 
ATOM   1149  C C   . PRO A 1 183 ? 44.134  48.056  35.649  1.00 53.44 ? 183 PRO D C   1 
ATOM   1150  O O   . PRO A 1 183 ? 44.416  47.064  34.976  1.00 53.52 ? 183 PRO D O   1 
ATOM   1151  C CB  . PRO A 1 183 ? 44.741  50.189  34.510  1.00 53.03 ? 183 PRO D CB  1 
ATOM   1152  C CG  . PRO A 1 183 ? 45.678  49.788  33.421  1.00 52.94 ? 183 PRO D CG  1 
ATOM   1153  C CD  . PRO A 1 183 ? 46.940  49.477  34.137  1.00 52.89 ? 183 PRO D CD  1 
ATOM   1154  N N   . GLU A 1 184 ? 43.026  48.154  36.378  1.00 53.71 ? 184 GLU D N   1 
ATOM   1155  C CA  . GLU A 1 184 ? 41.990  47.121  36.354  1.00 54.22 ? 184 GLU D CA  1 
ATOM   1156  C C   . GLU A 1 184 ? 40.655  47.689  35.871  1.00 54.04 ? 184 GLU D C   1 
ATOM   1157  O O   . GLU A 1 184 ? 40.257  48.785  36.270  1.00 54.11 ? 184 GLU D O   1 
ATOM   1158  C CB  . GLU A 1 184 ? 41.817  46.487  37.739  1.00 54.23 ? 184 GLU D CB  1 
ATOM   1159  C CG  . GLU A 1 184 ? 42.940  45.545  38.155  1.00 54.75 ? 184 GLU D CG  1 
ATOM   1160  C CD  . GLU A 1 184 ? 42.665  44.857  39.486  1.00 55.14 ? 184 GLU D CD  1 
ATOM   1161  O OE1 . GLU A 1 184 ? 41.504  44.456  39.733  1.00 56.60 ? 184 GLU D OE1 1 
ATOM   1162  O OE2 . GLU A 1 184 ? 43.613  44.709  40.288  1.00 56.45 ? 184 GLU D OE2 1 
ATOM   1163  N N   . GLY A 1 185 ? 39.968  46.939  35.018  1.00 53.98 ? 185 GLY D N   1 
ATOM   1164  C CA  . GLY A 1 185 ? 38.680  47.365  34.489  1.00 54.05 ? 185 GLY D CA  1 
ATOM   1165  C C   . GLY A 1 185 ? 38.120  46.388  33.482  1.00 54.20 ? 185 GLY D C   1 
ATOM   1166  O O   . GLY A 1 185 ? 38.841  45.530  32.978  1.00 54.29 ? 185 GLY D O   1 
ATOM   1167  N N   . ASP A 1 186 ? 36.827  46.519  33.199  1.00 54.42 ? 186 ASP D N   1 
ATOM   1168  C CA  . ASP A 1 186 ? 36.145  45.692  32.204  1.00 54.59 ? 186 ASP D CA  1 
ATOM   1169  C C   . ASP A 1 186 ? 35.875  46.516  30.936  1.00 54.57 ? 186 ASP D C   1 
ATOM   1170  O O   . ASP A 1 186 ? 34.880  47.243  30.874  1.00 54.72 ? 186 ASP D O   1 
ATOM   1171  C CB  . ASP A 1 186 ? 34.840  45.132  32.787  1.00 54.66 ? 186 ASP D CB  1 
ATOM   1172  C CG  . ASP A 1 186 ? 34.121  44.184  31.833  1.00 55.24 ? 186 ASP D CG  1 
ATOM   1173  O OD1 . ASP A 1 186 ? 33.444  43.245  32.318  1.00 55.07 ? 186 ASP D OD1 1 
ATOM   1174  O OD2 . ASP A 1 186 ? 34.226  44.375  30.601  1.00 56.00 ? 186 ASP D OD2 1 
ATOM   1175  N N   . PRO A 1 187 ? 36.756  46.397  29.919  1.00 54.49 ? 187 PRO D N   1 
ATOM   1176  C CA  . PRO A 1 187 ? 36.709  47.204  28.691  1.00 54.42 ? 187 PRO D CA  1 
ATOM   1177  C C   . PRO A 1 187 ? 35.366  47.192  27.964  1.00 54.34 ? 187 PRO D C   1 
ATOM   1178  O O   . PRO A 1 187 ? 35.058  48.133  27.237  1.00 54.31 ? 187 PRO D O   1 
ATOM   1179  C CB  . PRO A 1 187 ? 37.781  46.558  27.810  1.00 54.38 ? 187 PRO D CB  1 
ATOM   1180  C CG  . PRO A 1 187 ? 38.738  45.980  28.771  1.00 54.48 ? 187 PRO D CG  1 
ATOM   1181  C CD  . PRO A 1 187 ? 37.888  45.454  29.889  1.00 54.48 ? 187 PRO D CD  1 
ATOM   1182  N N   . GLU A 1 188 ? 34.586  46.132  28.150  1.00 54.29 ? 188 GLU D N   1 
ATOM   1183  C CA  . GLU A 1 188 ? 33.270  46.028  27.529  1.00 54.24 ? 188 GLU D CA  1 
ATOM   1184  C C   . GLU A 1 188 ? 32.145  46.536  28.431  1.00 54.02 ? 188 GLU D C   1 
ATOM   1185  O O   . GLU A 1 188 ? 31.021  46.733  27.966  1.00 54.07 ? 188 GLU D O   1 
ATOM   1186  C CB  . GLU A 1 188 ? 32.995  44.590  27.063  1.00 54.39 ? 188 GLU D CB  1 
ATOM   1187  C CG  . GLU A 1 188 ? 33.039  44.397  25.542  1.00 55.02 ? 188 GLU D CG  1 
ATOM   1188  C CD  . GLU A 1 188 ? 34.417  44.639  24.943  1.00 55.92 ? 188 GLU D CD  1 
ATOM   1189  O OE1 . GLU A 1 188 ? 35.304  43.777  25.124  1.00 56.44 ? 188 GLU D OE1 1 
ATOM   1190  O OE2 . GLU A 1 188 ? 34.608  45.685  24.283  1.00 55.93 ? 188 GLU D OE2 1 
ATOM   1191  N N   . GLY A 1 189 ? 32.451  46.750  29.711  1.00 53.77 ? 189 GLY D N   1 
ATOM   1192  C CA  . GLY A 1 189 ? 31.477  47.279  30.672  1.00 53.61 ? 189 GLY D CA  1 
ATOM   1193  C C   . GLY A 1 189 ? 31.124  48.741  30.425  1.00 53.46 ? 189 GLY D C   1 
ATOM   1194  O O   . GLY A 1 189 ? 31.780  49.407  29.623  1.00 53.45 ? 189 GLY D O   1 
ATOM   1195  N N   . PRO A 1 190 ? 30.076  49.252  31.103  1.00 53.35 ? 190 PRO D N   1 
ATOM   1196  C CA  . PRO A 1 190 ? 29.674  50.652  30.931  1.00 53.16 ? 190 PRO D CA  1 
ATOM   1197  C C   . PRO A 1 190 ? 30.829  51.608  31.191  1.00 52.95 ? 190 PRO D C   1 
ATOM   1198  O O   . PRO A 1 190 ? 31.575  51.420  32.154  1.00 53.01 ? 190 PRO D O   1 
ATOM   1199  C CB  . PRO A 1 190 ? 28.571  50.843  31.983  1.00 53.13 ? 190 PRO D CB  1 
ATOM   1200  C CG  . PRO A 1 190 ? 28.672  49.668  32.890  1.00 53.36 ? 190 PRO D CG  1 
ATOM   1201  C CD  . PRO A 1 190 ? 29.200  48.551  32.056  1.00 53.37 ? 190 PRO D CD  1 
ATOM   1202  N N   . LEU A 1 191 ? 30.962  52.614  30.325  1.00 52.68 ? 191 LEU D N   1 
ATOM   1203  C CA  . LEU A 1 191 ? 32.061  53.579  30.357  1.00 52.36 ? 191 LEU D CA  1 
ATOM   1204  C C   . LEU A 1 191 ? 32.108  54.366  31.659  1.00 52.33 ? 191 LEU D C   1 
ATOM   1205  O O   . LEU A 1 191 ? 31.095  54.904  32.106  1.00 52.29 ? 191 LEU D O   1 
ATOM   1206  C CB  . LEU A 1 191 ? 31.915  54.575  29.202  1.00 52.35 ? 191 LEU D CB  1 
ATOM   1207  C CG  . LEU A 1 191 ? 33.067  55.367  28.550  1.00 52.49 ? 191 LEU D CG  1 
ATOM   1208  C CD1 . LEU A 1 191 ? 32.639  56.814  28.385  1.00 52.38 ? 191 LEU D CD1 1 
ATOM   1209  C CD2 . LEU A 1 191 ? 34.413  55.316  29.271  1.00 52.16 ? 191 LEU D CD2 1 
ATOM   1210  N N   . GLN A 1 192 ? 33.294  54.420  32.258  1.00 52.26 ? 192 GLN D N   1 
ATOM   1211  C CA  . GLN A 1 192 ? 33.592  55.341  33.351  1.00 52.21 ? 192 GLN D CA  1 
ATOM   1212  C C   . GLN A 1 192 ? 34.916  56.037  33.046  1.00 52.37 ? 192 GLN D C   1 
ATOM   1213  O O   . GLN A 1 192 ? 35.961  55.382  32.992  1.00 52.52 ? 192 GLN D O   1 
ATOM   1214  C CB  . GLN A 1 192 ? 33.685  54.601  34.687  1.00 52.23 ? 192 GLN D CB  1 
ATOM   1215  C CG  . GLN A 1 192 ? 32.355  54.095  35.219  1.00 51.97 ? 192 GLN D CG  1 
ATOM   1216  C CD  . GLN A 1 192 ? 32.486  53.429  36.571  1.00 51.76 ? 192 GLN D CD  1 
ATOM   1217  O OE1 . GLN A 1 192 ? 33.254  52.486  36.740  1.00 51.40 ? 192 GLN D OE1 1 
ATOM   1218  N NE2 . GLN A 1 192 ? 31.727  53.913  37.541  1.00 51.37 ? 192 GLN D NE2 1 
ATOM   1219  N N   . ALA A 1 193 ? 34.862  57.354  32.831  1.00 52.26 ? 193 ALA D N   1 
ATOM   1220  C CA  . ALA A 1 193 ? 36.055  58.147  32.514  1.00 52.09 ? 193 ALA D CA  1 
ATOM   1221  C C   . ALA A 1 193 ? 36.253  59.327  33.475  1.00 52.10 ? 193 ALA D C   1 
ATOM   1222  O O   . ALA A 1 193 ? 35.510  60.312  33.432  1.00 51.96 ? 193 ALA D O   1 
ATOM   1223  C CB  . ALA A 1 193 ? 36.014  58.627  31.066  1.00 51.87 ? 193 ALA D CB  1 
ATOM   1224  N N   . LEU A 1 194 ? 37.267  59.213  34.334  1.00 52.03 ? 194 LEU D N   1 
ATOM   1225  C CA  . LEU A 1 194 ? 37.582  60.238  35.327  1.00 51.94 ? 194 LEU D CA  1 
ATOM   1226  C C   . LEU A 1 194 ? 38.164  61.494  34.690  1.00 52.18 ? 194 LEU D C   1 
ATOM   1227  O O   . LEU A 1 194 ? 39.176  61.426  33.984  1.00 52.48 ? 194 LEU D O   1 
ATOM   1228  C CB  . LEU A 1 194 ? 38.563  59.684  36.369  1.00 51.91 ? 194 LEU D CB  1 
ATOM   1229  C CG  . LEU A 1 194 ? 39.198  60.617  37.414  1.00 51.52 ? 194 LEU D CG  1 
ATOM   1230  C CD1 . LEU A 1 194 ? 38.168  61.344  38.270  1.00 51.12 ? 194 LEU D CD1 1 
ATOM   1231  C CD2 . LEU A 1 194 ? 40.153  59.839  38.292  1.00 51.57 ? 194 LEU D CD2 1 
ATOM   1232  N N   . ILE A 1 195 ? 37.522  62.636  34.941  1.00 52.17 ? 195 ILE D N   1 
ATOM   1233  C CA  . ILE A 1 195 ? 38.066  63.924  34.517  1.00 52.05 ? 195 ILE D CA  1 
ATOM   1234  C C   . ILE A 1 195 ? 39.177  64.324  35.472  1.00 52.06 ? 195 ILE D C   1 
ATOM   1235  O O   . ILE A 1 195 ? 38.929  64.693  36.626  1.00 52.04 ? 195 ILE D O   1 
ATOM   1236  C CB  . ILE A 1 195 ? 37.003  65.049  34.437  1.00 52.06 ? 195 ILE D CB  1 
ATOM   1237  C CG1 . ILE A 1 195 ? 36.037  64.808  33.278  1.00 52.04 ? 195 ILE D CG1 1 
ATOM   1238  C CG2 . ILE A 1 195 ? 37.667  66.403  34.225  1.00 52.23 ? 195 ILE D CG2 1 
ATOM   1239  C CD1 . ILE A 1 195 ? 34.746  64.171  33.680  1.00 52.63 ? 195 ILE D CD1 1 
ATOM   1240  N N   . ILE A 1 196 ? 40.403  64.231  34.973  1.00 52.06 ? 196 ILE D N   1 
ATOM   1241  C CA  . ILE A 1 196 ? 41.593  64.633  35.711  1.00 52.05 ? 196 ILE D CA  1 
ATOM   1242  C C   . ILE A 1 196 ? 41.711  66.161  35.725  1.00 51.95 ? 196 ILE D C   1 
ATOM   1243  O O   . ILE A 1 196 ? 41.910  66.763  36.777  1.00 51.85 ? 196 ILE D O   1 
ATOM   1244  C CB  . ILE A 1 196 ? 42.855  63.971  35.099  1.00 52.11 ? 196 ILE D CB  1 
ATOM   1245  C CG1 . ILE A 1 196 ? 42.717  62.444  35.156  1.00 52.33 ? 196 ILE D CG1 1 
ATOM   1246  C CG2 . ILE A 1 196 ? 44.124  64.421  35.821  1.00 51.97 ? 196 ILE D CG2 1 
ATOM   1247  C CD1 . ILE A 1 196 ? 43.336  61.720  33.983  1.00 53.08 ? 196 ILE D CD1 1 
ATOM   1248  N N   . ASP A 1 197 ? 41.563  66.775  34.551  1.00 52.03 ? 197 ASP D N   1 
ATOM   1249  C CA  . ASP A 1 197 ? 41.688  68.222  34.389  1.00 51.94 ? 197 ASP D CA  1 
ATOM   1250  C C   . ASP A 1 197 ? 40.921  68.711  33.154  1.00 51.92 ? 197 ASP D C   1 
ATOM   1251  O O   . ASP A 1 197 ? 40.685  67.950  32.215  1.00 51.87 ? 197 ASP D O   1 
ATOM   1252  C CB  . ASP A 1 197 ? 43.169  68.599  34.271  1.00 51.89 ? 197 ASP D CB  1 
ATOM   1253  C CG  . ASP A 1 197 ? 43.427  70.075  34.518  1.00 52.23 ? 197 ASP D CG  1 
ATOM   1254  O OD1 . ASP A 1 197 ? 42.506  70.795  34.972  1.00 52.37 ? 197 ASP D OD1 1 
ATOM   1255  O OD2 . ASP A 1 197 ? 44.567  70.517  34.260  1.00 52.49 ? 197 ASP D OD2 1 
ATOM   1256  N N   . SER A 1 198 ? 40.530  69.982  33.166  1.00 51.94 ? 198 SER D N   1 
ATOM   1257  C CA  . SER A 1 198 ? 39.913  70.626  32.008  1.00 52.04 ? 198 SER D CA  1 
ATOM   1258  C C   . SER A 1 198 ? 40.454  72.040  31.859  1.00 52.07 ? 198 SER D C   1 
ATOM   1259  O O   . SER A 1 198 ? 40.672  72.730  32.853  1.00 52.23 ? 198 SER D O   1 
ATOM   1260  C CB  . SER A 1 198 ? 38.391  70.675  32.151  1.00 52.00 ? 198 SER D CB  1 
ATOM   1261  O OG  . SER A 1 198 ? 37.846  69.380  32.307  1.00 52.40 ? 198 SER D OG  1 
ATOM   1262  N N   . TRP A 1 199 ? 40.665  72.462  30.617  1.00 52.16 ? 199 TRP D N   1 
ATOM   1263  C CA  . TRP A 1 199 ? 41.168  73.802  30.313  1.00 52.31 ? 199 TRP D CA  1 
ATOM   1264  C C   . TRP A 1 199 ? 40.572  74.302  29.003  1.00 52.50 ? 199 TRP D C   1 
ATOM   1265  O O   . TRP A 1 199 ? 39.944  73.539  28.263  1.00 52.53 ? 199 TRP D O   1 
ATOM   1266  C CB  . TRP A 1 199 ? 42.693  73.795  30.209  1.00 52.25 ? 199 TRP D CB  1 
ATOM   1267  C CG  . TRP A 1 199 ? 43.182  72.881  29.141  1.00 52.08 ? 199 TRP D CG  1 
ATOM   1268  C CD1 . TRP A 1 199 ? 43.451  73.205  27.846  1.00 51.84 ? 199 TRP D CD1 1 
ATOM   1269  C CD2 . TRP A 1 199 ? 43.430  71.476  29.265  1.00 52.12 ? 199 TRP D CD2 1 
ATOM   1270  N NE1 . TRP A 1 199 ? 43.866  72.092  27.155  1.00 51.89 ? 199 TRP D NE1 1 
ATOM   1271  C CE2 . TRP A 1 199 ? 43.861  71.016  28.002  1.00 51.98 ? 199 TRP D CE2 1 
ATOM   1272  C CE3 . TRP A 1 199 ? 43.335  70.563  30.323  1.00 51.64 ? 199 TRP D CE3 1 
ATOM   1273  C CZ2 . TRP A 1 199 ? 44.201  69.683  27.768  1.00 52.00 ? 199 TRP D CZ2 1 
ATOM   1274  C CZ3 . TRP A 1 199 ? 43.671  69.239  30.088  1.00 51.91 ? 199 TRP D CZ3 1 
ATOM   1275  C CH2 . TRP A 1 199 ? 44.100  68.812  28.819  1.00 51.96 ? 199 TRP D CH2 1 
ATOM   1276  N N   . PHE A 1 200 ? 40.784  75.584  28.720  1.00 52.68 ? 200 PHE D N   1 
ATOM   1277  C CA  . PHE A 1 200 ? 40.301  76.200  27.493  1.00 52.71 ? 200 PHE D CA  1 
ATOM   1278  C C   . PHE A 1 200 ? 41.422  76.352  26.474  1.00 52.86 ? 200 PHE D C   1 
ATOM   1279  O O   . PHE A 1 200 ? 42.529  76.785  26.799  1.00 52.87 ? 200 PHE D O   1 
ATOM   1280  C CB  . PHE A 1 200 ? 39.659  77.554  27.791  1.00 52.64 ? 200 PHE D CB  1 
ATOM   1281  C CG  . PHE A 1 200 ? 38.850  78.101  26.655  1.00 52.63 ? 200 PHE D CG  1 
ATOM   1282  C CD1 . PHE A 1 200 ? 37.552  77.657  26.434  1.00 52.45 ? 200 PHE D CD1 1 
ATOM   1283  C CD2 . PHE A 1 200 ? 39.382  79.068  25.808  1.00 52.84 ? 200 PHE D CD2 1 
ATOM   1284  C CE1 . PHE A 1 200 ? 36.796  78.163  25.383  1.00 52.64 ? 200 PHE D CE1 1 
ATOM   1285  C CE2 . PHE A 1 200 ? 38.636  79.580  24.753  1.00 52.66 ? 200 PHE D CE2 1 
ATOM   1286  C CZ  . PHE A 1 200 ? 37.340  79.126  24.540  1.00 52.63 ? 200 PHE D CZ  1 
ATOM   1287  N N   . ASP A 1 201 ? 41.122  75.979  25.239  1.00 53.16 ? 201 ASP D N   1 
ATOM   1288  C CA  . ASP A 1 201 ? 42.062  76.106  24.141  1.00 53.54 ? 201 ASP D CA  1 
ATOM   1289  C C   . ASP A 1 201 ? 41.499  77.110  23.153  1.00 53.63 ? 201 ASP D C   1 
ATOM   1290  O O   . ASP A 1 201 ? 40.357  76.981  22.705  1.00 53.63 ? 201 ASP D O   1 
ATOM   1291  C CB  . ASP A 1 201 ? 42.286  74.745  23.468  1.00 53.67 ? 201 ASP D CB  1 
ATOM   1292  C CG  . ASP A 1 201 ? 43.354  74.785  22.382  1.00 54.03 ? 201 ASP D CG  1 
ATOM   1293  O OD1 . ASP A 1 201 ? 43.152  75.458  21.339  1.00 53.73 ? 201 ASP D OD1 1 
ATOM   1294  O OD2 . ASP A 1 201 ? 44.390  74.111  22.569  1.00 54.35 ? 201 ASP D OD2 1 
ATOM   1295  N N   . ASN A 1 202 ? 42.312  78.105  22.816  1.00 53.71 ? 202 ASN D N   1 
ATOM   1296  C CA  . ASN A 1 202 ? 41.897  79.194  21.934  1.00 53.83 ? 202 ASN D CA  1 
ATOM   1297  C C   . ASN A 1 202 ? 41.331  78.734  20.583  1.00 53.63 ? 202 ASN D C   1 
ATOM   1298  O O   . ASN A 1 202 ? 40.484  79.415  19.997  1.00 53.55 ? 202 ASN D O   1 
ATOM   1299  C CB  . ASN A 1 202 ? 43.059  80.172  21.731  1.00 54.03 ? 202 ASN D CB  1 
ATOM   1300  C CG  . ASN A 1 202 ? 43.663  80.646  23.049  1.00 54.61 ? 202 ASN D CG  1 
ATOM   1301  O OD1 . ASN A 1 202 ? 42.954  80.837  24.042  1.00 55.17 ? 202 ASN D OD1 1 
ATOM   1302  N ND2 . ASN A 1 202 ? 44.980  80.838  23.060  1.00 55.19 ? 202 ASN D ND2 1 
ATOM   1303  N N   . TYR A 1 203 ? 41.794  77.574  20.114  1.00 53.39 ? 203 TYR D N   1 
ATOM   1304  C CA  . TYR A 1 203 ? 41.348  76.993  18.841  1.00 53.02 ? 203 TYR D CA  1 
ATOM   1305  C C   . TYR A 1 203 ? 40.378  75.818  19.039  1.00 52.85 ? 203 TYR D C   1 
ATOM   1306  O O   . TYR A 1 203 ? 39.358  75.718  18.351  1.00 52.55 ? 203 TYR D O   1 
ATOM   1307  C CB  . TYR A 1 203 ? 42.565  76.572  18.000  1.00 52.82 ? 203 TYR D CB  1 
ATOM   1308  C CG  . TYR A 1 203 ? 42.232  76.003  16.634  1.00 52.51 ? 203 TYR D CG  1 
ATOM   1309  C CD1 . TYR A 1 203 ? 41.743  76.818  15.610  1.00 51.98 ? 203 TYR D CD1 1 
ATOM   1310  C CD2 . TYR A 1 203 ? 42.421  74.647  16.361  1.00 52.22 ? 203 TYR D CD2 1 
ATOM   1311  C CE1 . TYR A 1 203 ? 41.433  76.292  14.358  1.00 51.76 ? 203 TYR D CE1 1 
ATOM   1312  C CE2 . TYR A 1 203 ? 42.116  74.112  15.114  1.00 52.09 ? 203 TYR D CE2 1 
ATOM   1313  C CZ  . TYR A 1 203 ? 41.625  74.941  14.118  1.00 52.10 ? 203 TYR D CZ  1 
ATOM   1314  O OH  . TYR A 1 203 ? 41.328  74.410  12.887  1.00 52.48 ? 203 TYR D OH  1 
ATOM   1315  N N   . LEU A 1 204 ? 40.701  74.947  19.992  1.00 52.74 ? 204 LEU D N   1 
ATOM   1316  C CA  . LEU A 1 204 ? 39.949  73.713  20.228  1.00 52.76 ? 204 LEU D CA  1 
ATOM   1317  C C   . LEU A 1 204 ? 38.719  73.879  21.121  1.00 52.88 ? 204 LEU D C   1 
ATOM   1318  O O   . LEU A 1 204 ? 37.820  73.034  21.101  1.00 52.77 ? 204 LEU D O   1 
ATOM   1319  C CB  . LEU A 1 204 ? 40.875  72.652  20.838  1.00 52.72 ? 204 LEU D CB  1 
ATOM   1320  C CG  . LEU A 1 204 ? 41.652  71.644  19.980  1.00 52.26 ? 204 LEU D CG  1 
ATOM   1321  C CD1 . LEU A 1 204 ? 41.551  71.884  18.473  1.00 51.42 ? 204 LEU D CD1 1 
ATOM   1322  C CD2 . LEU A 1 204 ? 43.105  71.602  20.442  1.00 51.99 ? 204 LEU D CD2 1 
ATOM   1323  N N   . GLY A 1 205 ? 38.685  74.961  21.899  1.00 53.04 ? 205 GLY D N   1 
ATOM   1324  C CA  . GLY A 1 205 ? 37.644  75.165  22.909  1.00 53.19 ? 205 GLY D CA  1 
ATOM   1325  C C   . GLY A 1 205 ? 38.009  74.418  24.180  1.00 53.42 ? 205 GLY D C   1 
ATOM   1326  O O   . GLY A 1 205 ? 39.186  74.159  24.434  1.00 53.63 ? 205 GLY D O   1 
ATOM   1327  N N   . VAL A 1 206 ? 37.004  74.063  24.977  1.00 53.42 ? 206 VAL D N   1 
ATOM   1328  C CA  . VAL A 1 206 ? 37.221  73.300  26.206  1.00 53.35 ? 206 VAL D CA  1 
ATOM   1329  C C   . VAL A 1 206 ? 37.772  71.895  25.906  1.00 53.57 ? 206 VAL D C   1 
ATOM   1330  O O   . VAL A 1 206 ? 37.196  71.142  25.115  1.00 53.55 ? 206 VAL D O   1 
ATOM   1331  C CB  . VAL A 1 206 ? 35.924  73.233  27.053  1.00 53.23 ? 206 VAL D CB  1 
ATOM   1332  C CG1 . VAL A 1 206 ? 36.039  72.209  28.170  1.00 53.08 ? 206 VAL D CG1 1 
ATOM   1333  C CG2 . VAL A 1 206 ? 35.609  74.596  27.625  1.00 52.94 ? 206 VAL D CG2 1 
ATOM   1334  N N   . VAL A 1 207 ? 38.904  71.569  26.529  1.00 53.78 ? 207 VAL D N   1 
ATOM   1335  C CA  . VAL A 1 207 ? 39.548  70.261  26.384  1.00 54.07 ? 207 VAL D CA  1 
ATOM   1336  C C   . VAL A 1 207 ? 39.667  69.621  27.764  1.00 54.35 ? 207 VAL D C   1 
ATOM   1337  O O   . VAL A 1 207 ? 40.030  70.292  28.731  1.00 54.50 ? 207 VAL D O   1 
ATOM   1338  C CB  . VAL A 1 207 ? 40.976  70.365  25.763  1.00 53.96 ? 207 VAL D CB  1 
ATOM   1339  C CG1 . VAL A 1 207 ? 41.480  69.001  25.331  1.00 53.92 ? 207 VAL D CG1 1 
ATOM   1340  C CG2 . VAL A 1 207 ? 41.002  71.314  24.577  1.00 54.30 ? 207 VAL D CG2 1 
ATOM   1341  N N   . SER A 1 208 ? 39.365  68.328  27.853  1.00 54.58 ? 208 SER D N   1 
ATOM   1342  C CA  . SER A 1 208 ? 39.514  67.597  29.108  1.00 54.72 ? 208 SER D CA  1 
ATOM   1343  C C   . SER A 1 208 ? 40.606  66.542  29.044  1.00 54.93 ? 208 SER D C   1 
ATOM   1344  O O   . SER A 1 208 ? 40.878  65.978  27.986  1.00 55.05 ? 208 SER D O   1 
ATOM   1345  C CB  . SER A 1 208 ? 38.193  66.953  29.516  1.00 54.63 ? 208 SER D CB  1 
ATOM   1346  O OG  . SER A 1 208 ? 37.252  67.945  29.881  1.00 54.85 ? 208 SER D OG  1 
ATOM   1347  N N   . LEU A 1 209 ? 41.246  66.304  30.183  1.00 55.19 ? 209 LEU D N   1 
ATOM   1348  C CA  . LEU A 1 209 ? 42.136  65.165  30.349  1.00 55.38 ? 209 LEU D CA  1 
ATOM   1349  C C   . LEU A 1 209 ? 41.305  64.056  30.989  1.00 55.51 ? 209 LEU D C   1 
ATOM   1350  O O   . LEU A 1 209 ? 40.456  64.323  31.843  1.00 55.57 ? 209 LEU D O   1 
ATOM   1351  C CB  . LEU A 1 209 ? 43.345  65.532  31.224  1.00 55.43 ? 209 LEU D CB  1 
ATOM   1352  C CG  . LEU A 1 209 ? 44.592  64.633  31.161  1.00 55.35 ? 209 LEU D CG  1 
ATOM   1353  C CD1 . LEU A 1 209 ? 45.292  64.756  29.819  1.00 55.06 ? 209 LEU D CD1 1 
ATOM   1354  C CD2 . LEU A 1 209 ? 45.560  64.962  32.283  1.00 55.36 ? 209 LEU D CD2 1 
ATOM   1355  N N   . ILE A 1 210 ? 41.548  62.817  30.573  1.00 55.54 ? 210 ILE D N   1 
ATOM   1356  C CA  . ILE A 1 210 ? 40.663  61.707  30.913  1.00 55.53 ? 210 ILE D CA  1 
ATOM   1357  C C   . ILE A 1 210 ? 41.427  60.432  31.292  1.00 55.50 ? 210 ILE D C   1 
ATOM   1358  O O   . ILE A 1 210 ? 42.425  60.084  30.663  1.00 55.57 ? 210 ILE D O   1 
ATOM   1359  C CB  . ILE A 1 210 ? 39.682  61.441  29.737  1.00 55.48 ? 210 ILE D CB  1 
ATOM   1360  C CG1 . ILE A 1 210 ? 38.524  62.431  29.792  1.00 55.40 ? 210 ILE D CG1 1 
ATOM   1361  C CG2 . ILE A 1 210 ? 39.143  60.019  29.754  1.00 55.72 ? 210 ILE D CG2 1 
ATOM   1362  C CD1 . ILE A 1 210 ? 37.537  62.252  28.678  1.00 55.83 ? 210 ILE D CD1 1 
ATOM   1363  N N   . ARG A 1 211 ? 40.957  59.749  32.329  1.00 55.32 ? 211 ARG D N   1 
ATOM   1364  C CA  . ARG A 1 211 ? 41.444  58.412  32.638  1.00 55.29 ? 211 ARG D CA  1 
ATOM   1365  C C   . ARG A 1 211 ? 40.302  57.434  32.440  1.00 55.23 ? 211 ARG D C   1 
ATOM   1366  O O   . ARG A 1 211 ? 39.232  57.600  33.039  1.00 55.28 ? 211 ARG D O   1 
ATOM   1367  C CB  . ARG A 1 211 ? 41.935  58.329  34.083  1.00 55.31 ? 211 ARG D CB  1 
ATOM   1368  C CG  . ARG A 1 211 ? 43.024  57.297  34.329  1.00 55.40 ? 211 ARG D CG  1 
ATOM   1369  C CD  . ARG A 1 211 ? 42.537  55.869  34.223  1.00 55.18 ? 211 ARG D CD  1 
ATOM   1370  N NE  . ARG A 1 211 ? 43.380  54.991  35.023  1.00 56.16 ? 211 ARG D NE  1 
ATOM   1371  C CZ  . ARG A 1 211 ? 43.134  53.706  35.248  1.00 56.62 ? 211 ARG D CZ  1 
ATOM   1372  N NH1 . ARG A 1 211 ? 42.068  53.118  34.725  1.00 57.80 ? 211 ARG D NH1 1 
ATOM   1373  N NH2 . ARG A 1 211 ? 43.963  53.005  35.999  1.00 56.45 ? 211 ARG D NH2 1 
ATOM   1374  N N   . ILE A 1 212 ? 40.526  56.415  31.614  1.00 55.03 ? 212 ILE D N   1 
ATOM   1375  C CA  . ILE A 1 212 ? 39.496  55.405  31.363  1.00 54.83 ? 212 ILE D CA  1 
ATOM   1376  C C   . ILE A 1 212 ? 39.537  54.299  32.423  1.00 54.59 ? 212 ILE D C   1 
ATOM   1377  O O   . ILE A 1 212 ? 40.397  53.418  32.387  1.00 54.51 ? 212 ILE D O   1 
ATOM   1378  C CB  . ILE A 1 212 ? 39.596  54.803  29.937  1.00 54.85 ? 212 ILE D CB  1 
ATOM   1379  C CG1 . ILE A 1 212 ? 39.866  55.897  28.891  1.00 55.14 ? 212 ILE D CG1 1 
ATOM   1380  C CG2 . ILE A 1 212 ? 38.340  54.001  29.604  1.00 54.66 ? 212 ILE D CG2 1 
ATOM   1381  C CD1 . ILE A 1 212 ? 38.636  56.693  28.449  1.00 55.48 ? 212 ILE D CD1 1 
ATOM   1382  N N   . LYS A 1 213 ? 38.597  54.361  33.363  1.00 54.37 ? 213 LYS D N   1 
ATOM   1383  C CA  . LYS A 1 213 ? 38.506  53.382  34.444  1.00 54.16 ? 213 LYS D CA  1 
ATOM   1384  C C   . LYS A 1 213 ? 37.769  52.123  34.012  1.00 54.14 ? 213 LYS D C   1 
ATOM   1385  O O   . LYS A 1 213 ? 38.212  51.016  34.313  1.00 54.12 ? 213 LYS D O   1 
ATOM   1386  C CB  . LYS A 1 213 ? 37.828  53.992  35.673  1.00 54.18 ? 213 LYS D CB  1 
ATOM   1387  C CG  . LYS A 1 213 ? 38.676  55.007  36.425  1.00 53.77 ? 213 LYS D CG  1 
ATOM   1388  C CD  . LYS A 1 213 ? 39.618  54.334  37.401  1.00 53.69 ? 213 LYS D CD  1 
ATOM   1389  C CE  . LYS A 1 213 ? 40.333  55.361  38.260  1.00 53.75 ? 213 LYS D CE  1 
ATOM   1390  N NZ  . LYS A 1 213 ? 41.126  54.723  39.345  1.00 53.41 ? 213 LYS D NZ  1 
ATOM   1391  N N   . ASN A 1 214 ? 36.646  52.301  33.317  1.00 54.12 ? 214 ASN D N   1 
ATOM   1392  C CA  . ASN A 1 214 ? 35.853  51.188  32.774  1.00 54.15 ? 214 ASN D CA  1 
ATOM   1393  C C   . ASN A 1 214 ? 35.325  51.503  31.384  1.00 54.10 ? 214 ASN D C   1 
ATOM   1394  O O   . ASN A 1 214 ? 35.113  52.665  31.054  1.00 54.29 ? 214 ASN D O   1 
ATOM   1395  C CB  . ASN A 1 214 ? 34.683  50.836  33.702  1.00 54.11 ? 214 ASN D CB  1 
ATOM   1396  C CG  . ASN A 1 214 ? 34.891  49.526  34.437  1.00 54.18 ? 214 ASN D CG  1 
ATOM   1397  O OD1 . ASN A 1 214 ? 35.959  49.270  34.992  1.00 54.15 ? 214 ASN D OD1 1 
ATOM   1398  N ND2 . ASN A 1 214 ? 33.860  48.687  34.448  1.00 54.55 ? 214 ASN D ND2 1 
ATOM   1399  N N   . GLY A 1 215 ? 35.115  50.468  30.573  1.00 53.96 ? 215 GLY D N   1 
ATOM   1400  C CA  . GLY A 1 215 ? 34.590  50.649  29.221  1.00 53.79 ? 215 GLY D CA  1 
ATOM   1401  C C   . GLY A 1 215 ? 35.592  51.172  28.206  1.00 53.64 ? 215 GLY D C   1 
ATOM   1402  O O   . GLY A 1 215 ? 36.797  51.194  28.460  1.00 53.50 ? 215 GLY D O   1 
ATOM   1403  N N   . THR A 1 216 ? 35.081  51.587  27.050  1.00 53.61 ? 216 THR D N   1 
ATOM   1404  C CA  . THR A 1 216 ? 35.909  52.101  25.961  1.00 53.69 ? 216 THR D CA  1 
ATOM   1405  C C   . THR A 1 216 ? 35.270  53.343  25.343  1.00 53.76 ? 216 THR D C   1 
ATOM   1406  O O   . THR A 1 216 ? 34.065  53.361  25.082  1.00 53.90 ? 216 THR D O   1 
ATOM   1407  C CB  . THR A 1 216 ? 36.138  51.019  24.881  1.00 53.59 ? 216 THR D CB  1 
ATOM   1408  O OG1 . THR A 1 216 ? 36.934  49.967  25.434  1.00 53.78 ? 216 THR D OG1 1 
ATOM   1409  C CG2 . THR A 1 216 ? 36.858  51.587  23.663  1.00 53.56 ? 216 THR D CG2 1 
ATOM   1410  N N   . LEU A 1 217 ? 36.080  54.377  25.123  1.00 53.73 ? 217 LEU D N   1 
ATOM   1411  C CA  . LEU A 1 217 ? 35.619  55.592  24.454  1.00 53.63 ? 217 LEU D CA  1 
ATOM   1412  C C   . LEU A 1 217 ? 36.095  55.621  23.003  1.00 53.72 ? 217 LEU D C   1 
ATOM   1413  O O   . LEU A 1 217 ? 37.295  55.590  22.731  1.00 53.68 ? 217 LEU D O   1 
ATOM   1414  C CB  . LEU A 1 217 ? 36.083  56.841  25.213  1.00 53.65 ? 217 LEU D CB  1 
ATOM   1415  C CG  . LEU A 1 217 ? 35.623  58.226  24.741  1.00 53.56 ? 217 LEU D CG  1 
ATOM   1416  C CD1 . LEU A 1 217 ? 34.108  58.317  24.595  1.00 53.57 ? 217 LEU D CD1 1 
ATOM   1417  C CD2 . LEU A 1 217 ? 36.124  59.290  25.698  1.00 53.43 ? 217 LEU D CD2 1 
ATOM   1418  N N   . ARG A 1 218 ? 35.138  55.658  22.081  1.00 53.80 ? 218 ARG D N   1 
ATOM   1419  C CA  . ARG A 1 218 ? 35.418  55.715  20.649  1.00 53.92 ? 218 ARG D CA  1 
ATOM   1420  C C   . ARG A 1 218 ? 35.038  57.099  20.152  1.00 54.10 ? 218 ARG D C   1 
ATOM   1421  O O   . ARG A 1 218 ? 34.458  57.882  20.905  1.00 54.25 ? 218 ARG D O   1 
ATOM   1422  C CB  . ARG A 1 218 ? 34.632  54.632  19.905  1.00 53.84 ? 218 ARG D CB  1 
ATOM   1423  C CG  . ARG A 1 218 ? 35.067  53.216  20.249  1.00 53.68 ? 218 ARG D CG  1 
ATOM   1424  C CD  . ARG A 1 218 ? 33.982  52.188  19.944  1.00 53.43 ? 218 ARG D CD  1 
ATOM   1425  N NE  . ARG A 1 218 ? 34.079  51.038  20.845  1.00 52.81 ? 218 ARG D NE  1 
ATOM   1426  C CZ  . ARG A 1 218 ? 34.819  49.956  20.618  1.00 52.63 ? 218 ARG D CZ  1 
ATOM   1427  N NH1 . ARG A 1 218 ? 35.535  49.852  19.505  1.00 53.09 ? 218 ARG D NH1 1 
ATOM   1428  N NH2 . ARG A 1 218 ? 34.842  48.972  21.506  1.00 52.21 ? 218 ARG D NH2 1 
ATOM   1429  N N   . LYS A 1 219 ? 35.355  57.403  18.895  1.00 54.29 ? 219 LYS D N   1 
ATOM   1430  C CA  . LYS A 1 219 ? 35.163  58.753  18.360  1.00 54.42 ? 219 LYS D CA  1 
ATOM   1431  C C   . LYS A 1 219 ? 33.696  59.212  18.322  1.00 54.62 ? 219 LYS D C   1 
ATOM   1432  O O   . LYS A 1 219 ? 33.287  60.018  19.150  1.00 54.83 ? 219 LYS D O   1 
ATOM   1433  C CB  . LYS A 1 219 ? 35.834  58.906  16.994  1.00 54.32 ? 219 LYS D CB  1 
ATOM   1434  C CG  . LYS A 1 219 ? 36.169  60.342  16.637  1.00 53.96 ? 219 LYS D CG  1 
ATOM   1435  C CD  . LYS A 1 219 ? 37.219  60.389  15.550  1.00 53.83 ? 219 LYS D CD  1 
ATOM   1436  C CE  . LYS A 1 219 ? 37.444  61.800  15.062  1.00 53.74 ? 219 LYS D CE  1 
ATOM   1437  N NZ  . LYS A 1 219 ? 38.429  61.816  13.960  1.00 53.98 ? 219 LYS D NZ  1 
ATOM   1438  N N   . GLY A 1 220 ? 32.905  58.689  17.390  1.00 54.82 ? 220 GLY D N   1 
ATOM   1439  C CA  . GLY A 1 220 ? 31.515  59.136  17.206  1.00 55.10 ? 220 GLY D CA  1 
ATOM   1440  C C   . GLY A 1 220 ? 30.609  59.153  18.433  1.00 55.26 ? 220 GLY D C   1 
ATOM   1441  O O   . GLY A 1 220 ? 29.533  59.758  18.399  1.00 55.24 ? 220 GLY D O   1 
ATOM   1442  N N   . ASP A 1 221 ? 31.055  58.497  19.511  1.00 55.38 ? 221 ASP D N   1 
ATOM   1443  C CA  . ASP A 1 221 ? 30.288  58.312  20.754  1.00 55.43 ? 221 ASP D CA  1 
ATOM   1444  C C   . ASP A 1 221 ? 29.678  59.588  21.302  1.00 55.46 ? 221 ASP D C   1 
ATOM   1445  O O   . ASP A 1 221 ? 30.232  60.678  21.117  1.00 55.66 ? 221 ASP D O   1 
ATOM   1446  C CB  . ASP A 1 221 ? 31.185  57.723  21.848  1.00 55.42 ? 221 ASP D CB  1 
ATOM   1447  C CG  . ASP A 1 221 ? 31.529  56.263  21.616  1.00 55.84 ? 221 ASP D CG  1 
ATOM   1448  O OD1 . ASP A 1 221 ? 30.880  55.596  20.775  1.00 55.94 ? 221 ASP D OD1 1 
ATOM   1449  O OD2 . ASP A 1 221 ? 32.458  55.779  22.298  1.00 56.04 ? 221 ASP D OD2 1 
ATOM   1450  N N   . LYS A 1 222 ? 28.548  59.449  21.992  1.00 55.40 ? 222 LYS D N   1 
ATOM   1451  C CA  . LYS A 1 222 ? 27.988  60.577  22.735  1.00 55.40 ? 222 LYS D CA  1 
ATOM   1452  C C   . LYS A 1 222 ? 28.107  60.410  24.249  1.00 55.38 ? 222 LYS D C   1 
ATOM   1453  O O   . LYS A 1 222 ? 27.446  59.563  24.854  1.00 55.48 ? 222 LYS D O   1 
ATOM   1454  C CB  . LYS A 1 222 ? 26.560  60.926  22.297  1.00 55.42 ? 222 LYS D CB  1 
ATOM   1455  C CG  . LYS A 1 222 ? 25.559  59.792  22.297  1.00 55.36 ? 222 LYS D CG  1 
ATOM   1456  C CD  . LYS A 1 222 ? 24.144  60.334  22.141  1.00 55.68 ? 222 LYS D CD  1 
ATOM   1457  C CE  . LYS A 1 222 ? 23.951  61.059  20.814  1.00 55.95 ? 222 LYS D CE  1 
ATOM   1458  N NZ  . LYS A 1 222 ? 22.509  61.253  20.489  1.00 56.17 ? 222 LYS D NZ  1 
ATOM   1459  N N   . VAL A 1 223 ? 28.973  61.225  24.843  1.00 55.28 ? 223 VAL D N   1 
ATOM   1460  C CA  . VAL A 1 223 ? 29.293  61.133  26.266  1.00 55.16 ? 223 VAL D CA  1 
ATOM   1461  C C   . VAL A 1 223 ? 28.269  61.846  27.156  1.00 55.10 ? 223 VAL D C   1 
ATOM   1462  O O   . VAL A 1 223 ? 27.469  62.643  26.681  1.00 55.04 ? 223 VAL D O   1 
ATOM   1463  C CB  . VAL A 1 223 ? 30.723  61.656  26.561  1.00 55.06 ? 223 VAL D CB  1 
ATOM   1464  C CG1 . VAL A 1 223 ? 31.751  60.840  25.800  1.00 55.08 ? 223 VAL D CG1 1 
ATOM   1465  C CG2 . VAL A 1 223 ? 30.848  63.128  26.208  1.00 55.00 ? 223 VAL D CG2 1 
ATOM   1466  N N   . LYS A 1 224 ? 28.306  61.540  28.448  1.00 55.12 ? 224 LYS D N   1 
ATOM   1467  C CA  . LYS A 1 224 ? 27.447  62.176  29.429  1.00 55.12 ? 224 LYS D CA  1 
ATOM   1468  C C   . LYS A 1 224 ? 28.287  62.595  30.629  1.00 55.31 ? 224 LYS D C   1 
ATOM   1469  O O   . LYS A 1 224 ? 29.032  61.787  31.194  1.00 55.44 ? 224 LYS D O   1 
ATOM   1470  C CB  . LYS A 1 224 ? 26.345  61.213  29.869  1.00 55.06 ? 224 LYS D CB  1 
ATOM   1471  C CG  . LYS A 1 224 ? 25.258  61.844  30.722  1.00 55.11 ? 224 LYS D CG  1 
ATOM   1472  C CD  . LYS A 1 224 ? 24.087  60.891  30.910  1.00 55.18 ? 224 LYS D CD  1 
ATOM   1473  C CE  . LYS A 1 224 ? 22.843  61.635  31.369  1.00 55.22 ? 224 LYS D CE  1 
ATOM   1474  N NZ  . LYS A 1 224 ? 21.648  60.752  31.451  1.00 55.32 ? 224 LYS D NZ  1 
ATOM   1475  N N   . VAL A 1 225 ? 28.181  63.864  31.004  1.00 55.30 ? 225 VAL D N   1 
ATOM   1476  C CA  . VAL A 1 225 ? 28.813  64.343  32.223  1.00 55.30 ? 225 VAL D CA  1 
ATOM   1477  C C   . VAL A 1 225 ? 27.869  64.007  33.367  1.00 55.28 ? 225 VAL D C   1 
ATOM   1478  O O   . VAL A 1 225 ? 26.763  64.548  33.449  1.00 55.50 ? 225 VAL D O   1 
ATOM   1479  C CB  . VAL A 1 225 ? 29.080  65.857  32.177  1.00 55.37 ? 225 VAL D CB  1 
ATOM   1480  C CG1 . VAL A 1 225 ? 29.985  66.275  33.331  1.00 55.27 ? 225 VAL D CG1 1 
ATOM   1481  C CG2 . VAL A 1 225 ? 29.691  66.261  30.835  1.00 55.43 ? 225 VAL D CG2 1 
ATOM   1482  N N   . MET A 1 226 ? 28.302  63.111  34.246  1.00 55.13 ? 226 MET D N   1 
ATOM   1483  C CA  . MET A 1 226 ? 27.399  62.525  35.238  1.00 55.02 ? 226 MET D CA  1 
ATOM   1484  C C   . MET A 1 226 ? 26.818  63.491  36.279  1.00 55.12 ? 226 MET D C   1 
ATOM   1485  O O   . MET A 1 226 ? 25.789  63.195  36.884  1.00 55.12 ? 226 MET D O   1 
ATOM   1486  C CB  . MET A 1 226 ? 28.042  61.307  35.908  1.00 54.97 ? 226 MET D CB  1 
ATOM   1487  C CG  . MET A 1 226 ? 28.220  60.121  34.963  1.00 54.80 ? 226 MET D CG  1 
ATOM   1488  S SD  . MET A 1 226 ? 28.342  58.517  35.781  1.00 54.69 ? 226 MET D SD  1 
ATOM   1489  C CE  . MET A 1 226 ? 26.648  58.268  36.321  1.00 54.47 ? 226 MET D CE  1 
ATOM   1490  N N   . SER A 1 227 ? 27.462  64.641  36.472  1.00 55.26 ? 227 SER D N   1 
ATOM   1491  C CA  . SER A 1 227 ? 26.979  65.646  37.427  1.00 55.48 ? 227 SER D CA  1 
ATOM   1492  C C   . SER A 1 227 ? 25.937  66.573  36.821  1.00 55.51 ? 227 SER D C   1 
ATOM   1493  O O   . SER A 1 227 ? 24.905  66.840  37.432  1.00 55.48 ? 227 SER D O   1 
ATOM   1494  C CB  . SER A 1 227 ? 28.135  66.477  37.979  1.00 55.49 ? 227 SER D CB  1 
ATOM   1495  O OG  . SER A 1 227 ? 29.091  65.641  38.602  1.00 56.00 ? 227 SER D OG  1 
ATOM   1496  N N   . THR A 1 228 ? 26.223  67.078  35.627  1.00 55.71 ? 228 THR D N   1 
ATOM   1497  C CA  . THR A 1 228 ? 25.285  67.935  34.924  1.00 55.86 ? 228 THR D CA  1 
ATOM   1498  C C   . THR A 1 228 ? 24.157  67.104  34.306  1.00 55.89 ? 228 THR D C   1 
ATOM   1499  O O   . THR A 1 228 ? 22.990  67.497  34.357  1.00 55.78 ? 228 THR D O   1 
ATOM   1500  C CB  . THR A 1 228 ? 25.993  68.847  33.872  1.00 55.90 ? 228 THR D CB  1 
ATOM   1501  O OG1 . THR A 1 228 ? 25.029  69.690  33.227  1.00 56.53 ? 228 THR D OG1 1 
ATOM   1502  C CG2 . THR A 1 228 ? 26.726  68.038  32.818  1.00 55.90 ? 228 THR D CG2 1 
ATOM   1503  N N   . GLY A 1 229 ? 24.510  65.945  33.754  1.00 55.94 ? 229 GLY D N   1 
ATOM   1504  C CA  . GLY A 1 229 ? 23.564  65.116  33.013  1.00 56.03 ? 229 GLY D CA  1 
ATOM   1505  C C   . GLY A 1 229 ? 23.546  65.438  31.527  1.00 56.16 ? 229 GLY D C   1 
ATOM   1506  O O   . GLY A 1 229 ? 22.911  64.726  30.743  1.00 56.12 ? 229 GLY D O   1 
ATOM   1507  N N   . GLN A 1 230 ? 24.246  66.510  31.142  1.00 56.23 ? 230 GLN D N   1 
ATOM   1508  C CA  . GLN A 1 230 ? 24.310  66.963  29.746  1.00 56.25 ? 230 GLN D CA  1 
ATOM   1509  C C   . GLN A 1 230 ? 25.165  66.052  28.867  1.00 55.99 ? 230 GLN D C   1 
ATOM   1510  O O   . GLN A 1 230 ? 26.155  65.480  29.329  1.00 55.93 ? 230 GLN D O   1 
ATOM   1511  C CB  . GLN A 1 230 ? 24.809  68.412  29.653  1.00 56.42 ? 230 GLN D CB  1 
ATOM   1512  C CG  . GLN A 1 230 ? 23.694  69.466  29.585  1.00 57.00 ? 230 GLN D CG  1 
ATOM   1513  C CD  . GLN A 1 230 ? 24.057  70.665  28.699  1.00 57.72 ? 230 GLN D CD  1 
ATOM   1514  O OE1 . GLN A 1 230 ? 25.031  70.630  27.942  1.00 57.55 ? 230 GLN D OE1 1 
ATOM   1515  N NE2 . GLN A 1 230 ? 23.260  71.726  28.787  1.00 57.64 ? 230 GLN D NE2 1 
ATOM   1516  N N   . THR A 1 231 ? 24.770  65.929  27.601  1.00 55.84 ? 231 THR D N   1 
ATOM   1517  C CA  . THR A 1 231 ? 25.439  65.031  26.657  1.00 55.76 ? 231 THR D CA  1 
ATOM   1518  C C   . THR A 1 231 ? 26.139  65.778  25.524  1.00 55.84 ? 231 THR D C   1 
ATOM   1519  O O   . THR A 1 231 ? 25.776  66.907  25.189  1.00 55.84 ? 231 THR D O   1 
ATOM   1520  C CB  . THR A 1 231 ? 24.477  63.976  26.073  1.00 55.62 ? 231 THR D CB  1 
ATOM   1521  O OG1 . THR A 1 231 ? 23.375  64.631  25.440  1.00 55.80 ? 231 THR D OG1 1 
ATOM   1522  C CG2 . THR A 1 231 ? 23.964  63.048  27.169  1.00 55.20 ? 231 THR D CG2 1 
ATOM   1523  N N   . TYR A 1 232 ? 27.153  65.134  24.952  1.00 55.94 ? 232 TYR D N   1 
ATOM   1524  C CA  . TYR A 1 232 ? 28.039  65.761  23.973  1.00 56.15 ? 232 TYR D CA  1 
ATOM   1525  C C   . TYR A 1 232 ? 28.586  64.703  23.027  1.00 56.36 ? 232 TYR D C   1 
ATOM   1526  O O   . TYR A 1 232 ? 28.750  63.546  23.419  1.00 56.46 ? 232 TYR D O   1 
ATOM   1527  C CB  . TYR A 1 232 ? 29.219  66.437  24.678  1.00 56.06 ? 232 TYR D CB  1 
ATOM   1528  C CG  . TYR A 1 232 ? 28.841  67.515  25.675  1.00 56.18 ? 232 TYR D CG  1 
ATOM   1529  C CD1 . TYR A 1 232 ? 28.759  67.234  27.044  1.00 55.69 ? 232 TYR D CD1 1 
ATOM   1530  C CD2 . TYR A 1 232 ? 28.574  68.820  25.250  1.00 56.17 ? 232 TYR D CD2 1 
ATOM   1531  C CE1 . TYR A 1 232 ? 28.410  68.227  27.961  1.00 56.11 ? 232 TYR D CE1 1 
ATOM   1532  C CE2 . TYR A 1 232 ? 28.229  69.820  26.156  1.00 56.12 ? 232 TYR D CE2 1 
ATOM   1533  C CZ  . TYR A 1 232 ? 28.149  69.519  27.508  1.00 56.26 ? 232 TYR D CZ  1 
ATOM   1534  O OH  . TYR A 1 232 ? 27.805  70.514  28.397  1.00 56.11 ? 232 TYR D OH  1 
ATOM   1535  N N   . ASN A 1 233 ? 28.867  65.097  21.784  1.00 56.46 ? 233 ASN D N   1 
ATOM   1536  C CA  . ASN A 1 233 ? 29.554  64.213  20.840  1.00 56.49 ? 233 ASN D CA  1 
ATOM   1537  C C   . ASN A 1 233 ? 31.061  64.295  21.027  1.00 56.28 ? 233 ASN D C   1 
ATOM   1538  O O   . ASN A 1 233 ? 31.632  65.389  21.014  1.00 56.28 ? 233 ASN D O   1 
ATOM   1539  C CB  . ASN A 1 233 ? 29.180  64.536  19.385  1.00 56.57 ? 233 ASN D CB  1 
ATOM   1540  C CG  . ASN A 1 233 ? 27.949  63.769  18.903  1.00 57.31 ? 233 ASN D CG  1 
ATOM   1541  O OD1 . ASN A 1 233 ? 27.574  62.735  19.471  1.00 58.37 ? 233 ASN D OD1 1 
ATOM   1542  N ND2 . ASN A 1 233 ? 27.319  64.273  17.842  1.00 57.58 ? 233 ASN D ND2 1 
ATOM   1543  N N   . ALA A 1 234 ? 31.699  63.141  21.210  1.00 55.92 ? 234 ALA D N   1 
ATOM   1544  C CA  . ALA A 1 234 ? 33.151  63.081  21.315  1.00 55.76 ? 234 ALA D CA  1 
ATOM   1545  C C   . ALA A 1 234 ? 33.791  63.378  19.955  1.00 55.71 ? 234 ALA D C   1 
ATOM   1546  O O   . ALA A 1 234 ? 34.165  62.467  19.220  1.00 55.72 ? 234 ALA D O   1 
ATOM   1547  C CB  . ALA A 1 234 ? 33.586  61.726  21.840  1.00 55.72 ? 234 ALA D CB  1 
ATOM   1548  N N   . ASP A 1 235 ? 33.915  64.663  19.630  1.00 55.63 ? 235 ASP D N   1 
ATOM   1549  C CA  . ASP A 1 235 ? 34.362  65.094  18.302  1.00 55.56 ? 235 ASP D CA  1 
ATOM   1550  C C   . ASP A 1 235 ? 35.795  64.670  17.975  1.00 55.22 ? 235 ASP D C   1 
ATOM   1551  O O   . ASP A 1 235 ? 36.056  64.119  16.903  1.00 55.28 ? 235 ASP D O   1 
ATOM   1552  C CB  . ASP A 1 235 ? 34.186  66.608  18.136  1.00 55.66 ? 235 ASP D CB  1 
ATOM   1553  C CG  . ASP A 1 235 ? 32.731  67.038  18.229  1.00 56.29 ? 235 ASP D CG  1 
ATOM   1554  O OD1 . ASP A 1 235 ? 31.909  66.572  17.405  1.00 56.64 ? 235 ASP D OD1 1 
ATOM   1555  O OD2 . ASP A 1 235 ? 32.409  67.844  19.130  1.00 56.82 ? 235 ASP D OD2 1 
ATOM   1556  N N   . ARG A 1 236 ? 36.713  64.931  18.902  1.00 54.69 ? 236 ARG D N   1 
ATOM   1557  C CA  . ARG A 1 236 ? 38.118  64.557  18.740  1.00 54.07 ? 236 ARG D CA  1 
ATOM   1558  C C   . ARG A 1 236 ? 38.670  64.070  20.060  1.00 53.67 ? 236 ARG D C   1 
ATOM   1559  O O   . ARG A 1 236 ? 38.305  64.583  21.119  1.00 53.73 ? 236 ARG D O   1 
ATOM   1560  C CB  . ARG A 1 236 ? 38.961  65.747  18.264  1.00 54.15 ? 236 ARG D CB  1 
ATOM   1561  C CG  . ARG A 1 236 ? 38.747  66.158  16.822  1.00 53.85 ? 236 ARG D CG  1 
ATOM   1562  C CD  . ARG A 1 236 ? 39.542  67.409  16.493  1.00 53.63 ? 236 ARG D CD  1 
ATOM   1563  N NE  . ARG A 1 236 ? 40.975  67.133  16.391  1.00 52.67 ? 236 ARG D NE  1 
ATOM   1564  C CZ  . ARG A 1 236 ? 41.910  68.055  16.171  1.00 51.85 ? 236 ARG D CZ  1 
ATOM   1565  N NH1 . ARG A 1 236 ? 41.583  69.333  16.027  1.00 51.19 ? 236 ARG D NH1 1 
ATOM   1566  N NH2 . ARG A 1 236 ? 43.182  67.695  16.095  1.00 51.49 ? 236 ARG D NH2 1 
ATOM   1567  N N   . LEU A 1 237 ? 39.556  63.082  19.989  1.00 53.07 ? 237 LEU D N   1 
ATOM   1568  C CA  . LEU A 1 237 ? 40.274  62.602  21.163  1.00 52.53 ? 237 LEU D CA  1 
ATOM   1569  C C   . LEU A 1 237 ? 41.671  62.102  20.791  1.00 52.36 ? 237 LEU D C   1 
ATOM   1570  O O   . LEU A 1 237 ? 42.031  62.049  19.606  1.00 52.26 ? 237 LEU D O   1 
ATOM   1571  C CB  . LEU A 1 237 ? 39.459  61.533  21.912  1.00 52.43 ? 237 LEU D CB  1 
ATOM   1572  C CG  . LEU A 1 237 ? 39.025  60.247  21.209  1.00 51.98 ? 237 LEU D CG  1 
ATOM   1573  C CD1 . LEU A 1 237 ? 40.155  59.258  21.208  1.00 52.51 ? 237 LEU D CD1 1 
ATOM   1574  C CD2 . LEU A 1 237 ? 37.839  59.640  21.916  1.00 52.33 ? 237 LEU D CD2 1 
ATOM   1575  N N   . GLY A 1 238 ? 42.453  61.744  21.806  1.00 52.04 ? 238 GLY D N   1 
ATOM   1576  C CA  . GLY A 1 238 ? 43.804  61.249  21.592  1.00 51.91 ? 238 GLY D CA  1 
ATOM   1577  C C   . GLY A 1 238 ? 44.691  61.417  22.801  1.00 51.76 ? 238 GLY D C   1 
ATOM   1578  O O   . GLY A 1 238 ? 44.208  61.683  23.896  1.00 51.71 ? 238 GLY D O   1 
ATOM   1579  N N   . ILE A 1 239 ? 45.996  61.269  22.592  1.00 51.87 ? 239 ILE D N   1 
ATOM   1580  C CA  . ILE A 1 239 ? 46.978  61.307  23.684  1.00 51.94 ? 239 ILE D CA  1 
ATOM   1581  C C   . ILE A 1 239 ? 48.023  62.415  23.526  1.00 52.00 ? 239 ILE D C   1 
ATOM   1582  O O   . ILE A 1 239 ? 48.042  63.119  22.518  1.00 52.00 ? 239 ILE D O   1 
ATOM   1583  C CB  . ILE A 1 239 ? 47.694  59.944  23.856  1.00 51.77 ? 239 ILE D CB  1 
ATOM   1584  C CG1 . ILE A 1 239 ? 48.343  59.500  22.542  1.00 51.48 ? 239 ILE D CG1 1 
ATOM   1585  C CG2 . ILE A 1 239 ? 46.711  58.894  24.353  1.00 52.30 ? 239 ILE D CG2 1 
ATOM   1586  C CD1 . ILE A 1 239 ? 49.505  58.548  22.712  1.00 51.23 ? 239 ILE D CD1 1 
ATOM   1587  N N   . PHE A 1 240 ? 48.872  62.562  24.543  1.00 52.23 ? 240 PHE D N   1 
ATOM   1588  C CA  . PHE A 1 240 ? 49.969  63.525  24.539  1.00 52.53 ? 240 PHE D CA  1 
ATOM   1589  C C   . PHE A 1 240 ? 51.304  62.798  24.586  1.00 52.76 ? 240 PHE D C   1 
ATOM   1590  O O   . PHE A 1 240 ? 51.525  61.948  25.444  1.00 52.75 ? 240 PHE D O   1 
ATOM   1591  C CB  . PHE A 1 240 ? 49.858  64.478  25.726  1.00 52.62 ? 240 PHE D CB  1 
ATOM   1592  C CG  . PHE A 1 240 ? 48.743  65.471  25.609  1.00 52.62 ? 240 PHE D CG  1 
ATOM   1593  C CD1 . PHE A 1 240 ? 47.601  65.342  26.386  1.00 53.30 ? 240 PHE D CD1 1 
ATOM   1594  C CD2 . PHE A 1 240 ? 48.836  66.544  24.732  1.00 53.05 ? 240 PHE D CD2 1 
ATOM   1595  C CE1 . PHE A 1 240 ? 46.562  66.267  26.294  1.00 53.60 ? 240 PHE D CE1 1 
ATOM   1596  C CE2 . PHE A 1 240 ? 47.809  67.470  24.628  1.00 53.50 ? 240 PHE D CE2 1 
ATOM   1597  C CZ  . PHE A 1 240 ? 46.665  67.330  25.413  1.00 53.55 ? 240 PHE D CZ  1 
ATOM   1598  N N   . THR A 1 241 ? 52.201  63.182  23.683  1.00 53.13 ? 241 THR D N   1 
ATOM   1599  C CA  . THR A 1 241 ? 53.391  62.398  23.342  1.00 53.39 ? 241 THR D CA  1 
ATOM   1600  C C   . THR A 1 241 ? 54.798  62.901  23.769  1.00 53.63 ? 241 THR D C   1 
ATOM   1601  O O   . THR A 1 241 ? 55.751  62.107  23.755  1.00 53.73 ? 241 THR D O   1 
ATOM   1602  C CB  . THR A 1 241 ? 53.354  62.073  21.816  1.00 53.45 ? 241 THR D CB  1 
ATOM   1603  O OG1 . THR A 1 241 ? 53.068  60.684  21.642  1.00 53.76 ? 241 THR D OG1 1 
ATOM   1604  C CG2 . THR A 1 241 ? 54.658  62.439  21.086  1.00 53.30 ? 241 THR D CG2 1 
ATOM   1605  N N   . PRO A 1 242 ? 54.944  64.179  24.199  1.00 53.76 ? 242 PRO D N   1 
ATOM   1606  C CA  . PRO A 1 242 ? 53.981  65.195  24.643  1.00 53.86 ? 242 PRO D CA  1 
ATOM   1607  C C   . PRO A 1 242 ? 53.223  65.900  23.517  1.00 54.06 ? 242 PRO D C   1 
ATOM   1608  O O   . PRO A 1 242 ? 52.208  66.547  23.786  1.00 53.97 ? 242 PRO D O   1 
ATOM   1609  C CB  . PRO A 1 242 ? 54.857  66.190  25.407  1.00 53.78 ? 242 PRO D CB  1 
ATOM   1610  C CG  . PRO A 1 242 ? 56.178  66.107  24.738  1.00 53.63 ? 242 PRO D CG  1 
ATOM   1611  C CD  . PRO A 1 242 ? 56.325  64.705  24.217  1.00 53.67 ? 242 PRO D CD  1 
ATOM   1612  N N   . LYS A 1 243 ? 53.703  65.759  22.279  1.00 54.34 ? 243 LYS D N   1 
ATOM   1613  C CA  . LYS A 1 243 ? 53.028  66.325  21.108  1.00 54.67 ? 243 LYS D CA  1 
ATOM   1614  C C   . LYS A 1 243 ? 51.593  65.812  21.002  1.00 54.74 ? 243 LYS D C   1 
ATOM   1615  O O   . LYS A 1 243 ? 51.343  64.610  21.142  1.00 54.80 ? 243 LYS D O   1 
ATOM   1616  C CB  . LYS A 1 243 ? 53.801  66.023  19.818  1.00 54.60 ? 243 LYS D CB  1 
ATOM   1617  C CG  . LYS A 1 243 ? 55.119  66.791  19.684  1.00 55.10 ? 243 LYS D CG  1 
ATOM   1618  C CD  . LYS A 1 243 ? 55.627  66.854  18.241  1.00 55.04 ? 243 LYS D CD  1 
ATOM   1619  C CE  . LYS A 1 243 ? 56.427  65.611  17.840  1.00 55.64 ? 243 LYS D CE  1 
ATOM   1620  N NZ  . LYS A 1 243 ? 55.564  64.464  17.415  1.00 55.69 ? 243 LYS D NZ  1 
ATOM   1621  N N   . GLN A 1 244 ? 50.659  66.735  20.775  1.00 54.73 ? 244 GLN D N   1 
ATOM   1622  C CA  . GLN A 1 244 ? 49.242  66.407  20.658  1.00 54.63 ? 244 GLN D CA  1 
ATOM   1623  C C   . GLN A 1 244 ? 48.999  65.503  19.460  1.00 54.54 ? 244 GLN D C   1 
ATOM   1624  O O   . GLN A 1 244 ? 49.353  65.850  18.330  1.00 54.59 ? 244 GLN D O   1 
ATOM   1625  C CB  . GLN A 1 244 ? 48.421  67.682  20.521  1.00 54.72 ? 244 GLN D CB  1 
ATOM   1626  C CG  . GLN A 1 244 ? 46.922  67.463  20.505  1.00 54.77 ? 244 GLN D CG  1 
ATOM   1627  C CD  . GLN A 1 244 ? 46.159  68.711  20.891  1.00 55.12 ? 244 GLN D CD  1 
ATOM   1628  O OE1 . GLN A 1 244 ? 45.224  69.115  20.205  1.00 56.03 ? 244 GLN D OE1 1 
ATOM   1629  N NE2 . GLN A 1 244 ? 46.559  69.334  21.993  1.00 55.24 ? 244 GLN D NE2 1 
ATOM   1630  N N   . VAL A 1 245 ? 48.398  64.345  19.722  1.00 54.38 ? 245 VAL D N   1 
ATOM   1631  C CA  . VAL A 1 245 ? 48.175  63.320  18.699  1.00 54.34 ? 245 VAL D CA  1 
ATOM   1632  C C   . VAL A 1 245 ? 46.723  62.836  18.743  1.00 54.36 ? 245 VAL D C   1 
ATOM   1633  O O   . VAL A 1 245 ? 46.208  62.499  19.815  1.00 54.56 ? 245 VAL D O   1 
ATOM   1634  C CB  . VAL A 1 245 ? 49.170  62.122  18.867  1.00 54.29 ? 245 VAL D CB  1 
ATOM   1635  C CG1 . VAL A 1 245 ? 48.745  60.923  18.037  1.00 54.04 ? 245 VAL D CG1 1 
ATOM   1636  C CG2 . VAL A 1 245 ? 50.593  62.539  18.494  1.00 54.10 ? 245 VAL D CG2 1 
ATOM   1637  N N   . ASP A 1 246 ? 46.066  62.823  17.584  1.00 54.14 ? 246 ASP D N   1 
ATOM   1638  C CA  . ASP A 1 246 ? 44.700  62.308  17.480  1.00 54.00 ? 246 ASP D CA  1 
ATOM   1639  C C   . ASP A 1 246 ? 44.689  60.788  17.533  1.00 53.94 ? 246 ASP D C   1 
ATOM   1640  O O   . ASP A 1 246 ? 45.573  60.135  16.976  1.00 53.89 ? 246 ASP D O   1 
ATOM   1641  C CB  . ASP A 1 246 ? 44.029  62.779  16.186  1.00 53.96 ? 246 ASP D CB  1 
ATOM   1642  C CG  . ASP A 1 246 ? 43.325  64.118  16.336  1.00 53.84 ? 246 ASP D CG  1 
ATOM   1643  O OD1 . ASP A 1 246 ? 43.698  64.909  17.224  1.00 53.62 ? 246 ASP D OD1 1 
ATOM   1644  O OD2 . ASP A 1 246 ? 42.395  64.389  15.551  1.00 54.03 ? 246 ASP D OD2 1 
ATOM   1645  N N   . ARG A 1 247 ? 43.690  60.236  18.215  1.00 53.92 ? 247 ARG D N   1 
ATOM   1646  C CA  . ARG A 1 247 ? 43.470  58.789  18.236  1.00 53.84 ? 247 ARG D CA  1 
ATOM   1647  C C   . ARG A 1 247 ? 42.044  58.445  17.819  1.00 53.93 ? 247 ARG D C   1 
ATOM   1648  O O   . ARG A 1 247 ? 41.128  59.262  17.932  1.00 53.78 ? 247 ARG D O   1 
ATOM   1649  C CB  . ARG A 1 247 ? 43.770  58.195  19.620  1.00 53.69 ? 247 ARG D CB  1 
ATOM   1650  C CG  . ARG A 1 247 ? 45.249  58.107  19.982  1.00 53.59 ? 247 ARG D CG  1 
ATOM   1651  C CD  . ARG A 1 247 ? 45.905  56.845  19.422  1.00 53.34 ? 247 ARG D CD  1 
ATOM   1652  N NE  . ARG A 1 247 ? 47.349  56.812  19.661  1.00 52.54 ? 247 ARG D NE  1 
ATOM   1653  C CZ  . ARG A 1 247 ? 48.263  57.344  18.849  1.00 52.10 ? 247 ARG D CZ  1 
ATOM   1654  N NH1 . ARG A 1 247 ? 47.894  57.959  17.734  1.00 51.90 ? 247 ARG D NH1 1 
ATOM   1655  N NH2 . ARG A 1 247 ? 49.552  57.260  19.152  1.00 51.80 ? 247 ARG D NH2 1 
ATOM   1656  N N   . THR A 1 248 ? 41.878  57.223  17.327  1.00 54.15 ? 248 THR D N   1 
ATOM   1657  C CA  . THR A 1 248 ? 40.574  56.670  16.978  1.00 54.22 ? 248 THR D CA  1 
ATOM   1658  C C   . THR A 1 248 ? 39.705  56.402  18.220  1.00 54.14 ? 248 THR D C   1 
ATOM   1659  O O   . THR A 1 248 ? 38.475  56.522  18.169  1.00 54.01 ? 248 THR D O   1 
ATOM   1660  C CB  . THR A 1 248 ? 40.744  55.366  16.167  1.00 54.20 ? 248 THR D CB  1 
ATOM   1661  O OG1 . THR A 1 248 ? 39.571  54.558  16.306  1.00 54.89 ? 248 THR D OG1 1 
ATOM   1662  C CG2 . THR A 1 248 ? 41.952  54.566  16.664  1.00 54.09 ? 248 THR D CG2 1 
ATOM   1663  N N   . GLU A 1 249 ? 40.358  56.042  19.326  1.00 54.14 ? 249 GLU D N   1 
ATOM   1664  C CA  . GLU A 1 249 ? 39.675  55.647  20.561  1.00 54.18 ? 249 GLU D CA  1 
ATOM   1665  C C   . GLU A 1 249 ? 40.577  55.763  21.788  1.00 54.06 ? 249 GLU D C   1 
ATOM   1666  O O   . GLU A 1 249 ? 41.807  55.762  21.674  1.00 54.07 ? 249 GLU D O   1 
ATOM   1667  C CB  . GLU A 1 249 ? 39.165  54.205  20.450  1.00 54.35 ? 249 GLU D CB  1 
ATOM   1668  C CG  . GLU A 1 249 ? 40.260  53.140  20.390  1.00 54.67 ? 249 GLU D CG  1 
ATOM   1669  C CD  . GLU A 1 249 ? 39.753  51.829  19.829  1.00 56.05 ? 249 GLU D CD  1 
ATOM   1670  O OE1 . GLU A 1 249 ? 39.215  51.843  18.702  1.00 56.72 ? 249 GLU D OE1 1 
ATOM   1671  O OE2 . GLU A 1 249 ? 39.892  50.784  20.505  1.00 56.57 ? 249 GLU D OE2 1 
ATOM   1672  N N   . LEU A 1 250 ? 39.952  55.865  22.959  1.00 53.87 ? 250 LEU D N   1 
ATOM   1673  C CA  . LEU A 1 250 ? 40.659  55.750  24.231  1.00 53.58 ? 250 LEU D CA  1 
ATOM   1674  C C   . LEU A 1 250 ? 40.172  54.510  24.970  1.00 53.50 ? 250 LEU D C   1 
ATOM   1675  O O   . LEU A 1 250 ? 39.120  54.532  25.615  1.00 53.52 ? 250 LEU D O   1 
ATOM   1676  C CB  . LEU A 1 250 ? 40.473  57.006  25.089  1.00 53.40 ? 250 LEU D CB  1 
ATOM   1677  C CG  . LEU A 1 250 ? 41.342  58.223  24.757  1.00 53.00 ? 250 LEU D CG  1 
ATOM   1678  C CD1 . LEU A 1 250 ? 40.820  59.467  25.467  1.00 52.16 ? 250 LEU D CD1 1 
ATOM   1679  C CD2 . LEU A 1 250 ? 42.816  57.973  25.094  1.00 52.35 ? 250 LEU D CD2 1 
ATOM   1680  N N   . LYS A 1 251 ? 40.934  53.425  24.862  1.00 53.40 ? 251 LYS D N   1 
ATOM   1681  C CA  . LYS A 1 251 ? 40.535  52.158  25.477  1.00 53.40 ? 251 LYS D CA  1 
ATOM   1682  C C   . LYS A 1 251 ? 40.760  52.131  26.997  1.00 53.54 ? 251 LYS D C   1 
ATOM   1683  O O   . LYS A 1 251 ? 41.276  53.096  27.576  1.00 53.50 ? 251 LYS D O   1 
ATOM   1684  C CB  . LYS A 1 251 ? 41.192  50.964  24.772  1.00 53.22 ? 251 LYS D CB  1 
ATOM   1685  C CG  . LYS A 1 251 ? 42.705  51.006  24.705  1.00 52.79 ? 251 LYS D CG  1 
ATOM   1686  C CD  . LYS A 1 251 ? 43.250  49.953  23.754  1.00 52.24 ? 251 LYS D CD  1 
ATOM   1687  C CE  . LYS A 1 251 ? 42.981  50.312  22.305  1.00 51.76 ? 251 LYS D CE  1 
ATOM   1688  N NZ  . LYS A 1 251 ? 43.678  49.381  21.390  1.00 51.93 ? 251 LYS D NZ  1 
ATOM   1689  N N   . CYS A 1 252 ? 40.358  51.028  27.628  1.00 53.57 ? 252 CYS D N   1 
ATOM   1690  C CA  . CYS A 1 252 ? 40.331  50.913  29.090  1.00 53.50 ? 252 CYS D CA  1 
ATOM   1691  C C   . CYS A 1 252 ? 41.717  50.940  29.729  1.00 53.41 ? 252 CYS D C   1 
ATOM   1692  O O   . CYS A 1 252 ? 42.634  50.247  29.287  1.00 53.45 ? 252 CYS D O   1 
ATOM   1693  C CB  . CYS A 1 252 ? 39.587  49.644  29.504  1.00 53.56 ? 252 CYS D CB  1 
ATOM   1694  S SG  . CYS A 1 252 ? 39.080  49.627  31.224  1.00 53.63 ? 252 CYS D SG  1 
ATOM   1695  N N   . GLY A 1 253 ? 41.857  51.750  30.773  1.00 53.34 ? 253 GLY D N   1 
ATOM   1696  C CA  . GLY A 1 253 ? 43.127  51.888  31.483  1.00 53.29 ? 253 GLY D CA  1 
ATOM   1697  C C   . GLY A 1 253 ? 44.033  52.974  30.935  1.00 53.32 ? 253 GLY D C   1 
ATOM   1698  O O   . GLY A 1 253 ? 45.090  53.245  31.505  1.00 53.28 ? 253 GLY D O   1 
ATOM   1699  N N   . GLU A 1 254 ? 43.619  53.601  29.834  1.00 53.39 ? 254 GLU D N   1 
ATOM   1700  C CA  . GLU A 1 254 ? 44.439  54.613  29.167  1.00 53.55 ? 254 GLU D CA  1 
ATOM   1701  C C   . GLU A 1 254 ? 44.171  56.034  29.656  1.00 53.59 ? 254 GLU D C   1 
ATOM   1702  O O   . GLU A 1 254 ? 43.193  56.287  30.366  1.00 53.70 ? 254 GLU D O   1 
ATOM   1703  C CB  . GLU A 1 254 ? 44.270  54.535  27.645  1.00 53.62 ? 254 GLU D CB  1 
ATOM   1704  C CG  . GLU A 1 254 ? 44.901  53.299  27.006  1.00 53.60 ? 254 GLU D CG  1 
ATOM   1705  C CD  . GLU A 1 254 ? 44.926  53.359  25.488  1.00 53.56 ? 254 GLU D CD  1 
ATOM   1706  O OE1 . GLU A 1 254 ? 45.757  52.650  24.885  1.00 53.61 ? 254 GLU D OE1 1 
ATOM   1707  O OE2 . GLU A 1 254 ? 44.117  54.105  24.892  1.00 53.86 ? 254 GLU D OE2 1 
ATOM   1708  N N   . VAL A 1 255 ? 45.059  56.950  29.272  1.00 53.66 ? 255 VAL D N   1 
ATOM   1709  C CA  . VAL A 1 255 ? 44.962  58.367  29.628  1.00 53.70 ? 255 VAL D CA  1 
ATOM   1710  C C   . VAL A 1 255 ? 45.116  59.207  28.368  1.00 53.77 ? 255 VAL D C   1 
ATOM   1711  O O   . VAL A 1 255 ? 46.023  58.962  27.571  1.00 54.10 ? 255 VAL D O   1 
ATOM   1712  C CB  . VAL A 1 255 ? 46.050  58.781  30.657  1.00 53.69 ? 255 VAL D CB  1 
ATOM   1713  C CG1 . VAL A 1 255 ? 46.060  60.291  30.879  1.00 53.13 ? 255 VAL D CG1 1 
ATOM   1714  C CG2 . VAL A 1 255 ? 45.854  58.042  31.985  1.00 54.12 ? 255 VAL D CG2 1 
ATOM   1715  N N   . GLY A 1 256 ? 44.235  60.190  28.192  1.00 53.73 ? 256 GLY D N   1 
ATOM   1716  C CA  . GLY A 1 256 ? 44.282  61.066  27.025  1.00 53.79 ? 256 GLY D CA  1 
ATOM   1717  C C   . GLY A 1 256 ? 43.384  62.288  27.123  1.00 53.86 ? 256 GLY D C   1 
ATOM   1718  O O   . GLY A 1 256 ? 42.775  62.539  28.170  1.00 53.89 ? 256 GLY D O   1 
ATOM   1719  N N   . TRP A 1 257 ? 43.309  63.045  26.027  1.00 53.64 ? 257 TRP D N   1 
ATOM   1720  C CA  . TRP A 1 257 ? 42.491  64.253  25.964  1.00 53.58 ? 257 TRP D CA  1 
ATOM   1721  C C   . TRP A 1 257 ? 41.217  64.035  25.166  1.00 53.60 ? 257 TRP D C   1 
ATOM   1722  O O   . TRP A 1 257 ? 41.166  63.171  24.288  1.00 53.73 ? 257 TRP D O   1 
ATOM   1723  C CB  . TRP A 1 257 ? 43.279  65.433  25.383  1.00 53.69 ? 257 TRP D CB  1 
ATOM   1724  C CG  . TRP A 1 257 ? 43.872  65.185  24.020  1.00 53.51 ? 257 TRP D CG  1 
ATOM   1725  C CD1 . TRP A 1 257 ? 45.116  64.695  23.743  1.00 53.41 ? 257 TRP D CD1 1 
ATOM   1726  C CD2 . TRP A 1 257 ? 43.247  65.426  22.758  1.00 53.17 ? 257 TRP D CD2 1 
ATOM   1727  N NE1 . TRP A 1 257 ? 45.302  64.606  22.386  1.00 53.38 ? 257 TRP D NE1 1 
ATOM   1728  C CE2 . TRP A 1 257 ? 44.170  65.049  21.756  1.00 53.37 ? 257 TRP D CE2 1 
ATOM   1729  C CE3 . TRP A 1 257 ? 41.994  65.918  22.373  1.00 53.12 ? 257 TRP D CE3 1 
ATOM   1730  C CZ2 . TRP A 1 257 ? 43.881  65.150  20.395  1.00 53.51 ? 257 TRP D CZ2 1 
ATOM   1731  C CZ3 . TRP A 1 257 ? 41.706  66.021  21.016  1.00 53.46 ? 257 TRP D CZ3 1 
ATOM   1732  C CH2 . TRP A 1 257 ? 42.646  65.639  20.045  1.00 53.55 ? 257 TRP D CH2 1 
ATOM   1733  N N   . LEU A 1 258 ? 40.190  64.820  25.483  1.00 53.55 ? 258 LEU D N   1 
ATOM   1734  C CA  . LEU A 1 258 ? 38.902  64.733  24.804  1.00 53.39 ? 258 LEU D CA  1 
ATOM   1735  C C   . LEU A 1 258 ? 38.332  66.104  24.485  1.00 53.30 ? 258 LEU D C   1 
ATOM   1736  O O   . LEU A 1 258 ? 38.201  66.962  25.366  1.00 53.14 ? 258 LEU D O   1 
ATOM   1737  C CB  . LEU A 1 258 ? 37.886  63.944  25.635  1.00 53.42 ? 258 LEU D CB  1 
ATOM   1738  C CG  . LEU A 1 258 ? 36.454  63.941  25.074  1.00 53.51 ? 258 LEU D CG  1 
ATOM   1739  C CD1 . LEU A 1 258 ? 36.334  63.046  23.837  1.00 53.18 ? 258 LEU D CD1 1 
ATOM   1740  C CD2 . LEU A 1 258 ? 35.435  63.552  26.127  1.00 53.24 ? 258 LEU D CD2 1 
ATOM   1741  N N   . VAL A 1 259 ? 37.977  66.283  23.217  1.00 53.31 ? 259 VAL D N   1 
ATOM   1742  C CA  . VAL A 1 259 ? 37.369  67.517  22.734  1.00 53.32 ? 259 VAL D CA  1 
ATOM   1743  C C   . VAL A 1 259 ? 35.912  67.286  22.314  1.00 53.30 ? 259 VAL D C   1 
ATOM   1744  O O   . VAL A 1 259 ? 35.634  66.794  21.212  1.00 53.59 ? 259 VAL D O   1 
ATOM   1745  C CB  . VAL A 1 259 ? 38.197  68.138  21.570  1.00 53.33 ? 259 VAL D CB  1 
ATOM   1746  C CG1 . VAL A 1 259 ? 37.400  69.223  20.831  1.00 53.38 ? 259 VAL D CG1 1 
ATOM   1747  C CG2 . VAL A 1 259 ? 39.523  68.693  22.092  1.00 52.95 ? 259 VAL D CG2 1 
ATOM   1748  N N   . CYS A 1 260 ? 34.992  67.601  23.219  1.00 53.04 ? 260 CYS D N   1 
ATOM   1749  C CA  . CYS A 1 260 ? 33.591  67.791  22.855  1.00 53.05 ? 260 CYS D CA  1 
ATOM   1750  C C   . CYS A 1 260 ? 33.215  69.237  23.164  1.00 52.89 ? 260 CYS D C   1 
ATOM   1751  O O   . CYS A 1 260 ? 33.806  69.855  24.058  1.00 53.15 ? 260 CYS D O   1 
ATOM   1752  C CB  . CYS A 1 260 ? 32.674  66.798  23.564  1.00 53.07 ? 260 CYS D CB  1 
ATOM   1753  S SG  . CYS A 1 260 ? 33.073  66.473  25.276  1.00 53.48 ? 260 CYS D SG  1 
ATOM   1754  N N   . ALA A 1 261 ? 32.252  69.774  22.419  1.00 52.39 ? 261 ALA D N   1 
ATOM   1755  C CA  . ALA A 1 261 ? 31.975  71.211  22.436  1.00 52.02 ? 261 ALA D CA  1 
ATOM   1756  C C   . ALA A 1 261 ? 31.294  71.696  23.724  1.00 51.77 ? 261 ALA D C   1 
ATOM   1757  O O   . ALA A 1 261 ? 30.217  72.296  23.685  1.00 51.95 ? 261 ALA D O   1 
ATOM   1758  C CB  . ALA A 1 261 ? 31.169  71.613  21.200  1.00 51.95 ? 261 ALA D CB  1 
ATOM   1759  N N   . ILE A 1 262 ? 31.939  71.435  24.857  1.00 51.32 ? 262 ILE D N   1 
ATOM   1760  C CA  . ILE A 1 262 ? 31.463  71.883  26.159  1.00 51.00 ? 262 ILE D CA  1 
ATOM   1761  C C   . ILE A 1 262 ? 31.721  73.385  26.293  1.00 51.05 ? 262 ILE D C   1 
ATOM   1762  O O   . ILE A 1 262 ? 32.822  73.855  26.003  1.00 51.02 ? 262 ILE D O   1 
ATOM   1763  C CB  . ILE A 1 262 ? 32.115  71.067  27.316  1.00 50.98 ? 262 ILE D CB  1 
ATOM   1764  C CG1 . ILE A 1 262 ? 31.861  69.567  27.110  1.00 50.63 ? 262 ILE D CG1 1 
ATOM   1765  C CG2 . ILE A 1 262 ? 31.589  71.517  28.685  1.00 50.55 ? 262 ILE D CG2 1 
ATOM   1766  C CD1 . ILE A 1 262 ? 32.494  68.663  28.145  1.00 50.82 ? 262 ILE D CD1 1 
ATOM   1767  N N   . LYS A 1 263 ? 30.690  74.122  26.714  1.00 51.13 ? 263 LYS D N   1 
ATOM   1768  C CA  . LYS A 1 263 ? 30.700  75.594  26.759  1.00 51.22 ? 263 LYS D CA  1 
ATOM   1769  C C   . LYS A 1 263 ? 31.919  76.119  27.503  1.00 50.97 ? 263 LYS D C   1 
ATOM   1770  O O   . LYS A 1 263 ? 32.819  76.699  26.898  1.00 51.05 ? 263 LYS D O   1 
ATOM   1771  C CB  . LYS A 1 263 ? 29.423  76.127  27.424  1.00 51.38 ? 263 LYS D CB  1 
ATOM   1772  C CG  . LYS A 1 263 ? 28.188  75.244  27.241  1.00 52.36 ? 263 LYS D CG  1 
ATOM   1773  C CD  . LYS A 1 263 ? 27.144  75.876  26.330  1.00 53.47 ? 263 LYS D CD  1 
ATOM   1774  C CE  . LYS A 1 263 ? 26.141  76.699  27.134  1.00 53.77 ? 263 LYS D CE  1 
ATOM   1775  N NZ  . LYS A 1 263 ? 24.926  77.014  26.332  1.00 54.02 ? 263 LYS D NZ  1 
ATOM   1776  N N   . ASP A 1 264 ? 31.936  75.908  28.817  1.00 50.81 ? 264 ASP D N   1 
ATOM   1777  C CA  . ASP A 1 264 ? 33.066  76.280  29.665  1.00 50.61 ? 264 ASP D CA  1 
ATOM   1778  C C   . ASP A 1 264 ? 33.534  75.100  30.522  1.00 50.54 ? 264 ASP D C   1 
ATOM   1779  O O   . ASP A 1 264 ? 32.850  74.078  30.620  1.00 50.51 ? 264 ASP D O   1 
ATOM   1780  C CB  . ASP A 1 264 ? 32.729  77.501  30.534  1.00 50.41 ? 264 ASP D CB  1 
ATOM   1781  C CG  . ASP A 1 264 ? 31.406  77.363  31.265  1.00 50.13 ? 264 ASP D CG  1 
ATOM   1782  O OD1 . ASP A 1 264 ? 31.074  76.255  31.740  1.00 49.70 ? 264 ASP D OD1 1 
ATOM   1783  O OD2 . ASP A 1 264 ? 30.691  78.380  31.371  1.00 50.42 ? 264 ASP D OD2 1 
ATOM   1784  N N   . ILE A 1 265 ? 34.699  75.253  31.142  1.00 50.53 ? 265 ILE D N   1 
ATOM   1785  C CA  . ILE A 1 265 ? 35.314  74.181  31.929  1.00 50.55 ? 265 ILE D CA  1 
ATOM   1786  C C   . ILE A 1 265 ? 34.489  73.722  33.137  1.00 50.70 ? 265 ILE D C   1 
ATOM   1787  O O   . ILE A 1 265 ? 34.744  72.654  33.698  1.00 50.82 ? 265 ILE D O   1 
ATOM   1788  C CB  . ILE A 1 265 ? 36.745  74.548  32.374  1.00 50.48 ? 265 ILE D CB  1 
ATOM   1789  C CG1 . ILE A 1 265 ? 36.772  75.931  33.041  1.00 50.19 ? 265 ILE D CG1 1 
ATOM   1790  C CG2 . ILE A 1 265 ? 37.684  74.471  31.182  1.00 50.41 ? 265 ILE D CG2 1 
ATOM   1791  C CD1 . ILE A 1 265 ? 38.027  76.211  33.838  1.00 49.44 ? 265 ILE D CD1 1 
ATOM   1792  N N   . HIS A 1 266 ? 33.502  74.528  33.519  1.00 50.77 ? 266 HIS D N   1 
ATOM   1793  C CA  . HIS A 1 266 ? 32.565  74.180  34.588  1.00 50.84 ? 266 HIS D CA  1 
ATOM   1794  C C   . HIS A 1 266 ? 31.623  73.045  34.170  1.00 51.02 ? 266 HIS D C   1 
ATOM   1795  O O   . HIS A 1 266 ? 31.089  72.333  35.021  1.00 51.12 ? 266 HIS D O   1 
ATOM   1796  C CB  . HIS A 1 266 ? 31.769  75.415  35.021  1.00 50.73 ? 266 HIS D CB  1 
ATOM   1797  C CG  . HIS A 1 266 ? 32.630  76.568  35.436  1.00 50.90 ? 266 HIS D CG  1 
ATOM   1798  N ND1 . HIS A 1 266 ? 32.924  76.842  36.755  1.00 50.91 ? 266 HIS D ND1 1 
ATOM   1799  C CD2 . HIS A 1 266 ? 33.278  77.507  34.705  1.00 50.81 ? 266 HIS D CD2 1 
ATOM   1800  C CE1 . HIS A 1 266 ? 33.708  77.903  36.818  1.00 50.75 ? 266 HIS D CE1 1 
ATOM   1801  N NE2 . HIS A 1 266 ? 33.938  78.325  35.588  1.00 50.45 ? 266 HIS D NE2 1 
ATOM   1802  N N   . GLY A 1 267 ? 31.430  72.881  32.860  1.00 51.12 ? 267 GLY D N   1 
ATOM   1803  C CA  . GLY A 1 267 ? 30.629  71.781  32.317  1.00 51.33 ? 267 GLY D CA  1 
ATOM   1804  C C   . GLY A 1 267 ? 31.387  70.463  32.278  1.00 51.45 ? 267 GLY D C   1 
ATOM   1805  O O   . GLY A 1 267 ? 30.804  69.408  32.033  1.00 51.40 ? 267 GLY D O   1 
ATOM   1806  N N   . ALA A 1 268 ? 32.695  70.539  32.510  1.00 51.61 ? 268 ALA D N   1 
ATOM   1807  C CA  . ALA A 1 268 ? 33.557  69.367  32.636  1.00 51.72 ? 268 ALA D CA  1 
ATOM   1808  C C   . ALA A 1 268 ? 34.330  69.438  33.962  1.00 51.85 ? 268 ALA D C   1 
ATOM   1809  O O   . ALA A 1 268 ? 35.547  69.650  33.970  1.00 51.59 ? 268 ALA D O   1 
ATOM   1810  C CB  . ALA A 1 268 ? 34.508  69.285  31.455  1.00 51.74 ? 268 ALA D CB  1 
ATOM   1811  N N   . PRO A 1 269 ? 33.616  69.260  35.092  1.00 52.08 ? 269 PRO D N   1 
ATOM   1812  C CA  . PRO A 1 269 ? 34.199  69.467  36.414  1.00 52.25 ? 269 PRO D CA  1 
ATOM   1813  C C   . PRO A 1 269 ? 35.287  68.453  36.712  1.00 52.47 ? 269 PRO D C   1 
ATOM   1814  O O   . PRO A 1 269 ? 35.115  67.256  36.448  1.00 52.50 ? 269 PRO D O   1 
ATOM   1815  C CB  . PRO A 1 269 ? 33.013  69.247  37.365  1.00 52.26 ? 269 PRO D CB  1 
ATOM   1816  C CG  . PRO A 1 269 ? 31.799  69.343  36.520  1.00 52.23 ? 269 PRO D CG  1 
ATOM   1817  C CD  . PRO A 1 269 ? 32.210  68.830  35.186  1.00 52.09 ? 269 PRO D CD  1 
ATOM   1818  N N   . VAL A 1 270 ? 36.405  68.934  37.247  1.00 52.61 ? 270 VAL D N   1 
ATOM   1819  C CA  . VAL A 1 270 ? 37.482  68.043  37.662  1.00 52.66 ? 270 VAL D CA  1 
ATOM   1820  C C   . VAL A 1 270 ? 36.954  67.151  38.786  1.00 52.75 ? 270 VAL D C   1 
ATOM   1821  O O   . VAL A 1 270 ? 36.329  67.639  39.730  1.00 52.64 ? 270 VAL D O   1 
ATOM   1822  C CB  . VAL A 1 270 ? 38.774  68.815  38.046  1.00 52.46 ? 270 VAL D CB  1 
ATOM   1823  C CG1 . VAL A 1 270 ? 38.441  70.189  38.622  1.00 53.05 ? 270 VAL D CG1 1 
ATOM   1824  C CG2 . VAL A 1 270 ? 39.655  67.999  38.993  1.00 52.18 ? 270 VAL D CG2 1 
ATOM   1825  N N   . GLY A 1 271 ? 37.167  65.843  38.636  1.00 52.81 ? 271 GLY D N   1 
ATOM   1826  C CA  . GLY A 1 271 ? 36.691  64.851  39.597  1.00 52.75 ? 271 GLY D CA  1 
ATOM   1827  C C   . GLY A 1 271 ? 35.464  64.100  39.116  1.00 52.76 ? 271 GLY D C   1 
ATOM   1828  O O   . GLY A 1 271 ? 35.164  63.004  39.602  1.00 52.54 ? 271 GLY D O   1 
ATOM   1829  N N   . ASP A 1 272 ? 34.762  64.691  38.151  1.00 52.87 ? 272 ASP D N   1 
ATOM   1830  C CA  . ASP A 1 272 ? 33.542  64.108  37.591  1.00 53.07 ? 272 ASP D CA  1 
ATOM   1831  C C   . ASP A 1 272 ? 33.854  62.841  36.799  1.00 53.26 ? 272 ASP D C   1 
ATOM   1832  O O   . ASP A 1 272 ? 35.012  62.425  36.689  1.00 53.33 ? 272 ASP D O   1 
ATOM   1833  C CB  . ASP A 1 272 ? 32.831  65.130  36.695  1.00 52.89 ? 272 ASP D CB  1 
ATOM   1834  C CG  . ASP A 1 272 ? 31.320  64.989  36.714  1.00 53.00 ? 272 ASP D CG  1 
ATOM   1835  O OD1 . ASP A 1 272 ? 30.796  63.882  36.984  1.00 53.21 ? 272 ASP D OD1 1 
ATOM   1836  O OD2 . ASP A 1 272 ? 30.646  66.006  36.455  1.00 53.10 ? 272 ASP D OD2 1 
ATOM   1837  N N   . THR A 1 273 ? 32.815  62.220  36.254  1.00 53.43 ? 273 THR D N   1 
ATOM   1838  C CA  . THR A 1 273 ? 33.003  61.036  35.433  1.00 53.58 ? 273 THR D CA  1 
ATOM   1839  C C   . THR A 1 273 ? 32.215  61.166  34.140  1.00 53.59 ? 273 THR D C   1 
ATOM   1840  O O   . THR A 1 273 ? 31.120  61.741  34.118  1.00 53.68 ? 273 THR D O   1 
ATOM   1841  C CB  . THR A 1 273 ? 32.609  59.733  36.175  1.00 53.70 ? 273 THR D CB  1 
ATOM   1842  O OG1 . THR A 1 273 ? 31.339  59.259  35.704  1.00 53.83 ? 273 THR D OG1 1 
ATOM   1843  C CG2 . THR A 1 273 ? 32.562  59.957  37.691  1.00 53.75 ? 273 THR D CG2 1 
ATOM   1844  N N   . LEU A 1 274 ? 32.792  60.643  33.064  1.00 53.50 ? 274 LEU D N   1 
ATOM   1845  C CA  . LEU A 1 274 ? 32.115  60.589  31.784  1.00 53.28 ? 274 LEU D CA  1 
ATOM   1846  C C   . LEU A 1 274 ? 31.667  59.171  31.513  1.00 53.37 ? 274 LEU D C   1 
ATOM   1847  O O   . LEU A 1 274 ? 32.423  58.217  31.724  1.00 53.23 ? 274 LEU D O   1 
ATOM   1848  C CB  . LEU A 1 274 ? 33.022  61.085  30.657  1.00 53.04 ? 274 LEU D CB  1 
ATOM   1849  C CG  . LEU A 1 274 ? 33.392  62.566  30.658  1.00 52.72 ? 274 LEU D CG  1 
ATOM   1850  C CD1 . LEU A 1 274 ? 34.027  62.921  29.341  1.00 53.02 ? 274 LEU D CD1 1 
ATOM   1851  C CD2 . LEU A 1 274 ? 32.187  63.454  30.900  1.00 52.75 ? 274 LEU D CD2 1 
ATOM   1852  N N   . THR A 1 275 ? 30.425  59.042  31.062  1.00 53.58 ? 275 THR D N   1 
ATOM   1853  C CA  . THR A 1 275 ? 29.883  57.754  30.648  1.00 53.83 ? 275 THR D CA  1 
ATOM   1854  C C   . THR A 1 275 ? 29.173  57.907  29.306  1.00 53.86 ? 275 THR D C   1 
ATOM   1855  O O   . THR A 1 275 ? 29.024  59.024  28.811  1.00 53.86 ? 275 THR D O   1 
ATOM   1856  C CB  . THR A 1 275 ? 28.947  57.142  31.728  1.00 53.88 ? 275 THR D CB  1 
ATOM   1857  O OG1 . THR A 1 275 ? 28.714  55.759  31.429  1.00 53.82 ? 275 THR D OG1 1 
ATOM   1858  C CG2 . THR A 1 275 ? 27.611  57.893  31.815  1.00 54.01 ? 275 THR D CG2 1 
ATOM   1859  N N   . LEU A 1 276 ? 28.756  56.788  28.717  1.00 53.95 ? 276 LEU D N   1 
ATOM   1860  C CA  . LEU A 1 276 ? 28.030  56.814  27.454  1.00 54.01 ? 276 LEU D CA  1 
ATOM   1861  C C   . LEU A 1 276 ? 26.541  56.974  27.718  1.00 54.11 ? 276 LEU D C   1 
ATOM   1862  O O   . LEU A 1 276 ? 26.005  56.371  28.648  1.00 54.21 ? 276 LEU D O   1 
ATOM   1863  C CB  . LEU A 1 276 ? 28.308  55.552  26.630  1.00 53.96 ? 276 LEU D CB  1 
ATOM   1864  C CG  . LEU A 1 276 ? 29.724  55.342  26.064  1.00 54.23 ? 276 LEU D CG  1 
ATOM   1865  C CD1 . LEU A 1 276 ? 29.754  54.149  25.113  1.00 54.24 ? 276 LEU D CD1 1 
ATOM   1866  C CD2 . LEU A 1 276 ? 30.276  56.589  25.363  1.00 54.12 ? 276 LEU D CD2 1 
ATOM   1867  N N   . ALA A 1 277 ? 25.887  57.796  26.901  1.00 54.11 ? 277 ALA D N   1 
ATOM   1868  C CA  . ALA A 1 277 ? 24.458  58.083  27.043  1.00 54.05 ? 277 ALA D CA  1 
ATOM   1869  C C   . ALA A 1 277 ? 23.570  56.857  26.814  1.00 54.13 ? 277 ALA D C   1 
ATOM   1870  O O   . ALA A 1 277 ? 22.556  56.689  27.495  1.00 54.10 ? 277 ALA D O   1 
ATOM   1871  C CB  . ALA A 1 277 ? 24.051  59.216  26.112  1.00 53.94 ? 277 ALA D CB  1 
ATOM   1872  N N   . ARG A 1 278 ? 23.959  56.014  25.856  1.00 54.27 ? 278 ARG D N   1 
ATOM   1873  C CA  . ARG A 1 278 ? 23.202  54.808  25.499  1.00 54.41 ? 278 ARG D CA  1 
ATOM   1874  C C   . ARG A 1 278 ? 23.342  53.697  26.544  1.00 54.28 ? 278 ARG D C   1 
ATOM   1875  O O   . ARG A 1 278 ? 22.444  52.871  26.706  1.00 54.26 ? 278 ARG D O   1 
ATOM   1876  C CB  . ARG A 1 278 ? 23.622  54.296  24.113  1.00 54.59 ? 278 ARG D CB  1 
ATOM   1877  C CG  . ARG A 1 278 ? 25.004  53.643  24.065  1.00 55.39 ? 278 ARG D CG  1 
ATOM   1878  C CD  . ARG A 1 278 ? 25.588  53.656  22.668  1.00 56.80 ? 278 ARG D CD  1 
ATOM   1879  N NE  . ARG A 1 278 ? 26.932  53.077  22.644  1.00 58.20 ? 278 ARG D NE  1 
ATOM   1880  C CZ  . ARG A 1 278 ? 27.933  53.522  21.884  1.00 59.27 ? 278 ARG D CZ  1 
ATOM   1881  N NH1 . ARG A 1 278 ? 27.761  54.570  21.082  1.00 59.58 ? 278 ARG D NH1 1 
ATOM   1882  N NH2 . ARG A 1 278 ? 29.119  52.925  21.934  1.00 59.81 ? 278 ARG D NH2 1 
ATOM   1883  N N   . ASN A 1 279 ? 24.476  53.679  27.237  1.00 54.18 ? 279 ASN D N   1 
ATOM   1884  C CA  . ASN A 1 279 ? 24.719  52.714  28.301  1.00 54.04 ? 279 ASN D CA  1 
ATOM   1885  C C   . ASN A 1 279 ? 25.369  53.398  29.508  1.00 54.02 ? 279 ASN D C   1 
ATOM   1886  O O   . ASN A 1 279 ? 26.560  53.200  29.773  1.00 54.00 ? 279 ASN D O   1 
ATOM   1887  C CB  . ASN A 1 279 ? 25.579  51.557  27.785  1.00 53.94 ? 279 ASN D CB  1 
ATOM   1888  C CG  . ASN A 1 279 ? 25.762  50.460  28.814  1.00 54.04 ? 279 ASN D CG  1 
ATOM   1889  O OD1 . ASN A 1 279 ? 24.825  50.089  29.526  1.00 54.34 ? 279 ASN D OD1 1 
ATOM   1890  N ND2 . ASN A 1 279 ? 26.976  49.932  28.896  1.00 54.00 ? 279 ASN D ND2 1 
ATOM   1891  N N   . PRO A 1 280 ? 24.586  54.213  30.245  1.00 53.99 ? 280 PRO D N   1 
ATOM   1892  C CA  . PRO A 1 280 ? 25.160  54.978  31.351  1.00 53.91 ? 280 PRO D CA  1 
ATOM   1893  C C   . PRO A 1 280 ? 25.572  54.080  32.505  1.00 53.80 ? 280 PRO D C   1 
ATOM   1894  O O   . PRO A 1 280 ? 24.835  53.157  32.864  1.00 53.88 ? 280 PRO D O   1 
ATOM   1895  C CB  . PRO A 1 280 ? 24.014  55.906  31.772  1.00 53.92 ? 280 PRO D CB  1 
ATOM   1896  C CG  . PRO A 1 280 ? 22.784  55.215  31.343  1.00 53.73 ? 280 PRO D CG  1 
ATOM   1897  C CD  . PRO A 1 280 ? 23.138  54.458  30.101  1.00 53.88 ? 280 PRO D CD  1 
ATOM   1898  N N   . ALA A 1 281 ? 26.751  54.343  33.059  1.00 53.65 ? 281 ALA D N   1 
ATOM   1899  C CA  . ALA A 1 281 ? 27.214  53.655  34.256  1.00 53.61 ? 281 ALA D CA  1 
ATOM   1900  C C   . ALA A 1 281 ? 26.254  53.974  35.391  1.00 53.62 ? 281 ALA D C   1 
ATOM   1901  O O   . ALA A 1 281 ? 25.821  55.120  35.536  1.00 53.71 ? 281 ALA D O   1 
ATOM   1902  C CB  . ALA A 1 281 ? 28.629  54.091  34.611  1.00 53.54 ? 281 ALA D CB  1 
ATOM   1903  N N   . GLU A 1 282 ? 25.913  52.952  36.174  1.00 53.59 ? 282 GLU D N   1 
ATOM   1904  C CA  . GLU A 1 282 ? 24.953  53.078  37.271  1.00 53.63 ? 282 GLU D CA  1 
ATOM   1905  C C   . GLU A 1 282 ? 25.443  54.062  38.335  1.00 53.43 ? 282 GLU D C   1 
ATOM   1906  O O   . GLU A 1 282 ? 24.680  54.910  38.808  1.00 53.52 ? 282 GLU D O   1 
ATOM   1907  C CB  . GLU A 1 282 ? 24.685  51.702  37.889  1.00 53.54 ? 282 GLU D CB  1 
ATOM   1908  C CG  . GLU A 1 282 ? 23.406  51.608  38.710  1.00 53.96 ? 282 GLU D CG  1 
ATOM   1909  C CD  . GLU A 1 282 ? 23.071  50.180  39.134  1.00 54.19 ? 282 GLU D CD  1 
ATOM   1910  O OE1 . GLU A 1 282 ? 22.003  49.976  39.753  1.00 54.87 ? 282 GLU D OE1 1 
ATOM   1911  O OE2 . GLU A 1 282 ? 23.869  49.260  38.851  1.00 55.17 ? 282 GLU D OE2 1 
ATOM   1912  N N   . LYS A 1 283 ? 26.724  53.953  38.683  1.00 53.20 ? 283 LYS D N   1 
ATOM   1913  C CA  . LYS A 1 283 ? 27.326  54.753  39.740  1.00 52.89 ? 283 LYS D CA  1 
ATOM   1914  C C   . LYS A 1 283 ? 28.496  55.565  39.196  1.00 52.79 ? 283 LYS D C   1 
ATOM   1915  O O   . LYS A 1 283 ? 29.318  55.046  38.436  1.00 52.82 ? 283 LYS D O   1 
ATOM   1916  C CB  . LYS A 1 283 ? 27.801  53.836  40.871  1.00 52.89 ? 283 LYS D CB  1 
ATOM   1917  C CG  . LYS A 1 283 ? 27.886  54.497  42.236  1.00 52.79 ? 283 LYS D CG  1 
ATOM   1918  C CD  . LYS A 1 283 ? 27.958  53.457  43.342  1.00 52.73 ? 283 LYS D CD  1 
ATOM   1919  C CE  . LYS A 1 283 ? 27.576  54.056  44.686  1.00 53.12 ? 283 LYS D CE  1 
ATOM   1920  N NZ  . LYS A 1 283 ? 27.243  52.998  45.687  1.00 53.63 ? 283 LYS D NZ  1 
ATOM   1921  N N   . ALA A 1 284 ? 28.558  56.838  39.586  1.00 52.64 ? 284 ALA D N   1 
ATOM   1922  C CA  . ALA A 1 284 ? 29.664  57.726  39.219  1.00 52.33 ? 284 ALA D CA  1 
ATOM   1923  C C   . ALA A 1 284 ? 30.857  57.475  40.127  1.00 52.33 ? 284 ALA D C   1 
ATOM   1924  O O   . ALA A 1 284 ? 30.694  57.196  41.313  1.00 52.28 ? 284 ALA D O   1 
ATOM   1925  C CB  . ALA A 1 284 ? 29.229  59.175  39.310  1.00 52.11 ? 284 ALA D CB  1 
ATOM   1926  N N   . LEU A 1 285 ? 32.056  57.575  39.565  1.00 52.55 ? 285 LEU D N   1 
ATOM   1927  C CA  . LEU A 1 285 ? 33.295  57.347  40.314  1.00 52.74 ? 285 LEU D CA  1 
ATOM   1928  C C   . LEU A 1 285 ? 33.365  58.168  41.606  1.00 52.81 ? 285 LEU D C   1 
ATOM   1929  O O   . LEU A 1 285 ? 32.996  59.346  41.614  1.00 52.79 ? 285 LEU D O   1 
ATOM   1930  C CB  . LEU A 1 285 ? 34.516  57.633  39.433  1.00 52.68 ? 285 LEU D CB  1 
ATOM   1931  C CG  . LEU A 1 285 ? 34.778  56.685  38.261  1.00 52.70 ? 285 LEU D CG  1 
ATOM   1932  C CD1 . LEU A 1 285 ? 35.689  57.345  37.247  1.00 52.91 ? 285 LEU D CD1 1 
ATOM   1933  C CD2 . LEU A 1 285 ? 35.367  55.355  38.735  1.00 52.65 ? 285 LEU D CD2 1 
ATOM   1934  N N   . PRO A 1 286 ? 33.843  57.547  42.703  1.00 52.92 ? 286 PRO D N   1 
ATOM   1935  C CA  . PRO A 1 286 ? 33.855  58.221  43.998  1.00 53.01 ? 286 PRO D CA  1 
ATOM   1936  C C   . PRO A 1 286 ? 34.943  59.280  44.068  1.00 53.22 ? 286 PRO D C   1 
ATOM   1937  O O   . PRO A 1 286 ? 35.995  59.135  43.434  1.00 53.26 ? 286 PRO D O   1 
ATOM   1938  C CB  . PRO A 1 286 ? 34.170  57.092  44.990  1.00 52.83 ? 286 PRO D CB  1 
ATOM   1939  C CG  . PRO A 1 286 ? 34.164  55.827  44.205  1.00 52.80 ? 286 PRO D CG  1 
ATOM   1940  C CD  . PRO A 1 286 ? 34.417  56.195  42.793  1.00 52.93 ? 286 PRO D CD  1 
ATOM   1941  N N   . GLY A 1 287 ? 34.685  60.336  44.836  1.00 53.47 ? 287 GLY D N   1 
ATOM   1942  C CA  . GLY A 1 287 ? 35.673  61.392  45.063  1.00 53.67 ? 287 GLY D CA  1 
ATOM   1943  C C   . GLY A 1 287 ? 35.238  62.762  44.582  1.00 53.74 ? 287 GLY D C   1 
ATOM   1944  O O   . GLY A 1 287 ? 35.889  63.760  44.884  1.00 53.64 ? 287 GLY D O   1 
ATOM   1945  N N   . PHE A 1 288 ? 34.131  62.808  43.840  1.00 53.87 ? 288 PHE D N   1 
ATOM   1946  C CA  . PHE A 1 288 ? 33.632  64.055  43.280  1.00 53.94 ? 288 PHE D CA  1 
ATOM   1947  C C   . PHE A 1 288 ? 33.006  64.956  44.336  1.00 54.13 ? 288 PHE D C   1 
ATOM   1948  O O   . PHE A 1 288 ? 32.084  64.556  45.050  1.00 53.94 ? 288 PHE D O   1 
ATOM   1949  C CB  . PHE A 1 288 ? 32.628  63.799  42.151  1.00 53.93 ? 288 PHE D CB  1 
ATOM   1950  C CG  . PHE A 1 288 ? 32.041  65.060  41.573  1.00 54.16 ? 288 PHE D CG  1 
ATOM   1951  C CD1 . PHE A 1 288 ? 30.799  65.527  41.997  1.00 54.43 ? 288 PHE D CD1 1 
ATOM   1952  C CD2 . PHE A 1 288 ? 32.738  65.797  40.624  1.00 54.17 ? 288 PHE D CD2 1 
ATOM   1953  C CE1 . PHE A 1 288 ? 30.260  66.702  41.474  1.00 54.45 ? 288 PHE D CE1 1 
ATOM   1954  C CE2 . PHE A 1 288 ? 32.206  66.970  40.094  1.00 54.27 ? 288 PHE D CE2 1 
ATOM   1955  C CZ  . PHE A 1 288 ? 30.966  67.424  40.520  1.00 54.12 ? 288 PHE D CZ  1 
ATOM   1956  N N   . LYS A 1 289 ? 33.535  66.173  44.417  1.00 54.49 ? 289 LYS D N   1 
ATOM   1957  C CA  . LYS A 1 289 ? 32.971  67.253  45.225  1.00 54.80 ? 289 LYS D CA  1 
ATOM   1958  C C   . LYS A 1 289 ? 33.369  68.579  44.594  1.00 54.79 ? 289 LYS D C   1 
ATOM   1959  O O   . LYS A 1 289 ? 34.517  68.743  44.161  1.00 54.72 ? 289 LYS D O   1 
ATOM   1960  C CB  . LYS A 1 289 ? 33.438  67.177  46.690  1.00 54.91 ? 289 LYS D CB  1 
ATOM   1961  C CG  . LYS A 1 289 ? 34.954  67.258  46.907  1.00 55.60 ? 289 LYS D CG  1 
ATOM   1962  C CD  . LYS A 1 289 ? 35.400  66.454  48.129  1.00 57.24 ? 289 LYS D CD  1 
ATOM   1963  C CE  . LYS A 1 289 ? 35.175  64.949  47.924  1.00 58.26 ? 289 LYS D CE  1 
ATOM   1964  N NZ  . LYS A 1 289 ? 35.958  64.090  48.866  1.00 58.78 ? 289 LYS D NZ  1 
ATOM   1965  N N   . LYS A 1 290 ? 32.420  69.510  44.516  1.00 54.80 ? 290 LYS D N   1 
ATOM   1966  C CA  . LYS A 1 290 ? 32.727  70.837  44.001  1.00 54.96 ? 290 LYS D CA  1 
ATOM   1967  C C   . LYS A 1 290 ? 33.315  71.655  45.139  1.00 54.90 ? 290 LYS D C   1 
ATOM   1968  O O   . LYS A 1 290 ? 32.603  72.052  46.062  1.00 55.02 ? 290 LYS D O   1 
ATOM   1969  C CB  . LYS A 1 290 ? 31.494  71.525  43.398  1.00 54.93 ? 290 LYS D CB  1 
ATOM   1970  C CG  . LYS A 1 290 ? 31.684  71.976  41.939  1.00 55.45 ? 290 LYS D CG  1 
ATOM   1971  C CD  . LYS A 1 290 ? 32.983  72.773  41.704  1.00 55.98 ? 290 LYS D CD  1 
ATOM   1972  C CE  . LYS A 1 290 ? 32.733  74.196  41.203  1.00 56.11 ? 290 LYS D CE  1 
ATOM   1973  N NZ  . LYS A 1 290 ? 31.938  75.020  42.148  1.00 56.36 ? 290 LYS D NZ  1 
ATOM   1974  N N   . VAL A 1 291 ? 34.624  71.875  45.081  1.00 54.92 ? 291 VAL D N   1 
ATOM   1975  C CA  . VAL A 1 291 ? 35.327  72.592  46.138  1.00 55.04 ? 291 VAL D CA  1 
ATOM   1976  C C   . VAL A 1 291 ? 34.942  74.070  46.126  1.00 55.10 ? 291 VAL D C   1 
ATOM   1977  O O   . VAL A 1 291 ? 35.023  74.742  45.093  1.00 55.07 ? 291 VAL D O   1 
ATOM   1978  C CB  . VAL A 1 291 ? 36.869  72.363  46.068  1.00 55.08 ? 291 VAL D CB  1 
ATOM   1979  C CG1 . VAL A 1 291 ? 37.640  73.460  46.799  1.00 55.17 ? 291 VAL D CG1 1 
ATOM   1980  C CG2 . VAL A 1 291 ? 37.220  71.002  46.663  1.00 54.88 ? 291 VAL D CG2 1 
ATOM   1981  N N   . LYS A 1 292 ? 34.486  74.546  47.281  1.00 55.14 ? 292 LYS D N   1 
ATOM   1982  C CA  . LYS A 1 292 ? 34.128  75.942  47.469  1.00 55.26 ? 292 LYS D CA  1 
ATOM   1983  C C   . LYS A 1 292 ? 35.346  76.749  47.914  1.00 55.19 ? 292 LYS D C   1 
ATOM   1984  O O   . LYS A 1 292 ? 36.191  76.231  48.650  1.00 55.25 ? 292 LYS D O   1 
ATOM   1985  C CB  . LYS A 1 292 ? 33.017  76.064  48.515  1.00 55.38 ? 292 LYS D CB  1 
ATOM   1986  C CG  . LYS A 1 292 ? 31.620  75.838  47.973  1.00 55.90 ? 292 LYS D CG  1 
ATOM   1987  C CD  . LYS A 1 292 ? 30.574  76.109  49.045  1.00 56.88 ? 292 LYS D CD  1 
ATOM   1988  C CE  . LYS A 1 292 ? 29.161  76.044  48.474  1.00 57.53 ? 292 LYS D CE  1 
ATOM   1989  N NZ  . LYS A 1 292 ? 28.127  76.116  49.551  1.00 57.82 ? 292 LYS D NZ  1 
ATOM   1990  N N   . PRO A 1 293 ? 35.439  78.020  47.472  1.00 55.09 ? 293 PRO D N   1 
ATOM   1991  C CA  . PRO A 1 293 ? 36.499  78.931  47.911  1.00 55.05 ? 293 PRO D CA  1 
ATOM   1992  C C   . PRO A 1 293 ? 36.571  79.071  49.435  1.00 55.00 ? 293 PRO D C   1 
ATOM   1993  O O   . PRO A 1 293 ? 35.547  79.275  50.092  1.00 54.94 ? 293 PRO D O   1 
ATOM   1994  C CB  . PRO A 1 293 ? 36.100  80.271  47.275  1.00 55.10 ? 293 PRO D CB  1 
ATOM   1995  C CG  . PRO A 1 293 ? 34.664  80.113  46.880  1.00 55.06 ? 293 PRO D CG  1 
ATOM   1996  C CD  . PRO A 1 293 ? 34.532  78.676  46.515  1.00 55.08 ? 293 PRO D CD  1 
ATOM   1997  N N   . GLN A 1 294 ? 37.783  78.960  49.970  1.00 54.95 ? 294 GLN D N   1 
ATOM   1998  C CA  . GLN A 1 294 ? 38.043  78.990  51.413  1.00 55.02 ? 294 GLN D CA  1 
ATOM   1999  C C   . GLN A 1 294 ? 38.344  80.398  51.961  1.00 54.80 ? 294 GLN D C   1 
ATOM   2000  O O   . GLN A 1 294 ? 38.114  80.669  53.144  1.00 54.81 ? 294 GLN D O   1 
ATOM   2001  C CB  . GLN A 1 294 ? 39.174  77.993  51.745  1.00 55.03 ? 294 GLN D CB  1 
ATOM   2002  C CG  . GLN A 1 294 ? 40.095  78.355  52.923  1.00 55.37 ? 294 GLN D CG  1 
ATOM   2003  C CD  . GLN A 1 294 ? 41.414  77.571  52.930  1.00 55.37 ? 294 GLN D CD  1 
ATOM   2004  O OE1 . GLN A 1 294 ? 41.429  76.347  52.755  1.00 55.85 ? 294 GLN D OE1 1 
ATOM   2005  N NE2 . GLN A 1 294 ? 42.525  78.278  53.143  1.00 55.05 ? 294 GLN D NE2 1 
ATOM   2006  N N   . VAL A 1 295 ? 38.851  81.281  51.100  1.00 54.64 ? 295 VAL D N   1 
ATOM   2007  C CA  . VAL A 1 295 ? 39.252  82.643  51.491  1.00 54.39 ? 295 VAL D CA  1 
ATOM   2008  C C   . VAL A 1 295 ? 38.600  83.705  50.600  1.00 54.22 ? 295 VAL D C   1 
ATOM   2009  O O   . VAL A 1 295 ? 38.320  83.455  49.431  1.00 54.33 ? 295 VAL D O   1 
ATOM   2010  C CB  . VAL A 1 295 ? 40.795  82.815  51.454  1.00 54.34 ? 295 VAL D CB  1 
ATOM   2011  C CG1 . VAL A 1 295 ? 41.189  84.251  51.735  1.00 54.46 ? 295 VAL D CG1 1 
ATOM   2012  C CG2 . VAL A 1 295 ? 41.467  81.896  52.458  1.00 54.36 ? 295 VAL D CG2 1 
ATOM   2013  N N   . TYR A 1 296 ? 38.350  84.884  51.164  1.00 53.96 ? 296 TYR D N   1 
ATOM   2014  C CA  . TYR A 1 296 ? 37.809  86.006  50.398  1.00 53.61 ? 296 TYR D CA  1 
ATOM   2015  C C   . TYR A 1 296 ? 38.605  87.280  50.635  1.00 53.62 ? 296 TYR D C   1 
ATOM   2016  O O   . TYR A 1 296 ? 39.231  87.442  51.680  1.00 53.72 ? 296 TYR D O   1 
ATOM   2017  C CB  . TYR A 1 296 ? 36.332  86.238  50.725  1.00 53.27 ? 296 TYR D CB  1 
ATOM   2018  C CG  . TYR A 1 296 ? 35.433  85.114  50.287  1.00 52.78 ? 296 TYR D CG  1 
ATOM   2019  C CD1 . TYR A 1 296 ? 34.726  85.184  49.090  1.00 52.32 ? 296 TYR D CD1 1 
ATOM   2020  C CD2 . TYR A 1 296 ? 35.286  83.977  51.072  1.00 52.74 ? 296 TYR D CD2 1 
ATOM   2021  C CE1 . TYR A 1 296 ? 33.892  84.144  48.691  1.00 52.21 ? 296 TYR D CE1 1 
ATOM   2022  C CE2 . TYR A 1 296 ? 34.465  82.937  50.681  1.00 52.68 ? 296 TYR D CE2 1 
ATOM   2023  C CZ  . TYR A 1 296 ? 33.772  83.023  49.497  1.00 52.47 ? 296 TYR D CZ  1 
ATOM   2024  O OH  . TYR A 1 296 ? 32.965  81.976  49.135  1.00 52.61 ? 296 TYR D OH  1 
ATOM   2025  N N   . ALA A 1 297 ? 38.579  88.173  49.651  1.00 53.58 ? 297 ALA D N   1 
ATOM   2026  C CA  . ALA A 1 297 ? 39.269  89.454  49.725  1.00 53.60 ? 297 ALA D CA  1 
ATOM   2027  C C   . ALA A 1 297 ? 38.717  90.407  48.671  1.00 53.72 ? 297 ALA D C   1 
ATOM   2028  O O   . ALA A 1 297 ? 38.368  89.991  47.563  1.00 53.72 ? 297 ALA D O   1 
ATOM   2029  C CB  . ALA A 1 297 ? 40.767  89.267  49.540  1.00 53.59 ? 297 ALA D CB  1 
ATOM   2030  N N   . GLY A 1 298 ? 38.631  91.685  49.028  1.00 53.81 ? 298 GLY D N   1 
ATOM   2031  C CA  . GLY A 1 298 ? 38.169  92.713  48.106  1.00 53.84 ? 298 GLY D CA  1 
ATOM   2032  C C   . GLY A 1 298 ? 39.332  93.309  47.341  1.00 53.96 ? 298 GLY D C   1 
ATOM   2033  O O   . GLY A 1 298 ? 40.312  93.765  47.940  1.00 53.94 ? 298 GLY D O   1 
ATOM   2034  N N   . LEU A 1 299 ? 39.229  93.289  46.015  1.00 53.97 ? 299 LEU D N   1 
ATOM   2035  C CA  . LEU A 1 299 ? 40.255  93.868  45.159  1.00 54.10 ? 299 LEU D CA  1 
ATOM   2036  C C   . LEU A 1 299 ? 39.709  95.107  44.464  1.00 54.21 ? 299 LEU D C   1 
ATOM   2037  O O   . LEU A 1 299 ? 38.641  95.065  43.846  1.00 54.42 ? 299 LEU D O   1 
ATOM   2038  C CB  . LEU A 1 299 ? 40.755  92.853  44.128  1.00 54.02 ? 299 LEU D CB  1 
ATOM   2039  C CG  . LEU A 1 299 ? 41.421  91.552  44.584  1.00 54.17 ? 299 LEU D CG  1 
ATOM   2040  C CD1 . LEU A 1 299 ? 41.892  90.777  43.371  1.00 54.59 ? 299 LEU D CD1 1 
ATOM   2041  C CD2 . LEU A 1 299 ? 42.589  91.809  45.502  1.00 54.28 ? 299 LEU D CD2 1 
ATOM   2042  N N   . PHE A 1 300 ? 40.441  96.212  44.580  1.00 54.15 ? 300 PHE D N   1 
ATOM   2043  C CA  . PHE A 1 300 ? 40.011  97.484  44.011  1.00 54.06 ? 300 PHE D CA  1 
ATOM   2044  C C   . PHE A 1 300 ? 41.166  98.169  43.286  1.00 53.90 ? 300 PHE D C   1 
ATOM   2045  O O   . PHE A 1 300 ? 42.286  98.193  43.800  1.00 53.96 ? 300 PHE D O   1 
ATOM   2046  C CB  . PHE A 1 300 ? 39.458  98.394  45.111  1.00 54.15 ? 300 PHE D CB  1 
ATOM   2047  C CG  . PHE A 1 300 ? 38.332  97.782  45.888  1.00 54.15 ? 300 PHE D CG  1 
ATOM   2048  C CD1 . PHE A 1 300 ? 38.587  97.001  47.011  1.00 54.47 ? 300 PHE D CD1 1 
ATOM   2049  C CD2 . PHE A 1 300 ? 37.017  97.979  45.494  1.00 54.26 ? 300 PHE D CD2 1 
ATOM   2050  C CE1 . PHE A 1 300 ? 37.543  96.419  47.726  1.00 54.76 ? 300 PHE D CE1 1 
ATOM   2051  C CE2 . PHE A 1 300 ? 35.967  97.407  46.202  1.00 54.63 ? 300 PHE D CE2 1 
ATOM   2052  C CZ  . PHE A 1 300 ? 36.229  96.624  47.321  1.00 54.62 ? 300 PHE D CZ  1 
ATOM   2053  N N   . PRO A 1 301 ? 40.903  98.713  42.082  1.00 53.65 ? 301 PRO D N   1 
ATOM   2054  C CA  . PRO A 1 301 ? 41.930  99.454  41.345  1.00 53.46 ? 301 PRO D CA  1 
ATOM   2055  C C   . PRO A 1 301 ? 42.365  100.700 42.097  1.00 53.27 ? 301 PRO D C   1 
ATOM   2056  O O   . PRO A 1 301 ? 41.525  101.386 42.686  1.00 53.47 ? 301 PRO D O   1 
ATOM   2057  C CB  . PRO A 1 301 ? 41.219  99.853  40.045  1.00 53.44 ? 301 PRO D CB  1 
ATOM   2058  C CG  . PRO A 1 301 ? 40.051  98.912  39.932  1.00 53.54 ? 301 PRO D CG  1 
ATOM   2059  C CD  . PRO A 1 301 ? 39.632  98.645  41.339  1.00 53.58 ? 301 PRO D CD  1 
ATOM   2060  N N   . VAL A 1 302 ? 43.669  100.972 42.095  1.00 52.91 ? 302 VAL D N   1 
ATOM   2061  C CA  . VAL A 1 302 ? 44.197  102.227 42.634  1.00 52.49 ? 302 VAL D CA  1 
ATOM   2062  C C   . VAL A 1 302 ? 43.645  103.408 41.824  1.00 52.31 ? 302 VAL D C   1 
ATOM   2063  O O   . VAL A 1 302 ? 43.216  104.414 42.391  1.00 52.08 ? 302 VAL D O   1 
ATOM   2064  C CB  . VAL A 1 302 ? 45.745  102.244 42.641  1.00 52.43 ? 302 VAL D CB  1 
ATOM   2065  C CG1 . VAL A 1 302 ? 46.270  103.581 43.151  1.00 52.11 ? 302 VAL D CG1 1 
ATOM   2066  C CG2 . VAL A 1 302 ? 46.284  101.105 43.490  1.00 52.06 ? 302 VAL D CG2 1 
ATOM   2067  N N   . SER A 1 303 ? 43.652  103.252 40.502  1.00 52.21 ? 303 SER D N   1 
ATOM   2068  C CA  . SER A 1 303 ? 43.082  104.217 39.570  1.00 52.13 ? 303 SER D CA  1 
ATOM   2069  C C   . SER A 1 303 ? 41.852  103.622 38.887  1.00 52.12 ? 303 SER D C   1 
ATOM   2070  O O   . SER A 1 303 ? 41.953  102.605 38.202  1.00 52.18 ? 303 SER D O   1 
ATOM   2071  C CB  . SER A 1 303 ? 44.129  104.618 38.528  1.00 52.16 ? 303 SER D CB  1 
ATOM   2072  O OG  . SER A 1 303 ? 43.527  105.041 37.315  1.00 52.14 ? 303 SER D OG  1 
ATOM   2073  N N   . SER A 1 304 ? 40.706  104.280 39.058  1.00 52.04 ? 304 SER D N   1 
ATOM   2074  C CA  . SER A 1 304 ? 39.408  103.791 38.570  1.00 51.93 ? 304 SER D CA  1 
ATOM   2075  C C   . SER A 1 304 ? 39.358  103.481 37.066  1.00 51.96 ? 304 SER D C   1 
ATOM   2076  O O   . SER A 1 304 ? 38.469  102.761 36.606  1.00 52.14 ? 304 SER D O   1 
ATOM   2077  C CB  . SER A 1 304 ? 38.305  104.786 38.928  1.00 51.84 ? 304 SER D CB  1 
ATOM   2078  O OG  . SER A 1 304 ? 38.523  106.023 38.275  1.00 52.03 ? 304 SER D OG  1 
ATOM   2079  N N   . ASP A 1 305 ? 40.310  104.024 36.311  1.00 51.85 ? 305 ASP D N   1 
ATOM   2080  C CA  . ASP A 1 305 ? 40.388  103.797 34.866  1.00 51.64 ? 305 ASP D CA  1 
ATOM   2081  C C   . ASP A 1 305 ? 40.791  102.363 34.528  1.00 51.42 ? 305 ASP D C   1 
ATOM   2082  O O   . ASP A 1 305 ? 40.569  101.892 33.411  1.00 51.40 ? 305 ASP D O   1 
ATOM   2083  C CB  . ASP A 1 305 ? 41.359  104.791 34.221  1.00 51.64 ? 305 ASP D CB  1 
ATOM   2084  C CG  . ASP A 1 305 ? 40.871  106.231 34.311  1.00 51.83 ? 305 ASP D CG  1 
ATOM   2085  O OD1 . ASP A 1 305 ? 39.645  106.450 34.289  1.00 52.48 ? 305 ASP D OD1 1 
ATOM   2086  O OD2 . ASP A 1 305 ? 41.711  107.150 34.400  1.00 52.36 ? 305 ASP D OD2 1 
ATOM   2087  N N   . ASP A 1 306 ? 41.369  101.674 35.506  1.00 51.16 ? 306 ASP D N   1 
ATOM   2088  C CA  . ASP A 1 306 ? 41.813  100.300 35.331  1.00 50.99 ? 306 ASP D CA  1 
ATOM   2089  C C   . ASP A 1 306 ? 40.684  99.275  35.475  1.00 51.09 ? 306 ASP D C   1 
ATOM   2090  O O   . ASP A 1 306 ? 40.906  98.080  35.258  1.00 51.18 ? 306 ASP D O   1 
ATOM   2091  C CB  . ASP A 1 306 ? 42.931  99.978  36.324  1.00 50.87 ? 306 ASP D CB  1 
ATOM   2092  C CG  . ASP A 1 306 ? 44.261  100.579 35.929  1.00 50.37 ? 306 ASP D CG  1 
ATOM   2093  O OD1 . ASP A 1 306 ? 44.550  100.664 34.719  1.00 50.58 ? 306 ASP D OD1 1 
ATOM   2094  O OD2 . ASP A 1 306 ? 45.030  100.954 36.836  1.00 49.72 ? 306 ASP D OD2 1 
ATOM   2095  N N   . TYR A 1 307 ? 39.484  99.741  35.829  1.00 51.10 ? 307 TYR D N   1 
ATOM   2096  C CA  . TYR A 1 307 ? 38.347  98.850  36.106  1.00 51.08 ? 307 TYR D CA  1 
ATOM   2097  C C   . TYR A 1 307 ? 37.990  97.897  34.967  1.00 51.18 ? 307 TYR D C   1 
ATOM   2098  O O   . TYR A 1 307 ? 37.773  96.706  35.205  1.00 51.31 ? 307 TYR D O   1 
ATOM   2099  C CB  . TYR A 1 307 ? 37.109  99.644  36.521  1.00 51.00 ? 307 TYR D CB  1 
ATOM   2100  C CG  . TYR A 1 307 ? 35.958  98.773  36.989  1.00 51.05 ? 307 TYR D CG  1 
ATOM   2101  C CD1 . TYR A 1 307 ? 35.925  98.273  38.291  1.00 51.01 ? 307 TYR D CD1 1 
ATOM   2102  C CD2 . TYR A 1 307 ? 34.904  98.448  36.132  1.00 50.60 ? 307 TYR D CD2 1 
ATOM   2103  C CE1 . TYR A 1 307 ? 34.874  97.476  38.727  1.00 50.86 ? 307 TYR D CE1 1 
ATOM   2104  C CE2 . TYR A 1 307 ? 33.850  97.651  36.559  1.00 50.24 ? 307 TYR D CE2 1 
ATOM   2105  C CZ  . TYR A 1 307 ? 33.841  97.171  37.856  1.00 50.88 ? 307 TYR D CZ  1 
ATOM   2106  O OH  . TYR A 1 307 ? 32.802  96.383  38.294  1.00 51.57 ? 307 TYR D OH  1 
ATOM   2107  N N   . GLU A 1 308 ? 37.922  98.419  33.743  1.00 51.21 ? 308 GLU D N   1 
ATOM   2108  C CA  . GLU A 1 308 ? 37.559  97.613  32.577  1.00 51.23 ? 308 GLU D CA  1 
ATOM   2109  C C   . GLU A 1 308 ? 38.565  96.471  32.371  1.00 51.15 ? 308 GLU D C   1 
ATOM   2110  O O   . GLU A 1 308 ? 38.173  95.312  32.186  1.00 51.07 ? 308 GLU D O   1 
ATOM   2111  C CB  . GLU A 1 308 ? 37.470  98.479  31.315  1.00 51.29 ? 308 GLU D CB  1 
ATOM   2112  C CG  . GLU A 1 308 ? 37.028  99.927  31.542  1.00 51.95 ? 308 GLU D CG  1 
ATOM   2113  C CD  . GLU A 1 308 ? 35.518  100.118 31.544  1.00 52.89 ? 308 GLU D CD  1 
ATOM   2114  O OE1 . GLU A 1 308 ? 34.798  99.353  30.867  1.00 53.10 ? 308 GLU D OE1 1 
ATOM   2115  O OE2 . GLU A 1 308 ? 35.048  101.060 32.217  1.00 53.59 ? 308 GLU D OE2 1 
ATOM   2116  N N   . ALA A 1 309 ? 39.857  96.809  32.421  1.00 51.09 ? 309 ALA D N   1 
ATOM   2117  C CA  . ALA A 1 309 ? 40.953  95.837  32.266  1.00 50.86 ? 309 ALA D CA  1 
ATOM   2118  C C   . ALA A 1 309 ? 40.955  94.831  33.404  1.00 50.63 ? 309 ALA D C   1 
ATOM   2119  O O   . ALA A 1 309 ? 41.228  93.650  33.207  1.00 50.63 ? 309 ALA D O   1 
ATOM   2120  C CB  . ALA A 1 309 ? 42.294  96.553  32.201  1.00 50.78 ? 309 ALA D CB  1 
ATOM   2121  N N   . PHE A 1 310 ? 40.643  95.319  34.597  1.00 50.42 ? 310 PHE D N   1 
ATOM   2122  C CA  . PHE A 1 310 ? 40.533  94.490  35.780  1.00 50.34 ? 310 PHE D CA  1 
ATOM   2123  C C   . PHE A 1 310 ? 39.392  93.473  35.633  1.00 50.25 ? 310 PHE D C   1 
ATOM   2124  O O   . PHE A 1 310 ? 39.580  92.284  35.887  1.00 50.25 ? 310 PHE D O   1 
ATOM   2125  C CB  . PHE A 1 310 ? 40.357  95.394  37.007  1.00 50.39 ? 310 PHE D CB  1 
ATOM   2126  C CG  . PHE A 1 310 ? 40.321  94.665  38.320  1.00 50.62 ? 310 PHE D CG  1 
ATOM   2127  C CD1 . PHE A 1 310 ? 41.064  93.503  38.523  1.00 50.49 ? 310 PHE D CD1 1 
ATOM   2128  C CD2 . PHE A 1 310 ? 39.562  95.170  39.375  1.00 51.01 ? 310 PHE D CD2 1 
ATOM   2129  C CE1 . PHE A 1 310 ? 41.028  92.841  39.742  1.00 50.92 ? 310 PHE D CE1 1 
ATOM   2130  C CE2 . PHE A 1 310 ? 39.526  94.518  40.606  1.00 51.33 ? 310 PHE D CE2 1 
ATOM   2131  C CZ  . PHE A 1 310 ? 40.258  93.352  40.788  1.00 51.11 ? 310 PHE D CZ  1 
ATOM   2132  N N   . ARG A 1 311 ? 38.225  93.939  35.198  1.00 50.06 ? 311 ARG D N   1 
ATOM   2133  C CA  . ARG A 1 311 ? 37.079  93.061  34.984  1.00 50.07 ? 311 ARG D CA  1 
ATOM   2134  C C   . ARG A 1 311 ? 37.342  92.062  33.857  1.00 50.05 ? 311 ARG D C   1 
ATOM   2135  O O   . ARG A 1 311 ? 36.870  90.919  33.902  1.00 49.96 ? 311 ARG D O   1 
ATOM   2136  C CB  . ARG A 1 311 ? 35.839  93.890  34.672  1.00 50.14 ? 311 ARG D CB  1 
ATOM   2137  C CG  . ARG A 1 311 ? 34.546  93.099  34.610  1.00 50.26 ? 311 ARG D CG  1 
ATOM   2138  C CD  . ARG A 1 311 ? 33.413  94.004  34.197  1.00 51.18 ? 311 ARG D CD  1 
ATOM   2139  N NE  . ARG A 1 311 ? 33.719  94.681  32.941  1.00 51.97 ? 311 ARG D NE  1 
ATOM   2140  C CZ  . ARG A 1 311 ? 33.073  95.745  32.476  1.00 52.42 ? 311 ARG D CZ  1 
ATOM   2141  N NH1 . ARG A 1 311 ? 32.068  96.277  33.166  1.00 51.89 ? 311 ARG D NH1 1 
ATOM   2142  N NH2 . ARG A 1 311 ? 33.439  96.279  31.315  1.00 52.56 ? 311 ARG D NH2 1 
ATOM   2143  N N   . ASP A 1 312 ? 38.094  92.505  32.851  1.00 50.05 ? 312 ASP D N   1 
ATOM   2144  C CA  . ASP A 1 312 ? 38.485  91.653  31.733  1.00 50.06 ? 312 ASP D CA  1 
ATOM   2145  C C   . ASP A 1 312 ? 39.561  90.646  32.119  1.00 50.10 ? 312 ASP D C   1 
ATOM   2146  O O   . ASP A 1 312 ? 39.609  89.545  31.560  1.00 50.15 ? 312 ASP D O   1 
ATOM   2147  C CB  . ASP A 1 312 ? 38.967  92.498  30.558  1.00 49.99 ? 312 ASP D CB  1 
ATOM   2148  C CG  . ASP A 1 312 ? 37.833  93.160  29.814  1.00 50.20 ? 312 ASP D CG  1 
ATOM   2149  O OD1 . ASP A 1 312 ? 36.681  92.676  29.901  1.00 50.72 ? 312 ASP D OD1 1 
ATOM   2150  O OD2 . ASP A 1 312 ? 38.099  94.165  29.128  1.00 50.09 ? 312 ASP D OD2 1 
ATOM   2151  N N   . ALA A 1 313 ? 40.421  91.032  33.062  1.00 49.91 ? 313 ALA D N   1 
ATOM   2152  C CA  . ALA A 1 313 ? 41.485  90.159  33.541  1.00 49.81 ? 313 ALA D CA  1 
ATOM   2153  C C   . ALA A 1 313 ? 40.918  89.022  34.382  1.00 49.79 ? 313 ALA D C   1 
ATOM   2154  O O   . ALA A 1 313 ? 41.357  87.880  34.258  1.00 50.04 ? 313 ALA D O   1 
ATOM   2155  C CB  . ALA A 1 313 ? 42.518  90.946  34.326  1.00 49.93 ? 313 ALA D CB  1 
ATOM   2156  N N   . LEU A 1 314 ? 39.942  89.335  35.231  1.00 49.54 ? 314 LEU D N   1 
ATOM   2157  C CA  . LEU A 1 314 ? 39.232  88.309  35.983  1.00 49.41 ? 314 LEU D CA  1 
ATOM   2158  C C   . LEU A 1 314 ? 38.482  87.375  35.032  1.00 49.53 ? 314 LEU D C   1 
ATOM   2159  O O   . LEU A 1 314 ? 38.543  86.156  35.185  1.00 49.62 ? 314 LEU D O   1 
ATOM   2160  C CB  . LEU A 1 314 ? 38.285  88.936  37.003  1.00 49.28 ? 314 LEU D CB  1 
ATOM   2161  C CG  . LEU A 1 314 ? 38.933  89.735  38.138  1.00 49.07 ? 314 LEU D CG  1 
ATOM   2162  C CD1 . LEU A 1 314 ? 37.948  90.723  38.722  1.00 48.52 ? 314 LEU D CD1 1 
ATOM   2163  C CD2 . LEU A 1 314 ? 39.507  88.834  39.229  1.00 48.44 ? 314 LEU D CD2 1 
ATOM   2164  N N   . GLY A 1 315 ? 37.803  87.952  34.041  1.00 49.62 ? 315 GLY D N   1 
ATOM   2165  C CA  . GLY A 1 315 ? 37.153  87.176  32.981  1.00 49.86 ? 315 GLY D CA  1 
ATOM   2166  C C   . GLY A 1 315 ? 38.082  86.214  32.249  1.00 49.98 ? 315 GLY D C   1 
ATOM   2167  O O   . GLY A 1 315 ? 37.744  85.041  32.062  1.00 49.87 ? 315 GLY D O   1 
ATOM   2168  N N   . LYS A 1 316 ? 39.252  86.713  31.840  1.00 50.12 ? 316 LYS D N   1 
ATOM   2169  C CA  . LYS A 1 316 ? 40.273  85.907  31.151  1.00 50.21 ? 316 LYS D CA  1 
ATOM   2170  C C   . LYS A 1 316 ? 40.765  84.750  32.010  1.00 50.23 ? 316 LYS D C   1 
ATOM   2171  O O   . LYS A 1 316 ? 40.825  83.610  31.544  1.00 50.26 ? 316 LYS D O   1 
ATOM   2172  C CB  . LYS A 1 316 ? 41.464  86.772  30.739  1.00 50.30 ? 316 LYS D CB  1 
ATOM   2173  C CG  . LYS A 1 316 ? 41.269  87.552  29.455  1.00 50.76 ? 316 LYS D CG  1 
ATOM   2174  C CD  . LYS A 1 316 ? 42.280  88.682  29.348  1.00 51.42 ? 316 LYS D CD  1 
ATOM   2175  C CE  . LYS A 1 316 ? 42.104  89.462  28.058  1.00 52.11 ? 316 LYS D CE  1 
ATOM   2176  N NZ  . LYS A 1 316 ? 42.885  90.728  28.073  1.00 52.31 ? 316 LYS D NZ  1 
ATOM   2177  N N   . LEU A 1 317 ? 41.115  85.060  33.260  1.00 50.17 ? 317 LEU D N   1 
ATOM   2178  C CA  . LEU A 1 317 ? 41.515  84.063  34.253  1.00 50.14 ? 317 LEU D CA  1 
ATOM   2179  C C   . LEU A 1 317 ? 40.444  82.999  34.449  1.00 50.36 ? 317 LEU D C   1 
ATOM   2180  O O   . LEU A 1 317 ? 40.745  81.807  34.534  1.00 50.45 ? 317 LEU D O   1 
ATOM   2181  C CB  . LEU A 1 317 ? 41.792  84.746  35.589  1.00 49.96 ? 317 LEU D CB  1 
ATOM   2182  C CG  . LEU A 1 317 ? 43.205  85.137  36.032  1.00 49.46 ? 317 LEU D CG  1 
ATOM   2183  C CD1 . LEU A 1 317 ? 44.198  85.295  34.895  1.00 48.82 ? 317 LEU D CD1 1 
ATOM   2184  C CD2 . LEU A 1 317 ? 43.108  86.409  36.843  1.00 48.66 ? 317 LEU D CD2 1 
ATOM   2185  N N   . SER A 1 318 ? 39.193  83.453  34.499  1.00 50.55 ? 318 SER D N   1 
ATOM   2186  C CA  . SER A 1 318 ? 38.028  82.604  34.735  1.00 50.66 ? 318 SER D CA  1 
ATOM   2187  C C   . SER A 1 318 ? 37.848  81.466  33.717  1.00 50.60 ? 318 SER D C   1 
ATOM   2188  O O   . SER A 1 318 ? 37.278  80.425  34.044  1.00 50.60 ? 318 SER D O   1 
ATOM   2189  C CB  . SER A 1 318 ? 36.774  83.475  34.785  1.00 50.60 ? 318 SER D CB  1 
ATOM   2190  O OG  . SER A 1 318 ? 35.697  82.766  35.358  1.00 51.52 ? 318 SER D OG  1 
ATOM   2191  N N   . LEU A 1 319 ? 38.337  81.666  32.494  1.00 50.58 ? 319 LEU D N   1 
ATOM   2192  C CA  . LEU A 1 319 ? 38.264  80.642  31.448  1.00 50.64 ? 319 LEU D CA  1 
ATOM   2193  C C   . LEU A 1 319 ? 39.092  79.405  31.780  1.00 50.54 ? 319 LEU D C   1 
ATOM   2194  O O   . LEU A 1 319 ? 38.841  78.323  31.246  1.00 50.49 ? 319 LEU D O   1 
ATOM   2195  C CB  . LEU A 1 319 ? 38.732  81.205  30.100  1.00 50.76 ? 319 LEU D CB  1 
ATOM   2196  C CG  . LEU A 1 319 ? 37.872  82.211  29.327  1.00 50.94 ? 319 LEU D CG  1 
ATOM   2197  C CD1 . LEU A 1 319 ? 38.728  82.908  28.277  1.00 50.89 ? 319 LEU D CD1 1 
ATOM   2198  C CD2 . LEU A 1 319 ? 36.650  81.552  28.682  1.00 50.63 ? 319 LEU D CD2 1 
ATOM   2199  N N   . ASN A 1 320 ? 40.080  79.577  32.657  1.00 50.56 ? 320 ASN D N   1 
ATOM   2200  C CA  . ASN A 1 320 ? 41.017  78.507  32.998  1.00 50.52 ? 320 ASN D CA  1 
ATOM   2201  C C   . ASN A 1 320 ? 41.079  78.146  34.480  1.00 50.71 ? 320 ASN D C   1 
ATOM   2202  O O   . ASN A 1 320 ? 41.486  77.036  34.835  1.00 50.88 ? 320 ASN D O   1 
ATOM   2203  C CB  . ASN A 1 320 ? 42.414  78.831  32.465  1.00 50.31 ? 320 ASN D CB  1 
ATOM   2204  C CG  . ASN A 1 320 ? 42.529  78.605  30.975  1.00 49.71 ? 320 ASN D CG  1 
ATOM   2205  O OD1 . ASN A 1 320 ? 42.586  79.554  30.197  1.00 49.02 ? 320 ASN D OD1 1 
ATOM   2206  N ND2 . ASN A 1 320 ? 42.549  77.341  30.566  1.00 49.15 ? 320 ASN D ND2 1 
ATOM   2207  N N   . ASP A 1 321 ? 40.682  79.080  35.338  1.00 50.86 ? 321 ASP D N   1 
ATOM   2208  C CA  . ASP A 1 321 ? 40.629  78.824  36.769  1.00 51.15 ? 321 ASP D CA  1 
ATOM   2209  C C   . ASP A 1 321 ? 39.211  78.403  37.131  1.00 51.46 ? 321 ASP D C   1 
ATOM   2210  O O   . ASP A 1 321 ? 38.284  79.222  37.128  1.00 51.50 ? 321 ASP D O   1 
ATOM   2211  C CB  . ASP A 1 321 ? 41.052  80.069  37.556  1.00 51.18 ? 321 ASP D CB  1 
ATOM   2212  C CG  . ASP A 1 321 ? 41.559  79.743  38.952  1.00 51.23 ? 321 ASP D CG  1 
ATOM   2213  O OD1 . ASP A 1 321 ? 42.613  80.289  39.337  1.00 51.14 ? 321 ASP D OD1 1 
ATOM   2214  O OD2 . ASP A 1 321 ? 40.912  78.951  39.669  1.00 51.78 ? 321 ASP D OD2 1 
ATOM   2215  N N   . ALA A 1 322 ? 39.049  77.116  37.431  1.00 51.75 ? 322 ALA D N   1 
ATOM   2216  C CA  . ALA A 1 322 ? 37.740  76.547  37.740  1.00 51.96 ? 322 ALA D CA  1 
ATOM   2217  C C   . ALA A 1 322 ? 37.187  77.009  39.090  1.00 52.24 ? 322 ALA D C   1 
ATOM   2218  O O   . ALA A 1 322 ? 35.970  77.000  39.299  1.00 52.32 ? 322 ALA D O   1 
ATOM   2219  C CB  . ALA A 1 322 ? 37.798  75.033  37.680  1.00 51.86 ? 322 ALA D CB  1 
ATOM   2220  N N   . SER A 1 323 ? 38.074  77.423  39.994  1.00 52.50 ? 323 SER D N   1 
ATOM   2221  C CA  . SER A 1 323 ? 37.665  77.767  41.356  1.00 52.87 ? 323 SER D CA  1 
ATOM   2222  C C   . SER A 1 323 ? 37.784  79.249  41.729  1.00 52.99 ? 323 SER D C   1 
ATOM   2223  O O   . SER A 1 323 ? 37.393  79.636  42.832  1.00 53.18 ? 323 SER D O   1 
ATOM   2224  C CB  . SER A 1 323 ? 38.408  76.892  42.374  1.00 52.94 ? 323 SER D CB  1 
ATOM   2225  O OG  . SER A 1 323 ? 39.796  77.173  42.369  1.00 53.55 ? 323 SER D OG  1 
ATOM   2226  N N   . LEU A 1 324 ? 38.313  80.071  40.821  1.00 53.19 ? 324 LEU D N   1 
ATOM   2227  C CA  . LEU A 1 324 ? 38.364  81.527  41.023  1.00 53.21 ? 324 LEU D CA  1 
ATOM   2228  C C   . LEU A 1 324 ? 36.956  82.090  41.131  1.00 53.26 ? 324 LEU D C   1 
ATOM   2229  O O   . LEU A 1 324 ? 36.176  82.010  40.182  1.00 53.41 ? 324 LEU D O   1 
ATOM   2230  C CB  . LEU A 1 324 ? 39.080  82.222  39.859  1.00 53.19 ? 324 LEU D CB  1 
ATOM   2231  C CG  . LEU A 1 324 ? 39.682  83.641  39.964  1.00 53.25 ? 324 LEU D CG  1 
ATOM   2232  C CD1 . LEU A 1 324 ? 39.544  84.374  38.630  1.00 53.20 ? 324 LEU D CD1 1 
ATOM   2233  C CD2 . LEU A 1 324 ? 39.156  84.510  41.112  1.00 52.79 ? 324 LEU D CD2 1 
ATOM   2234  N N   . PHE A 1 325 ? 36.637  82.661  42.286  1.00 53.37 ? 325 PHE D N   1 
ATOM   2235  C CA  . PHE A 1 325 ? 35.349  83.311  42.483  1.00 53.47 ? 325 PHE D CA  1 
ATOM   2236  C C   . PHE A 1 325 ? 35.474  84.830  42.458  1.00 53.29 ? 325 PHE D C   1 
ATOM   2237  O O   . PHE A 1 325 ? 36.361  85.393  43.092  1.00 53.15 ? 325 PHE D O   1 
ATOM   2238  C CB  . PHE A 1 325 ? 34.712  82.860  43.800  1.00 53.61 ? 325 PHE D CB  1 
ATOM   2239  C CG  . PHE A 1 325 ? 33.486  83.642  44.176  1.00 54.21 ? 325 PHE D CG  1 
ATOM   2240  C CD1 . PHE A 1 325 ? 32.298  83.489  43.460  1.00 54.24 ? 325 PHE D CD1 1 
ATOM   2241  C CD2 . PHE A 1 325 ? 33.518  84.541  45.239  1.00 54.48 ? 325 PHE D CD2 1 
ATOM   2242  C CE1 . PHE A 1 325 ? 31.161  84.215  43.803  1.00 54.30 ? 325 PHE D CE1 1 
ATOM   2243  C CE2 . PHE A 1 325 ? 32.383  85.272  45.592  1.00 54.36 ? 325 PHE D CE2 1 
ATOM   2244  C CZ  . PHE A 1 325 ? 31.204  85.109  44.875  1.00 54.11 ? 325 PHE D CZ  1 
ATOM   2245  N N   . TYR A 1 326 ? 34.588  85.484  41.714  1.00 53.29 ? 326 TYR D N   1 
ATOM   2246  C CA  . TYR A 1 326 ? 34.465  86.942  41.784  1.00 53.23 ? 326 TYR D CA  1 
ATOM   2247  C C   . TYR A 1 326 ? 33.036  87.446  41.617  1.00 53.18 ? 326 TYR D C   1 
ATOM   2248  O O   . TYR A 1 326 ? 32.166  86.760  41.082  1.00 53.18 ? 326 TYR D O   1 
ATOM   2249  C CB  . TYR A 1 326 ? 35.445  87.671  40.844  1.00 53.15 ? 326 TYR D CB  1 
ATOM   2250  C CG  . TYR A 1 326 ? 35.208  87.493  39.360  1.00 52.88 ? 326 TYR D CG  1 
ATOM   2251  C CD1 . TYR A 1 326 ? 35.736  86.398  38.681  1.00 53.06 ? 326 TYR D CD1 1 
ATOM   2252  C CD2 . TYR A 1 326 ? 34.493  88.440  38.627  1.00 52.78 ? 326 TYR D CD2 1 
ATOM   2253  C CE1 . TYR A 1 326 ? 35.535  86.234  37.314  1.00 53.24 ? 326 TYR D CE1 1 
ATOM   2254  C CE2 . TYR A 1 326 ? 34.286  88.288  37.257  1.00 52.47 ? 326 TYR D CE2 1 
ATOM   2255  C CZ  . TYR A 1 326 ? 34.813  87.183  36.611  1.00 52.87 ? 326 TYR D CZ  1 
ATOM   2256  O OH  . TYR A 1 326 ? 34.622  87.013  35.263  1.00 52.89 ? 326 TYR D OH  1 
ATOM   2257  N N   . GLU A 1 327 ? 32.825  88.663  42.096  1.00 53.29 ? 327 GLU D N   1 
ATOM   2258  C CA  . GLU A 1 327 ? 31.511  89.267  42.232  1.00 53.49 ? 327 GLU D CA  1 
ATOM   2259  C C   . GLU A 1 327 ? 31.745  90.763  42.431  1.00 53.39 ? 327 GLU D C   1 
ATOM   2260  O O   . GLU A 1 327 ? 32.624  91.153  43.207  1.00 53.56 ? 327 GLU D O   1 
ATOM   2261  C CB  . GLU A 1 327 ? 30.772  88.622  43.414  1.00 53.45 ? 327 GLU D CB  1 
ATOM   2262  C CG  . GLU A 1 327 ? 30.063  89.548  44.391  1.00 53.65 ? 327 GLU D CG  1 
ATOM   2263  C CD  . GLU A 1 327 ? 29.476  88.784  45.570  1.00 53.84 ? 327 GLU D CD  1 
ATOM   2264  O OE1 . GLU A 1 327 ? 28.772  87.779  45.329  1.00 53.96 ? 327 GLU D OE1 1 
ATOM   2265  O OE2 . GLU A 1 327 ? 29.718  89.182  46.734  1.00 53.97 ? 327 GLU D OE2 1 
ATOM   2266  N N   . PRO A 1 328 ? 30.992  91.606  41.705  1.00 53.20 ? 328 PRO D N   1 
ATOM   2267  C CA  . PRO A 1 328 ? 31.218  93.044  41.802  1.00 53.13 ? 328 PRO D CA  1 
ATOM   2268  C C   . PRO A 1 328 ? 30.972  93.594  43.208  1.00 52.96 ? 328 PRO D C   1 
ATOM   2269  O O   . PRO A 1 328 ? 30.147  93.067  43.947  1.00 52.89 ? 328 PRO D O   1 
ATOM   2270  C CB  . PRO A 1 328 ? 30.216  93.634  40.799  1.00 53.06 ? 328 PRO D CB  1 
ATOM   2271  C CG  . PRO A 1 328 ? 29.206  92.582  40.582  1.00 53.06 ? 328 PRO D CG  1 
ATOM   2272  C CD  . PRO A 1 328 ? 29.911  91.277  40.761  1.00 53.25 ? 328 PRO D CD  1 
ATOM   2273  N N   . GLU A 1 329 ? 31.718  94.633  43.566  1.00 52.95 ? 329 GLU D N   1 
ATOM   2274  C CA  . GLU A 1 329 ? 31.542  95.330  44.833  1.00 53.00 ? 329 GLU D CA  1 
ATOM   2275  C C   . GLU A 1 329 ? 31.985  96.779  44.680  1.00 52.79 ? 329 GLU D C   1 
ATOM   2276  O O   . GLU A 1 329 ? 32.999  97.060  44.037  1.00 52.84 ? 329 GLU D O   1 
ATOM   2277  C CB  . GLU A 1 329 ? 32.342  94.649  45.939  1.00 52.85 ? 329 GLU D CB  1 
ATOM   2278  C CG  . GLU A 1 329 ? 32.157  95.268  47.312  1.00 53.16 ? 329 GLU D CG  1 
ATOM   2279  C CD  . GLU A 1 329 ? 32.884  94.505  48.403  1.00 53.64 ? 329 GLU D CD  1 
ATOM   2280  O OE1 . GLU A 1 329 ? 34.002  93.994  48.149  1.00 54.72 ? 329 GLU D OE1 1 
ATOM   2281  O OE2 . GLU A 1 329 ? 32.341  94.426  49.526  1.00 54.13 ? 329 GLU D OE2 1 
ATOM   2282  N N   . SER A 1 330 ? 31.213  97.693  45.259  1.00 52.57 ? 330 SER D N   1 
ATOM   2283  C CA  . SER A 1 330 ? 31.569  99.104  45.252  1.00 52.38 ? 330 SER D CA  1 
ATOM   2284  C C   . SER A 1 330 ? 31.626  99.667  46.665  1.00 52.39 ? 330 SER D C   1 
ATOM   2285  O O   . SER A 1 330 ? 30.869  99.256  47.548  1.00 52.46 ? 330 SER D O   1 
ATOM   2286  C CB  . SER A 1 330 ? 30.589  99.907  44.400  1.00 52.31 ? 330 SER D CB  1 
ATOM   2287  O OG  . SER A 1 330 ? 29.271  99.784  44.895  1.00 52.15 ? 330 SER D OG  1 
ATOM   2288  N N   . SER A 1 331 ? 32.552  100.593 46.871  1.00 52.31 ? 331 SER D N   1 
ATOM   2289  C CA  . SER A 1 331 ? 32.661  101.316 48.125  1.00 52.28 ? 331 SER D CA  1 
ATOM   2290  C C   . SER A 1 331 ? 32.593  102.788 47.794  1.00 52.17 ? 331 SER D C   1 
ATOM   2291  O O   . SER A 1 331 ? 32.897  103.205 46.674  1.00 51.99 ? 331 SER D O   1 
ATOM   2292  C CB  . SER A 1 331 ? 33.989  101.018 48.836  1.00 52.35 ? 331 SER D CB  1 
ATOM   2293  O OG  . SER A 1 331 ? 34.220  99.622  48.977  1.00 52.96 ? 331 SER D OG  1 
ATOM   2294  N N   . SER A 1 332 ? 32.189  103.573 48.780  1.00 52.20 ? 332 SER D N   1 
ATOM   2295  C CA  . SER A 1 332 ? 32.189  105.017 48.661  1.00 52.02 ? 332 SER D CA  1 
ATOM   2296  C C   . SER A 1 332 ? 33.639  105.450 48.541  1.00 51.88 ? 332 SER D C   1 
ATOM   2297  O O   . SER A 1 332 ? 33.987  106.269 47.699  1.00 51.86 ? 332 SER D O   1 
ATOM   2298  C CB  . SER A 1 332 ? 31.591  105.625 49.923  1.00 52.10 ? 332 SER D CB  1 
ATOM   2299  O OG  . SER A 1 332 ? 31.116  104.609 50.794  1.00 51.92 ? 332 SER D OG  1 
ATOM   2300  N N   . ALA A 1 333 ? 34.477  104.848 49.381  1.00 51.73 ? 333 ALA D N   1 
ATOM   2301  C CA  . ALA A 1 333 ? 35.858  105.263 49.571  1.00 51.54 ? 333 ALA D CA  1 
ATOM   2302  C C   . ALA A 1 333 ? 36.844  104.580 48.634  1.00 51.44 ? 333 ALA D C   1 
ATOM   2303  O O   . ALA A 1 333 ? 37.711  105.244 48.071  1.00 51.33 ? 333 ALA D O   1 
ATOM   2304  C CB  . ALA A 1 333 ? 36.255  105.017 50.988  1.00 51.52 ? 333 ALA D CB  1 
ATOM   2305  N N   . LEU A 1 334 ? 36.715  103.261 48.484  1.00 51.44 ? 334 LEU D N   1 
ATOM   2306  C CA  . LEU A 1 334 ? 37.629  102.468 47.652  1.00 51.40 ? 334 LEU D CA  1 
ATOM   2307  C C   . LEU A 1 334 ? 37.252  102.477 46.170  1.00 51.49 ? 334 LEU D C   1 
ATOM   2308  O O   . LEU A 1 334 ? 38.091  102.204 45.310  1.00 51.46 ? 334 LEU D O   1 
ATOM   2309  C CB  . LEU A 1 334 ? 37.711  101.023 48.153  1.00 51.24 ? 334 LEU D CB  1 
ATOM   2310  C CG  . LEU A 1 334 ? 38.164  100.773 49.590  1.00 50.97 ? 334 LEU D CG  1 
ATOM   2311  C CD1 . LEU A 1 334 ? 37.941  99.317  49.955  1.00 50.51 ? 334 LEU D CD1 1 
ATOM   2312  C CD2 . LEU A 1 334 ? 39.620  101.163 49.792  1.00 50.92 ? 334 LEU D CD2 1 
ATOM   2313  N N   . GLY A 1 335 ? 35.991  102.784 45.880  1.00 51.63 ? 335 GLY D N   1 
ATOM   2314  C CA  . GLY A 1 335 ? 35.510  102.852 44.504  1.00 51.74 ? 335 GLY D CA  1 
ATOM   2315  C C   . GLY A 1 335 ? 35.003  101.517 44.010  1.00 51.86 ? 335 GLY D C   1 
ATOM   2316  O O   . GLY A 1 335 ? 34.648  100.649 44.805  1.00 51.96 ? 335 GLY D O   1 
ATOM   2317  N N   . PHE A 1 336 ? 34.972  101.354 42.692  1.00 52.07 ? 336 PHE D N   1 
ATOM   2318  C CA  . PHE A 1 336 ? 34.446  100.143 42.070  1.00 52.25 ? 336 PHE D CA  1 
ATOM   2319  C C   . PHE A 1 336 ? 35.497  99.044  41.971  1.00 52.33 ? 336 PHE D C   1 
ATOM   2320  O O   . PHE A 1 336 ? 36.534  99.224  41.332  1.00 52.36 ? 336 PHE D O   1 
ATOM   2321  C CB  . PHE A 1 336 ? 33.893  100.453 40.676  1.00 52.25 ? 336 PHE D CB  1 
ATOM   2322  C CG  . PHE A 1 336 ? 32.561  101.135 40.687  1.00 52.29 ? 336 PHE D CG  1 
ATOM   2323  C CD1 . PHE A 1 336 ? 31.390  100.401 40.865  1.00 52.56 ? 336 PHE D CD1 1 
ATOM   2324  C CD2 . PHE A 1 336 ? 32.469  102.511 40.503  1.00 52.43 ? 336 PHE D CD2 1 
ATOM   2325  C CE1 . PHE A 1 336 ? 30.140  101.032 40.871  1.00 52.50 ? 336 PHE D CE1 1 
ATOM   2326  C CE2 . PHE A 1 336 ? 31.223  103.150 40.504  1.00 52.61 ? 336 PHE D CE2 1 
ATOM   2327  C CZ  . PHE A 1 336 ? 30.059  102.408 40.689  1.00 52.14 ? 336 PHE D CZ  1 
ATOM   2328  N N   . GLY A 1 337 ? 35.213  97.904  42.596  1.00 52.52 ? 337 GLY D N   1 
ATOM   2329  C CA  . GLY A 1 337 ? 36.090  96.737  42.522  1.00 52.86 ? 337 GLY D CA  1 
ATOM   2330  C C   . GLY A 1 337 ? 35.340  95.418  42.556  1.00 53.04 ? 337 GLY D C   1 
ATOM   2331  O O   . GLY A 1 337 ? 34.178  95.344  42.150  1.00 53.20 ? 337 GLY D O   1 
ATOM   2332  N N   . PHE A 1 338 ? 36.011  94.375  43.041  1.00 53.11 ? 338 PHE D N   1 
ATOM   2333  C CA  . PHE A 1 338 ? 35.459  93.023  43.044  1.00 53.18 ? 338 PHE D CA  1 
ATOM   2334  C C   . PHE A 1 338 ? 35.773  92.283  44.331  1.00 53.54 ? 338 PHE D C   1 
ATOM   2335  O O   . PHE A 1 338 ? 36.926  92.238  44.770  1.00 53.55 ? 338 PHE D O   1 
ATOM   2336  C CB  . PHE A 1 338 ? 36.008  92.212  41.870  1.00 52.83 ? 338 PHE D CB  1 
ATOM   2337  C CG  . PHE A 1 338 ? 35.517  92.667  40.536  1.00 52.55 ? 338 PHE D CG  1 
ATOM   2338  C CD1 . PHE A 1 338 ? 34.330  92.177  40.018  1.00 52.76 ? 338 PHE D CD1 1 
ATOM   2339  C CD2 . PHE A 1 338 ? 36.248  93.578  39.787  1.00 52.40 ? 338 PHE D CD2 1 
ATOM   2340  C CE1 . PHE A 1 338 ? 33.874  92.594  38.775  1.00 52.98 ? 338 PHE D CE1 1 
ATOM   2341  C CE2 . PHE A 1 338 ? 35.802  93.998  38.546  1.00 52.16 ? 338 PHE D CE2 1 
ATOM   2342  C CZ  . PHE A 1 338 ? 34.613  93.509  38.040  1.00 52.34 ? 338 PHE D CZ  1 
ATOM   2343  N N   . ARG A 1 339 ? 34.738  91.698  44.927  1.00 53.88 ? 339 ARG D N   1 
ATOM   2344  C CA  . ARG A 1 339 ? 34.909  90.789  46.046  1.00 54.31 ? 339 ARG D CA  1 
ATOM   2345  C C   . ARG A 1 339 ? 35.246  89.409  45.476  1.00 54.40 ? 339 ARG D C   1 
ATOM   2346  O O   . ARG A 1 339 ? 34.464  88.842  44.708  1.00 54.37 ? 339 ARG D O   1 
ATOM   2347  C CB  . ARG A 1 339 ? 33.632  90.741  46.886  1.00 54.46 ? 339 ARG D CB  1 
ATOM   2348  C CG  . ARG A 1 339 ? 33.824  90.253  48.316  1.00 54.99 ? 339 ARG D CG  1 
ATOM   2349  C CD  . ARG A 1 339 ? 32.482  89.961  48.972  1.00 56.53 ? 339 ARG D CD  1 
ATOM   2350  N NE  . ARG A 1 339 ? 31.885  88.716  48.474  1.00 57.73 ? 339 ARG D NE  1 
ATOM   2351  C CZ  . ARG A 1 339 ? 31.958  87.541  49.097  1.00 58.37 ? 339 ARG D CZ  1 
ATOM   2352  N NH1 . ARG A 1 339 ? 32.595  87.429  50.260  1.00 58.73 ? 339 ARG D NH1 1 
ATOM   2353  N NH2 . ARG A 1 339 ? 31.384  86.472  48.560  1.00 58.54 ? 339 ARG D NH2 1 
ATOM   2354  N N   . CYS A 1 340 ? 36.412  88.881  45.849  1.00 54.49 ? 340 CYS D N   1 
ATOM   2355  C CA  . CYS A 1 340 ? 36.931  87.646  45.258  1.00 54.68 ? 340 CYS D CA  1 
ATOM   2356  C C   . CYS A 1 340 ? 37.072  86.482  46.228  1.00 54.46 ? 340 CYS D C   1 
ATOM   2357  O O   . CYS A 1 340 ? 37.226  86.682  47.426  1.00 54.62 ? 340 CYS D O   1 
ATOM   2358  C CB  . CYS A 1 340 ? 38.264  87.920  44.579  1.00 54.68 ? 340 CYS D CB  1 
ATOM   2359  S SG  . CYS A 1 340 ? 38.103  89.067  43.206  1.00 56.58 ? 340 CYS D SG  1 
ATOM   2360  N N   . GLY A 1 341 ? 37.018  85.266  45.692  1.00 54.34 ? 341 GLY D N   1 
ATOM   2361  C CA  . GLY A 1 341 ? 37.080  84.050  46.496  1.00 54.21 ? 341 GLY D CA  1 
ATOM   2362  C C   . GLY A 1 341 ? 38.100  83.060  45.972  1.00 54.15 ? 341 GLY D C   1 
ATOM   2363  O O   . GLY A 1 341 ? 38.145  82.774  44.773  1.00 54.22 ? 341 GLY D O   1 
ATOM   2364  N N   . PHE A 1 342 ? 38.910  82.523  46.880  1.00 54.05 ? 342 PHE D N   1 
ATOM   2365  C CA  . PHE A 1 342 ? 40.051  81.692  46.512  1.00 54.02 ? 342 PHE D CA  1 
ATOM   2366  C C   . PHE A 1 342 ? 40.090  80.382  47.290  1.00 54.16 ? 342 PHE D C   1 
ATOM   2367  O O   . PHE A 1 342 ? 39.405  80.226  48.296  1.00 54.16 ? 342 PHE D O   1 
ATOM   2368  C CB  . PHE A 1 342 ? 41.358  82.461  46.740  1.00 53.87 ? 342 PHE D CB  1 
ATOM   2369  C CG  . PHE A 1 342 ? 41.395  83.812  46.080  1.00 53.69 ? 342 PHE D CG  1 
ATOM   2370  C CD1 . PHE A 1 342 ? 41.798  83.945  44.758  1.00 53.35 ? 342 PHE D CD1 1 
ATOM   2371  C CD2 . PHE A 1 342 ? 41.025  84.955  46.784  1.00 53.81 ? 342 PHE D CD2 1 
ATOM   2372  C CE1 . PHE A 1 342 ? 41.836  85.195  44.149  1.00 53.57 ? 342 PHE D CE1 1 
ATOM   2373  C CE2 . PHE A 1 342 ? 41.057  86.209  46.181  1.00 53.48 ? 342 PHE D CE2 1 
ATOM   2374  C CZ  . PHE A 1 342 ? 41.466  86.328  44.863  1.00 53.45 ? 342 PHE D CZ  1 
ATOM   2375  N N   . LEU A 1 343 ? 40.903  79.445  46.812  1.00 54.44 ? 343 LEU D N   1 
ATOM   2376  C CA  . LEU A 1 343 ? 41.145  78.184  47.507  1.00 54.70 ? 343 LEU D CA  1 
ATOM   2377  C C   . LEU A 1 343 ? 41.884  78.425  48.825  1.00 55.00 ? 343 LEU D C   1 
ATOM   2378  O O   . LEU A 1 343 ? 41.620  77.758  49.823  1.00 55.02 ? 343 LEU D O   1 
ATOM   2379  C CB  . LEU A 1 343 ? 41.953  77.232  46.619  1.00 54.61 ? 343 LEU D CB  1 
ATOM   2380  C CG  . LEU A 1 343 ? 41.293  76.757  45.323  1.00 54.45 ? 343 LEU D CG  1 
ATOM   2381  C CD1 . LEU A 1 343 ? 42.338  76.448  44.263  1.00 53.99 ? 343 LEU D CD1 1 
ATOM   2382  C CD2 . LEU A 1 343 ? 40.394  75.556  45.576  1.00 54.21 ? 343 LEU D CD2 1 
ATOM   2383  N N   . GLY A 1 344 ? 42.807  79.383  48.816  1.00 55.27 ? 344 GLY D N   1 
ATOM   2384  C CA  . GLY A 1 344 ? 43.565  79.752  50.003  1.00 55.65 ? 344 GLY D CA  1 
ATOM   2385  C C   . GLY A 1 344 ? 44.542  80.867  49.694  1.00 55.98 ? 344 GLY D C   1 
ATOM   2386  O O   . GLY A 1 344 ? 44.375  81.593  48.710  1.00 55.98 ? 344 GLY D O   1 
ATOM   2387  N N   . LEU A 1 345 ? 45.572  80.991  50.530  1.00 56.22 ? 345 LEU D N   1 
ATOM   2388  C CA  . LEU A 1 345 ? 46.539  82.082  50.426  1.00 56.45 ? 345 LEU D CA  1 
ATOM   2389  C C   . LEU A 1 345 ? 47.293  82.144  49.096  1.00 56.60 ? 345 LEU D C   1 
ATOM   2390  O O   . LEU A 1 345 ? 47.251  83.164  48.406  1.00 56.69 ? 345 LEU D O   1 
ATOM   2391  C CB  . LEU A 1 345 ? 47.536  82.039  51.586  1.00 56.47 ? 345 LEU D CB  1 
ATOM   2392  C CG  . LEU A 1 345 ? 47.246  82.868  52.837  1.00 56.78 ? 345 LEU D CG  1 
ATOM   2393  C CD1 . LEU A 1 345 ? 48.327  82.614  53.887  1.00 57.19 ? 345 LEU D CD1 1 
ATOM   2394  C CD2 . LEU A 1 345 ? 47.149  84.358  52.513  1.00 57.00 ? 345 LEU D CD2 1 
ATOM   2395  N N   . LEU A 1 346 ? 47.980  81.060  48.741  1.00 56.69 ? 346 LEU D N   1 
ATOM   2396  C CA  . LEU A 1 346 ? 48.853  81.058  47.562  1.00 56.80 ? 346 LEU D CA  1 
ATOM   2397  C C   . LEU A 1 346 ? 48.102  80.941  46.235  1.00 56.70 ? 346 LEU D C   1 
ATOM   2398  O O   . LEU A 1 346 ? 48.644  81.278  45.180  1.00 56.65 ? 346 LEU D O   1 
ATOM   2399  C CB  . LEU A 1 346 ? 49.993  80.029  47.681  1.00 56.93 ? 346 LEU D CB  1 
ATOM   2400  C CG  . LEU A 1 346 ? 49.782  78.594  48.179  1.00 57.26 ? 346 LEU D CG  1 
ATOM   2401  C CD1 . LEU A 1 346 ? 49.168  78.561  49.585  1.00 57.40 ? 346 LEU D CD1 1 
ATOM   2402  C CD2 . LEU A 1 346 ? 48.967  77.768  47.183  1.00 57.84 ? 346 LEU D CD2 1 
ATOM   2403  N N   . HIS A 1 347 ? 46.862  80.456  46.293  1.00 56.53 ? 347 HIS D N   1 
ATOM   2404  C CA  . HIS A 1 347 ? 45.956  80.570  45.160  1.00 56.34 ? 347 HIS D CA  1 
ATOM   2405  C C   . HIS A 1 347 ? 45.662  82.049  44.932  1.00 56.48 ? 347 HIS D C   1 
ATOM   2406  O O   . HIS A 1 347 ? 45.795  82.549  43.812  1.00 56.72 ? 347 HIS D O   1 
ATOM   2407  C CB  . HIS A 1 347 ? 44.659  79.797  45.402  1.00 56.20 ? 347 HIS D CB  1 
ATOM   2408  C CG  . HIS A 1 347 ? 43.664  79.927  44.290  1.00 55.72 ? 347 HIS D CG  1 
ATOM   2409  N ND1 . HIS A 1 347 ? 43.983  79.676  42.973  1.00 55.43 ? 347 HIS D ND1 1 
ATOM   2410  C CD2 . HIS A 1 347 ? 42.356  80.272  44.299  1.00 55.39 ? 347 HIS D CD2 1 
ATOM   2411  C CE1 . HIS A 1 347 ? 42.916  79.868  42.219  1.00 55.11 ? 347 HIS D CE1 1 
ATOM   2412  N NE2 . HIS A 1 347 ? 41.914  80.230  42.999  1.00 55.22 ? 347 HIS D NE2 1 
ATOM   2413  N N   . MET A 1 348 ? 45.284  82.743  46.005  1.00 56.51 ? 348 MET D N   1 
ATOM   2414  C CA  . MET A 1 348 ? 45.050  84.183  45.967  1.00 56.52 ? 348 MET D CA  1 
ATOM   2415  C C   . MET A 1 348 ? 46.296  84.923  45.497  1.00 56.43 ? 348 MET D C   1 
ATOM   2416  O O   . MET A 1 348 ? 46.220  85.781  44.620  1.00 56.35 ? 348 MET D O   1 
ATOM   2417  C CB  . MET A 1 348 ? 44.616  84.690  47.342  1.00 56.41 ? 348 MET D CB  1 
ATOM   2418  C CG  . MET A 1 348 ? 44.412  86.191  47.417  1.00 56.62 ? 348 MET D CG  1 
ATOM   2419  S SD  . MET A 1 348 ? 44.049  86.773  49.082  1.00 56.88 ? 348 MET D SD  1 
ATOM   2420  C CE  . MET A 1 348 ? 45.672  86.645  49.847  1.00 56.75 ? 348 MET D CE  1 
ATOM   2421  N N   . GLU A 1 349 ? 47.438  84.560  46.074  1.00 56.48 ? 349 GLU D N   1 
ATOM   2422  C CA  . GLU A 1 349 ? 48.715  85.211  45.783  1.00 56.50 ? 349 GLU D CA  1 
ATOM   2423  C C   . GLU A 1 349 ? 49.265  84.918  44.386  1.00 56.27 ? 349 GLU D C   1 
ATOM   2424  O O   . GLU A 1 349 ? 50.067  85.693  43.868  1.00 56.17 ? 349 GLU D O   1 
ATOM   2425  C CB  . GLU A 1 349 ? 49.748  84.870  46.860  1.00 56.60 ? 349 GLU D CB  1 
ATOM   2426  C CG  . GLU A 1 349 ? 49.538  85.635  48.169  1.00 57.20 ? 349 GLU D CG  1 
ATOM   2427  C CD  . GLU A 1 349 ? 50.189  84.960  49.371  1.00 58.08 ? 349 GLU D CD  1 
ATOM   2428  O OE1 . GLU A 1 349 ? 51.280  84.363  49.218  1.00 58.87 ? 349 GLU D OE1 1 
ATOM   2429  O OE2 . GLU A 1 349 ? 49.607  85.033  50.476  1.00 57.83 ? 349 GLU D OE2 1 
ATOM   2430  N N   . ILE A 1 350 ? 48.847  83.803  43.787  1.00 56.12 ? 350 ILE D N   1 
ATOM   2431  C CA  . ILE A 1 350 ? 49.198  83.510  42.399  1.00 56.03 ? 350 ILE D CA  1 
ATOM   2432  C C   . ILE A 1 350 ? 48.380  84.419  41.498  1.00 55.94 ? 350 ILE D C   1 
ATOM   2433  O O   . ILE A 1 350 ? 48.906  85.009  40.557  1.00 56.02 ? 350 ILE D O   1 
ATOM   2434  C CB  . ILE A 1 350 ? 49.002  82.012  42.031  1.00 56.08 ? 350 ILE D CB  1 
ATOM   2435  C CG1 . ILE A 1 350 ? 50.270  81.218  42.375  1.00 56.15 ? 350 ILE D CG1 1 
ATOM   2436  C CG2 . ILE A 1 350 ? 48.667  81.841  40.543  1.00 55.88 ? 350 ILE D CG2 1 
ATOM   2437  C CD1 . ILE A 1 350 ? 50.074  79.706  42.445  1.00 56.05 ? 350 ILE D CD1 1 
ATOM   2438  N N   . ILE A 1 351 ? 47.097  84.548  41.814  1.00 55.87 ? 351 ILE D N   1 
ATOM   2439  C CA  . ILE A 1 351 ? 46.207  85.412  41.057  1.00 55.83 ? 351 ILE D CA  1 
ATOM   2440  C C   . ILE A 1 351 ? 46.648  86.872  41.144  1.00 55.91 ? 351 ILE D C   1 
ATOM   2441  O O   . ILE A 1 351 ? 46.762  87.539  40.119  1.00 56.13 ? 351 ILE D O   1 
ATOM   2442  C CB  . ILE A 1 351 ? 44.741  85.185  41.466  1.00 55.79 ? 351 ILE D CB  1 
ATOM   2443  C CG1 . ILE A 1 351 ? 44.193  84.002  40.669  1.00 55.92 ? 351 ILE D CG1 1 
ATOM   2444  C CG2 . ILE A 1 351 ? 43.887  86.429  41.227  1.00 55.75 ? 351 ILE D CG2 1 
ATOM   2445  C CD1 . ILE A 1 351 ? 43.056  83.286  41.329  1.00 56.86 ? 351 ILE D CD1 1 
ATOM   2446  N N   . GLN A 1 352 ? 46.928  87.346  42.357  1.00 55.95 ? 352 GLN D N   1 
ATOM   2447  C CA  . GLN A 1 352 ? 47.481  88.685  42.578  1.00 55.88 ? 352 GLN D CA  1 
ATOM   2448  C C   . GLN A 1 352 ? 48.724  88.969  41.737  1.00 56.03 ? 352 GLN D C   1 
ATOM   2449  O O   . GLN A 1 352 ? 48.808  90.007  41.076  1.00 56.10 ? 352 GLN D O   1 
ATOM   2450  C CB  . GLN A 1 352 ? 47.821  88.883  44.050  1.00 55.75 ? 352 GLN D CB  1 
ATOM   2451  C CG  . GLN A 1 352 ? 46.667  89.380  44.887  1.00 55.55 ? 352 GLN D CG  1 
ATOM   2452  C CD  . GLN A 1 352 ? 47.092  89.762  46.290  1.00 55.43 ? 352 GLN D CD  1 
ATOM   2453  O OE1 . GLN A 1 352 ? 48.028  89.187  46.849  1.00 55.52 ? 352 GLN D OE1 1 
ATOM   2454  N NE2 . GLN A 1 352 ? 46.403  90.738  46.868  1.00 55.22 ? 352 GLN D NE2 1 
ATOM   2455  N N   . GLU A 1 353 ? 49.679  88.043  41.767  1.00 56.16 ? 353 GLU D N   1 
ATOM   2456  C CA  . GLU A 1 353 ? 50.936  88.189  41.037  1.00 56.36 ? 353 GLU D CA  1 
ATOM   2457  C C   . GLU A 1 353 ? 50.700  88.211  39.529  1.00 56.37 ? 353 GLU D C   1 
ATOM   2458  O O   . GLU A 1 353 ? 51.394  88.914  38.792  1.00 56.31 ? 353 GLU D O   1 
ATOM   2459  C CB  . GLU A 1 353 ? 51.893  87.062  41.420  1.00 56.37 ? 353 GLU D CB  1 
ATOM   2460  C CG  . GLU A 1 353 ? 53.362  87.384  41.217  1.00 57.10 ? 353 GLU D CG  1 
ATOM   2461  C CD  . GLU A 1 353 ? 53.969  86.678  40.016  1.00 58.08 ? 353 GLU D CD  1 
ATOM   2462  O OE1 . GLU A 1 353 ? 53.302  86.566  38.962  1.00 58.59 ? 353 GLU D OE1 1 
ATOM   2463  O OE2 . GLU A 1 353 ? 55.132  86.235  40.129  1.00 58.58 ? 353 GLU D OE2 1 
ATOM   2464  N N   . ARG A 1 354 ? 49.705  87.446  39.090  1.00 56.44 ? 354 ARG D N   1 
ATOM   2465  C CA  . ARG A 1 354 ? 49.320  87.369  37.687  1.00 56.67 ? 354 ARG D CA  1 
ATOM   2466  C C   . ARG A 1 354 ? 48.608  88.651  37.241  1.00 56.61 ? 354 ARG D C   1 
ATOM   2467  O O   . ARG A 1 354 ? 48.831  89.150  36.135  1.00 56.37 ? 354 ARG D O   1 
ATOM   2468  C CB  . ARG A 1 354 ? 48.428  86.144  37.472  1.00 56.75 ? 354 ARG D CB  1 
ATOM   2469  C CG  . ARG A 1 354 ? 48.392  85.650  36.053  1.00 57.69 ? 354 ARG D CG  1 
ATOM   2470  C CD  . ARG A 1 354 ? 48.296  84.139  35.986  1.00 59.29 ? 354 ARG D CD  1 
ATOM   2471  N NE  . ARG A 1 354 ? 48.480  83.688  34.607  1.00 61.04 ? 354 ARG D NE  1 
ATOM   2472  C CZ  . ARG A 1 354 ? 47.542  83.117  33.853  1.00 61.81 ? 354 ARG D CZ  1 
ATOM   2473  N NH1 . ARG A 1 354 ? 46.327  82.878  34.338  1.00 61.86 ? 354 ARG D NH1 1 
ATOM   2474  N NH2 . ARG A 1 354 ? 47.834  82.763  32.606  1.00 62.17 ? 354 ARG D NH2 1 
ATOM   2475  N N   . LEU A 1 355 ? 47.756  89.169  38.124  1.00 56.69 ? 355 LEU D N   1 
ATOM   2476  C CA  . LEU A 1 355 ? 47.060  90.442  37.943  1.00 56.72 ? 355 LEU D CA  1 
ATOM   2477  C C   . LEU A 1 355 ? 48.029  91.607  37.888  1.00 56.90 ? 355 LEU D C   1 
ATOM   2478  O O   . LEU A 1 355 ? 47.778  92.604  37.217  1.00 56.83 ? 355 LEU D O   1 
ATOM   2479  C CB  . LEU A 1 355 ? 46.100  90.666  39.113  1.00 56.64 ? 355 LEU D CB  1 
ATOM   2480  C CG  . LEU A 1 355 ? 44.588  90.460  38.990  1.00 56.19 ? 355 LEU D CG  1 
ATOM   2481  C CD1 . LEU A 1 355 ? 44.200  89.524  37.871  1.00 55.37 ? 355 LEU D CD1 1 
ATOM   2482  C CD2 . LEU A 1 355 ? 44.040  89.980  40.325  1.00 55.79 ? 355 LEU D CD2 1 
ATOM   2483  N N   . GLU A 1 356 ? 49.132  91.461  38.613  1.00 57.30 ? 356 GLU D N   1 
ATOM   2484  C CA  . GLU A 1 356 ? 50.130  92.505  38.780  1.00 57.72 ? 356 GLU D CA  1 
ATOM   2485  C C   . GLU A 1 356 ? 51.123  92.572  37.613  1.00 57.90 ? 356 GLU D C   1 
ATOM   2486  O O   . GLU A 1 356 ? 51.545  93.662  37.219  1.00 58.09 ? 356 GLU D O   1 
ATOM   2487  C CB  . GLU A 1 356 ? 50.867  92.279  40.103  1.00 57.74 ? 356 GLU D CB  1 
ATOM   2488  C CG  . GLU A 1 356 ? 51.959  93.278  40.417  1.00 58.35 ? 356 GLU D CG  1 
ATOM   2489  C CD  . GLU A 1 356 ? 53.009  92.697  41.337  1.00 59.21 ? 356 GLU D CD  1 
ATOM   2490  O OE1 . GLU A 1 356 ? 52.656  92.291  42.467  1.00 59.29 ? 356 GLU D OE1 1 
ATOM   2491  O OE2 . GLU A 1 356 ? 54.189  92.642  40.926  1.00 59.67 ? 356 GLU D OE2 1 
ATOM   2492  N N   . ARG A 1 357 ? 51.497  91.416  37.063  1.00 58.00 ? 357 ARG D N   1 
ATOM   2493  C CA  . ARG A 1 357 ? 52.524  91.371  36.012  1.00 58.22 ? 357 ARG D CA  1 
ATOM   2494  C C   . ARG A 1 357 ? 51.989  91.158  34.592  1.00 57.85 ? 357 ARG D C   1 
ATOM   2495  O O   . ARG A 1 357 ? 52.365  91.889  33.674  1.00 57.77 ? 357 ARG D O   1 
ATOM   2496  C CB  . ARG A 1 357 ? 53.615  90.351  36.348  1.00 58.22 ? 357 ARG D CB  1 
ATOM   2497  C CG  . ARG A 1 357 ? 54.545  90.798  37.483  1.00 58.99 ? 357 ARG D CG  1 
ATOM   2498  C CD  . ARG A 1 357 ? 55.765  89.888  37.623  1.00 59.15 ? 357 ARG D CD  1 
ATOM   2499  N NE  . ARG A 1 357 ? 55.384  88.477  37.706  1.00 61.48 ? 357 ARG D NE  1 
ATOM   2500  C CZ  . ARG A 1 357 ? 55.672  87.554  36.789  1.00 62.11 ? 357 ARG D CZ  1 
ATOM   2501  N NH1 . ARG A 1 357 ? 56.375  87.871  35.707  1.00 62.22 ? 357 ARG D NH1 1 
ATOM   2502  N NH2 . ARG A 1 357 ? 55.264  86.301  36.963  1.00 62.53 ? 357 ARG D NH2 1 
ATOM   2503  N N   . GLU A 1 358 ? 51.129  90.154  34.417  1.00 57.59 ? 358 GLU D N   1 
ATOM   2504  C CA  . GLU A 1 358 ? 50.514  89.870  33.115  1.00 57.29 ? 358 GLU D CA  1 
ATOM   2505  C C   . GLU A 1 358 ? 49.553  90.964  32.675  1.00 56.79 ? 358 GLU D C   1 
ATOM   2506  O O   . GLU A 1 358 ? 49.490  91.297  31.492  1.00 56.94 ? 358 GLU D O   1 
ATOM   2507  C CB  . GLU A 1 358 ? 49.769  88.537  33.139  1.00 57.29 ? 358 GLU D CB  1 
ATOM   2508  C CG  . GLU A 1 358 ? 50.560  87.358  32.625  1.00 57.69 ? 358 GLU D CG  1 
ATOM   2509  C CD  . GLU A 1 358 ? 49.808  86.048  32.777  1.00 57.85 ? 358 GLU D CD  1 
ATOM   2510  O OE1 . GLU A 1 358 ? 48.636  85.962  32.334  1.00 58.61 ? 358 GLU D OE1 1 
ATOM   2511  O OE2 . GLU A 1 358 ? 50.396  85.100  33.339  1.00 58.35 ? 358 GLU D OE2 1 
ATOM   2512  N N   . TYR A 1 359 ? 48.808  91.514  33.629  1.00 56.16 ? 359 TYR D N   1 
ATOM   2513  C CA  . TYR A 1 359 ? 47.775  92.497  33.331  1.00 55.67 ? 359 TYR D CA  1 
ATOM   2514  C C   . TYR A 1 359 ? 48.153  93.918  33.731  1.00 55.41 ? 359 TYR D C   1 
ATOM   2515  O O   . TYR A 1 359 ? 47.414  94.863  33.440  1.00 55.45 ? 359 TYR D O   1 
ATOM   2516  C CB  . TYR A 1 359 ? 46.449  92.071  33.960  1.00 55.59 ? 359 TYR D CB  1 
ATOM   2517  C CG  . TYR A 1 359 ? 46.013  90.717  33.471  1.00 55.77 ? 359 TYR D CG  1 
ATOM   2518  C CD1 . TYR A 1 359 ? 45.550  90.543  32.167  1.00 55.71 ? 359 TYR D CD1 1 
ATOM   2519  C CD2 . TYR A 1 359 ? 46.094  89.598  34.295  1.00 56.09 ? 359 TYR D CD2 1 
ATOM   2520  C CE1 . TYR A 1 359 ? 45.163  89.291  31.702  1.00 55.57 ? 359 TYR D CE1 1 
ATOM   2521  C CE2 . TYR A 1 359 ? 45.708  88.341  33.836  1.00 55.77 ? 359 TYR D CE2 1 
ATOM   2522  C CZ  . TYR A 1 359 ? 45.244  88.199  32.540  1.00 55.34 ? 359 TYR D CZ  1 
ATOM   2523  O OH  . TYR A 1 359 ? 44.860  86.967  32.080  1.00 55.32 ? 359 TYR D OH  1 
ATOM   2524  N N   . ASP A 1 360 ? 49.308  94.056  34.383  1.00 55.08 ? 360 ASP D N   1 
ATOM   2525  C CA  . ASP A 1 360 ? 49.870  95.355  34.757  1.00 54.74 ? 360 ASP D CA  1 
ATOM   2526  C C   . ASP A 1 360 ? 48.872  96.188  35.578  1.00 54.32 ? 360 ASP D C   1 
ATOM   2527  O O   . ASP A 1 360 ? 48.623  97.356  35.280  1.00 54.24 ? 360 ASP D O   1 
ATOM   2528  C CB  . ASP A 1 360 ? 50.355  96.100  33.497  1.00 54.87 ? 360 ASP D CB  1 
ATOM   2529  C CG  . ASP A 1 360 ? 51.220  97.315  33.812  1.00 55.38 ? 360 ASP D CG  1 
ATOM   2530  O OD1 . ASP A 1 360 ? 51.991  97.277  34.800  1.00 56.08 ? 360 ASP D OD1 1 
ATOM   2531  O OD2 . ASP A 1 360 ? 51.131  98.310  33.053  1.00 55.46 ? 360 ASP D OD2 1 
ATOM   2532  N N   . LEU A 1 361 ? 48.306  95.570  36.614  1.00 53.89 ? 361 LEU D N   1 
ATOM   2533  C CA  . LEU A 1 361 ? 47.297  96.220  37.452  1.00 53.61 ? 361 LEU D CA  1 
ATOM   2534  C C   . LEU A 1 361 ? 47.770  96.511  38.875  1.00 53.54 ? 361 LEU D C   1 
ATOM   2535  O O   . LEU A 1 361 ? 48.128  95.598  39.620  1.00 53.56 ? 361 LEU D O   1 
ATOM   2536  C CB  . LEU A 1 361 ? 46.018  95.383  37.503  1.00 53.50 ? 361 LEU D CB  1 
ATOM   2537  C CG  . LEU A 1 361 ? 45.111  95.374  36.277  1.00 53.13 ? 361 LEU D CG  1 
ATOM   2538  C CD1 . LEU A 1 361 ? 44.093  94.263  36.409  1.00 52.69 ? 361 LEU D CD1 1 
ATOM   2539  C CD2 . LEU A 1 361 ? 44.425  96.713  36.107  1.00 52.79 ? 361 LEU D CD2 1 
ATOM   2540  N N   . ASP A 1 362 ? 47.764  97.790  39.241  1.00 53.48 ? 362 ASP D N   1 
ATOM   2541  C CA  . ASP A 1 362 ? 48.040  98.200  40.612  1.00 53.39 ? 362 ASP D CA  1 
ATOM   2542  C C   . ASP A 1 362 ? 46.728  98.161  41.378  1.00 53.31 ? 362 ASP D C   1 
ATOM   2543  O O   . ASP A 1 362 ? 45.778  98.870  41.027  1.00 53.44 ? 362 ASP D O   1 
ATOM   2544  C CB  . ASP A 1 362 ? 48.652  99.604  40.654  1.00 53.41 ? 362 ASP D CB  1 
ATOM   2545  C CG  . ASP A 1 362 ? 50.006  99.680  39.965  1.00 53.71 ? 362 ASP D CG  1 
ATOM   2546  O OD1 . ASP A 1 362 ? 50.694  98.644  39.837  1.00 53.99 ? 362 ASP D OD1 1 
ATOM   2547  O OD2 . ASP A 1 362 ? 50.389  100.792 39.552  1.00 54.50 ? 362 ASP D OD2 1 
ATOM   2548  N N   . LEU A 1 363 ? 46.672  97.325  42.414  1.00 53.03 ? 363 LEU D N   1 
ATOM   2549  C CA  . LEU A 1 363 ? 45.415  97.075  43.117  1.00 52.64 ? 363 LEU D CA  1 
ATOM   2550  C C   . LEU A 1 363 ? 45.527  97.177  44.638  1.00 52.63 ? 363 LEU D C   1 
ATOM   2551  O O   . LEU A 1 363 ? 46.503  96.716  45.243  1.00 52.62 ? 363 LEU D O   1 
ATOM   2552  C CB  . LEU A 1 363 ? 44.833  95.714  42.710  1.00 52.43 ? 363 LEU D CB  1 
ATOM   2553  C CG  . LEU A 1 363 ? 44.571  95.453  41.218  1.00 52.42 ? 363 LEU D CG  1 
ATOM   2554  C CD1 . LEU A 1 363 ? 44.388  93.972  40.933  1.00 52.35 ? 363 LEU D CD1 1 
ATOM   2555  C CD2 . LEU A 1 363 ? 43.372  96.236  40.706  1.00 52.34 ? 363 LEU D CD2 1 
ATOM   2556  N N   . ILE A 1 364 ? 44.520  97.811  45.236  1.00 52.50 ? 364 ILE D N   1 
ATOM   2557  C CA  . ILE A 1 364 ? 44.334  97.833  46.682  1.00 52.44 ? 364 ILE D CA  1 
ATOM   2558  C C   . ILE A 1 364 ? 43.689  96.501  47.066  1.00 52.24 ? 364 ILE D C   1 
ATOM   2559  O O   . ILE A 1 364 ? 42.724  96.068  46.428  1.00 52.09 ? 364 ILE D O   1 
ATOM   2560  C CB  . ILE A 1 364 ? 43.399  99.005  47.120  1.00 52.66 ? 364 ILE D CB  1 
ATOM   2561  C CG1 . ILE A 1 364 ? 43.885  100.362 46.574  1.00 52.81 ? 364 ILE D CG1 1 
ATOM   2562  C CG2 . ILE A 1 364 ? 43.191  99.025  48.645  1.00 52.60 ? 364 ILE D CG2 1 
ATOM   2563  C CD1 . ILE A 1 364 ? 45.256  100.807 47.055  1.00 53.41 ? 364 ILE D CD1 1 
ATOM   2564  N N   . THR A 1 365 ? 44.221  95.853  48.097  1.00 52.13 ? 365 THR D N   1 
ATOM   2565  C CA  . THR A 1 365 ? 43.663  94.575  48.548  1.00 52.14 ? 365 THR D CA  1 
ATOM   2566  C C   . THR A 1 365 ? 43.386  94.534  50.052  1.00 51.89 ? 365 THR D C   1 
ATOM   2567  O O   . THR A 1 365 ? 44.241  94.888  50.862  1.00 52.01 ? 365 THR D O   1 
ATOM   2568  C CB  . THR A 1 365 ? 44.519  93.360  48.099  1.00 52.13 ? 365 THR D CB  1 
ATOM   2569  O OG1 . THR A 1 365 ? 43.828  92.151  48.425  1.00 51.71 ? 365 THR D OG1 1 
ATOM   2570  C CG2 . THR A 1 365 ? 45.902  93.358  48.767  1.00 52.78 ? 365 THR D CG2 1 
ATOM   2571  N N   . THR A 1 366 ? 42.178  94.102  50.400  1.00 51.74 ? 366 THR D N   1 
ATOM   2572  C CA  . THR A 1 366 ? 41.712  94.074  51.787  1.00 51.64 ? 366 THR D CA  1 
ATOM   2573  C C   . THR A 1 366 ? 42.278  92.873  52.549  1.00 51.39 ? 366 THR D C   1 
ATOM   2574  O O   . THR A 1 366 ? 42.848  91.960  51.950  1.00 51.46 ? 366 THR D O   1 
ATOM   2575  C CB  . THR A 1 366 ? 40.165  94.027  51.857  1.00 51.73 ? 366 THR D CB  1 
ATOM   2576  O OG1 . THR A 1 366 ? 39.695  92.782  51.324  1.00 51.94 ? 366 THR D OG1 1 
ATOM   2577  C CG2 . THR A 1 366 ? 39.543  95.178  51.066  1.00 52.05 ? 366 THR D CG2 1 
ATOM   2578  N N   . ALA A 1 367 ? 42.118  92.882  53.871  1.00 51.15 ? 367 ALA D N   1 
ATOM   2579  C CA  . ALA A 1 367 ? 42.491  91.741  54.700  1.00 50.83 ? 367 ALA D CA  1 
ATOM   2580  C C   . ALA A 1 367 ? 41.668  90.507  54.317  1.00 50.63 ? 367 ALA D C   1 
ATOM   2581  O O   . ALA A 1 367 ? 40.435  90.551  54.322  1.00 50.76 ? 367 ALA D O   1 
ATOM   2582  C CB  . ALA A 1 367 ? 42.316  92.071  56.173  1.00 50.83 ? 367 ALA D CB  1 
ATOM   2583  N N   . PRO A 1 368 ? 42.351  89.406  53.961  1.00 50.33 ? 368 PRO D N   1 
ATOM   2584  C CA  . PRO A 1 368 ? 41.663  88.176  53.579  1.00 50.26 ? 368 PRO D CA  1 
ATOM   2585  C C   . PRO A 1 368 ? 40.815  87.596  54.717  1.00 50.26 ? 368 PRO D C   1 
ATOM   2586  O O   . PRO A 1 368 ? 41.326  87.351  55.811  1.00 50.36 ? 368 PRO D O   1 
ATOM   2587  C CB  . PRO A 1 368 ? 42.814  87.229  53.219  1.00 50.21 ? 368 PRO D CB  1 
ATOM   2588  C CG  . PRO A 1 368 ? 44.004  87.782  53.917  1.00 50.13 ? 368 PRO D CG  1 
ATOM   2589  C CD  . PRO A 1 368 ? 43.815  89.259  53.894  1.00 50.28 ? 368 PRO D CD  1 
ATOM   2590  N N   . THR A 1 369 ? 39.527  87.392  54.449  1.00 50.21 ? 369 THR D N   1 
ATOM   2591  C CA  . THR A 1 369 ? 38.594  86.834  55.438  1.00 50.14 ? 369 THR D CA  1 
ATOM   2592  C C   . THR A 1 369 ? 38.124  85.414  55.079  1.00 50.07 ? 369 THR D C   1 
ATOM   2593  O O   . THR A 1 369 ? 37.957  85.086  53.903  1.00 50.02 ? 369 THR D O   1 
ATOM   2594  C CB  . THR A 1 369 ? 37.391  87.793  55.707  1.00 50.05 ? 369 THR D CB  1 
ATOM   2595  O OG1 . THR A 1 369 ? 36.426  87.148  56.548  1.00 50.08 ? 369 THR D OG1 1 
ATOM   2596  C CG2 . THR A 1 369 ? 36.727  88.233  54.408  1.00 49.99 ? 369 THR D CG2 1 
ATOM   2597  N N   . VAL A 1 370 ? 37.924  84.585  56.102  1.00 50.07 ? 370 VAL D N   1 
ATOM   2598  C CA  . VAL A 1 370 ? 37.571  83.167  55.920  1.00 50.22 ? 370 VAL D CA  1 
ATOM   2599  C C   . VAL A 1 370 ? 36.069  82.870  56.082  1.00 50.39 ? 370 VAL D C   1 
ATOM   2600  O O   . VAL A 1 370 ? 35.291  83.737  56.482  1.00 50.37 ? 370 VAL D O   1 
ATOM   2601  C CB  . VAL A 1 370 ? 38.387  82.250  56.867  1.00 50.20 ? 370 VAL D CB  1 
ATOM   2602  C CG1 . VAL A 1 370 ? 39.857  82.255  56.483  1.00 50.20 ? 370 VAL D CG1 1 
ATOM   2603  C CG2 . VAL A 1 370 ? 38.207  82.669  58.319  1.00 50.11 ? 370 VAL D CG2 1 
ATOM   2604  N N   . VAL A 1 371 ? 35.676  81.637  55.769  1.00 50.57 ? 371 VAL D N   1 
ATOM   2605  C CA  . VAL A 1 371 ? 34.275  81.227  55.835  1.00 50.87 ? 371 VAL D CA  1 
ATOM   2606  C C   . VAL A 1 371 ? 33.924  80.703  57.227  1.00 51.21 ? 371 VAL D C   1 
ATOM   2607  O O   . VAL A 1 371 ? 34.437  79.669  57.663  1.00 51.19 ? 371 VAL D O   1 
ATOM   2608  C CB  . VAL A 1 371 ? 33.936  80.154  54.765  1.00 50.90 ? 371 VAL D CB  1 
ATOM   2609  C CG1 . VAL A 1 371 ? 32.448  79.808  54.788  1.00 50.81 ? 371 VAL D CG1 1 
ATOM   2610  C CG2 . VAL A 1 371 ? 34.344  80.629  53.383  1.00 50.53 ? 371 VAL D CG2 1 
ATOM   2611  N N   . TYR A 1 372 ? 33.042  81.424  57.913  1.00 51.67 ? 372 TYR D N   1 
ATOM   2612  C CA  . TYR A 1 372 ? 32.622  81.056  59.265  1.00 52.12 ? 372 TYR D CA  1 
ATOM   2613  C C   . TYR A 1 372 ? 31.301  80.292  59.270  1.00 52.43 ? 372 TYR D C   1 
ATOM   2614  O O   . TYR A 1 372 ? 30.440  80.506  58.411  1.00 52.47 ? 372 TYR D O   1 
ATOM   2615  C CB  . TYR A 1 372 ? 32.502  82.298  60.152  1.00 52.07 ? 372 TYR D CB  1 
ATOM   2616  C CG  . TYR A 1 372 ? 33.808  83.008  60.419  1.00 51.98 ? 372 TYR D CG  1 
ATOM   2617  C CD1 . TYR A 1 372 ? 34.539  82.748  61.575  1.00 51.97 ? 372 TYR D CD1 1 
ATOM   2618  C CD2 . TYR A 1 372 ? 34.309  83.949  59.519  1.00 52.21 ? 372 TYR D CD2 1 
ATOM   2619  C CE1 . TYR A 1 372 ? 35.742  83.403  61.827  1.00 52.23 ? 372 TYR D CE1 1 
ATOM   2620  C CE2 . TYR A 1 372 ? 35.509  84.610  59.760  1.00 52.19 ? 372 TYR D CE2 1 
ATOM   2621  C CZ  . TYR A 1 372 ? 36.218  84.332  60.915  1.00 52.21 ? 372 TYR D CZ  1 
ATOM   2622  O OH  . TYR A 1 372 ? 37.402  84.984  61.160  1.00 52.12 ? 372 TYR D OH  1 
ATOM   2623  N N   . GLU A 1 373 ? 31.159  79.397  60.245  1.00 52.78 ? 373 GLU D N   1 
ATOM   2624  C CA  . GLU A 1 373 ? 29.915  78.673  60.472  1.00 53.12 ? 373 GLU D CA  1 
ATOM   2625  C C   . GLU A 1 373 ? 29.189  79.300  61.659  1.00 53.45 ? 373 GLU D C   1 
ATOM   2626  O O   . GLU A 1 373 ? 29.774  79.473  62.729  1.00 53.46 ? 373 GLU D O   1 
ATOM   2627  C CB  . GLU A 1 373 ? 30.206  77.198  60.741  1.00 53.02 ? 373 GLU D CB  1 
ATOM   2628  C CG  . GLU A 1 373 ? 28.968  76.349  60.924  1.00 52.96 ? 373 GLU D CG  1 
ATOM   2629  C CD  . GLU A 1 373 ? 29.283  74.871  61.013  1.00 53.21 ? 373 GLU D CD  1 
ATOM   2630  O OE1 . GLU A 1 373 ? 29.790  74.426  62.067  1.00 53.05 ? 373 GLU D OE1 1 
ATOM   2631  O OE2 . GLU A 1 373 ? 29.009  74.151  60.029  1.00 53.29 ? 373 GLU D OE2 1 
ATOM   2632  N N   . VAL A 1 374 ? 27.920  79.650  61.471  1.00 53.77 ? 374 VAL D N   1 
ATOM   2633  C CA  . VAL A 1 374 ? 27.162  80.328  62.527  1.00 54.12 ? 374 VAL D CA  1 
ATOM   2634  C C   . VAL A 1 374 ? 25.861  79.602  62.873  1.00 54.38 ? 374 VAL D C   1 
ATOM   2635  O O   . VAL A 1 374 ? 25.179  79.068  61.995  1.00 54.46 ? 374 VAL D O   1 
ATOM   2636  C CB  . VAL A 1 374 ? 26.854  81.805  62.160  1.00 54.04 ? 374 VAL D CB  1 
ATOM   2637  C CG1 . VAL A 1 374 ? 26.374  82.576  63.377  1.00 54.05 ? 374 VAL D CG1 1 
ATOM   2638  C CG2 . VAL A 1 374 ? 28.083  82.483  61.585  1.00 54.33 ? 374 VAL D CG2 1 
ATOM   2639  N N   . GLU A 1 375 ? 25.538  79.574  64.164  1.00 54.69 ? 375 GLU D N   1 
ATOM   2640  C CA  . GLU A 1 375 ? 24.231  79.131  64.618  1.00 54.92 ? 375 GLU D CA  1 
ATOM   2641  C C   . GLU A 1 375 ? 23.410  80.343  65.027  1.00 55.11 ? 375 GLU D C   1 
ATOM   2642  O O   . GLU A 1 375 ? 23.765  81.061  65.965  1.00 55.06 ? 375 GLU D O   1 
ATOM   2643  C CB  . GLU A 1 375 ? 24.345  78.123  65.764  1.00 54.87 ? 375 GLU D CB  1 
ATOM   2644  C CG  . GLU A 1 375 ? 23.025  77.435  66.111  1.00 54.98 ? 375 GLU D CG  1 
ATOM   2645  C CD  . GLU A 1 375 ? 23.163  75.928  66.293  1.00 55.19 ? 375 GLU D CD  1 
ATOM   2646  O OE1 . GLU A 1 375 ? 22.500  75.369  67.194  1.00 55.27 ? 375 GLU D OE1 1 
ATOM   2647  O OE2 . GLU A 1 375 ? 23.925  75.297  65.529  1.00 55.20 ? 375 GLU D OE2 1 
ATOM   2648  N N   . THR A 1 376 ? 22.328  80.576  64.288  1.00 55.43 ? 376 THR D N   1 
ATOM   2649  C CA  . THR A 1 376 ? 21.368  81.629  64.598  1.00 55.76 ? 376 THR D CA  1 
ATOM   2650  C C   . THR A 1 376 ? 20.629  81.273  65.888  1.00 55.95 ? 376 THR D C   1 
ATOM   2651  O O   . THR A 1 376 ? 20.499  80.094  66.230  1.00 55.91 ? 376 THR D O   1 
ATOM   2652  C CB  . THR A 1 376 ? 20.381  81.855  63.411  1.00 55.83 ? 376 THR D CB  1 
ATOM   2653  O OG1 . THR A 1 376 ? 21.060  82.551  62.359  1.00 55.90 ? 376 THR D OG1 1 
ATOM   2654  C CG2 . THR A 1 376 ? 19.145  82.668  63.821  1.00 55.75 ? 376 THR D CG2 1 
ATOM   2655  N N   . THR A 1 377 ? 20.181  82.302  66.606  1.00 56.21 ? 377 THR D N   1 
ATOM   2656  C CA  . THR A 1 377 ? 19.375  82.143  67.818  1.00 56.44 ? 377 THR D CA  1 
ATOM   2657  C C   . THR A 1 377 ? 18.318  81.045  67.645  1.00 56.68 ? 377 THR D C   1 
ATOM   2658  O O   . THR A 1 377 ? 18.165  80.180  68.512  1.00 56.72 ? 377 THR D O   1 
ATOM   2659  C CB  . THR A 1 377 ? 18.743  83.495  68.268  1.00 56.38 ? 377 THR D CB  1 
ATOM   2660  O OG1 . THR A 1 377 ? 17.872  83.278  69.384  1.00 56.36 ? 377 THR D OG1 1 
ATOM   2661  C CG2 . THR A 1 377 ? 17.964  84.167  67.125  1.00 56.33 ? 377 THR D CG2 1 
ATOM   2662  N N   . SER A 1 378 ? 17.608  81.077  66.518  1.00 56.97 ? 378 SER D N   1 
ATOM   2663  C CA  . SER A 1 378 ? 16.782  79.958  66.093  1.00 57.17 ? 378 SER D CA  1 
ATOM   2664  C C   . SER A 1 378 ? 17.718  78.946  65.452  1.00 57.35 ? 378 SER D C   1 
ATOM   2665  O O   . SER A 1 378 ? 18.237  79.176  64.354  1.00 57.40 ? 378 SER D O   1 
ATOM   2666  C CB  . SER A 1 378 ? 15.718  80.414  65.098  1.00 57.18 ? 378 SER D CB  1 
ATOM   2667  O OG  . SER A 1 378 ? 15.004  79.302  64.589  1.00 57.26 ? 378 SER D OG  1 
ATOM   2668  N N   . ARG A 1 379 ? 17.938  77.837  66.157  1.00 57.55 ? 379 ARG D N   1 
ATOM   2669  C CA  . ARG A 1 379 ? 18.987  76.870  65.815  1.00 57.79 ? 379 ARG D CA  1 
ATOM   2670  C C   . ARG A 1 379 ? 18.967  76.412  64.357  1.00 57.87 ? 379 ARG D C   1 
ATOM   2671  O O   . ARG A 1 379 ? 18.075  75.670  63.932  1.00 58.07 ? 379 ARG D O   1 
ATOM   2672  C CB  . ARG A 1 379 ? 18.944  75.665  66.752  1.00 57.81 ? 379 ARG D CB  1 
ATOM   2673  C CG  . ARG A 1 379 ? 19.396  75.953  68.169  1.00 58.23 ? 379 ARG D CG  1 
ATOM   2674  C CD  . ARG A 1 379 ? 19.562  74.649  68.917  1.00 59.49 ? 379 ARG D CD  1 
ATOM   2675  N NE  . ARG A 1 379 ? 19.824  74.842  70.340  1.00 60.60 ? 379 ARG D NE  1 
ATOM   2676  C CZ  . ARG A 1 379 ? 21.037  74.888  70.886  1.00 60.99 ? 379 ARG D CZ  1 
ATOM   2677  N NH1 . ARG A 1 379 ? 22.124  74.761  70.129  1.00 60.84 ? 379 ARG D NH1 1 
ATOM   2678  N NH2 . ARG A 1 379 ? 21.160  75.059  72.196  1.00 61.03 ? 379 ARG D NH2 1 
ATOM   2679  N N   . GLU A 1 380 ? 19.958  76.886  63.606  1.00 57.85 ? 380 GLU D N   1 
ATOM   2680  C CA  . GLU A 1 380 ? 20.171  76.519  62.208  1.00 57.84 ? 380 GLU D CA  1 
ATOM   2681  C C   . GLU A 1 380 ? 21.578  76.958  61.817  1.00 57.73 ? 380 GLU D C   1 
ATOM   2682  O O   . GLU A 1 380 ? 22.199  77.758  62.518  1.00 57.77 ? 380 GLU D O   1 
ATOM   2683  C CB  . GLU A 1 380 ? 19.125  77.170  61.293  1.00 57.85 ? 380 GLU D CB  1 
ATOM   2684  C CG  . GLU A 1 380 ? 19.219  78.690  61.189  1.00 57.89 ? 380 GLU D CG  1 
ATOM   2685  C CD  . GLU A 1 380 ? 18.014  79.304  60.501  1.00 58.05 ? 380 GLU D CD  1 
ATOM   2686  O OE1 . GLU A 1 380 ? 16.891  79.176  61.040  1.00 58.12 ? 380 GLU D OE1 1 
ATOM   2687  O OE2 . GLU A 1 380 ? 18.192  79.923  59.427  1.00 58.06 ? 380 GLU D OE2 1 
ATOM   2688  N N   . VAL A 1 381 ? 22.076  76.436  60.701  1.00 57.58 ? 381 VAL D N   1 
ATOM   2689  C CA  . VAL A 1 381 ? 23.441  76.722  60.272  1.00 57.41 ? 381 VAL D CA  1 
ATOM   2690  C C   . VAL A 1 381 ? 23.478  77.516  58.960  1.00 57.29 ? 381 VAL D C   1 
ATOM   2691  O O   . VAL A 1 381 ? 22.929  77.081  57.943  1.00 57.27 ? 381 VAL D O   1 
ATOM   2692  C CB  . VAL A 1 381 ? 24.277  75.419  60.156  1.00 57.36 ? 381 VAL D CB  1 
ATOM   2693  C CG1 . VAL A 1 381 ? 25.653  75.704  59.582  1.00 57.44 ? 381 VAL D CG1 1 
ATOM   2694  C CG2 . VAL A 1 381 ? 24.403  74.744  61.515  1.00 57.29 ? 381 VAL D CG2 1 
ATOM   2695  N N   . ILE A 1 382 ? 24.111  78.688  59.008  1.00 57.12 ? 382 ILE D N   1 
ATOM   2696  C CA  . ILE A 1 382 ? 24.414  79.481  57.807  1.00 57.07 ? 382 ILE D CA  1 
ATOM   2697  C C   . ILE A 1 382 ? 25.903  79.827  57.760  1.00 57.01 ? 382 ILE D C   1 
ATOM   2698  O O   . ILE A 1 382 ? 26.560  79.913  58.804  1.00 57.03 ? 382 ILE D O   1 
ATOM   2699  C CB  . ILE A 1 382 ? 23.542  80.771  57.684  1.00 57.04 ? 382 ILE D CB  1 
ATOM   2700  C CG1 . ILE A 1 382 ? 23.593  81.599  58.977  1.00 56.93 ? 382 ILE D CG1 1 
ATOM   2701  C CG2 . ILE A 1 382 ? 22.104  80.415  57.267  1.00 56.95 ? 382 ILE D CG2 1 
ATOM   2702  C CD1 . ILE A 1 382 ? 22.749  82.859  58.955  1.00 57.02 ? 382 ILE D CD1 1 
ATOM   2703  N N   . TYR A 1 383 ? 26.426  80.019  56.549  1.00 56.92 ? 383 TYR D N   1 
ATOM   2704  C CA  . TYR A 1 383 ? 27.854  80.277  56.340  1.00 56.74 ? 383 TYR D CA  1 
ATOM   2705  C C   . TYR A 1 383 ? 28.108  81.686  55.827  1.00 56.64 ? 383 TYR D C   1 
ATOM   2706  O O   . TYR A 1 383 ? 27.493  82.121  54.852  1.00 56.59 ? 383 TYR D O   1 
ATOM   2707  C CB  . TYR A 1 383 ? 28.458  79.225  55.407  1.00 56.76 ? 383 TYR D CB  1 
ATOM   2708  C CG  . TYR A 1 383 ? 28.341  77.833  55.972  1.00 56.74 ? 383 TYR D CG  1 
ATOM   2709  C CD1 . TYR A 1 383 ? 27.237  77.032  55.679  1.00 56.94 ? 383 TYR D CD1 1 
ATOM   2710  C CD2 . TYR A 1 383 ? 29.314  77.327  56.829  1.00 56.77 ? 383 TYR D CD2 1 
ATOM   2711  C CE1 . TYR A 1 383 ? 27.115  75.756  56.216  1.00 56.98 ? 383 TYR D CE1 1 
ATOM   2712  C CE2 . TYR A 1 383 ? 29.202  76.050  57.369  1.00 56.96 ? 383 TYR D CE2 1 
ATOM   2713  C CZ  . TYR A 1 383 ? 28.100  75.273  57.060  1.00 56.75 ? 383 TYR D CZ  1 
ATOM   2714  O OH  . TYR A 1 383 ? 27.984  74.013  57.595  1.00 56.71 ? 383 TYR D OH  1 
ATOM   2715  N N   . VAL A 1 384 ? 29.021  82.386  56.493  1.00 56.61 ? 384 VAL D N   1 
ATOM   2716  C CA  . VAL A 1 384 ? 29.238  83.812  56.259  1.00 56.70 ? 384 VAL D CA  1 
ATOM   2717  C C   . VAL A 1 384 ? 30.553  84.084  55.524  1.00 56.80 ? 384 VAL D C   1 
ATOM   2718  O O   . VAL A 1 384 ? 31.628  83.733  56.011  1.00 56.63 ? 384 VAL D O   1 
ATOM   2719  C CB  . VAL A 1 384 ? 29.185  84.609  57.590  1.00 56.66 ? 384 VAL D CB  1 
ATOM   2720  C CG1 . VAL A 1 384 ? 29.333  86.105  57.341  1.00 56.75 ? 384 VAL D CG1 1 
ATOM   2721  C CG2 . VAL A 1 384 ? 27.888  84.328  58.328  1.00 56.34 ? 384 VAL D CG2 1 
ATOM   2722  N N   . ASP A 1 385 ? 30.443  84.709  54.351  1.00 57.08 ? 385 ASP D N   1 
ATOM   2723  C CA  . ASP A 1 385 ? 31.601  85.093  53.540  1.00 57.41 ? 385 ASP D CA  1 
ATOM   2724  C C   . ASP A 1 385 ? 32.159  86.428  53.999  1.00 57.56 ? 385 ASP D C   1 
ATOM   2725  O O   . ASP A 1 385 ? 33.278  86.503  54.509  1.00 57.61 ? 385 ASP D O   1 
ATOM   2726  C CB  . ASP A 1 385 ? 31.216  85.217  52.062  1.00 57.48 ? 385 ASP D CB  1 
ATOM   2727  C CG  . ASP A 1 385 ? 30.856  83.895  51.431  1.00 57.66 ? 385 ASP D CG  1 
ATOM   2728  O OD1 . ASP A 1 385 ? 31.425  82.859  51.840  1.00 57.75 ? 385 ASP D OD1 1 
ATOM   2729  O OD2 . ASP A 1 385 ? 30.008  83.904  50.509  1.00 57.60 ? 385 ASP D OD2 1 
ATOM   2730  N N   . SER A 1 386 ? 31.372  87.481  53.792  1.00 57.75 ? 386 SER D N   1 
ATOM   2731  C CA  . SER A 1 386 ? 31.772  88.832  54.150  1.00 58.05 ? 386 SER D CA  1 
ATOM   2732  C C   . SER A 1 386 ? 31.207  89.180  55.517  1.00 58.14 ? 386 SER D C   1 
ATOM   2733  O O   . SER A 1 386 ? 30.020  88.965  55.763  1.00 58.20 ? 386 SER D O   1 
ATOM   2734  C CB  . SER A 1 386 ? 31.295  89.840  53.099  1.00 58.12 ? 386 SER D CB  1 
ATOM   2735  O OG  . SER A 1 386 ? 29.884  89.827  52.983  1.00 58.35 ? 386 SER D OG  1 
ATOM   2736  N N   . PRO A 1 387 ? 32.060  89.716  56.412  1.00 58.25 ? 387 PRO D N   1 
ATOM   2737  C CA  . PRO A 1 387 ? 31.683  90.075  57.784  1.00 58.21 ? 387 PRO D CA  1 
ATOM   2738  C C   . PRO A 1 387 ? 30.405  90.909  57.852  1.00 58.16 ? 387 PRO D C   1 
ATOM   2739  O O   . PRO A 1 387 ? 29.583  90.697  58.739  1.00 58.28 ? 387 PRO D O   1 
ATOM   2740  C CB  . PRO A 1 387 ? 32.879  90.896  58.267  1.00 58.33 ? 387 PRO D CB  1 
ATOM   2741  C CG  . PRO A 1 387 ? 34.027  90.351  57.497  1.00 58.43 ? 387 PRO D CG  1 
ATOM   2742  C CD  . PRO A 1 387 ? 33.480  90.011  56.141  1.00 58.21 ? 387 PRO D CD  1 
ATOM   2743  N N   . SER A 1 388 ? 30.239  91.831  56.908  1.00 58.10 ? 388 SER D N   1 
ATOM   2744  C CA  . SER A 1 388 ? 29.050  92.681  56.830  1.00 57.99 ? 388 SER D CA  1 
ATOM   2745  C C   . SER A 1 388 ? 27.742  91.890  56.710  1.00 57.88 ? 388 SER D C   1 
ATOM   2746  O O   . SER A 1 388 ? 26.652  92.460  56.801  1.00 57.90 ? 388 SER D O   1 
ATOM   2747  C CB  . SER A 1 388 ? 29.186  93.670  55.669  1.00 58.09 ? 388 SER D CB  1 
ATOM   2748  O OG  . SER A 1 388 ? 29.741  93.052  54.517  1.00 58.21 ? 388 SER D OG  1 
ATOM   2749  N N   . LYS A 1 389 ? 27.859  90.581  56.510  1.00 57.75 ? 389 LYS D N   1 
ATOM   2750  C CA  . LYS A 1 389 ? 26.698  89.702  56.420  1.00 57.65 ? 389 LYS D CA  1 
ATOM   2751  C C   . LYS A 1 389 ? 26.479  88.909  57.702  1.00 57.56 ? 389 LYS D C   1 
ATOM   2752  O O   . LYS A 1 389 ? 25.476  88.208  57.828  1.00 57.64 ? 389 LYS D O   1 
ATOM   2753  C CB  . LYS A 1 389 ? 26.836  88.741  55.237  1.00 57.62 ? 389 LYS D CB  1 
ATOM   2754  C CG  . LYS A 1 389 ? 26.666  89.390  53.880  1.00 57.74 ? 389 LYS D CG  1 
ATOM   2755  C CD  . LYS A 1 389 ? 26.828  88.366  52.774  1.00 58.16 ? 389 LYS D CD  1 
ATOM   2756  C CE  . LYS A 1 389 ? 26.509  88.969  51.418  1.00 58.39 ? 389 LYS D CE  1 
ATOM   2757  N NZ  . LYS A 1 389 ? 26.583  87.943  50.340  1.00 58.69 ? 389 LYS D NZ  1 
ATOM   2758  N N   . LEU A 1 390 ? 27.415  89.016  58.644  1.00 57.49 ? 390 LEU D N   1 
ATOM   2759  C CA  . LEU A 1 390 ? 27.320  88.300  59.916  1.00 57.48 ? 390 LEU D CA  1 
ATOM   2760  C C   . LEU A 1 390 ? 26.141  88.832  60.723  1.00 57.67 ? 390 LEU D C   1 
ATOM   2761  O O   . LEU A 1 390 ? 26.057  90.039  60.968  1.00 57.77 ? 390 LEU D O   1 
ATOM   2762  C CB  . LEU A 1 390 ? 28.623  88.416  60.718  1.00 57.39 ? 390 LEU D CB  1 
ATOM   2763  C CG  . LEU A 1 390 ? 28.774  87.626  62.025  1.00 57.37 ? 390 LEU D CG  1 
ATOM   2764  C CD1 . LEU A 1 390 ? 28.930  86.132  61.774  1.00 56.91 ? 390 LEU D CD1 1 
ATOM   2765  C CD2 . LEU A 1 390 ? 29.956  88.139  62.823  1.00 57.40 ? 390 LEU D CD2 1 
ATOM   2766  N N   . PRO A 1 391 ? 25.224  87.931  61.133  1.00 57.77 ? 391 PRO D N   1 
ATOM   2767  C CA  . PRO A 1 391 ? 23.995  88.296  61.836  1.00 57.87 ? 391 PRO D CA  1 
ATOM   2768  C C   . PRO A 1 391 ? 24.242  89.121  63.094  1.00 58.01 ? 391 PRO D C   1 
ATOM   2769  O O   . PRO A 1 391 ? 25.356  89.125  63.624  1.00 58.03 ? 391 PRO D O   1 
ATOM   2770  C CB  . PRO A 1 391 ? 23.387  86.937  62.210  1.00 57.85 ? 391 PRO D CB  1 
ATOM   2771  C CG  . PRO A 1 391 ? 24.501  85.959  62.082  1.00 57.71 ? 391 PRO D CG  1 
ATOM   2772  C CD  . PRO A 1 391 ? 25.315  86.473  60.951  1.00 57.73 ? 391 PRO D CD  1 
ATOM   2773  N N   . ALA A 1 392 ? 23.201  89.816  63.552  1.00 58.18 ? 392 ALA D N   1 
ATOM   2774  C CA  . ALA A 1 392 ? 23.256  90.621  64.772  1.00 58.15 ? 392 ALA D CA  1 
ATOM   2775  C C   . ALA A 1 392 ? 23.702  89.768  65.954  1.00 58.10 ? 392 ALA D C   1 
ATOM   2776  O O   . ALA A 1 392 ? 23.278  88.616  66.091  1.00 58.08 ? 392 ALA D O   1 
ATOM   2777  C CB  . ALA A 1 392 ? 21.898  91.255  65.053  1.00 58.13 ? 392 ALA D CB  1 
ATOM   2778  N N   . VAL A 1 393 ? 24.562  90.345  66.794  1.00 58.01 ? 393 VAL D N   1 
ATOM   2779  C CA  . VAL A 1 393 ? 25.124  89.660  67.965  1.00 57.84 ? 393 VAL D CA  1 
ATOM   2780  C C   . VAL A 1 393 ? 24.031  89.065  68.859  1.00 57.68 ? 393 VAL D C   1 
ATOM   2781  O O   . VAL A 1 393 ? 24.234  88.018  69.479  1.00 57.71 ? 393 VAL D O   1 
ATOM   2782  C CB  . VAL A 1 393 ? 26.042  90.599  68.791  1.00 57.88 ? 393 VAL D CB  1 
ATOM   2783  C CG1 . VAL A 1 393 ? 26.943  89.793  69.725  1.00 57.88 ? 393 VAL D CG1 1 
ATOM   2784  C CG2 . VAL A 1 393 ? 26.889  91.475  67.864  1.00 57.98 ? 393 VAL D CG2 1 
ATOM   2785  N N   . ASN A 1 394 ? 22.878  89.734  68.907  1.00 57.48 ? 394 ASN D N   1 
ATOM   2786  C CA  . ASN A 1 394 ? 21.691  89.228  69.603  1.00 57.27 ? 394 ASN D CA  1 
ATOM   2787  C C   . ASN A 1 394 ? 21.255  87.867  69.071  1.00 57.06 ? 394 ASN D C   1 
ATOM   2788  O O   . ASN A 1 394 ? 20.877  86.984  69.838  1.00 57.12 ? 394 ASN D O   1 
ATOM   2789  C CB  . ASN A 1 394 ? 20.511  90.201  69.459  1.00 57.31 ? 394 ASN D CB  1 
ATOM   2790  C CG  . ASN A 1 394 ? 20.908  91.652  69.654  1.00 57.39 ? 394 ASN D CG  1 
ATOM   2791  O OD1 . ASN A 1 394 ? 21.699  92.205  68.884  1.00 57.24 ? 394 ASN D OD1 1 
ATOM   2792  N ND2 . ASN A 1 394 ? 20.342  92.283  70.677  1.00 57.33 ? 394 ASN D ND2 1 
ATOM   2793  N N   . ASN A 1 395 ? 21.312  87.718  67.749  1.00 56.82 ? 395 ASN D N   1 
ATOM   2794  C CA  . ASN A 1 395 ? 20.784  86.545  67.058  1.00 56.53 ? 395 ASN D CA  1 
ATOM   2795  C C   . ASN A 1 395 ? 21.804  85.436  66.797  1.00 56.31 ? 395 ASN D C   1 
ATOM   2796  O O   . ASN A 1 395 ? 21.526  84.498  66.048  1.00 56.28 ? 395 ASN D O   1 
ATOM   2797  C CB  . ASN A 1 395 ? 20.121  86.974  65.747  1.00 56.56 ? 395 ASN D CB  1 
ATOM   2798  C CG  . ASN A 1 395 ? 18.966  87.927  65.968  1.00 56.77 ? 395 ASN D CG  1 
ATOM   2799  O OD1 . ASN A 1 395 ? 17.942  87.559  66.546  1.00 57.01 ? 395 ASN D OD1 1 
ATOM   2800  N ND2 . ASN A 1 395 ? 19.125  89.164  65.507  1.00 56.84 ? 395 ASN D ND2 1 
ATOM   2801  N N   . ILE A 1 396 ? 22.980  85.544  67.412  1.00 56.02 ? 396 ILE D N   1 
ATOM   2802  C CA  . ILE A 1 396 ? 24.010  84.514  67.284  1.00 55.70 ? 396 ILE D CA  1 
ATOM   2803  C C   . ILE A 1 396 ? 24.005  83.618  68.516  1.00 55.51 ? 396 ILE D C   1 
ATOM   2804  O O   . ILE A 1 396 ? 24.338  84.066  69.613  1.00 55.54 ? 396 ILE D O   1 
ATOM   2805  C CB  . ILE A 1 396 ? 25.430  85.118  67.081  1.00 55.68 ? 396 ILE D CB  1 
ATOM   2806  C CG1 . ILE A 1 396 ? 25.471  86.014  65.840  1.00 55.49 ? 396 ILE D CG1 1 
ATOM   2807  C CG2 . ILE A 1 396 ? 26.481  84.005  66.973  1.00 55.66 ? 396 ILE D CG2 1 
ATOM   2808  C CD1 . ILE A 1 396 ? 26.681  86.925  65.776  1.00 55.58 ? 396 ILE D CD1 1 
ATOM   2809  N N   . TYR A 1 397 ? 23.616  82.359  68.337  1.00 55.31 ? 397 TYR D N   1 
ATOM   2810  C CA  . TYR A 1 397 ? 23.724  81.384  69.415  1.00 55.24 ? 397 TYR D CA  1 
ATOM   2811  C C   . TYR A 1 397 ? 25.182  80.964  69.595  1.00 55.04 ? 397 TYR D C   1 
ATOM   2812  O O   . TYR A 1 397 ? 25.740  81.058  70.694  1.00 55.04 ? 397 TYR D O   1 
ATOM   2813  C CB  . TYR A 1 397 ? 22.842  80.152  69.170  1.00 55.42 ? 397 TYR D CB  1 
ATOM   2814  C CG  . TYR A 1 397 ? 23.109  79.047  70.175  1.00 55.82 ? 397 TYR D CG  1 
ATOM   2815  C CD1 . TYR A 1 397 ? 22.471  79.037  71.422  1.00 56.09 ? 397 TYR D CD1 1 
ATOM   2816  C CD2 . TYR A 1 397 ? 24.024  78.028  69.892  1.00 55.73 ? 397 TYR D CD2 1 
ATOM   2817  C CE1 . TYR A 1 397 ? 22.731  78.032  72.356  1.00 56.05 ? 397 TYR D CE1 1 
ATOM   2818  C CE2 . TYR A 1 397 ? 24.295  77.025  70.817  1.00 55.88 ? 397 TYR D CE2 1 
ATOM   2819  C CZ  . TYR A 1 397 ? 23.644  77.032  72.043  1.00 55.90 ? 397 TYR D CZ  1 
ATOM   2820  O OH  . TYR A 1 397 ? 23.910  76.037  72.952  1.00 55.84 ? 397 TYR D OH  1 
ATOM   2821  N N   . GLU A 1 398 ? 25.784  80.492  68.508  1.00 54.76 ? 398 GLU D N   1 
ATOM   2822  C CA  . GLU A 1 398 ? 27.171  80.063  68.513  1.00 54.43 ? 398 GLU D CA  1 
ATOM   2823  C C   . GLU A 1 398 ? 27.819  80.455  67.191  1.00 54.41 ? 398 GLU D C   1 
ATOM   2824  O O   . GLU A 1 398 ? 27.337  80.076  66.120  1.00 54.52 ? 398 GLU D O   1 
ATOM   2825  C CB  . GLU A 1 398 ? 27.256  78.550  68.715  1.00 54.41 ? 398 GLU D CB  1 
ATOM   2826  C CG  . GLU A 1 398 ? 28.560  78.066  69.318  1.00 54.29 ? 398 GLU D CG  1 
ATOM   2827  C CD  . GLU A 1 398 ? 28.582  76.560  69.541  1.00 54.22 ? 398 GLU D CD  1 
ATOM   2828  O OE1 . GLU A 1 398 ? 28.643  76.131  70.712  1.00 53.79 ? 398 GLU D OE1 1 
ATOM   2829  O OE2 . GLU A 1 398 ? 28.536  75.804  68.549  1.00 53.86 ? 398 GLU D OE2 1 
ATOM   2830  N N   . LEU A 1 399 ? 28.893  81.236  67.275  1.00 54.06 ? 399 LEU D N   1 
ATOM   2831  C CA  . LEU A 1 399 ? 29.715  81.559  66.119  1.00 53.78 ? 399 LEU D CA  1 
ATOM   2832  C C   . LEU A 1 399 ? 30.890  80.585  66.087  1.00 53.69 ? 399 LEU D C   1 
ATOM   2833  O O   . LEU A 1 399 ? 31.681  80.522  67.031  1.00 53.72 ? 399 LEU D O   1 
ATOM   2834  C CB  . LEU A 1 399 ? 30.182  83.020  66.191  1.00 53.82 ? 399 LEU D CB  1 
ATOM   2835  C CG  . LEU A 1 399 ? 31.194  83.658  65.223  1.00 53.87 ? 399 LEU D CG  1 
ATOM   2836  C CD1 . LEU A 1 399 ? 31.050  83.189  63.772  1.00 53.45 ? 399 LEU D CD1 1 
ATOM   2837  C CD2 . LEU A 1 399 ? 31.087  85.180  65.311  1.00 53.61 ? 399 LEU D CD2 1 
ATOM   2838  N N   . ARG A 1 400 ? 30.977  79.813  65.004  1.00 53.53 ? 400 ARG D N   1 
ATOM   2839  C CA  . ARG A 1 400 ? 31.995  78.770  64.858  1.00 53.31 ? 400 ARG D CA  1 
ATOM   2840  C C   . ARG A 1 400 ? 33.075  79.118  63.838  1.00 53.20 ? 400 ARG D C   1 
ATOM   2841  O O   . ARG A 1 400 ? 32.802  79.302  62.648  1.00 53.21 ? 400 ARG D O   1 
ATOM   2842  C CB  . ARG A 1 400 ? 31.351  77.414  64.538  1.00 53.48 ? 400 ARG D CB  1 
ATOM   2843  C CG  . ARG A 1 400 ? 31.139  76.532  65.765  1.00 53.24 ? 400 ARG D CG  1 
ATOM   2844  C CD  . ARG A 1 400 ? 30.253  75.330  65.481  1.00 53.12 ? 400 ARG D CD  1 
ATOM   2845  N NE  . ARG A 1 400 ? 28.869  75.572  65.888  1.00 52.82 ? 400 ARG D NE  1 
ATOM   2846  C CZ  . ARG A 1 400 ? 27.802  75.407  65.110  1.00 52.49 ? 400 ARG D CZ  1 
ATOM   2847  N NH1 . ARG A 1 400 ? 27.931  74.977  63.862  1.00 52.03 ? 400 ARG D NH1 1 
ATOM   2848  N NH2 . ARG A 1 400 ? 26.595  75.659  65.591  1.00 52.44 ? 400 ARG D NH2 1 
ATOM   2849  N N   . GLU A 1 401 ? 34.303  79.191  64.341  1.00 53.00 ? 401 GLU D N   1 
ATOM   2850  C CA  . GLU A 1 401 ? 35.484  79.584  63.588  1.00 52.83 ? 401 GLU D CA  1 
ATOM   2851  C C   . GLU A 1 401 ? 36.138  78.361  62.946  1.00 52.77 ? 401 GLU D C   1 
ATOM   2852  O O   . GLU A 1 401 ? 36.240  77.312  63.586  1.00 52.94 ? 401 GLU D O   1 
ATOM   2853  C CB  . GLU A 1 401 ? 36.463  80.265  64.549  1.00 52.79 ? 401 GLU D CB  1 
ATOM   2854  C CG  . GLU A 1 401 ? 37.888  80.446  64.045  1.00 52.98 ? 401 GLU D CG  1 
ATOM   2855  C CD  . GLU A 1 401 ? 38.820  80.962  65.122  1.00 52.87 ? 401 GLU D CD  1 
ATOM   2856  O OE1 . GLU A 1 401 ? 38.844  80.383  66.229  1.00 53.10 ? 401 GLU D OE1 1 
ATOM   2857  O OE2 . GLU A 1 401 ? 39.528  81.954  64.865  1.00 53.09 ? 401 GLU D OE2 1 
ATOM   2858  N N   . PRO A 1 402 ? 36.579  78.486  61.678  1.00 52.56 ? 402 PRO D N   1 
ATOM   2859  C CA  . PRO A 1 402 ? 37.331  77.399  61.040  1.00 52.41 ? 402 PRO D CA  1 
ATOM   2860  C C   . PRO A 1 402 ? 38.732  77.212  61.630  1.00 52.23 ? 402 PRO D C   1 
ATOM   2861  O O   . PRO A 1 402 ? 39.449  78.193  61.848  1.00 52.06 ? 402 PRO D O   1 
ATOM   2862  C CB  . PRO A 1 402 ? 37.412  77.835  59.572  1.00 52.44 ? 402 PRO D CB  1 
ATOM   2863  C CG  . PRO A 1 402 ? 37.247  79.308  59.593  1.00 52.41 ? 402 PRO D CG  1 
ATOM   2864  C CD  . PRO A 1 402 ? 36.374  79.630  60.770  1.00 52.52 ? 402 PRO D CD  1 
ATOM   2865  N N   . ILE A 1 403 ? 39.093  75.954  61.883  1.00 52.23 ? 403 ILE D N   1 
ATOM   2866  C CA  . ILE A 1 403 ? 40.392  75.570  62.448  1.00 52.28 ? 403 ILE D CA  1 
ATOM   2867  C C   . ILE A 1 403 ? 41.192  74.775  61.415  1.00 52.47 ? 403 ILE D C   1 
ATOM   2868  O O   . ILE A 1 403 ? 40.649  73.895  60.742  1.00 52.39 ? 403 ILE D O   1 
ATOM   2869  C CB  . ILE A 1 403 ? 40.225  74.711  63.747  1.00 52.21 ? 403 ILE D CB  1 
ATOM   2870  C CG1 . ILE A 1 403 ? 39.410  75.456  64.815  1.00 52.02 ? 403 ILE D CG1 1 
ATOM   2871  C CG2 . ILE A 1 403 ? 41.581  74.251  64.304  1.00 52.18 ? 403 ILE D CG2 1 
ATOM   2872  C CD1 . ILE A 1 403 ? 40.110  76.654  65.444  1.00 51.64 ? 403 ILE D CD1 1 
ATOM   2873  N N   . ALA A 1 404 ? 42.481  75.085  61.302  1.00 52.75 ? 404 ALA D N   1 
ATOM   2874  C CA  . ALA A 1 404 ? 43.351  74.434  60.326  1.00 53.04 ? 404 ALA D CA  1 
ATOM   2875  C C   . ALA A 1 404 ? 44.438  73.602  60.991  1.00 53.29 ? 404 ALA D C   1 
ATOM   2876  O O   . ALA A 1 404 ? 45.170  74.093  61.850  1.00 53.35 ? 404 ALA D O   1 
ATOM   2877  C CB  . ALA A 1 404 ? 43.974  75.467  59.400  1.00 52.91 ? 404 ALA D CB  1 
ATOM   2878  N N   . GLU A 1 405 ? 44.533  72.340  60.587  1.00 53.65 ? 405 GLU D N   1 
ATOM   2879  C CA  . GLU A 1 405 ? 45.615  71.460  61.012  1.00 53.98 ? 405 GLU D CA  1 
ATOM   2880  C C   . GLU A 1 405 ? 46.870  71.798  60.211  1.00 54.29 ? 405 GLU D C   1 
ATOM   2881  O O   . GLU A 1 405 ? 46.844  71.770  58.980  1.00 54.38 ? 405 GLU D O   1 
ATOM   2882  C CB  . GLU A 1 405 ? 45.216  70.004  60.788  1.00 53.91 ? 405 GLU D CB  1 
ATOM   2883  C CG  . GLU A 1 405 ? 46.245  68.984  61.229  1.00 53.97 ? 405 GLU D CG  1 
ATOM   2884  C CD  . GLU A 1 405 ? 45.806  67.567  60.934  1.00 54.21 ? 405 GLU D CD  1 
ATOM   2885  O OE1 . GLU A 1 405 ? 45.537  67.254  59.754  1.00 54.74 ? 405 GLU D OE1 1 
ATOM   2886  O OE2 . GLU A 1 405 ? 45.732  66.763  61.885  1.00 54.43 ? 405 GLU D OE2 1 
ATOM   2887  N N   . CYS A 1 406 ? 47.960  72.111  60.909  1.00 54.61 ? 406 CYS D N   1 
ATOM   2888  C CA  . CYS A 1 406 ? 49.186  72.583  60.261  1.00 55.01 ? 406 CYS D CA  1 
ATOM   2889  C C   . CYS A 1 406 ? 50.389  71.678  60.500  1.00 55.29 ? 406 CYS D C   1 
ATOM   2890  O O   . CYS A 1 406 ? 51.054  71.776  61.531  1.00 55.37 ? 406 CYS D O   1 
ATOM   2891  C CB  . CYS A 1 406 ? 49.519  74.008  60.709  1.00 54.90 ? 406 CYS D CB  1 
ATOM   2892  S SG  . CYS A 1 406 ? 48.182  75.181  60.482  1.00 55.15 ? 406 CYS D SG  1 
ATOM   2893  N N   . HIS A 1 407 ? 50.665  70.807  59.536  1.00 55.71 ? 407 HIS D N   1 
ATOM   2894  C CA  . HIS A 1 407 ? 51.872  69.988  59.557  1.00 56.12 ? 407 HIS D CA  1 
ATOM   2895  C C   . HIS A 1 407 ? 53.039  70.847  59.081  1.00 56.28 ? 407 HIS D C   1 
ATOM   2896  O O   . HIS A 1 407 ? 52.949  71.506  58.041  1.00 56.42 ? 407 HIS D O   1 
ATOM   2897  C CB  . HIS A 1 407 ? 51.718  68.756  58.661  1.00 56.16 ? 407 HIS D CB  1 
ATOM   2898  C CG  . HIS A 1 407 ? 50.397  68.058  58.800  1.00 56.90 ? 407 HIS D CG  1 
ATOM   2899  N ND1 . HIS A 1 407 ? 49.379  68.201  57.879  1.00 57.44 ? 407 HIS D ND1 1 
ATOM   2900  C CD2 . HIS A 1 407 ? 49.930  67.210  59.747  1.00 57.25 ? 407 HIS D CD2 1 
ATOM   2901  C CE1 . HIS A 1 407 ? 48.343  67.471  58.252  1.00 57.40 ? 407 HIS D CE1 1 
ATOM   2902  N NE2 . HIS A 1 407 ? 48.651  66.860  59.383  1.00 57.58 ? 407 HIS D NE2 1 
ATOM   2903  N N   . MET A 1 408 ? 54.123  70.857  59.857  1.00 56.48 ? 408 MET D N   1 
ATOM   2904  C CA  . MET A 1 408 ? 55.305  71.662  59.531  1.00 56.45 ? 408 MET D CA  1 
ATOM   2905  C C   . MET A 1 408 ? 56.600  70.894  59.778  1.00 56.69 ? 408 MET D C   1 
ATOM   2906  O O   . MET A 1 408 ? 56.694  70.099  60.717  1.00 56.79 ? 408 MET D O   1 
ATOM   2907  C CB  . MET A 1 408 ? 55.336  72.960  60.339  1.00 56.33 ? 408 MET D CB  1 
ATOM   2908  C CG  . MET A 1 408 ? 54.012  73.371  60.961  1.00 56.25 ? 408 MET D CG  1 
ATOM   2909  S SD  . MET A 1 408 ? 53.997  75.073  61.543  1.00 56.09 ? 408 MET D SD  1 
ATOM   2910  C CE  . MET A 1 408 ? 55.449  75.106  62.580  1.00 56.06 ? 408 MET D CE  1 
ATOM   2911  N N   . LEU A 1 409 ? 57.592  71.137  58.924  1.00 56.87 ? 409 LEU D N   1 
ATOM   2912  C CA  . LEU A 1 409 ? 58.929  70.568  59.089  1.00 56.95 ? 409 LEU D CA  1 
ATOM   2913  C C   . LEU A 1 409 ? 59.952  71.686  59.227  1.00 57.04 ? 409 LEU D C   1 
ATOM   2914  O O   . LEU A 1 409 ? 59.937  72.650  58.457  1.00 56.95 ? 409 LEU D O   1 
ATOM   2915  C CB  . LEU A 1 409 ? 59.295  69.652  57.912  1.00 56.94 ? 409 LEU D CB  1 
ATOM   2916  C CG  . LEU A 1 409 ? 58.999  68.142  57.949  1.00 56.94 ? 409 LEU D CG  1 
ATOM   2917  C CD1 . LEU A 1 409 ? 59.858  67.428  58.992  1.00 57.03 ? 409 LEU D CD1 1 
ATOM   2918  C CD2 . LEU A 1 409 ? 57.513  67.822  58.154  1.00 56.83 ? 409 LEU D CD2 1 
ATOM   2919  N N   . LEU A 1 410 ? 60.832  71.547  60.216  1.00 57.17 ? 410 LEU D N   1 
ATOM   2920  C CA  . LEU A 1 410 ? 61.841  72.561  60.529  1.00 57.28 ? 410 LEU D CA  1 
ATOM   2921  C C   . LEU A 1 410 ? 63.002  71.948  61.310  1.00 57.37 ? 410 LEU D C   1 
ATOM   2922  O O   . LEU A 1 410 ? 62.802  70.981  62.046  1.00 57.41 ? 410 LEU D O   1 
ATOM   2923  C CB  . LEU A 1 410 ? 61.225  73.709  61.341  1.00 57.30 ? 410 LEU D CB  1 
ATOM   2924  C CG  . LEU A 1 410 ? 60.425  73.352  62.599  1.00 57.25 ? 410 LEU D CG  1 
ATOM   2925  C CD1 . LEU A 1 410 ? 60.782  74.278  63.747  1.00 57.09 ? 410 LEU D CD1 1 
ATOM   2926  C CD2 . LEU A 1 410 ? 58.922  73.362  62.322  1.00 57.06 ? 410 LEU D CD2 1 
ATOM   2927  N N   . PRO A 1 411 ? 64.222  72.499  61.144  1.00 57.47 ? 411 PRO D N   1 
ATOM   2928  C CA  . PRO A 1 411 ? 65.361  72.068  61.962  1.00 57.52 ? 411 PRO D CA  1 
ATOM   2929  C C   . PRO A 1 411 ? 65.215  72.444  63.439  1.00 57.50 ? 411 PRO D C   1 
ATOM   2930  O O   . PRO A 1 411 ? 64.564  73.441  63.763  1.00 57.41 ? 411 PRO D O   1 
ATOM   2931  C CB  . PRO A 1 411 ? 66.553  72.798  61.331  1.00 57.60 ? 411 PRO D CB  1 
ATOM   2932  C CG  . PRO A 1 411 ? 65.961  73.954  60.610  1.00 57.59 ? 411 PRO D CG  1 
ATOM   2933  C CD  . PRO A 1 411 ? 64.607  73.522  60.153  1.00 57.47 ? 411 PRO D CD  1 
ATOM   2934  N N   . GLN A 1 412 ? 65.830  71.639  64.309  1.00 57.57 ? 412 GLN D N   1 
ATOM   2935  C CA  . GLN A 1 412 ? 65.735  71.781  65.772  1.00 57.64 ? 412 GLN D CA  1 
ATOM   2936  C C   . GLN A 1 412 ? 66.100  73.167  66.293  1.00 57.62 ? 412 GLN D C   1 
ATOM   2937  O O   . GLN A 1 412 ? 65.476  73.665  67.229  1.00 57.57 ? 412 GLN D O   1 
ATOM   2938  C CB  . GLN A 1 412 ? 66.630  70.750  66.470  1.00 57.59 ? 412 GLN D CB  1 
ATOM   2939  C CG  . GLN A 1 412 ? 66.141  69.311  66.404  1.00 57.73 ? 412 GLN D CG  1 
ATOM   2940  C CD  . GLN A 1 412 ? 67.041  68.349  67.170  1.00 57.87 ? 412 GLN D CD  1 
ATOM   2941  O OE1 . GLN A 1 412 ? 67.894  68.765  67.958  1.00 58.01 ? 412 GLN D OE1 1 
ATOM   2942  N NE2 . GLN A 1 412 ? 66.851  67.054  66.943  1.00 58.40 ? 412 GLN D NE2 1 
ATOM   2943  N N   . ALA A 1 413 ? 67.113  73.782  65.688  1.00 57.68 ? 413 ALA D N   1 
ATOM   2944  C CA  . ALA A 1 413 ? 67.611  75.086  66.122  1.00 57.79 ? 413 ALA D CA  1 
ATOM   2945  C C   . ALA A 1 413 ? 66.511  76.136  66.297  1.00 57.89 ? 413 ALA D C   1 
ATOM   2946  O O   . ALA A 1 413 ? 66.661  77.066  67.092  1.00 57.97 ? 413 ALA D O   1 
ATOM   2947  C CB  . ALA A 1 413 ? 68.675  75.589  65.155  1.00 57.72 ? 413 ALA D CB  1 
ATOM   2948  N N   . TYR A 1 414 ? 65.405  75.967  65.571  1.00 58.01 ? 414 TYR D N   1 
ATOM   2949  C CA  . TYR A 1 414 ? 64.361  76.990  65.494  1.00 58.11 ? 414 TYR D CA  1 
ATOM   2950  C C   . TYR A 1 414 ? 63.071  76.686  66.257  1.00 58.11 ? 414 TYR D C   1 
ATOM   2951  O O   . TYR A 1 414 ? 62.258  77.591  66.458  1.00 58.19 ? 414 TYR D O   1 
ATOM   2952  C CB  . TYR A 1 414 ? 64.015  77.290  64.031  1.00 58.22 ? 414 TYR D CB  1 
ATOM   2953  C CG  . TYR A 1 414 ? 65.161  77.837  63.206  1.00 58.52 ? 414 TYR D CG  1 
ATOM   2954  C CD1 . TYR A 1 414 ? 65.619  79.146  63.384  1.00 58.60 ? 414 TYR D CD1 1 
ATOM   2955  C CD2 . TYR A 1 414 ? 65.778  77.052  62.234  1.00 58.61 ? 414 TYR D CD2 1 
ATOM   2956  C CE1 . TYR A 1 414 ? 66.669  79.651  62.621  1.00 58.46 ? 414 TYR D CE1 1 
ATOM   2957  C CE2 . TYR A 1 414 ? 66.828  77.548  61.465  1.00 58.50 ? 414 TYR D CE2 1 
ATOM   2958  C CZ  . TYR A 1 414 ? 67.266  78.846  61.665  1.00 58.42 ? 414 TYR D CZ  1 
ATOM   2959  O OH  . TYR A 1 414 ? 68.302  79.337  60.906  1.00 58.63 ? 414 TYR D OH  1 
ATOM   2960  N N   . LEU A 1 415 ? 62.881  75.436  66.685  1.00 58.05 ? 415 LEU D N   1 
ATOM   2961  C CA  . LEU A 1 415 ? 61.600  75.009  67.281  1.00 58.01 ? 415 LEU D CA  1 
ATOM   2962  C C   . LEU A 1 415 ? 61.024  75.910  68.378  1.00 57.92 ? 415 LEU D C   1 
ATOM   2963  O O   . LEU A 1 415 ? 59.809  76.073  68.460  1.00 57.97 ? 415 LEU D O   1 
ATOM   2964  C CB  . LEU A 1 415 ? 61.630  73.545  67.751  1.00 57.95 ? 415 LEU D CB  1 
ATOM   2965  C CG  . LEU A 1 415 ? 62.753  72.902  68.573  1.00 58.12 ? 415 LEU D CG  1 
ATOM   2966  C CD1 . LEU A 1 415 ? 63.308  73.767  69.709  1.00 58.40 ? 415 LEU D CD1 1 
ATOM   2967  C CD2 . LEU A 1 415 ? 62.242  71.586  69.119  1.00 58.11 ? 415 LEU D CD2 1 
ATOM   2968  N N   . GLY A 1 416 ? 61.893  76.494  69.201  1.00 57.81 ? 416 GLY D N   1 
ATOM   2969  C CA  . GLY A 1 416 ? 61.472  77.411  70.263  1.00 57.61 ? 416 GLY D CA  1 
ATOM   2970  C C   . GLY A 1 416 ? 60.873  78.697  69.721  1.00 57.49 ? 416 GLY D C   1 
ATOM   2971  O O   . GLY A 1 416 ? 59.887  79.211  70.253  1.00 57.48 ? 416 GLY D O   1 
ATOM   2972  N N   . ASN A 1 417 ? 61.475  79.208  68.651  1.00 57.39 ? 417 ASN D N   1 
ATOM   2973  C CA  . ASN A 1 417 ? 61.017  80.429  67.998  1.00 57.27 ? 417 ASN D CA  1 
ATOM   2974  C C   . ASN A 1 417 ? 59.769  80.229  67.141  1.00 57.15 ? 417 ASN D C   1 
ATOM   2975  O O   . ASN A 1 417 ? 59.136  81.201  66.716  1.00 57.14 ? 417 ASN D O   1 
ATOM   2976  C CB  . ASN A 1 417 ? 62.140  81.024  67.143  1.00 57.30 ? 417 ASN D CB  1 
ATOM   2977  C CG  . ASN A 1 417 ? 63.238  81.657  67.973  1.00 57.28 ? 417 ASN D CG  1 
ATOM   2978  O OD1 . ASN A 1 417 ? 63.242  81.566  69.201  1.00 57.34 ? 417 ASN D OD1 1 
ATOM   2979  N ND2 . ASN A 1 417 ? 64.180  82.309  67.302  1.00 57.46 ? 417 ASN D ND2 1 
ATOM   2980  N N   . VAL A 1 418 ? 59.420  78.973  66.882  1.00 56.94 ? 418 VAL D N   1 
ATOM   2981  C CA  . VAL A 1 418 ? 58.298  78.674  66.002  1.00 56.76 ? 418 VAL D CA  1 
ATOM   2982  C C   . VAL A 1 418 ? 57.024  78.412  66.795  1.00 56.68 ? 418 VAL D C   1 
ATOM   2983  O O   . VAL A 1 418 ? 55.987  79.011  66.505  1.00 56.62 ? 418 VAL D O   1 
ATOM   2984  C CB  . VAL A 1 418 ? 58.611  77.520  65.020  1.00 56.76 ? 418 VAL D CB  1 
ATOM   2985  C CG1 . VAL A 1 418 ? 57.440  77.282  64.096  1.00 56.64 ? 418 VAL D CG1 1 
ATOM   2986  C CG2 . VAL A 1 418 ? 59.847  77.850  64.197  1.00 56.78 ? 418 VAL D CG2 1 
ATOM   2987  N N   . ILE A 1 419 ? 57.103  77.537  67.800  1.00 56.65 ? 419 ILE D N   1 
ATOM   2988  C CA  . ILE A 1 419 ? 55.934  77.258  68.646  1.00 56.63 ? 419 ILE D CA  1 
ATOM   2989  C C   . ILE A 1 419 ? 55.505  78.504  69.431  1.00 56.62 ? 419 ILE D C   1 
ATOM   2990  O O   . ILE A 1 419 ? 54.350  78.612  69.847  1.00 56.71 ? 419 ILE D O   1 
ATOM   2991  C CB  . ILE A 1 419 ? 56.088  75.992  69.586  1.00 56.61 ? 419 ILE D CB  1 
ATOM   2992  C CG1 . ILE A 1 419 ? 56.602  76.351  70.990  1.00 56.58 ? 419 ILE D CG1 1 
ATOM   2993  C CG2 . ILE A 1 419 ? 56.884  74.861  68.911  1.00 56.58 ? 419 ILE D CG2 1 
ATOM   2994  C CD1 . ILE A 1 419 ? 58.066  76.714  71.066  1.00 57.06 ? 419 ILE D CD1 1 
ATOM   2995  N N   . THR A 1 420 ? 56.434  79.446  69.608  1.00 56.52 ? 420 THR D N   1 
ATOM   2996  C CA  . THR A 1 420 ? 56.119  80.726  70.235  1.00 56.41 ? 420 THR D CA  1 
ATOM   2997  C C   . THR A 1 420 ? 55.193  81.549  69.339  1.00 56.20 ? 420 THR D C   1 
ATOM   2998  O O   . THR A 1 420 ? 54.328  82.272  69.835  1.00 56.28 ? 420 THR D O   1 
ATOM   2999  C CB  . THR A 1 420 ? 57.391  81.531  70.631  1.00 56.46 ? 420 THR D CB  1 
ATOM   3000  O OG1 . THR A 1 420 ? 57.052  82.507  71.621  1.00 56.73 ? 420 THR D OG1 1 
ATOM   3001  C CG2 . THR A 1 420 ? 58.014  82.240  69.438  1.00 56.52 ? 420 THR D CG2 1 
ATOM   3002  N N   . LEU A 1 421 ? 55.371  81.416  68.026  1.00 55.93 ? 421 LEU D N   1 
ATOM   3003  C CA  . LEU A 1 421 ? 54.530  82.099  67.050  1.00 55.71 ? 421 LEU D CA  1 
ATOM   3004  C C   . LEU A 1 421 ? 53.163  81.428  66.997  1.00 55.62 ? 421 LEU D C   1 
ATOM   3005  O O   . LEU A 1 421 ? 52.129  82.102  66.973  1.00 55.68 ? 421 LEU D O   1 
ATOM   3006  C CB  . LEU A 1 421 ? 55.175  82.055  65.663  1.00 55.60 ? 421 LEU D CB  1 
ATOM   3007  C CG  . LEU A 1 421 ? 54.994  83.204  64.662  1.00 55.51 ? 421 LEU D CG  1 
ATOM   3008  C CD1 . LEU A 1 421 ? 55.516  82.757  63.322  1.00 55.32 ? 421 LEU D CD1 1 
ATOM   3009  C CD2 . LEU A 1 421 ? 53.556  83.698  64.512  1.00 55.54 ? 421 LEU D CD2 1 
ATOM   3010  N N   . CYS A 1 422 ? 53.170  80.098  66.976  1.00 55.34 ? 422 CYS D N   1 
ATOM   3011  C CA  . CYS A 1 422 ? 51.944  79.317  66.901  1.00 55.04 ? 422 CYS D CA  1 
ATOM   3012  C C   . CYS A 1 422 ? 50.979  79.653  68.038  1.00 55.12 ? 422 CYS D C   1 
ATOM   3013  O O   . CYS A 1 422 ? 49.828  80.004  67.784  1.00 55.19 ? 422 CYS D O   1 
ATOM   3014  C CB  . CYS A 1 422 ? 52.265  77.824  66.876  1.00 55.00 ? 422 CYS D CB  1 
ATOM   3015  S SG  . CYS A 1 422 ? 53.055  77.267  65.352  1.00 54.23 ? 422 CYS D SG  1 
ATOM   3016  N N   . VAL A 1 423 ? 51.456  79.570  69.281  1.00 55.09 ? 423 VAL D N   1 
ATOM   3017  C CA  . VAL A 1 423 ? 50.632  79.896  70.454  1.00 55.02 ? 423 VAL D CA  1 
ATOM   3018  C C   . VAL A 1 423 ? 50.237  81.373  70.491  1.00 54.89 ? 423 VAL D C   1 
ATOM   3019  O O   . VAL A 1 423 ? 49.189  81.725  71.035  1.00 54.92 ? 423 VAL D O   1 
ATOM   3020  C CB  . VAL A 1 423 ? 51.298  79.483  71.806  1.00 55.06 ? 423 VAL D CB  1 
ATOM   3021  C CG1 . VAL A 1 423 ? 51.448  77.966  71.897  1.00 55.05 ? 423 VAL D CG1 1 
ATOM   3022  C CG2 . VAL A 1 423 ? 52.641  80.187  72.014  1.00 55.05 ? 423 VAL D CG2 1 
ATOM   3023  N N   . GLU A 1 424 ? 51.083  82.224  69.912  1.00 54.72 ? 424 GLU D N   1 
ATOM   3024  C CA  . GLU A 1 424 ? 50.787  83.647  69.774  1.00 54.60 ? 424 GLU D CA  1 
ATOM   3025  C C   . GLU A 1 424 ? 49.598  83.816  68.831  1.00 54.32 ? 424 GLU D C   1 
ATOM   3026  O O   . GLU A 1 424 ? 48.709  84.633  69.080  1.00 54.32 ? 424 GLU D O   1 
ATOM   3027  C CB  . GLU A 1 424 ? 52.016  84.402  69.255  1.00 54.68 ? 424 GLU D CB  1 
ATOM   3028  C CG  . GLU A 1 424 ? 52.057  85.883  69.612  1.00 55.17 ? 424 GLU D CG  1 
ATOM   3029  C CD  . GLU A 1 424 ? 51.446  86.768  68.538  1.00 55.82 ? 424 GLU D CD  1 
ATOM   3030  O OE1 . GLU A 1 424 ? 50.330  87.288  68.764  1.00 56.28 ? 424 GLU D OE1 1 
ATOM   3031  O OE2 . GLU A 1 424 ? 52.078  86.944  67.471  1.00 55.63 ? 424 GLU D OE2 1 
ATOM   3032  N N   . LYS A 1 425 ? 49.586  83.015  67.764  1.00 53.98 ? 425 LYS D N   1 
ATOM   3033  C CA  . LYS A 1 425 ? 48.470  82.968  66.819  1.00 53.59 ? 425 LYS D CA  1 
ATOM   3034  C C   . LYS A 1 425 ? 47.407  81.944  67.250  1.00 53.21 ? 425 LYS D C   1 
ATOM   3035  O O   . LYS A 1 425 ? 46.823  81.250  66.413  1.00 53.19 ? 425 LYS D O   1 
ATOM   3036  C CB  . LYS A 1 425 ? 48.974  82.666  65.398  1.00 53.64 ? 425 LYS D CB  1 
ATOM   3037  C CG  . LYS A 1 425 ? 49.816  83.769  64.738  1.00 53.95 ? 425 LYS D CG  1 
ATOM   3038  C CD  . LYS A 1 425 ? 49.065  85.101  64.619  1.00 54.85 ? 425 LYS D CD  1 
ATOM   3039  C CE  . LYS A 1 425 ? 49.277  85.768  63.256  1.00 55.19 ? 425 LYS D CE  1 
ATOM   3040  N NZ  . LYS A 1 425 ? 50.677  86.226  63.023  1.00 55.05 ? 425 LYS D NZ  1 
ATOM   3041  N N   . ARG A 1 426 ? 47.181  81.859  68.564  1.00 52.70 ? 426 ARG D N   1 
ATOM   3042  C CA  . ARG A 1 426 ? 46.124  81.035  69.180  1.00 52.17 ? 426 ARG D CA  1 
ATOM   3043  C C   . ARG A 1 426 ? 46.159  79.541  68.832  1.00 52.09 ? 426 ARG D C   1 
ATOM   3044  O O   . ARG A 1 426 ? 45.130  78.866  68.853  1.00 51.99 ? 426 ARG D O   1 
ATOM   3045  C CB  . ARG A 1 426 ? 44.736  81.631  68.899  1.00 52.17 ? 426 ARG D CB  1 
ATOM   3046  C CG  . ARG A 1 426 ? 44.538  83.030  69.458  1.00 51.79 ? 426 ARG D CG  1 
ATOM   3047  C CD  . ARG A 1 426 ? 43.094  83.491  69.355  1.00 51.74 ? 426 ARG D CD  1 
ATOM   3048  N NE  . ARG A 1 426 ? 42.681  83.723  67.974  1.00 50.61 ? 426 ARG D NE  1 
ATOM   3049  C CZ  . ARG A 1 426 ? 41.770  83.000  67.328  1.00 50.43 ? 426 ARG D CZ  1 
ATOM   3050  N NH1 . ARG A 1 426 ? 41.156  81.993  67.932  1.00 50.34 ? 426 ARG D NH1 1 
ATOM   3051  N NH2 . ARG A 1 426 ? 41.467  83.293  66.071  1.00 50.23 ? 426 ARG D NH2 1 
ATOM   3052  N N   . GLY A 1 427 ? 47.349  79.024  68.545  1.00 52.04 ? 427 GLY D N   1 
ATOM   3053  C CA  . GLY A 1 427 ? 47.506  77.636  68.118  1.00 52.00 ? 427 GLY D CA  1 
ATOM   3054  C C   . GLY A 1 427 ? 47.640  76.633  69.248  1.00 51.98 ? 427 GLY D C   1 
ATOM   3055  O O   . GLY A 1 427 ? 48.214  76.931  70.300  1.00 51.95 ? 427 GLY D O   1 
ATOM   3056  N N   . VAL A 1 428 ? 47.102  75.437  69.016  1.00 51.93 ? 428 VAL D N   1 
ATOM   3057  C CA  . VAL A 1 428 ? 47.192  74.323  69.961  1.00 51.84 ? 428 VAL D CA  1 
ATOM   3058  C C   . VAL A 1 428 ? 48.050  73.227  69.331  1.00 51.78 ? 428 VAL D C   1 
ATOM   3059  O O   . VAL A 1 428 ? 47.775  72.796  68.210  1.00 51.79 ? 428 VAL D O   1 
ATOM   3060  C CB  . VAL A 1 428 ? 45.786  73.738  70.296  1.00 51.85 ? 428 VAL D CB  1 
ATOM   3061  C CG1 . VAL A 1 428 ? 45.876  72.710  71.416  1.00 51.70 ? 428 VAL D CG1 1 
ATOM   3062  C CG2 . VAL A 1 428 ? 44.800  74.844  70.666  1.00 51.72 ? 428 VAL D CG2 1 
ATOM   3063  N N   . GLN A 1 429 ? 49.091  72.785  70.035  1.00 51.69 ? 429 GLN D N   1 
ATOM   3064  C CA  . GLN A 1 429 ? 49.931  71.694  69.534  1.00 51.71 ? 429 GLN D CA  1 
ATOM   3065  C C   . GLN A 1 429 ? 49.205  70.355  69.625  1.00 51.72 ? 429 GLN D C   1 
ATOM   3066  O O   . GLN A 1 429 ? 48.654  70.005  70.671  1.00 51.70 ? 429 GLN D O   1 
ATOM   3067  C CB  . GLN A 1 429 ? 51.271  71.628  70.268  1.00 51.67 ? 429 GLN D CB  1 
ATOM   3068  C CG  . GLN A 1 429 ? 52.205  70.547  69.731  1.00 51.64 ? 429 GLN D CG  1 
ATOM   3069  C CD  . GLN A 1 429 ? 53.551  70.539  70.412  1.00 51.72 ? 429 GLN D CD  1 
ATOM   3070  O OE1 . GLN A 1 429 ? 54.150  71.590  70.641  1.00 51.96 ? 429 GLN D OE1 1 
ATOM   3071  N NE2 . GLN A 1 429 ? 54.044  69.345  70.736  1.00 51.58 ? 429 GLN D NE2 1 
ATOM   3072  N N   . THR A 1 430 ? 49.217  69.613  68.522  1.00 51.75 ? 430 THR D N   1 
ATOM   3073  C CA  . THR A 1 430 ? 48.453  68.376  68.420  1.00 51.83 ? 430 THR D CA  1 
ATOM   3074  C C   . THR A 1 430 ? 49.361  67.133  68.400  1.00 51.88 ? 430 THR D C   1 
ATOM   3075  O O   . THR A 1 430 ? 48.925  66.035  68.756  1.00 51.81 ? 430 THR D O   1 
ATOM   3076  C CB  . THR A 1 430 ? 47.462  68.434  67.210  1.00 51.84 ? 430 THR D CB  1 
ATOM   3077  O OG1 . THR A 1 430 ? 46.173  67.951  67.606  1.00 51.71 ? 430 THR D OG1 1 
ATOM   3078  C CG2 . THR A 1 430 ? 47.968  67.651  65.994  1.00 52.01 ? 430 THR D CG2 1 
ATOM   3079  N N   . ASN A 1 431 ? 50.620  67.329  68.001  1.00 52.04 ? 431 ASN D N   1 
ATOM   3080  C CA  . ASN A 1 431 ? 51.626  66.259  67.924  1.00 52.12 ? 431 ASN D CA  1 
ATOM   3081  C C   . ASN A 1 431 ? 53.024  66.812  67.611  1.00 52.09 ? 431 ASN D C   1 
ATOM   3082  O O   . ASN A 1 431 ? 53.165  67.933  67.119  1.00 51.85 ? 431 ASN D O   1 
ATOM   3083  C CB  . ASN A 1 431 ? 51.212  65.191  66.892  1.00 52.19 ? 431 ASN D CB  1 
ATOM   3084  C CG  . ASN A 1 431 ? 52.145  63.985  66.868  1.00 52.20 ? 431 ASN D CG  1 
ATOM   3085  O OD1 . ASN A 1 431 ? 52.808  63.667  67.858  1.00 52.54 ? 431 ASN D OD1 1 
ATOM   3086  N ND2 . ASN A 1 431 ? 52.193  63.303  65.730  1.00 51.98 ? 431 ASN D ND2 1 
ATOM   3087  N N   . MET A 1 432 ? 54.048  66.016  67.917  1.00 52.24 ? 432 MET D N   1 
ATOM   3088  C CA  . MET A 1 432 ? 55.439  66.386  67.676  1.00 52.43 ? 432 MET D CA  1 
ATOM   3089  C C   . MET A 1 432 ? 56.302  65.146  67.465  1.00 52.57 ? 432 MET D C   1 
ATOM   3090  O O   . MET A 1 432 ? 56.218  64.185  68.233  1.00 52.49 ? 432 MET D O   1 
ATOM   3091  C CB  . MET A 1 432 ? 55.979  67.191  68.851  1.00 52.43 ? 432 MET D CB  1 
ATOM   3092  C CG  . MET A 1 432 ? 57.178  68.038  68.517  1.00 52.35 ? 432 MET D CG  1 
ATOM   3093  S SD  . MET A 1 432 ? 57.819  68.807  70.003  1.00 52.48 ? 432 MET D SD  1 
ATOM   3094  C CE  . MET A 1 432 ? 58.736  70.178  69.303  1.00 52.72 ? 432 MET D CE  1 
ATOM   3095  N N   . VAL A 1 433 ? 57.123  65.174  66.417  1.00 52.82 ? 433 VAL D N   1 
ATOM   3096  C CA  . VAL A 1 433 ? 58.007  64.055  66.075  1.00 53.07 ? 433 VAL D CA  1 
ATOM   3097  C C   . VAL A 1 433 ? 59.392  64.566  65.673  1.00 53.27 ? 433 VAL D C   1 
ATOM   3098  O O   . VAL A 1 433 ? 59.516  65.573  64.971  1.00 53.27 ? 433 VAL D O   1 
ATOM   3099  C CB  . VAL A 1 433 ? 57.423  63.164  64.937  1.00 53.07 ? 433 VAL D CB  1 
ATOM   3100  C CG1 . VAL A 1 433 ? 58.367  62.011  64.606  1.00 52.99 ? 433 VAL D CG1 1 
ATOM   3101  C CG2 . VAL A 1 433 ? 56.048  62.607  65.315  1.00 53.16 ? 433 VAL D CG2 1 
ATOM   3102  N N   . TYR A 1 434 ? 60.425  63.864  66.132  1.00 53.47 ? 434 TYR D N   1 
ATOM   3103  C CA  . TYR A 1 434 ? 61.808  64.191  65.799  1.00 53.64 ? 434 TYR D CA  1 
ATOM   3104  C C   . TYR A 1 434 ? 62.343  63.306  64.679  1.00 53.66 ? 434 TYR D C   1 
ATOM   3105  O O   . TYR A 1 434 ? 61.949  62.144  64.553  1.00 53.65 ? 434 TYR D O   1 
ATOM   3106  C CB  . TYR A 1 434 ? 62.697  64.051  67.035  1.00 53.76 ? 434 TYR D CB  1 
ATOM   3107  C CG  . TYR A 1 434 ? 62.717  65.279  67.913  1.00 53.97 ? 434 TYR D CG  1 
ATOM   3108  C CD1 . TYR A 1 434 ? 61.695  65.524  68.831  1.00 53.96 ? 434 TYR D CD1 1 
ATOM   3109  C CD2 . TYR A 1 434 ? 63.763  66.199  67.827  1.00 54.01 ? 434 TYR D CD2 1 
ATOM   3110  C CE1 . TYR A 1 434 ? 61.714  66.656  69.639  1.00 54.17 ? 434 TYR D CE1 1 
ATOM   3111  C CE2 . TYR A 1 434 ? 63.794  67.332  68.631  1.00 53.94 ? 434 TYR D CE2 1 
ATOM   3112  C CZ  . TYR A 1 434 ? 62.768  67.555  69.533  1.00 54.10 ? 434 TYR D CZ  1 
ATOM   3113  O OH  . TYR A 1 434 ? 62.796  68.674  70.331  1.00 54.15 ? 434 TYR D OH  1 
ATOM   3114  N N   . HIS A 1 435 ? 63.238  63.872  63.870  1.00 53.68 ? 435 HIS D N   1 
ATOM   3115  C CA  . HIS A 1 435 ? 63.930  63.136  62.812  1.00 53.66 ? 435 HIS D CA  1 
ATOM   3116  C C   . HIS A 1 435 ? 65.380  63.618  62.705  1.00 53.54 ? 435 HIS D C   1 
ATOM   3117  O O   . HIS A 1 435 ? 65.681  64.527  61.932  1.00 53.58 ? 435 HIS D O   1 
ATOM   3118  C CB  . HIS A 1 435 ? 63.207  63.298  61.466  1.00 53.71 ? 435 HIS D CB  1 
ATOM   3119  C CG  . HIS A 1 435 ? 61.797  62.786  61.462  1.00 54.00 ? 435 HIS D CG  1 
ATOM   3120  N ND1 . HIS A 1 435 ? 60.701  63.622  61.452  1.00 54.14 ? 435 HIS D ND1 1 
ATOM   3121  C CD2 . HIS A 1 435 ? 61.305  61.523  61.469  1.00 54.18 ? 435 HIS D CD2 1 
ATOM   3122  C CE1 . HIS A 1 435 ? 59.596  62.898  61.448  1.00 54.00 ? 435 HIS D CE1 1 
ATOM   3123  N NE2 . HIS A 1 435 ? 59.934  61.621  61.460  1.00 54.07 ? 435 HIS D NE2 1 
ATOM   3124  N N   . GLY A 1 436 ? 66.270  63.012  63.490  1.00 53.45 ? 436 GLY D N   1 
ATOM   3125  C CA  . GLY A 1 436 ? 67.683  63.416  63.534  1.00 53.26 ? 436 GLY D CA  1 
ATOM   3126  C C   . GLY A 1 436 ? 67.861  64.806  64.123  1.00 53.11 ? 436 GLY D C   1 
ATOM   3127  O O   . GLY A 1 436 ? 68.121  64.957  65.318  1.00 53.14 ? 436 GLY D O   1 
ATOM   3128  N N   . ASN A 1 437 ? 67.736  65.818  63.269  1.00 52.93 ? 437 ASN D N   1 
ATOM   3129  C CA  . ASN A 1 437 ? 67.633  67.213  63.705  1.00 52.80 ? 437 ASN D CA  1 
ATOM   3130  C C   . ASN A 1 437 ? 66.562  67.967  62.911  1.00 52.83 ? 437 ASN D C   1 
ATOM   3131  O O   . ASN A 1 437 ? 66.705  69.151  62.598  1.00 52.76 ? 437 ASN D O   1 
ATOM   3132  C CB  . ASN A 1 437 ? 68.994  67.932  63.666  1.00 52.74 ? 437 ASN D CB  1 
ATOM   3133  C CG  . ASN A 1 437 ? 69.839  67.550  62.462  1.00 52.38 ? 437 ASN D CG  1 
ATOM   3134  O OD1 . ASN A 1 437 ? 70.997  67.170  62.610  1.00 51.87 ? 437 ASN D OD1 1 
ATOM   3135  N ND2 . ASN A 1 437 ? 69.267  67.653  61.266  1.00 52.29 ? 437 ASN D ND2 1 
ATOM   3136  N N   . GLN A 1 438 ? 65.484  67.253  62.600  1.00 52.90 ? 438 GLN D N   1 
ATOM   3137  C CA  . GLN A 1 438 ? 64.388  67.775  61.800  1.00 52.97 ? 438 GLN D CA  1 
ATOM   3138  C C   . GLN A 1 438 ? 63.075  67.533  62.545  1.00 52.99 ? 438 GLN D C   1 
ATOM   3139  O O   . GLN A 1 438 ? 62.514  66.436  62.499  1.00 53.02 ? 438 GLN D O   1 
ATOM   3140  C CB  . GLN A 1 438 ? 64.374  67.094  60.424  1.00 52.94 ? 438 GLN D CB  1 
ATOM   3141  C CG  . GLN A 1 438 ? 63.510  67.776  59.362  1.00 53.03 ? 438 GLN D CG  1 
ATOM   3142  C CD  . GLN A 1 438 ? 64.223  68.903  58.627  1.00 52.84 ? 438 GLN D CD  1 
ATOM   3143  O OE1 . GLN A 1 438 ? 63.584  69.828  58.125  1.00 52.63 ? 438 GLN D OE1 1 
ATOM   3144  N NE2 . GLN A 1 438 ? 65.549  68.825  58.553  1.00 52.71 ? 438 GLN D NE2 1 
ATOM   3145  N N   . VAL A 1 439 ? 62.605  68.563  63.244  1.00 53.01 ? 439 VAL D N   1 
ATOM   3146  C CA  . VAL A 1 439 ? 61.374  68.485  64.030  1.00 53.05 ? 439 VAL D CA  1 
ATOM   3147  C C   . VAL A 1 439 ? 60.133  68.534  63.135  1.00 53.11 ? 439 VAL D C   1 
ATOM   3148  O O   . VAL A 1 439 ? 59.930  69.495  62.381  1.00 53.08 ? 439 VAL D O   1 
ATOM   3149  C CB  . VAL A 1 439 ? 61.299  69.615  65.091  1.00 53.07 ? 439 VAL D CB  1 
ATOM   3150  C CG1 . VAL A 1 439 ? 60.046  69.476  65.943  1.00 53.04 ? 439 VAL D CG1 1 
ATOM   3151  C CG2 . VAL A 1 439 ? 62.536  69.609  65.969  1.00 53.04 ? 439 VAL D CG2 1 
ATOM   3152  N N   . ALA A 1 440 ? 59.313  67.489  63.232  1.00 53.18 ? 440 ALA D N   1 
ATOM   3153  C CA  . ALA A 1 440 ? 58.051  67.396  62.495  1.00 53.19 ? 440 ALA D CA  1 
ATOM   3154  C C   . ALA A 1 440 ? 56.882  67.910  63.337  1.00 53.18 ? 440 ALA D C   1 
ATOM   3155  O O   . ALA A 1 440 ? 56.164  67.135  63.981  1.00 53.21 ? 440 ALA D O   1 
ATOM   3156  C CB  . ALA A 1 440 ? 57.803  65.959  62.037  1.00 53.22 ? 440 ALA D CB  1 
ATOM   3157  N N   . LEU A 1 441 ? 56.709  69.228  63.330  1.00 53.11 ? 441 LEU D N   1 
ATOM   3158  C CA  . LEU A 1 441 ? 55.639  69.881  64.081  1.00 53.02 ? 441 LEU D CA  1 
ATOM   3159  C C   . LEU A 1 441 ? 54.270  69.723  63.437  1.00 52.94 ? 441 LEU D C   1 
ATOM   3160  O O   . LEU A 1 441 ? 54.145  69.706  62.211  1.00 53.00 ? 441 LEU D O   1 
ATOM   3161  C CB  . LEU A 1 441 ? 55.938  71.372  64.245  1.00 53.01 ? 441 LEU D CB  1 
ATOM   3162  C CG  . LEU A 1 441 ? 56.461  71.855  65.594  1.00 52.80 ? 441 LEU D CG  1 
ATOM   3163  C CD1 . LEU A 1 441 ? 56.794  73.333  65.520  1.00 52.40 ? 441 LEU D CD1 1 
ATOM   3164  C CD2 . LEU A 1 441 ? 55.429  71.587  66.677  1.00 52.90 ? 441 LEU D CD2 1 
ATOM   3165  N N   . THR A 1 442 ? 53.248  69.606  64.277  1.00 52.85 ? 442 THR D N   1 
ATOM   3166  C CA  . THR A 1 442 ? 51.860  69.664  63.821  1.00 52.81 ? 442 THR D CA  1 
ATOM   3167  C C   . THR A 1 442 ? 50.950  70.356  64.843  1.00 52.86 ? 442 THR D C   1 
ATOM   3168  O O   . THR A 1 442 ? 50.657  69.816  65.914  1.00 52.79 ? 442 THR D O   1 
ATOM   3169  C CB  . THR A 1 442 ? 51.309  68.287  63.338  1.00 52.74 ? 442 THR D CB  1 
ATOM   3170  O OG1 . THR A 1 442 ? 49.880  68.281  63.421  1.00 52.53 ? 442 THR D OG1 1 
ATOM   3171  C CG2 . THR A 1 442 ? 51.876  67.136  64.151  1.00 52.73 ? 442 THR D CG2 1 
ATOM   3172  N N   . TYR A 1 443 ? 50.532  71.570  64.487  1.00 52.95 ? 443 TYR D N   1 
ATOM   3173  C CA  . TYR A 1 443 ? 49.699  72.430  65.330  1.00 52.98 ? 443 TYR D CA  1 
ATOM   3174  C C   . TYR A 1 443 ? 48.287  72.573  64.764  1.00 52.81 ? 443 TYR D C   1 
ATOM   3175  O O   . TYR A 1 443 ? 48.094  72.504  63.551  1.00 52.78 ? 443 TYR D O   1 
ATOM   3176  C CB  . TYR A 1 443 ? 50.334  73.821  65.431  1.00 53.13 ? 443 TYR D CB  1 
ATOM   3177  C CG  . TYR A 1 443 ? 51.084  74.104  66.717  1.00 53.29 ? 443 TYR D CG  1 
ATOM   3178  C CD1 . TYR A 1 443 ? 50.488  74.842  67.740  1.00 53.31 ? 443 TYR D CD1 1 
ATOM   3179  C CD2 . TYR A 1 443 ? 52.394  73.660  66.904  1.00 53.27 ? 443 TYR D CD2 1 
ATOM   3180  C CE1 . TYR A 1 443 ? 51.166  75.120  68.921  1.00 53.26 ? 443 TYR D CE1 1 
ATOM   3181  C CE2 . TYR A 1 443 ? 53.084  73.936  68.085  1.00 53.28 ? 443 TYR D CE2 1 
ATOM   3182  C CZ  . TYR A 1 443 ? 52.462  74.666  69.088  1.00 53.42 ? 443 TYR D CZ  1 
ATOM   3183  O OH  . TYR A 1 443 ? 53.129  74.939  70.263  1.00 53.63 ? 443 TYR D OH  1 
ATOM   3184  N N   . GLU A 1 444 ? 47.308  72.767  65.648  1.00 52.69 ? 444 GLU D N   1 
ATOM   3185  C CA  . GLU A 1 444 ? 45.957  73.170  65.250  1.00 52.56 ? 444 GLU D CA  1 
ATOM   3186  C C   . GLU A 1 444 ? 45.792  74.669  65.479  1.00 52.54 ? 444 GLU D C   1 
ATOM   3187  O O   . GLU A 1 444 ? 45.712  75.137  66.620  1.00 52.57 ? 444 GLU D O   1 
ATOM   3188  C CB  . GLU A 1 444 ? 44.878  72.376  65.996  1.00 52.52 ? 444 GLU D CB  1 
ATOM   3189  C CG  . GLU A 1 444 ? 44.519  71.040  65.344  1.00 52.48 ? 444 GLU D CG  1 
ATOM   3190  C CD  . GLU A 1 444 ? 43.411  70.277  66.073  1.00 52.52 ? 444 GLU D CD  1 
ATOM   3191  O OE1 . GLU A 1 444 ? 42.787  70.841  67.006  1.00 52.01 ? 444 GLU D OE1 1 
ATOM   3192  O OE2 . GLU A 1 444 ? 43.164  69.105  65.704  1.00 51.96 ? 444 GLU D OE2 1 
ATOM   3193  N N   . ILE A 1 445 ? 45.763  75.411  64.374  1.00 52.48 ? 445 ILE D N   1 
ATOM   3194  C CA  . ILE A 1 445 ? 45.725  76.869  64.389  1.00 52.48 ? 445 ILE D CA  1 
ATOM   3195  C C   . ILE A 1 445 ? 44.468  77.358  63.659  1.00 52.63 ? 445 ILE D C   1 
ATOM   3196  O O   . ILE A 1 445 ? 44.161  76.868  62.570  1.00 52.69 ? 445 ILE D O   1 
ATOM   3197  C CB  . ILE A 1 445 ? 46.999  77.469  63.722  1.00 52.44 ? 445 ILE D CB  1 
ATOM   3198  C CG1 . ILE A 1 445 ? 48.273  76.883  64.349  1.00 52.33 ? 445 ILE D CG1 1 
ATOM   3199  C CG2 . ILE A 1 445 ? 46.999  78.998  63.811  1.00 52.48 ? 445 ILE D CG2 1 
ATOM   3200  C CD1 . ILE A 1 445 ? 49.529  77.055  63.507  1.00 52.29 ? 445 ILE D CD1 1 
ATOM   3201  N N   . PRO A 1 446 ? 43.721  78.306  64.267  1.00 52.71 ? 446 PRO D N   1 
ATOM   3202  C CA  . PRO A 1 446 ? 42.555  78.913  63.619  1.00 52.80 ? 446 PRO D CA  1 
ATOM   3203  C C   . PRO A 1 446 ? 42.864  79.396  62.208  1.00 52.94 ? 446 PRO D C   1 
ATOM   3204  O O   . PRO A 1 446 ? 43.877  80.063  61.997  1.00 52.96 ? 446 PRO D O   1 
ATOM   3205  C CB  . PRO A 1 446 ? 42.238  80.100  64.526  1.00 52.82 ? 446 PRO D CB  1 
ATOM   3206  C CG  . PRO A 1 446 ? 42.691  79.663  65.870  1.00 52.75 ? 446 PRO D CG  1 
ATOM   3207  C CD  . PRO A 1 446 ? 43.922  78.837  65.630  1.00 52.74 ? 446 PRO D CD  1 
ATOM   3208  N N   . MET A 1 447 ? 41.994  79.047  61.260  1.00 53.21 ? 447 MET D N   1 
ATOM   3209  C CA  . MET A 1 447 ? 42.195  79.344  59.837  1.00 53.41 ? 447 MET D CA  1 
ATOM   3210  C C   . MET A 1 447 ? 42.309  80.845  59.593  1.00 53.53 ? 447 MET D C   1 
ATOM   3211  O O   . MET A 1 447 ? 43.170  81.288  58.832  1.00 53.58 ? 447 MET D O   1 
ATOM   3212  C CB  . MET A 1 447 ? 41.071  78.725  58.986  1.00 53.45 ? 447 MET D CB  1 
ATOM   3213  C CG  . MET A 1 447 ? 41.180  78.957  57.470  1.00 53.69 ? 447 MET D CG  1 
ATOM   3214  S SD  . MET A 1 447 ? 42.609  78.191  56.663  1.00 53.91 ? 447 MET D SD  1 
ATOM   3215  C CE  . MET A 1 447 ? 42.041  76.496  56.506  1.00 53.72 ? 447 MET D CE  1 
ATOM   3216  N N   . ALA A 1 448 ? 41.450  81.614  60.259  1.00 53.68 ? 448 ALA D N   1 
ATOM   3217  C CA  . ALA A 1 448 ? 41.489  83.073  60.208  1.00 53.89 ? 448 ALA D CA  1 
ATOM   3218  C C   . ALA A 1 448 ? 42.876  83.624  60.537  1.00 54.13 ? 448 ALA D C   1 
ATOM   3219  O O   . ALA A 1 448 ? 43.280  84.661  60.009  1.00 54.16 ? 448 ALA D O   1 
ATOM   3220  C CB  . ALA A 1 448 ? 40.458  83.653  61.156  1.00 53.79 ? 448 ALA D CB  1 
ATOM   3221  N N   . GLU A 1 449 ? 43.600  82.916  61.400  1.00 54.45 ? 449 GLU D N   1 
ATOM   3222  C CA  . GLU A 1 449 ? 44.916  83.349  61.851  1.00 54.85 ? 449 GLU D CA  1 
ATOM   3223  C C   . GLU A 1 449 ? 46.040  82.905  60.907  1.00 55.21 ? 449 GLU D C   1 
ATOM   3224  O O   . GLU A 1 449 ? 47.081  83.558  60.830  1.00 55.32 ? 449 GLU D O   1 
ATOM   3225  C CB  . GLU A 1 449 ? 45.171  82.858  63.276  1.00 54.71 ? 449 GLU D CB  1 
ATOM   3226  C CG  . GLU A 1 449 ? 45.739  83.919  64.206  1.00 54.90 ? 449 GLU D CG  1 
ATOM   3227  C CD  . GLU A 1 449 ? 44.705  84.940  64.667  1.00 55.19 ? 449 GLU D CD  1 
ATOM   3228  O OE1 . GLU A 1 449 ? 43.976  85.495  63.820  1.00 55.32 ? 449 GLU D OE1 1 
ATOM   3229  O OE2 . GLU A 1 449 ? 44.629  85.200  65.887  1.00 55.32 ? 449 GLU D OE2 1 
ATOM   3230  N N   . VAL A 1 450 ? 45.817  81.803  60.191  1.00 55.57 ? 450 VAL D N   1 
ATOM   3231  C CA  . VAL A 1 450 ? 46.769  81.289  59.202  1.00 55.97 ? 450 VAL D CA  1 
ATOM   3232  C C   . VAL A 1 450 ? 46.800  82.178  57.954  1.00 56.48 ? 450 VAL D C   1 
ATOM   3233  O O   . VAL A 1 450 ? 47.864  82.447  57.384  1.00 56.41 ? 450 VAL D O   1 
ATOM   3234  C CB  . VAL A 1 450 ? 46.413  79.833  58.790  1.00 55.86 ? 450 VAL D CB  1 
ATOM   3235  C CG1 . VAL A 1 450 ? 47.382  79.298  57.736  1.00 55.72 ? 450 VAL D CG1 1 
ATOM   3236  C CG2 . VAL A 1 450 ? 46.398  78.918  60.003  1.00 55.72 ? 450 VAL D CG2 1 
ATOM   3237  N N   . VAL A 1 451 ? 45.619  82.632  57.550  1.00 57.20 ? 451 VAL D N   1 
ATOM   3238  C CA  . VAL A 1 451 ? 45.431  83.401  56.323  1.00 57.91 ? 451 VAL D CA  1 
ATOM   3239  C C   . VAL A 1 451 ? 45.903  84.854  56.474  1.00 58.46 ? 451 VAL D C   1 
ATOM   3240  O O   . VAL A 1 451 ? 46.427  85.440  55.523  1.00 58.36 ? 451 VAL D O   1 
ATOM   3241  C CB  . VAL A 1 451 ? 43.962  83.319  55.853  1.00 57.82 ? 451 VAL D CB  1 
ATOM   3242  C CG1 . VAL A 1 451 ? 43.759  84.093  54.575  1.00 58.32 ? 451 VAL D CG1 1 
ATOM   3243  C CG2 . VAL A 1 451 ? 43.567  81.868  55.635  1.00 57.85 ? 451 VAL D CG2 1 
ATOM   3244  N N   . LEU A 1 452 ? 45.709  85.429  57.664  1.00 59.32 ? 452 LEU D N   1 
ATOM   3245  C CA  . LEU A 1 452 ? 46.348  86.699  58.023  1.00 60.05 ? 452 LEU D CA  1 
ATOM   3246  C C   . LEU A 1 452 ? 47.835  86.423  58.166  1.00 60.43 ? 452 LEU D C   1 
ATOM   3247  O O   . LEU A 1 452 ? 48.230  85.561  58.950  1.00 60.67 ? 452 LEU D O   1 
ATOM   3248  C CB  . LEU A 1 452 ? 45.777  87.278  59.328  1.00 60.11 ? 452 LEU D CB  1 
ATOM   3249  C CG  . LEU A 1 452 ? 44.668  88.341  59.283  1.00 60.54 ? 452 LEU D CG  1 
ATOM   3250  C CD1 . LEU A 1 452 ? 44.953  89.415  58.223  1.00 60.88 ? 452 LEU D CD1 1 
ATOM   3251  C CD2 . LEU A 1 452 ? 43.283  87.725  59.065  1.00 61.26 ? 452 LEU D CD2 1 
ATOM   3252  N N   . ASP A 1 453 ? 48.646  87.158  57.409  1.00 60.91 ? 453 ASP D N   1 
ATOM   3253  C CA  . ASP A 1 453 ? 50.048  86.795  57.160  1.00 61.30 ? 453 ASP D CA  1 
ATOM   3254  C C   . ASP A 1 453 ? 50.791  86.155  58.345  1.00 61.18 ? 453 ASP D C   1 
ATOM   3255  O O   . ASP A 1 453 ? 51.348  86.836  59.210  1.00 61.00 ? 453 ASP D O   1 
ATOM   3256  C CB  . ASP A 1 453 ? 50.829  87.977  56.560  1.00 61.60 ? 453 ASP D CB  1 
ATOM   3257  C CG  . ASP A 1 453 ? 51.643  87.576  55.329  1.00 62.40 ? 453 ASP D CG  1 
ATOM   3258  O OD1 . ASP A 1 453 ? 51.934  88.458  54.489  1.00 62.90 ? 453 ASP D OD1 1 
ATOM   3259  O OD2 . ASP A 1 453 ? 51.978  86.375  55.193  1.00 63.48 ? 453 ASP D OD2 1 
ATOM   3260  N N   . PHE A 1 454 ? 50.758  84.825  58.355  1.00 61.28 ? 454 PHE D N   1 
ATOM   3261  C CA  . PHE A 1 454 ? 51.424  83.992  59.350  1.00 61.32 ? 454 PHE D CA  1 
ATOM   3262  C C   . PHE A 1 454 ? 52.498  83.174  58.645  1.00 61.52 ? 454 PHE D C   1 
ATOM   3263  O O   . PHE A 1 454 ? 53.580  82.958  59.189  1.00 61.49 ? 454 PHE D O   1 
ATOM   3264  C CB  . PHE A 1 454 ? 50.398  83.084  60.051  1.00 61.07 ? 454 PHE D CB  1 
ATOM   3265  C CG  . PHE A 1 454 ? 50.953  81.755  60.521  1.00 60.93 ? 454 PHE D CG  1 
ATOM   3266  C CD1 . PHE A 1 454 ? 51.746  81.672  61.666  1.00 60.78 ? 454 PHE D CD1 1 
ATOM   3267  C CD2 . PHE A 1 454 ? 50.659  80.581  59.829  1.00 60.41 ? 454 PHE D CD2 1 
ATOM   3268  C CE1 . PHE A 1 454 ? 52.252  80.442  62.102  1.00 60.50 ? 454 PHE D CE1 1 
ATOM   3269  C CE2 . PHE A 1 454 ? 51.161  79.349  60.258  1.00 60.25 ? 454 PHE D CE2 1 
ATOM   3270  C CZ  . PHE A 1 454 ? 51.956  79.280  61.397  1.00 60.43 ? 454 PHE D CZ  1 
ATOM   3271  N N   . PHE A 1 455 ? 52.178  82.731  57.430  1.00 61.83 ? 455 PHE D N   1 
ATOM   3272  C CA  . PHE A 1 455 ? 53.095  81.977  56.576  1.00 62.23 ? 455 PHE D CA  1 
ATOM   3273  C C   . PHE A 1 455 ? 54.439  82.697  56.384  1.00 62.45 ? 455 PHE D C   1 
ATOM   3274  O O   . PHE A 1 455 ? 55.498  82.058  56.374  1.00 62.43 ? 455 PHE D O   1 
ATOM   3275  C CB  . PHE A 1 455 ? 52.420  81.685  55.227  1.00 62.28 ? 455 PHE D CB  1 
ATOM   3276  C CG  . PHE A 1 455 ? 53.331  81.068  54.201  1.00 62.54 ? 455 PHE D CG  1 
ATOM   3277  C CD1 . PHE A 1 455 ? 53.927  79.826  54.425  1.00 62.62 ? 455 PHE D CD1 1 
ATOM   3278  C CD2 . PHE A 1 455 ? 53.577  81.722  52.994  1.00 63.07 ? 455 PHE D CD2 1 
ATOM   3279  C CE1 . PHE A 1 455 ? 54.769  79.250  53.469  1.00 62.84 ? 455 PHE D CE1 1 
ATOM   3280  C CE2 . PHE A 1 455 ? 54.415  81.155  52.026  1.00 63.01 ? 455 PHE D CE2 1 
ATOM   3281  C CZ  . PHE A 1 455 ? 55.012  79.916  52.266  1.00 62.84 ? 455 PHE D CZ  1 
ATOM   3282  N N   . ASP A 1 456 ? 54.384  84.022  56.243  1.00 62.62 ? 456 ASP D N   1 
ATOM   3283  C CA  . ASP A 1 456 ? 55.589  84.846  56.151  1.00 62.72 ? 456 ASP D CA  1 
ATOM   3284  C C   . ASP A 1 456 ? 56.328  84.886  57.482  1.00 62.64 ? 456 ASP D C   1 
ATOM   3285  O O   . ASP A 1 456 ? 57.489  84.484  57.560  1.00 62.70 ? 456 ASP D O   1 
ATOM   3286  C CB  . ASP A 1 456 ? 55.252  86.269  55.681  1.00 62.77 ? 456 ASP D CB  1 
ATOM   3287  C CG  . ASP A 1 456 ? 54.871  86.329  54.207  1.00 63.30 ? 456 ASP D CG  1 
ATOM   3288  O OD1 . ASP A 1 456 ? 54.710  85.261  53.573  1.00 64.17 ? 456 ASP D OD1 1 
ATOM   3289  O OD2 . ASP A 1 456 ? 54.724  87.452  53.681  1.00 63.74 ? 456 ASP D OD2 1 
ATOM   3290  N N   . ARG A 1 457 ? 55.639  85.353  58.523  1.00 62.57 ? 457 ARG D N   1 
ATOM   3291  C CA  . ARG A 1 457 ? 56.212  85.484  59.865  1.00 62.58 ? 457 ARG D CA  1 
ATOM   3292  C C   . ARG A 1 457 ? 56.882  84.209  60.367  1.00 62.43 ? 457 ARG D C   1 
ATOM   3293  O O   . ARG A 1 457 ? 57.879  84.271  61.084  1.00 62.37 ? 457 ARG D O   1 
ATOM   3294  C CB  . ARG A 1 457 ? 55.141  85.931  60.857  1.00 62.57 ? 457 ARG D CB  1 
ATOM   3295  C CG  . ARG A 1 457 ? 54.739  87.387  60.708  1.00 62.71 ? 457 ARG D CG  1 
ATOM   3296  C CD  . ARG A 1 457 ? 53.591  87.764  61.641  1.00 62.86 ? 457 ARG D CD  1 
ATOM   3297  N NE  . ARG A 1 457 ? 53.734  87.219  62.993  1.00 63.45 ? 457 ARG D NE  1 
ATOM   3298  C CZ  . ARG A 1 457 ? 54.613  87.639  63.901  1.00 63.72 ? 457 ARG D CZ  1 
ATOM   3299  N NH1 . ARG A 1 457 ? 55.469  88.615  63.617  1.00 63.96 ? 457 ARG D NH1 1 
ATOM   3300  N NH2 . ARG A 1 457 ? 54.643  87.070  65.099  1.00 63.89 ? 457 ARG D NH2 1 
ATOM   3301  N N   . LEU A 1 458 ? 56.324  83.063  59.985  1.00 62.38 ? 458 LEU D N   1 
ATOM   3302  C CA  . LEU A 1 458 ? 56.893  81.758  60.316  1.00 62.33 ? 458 LEU D CA  1 
ATOM   3303  C C   . LEU A 1 458 ? 58.187  81.501  59.556  1.00 62.21 ? 458 LEU D C   1 
ATOM   3304  O O   . LEU A 1 458 ? 59.150  80.968  60.114  1.00 62.25 ? 458 LEU D O   1 
ATOM   3305  C CB  . LEU A 1 458 ? 55.869  80.645  60.051  1.00 62.43 ? 458 LEU D CB  1 
ATOM   3306  C CG  . LEU A 1 458 ? 56.343  79.227  59.701  1.00 62.62 ? 458 LEU D CG  1 
ATOM   3307  C CD1 . LEU A 1 458 ? 55.490  78.181  60.398  1.00 62.71 ? 458 LEU D CD1 1 
ATOM   3308  C CD2 . LEU A 1 458 ? 56.353  79.013  58.185  1.00 62.61 ? 458 LEU D CD2 1 
ATOM   3309  N N   . LYS A 1 459 ? 58.199  81.879  58.282  1.00 62.08 ? 459 LYS D N   1 
ATOM   3310  C CA  . LYS A 1 459 ? 59.364  81.672  57.435  1.00 61.93 ? 459 LYS D CA  1 
ATOM   3311  C C   . LYS A 1 459 ? 60.503  82.616  57.828  1.00 61.80 ? 459 LYS D C   1 
ATOM   3312  O O   . LYS A 1 459 ? 61.675  82.254  57.716  1.00 61.91 ? 459 LYS D O   1 
ATOM   3313  C CB  . LYS A 1 459 ? 58.991  81.825  55.958  1.00 61.92 ? 459 LYS D CB  1 
ATOM   3314  C CG  . LYS A 1 459 ? 59.832  80.968  55.031  1.00 61.95 ? 459 LYS D CG  1 
ATOM   3315  C CD  . LYS A 1 459 ? 59.016  80.420  53.868  1.00 62.01 ? 459 LYS D CD  1 
ATOM   3316  C CE  . LYS A 1 459 ? 59.759  79.293  53.147  1.00 62.08 ? 459 LYS D CE  1 
ATOM   3317  N NZ  . LYS A 1 459 ? 59.874  78.045  53.967  1.00 61.79 ? 459 LYS D NZ  1 
ATOM   3318  N N   . SER A 1 460 ? 60.153  83.810  58.304  1.00 61.47 ? 460 SER D N   1 
ATOM   3319  C CA  . SER A 1 460 ? 61.142  84.779  58.770  1.00 61.21 ? 460 SER D CA  1 
ATOM   3320  C C   . SER A 1 460 ? 61.766  84.373  60.108  1.00 61.05 ? 460 SER D C   1 
ATOM   3321  O O   . SER A 1 460 ? 62.973  84.530  60.302  1.00 61.09 ? 460 SER D O   1 
ATOM   3322  C CB  . SER A 1 460 ? 60.523  86.174  58.881  1.00 61.24 ? 460 SER D CB  1 
ATOM   3323  O OG  . SER A 1 460 ? 59.704  86.282  60.033  1.00 61.34 ? 460 SER D OG  1 
ATOM   3324  N N   . THR A 1 461 ? 60.946  83.852  61.022  1.00 60.78 ? 461 THR D N   1 
ATOM   3325  C CA  . THR A 1 461 ? 61.419  83.449  62.354  1.00 60.48 ? 461 THR D CA  1 
ATOM   3326  C C   . THR A 1 461 ? 62.227  82.142  62.343  1.00 60.30 ? 461 THR D C   1 
ATOM   3327  O O   . THR A 1 461 ? 62.957  81.852  63.293  1.00 60.30 ? 461 THR D O   1 
ATOM   3328  C CB  . THR A 1 461 ? 60.268  83.399  63.408  1.00 60.44 ? 461 THR D CB  1 
ATOM   3329  O OG1 . THR A 1 461 ? 60.822  83.293  64.725  1.00 60.34 ? 461 THR D OG1 1 
ATOM   3330  C CG2 . THR A 1 461 ? 59.339  82.220  63.169  1.00 60.58 ? 461 THR D CG2 1 
ATOM   3331  N N   . SER A 1 462 ? 62.086  81.362  61.273  1.00 60.06 ? 462 SER D N   1 
ATOM   3332  C CA  . SER A 1 462 ? 62.905  80.166  61.072  1.00 59.94 ? 462 SER D CA  1 
ATOM   3333  C C   . SER A 1 462 ? 63.994  80.429  60.026  1.00 59.87 ? 462 SER D C   1 
ATOM   3334  O O   . SER A 1 462 ? 64.821  79.555  59.742  1.00 59.87 ? 462 SER D O   1 
ATOM   3335  C CB  . SER A 1 462 ? 62.037  78.973  60.657  1.00 59.95 ? 462 SER D CB  1 
ATOM   3336  O OG  . SER A 1 462 ? 61.549  79.117  59.332  1.00 59.98 ? 462 SER D OG  1 
ATOM   3337  N N   . ARG A 1 463 ? 63.974  81.642  59.469  1.00 59.67 ? 463 ARG D N   1 
ATOM   3338  C CA  . ARG A 1 463 ? 64.904  82.093  58.421  1.00 59.45 ? 463 ARG D CA  1 
ATOM   3339  C C   . ARG A 1 463 ? 64.856  81.273  57.120  1.00 59.34 ? 463 ARG D C   1 
ATOM   3340  O O   . ARG A 1 463 ? 65.872  81.106  56.434  1.00 59.29 ? 463 ARG D O   1 
ATOM   3341  C CB  . ARG A 1 463 ? 66.334  82.251  58.966  1.00 59.51 ? 463 ARG D CB  1 
ATOM   3342  C CG  . ARG A 1 463 ? 66.570  83.589  59.652  1.00 59.35 ? 463 ARG D CG  1 
ATOM   3343  C CD  . ARG A 1 463 ? 68.027  83.783  60.038  1.00 59.32 ? 463 ARG D CD  1 
ATOM   3344  N NE  . ARG A 1 463 ? 68.321  83.246  61.365  1.00 58.87 ? 463 ARG D NE  1 
ATOM   3345  C CZ  . ARG A 1 463 ? 69.438  83.490  62.047  1.00 58.58 ? 463 ARG D CZ  1 
ATOM   3346  N NH1 . ARG A 1 463 ? 70.384  84.267  61.535  1.00 58.40 ? 463 ARG D NH1 1 
ATOM   3347  N NH2 . ARG A 1 463 ? 69.610  82.957  63.249  1.00 58.46 ? 463 ARG D NH2 1 
ATOM   3348  N N   . GLY A 1 464 ? 63.662  80.777  56.795  1.00 59.18 ? 464 GLY D N   1 
ATOM   3349  C CA  . GLY A 1 464 ? 63.399  80.069  55.539  1.00 59.05 ? 464 GLY D CA  1 
ATOM   3350  C C   . GLY A 1 464 ? 63.549  78.560  55.617  1.00 58.98 ? 464 GLY D C   1 
ATOM   3351  O O   . GLY A 1 464 ? 64.103  77.941  54.706  1.00 59.00 ? 464 GLY D O   1 
ATOM   3352  N N   . TYR A 1 465 ? 63.044  77.962  56.694  1.00 58.87 ? 465 TYR D N   1 
ATOM   3353  C CA  . TYR A 1 465 ? 63.274  76.541  56.954  1.00 58.69 ? 465 TYR D CA  1 
ATOM   3354  C C   . TYR A 1 465 ? 62.035  75.736  57.367  1.00 58.65 ? 465 TYR D C   1 
ATOM   3355  O O   . TYR A 1 465 ? 62.057  74.504  57.313  1.00 58.68 ? 465 TYR D O   1 
ATOM   3356  C CB  . TYR A 1 465 ? 64.375  76.377  58.011  1.00 58.63 ? 465 TYR D CB  1 
ATOM   3357  C CG  . TYR A 1 465 ? 65.790  76.476  57.474  1.00 58.45 ? 465 TYR D CG  1 
ATOM   3358  C CD1 . TYR A 1 465 ? 66.374  77.715  57.206  1.00 58.21 ? 465 TYR D CD1 1 
ATOM   3359  C CD2 . TYR A 1 465 ? 66.551  75.327  57.249  1.00 58.36 ? 465 TYR D CD2 1 
ATOM   3360  C CE1 . TYR A 1 465 ? 67.673  77.807  56.716  1.00 58.21 ? 465 TYR D CE1 1 
ATOM   3361  C CE2 . TYR A 1 465 ? 67.851  75.409  56.761  1.00 58.17 ? 465 TYR D CE2 1 
ATOM   3362  C CZ  . TYR A 1 465 ? 68.403  76.651  56.499  1.00 58.19 ? 465 TYR D CZ  1 
ATOM   3363  O OH  . TYR A 1 465 ? 69.686  76.736  56.019  1.00 58.22 ? 465 TYR D OH  1 
ATOM   3364  N N   . ALA A 1 466 ? 60.961  76.423  57.760  1.00 58.50 ? 466 ALA D N   1 
ATOM   3365  C CA  . ALA A 1 466 ? 59.810  75.757  58.384  1.00 58.40 ? 466 ALA D CA  1 
ATOM   3366  C C   . ALA A 1 466 ? 58.597  75.527  57.466  1.00 58.34 ? 466 ALA D C   1 
ATOM   3367  O O   . ALA A 1 466 ? 57.516  76.080  57.699  1.00 58.35 ? 466 ALA D O   1 
ATOM   3368  C CB  . ALA A 1 466 ? 59.397  76.500  59.656  1.00 58.45 ? 466 ALA D CB  1 
ATOM   3369  N N   . SER A 1 467 ? 58.776  74.677  56.455  1.00 58.14 ? 467 SER D N   1 
ATOM   3370  C CA  . SER A 1 467 ? 57.742  74.389  55.446  1.00 57.95 ? 467 SER D CA  1 
ATOM   3371  C C   . SER A 1 467 ? 56.343  74.103  56.010  1.00 57.74 ? 467 SER D C   1 
ATOM   3372  O O   . SER A 1 467 ? 56.140  73.132  56.738  1.00 57.73 ? 467 SER D O   1 
ATOM   3373  C CB  . SER A 1 467 ? 58.187  73.233  54.550  1.00 58.01 ? 467 SER D CB  1 
ATOM   3374  O OG  . SER A 1 467 ? 58.419  72.067  55.320  1.00 58.21 ? 467 SER D OG  1 
ATOM   3375  N N   . LEU A 1 468 ? 55.390  74.956  55.644  1.00 57.55 ? 468 LEU D N   1 
ATOM   3376  C CA  . LEU A 1 468 ? 54.014  74.874  56.124  1.00 57.33 ? 468 LEU D CA  1 
ATOM   3377  C C   . LEU A 1 468 ? 53.150  74.038  55.190  1.00 57.23 ? 468 LEU D C   1 
ATOM   3378  O O   . LEU A 1 468 ? 53.244  74.150  53.968  1.00 57.28 ? 468 LEU D O   1 
ATOM   3379  C CB  . LEU A 1 468 ? 53.414  76.279  56.221  1.00 57.35 ? 468 LEU D CB  1 
ATOM   3380  C CG  . LEU A 1 468 ? 52.305  76.652  57.219  1.00 57.41 ? 468 LEU D CG  1 
ATOM   3381  C CD1 . LEU A 1 468 ? 51.770  78.040  56.877  1.00 57.26 ? 468 LEU D CD1 1 
ATOM   3382  C CD2 . LEU A 1 468 ? 51.151  75.656  57.297  1.00 57.04 ? 468 LEU D CD2 1 
ATOM   3383  N N   . ASP A 1 469 ? 52.305  73.203  55.781  1.00 57.08 ? 469 ASP D N   1 
ATOM   3384  C CA  . ASP A 1 469 ? 51.267  72.498  55.049  1.00 56.90 ? 469 ASP D CA  1 
ATOM   3385  C C   . ASP A 1 469 ? 50.039  72.424  55.936  1.00 56.73 ? 469 ASP D C   1 
ATOM   3386  O O   . ASP A 1 469 ? 50.121  71.957  57.072  1.00 56.72 ? 469 ASP D O   1 
ATOM   3387  C CB  . ASP A 1 469 ? 51.722  71.090  54.682  1.00 57.03 ? 469 ASP D CB  1 
ATOM   3388  C CG  . ASP A 1 469 ? 50.715  70.367  53.807  1.00 57.58 ? 469 ASP D CG  1 
ATOM   3389  O OD1 . ASP A 1 469 ? 50.736  70.588  52.573  1.00 57.58 ? 469 ASP D OD1 1 
ATOM   3390  O OD2 . ASP A 1 469 ? 49.909  69.576  54.354  1.00 57.92 ? 469 ASP D OD2 1 
ATOM   3391  N N   . TYR A 1 470 ? 48.904  72.891  55.425  1.00 56.45 ? 470 TYR D N   1 
ATOM   3392  C CA  . TYR A 1 470 ? 47.686  72.914  56.224  1.00 56.26 ? 470 TYR D CA  1 
ATOM   3393  C C   . TYR A 1 470 ? 46.440  72.474  55.467  1.00 56.17 ? 470 TYR D C   1 
ATOM   3394  O O   . TYR A 1 470 ? 46.321  72.676  54.260  1.00 56.25 ? 470 TYR D O   1 
ATOM   3395  C CB  . TYR A 1 470 ? 47.472  74.295  56.865  1.00 56.23 ? 470 TYR D CB  1 
ATOM   3396  C CG  . TYR A 1 470 ? 47.093  75.392  55.898  1.00 56.15 ? 470 TYR D CG  1 
ATOM   3397  C CD1 . TYR A 1 470 ? 48.064  76.233  55.356  1.00 56.21 ? 470 TYR D CD1 1 
ATOM   3398  C CD2 . TYR A 1 470 ? 45.760  75.600  55.533  1.00 56.32 ? 470 TYR D CD2 1 
ATOM   3399  C CE1 . TYR A 1 470 ? 47.722  77.250  54.465  1.00 56.52 ? 470 TYR D CE1 1 
ATOM   3400  C CE2 . TYR A 1 470 ? 45.406  76.612  54.638  1.00 56.54 ? 470 TYR D CE2 1 
ATOM   3401  C CZ  . TYR A 1 470 ? 46.392  77.433  54.111  1.00 56.46 ? 470 TYR D CZ  1 
ATOM   3402  O OH  . TYR A 1 470 ? 46.051  78.434  53.230  1.00 56.35 ? 470 TYR D OH  1 
ATOM   3403  N N   . ASN A 1 471 ? 45.519  71.859  56.198  1.00 55.95 ? 471 ASN D N   1 
ATOM   3404  C CA  . ASN A 1 471 ? 44.209  71.520  55.671  1.00 55.81 ? 471 ASN D CA  1 
ATOM   3405  C C   . ASN A 1 471 ? 43.129  72.055  56.604  1.00 55.57 ? 471 ASN D C   1 
ATOM   3406  O O   . ASN A 1 471 ? 43.419  72.400  57.750  1.00 55.59 ? 471 ASN D O   1 
ATOM   3407  C CB  . ASN A 1 471 ? 44.076  70.001  55.480  1.00 55.86 ? 471 ASN D CB  1 
ATOM   3408  C CG  . ASN A 1 471 ? 44.453  69.205  56.732  1.00 56.28 ? 471 ASN D CG  1 
ATOM   3409  O OD1 . ASN A 1 471 ? 45.473  68.513  56.753  1.00 56.78 ? 471 ASN D OD1 1 
ATOM   3410  N ND2 . ASN A 1 471 ? 43.628  69.295  57.774  1.00 56.28 ? 471 ASN D ND2 1 
ATOM   3411  N N   . PHE A 1 472 ? 41.897  72.148  56.111  1.00 55.27 ? 472 PHE D N   1 
ATOM   3412  C CA  . PHE A 1 472 ? 40.757  72.410  56.979  1.00 55.01 ? 472 PHE D CA  1 
ATOM   3413  C C   . PHE A 1 472 ? 40.543  71.185  57.859  1.00 55.01 ? 472 PHE D C   1 
ATOM   3414  O O   . PHE A 1 472 ? 40.670  70.052  57.395  1.00 55.04 ? 472 PHE D O   1 
ATOM   3415  C CB  . PHE A 1 472 ? 39.500  72.707  56.161  1.00 54.90 ? 472 PHE D CB  1 
ATOM   3416  C CG  . PHE A 1 472 ? 38.232  72.706  56.970  1.00 54.45 ? 472 PHE D CG  1 
ATOM   3417  C CD1 . PHE A 1 472 ? 37.817  73.853  57.638  1.00 54.27 ? 472 PHE D CD1 1 
ATOM   3418  C CD2 . PHE A 1 472 ? 37.448  71.557  57.058  1.00 54.10 ? 472 PHE D CD2 1 
ATOM   3419  C CE1 . PHE A 1 472 ? 36.638  73.855  58.388  1.00 54.38 ? 472 PHE D CE1 1 
ATOM   3420  C CE2 . PHE A 1 472 ? 36.271  71.547  57.800  1.00 54.05 ? 472 PHE D CE2 1 
ATOM   3421  C CZ  . PHE A 1 472 ? 35.864  72.699  58.468  1.00 54.29 ? 472 PHE D CZ  1 
ATOM   3422  N N   . LYS A 1 473 ? 40.224  71.421  59.126  1.00 55.02 ? 473 LYS D N   1 
ATOM   3423  C CA  . LYS A 1 473 ? 40.080  70.347  60.101  1.00 54.99 ? 473 LYS D CA  1 
ATOM   3424  C C   . LYS A 1 473 ? 38.663  70.289  60.663  1.00 55.01 ? 473 LYS D C   1 
ATOM   3425  O O   . LYS A 1 473 ? 37.998  69.253  60.587  1.00 55.06 ? 473 LYS D O   1 
ATOM   3426  C CB  . LYS A 1 473 ? 41.091  70.535  61.240  1.00 54.98 ? 473 LYS D CB  1 
ATOM   3427  C CG  . LYS A 1 473 ? 41.139  69.408  62.264  1.00 55.10 ? 473 LYS D CG  1 
ATOM   3428  C CD  . LYS A 1 473 ? 42.013  68.263  61.784  1.00 55.59 ? 473 LYS D CD  1 
ATOM   3429  C CE  . LYS A 1 473 ? 42.170  67.198  62.846  1.00 55.67 ? 473 LYS D CE  1 
ATOM   3430  N NZ  . LYS A 1 473 ? 43.004  66.085  62.326  1.00 56.28 ? 473 LYS D NZ  1 
ATOM   3431  N N   . ARG A 1 474 ? 38.204  71.416  61.204  1.00 54.92 ? 474 ARG D N   1 
ATOM   3432  C CA  . ARG A 1 474 ? 37.022  71.450  62.047  1.00 54.92 ? 474 ARG D CA  1 
ATOM   3433  C C   . ARG A 1 474 ? 36.579  72.891  62.252  1.00 54.82 ? 474 ARG D C   1 
ATOM   3434  O O   . ARG A 1 474 ? 37.406  73.802  62.294  1.00 54.96 ? 474 ARG D O   1 
ATOM   3435  C CB  . ARG A 1 474 ? 37.382  70.856  63.410  1.00 55.00 ? 474 ARG D CB  1 
ATOM   3436  C CG  . ARG A 1 474 ? 36.222  70.379  64.264  1.00 55.53 ? 474 ARG D CG  1 
ATOM   3437  C CD  . ARG A 1 474 ? 36.532  70.512  65.765  1.00 56.81 ? 474 ARG D CD  1 
ATOM   3438  N NE  . ARG A 1 474 ? 37.906  70.132  66.119  1.00 57.45 ? 474 ARG D NE  1 
ATOM   3439  C CZ  . ARG A 1 474 ? 38.890  70.993  66.385  1.00 57.51 ? 474 ARG D CZ  1 
ATOM   3440  N NH1 . ARG A 1 474 ? 38.673  72.300  66.339  1.00 57.79 ? 474 ARG D NH1 1 
ATOM   3441  N NH2 . ARG A 1 474 ? 40.099  70.546  66.693  1.00 57.38 ? 474 ARG D NH2 1 
ATOM   3442  N N   . PHE A 1 475 ? 35.273  73.096  62.381  1.00 54.56 ? 475 PHE D N   1 
ATOM   3443  C CA  . PHE A 1 475 ? 34.760  74.347  62.914  1.00 54.26 ? 475 PHE D CA  1 
ATOM   3444  C C   . PHE A 1 475 ? 34.690  74.205  64.431  1.00 54.15 ? 475 PHE D C   1 
ATOM   3445  O O   . PHE A 1 475 ? 34.376  73.129  64.944  1.00 54.12 ? 475 PHE D O   1 
ATOM   3446  C CB  . PHE A 1 475 ? 33.373  74.662  62.349  1.00 54.21 ? 475 PHE D CB  1 
ATOM   3447  C CG  . PHE A 1 475 ? 33.379  75.094  60.908  1.00 53.99 ? 475 PHE D CG  1 
ATOM   3448  C CD1 . PHE A 1 475 ? 32.924  74.240  59.913  1.00 53.53 ? 475 PHE D CD1 1 
ATOM   3449  C CD2 . PHE A 1 475 ? 33.821  76.364  60.546  1.00 54.32 ? 475 PHE D CD2 1 
ATOM   3450  C CE1 . PHE A 1 475 ? 32.915  74.640  58.577  1.00 53.59 ? 475 PHE D CE1 1 
ATOM   3451  C CE2 . PHE A 1 475 ? 33.819  76.772  59.209  1.00 54.05 ? 475 PHE D CE2 1 
ATOM   3452  C CZ  . PHE A 1 475 ? 33.366  75.905  58.225  1.00 53.72 ? 475 PHE D CZ  1 
ATOM   3453  N N   . GLN A 1 476 ? 34.996  75.282  65.149  1.00 54.07 ? 476 GLN D N   1 
ATOM   3454  C CA  . GLN A 1 476 ? 34.901  75.271  66.610  1.00 54.01 ? 476 GLN D CA  1 
ATOM   3455  C C   . GLN A 1 476 ? 34.422  76.602  67.175  1.00 53.66 ? 476 GLN D C   1 
ATOM   3456  O O   . GLN A 1 476 ? 34.811  77.666  66.692  1.00 53.67 ? 476 GLN D O   1 
ATOM   3457  C CB  . GLN A 1 476 ? 36.232  74.863  67.249  1.00 54.16 ? 476 GLN D CB  1 
ATOM   3458  C CG  . GLN A 1 476 ? 36.084  74.348  68.683  1.00 54.94 ? 476 GLN D CG  1 
ATOM   3459  C CD  . GLN A 1 476 ? 37.180  73.376  69.080  1.00 55.96 ? 476 GLN D CD  1 
ATOM   3460  O OE1 . GLN A 1 476 ? 38.348  73.554  68.727  1.00 56.56 ? 476 GLN D OE1 1 
ATOM   3461  N NE2 . GLN A 1 476 ? 36.806  72.338  69.823  1.00 56.13 ? 476 GLN D NE2 1 
ATOM   3462  N N   . ALA A 1 477 ? 33.575  76.521  68.200  1.00 53.31 ? 477 ALA D N   1 
ATOM   3463  C CA  . ALA A 1 477 ? 32.998  77.690  68.861  1.00 52.98 ? 477 ALA D CA  1 
ATOM   3464  C C   . ALA A 1 477 ? 34.077  78.594  69.443  1.00 52.76 ? 477 ALA D C   1 
ATOM   3465  O O   . ALA A 1 477 ? 34.998  78.124  70.116  1.00 52.71 ? 477 ALA D O   1 
ATOM   3466  C CB  . ALA A 1 477 ? 32.040  77.248  69.946  1.00 53.04 ? 477 ALA D CB  1 
ATOM   3467  N N   . SER A 1 478 ? 33.962  79.891  69.177  1.00 52.46 ? 478 SER D N   1 
ATOM   3468  C CA  . SER A 1 478 ? 34.971  80.844  69.621  1.00 52.26 ? 478 SER D CA  1 
ATOM   3469  C C   . SER A 1 478 ? 34.408  82.250  69.819  1.00 52.02 ? 478 SER D C   1 
ATOM   3470  O O   . SER A 1 478 ? 33.490  82.666  69.108  1.00 52.00 ? 478 SER D O   1 
ATOM   3471  C CB  . SER A 1 478 ? 36.134  80.872  68.630  1.00 52.23 ? 478 SER D CB  1 
ATOM   3472  O OG  . SER A 1 478 ? 37.286  81.442  69.224  1.00 52.53 ? 478 SER D OG  1 
ATOM   3473  N N   . ASP A 1 479 ? 34.968  82.971  70.790  1.00 51.71 ? 479 ASP D N   1 
ATOM   3474  C CA  . ASP A 1 479 ? 34.554  84.338  71.098  1.00 51.42 ? 479 ASP D CA  1 
ATOM   3475  C C   . ASP A 1 479 ? 35.067  85.302  70.027  1.00 51.46 ? 479 ASP D C   1 
ATOM   3476  O O   . ASP A 1 479 ? 36.099  85.964  70.194  1.00 51.47 ? 479 ASP D O   1 
ATOM   3477  C CB  . ASP A 1 479 ? 35.037  84.744  72.493  1.00 51.29 ? 479 ASP D CB  1 
ATOM   3478  C CG  . ASP A 1 479 ? 34.463  86.069  72.950  1.00 50.97 ? 479 ASP D CG  1 
ATOM   3479  O OD1 . ASP A 1 479 ? 34.998  86.638  73.922  1.00 50.54 ? 479 ASP D OD1 1 
ATOM   3480  O OD2 . ASP A 1 479 ? 33.483  86.546  72.341  1.00 50.64 ? 479 ASP D OD2 1 
ATOM   3481  N N   . MET A 1 480 ? 34.318  85.371  68.930  1.00 51.42 ? 480 MET D N   1 
ATOM   3482  C CA  . MET A 1 480 ? 34.716  86.093  67.729  1.00 51.33 ? 480 MET D CA  1 
ATOM   3483  C C   . MET A 1 480 ? 33.836  87.331  67.559  1.00 51.32 ? 480 MET D C   1 
ATOM   3484  O O   . MET A 1 480 ? 32.615  87.255  67.725  1.00 51.42 ? 480 MET D O   1 
ATOM   3485  C CB  . MET A 1 480 ? 34.566  85.158  66.527  1.00 51.25 ? 480 MET D CB  1 
ATOM   3486  C CG  . MET A 1 480 ? 35.664  85.246  65.483  1.00 51.43 ? 480 MET D CG  1 
ATOM   3487  S SD  . MET A 1 480 ? 37.332  84.894  66.078  1.00 51.60 ? 480 MET D SD  1 
ATOM   3488  C CE  . MET A 1 480 ? 37.110  83.295  66.820  1.00 51.29 ? 480 MET D CE  1 
ATOM   3489  N N   . VAL A 1 481 ? 34.451  88.472  67.249  1.00 51.19 ? 481 VAL D N   1 
ATOM   3490  C CA  . VAL A 1 481 ? 33.695  89.721  67.073  1.00 51.11 ? 481 VAL D CA  1 
ATOM   3491  C C   . VAL A 1 481 ? 33.896  90.358  65.708  1.00 51.18 ? 481 VAL D C   1 
ATOM   3492  O O   . VAL A 1 481 ? 34.830  90.024  64.976  1.00 51.36 ? 481 VAL D O   1 
ATOM   3493  C CB  . VAL A 1 481 ? 34.004  90.786  68.158  1.00 51.02 ? 481 VAL D CB  1 
ATOM   3494  C CG1 . VAL A 1 481 ? 33.426  90.372  69.502  1.00 51.22 ? 481 VAL D CG1 1 
ATOM   3495  C CG2 . VAL A 1 481 ? 35.499  91.061  68.250  1.00 50.92 ? 481 VAL D CG2 1 
ATOM   3496  N N   . ARG A 1 482 ? 33.011  91.292  65.385  1.00 51.08 ? 482 ARG D N   1 
ATOM   3497  C CA  . ARG A 1 482 ? 33.057  91.988  64.116  1.00 50.93 ? 482 ARG D CA  1 
ATOM   3498  C C   . ARG A 1 482 ? 33.579  93.394  64.320  1.00 50.76 ? 482 ARG D C   1 
ATOM   3499  O O   . ARG A 1 482 ? 33.138  94.105  65.220  1.00 50.74 ? 482 ARG D O   1 
ATOM   3500  C CB  . ARG A 1 482 ? 31.664  92.026  63.497  1.00 50.96 ? 482 ARG D CB  1 
ATOM   3501  C CG  . ARG A 1 482 ? 31.596  92.681  62.140  1.00 51.08 ? 482 ARG D CG  1 
ATOM   3502  C CD  . ARG A 1 482 ? 30.334  92.248  61.438  1.00 51.42 ? 482 ARG D CD  1 
ATOM   3503  N NE  . ARG A 1 482 ? 29.862  93.244  60.483  1.00 51.23 ? 482 ARG D NE  1 
ATOM   3504  C CZ  . ARG A 1 482 ? 28.675  93.834  60.542  1.00 50.80 ? 482 ARG D CZ  1 
ATOM   3505  N NH1 . ARG A 1 482 ? 27.819  93.523  61.507  1.00 50.15 ? 482 ARG D NH1 1 
ATOM   3506  N NH2 . ARG A 1 482 ? 28.340  94.728  59.621  1.00 51.25 ? 482 ARG D NH2 1 
ATOM   3507  N N   . VAL A 1 483 ? 34.529  93.780  63.479  1.00 50.67 ? 483 VAL D N   1 
ATOM   3508  C CA  . VAL A 1 483 ? 35.039  95.140  63.469  1.00 50.59 ? 483 VAL D CA  1 
ATOM   3509  C C   . VAL A 1 483 ? 34.559  95.828  62.196  1.00 50.74 ? 483 VAL D C   1 
ATOM   3510  O O   . VAL A 1 483 ? 34.903  95.409  61.089  1.00 50.71 ? 483 VAL D O   1 
ATOM   3511  C CB  . VAL A 1 483 ? 36.586  95.171  63.558  1.00 50.49 ? 483 VAL D CB  1 
ATOM   3512  C CG1 . VAL A 1 483 ? 37.109  96.604  63.528  1.00 50.29 ? 483 VAL D CG1 1 
ATOM   3513  C CG2 . VAL A 1 483 ? 37.066  94.453  64.809  1.00 50.26 ? 483 VAL D CG2 1 
ATOM   3514  N N   . ASP A 1 484 ? 33.749  96.871  62.359  1.00 50.96 ? 484 ASP D N   1 
ATOM   3515  C CA  . ASP A 1 484 ? 33.295  97.680  61.227  1.00 51.24 ? 484 ASP D CA  1 
ATOM   3516  C C   . ASP A 1 484 ? 34.208  98.880  60.998  1.00 51.32 ? 484 ASP D C   1 
ATOM   3517  O O   . ASP A 1 484 ? 34.632  99.535  61.948  1.00 51.26 ? 484 ASP D O   1 
ATOM   3518  C CB  . ASP A 1 484 ? 31.859  98.154  61.442  1.00 51.20 ? 484 ASP D CB  1 
ATOM   3519  C CG  . ASP A 1 484 ? 30.858  97.029  61.337  1.00 51.55 ? 484 ASP D CG  1 
ATOM   3520  O OD1 . ASP A 1 484 ? 30.723  96.445  60.240  1.00 51.70 ? 484 ASP D OD1 1 
ATOM   3521  O OD2 . ASP A 1 484 ? 30.200  96.732  62.355  1.00 52.41 ? 484 ASP D OD2 1 
ATOM   3522  N N   . VAL A 1 485 ? 34.509  99.152  59.730  1.00 51.55 ? 485 VAL D N   1 
ATOM   3523  C CA  . VAL A 1 485 ? 35.317  100.313 59.348  1.00 51.63 ? 485 VAL D CA  1 
ATOM   3524  C C   . VAL A 1 485 ? 34.435  101.326 58.631  1.00 51.86 ? 485 VAL D C   1 
ATOM   3525  O O   . VAL A 1 485 ? 33.688  100.973 57.715  1.00 51.95 ? 485 VAL D O   1 
ATOM   3526  C CB  . VAL A 1 485 ? 36.490  99.934  58.405  1.00 51.45 ? 485 VAL D CB  1 
ATOM   3527  C CG1 . VAL A 1 485 ? 37.525  101.040 58.374  1.00 51.44 ? 485 VAL D CG1 1 
ATOM   3528  C CG2 . VAL A 1 485 ? 37.139  98.645  58.837  1.00 51.27 ? 485 VAL D CG2 1 
ATOM   3529  N N   . LEU A 1 486 ? 34.513  102.582 59.055  1.00 52.14 ? 486 LEU D N   1 
ATOM   3530  C CA  . LEU A 1 486 ? 33.879  103.661 58.308  1.00 52.56 ? 486 LEU D CA  1 
ATOM   3531  C C   . LEU A 1 486 ? 34.817  104.844 58.119  1.00 52.72 ? 486 LEU D C   1 
ATOM   3532  O O   . LEU A 1 486 ? 35.514  105.252 59.047  1.00 52.82 ? 486 LEU D O   1 
ATOM   3533  C CB  . LEU A 1 486 ? 32.549  104.095 58.938  1.00 52.63 ? 486 LEU D CB  1 
ATOM   3534  C CG  . LEU A 1 486 ? 32.462  104.459 60.418  1.00 53.15 ? 486 LEU D CG  1 
ATOM   3535  C CD1 . LEU A 1 486 ? 31.576  105.680 60.598  1.00 53.67 ? 486 LEU D CD1 1 
ATOM   3536  C CD2 . LEU A 1 486 ? 31.962  103.277 61.256  1.00 53.69 ? 486 LEU D CD2 1 
ATOM   3537  N N   . ILE A 1 487 ? 34.847  105.371 56.898  1.00 53.05 ? 487 ILE D N   1 
ATOM   3538  C CA  . ILE A 1 487 ? 35.653  106.553 56.589  1.00 53.38 ? 487 ILE D CA  1 
ATOM   3539  C C   . ILE A 1 487 ? 34.806  107.640 55.915  1.00 53.46 ? 487 ILE D C   1 
ATOM   3540  O O   . ILE A 1 487 ? 34.007  107.348 55.018  1.00 53.40 ? 487 ILE D O   1 
ATOM   3541  C CB  . ILE A 1 487 ? 36.950  106.208 55.795  1.00 53.36 ? 487 ILE D CB  1 
ATOM   3542  C CG1 . ILE A 1 487 ? 36.663  105.896 54.335  1.00 53.29 ? 487 ILE D CG1 1 
ATOM   3543  C CG2 . ILE A 1 487 ? 37.665  105.009 56.416  1.00 53.91 ? 487 ILE D CG2 1 
ATOM   3544  C CD1 . ILE A 1 487 ? 37.913  105.583 53.552  1.00 53.42 ? 487 ILE D CD1 1 
ATOM   3545  N N   . ASN A 1 488 ? 34.982  108.881 56.377  1.00 53.63 ? 488 ASN D N   1 
ATOM   3546  C CA  . ASN A 1 488 ? 34.088  110.003 56.052  1.00 53.70 ? 488 ASN D CA  1 
ATOM   3547  C C   . ASN A 1 488 ? 32.614  109.674 56.294  1.00 53.81 ? 488 ASN D C   1 
ATOM   3548  O O   . ASN A 1 488 ? 31.752  109.992 55.472  1.00 53.81 ? 488 ASN D O   1 
ATOM   3549  C CB  . ASN A 1 488 ? 34.304  110.500 54.619  1.00 53.72 ? 488 ASN D CB  1 
ATOM   3550  C CG  . ASN A 1 488 ? 35.619  111.228 54.445  1.00 53.72 ? 488 ASN D CG  1 
ATOM   3551  O OD1 . ASN A 1 488 ? 36.282  111.583 55.417  1.00 54.21 ? 488 ASN D OD1 1 
ATOM   3552  N ND2 . ASN A 1 488 ? 36.001  111.458 53.197  1.00 53.79 ? 488 ASN D ND2 1 
ATOM   3553  N N   . GLY A 1 489 ? 32.342  109.027 57.426  1.00 54.00 ? 489 GLY D N   1 
ATOM   3554  C CA  . GLY A 1 489 ? 30.990  108.626 57.799  1.00 54.18 ? 489 GLY D CA  1 
ATOM   3555  C C   . GLY A 1 489 ? 30.491  107.380 57.089  1.00 54.43 ? 489 GLY D C   1 
ATOM   3556  O O   . GLY A 1 489 ? 29.580  106.713 57.581  1.00 54.50 ? 489 GLY D O   1 
ATOM   3557  N N   . GLU A 1 490 ? 31.093  107.060 55.942  1.00 54.62 ? 490 GLU D N   1 
ATOM   3558  C CA  . GLU A 1 490 ? 30.619  105.977 55.072  1.00 54.92 ? 490 GLU D CA  1 
ATOM   3559  C C   . GLU A 1 490 ? 31.046  104.593 55.545  1.00 54.84 ? 490 GLU D C   1 
ATOM   3560  O O   . GLU A 1 490 ? 32.232  104.311 55.682  1.00 54.89 ? 490 GLU D O   1 
ATOM   3561  C CB  . GLU A 1 490 ? 31.067  106.199 53.623  1.00 54.98 ? 490 GLU D CB  1 
ATOM   3562  C CG  . GLU A 1 490 ? 30.449  107.426 52.946  1.00 56.01 ? 490 GLU D CG  1 
ATOM   3563  C CD  . GLU A 1 490 ? 29.110  107.141 52.266  1.00 57.29 ? 490 GLU D CD  1 
ATOM   3564  O OE1 . GLU A 1 490 ? 29.023  107.332 51.031  1.00 57.50 ? 490 GLU D OE1 1 
ATOM   3565  O OE2 . GLU A 1 490 ? 28.143  106.736 52.957  1.00 58.06 ? 490 GLU D OE2 1 
ATOM   3566  N N   . ARG A 1 491 ? 30.054  103.738 55.774  1.00 54.88 ? 491 ARG D N   1 
ATOM   3567  C CA  . ARG A 1 491 ? 30.248  102.378 56.264  1.00 54.90 ? 491 ARG D CA  1 
ATOM   3568  C C   . ARG A 1 491 ? 30.847  101.502 55.167  1.00 54.56 ? 491 ARG D C   1 
ATOM   3569  O O   . ARG A 1 491 ? 30.135  101.035 54.277  1.00 54.68 ? 491 ARG D O   1 
ATOM   3570  C CB  . ARG A 1 491 ? 28.897  101.823 56.725  1.00 54.88 ? 491 ARG D CB  1 
ATOM   3571  C CG  . ARG A 1 491 ? 28.922  100.491 57.460  1.00 55.37 ? 491 ARG D CG  1 
ATOM   3572  C CD  . ARG A 1 491 ? 27.480  100.020 57.703  1.00 55.51 ? 491 ARG D CD  1 
ATOM   3573  N NE  . ARG A 1 491 ? 27.374  98.960  58.708  1.00 56.75 ? 491 ARG D NE  1 
ATOM   3574  C CZ  . ARG A 1 491 ? 27.365  99.160  60.027  1.00 57.05 ? 491 ARG D CZ  1 
ATOM   3575  N NH1 . ARG A 1 491 ? 27.470  100.386 60.533  1.00 56.87 ? 491 ARG D NH1 1 
ATOM   3576  N NH2 . ARG A 1 491 ? 27.257  98.123  60.848  1.00 57.22 ? 491 ARG D NH2 1 
ATOM   3577  N N   . VAL A 1 492 ? 32.159  101.292 55.227  1.00 54.28 ? 492 VAL D N   1 
ATOM   3578  C CA  . VAL A 1 492 ? 32.851  100.500 54.206  1.00 54.02 ? 492 VAL D CA  1 
ATOM   3579  C C   . VAL A 1 492 ? 32.827  99.013  54.571  1.00 53.83 ? 492 VAL D C   1 
ATOM   3580  O O   . VAL A 1 492 ? 33.597  98.553  55.419  1.00 53.75 ? 492 VAL D O   1 
ATOM   3581  C CB  . VAL A 1 492 ? 34.306  100.986 53.955  1.00 53.94 ? 492 VAL D CB  1 
ATOM   3582  C CG1 . VAL A 1 492 ? 34.874  100.331 52.705  1.00 54.02 ? 492 VAL D CG1 1 
ATOM   3583  C CG2 . VAL A 1 492 ? 34.358  102.503 53.815  1.00 53.87 ? 492 VAL D CG2 1 
ATOM   3584  N N   . ASP A 1 493 ? 31.933  98.277  53.915  1.00 53.59 ? 493 ASP D N   1 
ATOM   3585  C CA  . ASP A 1 493 ? 31.699  96.867  54.214  1.00 53.40 ? 493 ASP D CA  1 
ATOM   3586  C C   . ASP A 1 493 ? 32.870  95.970  53.815  1.00 53.22 ? 493 ASP D C   1 
ATOM   3587  O O   . ASP A 1 493 ? 33.255  95.074  54.566  1.00 52.99 ? 493 ASP D O   1 
ATOM   3588  C CB  . ASP A 1 493 ? 30.405  96.390  53.537  1.00 53.49 ? 493 ASP D CB  1 
ATOM   3589  C CG  . ASP A 1 493 ? 29.158  97.072  54.094  1.00 53.27 ? 493 ASP D CG  1 
ATOM   3590  O OD1 . ASP A 1 493 ? 29.132  97.424  55.295  1.00 53.08 ? 493 ASP D OD1 1 
ATOM   3591  O OD2 . ASP A 1 493 ? 28.194  97.249  53.323  1.00 52.97 ? 493 ASP D OD2 1 
ATOM   3592  N N   . ALA A 1 494 ? 33.430  96.231  52.636  1.00 53.22 ? 494 ALA D N   1 
ATOM   3593  C CA  . ALA A 1 494 ? 34.549  95.459  52.080  1.00 53.28 ? 494 ALA D CA  1 
ATOM   3594  C C   . ALA A 1 494 ? 35.778  95.441  52.986  1.00 53.18 ? 494 ALA D C   1 
ATOM   3595  O O   . ALA A 1 494 ? 36.684  94.617  52.814  1.00 53.12 ? 494 ALA D O   1 
ATOM   3596  C CB  . ALA A 1 494 ? 34.932  96.016  50.717  1.00 53.31 ? 494 ALA D CB  1 
ATOM   3597  N N   . LEU A 1 495 ? 35.789  96.353  53.951  1.00 53.06 ? 495 LEU D N   1 
ATOM   3598  C CA  . LEU A 1 495 ? 36.959  96.625  54.764  1.00 52.95 ? 495 LEU D CA  1 
ATOM   3599  C C   . LEU A 1 495 ? 36.806  96.054  56.172  1.00 53.16 ? 495 LEU D C   1 
ATOM   3600  O O   . LEU A 1 495 ? 37.754  96.069  56.964  1.00 53.21 ? 495 LEU D O   1 
ATOM   3601  C CB  . LEU A 1 495 ? 37.169  98.135  54.813  1.00 52.73 ? 495 LEU D CB  1 
ATOM   3602  C CG  . LEU A 1 495 ? 38.560  98.754  54.709  1.00 52.25 ? 495 LEU D CG  1 
ATOM   3603  C CD1 . LEU A 1 495 ? 39.489  98.006  53.757  1.00 51.64 ? 495 LEU D CD1 1 
ATOM   3604  C CD2 . LEU A 1 495 ? 38.387  100.194 54.276  1.00 51.72 ? 495 LEU D CD2 1 
ATOM   3605  N N   . ALA A 1 496 ? 35.611  95.543  56.467  1.00 53.37 ? 496 ALA D N   1 
ATOM   3606  C CA  . ALA A 1 496 ? 35.291  94.965  57.770  1.00 53.56 ? 496 ALA D CA  1 
ATOM   3607  C C   . ALA A 1 496 ? 35.959  93.609  57.962  1.00 53.77 ? 496 ALA D C   1 
ATOM   3608  O O   . ALA A 1 496 ? 36.325  92.947  56.993  1.00 53.79 ? 496 ALA D O   1 
ATOM   3609  C CB  . ALA A 1 496 ? 33.787  94.840  57.929  1.00 53.59 ? 496 ALA D CB  1 
ATOM   3610  N N   . LEU A 1 497 ? 36.121  93.202  59.217  1.00 54.13 ? 497 LEU D N   1 
ATOM   3611  C CA  . LEU A 1 497 ? 36.727  91.905  59.530  1.00 54.43 ? 497 LEU D CA  1 
ATOM   3612  C C   . LEU A 1 497 ? 36.084  91.198  60.725  1.00 54.41 ? 497 LEU D C   1 
ATOM   3613  O O   . LEU A 1 497 ? 35.345  91.808  61.507  1.00 54.54 ? 497 LEU D O   1 
ATOM   3614  C CB  . LEU A 1 497 ? 38.248  92.038  59.733  1.00 54.46 ? 497 LEU D CB  1 
ATOM   3615  C CG  . LEU A 1 497 ? 38.842  92.941  60.824  1.00 54.59 ? 497 LEU D CG  1 
ATOM   3616  C CD1 . LEU A 1 497 ? 38.669  92.346  62.202  1.00 54.53 ? 497 LEU D CD1 1 
ATOM   3617  C CD2 . LEU A 1 497 ? 40.323  93.174  60.559  1.00 54.80 ? 497 LEU D CD2 1 
ATOM   3618  N N   . ILE A 1 498 ? 36.372  89.903  60.842  1.00 54.37 ? 498 ILE D N   1 
ATOM   3619  C CA  . ILE A 1 498 ? 35.995  89.109  62.006  1.00 54.15 ? 498 ILE D CA  1 
ATOM   3620  C C   . ILE A 1 498 ? 37.291  88.667  62.687  1.00 54.24 ? 498 ILE D C   1 
ATOM   3621  O O   . ILE A 1 498 ? 38.206  88.169  62.025  1.00 54.22 ? 498 ILE D O   1 
ATOM   3622  C CB  . ILE A 1 498 ? 35.107  87.889  61.624  1.00 54.16 ? 498 ILE D CB  1 
ATOM   3623  C CG1 . ILE A 1 498 ? 33.976  88.321  60.680  1.00 54.07 ? 498 ILE D CG1 1 
ATOM   3624  C CG2 . ILE A 1 498 ? 34.528  87.235  62.868  1.00 54.02 ? 498 ILE D CG2 1 
ATOM   3625  C CD1 . ILE A 1 498 ? 33.048  87.213  60.235  1.00 53.86 ? 498 ILE D CD1 1 
ATOM   3626  N N   . THR A 1 499 ? 37.374  88.883  64.000  1.00 54.30 ? 499 THR D N   1 
ATOM   3627  C CA  . THR A 1 499 ? 38.580  88.569  64.774  1.00 54.35 ? 499 THR D CA  1 
ATOM   3628  C C   . THR A 1 499 ? 38.264  88.244  66.245  1.00 54.60 ? 499 THR D C   1 
ATOM   3629  O O   . THR A 1 499 ? 37.169  88.546  66.741  1.00 54.49 ? 499 THR D O   1 
ATOM   3630  C CB  . THR A 1 499 ? 39.651  89.704  64.661  1.00 54.30 ? 499 THR D CB  1 
ATOM   3631  O OG1 . THR A 1 499 ? 40.929  89.219  65.091  1.00 54.10 ? 499 THR D OG1 1 
ATOM   3632  C CG2 . THR A 1 499 ? 39.259  90.932  65.482  1.00 53.99 ? 499 THR D CG2 1 
ATOM   3633  N N   . HIS A 1 500 ? 39.229  87.623  66.926  1.00 54.80 ? 500 HIS D N   1 
ATOM   3634  C CA  . HIS A 1 500 ? 39.068  87.188  68.315  1.00 54.98 ? 500 HIS D CA  1 
ATOM   3635  C C   . HIS A 1 500 ? 39.194  88.351  69.301  1.00 55.11 ? 500 HIS D C   1 
ATOM   3636  O O   . HIS A 1 500 ? 40.105  89.177  69.187  1.00 55.27 ? 500 HIS D O   1 
ATOM   3637  C CB  . HIS A 1 500 ? 40.083  86.088  68.641  1.00 55.00 ? 500 HIS D CB  1 
ATOM   3638  C CG  . HIS A 1 500 ? 39.903  85.478  69.997  1.00 55.31 ? 500 HIS D CG  1 
ATOM   3639  N ND1 . HIS A 1 500 ? 38.906  84.567  70.278  1.00 55.41 ? 500 HIS D ND1 1 
ATOM   3640  C CD2 . HIS A 1 500 ? 40.595  85.644  71.148  1.00 55.20 ? 500 HIS D CD2 1 
ATOM   3641  C CE1 . HIS A 1 500 ? 38.987  84.203  71.545  1.00 55.07 ? 500 HIS D CE1 1 
ATOM   3642  N NE2 . HIS A 1 500 ? 40.004  84.842  72.095  1.00 55.37 ? 500 HIS D NE2 1 
ATOM   3643  N N   . ARG A 1 501 ? 38.278  88.397  70.270  1.00 55.12 ? 501 ARG D N   1 
ATOM   3644  C CA  . ARG A 1 501 ? 38.212  89.483  71.256  1.00 55.11 ? 501 ARG D CA  1 
ATOM   3645  C C   . ARG A 1 501 ? 39.556  89.934  71.800  1.00 55.30 ? 501 ARG D C   1 
ATOM   3646  O O   . ARG A 1 501 ? 39.889  91.114  71.729  1.00 55.32 ? 501 ARG D O   1 
ATOM   3647  C CB  . ARG A 1 501 ? 37.323  89.099  72.440  1.00 55.00 ? 501 ARG D CB  1 
ATOM   3648  C CG  . ARG A 1 501 ? 35.907  89.543  72.285  1.00 54.46 ? 501 ARG D CG  1 
ATOM   3649  C CD  . ARG A 1 501 ? 35.298  89.977  73.606  1.00 52.95 ? 501 ARG D CD  1 
ATOM   3650  N NE  . ARG A 1 501 ? 34.133  90.813  73.341  1.00 52.00 ? 501 ARG D NE  1 
ATOM   3651  C CZ  . ARG A 1 501 ? 32.927  90.345  73.034  1.00 51.15 ? 501 ARG D CZ  1 
ATOM   3652  N NH1 . ARG A 1 501 ? 32.708  89.039  72.972  1.00 50.30 ? 501 ARG D NH1 1 
ATOM   3653  N NH2 . ARG A 1 501 ? 31.937  91.189  72.789  1.00 51.16 ? 501 ARG D NH2 1 
ATOM   3654  N N   . ASP A 1 502 ? 40.319  88.981  72.332  1.00 55.56 ? 502 ASP D N   1 
ATOM   3655  C CA  . ASP A 1 502 ? 41.520  89.265  73.123  1.00 55.69 ? 502 ASP D CA  1 
ATOM   3656  C C   . ASP A 1 502 ? 42.515  90.207  72.443  1.00 55.88 ? 502 ASP D C   1 
ATOM   3657  O O   . ASP A 1 502 ? 43.270  90.900  73.124  1.00 55.93 ? 502 ASP D O   1 
ATOM   3658  C CB  . ASP A 1 502 ? 42.194  87.961  73.577  1.00 55.55 ? 502 ASP D CB  1 
ATOM   3659  C CG  . ASP A 1 502 ? 41.385  87.220  74.644  1.00 55.57 ? 502 ASP D CG  1 
ATOM   3660  O OD1 . ASP A 1 502 ? 40.137  87.184  74.562  1.00 55.13 ? 502 ASP D OD1 1 
ATOM   3661  O OD2 . ASP A 1 502 ? 42.003  86.662  75.575  1.00 56.01 ? 502 ASP D OD2 1 
ATOM   3662  N N   . ASN A 1 503 ? 42.498  90.248  71.112  1.00 56.13 ? 503 ASN D N   1 
ATOM   3663  C CA  . ASN A 1 503 ? 43.267  91.249  70.368  1.00 56.45 ? 503 ASN D CA  1 
ATOM   3664  C C   . ASN A 1 503 ? 42.476  91.916  69.240  1.00 56.54 ? 503 ASN D C   1 
ATOM   3665  O O   . ASN A 1 503 ? 43.039  92.286  68.208  1.00 56.63 ? 503 ASN D O   1 
ATOM   3666  C CB  . ASN A 1 503 ? 44.589  90.664  69.855  1.00 56.56 ? 503 ASN D CB  1 
ATOM   3667  C CG  . ASN A 1 503 ? 45.711  90.764  70.880  1.00 57.02 ? 503 ASN D CG  1 
ATOM   3668  O OD1 . ASN A 1 503 ? 45.965  89.821  71.635  1.00 57.46 ? 503 ASN D OD1 1 
ATOM   3669  N ND2 . ASN A 1 503 ? 46.382  91.915  70.918  1.00 57.30 ? 503 ASN D ND2 1 
ATOM   3670  N N   . SER A 1 504 ? 41.168  92.066  69.456  1.00 56.71 ? 504 SER D N   1 
ATOM   3671  C CA  . SER A 1 504 ? 40.275  92.768  68.527  1.00 56.77 ? 504 SER D CA  1 
ATOM   3672  C C   . SER A 1 504 ? 40.537  94.274  68.502  1.00 57.01 ? 504 SER D C   1 
ATOM   3673  O O   . SER A 1 504 ? 40.350  94.925  67.473  1.00 56.97 ? 504 SER D O   1 
ATOM   3674  C CB  . SER A 1 504 ? 38.814  92.504  68.889  1.00 56.75 ? 504 SER D CB  1 
ATOM   3675  O OG  . SER A 1 504 ? 38.532  92.915  70.216  1.00 56.25 ? 504 SER D OG  1 
ATOM   3676  N N   . GLN A 1 505 ? 40.948  94.813  69.650  1.00 57.30 ? 505 GLN D N   1 
ATOM   3677  C CA  . GLN A 1 505 ? 41.431  96.186  69.761  1.00 57.61 ? 505 GLN D CA  1 
ATOM   3678  C C   . GLN A 1 505 ? 42.666  96.376  68.887  1.00 57.63 ? 505 GLN D C   1 
ATOM   3679  O O   . GLN A 1 505 ? 42.805  97.388  68.202  1.00 57.64 ? 505 GLN D O   1 
ATOM   3680  C CB  . GLN A 1 505 ? 41.768  96.499  71.225  1.00 57.77 ? 505 GLN D CB  1 
ATOM   3681  C CG  . GLN A 1 505 ? 42.653  97.729  71.465  1.00 58.59 ? 505 GLN D CG  1 
ATOM   3682  C CD  . GLN A 1 505 ? 41.890  99.046  71.373  1.00 59.69 ? 505 GLN D CD  1 
ATOM   3683  O OE1 . GLN A 1 505 ? 41.404  99.430  70.304  1.00 59.91 ? 505 GLN D OE1 1 
ATOM   3684  N NE2 . GLN A 1 505 ? 41.797  99.751  72.496  1.00 59.62 ? 505 GLN D NE2 1 
ATOM   3685  N N   . ASN A 1 506 ? 43.553  95.386  68.920  1.00 57.73 ? 506 ASN D N   1 
ATOM   3686  C CA  . ASN A 1 506 ? 44.798  95.416  68.173  1.00 57.87 ? 506 ASN D CA  1 
ATOM   3687  C C   . ASN A 1 506 ? 44.551  95.478  66.666  1.00 57.96 ? 506 ASN D C   1 
ATOM   3688  O O   . ASN A 1 506 ? 45.092  96.346  65.979  1.00 58.06 ? 506 ASN D O   1 
ATOM   3689  C CB  . ASN A 1 506 ? 45.644  94.189  68.525  1.00 57.96 ? 506 ASN D CB  1 
ATOM   3690  C CG  . ASN A 1 506 ? 47.116  94.518  68.707  1.00 58.00 ? 506 ASN D CG  1 
ATOM   3691  O OD1 . ASN A 1 506 ? 47.722  94.140  69.711  1.00 57.88 ? 506 ASN D OD1 1 
ATOM   3692  N ND2 . ASN A 1 506 ? 47.698  95.222  67.739  1.00 58.08 ? 506 ASN D ND2 1 
ATOM   3693  N N   . ARG A 1 507 ? 43.716  94.566  66.167  1.00 57.99 ? 507 ARG D N   1 
ATOM   3694  C CA  . ARG A 1 507 ? 43.376  94.500  64.745  1.00 57.93 ? 507 ARG D CA  1 
ATOM   3695  C C   . ARG A 1 507 ? 42.679  95.759  64.222  1.00 57.59 ? 507 ARG D C   1 
ATOM   3696  O O   . ARG A 1 507 ? 42.786  96.082  63.040  1.00 57.72 ? 507 ARG D O   1 
ATOM   3697  C CB  . ARG A 1 507 ? 42.538  93.248  64.451  1.00 58.18 ? 507 ARG D CB  1 
ATOM   3698  C CG  . ARG A 1 507 ? 43.295  92.106  63.741  1.00 59.43 ? 507 ARG D CG  1 
ATOM   3699  C CD  . ARG A 1 507 ? 44.613  91.717  64.435  1.00 61.19 ? 507 ARG D CD  1 
ATOM   3700  N NE  . ARG A 1 507 ? 44.408  91.041  65.719  1.00 62.40 ? 507 ARG D NE  1 
ATOM   3701  C CZ  . ARG A 1 507 ? 44.339  89.718  65.873  1.00 62.94 ? 507 ARG D CZ  1 
ATOM   3702  N NH1 . ARG A 1 507 ? 44.456  88.909  64.820  1.00 62.64 ? 507 ARG D NH1 1 
ATOM   3703  N NH2 . ARG A 1 507 ? 44.150  89.200  67.084  1.00 62.47 ? 507 ARG D NH2 1 
ATOM   3704  N N   . GLY A 1 508 ? 41.976  96.465  65.104  1.00 57.24 ? 508 GLY D N   1 
ATOM   3705  C CA  . GLY A 1 508 ? 41.336  97.732  64.756  1.00 56.73 ? 508 GLY D CA  1 
ATOM   3706  C C   . GLY A 1 508 ? 42.351  98.813  64.442  1.00 56.42 ? 508 GLY D C   1 
ATOM   3707  O O   . GLY A 1 508 ? 42.337  99.384  63.352  1.00 56.42 ? 508 GLY D O   1 
ATOM   3708  N N   . ARG A 1 509 ? 43.238  99.076  65.402  1.00 56.17 ? 509 ARG D N   1 
ATOM   3709  C CA  . ARG A 1 509 ? 44.303  100.078 65.271  1.00 55.90 ? 509 ARG D CA  1 
ATOM   3710  C C   . ARG A 1 509 ? 45.232  99.774  64.094  1.00 55.51 ? 509 ARG D C   1 
ATOM   3711  O O   . ARG A 1 509 ? 45.696  100.690 63.417  1.00 55.37 ? 509 ARG D O   1 
ATOM   3712  C CB  . ARG A 1 509 ? 45.101  100.162 66.576  1.00 56.02 ? 509 ARG D CB  1 
ATOM   3713  C CG  . ARG A 1 509 ? 45.909  101.455 66.794  1.00 56.92 ? 509 ARG D CG  1 
ATOM   3714  C CD  . ARG A 1 509 ? 47.350  101.392 66.248  1.00 58.41 ? 509 ARG D CD  1 
ATOM   3715  N NE  . ARG A 1 509 ? 47.866  100.023 66.137  1.00 59.41 ? 509 ARG D NE  1 
ATOM   3716  C CZ  . ARG A 1 509 ? 48.439  99.335  67.122  1.00 59.80 ? 509 ARG D CZ  1 
ATOM   3717  N NH1 . ARG A 1 509 ? 48.591  99.871  68.328  1.00 59.94 ? 509 ARG D NH1 1 
ATOM   3718  N NH2 . ARG A 1 509 ? 48.859  98.096  66.896  1.00 59.77 ? 509 ARG D NH2 1 
ATOM   3719  N N   . GLU A 1 510 ? 45.493  98.486  63.865  1.00 55.15 ? 510 GLU D N   1 
ATOM   3720  C CA  . GLU A 1 510 ? 46.285  98.021  62.724  1.00 54.84 ? 510 GLU D CA  1 
ATOM   3721  C C   . GLU A 1 510 ? 45.621  98.370  61.399  1.00 54.51 ? 510 GLU D C   1 
ATOM   3722  O O   . GLU A 1 510 ? 46.294  98.781  60.450  1.00 54.51 ? 510 GLU D O   1 
ATOM   3723  C CB  . GLU A 1 510 ? 46.486  96.507  62.785  1.00 54.75 ? 510 GLU D CB  1 
ATOM   3724  C CG  . GLU A 1 510 ? 47.448  96.026  63.858  1.00 55.10 ? 510 GLU D CG  1 
ATOM   3725  C CD  . GLU A 1 510 ? 47.723  94.532  63.767  1.00 55.28 ? 510 GLU D CD  1 
ATOM   3726  O OE1 . GLU A 1 510 ? 47.931  94.031  62.634  1.00 55.70 ? 510 GLU D OE1 1 
ATOM   3727  O OE2 . GLU A 1 510 ? 47.738  93.862  64.827  1.00 55.67 ? 510 GLU D OE2 1 
ATOM   3728  N N   . LEU A 1 511 ? 44.301  98.200  61.349  1.00 54.14 ? 511 LEU D N   1 
ATOM   3729  C CA  . LEU A 1 511 ? 43.517  98.443  60.143  1.00 53.80 ? 511 LEU D CA  1 
ATOM   3730  C C   . LEU A 1 511 ? 43.543  99.911  59.760  1.00 53.52 ? 511 LEU D C   1 
ATOM   3731  O O   . LEU A 1 511 ? 43.671  100.249 58.587  1.00 53.54 ? 511 LEU D O   1 
ATOM   3732  C CB  . LEU A 1 511 ? 42.072  97.997  60.358  1.00 53.80 ? 511 LEU D CB  1 
ATOM   3733  C CG  . LEU A 1 511 ? 41.246  97.507  59.170  1.00 53.65 ? 511 LEU D CG  1 
ATOM   3734  C CD1 . LEU A 1 511 ? 39.978  96.887  59.714  1.00 53.85 ? 511 LEU D CD1 1 
ATOM   3735  C CD2 . LEU A 1 511 ? 40.917  98.604  58.169  1.00 53.28 ? 511 LEU D CD2 1 
ATOM   3736  N N   . VAL A 1 512 ? 43.423  100.773 60.762  1.00 53.26 ? 512 VAL D N   1 
ATOM   3737  C CA  . VAL A 1 512 ? 43.389  102.220 60.558  1.00 53.21 ? 512 VAL D CA  1 
ATOM   3738  C C   . VAL A 1 512 ? 44.739  102.773 60.072  1.00 53.16 ? 512 VAL D C   1 
ATOM   3739  O O   . VAL A 1 512 ? 44.774  103.710 59.269  1.00 53.02 ? 512 VAL D O   1 
ATOM   3740  C CB  . VAL A 1 512 ? 42.898  102.945 61.841  1.00 53.18 ? 512 VAL D CB  1 
ATOM   3741  C CG1 . VAL A 1 512 ? 43.011  104.447 61.706  1.00 53.22 ? 512 VAL D CG1 1 
ATOM   3742  C CG2 . VAL A 1 512 ? 41.456  102.553 62.153  1.00 53.00 ? 512 VAL D CG2 1 
ATOM   3743  N N   . GLU A 1 513 ? 45.835  102.181 60.552  1.00 53.19 ? 513 GLU D N   1 
ATOM   3744  C CA  . GLU A 1 513 ? 47.191  102.548 60.117  1.00 53.32 ? 513 GLU D CA  1 
ATOM   3745  C C   . GLU A 1 513 ? 47.463  102.107 58.682  1.00 53.17 ? 513 GLU D C   1 
ATOM   3746  O O   . GLU A 1 513 ? 48.158  102.795 57.928  1.00 53.06 ? 513 GLU D O   1 
ATOM   3747  C CB  . GLU A 1 513 ? 48.251  101.952 61.053  1.00 53.36 ? 513 GLU D CB  1 
ATOM   3748  C CG  . GLU A 1 513 ? 48.302  102.588 62.446  1.00 54.36 ? 513 GLU D CG  1 
ATOM   3749  C CD  . GLU A 1 513 ? 48.541  104.095 62.415  1.00 55.38 ? 513 GLU D CD  1 
ATOM   3750  O OE1 . GLU A 1 513 ? 47.672  104.847 62.913  1.00 55.78 ? 513 GLU D OE1 1 
ATOM   3751  O OE2 . GLU A 1 513 ? 49.591  104.527 61.887  1.00 55.79 ? 513 GLU D OE2 1 
ATOM   3752  N N   . LYS A 1 514 ? 46.912  100.950 58.323  1.00 53.05 ? 514 LYS D N   1 
ATOM   3753  C CA  . LYS A 1 514 ? 47.008  100.403 56.979  1.00 52.91 ? 514 LYS D CA  1 
ATOM   3754  C C   . LYS A 1 514 ? 46.231  101.292 56.013  1.00 52.67 ? 514 LYS D C   1 
ATOM   3755  O O   . LYS A 1 514 ? 46.681  101.547 54.898  1.00 52.76 ? 514 LYS D O   1 
ATOM   3756  C CB  . LYS A 1 514 ? 46.460  98.975  56.970  1.00 53.09 ? 514 LYS D CB  1 
ATOM   3757  C CG  . LYS A 1 514 ? 46.657  98.199  55.680  1.00 53.66 ? 514 LYS D CG  1 
ATOM   3758  C CD  . LYS A 1 514 ? 46.036  96.815  55.813  1.00 55.13 ? 514 LYS D CD  1 
ATOM   3759  C CE  . LYS A 1 514 ? 46.032  96.053  54.492  1.00 56.17 ? 514 LYS D CE  1 
ATOM   3760  N NZ  . LYS A 1 514 ? 45.474  94.678  54.673  1.00 56.74 ? 514 LYS D NZ  1 
ATOM   3761  N N   . MET A 1 515 ? 45.070  101.770 56.455  1.00 52.39 ? 515 MET D N   1 
ATOM   3762  C CA  . MET A 1 515 ? 44.265  102.706 55.674  1.00 52.08 ? 515 MET D CA  1 
ATOM   3763  C C   . MET A 1 515 ? 44.956  104.054 55.514  1.00 51.88 ? 515 MET D C   1 
ATOM   3764  O O   . MET A 1 515 ? 44.869  104.675 54.454  1.00 52.00 ? 515 MET D O   1 
ATOM   3765  C CB  . MET A 1 515 ? 42.867  102.889 56.277  1.00 51.98 ? 515 MET D CB  1 
ATOM   3766  C CG  . MET A 1 515 ? 41.925  101.711 56.053  1.00 52.01 ? 515 MET D CG  1 
ATOM   3767  S SD  . MET A 1 515 ? 42.061  100.917 54.426  1.00 52.44 ? 515 MET D SD  1 
ATOM   3768  C CE  . MET A 1 515 ? 41.419  102.185 53.334  1.00 52.17 ? 515 MET D CE  1 
ATOM   3769  N N   . LYS A 1 516 ? 45.643  104.500 56.562  1.00 51.57 ? 516 LYS D N   1 
ATOM   3770  C CA  . LYS A 1 516 ? 46.394  105.747 56.500  1.00 51.34 ? 516 LYS D CA  1 
ATOM   3771  C C   . LYS A 1 516 ? 47.535  105.663 55.492  1.00 51.19 ? 516 LYS D C   1 
ATOM   3772  O O   . LYS A 1 516 ? 47.941  106.677 54.925  1.00 51.25 ? 516 LYS D O   1 
ATOM   3773  C CB  . LYS A 1 516 ? 46.921  106.153 57.877  1.00 51.35 ? 516 LYS D CB  1 
ATOM   3774  C CG  . LYS A 1 516 ? 45.939  106.983 58.692  1.00 51.27 ? 516 LYS D CG  1 
ATOM   3775  C CD  . LYS A 1 516 ? 46.613  108.216 59.300  1.00 51.24 ? 516 LYS D CD  1 
ATOM   3776  C CE  . LYS A 1 516 ? 47.159  107.971 60.698  1.00 51.19 ? 516 LYS D CE  1 
ATOM   3777  N NZ  . LYS A 1 516 ? 48.241  106.955 60.757  1.00 51.58 ? 516 LYS D NZ  1 
ATOM   3778  N N   . ASP A 1 517 ? 48.044  104.454 55.269  1.00 50.98 ? 517 ASP D N   1 
ATOM   3779  C CA  . ASP A 1 517 ? 49.064  104.230 54.254  1.00 50.84 ? 517 ASP D CA  1 
ATOM   3780  C C   . ASP A 1 517 ? 48.494  104.367 52.845  1.00 50.66 ? 517 ASP D C   1 
ATOM   3781  O O   . ASP A 1 517 ? 49.172  104.860 51.946  1.00 50.76 ? 517 ASP D O   1 
ATOM   3782  C CB  . ASP A 1 517 ? 49.726  102.860 54.432  1.00 50.93 ? 517 ASP D CB  1 
ATOM   3783  C CG  . ASP A 1 517 ? 50.924  102.898 55.373  1.00 51.31 ? 517 ASP D CG  1 
ATOM   3784  O OD1 . ASP A 1 517 ? 51.310  103.997 55.833  1.00 52.01 ? 517 ASP D OD1 1 
ATOM   3785  O OD2 . ASP A 1 517 ? 51.492  101.819 55.649  1.00 51.52 ? 517 ASP D OD2 1 
ATOM   3786  N N   . LEU A 1 518 ? 47.248  103.940 52.662  1.00 50.35 ? 518 LEU D N   1 
ATOM   3787  C CA  . LEU A 1 518 ? 46.621  103.932 51.340  1.00 50.21 ? 518 LEU D CA  1 
ATOM   3788  C C   . LEU A 1 518 ? 45.917  105.243 51.011  1.00 49.80 ? 518 LEU D C   1 
ATOM   3789  O O   . LEU A 1 518 ? 45.640  105.529 49.846  1.00 49.67 ? 518 LEU D O   1 
ATOM   3790  C CB  . LEU A 1 518 ? 45.640  102.760 51.208  1.00 50.49 ? 518 LEU D CB  1 
ATOM   3791  C CG  . LEU A 1 518 ? 46.154  101.340 51.491  1.00 51.17 ? 518 LEU D CG  1 
ATOM   3792  C CD1 . LEU A 1 518 ? 44.975  100.391 51.704  1.00 51.64 ? 518 LEU D CD1 1 
ATOM   3793  C CD2 . LEU A 1 518 ? 47.095  100.818 50.395  1.00 51.22 ? 518 LEU D CD2 1 
ATOM   3794  N N   . ILE A 1 519 ? 45.624  106.030 52.041  1.00 49.45 ? 519 ILE D N   1 
ATOM   3795  C CA  . ILE A 1 519 ? 44.964  107.323 51.872  1.00 49.09 ? 519 ILE D CA  1 
ATOM   3796  C C   . ILE A 1 519 ? 45.919  108.450 52.289  1.00 48.88 ? 519 ILE D C   1 
ATOM   3797  O O   . ILE A 1 519 ? 46.139  108.668 53.485  1.00 48.99 ? 519 ILE D O   1 
ATOM   3798  C CB  . ILE A 1 519 ? 43.624  107.385 52.655  1.00 49.01 ? 519 ILE D CB  1 
ATOM   3799  C CG1 . ILE A 1 519 ? 42.647  106.340 52.112  1.00 48.91 ? 519 ILE D CG1 1 
ATOM   3800  C CG2 . ILE A 1 519 ? 43.000  108.765 52.559  1.00 48.94 ? 519 ILE D CG2 1 
ATOM   3801  C CD1 . ILE A 1 519 ? 41.447  106.104 52.990  1.00 48.74 ? 519 ILE D CD1 1 
ATOM   3802  N N   . PRO A 1 520 ? 46.501  109.159 51.300  1.00 48.59 ? 520 PRO D N   1 
ATOM   3803  C CA  . PRO A 1 520 ? 47.451  110.234 51.593  1.00 48.39 ? 520 PRO D CA  1 
ATOM   3804  C C   . PRO A 1 520 ? 46.739  111.500 52.068  1.00 48.21 ? 520 PRO D C   1 
ATOM   3805  O O   . PRO A 1 520 ? 45.507  111.555 52.048  1.00 48.19 ? 520 PRO D O   1 
ATOM   3806  C CB  . PRO A 1 520 ? 48.135  110.471 50.243  1.00 48.40 ? 520 PRO D CB  1 
ATOM   3807  C CG  . PRO A 1 520 ? 47.129  110.067 49.230  1.00 48.35 ? 520 PRO D CG  1 
ATOM   3808  C CD  . PRO A 1 520 ? 46.293  108.983 49.849  1.00 48.53 ? 520 PRO D CD  1 
ATOM   3809  N N   . ARG A 1 521 ? 47.507  112.497 52.504  1.00 48.04 ? 521 ARG D N   1 
ATOM   3810  C CA  . ARG A 1 521 ? 46.935  113.778 52.904  1.00 47.99 ? 521 ARG D CA  1 
ATOM   3811  C C   . ARG A 1 521 ? 46.419  114.468 51.647  1.00 48.15 ? 521 ARG D C   1 
ATOM   3812  O O   . ARG A 1 521 ? 47.172  114.647 50.693  1.00 48.29 ? 521 ARG D O   1 
ATOM   3813  C CB  . ARG A 1 521 ? 47.962  114.658 53.636  1.00 47.97 ? 521 ARG D CB  1 
ATOM   3814  C CG  . ARG A 1 521 ? 48.812  113.951 54.688  1.00 47.23 ? 521 ARG D CG  1 
ATOM   3815  C CD  . ARG A 1 521 ? 48.882  114.738 55.988  1.00 46.36 ? 521 ARG D CD  1 
ATOM   3816  N NE  . ARG A 1 521 ? 49.855  115.830 55.974  1.00 45.81 ? 521 ARG D NE  1 
ATOM   3817  C CZ  . ARG A 1 521 ? 49.559  117.124 56.094  1.00 45.14 ? 521 ARG D CZ  1 
ATOM   3818  N NH1 . ARG A 1 521 ? 48.304  117.525 56.224  1.00 45.09 ? 521 ARG D NH1 1 
ATOM   3819  N NH2 . ARG A 1 521 ? 50.529  118.027 56.081  1.00 44.75 ? 521 ARG D NH2 1 
ATOM   3820  N N   . GLN A 1 522 ? 45.136  114.832 51.640  1.00 48.37 ? 522 GLN D N   1 
ATOM   3821  C CA  . GLN A 1 522 ? 44.476  115.352 50.430  1.00 48.41 ? 522 GLN D CA  1 
ATOM   3822  C C   . GLN A 1 522 ? 43.845  116.735 50.599  1.00 48.67 ? 522 GLN D C   1 
ATOM   3823  O O   . GLN A 1 522 ? 44.279  117.547 51.420  1.00 48.56 ? 522 GLN D O   1 
ATOM   3824  C CB  . GLN A 1 522 ? 43.382  114.393 49.958  1.00 48.29 ? 522 GLN D CB  1 
ATOM   3825  C CG  . GLN A 1 522 ? 43.802  112.959 49.802  1.00 47.89 ? 522 GLN D CG  1 
ATOM   3826  C CD  . GLN A 1 522 ? 42.638  112.037 49.520  1.00 46.72 ? 522 GLN D CD  1 
ATOM   3827  O OE1 . GLN A 1 522 ? 41.572  112.463 49.083  1.00 45.79 ? 522 GLN D OE1 1 
ATOM   3828  N NE2 . GLN A 1 522 ? 42.843  110.757 49.764  1.00 47.38 ? 522 GLN D NE2 1 
ATOM   3829  N N   . GLN A 1 523 ? 42.802  116.968 49.800  1.00 48.97 ? 523 GLN D N   1 
ATOM   3830  C CA  . GLN A 1 523 ? 42.044  118.217 49.761  1.00 49.17 ? 523 GLN D CA  1 
ATOM   3831  C C   . GLN A 1 523 ? 41.293  118.469 51.070  1.00 49.27 ? 523 GLN D C   1 
ATOM   3832  O O   . GLN A 1 523 ? 41.462  119.520 51.699  1.00 49.33 ? 523 GLN D O   1 
ATOM   3833  C CB  . GLN A 1 523 ? 41.066  118.164 48.586  1.00 49.05 ? 523 GLN D CB  1 
ATOM   3834  C CG  . GLN A 1 523 ? 40.420  119.481 48.209  1.00 49.20 ? 523 GLN D CG  1 
ATOM   3835  C CD  . GLN A 1 523 ? 39.505  119.362 46.992  1.00 49.44 ? 523 GLN D CD  1 
ATOM   3836  O OE1 . GLN A 1 523 ? 38.858  120.331 46.600  1.00 50.10 ? 523 GLN D OE1 1 
ATOM   3837  N NE2 . GLN A 1 523 ? 39.448  118.173 46.391  1.00 49.20 ? 523 GLN D NE2 1 
ATOM   3838  N N   . PHE A 1 524 ? 40.475  117.499 51.475  1.00 49.26 ? 524 PHE D N   1 
ATOM   3839  C CA  . PHE A 1 524 ? 39.679  117.613 52.690  1.00 49.35 ? 524 PHE D CA  1 
ATOM   3840  C C   . PHE A 1 524 ? 40.147  116.624 53.742  1.00 49.44 ? 524 PHE D C   1 
ATOM   3841  O O   . PHE A 1 524 ? 40.776  115.618 53.413  1.00 49.47 ? 524 PHE D O   1 
ATOM   3842  C CB  . PHE A 1 524 ? 38.198  117.372 52.382  1.00 49.37 ? 524 PHE D CB  1 
ATOM   3843  C CG  . PHE A 1 524 ? 37.669  118.211 51.256  1.00 49.33 ? 524 PHE D CG  1 
ATOM   3844  C CD1 . PHE A 1 524 ? 37.411  117.639 50.013  1.00 49.33 ? 524 PHE D CD1 1 
ATOM   3845  C CD2 . PHE A 1 524 ? 37.437  119.575 51.432  1.00 49.10 ? 524 PHE D CD2 1 
ATOM   3846  C CE1 . PHE A 1 524 ? 36.921  118.409 48.962  1.00 49.26 ? 524 PHE D CE1 1 
ATOM   3847  C CE2 . PHE A 1 524 ? 36.952  120.357 50.390  1.00 49.25 ? 524 PHE D CE2 1 
ATOM   3848  C CZ  . PHE A 1 524 ? 36.693  119.773 49.149  1.00 49.50 ? 524 PHE D CZ  1 
ATOM   3849  N N   . ASP A 1 525 ? 39.838  116.919 55.006  1.00 49.61 ? 525 ASP D N   1 
ATOM   3850  C CA  . ASP A 1 525 ? 40.068  115.988 56.110  1.00 49.72 ? 525 ASP D CA  1 
ATOM   3851  C C   . ASP A 1 525 ? 39.379  114.654 55.828  1.00 49.74 ? 525 ASP D C   1 
ATOM   3852  O O   . ASP A 1 525 ? 38.260  114.624 55.311  1.00 49.75 ? 525 ASP D O   1 
ATOM   3853  C CB  . ASP A 1 525 ? 39.519  116.558 57.421  1.00 49.76 ? 525 ASP D CB  1 
ATOM   3854  C CG  . ASP A 1 525 ? 40.374  117.672 57.994  1.00 50.00 ? 525 ASP D CG  1 
ATOM   3855  O OD1 . ASP A 1 525 ? 41.421  118.009 57.406  1.00 50.37 ? 525 ASP D OD1 1 
ATOM   3856  O OD2 . ASP A 1 525 ? 39.991  118.212 59.053  1.00 50.28 ? 525 ASP D OD2 1 
ATOM   3857  N N   . ILE A 1 526 ? 40.048  113.555 56.162  1.00 49.74 ? 526 ILE D N   1 
ATOM   3858  C CA  . ILE A 1 526 ? 39.447  112.229 56.024  1.00 49.76 ? 526 ILE D CA  1 
ATOM   3859  C C   . ILE A 1 526 ? 39.466  111.502 57.367  1.00 49.93 ? 526 ILE D C   1 
ATOM   3860  O O   . ILE A 1 526 ? 40.530  111.264 57.939  1.00 50.24 ? 526 ILE D O   1 
ATOM   3861  C CB  . ILE A 1 526 ? 40.123  111.404 54.906  1.00 49.63 ? 526 ILE D CB  1 
ATOM   3862  C CG1 . ILE A 1 526 ? 39.840  112.049 53.545  1.00 49.31 ? 526 ILE D CG1 1 
ATOM   3863  C CG2 . ILE A 1 526 ? 39.623  109.961 54.920  1.00 49.59 ? 526 ILE D CG2 1 
ATOM   3864  C CD1 . ILE A 1 526 ? 40.832  111.712 52.477  1.00 48.50 ? 526 ILE D CD1 1 
ATOM   3865  N N   . ALA A 1 527 ? 38.282  111.179 57.877  1.00 50.03 ? 527 ALA D N   1 
ATOM   3866  C CA  . ALA A 1 527 ? 38.164  110.554 59.188  1.00 50.10 ? 527 ALA D CA  1 
ATOM   3867  C C   . ALA A 1 527 ? 37.986  109.051 59.046  1.00 50.15 ? 527 ALA D C   1 
ATOM   3868  O O   . ALA A 1 527 ? 36.911  108.570 58.683  1.00 50.21 ? 527 ALA D O   1 
ATOM   3869  C CB  . ALA A 1 527 ? 37.016  111.168 59.976  1.00 50.04 ? 527 ALA D CB  1 
ATOM   3870  N N   . ILE A 1 528 ? 39.065  108.323 59.313  1.00 50.20 ? 528 ILE D N   1 
ATOM   3871  C CA  . ILE A 1 528 ? 39.062  106.866 59.309  1.00 50.19 ? 528 ILE D CA  1 
ATOM   3872  C C   . ILE A 1 528 ? 38.831  106.389 60.736  1.00 50.41 ? 528 ILE D C   1 
ATOM   3873  O O   . ILE A 1 528 ? 39.482  106.869 61.668  1.00 50.20 ? 528 ILE D O   1 
ATOM   3874  C CB  . ILE A 1 528 ? 40.406  106.301 58.809  1.00 49.99 ? 528 ILE D CB  1 
ATOM   3875  C CG1 . ILE A 1 528 ? 40.743  106.854 57.428  1.00 50.12 ? 528 ILE D CG1 1 
ATOM   3876  C CG2 . ILE A 1 528 ? 40.379  104.781 58.785  1.00 49.92 ? 528 ILE D CG2 1 
ATOM   3877  C CD1 . ILE A 1 528 ? 42.226  106.859 57.117  1.00 50.61 ? 528 ILE D CD1 1 
ATOM   3878  N N   . GLN A 1 529 ? 37.902  105.451 60.902  1.00 50.67 ? 529 GLN D N   1 
ATOM   3879  C CA  . GLN A 1 529 ? 37.653  104.851 62.210  1.00 50.95 ? 529 GLN D CA  1 
ATOM   3880  C C   . GLN A 1 529 ? 37.229  103.389 62.150  1.00 50.91 ? 529 GLN D C   1 
ATOM   3881  O O   . GLN A 1 529 ? 36.766  102.900 61.115  1.00 50.78 ? 529 GLN D O   1 
ATOM   3882  C CB  . GLN A 1 529 ? 36.647  105.677 63.026  1.00 51.11 ? 529 GLN D CB  1 
ATOM   3883  C CG  . GLN A 1 529 ? 35.405  106.114 62.272  1.00 51.74 ? 529 GLN D CG  1 
ATOM   3884  C CD  . GLN A 1 529 ? 34.247  106.418 63.203  1.00 53.02 ? 529 GLN D CD  1 
ATOM   3885  O OE1 . GLN A 1 529 ? 33.891  105.605 64.062  1.00 53.35 ? 529 GLN D OE1 1 
ATOM   3886  N NE2 . GLN A 1 529 ? 33.645  107.589 63.032  1.00 53.42 ? 529 GLN D NE2 1 
ATOM   3887  N N   . ALA A 1 530 ? 37.410  102.704 63.278  1.00 50.91 ? 530 ALA D N   1 
ATOM   3888  C CA  . ALA A 1 530 ? 37.041  101.303 63.436  1.00 50.96 ? 530 ALA D CA  1 
ATOM   3889  C C   . ALA A 1 530 ? 36.159  101.142 64.667  1.00 51.00 ? 530 ALA D C   1 
ATOM   3890  O O   . ALA A 1 530 ? 36.457  101.690 65.731  1.00 51.11 ? 530 ALA D O   1 
ATOM   3891  C CB  . ALA A 1 530 ? 38.286  100.434 63.550  1.00 50.92 ? 530 ALA D CB  1 
ATOM   3892  N N   . ALA A 1 531 ? 35.073  100.390 64.518  1.00 51.08 ? 531 ALA D N   1 
ATOM   3893  C CA  . ALA A 1 531 ? 34.100  100.219 65.592  1.00 51.04 ? 531 ALA D CA  1 
ATOM   3894  C C   . ALA A 1 531 ? 33.744  98.757  65.841  1.00 51.06 ? 531 ALA D C   1 
ATOM   3895  O O   . ALA A 1 531 ? 33.916  97.905  64.967  1.00 50.96 ? 531 ALA D O   1 
ATOM   3896  C CB  . ALA A 1 531 ? 32.840  101.033 65.296  1.00 50.94 ? 531 ALA D CB  1 
ATOM   3897  N N   . ILE A 1 532 ? 33.280  98.478  67.056  1.00 51.15 ? 532 ILE D N   1 
ATOM   3898  C CA  . ILE A 1 532 ? 32.630  97.217  67.383  1.00 51.29 ? 532 ILE D CA  1 
ATOM   3899  C C   . ILE A 1 532 ? 31.275  97.596  67.970  1.00 51.42 ? 532 ILE D C   1 
ATOM   3900  O O   . ILE A 1 532 ? 31.196  98.106  69.090  1.00 51.53 ? 532 ILE D O   1 
ATOM   3901  C CB  . ILE A 1 532 ? 33.434  96.377  68.403  1.00 51.28 ? 532 ILE D CB  1 
ATOM   3902  C CG1 . ILE A 1 532 ? 34.919  96.325  68.031  1.00 51.42 ? 532 ILE D CG1 1 
ATOM   3903  C CG2 . ILE A 1 532 ? 32.861  94.963  68.499  1.00 51.51 ? 532 ILE D CG2 1 
ATOM   3904  C CD1 . ILE A 1 532 ? 35.813  95.762  69.127  1.00 51.38 ? 532 ILE D CD1 1 
ATOM   3905  N N   . GLY A 1 533 ? 30.213  97.364  67.203  1.00 51.56 ? 533 GLY D N   1 
ATOM   3906  C CA  . GLY A 1 533 ? 28.880  97.834  67.570  1.00 51.66 ? 533 GLY D CA  1 
ATOM   3907  C C   . GLY A 1 533 ? 28.811  99.347  67.474  1.00 51.82 ? 533 GLY D C   1 
ATOM   3908  O O   . GLY A 1 533 ? 29.344  99.943  66.535  1.00 51.78 ? 533 GLY D O   1 
ATOM   3909  N N   . THR A 1 534 ? 28.166  99.971  68.454  1.00 52.02 ? 534 THR D N   1 
ATOM   3910  C CA  . THR A 1 534 ? 28.055  101.428 68.500  1.00 52.29 ? 534 THR D CA  1 
ATOM   3911  C C   . THR A 1 534 ? 29.392  102.075 68.872  1.00 52.36 ? 534 THR D C   1 
ATOM   3912  O O   . THR A 1 534 ? 29.613  103.258 68.602  1.00 52.39 ? 534 THR D O   1 
ATOM   3913  C CB  . THR A 1 534 ? 26.982  101.886 69.523  1.00 52.37 ? 534 THR D CB  1 
ATOM   3914  O OG1 . THR A 1 534 ? 25.921  100.925 69.584  1.00 52.59 ? 534 THR D OG1 1 
ATOM   3915  C CG2 . THR A 1 534 ? 26.407  103.253 69.143  1.00 52.52 ? 534 THR D CG2 1 
ATOM   3916  N N   . HIS A 1 535 ? 30.284  101.287 69.470  1.00 52.41 ? 535 HIS D N   1 
ATOM   3917  C CA  . HIS A 1 535 ? 31.471  101.820 70.140  1.00 52.43 ? 535 HIS D CA  1 
ATOM   3918  C C   . HIS A 1 535 ? 32.742  101.888 69.290  1.00 52.38 ? 535 HIS D C   1 
ATOM   3919  O O   . HIS A 1 535 ? 33.182  100.891 68.714  1.00 52.51 ? 535 HIS D O   1 
ATOM   3920  C CB  . HIS A 1 535 ? 31.721  101.058 71.441  1.00 52.40 ? 535 HIS D CB  1 
ATOM   3921  C CG  . HIS A 1 535 ? 30.685  101.317 72.488  1.00 52.81 ? 535 HIS D CG  1 
ATOM   3922  N ND1 . HIS A 1 535 ? 29.539  100.559 72.603  1.00 53.20 ? 535 HIS D ND1 1 
ATOM   3923  C CD2 . HIS A 1 535 ? 30.609  102.264 73.452  1.00 53.21 ? 535 HIS D CD2 1 
ATOM   3924  C CE1 . HIS A 1 535 ? 28.808  101.019 73.603  1.00 53.29 ? 535 HIS D CE1 1 
ATOM   3925  N NE2 . HIS A 1 535 ? 29.435  102.055 74.135  1.00 53.51 ? 535 HIS D NE2 1 
ATOM   3926  N N   . ILE A 1 536 ? 33.323  103.085 69.240  1.00 52.21 ? 536 ILE D N   1 
ATOM   3927  C CA  . ILE A 1 536 ? 34.551  103.347 68.497  1.00 52.14 ? 536 ILE D CA  1 
ATOM   3928  C C   . ILE A 1 536 ? 35.767  102.838 69.269  1.00 52.11 ? 536 ILE D C   1 
ATOM   3929  O O   . ILE A 1 536 ? 35.950  103.172 70.443  1.00 52.14 ? 536 ILE D O   1 
ATOM   3930  C CB  . ILE A 1 536 ? 34.706  104.858 68.196  1.00 52.07 ? 536 ILE D CB  1 
ATOM   3931  C CG1 . ILE A 1 536 ? 33.533  105.347 67.335  1.00 52.21 ? 536 ILE D CG1 1 
ATOM   3932  C CG2 . ILE A 1 536 ? 36.049  105.142 67.522  1.00 52.11 ? 536 ILE D CG2 1 
ATOM   3933  C CD1 . ILE A 1 536 ? 33.425  106.858 67.200  1.00 52.26 ? 536 ILE D CD1 1 
ATOM   3934  N N   . ILE A 1 537 ? 36.594  102.033 68.604  1.00 51.97 ? 537 ILE D N   1 
ATOM   3935  C CA  . ILE A 1 537 ? 37.774  101.436 69.236  1.00 51.78 ? 537 ILE D CA  1 
ATOM   3936  C C   . ILE A 1 537 ? 39.096  101.995 68.702  1.00 51.74 ? 537 ILE D C   1 
ATOM   3937  O O   . ILE A 1 537 ? 40.110  101.994 69.403  1.00 51.61 ? 537 ILE D O   1 
ATOM   3938  C CB  . ILE A 1 537 ? 37.761  99.889  69.134  1.00 51.75 ? 537 ILE D CB  1 
ATOM   3939  C CG1 . ILE A 1 537 ? 37.755  99.429  67.669  1.00 51.71 ? 537 ILE D CG1 1 
ATOM   3940  C CG2 . ILE A 1 537 ? 36.563  99.323  69.897  1.00 51.85 ? 537 ILE D CG2 1 
ATOM   3941  C CD1 . ILE A 1 537 ? 38.306  98.027  67.446  1.00 51.49 ? 537 ILE D CD1 1 
ATOM   3942  N N   . ALA A 1 538 ? 39.070  102.471 67.462  1.00 51.78 ? 538 ALA D N   1 
ATOM   3943  C CA  . ALA A 1 538 ? 40.243  103.049 66.818  1.00 51.90 ? 538 ALA D CA  1 
ATOM   3944  C C   . ALA A 1 538 ? 39.823  104.151 65.858  1.00 52.01 ? 538 ALA D C   1 
ATOM   3945  O O   . ALA A 1 538 ? 38.892  103.979 65.072  1.00 51.98 ? 538 ALA D O   1 
ATOM   3946  C CB  . ALA A 1 538 ? 41.029  101.975 66.083  1.00 51.89 ? 538 ALA D CB  1 
ATOM   3947  N N   . ARG A 1 539 ? 40.504  105.288 65.937  1.00 52.17 ? 539 ARG D N   1 
ATOM   3948  C CA  . ARG A 1 539 ? 40.240  106.403 65.036  1.00 52.45 ? 539 ARG D CA  1 
ATOM   3949  C C   . ARG A 1 539 ? 41.541  107.111 64.678  1.00 52.41 ? 539 ARG D C   1 
ATOM   3950  O O   . ARG A 1 539 ? 42.464  107.184 65.493  1.00 52.55 ? 539 ARG D O   1 
ATOM   3951  C CB  . ARG A 1 539 ? 39.252  107.397 65.659  1.00 52.58 ? 539 ARG D CB  1 
ATOM   3952  C CG  . ARG A 1 539 ? 38.496  108.254 64.637  1.00 53.45 ? 539 ARG D CG  1 
ATOM   3953  C CD  . ARG A 1 539 ? 38.235  109.675 65.127  1.00 54.90 ? 539 ARG D CD  1 
ATOM   3954  N NE  . ARG A 1 539 ? 37.344  109.723 66.289  1.00 56.33 ? 539 ARG D NE  1 
ATOM   3955  C CZ  . ARG A 1 539 ? 36.014  109.765 66.225  1.00 56.81 ? 539 ARG D CZ  1 
ATOM   3956  N NH1 . ARG A 1 539 ? 35.398  109.760 65.046  1.00 57.10 ? 539 ARG D NH1 1 
ATOM   3957  N NH2 . ARG A 1 539 ? 35.296  109.809 67.345  1.00 56.17 ? 539 ARG D NH2 1 
ATOM   3958  N N   . SER A 1 540 ? 41.605  107.613 63.449  1.00 52.35 ? 540 SER D N   1 
ATOM   3959  C CA  . SER A 1 540 ? 42.719  108.430 62.989  1.00 52.29 ? 540 SER D CA  1 
ATOM   3960  C C   . SER A 1 540 ? 42.229  109.323 61.866  1.00 52.31 ? 540 SER D C   1 
ATOM   3961  O O   . SER A 1 540 ? 41.541  108.867 60.956  1.00 52.34 ? 540 SER D O   1 
ATOM   3962  C CB  . SER A 1 540 ? 43.873  107.557 62.505  1.00 52.18 ? 540 SER D CB  1 
ATOM   3963  O OG  . SER A 1 540 ? 45.114  108.108 62.894  1.00 52.34 ? 540 SER D OG  1 
ATOM   3964  N N   . THR A 1 541 ? 42.571  110.601 61.937  1.00 52.42 ? 541 THR D N   1 
ATOM   3965  C CA  . THR A 1 541 ? 42.126  111.552 60.927  1.00 52.62 ? 541 THR D CA  1 
ATOM   3966  C C   . THR A 1 541 ? 43.300  112.077 60.105  1.00 52.57 ? 541 THR D C   1 
ATOM   3967  O O   . THR A 1 541 ? 44.222  112.691 60.645  1.00 52.59 ? 541 THR D O   1 
ATOM   3968  C CB  . THR A 1 541 ? 41.270  112.703 61.538  1.00 52.72 ? 541 THR D CB  1 
ATOM   3969  O OG1 . THR A 1 541 ? 41.186  113.791 60.609  1.00 52.98 ? 541 THR D OG1 1 
ATOM   3970  C CG2 . THR A 1 541 ? 41.857  113.200 62.865  1.00 52.96 ? 541 THR D CG2 1 
ATOM   3971  N N   . VAL A 1 542 ? 43.258  111.810 58.799  1.00 52.44 ? 542 VAL D N   1 
ATOM   3972  C CA  . VAL A 1 542 ? 44.289  112.262 57.868  1.00 52.40 ? 542 VAL D CA  1 
ATOM   3973  C C   . VAL A 1 542 ? 44.103  113.751 57.593  1.00 52.50 ? 542 VAL D C   1 
ATOM   3974  O O   . VAL A 1 542 ? 43.142  114.151 56.931  1.00 52.60 ? 542 VAL D O   1 
ATOM   3975  C CB  . VAL A 1 542 ? 44.256  111.463 56.539  1.00 52.31 ? 542 VAL D CB  1 
ATOM   3976  C CG1 . VAL A 1 542 ? 45.337  111.941 55.597  1.00 52.19 ? 542 VAL D CG1 1 
ATOM   3977  C CG2 . VAL A 1 542 ? 44.429  109.983 56.800  1.00 52.26 ? 542 VAL D CG2 1 
ATOM   3978  N N   . LYS A 1 543 ? 45.025  114.561 58.113  1.00 52.67 ? 543 LYS D N   1 
ATOM   3979  C CA  . LYS A 1 543 ? 44.946  116.021 58.007  1.00 52.82 ? 543 LYS D CA  1 
ATOM   3980  C C   . LYS A 1 543 ? 44.989  116.470 56.553  1.00 52.95 ? 543 LYS D C   1 
ATOM   3981  O O   . LYS A 1 543 ? 45.824  116.000 55.773  1.00 52.92 ? 543 LYS D O   1 
ATOM   3982  C CB  . LYS A 1 543 ? 46.088  116.704 58.780  1.00 52.80 ? 543 LYS D CB  1 
ATOM   3983  C CG  . LYS A 1 543 ? 46.258  116.285 60.236  1.00 52.75 ? 543 LYS D CG  1 
ATOM   3984  C CD  . LYS A 1 543 ? 45.113  116.761 61.111  1.00 53.14 ? 543 LYS D CD  1 
ATOM   3985  C CE  . LYS A 1 543 ? 45.192  116.128 62.492  1.00 53.35 ? 543 LYS D CE  1 
ATOM   3986  N NZ  . LYS A 1 543 ? 43.898  116.267 63.215  1.00 53.73 ? 543 LYS D NZ  1 
ATOM   3987  N N   . GLN A 1 544 ? 44.084  117.379 56.195  1.00 53.06 ? 544 GLN D N   1 
ATOM   3988  C CA  . GLN A 1 544 ? 44.063  117.959 54.858  1.00 53.13 ? 544 GLN D CA  1 
ATOM   3989  C C   . GLN A 1 544 ? 45.361  118.706 54.567  1.00 53.30 ? 544 GLN D C   1 
ATOM   3990  O O   . GLN A 1 544 ? 46.021  119.214 55.477  1.00 53.30 ? 544 GLN D O   1 
ATOM   3991  C CB  . GLN A 1 544 ? 42.868  118.903 54.686  1.00 53.11 ? 544 GLN D CB  1 
ATOM   3992  C CG  . GLN A 1 544 ? 42.970  120.208 55.486  1.00 53.24 ? 544 GLN D CG  1 
ATOM   3993  C CD  . GLN A 1 544 ? 41.928  121.239 55.098  1.00 52.99 ? 544 GLN D CD  1 
ATOM   3994  O OE1 . GLN A 1 544 ? 42.268  122.355 54.708  1.00 52.44 ? 544 GLN D OE1 1 
ATOM   3995  N NE2 . GLN A 1 544 ? 40.652  120.873 55.205  1.00 52.87 ? 544 GLN D NE2 1 
ATOM   3996  N N   . LEU A 1 545 ? 45.719  118.748 53.288  1.00 53.56 ? 545 LEU D N   1 
ATOM   3997  C CA  . LEU A 1 545 ? 46.830  119.550 52.799  1.00 53.75 ? 545 LEU D CA  1 
ATOM   3998  C C   . LEU A 1 545 ? 46.510  121.028 52.894  1.00 53.84 ? 545 LEU D C   1 
ATOM   3999  O O   . LEU A 1 545 ? 45.362  121.437 52.707  1.00 53.83 ? 545 LEU D O   1 
ATOM   4000  C CB  . LEU A 1 545 ? 47.086  119.226 51.327  1.00 53.80 ? 545 LEU D CB  1 
ATOM   4001  C CG  . LEU A 1 545 ? 48.229  118.341 50.832  1.00 53.90 ? 545 LEU D CG  1 
ATOM   4002  C CD1 . LEU A 1 545 ? 48.670  117.290 51.839  1.00 53.58 ? 545 LEU D CD1 1 
ATOM   4003  C CD2 . LEU A 1 545 ? 47.810  117.710 49.513  1.00 53.75 ? 545 LEU D CD2 1 
ATOM   4004  N N   . ARG A 1 546 ? 47.530  121.828 53.180  1.00 54.04 ? 546 ARG D N   1 
ATOM   4005  C CA  . ARG A 1 546 ? 47.453  123.258 52.924  1.00 54.28 ? 546 ARG D CA  1 
ATOM   4006  C C   . ARG A 1 546 ? 47.463  123.460 51.412  1.00 54.19 ? 546 ARG D C   1 
ATOM   4007  O O   . ARG A 1 546 ? 48.027  122.645 50.681  1.00 54.39 ? 546 ARG D O   1 
ATOM   4008  C CB  . ARG A 1 546 ? 48.615  123.997 53.587  1.00 54.27 ? 546 ARG D CB  1 
ATOM   4009  C CG  . ARG A 1 546 ? 48.250  124.584 54.939  1.00 54.88 ? 546 ARG D CG  1 
ATOM   4010  C CD  . ARG A 1 546 ? 49.481  124.869 55.776  1.00 55.67 ? 546 ARG D CD  1 
ATOM   4011  N NE  . ARG A 1 546 ? 50.109  123.632 56.238  1.00 55.86 ? 546 ARG D NE  1 
ATOM   4012  C CZ  . ARG A 1 546 ? 51.257  123.571 56.904  1.00 55.42 ? 546 ARG D CZ  1 
ATOM   4013  N NH1 . ARG A 1 546 ? 51.923  124.683 57.195  1.00 55.20 ? 546 ARG D NH1 1 
ATOM   4014  N NH2 . ARG A 1 546 ? 51.738  122.391 57.277  1.00 55.15 ? 546 ARG D NH2 1 
ATOM   4015  N N   . LYS A 1 547 ? 46.825  124.529 50.949  1.00 54.08 ? 547 LYS D N   1 
ATOM   4016  C CA  . LYS A 1 547 ? 46.702  124.801 49.517  1.00 54.01 ? 547 LYS D CA  1 
ATOM   4017  C C   . LYS A 1 547 ? 48.062  124.912 48.824  1.00 53.62 ? 547 LYS D C   1 
ATOM   4018  O O   . LYS A 1 547 ? 49.066  125.228 49.467  1.00 53.54 ? 547 LYS D O   1 
ATOM   4019  C CB  . LYS A 1 547 ? 45.850  126.055 49.279  1.00 54.29 ? 547 LYS D CB  1 
ATOM   4020  C CG  . LYS A 1 547 ? 46.273  127.278 50.098  1.00 55.46 ? 547 LYS D CG  1 
ATOM   4021  C CD  . LYS A 1 547 ? 45.092  128.203 50.417  1.00 57.02 ? 547 LYS D CD  1 
ATOM   4022  C CE  . LYS A 1 547 ? 44.748  129.124 49.248  1.00 57.98 ? 547 LYS D CE  1 
ATOM   4023  N NZ  . LYS A 1 547 ? 43.774  130.175 49.658  1.00 58.82 ? 547 LYS D NZ  1 
ATOM   4024  N N   . ASN A 1 548 ? 48.076  124.620 47.520  1.00 53.24 ? 548 ASN D N   1 
ATOM   4025  C CA  . ASN A 1 548 ? 49.276  124.681 46.657  1.00 52.74 ? 548 ASN D CA  1 
ATOM   4026  C C   . ASN A 1 548 ? 50.228  123.481 46.761  1.00 52.23 ? 548 ASN D C   1 
ATOM   4027  O O   . ASN A 1 548 ? 51.094  123.289 45.899  1.00 52.33 ? 548 ASN D O   1 
ATOM   4028  C CB  . ASN A 1 548 ? 50.039  126.006 46.830  1.00 52.84 ? 548 ASN D CB  1 
ATOM   4029  C CG  . ASN A 1 548 ? 49.223  127.217 46.392  1.00 53.33 ? 548 ASN D CG  1 
ATOM   4030  O OD1 . ASN A 1 548 ? 48.182  127.085 45.738  1.00 53.90 ? 548 ASN D OD1 1 
ATOM   4031  N ND2 . ASN A 1 548 ? 49.699  128.409 46.749  1.00 53.58 ? 548 ASN D ND2 1 
ATOM   4032  N N   . VAL A 1 549 ? 50.055  122.684 47.811  1.00 51.45 ? 549 VAL D N   1 
ATOM   4033  C CA  . VAL A 1 549 ? 50.845  121.478 48.036  1.00 50.68 ? 549 VAL D CA  1 
ATOM   4034  C C   . VAL A 1 549 ? 50.237  120.325 47.241  1.00 50.19 ? 549 VAL D C   1 
ATOM   4035  O O   . VAL A 1 549 ? 49.015  120.247 47.092  1.00 50.10 ? 549 VAL D O   1 
ATOM   4036  C CB  . VAL A 1 549 ? 50.876  121.117 49.546  1.00 50.70 ? 549 VAL D CB  1 
ATOM   4037  C CG1 . VAL A 1 549 ? 51.754  119.899 49.814  1.00 50.71 ? 549 VAL D CG1 1 
ATOM   4038  C CG2 . VAL A 1 549 ? 51.351  122.305 50.372  1.00 50.79 ? 549 VAL D CG2 1 
ATOM   4039  N N   . LEU A 1 550 ? 51.088  119.439 46.730  1.00 49.56 ? 550 LEU D N   1 
ATOM   4040  C CA  . LEU A 1 550 ? 50.627  118.227 46.053  1.00 49.01 ? 550 LEU D CA  1 
ATOM   4041  C C   . LEU A 1 550 ? 50.473  117.068 47.031  1.00 48.83 ? 550 LEU D C   1 
ATOM   4042  O O   . LEU A 1 550 ? 51.188  116.995 48.028  1.00 48.83 ? 550 LEU D O   1 
ATOM   4043  C CB  . LEU A 1 550 ? 51.597  117.820 44.944  1.00 48.86 ? 550 LEU D CB  1 
ATOM   4044  C CG  . LEU A 1 550 ? 51.889  118.782 43.796  1.00 48.24 ? 550 LEU D CG  1 
ATOM   4045  C CD1 . LEU A 1 550 ? 52.922  118.146 42.897  1.00 48.09 ? 550 LEU D CD1 1 
ATOM   4046  C CD2 . LEU A 1 550 ? 50.632  119.118 43.013  1.00 47.81 ? 550 LEU D CD2 1 
ATOM   4047  N N   . ALA A 1 551 ? 49.538  116.168 46.737  1.00 48.64 ? 551 ALA D N   1 
ATOM   4048  C CA  . ALA A 1 551 ? 49.388  114.930 47.497  1.00 48.61 ? 551 ALA D CA  1 
ATOM   4049  C C   . ALA A 1 551 ? 50.498  113.962 47.101  1.00 48.66 ? 551 ALA D C   1 
ATOM   4050  O O   . ALA A 1 551 ? 50.753  113.761 45.915  1.00 48.68 ? 551 ALA D O   1 
ATOM   4051  C CB  . ALA A 1 551 ? 48.028  114.316 47.242  1.00 48.47 ? 551 ALA D CB  1 
ATOM   4052  N N   . LYS A 1 552 ? 51.165  113.374 48.090  1.00 48.68 ? 552 LYS D N   1 
ATOM   4053  C CA  . LYS A 1 552 ? 52.338  112.543 47.827  1.00 48.88 ? 552 LYS D CA  1 
ATOM   4054  C C   . LYS A 1 552 ? 52.267  111.200 48.552  1.00 49.32 ? 552 LYS D C   1 
ATOM   4055  O O   . LYS A 1 552 ? 51.519  111.057 49.514  1.00 49.35 ? 552 LYS D O   1 
ATOM   4056  C CB  . LYS A 1 552 ? 53.620  113.286 48.217  1.00 48.68 ? 552 LYS D CB  1 
ATOM   4057  C CG  . LYS A 1 552 ? 53.718  114.708 47.694  1.00 47.96 ? 552 LYS D CG  1 
ATOM   4058  C CD  . LYS A 1 552 ? 54.884  115.442 48.328  1.00 47.10 ? 552 LYS D CD  1 
ATOM   4059  C CE  . LYS A 1 552 ? 54.570  116.907 48.525  1.00 46.19 ? 552 LYS D CE  1 
ATOM   4060  N NZ  . LYS A 1 552 ? 53.608  117.088 49.633  1.00 46.22 ? 552 LYS D NZ  1 
ATOM   4061  N N   . CYS A 1 553 ? 53.051  110.224 48.090  1.00 50.01 ? 553 CYS D N   1 
ATOM   4062  C CA  . CYS A 1 553 ? 53.055  108.889 48.696  1.00 50.71 ? 553 CYS D CA  1 
ATOM   4063  C C   . CYS A 1 553 ? 54.411  108.230 48.940  1.00 51.01 ? 553 CYS D C   1 
ATOM   4064  O O   . CYS A 1 553 ? 55.321  108.305 48.111  1.00 51.13 ? 553 CYS D O   1 
ATOM   4065  C CB  . CYS A 1 553 ? 52.164  107.957 47.905  1.00 50.72 ? 553 CYS D CB  1 
ATOM   4066  S SG  . CYS A 1 553 ? 50.458  108.192 48.347  1.00 52.15 ? 553 CYS D SG  1 
ATOM   4067  N N   . TYR A 1 554 ? 54.507  107.565 50.089  1.00 51.41 ? 554 TYR D N   1 
ATOM   4068  C CA  . TYR A 1 554 ? 55.740  106.941 50.563  1.00 51.82 ? 554 TYR D CA  1 
ATOM   4069  C C   . TYR A 1 554 ? 56.021  105.625 49.839  1.00 51.88 ? 554 TYR D C   1 
ATOM   4070  O O   . TYR A 1 554 ? 55.153  104.752 49.768  1.00 51.98 ? 554 TYR D O   1 
ATOM   4071  C CB  . TYR A 1 554 ? 55.656  106.735 52.085  1.00 52.05 ? 554 TYR D CB  1 
ATOM   4072  C CG  . TYR A 1 554 ? 56.829  106.015 52.716  1.00 52.35 ? 554 TYR D CG  1 
ATOM   4073  C CD1 . TYR A 1 554 ? 58.139  106.489 52.565  1.00 52.50 ? 554 TYR D CD1 1 
ATOM   4074  C CD2 . TYR A 1 554 ? 56.624  104.870 53.489  1.00 52.58 ? 554 TYR D CD2 1 
ATOM   4075  C CE1 . TYR A 1 554 ? 59.216  105.824 53.153  1.00 52.89 ? 554 TYR D CE1 1 
ATOM   4076  C CE2 . TYR A 1 554 ? 57.690  104.199 54.086  1.00 52.72 ? 554 TYR D CE2 1 
ATOM   4077  C CZ  . TYR A 1 554 ? 58.981  104.679 53.915  1.00 52.93 ? 554 TYR D CZ  1 
ATOM   4078  O OH  . TYR A 1 554 ? 60.031  104.011 54.506  1.00 52.97 ? 554 TYR D OH  1 
ATOM   4079  N N   . GLY A 1 555 ? 57.236  105.500 49.302  1.00 51.94 ? 555 GLY D N   1 
ATOM   4080  C CA  . GLY A 1 555 ? 57.653  104.315 48.544  1.00 51.95 ? 555 GLY D CA  1 
ATOM   4081  C C   . GLY A 1 555 ? 57.584  103.005 49.313  1.00 51.90 ? 555 GLY D C   1 
ATOM   4082  O O   . GLY A 1 555 ? 58.191  102.860 50.377  1.00 51.88 ? 555 GLY D O   1 
ATOM   4083  N N   . MET B 1 1   ? 11.703  118.051 152.603 1.00 51.21 ? 1   MET A N   1 
ATOM   4084  C CA  . MET B 1 1   ? 12.439  117.513 151.424 1.00 51.13 ? 1   MET A CA  1 
ATOM   4085  C C   . MET B 1 1   ? 13.708  118.305 151.148 1.00 50.87 ? 1   MET A C   1 
ATOM   4086  O O   . MET B 1 1   ? 14.739  117.727 150.807 1.00 50.79 ? 1   MET A O   1 
ATOM   4087  C CB  . MET B 1 1   ? 11.556  117.525 150.180 1.00 50.90 ? 1   MET A CB  1 
ATOM   4088  C CG  . MET B 1 1   ? 10.356  116.614 150.251 1.00 51.27 ? 1   MET A CG  1 
ATOM   4089  S SD  . MET B 1 1   ? 9.568   116.438 148.640 1.00 51.95 ? 1   MET A SD  1 
ATOM   4090  C CE  . MET B 1 1   ? 10.670  115.258 147.875 1.00 52.12 ? 1   MET A CE  1 
ATOM   4091  N N   . LYS B 1 2   ? 13.621  119.624 151.309 1.00 50.70 ? 2   LYS A N   1 
ATOM   4092  C CA  . LYS B 1 2   ? 14.705  120.543 150.960 1.00 50.73 ? 2   LYS A CA  1 
ATOM   4093  C C   . LYS B 1 2   ? 15.996  120.334 151.755 1.00 50.50 ? 2   LYS A C   1 
ATOM   4094  O O   . LYS B 1 2   ? 17.073  120.741 151.315 1.00 50.43 ? 2   LYS A O   1 
ATOM   4095  C CB  . LYS B 1 2   ? 14.233  121.996 151.076 1.00 50.67 ? 2   LYS A CB  1 
ATOM   4096  C CG  . LYS B 1 2   ? 13.519  122.507 149.827 1.00 51.05 ? 2   LYS A CG  1 
ATOM   4097  C CD  . LYS B 1 2   ? 13.062  123.952 149.986 1.00 51.50 ? 2   LYS A CD  1 
ATOM   4098  C CE  . LYS B 1 2   ? 11.732  124.052 150.748 1.00 53.03 ? 2   LYS A CE  1 
ATOM   4099  N NZ  . LYS B 1 2   ? 11.159  125.433 150.730 1.00 53.12 ? 2   LYS A NZ  1 
ATOM   4100  N N   . ASN B 1 3   ? 15.886  119.699 152.916 1.00 50.40 ? 3   ASN A N   1 
ATOM   4101  C CA  . ASN B 1 3   ? 17.054  119.410 153.730 1.00 50.24 ? 3   ASN A CA  1 
ATOM   4102  C C   . ASN B 1 3   ? 17.510  117.958 153.631 1.00 50.15 ? 3   ASN A C   1 
ATOM   4103  O O   . ASN B 1 3   ? 18.207  117.455 154.510 1.00 50.17 ? 3   ASN A O   1 
ATOM   4104  C CB  . ASN B 1 3   ? 16.807  119.821 155.180 1.00 50.33 ? 3   ASN A CB  1 
ATOM   4105  C CG  . ASN B 1 3   ? 16.817  121.324 155.364 1.00 50.59 ? 3   ASN A CG  1 
ATOM   4106  O OD1 . ASN B 1 3   ? 16.236  122.066 154.569 1.00 51.06 ? 3   ASN A OD1 1 
ATOM   4107  N ND2 . ASN B 1 3   ? 17.480  121.783 156.415 1.00 50.85 ? 3   ASN A ND2 1 
ATOM   4108  N N   . ILE B 1 4   ? 17.126  117.299 152.544 1.00 50.13 ? 4   ILE A N   1 
ATOM   4109  C CA  . ILE B 1 4   ? 17.501  115.906 152.302 1.00 50.19 ? 4   ILE A CA  1 
ATOM   4110  C C   . ILE B 1 4   ? 18.492  115.804 151.139 1.00 50.23 ? 4   ILE A C   1 
ATOM   4111  O O   . ILE B 1 4   ? 18.337  116.477 150.116 1.00 50.28 ? 4   ILE A O   1 
ATOM   4112  C CB  . ILE B 1 4   ? 16.252  115.022 152.028 1.00 50.15 ? 4   ILE A CB  1 
ATOM   4113  C CG1 . ILE B 1 4   ? 15.334  115.000 153.253 1.00 49.86 ? 4   ILE A CG1 1 
ATOM   4114  C CG2 . ILE B 1 4   ? 16.654  113.600 151.627 1.00 50.03 ? 4   ILE A CG2 1 
ATOM   4115  C CD1 . ILE B 1 4   ? 13.952  114.455 152.974 1.00 49.13 ? 4   ILE A CD1 1 
ATOM   4116  N N   . ARG B 1 5   ? 19.518  114.975 151.316 1.00 50.17 ? 5   ARG A N   1 
ATOM   4117  C CA  . ARG B 1 5   ? 20.457  114.666 150.246 1.00 50.19 ? 5   ARG A CA  1 
ATOM   4118  C C   . ARG B 1 5   ? 20.617  113.154 150.110 1.00 50.45 ? 5   ARG A C   1 
ATOM   4119  O O   . ARG B 1 5   ? 21.163  112.490 150.994 1.00 50.56 ? 5   ARG A O   1 
ATOM   4120  C CB  . ARG B 1 5   ? 21.819  115.317 150.506 1.00 50.10 ? 5   ARG A CB  1 
ATOM   4121  C CG  . ARG B 1 5   ? 21.817  116.835 150.668 1.00 49.76 ? 5   ARG A CG  1 
ATOM   4122  C CD  . ARG B 1 5   ? 21.679  117.552 149.334 1.00 48.72 ? 5   ARG A CD  1 
ATOM   4123  N NE  . ARG B 1 5   ? 21.652  119.008 149.473 1.00 47.37 ? 5   ARG A NE  1 
ATOM   4124  C CZ  . ARG B 1 5   ? 20.612  119.705 149.924 1.00 47.03 ? 5   ARG A CZ  1 
ATOM   4125  N NH1 . ARG B 1 5   ? 19.500  119.089 150.304 1.00 47.34 ? 5   ARG A NH1 1 
ATOM   4126  N NH2 . ARG B 1 5   ? 20.684  121.024 150.003 1.00 46.14 ? 5   ARG A NH2 1 
ATOM   4127  N N   . ASN B 1 6   ? 20.116  112.612 149.007 1.00 50.84 ? 6   ASN A N   1 
ATOM   4128  C CA  . ASN B 1 6   ? 20.287  111.198 148.698 1.00 51.19 ? 6   ASN A CA  1 
ATOM   4129  C C   . ASN B 1 6   ? 21.460  111.046 147.744 1.00 51.60 ? 6   ASN A C   1 
ATOM   4130  O O   . ASN B 1 6   ? 21.497  111.681 146.680 1.00 51.64 ? 6   ASN A O   1 
ATOM   4131  C CB  . ASN B 1 6   ? 19.019  110.616 148.069 1.00 50.99 ? 6   ASN A CB  1 
ATOM   4132  C CG  . ASN B 1 6   ? 17.781  110.921 148.873 1.00 50.73 ? 6   ASN A CG  1 
ATOM   4133  O OD1 . ASN B 1 6   ? 17.678  110.546 150.037 1.00 50.70 ? 6   ASN A OD1 1 
ATOM   4134  N ND2 . ASN B 1 6   ? 16.829  111.607 148.256 1.00 50.35 ? 6   ASN A ND2 1 
ATOM   4135  N N   . PHE B 1 7   ? 22.422  110.216 148.131 1.00 51.85 ? 7   PHE A N   1 
ATOM   4136  C CA  . PHE B 1 7   ? 23.629  110.045 147.340 1.00 52.19 ? 7   PHE A CA  1 
ATOM   4137  C C   . PHE B 1 7   ? 24.203  108.654 147.518 1.00 52.44 ? 7   PHE A C   1 
ATOM   4138  O O   . PHE B 1 7   ? 23.945  107.998 148.528 1.00 52.62 ? 7   PHE A O   1 
ATOM   4139  C CB  . PHE B 1 7   ? 24.672  111.104 147.719 1.00 52.03 ? 7   PHE A CB  1 
ATOM   4140  C CG  . PHE B 1 7   ? 25.256  110.926 149.096 1.00 52.33 ? 7   PHE A CG  1 
ATOM   4141  C CD1 . PHE B 1 7   ? 24.629  111.474 150.211 1.00 52.43 ? 7   PHE A CD1 1 
ATOM   4142  C CD2 . PHE B 1 7   ? 26.449  110.218 149.277 1.00 52.37 ? 7   PHE A CD2 1 
ATOM   4143  C CE1 . PHE B 1 7   ? 25.177  111.307 151.489 1.00 53.02 ? 7   PHE A CE1 1 
ATOM   4144  C CE2 . PHE B 1 7   ? 27.004  110.049 150.548 1.00 51.93 ? 7   PHE A CE2 1 
ATOM   4145  C CZ  . PHE B 1 7   ? 26.371  110.593 151.655 1.00 52.08 ? 7   PHE A CZ  1 
ATOM   4146  N N   . SER B 1 8   ? 24.985  108.211 146.539 1.00 52.65 ? 8   SER A N   1 
ATOM   4147  C CA  . SER B 1 8   ? 25.752  106.976 146.676 1.00 52.97 ? 8   SER A CA  1 
ATOM   4148  C C   . SER B 1 8   ? 27.259  107.229 146.545 1.00 52.98 ? 8   SER A C   1 
ATOM   4149  O O   . SER B 1 8   ? 27.684  108.335 146.211 1.00 52.74 ? 8   SER A O   1 
ATOM   4150  C CB  . SER B 1 8   ? 25.269  105.927 145.677 1.00 52.95 ? 8   SER A CB  1 
ATOM   4151  O OG  . SER B 1 8   ? 25.234  106.454 144.368 1.00 53.74 ? 8   SER A OG  1 
ATOM   4152  N N   . ILE B 1 9   ? 28.059  106.206 146.837 1.00 53.29 ? 9   ILE A N   1 
ATOM   4153  C CA  . ILE B 1 9   ? 29.517  106.315 146.767 1.00 53.65 ? 9   ILE A CA  1 
ATOM   4154  C C   . ILE B 1 9   ? 30.081  105.403 145.685 1.00 53.97 ? 9   ILE A C   1 
ATOM   4155  O O   . ILE B 1 9   ? 29.798  104.203 145.668 1.00 54.16 ? 9   ILE A O   1 
ATOM   4156  C CB  . ILE B 1 9   ? 30.188  105.996 148.125 1.00 53.55 ? 9   ILE A CB  1 
ATOM   4157  C CG1 . ILE B 1 9   ? 29.761  107.021 149.183 1.00 53.75 ? 9   ILE A CG1 1 
ATOM   4158  C CG2 . ILE B 1 9   ? 31.708  105.971 147.982 1.00 53.42 ? 9   ILE A CG2 1 
ATOM   4159  C CD1 . ILE B 1 9   ? 30.316  106.768 150.574 1.00 53.67 ? 9   ILE A CD1 1 
ATOM   4160  N N   . ILE B 1 10  ? 30.863  105.985 144.775 1.00 54.34 ? 10  ILE A N   1 
ATOM   4161  C CA  . ILE B 1 10  ? 31.577  105.213 143.757 1.00 54.64 ? 10  ILE A CA  1 
ATOM   4162  C C   . ILE B 1 10  ? 33.086  105.278 144.020 1.00 55.13 ? 10  ILE A C   1 
ATOM   4163  O O   . ILE B 1 10  ? 33.718  106.318 143.827 1.00 55.14 ? 10  ILE A O   1 
ATOM   4164  C CB  . ILE B 1 10  ? 31.241  105.678 142.323 1.00 54.53 ? 10  ILE A CB  1 
ATOM   4165  C CG1 . ILE B 1 10  ? 29.746  106.007 142.202 1.00 54.36 ? 10  ILE A CG1 1 
ATOM   4166  C CG2 . ILE B 1 10  ? 31.655  104.601 141.322 1.00 54.69 ? 10  ILE A CG2 1 
ATOM   4167  C CD1 . ILE B 1 10  ? 29.352  106.801 140.963 1.00 54.27 ? 10  ILE A CD1 1 
ATOM   4168  N N   . ALA B 1 11  ? 33.643  104.159 144.481 1.00 55.76 ? 11  ALA A N   1 
ATOM   4169  C CA  . ALA B 1 11  ? 35.045  104.078 144.891 1.00 56.43 ? 11  ALA A CA  1 
ATOM   4170  C C   . ALA B 1 11  ? 35.629  102.695 144.580 1.00 56.97 ? 11  ALA A C   1 
ATOM   4171  O O   . ALA B 1 11  ? 35.030  101.922 143.828 1.00 56.99 ? 11  ALA A O   1 
ATOM   4172  C CB  . ALA B 1 11  ? 35.175  104.401 146.378 1.00 56.39 ? 11  ALA A CB  1 
ATOM   4173  N N   . HIS B 1 12  ? 36.793  102.384 145.151 1.00 57.65 ? 12  HIS A N   1 
ATOM   4174  C CA  . HIS B 1 12  ? 37.421  101.082 144.932 1.00 58.37 ? 12  HIS A CA  1 
ATOM   4175  C C   . HIS B 1 12  ? 38.030  100.449 146.195 1.00 58.90 ? 12  HIS A C   1 
ATOM   4176  O O   . HIS B 1 12  ? 37.426  99.543  146.792 1.00 58.99 ? 12  HIS A O   1 
ATOM   4177  C CB  . HIS B 1 12  ? 38.450  101.156 143.799 1.00 58.40 ? 12  HIS A CB  1 
ATOM   4178  C CG  . HIS B 1 12  ? 39.010  99.823  143.415 1.00 58.67 ? 12  HIS A CG  1 
ATOM   4179  N ND1 . HIS B 1 12  ? 40.289  99.429  143.748 1.00 59.03 ? 12  HIS A ND1 1 
ATOM   4180  C CD2 . HIS B 1 12  ? 38.455  98.780  142.753 1.00 58.54 ? 12  HIS A CD2 1 
ATOM   4181  C CE1 . HIS B 1 12  ? 40.502  98.207  143.292 1.00 58.91 ? 12  HIS A CE1 1 
ATOM   4182  N NE2 . HIS B 1 12  ? 39.405  97.791  142.685 1.00 58.69 ? 12  HIS A NE2 1 
ATOM   4183  N N   . ILE B 1 13  ? 39.221  100.914 146.586 1.00 59.36 ? 13  ILE A N   1 
ATOM   4184  C CA  . ILE B 1 13  ? 39.928  100.385 147.763 1.00 59.65 ? 13  ILE A CA  1 
ATOM   4185  C C   . ILE B 1 13  ? 39.271  100.875 149.064 1.00 59.91 ? 13  ILE A C   1 
ATOM   4186  O O   . ILE B 1 13  ? 39.337  100.209 150.103 1.00 60.24 ? 13  ILE A O   1 
ATOM   4187  C CB  . ILE B 1 13  ? 41.439  100.764 147.747 1.00 59.67 ? 13  ILE A CB  1 
ATOM   4188  C CG1 . ILE B 1 13  ? 42.223  99.901  148.749 1.00 59.57 ? 13  ILE A CG1 1 
ATOM   4189  C CG2 . ILE B 1 13  ? 41.628  102.278 147.991 1.00 59.68 ? 13  ILE A CG2 1 
ATOM   4190  C CD1 . ILE B 1 13  ? 43.734  99.931  148.573 1.00 59.60 ? 13  ILE A CD1 1 
ATOM   4191  N N   . SER B 1 18  ? 39.601  102.282 156.696 1.00 59.65 ? 18  SER A N   1 
ATOM   4192  C CA  . SER B 1 18  ? 38.485  103.217 156.811 1.00 59.63 ? 18  SER A CA  1 
ATOM   4193  C C   . SER B 1 18  ? 38.099  103.739 155.441 1.00 59.43 ? 18  SER A C   1 
ATOM   4194  O O   . SER B 1 18  ? 38.842  104.514 154.838 1.00 59.47 ? 18  SER A O   1 
ATOM   4195  C CB  . SER B 1 18  ? 38.855  104.409 157.706 1.00 59.69 ? 18  SER A CB  1 
ATOM   4196  O OG  . SER B 1 18  ? 39.750  104.035 158.740 1.00 60.48 ? 18  SER A OG  1 
ATOM   4197  N N   . THR B 1 19  ? 36.941  103.310 154.948 1.00 59.27 ? 19  THR A N   1 
ATOM   4198  C CA  . THR B 1 19  ? 36.367  103.895 153.738 1.00 59.11 ? 19  THR A CA  1 
ATOM   4199  C C   . THR B 1 19  ? 35.605  105.164 154.110 1.00 58.76 ? 19  THR A C   1 
ATOM   4200  O O   . THR B 1 19  ? 35.224  105.344 155.269 1.00 58.75 ? 19  THR A O   1 
ATOM   4201  C CB  . THR B 1 19  ? 35.435  102.912 152.990 1.00 59.26 ? 19  THR A CB  1 
ATOM   4202  O OG1 . THR B 1 19  ? 34.592  102.229 153.929 1.00 59.48 ? 19  THR A OG1 1 
ATOM   4203  C CG2 . THR B 1 19  ? 36.250  101.893 152.198 1.00 59.34 ? 19  THR A CG2 1 
ATOM   4204  N N   . LEU B 1 20  ? 35.388  106.034 153.126 1.00 58.32 ? 20  LEU A N   1 
ATOM   4205  C CA  . LEU B 1 20  ? 34.749  107.332 153.352 1.00 57.93 ? 20  LEU A CA  1 
ATOM   4206  C C   . LEU B 1 20  ? 33.391  107.206 154.032 1.00 57.73 ? 20  LEU A C   1 
ATOM   4207  O O   . LEU B 1 20  ? 33.028  108.036 154.861 1.00 57.72 ? 20  LEU A O   1 
ATOM   4208  C CB  . LEU B 1 20  ? 34.606  108.102 152.036 1.00 57.92 ? 20  LEU A CB  1 
ATOM   4209  C CG  . LEU B 1 20  ? 34.260  109.591 152.147 1.00 57.85 ? 20  LEU A CG  1 
ATOM   4210  C CD1 . LEU B 1 20  ? 35.473  110.419 152.568 1.00 58.30 ? 20  LEU A CD1 1 
ATOM   4211  C CD2 . LEU B 1 20  ? 33.702  110.110 150.844 1.00 57.43 ? 20  LEU A CD2 1 
ATOM   4212  N N   . SER B 1 21  ? 32.653  106.162 153.667 1.00 57.57 ? 21  SER A N   1 
ATOM   4213  C CA  . SER B 1 21  ? 31.356  105.856 154.262 1.00 57.38 ? 21  SER A CA  1 
ATOM   4214  C C   . SER B 1 21  ? 31.461  105.787 155.786 1.00 57.24 ? 21  SER A C   1 
ATOM   4215  O O   . SER B 1 21  ? 30.663  106.396 156.494 1.00 57.26 ? 21  SER A O   1 
ATOM   4216  C CB  . SER B 1 21  ? 30.813  104.545 153.675 1.00 57.45 ? 21  SER A CB  1 
ATOM   4217  O OG  . SER B 1 21  ? 29.904  103.902 154.550 1.00 57.70 ? 21  SER A OG  1 
ATOM   4218  N N   . ASP B 1 22  ? 32.467  105.065 156.276 1.00 57.13 ? 22  ASP A N   1 
ATOM   4219  C CA  . ASP B 1 22  ? 32.708  104.909 157.710 1.00 56.90 ? 22  ASP A CA  1 
ATOM   4220  C C   . ASP B 1 22  ? 33.060  106.218 158.408 1.00 56.51 ? 22  ASP A C   1 
ATOM   4221  O O   . ASP B 1 22  ? 32.660  106.429 159.554 1.00 56.50 ? 22  ASP A O   1 
ATOM   4222  C CB  . ASP B 1 22  ? 33.801  103.862 157.962 1.00 57.13 ? 22  ASP A CB  1 
ATOM   4223  C CG  . ASP B 1 22  ? 33.319  102.440 157.712 1.00 57.81 ? 22  ASP A CG  1 
ATOM   4224  O OD1 . ASP B 1 22  ? 32.643  102.206 156.688 1.00 59.10 ? 22  ASP A OD1 1 
ATOM   4225  O OD2 . ASP B 1 22  ? 33.611  101.551 158.540 1.00 58.17 ? 22  ASP A OD2 1 
ATOM   4226  N N   . ARG B 1 23  ? 33.801  107.090 157.724 1.00 56.03 ? 23  ARG A N   1 
ATOM   4227  C CA  . ARG B 1 23  ? 34.168  108.386 158.294 1.00 55.74 ? 23  ARG A CA  1 
ATOM   4228  C C   . ARG B 1 23  ? 33.019  109.385 158.301 1.00 55.57 ? 23  ARG A C   1 
ATOM   4229  O O   . ARG B 1 23  ? 32.944  110.240 159.187 1.00 55.53 ? 23  ARG A O   1 
ATOM   4230  C CB  . ARG B 1 23  ? 35.383  108.987 157.598 1.00 55.74 ? 23  ARG A CB  1 
ATOM   4231  C CG  . ARG B 1 23  ? 36.701  108.409 158.078 1.00 55.94 ? 23  ARG A CG  1 
ATOM   4232  C CD  . ARG B 1 23  ? 37.428  107.704 156.966 1.00 55.87 ? 23  ARG A CD  1 
ATOM   4233  N NE  . ARG B 1 23  ? 38.012  108.679 156.054 1.00 55.61 ? 23  ARG A NE  1 
ATOM   4234  C CZ  . ARG B 1 23  ? 38.412  108.416 154.815 1.00 56.25 ? 23  ARG A CZ  1 
ATOM   4235  N NH1 . ARG B 1 23  ? 38.302  107.194 154.304 1.00 56.58 ? 23  ARG A NH1 1 
ATOM   4236  N NH2 . ARG B 1 23  ? 38.922  109.389 154.082 1.00 56.46 ? 23  ARG A NH2 1 
ATOM   4237  N N   . ILE B 1 24  ? 32.132  109.279 157.313 1.00 55.43 ? 24  ILE A N   1 
ATOM   4238  C CA  . ILE B 1 24  ? 30.914  110.083 157.288 1.00 55.25 ? 24  ILE A CA  1 
ATOM   4239  C C   . ILE B 1 24  ? 30.007  109.701 158.461 1.00 55.49 ? 24  ILE A C   1 
ATOM   4240  O O   . ILE B 1 24  ? 29.505  110.577 159.174 1.00 55.64 ? 24  ILE A O   1 
ATOM   4241  C CB  . ILE B 1 24  ? 30.162  109.968 155.943 1.00 55.18 ? 24  ILE A CB  1 
ATOM   4242  C CG1 . ILE B 1 24  ? 30.970  110.634 154.824 1.00 55.01 ? 24  ILE A CG1 1 
ATOM   4243  C CG2 . ILE B 1 24  ? 28.780  110.605 156.045 1.00 55.32 ? 24  ILE A CG2 1 
ATOM   4244  C CD1 . ILE B 1 24  ? 30.362  110.515 153.443 1.00 54.77 ? 24  ILE A CD1 1 
ATOM   4245  N N   . ILE B 1 25  ? 29.824  108.398 158.676 1.00 55.56 ? 25  ILE A N   1 
ATOM   4246  C CA  . ILE B 1 25  ? 29.029  107.911 159.806 1.00 55.73 ? 25  ILE A CA  1 
ATOM   4247  C C   . ILE B 1 25  ? 29.595  108.411 161.138 1.00 55.88 ? 25  ILE A C   1 
ATOM   4248  O O   . ILE B 1 25  ? 28.835  108.767 162.040 1.00 55.90 ? 25  ILE A O   1 
ATOM   4249  C CB  . ILE B 1 25  ? 28.899  106.361 159.816 1.00 55.67 ? 25  ILE A CB  1 
ATOM   4250  C CG1 . ILE B 1 25  ? 28.145  105.868 158.577 1.00 55.39 ? 25  ILE A CG1 1 
ATOM   4251  C CG2 . ILE B 1 25  ? 28.174  105.881 161.071 1.00 55.81 ? 25  ILE A CG2 1 
ATOM   4252  C CD1 . ILE B 1 25  ? 28.355  104.389 158.275 1.00 54.87 ? 25  ILE A CD1 1 
ATOM   4253  N N   . GLN B 1 26  ? 30.923  108.459 161.243 1.00 56.14 ? 26  GLN A N   1 
ATOM   4254  C CA  . GLN B 1 26  ? 31.592  108.863 162.485 1.00 56.62 ? 26  GLN A CA  1 
ATOM   4255  C C   . GLN B 1 26  ? 31.382  110.324 162.867 1.00 56.48 ? 26  GLN A C   1 
ATOM   4256  O O   . GLN B 1 26  ? 31.306  110.653 164.053 1.00 56.47 ? 26  GLN A O   1 
ATOM   4257  C CB  . GLN B 1 26  ? 33.083  108.530 162.437 1.00 56.40 ? 26  GLN A CB  1 
ATOM   4258  C CG  . GLN B 1 26  ? 33.385  107.081 162.777 1.00 57.24 ? 26  GLN A CG  1 
ATOM   4259  C CD  . GLN B 1 26  ? 34.864  106.736 162.661 1.00 57.71 ? 26  GLN A CD  1 
ATOM   4260  O OE1 . GLN B 1 26  ? 35.714  107.325 163.338 1.00 59.40 ? 26  GLN A OE1 1 
ATOM   4261  N NE2 . GLN B 1 26  ? 35.177  105.765 161.806 1.00 58.92 ? 26  GLN A NE2 1 
ATOM   4262  N N   . ILE B 1 27  ? 31.282  111.198 161.870 1.00 56.61 ? 27  ILE A N   1 
ATOM   4263  C CA  . ILE B 1 27  ? 31.081  112.624 162.142 1.00 56.76 ? 27  ILE A CA  1 
ATOM   4264  C C   . ILE B 1 27  ? 29.598  113.016 162.154 1.00 56.78 ? 27  ILE A C   1 
ATOM   4265  O O   . ILE B 1 27  ? 29.249  114.157 162.461 1.00 56.96 ? 27  ILE A O   1 
ATOM   4266  C CB  . ILE B 1 27  ? 31.915  113.540 161.204 1.00 56.60 ? 27  ILE A CB  1 
ATOM   4267  C CG1 . ILE B 1 27  ? 31.338  113.572 159.797 1.00 56.64 ? 27  ILE A CG1 1 
ATOM   4268  C CG2 . ILE B 1 27  ? 33.365  113.091 161.162 1.00 56.55 ? 27  ILE A CG2 1 
ATOM   4269  C CD1 . ILE B 1 27  ? 32.097  114.508 158.881 1.00 57.15 ? 27  ILE A CD1 1 
ATOM   4270  N N   . CYS B 1 28  ? 28.734  112.062 161.824 1.00 56.77 ? 28  CYS A N   1 
ATOM   4271  C CA  . CYS B 1 28  ? 27.301  112.234 162.001 1.00 56.68 ? 28  CYS A CA  1 
ATOM   4272  C C   . CYS B 1 28  ? 26.857  111.315 163.138 1.00 56.90 ? 28  CYS A C   1 
ATOM   4273  O O   . CYS B 1 28  ? 27.462  111.337 164.211 1.00 56.73 ? 28  CYS A O   1 
ATOM   4274  C CB  . CYS B 1 28  ? 26.570  111.936 160.697 1.00 56.71 ? 28  CYS A CB  1 
ATOM   4275  S SG  . CYS B 1 28  ? 27.145  112.917 159.284 1.00 56.31 ? 28  CYS A SG  1 
ATOM   4276  N N   . GLY B 1 29  ? 25.818  110.507 162.911 1.00 57.36 ? 29  GLY A N   1 
ATOM   4277  C CA  . GLY B 1 29  ? 25.335  109.535 163.909 1.00 57.88 ? 29  GLY A CA  1 
ATOM   4278  C C   . GLY B 1 29  ? 26.354  109.101 164.957 1.00 58.27 ? 29  GLY A C   1 
ATOM   4279  O O   . GLY B 1 29  ? 26.145  109.314 166.160 1.00 58.33 ? 29  GLY A O   1 
ATOM   4280  N N   . GLY B 1 30  ? 27.458  108.499 164.500 1.00 58.50 ? 30  GLY A N   1 
ATOM   4281  C CA  . GLY B 1 30  ? 28.542  108.061 165.389 1.00 58.69 ? 30  GLY A CA  1 
ATOM   4282  C C   . GLY B 1 30  ? 28.728  106.547 165.472 1.00 58.81 ? 30  GLY A C   1 
ATOM   4283  O O   . GLY B 1 30  ? 27.957  105.786 164.863 1.00 58.87 ? 30  GLY A O   1 
ATOM   4284  N N   . GLN B 1 57  ? 25.261  98.829  154.374 1.00 59.78 ? 57  GLN A N   1 
ATOM   4285  C CA  . GLN B 1 57  ? 24.712  98.867  153.024 1.00 59.78 ? 57  GLN A CA  1 
ATOM   4286  C C   . GLN B 1 57  ? 23.988  100.194 152.725 1.00 59.49 ? 57  GLN A C   1 
ATOM   4287  O O   . GLN B 1 57  ? 23.989  100.667 151.584 1.00 59.68 ? 57  GLN A O   1 
ATOM   4288  C CB  . GLN B 1 57  ? 23.766  97.681  152.798 1.00 59.94 ? 57  GLN A CB  1 
ATOM   4289  C CG  . GLN B 1 57  ? 23.515  97.359  151.322 1.00 60.81 ? 57  GLN A CG  1 
ATOM   4290  C CD  . GLN B 1 57  ? 22.066  96.986  151.019 1.00 61.83 ? 57  GLN A CD  1 
ATOM   4291  O OE1 . GLN B 1 57  ? 21.482  97.471  150.045 1.00 61.79 ? 57  GLN A OE1 1 
ATOM   4292  N NE2 . GLN B 1 57  ? 21.480  96.122  151.852 1.00 62.37 ? 57  GLN A NE2 1 
ATOM   4293  N N   . SER B 1 58  ? 23.352  100.775 153.743 1.00 58.85 ? 58  SER A N   1 
ATOM   4294  C CA  . SER B 1 58  ? 22.711  102.088 153.611 1.00 58.07 ? 58  SER A CA  1 
ATOM   4295  C C   . SER B 1 58  ? 22.583  102.770 154.966 1.00 57.36 ? 58  SER A C   1 
ATOM   4296  O O   . SER B 1 58  ? 22.319  102.117 155.972 1.00 57.32 ? 58  SER A O   1 
ATOM   4297  C CB  . SER B 1 58  ? 21.336  101.976 152.949 1.00 58.23 ? 58  SER A CB  1 
ATOM   4298  O OG  . SER B 1 58  ? 20.387  101.381 153.820 1.00 58.46 ? 58  SER A OG  1 
ATOM   4299  N N   . VAL B 1 59  ? 22.777  104.083 154.990 1.00 56.54 ? 59  VAL A N   1 
ATOM   4300  C CA  . VAL B 1 59  ? 22.712  104.831 156.238 1.00 55.92 ? 59  VAL A CA  1 
ATOM   4301  C C   . VAL B 1 59  ? 21.846  106.075 156.084 1.00 55.42 ? 59  VAL A C   1 
ATOM   4302  O O   . VAL B 1 59  ? 21.830  106.706 155.027 1.00 55.26 ? 59  VAL A O   1 
ATOM   4303  C CB  . VAL B 1 59  ? 24.125  105.263 156.757 1.00 56.02 ? 59  VAL A CB  1 
ATOM   4304  C CG1 . VAL B 1 59  ? 24.139  105.339 158.275 1.00 55.58 ? 59  VAL A CG1 1 
ATOM   4305  C CG2 . VAL B 1 59  ? 25.210  104.307 156.291 1.00 56.18 ? 59  VAL A CG2 1 
ATOM   4306  N N   . THR B 1 60  ? 21.118  106.402 157.144 1.00 54.92 ? 60  THR A N   1 
ATOM   4307  C CA  . THR B 1 60  ? 20.466  107.695 157.276 1.00 54.67 ? 60  THR A CA  1 
ATOM   4308  C C   . THR B 1 60  ? 21.135  108.454 158.420 1.00 54.62 ? 60  THR A C   1 
ATOM   4309  O O   . THR B 1 60  ? 21.203  107.966 159.556 1.00 54.39 ? 60  THR A O   1 
ATOM   4310  C CB  . THR B 1 60  ? 18.956  107.554 157.514 1.00 54.60 ? 60  THR A CB  1 
ATOM   4311  O OG1 . THR B 1 60  ? 18.362  106.912 156.379 1.00 54.80 ? 60  THR A OG1 1 
ATOM   4312  C CG2 . THR B 1 60  ? 18.308  108.920 157.721 1.00 54.16 ? 60  THR A CG2 1 
ATOM   4313  N N   . LEU B 1 61  ? 21.638  109.643 158.102 1.00 54.49 ? 61  LEU A N   1 
ATOM   4314  C CA  . LEU B 1 61  ? 22.442  110.422 159.032 1.00 54.49 ? 61  LEU A CA  1 
ATOM   4315  C C   . LEU B 1 61  ? 21.932  111.843 159.177 1.00 54.60 ? 61  LEU A C   1 
ATOM   4316  O O   . LEU B 1 61  ? 21.190  112.342 158.332 1.00 54.65 ? 61  LEU A O   1 
ATOM   4317  C CB  . LEU B 1 61  ? 23.894  110.464 158.559 1.00 54.29 ? 61  LEU A CB  1 
ATOM   4318  C CG  . LEU B 1 61  ? 24.619  109.133 158.413 1.00 54.17 ? 61  LEU A CG  1 
ATOM   4319  C CD1 . LEU B 1 61  ? 25.762  109.280 157.427 1.00 54.05 ? 61  LEU A CD1 1 
ATOM   4320  C CD2 . LEU B 1 61  ? 25.103  108.634 159.772 1.00 54.35 ? 61  LEU A CD2 1 
ATOM   4321  N N   . ASP B 1 62  ? 22.351  112.493 160.256 1.00 54.74 ? 62  ASP A N   1 
ATOM   4322  C CA  . ASP B 1 62  ? 22.038  113.894 160.477 1.00 54.80 ? 62  ASP A CA  1 
ATOM   4323  C C   . ASP B 1 62  ? 23.303  114.745 160.470 1.00 54.77 ? 62  ASP A C   1 
ATOM   4324  O O   . ASP B 1 62  ? 24.289  114.430 161.144 1.00 54.83 ? 62  ASP A O   1 
ATOM   4325  C CB  . ASP B 1 62  ? 21.270  114.071 161.791 1.00 54.78 ? 62  ASP A CB  1 
ATOM   4326  C CG  . ASP B 1 62  ? 19.780  113.788 161.645 1.00 55.01 ? 62  ASP A CG  1 
ATOM   4327  O OD1 . ASP B 1 62  ? 19.271  113.727 160.500 1.00 54.26 ? 62  ASP A OD1 1 
ATOM   4328  O OD2 . ASP B 1 62  ? 19.113  113.637 162.692 1.00 55.78 ? 62  ASP A OD2 1 
ATOM   4329  N N   . TYR B 1 63  ? 23.269  115.826 159.701 1.00 54.67 ? 63  TYR A N   1 
ATOM   4330  C CA  . TYR B 1 63  ? 24.393  116.734 159.646 1.00 54.60 ? 63  TYR A CA  1 
ATOM   4331  C C   . TYR B 1 63  ? 23.977  118.177 159.875 1.00 54.69 ? 63  TYR A C   1 
ATOM   4332  O O   . TYR B 1 63  ? 23.277  118.768 159.048 1.00 54.65 ? 63  TYR A O   1 
ATOM   4333  C CB  . TYR B 1 63  ? 25.139  116.591 158.320 1.00 54.49 ? 63  TYR A CB  1 
ATOM   4334  C CG  . TYR B 1 63  ? 26.317  117.527 158.190 1.00 54.34 ? 63  TYR A CG  1 
ATOM   4335  C CD1 . TYR B 1 63  ? 27.359  117.500 159.119 1.00 54.20 ? 63  TYR A CD1 1 
ATOM   4336  C CD2 . TYR B 1 63  ? 26.393  118.438 157.139 1.00 54.11 ? 63  TYR A CD2 1 
ATOM   4337  C CE1 . TYR B 1 63  ? 28.444  118.361 159.004 1.00 54.11 ? 63  TYR A CE1 1 
ATOM   4338  C CE2 . TYR B 1 63  ? 27.478  119.298 157.012 1.00 53.88 ? 63  TYR A CE2 1 
ATOM   4339  C CZ  . TYR B 1 63  ? 28.495  119.256 157.948 1.00 53.95 ? 63  TYR A CZ  1 
ATOM   4340  O OH  . TYR B 1 63  ? 29.564  120.108 157.833 1.00 54.25 ? 63  TYR A OH  1 
ATOM   4341  N N   . LYS B 1 64  ? 24.401  118.723 161.015 1.00 54.84 ? 64  LYS A N   1 
ATOM   4342  C CA  . LYS B 1 64  ? 24.337  120.160 161.263 1.00 54.90 ? 64  LYS A CA  1 
ATOM   4343  C C   . LYS B 1 64  ? 25.444  120.818 160.466 1.00 54.66 ? 64  LYS A C   1 
ATOM   4344  O O   . LYS B 1 64  ? 26.626  120.566 160.702 1.00 54.79 ? 64  LYS A O   1 
ATOM   4345  C CB  . LYS B 1 64  ? 24.470  120.487 162.753 1.00 54.78 ? 64  LYS A CB  1 
ATOM   4346  C CG  . LYS B 1 64  ? 23.190  121.049 163.376 1.00 55.29 ? 64  LYS A CG  1 
ATOM   4347  C CD  . LYS B 1 64  ? 23.275  121.203 164.907 1.00 55.45 ? 64  LYS A CD  1 
ATOM   4348  C CE  . LYS B 1 64  ? 24.314  122.243 165.356 1.00 56.22 ? 64  LYS A CE  1 
ATOM   4349  N NZ  . LYS B 1 64  ? 23.973  123.640 164.958 1.00 56.29 ? 64  LYS A NZ  1 
ATOM   4350  N N   . ALA B 1 65  ? 25.044  121.639 159.502 1.00 54.56 ? 65  ALA A N   1 
ATOM   4351  C CA  . ALA B 1 65  ? 25.964  122.263 158.563 1.00 54.35 ? 65  ALA A CA  1 
ATOM   4352  C C   . ALA B 1 65  ? 26.330  123.678 159.002 1.00 54.27 ? 65  ALA A C   1 
ATOM   4353  O O   . ALA B 1 65  ? 25.699  124.238 159.900 1.00 54.23 ? 65  ALA A O   1 
ATOM   4354  C CB  . ALA B 1 65  ? 25.352  122.271 157.165 1.00 54.28 ? 65  ALA A CB  1 
ATOM   4355  N N   . SER B 1 66  ? 27.350  124.245 158.360 1.00 54.23 ? 66  SER A N   1 
ATOM   4356  C CA  . SER B 1 66  ? 27.815  125.600 158.652 1.00 54.14 ? 66  SER A CA  1 
ATOM   4357  C C   . SER B 1 66  ? 26.695  126.640 158.556 1.00 54.24 ? 66  SER A C   1 
ATOM   4358  O O   . SER B 1 66  ? 26.742  127.673 159.228 1.00 54.22 ? 66  SER A O   1 
ATOM   4359  C CB  . SER B 1 66  ? 28.963  125.980 157.717 1.00 54.07 ? 66  SER A CB  1 
ATOM   4360  O OG  . SER B 1 66  ? 28.535  125.959 156.368 1.00 53.59 ? 66  SER A OG  1 
ATOM   4361  N N   . ASP B 1 67  ? 25.689  126.359 157.728 1.00 54.24 ? 67  ASP A N   1 
ATOM   4362  C CA  . ASP B 1 67  ? 24.522  127.232 157.607 1.00 54.37 ? 67  ASP A CA  1 
ATOM   4363  C C   . ASP B 1 67  ? 23.581  127.127 158.823 1.00 54.30 ? 67  ASP A C   1 
ATOM   4364  O O   . ASP B 1 67  ? 22.486  127.691 158.827 1.00 54.15 ? 67  ASP A O   1 
ATOM   4365  C CB  . ASP B 1 67  ? 23.775  126.959 156.290 1.00 54.45 ? 67  ASP A CB  1 
ATOM   4366  C CG  . ASP B 1 67  ? 22.853  125.743 156.365 1.00 55.01 ? 67  ASP A CG  1 
ATOM   4367  O OD1 . ASP B 1 67  ? 23.163  124.780 157.104 1.00 55.63 ? 67  ASP A OD1 1 
ATOM   4368  O OD2 . ASP B 1 67  ? 21.808  125.754 155.676 1.00 55.46 ? 67  ASP A OD2 1 
ATOM   4369  N N   . GLY B 1 68  ? 24.015  126.392 159.844 1.00 54.40 ? 68  GLY A N   1 
ATOM   4370  C CA  . GLY B 1 68  ? 23.262  126.247 161.086 1.00 54.52 ? 68  GLY A CA  1 
ATOM   4371  C C   . GLY B 1 68  ? 22.074  125.308 160.987 1.00 54.69 ? 68  GLY A C   1 
ATOM   4372  O O   . GLY B 1 68  ? 21.393  125.051 161.987 1.00 54.79 ? 68  GLY A O   1 
ATOM   4373  N N   . GLU B 1 69  ? 21.823  124.785 159.790 1.00 54.64 ? 69  GLU A N   1 
ATOM   4374  C CA  . GLU B 1 69  ? 20.657  123.939 159.570 1.00 54.60 ? 69  GLU A CA  1 
ATOM   4375  C C   . GLU B 1 69  ? 21.018  122.455 159.539 1.00 54.40 ? 69  GLU A C   1 
ATOM   4376  O O   . GLU B 1 69  ? 22.175  122.089 159.341 1.00 54.39 ? 69  GLU A O   1 
ATOM   4377  C CB  . GLU B 1 69  ? 19.919  124.364 158.303 1.00 54.61 ? 69  GLU A CB  1 
ATOM   4378  C CG  . GLU B 1 69  ? 18.442  124.598 158.545 1.00 55.44 ? 69  GLU A CG  1 
ATOM   4379  C CD  . GLU B 1 69  ? 17.780  125.376 157.428 1.00 56.56 ? 69  GLU A CD  1 
ATOM   4380  O OE1 . GLU B 1 69  ? 17.540  124.779 156.354 1.00 57.40 ? 69  GLU A OE1 1 
ATOM   4381  O OE2 . GLU B 1 69  ? 17.485  126.579 157.627 1.00 56.87 ? 69  GLU A OE2 1 
ATOM   4382  N N   . THR B 1 70  ? 20.016  121.609 159.750 1.00 54.25 ? 70  THR A N   1 
ATOM   4383  C CA  . THR B 1 70  ? 20.221  120.171 159.845 1.00 54.04 ? 70  THR A CA  1 
ATOM   4384  C C   . THR B 1 70  ? 19.784  119.488 158.559 1.00 53.87 ? 70  THR A C   1 
ATOM   4385  O O   . THR B 1 70  ? 18.709  119.771 158.027 1.00 53.90 ? 70  THR A O   1 
ATOM   4386  C CB  . THR B 1 70  ? 19.460  119.582 161.051 1.00 54.09 ? 70  THR A CB  1 
ATOM   4387  O OG1 . THR B 1 70  ? 19.831  120.294 162.241 1.00 54.33 ? 70  THR A OG1 1 
ATOM   4388  C CG2 . THR B 1 70  ? 19.771  118.096 161.232 1.00 53.99 ? 70  THR A CG2 1 
ATOM   4389  N N   . TYR B 1 71  ? 20.629  118.592 158.061 1.00 53.67 ? 71  TYR A N   1 
ATOM   4390  C CA  . TYR B 1 71  ? 20.345  117.883 156.824 1.00 53.48 ? 71  TYR A CA  1 
ATOM   4391  C C   . TYR B 1 71  ? 20.307  116.376 157.054 1.00 53.46 ? 71  TYR A C   1 
ATOM   4392  O O   . TYR B 1 71  ? 21.166  115.823 157.746 1.00 53.58 ? 71  TYR A O   1 
ATOM   4393  C CB  . TYR B 1 71  ? 21.370  118.251 155.743 1.00 53.28 ? 71  TYR A CB  1 
ATOM   4394  C CG  . TYR B 1 71  ? 21.276  119.689 155.278 1.00 53.01 ? 71  TYR A CG  1 
ATOM   4395  C CD1 . TYR B 1 71  ? 21.901  120.714 155.985 1.00 53.11 ? 71  TYR A CD1 1 
ATOM   4396  C CD2 . TYR B 1 71  ? 20.559  120.026 154.131 1.00 53.11 ? 71  TYR A CD2 1 
ATOM   4397  C CE1 . TYR B 1 71  ? 21.809  122.042 155.563 1.00 53.07 ? 71  TYR A CE1 1 
ATOM   4398  C CE2 . TYR B 1 71  ? 20.459  121.348 153.701 1.00 52.69 ? 71  TYR A CE2 1 
ATOM   4399  C CZ  . TYR B 1 71  ? 21.087  122.349 154.421 1.00 52.82 ? 71  TYR A CZ  1 
ATOM   4400  O OH  . TYR B 1 71  ? 20.999  123.657 154.003 1.00 52.66 ? 71  TYR A OH  1 
ATOM   4401  N N   . GLN B 1 72  ? 19.290  115.727 156.489 1.00 53.31 ? 72  GLN A N   1 
ATOM   4402  C CA  . GLN B 1 72  ? 19.173  114.273 156.515 1.00 53.11 ? 72  GLN A CA  1 
ATOM   4403  C C   . GLN B 1 72  ? 19.952  113.700 155.342 1.00 52.96 ? 72  GLN A C   1 
ATOM   4404  O O   . GLN B 1 72  ? 19.570  113.872 154.179 1.00 52.94 ? 72  GLN A O   1 
ATOM   4405  C CB  . GLN B 1 72  ? 17.702  113.836 156.458 1.00 53.12 ? 72  GLN A CB  1 
ATOM   4406  C CG  . GLN B 1 72  ? 17.479  112.330 156.257 1.00 53.00 ? 72  GLN A CG  1 
ATOM   4407  C CD  . GLN B 1 72  ? 16.032  111.982 155.926 1.00 53.29 ? 72  GLN A CD  1 
ATOM   4408  O OE1 . GLN B 1 72  ? 15.161  112.852 155.899 1.00 53.54 ? 72  GLN A OE1 1 
ATOM   4409  N NE2 . GLN B 1 72  ? 15.772  110.700 155.677 1.00 54.11 ? 72  GLN A NE2 1 
ATOM   4410  N N   . LEU B 1 73  ? 21.058  113.035 155.652 1.00 52.80 ? 73  LEU A N   1 
ATOM   4411  C CA  . LEU B 1 73  ? 21.861  112.403 154.622 1.00 52.79 ? 73  LEU A CA  1 
ATOM   4412  C C   . LEU B 1 73  ? 21.460  110.947 154.489 1.00 52.90 ? 73  LEU A C   1 
ATOM   4413  O O   . LEU B 1 73  ? 21.469  110.201 155.470 1.00 52.94 ? 73  LEU A O   1 
ATOM   4414  C CB  . LEU B 1 73  ? 23.352  112.526 154.933 1.00 52.55 ? 73  LEU A CB  1 
ATOM   4415  C CG  . LEU B 1 73  ? 23.934  113.929 155.101 1.00 52.49 ? 73  LEU A CG  1 
ATOM   4416  C CD1 . LEU B 1 73  ? 25.436  113.817 155.194 1.00 53.16 ? 73  LEU A CD1 1 
ATOM   4417  C CD2 . LEU B 1 73  ? 23.547  114.861 153.959 1.00 52.28 ? 73  LEU A CD2 1 
ATOM   4418  N N   . ASN B 1 74  ? 21.078  110.559 153.277 1.00 52.96 ? 74  ASN A N   1 
ATOM   4419  C CA  . ASN B 1 74  ? 20.771  109.172 152.981 1.00 53.17 ? 74  ASN A CA  1 
ATOM   4420  C C   . ASN B 1 74  ? 21.788  108.634 151.997 1.00 53.73 ? 74  ASN A C   1 
ATOM   4421  O O   . ASN B 1 74  ? 21.856  109.083 150.848 1.00 53.88 ? 74  ASN A O   1 
ATOM   4422  C CB  . ASN B 1 74  ? 19.356  109.028 152.428 1.00 52.91 ? 74  ASN A CB  1 
ATOM   4423  C CG  . ASN B 1 74  ? 18.296  109.406 153.436 1.00 52.29 ? 74  ASN A CG  1 
ATOM   4424  O OD1 . ASN B 1 74  ? 18.262  108.883 154.547 1.00 51.50 ? 74  ASN A OD1 1 
ATOM   4425  N ND2 . ASN B 1 74  ? 17.416  110.315 153.048 1.00 52.23 ? 74  ASN A ND2 1 
ATOM   4426  N N   . PHE B 1 75  ? 22.596  107.687 152.463 1.00 54.33 ? 75  PHE A N   1 
ATOM   4427  C CA  . PHE B 1 75  ? 23.646  107.110 151.640 1.00 54.98 ? 75  PHE A CA  1 
ATOM   4428  C C   . PHE B 1 75  ? 23.323  105.670 151.268 1.00 55.34 ? 75  PHE A C   1 
ATOM   4429  O O   . PHE B 1 75  ? 23.199  104.805 152.134 1.00 55.60 ? 75  PHE A O   1 
ATOM   4430  C CB  . PHE B 1 75  ? 25.018  107.245 152.330 1.00 55.12 ? 75  PHE A CB  1 
ATOM   4431  C CG  . PHE B 1 75  ? 25.965  106.112 152.034 1.00 55.44 ? 75  PHE A CG  1 
ATOM   4432  C CD1 . PHE B 1 75  ? 26.412  105.289 153.062 1.00 55.84 ? 75  PHE A CD1 1 
ATOM   4433  C CD2 . PHE B 1 75  ? 26.404  105.859 150.728 1.00 56.17 ? 75  PHE A CD2 1 
ATOM   4434  C CE1 . PHE B 1 75  ? 27.281  104.231 152.804 1.00 56.15 ? 75  PHE A CE1 1 
ATOM   4435  C CE2 . PHE B 1 75  ? 27.272  104.796 150.457 1.00 56.25 ? 75  PHE A CE2 1 
ATOM   4436  C CZ  . PHE B 1 75  ? 27.716  103.985 151.501 1.00 56.09 ? 75  PHE A CZ  1 
ATOM   4437  N N   . ILE B 1 76  ? 23.176  105.429 149.970 1.00 55.84 ? 76  ILE A N   1 
ATOM   4438  C CA  . ILE B 1 76  ? 22.941  104.084 149.440 1.00 56.39 ? 76  ILE A CA  1 
ATOM   4439  C C   . ILE B 1 76  ? 24.261  103.510 148.908 1.00 56.72 ? 76  ILE A C   1 
ATOM   4440  O O   . ILE B 1 76  ? 25.006  104.206 148.216 1.00 56.79 ? 76  ILE A O   1 
ATOM   4441  C CB  . ILE B 1 76  ? 21.837  104.088 148.341 1.00 56.23 ? 76  ILE A CB  1 
ATOM   4442  C CG1 . ILE B 1 76  ? 20.457  104.363 148.948 1.00 56.23 ? 76  ILE A CG1 1 
ATOM   4443  C CG2 . ILE B 1 76  ? 21.780  102.759 147.608 1.00 56.56 ? 76  ILE A CG2 1 
ATOM   4444  C CD1 . ILE B 1 76  ? 20.045  105.825 148.955 1.00 56.15 ? 76  ILE A CD1 1 
ATOM   4445  N N   . ASP B 1 77  ? 24.561  102.257 149.245 1.00 57.17 ? 77  ASP A N   1 
ATOM   4446  C CA  . ASP B 1 77  ? 25.807  101.643 148.786 1.00 57.79 ? 77  ASP A CA  1 
ATOM   4447  C C   . ASP B 1 77  ? 25.690  101.145 147.348 1.00 58.13 ? 77  ASP A C   1 
ATOM   4448  O O   . ASP B 1 77  ? 24.596  100.819 146.878 1.00 58.17 ? 77  ASP A O   1 
ATOM   4449  C CB  . ASP B 1 77  ? 26.273  100.517 149.716 1.00 57.75 ? 77  ASP A CB  1 
ATOM   4450  C CG  . ASP B 1 77  ? 27.792  100.465 149.858 1.00 57.99 ? 77  ASP A CG  1 
ATOM   4451  O OD1 . ASP B 1 77  ? 28.495  101.146 149.079 1.00 58.36 ? 77  ASP A OD1 1 
ATOM   4452  O OD2 . ASP B 1 77  ? 28.288  99.751  150.759 1.00 58.44 ? 77  ASP A OD2 1 
ATOM   4453  N N   . THR B 1 78  ? 26.828  101.093 146.661 1.00 58.54 ? 78  THR A N   1 
ATOM   4454  C CA  . THR B 1 78  ? 26.873  100.709 145.257 1.00 58.88 ? 78  THR A CA  1 
ATOM   4455  C C   . THR B 1 78  ? 27.892  99.596  145.031 1.00 58.90 ? 78  THR A C   1 
ATOM   4456  O O   . THR B 1 78  ? 29.083  99.785  145.307 1.00 59.07 ? 78  THR A O   1 
ATOM   4457  C CB  . THR B 1 78  ? 27.236  101.918 144.369 1.00 58.97 ? 78  THR A CB  1 
ATOM   4458  O OG1 . THR B 1 78  ? 26.460  103.056 144.771 1.00 59.72 ? 78  THR A OG1 1 
ATOM   4459  C CG2 . THR B 1 78  ? 26.962  101.618 142.902 1.00 59.27 ? 78  THR A CG2 1 
ATOM   4460  N N   . PRO B 1 79  ? 27.430  98.422  144.545 1.00 58.91 ? 79  PRO A N   1 
ATOM   4461  C CA  . PRO B 1 79  ? 28.396  97.412  144.095 1.00 58.78 ? 79  PRO A CA  1 
ATOM   4462  C C   . PRO B 1 79  ? 29.150  97.926  142.867 1.00 58.69 ? 79  PRO A C   1 
ATOM   4463  O O   . PRO B 1 79  ? 28.595  98.699  142.078 1.00 58.69 ? 79  PRO A O   1 
ATOM   4464  C CB  . PRO B 1 79  ? 27.523  96.197  143.744 1.00 58.75 ? 79  PRO A CB  1 
ATOM   4465  C CG  . PRO B 1 79  ? 26.140  96.728  143.567 1.00 58.81 ? 79  PRO A CG  1 
ATOM   4466  C CD  . PRO B 1 79  ? 26.030  97.970  144.404 1.00 58.92 ? 79  PRO A CD  1 
ATOM   4467  N N   . GLY B 1 80  ? 30.403  97.509  142.715 1.00 58.49 ? 80  GLY A N   1 
ATOM   4468  C CA  . GLY B 1 80  ? 31.255  98.047  141.662 1.00 58.12 ? 80  GLY A CA  1 
ATOM   4469  C C   . GLY B 1 80  ? 31.320  97.292  140.345 1.00 57.88 ? 80  GLY A C   1 
ATOM   4470  O O   . GLY B 1 80  ? 32.023  97.731  139.428 1.00 58.10 ? 80  GLY A O   1 
ATOM   4471  N N   . HIS B 1 81  ? 30.603  96.173  140.223 1.00 57.51 ? 81  HIS A N   1 
ATOM   4472  C CA  . HIS B 1 81  ? 30.712  95.361  139.001 1.00 57.21 ? 81  HIS A CA  1 
ATOM   4473  C C   . HIS B 1 81  ? 29.503  95.397  138.059 1.00 56.82 ? 81  HIS A C   1 
ATOM   4474  O O   . HIS B 1 81  ? 28.358  95.488  138.502 1.00 56.87 ? 81  HIS A O   1 
ATOM   4475  C CB  . HIS B 1 81  ? 31.114  93.914  139.306 1.00 57.23 ? 81  HIS A CB  1 
ATOM   4476  C CG  . HIS B 1 81  ? 31.782  93.236  138.151 1.00 57.73 ? 81  HIS A CG  1 
ATOM   4477  N ND1 . HIS B 1 81  ? 33.151  93.108  138.056 1.00 58.29 ? 81  HIS A ND1 1 
ATOM   4478  C CD2 . HIS B 1 81  ? 31.273  92.690  137.020 1.00 57.99 ? 81  HIS A CD2 1 
ATOM   4479  C CE1 . HIS B 1 81  ? 33.456  92.495  136.925 1.00 58.32 ? 81  HIS A CE1 1 
ATOM   4480  N NE2 . HIS B 1 81  ? 32.333  92.233  136.277 1.00 58.09 ? 81  HIS A NE2 1 
ATOM   4481  N N   . VAL B 1 82  ? 29.782  95.297  136.759 1.00 56.33 ? 82  VAL A N   1 
ATOM   4482  C CA  . VAL B 1 82  ? 28.751  95.276  135.711 1.00 55.90 ? 82  VAL A CA  1 
ATOM   4483  C C   . VAL B 1 82  ? 27.936  93.983  135.630 1.00 55.48 ? 82  VAL A C   1 
ATOM   4484  O O   . VAL B 1 82  ? 27.078  93.850  134.754 1.00 55.61 ? 82  VAL A O   1 
ATOM   4485  C CB  . VAL B 1 82  ? 29.328  95.578  134.300 1.00 55.97 ? 82  VAL A CB  1 
ATOM   4486  C CG1 . VAL B 1 82  ? 29.568  97.074  134.127 1.00 55.98 ? 82  VAL A CG1 1 
ATOM   4487  C CG2 . VAL B 1 82  ? 30.585  94.741  134.017 1.00 55.89 ? 82  VAL A CG2 1 
ATOM   4488  N N   . ASP B 1 83  ? 28.210  93.031  136.517 1.00 54.81 ? 83  ASP A N   1 
ATOM   4489  C CA  . ASP B 1 83  ? 27.343  91.867  136.659 1.00 54.18 ? 83  ASP A CA  1 
ATOM   4490  C C   . ASP B 1 83  ? 26.037  92.289  137.325 1.00 53.83 ? 83  ASP A C   1 
ATOM   4491  O O   . ASP B 1 83  ? 24.970  91.764  137.003 1.00 53.78 ? 83  ASP A O   1 
ATOM   4492  C CB  . ASP B 1 83  ? 28.027  90.761  137.463 1.00 54.10 ? 83  ASP A CB  1 
ATOM   4493  C CG  . ASP B 1 83  ? 28.832  89.815  136.593 1.00 54.02 ? 83  ASP A CG  1 
ATOM   4494  O OD1 . ASP B 1 83  ? 28.963  90.070  135.378 1.00 54.04 ? 83  ASP A OD1 1 
ATOM   4495  O OD2 . ASP B 1 83  ? 29.332  88.805  137.127 1.00 54.00 ? 83  ASP A OD2 1 
ATOM   4496  N N   . PHE B 1 84  ? 26.137  93.253  138.240 1.00 53.32 ? 84  PHE A N   1 
ATOM   4497  C CA  . PHE B 1 84  ? 24.981  93.786  138.954 1.00 52.89 ? 84  PHE A CA  1 
ATOM   4498  C C   . PHE B 1 84  ? 24.575  95.140  138.379 1.00 52.71 ? 84  PHE A C   1 
ATOM   4499  O O   . PHE B 1 84  ? 24.019  95.994  139.078 1.00 52.71 ? 84  PHE A O   1 
ATOM   4500  C CB  . PHE B 1 84  ? 25.282  93.882  140.453 1.00 52.88 ? 84  PHE A CB  1 
ATOM   4501  C CG  . PHE B 1 84  ? 25.858  92.621  141.036 1.00 52.85 ? 84  PHE A CG  1 
ATOM   4502  C CD1 . PHE B 1 84  ? 27.154  92.605  141.538 1.00 52.96 ? 84  PHE A CD1 1 
ATOM   4503  C CD2 . PHE B 1 84  ? 25.109  91.443  141.067 1.00 52.85 ? 84  PHE A CD2 1 
ATOM   4504  C CE1 . PHE B 1 84  ? 27.694  91.438  142.073 1.00 53.13 ? 84  PHE A CE1 1 
ATOM   4505  C CE2 . PHE B 1 84  ? 25.641  90.270  141.594 1.00 52.69 ? 84  PHE A CE2 1 
ATOM   4506  C CZ  . PHE B 1 84  ? 26.934  90.266  142.099 1.00 52.96 ? 84  PHE A CZ  1 
ATOM   4507  N N   . SER B 1 85  ? 24.859  95.307  137.088 1.00 52.42 ? 85  SER A N   1 
ATOM   4508  C CA  . SER B 1 85  ? 24.558  96.512  136.309 1.00 52.10 ? 85  SER A CA  1 
ATOM   4509  C C   . SER B 1 85  ? 23.177  97.112  136.609 1.00 51.76 ? 85  SER A C   1 
ATOM   4510  O O   . SER B 1 85  ? 23.045  98.324  136.778 1.00 51.60 ? 85  SER A O   1 
ATOM   4511  C CB  . SER B 1 85  ? 24.689  96.179  134.815 1.00 52.19 ? 85  SER A CB  1 
ATOM   4512  O OG  . SER B 1 85  ? 24.522  97.317  133.992 1.00 52.66 ? 85  SER A OG  1 
ATOM   4513  N N   . TYR B 1 86  ? 22.161  96.253  136.677 1.00 51.47 ? 86  TYR A N   1 
ATOM   4514  C CA  . TYR B 1 86  ? 20.791  96.681  136.943 1.00 51.20 ? 86  TYR A CA  1 
ATOM   4515  C C   . TYR B 1 86  ? 20.611  97.123  138.391 1.00 51.10 ? 86  TYR A C   1 
ATOM   4516  O O   . TYR B 1 86  ? 20.242  98.274  138.647 1.00 51.10 ? 86  TYR A O   1 
ATOM   4517  C CB  . TYR B 1 86  ? 19.801  95.574  136.585 1.00 51.13 ? 86  TYR A CB  1 
ATOM   4518  C CG  . TYR B 1 86  ? 18.355  95.901  136.890 1.00 51.01 ? 86  TYR A CG  1 
ATOM   4519  C CD1 . TYR B 1 86  ? 17.616  96.746  136.061 1.00 50.95 ? 86  TYR A CD1 1 
ATOM   4520  C CD2 . TYR B 1 86  ? 17.721  95.351  138.003 1.00 50.81 ? 86  TYR A CD2 1 
ATOM   4521  C CE1 . TYR B 1 86  ? 16.284  97.043  136.342 1.00 51.04 ? 86  TYR A CE1 1 
ATOM   4522  C CE2 . TYR B 1 86  ? 16.395  95.638  138.288 1.00 50.73 ? 86  TYR A CE2 1 
ATOM   4523  C CZ  . TYR B 1 86  ? 15.682  96.482  137.457 1.00 50.97 ? 86  TYR A CZ  1 
ATOM   4524  O OH  . TYR B 1 86  ? 14.366  96.760  137.745 1.00 51.21 ? 86  TYR A OH  1 
ATOM   4525  N N   . GLU B 1 87  ? 20.874  96.214  139.332 1.00 50.88 ? 87  GLU A N   1 
ATOM   4526  C CA  . GLU B 1 87  ? 20.843  96.551  140.762 1.00 50.80 ? 87  GLU A CA  1 
ATOM   4527  C C   . GLU B 1 87  ? 21.516  97.902  141.018 1.00 50.39 ? 87  GLU A C   1 
ATOM   4528  O O   . GLU B 1 87  ? 21.012  98.713  141.795 1.00 50.37 ? 87  GLU A O   1 
ATOM   4529  C CB  . GLU B 1 87  ? 21.507  95.458  141.607 1.00 50.67 ? 87  GLU A CB  1 
ATOM   4530  C CG  . GLU B 1 87  ? 20.702  94.163  141.721 1.00 51.23 ? 87  GLU A CG  1 
ATOM   4531  C CD  . GLU B 1 87  ? 21.432  93.067  142.503 1.00 51.42 ? 87  GLU A CD  1 
ATOM   4532  O OE1 . GLU B 1 87  ? 22.111  93.390  143.509 1.00 52.02 ? 87  GLU A OE1 1 
ATOM   4533  O OE2 . GLU B 1 87  ? 21.317  91.879  142.113 1.00 51.41 ? 87  GLU A OE2 1 
ATOM   4534  N N   . VAL B 1 88  ? 22.639  98.134  140.340 1.00 50.07 ? 88  VAL A N   1 
ATOM   4535  C CA  . VAL B 1 88  ? 23.381  99.391  140.435 1.00 49.83 ? 88  VAL A CA  1 
ATOM   4536  C C   . VAL B 1 88  ? 22.534  100.590 139.996 1.00 49.61 ? 88  VAL A C   1 
ATOM   4537  O O   . VAL B 1 88  ? 22.450  101.591 140.711 1.00 49.50 ? 88  VAL A O   1 
ATOM   4538  C CB  . VAL B 1 88  ? 24.698  99.329  139.616 1.00 49.75 ? 88  VAL A CB  1 
ATOM   4539  C CG1 . VAL B 1 88  ? 25.308  100.710 139.450 1.00 49.63 ? 88  VAL A CG1 1 
ATOM   4540  C CG2 . VAL B 1 88  ? 25.694  98.400  140.286 1.00 49.98 ? 88  VAL A CG2 1 
ATOM   4541  N N   . SER B 1 89  ? 21.901  100.463 138.831 1.00 49.41 ? 89  SER A N   1 
ATOM   4542  C CA  . SER B 1 89  ? 21.119  101.541 138.233 1.00 49.11 ? 89  SER A CA  1 
ATOM   4543  C C   . SER B 1 89  ? 19.865  101.860 139.033 1.00 49.05 ? 89  SER A C   1 
ATOM   4544  O O   . SER B 1 89  ? 19.380  102.986 139.005 1.00 49.14 ? 89  SER A O   1 
ATOM   4545  C CB  . SER B 1 89  ? 20.725  101.184 136.802 1.00 49.02 ? 89  SER A CB  1 
ATOM   4546  O OG  . SER B 1 89  ? 19.672  100.244 136.795 1.00 48.83 ? 89  SER A OG  1 
ATOM   4547  N N   . ARG B 1 90  ? 19.335  100.869 139.738 1.00 48.87 ? 90  ARG A N   1 
ATOM   4548  C CA  . ARG B 1 90  ? 18.145  101.093 140.540 1.00 48.83 ? 90  ARG A CA  1 
ATOM   4549  C C   . ARG B 1 90  ? 18.490  101.846 141.815 1.00 49.02 ? 90  ARG A C   1 
ATOM   4550  O O   . ARG B 1 90  ? 17.717  102.696 142.261 1.00 49.13 ? 90  ARG A O   1 
ATOM   4551  C CB  . ARG B 1 90  ? 17.417  99.777  140.833 1.00 48.71 ? 90  ARG A CB  1 
ATOM   4552  C CG  . ARG B 1 90  ? 16.958  99.013  139.586 1.00 48.49 ? 90  ARG A CG  1 
ATOM   4553  C CD  . ARG B 1 90  ? 16.022  99.837  138.696 1.00 47.74 ? 90  ARG A CD  1 
ATOM   4554  N NE  . ARG B 1 90  ? 16.752  100.751 137.820 1.00 47.42 ? 90  ARG A NE  1 
ATOM   4555  C CZ  . ARG B 1 90  ? 16.270  101.899 137.352 1.00 47.07 ? 90  ARG A CZ  1 
ATOM   4556  N NH1 . ARG B 1 90  ? 15.045  102.295 137.678 1.00 46.96 ? 90  ARG A NH1 1 
ATOM   4557  N NH2 . ARG B 1 90  ? 17.020  102.658 136.562 1.00 46.76 ? 90  ARG A NH2 1 
ATOM   4558  N N   . SER B 1 91  ? 19.656  101.536 142.386 1.00 49.16 ? 91  SER A N   1 
ATOM   4559  C CA  . SER B 1 91  ? 20.190  102.262 143.539 1.00 49.25 ? 91  SER A CA  1 
ATOM   4560  C C   . SER B 1 91  ? 20.474  103.716 143.183 1.00 49.41 ? 91  SER A C   1 
ATOM   4561  O O   . SER B 1 91  ? 20.230  104.612 143.989 1.00 49.65 ? 91  SER A O   1 
ATOM   4562  C CB  . SER B 1 91  ? 21.467  101.600 144.057 1.00 49.17 ? 91  SER A CB  1 
ATOM   4563  O OG  . SER B 1 91  ? 21.173  100.510 144.909 1.00 49.40 ? 91  SER A OG  1 
ATOM   4564  N N   . LEU B 1 92  ? 20.990  103.935 141.975 1.00 49.42 ? 92  LEU A N   1 
ATOM   4565  C CA  . LEU B 1 92  ? 21.300  105.271 141.472 1.00 49.42 ? 92  LEU A CA  1 
ATOM   4566  C C   . LEU B 1 92  ? 20.048  106.077 141.128 1.00 49.43 ? 92  LEU A C   1 
ATOM   4567  O O   . LEU B 1 92  ? 20.061  107.305 141.195 1.00 49.61 ? 92  LEU A O   1 
ATOM   4568  C CB  . LEU B 1 92  ? 22.196  105.181 140.233 1.00 49.51 ? 92  LEU A CB  1 
ATOM   4569  C CG  . LEU B 1 92  ? 23.644  104.719 140.400 1.00 49.49 ? 92  LEU A CG  1 
ATOM   4570  C CD1 . LEU B 1 92  ? 24.236  104.335 139.046 1.00 48.66 ? 92  LEU A CD1 1 
ATOM   4571  C CD2 . LEU B 1 92  ? 24.485  105.790 141.084 1.00 49.64 ? 92  LEU A CD2 1 
ATOM   4572  N N   . ALA B 1 93  ? 18.976  105.389 140.741 1.00 49.33 ? 93  ALA A N   1 
ATOM   4573  C CA  . ALA B 1 93  ? 17.702  106.052 140.456 1.00 49.15 ? 93  ALA A CA  1 
ATOM   4574  C C   . ALA B 1 93  ? 17.116  106.622 141.736 1.00 49.07 ? 93  ALA A C   1 
ATOM   4575  O O   . ALA B 1 93  ? 16.296  107.528 141.691 1.00 49.11 ? 93  ALA A O   1 
ATOM   4576  C CB  . ALA B 1 93  ? 16.719  105.087 139.798 1.00 49.04 ? 93  ALA A CB  1 
ATOM   4577  N N   . ALA B 1 94  ? 17.562  106.086 142.870 1.00 49.09 ? 94  ALA A N   1 
ATOM   4578  C CA  . ALA B 1 94  ? 17.114  106.515 144.193 1.00 49.08 ? 94  ALA A CA  1 
ATOM   4579  C C   . ALA B 1 94  ? 17.893  107.719 144.728 1.00 49.05 ? 94  ALA A C   1 
ATOM   4580  O O   . ALA B 1 94  ? 17.582  108.228 145.809 1.00 48.94 ? 94  ALA A O   1 
ATOM   4581  C CB  . ALA B 1 94  ? 17.198  105.354 145.169 1.00 48.95 ? 94  ALA A CB  1 
ATOM   4582  N N   . CYS B 1 95  ? 18.882  108.174 143.957 1.00 49.14 ? 95  CYS A N   1 
ATOM   4583  C CA  . CYS B 1 95  ? 19.772  109.275 144.349 1.00 49.41 ? 95  CYS A CA  1 
ATOM   4584  C C   . CYS B 1 95  ? 19.672  110.511 143.450 1.00 49.32 ? 95  CYS A C   1 
ATOM   4585  O O   . CYS B 1 95  ? 19.250  110.415 142.299 1.00 49.44 ? 95  CYS A O   1 
ATOM   4586  C CB  . CYS B 1 95  ? 21.218  108.789 144.346 1.00 49.40 ? 95  CYS A CB  1 
ATOM   4587  S SG  . CYS B 1 95  ? 21.503  107.348 145.359 1.00 50.53 ? 95  CYS A SG  1 
ATOM   4588  N N   . GLU B 1 96  ? 20.068  111.666 143.986 1.00 49.41 ? 96  GLU A N   1 
ATOM   4589  C CA  . GLU B 1 96  ? 20.212  112.899 143.199 1.00 49.47 ? 96  GLU A CA  1 
ATOM   4590  C C   . GLU B 1 96  ? 21.673  113.181 142.900 1.00 49.56 ? 96  GLU A C   1 
ATOM   4591  O O   . GLU B 1 96  ? 21.991  113.873 141.935 1.00 49.81 ? 96  GLU A O   1 
ATOM   4592  C CB  . GLU B 1 96  ? 19.614  114.113 143.917 1.00 49.38 ? 96  GLU A CB  1 
ATOM   4593  C CG  . GLU B 1 96  ? 18.110  114.197 143.869 1.00 49.49 ? 96  GLU A CG  1 
ATOM   4594  C CD  . GLU B 1 96  ? 17.463  113.161 144.745 1.00 51.01 ? 96  GLU A CD  1 
ATOM   4595  O OE1 . GLU B 1 96  ? 17.783  113.117 145.959 1.00 52.58 ? 96  GLU A OE1 1 
ATOM   4596  O OE2 . GLU B 1 96  ? 16.650  112.378 144.217 1.00 51.12 ? 96  GLU A OE2 1 
ATOM   4597  N N   . GLY B 1 97  ? 22.558  112.655 143.740 1.00 49.58 ? 97  GLY A N   1 
ATOM   4598  C CA  . GLY B 1 97  ? 23.990  112.804 143.536 1.00 49.59 ? 97  GLY A CA  1 
ATOM   4599  C C   . GLY B 1 97  ? 24.772  111.548 143.858 1.00 49.70 ? 97  GLY A C   1 
ATOM   4600  O O   . GLY B 1 97  ? 24.205  110.535 144.280 1.00 49.70 ? 97  GLY A O   1 
ATOM   4601  N N   . ALA B 1 98  ? 26.082  111.619 143.645 1.00 49.74 ? 98  ALA A N   1 
ATOM   4602  C CA  . ALA B 1 98  ? 26.999  110.543 143.996 1.00 49.72 ? 98  ALA A CA  1 
ATOM   4603  C C   . ALA B 1 98  ? 28.392  111.113 144.218 1.00 49.80 ? 98  ALA A C   1 
ATOM   4604  O O   . ALA B 1 98  ? 28.809  112.037 143.521 1.00 49.75 ? 98  ALA A O   1 
ATOM   4605  C CB  . ALA B 1 98  ? 27.024  109.483 142.908 1.00 49.62 ? 98  ALA A CB  1 
ATOM   4606  N N   . LEU B 1 99  ? 29.104  110.569 145.198 1.00 50.03 ? 99  LEU A N   1 
ATOM   4607  C CA  . LEU B 1 99  ? 30.482  110.964 145.452 1.00 50.23 ? 99  LEU A CA  1 
ATOM   4608  C C   . LEU B 1 99  ? 31.435  110.036 144.713 1.00 50.49 ? 99  LEU A C   1 
ATOM   4609  O O   . LEU B 1 99  ? 31.525  108.851 145.034 1.00 50.60 ? 99  LEU A O   1 
ATOM   4610  C CB  . LEU B 1 99  ? 30.799  110.922 146.950 1.00 50.17 ? 99  LEU A CB  1 
ATOM   4611  C CG  . LEU B 1 99  ? 29.912  111.643 147.970 1.00 50.36 ? 99  LEU A CG  1 
ATOM   4612  C CD1 . LEU B 1 99  ? 30.456  111.409 149.376 1.00 49.83 ? 99  LEU A CD1 1 
ATOM   4613  C CD2 . LEU B 1 99  ? 29.774  113.140 147.683 1.00 49.85 ? 99  LEU A CD2 1 
ATOM   4614  N N   . LEU B 1 100 ? 32.132  110.570 143.714 1.00 50.80 ? 100 LEU A N   1 
ATOM   4615  C CA  . LEU B 1 100 ? 33.231  109.845 143.080 1.00 50.99 ? 100 LEU A CA  1 
ATOM   4616  C C   . LEU B 1 100 ? 34.486  110.008 143.937 1.00 51.22 ? 100 LEU A C   1 
ATOM   4617  O O   . LEU B 1 100 ? 35.119  111.070 143.934 1.00 51.32 ? 100 LEU A O   1 
ATOM   4618  C CB  . LEU B 1 100 ? 33.467  110.335 141.648 1.00 50.86 ? 100 LEU A CB  1 
ATOM   4619  C CG  . LEU B 1 100 ? 34.750  109.916 140.918 1.00 50.79 ? 100 LEU A CG  1 
ATOM   4620  C CD1 . LEU B 1 100 ? 34.886  108.401 140.785 1.00 50.57 ? 100 LEU A CD1 1 
ATOM   4621  C CD2 . LEU B 1 100 ? 34.811  110.584 139.558 1.00 50.78 ? 100 LEU A CD2 1 
ATOM   4622  N N   . VAL B 1 101 ? 34.824  108.954 144.677 1.00 51.44 ? 101 VAL A N   1 
ATOM   4623  C CA  . VAL B 1 101 ? 35.951  108.982 145.608 1.00 51.72 ? 101 VAL A CA  1 
ATOM   4624  C C   . VAL B 1 101 ? 37.165  108.302 144.992 1.00 52.00 ? 101 VAL A C   1 
ATOM   4625  O O   . VAL B 1 101 ? 37.180  107.085 144.791 1.00 52.10 ? 101 VAL A O   1 
ATOM   4626  C CB  . VAL B 1 101 ? 35.598  108.341 146.979 1.00 51.66 ? 101 VAL A CB  1 
ATOM   4627  C CG1 . VAL B 1 101 ? 36.820  108.278 147.883 1.00 51.55 ? 101 VAL A CG1 1 
ATOM   4628  C CG2 . VAL B 1 101 ? 34.499  109.124 147.657 1.00 51.73 ? 101 VAL A CG2 1 
ATOM   4629  N N   . VAL B 1 102 ? 38.177  109.112 144.698 1.00 52.37 ? 102 VAL A N   1 
ATOM   4630  C CA  . VAL B 1 102 ? 39.401  108.649 144.058 1.00 52.67 ? 102 VAL A CA  1 
ATOM   4631  C C   . VAL B 1 102 ? 40.566  108.785 145.032 1.00 53.01 ? 102 VAL A C   1 
ATOM   4632  O O   . VAL B 1 102 ? 40.709  109.813 145.697 1.00 53.04 ? 102 VAL A O   1 
ATOM   4633  C CB  . VAL B 1 102 ? 39.708  109.461 142.769 1.00 52.55 ? 102 VAL A CB  1 
ATOM   4634  C CG1 . VAL B 1 102 ? 40.909  108.890 142.054 1.00 52.38 ? 102 VAL A CG1 1 
ATOM   4635  C CG2 . VAL B 1 102 ? 38.500  109.485 141.832 1.00 52.30 ? 102 VAL A CG2 1 
ATOM   4636  N N   . ASP B 1 103 ? 41.382  107.737 145.119 1.00 53.49 ? 103 ASP A N   1 
ATOM   4637  C CA  . ASP B 1 103 ? 42.641  107.781 145.858 1.00 54.03 ? 103 ASP A CA  1 
ATOM   4638  C C   . ASP B 1 103 ? 43.571  108.805 145.195 1.00 54.28 ? 103 ASP A C   1 
ATOM   4639  O O   . ASP B 1 103 ? 43.813  108.737 143.990 1.00 54.35 ? 103 ASP A O   1 
ATOM   4640  C CB  . ASP B 1 103 ? 43.290  106.388 145.863 1.00 54.13 ? 103 ASP A CB  1 
ATOM   4641  C CG  . ASP B 1 103 ? 44.381  106.234 146.924 1.00 54.23 ? 103 ASP A CG  1 
ATOM   4642  O OD1 . ASP B 1 103 ? 45.107  107.211 147.217 1.00 54.31 ? 103 ASP A OD1 1 
ATOM   4643  O OD2 . ASP B 1 103 ? 44.520  105.113 147.460 1.00 54.12 ? 103 ASP A OD2 1 
ATOM   4644  N N   . ALA B 1 104 ? 44.076  109.756 145.978 1.00 54.59 ? 104 ALA A N   1 
ATOM   4645  C CA  . ALA B 1 104 ? 45.000  110.772 145.458 1.00 54.81 ? 104 ALA A CA  1 
ATOM   4646  C C   . ALA B 1 104 ? 46.383  110.189 145.176 1.00 54.96 ? 104 ALA A C   1 
ATOM   4647  O O   . ALA B 1 104 ? 47.176  110.780 144.440 1.00 54.92 ? 104 ALA A O   1 
ATOM   4648  C CB  . ALA B 1 104 ? 45.100  111.956 146.419 1.00 54.77 ? 104 ALA A CB  1 
ATOM   4649  N N   . GLY B 1 105 ? 46.659  109.029 145.768 1.00 55.20 ? 105 GLY A N   1 
ATOM   4650  C CA  . GLY B 1 105 ? 47.926  108.334 145.584 1.00 55.50 ? 105 GLY A CA  1 
ATOM   4651  C C   . GLY B 1 105 ? 47.904  107.299 144.474 1.00 55.80 ? 105 GLY A C   1 
ATOM   4652  O O   . GLY B 1 105 ? 48.947  106.684 144.169 1.00 55.87 ? 105 GLY A O   1 
ATOM   4653  N N   . GLN B 1 106 ? 46.722  107.106 143.862 1.00 56.09 ? 106 GLN A N   1 
ATOM   4654  C CA  . GLN B 1 106 ? 46.560  106.074 142.832 1.00 56.37 ? 106 GLN A CA  1 
ATOM   4655  C C   . GLN B 1 106 ? 46.057  106.626 141.496 1.00 56.40 ? 106 GLN A C   1 
ATOM   4656  O O   . GLN B 1 106 ? 46.778  106.603 140.497 1.00 56.48 ? 106 GLN A O   1 
ATOM   4657  C CB  . GLN B 1 106 ? 45.626  104.958 143.323 1.00 56.46 ? 106 GLN A CB  1 
ATOM   4658  C CG  . GLN B 1 106 ? 46.176  104.106 144.467 1.00 57.06 ? 106 GLN A CG  1 
ATOM   4659  C CD  . GLN B 1 106 ? 47.047  102.954 143.986 1.00 57.83 ? 106 GLN A CD  1 
ATOM   4660  O OE1 . GLN B 1 106 ? 46.607  101.799 143.954 1.00 58.34 ? 106 GLN A OE1 1 
ATOM   4661  N NE2 . GLN B 1 106 ? 48.288  103.262 143.605 1.00 57.94 ? 106 GLN A NE2 1 
ATOM   4662  N N   . GLY B 1 107 ? 44.822  107.120 141.493 1.00 56.45 ? 107 GLY A N   1 
ATOM   4663  C CA  . GLY B 1 107 ? 44.142  107.539 140.275 1.00 56.71 ? 107 GLY A CA  1 
ATOM   4664  C C   . GLY B 1 107 ? 42.825  106.803 140.082 1.00 57.00 ? 107 GLY A C   1 
ATOM   4665  O O   . GLY B 1 107 ? 42.370  106.076 140.972 1.00 57.00 ? 107 GLY A O   1 
ATOM   4666  N N   . VAL B 1 108 ? 42.210  106.995 138.917 1.00 57.16 ? 108 VAL A N   1 
ATOM   4667  C CA  . VAL B 1 108 ? 40.921  106.379 138.600 1.00 57.32 ? 108 VAL A CA  1 
ATOM   4668  C C   . VAL B 1 108 ? 41.101  104.956 138.044 1.00 57.36 ? 108 VAL A C   1 
ATOM   4669  O O   . VAL B 1 108 ? 42.186  104.598 137.577 1.00 57.46 ? 108 VAL A O   1 
ATOM   4670  C CB  . VAL B 1 108 ? 40.091  107.277 137.627 1.00 57.36 ? 108 VAL A CB  1 
ATOM   4671  C CG1 . VAL B 1 108 ? 40.619  107.198 136.198 1.00 57.27 ? 108 VAL A CG1 1 
ATOM   4672  C CG2 . VAL B 1 108 ? 38.612  106.915 137.672 1.00 57.74 ? 108 VAL A CG2 1 
ATOM   4673  N N   . GLU B 1 109 ? 40.043  104.149 138.118 1.00 57.34 ? 109 GLU A N   1 
ATOM   4674  C CA  . GLU B 1 109 ? 40.047  102.792 137.556 1.00 57.31 ? 109 GLU A CA  1 
ATOM   4675  C C   . GLU B 1 109 ? 38.683  102.385 136.979 1.00 57.20 ? 109 GLU A C   1 
ATOM   4676  O O   . GLU B 1 109 ? 37.640  102.793 137.490 1.00 57.15 ? 109 GLU A O   1 
ATOM   4677  C CB  . GLU B 1 109 ? 40.579  101.768 138.572 1.00 57.40 ? 109 GLU A CB  1 
ATOM   4678  C CG  . GLU B 1 109 ? 40.520  102.206 140.039 1.00 57.63 ? 109 GLU A CG  1 
ATOM   4679  C CD  . GLU B 1 109 ? 41.763  101.804 140.824 1.00 57.94 ? 109 GLU A CD  1 
ATOM   4680  O OE1 . GLU B 1 109 ? 42.273  100.679 140.625 1.00 58.11 ? 109 GLU A OE1 1 
ATOM   4681  O OE2 . GLU B 1 109 ? 42.234  102.619 141.645 1.00 58.00 ? 109 GLU A OE2 1 
ATOM   4682  N N   . ALA B 1 110 ? 38.710  101.573 135.920 1.00 57.18 ? 110 ALA A N   1 
ATOM   4683  C CA  . ALA B 1 110 ? 37.533  101.304 135.070 1.00 57.23 ? 110 ALA A CA  1 
ATOM   4684  C C   . ALA B 1 110 ? 36.275  100.772 135.767 1.00 57.28 ? 110 ALA A C   1 
ATOM   4685  O O   . ALA B 1 110 ? 35.160  100.917 135.242 1.00 57.30 ? 110 ALA A O   1 
ATOM   4686  C CB  . ALA B 1 110 ? 37.911  100.406 133.896 1.00 57.30 ? 110 ALA A CB  1 
ATOM   4687  N N   . GLN B 1 111 ? 36.455  100.150 136.932 1.00 57.17 ? 111 GLN A N   1 
ATOM   4688  C CA  . GLN B 1 111 ? 35.333  99.650  137.730 1.00 57.00 ? 111 GLN A CA  1 
ATOM   4689  C C   . GLN B 1 111 ? 34.474  100.795 138.250 1.00 56.79 ? 111 GLN A C   1 
ATOM   4690  O O   . GLN B 1 111 ? 33.256  100.650 138.380 1.00 56.94 ? 111 GLN A O   1 
ATOM   4691  C CB  . GLN B 1 111 ? 35.802  98.751  138.882 1.00 57.07 ? 111 GLN A CB  1 
ATOM   4692  C CG  . GLN B 1 111 ? 37.050  99.221  139.618 1.00 57.26 ? 111 GLN A CG  1 
ATOM   4693  C CD  . GLN B 1 111 ? 38.330  98.746  138.953 1.00 57.86 ? 111 GLN A CD  1 
ATOM   4694  O OE1 . GLN B 1 111 ? 38.667  99.175  137.850 1.00 58.39 ? 111 GLN A OE1 1 
ATOM   4695  N NE2 . GLN B 1 111 ? 39.052  97.856  139.625 1.00 57.93 ? 111 GLN A NE2 1 
ATOM   4696  N N   . THR B 1 112 ? 35.109  101.931 138.536 1.00 56.37 ? 112 THR A N   1 
ATOM   4697  C CA  . THR B 1 112 ? 34.374  103.141 138.910 1.00 56.04 ? 112 THR A CA  1 
ATOM   4698  C C   . THR B 1 112 ? 33.919  103.935 137.679 1.00 55.76 ? 112 THR A C   1 
ATOM   4699  O O   . THR B 1 112 ? 33.090  104.835 137.799 1.00 55.79 ? 112 THR A O   1 
ATOM   4700  C CB  . THR B 1 112 ? 35.164  104.058 139.895 1.00 55.87 ? 112 THR A CB  1 
ATOM   4701  O OG1 . THR B 1 112 ? 36.187  104.775 139.196 1.00 55.94 ? 112 THR A OG1 1 
ATOM   4702  C CG2 . THR B 1 112 ? 35.793  103.248 141.009 1.00 56.10 ? 112 THR A CG2 1 
ATOM   4703  N N   . LEU B 1 113 ? 34.450  103.592 136.505 1.00 55.44 ? 113 LEU A N   1 
ATOM   4704  C CA  . LEU B 1 113 ? 34.100  104.296 135.267 1.00 55.21 ? 113 LEU A CA  1 
ATOM   4705  C C   . LEU B 1 113 ? 32.714  103.926 134.764 1.00 55.05 ? 113 LEU A C   1 
ATOM   4706  O O   . LEU B 1 113 ? 31.899  104.807 134.495 1.00 55.09 ? 113 LEU A O   1 
ATOM   4707  C CB  . LEU B 1 113 ? 35.149  104.078 134.170 1.00 55.17 ? 113 LEU A CB  1 
ATOM   4708  C CG  . LEU B 1 113 ? 36.521  104.741 134.349 1.00 55.13 ? 113 LEU A CG  1 
ATOM   4709  C CD1 . LEU B 1 113 ? 37.419  104.460 133.150 1.00 55.02 ? 113 LEU A CD1 1 
ATOM   4710  C CD2 . LEU B 1 113 ? 36.401  106.239 134.573 1.00 54.98 ? 113 LEU A CD2 1 
ATOM   4711  N N   . ALA B 1 114 ? 32.453  102.625 134.654 1.00 54.90 ? 114 ALA A N   1 
ATOM   4712  C CA  . ALA B 1 114 ? 31.142  102.116 134.248 1.00 54.75 ? 114 ALA A CA  1 
ATOM   4713  C C   . ALA B 1 114 ? 30.014  102.756 135.050 1.00 54.71 ? 114 ALA A C   1 
ATOM   4714  O O   . ALA B 1 114 ? 29.077  103.312 134.475 1.00 54.73 ? 114 ALA A O   1 
ATOM   4715  C CB  . ALA B 1 114 ? 31.097  100.608 134.389 1.00 54.75 ? 114 ALA A CB  1 
ATOM   4716  N N   . ASN B 1 115 ? 30.121  102.682 136.375 1.00 54.70 ? 115 ASN A N   1 
ATOM   4717  C CA  . ASN B 1 115 ? 29.130  103.272 137.273 1.00 54.76 ? 115 ASN A CA  1 
ATOM   4718  C C   . ASN B 1 115 ? 29.062  104.788 137.187 1.00 54.80 ? 115 ASN A C   1 
ATOM   4719  O O   . ASN B 1 115 ? 27.997  105.382 137.365 1.00 54.75 ? 115 ASN A O   1 
ATOM   4720  C CB  . ASN B 1 115 ? 29.401  102.857 138.718 1.00 54.76 ? 115 ASN A CB  1 
ATOM   4721  C CG  . ASN B 1 115 ? 28.933  101.451 139.020 1.00 54.62 ? 115 ASN A CG  1 
ATOM   4722  O OD1 . ASN B 1 115 ? 28.447  100.736 138.141 1.00 54.23 ? 115 ASN A OD1 1 
ATOM   4723  N ND2 . ASN B 1 115 ? 29.078  101.044 140.274 1.00 54.86 ? 115 ASN A ND2 1 
ATOM   4724  N N   . CYS B 1 116 ? 30.206  105.404 136.913 1.00 55.01 ? 116 CYS A N   1 
ATOM   4725  C CA  . CYS B 1 116 ? 30.303  106.851 136.831 1.00 55.13 ? 116 CYS A CA  1 
ATOM   4726  C C   . CYS B 1 116 ? 29.545  107.386 135.623 1.00 55.22 ? 116 CYS A C   1 
ATOM   4727  O O   . CYS B 1 116 ? 28.861  108.405 135.722 1.00 55.03 ? 116 CYS A O   1 
ATOM   4728  C CB  . CYS B 1 116 ? 31.764  107.282 136.766 1.00 55.14 ? 116 CYS A CB  1 
ATOM   4729  S SG  . CYS B 1 116 ? 32.118  108.742 137.735 1.00 55.35 ? 116 CYS A SG  1 
ATOM   4730  N N   . TYR B 1 117 ? 29.661  106.685 134.493 1.00 55.35 ? 117 TYR A N   1 
ATOM   4731  C CA  . TYR B 1 117 ? 28.995  107.096 133.260 1.00 55.65 ? 117 TYR A CA  1 
ATOM   4732  C C   . TYR B 1 117 ? 27.480  106.969 133.366 1.00 55.68 ? 117 TYR A C   1 
ATOM   4733  O O   . TYR B 1 117 ? 26.749  107.848 132.906 1.00 55.82 ? 117 TYR A O   1 
ATOM   4734  C CB  . TYR B 1 117 ? 29.517  106.317 132.044 1.00 55.90 ? 117 TYR A CB  1 
ATOM   4735  C CG  . TYR B 1 117 ? 31.012  106.431 131.817 1.00 56.36 ? 117 TYR A CG  1 
ATOM   4736  C CD1 . TYR B 1 117 ? 31.777  105.303 131.509 1.00 56.68 ? 117 TYR A CD1 1 
ATOM   4737  C CD2 . TYR B 1 117 ? 31.665  107.665 131.913 1.00 56.61 ? 117 TYR A CD2 1 
ATOM   4738  C CE1 . TYR B 1 117 ? 33.156  105.401 131.305 1.00 56.85 ? 117 TYR A CE1 1 
ATOM   4739  C CE2 . TYR B 1 117 ? 33.042  107.774 131.712 1.00 56.80 ? 117 TYR A CE2 1 
ATOM   4740  C CZ  . TYR B 1 117 ? 33.781  106.639 131.409 1.00 56.76 ? 117 TYR A CZ  1 
ATOM   4741  O OH  . TYR B 1 117 ? 35.140  106.744 131.206 1.00 56.63 ? 117 TYR A OH  1 
ATOM   4742  N N   . THR B 1 118 ? 27.015  105.880 133.975 1.00 55.60 ? 118 THR A N   1 
ATOM   4743  C CA  . THR B 1 118 ? 25.580  105.658 134.157 1.00 55.57 ? 118 THR A CA  1 
ATOM   4744  C C   . THR B 1 118 ? 24.990  106.674 135.130 1.00 55.48 ? 118 THR A C   1 
ATOM   4745  O O   . THR B 1 118 ? 23.871  107.151 134.937 1.00 55.37 ? 118 THR A O   1 
ATOM   4746  C CB  . THR B 1 118 ? 25.254  104.206 134.582 1.00 55.49 ? 118 THR A CB  1 
ATOM   4747  O OG1 . THR B 1 118 ? 26.391  103.631 135.230 1.00 55.56 ? 118 THR A OG1 1 
ATOM   4748  C CG2 . THR B 1 118 ? 24.927  103.355 133.358 1.00 55.78 ? 118 THR A CG2 1 
ATOM   4749  N N   . ALA B 1 119 ? 25.766  107.023 136.153 1.00 55.47 ? 119 ALA A N   1 
ATOM   4750  C CA  . ALA B 1 119 ? 25.376  108.070 137.096 1.00 55.49 ? 119 ALA A CA  1 
ATOM   4751  C C   . ALA B 1 119 ? 25.265  109.435 136.415 1.00 55.52 ? 119 ALA A C   1 
ATOM   4752  O O   . ALA B 1 119 ? 24.505  110.289 136.865 1.00 55.29 ? 119 ALA A O   1 
ATOM   4753  C CB  . ALA B 1 119 ? 26.352  108.131 138.254 1.00 55.41 ? 119 ALA A CB  1 
ATOM   4754  N N   . MET B 1 120 ? 26.029  109.630 135.341 1.00 55.72 ? 120 MET A N   1 
ATOM   4755  C CA  . MET B 1 120 ? 25.996  110.876 134.572 1.00 56.02 ? 120 MET A CA  1 
ATOM   4756  C C   . MET B 1 120 ? 24.914  110.860 133.489 1.00 56.32 ? 120 MET A C   1 
ATOM   4757  O O   . MET B 1 120 ? 24.335  111.904 133.180 1.00 56.35 ? 120 MET A O   1 
ATOM   4758  C CB  . MET B 1 120 ? 27.360  111.181 133.947 1.00 55.92 ? 120 MET A CB  1 
ATOM   4759  C CG  . MET B 1 120 ? 28.478  111.404 134.957 1.00 56.04 ? 120 MET A CG  1 
ATOM   4760  S SD  . MET B 1 120 ? 30.068  111.904 134.252 1.00 56.04 ? 120 MET A SD  1 
ATOM   4761  C CE  . MET B 1 120 ? 30.250  110.810 132.843 1.00 55.67 ? 120 MET A CE  1 
ATOM   4762  N N   . GLU B 1 121 ? 24.645  109.683 132.920 1.00 56.53 ? 121 GLU A N   1 
ATOM   4763  C CA  . GLU B 1 121 ? 23.570  109.525 131.938 1.00 56.87 ? 121 GLU A CA  1 
ATOM   4764  C C   . GLU B 1 121 ? 22.227  109.855 132.585 1.00 56.76 ? 121 GLU A C   1 
ATOM   4765  O O   . GLU B 1 121 ? 21.422  110.597 132.023 1.00 56.83 ? 121 GLU A O   1 
ATOM   4766  C CB  . GLU B 1 121 ? 23.563  108.110 131.349 1.00 56.84 ? 121 GLU A CB  1 
ATOM   4767  C CG  . GLU B 1 121 ? 24.656  107.847 130.312 1.00 57.27 ? 121 GLU A CG  1 
ATOM   4768  C CD  . GLU B 1 121 ? 24.879  106.358 130.039 1.00 57.62 ? 121 GLU A CD  1 
ATOM   4769  O OE1 . GLU B 1 121 ? 24.566  105.523 130.922 1.00 58.32 ? 121 GLU A OE1 1 
ATOM   4770  O OE2 . GLU B 1 121 ? 25.375  106.020 128.938 1.00 58.48 ? 121 GLU A OE2 1 
ATOM   4771  N N   . MET B 1 122 ? 21.998  109.295 133.769 1.00 56.83 ? 122 MET A N   1 
ATOM   4772  C CA  . MET B 1 122 ? 20.929  109.748 134.652 1.00 56.85 ? 122 MET A CA  1 
ATOM   4773  C C   . MET B 1 122 ? 21.415  111.091 135.176 1.00 57.00 ? 122 MET A C   1 
ATOM   4774  O O   . MET B 1 122 ? 22.620  111.286 135.331 1.00 57.38 ? 122 MET A O   1 
ATOM   4775  C CB  . MET B 1 122 ? 20.738  108.755 135.800 1.00 56.75 ? 122 MET A CB  1 
ATOM   4776  C CG  . MET B 1 122 ? 20.730  107.289 135.355 1.00 56.78 ? 122 MET A CG  1 
ATOM   4777  S SD  . MET B 1 122 ? 20.551  106.083 136.690 1.00 56.77 ? 122 MET A SD  1 
ATOM   4778  C CE  . MET B 1 122 ? 18.769  106.007 136.832 1.00 56.29 ? 122 MET A CE  1 
ATOM   4779  N N   . ASP B 1 123 ? 20.522  112.035 135.436 1.00 56.87 ? 123 ASP A N   1 
ATOM   4780  C CA  . ASP B 1 123 ? 21.005  113.370 135.802 1.00 56.80 ? 123 ASP A CA  1 
ATOM   4781  C C   . ASP B 1 123 ? 21.405  113.514 137.264 1.00 56.48 ? 123 ASP A C   1 
ATOM   4782  O O   . ASP B 1 123 ? 20.731  114.192 138.040 1.00 56.81 ? 123 ASP A O   1 
ATOM   4783  C CB  . ASP B 1 123 ? 20.023  114.458 135.376 1.00 56.98 ? 123 ASP A CB  1 
ATOM   4784  C CG  . ASP B 1 123 ? 20.291  114.946 133.978 1.00 57.55 ? 123 ASP A CG  1 
ATOM   4785  O OD1 . ASP B 1 123 ? 21.378  115.527 133.758 1.00 58.27 ? 123 ASP A OD1 1 
ATOM   4786  O OD2 . ASP B 1 123 ? 19.426  114.740 133.100 1.00 58.29 ? 123 ASP A OD2 1 
ATOM   4787  N N   . LEU B 1 124 ? 22.514  112.879 137.631 1.00 55.90 ? 124 LEU A N   1 
ATOM   4788  C CA  . LEU B 1 124 ? 22.996  112.937 139.003 1.00 55.36 ? 124 LEU A CA  1 
ATOM   4789  C C   . LEU B 1 124 ? 24.225  113.815 139.126 1.00 54.92 ? 124 LEU A C   1 
ATOM   4790  O O   . LEU B 1 124 ? 25.138  113.736 138.310 1.00 54.71 ? 124 LEU A O   1 
ATOM   4791  C CB  . LEU B 1 124 ? 23.309  111.539 139.558 1.00 55.40 ? 124 LEU A CB  1 
ATOM   4792  C CG  . LEU B 1 124 ? 22.304  110.383 139.511 1.00 55.29 ? 124 LEU A CG  1 
ATOM   4793  C CD1 . LEU B 1 124 ? 22.637  109.395 140.617 1.00 54.48 ? 124 LEU A CD1 1 
ATOM   4794  C CD2 . LEU B 1 124 ? 20.858  110.849 139.636 1.00 55.79 ? 124 LEU A CD2 1 
ATOM   4795  N N   . GLU B 1 125 ? 24.235  114.648 140.159 1.00 54.59 ? 125 GLU A N   1 
ATOM   4796  C CA  . GLU B 1 125 ? 25.404  115.447 140.501 1.00 54.41 ? 125 GLU A CA  1 
ATOM   4797  C C   . GLU B 1 125 ? 26.525  114.555 141.010 1.00 53.98 ? 125 GLU A C   1 
ATOM   4798  O O   . GLU B 1 125 ? 26.411  113.948 142.078 1.00 53.99 ? 125 GLU A O   1 
ATOM   4799  C CB  . GLU B 1 125 ? 25.046  116.492 141.561 1.00 54.56 ? 125 GLU A CB  1 
ATOM   4800  C CG  . GLU B 1 125 ? 24.799  117.870 140.993 1.00 55.43 ? 125 GLU A CG  1 
ATOM   4801  C CD  . GLU B 1 125 ? 26.074  118.509 140.490 1.00 56.49 ? 125 GLU A CD  1 
ATOM   4802  O OE1 . GLU B 1 125 ? 27.064  118.556 141.260 1.00 56.74 ? 125 GLU A OE1 1 
ATOM   4803  O OE2 . GLU B 1 125 ? 26.085  118.957 139.324 1.00 56.79 ? 125 GLU A OE2 1 
ATOM   4804  N N   . VAL B 1 126 ? 27.602  114.460 140.242 1.00 53.39 ? 126 VAL A N   1 
ATOM   4805  C CA  . VAL B 1 126 ? 28.739  113.657 140.674 1.00 52.88 ? 126 VAL A CA  1 
ATOM   4806  C C   . VAL B 1 126 ? 29.759  114.562 141.352 1.00 52.42 ? 126 VAL A C   1 
ATOM   4807  O O   . VAL B 1 126 ? 30.288  115.480 140.729 1.00 52.56 ? 126 VAL A O   1 
ATOM   4808  C CB  . VAL B 1 126 ? 29.378  112.869 139.512 1.00 52.88 ? 126 VAL A CB  1 
ATOM   4809  C CG1 . VAL B 1 126 ? 30.530  112.025 140.016 1.00 52.90 ? 126 VAL A CG1 1 
ATOM   4810  C CG2 . VAL B 1 126 ? 28.347  111.978 138.845 1.00 52.93 ? 126 VAL A CG2 1 
ATOM   4811  N N   . VAL B 1 127 ? 30.009  114.310 142.634 1.00 51.71 ? 127 VAL A N   1 
ATOM   4812  C CA  . VAL B 1 127 ? 30.937  115.123 143.418 1.00 51.03 ? 127 VAL A CA  1 
ATOM   4813  C C   . VAL B 1 127 ? 32.288  114.408 143.549 1.00 50.84 ? 127 VAL A C   1 
ATOM   4814  O O   . VAL B 1 127 ? 32.366  113.332 144.145 1.00 50.78 ? 127 VAL A O   1 
ATOM   4815  C CB  . VAL B 1 127 ? 30.371  115.453 144.821 1.00 50.94 ? 127 VAL A CB  1 
ATOM   4816  C CG1 . VAL B 1 127 ? 31.231  116.500 145.516 1.00 50.83 ? 127 VAL A CG1 1 
ATOM   4817  C CG2 . VAL B 1 127 ? 28.927  115.925 144.730 1.00 50.27 ? 127 VAL A CG2 1 
ATOM   4818  N N   . PRO B 1 128 ? 33.357  115.003 142.986 1.00 50.58 ? 128 PRO A N   1 
ATOM   4819  C CA  . PRO B 1 128 ? 34.668  114.365 143.057 1.00 50.34 ? 128 PRO A CA  1 
ATOM   4820  C C   . PRO B 1 128 ? 35.360  114.604 144.400 1.00 50.23 ? 128 PRO A C   1 
ATOM   4821  O O   . PRO B 1 128 ? 35.370  115.731 144.917 1.00 50.08 ? 128 PRO A O   1 
ATOM   4822  C CB  . PRO B 1 128 ? 35.440  115.025 141.916 1.00 50.20 ? 128 PRO A CB  1 
ATOM   4823  C CG  . PRO B 1 128 ? 34.825  116.368 141.769 1.00 50.46 ? 128 PRO A CG  1 
ATOM   4824  C CD  . PRO B 1 128 ? 33.404  116.287 142.260 1.00 50.54 ? 128 PRO A CD  1 
ATOM   4825  N N   . VAL B 1 129 ? 35.917  113.535 144.962 1.00 50.08 ? 129 VAL A N   1 
ATOM   4826  C CA  . VAL B 1 129 ? 36.650  113.614 146.219 1.00 49.95 ? 129 VAL A CA  1 
ATOM   4827  C C   . VAL B 1 129 ? 38.026  112.988 146.044 1.00 49.97 ? 129 VAL A C   1 
ATOM   4828  O O   . VAL B 1 129 ? 38.155  111.901 145.480 1.00 49.98 ? 129 VAL A O   1 
ATOM   4829  C CB  . VAL B 1 129 ? 35.896  112.917 147.378 1.00 49.95 ? 129 VAL A CB  1 
ATOM   4830  C CG1 . VAL B 1 129 ? 36.702  112.988 148.672 1.00 49.91 ? 129 VAL A CG1 1 
ATOM   4831  C CG2 . VAL B 1 129 ? 34.526  113.545 147.586 1.00 49.78 ? 129 VAL A CG2 1 
ATOM   4832  N N   . LEU B 1 130 ? 39.050  113.691 146.514 1.00 50.04 ? 130 LEU A N   1 
ATOM   4833  C CA  . LEU B 1 130 ? 40.408  113.171 146.508 1.00 50.04 ? 130 LEU A CA  1 
ATOM   4834  C C   . LEU B 1 130 ? 40.745  112.684 147.907 1.00 50.15 ? 130 LEU A C   1 
ATOM   4835  O O   . LEU B 1 130 ? 41.020  113.482 148.802 1.00 50.14 ? 130 LEU A O   1 
ATOM   4836  C CB  . LEU B 1 130 ? 41.403  114.244 146.061 1.00 49.96 ? 130 LEU A CB  1 
ATOM   4837  C CG  . LEU B 1 130 ? 41.150  114.963 144.736 1.00 49.84 ? 130 LEU A CG  1 
ATOM   4838  C CD1 . LEU B 1 130 ? 42.083  116.156 144.609 1.00 49.57 ? 130 LEU A CD1 1 
ATOM   4839  C CD2 . LEU B 1 130 ? 41.308  114.021 143.549 1.00 50.04 ? 130 LEU A CD2 1 
ATOM   4840  N N   . ASN B 1 131 ? 40.705  111.370 148.092 1.00 50.28 ? 131 ASN A N   1 
ATOM   4841  C CA  . ASN B 1 131 ? 40.978  110.772 149.391 1.00 50.44 ? 131 ASN A CA  1 
ATOM   4842  C C   . ASN B 1 131 ? 42.447  110.412 149.567 1.00 50.50 ? 131 ASN A C   1 
ATOM   4843  O O   . ASN B 1 131 ? 43.195  110.344 148.590 1.00 50.49 ? 131 ASN A O   1 
ATOM   4844  C CB  . ASN B 1 131 ? 40.098  109.537 149.609 1.00 50.48 ? 131 ASN A CB  1 
ATOM   4845  C CG  . ASN B 1 131 ? 39.795  109.288 151.074 1.00 50.82 ? 131 ASN A CG  1 
ATOM   4846  O OD1 . ASN B 1 131 ? 39.479  108.168 151.475 1.00 51.10 ? 131 ASN A OD1 1 
ATOM   4847  N ND2 . ASN B 1 131 ? 39.886  110.340 151.884 1.00 50.99 ? 131 ASN A ND2 1 
ATOM   4848  N N   . LYS B 1 132 ? 42.838  110.188 150.821 1.00 50.71 ? 132 LYS A N   1 
ATOM   4849  C CA  . LYS B 1 132 ? 44.201  109.807 151.217 1.00 50.90 ? 132 LYS A CA  1 
ATOM   4850  C C   . LYS B 1 132 ? 45.288  110.769 150.735 1.00 50.99 ? 132 LYS A C   1 
ATOM   4851  O O   . LYS B 1 132 ? 46.288  110.343 150.154 1.00 51.00 ? 132 LYS A O   1 
ATOM   4852  C CB  . LYS B 1 132 ? 44.526  108.368 150.794 1.00 50.90 ? 132 LYS A CB  1 
ATOM   4853  C CG  . LYS B 1 132 ? 43.613  107.313 151.388 1.00 51.28 ? 132 LYS A CG  1 
ATOM   4854  C CD  . LYS B 1 132 ? 43.975  105.931 150.868 1.00 52.11 ? 132 LYS A CD  1 
ATOM   4855  C CE  . LYS B 1 132 ? 42.982  104.879 151.343 1.00 52.92 ? 132 LYS A CE  1 
ATOM   4856  N NZ  . LYS B 1 132 ? 43.074  104.621 152.814 1.00 53.51 ? 132 LYS A NZ  1 
ATOM   4857  N N   . ILE B 1 133 ? 45.085  112.062 150.985 1.00 51.26 ? 133 ILE A N   1 
ATOM   4858  C CA  . ILE B 1 133 ? 46.101  113.083 150.691 1.00 51.77 ? 133 ILE A CA  1 
ATOM   4859  C C   . ILE B 1 133 ? 47.310  113.006 151.639 1.00 52.11 ? 133 ILE A C   1 
ATOM   4860  O O   . ILE B 1 133 ? 48.395  113.504 151.323 1.00 51.93 ? 133 ILE A O   1 
ATOM   4861  C CB  . ILE B 1 133 ? 45.516  114.531 150.666 1.00 51.74 ? 133 ILE A CB  1 
ATOM   4862  C CG1 . ILE B 1 133 ? 44.305  114.665 151.592 1.00 51.79 ? 133 ILE A CG1 1 
ATOM   4863  C CG2 . ILE B 1 133 ? 45.133  114.936 149.252 1.00 51.79 ? 133 ILE A CG2 1 
ATOM   4864  C CD1 . ILE B 1 133 ? 44.647  115.136 152.994 1.00 52.53 ? 133 ILE A CD1 1 
ATOM   4865  N N   . ASP B 1 134 ? 47.107  112.365 152.789 1.00 52.63 ? 134 ASP A N   1 
ATOM   4866  C CA  . ASP B 1 134 ? 48.139  112.204 153.810 1.00 53.14 ? 134 ASP A CA  1 
ATOM   4867  C C   . ASP B 1 134 ? 49.293  111.297 153.393 1.00 53.21 ? 134 ASP A C   1 
ATOM   4868  O O   . ASP B 1 134 ? 50.421  111.495 153.839 1.00 53.18 ? 134 ASP A O   1 
ATOM   4869  C CB  . ASP B 1 134 ? 47.520  111.680 155.112 1.00 53.39 ? 134 ASP A CB  1 
ATOM   4870  C CG  . ASP B 1 134 ? 47.091  112.797 156.052 1.00 54.27 ? 134 ASP A CG  1 
ATOM   4871  O OD1 . ASP B 1 134 ? 46.878  113.936 155.580 1.00 55.21 ? 134 ASP A OD1 1 
ATOM   4872  O OD2 . ASP B 1 134 ? 46.962  112.535 157.270 1.00 54.99 ? 134 ASP A OD2 1 
ATOM   4873  N N   . LEU B 1 135 ? 49.004  110.305 152.550 1.00 53.46 ? 135 LEU A N   1 
ATOM   4874  C CA  . LEU B 1 135 ? 50.000  109.309 152.127 1.00 53.68 ? 135 LEU A CA  1 
ATOM   4875  C C   . LEU B 1 135 ? 51.206  109.937 151.413 1.00 53.85 ? 135 LEU A C   1 
ATOM   4876  O O   . LEU B 1 135 ? 51.069  110.979 150.767 1.00 53.90 ? 135 LEU A O   1 
ATOM   4877  C CB  . LEU B 1 135 ? 49.357  108.241 151.230 1.00 53.64 ? 135 LEU A CB  1 
ATOM   4878  C CG  . LEU B 1 135 ? 48.212  107.361 151.749 1.00 53.58 ? 135 LEU A CG  1 
ATOM   4879  C CD1 . LEU B 1 135 ? 47.795  106.373 150.661 1.00 53.58 ? 135 LEU A CD1 1 
ATOM   4880  C CD2 . LEU B 1 135 ? 48.565  106.621 153.040 1.00 53.19 ? 135 LEU A CD2 1 
ATOM   4881  N N   . PRO B 1 136 ? 52.393  109.308 151.530 1.00 54.02 ? 136 PRO A N   1 
ATOM   4882  C CA  . PRO B 1 136 ? 53.579  109.819 150.828 1.00 54.13 ? 136 PRO A CA  1 
ATOM   4883  C C   . PRO B 1 136 ? 53.461  109.756 149.299 1.00 54.29 ? 136 PRO A C   1 
ATOM   4884  O O   . PRO B 1 136 ? 54.213  110.434 148.599 1.00 54.19 ? 136 PRO A O   1 
ATOM   4885  C CB  . PRO B 1 136 ? 54.705  108.899 151.318 1.00 54.06 ? 136 PRO A CB  1 
ATOM   4886  C CG  . PRO B 1 136 ? 54.023  107.661 151.776 1.00 53.97 ? 136 PRO A CG  1 
ATOM   4887  C CD  . PRO B 1 136 ? 52.704  108.105 152.327 1.00 54.08 ? 136 PRO A CD  1 
ATOM   4888  N N   . ALA B 1 137 ? 52.515  108.961 148.800 1.00 54.59 ? 137 ALA A N   1 
ATOM   4889  C CA  . ALA B 1 137 ? 52.327  108.757 147.361 1.00 54.81 ? 137 ALA A CA  1 
ATOM   4890  C C   . ALA B 1 137 ? 51.377  109.765 146.704 1.00 54.96 ? 137 ALA A C   1 
ATOM   4891  O O   . ALA B 1 137 ? 51.348  109.878 145.476 1.00 54.96 ? 137 ALA A O   1 
ATOM   4892  C CB  . ALA B 1 137 ? 51.857  107.328 147.090 1.00 54.75 ? 137 ALA A CB  1 
ATOM   4893  N N   . ALA B 1 138 ? 50.618  110.495 147.522 1.00 55.20 ? 138 ALA A N   1 
ATOM   4894  C CA  . ALA B 1 138 ? 49.558  111.387 147.040 1.00 55.46 ? 138 ALA A CA  1 
ATOM   4895  C C   . ALA B 1 138 ? 50.030  112.433 146.032 1.00 55.73 ? 138 ALA A C   1 
ATOM   4896  O O   . ALA B 1 138 ? 50.983  113.171 146.281 1.00 55.79 ? 138 ALA A O   1 
ATOM   4897  C CB  . ALA B 1 138 ? 48.855  112.054 148.208 1.00 55.37 ? 138 ALA A CB  1 
ATOM   4898  N N   . ASP B 1 139 ? 49.351  112.467 144.888 1.00 56.15 ? 139 ASP A N   1 
ATOM   4899  C CA  . ASP B 1 139 ? 49.611  113.438 143.823 1.00 56.51 ? 139 ASP A CA  1 
ATOM   4900  C C   . ASP B 1 139 ? 48.262  113.995 143.356 1.00 56.71 ? 139 ASP A C   1 
ATOM   4901  O O   . ASP B 1 139 ? 47.714  113.550 142.342 1.00 56.74 ? 139 ASP A O   1 
ATOM   4902  C CB  . ASP B 1 139 ? 50.382  112.781 142.665 1.00 56.49 ? 139 ASP A CB  1 
ATOM   4903  C CG  . ASP B 1 139 ? 50.847  113.787 141.607 1.00 56.65 ? 139 ASP A CG  1 
ATOM   4904  O OD1 . ASP B 1 139 ? 50.572  115.002 141.748 1.00 56.47 ? 139 ASP A OD1 1 
ATOM   4905  O OD2 . ASP B 1 139 ? 51.495  113.352 140.625 1.00 56.31 ? 139 ASP A OD2 1 
ATOM   4906  N N   . PRO B 1 140 ? 47.724  114.978 144.102 1.00 56.88 ? 140 PRO A N   1 
ATOM   4907  C CA  . PRO B 1 140 ? 46.359  115.469 143.914 1.00 57.03 ? 140 PRO A CA  1 
ATOM   4908  C C   . PRO B 1 140 ? 46.127  116.171 142.579 1.00 57.18 ? 140 PRO A C   1 
ATOM   4909  O O   . PRO B 1 140 ? 45.111  115.917 141.933 1.00 57.18 ? 140 PRO A O   1 
ATOM   4910  C CB  . PRO B 1 140 ? 46.173  116.457 145.073 1.00 57.06 ? 140 PRO A CB  1 
ATOM   4911  C CG  . PRO B 1 140 ? 47.279  116.165 146.029 1.00 57.13 ? 140 PRO A CG  1 
ATOM   4912  C CD  . PRO B 1 140 ? 48.410  115.695 145.189 1.00 56.94 ? 140 PRO A CD  1 
ATOM   4913  N N   . GLU B 1 141 ? 47.054  117.040 142.177 1.00 57.40 ? 141 GLU A N   1 
ATOM   4914  C CA  . GLU B 1 141 ? 46.914  117.808 140.935 1.00 57.63 ? 141 GLU A CA  1 
ATOM   4915  C C   . GLU B 1 141 ? 46.862  116.927 139.688 1.00 57.57 ? 141 GLU A C   1 
ATOM   4916  O O   . GLU B 1 141 ? 46.035  117.153 138.802 1.00 57.50 ? 141 GLU A O   1 
ATOM   4917  C CB  . GLU B 1 141 ? 48.024  118.854 140.805 1.00 57.72 ? 141 GLU A CB  1 
ATOM   4918  C CG  . GLU B 1 141 ? 47.723  120.180 141.502 1.00 58.60 ? 141 GLU A CG  1 
ATOM   4919  C CD  . GLU B 1 141 ? 47.996  120.150 143.000 1.00 59.69 ? 141 GLU A CD  1 
ATOM   4920  O OE1 . GLU B 1 141 ? 49.122  119.780 143.399 1.00 60.00 ? 141 GLU A OE1 1 
ATOM   4921  O OE2 . GLU B 1 141 ? 47.087  120.513 143.781 1.00 60.28 ? 141 GLU A OE2 1 
ATOM   4922  N N   . ARG B 1 142 ? 47.739  115.925 139.636 1.00 57.62 ? 142 ARG A N   1 
ATOM   4923  C CA  . ARG B 1 142 ? 47.798  114.979 138.517 1.00 57.75 ? 142 ARG A CA  1 
ATOM   4924  C C   . ARG B 1 142 ? 46.559  114.076 138.462 1.00 57.68 ? 142 ARG A C   1 
ATOM   4925  O O   . ARG B 1 142 ? 46.088  113.725 137.376 1.00 57.71 ? 142 ARG A O   1 
ATOM   4926  C CB  . ARG B 1 142 ? 49.085  114.147 138.590 1.00 57.79 ? 142 ARG A CB  1 
ATOM   4927  C CG  . ARG B 1 142 ? 49.363  113.251 137.380 1.00 58.45 ? 142 ARG A CG  1 
ATOM   4928  C CD  . ARG B 1 142 ? 48.919  111.812 137.620 1.00 59.30 ? 142 ARG A CD  1 
ATOM   4929  N NE  . ARG B 1 142 ? 49.788  111.130 138.579 1.00 59.94 ? 142 ARG A NE  1 
ATOM   4930  C CZ  . ARG B 1 142 ? 49.453  110.038 139.264 1.00 60.27 ? 142 ARG A CZ  1 
ATOM   4931  N NH1 . ARG B 1 142 ? 48.252  109.480 139.116 1.00 59.71 ? 142 ARG A NH1 1 
ATOM   4932  N NH2 . ARG B 1 142 ? 50.327  109.505 140.110 1.00 60.45 ? 142 ARG A NH2 1 
ATOM   4933  N N   . VAL B 1 143 ? 46.044  113.705 139.632 1.00 57.57 ? 143 VAL A N   1 
ATOM   4934  C CA  . VAL B 1 143 ? 44.820  112.910 139.729 1.00 57.52 ? 143 VAL A CA  1 
ATOM   4935  C C   . VAL B 1 143 ? 43.589  113.774 139.403 1.00 57.50 ? 143 VAL A C   1 
ATOM   4936  O O   . VAL B 1 143 ? 42.566  113.263 138.938 1.00 57.47 ? 143 VAL A O   1 
ATOM   4937  C CB  . VAL B 1 143 ? 44.698  112.210 141.116 1.00 57.53 ? 143 VAL A CB  1 
ATOM   4938  C CG1 . VAL B 1 143 ? 43.311  111.627 141.329 1.00 57.49 ? 143 VAL A CG1 1 
ATOM   4939  C CG2 . VAL B 1 143 ? 45.750  111.113 141.255 1.00 57.49 ? 143 VAL A CG2 1 
ATOM   4940  N N   . ALA B 1 144 ? 43.704  115.082 139.633 1.00 57.43 ? 144 ALA A N   1 
ATOM   4941  C CA  . ALA B 1 144 ? 42.665  116.035 139.245 1.00 57.36 ? 144 ALA A CA  1 
ATOM   4942  C C   . ALA B 1 144 ? 42.555  116.112 137.721 1.00 57.36 ? 144 ALA A C   1 
ATOM   4943  O O   . ALA B 1 144 ? 41.461  116.303 137.178 1.00 57.37 ? 144 ALA A O   1 
ATOM   4944  C CB  . ALA B 1 144 ? 42.948  117.410 139.836 1.00 57.38 ? 144 ALA A CB  1 
ATOM   4945  N N   . GLU B 1 145 ? 43.694  115.960 137.045 1.00 57.24 ? 145 GLU A N   1 
ATOM   4946  C CA  . GLU B 1 145 ? 43.735  115.864 135.589 1.00 57.15 ? 145 GLU A CA  1 
ATOM   4947  C C   . GLU B 1 145 ? 43.109  114.559 135.105 1.00 56.97 ? 145 GLU A C   1 
ATOM   4948  O O   . GLU B 1 145 ? 42.372  114.553 134.121 1.00 56.96 ? 145 GLU A O   1 
ATOM   4949  C CB  . GLU B 1 145 ? 45.173  115.966 135.071 1.00 57.11 ? 145 GLU A CB  1 
ATOM   4950  C CG  . GLU B 1 145 ? 45.772  117.359 135.124 1.00 57.21 ? 145 GLU A CG  1 
ATOM   4951  C CD  . GLU B 1 145 ? 47.056  117.469 134.317 1.00 57.47 ? 145 GLU A CD  1 
ATOM   4952  O OE1 . GLU B 1 145 ? 48.121  117.735 134.918 1.00 57.73 ? 145 GLU A OE1 1 
ATOM   4953  O OE2 . GLU B 1 145 ? 47.002  117.280 133.081 1.00 57.94 ? 145 GLU A OE2 1 
ATOM   4954  N N   . GLU B 1 146 ? 43.405  113.463 135.803 1.00 56.85 ? 146 GLU A N   1 
ATOM   4955  C CA  . GLU B 1 146 ? 42.886  112.142 135.440 1.00 56.78 ? 146 GLU A CA  1 
ATOM   4956  C C   . GLU B 1 146 ? 41.363  112.067 135.474 1.00 56.62 ? 146 GLU A C   1 
ATOM   4957  O O   . GLU B 1 146 ? 40.756  111.450 134.603 1.00 56.64 ? 146 GLU A O   1 
ATOM   4958  C CB  . GLU B 1 146 ? 43.489  111.048 136.322 1.00 56.75 ? 146 GLU A CB  1 
ATOM   4959  C CG  . GLU B 1 146 ? 44.772  110.444 135.767 1.00 56.86 ? 146 GLU A CG  1 
ATOM   4960  C CD  . GLU B 1 146 ? 45.174  109.155 136.470 1.00 56.95 ? 146 GLU A CD  1 
ATOM   4961  O OE1 . GLU B 1 146 ? 44.286  108.440 136.994 1.00 56.69 ? 146 GLU A OE1 1 
ATOM   4962  O OE2 . GLU B 1 146 ? 46.386  108.851 136.489 1.00 57.42 ? 146 GLU A OE2 1 
ATOM   4963  N N   . ILE B 1 147 ? 40.754  112.694 136.476 1.00 56.47 ? 147 ILE A N   1 
ATOM   4964  C CA  . ILE B 1 147 ? 39.301  112.749 136.572 1.00 56.49 ? 147 ILE A CA  1 
ATOM   4965  C C   . ILE B 1 147 ? 38.740  113.585 135.426 1.00 56.55 ? 147 ILE A C   1 
ATOM   4966  O O   . ILE B 1 147 ? 37.794  113.178 134.751 1.00 56.66 ? 147 ILE A O   1 
ATOM   4967  C CB  . ILE B 1 147 ? 38.840  113.327 137.930 1.00 56.54 ? 147 ILE A CB  1 
ATOM   4968  C CG1 . ILE B 1 147 ? 39.310  112.423 139.077 1.00 56.54 ? 147 ILE A CG1 1 
ATOM   4969  C CG2 . ILE B 1 147 ? 37.315  113.500 137.958 1.00 56.39 ? 147 ILE A CG2 1 
ATOM   4970  C CD1 . ILE B 1 147 ? 39.254  113.069 140.445 1.00 56.50 ? 147 ILE A CD1 1 
ATOM   4971  N N   . GLU B 1 148 ? 39.349  114.745 135.208 1.00 56.56 ? 148 GLU A N   1 
ATOM   4972  C CA  . GLU B 1 148 ? 38.917  115.690 134.186 1.00 56.66 ? 148 GLU A CA  1 
ATOM   4973  C C   . GLU B 1 148 ? 39.009  115.086 132.790 1.00 56.42 ? 148 GLU A C   1 
ATOM   4974  O O   . GLU B 1 148 ? 38.109  115.256 131.971 1.00 56.46 ? 148 GLU A O   1 
ATOM   4975  C CB  . GLU B 1 148 ? 39.787  116.943 134.267 1.00 56.93 ? 148 GLU A CB  1 
ATOM   4976  C CG  . GLU B 1 148 ? 39.086  118.246 133.938 1.00 57.76 ? 148 GLU A CG  1 
ATOM   4977  C CD  . GLU B 1 148 ? 39.621  119.398 134.774 1.00 58.99 ? 148 GLU A CD  1 
ATOM   4978  O OE1 . GLU B 1 148 ? 40.335  120.262 134.217 1.00 59.47 ? 148 GLU A OE1 1 
ATOM   4979  O OE2 . GLU B 1 148 ? 39.341  119.427 135.997 1.00 59.46 ? 148 GLU A OE2 1 
ATOM   4980  N N   . ASP B 1 149 ? 40.099  114.366 132.544 1.00 56.21 ? 149 ASP A N   1 
ATOM   4981  C CA  . ASP B 1 149 ? 40.406  113.804 131.234 1.00 56.02 ? 149 ASP A CA  1 
ATOM   4982  C C   . ASP B 1 149 ? 39.550  112.578 130.899 1.00 55.91 ? 149 ASP A C   1 
ATOM   4983  O O   . ASP B 1 149 ? 39.028  112.472 129.788 1.00 55.85 ? 149 ASP A O   1 
ATOM   4984  C CB  . ASP B 1 149 ? 41.900  113.457 131.165 1.00 55.98 ? 149 ASP A CB  1 
ATOM   4985  C CG  . ASP B 1 149 ? 42.379  113.153 129.755 1.00 56.27 ? 149 ASP A CG  1 
ATOM   4986  O OD1 . ASP B 1 149 ? 41.958  113.841 128.796 1.00 56.65 ? 149 ASP A OD1 1 
ATOM   4987  O OD2 . ASP B 1 149 ? 43.203  112.227 129.611 1.00 56.44 ? 149 ASP A OD2 1 
ATOM   4988  N N   . ILE B 1 150 ? 39.394  111.673 131.866 1.00 55.84 ? 150 ILE A N   1 
ATOM   4989  C CA  . ILE B 1 150 ? 38.778  110.355 131.630 1.00 55.69 ? 150 ILE A CA  1 
ATOM   4990  C C   . ILE B 1 150 ? 37.275  110.298 131.937 1.00 55.78 ? 150 ILE A C   1 
ATOM   4991  O O   . ILE B 1 150 ? 36.523  109.601 131.249 1.00 55.68 ? 150 ILE A O   1 
ATOM   4992  C CB  . ILE B 1 150 ? 39.533  109.229 132.393 1.00 55.62 ? 150 ILE A CB  1 
ATOM   4993  C CG1 . ILE B 1 150 ? 41.021  109.236 132.010 1.00 55.61 ? 150 ILE A CG1 1 
ATOM   4994  C CG2 . ILE B 1 150 ? 38.898  107.861 132.126 1.00 55.41 ? 150 ILE A CG2 1 
ATOM   4995  C CD1 . ILE B 1 150 ? 41.916  108.335 132.852 1.00 55.64 ? 150 ILE A CD1 1 
ATOM   4996  N N   . VAL B 1 151 ? 36.844  111.023 132.967 1.00 55.91 ? 151 VAL A N   1 
ATOM   4997  C CA  . VAL B 1 151 ? 35.429  111.049 133.346 1.00 56.05 ? 151 VAL A CA  1 
ATOM   4998  C C   . VAL B 1 151 ? 34.735  112.296 132.797 1.00 56.31 ? 151 VAL A C   1 
ATOM   4999  O O   . VAL B 1 151 ? 33.564  112.246 132.412 1.00 56.41 ? 151 VAL A O   1 
ATOM   5000  C CB  . VAL B 1 151 ? 35.239  110.940 134.883 1.00 56.00 ? 151 VAL A CB  1 
ATOM   5001  C CG1 . VAL B 1 151 ? 33.771  111.062 135.272 1.00 55.90 ? 151 VAL A CG1 1 
ATOM   5002  C CG2 . VAL B 1 151 ? 35.803  109.629 135.394 1.00 55.70 ? 151 VAL A CG2 1 
ATOM   5003  N N   . GLY B 1 152 ? 35.468  113.406 132.750 1.00 56.55 ? 152 GLY A N   1 
ATOM   5004  C CA  . GLY B 1 152 ? 34.923  114.665 132.255 1.00 56.86 ? 152 GLY A CA  1 
ATOM   5005  C C   . GLY B 1 152 ? 34.123  115.395 133.316 1.00 57.14 ? 152 GLY A C   1 
ATOM   5006  O O   . GLY B 1 152 ? 33.087  115.993 133.019 1.00 57.17 ? 152 GLY A O   1 
ATOM   5007  N N   . ILE B 1 153 ? 34.603  115.331 134.558 1.00 57.35 ? 153 ILE A N   1 
ATOM   5008  C CA  . ILE B 1 153 ? 34.006  116.064 135.676 1.00 57.60 ? 153 ILE A CA  1 
ATOM   5009  C C   . ILE B 1 153 ? 34.943  117.179 136.151 1.00 57.73 ? 153 ILE A C   1 
ATOM   5010  O O   . ILE B 1 153 ? 36.164  116.996 136.213 1.00 57.79 ? 153 ILE A O   1 
ATOM   5011  C CB  . ILE B 1 153 ? 33.564  115.100 136.835 1.00 57.63 ? 153 ILE A CB  1 
ATOM   5012  C CG1 . ILE B 1 153 ? 32.036  114.985 136.913 1.00 57.66 ? 153 ILE A CG1 1 
ATOM   5013  C CG2 . ILE B 1 153 ? 34.050  115.584 138.191 1.00 57.63 ? 153 ILE A CG2 1 
ATOM   5014  C CD1 . ILE B 1 153 ? 31.315  114.869 135.578 1.00 57.73 ? 153 ILE A CD1 1 
ATOM   5015  N N   . ASP B 1 154 ? 34.354  118.337 136.451 1.00 57.89 ? 154 ASP A N   1 
ATOM   5016  C CA  . ASP B 1 154 ? 35.083  119.517 136.929 1.00 58.02 ? 154 ASP A CA  1 
ATOM   5017  C C   . ASP B 1 154 ? 35.686  119.240 138.311 1.00 57.85 ? 154 ASP A C   1 
ATOM   5018  O O   . ASP B 1 154 ? 34.976  119.261 139.320 1.00 57.80 ? 154 ASP A O   1 
ATOM   5019  C CB  . ASP B 1 154 ? 34.132  120.724 136.971 1.00 58.16 ? 154 ASP A CB  1 
ATOM   5020  C CG  . ASP B 1 154 ? 34.846  122.043 137.257 1.00 58.62 ? 154 ASP A CG  1 
ATOM   5021  O OD1 . ASP B 1 154 ? 36.034  122.200 136.883 1.00 58.62 ? 154 ASP A OD1 1 
ATOM   5022  O OD2 . ASP B 1 154 ? 34.196  122.933 137.852 1.00 59.07 ? 154 ASP A OD2 1 
ATOM   5023  N N   . ALA B 1 155 ? 36.993  118.981 138.345 1.00 57.67 ? 155 ALA A N   1 
ATOM   5024  C CA  . ALA B 1 155 ? 37.649  118.468 139.552 1.00 57.53 ? 155 ALA A CA  1 
ATOM   5025  C C   . ALA B 1 155 ? 38.613  119.451 140.210 1.00 57.48 ? 155 ALA A C   1 
ATOM   5026  O O   . ALA B 1 155 ? 39.273  119.118 141.201 1.00 57.50 ? 155 ALA A O   1 
ATOM   5027  C CB  . ALA B 1 155 ? 38.365  117.157 139.240 1.00 57.49 ? 155 ALA A CB  1 
ATOM   5028  N N   . THR B 1 156 ? 38.680  120.664 139.668 1.00 57.41 ? 156 THR A N   1 
ATOM   5029  C CA  . THR B 1 156 ? 39.677  121.655 140.092 1.00 57.22 ? 156 THR A CA  1 
ATOM   5030  C C   . THR B 1 156 ? 39.470  122.159 141.523 1.00 57.03 ? 156 THR A C   1 
ATOM   5031  O O   . THR B 1 156 ? 40.425  122.595 142.173 1.00 57.05 ? 156 THR A O   1 
ATOM   5032  C CB  . THR B 1 156 ? 39.747  122.856 139.117 1.00 57.23 ? 156 THR A CB  1 
ATOM   5033  O OG1 . THR B 1 156 ? 38.449  123.455 138.996 1.00 57.24 ? 156 THR A OG1 1 
ATOM   5034  C CG2 . THR B 1 156 ? 40.241  122.409 137.738 1.00 57.06 ? 156 THR A CG2 1 
ATOM   5035  N N   . ASP B 1 157 ? 38.230  122.090 142.005 1.00 56.69 ? 157 ASP A N   1 
ATOM   5036  C CA  . ASP B 1 157 ? 37.892  122.543 143.352 1.00 56.41 ? 157 ASP A CA  1 
ATOM   5037  C C   . ASP B 1 157 ? 37.456  121.373 144.237 1.00 56.04 ? 157 ASP A C   1 
ATOM   5038  O O   . ASP B 1 157 ? 36.838  121.562 145.293 1.00 56.06 ? 157 ASP A O   1 
ATOM   5039  C CB  . ASP B 1 157 ? 36.799  123.615 143.296 1.00 56.63 ? 157 ASP A CB  1 
ATOM   5040  C CG  . ASP B 1 157 ? 36.726  124.446 144.569 1.00 57.36 ? 157 ASP A CG  1 
ATOM   5041  O OD1 . ASP B 1 157 ? 37.765  125.017 144.976 1.00 57.82 ? 157 ASP A OD1 1 
ATOM   5042  O OD2 . ASP B 1 157 ? 35.625  124.532 145.159 1.00 58.21 ? 157 ASP A OD2 1 
ATOM   5043  N N   . ALA B 1 158 ? 37.789  120.162 143.801 1.00 55.44 ? 158 ALA A N   1 
ATOM   5044  C CA  . ALA B 1 158 ? 37.448  118.961 144.544 1.00 54.77 ? 158 ALA A CA  1 
ATOM   5045  C C   . ALA B 1 158 ? 37.989  119.034 145.967 1.00 54.35 ? 158 ALA A C   1 
ATOM   5046  O O   . ALA B 1 158 ? 39.147  119.396 146.190 1.00 54.30 ? 158 ALA A O   1 
ATOM   5047  C CB  . ALA B 1 158 ? 37.968  117.722 143.829 1.00 54.75 ? 158 ALA A CB  1 
ATOM   5048  N N   . VAL B 1 159 ? 37.123  118.712 146.922 1.00 53.90 ? 159 VAL A N   1 
ATOM   5049  C CA  . VAL B 1 159 ? 37.501  118.622 148.327 1.00 53.33 ? 159 VAL A CA  1 
ATOM   5050  C C   . VAL B 1 159 ? 38.401  117.399 148.534 1.00 53.02 ? 159 VAL A C   1 
ATOM   5051  O O   . VAL B 1 159 ? 38.154  116.337 147.962 1.00 52.88 ? 159 VAL A O   1 
ATOM   5052  C CB  . VAL B 1 159 ? 36.242  118.568 149.241 1.00 53.24 ? 159 VAL A CB  1 
ATOM   5053  C CG1 . VAL B 1 159 ? 36.606  118.187 150.664 1.00 52.95 ? 159 VAL A CG1 1 
ATOM   5054  C CG2 . VAL B 1 159 ? 35.517  119.906 149.227 1.00 52.85 ? 159 VAL A CG2 1 
ATOM   5055  N N   . ARG B 1 160 ? 39.453  117.564 149.330 1.00 52.75 ? 160 ARG A N   1 
ATOM   5056  C CA  . ARG B 1 160 ? 40.382  116.468 149.622 1.00 52.63 ? 160 ARG A CA  1 
ATOM   5057  C C   . ARG B 1 160 ? 40.470  116.161 151.114 1.00 52.37 ? 160 ARG A C   1 
ATOM   5058  O O   . ARG B 1 160 ? 40.308  117.057 151.941 1.00 52.47 ? 160 ARG A O   1 
ATOM   5059  C CB  . ARG B 1 160 ? 41.773  116.718 149.009 1.00 52.69 ? 160 ARG A CB  1 
ATOM   5060  C CG  . ARG B 1 160 ? 42.201  118.175 148.875 1.00 52.56 ? 160 ARG A CG  1 
ATOM   5061  C CD  . ARG B 1 160 ? 42.921  118.363 147.548 1.00 53.12 ? 160 ARG A CD  1 
ATOM   5062  N NE  . ARG B 1 160 ? 43.714  119.591 147.486 1.00 53.58 ? 160 ARG A NE  1 
ATOM   5063  C CZ  . ARG B 1 160 ? 44.473  119.951 146.451 1.00 53.68 ? 160 ARG A CZ  1 
ATOM   5064  N NH1 . ARG B 1 160 ? 44.556  119.186 145.367 1.00 52.99 ? 160 ARG A NH1 1 
ATOM   5065  N NH2 . ARG B 1 160 ? 45.153  121.089 146.498 1.00 54.28 ? 160 ARG A NH2 1 
ATOM   5066  N N   . CYS B 1 161 ? 40.723  114.897 151.453 1.00 52.08 ? 161 CYS A N   1 
ATOM   5067  C CA  . CYS B 1 161 ? 40.615  114.453 152.845 1.00 51.92 ? 161 CYS A CA  1 
ATOM   5068  C C   . CYS B 1 161 ? 41.502  113.277 153.260 1.00 51.71 ? 161 CYS A C   1 
ATOM   5069  O O   . CYS B 1 161 ? 41.770  112.370 152.470 1.00 51.79 ? 161 CYS A O   1 
ATOM   5070  C CB  . CYS B 1 161 ? 39.161  114.122 153.164 1.00 51.94 ? 161 CYS A CB  1 
ATOM   5071  S SG  . CYS B 1 161 ? 38.393  113.104 151.925 1.00 52.12 ? 161 CYS A SG  1 
ATOM   5072  N N   . SER B 1 162 ? 41.932  113.307 154.520 1.00 51.34 ? 162 SER A N   1 
ATOM   5073  C CA  . SER B 1 162 ? 42.734  112.244 155.122 1.00 50.97 ? 162 SER A CA  1 
ATOM   5074  C C   . SER B 1 162 ? 41.864  111.137 155.719 1.00 50.85 ? 162 SER A C   1 
ATOM   5075  O O   . SER B 1 162 ? 40.737  111.388 156.151 1.00 50.79 ? 162 SER A O   1 
ATOM   5076  C CB  . SER B 1 162 ? 43.639  112.829 156.211 1.00 50.85 ? 162 SER A CB  1 
ATOM   5077  O OG  . SER B 1 162 ? 44.150  111.818 157.060 1.00 50.06 ? 162 SER A OG  1 
ATOM   5078  N N   . ALA B 1 163 ? 42.404  109.918 155.731 1.00 50.66 ? 163 ALA A N   1 
ATOM   5079  C CA  . ALA B 1 163 ? 41.782  108.776 156.402 1.00 50.34 ? 163 ALA A CA  1 
ATOM   5080  C C   . ALA B 1 163 ? 42.447  108.534 157.756 1.00 50.22 ? 163 ALA A C   1 
ATOM   5081  O O   . ALA B 1 163 ? 41.848  107.944 158.659 1.00 50.21 ? 163 ALA A O   1 
ATOM   5082  C CB  . ALA B 1 163 ? 41.877  107.534 155.533 1.00 50.35 ? 163 ALA A CB  1 
ATOM   5083  N N   . LYS B 1 164 ? 43.692  108.990 157.882 1.00 50.04 ? 164 LYS A N   1 
ATOM   5084  C CA  . LYS B 1 164 ? 44.432  108.923 159.138 1.00 49.91 ? 164 LYS A CA  1 
ATOM   5085  C C   . LYS B 1 164 ? 43.797  109.840 160.185 1.00 49.95 ? 164 LYS A C   1 
ATOM   5086  O O   . LYS B 1 164 ? 43.538  109.415 161.318 1.00 49.94 ? 164 LYS A O   1 
ATOM   5087  C CB  . LYS B 1 164 ? 45.899  109.328 158.930 1.00 49.99 ? 164 LYS A CB  1 
ATOM   5088  C CG  . LYS B 1 164 ? 46.699  108.438 157.988 1.00 49.85 ? 164 LYS A CG  1 
ATOM   5089  C CD  . LYS B 1 164 ? 48.103  108.984 157.780 1.00 49.76 ? 164 LYS A CD  1 
ATOM   5090  C CE  . LYS B 1 164 ? 48.945  108.028 156.948 1.00 50.00 ? 164 LYS A CE  1 
ATOM   5091  N NZ  . LYS B 1 164 ? 50.405  108.282 157.102 1.00 49.87 ? 164 LYS A NZ  1 
ATOM   5092  N N   . THR B 1 165 ? 43.546  111.091 159.794 1.00 49.83 ? 165 THR A N   1 
ATOM   5093  C CA  . THR B 1 165 ? 43.048  112.111 160.718 1.00 49.62 ? 165 THR A CA  1 
ATOM   5094  C C   . THR B 1 165 ? 41.550  112.347 160.576 1.00 49.65 ? 165 THR A C   1 
ATOM   5095  O O   . THR B 1 165 ? 40.848  112.506 161.575 1.00 49.92 ? 165 THR A O   1 
ATOM   5096  C CB  . THR B 1 165 ? 43.809  113.455 160.587 1.00 49.49 ? 165 THR A CB  1 
ATOM   5097  O OG1 . THR B 1 165 ? 43.547  114.043 159.309 1.00 49.47 ? 165 THR A OG1 1 
ATOM   5098  C CG2 . THR B 1 165 ? 45.309  113.251 160.750 1.00 49.39 ? 165 THR A CG2 1 
ATOM   5099  N N   . GLY B 1 166 ? 41.062  112.363 159.342 1.00 49.62 ? 166 GLY A N   1 
ATOM   5100  C CA  . GLY B 1 166 ? 39.636  112.565 159.092 1.00 49.60 ? 166 GLY A CA  1 
ATOM   5101  C C   . GLY B 1 166 ? 39.265  113.983 158.696 1.00 49.61 ? 166 GLY A C   1 
ATOM   5102  O O   . GLY B 1 166 ? 38.099  114.267 158.419 1.00 49.68 ? 166 GLY A O   1 
ATOM   5103  N N   . VAL B 1 167 ? 40.249  114.878 158.670 1.00 49.57 ? 167 VAL A N   1 
ATOM   5104  C CA  . VAL B 1 167 ? 40.012  116.250 158.228 1.00 49.55 ? 167 VAL A CA  1 
ATOM   5105  C C   . VAL B 1 167 ? 39.672  116.263 156.740 1.00 49.58 ? 167 VAL A C   1 
ATOM   5106  O O   . VAL B 1 167 ? 40.265  115.526 155.957 1.00 49.45 ? 167 VAL A O   1 
ATOM   5107  C CB  . VAL B 1 167 ? 41.196  117.214 158.556 1.00 49.51 ? 167 VAL A CB  1 
ATOM   5108  C CG1 . VAL B 1 167 ? 41.433  117.272 160.054 1.00 49.41 ? 167 VAL A CG1 1 
ATOM   5109  C CG2 . VAL B 1 167 ? 42.479  116.812 157.831 1.00 49.68 ? 167 VAL A CG2 1 
ATOM   5110  N N   . GLY B 1 168 ? 38.697  117.086 156.369 1.00 49.80 ? 168 GLY A N   1 
ATOM   5111  C CA  . GLY B 1 168 ? 38.246  117.176 154.987 1.00 49.97 ? 168 GLY A CA  1 
ATOM   5112  C C   . GLY B 1 168 ? 36.929  116.460 154.770 1.00 50.22 ? 168 GLY A C   1 
ATOM   5113  O O   . GLY B 1 168 ? 36.163  116.818 153.877 1.00 50.24 ? 168 GLY A O   1 
ATOM   5114  N N   . VAL B 1 169 ? 36.667  115.444 155.590 1.00 50.37 ? 169 VAL A N   1 
ATOM   5115  C CA  . VAL B 1 169 ? 35.430  114.669 155.491 1.00 50.56 ? 169 VAL A CA  1 
ATOM   5116  C C   . VAL B 1 169 ? 34.215  115.569 155.736 1.00 50.69 ? 169 VAL A C   1 
ATOM   5117  O O   . VAL B 1 169 ? 33.197  115.444 155.049 1.00 50.81 ? 169 VAL A O   1 
ATOM   5118  C CB  . VAL B 1 169 ? 35.442  113.434 156.436 1.00 50.57 ? 169 VAL A CB  1 
ATOM   5119  C CG1 . VAL B 1 169 ? 34.151  112.637 156.328 1.00 50.47 ? 169 VAL A CG1 1 
ATOM   5120  C CG2 . VAL B 1 169 ? 36.613  112.534 156.097 1.00 50.72 ? 169 VAL A CG2 1 
ATOM   5121  N N   . GLN B 1 170 ? 34.336  116.484 156.695 1.00 50.84 ? 170 GLN A N   1 
ATOM   5122  C CA  . GLN B 1 170 ? 33.297  117.481 156.943 1.00 50.90 ? 170 GLN A CA  1 
ATOM   5123  C C   . GLN B 1 170 ? 33.157  118.442 155.759 1.00 50.99 ? 170 GLN A C   1 
ATOM   5124  O O   . GLN B 1 170 ? 32.040  118.799 155.373 1.00 50.82 ? 170 GLN A O   1 
ATOM   5125  C CB  . GLN B 1 170 ? 33.577  118.251 158.232 1.00 50.88 ? 170 GLN A CB  1 
ATOM   5126  C CG  . GLN B 1 170 ? 32.380  119.031 158.752 1.00 51.02 ? 170 GLN A CG  1 
ATOM   5127  C CD  . GLN B 1 170 ? 32.740  120.029 159.836 1.00 52.13 ? 170 GLN A CD  1 
ATOM   5128  O OE1 . GLN B 1 170 ? 33.916  120.232 160.157 1.00 52.71 ? 170 GLN A OE1 1 
ATOM   5129  N NE2 . GLN B 1 170 ? 31.724  120.666 160.405 1.00 52.45 ? 170 GLN A NE2 1 
ATOM   5130  N N   . ASP B 1 171 ? 34.292  118.847 155.186 1.00 51.18 ? 171 ASP A N   1 
ATOM   5131  C CA  . ASP B 1 171 ? 34.301  119.696 153.991 1.00 51.40 ? 171 ASP A CA  1 
ATOM   5132  C C   . ASP B 1 171 ? 33.612  119.019 152.803 1.00 51.37 ? 171 ASP A C   1 
ATOM   5133  O O   . ASP B 1 171 ? 32.904  119.676 152.038 1.00 51.33 ? 171 ASP A O   1 
ATOM   5134  C CB  . ASP B 1 171 ? 35.729  120.122 153.632 1.00 51.35 ? 171 ASP A CB  1 
ATOM   5135  C CG  . ASP B 1 171 ? 36.276  121.193 154.567 1.00 52.04 ? 171 ASP A CG  1 
ATOM   5136  O OD1 . ASP B 1 171 ? 35.507  121.737 155.394 1.00 53.15 ? 171 ASP A OD1 1 
ATOM   5137  O OD2 . ASP B 1 171 ? 37.481  121.499 154.475 1.00 51.98 ? 171 ASP A OD2 1 
ATOM   5138  N N   . VAL B 1 172 ? 33.823  117.706 152.676 1.00 51.46 ? 172 VAL A N   1 
ATOM   5139  C CA  . VAL B 1 172 ? 33.144  116.864 151.688 1.00 51.57 ? 172 VAL A CA  1 
ATOM   5140  C C   . VAL B 1 172 ? 31.639  116.918 151.897 1.00 51.60 ? 172 VAL A C   1 
ATOM   5141  O O   . VAL B 1 172 ? 30.878  117.131 150.959 1.00 51.78 ? 172 VAL A O   1 
ATOM   5142  C CB  . VAL B 1 172 ? 33.600  115.383 151.795 1.00 51.58 ? 172 VAL A CB  1 
ATOM   5143  C CG1 . VAL B 1 172 ? 32.594  114.447 151.144 1.00 51.56 ? 172 VAL A CG1 1 
ATOM   5144  C CG2 . VAL B 1 172 ? 34.980  115.188 151.185 1.00 51.88 ? 172 VAL A CG2 1 
ATOM   5145  N N   . LEU B 1 173 ? 31.231  116.734 153.147 1.00 51.56 ? 173 LEU A N   1 
ATOM   5146  C CA  . LEU B 1 173 ? 29.836  116.754 153.539 1.00 51.39 ? 173 LEU A CA  1 
ATOM   5147  C C   . LEU B 1 173 ? 29.210  118.122 153.280 1.00 51.45 ? 173 LEU A C   1 
ATOM   5148  O O   . LEU B 1 173 ? 28.055  118.210 152.864 1.00 51.47 ? 173 LEU A O   1 
ATOM   5149  C CB  . LEU B 1 173 ? 29.749  116.413 155.015 1.00 51.38 ? 173 LEU A CB  1 
ATOM   5150  C CG  . LEU B 1 173 ? 28.886  115.245 155.461 1.00 51.46 ? 173 LEU A CG  1 
ATOM   5151  C CD1 . LEU B 1 173 ? 29.120  114.027 154.593 1.00 51.51 ? 173 LEU A CD1 1 
ATOM   5152  C CD2 . LEU B 1 173 ? 29.216  114.946 156.913 1.00 51.38 ? 173 LEU A CD2 1 
ATOM   5153  N N   . GLU B 1 174 ? 29.974  119.186 153.529 1.00 51.48 ? 174 GLU A N   1 
ATOM   5154  C CA  . GLU B 1 174 ? 29.535  120.551 153.218 1.00 51.48 ? 174 GLU A CA  1 
ATOM   5155  C C   . GLU B 1 174 ? 29.334  120.736 151.715 1.00 51.47 ? 174 GLU A C   1 
ATOM   5156  O O   . GLU B 1 174 ? 28.355  121.349 151.282 1.00 51.48 ? 174 GLU A O   1 
ATOM   5157  C CB  . GLU B 1 174 ? 30.537  121.582 153.743 1.00 51.38 ? 174 GLU A CB  1 
ATOM   5158  C CG  . GLU B 1 174 ? 30.464  121.828 155.248 1.00 51.28 ? 174 GLU A CG  1 
ATOM   5159  C CD  . GLU B 1 174 ? 29.304  122.723 155.654 1.00 50.69 ? 174 GLU A CD  1 
ATOM   5160  O OE1 . GLU B 1 174 ? 29.170  123.824 155.090 1.00 51.00 ? 174 GLU A OE1 1 
ATOM   5161  O OE2 . GLU B 1 174 ? 28.533  122.334 156.550 1.00 50.34 ? 174 GLU A OE2 1 
ATOM   5162  N N   . ARG B 1 175 ? 30.266  120.194 150.934 1.00 51.35 ? 175 ARG A N   1 
ATOM   5163  C CA  . ARG B 1 175 ? 30.215  120.267 149.478 1.00 51.36 ? 175 ARG A CA  1 
ATOM   5164  C C   . ARG B 1 175 ? 29.049  119.440 148.941 1.00 51.29 ? 175 ARG A C   1 
ATOM   5165  O O   . ARG B 1 175 ? 28.385  119.822 147.975 1.00 51.30 ? 175 ARG A O   1 
ATOM   5166  C CB  . ARG B 1 175 ? 31.544  119.782 148.886 1.00 51.27 ? 175 ARG A CB  1 
ATOM   5167  C CG  . ARG B 1 175 ? 31.641  119.827 147.366 1.00 51.43 ? 175 ARG A CG  1 
ATOM   5168  C CD  . ARG B 1 175 ? 31.483  121.236 146.802 1.00 51.32 ? 175 ARG A CD  1 
ATOM   5169  N NE  . ARG B 1 175 ? 32.414  122.192 147.398 1.00 51.71 ? 175 ARG A NE  1 
ATOM   5170  C CZ  . ARG B 1 175 ? 33.679  122.356 147.019 1.00 51.95 ? 175 ARG A CZ  1 
ATOM   5171  N NH1 . ARG B 1 175 ? 34.434  123.257 147.629 1.00 52.06 ? 175 ARG A NH1 1 
ATOM   5172  N NH2 . ARG B 1 175 ? 34.196  121.625 146.036 1.00 52.23 ? 175 ARG A NH2 1 
ATOM   5173  N N   . LEU B 1 176 ? 28.816  118.307 149.591 1.00 51.23 ? 176 LEU A N   1 
ATOM   5174  C CA  . LEU B 1 176 ? 27.714  117.409 149.283 1.00 51.23 ? 176 LEU A CA  1 
ATOM   5175  C C   . LEU B 1 176 ? 26.380  118.150 149.381 1.00 51.25 ? 176 LEU A C   1 
ATOM   5176  O O   . LEU B 1 176 ? 25.556  118.098 148.459 1.00 51.37 ? 176 LEU A O   1 
ATOM   5177  C CB  . LEU B 1 176 ? 27.748  116.248 150.278 1.00 51.21 ? 176 LEU A CB  1 
ATOM   5178  C CG  . LEU B 1 176 ? 26.931  114.973 150.123 1.00 51.30 ? 176 LEU A CG  1 
ATOM   5179  C CD1 . LEU B 1 176 ? 27.595  113.911 150.972 1.00 51.31 ? 176 LEU A CD1 1 
ATOM   5180  C CD2 . LEU B 1 176 ? 25.479  115.168 150.536 1.00 51.31 ? 176 LEU A CD2 1 
ATOM   5181  N N   . VAL B 1 177 ? 26.195  118.842 150.505 1.00 50.95 ? 177 VAL A N   1 
ATOM   5182  C CA  . VAL B 1 177 ? 24.973  119.575 150.806 1.00 50.51 ? 177 VAL A CA  1 
ATOM   5183  C C   . VAL B 1 177 ? 24.737  120.701 149.800 1.00 50.31 ? 177 VAL A C   1 
ATOM   5184  O O   . VAL B 1 177 ? 23.616  120.892 149.334 1.00 50.40 ? 177 VAL A O   1 
ATOM   5185  C CB  . VAL B 1 177 ? 24.995  120.109 152.267 1.00 50.55 ? 177 VAL A CB  1 
ATOM   5186  C CG1 . VAL B 1 177 ? 23.848  121.076 152.533 1.00 49.93 ? 177 VAL A CG1 1 
ATOM   5187  C CG2 . VAL B 1 177 ? 24.957  118.944 153.260 1.00 50.35 ? 177 VAL A CG2 1 
ATOM   5188  N N   . ARG B 1 178 ? 25.799  121.417 149.446 1.00 50.10 ? 178 ARG A N   1 
ATOM   5189  C CA  . ARG B 1 178 ? 25.694  122.580 148.559 1.00 50.09 ? 178 ARG A CA  1 
ATOM   5190  C C   . ARG B 1 178 ? 25.342  122.218 147.110 1.00 50.15 ? 178 ARG A C   1 
ATOM   5191  O O   . ARG B 1 178 ? 24.592  122.939 146.449 1.00 50.10 ? 178 ARG A O   1 
ATOM   5192  C CB  . ARG B 1 178 ? 26.996  123.392 148.595 1.00 49.99 ? 178 ARG A CB  1 
ATOM   5193  C CG  . ARG B 1 178 ? 26.949  124.708 147.832 1.00 49.59 ? 178 ARG A CG  1 
ATOM   5194  C CD  . ARG B 1 178 ? 28.350  125.263 147.584 1.00 49.25 ? 178 ARG A CD  1 
ATOM   5195  N NE  . ARG B 1 178 ? 29.096  124.475 146.604 1.00 48.25 ? 178 ARG A NE  1 
ATOM   5196  C CZ  . ARG B 1 178 ? 30.317  124.767 146.168 1.00 47.74 ? 178 ARG A CZ  1 
ATOM   5197  N NH1 . ARG B 1 178 ? 30.953  125.836 146.618 1.00 47.81 ? 178 ARG A NH1 1 
ATOM   5198  N NH2 . ARG B 1 178 ? 30.906  123.985 145.274 1.00 47.47 ? 178 ARG A NH2 1 
ATOM   5199  N N   . ASP B 1 179 ? 25.877  121.100 146.628 1.00 50.17 ? 179 ASP A N   1 
ATOM   5200  C CA  . ASP B 1 179 ? 25.815  120.780 145.205 1.00 50.14 ? 179 ASP A CA  1 
ATOM   5201  C C   . ASP B 1 179 ? 24.749  119.775 144.786 1.00 49.98 ? 179 ASP A C   1 
ATOM   5202  O O   . ASP B 1 179 ? 24.112  119.949 143.746 1.00 50.17 ? 179 ASP A O   1 
ATOM   5203  C CB  . ASP B 1 179 ? 27.197  120.371 144.689 1.00 50.25 ? 179 ASP A CB  1 
ATOM   5204  C CG  . ASP B 1 179 ? 28.100  121.562 144.465 1.00 50.63 ? 179 ASP A CG  1 
ATOM   5205  O OD1 . ASP B 1 179 ? 27.792  122.645 144.998 1.00 51.56 ? 179 ASP A OD1 1 
ATOM   5206  O OD2 . ASP B 1 179 ? 29.114  121.424 143.752 1.00 51.42 ? 179 ASP A OD2 1 
ATOM   5207  N N   . ILE B 1 180 ? 24.562  118.723 145.575 1.00 49.69 ? 180 ILE A N   1 
ATOM   5208  C CA  . ILE B 1 180 ? 23.541  117.727 145.262 1.00 49.51 ? 180 ILE A CA  1 
ATOM   5209  C C   . ILE B 1 180 ? 22.147  118.327 145.473 1.00 49.42 ? 180 ILE A C   1 
ATOM   5210  O O   . ILE B 1 180 ? 21.851  118.838 146.552 1.00 49.39 ? 180 ILE A O   1 
ATOM   5211  C CB  . ILE B 1 180 ? 23.727  116.428 146.086 1.00 49.51 ? 180 ILE A CB  1 
ATOM   5212  C CG1 . ILE B 1 180 ? 25.055  115.755 145.717 1.00 49.44 ? 180 ILE A CG1 1 
ATOM   5213  C CG2 . ILE B 1 180 ? 22.566  115.470 145.858 1.00 49.22 ? 180 ILE A CG2 1 
ATOM   5214  C CD1 . ILE B 1 180 ? 25.450  114.601 146.617 1.00 49.43 ? 180 ILE A CD1 1 
ATOM   5215  N N   . PRO B 1 181 ? 21.296  118.294 144.428 1.00 49.38 ? 181 PRO A N   1 
ATOM   5216  C CA  . PRO B 1 181 ? 19.933  118.805 144.568 1.00 49.23 ? 181 PRO A CA  1 
ATOM   5217  C C   . PRO B 1 181 ? 19.138  118.048 145.631 1.00 49.11 ? 181 PRO A C   1 
ATOM   5218  O O   . PRO B 1 181 ? 19.367  116.855 145.833 1.00 49.03 ? 181 PRO A O   1 
ATOM   5219  C CB  . PRO B 1 181 ? 19.318  118.569 143.180 1.00 49.16 ? 181 PRO A CB  1 
ATOM   5220  C CG  . PRO B 1 181 ? 20.181  117.537 142.534 1.00 49.21 ? 181 PRO A CG  1 
ATOM   5221  C CD  . PRO B 1 181 ? 21.556  117.790 143.066 1.00 49.38 ? 181 PRO A CD  1 
ATOM   5222  N N   . PRO B 1 182 ? 18.223  118.745 146.329 1.00 49.09 ? 182 PRO A N   1 
ATOM   5223  C CA  . PRO B 1 182 ? 17.279  118.036 147.180 1.00 49.12 ? 182 PRO A CA  1 
ATOM   5224  C C   . PRO B 1 182 ? 16.313  117.202 146.331 1.00 49.30 ? 182 PRO A C   1 
ATOM   5225  O O   . PRO B 1 182 ? 16.131  117.494 145.144 1.00 49.41 ? 182 PRO A O   1 
ATOM   5226  C CB  . PRO B 1 182 ? 16.543  119.167 147.904 1.00 49.06 ? 182 PRO A CB  1 
ATOM   5227  C CG  . PRO B 1 182 ? 16.696  120.350 147.035 1.00 48.91 ? 182 PRO A CG  1 
ATOM   5228  C CD  . PRO B 1 182 ? 18.028  120.206 146.384 1.00 49.01 ? 182 PRO A CD  1 
ATOM   5229  N N   . PRO B 1 183 ? 15.707  116.160 146.925 1.00 49.53 ? 183 PRO A N   1 
ATOM   5230  C CA  . PRO B 1 183 ? 14.747  115.304 146.222 1.00 49.66 ? 183 PRO A CA  1 
ATOM   5231  C C   . PRO B 1 183 ? 13.478  116.051 145.809 1.00 49.91 ? 183 PRO A C   1 
ATOM   5232  O O   . PRO B 1 183 ? 13.206  117.136 146.321 1.00 49.74 ? 183 PRO A O   1 
ATOM   5233  C CB  . PRO B 1 183 ? 14.405  114.242 147.271 1.00 49.69 ? 183 PRO A CB  1 
ATOM   5234  C CG  . PRO B 1 183 ? 14.692  114.891 148.580 1.00 49.47 ? 183 PRO A CG  1 
ATOM   5235  C CD  . PRO B 1 183 ? 15.902  115.720 148.319 1.00 49.58 ? 183 PRO A CD  1 
ATOM   5236  N N   . GLU B 1 184 ? 12.706  115.462 144.901 1.00 50.36 ? 184 GLU A N   1 
ATOM   5237  C CA  . GLU B 1 184 ? 11.458  116.073 144.447 1.00 51.00 ? 184 GLU A CA  1 
ATOM   5238  C C   . GLU B 1 184 ? 10.267  115.127 144.433 1.00 50.99 ? 184 GLU A C   1 
ATOM   5239  O O   . GLU B 1 184 ? 10.412  113.917 144.241 1.00 50.94 ? 184 GLU A O   1 
ATOM   5240  C CB  . GLU B 1 184 ? 11.631  116.680 143.063 1.00 51.11 ? 184 GLU A CB  1 
ATOM   5241  C CG  . GLU B 1 184 ? 12.318  118.009 143.080 1.00 53.01 ? 184 GLU A CG  1 
ATOM   5242  C CD  . GLU B 1 184 ? 13.028  118.280 141.780 1.00 56.05 ? 184 GLU A CD  1 
ATOM   5243  O OE1 . GLU B 1 184 ? 12.337  118.508 140.757 1.00 56.96 ? 184 GLU A OE1 1 
ATOM   5244  O OE2 . GLU B 1 184 ? 14.282  118.262 141.783 1.00 57.64 ? 184 GLU A OE2 1 
ATOM   5245  N N   . GLY B 1 185 ? 9.087   115.706 144.632 1.00 51.14 ? 185 GLY A N   1 
ATOM   5246  C CA  . GLY B 1 185 ? 7.833   114.980 144.531 1.00 51.29 ? 185 GLY A CA  1 
ATOM   5247  C C   . GLY B 1 185 ? 6.718   115.730 145.216 1.00 51.45 ? 185 GLY A C   1 
ATOM   5248  O O   . GLY B 1 185 ? 6.923   116.834 145.719 1.00 51.51 ? 185 GLY A O   1 
ATOM   5249  N N   . ASP B 1 186 ? 5.532   115.132 145.221 1.00 51.60 ? 186 ASP A N   1 
ATOM   5250  C CA  . ASP B 1 186 ? 4.405   115.662 145.969 1.00 51.87 ? 186 ASP A CA  1 
ATOM   5251  C C   . ASP B 1 186 ? 4.121   114.706 147.118 1.00 51.89 ? 186 ASP A C   1 
ATOM   5252  O O   . ASP B 1 186 ? 3.767   113.557 146.879 1.00 52.16 ? 186 ASP A O   1 
ATOM   5253  C CB  . ASP B 1 186 ? 3.176   115.797 145.065 1.00 52.02 ? 186 ASP A CB  1 
ATOM   5254  C CG  . ASP B 1 186 ? 2.008   116.499 145.749 1.00 52.63 ? 186 ASP A CG  1 
ATOM   5255  O OD1 . ASP B 1 186 ? 1.183   117.106 145.030 1.00 53.23 ? 186 ASP A OD1 1 
ATOM   5256  O OD2 . ASP B 1 186 ? 1.903   116.448 146.995 1.00 53.11 ? 186 ASP A OD2 1 
ATOM   5257  N N   . PRO B 1 187 ? 4.271   115.176 148.368 1.00 51.93 ? 187 PRO A N   1 
ATOM   5258  C CA  . PRO B 1 187 ? 4.028   114.318 149.531 1.00 52.04 ? 187 PRO A CA  1 
ATOM   5259  C C   . PRO B 1 187 ? 2.555   113.907 149.680 1.00 52.14 ? 187 PRO A C   1 
ATOM   5260  O O   . PRO B 1 187 ? 2.263   112.888 150.312 1.00 52.21 ? 187 PRO A O   1 
ATOM   5261  C CB  . PRO B 1 187 ? 4.455   115.194 150.720 1.00 52.04 ? 187 PRO A CB  1 
ATOM   5262  C CG  . PRO B 1 187 ? 5.221   116.336 150.132 1.00 52.05 ? 187 PRO A CG  1 
ATOM   5263  C CD  . PRO B 1 187 ? 4.665   116.539 148.766 1.00 51.98 ? 187 PRO A CD  1 
ATOM   5264  N N   . GLU B 1 188 ? 1.645   114.695 149.109 1.00 52.07 ? 188 GLU A N   1 
ATOM   5265  C CA  . GLU B 1 188 ? 0.216   114.367 149.117 1.00 52.11 ? 188 GLU A CA  1 
ATOM   5266  C C   . GLU B 1 188 ? -0.205  113.640 147.845 1.00 51.92 ? 188 GLU A C   1 
ATOM   5267  O O   . GLU B 1 188 ? -1.324  113.128 147.755 1.00 51.72 ? 188 GLU A O   1 
ATOM   5268  C CB  . GLU B 1 188 ? -0.645  115.621 149.351 1.00 52.29 ? 188 GLU A CB  1 
ATOM   5269  C CG  . GLU B 1 188 ? -1.038  115.850 150.819 1.00 52.67 ? 188 GLU A CG  1 
ATOM   5270  C CD  . GLU B 1 188 ? 0.157   115.832 151.765 1.00 53.56 ? 188 GLU A CD  1 
ATOM   5271  O OE1 . GLU B 1 188 ? 0.942   116.808 151.753 1.00 53.93 ? 188 GLU A OE1 1 
ATOM   5272  O OE2 . GLU B 1 188 ? 0.312   114.840 152.516 1.00 53.45 ? 188 GLU A OE2 1 
ATOM   5273  N N   . GLY B 1 189 ? 0.706   113.587 146.874 1.00 51.73 ? 189 GLY A N   1 
ATOM   5274  C CA  . GLY B 1 189 ? 0.489   112.832 145.644 1.00 51.57 ? 189 GLY A CA  1 
ATOM   5275  C C   . GLY B 1 189 ? 0.352   111.339 145.902 1.00 51.48 ? 189 GLY A C   1 
ATOM   5276  O O   . GLY B 1 189 ? 0.635   110.870 147.009 1.00 51.40 ? 189 GLY A O   1 
ATOM   5277  N N   . PRO B 1 190 ? -0.098  110.579 144.887 1.00 51.44 ? 190 PRO A N   1 
ATOM   5278  C CA  . PRO B 1 190 ? -0.203  109.128 145.049 1.00 51.52 ? 190 PRO A CA  1 
ATOM   5279  C C   . PRO B 1 190 ? 1.170   108.473 145.247 1.00 51.47 ? 190 PRO A C   1 
ATOM   5280  O O   . PRO B 1 190 ? 2.129   108.826 144.554 1.00 51.39 ? 190 PRO A O   1 
ATOM   5281  C CB  . PRO B 1 190 ? -0.874  108.670 143.745 1.00 51.54 ? 190 PRO A CB  1 
ATOM   5282  C CG  . PRO B 1 190 ? -0.627  109.761 142.774 1.00 51.41 ? 190 PRO A CG  1 
ATOM   5283  C CD  . PRO B 1 190 ? -0.539  111.026 143.554 1.00 51.33 ? 190 PRO A CD  1 
ATOM   5284  N N   . LEU B 1 191 ? 1.248   107.541 146.197 1.00 51.56 ? 191 LEU A N   1 
ATOM   5285  C CA  . LEU B 1 191 ? 2.515   106.930 146.613 1.00 51.77 ? 191 LEU A CA  1 
ATOM   5286  C C   . LEU B 1 191 ? 3.276   106.288 145.456 1.00 51.90 ? 191 LEU A C   1 
ATOM   5287  O O   . LEU B 1 191 ? 2.684   105.611 144.599 1.00 51.70 ? 191 LEU A O   1 
ATOM   5288  C CB  . LEU B 1 191 ? 2.283   105.871 147.702 1.00 51.78 ? 191 LEU A CB  1 
ATOM   5289  C CG  . LEU B 1 191 ? 3.276   105.628 148.860 1.00 52.07 ? 191 LEU A CG  1 
ATOM   5290  C CD1 . LEU B 1 191 ? 3.421   104.131 149.111 1.00 52.36 ? 191 LEU A CD1 1 
ATOM   5291  C CD2 . LEU B 1 191 ? 4.657   106.232 148.676 1.00 51.54 ? 191 LEU A CD2 1 
ATOM   5292  N N   . GLN B 1 192 ? 4.588   106.523 145.446 1.00 51.87 ? 192 GLN A N   1 
ATOM   5293  C CA  . GLN B 1 192 ? 5.522   105.871 144.535 1.00 51.87 ? 192 GLN A CA  1 
ATOM   5294  C C   . GLN B 1 192 ? 6.846   105.674 145.260 1.00 52.23 ? 192 GLN A C   1 
ATOM   5295  O O   . GLN B 1 192 ? 7.631   106.615 145.402 1.00 52.30 ? 192 GLN A O   1 
ATOM   5296  C CB  . GLN B 1 192 ? 5.743   106.707 143.274 1.00 51.61 ? 192 GLN A CB  1 
ATOM   5297  C CG  . GLN B 1 192 ? 4.611   106.655 142.280 1.00 50.63 ? 192 GLN A CG  1 
ATOM   5298  C CD  . GLN B 1 192 ? 4.909   107.424 141.018 1.00 49.49 ? 192 GLN A CD  1 
ATOM   5299  O OE1 . GLN B 1 192 ? 5.360   108.571 141.058 1.00 49.30 ? 192 GLN A OE1 1 
ATOM   5300  N NE2 . GLN B 1 192 ? 4.649   106.799 139.884 1.00 48.90 ? 192 GLN A NE2 1 
ATOM   5301  N N   . ALA B 1 193 ? 7.081   104.451 145.731 1.00 52.63 ? 193 ALA A N   1 
ATOM   5302  C CA  . ALA B 1 193 ? 8.313   104.119 146.449 1.00 52.80 ? 193 ALA A CA  1 
ATOM   5303  C C   . ALA B 1 193 ? 9.147   103.136 145.645 1.00 53.06 ? 193 ALA A C   1 
ATOM   5304  O O   . ALA B 1 193 ? 8.674   102.059 145.279 1.00 53.00 ? 193 ALA A O   1 
ATOM   5305  C CB  . ALA B 1 193 ? 8.004   103.562 147.835 1.00 52.57 ? 193 ALA A CB  1 
ATOM   5306  N N   . LEU B 1 194 ? 10.387  103.524 145.364 1.00 53.40 ? 194 LEU A N   1 
ATOM   5307  C CA  . LEU B 1 194 ? 11.299  102.704 144.582 1.00 53.61 ? 194 LEU A CA  1 
ATOM   5308  C C   . LEU B 1 194 ? 11.934  101.639 145.471 1.00 53.76 ? 194 LEU A C   1 
ATOM   5309  O O   . LEU B 1 194 ? 12.557  101.978 146.482 1.00 54.20 ? 194 LEU A O   1 
ATOM   5310  C CB  . LEU B 1 194 ? 12.374  103.586 143.944 1.00 53.44 ? 194 LEU A CB  1 
ATOM   5311  C CG  . LEU B 1 194 ? 13.379  102.962 142.972 1.00 53.75 ? 194 LEU A CG  1 
ATOM   5312  C CD1 . LEU B 1 194 ? 12.703  102.564 141.661 1.00 54.06 ? 194 LEU A CD1 1 
ATOM   5313  C CD2 . LEU B 1 194 ? 14.526  103.934 142.716 1.00 53.62 ? 194 LEU A CD2 1 
ATOM   5314  N N   . ILE B 1 195 ? 11.754  100.364 145.107 1.00 53.68 ? 195 ILE A N   1 
ATOM   5315  C CA  . ILE B 1 195 ? 12.440  99.254  145.775 1.00 53.66 ? 195 ILE A CA  1 
ATOM   5316  C C   . ILE B 1 195 ? 13.901  99.238  145.331 1.00 53.52 ? 195 ILE A C   1 
ATOM   5317  O O   . ILE B 1 195 ? 14.221  98.917  144.184 1.00 53.45 ? 195 ILE A O   1 
ATOM   5318  C CB  . ILE B 1 195 ? 11.772  97.867  145.503 1.00 53.85 ? 195 ILE A CB  1 
ATOM   5319  C CG1 . ILE B 1 195 ? 10.453  97.725  146.256 1.00 53.90 ? 195 ILE A CG1 1 
ATOM   5320  C CG2 . ILE B 1 195 ? 12.670  96.720  145.957 1.00 54.29 ? 195 ILE A CG2 1 
ATOM   5321  C CD1 . ILE B 1 195 ? 9.258   98.090  145.449 1.00 55.19 ? 195 ILE A CD1 1 
ATOM   5322  N N   . ILE B 1 196 ? 14.785  99.598  146.247 1.00 53.48 ? 196 ILE A N   1 
ATOM   5323  C CA  . ILE B 1 196 ? 16.207  99.637  145.953 1.00 53.76 ? 196 ILE A CA  1 
ATOM   5324  C C   . ILE B 1 196 ? 16.802  98.244  146.095 1.00 53.82 ? 196 ILE A C   1 
ATOM   5325  O O   . ILE B 1 196 ? 17.629  97.823  145.291 1.00 54.13 ? 196 ILE A O   1 
ATOM   5326  C CB  . ILE B 1 196 ? 16.946  100.618 146.887 1.00 53.78 ? 196 ILE A CB  1 
ATOM   5327  C CG1 . ILE B 1 196 ? 16.330  102.019 146.784 1.00 54.28 ? 196 ILE A CG1 1 
ATOM   5328  C CG2 . ILE B 1 196 ? 18.423  100.661 146.546 1.00 53.64 ? 196 ILE A CG2 1 
ATOM   5329  C CD1 . ILE B 1 196 ? 16.560  102.896 148.013 1.00 55.23 ? 196 ILE A CD1 1 
ATOM   5330  N N   . ASP B 1 197 ? 16.371  97.529  147.126 1.00 53.82 ? 197 ASP A N   1 
ATOM   5331  C CA  . ASP B 1 197 ? 16.926  96.227  147.444 1.00 53.71 ? 197 ASP A CA  1 
ATOM   5332  C C   . ASP B 1 197 ? 15.931  95.481  148.312 1.00 53.65 ? 197 ASP A C   1 
ATOM   5333  O O   . ASP B 1 197 ? 15.172  96.106  149.064 1.00 53.80 ? 197 ASP A O   1 
ATOM   5334  C CB  . ASP B 1 197 ? 18.255  96.398  148.189 1.00 53.78 ? 197 ASP A CB  1 
ATOM   5335  C CG  . ASP B 1 197 ? 19.024  95.101  148.329 1.00 54.12 ? 197 ASP A CG  1 
ATOM   5336  O OD1 . ASP B 1 197 ? 18.917  94.240  147.433 1.00 54.71 ? 197 ASP A OD1 1 
ATOM   5337  O OD2 . ASP B 1 197 ? 19.748  94.947  149.337 1.00 55.06 ? 197 ASP A OD2 1 
ATOM   5338  N N   . SER B 1 198 ? 15.928  94.152  148.195 1.00 53.29 ? 198 SER A N   1 
ATOM   5339  C CA  . SER B 1 198 ? 15.124  93.288  149.064 1.00 52.96 ? 198 SER A CA  1 
ATOM   5340  C C   . SER B 1 198 ? 15.926  92.070  149.529 1.00 52.75 ? 198 SER A C   1 
ATOM   5341  O O   . SER B 1 198 ? 16.545  91.381  148.712 1.00 52.86 ? 198 SER A O   1 
ATOM   5342  C CB  . SER B 1 198 ? 13.839  92.840  148.359 1.00 52.87 ? 198 SER A CB  1 
ATOM   5343  O OG  . SER B 1 198 ? 12.902  93.897  148.282 1.00 52.47 ? 198 SER A OG  1 
ATOM   5344  N N   . TRP B 1 199 ? 15.911  91.818  150.838 1.00 52.31 ? 199 TRP A N   1 
ATOM   5345  C CA  . TRP B 1 199 ? 16.585  90.656  151.426 1.00 52.01 ? 199 TRP A CA  1 
ATOM   5346  C C   . TRP B 1 199 ? 15.669  89.840  152.358 1.00 51.90 ? 199 TRP A C   1 
ATOM   5347  O O   . TRP B 1 199 ? 14.523  90.222  152.612 1.00 51.63 ? 199 TRP A O   1 
ATOM   5348  C CB  . TRP B 1 199 ? 17.874  91.076  152.146 1.00 51.70 ? 199 TRP A CB  1 
ATOM   5349  C CG  . TRP B 1 199 ? 17.643  91.945  153.341 1.00 51.53 ? 199 TRP A CG  1 
ATOM   5350  C CD1 . TRP B 1 199 ? 17.589  91.550  154.650 1.00 51.07 ? 199 TRP A CD1 1 
ATOM   5351  C CD2 . TRP B 1 199 ? 17.433  93.360  153.339 1.00 51.50 ? 199 TRP A CD2 1 
ATOM   5352  N NE1 . TRP B 1 199 ? 17.356  92.633  155.463 1.00 51.16 ? 199 TRP A NE1 1 
ATOM   5353  C CE2 . TRP B 1 199 ? 17.255  93.757  154.683 1.00 51.72 ? 199 TRP A CE2 1 
ATOM   5354  C CE3 . TRP B 1 199 ? 17.376  94.334  152.331 1.00 51.01 ? 199 TRP A CE3 1 
ATOM   5355  C CZ2 . TRP B 1 199 ? 17.025  95.085  155.042 1.00 51.46 ? 199 TRP A CZ2 1 
ATOM   5356  C CZ3 . TRP B 1 199 ? 17.140  95.645  152.687 1.00 50.87 ? 199 TRP A CZ3 1 
ATOM   5357  C CH2 . TRP B 1 199 ? 16.969  96.010  154.030 1.00 51.34 ? 199 TRP A CH2 1 
ATOM   5358  N N   . PHE B 1 200 ? 16.178  88.705  152.840 1.00 51.87 ? 200 PHE A N   1 
ATOM   5359  C CA  . PHE B 1 200 ? 15.435  87.872  153.780 1.00 51.81 ? 200 PHE A CA  1 
ATOM   5360  C C   . PHE B 1 200 ? 16.050  87.904  155.170 1.00 51.88 ? 200 PHE A C   1 
ATOM   5361  O O   . PHE B 1 200 ? 17.215  87.541  155.360 1.00 51.86 ? 200 PHE A O   1 
ATOM   5362  C CB  . PHE B 1 200 ? 15.307  86.424  153.297 1.00 51.60 ? 200 PHE A CB  1 
ATOM   5363  C CG  . PHE B 1 200 ? 14.330  85.617  154.100 1.00 51.45 ? 200 PHE A CG  1 
ATOM   5364  C CD1 . PHE B 1 200 ? 12.978  85.608  153.768 1.00 51.59 ? 200 PHE A CD1 1 
ATOM   5365  C CD2 . PHE B 1 200 ? 14.751  84.890  155.209 1.00 51.48 ? 200 PHE A CD2 1 
ATOM   5366  C CE1 . PHE B 1 200 ? 12.058  84.874  154.521 1.00 51.12 ? 200 PHE A CE1 1 
ATOM   5367  C CE2 . PHE B 1 200 ? 13.842  84.152  155.966 1.00 51.49 ? 200 PHE A CE2 1 
ATOM   5368  C CZ  . PHE B 1 200 ? 12.492  84.147  155.619 1.00 51.33 ? 200 PHE A CZ  1 
ATOM   5369  N N   . ASP B 1 201 ? 15.245  88.350  156.127 1.00 51.93 ? 201 ASP A N   1 
ATOM   5370  C CA  . ASP B 1 201 ? 15.633  88.417  157.521 1.00 52.10 ? 201 ASP A CA  1 
ATOM   5371  C C   . ASP B 1 201 ? 15.082  87.188  158.220 1.00 52.37 ? 201 ASP A C   1 
ATOM   5372  O O   . ASP B 1 201 ? 13.887  86.884  158.112 1.00 52.49 ? 201 ASP A O   1 
ATOM   5373  C CB  . ASP B 1 201 ? 15.072  89.683  158.161 1.00 52.11 ? 201 ASP A CB  1 
ATOM   5374  C CG  . ASP B 1 201 ? 15.694  89.984  159.506 1.00 52.23 ? 201 ASP A CG  1 
ATOM   5375  O OD1 . ASP B 1 201 ? 15.346  89.294  160.493 1.00 52.44 ? 201 ASP A OD1 1 
ATOM   5376  O OD2 . ASP B 1 201 ? 16.524  90.922  159.571 1.00 51.94 ? 201 ASP A OD2 1 
ATOM   5377  N N   . ASN B 1 202 ? 15.956  86.495  158.945 1.00 52.47 ? 202 ASN A N   1 
ATOM   5378  C CA  . ASN B 1 202 ? 15.615  85.235  159.589 1.00 52.52 ? 202 ASN A CA  1 
ATOM   5379  C C   . ASN B 1 202 ? 14.567  85.371  160.692 1.00 52.42 ? 202 ASN A C   1 
ATOM   5380  O O   . ASN B 1 202 ? 14.102  84.366  161.244 1.00 52.60 ? 202 ASN A O   1 
ATOM   5381  C CB  . ASN B 1 202 ? 16.878  84.570  160.144 1.00 52.82 ? 202 ASN A CB  1 
ATOM   5382  C CG  . ASN B 1 202 ? 17.838  84.110  159.050 1.00 53.34 ? 202 ASN A CG  1 
ATOM   5383  O OD1 . ASN B 1 202 ? 17.455  83.926  157.887 1.00 53.76 ? 202 ASN A OD1 1 
ATOM   5384  N ND2 . ASN B 1 202 ? 19.098  83.911  159.428 1.00 53.77 ? 202 ASN A ND2 1 
ATOM   5385  N N   . TYR B 1 203 ? 14.207  86.611  161.016 1.00 52.02 ? 203 TYR A N   1 
ATOM   5386  C CA  . TYR B 1 203 ? 13.188  86.872  162.020 1.00 51.65 ? 203 TYR A CA  1 
ATOM   5387  C C   . TYR B 1 203 ? 12.029  87.707  161.478 1.00 51.58 ? 203 TYR A C   1 
ATOM   5388  O O   . TYR B 1 203 ? 10.866  87.392  161.723 1.00 51.37 ? 203 TYR A O   1 
ATOM   5389  C CB  . TYR B 1 203 ? 13.805  87.537  163.253 1.00 51.50 ? 203 TYR A CB  1 
ATOM   5390  C CG  . TYR B 1 203 ? 12.787  87.941  164.298 1.00 51.33 ? 203 TYR A CG  1 
ATOM   5391  C CD1 . TYR B 1 203 ? 12.118  86.980  165.067 1.00 50.75 ? 203 TYR A CD1 1 
ATOM   5392  C CD2 . TYR B 1 203 ? 12.488  89.281  164.515 1.00 50.90 ? 203 TYR A CD2 1 
ATOM   5393  C CE1 . TYR B 1 203 ? 11.177  87.353  166.024 1.00 50.65 ? 203 TYR A CE1 1 
ATOM   5394  C CE2 . TYR B 1 203 ? 11.548  89.664  165.466 1.00 51.18 ? 203 TYR A CE2 1 
ATOM   5395  C CZ  . TYR B 1 203 ? 10.899  88.698  166.216 1.00 51.03 ? 203 TYR A CZ  1 
ATOM   5396  O OH  . TYR B 1 203 ? 9.973   89.092  167.152 1.00 51.27 ? 203 TYR A OH  1 
ATOM   5397  N N   . LEU B 1 204 ? 12.363  88.765  160.744 1.00 51.68 ? 204 LEU A N   1 
ATOM   5398  C CA  . LEU B 1 204 ? 11.387  89.729  160.242 1.00 51.73 ? 204 LEU A CA  1 
ATOM   5399  C C   . LEU B 1 204 ? 10.698  89.288  158.954 1.00 51.92 ? 204 LEU A C   1 
ATOM   5400  O O   . LEU B 1 204 ? 9.670   89.855  158.570 1.00 51.93 ? 204 LEU A O   1 
ATOM   5401  C CB  . LEU B 1 204 ? 12.077  91.076  160.007 1.00 51.80 ? 204 LEU A CB  1 
ATOM   5402  C CG  . LEU B 1 204 ? 12.039  92.224  161.020 1.00 51.53 ? 204 LEU A CG  1 
ATOM   5403  C CD1 . LEU B 1 204 ? 12.011  91.764  162.458 1.00 51.77 ? 204 LEU A CD1 1 
ATOM   5404  C CD2 . LEU B 1 204 ? 13.233  93.129  160.778 1.00 51.69 ? 204 LEU A CD2 1 
ATOM   5405  N N   . GLY B 1 205 ? 11.268  88.288  158.288 1.00 52.18 ? 205 GLY A N   1 
ATOM   5406  C CA  . GLY B 1 205 ? 10.791  87.863  156.974 1.00 52.67 ? 205 GLY A CA  1 
ATOM   5407  C C   . GLY B 1 205 ? 11.490  88.641  155.874 1.00 52.97 ? 205 GLY A C   1 
ATOM   5408  O O   . GLY B 1 205 ? 12.700  88.848  155.927 1.00 53.24 ? 205 GLY A O   1 
ATOM   5409  N N   . VAL B 1 206 ? 10.732  89.080  154.876 1.00 53.14 ? 206 VAL A N   1 
ATOM   5410  C CA  . VAL B 1 206 ? 11.301  89.842  153.772 1.00 53.21 ? 206 VAL A CA  1 
ATOM   5411  C C   . VAL B 1 206 ? 11.329  91.322  154.133 1.00 53.44 ? 206 VAL A C   1 
ATOM   5412  O O   . VAL B 1 206 ? 10.323  91.872  154.575 1.00 53.60 ? 206 VAL A O   1 
ATOM   5413  C CB  . VAL B 1 206 ? 10.512  89.608  152.459 1.00 53.22 ? 206 VAL A CB  1 
ATOM   5414  C CG1 . VAL B 1 206 ? 10.920  90.612  151.376 1.00 53.21 ? 206 VAL A CG1 1 
ATOM   5415  C CG2 . VAL B 1 206 ? 10.710  88.183  151.969 1.00 52.76 ? 206 VAL A CG2 1 
ATOM   5416  N N   . VAL B 1 207 ? 12.490  91.951  153.948 1.00 53.76 ? 207 VAL A N   1 
ATOM   5417  C CA  . VAL B 1 207 ? 12.676  93.380  154.209 1.00 54.07 ? 207 VAL A CA  1 
ATOM   5418  C C   . VAL B 1 207 ? 13.152  94.112  152.945 1.00 54.47 ? 207 VAL A C   1 
ATOM   5419  O O   . VAL B 1 207 ? 14.083  93.659  152.274 1.00 54.45 ? 207 VAL A O   1 
ATOM   5420  C CB  . VAL B 1 207 ? 13.696  93.617  155.342 1.00 54.04 ? 207 VAL A CB  1 
ATOM   5421  C CG1 . VAL B 1 207 ? 13.548  95.025  155.920 1.00 53.75 ? 207 VAL A CG1 1 
ATOM   5422  C CG2 . VAL B 1 207 ? 13.532  92.570  156.445 1.00 54.28 ? 207 VAL A CG2 1 
ATOM   5423  N N   . SER B 1 208 ? 12.508  95.234  152.623 1.00 54.71 ? 208 SER A N   1 
ATOM   5424  C CA  . SER B 1 208 ? 12.885  96.031  151.454 1.00 55.24 ? 208 SER A CA  1 
ATOM   5425  C C   . SER B 1 208 ? 13.480  97.372  151.850 1.00 55.45 ? 208 SER A C   1 
ATOM   5426  O O   . SER B 1 208 ? 12.978  98.032  152.759 1.00 55.80 ? 208 SER A O   1 
ATOM   5427  C CB  . SER B 1 208 ? 11.679  96.284  150.546 1.00 55.16 ? 208 SER A CB  1 
ATOM   5428  O OG  . SER B 1 208 ? 11.263  95.099  149.896 1.00 56.10 ? 208 SER A OG  1 
ATOM   5429  N N   . LEU B 1 209 ? 14.550  97.774  151.165 1.00 55.49 ? 209 LEU A N   1 
ATOM   5430  C CA  . LEU B 1 209 ? 15.049  99.137  151.282 1.00 55.27 ? 209 LEU A CA  1 
ATOM   5431  C C   . LEU B 1 209 ? 14.367  99.972  150.212 1.00 55.32 ? 209 LEU A C   1 
ATOM   5432  O O   . LEU B 1 209 ? 14.393  99.626  149.030 1.00 55.48 ? 209 LEU A O   1 
ATOM   5433  C CB  . LEU B 1 209 ? 16.572  99.201  151.146 1.00 55.23 ? 209 LEU A CB  1 
ATOM   5434  C CG  . LEU B 1 209 ? 17.216  100.583 151.311 1.00 54.57 ? 209 LEU A CG  1 
ATOM   5435  C CD1 . LEU B 1 209 ? 17.132  101.068 152.753 1.00 53.93 ? 209 LEU A CD1 1 
ATOM   5436  C CD2 . LEU B 1 209 ? 18.651  100.554 150.841 1.00 53.89 ? 209 LEU A CD2 1 
ATOM   5437  N N   . ILE B 1 210 ? 13.786  101.085 150.644 1.00 55.28 ? 210 ILE A N   1 
ATOM   5438  C CA  . ILE B 1 210 ? 12.828  101.844 149.858 1.00 55.34 ? 210 ILE A CA  1 
ATOM   5439  C C   . ILE B 1 210 ? 13.192  103.323 149.746 1.00 55.00 ? 210 ILE A C   1 
ATOM   5440  O O   . ILE B 1 210 ? 13.618  103.936 150.726 1.00 54.72 ? 210 ILE A O   1 
ATOM   5441  C CB  . ILE B 1 210 ? 11.433  101.704 150.514 1.00 55.75 ? 210 ILE A CB  1 
ATOM   5442  C CG1 . ILE B 1 210 ? 10.655  100.575 149.875 1.00 56.13 ? 210 ILE A CG1 1 
ATOM   5443  C CG2 . ILE B 1 210 ? 10.593  102.990 150.448 1.00 55.88 ? 210 ILE A CG2 1 
ATOM   5444  C CD1 . ILE B 1 210 ? 9.310   100.458 150.516 1.00 59.20 ? 210 ILE A CD1 1 
ATOM   5445  N N   . ARG B 1 211 ? 13.008  103.881 148.549 1.00 54.75 ? 211 ARG A N   1 
ATOM   5446  C CA  . ARG B 1 211 ? 13.057  105.326 148.341 1.00 54.74 ? 211 ARG A CA  1 
ATOM   5447  C C   . ARG B 1 211 ? 11.664  105.869 148.054 1.00 54.66 ? 211 ARG A C   1 
ATOM   5448  O O   . ARG B 1 211 ? 11.020  105.455 147.089 1.00 54.75 ? 211 ARG A O   1 
ATOM   5449  C CB  . ARG B 1 211 ? 13.966  105.678 147.165 1.00 54.67 ? 211 ARG A CB  1 
ATOM   5450  C CG  . ARG B 1 211 ? 14.645  107.034 147.271 1.00 55.10 ? 211 ARG A CG  1 
ATOM   5451  C CD  . ARG B 1 211 ? 13.730  108.218 146.990 1.00 55.53 ? 211 ARG A CD  1 
ATOM   5452  N NE  . ARG B 1 211 ? 14.538  109.362 146.579 1.00 56.78 ? 211 ARG A NE  1 
ATOM   5453  C CZ  . ARG B 1 211 ? 14.066  110.538 146.176 1.00 57.37 ? 211 ARG A CZ  1 
ATOM   5454  N NH1 . ARG B 1 211 ? 12.763  110.780 146.127 1.00 57.95 ? 211 ARG A NH1 1 
ATOM   5455  N NH2 . ARG B 1 211 ? 14.914  111.486 145.818 1.00 57.90 ? 211 ARG A NH2 1 
ATOM   5456  N N   . ILE B 1 212 ? 11.208  106.807 148.881 1.00 54.49 ? 212 ILE A N   1 
ATOM   5457  C CA  . ILE B 1 212 ? 9.936   107.489 148.632 1.00 54.28 ? 212 ILE A CA  1 
ATOM   5458  C C   . ILE B 1 212 ? 10.113  108.604 147.594 1.00 53.93 ? 212 ILE A C   1 
ATOM   5459  O O   . ILE B 1 212 ? 10.568  109.702 147.920 1.00 54.04 ? 212 ILE A O   1 
ATOM   5460  C CB  . ILE B 1 212 ? 9.315   108.066 149.931 1.00 54.33 ? 212 ILE A CB  1 
ATOM   5461  C CG1 . ILE B 1 212 ? 9.378   107.044 151.078 1.00 54.15 ? 212 ILE A CG1 1 
ATOM   5462  C CG2 . ILE B 1 212 ? 7.889   108.578 149.666 1.00 54.16 ? 212 ILE A CG2 1 
ATOM   5463  C CD1 . ILE B 1 212 ? 8.436   105.849 150.937 1.00 54.44 ? 212 ILE A CD1 1 
ATOM   5464  N N   . LYS B 1 213 ? 9.764   108.308 146.346 1.00 53.46 ? 213 LYS A N   1 
ATOM   5465  C CA  . LYS B 1 213 ? 9.860   109.284 145.262 1.00 53.05 ? 213 LYS A CA  1 
ATOM   5466  C C   . LYS B 1 213 ? 8.710   110.273 145.321 1.00 52.96 ? 213 LYS A C   1 
ATOM   5467  O O   . LYS B 1 213 ? 8.880   111.452 145.011 1.00 53.18 ? 213 LYS A O   1 
ATOM   5468  C CB  . LYS B 1 213 ? 9.849   108.593 143.898 1.00 52.89 ? 213 LYS A CB  1 
ATOM   5469  C CG  . LYS B 1 213 ? 11.114  107.848 143.554 1.00 52.78 ? 213 LYS A CG  1 
ATOM   5470  C CD  . LYS B 1 213 ? 12.246  108.796 143.230 1.00 53.41 ? 213 LYS A CD  1 
ATOM   5471  C CE  . LYS B 1 213 ? 13.268  108.125 142.342 1.00 53.66 ? 213 LYS A CE  1 
ATOM   5472  N NZ  . LYS B 1 213 ? 14.155  109.126 141.693 1.00 54.16 ? 213 LYS A NZ  1 
ATOM   5473  N N   . ASN B 1 214 ? 7.544   109.778 145.728 1.00 52.55 ? 214 ASN A N   1 
ATOM   5474  C CA  . ASN B 1 214 ? 6.311   110.533 145.660 1.00 52.21 ? 214 ASN A CA  1 
ATOM   5475  C C   . ASN B 1 214 ? 5.337   110.059 146.734 1.00 52.16 ? 214 ASN A C   1 
ATOM   5476  O O   . ASN B 1 214 ? 5.248   108.867 147.010 1.00 52.44 ? 214 ASN A O   1 
ATOM   5477  C CB  . ASN B 1 214 ? 5.690   110.330 144.281 1.00 52.21 ? 214 ASN A CB  1 
ATOM   5478  C CG  . ASN B 1 214 ? 5.086   111.580 143.731 1.00 51.97 ? 214 ASN A CG  1 
ATOM   5479  O OD1 . ASN B 1 214 ? 5.796   112.530 143.403 1.00 51.55 ? 214 ASN A OD1 1 
ATOM   5480  N ND2 . ASN B 1 214 ? 3.761   111.593 143.609 1.00 52.19 ? 214 ASN A ND2 1 
ATOM   5481  N N   . GLY B 1 215 ? 4.603   110.985 147.334 1.00 51.97 ? 215 GLY A N   1 
ATOM   5482  C CA  . GLY B 1 215 ? 3.613   110.631 148.342 1.00 51.72 ? 215 GLY A CA  1 
ATOM   5483  C C   . GLY B 1 215 ? 4.221   110.403 149.707 1.00 51.63 ? 215 GLY A C   1 
ATOM   5484  O O   . GLY B 1 215 ? 5.326   110.860 149.985 1.00 51.65 ? 215 GLY A O   1 
ATOM   5485  N N   . THR B 1 216 ? 3.482   109.693 150.553 1.00 51.73 ? 216 THR A N   1 
ATOM   5486  C CA  . THR B 1 216 ? 3.882   109.395 151.927 1.00 51.83 ? 216 THR A CA  1 
ATOM   5487  C C   . THR B 1 216 ? 3.449   107.966 152.266 1.00 52.05 ? 216 THR A C   1 
ATOM   5488  O O   . THR B 1 216 ? 2.364   107.544 151.887 1.00 52.07 ? 216 THR A O   1 
ATOM   5489  C CB  . THR B 1 216 ? 3.239   110.399 152.926 1.00 51.74 ? 216 THR A CB  1 
ATOM   5490  O OG1 . THR B 1 216 ? 3.529   111.740 152.513 1.00 51.53 ? 216 THR A OG1 1 
ATOM   5491  C CG2 . THR B 1 216 ? 3.761   110.196 154.345 1.00 51.34 ? 216 THR A CG2 1 
ATOM   5492  N N   . LEU B 1 217 ? 4.302   107.223 152.965 1.00 52.51 ? 217 LEU A N   1 
ATOM   5493  C CA  . LEU B 1 217 ? 3.957   105.879 153.413 1.00 52.97 ? 217 LEU A CA  1 
ATOM   5494  C C   . LEU B 1 217 ? 3.901   105.815 154.931 1.00 53.42 ? 217 LEU A C   1 
ATOM   5495  O O   . LEU B 1 217 ? 4.887   106.125 155.601 1.00 53.79 ? 217 LEU A O   1 
ATOM   5496  C CB  . LEU B 1 217 ? 4.960   104.860 152.874 1.00 52.98 ? 217 LEU A CB  1 
ATOM   5497  C CG  . LEU B 1 217 ? 4.856   103.401 153.334 1.00 53.07 ? 217 LEU A CG  1 
ATOM   5498  C CD1 . LEU B 1 217 ? 3.498   102.779 153.018 1.00 53.47 ? 217 LEU A CD1 1 
ATOM   5499  C CD2 . LEU B 1 217 ? 5.969   102.589 152.706 1.00 53.03 ? 217 LEU A CD2 1 
ATOM   5500  N N   . ARG B 1 218 ? 2.747   105.416 155.461 1.00 53.86 ? 218 ARG A N   1 
ATOM   5501  C CA  . ARG B 1 218 ? 2.533   105.314 156.913 1.00 54.35 ? 218 ARG A CA  1 
ATOM   5502  C C   . ARG B 1 218 ? 2.403   103.853 157.363 1.00 54.61 ? 218 ARG A C   1 
ATOM   5503  O O   . ARG B 1 218 ? 2.309   102.944 156.531 1.00 54.88 ? 218 ARG A O   1 
ATOM   5504  C CB  . ARG B 1 218 ? 1.294   106.109 157.335 1.00 54.25 ? 218 ARG A CB  1 
ATOM   5505  C CG  . ARG B 1 218 ? 1.380   107.580 157.020 1.00 54.51 ? 218 ARG A CG  1 
ATOM   5506  C CD  . ARG B 1 218 ? 0.006   108.206 156.965 1.00 55.23 ? 218 ARG A CD  1 
ATOM   5507  N NE  . ARG B 1 218 ? -0.091  109.179 155.875 1.00 56.02 ? 218 ARG A NE  1 
ATOM   5508  C CZ  . ARG B 1 218 ? 0.192   110.477 155.983 1.00 56.38 ? 218 ARG A CZ  1 
ATOM   5509  N NH1 . ARG B 1 218 ? 0.597   110.991 157.140 1.00 56.79 ? 218 ARG A NH1 1 
ATOM   5510  N NH2 . ARG B 1 218 ? 0.070   111.266 154.925 1.00 56.75 ? 218 ARG A NH2 1 
ATOM   5511  N N   . LYS B 1 219 ? 2.385   103.632 158.676 1.00 54.67 ? 219 LYS A N   1 
ATOM   5512  C CA  . LYS B 1 219 ? 2.386   102.277 159.219 1.00 54.77 ? 219 LYS A CA  1 
ATOM   5513  C C   . LYS B 1 219 ? 1.167   101.464 158.773 1.00 54.84 ? 219 LYS A C   1 
ATOM   5514  O O   . LYS B 1 219 ? 1.302   100.506 158.017 1.00 55.10 ? 219 LYS A O   1 
ATOM   5515  C CB  . LYS B 1 219 ? 2.511   102.292 160.742 1.00 54.73 ? 219 LYS A CB  1 
ATOM   5516  C CG  . LYS B 1 219 ? 3.441   101.218 161.263 1.00 54.67 ? 219 LYS A CG  1 
ATOM   5517  C CD  . LYS B 1 219 ? 3.439   101.154 162.774 1.00 54.65 ? 219 LYS A CD  1 
ATOM   5518  C CE  . LYS B 1 219 ? 4.396   100.082 163.252 1.00 54.76 ? 219 LYS A CE  1 
ATOM   5519  N NZ  . LYS B 1 219 ? 4.197   99.768  164.688 1.00 55.69 ? 219 LYS A NZ  1 
ATOM   5520  N N   . GLY B 1 220 ? -0.023  101.860 159.200 1.00 54.69 ? 220 GLY A N   1 
ATOM   5521  C CA  . GLY B 1 220 ? -1.231  101.114 158.838 1.00 54.59 ? 220 GLY A CA  1 
ATOM   5522  C C   . GLY B 1 220 ? -1.428  100.834 157.353 1.00 54.28 ? 220 GLY A C   1 
ATOM   5523  O O   . GLY B 1 220 ? -2.093  99.866  156.986 1.00 54.21 ? 220 GLY A O   1 
ATOM   5524  N N   . ASP B 1 221 ? -0.832  101.675 156.509 1.00 54.05 ? 221 ASP A N   1 
ATOM   5525  C CA  . ASP B 1 221 ? -1.122  101.706 155.077 1.00 53.88 ? 221 ASP A CA  1 
ATOM   5526  C C   . ASP B 1 221 ? -1.029  100.342 154.399 1.00 53.77 ? 221 ASP A C   1 
ATOM   5527  O O   . ASP B 1 221 ? -0.060  99.608  154.602 1.00 53.93 ? 221 ASP A O   1 
ATOM   5528  C CB  . ASP B 1 221 ? -0.197  102.705 154.376 1.00 53.90 ? 221 ASP A CB  1 
ATOM   5529  C CG  . ASP B 1 221 ? -0.606  104.157 154.602 1.00 54.05 ? 221 ASP A CG  1 
ATOM   5530  O OD1 . ASP B 1 221 ? -1.774  104.423 154.968 1.00 53.92 ? 221 ASP A OD1 1 
ATOM   5531  O OD2 . ASP B 1 221 ? 0.251   105.043 154.390 1.00 54.24 ? 221 ASP A OD2 1 
ATOM   5532  N N   . LYS B 1 222 ? -2.049  100.006 153.607 1.00 53.52 ? 222 LYS A N   1 
ATOM   5533  C CA  . LYS B 1 222 ? -2.036  98.770  152.829 1.00 53.24 ? 222 LYS A CA  1 
ATOM   5534  C C   . LYS B 1 222 ? -1.511  99.022  151.411 1.00 52.95 ? 222 LYS A C   1 
ATOM   5535  O O   . LYS B 1 222 ? -2.142  99.718  150.610 1.00 52.84 ? 222 LYS A O   1 
ATOM   5536  C CB  . LYS B 1 222 ? -3.397  98.045  152.870 1.00 53.36 ? 222 LYS A CB  1 
ATOM   5537  C CG  . LYS B 1 222 ? -4.243  98.048  151.596 1.00 53.51 ? 222 LYS A CG  1 
ATOM   5538  C CD  . LYS B 1 222 ? -5.220  96.861  151.553 1.00 53.35 ? 222 LYS A CD  1 
ATOM   5539  C CE  . LYS B 1 222 ? -6.336  96.993  152.603 1.00 54.19 ? 222 LYS A CE  1 
ATOM   5540  N NZ  . LYS B 1 222 ? -7.521  96.110  152.346 1.00 54.05 ? 222 LYS A NZ  1 
ATOM   5541  N N   . VAL B 1 223 ? -0.336  98.455  151.136 1.00 52.62 ? 223 VAL A N   1 
ATOM   5542  C CA  . VAL B 1 223 ? 0.442   98.757  149.931 1.00 52.15 ? 223 VAL A CA  1 
ATOM   5543  C C   . VAL B 1 223 ? 0.244   97.763  148.792 1.00 51.89 ? 223 VAL A C   1 
ATOM   5544  O O   . VAL B 1 223 ? -0.212  96.638  149.000 1.00 51.86 ? 223 VAL A O   1 
ATOM   5545  C CB  . VAL B 1 223 ? 1.956   98.854  150.230 1.00 52.04 ? 223 VAL A CB  1 
ATOM   5546  C CG1 . VAL B 1 223 ? 2.228   99.920  151.260 1.00 52.13 ? 223 VAL A CG1 1 
ATOM   5547  C CG2 . VAL B 1 223 ? 2.508   97.511  150.682 1.00 52.18 ? 223 VAL A CG2 1 
ATOM   5548  N N   . LYS B 1 224 ? 0.608   98.202  147.592 1.00 51.48 ? 224 LYS A N   1 
ATOM   5549  C CA  . LYS B 1 224 ? 0.541   97.385  146.397 1.00 51.14 ? 224 LYS A CA  1 
ATOM   5550  C C   . LYS B 1 224 ? 1.912   97.381  145.739 1.00 51.15 ? 224 LYS A C   1 
ATOM   5551  O O   . LYS B 1 224 ? 2.539   98.433  145.577 1.00 51.28 ? 224 LYS A O   1 
ATOM   5552  C CB  . LYS B 1 224 ? -0.481  97.976  145.435 1.00 51.08 ? 224 LYS A CB  1 
ATOM   5553  C CG  . LYS B 1 224 ? -1.017  97.016  144.403 1.00 50.60 ? 224 LYS A CG  1 
ATOM   5554  C CD  . LYS B 1 224 ? -1.947  97.757  143.481 1.00 50.20 ? 224 LYS A CD  1 
ATOM   5555  C CE  . LYS B 1 224 ? -3.118  96.915  143.060 1.00 49.87 ? 224 LYS A CE  1 
ATOM   5556  N NZ  . LYS B 1 224 ? -3.967  97.742  142.177 1.00 50.40 ? 224 LYS A NZ  1 
ATOM   5557  N N   . VAL B 1 225 ? 2.386   96.195  145.380 1.00 50.86 ? 225 VAL A N   1 
ATOM   5558  C CA  . VAL B 1 225 ? 3.601   96.085  144.593 1.00 50.86 ? 225 VAL A CA  1 
ATOM   5559  C C   . VAL B 1 225 ? 3.154   96.044  143.135 1.00 50.94 ? 225 VAL A C   1 
ATOM   5560  O O   . VAL B 1 225 ? 2.324   95.213  142.760 1.00 51.03 ? 225 VAL A O   1 
ATOM   5561  C CB  . VAL B 1 225 ? 4.426   94.837  144.972 1.00 50.86 ? 225 VAL A CB  1 
ATOM   5562  C CG1 . VAL B 1 225 ? 5.835   94.943  144.432 1.00 50.61 ? 225 VAL A CG1 1 
ATOM   5563  C CG2 . VAL B 1 225 ? 4.464   94.652  146.482 1.00 50.82 ? 225 VAL A CG2 1 
ATOM   5564  N N   . MET B 1 226 ? 3.687   96.952  142.321 1.00 50.93 ? 226 MET A N   1 
ATOM   5565  C CA  . MET B 1 226 ? 3.132   97.187  140.981 1.00 50.94 ? 226 MET A CA  1 
ATOM   5566  C C   . MET B 1 226 ? 3.438   96.109  139.921 1.00 51.02 ? 226 MET A C   1 
ATOM   5567  O O   . MET B 1 226 ? 2.615   95.881  139.042 1.00 50.93 ? 226 MET A O   1 
ATOM   5568  C CB  . MET B 1 226 ? 3.448   98.604  140.490 1.00 50.91 ? 226 MET A CB  1 
ATOM   5569  C CG  . MET B 1 226 ? 2.712   99.693  141.277 1.00 50.62 ? 226 MET A CG  1 
ATOM   5570  S SD  . MET B 1 226 ? 2.902   101.366 140.621 1.00 50.67 ? 226 MET A SD  1 
ATOM   5571  C CE  . MET B 1 226 ? 1.842   101.297 139.174 1.00 49.33 ? 226 MET A CE  1 
ATOM   5572  N N   . SER B 1 227 ? 4.596   95.451  140.009 1.00 51.14 ? 227 SER A N   1 
ATOM   5573  C CA  . SER B 1 227 ? 4.879   94.280  139.170 1.00 51.27 ? 227 SER A CA  1 
ATOM   5574  C C   . SER B 1 227 ? 3.855   93.196  139.421 1.00 51.53 ? 227 SER A C   1 
ATOM   5575  O O   . SER B 1 227 ? 3.160   92.768  138.507 1.00 51.67 ? 227 SER A O   1 
ATOM   5576  C CB  . SER B 1 227 ? 6.248   93.674  139.478 1.00 50.99 ? 227 SER A CB  1 
ATOM   5577  O OG  . SER B 1 227 ? 7.286   94.531  139.096 1.00 51.13 ? 227 SER A OG  1 
ATOM   5578  N N   . THR B 1 228 ? 3.792   92.754  140.675 1.00 51.93 ? 228 THR A N   1 
ATOM   5579  C CA  . THR B 1 228 ? 2.998   91.602  141.071 1.00 52.39 ? 228 THR A CA  1 
ATOM   5580  C C   . THR B 1 228 ? 1.505   91.907  141.074 1.00 52.47 ? 228 THR A C   1 
ATOM   5581  O O   . THR B 1 228 ? 0.696   91.074  140.662 1.00 52.53 ? 228 THR A O   1 
ATOM   5582  C CB  . THR B 1 228 ? 3.454   91.013  142.445 1.00 52.51 ? 228 THR A CB  1 
ATOM   5583  O OG1 . THR B 1 228 ? 2.514   90.027  142.889 1.00 53.56 ? 228 THR A OG1 1 
ATOM   5584  C CG2 . THR B 1 228 ? 3.568   92.085  143.514 1.00 52.64 ? 228 THR A CG2 1 
ATOM   5585  N N   . GLY B 1 229 ? 1.152   93.109  141.516 1.00 52.60 ? 229 GLY A N   1 
ATOM   5586  C CA  . GLY B 1 229 ? -0.246  93.494  141.658 1.00 52.66 ? 229 GLY A CA  1 
ATOM   5587  C C   . GLY B 1 229 ? -0.828  93.025  142.977 1.00 52.69 ? 229 GLY A C   1 
ATOM   5588  O O   . GLY B 1 229 ? -2.042  93.086  143.176 1.00 52.63 ? 229 GLY A O   1 
ATOM   5589  N N   . GLN B 1 230 ? 0.035   92.563  143.882 1.00 52.77 ? 230 GLN A N   1 
ATOM   5590  C CA  . GLN B 1 230 ? -0.419  92.061  145.173 1.00 52.98 ? 230 GLN A CA  1 
ATOM   5591  C C   . GLN B 1 230 ? -0.301  93.095  146.285 1.00 52.84 ? 230 GLN A C   1 
ATOM   5592  O O   . GLN B 1 230 ? 0.528   94.000  146.211 1.00 52.91 ? 230 GLN A O   1 
ATOM   5593  C CB  . GLN B 1 230 ? 0.284   90.753  145.539 1.00 53.08 ? 230 GLN A CB  1 
ATOM   5594  C CG  . GLN B 1 230 ? -0.558  89.504  145.232 1.00 54.25 ? 230 GLN A CG  1 
ATOM   5595  C CD  . GLN B 1 230 ? -0.644  88.536  146.429 1.00 56.56 ? 230 GLN A CD  1 
ATOM   5596  O OE1 . GLN B 1 230 ? 0.228   88.523  147.317 1.00 56.83 ? 230 GLN A OE1 1 
ATOM   5597  N NE2 . GLN B 1 230 ? -1.702  87.727  146.456 1.00 56.45 ? 230 GLN A NE2 1 
ATOM   5598  N N   . THR B 1 231 ? -1.155  92.962  147.300 1.00 52.81 ? 231 THR A N   1 
ATOM   5599  C CA  . THR B 1 231 ? -1.307  93.973  148.351 1.00 52.64 ? 231 THR A CA  1 
ATOM   5600  C C   . THR B 1 231 ? -0.958  93.428  149.731 1.00 52.71 ? 231 THR A C   1 
ATOM   5601  O O   . THR B 1 231 ? -1.285  92.291  150.061 1.00 52.84 ? 231 THR A O   1 
ATOM   5602  C CB  . THR B 1 231 ? -2.753  94.554  148.394 1.00 52.67 ? 231 THR A CB  1 
ATOM   5603  O OG1 . THR B 1 231 ? -3.697  93.495  148.580 1.00 52.23 ? 231 THR A OG1 1 
ATOM   5604  C CG2 . THR B 1 231 ? -3.093  95.306  147.111 1.00 52.41 ? 231 THR A CG2 1 
ATOM   5605  N N   . TYR B 1 232 ? -0.300  94.253  150.538 1.00 52.84 ? 232 TYR A N   1 
ATOM   5606  C CA  . TYR B 1 232 ? 0.168   93.848  151.864 1.00 52.93 ? 232 TYR A CA  1 
ATOM   5607  C C   . TYR B 1 232 ? 0.032   95.021  152.826 1.00 52.84 ? 232 TYR A C   1 
ATOM   5608  O O   . TYR B 1 232 ? -0.084  96.161  152.393 1.00 52.76 ? 232 TYR A O   1 
ATOM   5609  C CB  . TYR B 1 232 ? 1.640   93.429  151.811 1.00 53.12 ? 232 TYR A CB  1 
ATOM   5610  C CG  . TYR B 1 232 ? 2.007   92.477  150.693 1.00 53.24 ? 232 TYR A CG  1 
ATOM   5611  C CD1 . TYR B 1 232 ? 2.418   92.958  149.448 1.00 53.21 ? 232 TYR A CD1 1 
ATOM   5612  C CD2 . TYR B 1 232 ? 1.963   91.099  150.884 1.00 53.06 ? 232 TYR A CD2 1 
ATOM   5613  C CE1 . TYR B 1 232 ? 2.765   92.090  148.421 1.00 53.14 ? 232 TYR A CE1 1 
ATOM   5614  C CE2 . TYR B 1 232 ? 2.308   90.223  149.863 1.00 53.52 ? 232 TYR A CE2 1 
ATOM   5615  C CZ  . TYR B 1 232 ? 2.708   90.725  148.635 1.00 53.62 ? 232 TYR A CZ  1 
ATOM   5616  O OH  . TYR B 1 232 ? 3.049   89.857  147.621 1.00 54.05 ? 232 TYR A OH  1 
ATOM   5617  N N   . ASN B 1 233 ? 0.058   94.742  154.127 1.00 52.82 ? 233 ASN A N   1 
ATOM   5618  C CA  . ASN B 1 233 ? 0.035   95.804  155.133 1.00 52.81 ? 233 ASN A CA  1 
ATOM   5619  C C   . ASN B 1 233 ? 1.421   96.192  155.625 1.00 52.66 ? 233 ASN A C   1 
ATOM   5620  O O   . ASN B 1 233 ? 2.235   95.330  155.967 1.00 52.74 ? 233 ASN A O   1 
ATOM   5621  C CB  . ASN B 1 233 ? -0.864  95.430  156.308 1.00 52.73 ? 233 ASN A CB  1 
ATOM   5622  C CG  . ASN B 1 233 ? -2.334  95.618  155.987 1.00 53.64 ? 233 ASN A CG  1 
ATOM   5623  O OD1 . ASN B 1 233 ? -2.774  96.727  155.674 1.00 54.07 ? 233 ASN A OD1 1 
ATOM   5624  N ND2 . ASN B 1 233 ? -3.104  94.534  156.061 1.00 53.90 ? 233 ASN A ND2 1 
ATOM   5625  N N   . ALA B 1 234 ? 1.684   97.494  155.660 1.00 52.28 ? 234 ALA A N   1 
ATOM   5626  C CA  . ALA B 1 234 ? 2.959   98.003  156.136 1.00 52.05 ? 234 ALA A CA  1 
ATOM   5627  C C   . ALA B 1 234 ? 3.077   97.840  157.648 1.00 51.88 ? 234 ALA A C   1 
ATOM   5628  O O   . ALA B 1 234 ? 2.955   98.803  158.394 1.00 51.72 ? 234 ALA A O   1 
ATOM   5629  C CB  . ALA B 1 234 ? 3.135   99.460  155.726 1.00 52.11 ? 234 ALA A CB  1 
ATOM   5630  N N   . ASP B 1 235 ? 3.326   96.607  158.086 1.00 52.01 ? 235 ASP A N   1 
ATOM   5631  C CA  . ASP B 1 235 ? 3.404   96.267  159.512 1.00 51.95 ? 235 ASP A CA  1 
ATOM   5632  C C   . ASP B 1 235 ? 4.495   97.047  160.230 1.00 51.83 ? 235 ASP A C   1 
ATOM   5633  O O   . ASP B 1 235 ? 4.290   97.528  161.345 1.00 51.82 ? 235 ASP A O   1 
ATOM   5634  C CB  . ASP B 1 235 ? 3.647   94.770  159.699 1.00 51.98 ? 235 ASP A CB  1 
ATOM   5635  C CG  . ASP B 1 235 ? 2.677   93.919  158.912 1.00 52.74 ? 235 ASP A CG  1 
ATOM   5636  O OD1 . ASP B 1 235 ? 1.450   94.176  158.982 1.00 53.75 ? 235 ASP A OD1 1 
ATOM   5637  O OD2 . ASP B 1 235 ? 3.149   92.990  158.223 1.00 53.08 ? 235 ASP A OD2 1 
ATOM   5638  N N   . ARG B 1 236 ? 5.655   97.171  159.592 1.00 51.61 ? 236 ARG A N   1 
ATOM   5639  C CA  . ARG B 1 236 ? 6.755   97.923  160.177 1.00 51.50 ? 236 ARG A CA  1 
ATOM   5640  C C   . ARG B 1 236 ? 7.583   98.630  159.119 1.00 51.57 ? 236 ARG A C   1 
ATOM   5641  O O   . ARG B 1 236 ? 7.801   98.105  158.021 1.00 51.71 ? 236 ARG A O   1 
ATOM   5642  C CB  . ARG B 1 236 ? 7.643   97.016  161.032 1.00 51.33 ? 236 ARG A CB  1 
ATOM   5643  C CG  . ARG B 1 236 ? 6.995   96.575  162.332 1.00 51.12 ? 236 ARG A CG  1 
ATOM   5644  C CD  . ARG B 1 236 ? 7.892   95.662  163.117 1.00 50.93 ? 236 ARG A CD  1 
ATOM   5645  N NE  . ARG B 1 236 ? 9.078   96.370  163.582 1.00 50.58 ? 236 ARG A NE  1 
ATOM   5646  C CZ  . ARG B 1 236 ? 10.099  95.796  164.204 1.00 50.37 ? 236 ARG A CZ  1 
ATOM   5647  N NH1 . ARG B 1 236 ? 10.091  94.491  164.449 1.00 50.64 ? 236 ARG A NH1 1 
ATOM   5648  N NH2 . ARG B 1 236 ? 11.128  96.533  164.585 1.00 50.34 ? 236 ARG A NH2 1 
ATOM   5649  N N   . LEU B 1 237 ? 8.025   99.836  159.457 1.00 51.48 ? 237 LEU A N   1 
ATOM   5650  C CA  . LEU B 1 237 ? 8.949   100.589 158.625 1.00 51.40 ? 237 LEU A CA  1 
ATOM   5651  C C   . LEU B 1 237 ? 9.846   101.453 159.500 1.00 51.83 ? 237 LEU A C   1 
ATOM   5652  O O   . LEU B 1 237 ? 9.480   101.790 160.634 1.00 52.09 ? 237 LEU A O   1 
ATOM   5653  C CB  . LEU B 1 237 ? 8.204   101.433 157.584 1.00 51.27 ? 237 LEU A CB  1 
ATOM   5654  C CG  . LEU B 1 237 ? 6.953   102.231 157.952 1.00 50.73 ? 237 LEU A CG  1 
ATOM   5655  C CD1 . LEU B 1 237 ? 7.277   103.363 158.886 1.00 50.90 ? 237 LEU A CD1 1 
ATOM   5656  C CD2 . LEU B 1 237 ? 6.315   102.783 156.699 1.00 50.95 ? 237 LEU A CD2 1 
ATOM   5657  N N   . GLY B 1 238 ? 11.021  101.801 158.983 1.00 51.93 ? 238 GLY A N   1 
ATOM   5658  C CA  . GLY B 1 238 ? 11.956  102.645 159.720 1.00 52.33 ? 238 GLY A CA  1 
ATOM   5659  C C   . GLY B 1 238 ? 13.180  103.012 158.910 1.00 52.61 ? 238 GLY A C   1 
ATOM   5660  O O   . GLY B 1 238 ? 13.174  102.908 157.678 1.00 52.77 ? 238 GLY A O   1 
ATOM   5661  N N   . ILE B 1 239 ? 14.234  103.437 159.601 1.00 52.52 ? 239 ILE A N   1 
ATOM   5662  C CA  . ILE B 1 239 ? 15.470  103.848 158.935 1.00 52.66 ? 239 ILE A CA  1 
ATOM   5663  C C   . ILE B 1 239 ? 16.684  103.096 159.481 1.00 52.77 ? 239 ILE A C   1 
ATOM   5664  O O   . ILE B 1 239 ? 16.613  102.502 160.564 1.00 53.05 ? 239 ILE A O   1 
ATOM   5665  C CB  . ILE B 1 239 ? 15.707  105.388 159.026 1.00 52.65 ? 239 ILE A CB  1 
ATOM   5666  C CG1 . ILE B 1 239 ? 15.713  105.860 160.484 1.00 52.37 ? 239 ILE A CG1 1 
ATOM   5667  C CG2 . ILE B 1 239 ? 14.669  106.145 158.198 1.00 52.50 ? 239 ILE A CG2 1 
ATOM   5668  C CD1 . ILE B 1 239 ? 16.226  107.260 160.668 1.00 52.50 ? 239 ILE A CD1 1 
ATOM   5669  N N   . PHE B 1 240 ? 17.784  103.118 158.725 1.00 52.48 ? 240 PHE A N   1 
ATOM   5670  C CA  . PHE B 1 240 ? 19.046  102.559 159.198 1.00 52.43 ? 240 PHE A CA  1 
ATOM   5671  C C   . PHE B 1 240 ? 19.968  103.667 159.652 1.00 52.60 ? 240 PHE A C   1 
ATOM   5672  O O   . PHE B 1 240 ? 20.179  104.652 158.944 1.00 52.90 ? 240 PHE A O   1 
ATOM   5673  C CB  . PHE B 1 240 ? 19.713  101.680 158.144 1.00 52.18 ? 240 PHE A CB  1 
ATOM   5674  C CG  . PHE B 1 240 ? 18.995  100.389 157.909 1.00 51.98 ? 240 PHE A CG  1 
ATOM   5675  C CD1 . PHE B 1 240 ? 18.333  100.157 156.708 1.00 51.47 ? 240 PHE A CD1 1 
ATOM   5676  C CD2 . PHE B 1 240 ? 18.951  99.414  158.903 1.00 51.08 ? 240 PHE A CD2 1 
ATOM   5677  C CE1 . PHE B 1 240 ? 17.657  98.971  156.494 1.00 50.96 ? 240 PHE A CE1 1 
ATOM   5678  C CE2 . PHE B 1 240 ? 18.280  98.223  158.699 1.00 50.48 ? 240 PHE A CE2 1 
ATOM   5679  C CZ  . PHE B 1 240 ? 17.632  97.999  157.494 1.00 51.26 ? 240 PHE A CZ  1 
ATOM   5680  N N   . THR B 1 241 ? 20.540  103.472 160.832 1.00 52.51 ? 241 THR A N   1 
ATOM   5681  C CA  . THR B 1 241 ? 21.092  104.559 161.616 1.00 52.26 ? 241 THR A CA  1 
ATOM   5682  C C   . THR B 1 241 ? 22.619  104.620 161.837 1.00 52.23 ? 241 THR A C   1 
ATOM   5683  O O   . THR B 1 241 ? 23.118  105.664 162.258 1.00 52.31 ? 241 THR A O   1 
ATOM   5684  C CB  . THR B 1 241 ? 20.291  104.680 162.942 1.00 52.29 ? 241 THR A CB  1 
ATOM   5685  O OG1 . THR B 1 241 ? 19.557  105.909 162.933 1.00 52.30 ? 241 THR A OG1 1 
ATOM   5686  C CG2 . THR B 1 241 ? 21.182  104.585 164.192 1.00 52.07 ? 241 THR A CG2 1 
ATOM   5687  N N   . PRO B 1 242 ? 23.381  103.549 161.516 1.00 52.20 ? 242 PRO A N   1 
ATOM   5688  C CA  . PRO B 1 242 ? 23.133  102.231 160.902 1.00 52.10 ? 242 PRO A CA  1 
ATOM   5689  C C   . PRO B 1 242 ? 22.194  101.282 161.647 1.00 51.94 ? 242 PRO A C   1 
ATOM   5690  O O   . PRO B 1 242 ? 21.602  100.412 161.011 1.00 51.84 ? 242 PRO A O   1 
ATOM   5691  C CB  . PRO B 1 242 ? 24.538  101.610 160.819 1.00 52.17 ? 242 PRO A CB  1 
ATOM   5692  C CG  . PRO B 1 242 ? 25.342  102.338 161.831 1.00 52.13 ? 242 PRO A CG  1 
ATOM   5693  C CD  . PRO B 1 242 ? 24.817  103.733 161.803 1.00 52.07 ? 242 PRO A CD  1 
ATOM   5694  N N   . LYS B 1 243 ? 22.052  101.435 162.961 1.00 51.94 ? 243 LYS A N   1 
ATOM   5695  C CA  . LYS B 1 243 ? 21.155  100.557 163.718 1.00 52.17 ? 243 LYS A CA  1 
ATOM   5696  C C   . LYS B 1 243 ? 19.723  100.626 163.201 1.00 52.03 ? 243 LYS A C   1 
ATOM   5697  O O   . LYS B 1 243 ? 19.238  101.693 162.818 1.00 52.14 ? 243 LYS A O   1 
ATOM   5698  C CB  . LYS B 1 243 ? 21.202  100.852 165.216 1.00 52.23 ? 243 LYS A CB  1 
ATOM   5699  C CG  . LYS B 1 243 ? 22.414  100.233 165.915 1.00 53.48 ? 243 LYS A CG  1 
ATOM   5700  C CD  . LYS B 1 243 ? 22.177  99.977  167.411 1.00 55.30 ? 243 LYS A CD  1 
ATOM   5701  C CE  . LYS B 1 243 ? 22.301  101.246 168.253 1.00 56.16 ? 243 LYS A CE  1 
ATOM   5702  N NZ  . LYS B 1 243 ? 21.229  102.242 167.927 1.00 56.98 ? 243 LYS A NZ  1 
ATOM   5703  N N   . GLN B 1 244 ? 19.058  99.476  163.168 1.00 51.89 ? 244 GLN A N   1 
ATOM   5704  C CA  . GLN B 1 244 ? 17.685  99.400  162.680 1.00 51.72 ? 244 GLN A CA  1 
ATOM   5705  C C   . GLN B 1 244 ? 16.728  100.097 163.645 1.00 51.65 ? 244 GLN A C   1 
ATOM   5706  O O   . GLN B 1 244 ? 16.526  99.649  164.776 1.00 51.68 ? 244 GLN A O   1 
ATOM   5707  C CB  . GLN B 1 244 ? 17.277  97.949  162.458 1.00 51.59 ? 244 GLN A CB  1 
ATOM   5708  C CG  . GLN B 1 244 ? 15.841  97.785  162.043 1.00 51.77 ? 244 GLN A CG  1 
ATOM   5709  C CD  . GLN B 1 244 ? 15.445  96.338  161.931 1.00 52.08 ? 244 GLN A CD  1 
ATOM   5710  O OE1 . GLN B 1 244 ? 14.796  95.790  162.827 1.00 51.78 ? 244 GLN A OE1 1 
ATOM   5711  N NE2 . GLN B 1 244 ? 15.842  95.699  160.834 1.00 51.63 ? 244 GLN A NE2 1 
ATOM   5712  N N   . VAL B 1 245 ? 16.152  101.205 163.195 1.00 51.51 ? 245 VAL A N   1 
ATOM   5713  C CA  . VAL B 1 245 ? 15.312  102.028 164.054 1.00 51.48 ? 245 VAL A CA  1 
ATOM   5714  C C   . VAL B 1 245 ? 13.921  102.171 163.451 1.00 51.34 ? 245 VAL A C   1 
ATOM   5715  O O   . VAL B 1 245 ? 13.777  102.496 162.276 1.00 51.68 ? 245 VAL A O   1 
ATOM   5716  C CB  . VAL B 1 245 ? 15.974  103.402 164.324 1.00 51.43 ? 245 VAL A CB  1 
ATOM   5717  C CG1 . VAL B 1 245 ? 14.964  104.414 164.799 1.00 51.89 ? 245 VAL A CG1 1 
ATOM   5718  C CG2 . VAL B 1 245 ? 17.086  103.257 165.355 1.00 51.43 ? 245 VAL A CG2 1 
ATOM   5719  N N   . ASP B 1 246 ? 12.901  101.897 164.252 1.00 51.19 ? 246 ASP A N   1 
ATOM   5720  C CA  . ASP B 1 246 ? 11.522  101.958 163.771 1.00 51.17 ? 246 ASP A CA  1 
ATOM   5721  C C   . ASP B 1 246 ? 11.033  103.391 163.635 1.00 51.26 ? 246 ASP A C   1 
ATOM   5722  O O   . ASP B 1 246 ? 11.366  104.257 164.447 1.00 51.30 ? 246 ASP A O   1 
ATOM   5723  C CB  . ASP B 1 246 ? 10.581  101.187 164.702 1.00 50.94 ? 246 ASP A CB  1 
ATOM   5724  C CG  . ASP B 1 246 ? 10.419  99.739  164.304 1.00 50.88 ? 246 ASP A CG  1 
ATOM   5725  O OD1 . ASP B 1 246 ? 11.437  99.042  164.123 1.00 51.37 ? 246 ASP A OD1 1 
ATOM   5726  O OD2 . ASP B 1 246 ? 9.264   99.288  164.186 1.00 51.54 ? 246 ASP A OD2 1 
ATOM   5727  N N   . ARG B 1 247 ? 10.241  103.631 162.599 1.00 51.32 ? 247 ARG A N   1 
ATOM   5728  C CA  . ARG B 1 247 ? 9.567   104.906 162.440 1.00 51.50 ? 247 ARG A CA  1 
ATOM   5729  C C   . ARG B 1 247 ? 8.072   104.666 162.303 1.00 51.65 ? 247 ARG A C   1 
ATOM   5730  O O   . ARG B 1 247 ? 7.617   103.520 162.231 1.00 51.61 ? 247 ARG A O   1 
ATOM   5731  C CB  . ARG B 1 247 ? 10.109  105.673 161.228 1.00 51.59 ? 247 ARG A CB  1 
ATOM   5732  C CG  . ARG B 1 247 ? 11.560  106.125 161.350 1.00 51.55 ? 247 ARG A CG  1 
ATOM   5733  C CD  . ARG B 1 247 ? 11.695  107.424 162.128 1.00 51.77 ? 247 ARG A CD  1 
ATOM   5734  N NE  . ARG B 1 247 ? 13.093  107.711 162.437 1.00 52.86 ? 247 ARG A NE  1 
ATOM   5735  C CZ  . ARG B 1 247 ? 13.682  107.440 163.601 1.00 53.33 ? 247 ARG A CZ  1 
ATOM   5736  N NH1 . ARG B 1 247 ? 12.992  106.884 164.588 1.00 53.79 ? 247 ARG A NH1 1 
ATOM   5737  N NH2 . ARG B 1 247 ? 14.963  107.735 163.788 1.00 53.38 ? 247 ARG A NH2 1 
ATOM   5738  N N   . THR B 1 248 ? 7.315   105.755 162.278 1.00 51.92 ? 248 THR A N   1 
ATOM   5739  C CA  . THR B 1 248 ? 5.866   105.691 162.162 1.00 52.11 ? 248 THR A CA  1 
ATOM   5740  C C   . THR B 1 248 ? 5.419   105.986 160.729 1.00 52.31 ? 248 THR A C   1 
ATOM   5741  O O   . THR B 1 248 ? 4.262   105.754 160.372 1.00 52.35 ? 248 THR A O   1 
ATOM   5742  C CB  . THR B 1 248 ? 5.199   106.672 163.131 1.00 51.99 ? 248 THR A CB  1 
ATOM   5743  O OG1 . THR B 1 248 ? 3.793   106.432 163.139 1.00 52.56 ? 248 THR A OG1 1 
ATOM   5744  C CG2 . THR B 1 248 ? 5.463   108.123 162.712 1.00 52.27 ? 248 THR A CG2 1 
ATOM   5745  N N   . GLU B 1 249 ? 6.349   106.508 159.926 1.00 52.49 ? 249 GLU A N   1 
ATOM   5746  C CA  . GLU B 1 249 ? 6.129   106.809 158.510 1.00 52.55 ? 249 GLU A CA  1 
ATOM   5747  C C   . GLU B 1 249 ? 7.460   107.058 157.807 1.00 52.55 ? 249 GLU A C   1 
ATOM   5748  O O   . GLU B 1 249 ? 8.467   107.380 158.455 1.00 52.80 ? 249 GLU A O   1 
ATOM   5749  C CB  . GLU B 1 249 ? 5.240   108.041 158.351 1.00 52.73 ? 249 GLU A CB  1 
ATOM   5750  C CG  . GLU B 1 249 ? 5.869   109.345 158.849 1.00 53.54 ? 249 GLU A CG  1 
ATOM   5751  C CD  . GLU B 1 249 ? 4.843   110.426 159.160 1.00 55.33 ? 249 GLU A CD  1 
ATOM   5752  O OE1 . GLU B 1 249 ? 3.617   110.114 159.237 1.00 55.76 ? 249 GLU A OE1 1 
ATOM   5753  O OE2 . GLU B 1 249 ? 5.267   111.597 159.331 1.00 55.96 ? 249 GLU A OE2 1 
ATOM   5754  N N   . LEU B 1 250 ? 7.469   106.898 156.485 1.00 52.13 ? 250 LEU A N   1 
ATOM   5755  C CA  . LEU B 1 250 ? 8.581   107.377 155.671 1.00 51.67 ? 250 LEU A CA  1 
ATOM   5756  C C   . LEU B 1 250 ? 8.032   108.412 154.695 1.00 51.64 ? 250 LEU A C   1 
ATOM   5757  O O   . LEU B 1 250 ? 7.254   108.076 153.794 1.00 51.95 ? 250 LEU A O   1 
ATOM   5758  C CB  . LEU B 1 250 ? 9.270   106.221 154.937 1.00 51.49 ? 250 LEU A CB  1 
ATOM   5759  C CG  . LEU B 1 250 ? 10.197  105.289 155.730 1.00 51.08 ? 250 LEU A CG  1 
ATOM   5760  C CD1 . LEU B 1 250 ? 10.511  104.046 154.922 1.00 50.02 ? 250 LEU A CD1 1 
ATOM   5761  C CD2 . LEU B 1 250 ? 11.496  105.982 156.173 1.00 50.30 ? 250 LEU A CD2 1 
ATOM   5762  N N   . LYS B 1 251 ? 8.404   109.675 154.888 1.00 51.28 ? 251 LYS A N   1 
ATOM   5763  C CA  . LYS B 1 251 ? 7.829   110.744 154.072 1.00 51.34 ? 251 LYS A CA  1 
ATOM   5764  C C   . LYS B 1 251 ? 8.549   110.918 152.742 1.00 51.38 ? 251 LYS A C   1 
ATOM   5765  O O   . LYS B 1 251 ? 9.446   110.148 152.411 1.00 51.49 ? 251 LYS A O   1 
ATOM   5766  C CB  . LYS B 1 251 ? 7.695   112.061 154.846 1.00 51.28 ? 251 LYS A CB  1 
ATOM   5767  C CG  . LYS B 1 251 ? 8.821   112.341 155.804 1.00 51.30 ? 251 LYS A CG  1 
ATOM   5768  C CD  . LYS B 1 251 ? 8.507   113.508 156.714 1.00 50.97 ? 251 LYS A CD  1 
ATOM   5769  C CE  . LYS B 1 251 ? 7.987   113.045 158.055 1.00 51.08 ? 251 LYS A CE  1 
ATOM   5770  N NZ  . LYS B 1 251 ? 8.315   114.038 159.112 1.00 51.54 ? 251 LYS A NZ  1 
ATOM   5771  N N   . CYS B 1 252 ? 8.130   111.916 151.969 1.00 51.45 ? 252 CYS A N   1 
ATOM   5772  C CA  . CYS B 1 252 ? 8.650   112.104 150.620 1.00 51.31 ? 252 CYS A CA  1 
ATOM   5773  C C   . CYS B 1 252 ? 10.144  112.414 150.639 1.00 51.19 ? 252 CYS A C   1 
ATOM   5774  O O   . CYS B 1 252 ? 10.617  113.178 151.478 1.00 51.19 ? 252 CYS A O   1 
ATOM   5775  C CB  . CYS B 1 252 ? 7.875   113.200 149.895 1.00 51.26 ? 252 CYS A CB  1 
ATOM   5776  S SG  . CYS B 1 252 ? 7.788   112.969 148.106 1.00 51.48 ? 252 CYS A SG  1 
ATOM   5777  N N   . GLY B 1 253 ? 10.878  111.794 149.723 1.00 51.02 ? 253 GLY A N   1 
ATOM   5778  C CA  . GLY B 1 253 ? 12.311  112.021 149.596 1.00 50.91 ? 253 GLY A CA  1 
ATOM   5779  C C   . GLY B 1 253 ? 13.165  111.152 150.500 1.00 50.89 ? 253 GLY A C   1 
ATOM   5780  O O   . GLY B 1 253 ? 14.394  111.206 150.437 1.00 50.95 ? 253 GLY A O   1 
ATOM   5781  N N   . GLU B 1 254 ? 12.521  110.338 151.331 1.00 50.73 ? 254 GLU A N   1 
ATOM   5782  C CA  . GLU B 1 254 ? 13.239  109.556 152.336 1.00 50.62 ? 254 GLU A CA  1 
ATOM   5783  C C   . GLU B 1 254 ? 13.660  108.163 151.872 1.00 50.72 ? 254 GLU A C   1 
ATOM   5784  O O   . GLU B 1 254 ? 13.164  107.643 150.878 1.00 50.81 ? 254 GLU A O   1 
ATOM   5785  C CB  . GLU B 1 254 ? 12.424  109.466 153.626 1.00 50.45 ? 254 GLU A CB  1 
ATOM   5786  C CG  . GLU B 1 254 ? 12.238  110.813 154.306 1.00 50.35 ? 254 GLU A CG  1 
ATOM   5787  C CD  . GLU B 1 254 ? 11.831  110.699 155.759 1.00 50.20 ? 254 GLU A CD  1 
ATOM   5788  O OE1 . GLU B 1 254 ? 12.136  111.631 156.526 1.00 50.11 ? 254 GLU A OE1 1 
ATOM   5789  O OE2 . GLU B 1 254 ? 11.203  109.689 156.139 1.00 51.05 ? 254 GLU A OE2 1 
ATOM   5790  N N   . VAL B 1 255 ? 14.597  107.573 152.604 1.00 50.88 ? 255 VAL A N   1 
ATOM   5791  C CA  . VAL B 1 255 ? 15.034  106.212 152.363 1.00 50.95 ? 255 VAL A CA  1 
ATOM   5792  C C   . VAL B 1 255 ? 14.912  105.460 153.668 1.00 51.35 ? 255 VAL A C   1 
ATOM   5793  O O   . VAL B 1 255 ? 15.325  105.968 154.713 1.00 51.81 ? 255 VAL A O   1 
ATOM   5794  C CB  . VAL B 1 255 ? 16.495  106.163 151.889 1.00 50.73 ? 255 VAL A CB  1 
ATOM   5795  C CG1 . VAL B 1 255 ? 16.966  104.733 151.749 1.00 50.10 ? 255 VAL A CG1 1 
ATOM   5796  C CG2 . VAL B 1 255 ? 16.642  106.893 150.566 1.00 51.30 ? 255 VAL A CG2 1 
ATOM   5797  N N   . GLY B 1 256 ? 14.340  104.260 153.611 1.00 51.66 ? 256 GLY A N   1 
ATOM   5798  C CA  . GLY B 1 256 ? 14.254  103.390 154.784 1.00 51.94 ? 256 GLY A CA  1 
ATOM   5799  C C   . GLY B 1 256 ? 13.853  101.961 154.467 1.00 52.16 ? 256 GLY A C   1 
ATOM   5800  O O   . GLY B 1 256 ? 13.834  101.557 153.304 1.00 52.31 ? 256 GLY A O   1 
ATOM   5801  N N   . TRP B 1 257 ? 13.526  101.199 155.507 1.00 52.21 ? 257 TRP A N   1 
ATOM   5802  C CA  . TRP B 1 257 ? 13.177  99.789  155.348 1.00 52.45 ? 257 TRP A CA  1 
ATOM   5803  C C   . TRP B 1 257 ? 11.691  99.545  155.581 1.00 52.90 ? 257 TRP A C   1 
ATOM   5804  O O   . TRP B 1 257 ? 11.040  100.297 156.306 1.00 53.40 ? 257 TRP A O   1 
ATOM   5805  C CB  . TRP B 1 257 ? 14.027  98.901  156.266 1.00 52.13 ? 257 TRP A CB  1 
ATOM   5806  C CG  . TRP B 1 257 ? 13.988  99.273  157.727 1.00 51.83 ? 257 TRP A CG  1 
ATOM   5807  C CD1 . TRP B 1 257 ? 14.879  100.065 158.396 1.00 51.65 ? 257 TRP A CD1 1 
ATOM   5808  C CD2 . TRP B 1 257 ? 13.024  98.849  158.697 1.00 51.40 ? 257 TRP A CD2 1 
ATOM   5809  N NE1 . TRP B 1 257 ? 14.526  100.166 159.719 1.00 51.47 ? 257 TRP A NE1 1 
ATOM   5810  C CE2 . TRP B 1 257 ? 13.391  99.427  159.932 1.00 51.92 ? 257 TRP A CE2 1 
ATOM   5811  C CE3 . TRP B 1 257 ? 11.887  98.032  158.645 1.00 51.08 ? 257 TRP A CE3 1 
ATOM   5812  C CZ2 . TRP B 1 257 ? 12.652  99.223  161.107 1.00 52.06 ? 257 TRP A CZ2 1 
ATOM   5813  C CZ3 . TRP B 1 257 ? 11.156  97.825  159.814 1.00 51.44 ? 257 TRP A CZ3 1 
ATOM   5814  C CH2 . TRP B 1 257 ? 11.542  98.419  161.027 1.00 51.47 ? 257 TRP A CH2 1 
ATOM   5815  N N   . LEU B 1 258 ? 11.157  98.499  154.959 1.00 53.02 ? 258 LEU A N   1 
ATOM   5816  C CA  . LEU B 1 258 ? 9.743   98.187  155.074 1.00 53.28 ? 258 LEU A CA  1 
ATOM   5817  C C   . LEU B 1 258 ? 9.542   96.704  155.323 1.00 53.64 ? 258 LEU A C   1 
ATOM   5818  O O   . LEU B 1 258 ? 10.163  95.863  154.663 1.00 53.96 ? 258 LEU A O   1 
ATOM   5819  C CB  . LEU B 1 258 ? 8.992   98.612  153.809 1.00 53.15 ? 258 LEU A CB  1 
ATOM   5820  C CG  . LEU B 1 258 ? 7.500   98.270  153.751 1.00 53.01 ? 258 LEU A CG  1 
ATOM   5821  C CD1 . LEU B 1 258 ? 6.690   99.143  154.694 1.00 52.99 ? 258 LEU A CD1 1 
ATOM   5822  C CD2 . LEU B 1 258 ? 6.975   98.403  152.347 1.00 53.34 ? 258 LEU A CD2 1 
ATOM   5823  N N   . VAL B 1 259 ? 8.676   96.395  156.285 1.00 53.75 ? 259 VAL A N   1 
ATOM   5824  C CA  . VAL B 1 259 ? 8.311   95.020  156.604 1.00 53.76 ? 259 VAL A CA  1 
ATOM   5825  C C   . VAL B 1 259 ? 6.800   94.865  156.484 1.00 54.05 ? 259 VAL A C   1 
ATOM   5826  O O   . VAL B 1 259 ? 6.032   95.348  157.332 1.00 54.24 ? 259 VAL A O   1 
ATOM   5827  C CB  . VAL B 1 259 ? 8.769   94.597  158.032 1.00 53.81 ? 259 VAL A CB  1 
ATOM   5828  C CG1 . VAL B 1 259 ? 8.187   93.232  158.413 1.00 53.63 ? 259 VAL A CG1 1 
ATOM   5829  C CG2 . VAL B 1 259 ? 10.285  94.578  158.138 1.00 53.47 ? 259 VAL A CG2 1 
ATOM   5830  N N   . CYS B 1 260 ? 6.392   94.241  155.386 1.00 54.03 ? 260 CYS A N   1 
ATOM   5831  C CA  . CYS B 1 260 ? 5.088   93.609  155.256 1.00 54.04 ? 260 CYS A CA  1 
ATOM   5832  C C   . CYS B 1 260 ? 5.402   92.169  154.876 1.00 54.02 ? 260 CYS A C   1 
ATOM   5833  O O   . CYS B 1 260 ? 6.510   91.886  154.405 1.00 54.70 ? 260 CYS A O   1 
ATOM   5834  C CB  . CYS B 1 260 ? 4.241   94.297  154.193 1.00 54.12 ? 260 CYS A CB  1 
ATOM   5835  S SG  . CYS B 1 260 ? 5.143   94.953  152.778 1.00 54.54 ? 260 CYS A SG  1 
ATOM   5836  N N   . ALA B 1 261 ? 4.463   91.256  155.084 1.00 53.46 ? 261 ALA A N   1 
ATOM   5837  C CA  . ALA B 1 261 ? 4.788   89.839  154.995 1.00 53.06 ? 261 ALA A CA  1 
ATOM   5838  C C   . ALA B 1 261 ? 4.795   89.310  153.562 1.00 52.92 ? 261 ALA A C   1 
ATOM   5839  O O   . ALA B 1 261 ? 4.024   88.409  153.215 1.00 53.14 ? 261 ALA A O   1 
ATOM   5840  C CB  . ALA B 1 261 ? 3.850   89.024  155.877 1.00 53.20 ? 261 ALA A CB  1 
ATOM   5841  N N   . ILE B 1 262 ? 5.661   89.878  152.731 1.00 52.61 ? 262 ILE A N   1 
ATOM   5842  C CA  . ILE B 1 262 ? 5.883   89.361  151.384 1.00 52.61 ? 262 ILE A CA  1 
ATOM   5843  C C   . ILE B 1 262 ? 6.604   88.015  151.521 1.00 53.02 ? 262 ILE A C   1 
ATOM   5844  O O   . ILE B 1 262 ? 7.520   87.872  152.342 1.00 52.97 ? 262 ILE A O   1 
ATOM   5845  C CB  . ILE B 1 262 ? 6.660   90.372  150.487 1.00 52.51 ? 262 ILE A CB  1 
ATOM   5846  C CG1 . ILE B 1 262 ? 5.865   91.679  150.351 1.00 51.82 ? 262 ILE A CG1 1 
ATOM   5847  C CG2 . ILE B 1 262 ? 6.942   89.776  149.110 1.00 52.05 ? 262 ILE A CG2 1 
ATOM   5848  C CD1 . ILE B 1 262 ? 6.637   92.834  149.771 1.00 50.14 ? 262 ILE A CD1 1 
ATOM   5849  N N   . LYS B 1 263 ? 6.163   87.032  150.738 1.00 53.40 ? 263 LYS A N   1 
ATOM   5850  C CA  . LYS B 1 263 ? 6.568   85.633  150.923 1.00 53.86 ? 263 LYS A CA  1 
ATOM   5851  C C   . LYS B 1 263 ? 8.037   85.377  150.595 1.00 53.91 ? 263 LYS A C   1 
ATOM   5852  O O   . LYS B 1 263 ? 8.737   84.689  151.342 1.00 53.87 ? 263 LYS A O   1 
ATOM   5853  C CB  . LYS B 1 263 ? 5.649   84.692  150.134 1.00 53.94 ? 263 LYS A CB  1 
ATOM   5854  C CG  . LYS B 1 263 ? 4.191   84.736  150.627 1.00 54.80 ? 263 LYS A CG  1 
ATOM   5855  C CD  . LYS B 1 263 ? 3.372   83.580  150.045 1.00 55.91 ? 263 LYS A CD  1 
ATOM   5856  C CE  . LYS B 1 263 ? 2.620   84.007  148.774 1.00 56.21 ? 263 LYS A CE  1 
ATOM   5857  N NZ  . LYS B 1 263 ? 1.575   82.987  148.420 1.00 57.31 ? 263 LYS A NZ  1 
ATOM   5858  N N   . ASP B 1 264 ? 8.494   85.929  149.479 1.00 54.06 ? 264 ASP A N   1 
ATOM   5859  C CA  . ASP B 1 264 ? 9.902   85.872  149.118 1.00 54.38 ? 264 ASP A CA  1 
ATOM   5860  C C   . ASP B 1 264 ? 10.335  87.185  148.474 1.00 54.69 ? 264 ASP A C   1 
ATOM   5861  O O   . ASP B 1 264 ? 9.496   88.023  148.136 1.00 54.86 ? 264 ASP A O   1 
ATOM   5862  C CB  . ASP B 1 264 ? 10.190  84.679  148.203 1.00 54.33 ? 264 ASP A CB  1 
ATOM   5863  C CG  . ASP B 1 264 ? 9.227   84.583  147.039 1.00 54.24 ? 264 ASP A CG  1 
ATOM   5864  O OD1 . ASP B 1 264 ? 8.918   85.620  146.415 1.00 54.29 ? 264 ASP A OD1 1 
ATOM   5865  O OD2 . ASP B 1 264 ? 8.788   83.456  146.741 1.00 54.11 ? 264 ASP A OD2 1 
ATOM   5866  N N   . ILE B 1 265 ? 11.644  87.357  148.310 1.00 54.85 ? 265 ILE A N   1 
ATOM   5867  C CA  . ILE B 1 265 ? 12.199  88.575  147.733 1.00 54.85 ? 265 ILE A CA  1 
ATOM   5868  C C   . ILE B 1 265 ? 11.773  88.811  146.283 1.00 55.09 ? 265 ILE A C   1 
ATOM   5869  O O   . ILE B 1 265 ? 11.776  89.954  145.815 1.00 55.32 ? 265 ILE A O   1 
ATOM   5870  C CB  . ILE B 1 265 ? 13.724  88.608  147.846 1.00 54.86 ? 265 ILE A CB  1 
ATOM   5871  C CG1 . ILE B 1 265 ? 14.335  87.355  147.214 1.00 54.51 ? 265 ILE A CG1 1 
ATOM   5872  C CG2 . ILE B 1 265 ? 14.129  88.754  149.310 1.00 55.11 ? 265 ILE A CG2 1 
ATOM   5873  C CD1 . ILE B 1 265 ? 15.823  87.423  147.065 1.00 53.66 ? 265 ILE A CD1 1 
ATOM   5874  N N   . HIS B 1 266 ? 11.400  87.739  145.582 1.00 55.10 ? 266 HIS A N   1 
ATOM   5875  C CA  . HIS B 1 266 ? 10.820  87.848  144.241 1.00 55.19 ? 266 HIS A CA  1 
ATOM   5876  C C   . HIS B 1 266 ? 9.513   88.641  144.262 1.00 55.10 ? 266 HIS A C   1 
ATOM   5877  O O   . HIS B 1 266 ? 9.126   89.237  143.259 1.00 55.28 ? 266 HIS A O   1 
ATOM   5878  C CB  . HIS B 1 266 ? 10.566  86.466  143.645 1.00 55.34 ? 266 HIS A CB  1 
ATOM   5879  C CG  . HIS B 1 266 ? 11.810  85.666  143.413 1.00 56.43 ? 266 HIS A CG  1 
ATOM   5880  N ND1 . HIS B 1 266 ? 12.487  85.673  142.212 1.00 57.37 ? 266 HIS A ND1 1 
ATOM   5881  C CD2 . HIS B 1 266 ? 12.494  84.825  144.225 1.00 57.16 ? 266 HIS A CD2 1 
ATOM   5882  C CE1 . HIS B 1 266 ? 13.535  84.873  142.294 1.00 57.56 ? 266 HIS A CE1 1 
ATOM   5883  N NE2 . HIS B 1 266 ? 13.563  84.347  143.505 1.00 57.51 ? 266 HIS A NE2 1 
ATOM   5884  N N   . GLY B 1 267 ? 8.836   88.636  145.410 1.00 54.97 ? 267 GLY A N   1 
ATOM   5885  C CA  . GLY B 1 267 ? 7.598   89.389  145.600 1.00 54.69 ? 267 GLY A CA  1 
ATOM   5886  C C   . GLY B 1 267 ? 7.803   90.888  145.728 1.00 54.56 ? 267 GLY A C   1 
ATOM   5887  O O   . GLY B 1 267 ? 6.859   91.659  145.595 1.00 54.70 ? 267 GLY A O   1 
ATOM   5888  N N   . ALA B 1 268 ? 9.035   91.299  146.015 1.00 54.46 ? 268 ALA A N   1 
ATOM   5889  C CA  . ALA B 1 268 ? 9.422   92.707  145.985 1.00 54.33 ? 268 ALA A CA  1 
ATOM   5890  C C   . ALA B 1 268 ? 10.683  92.848  145.129 1.00 54.26 ? 268 ALA A C   1 
ATOM   5891  O O   . ALA B 1 268 ? 11.792  92.951  145.666 1.00 54.06 ? 268 ALA A O   1 
ATOM   5892  C CB  . ALA B 1 268 ? 9.655   93.238  147.394 1.00 54.38 ? 268 ALA A CB  1 
ATOM   5893  N N   . PRO B 1 269 ? 10.515  92.821  143.787 1.00 54.15 ? 269 PRO A N   1 
ATOM   5894  C CA  . PRO B 1 269 ? 11.631  92.874  142.846 1.00 54.02 ? 269 PRO A CA  1 
ATOM   5895  C C   . PRO B 1 269 ? 12.386  94.182  142.968 1.00 54.16 ? 269 PRO A C   1 
ATOM   5896  O O   . PRO B 1 269 ? 11.782  95.227  143.239 1.00 54.51 ? 269 PRO A O   1 
ATOM   5897  C CB  . PRO B 1 269 ? 10.938  92.812  141.483 1.00 53.86 ? 269 PRO A CB  1 
ATOM   5898  C CG  . PRO B 1 269 ? 9.626   92.207  141.751 1.00 53.80 ? 269 PRO A CG  1 
ATOM   5899  C CD  . PRO B 1 269 ? 9.228   92.735  143.078 1.00 53.97 ? 269 PRO A CD  1 
ATOM   5900  N N   . VAL B 1 270 ? 13.700  94.131  142.790 1.00 54.10 ? 270 VAL A N   1 
ATOM   5901  C CA  . VAL B 1 270 ? 14.488  95.355  142.804 1.00 54.09 ? 270 VAL A CA  1 
ATOM   5902  C C   . VAL B 1 270 ? 14.139  96.186  141.566 1.00 54.11 ? 270 VAL A C   1 
ATOM   5903  O O   . VAL B 1 270 ? 14.094  95.668  140.449 1.00 53.90 ? 270 VAL A O   1 
ATOM   5904  C CB  . VAL B 1 270 ? 16.011  95.085  142.995 1.00 53.98 ? 270 VAL A CB  1 
ATOM   5905  C CG1 . VAL B 1 270 ? 16.394  93.683  142.499 1.00 54.71 ? 270 VAL A CG1 1 
ATOM   5906  C CG2 . VAL B 1 270 ? 16.876  96.186  142.355 1.00 53.86 ? 270 VAL A CG2 1 
ATOM   5907  N N   . GLY B 1 271 ? 13.833  97.462  141.795 1.00 54.39 ? 271 GLY A N   1 
ATOM   5908  C CA  . GLY B 1 271 ? 13.456  98.385  140.727 1.00 54.52 ? 271 GLY A CA  1 
ATOM   5909  C C   . GLY B 1 271 ? 11.956  98.575  140.619 1.00 54.74 ? 271 GLY A C   1 
ATOM   5910  O O   . GLY B 1 271 ? 11.481  99.466  139.915 1.00 54.97 ? 271 GLY A O   1 
ATOM   5911  N N   . ASP B 1 272 ? 11.205  97.728  141.316 1.00 54.76 ? 272 ASP A N   1 
ATOM   5912  C CA  . ASP B 1 272 ? 9.750   97.808  141.315 1.00 54.72 ? 272 ASP A CA  1 
ATOM   5913  C C   . ASP B 1 272 ? 9.320   99.077  142.029 1.00 54.47 ? 272 ASP A C   1 
ATOM   5914  O O   . ASP B 1 272 ? 10.150  99.769  142.619 1.00 54.45 ? 272 ASP A O   1 
ATOM   5915  C CB  . ASP B 1 272 ? 9.153   96.583  142.015 1.00 54.81 ? 272 ASP A CB  1 
ATOM   5916  C CG  . ASP B 1 272 ? 7.782   96.218  141.489 1.00 55.10 ? 272 ASP A CG  1 
ATOM   5917  O OD1 . ASP B 1 272 ? 7.098   97.081  140.893 1.00 55.36 ? 272 ASP A OD1 1 
ATOM   5918  O OD2 . ASP B 1 272 ? 7.391   95.050  141.666 1.00 55.86 ? 272 ASP A OD2 1 
ATOM   5919  N N   . THR B 1 273 ? 8.030   99.392  141.979 1.00 54.15 ? 273 THR A N   1 
ATOM   5920  C CA  . THR B 1 273 ? 7.543   100.555 142.703 1.00 53.93 ? 273 THR A CA  1 
ATOM   5921  C C   . THR B 1 273 ? 6.354   100.220 143.594 1.00 53.83 ? 273 THR A C   1 
ATOM   5922  O O   . THR B 1 273 ? 5.402   99.570  143.161 1.00 53.88 ? 273 THR A O   1 
ATOM   5923  C CB  . THR B 1 273 ? 7.232   101.758 141.767 1.00 53.85 ? 273 THR A CB  1 
ATOM   5924  O OG1 . THR B 1 273 ? 5.818   101.907 141.598 1.00 54.20 ? 273 THR A OG1 1 
ATOM   5925  C CG2 . THR B 1 273 ? 7.907   101.585 140.414 1.00 53.83 ? 273 THR A CG2 1 
ATOM   5926  N N   . LEU B 1 274 ? 6.432   100.654 144.848 1.00 53.65 ? 274 LEU A N   1 
ATOM   5927  C CA  . LEU B 1 274 ? 5.328   100.506 145.780 1.00 53.48 ? 274 LEU A CA  1 
ATOM   5928  C C   . LEU B 1 274 ? 4.399   101.697 145.716 1.00 53.44 ? 274 LEU A C   1 
ATOM   5929  O O   . LEU B 1 274 ? 4.843   102.849 145.656 1.00 53.26 ? 274 LEU A O   1 
ATOM   5930  C CB  . LEU B 1 274 ? 5.836   100.345 147.207 1.00 53.40 ? 274 LEU A CB  1 
ATOM   5931  C CG  . LEU B 1 274 ? 6.594   99.056  147.486 1.00 53.54 ? 274 LEU A CG  1 
ATOM   5932  C CD1 . LEU B 1 274 ? 7.137   99.076  148.885 1.00 53.45 ? 274 LEU A CD1 1 
ATOM   5933  C CD2 . LEU B 1 274 ? 5.689   97.859  147.286 1.00 53.89 ? 274 LEU A CD2 1 
ATOM   5934  N N   . THR B 1 275 ? 3.104   101.401 145.740 1.00 53.44 ? 275 THR A N   1 
ATOM   5935  C CA  . THR B 1 275 ? 2.070   102.424 145.830 1.00 53.46 ? 275 THR A CA  1 
ATOM   5936  C C   . THR B 1 275 ? 1.048   102.036 146.906 1.00 53.49 ? 275 THR A C   1 
ATOM   5937  O O   . THR B 1 275 ? 1.197   100.999 147.555 1.00 53.48 ? 275 THR A O   1 
ATOM   5938  C CB  . THR B 1 275 ? 1.413   102.685 144.445 1.00 53.43 ? 275 THR A CB  1 
ATOM   5939  O OG1 . THR B 1 275 ? 0.634   103.883 144.503 1.00 53.47 ? 275 THR A OG1 1 
ATOM   5940  C CG2 . THR B 1 275 ? 0.536   101.514 143.993 1.00 53.44 ? 275 THR A CG2 1 
ATOM   5941  N N   . LEU B 1 276 ? 0.032   102.871 147.105 1.00 53.62 ? 276 LEU A N   1 
ATOM   5942  C CA  . LEU B 1 276 ? -1.027  102.577 148.067 1.00 53.74 ? 276 LEU A CA  1 
ATOM   5943  C C   . LEU B 1 276 ? -2.217  101.963 147.365 1.00 53.82 ? 276 LEU A C   1 
ATOM   5944  O O   . LEU B 1 276 ? -2.483  102.292 146.214 1.00 53.86 ? 276 LEU A O   1 
ATOM   5945  C CB  . LEU B 1 276 ? -1.450  103.841 148.813 1.00 53.70 ? 276 LEU A CB  1 
ATOM   5946  C CG  . LEU B 1 276 ? -0.438  104.354 149.837 1.00 54.02 ? 276 LEU A CG  1 
ATOM   5947  C CD1 . LEU B 1 276 ? -0.959  105.589 150.552 1.00 54.15 ? 276 LEU A CD1 1 
ATOM   5948  C CD2 . LEU B 1 276 ? -0.083  103.262 150.835 1.00 54.50 ? 276 LEU A CD2 1 
ATOM   5949  N N   . ALA B 1 277 ? -2.934  101.083 148.062 1.00 54.03 ? 277 ALA A N   1 
ATOM   5950  C CA  . ALA B 1 277 ? -4.061  100.360 147.467 1.00 54.32 ? 277 ALA A CA  1 
ATOM   5951  C C   . ALA B 1 277 ? -5.328  101.198 147.272 1.00 54.58 ? 277 ALA A C   1 
ATOM   5952  O O   . ALA B 1 277 ? -6.056  100.984 146.309 1.00 54.35 ? 277 ALA A O   1 
ATOM   5953  C CB  . ALA B 1 277 ? -4.371  99.103  148.255 1.00 54.25 ? 277 ALA A CB  1 
ATOM   5954  N N   . ARG B 1 278 ? -5.590  102.139 148.176 1.00 55.24 ? 278 ARG A N   1 
ATOM   5955  C CA  . ARG B 1 278 ? -6.795  102.968 148.079 1.00 56.05 ? 278 ARG A CA  1 
ATOM   5956  C C   . ARG B 1 278 ? -6.660  104.034 146.991 1.00 56.16 ? 278 ARG A C   1 
ATOM   5957  O O   . ARG B 1 278 ? -7.627  104.344 146.292 1.00 56.32 ? 278 ARG A O   1 
ATOM   5958  C CB  . ARG B 1 278 ? -7.168  103.591 149.434 1.00 56.34 ? 278 ARG A CB  1 
ATOM   5959  C CG  . ARG B 1 278 ? -6.466  104.905 149.765 1.00 57.90 ? 278 ARG A CG  1 
ATOM   5960  C CD  . ARG B 1 278 ? -6.103  104.980 151.240 1.00 60.75 ? 278 ARG A CD  1 
ATOM   5961  N NE  . ARG B 1 278 ? -5.045  105.960 151.495 1.00 62.05 ? 278 ARG A NE  1 
ATOM   5962  C CZ  . ARG B 1 278 ? -4.142  105.869 152.471 1.00 62.62 ? 278 ARG A CZ  1 
ATOM   5963  N NH1 . ARG B 1 278 ? -4.134  104.830 153.305 1.00 62.62 ? 278 ARG A NH1 1 
ATOM   5964  N NH2 . ARG B 1 278 ? -3.232  106.826 152.609 1.00 63.36 ? 278 ARG A NH2 1 
ATOM   5965  N N   . ASN B 1 279 ? -5.459  104.585 146.852 1.00 56.29 ? 279 ASN A N   1 
ATOM   5966  C CA  . ASN B 1 279 ? -5.175  105.538 145.791 1.00 56.40 ? 279 ASN A CA  1 
ATOM   5967  C C   . ASN B 1 279 ? -3.905  105.142 145.044 1.00 56.30 ? 279 ASN A C   1 
ATOM   5968  O O   . ASN B 1 279 ? -2.820  105.666 145.320 1.00 56.56 ? 279 ASN A O   1 
ATOM   5969  C CB  . ASN B 1 279 ? -5.074  106.961 146.342 1.00 56.53 ? 279 ASN A CB  1 
ATOM   5970  C CG  . ASN B 1 279 ? -4.766  107.979 145.263 1.00 57.16 ? 279 ASN A CG  1 
ATOM   5971  O OD1 . ASN B 1 279 ? -5.287  107.896 144.148 1.00 58.29 ? 279 ASN A OD1 1 
ATOM   5972  N ND2 . ASN B 1 279 ? -3.907  108.942 145.583 1.00 57.44 ? 279 ASN A ND2 1 
ATOM   5973  N N   . PRO B 1 280 ? -4.034  104.202 144.098 1.00 56.15 ? 280 PRO A N   1 
ATOM   5974  C CA  . PRO B 1 280 ? -2.849  103.719 143.406 1.00 55.96 ? 280 PRO A CA  1 
ATOM   5975  C C   . PRO B 1 280 ? -2.381  104.661 142.307 1.00 55.72 ? 280 PRO A C   1 
ATOM   5976  O O   . PRO B 1 280 ? -3.196  105.230 141.578 1.00 55.66 ? 280 PRO A O   1 
ATOM   5977  C CB  . PRO B 1 280 ? -3.287  102.362 142.836 1.00 55.96 ? 280 PRO A CB  1 
ATOM   5978  C CG  . PRO B 1 280 ? -4.769  102.368 142.839 1.00 56.09 ? 280 PRO A CG  1 
ATOM   5979  C CD  . PRO B 1 280 ? -5.268  103.549 143.624 1.00 56.26 ? 280 PRO A CD  1 
ATOM   5980  N N   . ALA B 1 281 ? -1.062  104.821 142.222 1.00 55.60 ? 281 ALA A N   1 
ATOM   5981  C CA  . ALA B 1 281 ? -0.403  105.598 141.177 1.00 55.51 ? 281 ALA A CA  1 
ATOM   5982  C C   . ALA B 1 281 ? -0.766  105.072 139.793 1.00 55.44 ? 281 ALA A C   1 
ATOM   5983  O O   . ALA B 1 281 ? -0.893  103.864 139.591 1.00 55.58 ? 281 ALA A O   1 
ATOM   5984  C CB  . ALA B 1 281 ? 1.107   105.559 141.377 1.00 55.41 ? 281 ALA A CB  1 
ATOM   5985  N N   . GLU B 1 282 ? -0.930  105.986 138.843 1.00 55.31 ? 282 GLU A N   1 
ATOM   5986  C CA  . GLU B 1 282 ? -1.320  105.621 137.484 1.00 55.31 ? 282 GLU A CA  1 
ATOM   5987  C C   . GLU B 1 282 ? -0.229  104.808 136.778 1.00 55.11 ? 282 GLU A C   1 
ATOM   5988  O O   . GLU B 1 282 ? -0.519  103.908 135.980 1.00 55.03 ? 282 GLU A O   1 
ATOM   5989  C CB  . GLU B 1 282 ? -1.653  106.884 136.682 1.00 55.34 ? 282 GLU A CB  1 
ATOM   5990  C CG  . GLU B 1 282 ? -2.493  106.648 135.435 1.00 55.83 ? 282 GLU A CG  1 
ATOM   5991  C CD  . GLU B 1 282 ? -3.317  107.867 135.045 1.00 56.81 ? 282 GLU A CD  1 
ATOM   5992  O OE1 . GLU B 1 282 ? -4.379  107.687 134.410 1.00 56.67 ? 282 GLU A OE1 1 
ATOM   5993  O OE2 . GLU B 1 282 ? -2.914  109.005 135.383 1.00 57.31 ? 282 GLU A OE2 1 
ATOM   5994  N N   . LYS B 1 283 ? 1.022   105.119 137.099 1.00 54.78 ? 283 LYS A N   1 
ATOM   5995  C CA  . LYS B 1 283 ? 2.155   104.613 136.350 1.00 54.59 ? 283 LYS A CA  1 
ATOM   5996  C C   . LYS B 1 283 ? 3.274   104.294 137.310 1.00 54.22 ? 283 LYS A C   1 
ATOM   5997  O O   . LYS B 1 283 ? 3.538   105.063 138.230 1.00 54.39 ? 283 LYS A O   1 
ATOM   5998  C CB  . LYS B 1 283 ? 2.619   105.688 135.369 1.00 54.79 ? 283 LYS A CB  1 
ATOM   5999  C CG  . LYS B 1 283 ? 3.183   105.177 134.064 1.00 55.45 ? 283 LYS A CG  1 
ATOM   6000  C CD  . LYS B 1 283 ? 3.258   106.314 133.049 1.00 56.39 ? 283 LYS A CD  1 
ATOM   6001  C CE  . LYS B 1 283 ? 3.673   105.812 131.675 1.00 56.82 ? 283 LYS A CE  1 
ATOM   6002  N NZ  . LYS B 1 283 ? 3.784   106.938 130.713 1.00 57.33 ? 283 LYS A NZ  1 
ATOM   6003  N N   . ALA B 1 284 ? 3.928   103.157 137.102 1.00 53.82 ? 284 ALA A N   1 
ATOM   6004  C CA  . ALA B 1 284 ? 5.090   102.779 137.900 1.00 53.29 ? 284 ALA A CA  1 
ATOM   6005  C C   . ALA B 1 284 ? 6.311   103.605 137.495 1.00 53.09 ? 284 ALA A C   1 
ATOM   6006  O O   . ALA B 1 284 ? 6.412   104.053 136.351 1.00 53.14 ? 284 ALA A O   1 
ATOM   6007  C CB  . ALA B 1 284 ? 5.372   101.302 137.737 1.00 53.18 ? 284 ALA A CB  1 
ATOM   6008  N N   . LEU B 1 285 ? 7.230   103.807 138.436 1.00 52.92 ? 285 LEU A N   1 
ATOM   6009  C CA  . LEU B 1 285 ? 8.502   104.488 138.161 1.00 52.73 ? 285 LEU A CA  1 
ATOM   6010  C C   . LEU B 1 285 ? 9.272   103.785 137.039 1.00 52.48 ? 285 LEU A C   1 
ATOM   6011  O O   . LEU B 1 285 ? 9.346   102.549 137.011 1.00 52.32 ? 285 LEU A O   1 
ATOM   6012  C CB  . LEU B 1 285 ? 9.366   104.580 139.429 1.00 52.75 ? 285 LEU A CB  1 
ATOM   6013  C CG  . LEU B 1 285 ? 8.746   105.189 140.694 1.00 52.79 ? 285 LEU A CG  1 
ATOM   6014  C CD1 . LEU B 1 285 ? 9.617   104.898 141.896 1.00 53.24 ? 285 LEU A CD1 1 
ATOM   6015  C CD2 . LEU B 1 285 ? 8.499   106.687 140.555 1.00 53.08 ? 285 LEU A CD2 1 
ATOM   6016  N N   . PRO B 1 286 ? 9.853   104.572 136.117 1.00 52.36 ? 286 PRO A N   1 
ATOM   6017  C CA  . PRO B 1 286 ? 10.440  104.009 134.902 1.00 52.43 ? 286 PRO A CA  1 
ATOM   6018  C C   . PRO B 1 286 ? 11.715  103.207 135.166 1.00 52.48 ? 286 PRO A C   1 
ATOM   6019  O O   . PRO B 1 286 ? 12.326  103.345 136.233 1.00 52.59 ? 286 PRO A O   1 
ATOM   6020  C CB  . PRO B 1 286 ? 10.762  105.253 134.066 1.00 52.29 ? 286 PRO A CB  1 
ATOM   6021  C CG  . PRO B 1 286 ? 10.983  106.326 135.064 1.00 51.97 ? 286 PRO A CG  1 
ATOM   6022  C CD  . PRO B 1 286 ? 10.013  106.039 136.171 1.00 52.33 ? 286 PRO A CD  1 
ATOM   6023  N N   . GLY B 1 287 ? 12.103  102.382 134.195 1.00 52.37 ? 287 GLY A N   1 
ATOM   6024  C CA  . GLY B 1 287 ? 13.378  101.678 134.239 1.00 52.37 ? 287 GLY A CA  1 
ATOM   6025  C C   . GLY B 1 287 ? 13.323  100.352 134.963 1.00 52.45 ? 287 GLY A C   1 
ATOM   6026  O O   . GLY B 1 287 ? 14.360  99.776  135.298 1.00 52.21 ? 287 GLY A O   1 
ATOM   6027  N N   . PHE B 1 288 ? 12.112  99.866  135.211 1.00 52.77 ? 288 PHE A N   1 
ATOM   6028  C CA  . PHE B 1 288 ? 11.958  98.557  135.815 1.00 53.22 ? 288 PHE A CA  1 
ATOM   6029  C C   . PHE B 1 288 ? 12.052  97.440  134.783 1.00 53.71 ? 288 PHE A C   1 
ATOM   6030  O O   . PHE B 1 288 ? 11.445  97.508  133.712 1.00 53.72 ? 288 PHE A O   1 
ATOM   6031  C CB  . PHE B 1 288 ? 10.639  98.422  136.583 1.00 53.04 ? 288 PHE A CB  1 
ATOM   6032  C CG  . PHE B 1 288 ? 10.388  97.025  137.067 1.00 52.99 ? 288 PHE A CG  1 
ATOM   6033  C CD1 . PHE B 1 288 ? 9.530   96.177  136.374 1.00 52.92 ? 288 PHE A CD1 1 
ATOM   6034  C CD2 . PHE B 1 288 ? 11.072  96.529  138.171 1.00 52.71 ? 288 PHE A CD2 1 
ATOM   6035  C CE1 . PHE B 1 288 ? 9.329   94.865  136.798 1.00 52.89 ? 288 PHE A CE1 1 
ATOM   6036  C CE2 . PHE B 1 288 ? 10.874  95.224  138.609 1.00 53.01 ? 288 PHE A CE2 1 
ATOM   6037  C CZ  . PHE B 1 288 ? 10.005  94.388  137.920 1.00 52.90 ? 288 PHE A CZ  1 
ATOM   6038  N N   . LYS B 1 289 ? 12.815  96.409  135.128 1.00 54.35 ? 289 LYS A N   1 
ATOM   6039  C CA  . LYS B 1 289 ? 12.786  95.139  134.406 1.00 55.22 ? 289 LYS A CA  1 
ATOM   6040  C C   . LYS B 1 289 ? 13.185  94.009  135.352 1.00 55.64 ? 289 LYS A C   1 
ATOM   6041  O O   . LYS B 1 289 ? 13.899  94.244  136.333 1.00 55.73 ? 289 LYS A O   1 
ATOM   6042  C CB  . LYS B 1 289 ? 13.677  95.175  133.154 1.00 55.10 ? 289 LYS A CB  1 
ATOM   6043  C CG  . LYS B 1 289 ? 15.147  95.456  133.414 1.00 55.42 ? 289 LYS A CG  1 
ATOM   6044  C CD  . LYS B 1 289 ? 15.861  95.941  132.157 1.00 56.53 ? 289 LYS A CD  1 
ATOM   6045  C CE  . LYS B 1 289 ? 15.740  97.455  131.978 1.00 56.87 ? 289 LYS A CE  1 
ATOM   6046  N NZ  . LYS B 1 289 ? 16.742  97.970  131.000 1.00 56.99 ? 289 LYS A NZ  1 
ATOM   6047  N N   . LYS B 1 290 ? 12.695  92.801  135.082 1.00 56.10 ? 290 LYS A N   1 
ATOM   6048  C CA  . LYS B 1 290 ? 13.119  91.641  135.845 1.00 56.88 ? 290 LYS A CA  1 
ATOM   6049  C C   . LYS B 1 290 ? 14.178  90.944  135.027 1.00 57.16 ? 290 LYS A C   1 
ATOM   6050  O O   . LYS B 1 290 ? 13.867  90.249  134.062 1.00 57.51 ? 290 LYS A O   1 
ATOM   6051  C CB  . LYS B 1 290 ? 11.956  90.692  136.146 1.00 56.97 ? 290 LYS A CB  1 
ATOM   6052  C CG  . LYS B 1 290 ? 11.960  90.145  137.583 1.00 57.99 ? 290 LYS A CG  1 
ATOM   6053  C CD  . LYS B 1 290 ? 13.149  89.213  137.880 1.00 59.73 ? 290 LYS A CD  1 
ATOM   6054  C CE  . LYS B 1 290 ? 12.736  87.733  137.967 1.00 60.41 ? 290 LYS A CE  1 
ATOM   6055  N NZ  . LYS B 1 290 ? 12.465  87.092  136.648 1.00 60.42 ? 290 LYS A NZ  1 
ATOM   6056  N N   . VAL B 1 291 ? 15.432  91.148  135.410 1.00 57.55 ? 291 VAL A N   1 
ATOM   6057  C CA  . VAL B 1 291 ? 16.571  90.660  134.635 1.00 57.94 ? 291 VAL A CA  1 
ATOM   6058  C C   . VAL B 1 291 ? 16.621  89.133  134.609 1.00 58.06 ? 291 VAL A C   1 
ATOM   6059  O O   . VAL B 1 291 ? 16.477  88.469  135.639 1.00 58.05 ? 291 VAL A O   1 
ATOM   6060  C CB  . VAL B 1 291 ? 17.925  91.233  135.157 1.00 58.05 ? 291 VAL A CB  1 
ATOM   6061  C CG1 . VAL B 1 291 ? 19.050  90.967  134.160 1.00 58.13 ? 291 VAL A CG1 1 
ATOM   6062  C CG2 . VAL B 1 291 ? 17.809  92.727  135.438 1.00 57.95 ? 291 VAL A CG2 1 
ATOM   6063  N N   . LYS B 1 292 ? 16.801  88.595  133.410 1.00 58.23 ? 292 LYS A N   1 
ATOM   6064  C CA  . LYS B 1 292 ? 16.997  87.170  133.217 1.00 58.40 ? 292 LYS A CA  1 
ATOM   6065  C C   . LYS B 1 292 ? 18.495  86.907  133.132 1.00 58.28 ? 292 LYS A C   1 
ATOM   6066  O O   . LYS B 1 292 ? 19.237  87.737  132.597 1.00 58.43 ? 292 LYS A O   1 
ATOM   6067  C CB  . LYS B 1 292 ? 16.283  86.698  131.945 1.00 58.53 ? 292 LYS A CB  1 
ATOM   6068  C CG  . LYS B 1 292 ? 14.796  87.004  131.947 1.00 59.25 ? 292 LYS A CG  1 
ATOM   6069  C CD  . LYS B 1 292 ? 14.048  86.348  130.803 1.00 60.43 ? 292 LYS A CD  1 
ATOM   6070  C CE  . LYS B 1 292 ? 12.564  86.717  130.879 1.00 60.83 ? 292 LYS A CE  1 
ATOM   6071  N NZ  . LYS B 1 292 ? 11.717  85.869  129.999 1.00 61.39 ? 292 LYS A NZ  1 
ATOM   6072  N N   . PRO B 1 293 ? 18.953  85.765  133.678 1.00 58.11 ? 293 PRO A N   1 
ATOM   6073  C CA  . PRO B 1 293 ? 20.374  85.404  133.644 1.00 57.89 ? 293 PRO A CA  1 
ATOM   6074  C C   . PRO B 1 293 ? 21.003  85.519  132.255 1.00 57.69 ? 293 PRO A C   1 
ATOM   6075  O O   . PRO B 1 293 ? 20.359  85.214  131.250 1.00 57.79 ? 293 PRO A O   1 
ATOM   6076  C CB  . PRO B 1 293 ? 20.387  83.942  134.116 1.00 57.93 ? 293 PRO A CB  1 
ATOM   6077  C CG  . PRO B 1 293 ? 18.952  83.519  134.230 1.00 57.98 ? 293 PRO A CG  1 
ATOM   6078  C CD  . PRO B 1 293 ? 18.148  84.758  134.390 1.00 58.08 ? 293 PRO A CD  1 
ATOM   6079  N N   . GLN B 1 294 ? 22.251  85.971  132.221 1.00 57.44 ? 294 GLN A N   1 
ATOM   6080  C CA  . GLN B 1 294 ? 23.000  86.166  130.984 1.00 57.31 ? 294 GLN A CA  1 
ATOM   6081  C C   . GLN B 1 294 ? 23.855  84.939  130.662 1.00 56.94 ? 294 GLN A C   1 
ATOM   6082  O O   . GLN B 1 294 ? 24.118  84.632  129.491 1.00 57.00 ? 294 GLN A O   1 
ATOM   6083  C CB  . GLN B 1 294 ? 23.888  87.407  131.122 1.00 57.35 ? 294 GLN A CB  1 
ATOM   6084  C CG  . GLN B 1 294 ? 24.938  87.591  130.021 1.00 57.98 ? 294 GLN A CG  1 
ATOM   6085  C CD  . GLN B 1 294 ? 26.063  88.537  130.425 1.00 57.75 ? 294 GLN A CD  1 
ATOM   6086  O OE1 . GLN B 1 294 ? 25.836  89.724  130.667 1.00 57.90 ? 294 GLN A OE1 1 
ATOM   6087  N NE2 . GLN B 1 294 ? 27.287  88.011  130.490 1.00 57.96 ? 294 GLN A NE2 1 
ATOM   6088  N N   . VAL B 1 295 ? 24.283  84.249  131.715 1.00 56.40 ? 295 VAL A N   1 
ATOM   6089  C CA  . VAL B 1 295 ? 25.200  83.124  131.610 1.00 55.75 ? 295 VAL A CA  1 
ATOM   6090  C C   . VAL B 1 295 ? 24.611  81.918  132.331 1.00 55.41 ? 295 VAL A C   1 
ATOM   6091  O O   . VAL B 1 295 ? 24.264  82.004  133.506 1.00 55.46 ? 295 VAL A O   1 
ATOM   6092  C CB  . VAL B 1 295 ? 26.573  83.481  132.228 1.00 55.76 ? 295 VAL A CB  1 
ATOM   6093  C CG1 . VAL B 1 295 ? 27.463  82.260  132.333 1.00 55.53 ? 295 VAL A CG1 1 
ATOM   6094  C CG2 . VAL B 1 295 ? 27.254  84.574  131.418 1.00 55.82 ? 295 VAL A CG2 1 
ATOM   6095  N N   . TYR B 1 296 ? 24.495  80.799  131.620 1.00 54.97 ? 296 TYR A N   1 
ATOM   6096  C CA  . TYR B 1 296 ? 24.033  79.548  132.216 1.00 54.39 ? 296 TYR A CA  1 
ATOM   6097  C C   . TYR B 1 296 ? 25.170  78.538  132.263 1.00 54.09 ? 296 TYR A C   1 
ATOM   6098  O O   . TYR B 1 296 ? 26.057  78.555  131.408 1.00 54.07 ? 296 TYR A O   1 
ATOM   6099  C CB  . TYR B 1 296 ? 22.864  78.963  131.429 1.00 54.32 ? 296 TYR A CB  1 
ATOM   6100  C CG  . TYR B 1 296 ? 21.599  79.787  131.463 1.00 54.28 ? 296 TYR A CG  1 
ATOM   6101  C CD1 . TYR B 1 296 ? 20.526  79.412  132.263 1.00 54.21 ? 296 TYR A CD1 1 
ATOM   6102  C CD2 . TYR B 1 296 ? 21.466  80.931  130.677 1.00 54.34 ? 296 TYR A CD2 1 
ATOM   6103  C CE1 . TYR B 1 296 ? 19.349  80.159  132.286 1.00 54.62 ? 296 TYR A CE1 1 
ATOM   6104  C CE2 . TYR B 1 296 ? 20.303  81.686  130.694 1.00 54.49 ? 296 TYR A CE2 1 
ATOM   6105  C CZ  . TYR B 1 296 ? 19.245  81.297  131.499 1.00 54.66 ? 296 TYR A CZ  1 
ATOM   6106  O OH  . TYR B 1 296 ? 18.088  82.050  131.512 1.00 54.32 ? 296 TYR A OH  1 
ATOM   6107  N N   . ALA B 1 297 ? 25.139  77.670  133.271 1.00 53.67 ? 297 ALA A N   1 
ATOM   6108  C CA  . ALA B 1 297 ? 26.121  76.599  133.427 1.00 53.19 ? 297 ALA A CA  1 
ATOM   6109  C C   . ALA B 1 297 ? 25.489  75.417  134.151 1.00 52.93 ? 297 ALA A C   1 
ATOM   6110  O O   . ALA B 1 297 ? 24.481  75.571  134.840 1.00 52.82 ? 297 ALA A O   1 
ATOM   6111  C CB  . ALA B 1 297 ? 27.344  77.096  134.187 1.00 53.15 ? 297 ALA A CB  1 
ATOM   6112  N N   . GLY B 1 298 ? 26.085  74.241  133.981 1.00 52.66 ? 298 GLY A N   1 
ATOM   6113  C CA  . GLY B 1 298 ? 25.643  73.033  134.667 1.00 52.39 ? 298 GLY A CA  1 
ATOM   6114  C C   . GLY B 1 298 ? 26.576  72.695  135.812 1.00 52.24 ? 298 GLY A C   1 
ATOM   6115  O O   . GLY B 1 298 ? 27.800  72.667  135.647 1.00 52.17 ? 298 GLY A O   1 
ATOM   6116  N N   . LEU B 1 299 ? 25.991  72.452  136.979 1.00 52.05 ? 299 LEU A N   1 
ATOM   6117  C CA  . LEU B 1 299 ? 26.753  72.108  138.172 1.00 51.76 ? 299 LEU A CA  1 
ATOM   6118  C C   . LEU B 1 299 ? 26.356  70.731  138.675 1.00 51.67 ? 299 LEU A C   1 
ATOM   6119  O O   . LEU B 1 299 ? 25.172  70.428  138.824 1.00 51.67 ? 299 LEU A O   1 
ATOM   6120  C CB  . LEU B 1 299 ? 26.552  73.162  139.264 1.00 51.69 ? 299 LEU A CB  1 
ATOM   6121  C CG  . LEU B 1 299 ? 27.400  74.429  139.153 1.00 51.49 ? 299 LEU A CG  1 
ATOM   6122  C CD1 . LEU B 1 299 ? 26.839  75.534  140.019 1.00 50.96 ? 299 LEU A CD1 1 
ATOM   6123  C CD2 . LEU B 1 299 ? 28.843  74.135  139.544 1.00 52.78 ? 299 LEU A CD2 1 
ATOM   6124  N N   . PHE B 1 300 ? 27.358  69.897  138.924 1.00 51.51 ? 300 PHE A N   1 
ATOM   6125  C CA  . PHE B 1 300 ? 27.135  68.521  139.335 1.00 51.48 ? 300 PHE A CA  1 
ATOM   6126  C C   . PHE B 1 300 ? 28.086  68.157  140.467 1.00 51.57 ? 300 PHE A C   1 
ATOM   6127  O O   . PHE B 1 300 ? 29.274  68.463  140.387 1.00 51.77 ? 300 PHE A O   1 
ATOM   6128  C CB  . PHE B 1 300 ? 27.330  67.578  138.142 1.00 51.46 ? 300 PHE A CB  1 
ATOM   6129  C CG  . PHE B 1 300 ? 26.304  67.762  137.054 1.00 51.17 ? 300 PHE A CG  1 
ATOM   6130  C CD1 . PHE B 1 300 ? 26.522  68.665  136.018 1.00 51.25 ? 300 PHE A CD1 1 
ATOM   6131  C CD2 . PHE B 1 300 ? 25.118  67.040  137.073 1.00 50.45 ? 300 PHE A CD2 1 
ATOM   6132  C CE1 . PHE B 1 300 ? 25.571  68.845  135.022 1.00 51.27 ? 300 PHE A CE1 1 
ATOM   6133  C CE2 . PHE B 1 300 ? 24.168  67.211  136.087 1.00 50.76 ? 300 PHE A CE2 1 
ATOM   6134  C CZ  . PHE B 1 300 ? 24.392  68.115  135.056 1.00 51.28 ? 300 PHE A CZ  1 
ATOM   6135  N N   . PRO B 1 301 ? 27.565  67.516  141.533 1.00 51.41 ? 301 PRO A N   1 
ATOM   6136  C CA  . PRO B 1 301 ? 28.388  67.110  142.671 1.00 51.27 ? 301 PRO A CA  1 
ATOM   6137  C C   . PRO B 1 301 ? 29.316  65.960  142.302 1.00 51.21 ? 301 PRO A C   1 
ATOM   6138  O O   . PRO B 1 301 ? 28.878  65.004  141.662 1.00 51.44 ? 301 PRO A O   1 
ATOM   6139  C CB  . PRO B 1 301 ? 27.360  66.636  143.707 1.00 51.16 ? 301 PRO A CB  1 
ATOM   6140  C CG  . PRO B 1 301 ? 26.033  67.083  143.201 1.00 51.51 ? 301 PRO A CG  1 
ATOM   6141  C CD  . PRO B 1 301 ? 26.157  67.139  141.722 1.00 51.41 ? 301 PRO A CD  1 
ATOM   6142  N N   . VAL B 1 302 ? 30.584  66.062  142.702 1.00 51.00 ? 302 VAL A N   1 
ATOM   6143  C CA  . VAL B 1 302 ? 31.571  65.006  142.472 1.00 50.76 ? 302 VAL A CA  1 
ATOM   6144  C C   . VAL B 1 302 ? 31.065  63.697  143.062 1.00 50.73 ? 302 VAL A C   1 
ATOM   6145  O O   . VAL B 1 302 ? 31.170  62.646  142.433 1.00 50.73 ? 302 VAL A O   1 
ATOM   6146  C CB  . VAL B 1 302 ? 32.960  65.372  143.069 1.00 50.78 ? 302 VAL A CB  1 
ATOM   6147  C CG1 . VAL B 1 302 ? 33.931  64.208  142.965 1.00 50.28 ? 302 VAL A CG1 1 
ATOM   6148  C CG2 . VAL B 1 302 ? 33.536  66.595  142.373 1.00 50.72 ? 302 VAL A CG2 1 
ATOM   6149  N N   . SER B 1 303 ? 30.501  63.781  144.263 1.00 50.83 ? 303 SER A N   1 
ATOM   6150  C CA  . SER B 1 303 ? 29.927  62.631  144.947 1.00 50.97 ? 303 SER A CA  1 
ATOM   6151  C C   . SER B 1 303 ? 28.415  62.776  145.013 1.00 51.14 ? 303 SER A C   1 
ATOM   6152  O O   . SER B 1 303 ? 27.901  63.814  145.446 1.00 51.24 ? 303 SER A O   1 
ATOM   6153  C CB  . SER B 1 303 ? 30.510  62.505  146.355 1.00 50.95 ? 303 SER A CB  1 
ATOM   6154  O OG  . SER B 1 303 ? 29.841  61.507  147.104 1.00 51.08 ? 303 SER A OG  1 
ATOM   6155  N N   . SER B 1 304 ? 27.710  61.728  144.591 1.00 51.33 ? 304 SER A N   1 
ATOM   6156  C CA  . SER B 1 304 ? 26.245  61.739  144.534 1.00 51.38 ? 304 SER A CA  1 
ATOM   6157  C C   . SER B 1 304 ? 25.611  61.954  145.902 1.00 51.51 ? 304 SER A C   1 
ATOM   6158  O O   . SER B 1 304 ? 24.497  62.467  145.996 1.00 51.65 ? 304 SER A O   1 
ATOM   6159  C CB  . SER B 1 304 ? 25.726  60.439  143.942 1.00 51.21 ? 304 SER A CB  1 
ATOM   6160  O OG  . SER B 1 304 ? 25.692  59.436  144.940 1.00 51.59 ? 304 SER A OG  1 
ATOM   6161  N N   . ASP B 1 305 ? 26.325  61.551  146.952 1.00 51.71 ? 305 ASP A N   1 
ATOM   6162  C CA  . ASP B 1 305 ? 25.867  61.699  148.335 1.00 52.03 ? 305 ASP A CA  1 
ATOM   6163  C C   . ASP B 1 305 ? 25.622  63.151  148.731 1.00 52.18 ? 305 ASP A C   1 
ATOM   6164  O O   . ASP B 1 305 ? 24.846  63.420  149.650 1.00 52.18 ? 305 ASP A O   1 
ATOM   6165  C CB  . ASP B 1 305 ? 26.875  61.072  149.304 1.00 52.11 ? 305 ASP A CB  1 
ATOM   6166  C CG  . ASP B 1 305 ? 26.713  59.568  149.431 1.00 52.26 ? 305 ASP A CG  1 
ATOM   6167  O OD1 . ASP B 1 305 ? 25.574  59.076  149.289 1.00 52.62 ? 305 ASP A OD1 1 
ATOM   6168  O OD2 . ASP B 1 305 ? 27.725  58.879  149.686 1.00 52.47 ? 305 ASP A OD2 1 
ATOM   6169  N N   . ASP B 1 306 ? 26.281  64.073  148.027 1.00 52.31 ? 306 ASP A N   1 
ATOM   6170  C CA  . ASP B 1 306 ? 26.182  65.508  148.301 1.00 52.27 ? 306 ASP A CA  1 
ATOM   6171  C C   . ASP B 1 306 ? 24.963  66.188  147.672 1.00 52.26 ? 306 ASP A C   1 
ATOM   6172  O O   . ASP B 1 306 ? 24.738  67.375  147.893 1.00 52.41 ? 306 ASP A O   1 
ATOM   6173  C CB  . ASP B 1 306 ? 27.459  66.226  147.846 1.00 52.30 ? 306 ASP A CB  1 
ATOM   6174  C CG  . ASP B 1 306 ? 28.657  65.925  148.734 1.00 52.52 ? 306 ASP A CG  1 
ATOM   6175  O OD1 . ASP B 1 306 ? 28.478  65.674  149.945 1.00 52.91 ? 306 ASP A OD1 1 
ATOM   6176  O OD2 . ASP B 1 306 ? 29.791  65.958  148.217 1.00 52.63 ? 306 ASP A OD2 1 
ATOM   6177  N N   . TYR B 1 307 ? 24.179  65.450  146.892 1.00 52.34 ? 307 TYR A N   1 
ATOM   6178  C CA  . TYR B 1 307 ? 23.024  66.033  146.209 1.00 52.52 ? 307 TYR A CA  1 
ATOM   6179  C C   . TYR B 1 307 ? 22.062  66.745  147.171 1.00 52.86 ? 307 TYR A C   1 
ATOM   6180  O O   . TYR B 1 307 ? 21.685  67.894  146.929 1.00 52.93 ? 307 TYR A O   1 
ATOM   6181  C CB  . TYR B 1 307 ? 22.291  64.979  145.376 1.00 52.42 ? 307 TYR A CB  1 
ATOM   6182  C CG  . TYR B 1 307 ? 21.149  65.528  144.546 1.00 52.37 ? 307 TYR A CG  1 
ATOM   6183  C CD1 . TYR B 1 307 ? 21.378  66.081  143.285 1.00 52.25 ? 307 TYR A CD1 1 
ATOM   6184  C CD2 . TYR B 1 307 ? 19.836  65.488  145.020 1.00 51.99 ? 307 TYR A CD2 1 
ATOM   6185  C CE1 . TYR B 1 307 ? 20.325  66.591  142.523 1.00 52.35 ? 307 TYR A CE1 1 
ATOM   6186  C CE2 . TYR B 1 307 ? 18.783  65.992  144.269 1.00 52.01 ? 307 TYR A CE2 1 
ATOM   6187  C CZ  . TYR B 1 307 ? 19.031  66.540  143.024 1.00 52.24 ? 307 TYR A CZ  1 
ATOM   6188  O OH  . TYR B 1 307 ? 17.982  67.031  142.283 1.00 52.13 ? 307 TYR A OH  1 
ATOM   6189  N N   . GLU B 1 308 ? 21.688  66.066  148.258 1.00 53.14 ? 308 GLU A N   1 
ATOM   6190  C CA  . GLU B 1 308 ? 20.783  66.626  149.273 1.00 53.40 ? 308 GLU A CA  1 
ATOM   6191  C C   . GLU B 1 308 ? 21.271  67.986  149.782 1.00 53.40 ? 308 GLU A C   1 
ATOM   6192  O O   . GLU B 1 308 ? 20.501  68.942  149.843 1.00 53.62 ? 308 GLU A O   1 
ATOM   6193  C CB  . GLU B 1 308 ? 20.620  65.674  150.471 1.00 53.63 ? 308 GLU A CB  1 
ATOM   6194  C CG  . GLU B 1 308 ? 20.862  64.183  150.194 1.00 54.29 ? 308 GLU A CG  1 
ATOM   6195  C CD  . GLU B 1 308 ? 19.703  63.498  149.486 1.00 55.29 ? 308 GLU A CD  1 
ATOM   6196  O OE1 . GLU B 1 308 ? 18.571  64.040  149.486 1.00 55.89 ? 308 GLU A OE1 1 
ATOM   6197  O OE2 . GLU B 1 308 ? 19.931  62.402  148.932 1.00 55.29 ? 308 GLU A OE2 1 
ATOM   6198  N N   . ALA B 1 309 ? 22.550  68.060  150.149 1.00 53.36 ? 309 ALA A N   1 
ATOM   6199  C CA  . ALA B 1 309 ? 23.154  69.295  150.651 1.00 53.30 ? 309 ALA A CA  1 
ATOM   6200  C C   . ALA B 1 309 ? 23.197  70.381  149.575 1.00 53.37 ? 309 ALA A C   1 
ATOM   6201  O O   . ALA B 1 309 ? 22.933  71.558  149.855 1.00 53.28 ? 309 ALA A O   1 
ATOM   6202  C CB  . ALA B 1 309 ? 24.553  69.021  151.191 1.00 53.23 ? 309 ALA A CB  1 
ATOM   6203  N N   . PHE B 1 310 ? 23.521  69.970  148.349 1.00 53.32 ? 310 PHE A N   1 
ATOM   6204  C CA  . PHE B 1 310 ? 23.613  70.876  147.207 1.00 53.30 ? 310 PHE A CA  1 
ATOM   6205  C C   . PHE B 1 310 ? 22.263  71.531  146.908 1.00 53.29 ? 310 PHE A C   1 
ATOM   6206  O O   . PHE B 1 310 ? 22.180  72.754  146.798 1.00 53.39 ? 310 PHE A O   1 
ATOM   6207  C CB  . PHE B 1 310 ? 24.185  70.132  145.992 1.00 53.31 ? 310 PHE A CB  1 
ATOM   6208  C CG  . PHE B 1 310 ? 24.427  71.001  144.777 1.00 53.40 ? 310 PHE A CG  1 
ATOM   6209  C CD1 . PHE B 1 310 ? 24.652  72.372  144.895 1.00 53.12 ? 310 PHE A CD1 1 
ATOM   6210  C CD2 . PHE B 1 310 ? 24.465  70.426  143.505 1.00 53.17 ? 310 PHE A CD2 1 
ATOM   6211  C CE1 . PHE B 1 310 ? 24.876  73.160  143.763 1.00 53.05 ? 310 PHE A CE1 1 
ATOM   6212  C CE2 . PHE B 1 310 ? 24.694  71.205  142.372 1.00 53.00 ? 310 PHE A CE2 1 
ATOM   6213  C CZ  . PHE B 1 310 ? 24.900  72.574  142.502 1.00 53.09 ? 310 PHE A CZ  1 
ATOM   6214  N N   . ARG B 1 311 ? 21.213  70.716  146.811 1.00 53.25 ? 311 ARG A N   1 
ATOM   6215  C CA  . ARG B 1 311 ? 19.846  71.210  146.634 1.00 53.23 ? 311 ARG A CA  1 
ATOM   6216  C C   . ARG B 1 311 ? 19.444  72.180  147.746 1.00 52.98 ? 311 ARG A C   1 
ATOM   6217  O O   . ARG B 1 311 ? 18.814  73.204  147.480 1.00 53.07 ? 311 ARG A O   1 
ATOM   6218  C CB  . ARG B 1 311 ? 18.856  70.042  146.569 1.00 53.24 ? 311 ARG A CB  1 
ATOM   6219  C CG  . ARG B 1 311 ? 17.433  70.432  146.167 1.00 53.47 ? 311 ARG A CG  1 
ATOM   6220  C CD  . ARG B 1 311 ? 16.543  69.209  146.035 1.00 53.80 ? 311 ARG A CD  1 
ATOM   6221  N NE  . ARG B 1 311 ? 16.282  68.568  147.327 1.00 55.61 ? 311 ARG A NE  1 
ATOM   6222  C CZ  . ARG B 1 311 ? 15.893  67.301  147.483 1.00 55.67 ? 311 ARG A CZ  1 
ATOM   6223  N NH1 . ARG B 1 311 ? 15.720  66.509  146.431 1.00 54.47 ? 311 ARG A NH1 1 
ATOM   6224  N NH2 . ARG B 1 311 ? 15.679  66.824  148.703 1.00 56.17 ? 311 ARG A NH2 1 
ATOM   6225  N N   . ASP B 1 312 ? 19.808  71.847  148.982 1.00 52.70 ? 312 ASP A N   1 
ATOM   6226  C CA  . ASP B 1 312 ? 19.553  72.713  150.132 1.00 52.49 ? 312 ASP A CA  1 
ATOM   6227  C C   . ASP B 1 312 ? 20.318  74.032  150.042 1.00 52.42 ? 312 ASP A C   1 
ATOM   6228  O O   . ASP B 1 312 ? 19.776  75.096  150.350 1.00 52.20 ? 312 ASP A O   1 
ATOM   6229  C CB  . ASP B 1 312 ? 19.930  71.994  151.425 1.00 52.49 ? 312 ASP A CB  1 
ATOM   6230  C CG  . ASP B 1 312 ? 18.850  71.056  151.912 1.00 52.58 ? 312 ASP A CG  1 
ATOM   6231  O OD1 . ASP B 1 312 ? 17.806  70.918  151.235 1.00 53.33 ? 312 ASP A OD1 1 
ATOM   6232  O OD2 . ASP B 1 312 ? 19.046  70.460  152.992 1.00 52.85 ? 312 ASP A OD2 1 
ATOM   6233  N N   . ALA B 1 313 ? 21.581  73.940  149.619 1.00 52.42 ? 313 ALA A N   1 
ATOM   6234  C CA  . ALA B 1 313 ? 22.463  75.095  149.484 1.00 52.11 ? 313 ALA A CA  1 
ATOM   6235  C C   . ALA B 1 313 ? 21.931  76.085  148.455 1.00 51.97 ? 313 ALA A C   1 
ATOM   6236  O O   . ALA B 1 313 ? 21.935  77.291  148.697 1.00 52.12 ? 313 ALA A O   1 
ATOM   6237  C CB  . ALA B 1 313 ? 23.871  74.648  149.122 1.00 52.15 ? 313 ALA A CB  1 
ATOM   6238  N N   . LEU B 1 314 ? 21.469  75.574  147.315 1.00 51.65 ? 314 LEU A N   1 
ATOM   6239  C CA  . LEU B 1 314 ? 20.858  76.422  146.293 1.00 51.43 ? 314 LEU A CA  1 
ATOM   6240  C C   . LEU B 1 314 ? 19.583  77.077  146.805 1.00 51.40 ? 314 LEU A C   1 
ATOM   6241  O O   . LEU B 1 314 ? 19.356  78.265  146.565 1.00 51.56 ? 314 LEU A O   1 
ATOM   6242  C CB  . LEU B 1 314 ? 20.579  75.632  145.014 1.00 51.35 ? 314 LEU A CB  1 
ATOM   6243  C CG  . LEU B 1 314 ? 21.782  75.348  144.112 1.00 50.93 ? 314 LEU A CG  1 
ATOM   6244  C CD1 . LEU B 1 314 ? 21.413  74.302  143.096 1.00 50.62 ? 314 LEU A CD1 1 
ATOM   6245  C CD2 . LEU B 1 314 ? 22.293  76.611  143.424 1.00 50.34 ? 314 LEU A CD2 1 
ATOM   6246  N N   . GLY B 1 315 ? 18.767  76.298  147.515 1.00 51.28 ? 315 GLY A N   1 
ATOM   6247  C CA  . GLY B 1 315 ? 17.570  76.802  148.178 1.00 51.02 ? 315 GLY A CA  1 
ATOM   6248  C C   . GLY B 1 315 ? 17.886  77.917  149.155 1.00 51.12 ? 315 GLY A C   1 
ATOM   6249  O O   . GLY B 1 315 ? 17.235  78.966  149.133 1.00 51.26 ? 315 GLY A O   1 
ATOM   6250  N N   . LYS B 1 316 ? 18.886  77.693  150.009 1.00 51.05 ? 316 LYS A N   1 
ATOM   6251  C CA  . LYS B 1 316 ? 19.324  78.695  150.993 1.00 51.11 ? 316 LYS A CA  1 
ATOM   6252  C C   . LYS B 1 316 ? 19.834  79.963  150.310 1.00 51.01 ? 316 LYS A C   1 
ATOM   6253  O O   . LYS B 1 316 ? 19.534  81.077  150.745 1.00 51.02 ? 316 LYS A O   1 
ATOM   6254  C CB  . LYS B 1 316 ? 20.420  78.137  151.908 1.00 51.16 ? 316 LYS A CB  1 
ATOM   6255  C CG  . LYS B 1 316 ? 19.941  77.172  152.977 1.00 51.51 ? 316 LYS A CG  1 
ATOM   6256  C CD  . LYS B 1 316 ? 21.117  76.533  153.697 1.00 52.16 ? 316 LYS A CD  1 
ATOM   6257  C CE  . LYS B 1 316 ? 20.678  75.335  154.532 1.00 52.93 ? 316 LYS A CE  1 
ATOM   6258  N NZ  . LYS B 1 316 ? 21.838  74.615  155.150 1.00 52.76 ? 316 LYS A NZ  1 
ATOM   6259  N N   . LEU B 1 317 ? 20.609  79.775  149.244 1.00 50.84 ? 317 LEU A N   1 
ATOM   6260  C CA  . LEU B 1 317 ? 21.146  80.876  148.453 1.00 50.59 ? 317 LEU A CA  1 
ATOM   6261  C C   . LEU B 1 317 ? 20.028  81.688  147.825 1.00 50.53 ? 317 LEU A C   1 
ATOM   6262  O O   . LEU B 1 317 ? 20.041  82.922  147.869 1.00 50.42 ? 317 LEU A O   1 
ATOM   6263  C CB  . LEU B 1 317 ? 22.067  80.333  147.360 1.00 50.56 ? 317 LEU A CB  1 
ATOM   6264  C CG  . LEU B 1 317 ? 23.581  80.365  147.579 1.00 50.51 ? 317 LEU A CG  1 
ATOM   6265  C CD1 . LEU B 1 317 ? 23.961  79.874  148.945 1.00 50.64 ? 317 LEU A CD1 1 
ATOM   6266  C CD2 . LEU B 1 317 ? 24.277  79.543  146.512 1.00 50.44 ? 317 LEU A CD2 1 
ATOM   6267  N N   . SER B 1 318 ? 19.052  80.975  147.271 1.00 50.46 ? 318 SER A N   1 
ATOM   6268  C CA  . SER B 1 318 ? 17.952  81.571  146.526 1.00 50.46 ? 318 SER A CA  1 
ATOM   6269  C C   . SER B 1 318 ? 17.068  82.493  147.365 1.00 50.15 ? 318 SER A C   1 
ATOM   6270  O O   . SER B 1 318 ? 16.376  83.346  146.821 1.00 50.11 ? 318 SER A O   1 
ATOM   6271  C CB  . SER B 1 318 ? 17.109  80.469  145.893 1.00 50.56 ? 318 SER A CB  1 
ATOM   6272  O OG  . SER B 1 318 ? 16.842  80.762  144.533 1.00 51.70 ? 318 SER A OG  1 
ATOM   6273  N N   . LEU B 1 319 ? 17.103  82.316  148.684 1.00 50.08 ? 319 LEU A N   1 
ATOM   6274  C CA  . LEU B 1 319 ? 16.324  83.130  149.621 1.00 49.94 ? 319 LEU A CA  1 
ATOM   6275  C C   . LEU B 1 319 ? 16.774  84.579  149.656 1.00 49.92 ? 319 LEU A C   1 
ATOM   6276  O O   . LEU B 1 319 ? 15.979  85.471  149.953 1.00 49.89 ? 319 LEU A O   1 
ATOM   6277  C CB  . LEU B 1 319 ? 16.427  82.560  151.033 1.00 49.99 ? 319 LEU A CB  1 
ATOM   6278  C CG  . LEU B 1 319 ? 15.640  81.305  151.398 1.00 50.11 ? 319 LEU A CG  1 
ATOM   6279  C CD1 . LEU B 1 319 ? 15.954  80.937  152.844 1.00 50.23 ? 319 LEU A CD1 1 
ATOM   6280  C CD2 . LEU B 1 319 ? 14.138  81.514  151.193 1.00 49.60 ? 319 LEU A CD2 1 
ATOM   6281  N N   . ASN B 1 320 ? 18.057  84.798  149.373 1.00 50.05 ? 320 ASN A N   1 
ATOM   6282  C CA  . ASN B 1 320 ? 18.631  86.139  149.327 1.00 50.05 ? 320 ASN A CA  1 
ATOM   6283  C C   . ASN B 1 320 ? 19.099  86.574  147.947 1.00 50.16 ? 320 ASN A C   1 
ATOM   6284  O O   . ASN B 1 320 ? 19.322  87.761  147.720 1.00 50.10 ? 320 ASN A O   1 
ATOM   6285  C CB  . ASN B 1 320 ? 19.773  86.269  150.326 1.00 50.00 ? 320 ASN A CB  1 
ATOM   6286  C CG  . ASN B 1 320 ? 19.289  86.599  151.707 1.00 49.86 ? 320 ASN A CG  1 
ATOM   6287  O OD1 . ASN B 1 320 ? 19.387  85.783  152.614 1.00 50.41 ? 320 ASN A OD1 1 
ATOM   6288  N ND2 . ASN B 1 320 ? 18.751  87.799  151.878 1.00 49.76 ? 320 ASN A ND2 1 
ATOM   6289  N N   . ASP B 1 321 ? 19.239  85.620  147.031 1.00 50.52 ? 321 ASP A N   1 
ATOM   6290  C CA  . ASP B 1 321 ? 19.636  85.939  145.663 1.00 51.02 ? 321 ASP A CA  1 
ATOM   6291  C C   . ASP B 1 321 ? 18.437  86.005  144.717 1.00 51.24 ? 321 ASP A C   1 
ATOM   6292  O O   . ASP B 1 321 ? 17.912  84.975  144.276 1.00 51.04 ? 321 ASP A O   1 
ATOM   6293  C CB  . ASP B 1 321 ? 20.697  84.967  145.144 1.00 51.07 ? 321 ASP A CB  1 
ATOM   6294  C CG  . ASP B 1 321 ? 21.475  85.526  143.963 1.00 51.81 ? 321 ASP A CG  1 
ATOM   6295  O OD1 . ASP B 1 321 ? 22.616  85.067  143.749 1.00 52.73 ? 321 ASP A OD1 1 
ATOM   6296  O OD2 . ASP B 1 321 ? 20.957  86.419  143.247 1.00 52.14 ? 321 ASP A OD2 1 
ATOM   6297  N N   . ALA B 1 322 ? 18.034  87.237  144.406 1.00 51.61 ? 322 ALA A N   1 
ATOM   6298  C CA  . ALA B 1 322 ? 16.870  87.514  143.570 1.00 51.92 ? 322 ALA A CA  1 
ATOM   6299  C C   . ALA B 1 322 ? 17.047  87.057  142.124 1.00 52.23 ? 322 ALA A C   1 
ATOM   6300  O O   . ALA B 1 322 ? 16.058  86.823  141.421 1.00 52.42 ? 322 ALA A O   1 
ATOM   6301  C CB  . ALA B 1 322 ? 16.537  88.996  143.617 1.00 51.83 ? 322 ALA A CB  1 
ATOM   6302  N N   . SER B 1 323 ? 18.299  86.921  141.687 1.00 52.37 ? 323 SER A N   1 
ATOM   6303  C CA  . SER B 1 323 ? 18.589  86.649  140.279 1.00 52.57 ? 323 SER A CA  1 
ATOM   6304  C C   . SER B 1 323 ? 19.254  85.295  139.983 1.00 52.59 ? 323 SER A C   1 
ATOM   6305  O O   . SER B 1 323 ? 19.404  84.924  138.820 1.00 52.70 ? 323 SER A O   1 
ATOM   6306  C CB  . SER B 1 323 ? 19.361  87.817  139.650 1.00 52.58 ? 323 SER A CB  1 
ATOM   6307  O OG  . SER B 1 323 ? 20.054  88.559  140.638 1.00 52.99 ? 323 SER A OG  1 
ATOM   6308  N N   . LEU B 1 324 ? 19.633  84.560  141.028 1.00 52.69 ? 324 LEU A N   1 
ATOM   6309  C CA  . LEU B 1 324 ? 20.113  83.181  140.881 1.00 52.65 ? 324 LEU A CA  1 
ATOM   6310  C C   . LEU B 1 324 ? 18.992  82.292  140.341 1.00 52.64 ? 324 LEU A C   1 
ATOM   6311  O O   . LEU B 1 324 ? 17.911  82.222  140.931 1.00 52.69 ? 324 LEU A O   1 
ATOM   6312  C CB  . LEU B 1 324 ? 20.577  82.633  142.234 1.00 52.65 ? 324 LEU A CB  1 
ATOM   6313  C CG  . LEU B 1 324 ? 21.541  81.447  142.433 1.00 52.72 ? 324 LEU A CG  1 
ATOM   6314  C CD1 . LEU B 1 324 ? 21.094  80.621  143.638 1.00 52.87 ? 324 LEU A CD1 1 
ATOM   6315  C CD2 . LEU B 1 324 ? 21.776  80.550  141.216 1.00 52.42 ? 324 LEU A CD2 1 
ATOM   6316  N N   . PHE B 1 325 ? 19.254  81.634  139.214 1.00 52.70 ? 325 PHE A N   1 
ATOM   6317  C CA  . PHE B 1 325 ? 18.338  80.642  138.641 1.00 52.69 ? 325 PHE A CA  1 
ATOM   6318  C C   . PHE B 1 325 ? 18.949  79.245  138.763 1.00 52.66 ? 325 PHE A C   1 
ATOM   6319  O O   . PHE B 1 325 ? 20.134  79.059  138.492 1.00 52.52 ? 325 PHE A O   1 
ATOM   6320  C CB  . PHE B 1 325 ? 18.025  80.975  137.169 1.00 52.63 ? 325 PHE A CB  1 
ATOM   6321  C CG  . PHE B 1 325 ? 17.354  79.848  136.406 1.00 52.53 ? 325 PHE A CG  1 
ATOM   6322  C CD1 . PHE B 1 325 ? 15.964  79.795  136.295 1.00 52.16 ? 325 PHE A CD1 1 
ATOM   6323  C CD2 . PHE B 1 325 ? 18.115  78.843  135.798 1.00 51.98 ? 325 PHE A CD2 1 
ATOM   6324  C CE1 . PHE B 1 325 ? 15.338  78.759  135.599 1.00 51.44 ? 325 PHE A CE1 1 
ATOM   6325  C CE2 . PHE B 1 325 ? 17.501  77.804  135.103 1.00 51.88 ? 325 PHE A CE2 1 
ATOM   6326  C CZ  . PHE B 1 325 ? 16.107  77.764  135.001 1.00 52.06 ? 325 PHE A CZ  1 
ATOM   6327  N N   . TYR B 1 326 ? 18.138  78.273  139.176 1.00 52.80 ? 326 TYR A N   1 
ATOM   6328  C CA  . TYR B 1 326 ? 18.571  76.871  139.226 1.00 53.13 ? 326 TYR A CA  1 
ATOM   6329  C C   . TYR B 1 326 ? 17.417  75.905  138.965 1.00 53.42 ? 326 TYR A C   1 
ATOM   6330  O O   . TYR B 1 326 ? 16.295  76.102  139.439 1.00 53.66 ? 326 TYR A O   1 
ATOM   6331  C CB  . TYR B 1 326 ? 19.275  76.535  140.550 1.00 52.94 ? 326 TYR A CB  1 
ATOM   6332  C CG  . TYR B 1 326 ? 18.360  76.498  141.749 1.00 52.73 ? 326 TYR A CG  1 
ATOM   6333  C CD1 . TYR B 1 326 ? 17.938  77.675  142.367 1.00 52.77 ? 326 TYR A CD1 1 
ATOM   6334  C CD2 . TYR B 1 326 ? 17.914  75.283  142.268 1.00 52.82 ? 326 TYR A CD2 1 
ATOM   6335  C CE1 . TYR B 1 326 ? 17.089  77.642  143.471 1.00 52.90 ? 326 TYR A CE1 1 
ATOM   6336  C CE2 . TYR B 1 326 ? 17.063  75.239  143.372 1.00 52.62 ? 326 TYR A CE2 1 
ATOM   6337  C CZ  . TYR B 1 326 ? 16.659  76.421  143.967 1.00 52.69 ? 326 TYR A CZ  1 
ATOM   6338  O OH  . TYR B 1 326 ? 15.824  76.385  145.054 1.00 53.08 ? 326 TYR A OH  1 
ATOM   6339  N N   . GLU B 1 327 ? 17.717  74.853  138.216 1.00 53.69 ? 327 GLU A N   1 
ATOM   6340  C CA  . GLU B 1 327 ? 16.722  73.891  137.777 1.00 54.00 ? 327 GLU A CA  1 
ATOM   6341  C C   . GLU B 1 327 ? 17.386  72.515  137.670 1.00 54.08 ? 327 GLU A C   1 
ATOM   6342  O O   . GLU B 1 327 ? 18.510  72.411  137.161 1.00 54.16 ? 327 GLU A O   1 
ATOM   6343  C CB  . GLU B 1 327 ? 16.133  74.370  136.445 1.00 54.02 ? 327 GLU A CB  1 
ATOM   6344  C CG  . GLU B 1 327 ? 15.841  73.318  135.390 1.00 54.44 ? 327 GLU A CG  1 
ATOM   6345  C CD  . GLU B 1 327 ? 15.598  73.944  134.029 1.00 54.53 ? 327 GLU A CD  1 
ATOM   6346  O OE1 . GLU B 1 327 ? 14.532  74.580  133.844 1.00 55.22 ? 327 GLU A OE1 1 
ATOM   6347  O OE2 . GLU B 1 327 ? 16.478  73.806  133.149 1.00 55.11 ? 327 GLU A OE2 1 
ATOM   6348  N N   . PRO B 1 328 ? 16.715  71.460  138.181 1.00 54.09 ? 328 PRO A N   1 
ATOM   6349  C CA  . PRO B 1 328 ? 17.314  70.121  138.159 1.00 54.12 ? 328 PRO A CA  1 
ATOM   6350  C C   . PRO B 1 328 ? 17.717  69.660  136.760 1.00 54.14 ? 328 PRO A C   1 
ATOM   6351  O O   . PRO B 1 328 ? 17.030  69.955  135.783 1.00 54.09 ? 328 PRO A O   1 
ATOM   6352  C CB  . PRO B 1 328 ? 16.214  69.214  138.742 1.00 53.94 ? 328 PRO A CB  1 
ATOM   6353  C CG  . PRO B 1 328 ? 14.974  70.027  138.757 1.00 53.96 ? 328 PRO A CG  1 
ATOM   6354  C CD  . PRO B 1 328 ? 15.387  71.460  138.820 1.00 54.12 ? 328 PRO A CD  1 
ATOM   6355  N N   . GLU B 1 329 ? 18.849  68.968  136.684 1.00 54.34 ? 329 GLU A N   1 
ATOM   6356  C CA  . GLU B 1 329 ? 19.329  68.351  135.453 1.00 54.65 ? 329 GLU A CA  1 
ATOM   6357  C C   . GLU B 1 329 ? 20.104  67.083  135.801 1.00 54.53 ? 329 GLU A C   1 
ATOM   6358  O O   . GLU B 1 329 ? 20.868  67.059  136.772 1.00 54.51 ? 329 GLU A O   1 
ATOM   6359  C CB  . GLU B 1 329 ? 20.218  69.319  134.666 1.00 54.64 ? 329 GLU A CB  1 
ATOM   6360  C CG  . GLU B 1 329 ? 20.597  68.822  133.268 1.00 55.26 ? 329 GLU A CG  1 
ATOM   6361  C CD  . GLU B 1 329 ? 21.451  69.809  132.492 1.00 55.30 ? 329 GLU A CD  1 
ATOM   6362  O OE1 . GLU B 1 329 ? 22.508  70.233  133.013 1.00 55.88 ? 329 GLU A OE1 1 
ATOM   6363  O OE2 . GLU B 1 329 ? 21.068  70.152  131.350 1.00 55.80 ? 329 GLU A OE2 1 
ATOM   6364  N N   . SER B 1 330 ? 19.903  66.033  135.012 1.00 54.50 ? 330 SER A N   1 
ATOM   6365  C CA  . SER B 1 330 ? 20.582  64.765  135.250 1.00 54.43 ? 330 SER A CA  1 
ATOM   6366  C C   . SER B 1 330 ? 21.245  64.221  133.991 1.00 54.47 ? 330 SER A C   1 
ATOM   6367  O O   . SER B 1 330 ? 20.579  63.966  132.985 1.00 54.55 ? 330 SER A O   1 
ATOM   6368  C CB  . SER B 1 330 ? 19.613  63.731  135.822 1.00 54.30 ? 330 SER A CB  1 
ATOM   6369  O OG  . SER B 1 330 ? 18.721  63.269  134.825 1.00 54.43 ? 330 SER A OG  1 
ATOM   6370  N N   . SER B 1 331 ? 22.563  64.055  134.062 1.00 54.49 ? 331 SER A N   1 
ATOM   6371  C CA  . SER B 1 331 ? 23.324  63.380  133.023 1.00 54.47 ? 331 SER A CA  1 
ATOM   6372  C C   . SER B 1 331 ? 23.436  61.909  133.354 1.00 54.24 ? 331 SER A C   1 
ATOM   6373  O O   . SER B 1 331 ? 23.463  61.520  134.526 1.00 54.15 ? 331 SER A O   1 
ATOM   6374  C CB  . SER B 1 331 ? 24.740  63.951  132.921 1.00 54.55 ? 331 SER A CB  1 
ATOM   6375  O OG  . SER B 1 331 ? 24.726  65.326  132.602 1.00 55.49 ? 331 SER A OG  1 
ATOM   6376  N N   . SER B 1 332 ? 23.505  61.097  132.306 1.00 54.10 ? 332 SER A N   1 
ATOM   6377  C CA  . SER B 1 332 ? 23.932  59.709  132.426 1.00 53.77 ? 332 SER A CA  1 
ATOM   6378  C C   . SER B 1 332 ? 25.335  59.680  133.039 1.00 53.46 ? 332 SER A C   1 
ATOM   6379  O O   . SER B 1 332 ? 25.598  58.949  133.993 1.00 53.37 ? 332 SER A O   1 
ATOM   6380  C CB  . SER B 1 332 ? 23.951  59.057  131.040 1.00 53.85 ? 332 SER A CB  1 
ATOM   6381  O OG  . SER B 1 332 ? 24.708  59.832  130.115 1.00 53.45 ? 332 SER A OG  1 
ATOM   6382  N N   . ALA B 1 333 ? 26.208  60.520  132.490 1.00 53.00 ? 333 ALA A N   1 
ATOM   6383  C CA  . ALA B 1 333 ? 27.625  60.536  132.817 1.00 52.58 ? 333 ALA A CA  1 
ATOM   6384  C C   . ALA B 1 333 ? 27.924  61.193  134.155 1.00 52.24 ? 333 ALA A C   1 
ATOM   6385  O O   . ALA B 1 333 ? 28.616  60.619  134.993 1.00 52.31 ? 333 ALA A O   1 
ATOM   6386  C CB  . ALA B 1 333 ? 28.382  61.248  131.719 1.00 52.47 ? 333 ALA A CB  1 
ATOM   6387  N N   . LEU B 1 334 ? 27.401  62.401  134.341 1.00 51.87 ? 334 LEU A N   1 
ATOM   6388  C CA  . LEU B 1 334 ? 27.776  63.250  135.465 1.00 51.47 ? 334 LEU A CA  1 
ATOM   6389  C C   . LEU B 1 334 ? 26.917  63.058  136.716 1.00 51.32 ? 334 LEU A C   1 
ATOM   6390  O O   . LEU B 1 334 ? 27.278  63.522  137.793 1.00 51.18 ? 334 LEU A O   1 
ATOM   6391  C CB  . LEU B 1 334 ? 27.768  64.714  135.029 1.00 51.50 ? 334 LEU A CB  1 
ATOM   6392  C CG  . LEU B 1 334 ? 28.824  65.120  133.996 1.00 51.32 ? 334 LEU A CG  1 
ATOM   6393  C CD1 . LEU B 1 334 ? 28.422  66.397  133.282 1.00 50.92 ? 334 LEU A CD1 1 
ATOM   6394  C CD2 . LEU B 1 334 ? 30.194  65.277  134.653 1.00 51.59 ? 334 LEU A CD2 1 
ATOM   6395  N N   . GLY B 1 335 ? 25.797  62.356  136.575 1.00 51.33 ? 335 GLY A N   1 
ATOM   6396  C CA  . GLY B 1 335 ? 24.904  62.102  137.698 1.00 51.27 ? 335 GLY A CA  1 
ATOM   6397  C C   . GLY B 1 335 ? 23.881  63.209  137.854 1.00 51.40 ? 335 GLY A C   1 
ATOM   6398  O O   . GLY B 1 335 ? 23.656  63.992  136.932 1.00 51.26 ? 335 GLY A O   1 
ATOM   6399  N N   . PHE B 1 336 ? 23.260  63.274  139.026 1.00 51.56 ? 336 PHE A N   1 
ATOM   6400  C CA  . PHE B 1 336 ? 22.215  64.255  139.278 1.00 51.88 ? 336 PHE A CA  1 
ATOM   6401  C C   . PHE B 1 336 ? 22.834  65.560  139.741 1.00 52.23 ? 336 PHE A C   1 
ATOM   6402  O O   . PHE B 1 336 ? 23.678  65.572  140.640 1.00 52.50 ? 336 PHE A O   1 
ATOM   6403  C CB  . PHE B 1 336 ? 21.215  63.737  140.317 1.00 51.79 ? 336 PHE A CB  1 
ATOM   6404  C CG  . PHE B 1 336 ? 20.281  62.687  139.790 1.00 51.76 ? 336 PHE A CG  1 
ATOM   6405  C CD1 . PHE B 1 336 ? 19.048  63.044  139.247 1.00 51.96 ? 336 PHE A CD1 1 
ATOM   6406  C CD2 . PHE B 1 336 ? 20.630  61.339  139.835 1.00 51.85 ? 336 PHE A CD2 1 
ATOM   6407  C CE1 . PHE B 1 336 ? 18.177  62.076  138.748 1.00 51.77 ? 336 PHE A CE1 1 
ATOM   6408  C CE2 . PHE B 1 336 ? 19.766  60.363  139.340 1.00 51.99 ? 336 PHE A CE2 1 
ATOM   6409  C CZ  . PHE B 1 336 ? 18.536  60.734  138.794 1.00 51.76 ? 336 PHE A CZ  1 
ATOM   6410  N N   . GLY B 1 337 ? 22.416  66.657  139.116 1.00 52.45 ? 337 GLY A N   1 
ATOM   6411  C CA  . GLY B 1 337 ? 22.893  67.984  139.483 1.00 52.50 ? 337 GLY A CA  1 
ATOM   6412  C C   . GLY B 1 337 ? 21.899  69.065  139.125 1.00 52.67 ? 337 GLY A C   1 
ATOM   6413  O O   . GLY B 1 337 ? 20.689  68.828  139.093 1.00 52.71 ? 337 GLY A O   1 
ATOM   6414  N N   . PHE B 1 338 ? 22.414  70.258  138.853 1.00 52.87 ? 338 PHE A N   1 
ATOM   6415  C CA  . PHE B 1 338 ? 21.570  71.418  138.605 1.00 53.10 ? 338 PHE A CA  1 
ATOM   6416  C C   . PHE B 1 338 ? 22.096  72.290  137.476 1.00 53.44 ? 338 PHE A C   1 
ATOM   6417  O O   . PHE B 1 338 ? 23.305  72.521  137.360 1.00 53.51 ? 338 PHE A O   1 
ATOM   6418  C CB  . PHE B 1 338 ? 21.422  72.245  139.885 1.00 52.85 ? 338 PHE A CB  1 
ATOM   6419  C CG  . PHE B 1 338 ? 20.614  71.564  140.952 1.00 52.70 ? 338 PHE A CG  1 
ATOM   6420  C CD1 . PHE B 1 338 ? 19.227  71.653  140.954 1.00 52.34 ? 338 PHE A CD1 1 
ATOM   6421  C CD2 . PHE B 1 338 ? 21.237  70.829  141.951 1.00 52.41 ? 338 PHE A CD2 1 
ATOM   6422  C CE1 . PHE B 1 338 ? 18.476  71.022  141.935 1.00 52.34 ? 338 PHE A CE1 1 
ATOM   6423  C CE2 . PHE B 1 338 ? 20.489  70.192  142.938 1.00 52.45 ? 338 PHE A CE2 1 
ATOM   6424  C CZ  . PHE B 1 338 ? 19.108  70.290  142.929 1.00 52.29 ? 338 PHE A CZ  1 
ATOM   6425  N N   . ARG B 1 339 ? 21.173  72.763  136.643 1.00 53.72 ? 339 ARG A N   1 
ATOM   6426  C CA  . ARG B 1 339 ? 21.493  73.744  135.618 1.00 54.06 ? 339 ARG A CA  1 
ATOM   6427  C C   . ARG B 1 339 ? 21.174  75.131  136.174 1.00 53.92 ? 339 ARG A C   1 
ATOM   6428  O O   . ARG B 1 339 ? 20.046  75.393  136.594 1.00 53.89 ? 339 ARG A O   1 
ATOM   6429  C CB  . ARG B 1 339 ? 20.703  73.466  134.342 1.00 54.29 ? 339 ARG A CB  1 
ATOM   6430  C CG  . ARG B 1 339 ? 21.298  74.084  133.083 1.00 55.48 ? 339 ARG A CG  1 
ATOM   6431  C CD  . ARG B 1 339 ? 20.441  73.753  131.872 1.00 57.99 ? 339 ARG A CD  1 
ATOM   6432  N NE  . ARG B 1 339 ? 19.100  74.335  131.976 1.00 59.34 ? 339 ARG A NE  1 
ATOM   6433  C CZ  . ARG B 1 339 ? 18.728  75.479  131.404 1.00 60.02 ? 339 ARG A CZ  1 
ATOM   6434  N NH1 . ARG B 1 339 ? 19.592  76.177  130.668 1.00 60.03 ? 339 ARG A NH1 1 
ATOM   6435  N NH2 . ARG B 1 339 ? 17.486  75.923  131.565 1.00 59.79 ? 339 ARG A NH2 1 
ATOM   6436  N N   . CYS B 1 340 ? 22.179  76.005  136.183 1.00 53.80 ? 340 CYS A N   1 
ATOM   6437  C CA  . CYS B 1 340 ? 22.079  77.287  136.872 1.00 53.75 ? 340 CYS A CA  1 
ATOM   6438  C C   . CYS B 1 340 ? 22.302  78.497  135.974 1.00 53.62 ? 340 CYS A C   1 
ATOM   6439  O O   . CYS B 1 340 ? 23.157  78.488  135.087 1.00 53.55 ? 340 CYS A O   1 
ATOM   6440  C CB  . CYS B 1 340 ? 23.058  77.335  138.042 1.00 53.78 ? 340 CYS A CB  1 
ATOM   6441  S SG  . CYS B 1 340 ? 23.013  75.882  139.099 1.00 54.37 ? 340 CYS A SG  1 
ATOM   6442  N N   . GLY B 1 341 ? 21.524  79.543  136.231 1.00 53.54 ? 341 GLY A N   1 
ATOM   6443  C CA  . GLY B 1 341 ? 21.634  80.797  135.505 1.00 53.37 ? 341 GLY A CA  1 
ATOM   6444  C C   . GLY B 1 341 ? 22.241  81.877  136.371 1.00 53.20 ? 341 GLY A C   1 
ATOM   6445  O O   . GLY B 1 341 ? 21.971  81.949  137.569 1.00 53.24 ? 341 GLY A O   1 
ATOM   6446  N N   . PHE B 1 342 ? 23.067  82.713  135.753 1.00 53.08 ? 342 PHE A N   1 
ATOM   6447  C CA  . PHE B 1 342 ? 23.776  83.775  136.448 1.00 53.07 ? 342 PHE A CA  1 
ATOM   6448  C C   . PHE B 1 342 ? 23.783  85.052  135.613 1.00 53.17 ? 342 PHE A C   1 
ATOM   6449  O O   . PHE B 1 342 ? 23.566  85.012  134.401 1.00 53.06 ? 342 PHE A O   1 
ATOM   6450  C CB  . PHE B 1 342 ? 25.218  83.353  136.744 1.00 53.08 ? 342 PHE A CB  1 
ATOM   6451  C CG  . PHE B 1 342 ? 25.339  82.029  137.445 1.00 53.01 ? 342 PHE A CG  1 
ATOM   6452  C CD1 . PHE B 1 342 ? 25.180  81.937  138.824 1.00 53.24 ? 342 PHE A CD1 1 
ATOM   6453  C CD2 . PHE B 1 342 ? 25.622  80.874  136.726 1.00 52.47 ? 342 PHE A CD2 1 
ATOM   6454  C CE1 . PHE B 1 342 ? 25.298  80.712  139.476 1.00 53.15 ? 342 PHE A CE1 1 
ATOM   6455  C CE2 . PHE B 1 342 ? 25.740  79.647  137.369 1.00 52.44 ? 342 PHE A CE2 1 
ATOM   6456  C CZ  . PHE B 1 342 ? 25.580  79.567  138.745 1.00 52.59 ? 342 PHE A CZ  1 
ATOM   6457  N N   . LEU B 1 343 ? 24.043  86.177  136.273 1.00 53.32 ? 343 LEU A N   1 
ATOM   6458  C CA  . LEU B 1 343 ? 24.065  87.487  135.625 1.00 53.43 ? 343 LEU A CA  1 
ATOM   6459  C C   . LEU B 1 343 ? 25.339  87.688  134.807 1.00 53.58 ? 343 LEU A C   1 
ATOM   6460  O O   . LEU B 1 343 ? 25.352  88.455  133.844 1.00 53.67 ? 343 LEU A O   1 
ATOM   6461  C CB  . LEU B 1 343 ? 23.929  88.608  136.668 1.00 53.34 ? 343 LEU A CB  1 
ATOM   6462  C CG  . LEU B 1 343 ? 22.630  88.738  137.480 1.00 53.31 ? 343 LEU A CG  1 
ATOM   6463  C CD1 . LEU B 1 343 ? 22.872  89.460  138.805 1.00 52.95 ? 343 LEU A CD1 1 
ATOM   6464  C CD2 . LEU B 1 343 ? 21.531  89.432  136.690 1.00 53.30 ? 343 LEU A CD2 1 
ATOM   6465  N N   . GLY B 1 344 ? 26.404  86.996  135.202 1.00 53.66 ? 344 GLY A N   1 
ATOM   6466  C CA  . GLY B 1 344 ? 27.712  87.144  134.579 1.00 53.76 ? 344 GLY A CA  1 
ATOM   6467  C C   . GLY B 1 344 ? 28.742  86.304  135.301 1.00 53.91 ? 344 GLY A C   1 
ATOM   6468  O O   . GLY B 1 344 ? 28.399  85.537  136.204 1.00 53.99 ? 344 GLY A O   1 
ATOM   6469  N N   . LEU B 1 345 ? 30.006  86.466  134.921 1.00 53.95 ? 345 LEU A N   1 
ATOM   6470  C CA  . LEU B 1 345 ? 31.079  85.587  135.384 1.00 54.11 ? 345 LEU A CA  1 
ATOM   6471  C C   . LEU B 1 345 ? 31.309  85.533  136.892 1.00 54.25 ? 345 LEU A C   1 
ATOM   6472  O O   . LEU B 1 345 ? 31.307  84.443  137.461 1.00 54.30 ? 345 LEU A O   1 
ATOM   6473  C CB  . LEU B 1 345 ? 32.395  85.871  134.652 1.00 54.20 ? 345 LEU A CB  1 
ATOM   6474  C CG  . LEU B 1 345 ? 32.567  85.184  133.295 1.00 53.95 ? 345 LEU A CG  1 
ATOM   6475  C CD1 . LEU B 1 345 ? 33.918  85.537  132.702 1.00 53.69 ? 345 LEU A CD1 1 
ATOM   6476  C CD2 . LEU B 1 345 ? 32.409  83.671  133.415 1.00 53.75 ? 345 LEU A CD2 1 
ATOM   6477  N N   . LEU B 1 346 ? 31.512  86.679  137.541 1.00 54.44 ? 346 LEU A N   1 
ATOM   6478  C CA  . LEU B 1 346 ? 31.760  86.651  138.990 1.00 54.81 ? 346 LEU A CA  1 
ATOM   6479  C C   . LEU B 1 346 ? 30.509  86.539  139.854 1.00 54.82 ? 346 LEU A C   1 
ATOM   6480  O O   . LEU B 1 346 ? 30.623  86.303  141.055 1.00 54.90 ? 346 LEU A O   1 
ATOM   6481  C CB  . LEU B 1 346 ? 32.685  87.777  139.488 1.00 55.00 ? 346 LEU A CB  1 
ATOM   6482  C CG  . LEU B 1 346 ? 32.427  89.278  139.325 1.00 55.64 ? 346 LEU A CG  1 
ATOM   6483  C CD1 . LEU B 1 346 ? 32.496  89.652  137.854 1.00 56.36 ? 346 LEU A CD1 1 
ATOM   6484  C CD2 . LEU B 1 346 ? 31.123  89.747  139.972 1.00 55.99 ? 346 LEU A CD2 1 
ATOM   6485  N N   . HIS B 1 347 ? 29.330  86.709  139.253 1.00 54.77 ? 347 HIS A N   1 
ATOM   6486  C CA  . HIS B 1 347 ? 28.092  86.321  139.919 1.00 54.52 ? 347 HIS A CA  1 
ATOM   6487  C C   . HIS B 1 347 ? 28.160  84.816  140.104 1.00 54.74 ? 347 HIS A C   1 
ATOM   6488  O O   . HIS B 1 347 ? 28.001  84.313  141.219 1.00 54.89 ? 347 HIS A O   1 
ATOM   6489  C CB  . HIS B 1 347 ? 26.859  86.713  139.106 1.00 54.29 ? 347 HIS A CB  1 
ATOM   6490  C CG  . HIS B 1 347 ? 25.563  86.266  139.716 1.00 53.75 ? 347 HIS A CG  1 
ATOM   6491  N ND1 . HIS B 1 347 ? 25.313  86.331  141.070 1.00 53.31 ? 347 HIS A ND1 1 
ATOM   6492  C CD2 . HIS B 1 347 ? 24.439  85.765  139.153 1.00 53.12 ? 347 HIS A CD2 1 
ATOM   6493  C CE1 . HIS B 1 347 ? 24.095  85.881  141.315 1.00 52.68 ? 347 HIS A CE1 1 
ATOM   6494  N NE2 . HIS B 1 347 ? 23.544  85.531  140.168 1.00 53.09 ? 347 HIS A NE2 1 
ATOM   6495  N N   . MET B 1 348 ? 28.434  84.117  139.002 1.00 54.90 ? 348 MET A N   1 
ATOM   6496  C CA  . MET B 1 348 ? 28.675  82.680  139.002 1.00 55.17 ? 348 MET A CA  1 
ATOM   6497  C C   . MET B 1 348 ? 29.793  82.315  139.974 1.00 55.23 ? 348 MET A C   1 
ATOM   6498  O O   . MET B 1 348 ? 29.661  81.374  140.754 1.00 55.49 ? 348 MET A O   1 
ATOM   6499  C CB  . MET B 1 348 ? 29.022  82.204  137.589 1.00 55.03 ? 348 MET A CB  1 
ATOM   6500  C CG  . MET B 1 348 ? 29.185  80.697  137.445 1.00 55.43 ? 348 MET A CG  1 
ATOM   6501  S SD  . MET B 1 348 ? 29.528  80.179  135.746 1.00 55.61 ? 348 MET A SD  1 
ATOM   6502  C CE  . MET B 1 348 ? 31.313  80.366  135.692 1.00 56.52 ? 348 MET A CE  1 
ATOM   6503  N N   . GLU B 1 349 ? 30.880  83.074  139.939 1.00 55.27 ? 349 GLU A N   1 
ATOM   6504  C CA  . GLU B 1 349 ? 32.043  82.772  140.765 1.00 55.46 ? 349 GLU A CA  1 
ATOM   6505  C C   . GLU B 1 349 ? 31.828  83.050  142.254 1.00 55.32 ? 349 GLU A C   1 
ATOM   6506  O O   . GLU B 1 349 ? 32.420  82.380  143.099 1.00 55.33 ? 349 GLU A O   1 
ATOM   6507  C CB  . GLU B 1 349 ? 33.279  83.500  140.236 1.00 55.62 ? 349 GLU A CB  1 
ATOM   6508  C CG  . GLU B 1 349 ? 33.810  82.899  138.935 1.00 56.57 ? 349 GLU A CG  1 
ATOM   6509  C CD  . GLU B 1 349 ? 34.722  83.839  138.164 1.00 57.87 ? 349 GLU A CD  1 
ATOM   6510  O OE1 . GLU B 1 349 ? 35.177  84.856  138.742 1.00 58.33 ? 349 GLU A OE1 1 
ATOM   6511  O OE2 . GLU B 1 349 ? 34.985  83.551  136.974 1.00 58.34 ? 349 GLU A OE2 1 
ATOM   6512  N N   . ILE B 1 350 ? 30.987  84.033  142.569 1.00 55.17 ? 350 ILE A N   1 
ATOM   6513  C CA  . ILE B 1 350 ? 30.612  84.304  143.956 1.00 54.98 ? 350 ILE A CA  1 
ATOM   6514  C C   . ILE B 1 350 ? 29.834  83.110  144.498 1.00 54.86 ? 350 ILE A C   1 
ATOM   6515  O O   . ILE B 1 350 ? 30.135  82.609  145.581 1.00 54.83 ? 350 ILE A O   1 
ATOM   6516  C CB  . ILE B 1 350 ? 29.814  85.639  144.098 1.00 55.03 ? 350 ILE A CB  1 
ATOM   6517  C CG1 . ILE B 1 350 ? 30.782  86.826  144.151 1.00 55.07 ? 350 ILE A CG1 1 
ATOM   6518  C CG2 . ILE B 1 350 ? 28.920  85.643  145.346 1.00 54.88 ? 350 ILE A CG2 1 
ATOM   6519  C CD1 . ILE B 1 350 ? 30.144  88.173  143.831 1.00 55.23 ? 350 ILE A CD1 1 
ATOM   6520  N N   . ILE B 1 351 ? 28.858  82.648  143.719 1.00 54.76 ? 351 ILE A N   1 
ATOM   6521  C CA  . ILE B 1 351 ? 28.031  81.499  144.087 1.00 54.57 ? 351 ILE A CA  1 
ATOM   6522  C C   . ILE B 1 351 ? 28.830  80.201  144.143 1.00 54.50 ? 351 ILE A C   1 
ATOM   6523  O O   . ILE B 1 351 ? 28.613  79.380  145.029 1.00 54.42 ? 351 ILE A O   1 
ATOM   6524  C CB  . ILE B 1 351 ? 26.793  81.386  143.169 1.00 54.52 ? 351 ILE A CB  1 
ATOM   6525  C CG1 . ILE B 1 351 ? 25.668  82.226  143.760 1.00 54.34 ? 351 ILE A CG1 1 
ATOM   6526  C CG2 . ILE B 1 351 ? 26.331  79.934  143.005 1.00 54.18 ? 351 ILE A CG2 1 
ATOM   6527  C CD1 . ILE B 1 351 ? 24.782  82.831  142.738 1.00 55.68 ? 351 ILE A CD1 1 
ATOM   6528  N N   . GLN B 1 352 ? 29.762  80.033  143.212 1.00 54.52 ? 352 GLN A N   1 
ATOM   6529  C CA  . GLN B 1 352 ? 30.630  78.870  143.215 1.00 54.63 ? 352 GLN A CA  1 
ATOM   6530  C C   . GLN B 1 352 ? 31.538  78.859  144.441 1.00 54.79 ? 352 GLN A C   1 
ATOM   6531  O O   . GLN B 1 352 ? 31.634  77.844  145.129 1.00 54.87 ? 352 GLN A O   1 
ATOM   6532  C CB  . GLN B 1 352 ? 31.444  78.804  141.930 1.00 54.56 ? 352 GLN A CB  1 
ATOM   6533  C CG  . GLN B 1 352 ? 30.679  78.215  140.772 1.00 54.95 ? 352 GLN A CG  1 
ATOM   6534  C CD  . GLN B 1 352 ? 31.490  78.173  139.497 1.00 56.07 ? 352 GLN A CD  1 
ATOM   6535  O OE1 . GLN B 1 352 ? 32.073  79.175  139.081 1.00 56.22 ? 352 GLN A OE1 1 
ATOM   6536  N NE2 . GLN B 1 352 ? 31.524  77.006  138.858 1.00 56.84 ? 352 GLN A NE2 1 
ATOM   6537  N N   . GLU B 1 353 ? 32.180  79.993  144.718 1.00 54.97 ? 353 GLU A N   1 
ATOM   6538  C CA  . GLU B 1 353 ? 33.048  80.143  145.887 1.00 55.22 ? 353 GLU A CA  1 
ATOM   6539  C C   . GLU B 1 353 ? 32.266  79.916  147.183 1.00 55.24 ? 353 GLU A C   1 
ATOM   6540  O O   . GLU B 1 353 ? 32.795  79.358  148.147 1.00 55.42 ? 353 GLU A O   1 
ATOM   6541  C CB  . GLU B 1 353 ? 33.698  81.529  145.887 1.00 55.34 ? 353 GLU A CB  1 
ATOM   6542  C CG  . GLU B 1 353 ? 35.042  81.614  146.618 1.00 56.28 ? 353 GLU A CG  1 
ATOM   6543  C CD  . GLU B 1 353 ? 34.960  82.281  147.995 1.00 57.26 ? 353 GLU A CD  1 
ATOM   6544  O OE1 . GLU B 1 353 ? 33.850  82.375  148.570 1.00 57.61 ? 353 GLU A OE1 1 
ATOM   6545  O OE2 . GLU B 1 353 ? 36.021  82.711  148.505 1.00 57.13 ? 353 GLU A OE2 1 
ATOM   6546  N N   . ARG B 1 354 ? 31.003  80.338  147.186 1.00 55.12 ? 354 ARG A N   1 
ATOM   6547  C CA  . ARG B 1 354 ? 30.124  80.187  148.340 1.00 54.96 ? 354 ARG A CA  1 
ATOM   6548  C C   . ARG B 1 354 ? 29.732  78.723  148.526 1.00 54.79 ? 354 ARG A C   1 
ATOM   6549  O O   . ARG B 1 354 ? 29.842  78.181  149.629 1.00 54.86 ? 354 ARG A O   1 
ATOM   6550  C CB  . ARG B 1 354 ? 28.879  81.051  148.161 1.00 55.03 ? 354 ARG A CB  1 
ATOM   6551  C CG  . ARG B 1 354 ? 28.676  82.091  149.246 1.00 55.26 ? 354 ARG A CG  1 
ATOM   6552  C CD  . ARG B 1 354 ? 27.867  83.249  148.693 1.00 56.08 ? 354 ARG A CD  1 
ATOM   6553  N NE  . ARG B 1 354 ? 27.181  84.022  149.726 1.00 57.24 ? 354 ARG A NE  1 
ATOM   6554  C CZ  . ARG B 1 354 ? 26.043  83.659  150.321 1.00 57.75 ? 354 ARG A CZ  1 
ATOM   6555  N NH1 . ARG B 1 354 ? 25.444  82.510  150.009 1.00 57.94 ? 354 ARG A NH1 1 
ATOM   6556  N NH2 . ARG B 1 354 ? 25.503  84.448  151.240 1.00 57.50 ? 354 ARG A NH2 1 
ATOM   6557  N N   . LEU B 1 355 ? 29.284  78.094  147.438 1.00 54.52 ? 355 LEU A N   1 
ATOM   6558  C CA  . LEU B 1 355 ? 28.973  76.662  147.403 1.00 54.28 ? 355 LEU A CA  1 
ATOM   6559  C C   . LEU B 1 355 ? 30.146  75.804  147.860 1.00 54.41 ? 355 LEU A C   1 
ATOM   6560  O O   . LEU B 1 355 ? 29.957  74.787  148.527 1.00 54.40 ? 355 LEU A O   1 
ATOM   6561  C CB  . LEU B 1 355 ? 28.563  76.247  145.987 1.00 54.10 ? 355 LEU A CB  1 
ATOM   6562  C CG  . LEU B 1 355 ? 27.106  75.940  145.627 1.00 53.56 ? 355 LEU A CG  1 
ATOM   6563  C CD1 . LEU B 1 355 ? 26.103  76.622  146.541 1.00 53.20 ? 355 LEU A CD1 1 
ATOM   6564  C CD2 . LEU B 1 355 ? 26.848  76.296  144.175 1.00 52.95 ? 355 LEU A CD2 1 
ATOM   6565  N N   . GLU B 1 356 ? 31.354  76.235  147.501 1.00 54.58 ? 356 GLU A N   1 
ATOM   6566  C CA  . GLU B 1 356 ? 32.579  75.519  147.819 1.00 54.88 ? 356 GLU A CA  1 
ATOM   6567  C C   . GLU B 1 356 ? 32.957  75.645  149.292 1.00 55.18 ? 356 GLU A C   1 
ATOM   6568  O O   . GLU B 1 356 ? 33.321  74.656  149.928 1.00 55.10 ? 356 GLU A O   1 
ATOM   6569  C CB  . GLU B 1 356 ? 33.720  76.038  146.942 1.00 54.79 ? 356 GLU A CB  1 
ATOM   6570  C CG  . GLU B 1 356 ? 35.071  75.374  147.188 1.00 54.99 ? 356 GLU A CG  1 
ATOM   6571  C CD  . GLU B 1 356 ? 36.181  75.961  146.332 1.00 55.17 ? 356 GLU A CD  1 
ATOM   6572  O OE1 . GLU B 1 356 ? 35.940  76.222  145.129 1.00 54.82 ? 356 GLU A OE1 1 
ATOM   6573  O OE2 . GLU B 1 356 ? 37.298  76.158  146.865 1.00 56.08 ? 356 GLU A OE2 1 
ATOM   6574  N N   . ARG B 1 357 ? 32.865  76.860  149.828 1.00 55.53 ? 357 ARG A N   1 
ATOM   6575  C CA  . ARG B 1 357 ? 33.417  77.155  151.150 1.00 55.97 ? 357 ARG A CA  1 
ATOM   6576  C C   . ARG B 1 357 ? 32.384  77.162  152.288 1.00 55.88 ? 357 ARG A C   1 
ATOM   6577  O O   . ARG B 1 357 ? 32.613  76.548  153.328 1.00 55.83 ? 357 ARG A O   1 
ATOM   6578  C CB  . ARG B 1 357 ? 34.224  78.458  151.113 1.00 55.89 ? 357 ARG A CB  1 
ATOM   6579  C CG  . ARG B 1 357 ? 35.243  78.518  149.965 1.00 56.52 ? 357 ARG A CG  1 
ATOM   6580  C CD  . ARG B 1 357 ? 36.379  79.518  150.209 1.00 56.86 ? 357 ARG A CD  1 
ATOM   6581  N NE  . ARG B 1 357 ? 35.897  80.820  150.671 1.00 58.92 ? 357 ARG A NE  1 
ATOM   6582  C CZ  . ARG B 1 357 ? 36.058  81.291  151.908 1.00 59.71 ? 357 ARG A CZ  1 
ATOM   6583  N NH1 . ARG B 1 357 ? 36.704  80.575  152.826 1.00 59.81 ? 357 ARG A NH1 1 
ATOM   6584  N NH2 . ARG B 1 357 ? 35.576  82.487  152.227 1.00 60.41 ? 357 ARG A NH2 1 
ATOM   6585  N N   . GLU B 1 358 ? 31.257  77.845  152.094 1.00 55.92 ? 358 GLU A N   1 
ATOM   6586  C CA  . GLU B 1 358 ? 30.195  77.862  153.105 1.00 55.92 ? 358 GLU A CA  1 
ATOM   6587  C C   . GLU B 1 358 ? 29.613  76.474  153.328 1.00 55.61 ? 358 GLU A C   1 
ATOM   6588  O O   . GLU B 1 358 ? 29.534  76.008  154.463 1.00 55.63 ? 358 GLU A O   1 
ATOM   6589  C CB  . GLU B 1 358 ? 29.063  78.810  152.709 1.00 55.93 ? 358 GLU A CB  1 
ATOM   6590  C CG  . GLU B 1 358 ? 29.261  80.255  153.105 1.00 56.34 ? 358 GLU A CG  1 
ATOM   6591  C CD  . GLU B 1 358 ? 28.028  81.093  152.818 1.00 56.44 ? 358 GLU A CD  1 
ATOM   6592  O OE1 . GLU B 1 358 ? 26.907  80.658  153.180 1.00 57.03 ? 358 GLU A OE1 1 
ATOM   6593  O OE2 . GLU B 1 358 ? 28.182  82.188  152.232 1.00 56.92 ? 358 GLU A OE2 1 
ATOM   6594  N N   . TYR B 1 359 ? 29.209  75.825  152.236 1.00 55.30 ? 359 TYR A N   1 
ATOM   6595  C CA  . TYR B 1 359 ? 28.509  74.544  152.305 1.00 54.92 ? 359 TYR A CA  1 
ATOM   6596  C C   . TYR B 1 359 ? 29.429  73.377  152.003 1.00 54.60 ? 359 TYR A C   1 
ATOM   6597  O O   . TYR B 1 359 ? 28.977  72.241  151.861 1.00 54.55 ? 359 TYR A O   1 
ATOM   6598  C CB  . TYR B 1 359 ? 27.301  74.544  151.367 1.00 55.04 ? 359 TYR A CB  1 
ATOM   6599  C CG  . TYR B 1 359 ? 26.427  75.757  151.552 1.00 55.22 ? 359 TYR A CG  1 
ATOM   6600  C CD1 . TYR B 1 359 ? 25.562  75.856  152.642 1.00 55.11 ? 359 TYR A CD1 1 
ATOM   6601  C CD2 . TYR B 1 359 ? 26.478  76.817  150.653 1.00 54.96 ? 359 TYR A CD2 1 
ATOM   6602  C CE1 . TYR B 1 359 ? 24.766  76.973  152.825 1.00 55.07 ? 359 TYR A CE1 1 
ATOM   6603  C CE2 . TYR B 1 359 ? 25.689  77.937  150.831 1.00 54.92 ? 359 TYR A CE2 1 
ATOM   6604  C CZ  . TYR B 1 359 ? 24.835  78.010  151.916 1.00 55.13 ? 359 TYR A CZ  1 
ATOM   6605  O OH  . TYR B 1 359 ? 24.045  79.123  152.097 1.00 55.57 ? 359 TYR A OH  1 
ATOM   6606  N N   . ASP B 1 360 ? 30.723  73.672  151.915 1.00 54.21 ? 360 ASP A N   1 
ATOM   6607  C CA  . ASP B 1 360 ? 31.755  72.667  151.708 1.00 53.89 ? 360 ASP A CA  1 
ATOM   6608  C C   . ASP B 1 360 ? 31.345  71.641  150.646 1.00 53.62 ? 360 ASP A C   1 
ATOM   6609  O O   . ASP B 1 360 ? 31.282  70.444  150.925 1.00 53.80 ? 360 ASP A O   1 
ATOM   6610  C CB  . ASP B 1 360 ? 32.105  71.981  153.039 1.00 53.87 ? 360 ASP A CB  1 
ATOM   6611  C CG  . ASP B 1 360 ? 33.531  71.449  153.071 1.00 53.87 ? 360 ASP A CG  1 
ATOM   6612  O OD1 . ASP B 1 360 ? 34.478  72.265  153.135 1.00 53.71 ? 360 ASP A OD1 1 
ATOM   6613  O OD2 . ASP B 1 360 ? 33.707  70.214  153.047 1.00 53.94 ? 360 ASP A OD2 1 
ATOM   6614  N N   . LEU B 1 361 ? 31.052  72.115  149.437 1.00 53.11 ? 361 LEU A N   1 
ATOM   6615  C CA  . LEU B 1 361 ? 30.678  71.226  148.342 1.00 52.77 ? 361 LEU A CA  1 
ATOM   6616  C C   . LEU B 1 361 ? 31.725  71.198  147.231 1.00 52.72 ? 361 LEU A C   1 
ATOM   6617  O O   . LEU B 1 361 ? 32.201  72.243  146.790 1.00 52.78 ? 361 LEU A O   1 
ATOM   6618  C CB  . LEU B 1 361 ? 29.313  71.614  147.766 1.00 52.71 ? 361 LEU A CB  1 
ATOM   6619  C CG  . LEU B 1 361 ? 28.053  71.433  148.618 1.00 52.44 ? 361 LEU A CG  1 
ATOM   6620  C CD1 . LEU B 1 361 ? 26.914  72.265  148.048 1.00 51.63 ? 361 LEU A CD1 1 
ATOM   6621  C CD2 . LEU B 1 361 ? 27.646  69.962  148.737 1.00 51.95 ? 361 LEU A CD2 1 
ATOM   6622  N N   . ASP B 1 362 ? 32.086  69.996  146.793 1.00 52.68 ? 362 ASP A N   1 
ATOM   6623  C CA  . ASP B 1 362 ? 32.968  69.824  145.644 1.00 52.76 ? 362 ASP A CA  1 
ATOM   6624  C C   . ASP B 1 362 ? 32.139  69.557  144.393 1.00 52.64 ? 362 ASP A C   1 
ATOM   6625  O O   . ASP B 1 362 ? 31.490  68.511  144.284 1.00 52.79 ? 362 ASP A O   1 
ATOM   6626  C CB  . ASP B 1 362 ? 33.960  68.687  145.887 1.00 52.85 ? 362 ASP A CB  1 
ATOM   6627  C CG  . ASP B 1 362 ? 35.098  69.089  146.808 1.00 53.58 ? 362 ASP A CG  1 
ATOM   6628  O OD1 . ASP B 1 362 ? 35.022  70.168  147.439 1.00 54.10 ? 362 ASP A OD1 1 
ATOM   6629  O OD2 . ASP B 1 362 ? 36.078  68.320  146.903 1.00 54.53 ? 362 ASP A OD2 1 
ATOM   6630  N N   . LEU B 1 363 ? 32.159  70.508  143.459 1.00 52.28 ? 363 LEU A N   1 
ATOM   6631  C CA  . LEU B 1 363 ? 31.294  70.447  142.282 1.00 51.99 ? 363 LEU A CA  1 
ATOM   6632  C C   . LEU B 1 363 ? 32.051  70.407  140.958 1.00 51.83 ? 363 LEU A C   1 
ATOM   6633  O O   . LEU B 1 363 ? 33.054  71.098  140.779 1.00 51.82 ? 363 LEU A O   1 
ATOM   6634  C CB  . LEU B 1 363 ? 30.306  71.623  142.275 1.00 51.95 ? 363 LEU A CB  1 
ATOM   6635  C CG  . LEU B 1 363 ? 29.281  71.765  143.409 1.00 51.96 ? 363 LEU A CG  1 
ATOM   6636  C CD1 . LEU B 1 363 ? 28.648  73.139  143.375 1.00 50.92 ? 363 LEU A CD1 1 
ATOM   6637  C CD2 . LEU B 1 363 ? 28.203  70.690  143.351 1.00 51.85 ? 363 LEU A CD2 1 
ATOM   6638  N N   . ILE B 1 364 ? 31.561  69.578  140.042 1.00 51.77 ? 364 ILE A N   1 
ATOM   6639  C CA  . ILE B 1 364 ? 31.948  69.637  138.636 1.00 51.77 ? 364 ILE A CA  1 
ATOM   6640  C C   . ILE B 1 364 ? 31.083  70.707  137.984 1.00 51.83 ? 364 ILE A C   1 
ATOM   6641  O O   . ILE B 1 364 ? 29.872  70.772  138.221 1.00 52.03 ? 364 ILE A O   1 
ATOM   6642  C CB  . ILE B 1 364 ? 31.717  68.281  137.909 1.00 51.72 ? 364 ILE A CB  1 
ATOM   6643  C CG1 . ILE B 1 364 ? 32.488  67.139  138.585 1.00 51.61 ? 364 ILE A CG1 1 
ATOM   6644  C CG2 . ILE B 1 364 ? 32.058  68.379  136.422 1.00 51.68 ? 364 ILE A CG2 1 
ATOM   6645  C CD1 . ILE B 1 364 ? 33.993  67.284  138.564 1.00 52.10 ? 364 ILE A CD1 1 
ATOM   6646  N N   . THR B 1 365 ? 31.705  71.560  137.179 1.00 51.77 ? 365 THR A N   1 
ATOM   6647  C CA  . THR B 1 365 ? 30.979  72.641  136.521 1.00 51.81 ? 365 THR A CA  1 
ATOM   6648  C C   . THR B 1 365 ? 31.217  72.618  135.012 1.00 51.53 ? 365 THR A C   1 
ATOM   6649  O O   . THR B 1 365 ? 32.359  72.492  134.555 1.00 51.70 ? 365 THR A O   1 
ATOM   6650  C CB  . THR B 1 365 ? 31.309  74.032  137.142 1.00 51.84 ? 365 THR A CB  1 
ATOM   6651  O OG1 . THR B 1 365 ? 30.434  75.015  136.591 1.00 52.13 ? 365 THR A OG1 1 
ATOM   6652  C CG2 . THR B 1 365 ? 32.768  74.453  136.891 1.00 52.46 ? 365 THR A CG2 1 
ATOM   6653  N N   . THR B 1 366 ? 30.136  72.714  134.242 1.00 51.09 ? 366 THR A N   1 
ATOM   6654  C CA  . THR B 1 366 ? 30.248  72.690  132.787 1.00 50.77 ? 366 THR A CA  1 
ATOM   6655  C C   . THR B 1 366 ? 30.571  74.089  132.289 1.00 50.56 ? 366 THR A C   1 
ATOM   6656  O O   . THR B 1 366 ? 30.289  75.067  132.975 1.00 50.66 ? 366 THR A O   1 
ATOM   6657  C CB  . THR B 1 366 ? 28.964  72.179  132.099 1.00 50.75 ? 366 THR A CB  1 
ATOM   6658  O OG1 . THR B 1 366 ? 27.907  73.124  132.284 1.00 50.84 ? 366 THR A OG1 1 
ATOM   6659  C CG2 . THR B 1 366 ? 28.546  70.827  132.658 1.00 50.60 ? 366 THR A CG2 1 
ATOM   6660  N N   . ALA B 1 367 ? 31.173  74.173  131.104 1.00 50.38 ? 367 ALA A N   1 
ATOM   6661  C CA  . ALA B 1 367 ? 31.483  75.457  130.476 1.00 50.01 ? 367 ALA A CA  1 
ATOM   6662  C C   . ALA B 1 367 ? 30.226  76.322  130.346 1.00 49.85 ? 367 ALA A C   1 
ATOM   6663  O O   . ALA B 1 367 ? 29.161  75.828  129.948 1.00 49.77 ? 367 ALA A O   1 
ATOM   6664  C CB  . ALA B 1 367 ? 32.131  75.243  129.117 1.00 49.98 ? 367 ALA A CB  1 
ATOM   6665  N N   . PRO B 1 368 ? 30.340  77.613  130.705 1.00 49.56 ? 368 PRO A N   1 
ATOM   6666  C CA  . PRO B 1 368 ? 29.214  78.530  130.631 1.00 49.40 ? 368 PRO A CA  1 
ATOM   6667  C C   . PRO B 1 368 ? 28.730  78.737  129.196 1.00 49.37 ? 368 PRO A C   1 
ATOM   6668  O O   . PRO B 1 368 ? 29.532  78.923  128.282 1.00 49.39 ? 368 PRO A O   1 
ATOM   6669  C CB  . PRO B 1 368 ? 29.781  79.825  131.216 1.00 49.24 ? 368 PRO A CB  1 
ATOM   6670  C CG  . PRO B 1 368 ? 31.244  79.720  131.036 1.00 49.36 ? 368 PRO A CG  1 
ATOM   6671  C CD  . PRO B 1 368 ? 31.552  78.278  131.213 1.00 49.61 ? 368 PRO A CD  1 
ATOM   6672  N N   . THR B 1 369 ? 27.418  78.674  129.012 1.00 49.37 ? 369 THR A N   1 
ATOM   6673  C CA  . THR B 1 369 ? 26.798  78.862  127.708 1.00 49.49 ? 369 THR A CA  1 
ATOM   6674  C C   . THR B 1 369 ? 25.817  80.025  127.800 1.00 49.51 ? 369 THR A C   1 
ATOM   6675  O O   . THR B 1 369 ? 25.091  80.147  128.788 1.00 49.76 ? 369 THR A O   1 
ATOM   6676  C CB  . THR B 1 369 ? 26.120  77.556  127.188 1.00 49.48 ? 369 THR A CB  1 
ATOM   6677  O OG1 . THR B 1 369 ? 24.914  77.874  126.483 1.00 49.83 ? 369 THR A OG1 1 
ATOM   6678  C CG2 . THR B 1 369 ? 25.783  76.611  128.335 1.00 49.50 ? 369 THR A CG2 1 
ATOM   6679  N N   . VAL B 1 370 ? 25.812  80.877  126.776 1.00 49.33 ? 370 VAL A N   1 
ATOM   6680  C CA  . VAL B 1 370 ? 25.037  82.121  126.787 1.00 49.20 ? 370 VAL A CA  1 
ATOM   6681  C C   . VAL B 1 370 ? 23.665  81.975  126.113 1.00 49.22 ? 370 VAL A C   1 
ATOM   6682  O O   . VAL B 1 370 ? 23.306  80.891  125.648 1.00 49.22 ? 370 VAL A O   1 
ATOM   6683  C CB  . VAL B 1 370 ? 25.829  83.293  126.136 1.00 49.30 ? 370 VAL A CB  1 
ATOM   6684  C CG1 . VAL B 1 370 ? 27.126  83.559  126.891 1.00 49.36 ? 370 VAL A CG1 1 
ATOM   6685  C CG2 . VAL B 1 370 ? 26.116  83.012  124.667 1.00 49.21 ? 370 VAL A CG2 1 
ATOM   6686  N N   . VAL B 1 371 ? 22.912  83.075  126.067 1.00 49.14 ? 371 VAL A N   1 
ATOM   6687  C CA  . VAL B 1 371 ? 21.584  83.100  125.457 1.00 49.07 ? 371 VAL A CA  1 
ATOM   6688  C C   . VAL B 1 371 ? 21.660  83.523  123.991 1.00 49.23 ? 371 VAL A C   1 
ATOM   6689  O O   . VAL B 1 371 ? 22.137  84.615  123.676 1.00 49.26 ? 371 VAL A O   1 
ATOM   6690  C CB  . VAL B 1 371 ? 20.616  84.058  126.210 1.00 49.05 ? 371 VAL A CB  1 
ATOM   6691  C CG1 . VAL B 1 371 ? 19.182  83.921  125.677 1.00 48.69 ? 371 VAL A CG1 1 
ATOM   6692  C CG2 . VAL B 1 371 ? 20.653  83.804  127.710 1.00 48.89 ? 371 VAL A CG2 1 
ATOM   6693  N N   . TYR B 1 372 ? 21.175  82.657  123.105 1.00 49.37 ? 372 TYR A N   1 
ATOM   6694  C CA  . TYR B 1 372 ? 21.120  82.954  121.676 1.00 49.57 ? 372 TYR A CA  1 
ATOM   6695  C C   . TYR B 1 372 ? 19.712  83.345  121.242 1.00 49.80 ? 372 TYR A C   1 
ATOM   6696  O O   . TYR B 1 372 ? 18.731  83.012  121.911 1.00 49.84 ? 372 TYR A O   1 
ATOM   6697  C CB  . TYR B 1 372 ? 21.635  81.765  120.855 1.00 49.46 ? 372 TYR A CB  1 
ATOM   6698  C CG  . TYR B 1 372 ? 23.076  81.431  121.153 1.00 49.46 ? 372 TYR A CG  1 
ATOM   6699  C CD1 . TYR B 1 372 ? 24.115  82.023  120.434 1.00 49.38 ? 372 TYR A CD1 1 
ATOM   6700  C CD2 . TYR B 1 372 ? 23.404  80.539  122.176 1.00 49.78 ? 372 TYR A CD2 1 
ATOM   6701  C CE1 . TYR B 1 372 ? 25.448  81.726  120.724 1.00 49.59 ? 372 TYR A CE1 1 
ATOM   6702  C CE2 . TYR B 1 372 ? 24.728  80.237  122.474 1.00 49.53 ? 372 TYR A CE2 1 
ATOM   6703  C CZ  . TYR B 1 372 ? 25.744  80.832  121.749 1.00 49.41 ? 372 TYR A CZ  1 
ATOM   6704  O OH  . TYR B 1 372 ? 27.049  80.526  122.052 1.00 48.96 ? 372 TYR A OH  1 
ATOM   6705  N N   . GLU B 1 373 ? 19.630  84.067  120.128 1.00 50.10 ? 373 GLU A N   1 
ATOM   6706  C CA  . GLU B 1 373 ? 18.360  84.470  119.540 1.00 50.47 ? 373 GLU A CA  1 
ATOM   6707  C C   . GLU B 1 373 ? 18.205  83.780  118.185 1.00 50.83 ? 373 GLU A C   1 
ATOM   6708  O O   . GLU B 1 373 ? 18.959  84.062  117.256 1.00 50.87 ? 373 GLU A O   1 
ATOM   6709  C CB  . GLU B 1 373 ? 18.306  85.995  119.384 1.00 50.32 ? 373 GLU A CB  1 
ATOM   6710  C CG  . GLU B 1 373 ? 16.939  86.526  118.993 1.00 50.34 ? 373 GLU A CG  1 
ATOM   6711  C CD  . GLU B 1 373 ? 16.900  88.032  118.827 1.00 50.42 ? 373 GLU A CD  1 
ATOM   6712  O OE1 . GLU B 1 373 ? 17.592  88.561  117.933 1.00 50.79 ? 373 GLU A OE1 1 
ATOM   6713  O OE2 . GLU B 1 373 ? 16.155  88.688  119.582 1.00 50.28 ? 373 GLU A OE2 1 
ATOM   6714  N N   . VAL B 1 374 ? 17.238  82.870  118.074 1.00 51.31 ? 374 VAL A N   1 
ATOM   6715  C CA  . VAL B 1 374 ? 17.101  82.061  116.856 1.00 51.80 ? 374 VAL A CA  1 
ATOM   6716  C C   . VAL B 1 374 ? 15.801  82.323  116.100 1.00 52.22 ? 374 VAL A C   1 
ATOM   6717  O O   . VAL B 1 374 ? 14.714  82.324  116.688 1.00 52.35 ? 374 VAL A O   1 
ATOM   6718  C CB  . VAL B 1 374 ? 17.207  80.543  117.140 1.00 51.78 ? 374 VAL A CB  1 
ATOM   6719  C CG1 . VAL B 1 374 ? 17.630  79.804  115.878 1.00 51.85 ? 374 VAL A CG1 1 
ATOM   6720  C CG2 . VAL B 1 374 ? 18.189  80.262  118.272 1.00 51.75 ? 374 VAL A CG2 1 
ATOM   6721  N N   . GLU B 1 375 ? 15.931  82.534  114.791 1.00 52.64 ? 375 GLU A N   1 
ATOM   6722  C CA  . GLU B 1 375 ? 14.782  82.661  113.904 1.00 53.01 ? 375 GLU A CA  1 
ATOM   6723  C C   . GLU B 1 375 ? 14.521  81.332  113.212 1.00 53.35 ? 375 GLU A C   1 
ATOM   6724  O O   . GLU B 1 375 ? 15.353  80.849  112.440 1.00 53.37 ? 375 GLU A O   1 
ATOM   6725  C CB  . GLU B 1 375 ? 15.008  83.768  112.874 1.00 53.01 ? 375 GLU A CB  1 
ATOM   6726  C CG  . GLU B 1 375 ? 13.799  84.049  111.989 1.00 53.12 ? 375 GLU A CG  1 
ATOM   6727  C CD  . GLU B 1 375 ? 13.671  85.513  111.611 1.00 53.07 ? 375 GLU A CD  1 
ATOM   6728  O OE1 . GLU B 1 375 ? 13.430  85.808  110.423 1.00 53.14 ? 375 GLU A OE1 1 
ATOM   6729  O OE2 . GLU B 1 375 ? 13.807  86.371  112.506 1.00 53.30 ? 375 GLU A OE2 1 
ATOM   6730  N N   . THR B 1 376 ? 13.360  80.750  113.500 1.00 53.82 ? 376 THR A N   1 
ATOM   6731  C CA  . THR B 1 376 ? 12.962  79.459  112.939 1.00 54.27 ? 376 THR A CA  1 
ATOM   6732  C C   . THR B 1 376 ? 12.686  79.587  111.438 1.00 54.45 ? 376 THR A C   1 
ATOM   6733  O O   . THR B 1 376 ? 12.523  80.699  110.923 1.00 54.48 ? 376 THR A O   1 
ATOM   6734  C CB  . THR B 1 376 ? 11.728  78.877  113.687 1.00 54.34 ? 376 THR A CB  1 
ATOM   6735  O OG1 . THR B 1 376 ? 11.937  78.972  115.103 1.00 54.73 ? 376 THR A OG1 1 
ATOM   6736  C CG2 . THR B 1 376 ? 11.485  77.405  113.325 1.00 54.53 ? 376 THR A CG2 1 
ATOM   6737  N N   . THR B 1 377 ? 12.671  78.445  110.746 1.00 54.69 ? 377 THR A N   1 
ATOM   6738  C CA  . THR B 1 377 ? 12.289  78.363  109.332 1.00 54.92 ? 377 THR A CA  1 
ATOM   6739  C C   . THR B 1 377 ? 10.941  79.064  109.099 1.00 55.07 ? 377 THR A C   1 
ATOM   6740  O O   . THR B 1 377 ? 10.798  79.858  108.166 1.00 54.98 ? 377 THR A O   1 
ATOM   6741  C CB  . THR B 1 377 ? 12.280  76.889  108.819 1.00 54.92 ? 377 THR A CB  1 
ATOM   6742  O OG1 . THR B 1 377 ? 11.771  76.842  107.480 1.00 55.12 ? 377 THR A OG1 1 
ATOM   6743  C CG2 . THR B 1 377 ? 11.438  75.972  109.721 1.00 54.85 ? 377 THR A CG2 1 
ATOM   6744  N N   . SER B 1 378 ? 9.972   78.761  109.964 1.00 55.26 ? 378 SER A N   1 
ATOM   6745  C CA  . SER B 1 378 ? 8.761   79.558  110.118 1.00 55.42 ? 378 SER A CA  1 
ATOM   6746  C C   . SER B 1 378 ? 9.121   80.717  111.045 1.00 55.45 ? 378 SER A C   1 
ATOM   6747  O O   . SER B 1 378 ? 9.150   80.553  112.270 1.00 55.49 ? 378 SER A O   1 
ATOM   6748  C CB  . SER B 1 378 ? 7.641   78.705  110.721 1.00 55.44 ? 378 SER A CB  1 
ATOM   6749  O OG  . SER B 1 378 ? 6.446   79.453  110.878 1.00 55.75 ? 378 SER A OG  1 
ATOM   6750  N N   . ARG B 1 379 ? 9.402   81.878  110.449 1.00 55.39 ? 379 ARG A N   1 
ATOM   6751  C CA  . ARG B 1 379 ? 10.082  82.986  111.140 1.00 55.39 ? 379 ARG A CA  1 
ATOM   6752  C C   . ARG B 1 379 ? 9.454   83.431  112.462 1.00 55.27 ? 379 ARG A C   1 
ATOM   6753  O O   . ARG B 1 379 ? 8.554   84.273  112.490 1.00 55.33 ? 379 ARG A O   1 
ATOM   6754  C CB  . ARG B 1 379 ? 10.258  84.193  110.212 1.00 55.41 ? 379 ARG A CB  1 
ATOM   6755  C CG  . ARG B 1 379 ? 11.163  83.956  109.020 1.00 55.64 ? 379 ARG A CG  1 
ATOM   6756  C CD  . ARG B 1 379 ? 11.044  85.118  108.056 1.00 56.12 ? 379 ARG A CD  1 
ATOM   6757  N NE  . ARG B 1 379 ? 11.847  84.934  106.851 1.00 56.80 ? 379 ARG A NE  1 
ATOM   6758  C CZ  . ARG B 1 379 ? 12.934  85.641  106.554 1.00 57.19 ? 379 ARG A CZ  1 
ATOM   6759  N NH1 . ARG B 1 379 ? 13.362  86.597  107.372 1.00 57.32 ? 379 ARG A NH1 1 
ATOM   6760  N NH2 . ARG B 1 379 ? 13.590  85.397  105.428 1.00 57.35 ? 379 ARG A NH2 1 
ATOM   6761  N N   . GLU B 1 380 ? 9.946   82.846  113.550 1.00 55.13 ? 380 GLU A N   1 
ATOM   6762  C CA  . GLU B 1 380 ? 9.600   83.272  114.902 1.00 55.04 ? 380 GLU A CA  1 
ATOM   6763  C C   . GLU B 1 380 ? 10.875  83.346  115.745 1.00 54.79 ? 380 GLU A C   1 
ATOM   6764  O O   . GLU B 1 380 ? 11.822  82.585  115.522 1.00 54.66 ? 380 GLU A O   1 
ATOM   6765  C CB  . GLU B 1 380 ? 8.558   82.339  115.533 1.00 55.00 ? 380 GLU A CB  1 
ATOM   6766  C CG  . GLU B 1 380 ? 9.040   80.906  115.784 1.00 55.38 ? 380 GLU A CG  1 
ATOM   6767  C CD  . GLU B 1 380 ? 7.907   79.923  116.044 1.00 55.39 ? 380 GLU A CD  1 
ATOM   6768  O OE1 . GLU B 1 380 ? 6.728   80.283  115.824 1.00 56.13 ? 380 GLU A OE1 1 
ATOM   6769  O OE2 . GLU B 1 380 ? 8.201   78.781  116.461 1.00 55.46 ? 380 GLU A OE2 1 
ATOM   6770  N N   . VAL B 1 381 ? 10.896  84.275  116.696 1.00 54.59 ? 381 VAL A N   1 
ATOM   6771  C CA  . VAL B 1 381 ? 12.080  84.513  117.519 1.00 54.43 ? 381 VAL A CA  1 
ATOM   6772  C C   . VAL B 1 381 ? 11.989  83.738  118.836 1.00 54.22 ? 381 VAL A C   1 
ATOM   6773  O O   . VAL B 1 381 ? 11.173  84.061  119.702 1.00 54.20 ? 381 VAL A O   1 
ATOM   6774  C CB  . VAL B 1 381 ? 12.312  86.042  117.772 1.00 54.49 ? 381 VAL A CB  1 
ATOM   6775  C CG1 . VAL B 1 381 ? 13.460  86.278  118.744 1.00 54.59 ? 381 VAL A CG1 1 
ATOM   6776  C CG2 . VAL B 1 381 ? 12.577  86.780  116.464 1.00 54.40 ? 381 VAL A CG2 1 
ATOM   6777  N N   . ILE B 1 382 ? 12.818  82.706  118.970 1.00 54.08 ? 382 ILE A N   1 
ATOM   6778  C CA  . ILE B 1 382 ? 12.939  81.970  120.236 1.00 54.01 ? 382 ILE A CA  1 
ATOM   6779  C C   . ILE B 1 382 ? 14.339  82.113  120.839 1.00 53.87 ? 382 ILE A C   1 
ATOM   6780  O O   . ILE B 1 382 ? 15.303  82.439  120.137 1.00 53.82 ? 382 ILE A O   1 
ATOM   6781  C CB  . ILE B 1 382 ? 12.553  80.470  120.105 1.00 53.98 ? 382 ILE A CB  1 
ATOM   6782  C CG1 . ILE B 1 382 ? 13.416  79.774  119.047 1.00 54.03 ? 382 ILE A CG1 1 
ATOM   6783  C CG2 . ILE B 1 382 ? 11.054  80.322  119.804 1.00 54.07 ? 382 ILE A CG2 1 
ATOM   6784  C CD1 . ILE B 1 382 ? 13.496  78.270  119.206 1.00 54.36 ? 382 ILE A CD1 1 
ATOM   6785  N N   . TYR B 1 383 ? 14.439  81.872  122.144 1.00 53.71 ? 383 TYR A N   1 
ATOM   6786  C CA  . TYR B 1 383 ? 15.695  82.040  122.866 1.00 53.48 ? 383 TYR A CA  1 
ATOM   6787  C C   . TYR B 1 383 ? 16.186  80.731  123.460 1.00 53.44 ? 383 TYR A C   1 
ATOM   6788  O O   . TYR B 1 383 ? 15.410  79.962  124.023 1.00 53.29 ? 383 TYR A O   1 
ATOM   6789  C CB  . TYR B 1 383 ? 15.551  83.123  123.935 1.00 53.44 ? 383 TYR A CB  1 
ATOM   6790  C CG  . TYR B 1 383 ? 15.245  84.478  123.342 1.00 53.33 ? 383 TYR A CG  1 
ATOM   6791  C CD1 . TYR B 1 383 ? 13.927  84.893  123.151 1.00 53.45 ? 383 TYR A CD1 1 
ATOM   6792  C CD2 . TYR B 1 383 ? 16.272  85.335  122.943 1.00 53.01 ? 383 TYR A CD2 1 
ATOM   6793  C CE1 . TYR B 1 383 ? 13.637  86.132  122.592 1.00 53.43 ? 383 TYR A CE1 1 
ATOM   6794  C CE2 . TYR B 1 383 ? 15.993  86.575  122.385 1.00 53.12 ? 383 TYR A CE2 1 
ATOM   6795  C CZ  . TYR B 1 383 ? 14.672  86.965  122.211 1.00 53.33 ? 383 TYR A CZ  1 
ATOM   6796  O OH  . TYR B 1 383 ? 14.380  88.187  121.657 1.00 53.35 ? 383 TYR A OH  1 
ATOM   6797  N N   . VAL B 1 384 ? 17.484  80.483  123.319 1.00 53.59 ? 384 VAL A N   1 
ATOM   6798  C CA  . VAL B 1 384 ? 18.071  79.205  123.709 1.00 53.87 ? 384 VAL A CA  1 
ATOM   6799  C C   . VAL B 1 384 ? 19.141  79.370  124.804 1.00 54.01 ? 384 VAL A C   1 
ATOM   6800  O O   . VAL B 1 384 ? 20.107  80.119  124.632 1.00 53.96 ? 384 VAL A O   1 
ATOM   6801  C CB  . VAL B 1 384 ? 18.641  78.455  122.468 1.00 53.89 ? 384 VAL A CB  1 
ATOM   6802  C CG1 . VAL B 1 384 ? 19.142  77.075  122.848 1.00 53.87 ? 384 VAL A CG1 1 
ATOM   6803  C CG2 . VAL B 1 384 ? 17.578  78.335  121.378 1.00 53.75 ? 384 VAL A CG2 1 
ATOM   6804  N N   . ASP B 1 385 ? 18.947  78.673  125.927 1.00 54.18 ? 385 ASP A N   1 
ATOM   6805  C CA  . ASP B 1 385 ? 19.890  78.695  127.050 1.00 54.26 ? 385 ASP A CA  1 
ATOM   6806  C C   . ASP B 1 385 ? 20.850  77.534  126.915 1.00 54.31 ? 385 ASP A C   1 
ATOM   6807  O O   . ASP B 1 385 ? 22.055  77.680  127.119 1.00 54.44 ? 385 ASP A O   1 
ATOM   6808  C CB  . ASP B 1 385 ? 19.178  78.540  128.402 1.00 54.23 ? 385 ASP A CB  1 
ATOM   6809  C CG  . ASP B 1 385 ? 17.768  79.083  128.393 1.00 54.52 ? 385 ASP A CG  1 
ATOM   6810  O OD1 . ASP B 1 385 ? 17.594  80.306  128.194 1.00 55.48 ? 385 ASP A OD1 1 
ATOM   6811  O OD2 . ASP B 1 385 ? 16.831  78.281  128.605 1.00 54.66 ? 385 ASP A OD2 1 
ATOM   6812  N N   . SER B 1 386 ? 20.293  76.370  126.600 1.00 54.42 ? 386 SER A N   1 
ATOM   6813  C CA  . SER B 1 386 ? 21.061  75.145  126.514 1.00 54.61 ? 386 SER A CA  1 
ATOM   6814  C C   . SER B 1 386 ? 21.070  74.655  125.078 1.00 54.73 ? 386 SER A C   1 
ATOM   6815  O O   . SER B 1 386 ? 20.007  74.510  124.474 1.00 54.80 ? 386 SER A O   1 
ATOM   6816  C CB  . SER B 1 386 ? 20.467  74.078  127.431 1.00 54.71 ? 386 SER A CB  1 
ATOM   6817  O OG  . SER B 1 386 ? 19.213  73.636  126.946 1.00 54.52 ? 386 SER A OG  1 
ATOM   6818  N N   . PRO B 1 387 ? 22.273  74.401  124.529 1.00 54.85 ? 387 PRO A N   1 
ATOM   6819  C CA  . PRO B 1 387 ? 22.472  73.899  123.166 1.00 54.96 ? 387 PRO A CA  1 
ATOM   6820  C C   . PRO B 1 387 ? 21.533  72.752  122.776 1.00 55.09 ? 387 PRO A C   1 
ATOM   6821  O O   . PRO B 1 387 ? 20.945  72.793  121.697 1.00 55.31 ? 387 PRO A O   1 
ATOM   6822  C CB  . PRO B 1 387 ? 23.926  73.428  123.185 1.00 54.98 ? 387 PRO A CB  1 
ATOM   6823  C CG  . PRO B 1 387 ? 24.580  74.347  124.153 1.00 54.94 ? 387 PRO A CG  1 
ATOM   6824  C CD  . PRO B 1 387 ? 23.559  74.609  125.224 1.00 54.81 ? 387 PRO A CD  1 
ATOM   6825  N N   . SER B 1 388 ? 21.382  71.757  123.650 1.00 55.19 ? 388 SER A N   1 
ATOM   6826  C CA  . SER B 1 388 ? 20.517  70.594  123.393 1.00 55.30 ? 388 SER A CA  1 
ATOM   6827  C C   . SER B 1 388 ? 19.110  70.954  122.907 1.00 55.48 ? 388 SER A C   1 
ATOM   6828  O O   . SER B 1 388 ? 18.501  70.202  122.139 1.00 55.54 ? 388 SER A O   1 
ATOM   6829  C CB  . SER B 1 388 ? 20.422  69.717  124.643 1.00 55.28 ? 388 SER A CB  1 
ATOM   6830  O OG  . SER B 1 388 ? 20.091  70.488  125.784 1.00 55.13 ? 388 SER A OG  1 
ATOM   6831  N N   . LYS B 1 389 ? 18.613  72.108  123.348 1.00 55.69 ? 389 LYS A N   1 
ATOM   6832  C CA  . LYS B 1 389 ? 17.274  72.579  122.992 1.00 55.96 ? 389 LYS A CA  1 
ATOM   6833  C C   . LYS B 1 389 ? 17.219  73.302  121.649 1.00 55.93 ? 389 LYS A C   1 
ATOM   6834  O O   . LYS B 1 389 ? 16.145  73.415  121.055 1.00 56.04 ? 389 LYS A O   1 
ATOM   6835  C CB  . LYS B 1 389 ? 16.712  73.487  124.091 1.00 56.05 ? 389 LYS A CB  1 
ATOM   6836  C CG  . LYS B 1 389 ? 16.396  72.762  125.386 1.00 56.71 ? 389 LYS A CG  1 
ATOM   6837  C CD  . LYS B 1 389 ? 15.871  73.716  126.445 1.00 57.99 ? 389 LYS A CD  1 
ATOM   6838  C CE  . LYS B 1 389 ? 15.506  72.963  127.722 1.00 58.74 ? 389 LYS A CE  1 
ATOM   6839  N NZ  . LYS B 1 389 ? 14.690  73.804  128.645 1.00 59.26 ? 389 LYS A NZ  1 
ATOM   6840  N N   . LEU B 1 390 ? 18.367  73.794  121.184 1.00 55.90 ? 390 LEU A N   1 
ATOM   6841  C CA  . LEU B 1 390 ? 18.454  74.519  119.913 1.00 55.93 ? 390 LEU A CA  1 
ATOM   6842  C C   . LEU B 1 390 ? 17.821  73.710  118.782 1.00 55.97 ? 390 LEU A C   1 
ATOM   6843  O O   . LEU B 1 390 ? 18.161  72.539  118.603 1.00 56.00 ? 390 LEU A O   1 
ATOM   6844  C CB  . LEU B 1 390 ? 19.916  74.843  119.577 1.00 55.95 ? 390 LEU A CB  1 
ATOM   6845  C CG  . LEU B 1 390 ? 20.256  75.625  118.302 1.00 55.99 ? 390 LEU A CG  1 
ATOM   6846  C CD1 . LEU B 1 390 ? 20.156  77.120  118.543 1.00 56.09 ? 390 LEU A CD1 1 
ATOM   6847  C CD2 . LEU B 1 390 ? 21.654  75.270  117.811 1.00 55.97 ? 390 LEU A CD2 1 
ATOM   6848  N N   . PRO B 1 391 ? 16.896  74.333  118.019 1.00 56.02 ? 391 PRO A N   1 
ATOM   6849  C CA  . PRO B 1 391 ? 16.191  73.677  116.907 1.00 55.98 ? 391 PRO A CA  1 
ATOM   6850  C C   . PRO B 1 391 ? 17.143  73.145  115.832 1.00 55.96 ? 391 PRO A C   1 
ATOM   6851  O O   . PRO B 1 391 ? 18.276  73.619  115.723 1.00 55.89 ? 391 PRO A O   1 
ATOM   6852  C CB  . PRO B 1 391 ? 15.315  74.801  116.335 1.00 55.99 ? 391 PRO A CB  1 
ATOM   6853  C CG  . PRO B 1 391 ? 15.931  76.070  116.828 1.00 55.85 ? 391 PRO A CG  1 
ATOM   6854  C CD  . PRO B 1 391 ? 16.464  75.734  118.177 1.00 56.01 ? 391 PRO A CD  1 
ATOM   6855  N N   . ALA B 1 392 ? 16.676  72.172  115.050 1.00 55.99 ? 392 ALA A N   1 
ATOM   6856  C CA  . ALA B 1 392 ? 17.508  71.507  114.043 1.00 56.04 ? 392 ALA A CA  1 
ATOM   6857  C C   . ALA B 1 392 ? 18.087  72.495  113.038 1.00 56.03 ? 392 ALA A C   1 
ATOM   6858  O O   . ALA B 1 392 ? 17.496  73.546  112.784 1.00 56.09 ? 392 ALA A O   1 
ATOM   6859  C CB  . ALA B 1 392 ? 16.719  70.417  113.330 1.00 56.09 ? 392 ALA A CB  1 
ATOM   6860  N N   . VAL B 1 393 ? 19.242  72.146  112.472 1.00 56.00 ? 393 VAL A N   1 
ATOM   6861  C CA  . VAL B 1 393 ? 19.971  73.011  111.534 1.00 55.94 ? 393 VAL A CA  1 
ATOM   6862  C C   . VAL B 1 393 ? 19.111  73.405  110.328 1.00 55.91 ? 393 VAL A C   1 
ATOM   6863  O O   . VAL B 1 393 ? 19.259  74.501  109.778 1.00 55.83 ? 393 VAL A O   1 
ATOM   6864  C CB  . VAL B 1 393 ? 21.287  72.347  111.048 1.00 55.94 ? 393 VAL A CB  1 
ATOM   6865  C CG1 . VAL B 1 393 ? 22.226  73.381  110.433 1.00 55.72 ? 393 VAL A CG1 1 
ATOM   6866  C CG2 . VAL B 1 393 ? 21.984  71.628  112.200 1.00 56.09 ? 393 VAL A CG2 1 
ATOM   6867  N N   . ASN B 1 394 ? 18.209  72.506  109.941 1.00 55.88 ? 394 ASN A N   1 
ATOM   6868  C CA  . ASN B 1 394 ? 17.281  72.725  108.831 1.00 55.86 ? 394 ASN A CA  1 
ATOM   6869  C C   . ASN B 1 394 ? 16.193  73.740  109.168 1.00 55.70 ? 394 ASN A C   1 
ATOM   6870  O O   . ASN B 1 394 ? 15.695  74.439  108.285 1.00 55.71 ? 394 ASN A O   1 
ATOM   6871  C CB  . ASN B 1 394 ? 16.622  71.404  108.413 1.00 55.93 ? 394 ASN A CB  1 
ATOM   6872  C CG  . ASN B 1 394 ? 17.576  70.220  108.479 1.00 56.29 ? 394 ASN A CG  1 
ATOM   6873  O OD1 . ASN B 1 394 ? 18.257  70.001  109.488 1.00 56.77 ? 394 ASN A OD1 1 
ATOM   6874  N ND2 . ASN B 1 394 ? 17.618  69.441  107.405 1.00 56.42 ? 394 ASN A ND2 1 
ATOM   6875  N N   . ASN B 1 395 ? 15.829  73.807  110.447 1.00 55.54 ? 395 ASN A N   1 
ATOM   6876  C CA  . ASN B 1 395 ? 14.764  74.692  110.918 1.00 55.42 ? 395 ASN A CA  1 
ATOM   6877  C C   . ASN B 1 395 ? 15.233  76.096  111.296 1.00 55.21 ? 395 ASN A C   1 
ATOM   6878  O O   . ASN B 1 395 ? 14.422  76.938  111.677 1.00 55.24 ? 395 ASN A O   1 
ATOM   6879  C CB  . ASN B 1 395 ? 14.026  74.059  112.103 1.00 55.54 ? 395 ASN A CB  1 
ATOM   6880  C CG  . ASN B 1 395 ? 13.342  72.759  111.737 1.00 55.93 ? 395 ASN A CG  1 
ATOM   6881  O OD1 . ASN B 1 395 ? 12.547  72.703  110.795 1.00 56.18 ? 395 ASN A OD1 1 
ATOM   6882  N ND2 . ASN B 1 395 ? 13.646  71.701  112.486 1.00 56.21 ? 395 ASN A ND2 1 
ATOM   6883  N N   . ILE B 1 396 ? 16.537  76.343  111.195 1.00 54.87 ? 396 ILE A N   1 
ATOM   6884  C CA  . ILE B 1 396 ? 17.105  77.645  111.541 1.00 54.57 ? 396 ILE A CA  1 
ATOM   6885  C C   . ILE B 1 396 ? 17.220  78.528  110.301 1.00 54.35 ? 396 ILE A C   1 
ATOM   6886  O O   . ILE B 1 396 ? 17.923  78.179  109.355 1.00 54.41 ? 396 ILE A O   1 
ATOM   6887  C CB  . ILE B 1 396 ? 18.499  77.496  112.210 1.00 54.55 ? 396 ILE A CB  1 
ATOM   6888  C CG1 . ILE B 1 396 ? 18.392  76.685  113.505 1.00 54.51 ? 396 ILE A CG1 1 
ATOM   6889  C CG2 . ILE B 1 396 ? 19.131  78.869  112.476 1.00 54.46 ? 396 ILE A CG2 1 
ATOM   6890  C CD1 . ILE B 1 396 ? 19.713  76.105  113.985 1.00 54.84 ? 396 ILE A CD1 1 
ATOM   6891  N N   . TYR B 1 397 ? 16.526  79.664  110.299 1.00 54.08 ? 397 TYR A N   1 
ATOM   6892  C CA  . TYR B 1 397 ? 16.718  80.647  109.231 1.00 53.93 ? 397 TYR A CA  1 
ATOM   6893  C C   . TYR B 1 397 ? 17.949  81.506  109.515 1.00 53.70 ? 397 TYR A C   1 
ATOM   6894  O O   . TYR B 1 397 ? 18.793  81.703  108.639 1.00 53.75 ? 397 TYR A O   1 
ATOM   6895  C CB  . TYR B 1 397 ? 15.476  81.527  109.011 1.00 54.00 ? 397 TYR A CB  1 
ATOM   6896  C CG  . TYR B 1 397 ? 15.784  82.831  108.298 1.00 54.09 ? 397 TYR A CG  1 
ATOM   6897  C CD1 . TYR B 1 397 ? 16.107  82.851  106.936 1.00 54.33 ? 397 TYR A CD1 1 
ATOM   6898  C CD2 . TYR B 1 397 ? 15.772  84.044  108.989 1.00 54.34 ? 397 TYR A CD2 1 
ATOM   6899  C CE1 . TYR B 1 397 ? 16.406  84.052  106.283 1.00 54.42 ? 397 TYR A CE1 1 
ATOM   6900  C CE2 . TYR B 1 397 ? 16.067  85.250  108.347 1.00 54.28 ? 397 TYR A CE2 1 
ATOM   6901  C CZ  . TYR B 1 397 ? 16.381  85.245  106.996 1.00 54.32 ? 397 TYR A CZ  1 
ATOM   6902  O OH  . TYR B 1 397 ? 16.669  86.432  106.365 1.00 54.12 ? 397 TYR A OH  1 
ATOM   6903  N N   . GLU B 1 398 ? 18.038  82.022  110.738 1.00 53.32 ? 398 GLU A N   1 
ATOM   6904  C CA  . GLU B 1 398 ? 19.152  82.872  111.137 1.00 52.86 ? 398 GLU A CA  1 
ATOM   6905  C C   . GLU B 1 398 ? 19.420  82.720  112.629 1.00 52.61 ? 398 GLU A C   1 
ATOM   6906  O O   . GLU B 1 398 ? 18.540  82.969  113.455 1.00 52.57 ? 398 GLU A O   1 
ATOM   6907  C CB  . GLU B 1 398 ? 18.861  84.333  110.784 1.00 52.88 ? 398 GLU A CB  1 
ATOM   6908  C CG  . GLU B 1 398 ? 20.095  85.216  110.720 1.00 52.76 ? 398 GLU A CG  1 
ATOM   6909  C CD  . GLU B 1 398 ? 19.769  86.667  110.410 1.00 52.67 ? 398 GLU A CD  1 
ATOM   6910  O OE1 . GLU B 1 398 ? 20.360  87.207  109.454 1.00 52.54 ? 398 GLU A OE1 1 
ATOM   6911  O OE2 . GLU B 1 398 ? 18.932  87.268  111.118 1.00 52.27 ? 398 GLU A OE2 1 
ATOM   6912  N N   . LEU B 1 399 ? 20.637  82.294  112.959 1.00 52.26 ? 399 LEU A N   1 
ATOM   6913  C CA  . LEU B 1 399 ? 21.052  82.119  114.345 1.00 51.93 ? 399 LEU A CA  1 
ATOM   6914  C C   . LEU B 1 399 ? 21.820  83.349  114.798 1.00 51.66 ? 399 LEU A C   1 
ATOM   6915  O O   . LEU B 1 399 ? 22.903  83.643  114.284 1.00 51.69 ? 399 LEU A O   1 
ATOM   6916  C CB  . LEU B 1 399 ? 21.889  80.841  114.506 1.00 51.99 ? 399 LEU A CB  1 
ATOM   6917  C CG  . LEU B 1 399 ? 22.546  80.455  115.843 1.00 52.18 ? 399 LEU A CG  1 
ATOM   6918  C CD1 . LEU B 1 399 ? 21.656  80.716  117.056 1.00 52.14 ? 399 LEU A CD1 1 
ATOM   6919  C CD2 . LEU B 1 399 ? 22.988  78.997  115.813 1.00 51.87 ? 399 LEU A CD2 1 
ATOM   6920  N N   . ARG B 1 400 ? 21.245  84.064  115.760 1.00 51.32 ? 400 ARG A N   1 
ATOM   6921  C CA  . ARG B 1 400 ? 21.800  85.336  116.220 1.00 51.00 ? 400 ARG A CA  1 
ATOM   6922  C C   . ARG B 1 400 ? 22.536  85.263  117.563 1.00 50.75 ? 400 ARG A C   1 
ATOM   6923  O O   . ARG B 1 400 ? 22.014  84.774  118.571 1.00 50.55 ? 400 ARG A O   1 
ATOM   6924  C CB  . ARG B 1 400 ? 20.727  86.431  116.216 1.00 51.07 ? 400 ARG A CB  1 
ATOM   6925  C CG  . ARG B 1 400 ? 20.623  87.162  114.889 1.00 50.88 ? 400 ARG A CG  1 
ATOM   6926  C CD  . ARG B 1 400 ? 19.409  88.068  114.819 1.00 50.41 ? 400 ARG A CD  1 
ATOM   6927  N NE  . ARG B 1 400 ? 18.402  87.543  113.901 1.00 50.06 ? 400 ARG A NE  1 
ATOM   6928  C CZ  . ARG B 1 400 ? 17.154  87.231  114.236 1.00 50.02 ? 400 ARG A CZ  1 
ATOM   6929  N NH1 . ARG B 1 400 ? 16.721  87.395  115.481 1.00 49.86 ? 400 ARG A NH1 1 
ATOM   6930  N NH2 . ARG B 1 400 ? 16.331  86.763  113.311 1.00 49.78 ? 400 ARG A NH2 1 
ATOM   6931  N N   . GLU B 1 401 ? 23.761  85.777  117.541 1.00 50.43 ? 401 GLU A N   1 
ATOM   6932  C CA  . GLU B 1 401 ? 24.718  85.646  118.622 1.00 50.18 ? 401 GLU A CA  1 
ATOM   6933  C C   . GLU B 1 401 ? 24.776  86.930  119.445 1.00 49.95 ? 401 GLU A C   1 
ATOM   6934  O O   . GLU B 1 401 ? 24.820  88.024  118.885 1.00 49.88 ? 401 GLU A O   1 
ATOM   6935  C CB  . GLU B 1 401 ? 26.083  85.331  118.008 1.00 50.22 ? 401 GLU A CB  1 
ATOM   6936  C CG  . GLU B 1 401 ? 27.280  85.376  118.940 1.00 50.41 ? 401 GLU A CG  1 
ATOM   6937  C CD  . GLU B 1 401 ? 28.594  85.318  118.181 1.00 50.26 ? 401 GLU A CD  1 
ATOM   6938  O OE1 . GLU B 1 401 ? 28.667  85.846  117.049 1.00 49.94 ? 401 GLU A OE1 1 
ATOM   6939  O OE2 . GLU B 1 401 ? 29.557  84.734  118.715 1.00 50.58 ? 401 GLU A OE2 1 
ATOM   6940  N N   . PRO B 1 402 ? 24.772  86.802  120.783 1.00 49.83 ? 402 PRO A N   1 
ATOM   6941  C CA  . PRO B 1 402 ? 24.892  87.984  121.627 1.00 49.85 ? 402 PRO A CA  1 
ATOM   6942  C C   . PRO B 1 402 ? 26.280  88.612  121.503 1.00 49.93 ? 402 PRO A C   1 
ATOM   6943  O O   . PRO B 1 402 ? 27.285  87.893  121.450 1.00 49.93 ? 402 PRO A O   1 
ATOM   6944  C CB  . PRO B 1 402 ? 24.677  87.427  123.036 1.00 49.79 ? 402 PRO A CB  1 
ATOM   6945  C CG  . PRO B 1 402 ? 25.075  86.006  122.940 1.00 49.65 ? 402 PRO A CG  1 
ATOM   6946  C CD  . PRO B 1 402 ? 24.659  85.567  121.578 1.00 49.73 ? 402 PRO A CD  1 
ATOM   6947  N N   . ILE B 1 403 ? 26.320  89.940  121.437 1.00 50.00 ? 403 ILE A N   1 
ATOM   6948  C CA  . ILE B 1 403 ? 27.574  90.683  121.334 1.00 50.08 ? 403 ILE A CA  1 
ATOM   6949  C C   . ILE B 1 403 ? 27.743  91.578  122.553 1.00 50.28 ? 403 ILE A C   1 
ATOM   6950  O O   . ILE B 1 403 ? 26.844  92.344  122.903 1.00 50.32 ? 403 ILE A O   1 
ATOM   6951  C CB  . ILE B 1 403 ? 27.645  91.547  120.038 1.00 50.01 ? 403 ILE A CB  1 
ATOM   6952  C CG1 . ILE B 1 403 ? 27.317  90.720  118.783 1.00 49.92 ? 403 ILE A CG1 1 
ATOM   6953  C CG2 . ILE B 1 403 ? 29.008  92.231  119.908 1.00 49.82 ? 403 ILE A CG2 1 
ATOM   6954  C CD1 . ILE B 1 403 ? 28.359  89.671  118.401 1.00 49.93 ? 403 ILE A CD1 1 
ATOM   6955  N N   . ALA B 1 404 ? 28.899  91.467  123.199 1.00 50.64 ? 404 ALA A N   1 
ATOM   6956  C CA  . ALA B 1 404 ? 29.219  92.282  124.366 1.00 50.90 ? 404 ALA A CA  1 
ATOM   6957  C C   . ALA B 1 404 ? 30.117  93.446  123.972 1.00 51.08 ? 404 ALA A C   1 
ATOM   6958  O O   . ALA B 1 404 ? 31.075  93.271  123.211 1.00 51.26 ? 404 ALA A O   1 
ATOM   6959  C CB  . ALA B 1 404 ? 29.889  91.432  125.440 1.00 50.80 ? 404 ALA A CB  1 
ATOM   6960  N N   . GLU B 1 405 ? 29.793  94.634  124.477 1.00 51.25 ? 405 GLU A N   1 
ATOM   6961  C CA  . GLU B 1 405 ? 30.652  95.803  124.309 1.00 51.43 ? 405 GLU A CA  1 
ATOM   6962  C C   . GLU B 1 405 ? 31.631  95.886  125.483 1.00 51.60 ? 405 GLU A C   1 
ATOM   6963  O O   . GLU B 1 405 ? 31.220  96.025  126.641 1.00 51.45 ? 405 GLU A O   1 
ATOM   6964  C CB  . GLU B 1 405 ? 29.816  97.079  124.197 1.00 51.37 ? 405 GLU A CB  1 
ATOM   6965  C CG  . GLU B 1 405 ? 30.625  98.325  123.867 1.00 51.49 ? 405 GLU A CG  1 
ATOM   6966  C CD  . GLU B 1 405 ? 29.844  99.609  124.069 1.00 51.54 ? 405 GLU A CD  1 
ATOM   6967  O OE1 . GLU B 1 405 ? 29.155  99.744  125.104 1.00 51.81 ? 405 GLU A OE1 1 
ATOM   6968  O OE2 . GLU B 1 405 ? 29.927  100.490 123.191 1.00 51.78 ? 405 GLU A OE2 1 
ATOM   6969  N N   . CYS B 1 406 ? 32.922  95.802  125.170 1.00 51.88 ? 406 CYS A N   1 
ATOM   6970  C CA  . CYS B 1 406 ? 33.972  95.683  126.182 1.00 52.22 ? 406 CYS A CA  1 
ATOM   6971  C C   . CYS B 1 406 ? 34.833  96.937  126.290 1.00 52.60 ? 406 CYS A C   1 
ATOM   6972  O O   . CYS B 1 406 ? 35.588  97.260  125.376 1.00 52.68 ? 406 CYS A O   1 
ATOM   6973  C CB  . CYS B 1 406 ? 34.857  94.469  125.886 1.00 52.10 ? 406 CYS A CB  1 
ATOM   6974  S SG  . CYS B 1 406 ? 33.957  92.915  125.656 1.00 52.06 ? 406 CYS A SG  1 
ATOM   6975  N N   . HIS B 1 407 ? 34.708  97.635  127.415 1.00 53.16 ? 407 HIS A N   1 
ATOM   6976  C CA  . HIS B 1 407 ? 35.529  98.806  127.719 1.00 53.65 ? 407 HIS A CA  1 
ATOM   6977  C C   . HIS B 1 407 ? 36.757  98.369  128.509 1.00 53.81 ? 407 HIS A C   1 
ATOM   6978  O O   . HIS B 1 407 ? 36.644  97.644  129.500 1.00 53.89 ? 407 HIS A O   1 
ATOM   6979  C CB  . HIS B 1 407 ? 34.731  99.832  128.525 1.00 53.78 ? 407 HIS A CB  1 
ATOM   6980  C CG  . HIS B 1 407 ? 33.431  100.226 127.892 1.00 54.61 ? 407 HIS A CG  1 
ATOM   6981  N ND1 . HIS B 1 407 ? 32.269  99.504  128.067 1.00 55.02 ? 407 HIS A ND1 1 
ATOM   6982  C CD2 . HIS B 1 407 ? 33.109  101.272 127.093 1.00 55.26 ? 407 HIS A CD2 1 
ATOM   6983  C CE1 . HIS B 1 407 ? 31.288  100.085 127.399 1.00 55.41 ? 407 HIS A CE1 1 
ATOM   6984  N NE2 . HIS B 1 407 ? 31.771  101.160 126.799 1.00 55.57 ? 407 HIS A NE2 1 
ATOM   6985  N N   . MET B 1 408 ? 37.930  98.810  128.070 1.00 54.09 ? 408 MET A N   1 
ATOM   6986  C CA  . MET B 1 408 ? 39.180  98.374  128.685 1.00 54.43 ? 408 MET A CA  1 
ATOM   6987  C C   . MET B 1 408 ? 40.168  99.512  128.897 1.00 54.60 ? 408 MET A C   1 
ATOM   6988  O O   . MET B 1 408 ? 40.301  100.393 128.048 1.00 54.61 ? 408 MET A O   1 
ATOM   6989  C CB  . MET B 1 408 ? 39.822  97.269  127.850 1.00 54.37 ? 408 MET A CB  1 
ATOM   6990  C CG  . MET B 1 408 ? 38.882  96.085  127.582 1.00 54.60 ? 408 MET A CG  1 
ATOM   6991  S SD  . MET B 1 408 ? 39.726  94.742  126.706 1.00 54.67 ? 408 MET A SD  1 
ATOM   6992  C CE  . MET B 1 408 ? 40.048  95.546  125.051 1.00 55.43 ? 408 MET A CE  1 
ATOM   6993  N N   . LEU B 1 409 ? 40.842  99.486  130.046 1.00 54.88 ? 409 LEU A N   1 
ATOM   6994  C CA  . LEU B 1 409 ? 41.910  100.434 130.367 1.00 55.16 ? 409 LEU A CA  1 
ATOM   6995  C C   . LEU B 1 409 ? 43.216  99.679  130.501 1.00 55.38 ? 409 LEU A C   1 
ATOM   6996  O O   . LEU B 1 409 ? 43.307  98.713  131.265 1.00 55.48 ? 409 LEU A O   1 
ATOM   6997  C CB  . LEU B 1 409 ? 41.613  101.198 131.665 1.00 55.19 ? 409 LEU A CB  1 
ATOM   6998  C CG  . LEU B 1 409 ? 41.061  102.631 131.638 1.00 55.19 ? 409 LEU A CG  1 
ATOM   6999  C CD1 . LEU B 1 409 ? 42.186  103.659 131.608 1.00 55.31 ? 409 LEU A CD1 1 
ATOM   7000  C CD2 . LEU B 1 409 ? 40.074  102.862 130.484 1.00 55.77 ? 409 LEU A CD2 1 
ATOM   7001  N N   . LEU B 1 410 ? 44.222  100.132 129.757 1.00 55.65 ? 410 LEU A N   1 
ATOM   7002  C CA  . LEU B 1 410 ? 45.505  99.437  129.659 1.00 55.82 ? 410 LEU A CA  1 
ATOM   7003  C C   . LEU B 1 410 ? 46.635  100.404 129.310 1.00 55.86 ? 410 LEU A C   1 
ATOM   7004  O O   . LEU B 1 410 ? 46.451  101.285 128.463 1.00 55.87 ? 410 LEU A O   1 
ATOM   7005  C CB  . LEU B 1 410 ? 45.432  98.315  128.606 1.00 55.88 ? 410 LEU A CB  1 
ATOM   7006  C CG  . LEU B 1 410 ? 45.146  98.673  127.136 1.00 55.93 ? 410 LEU A CG  1 
ATOM   7007  C CD1 . LEU B 1 410 ? 45.790  97.668  126.205 1.00 55.82 ? 410 LEU A CD1 1 
ATOM   7008  C CD2 . LEU B 1 410 ? 43.653  98.827  126.826 1.00 55.46 ? 410 LEU A CD2 1 
ATOM   7009  N N   . PRO B 1 411 ? 47.804  100.253 129.969 1.00 55.90 ? 411 PRO A N   1 
ATOM   7010  C CA  . PRO B 1 411 ? 48.992  101.022 129.591 1.00 55.88 ? 411 PRO A CA  1 
ATOM   7011  C C   . PRO B 1 411 ? 49.442  100.689 128.168 1.00 55.89 ? 411 PRO A C   1 
ATOM   7012  O O   . PRO B 1 411 ? 49.401  99.522  127.763 1.00 55.85 ? 411 PRO A O   1 
ATOM   7013  C CB  . PRO B 1 411 ? 50.045  100.583 130.616 1.00 55.89 ? 411 PRO A CB  1 
ATOM   7014  C CG  . PRO B 1 411 ? 49.554  99.289  131.152 1.00 55.86 ? 411 PRO A CG  1 
ATOM   7015  C CD  . PRO B 1 411 ? 48.065  99.369  131.119 1.00 55.89 ? 411 PRO A CD  1 
ATOM   7016  N N   . GLN B 1 412 ? 49.866  101.720 127.436 1.00 55.89 ? 412 GLN A N   1 
ATOM   7017  C CA  . GLN B 1 412 ? 50.175  101.644 125.998 1.00 55.90 ? 412 GLN A CA  1 
ATOM   7018  C C   . GLN B 1 412 ? 51.059  100.468 125.578 1.00 55.77 ? 412 GLN A C   1 
ATOM   7019  O O   . GLN B 1 412 ? 50.928  99.959  124.469 1.00 55.70 ? 412 GLN A O   1 
ATOM   7020  C CB  . GLN B 1 412 ? 50.812  102.955 125.515 1.00 55.88 ? 412 GLN A CB  1 
ATOM   7021  C CG  . GLN B 1 412 ? 50.048  104.220 125.905 1.00 56.12 ? 412 GLN A CG  1 
ATOM   7022  C CD  . GLN B 1 412 ? 50.488  105.459 125.131 1.00 56.34 ? 412 GLN A CD  1 
ATOM   7023  O OE1 . GLN B 1 412 ? 51.426  105.414 124.328 1.00 56.62 ? 412 GLN A OE1 1 
ATOM   7024  N NE2 . GLN B 1 412 ? 49.804  106.576 125.371 1.00 56.96 ? 412 GLN A NE2 1 
ATOM   7025  N N   . ALA B 1 413 ? 51.950  100.040 126.469 1.00 55.78 ? 413 ALA A N   1 
ATOM   7026  C CA  . ALA B 1 413 ? 52.915  98.982  126.171 1.00 55.82 ? 413 ALA A CA  1 
ATOM   7027  C C   . ALA B 1 413 ? 52.295  97.592  125.954 1.00 55.91 ? 413 ALA A C   1 
ATOM   7028  O O   . ALA B 1 413 ? 53.015  96.629  125.677 1.00 55.88 ? 413 ALA A O   1 
ATOM   7029  C CB  . ALA B 1 413 ? 53.977  98.927  127.262 1.00 55.79 ? 413 ALA A CB  1 
ATOM   7030  N N   . TYR B 1 414 ? 50.970  97.491  126.067 1.00 56.02 ? 414 TYR A N   1 
ATOM   7031  C CA  . TYR B 1 414 ? 50.284  96.198  125.973 1.00 56.02 ? 414 TYR A CA  1 
ATOM   7032  C C   . TYR B 1 414 ? 49.198  96.091  124.894 1.00 56.06 ? 414 TYR A C   1 
ATOM   7033  O O   . TYR B 1 414 ? 48.688  94.994  124.655 1.00 55.98 ? 414 TYR A O   1 
ATOM   7034  C CB  . TYR B 1 414 ? 49.685  95.802  127.329 1.00 55.99 ? 414 TYR A CB  1 
ATOM   7035  C CG  . TYR B 1 414 ? 50.700  95.542  128.419 1.00 55.98 ? 414 TYR A CG  1 
ATOM   7036  C CD1 . TYR B 1 414 ? 51.421  94.347  128.462 1.00 55.79 ? 414 TYR A CD1 1 
ATOM   7037  C CD2 . TYR B 1 414 ? 50.930  96.488  129.418 1.00 55.95 ? 414 TYR A CD2 1 
ATOM   7038  C CE1 . TYR B 1 414 ? 52.354  94.106  129.468 1.00 55.70 ? 414 TYR A CE1 1 
ATOM   7039  C CE2 . TYR B 1 414 ? 51.858  96.257  130.429 1.00 55.86 ? 414 TYR A CE2 1 
ATOM   7040  C CZ  . TYR B 1 414 ? 52.566  95.066  130.449 1.00 55.86 ? 414 TYR A CZ  1 
ATOM   7041  O OH  . TYR B 1 414 ? 53.486  94.838  131.450 1.00 56.03 ? 414 TYR A OH  1 
ATOM   7042  N N   . LEU B 1 415 ? 48.845  97.203  124.245 1.00 56.08 ? 415 LEU A N   1 
ATOM   7043  C CA  . LEU B 1 415 ? 47.727  97.190  123.283 1.00 56.26 ? 415 LEU A CA  1 
ATOM   7044  C C   . LEU B 1 415 ? 47.885  96.186  122.137 1.00 56.19 ? 415 LEU A C   1 
ATOM   7045  O O   . LEU B 1 415 ? 46.905  95.562  121.726 1.00 56.27 ? 415 LEU A O   1 
ATOM   7046  C CB  . LEU B 1 415 ? 47.368  98.588  122.755 1.00 56.21 ? 415 LEU A CB  1 
ATOM   7047  C CG  . LEU B 1 415 ? 48.406  99.691  122.575 1.00 56.55 ? 415 LEU A CG  1 
ATOM   7048  C CD1 . LEU B 1 415 ? 49.492  99.295  121.591 1.00 57.41 ? 415 LEU A CD1 1 
ATOM   7049  C CD2 . LEU B 1 415 ? 47.722  100.964 122.118 1.00 56.46 ? 415 LEU A CD2 1 
ATOM   7050  N N   . GLY B 1 416 ? 49.114  96.035  121.643 1.00 56.07 ? 416 GLY A N   1 
ATOM   7051  C CA  . GLY B 1 416 ? 49.432  95.046  120.615 1.00 55.93 ? 416 GLY A CA  1 
ATOM   7052  C C   . GLY B 1 416 ? 49.082  93.645  121.076 1.00 55.90 ? 416 GLY A C   1 
ATOM   7053  O O   . GLY B 1 416 ? 48.506  92.861  120.325 1.00 55.90 ? 416 GLY A O   1 
ATOM   7054  N N   . ASN B 1 417 ? 49.426  93.342  122.325 1.00 55.84 ? 417 ASN A N   1 
ATOM   7055  C CA  . ASN B 1 417 ? 49.109  92.060  122.944 1.00 55.76 ? 417 ASN A CA  1 
ATOM   7056  C C   . ASN B 1 417 ? 47.626  91.898  123.253 1.00 55.74 ? 417 ASN A C   1 
ATOM   7057  O O   . ASN B 1 417 ? 47.145  90.778  123.429 1.00 55.88 ? 417 ASN A O   1 
ATOM   7058  C CB  . ASN B 1 417 ? 49.923  91.875  124.230 1.00 55.74 ? 417 ASN A CB  1 
ATOM   7059  C CG  . ASN B 1 417 ? 51.312  91.320  123.975 1.00 55.54 ? 417 ASN A CG  1 
ATOM   7060  O OD1 . ASN B 1 417 ? 51.646  90.922  122.858 1.00 55.27 ? 417 ASN A OD1 1 
ATOM   7061  N ND2 . ASN B 1 417 ? 52.129  91.281  125.021 1.00 55.56 ? 417 ASN A ND2 1 
ATOM   7062  N N   . VAL B 1 418 ? 46.908  93.018  123.315 1.00 55.67 ? 418 VAL A N   1 
ATOM   7063  C CA  . VAL B 1 418 ? 45.505  93.016  123.723 1.00 55.54 ? 418 VAL A CA  1 
ATOM   7064  C C   . VAL B 1 418 ? 44.532  92.878  122.548 1.00 55.57 ? 418 VAL A C   1 
ATOM   7065  O O   . VAL B 1 418 ? 43.685  91.987  122.556 1.00 55.55 ? 418 VAL A O   1 
ATOM   7066  C CB  . VAL B 1 418 ? 45.172  94.239  124.610 1.00 55.51 ? 418 VAL A CB  1 
ATOM   7067  C CG1 . VAL B 1 418 ? 43.668  94.393  124.803 1.00 55.41 ? 418 VAL A CG1 1 
ATOM   7068  C CG2 . VAL B 1 418 ? 45.858  94.097  125.955 1.00 55.63 ? 418 VAL A CG2 1 
ATOM   7069  N N   . ILE B 1 419 ? 44.652  93.740  121.539 1.00 55.62 ? 419 ILE A N   1 
ATOM   7070  C CA  . ILE B 1 419 ? 43.768  93.646  120.370 1.00 55.66 ? 419 ILE A CA  1 
ATOM   7071  C C   . ILE B 1 419 ? 44.039  92.359  119.572 1.00 55.63 ? 419 ILE A C   1 
ATOM   7072  O O   . ILE B 1 419 ? 43.145  91.842  118.896 1.00 55.70 ? 419 ILE A O   1 
ATOM   7073  C CB  . ILE B 1 419 ? 43.810  94.912  119.435 1.00 55.64 ? 419 ILE A CB  1 
ATOM   7074  C CG1 . ILE B 1 419 ? 44.896  94.799  118.366 1.00 55.77 ? 419 ILE A CG1 1 
ATOM   7075  C CG2 . ILE B 1 419 ? 43.938  96.211  120.232 1.00 55.80 ? 419 ILE A CG2 1 
ATOM   7076  C CD1 . ILE B 1 419 ? 46.294  94.695  118.920 1.00 56.39 ? 419 ILE A CD1 1 
ATOM   7077  N N   . THR B 1 420 ? 45.270  91.852  119.668 1.00 55.51 ? 420 THR A N   1 
ATOM   7078  C CA  . THR B 1 420 ? 45.653  90.611  119.000 1.00 55.47 ? 420 THR A CA  1 
ATOM   7079  C C   . THR B 1 420 ? 44.913  89.433  119.631 1.00 55.36 ? 420 THR A C   1 
ATOM   7080  O O   . THR B 1 420 ? 44.725  88.400  118.993 1.00 55.43 ? 420 THR A O   1 
ATOM   7081  C CB  . THR B 1 420 ? 47.193  90.385  119.016 1.00 55.48 ? 420 THR A CB  1 
ATOM   7082  O OG1 . THR B 1 420 ? 47.576  89.589  117.889 1.00 55.32 ? 420 THR A OG1 1 
ATOM   7083  C CG2 . THR B 1 420 ? 47.655  89.697  120.303 1.00 55.73 ? 420 THR A CG2 1 
ATOM   7084  N N   . LEU B 1 421 ? 44.508  89.613  120.887 1.00 55.17 ? 421 LEU A N   1 
ATOM   7085  C CA  . LEU B 1 421 ? 43.645  88.679  121.595 1.00 55.02 ? 421 LEU A CA  1 
ATOM   7086  C C   . LEU B 1 421 ? 42.191  88.978  121.231 1.00 54.94 ? 421 LEU A C   1 
ATOM   7087  O O   . LEU B 1 421 ? 41.398  88.063  120.983 1.00 54.98 ? 421 LEU A O   1 
ATOM   7088  C CB  . LEU B 1 421 ? 43.840  88.840  123.106 1.00 54.96 ? 421 LEU A CB  1 
ATOM   7089  C CG  . LEU B 1 421 ? 43.430  87.793  124.149 1.00 54.85 ? 421 LEU A CG  1 
ATOM   7090  C CD1 . LEU B 1 421 ? 42.964  88.526  125.388 1.00 54.61 ? 421 LEU A CD1 1 
ATOM   7091  C CD2 . LEU B 1 421 ? 42.353  86.817  123.693 1.00 54.63 ? 421 LEU A CD2 1 
ATOM   7092  N N   . CYS B 1 422 ? 41.850  90.265  121.206 1.00 54.72 ? 422 CYS A N   1 
ATOM   7093  C CA  . CYS B 1 422 ? 40.492  90.701  120.909 1.00 54.53 ? 422 CYS A CA  1 
ATOM   7094  C C   . CYS B 1 422 ? 40.007  90.203  119.552 1.00 54.63 ? 422 CYS A C   1 
ATOM   7095  O O   . CYS B 1 422 ? 38.923  89.624  119.461 1.00 54.75 ? 422 CYS A O   1 
ATOM   7096  C CB  . CYS B 1 422 ? 40.375  92.221  121.002 1.00 54.46 ? 422 CYS A CB  1 
ATOM   7097  S SG  . CYS B 1 422 ? 40.223  92.833  122.687 1.00 53.67 ? 422 CYS A SG  1 
ATOM   7098  N N   . VAL B 1 423 ? 40.811  90.412  118.510 1.00 54.57 ? 423 VAL A N   1 
ATOM   7099  C CA  . VAL B 1 423 ? 40.461  89.922  117.175 1.00 54.58 ? 423 VAL A CA  1 
ATOM   7100  C C   . VAL B 1 423 ? 40.568  88.398  117.117 1.00 54.53 ? 423 VAL A C   1 
ATOM   7101  O O   . VAL B 1 423 ? 39.816  87.744  116.391 1.00 54.56 ? 423 VAL A O   1 
ATOM   7102  C CB  . VAL B 1 423 ? 41.284  90.603  116.031 1.00 54.59 ? 423 VAL A CB  1 
ATOM   7103  C CG1 . VAL B 1 423 ? 41.167  92.122  116.115 1.00 54.62 ? 423 VAL A CG1 1 
ATOM   7104  C CG2 . VAL B 1 423 ? 42.748  90.167  116.039 1.00 54.66 ? 423 VAL A CG2 1 
ATOM   7105  N N   . GLU B 1 424 ? 41.492  87.849  117.906 1.00 54.40 ? 424 GLU A N   1 
ATOM   7106  C CA  . GLU B 1 424 ? 41.689  86.406  118.003 1.00 54.43 ? 424 GLU A CA  1 
ATOM   7107  C C   . GLU B 1 424 ? 40.419  85.732  118.520 1.00 54.22 ? 424 GLU A C   1 
ATOM   7108  O O   . GLU B 1 424 ? 40.118  84.599  118.147 1.00 54.19 ? 424 GLU A O   1 
ATOM   7109  C CB  . GLU B 1 424 ? 42.885  86.091  118.910 1.00 54.58 ? 424 GLU A CB  1 
ATOM   7110  C CG  . GLU B 1 424 ? 43.634  84.801  118.583 1.00 55.19 ? 424 GLU A CG  1 
ATOM   7111  C CD  . GLU B 1 424 ? 43.426  83.716  119.626 1.00 56.00 ? 424 GLU A CD  1 
ATOM   7112  O OE1 . GLU B 1 424 ? 42.727  82.723  119.328 1.00 56.41 ? 424 GLU A OE1 1 
ATOM   7113  O OE2 . GLU B 1 424 ? 43.959  83.859  120.746 1.00 56.33 ? 424 GLU A OE2 1 
ATOM   7114  N N   . LYS B 1 425 ? 39.678  86.448  119.366 1.00 54.05 ? 425 LYS A N   1 
ATOM   7115  C CA  . LYS B 1 425 ? 38.375  85.991  119.858 1.00 53.79 ? 425 LYS A CA  1 
ATOM   7116  C C   . LYS B 1 425 ? 37.196  86.533  119.027 1.00 53.49 ? 425 LYS A C   1 
ATOM   7117  O O   . LYS B 1 425 ? 36.052  86.552  119.497 1.00 53.41 ? 425 LYS A O   1 
ATOM   7118  C CB  . LYS B 1 425 ? 38.207  86.330  121.349 1.00 53.86 ? 425 LYS A CB  1 
ATOM   7119  C CG  . LYS B 1 425 ? 38.978  85.414  122.316 1.00 54.06 ? 425 LYS A CG  1 
ATOM   7120  C CD  . LYS B 1 425 ? 38.596  83.936  122.141 1.00 54.53 ? 425 LYS A CD  1 
ATOM   7121  C CE  . LYS B 1 425 ? 39.155  83.050  123.245 1.00 54.53 ? 425 LYS A CE  1 
ATOM   7122  N NZ  . LYS B 1 425 ? 40.606  82.762  123.050 1.00 54.77 ? 425 LYS A NZ  1 
ATOM   7123  N N   . ARG B 1 426 ? 37.494  86.949  117.792 1.00 53.06 ? 426 ARG A N   1 
ATOM   7124  C CA  . ARG B 1 426 ? 36.510  87.464  116.816 1.00 52.72 ? 426 ARG A CA  1 
ATOM   7125  C C   . ARG B 1 426 ? 35.889  88.812  117.196 1.00 52.46 ? 426 ARG A C   1 
ATOM   7126  O O   . ARG B 1 426 ? 34.707  89.056  116.939 1.00 52.30 ? 426 ARG A O   1 
ATOM   7127  C CB  . ARG B 1 426 ? 35.409  86.438  116.504 1.00 52.72 ? 426 ARG A CB  1 
ATOM   7128  C CG  . ARG B 1 426 ? 35.897  85.116  115.933 1.00 52.77 ? 426 ARG A CG  1 
ATOM   7129  C CD  . ARG B 1 426 ? 34.741  84.147  115.683 1.00 52.72 ? 426 ARG A CD  1 
ATOM   7130  N NE  . ARG B 1 426 ? 33.899  83.950  116.864 1.00 52.28 ? 426 ARG A NE  1 
ATOM   7131  C CZ  . ARG B 1 426 ? 32.628  84.334  116.965 1.00 51.97 ? 426 ARG A CZ  1 
ATOM   7132  N NH1 . ARG B 1 426 ? 32.016  84.934  115.952 1.00 51.51 ? 426 ARG A NH1 1 
ATOM   7133  N NH2 . ARG B 1 426 ? 31.960  84.107  118.085 1.00 52.04 ? 426 ARG A NH2 1 
ATOM   7134  N N   . GLY B 1 427 ? 36.697  89.688  117.784 1.00 52.27 ? 427 GLY A N   1 
ATOM   7135  C CA  . GLY B 1 427 ? 36.236  91.020  118.172 1.00 52.10 ? 427 GLY A CA  1 
ATOM   7136  C C   . GLY B 1 427 ? 36.436  92.068  117.094 1.00 51.87 ? 427 GLY A C   1 
ATOM   7137  O O   . GLY B 1 427 ? 37.295  91.920  116.225 1.00 51.96 ? 427 GLY A O   1 
ATOM   7138  N N   . VAL B 1 428 ? 35.628  93.123  117.156 1.00 51.64 ? 428 VAL A N   1 
ATOM   7139  C CA  . VAL B 1 428 ? 35.736  94.264  116.245 1.00 51.47 ? 428 VAL A CA  1 
ATOM   7140  C C   . VAL B 1 428 ? 35.944  95.532  117.075 1.00 51.35 ? 428 VAL A C   1 
ATOM   7141  O O   . VAL B 1 428 ? 35.209  95.767  118.037 1.00 51.45 ? 428 VAL A O   1 
ATOM   7142  C CB  . VAL B 1 428 ? 34.464  94.409  115.367 1.00 51.43 ? 428 VAL A CB  1 
ATOM   7143  C CG1 . VAL B 1 428 ? 34.493  95.700  114.557 1.00 51.47 ? 428 VAL A CG1 1 
ATOM   7144  C CG2 . VAL B 1 428 ? 34.298  93.202  114.448 1.00 51.51 ? 428 VAL A CG2 1 
ATOM   7145  N N   . GLN B 1 429 ? 36.946  96.334  116.719 1.00 51.10 ? 429 GLN A N   1 
ATOM   7146  C CA  . GLN B 1 429 ? 37.226  97.576  117.447 1.00 50.87 ? 429 GLN A CA  1 
ATOM   7147  C C   . GLN B 1 429 ? 36.185  98.657  117.165 1.00 50.76 ? 429 GLN A C   1 
ATOM   7148  O O   . GLN B 1 429 ? 35.859  98.939  116.010 1.00 50.68 ? 429 GLN A O   1 
ATOM   7149  C CB  . GLN B 1 429 ? 38.630  98.102  117.139 1.00 50.80 ? 429 GLN A CB  1 
ATOM   7150  C CG  . GLN B 1 429 ? 38.990  99.351  117.934 1.00 50.71 ? 429 GLN A CG  1 
ATOM   7151  C CD  . GLN B 1 429 ? 40.456  99.703  117.862 1.00 50.82 ? 429 GLN A CD  1 
ATOM   7152  O OE1 . GLN B 1 429 ? 41.321  98.898  118.210 1.00 51.06 ? 429 GLN A OE1 1 
ATOM   7153  N NE2 . GLN B 1 429 ? 40.746  100.923 117.425 1.00 50.48 ? 429 GLN A NE2 1 
ATOM   7154  N N   . THR B 1 430 ? 35.680  99.267  118.232 1.00 50.63 ? 430 THR A N   1 
ATOM   7155  C CA  . THR B 1 430 ? 34.638  100.276 118.107 1.00 50.45 ? 430 THR A CA  1 
ATOM   7156  C C   . THR B 1 430 ? 35.151  101.696 118.407 1.00 50.24 ? 430 THR A C   1 
ATOM   7157  O O   . THR B 1 430 ? 34.653  102.669 117.838 1.00 50.28 ? 430 THR A O   1 
ATOM   7158  C CB  . THR B 1 430 ? 33.376  99.881  118.934 1.00 50.44 ? 430 THR A CB  1 
ATOM   7159  O OG1 . THR B 1 430 ? 32.209  100.020 118.119 1.00 50.75 ? 430 THR A OG1 1 
ATOM   7160  C CG2 . THR B 1 430 ? 33.219  100.711 120.200 1.00 50.49 ? 430 THR A CG2 1 
ATOM   7161  N N   . ASN B 1 431 ? 36.157  101.804 119.276 1.00 50.03 ? 431 ASN A N   1 
ATOM   7162  C CA  . ASN B 1 431 ? 36.753  103.096 119.632 1.00 49.83 ? 431 ASN A CA  1 
ATOM   7163  C C   . ASN B 1 431 ? 38.074  102.958 120.402 1.00 49.72 ? 431 ASN A C   1 
ATOM   7164  O O   . ASN B 1 431 ? 38.349  101.919 121.004 1.00 49.63 ? 431 ASN A O   1 
ATOM   7165  C CB  . ASN B 1 431 ? 35.748  103.948 120.428 1.00 49.85 ? 431 ASN A CB  1 
ATOM   7166  C CG  . ASN B 1 431 ? 36.143  105.415 120.508 1.00 49.73 ? 431 ASN A CG  1 
ATOM   7167  O OD1 . ASN B 1 431 ? 36.679  105.985 119.557 1.00 49.69 ? 431 ASN A OD1 1 
ATOM   7168  N ND2 . ASN B 1 431 ? 35.868  106.036 121.649 1.00 49.54 ? 431 ASN A ND2 1 
ATOM   7169  N N   . MET B 1 432 ? 38.887  104.012 120.367 1.00 49.65 ? 432 MET A N   1 
ATOM   7170  C CA  . MET B 1 432 ? 40.133  104.077 121.130 1.00 49.61 ? 432 MET A CA  1 
ATOM   7171  C C   . MET B 1 432 ? 40.442  105.522 121.531 1.00 49.61 ? 432 MET A C   1 
ATOM   7172  O O   . MET B 1 432 ? 40.468  106.417 120.681 1.00 49.59 ? 432 MET A O   1 
ATOM   7173  C CB  . MET B 1 432 ? 41.286  103.512 120.305 1.00 49.55 ? 432 MET A CB  1 
ATOM   7174  C CG  . MET B 1 432 ? 42.400  102.901 121.123 1.00 49.60 ? 432 MET A CG  1 
ATOM   7175  S SD  . MET B 1 432 ? 43.939  102.790 120.189 1.00 49.56 ? 432 MET A SD  1 
ATOM   7176  C CE  . MET B 1 432 ? 44.508  101.161 120.671 1.00 49.47 ? 432 MET A CE  1 
ATOM   7177  N N   . VAL B 1 433 ? 40.664  105.751 122.825 1.00 49.58 ? 433 VAL A N   1 
ATOM   7178  C CA  . VAL B 1 433 ? 41.051  107.080 123.317 1.00 49.54 ? 433 VAL A CA  1 
ATOM   7179  C C   . VAL B 1 433 ? 42.335  107.006 124.148 1.00 49.58 ? 433 VAL A C   1 
ATOM   7180  O O   . VAL B 1 433 ? 42.514  106.089 124.955 1.00 49.47 ? 433 VAL A O   1 
ATOM   7181  C CB  . VAL B 1 433 ? 39.931  107.765 124.150 1.00 49.52 ? 433 VAL A CB  1 
ATOM   7182  C CG1 . VAL B 1 433 ? 40.259  109.239 124.388 1.00 49.15 ? 433 VAL A CG1 1 
ATOM   7183  C CG2 . VAL B 1 433 ? 38.576  107.632 123.465 1.00 49.54 ? 433 VAL A CG2 1 
ATOM   7184  N N   . TYR B 1 434 ? 43.225  107.974 123.933 1.00 49.60 ? 434 TYR A N   1 
ATOM   7185  C CA  . TYR B 1 434 ? 44.465  108.065 124.694 1.00 49.59 ? 434 TYR A CA  1 
ATOM   7186  C C   . TYR B 1 434 ? 44.299  108.945 125.922 1.00 49.63 ? 434 TYR A C   1 
ATOM   7187  O O   . TYR B 1 434 ? 43.755  110.047 125.841 1.00 49.66 ? 434 TYR A O   1 
ATOM   7188  C CB  . TYR B 1 434 ? 45.600  108.596 123.821 1.00 49.54 ? 434 TYR A CB  1 
ATOM   7189  C CG  . TYR B 1 434 ? 46.194  107.563 122.893 1.00 49.49 ? 434 TYR A CG  1 
ATOM   7190  C CD1 . TYR B 1 434 ? 45.714  107.408 121.593 1.00 49.44 ? 434 TYR A CD1 1 
ATOM   7191  C CD2 . TYR B 1 434 ? 47.238  106.740 123.314 1.00 49.27 ? 434 TYR A CD2 1 
ATOM   7192  C CE1 . TYR B 1 434 ? 46.262  106.460 120.732 1.00 49.36 ? 434 TYR A CE1 1 
ATOM   7193  C CE2 . TYR B 1 434 ? 47.792  105.788 122.462 1.00 49.39 ? 434 TYR A CE2 1 
ATOM   7194  C CZ  . TYR B 1 434 ? 47.298  105.654 121.175 1.00 49.44 ? 434 TYR A CZ  1 
ATOM   7195  O OH  . TYR B 1 434 ? 47.840  104.716 120.328 1.00 49.48 ? 434 TYR A OH  1 
ATOM   7196  N N   . HIS B 1 435 ? 44.762  108.436 127.059 1.00 49.72 ? 435 HIS A N   1 
ATOM   7197  C CA  . HIS B 1 435 ? 44.755  109.177 128.316 1.00 49.87 ? 435 HIS A CA  1 
ATOM   7198  C C   . HIS B 1 435 ? 46.147  109.109 128.935 1.00 50.13 ? 435 HIS A C   1 
ATOM   7199  O O   . HIS B 1 435 ? 46.475  108.167 129.665 1.00 49.98 ? 435 HIS A O   1 
ATOM   7200  C CB  . HIS B 1 435 ? 43.685  108.631 129.274 1.00 49.77 ? 435 HIS A CB  1 
ATOM   7201  C CG  . HIS B 1 435 ? 42.285  108.771 128.759 1.00 49.33 ? 435 HIS A CG  1 
ATOM   7202  N ND1 . HIS B 1 435 ? 41.452  107.691 128.566 1.00 48.83 ? 435 HIS A ND1 1 
ATOM   7203  C CD2 . HIS B 1 435 ? 41.576  109.863 128.386 1.00 49.07 ? 435 HIS A CD2 1 
ATOM   7204  C CE1 . HIS B 1 435 ? 40.287  108.111 128.105 1.00 48.72 ? 435 HIS A CE1 1 
ATOM   7205  N NE2 . HIS B 1 435 ? 40.336  109.426 127.987 1.00 48.76 ? 435 HIS A NE2 1 
ATOM   7206  N N   . GLY B 1 436 ? 46.962  110.117 128.626 1.00 50.45 ? 436 GLY A N   1 
ATOM   7207  C CA  . GLY B 1 436 ? 48.380  110.116 128.980 1.00 50.88 ? 436 GLY A CA  1 
ATOM   7208  C C   . GLY B 1 436 ? 49.066  108.908 128.367 1.00 51.18 ? 436 GLY A C   1 
ATOM   7209  O O   . GLY B 1 436 ? 48.933  108.649 127.165 1.00 51.19 ? 436 GLY A O   1 
ATOM   7210  N N   . ASN B 1 437 ? 49.788  108.161 129.196 1.00 51.39 ? 437 ASN A N   1 
ATOM   7211  C CA  . ASN B 1 437 ? 50.393  106.907 128.759 1.00 51.67 ? 437 ASN A CA  1 
ATOM   7212  C C   . ASN B 1 437 ? 49.477  105.722 129.062 1.00 51.74 ? 437 ASN A C   1 
ATOM   7213  O O   . ASN B 1 437 ? 49.927  104.663 129.512 1.00 51.93 ? 437 ASN A O   1 
ATOM   7214  C CB  . ASN B 1 437 ? 51.802  106.724 129.350 1.00 51.82 ? 437 ASN A CB  1 
ATOM   7215  C CG  . ASN B 1 437 ? 51.856  106.978 130.852 1.00 52.04 ? 437 ASN A CG  1 
ATOM   7216  O OD1 . ASN B 1 437 ? 52.388  107.997 131.299 1.00 52.19 ? 437 ASN A OD1 1 
ATOM   7217  N ND2 . ASN B 1 437 ? 51.314  106.048 131.635 1.00 52.07 ? 437 ASN A ND2 1 
ATOM   7218  N N   . GLN B 1 438 ? 48.186  105.917 128.801 1.00 51.73 ? 438 GLN A N   1 
ATOM   7219  C CA  . GLN B 1 438 ? 47.169  104.900 129.041 1.00 51.62 ? 438 GLN A CA  1 
ATOM   7220  C C   . GLN B 1 438 ? 46.139  104.913 127.912 1.00 51.52 ? 438 GLN A C   1 
ATOM   7221  O O   . GLN B 1 438 ? 45.785  105.976 127.392 1.00 51.52 ? 438 GLN A O   1 
ATOM   7222  C CB  . GLN B 1 438 ? 46.494  105.152 130.389 1.00 51.72 ? 438 GLN A CB  1 
ATOM   7223  C CG  . GLN B 1 438 ? 45.805  103.942 130.999 1.00 51.78 ? 438 GLN A CG  1 
ATOM   7224  C CD  . GLN B 1 438 ? 45.638  104.092 132.519 1.00 51.54 ? 438 GLN A CD  1 
ATOM   7225  O OE1 . GLN B 1 438 ? 46.034  103.194 133.280 1.00 51.78 ? 438 GLN A OE1 1 
ATOM   7226  N NE2 . GLN B 1 438 ? 45.060  105.231 132.969 1.00 51.17 ? 438 GLN A NE2 1 
ATOM   7227  N N   . VAL B 1 439 ? 45.667  103.728 127.535 1.00 51.32 ? 439 VAL A N   1 
ATOM   7228  C CA  . VAL B 1 439 ? 44.752  103.581 126.406 1.00 51.17 ? 439 VAL A CA  1 
ATOM   7229  C C   . VAL B 1 439 ? 43.383  103.076 126.860 1.00 51.12 ? 439 VAL A C   1 
ATOM   7230  O O   . VAL B 1 439 ? 43.292  102.151 127.675 1.00 51.03 ? 439 VAL A O   1 
ATOM   7231  C CB  . VAL B 1 439 ? 45.325  102.625 125.334 1.00 51.12 ? 439 VAL A CB  1 
ATOM   7232  C CG1 . VAL B 1 439 ? 44.450  102.619 124.098 1.00 51.20 ? 439 VAL A CG1 1 
ATOM   7233  C CG2 . VAL B 1 439 ? 46.737  103.025 124.960 1.00 51.15 ? 439 VAL A CG2 1 
ATOM   7234  N N   . ALA B 1 440 ? 42.331  103.695 126.324 1.00 51.04 ? 440 ALA A N   1 
ATOM   7235  C CA  . ALA B 1 440 ? 40.951  103.298 126.592 1.00 50.89 ? 440 ALA A CA  1 
ATOM   7236  C C   . ALA B 1 440 ? 40.333  102.597 125.378 1.00 50.91 ? 440 ALA A C   1 
ATOM   7237  O O   . ALA B 1 440 ? 39.730  103.231 124.501 1.00 50.77 ? 440 ALA A O   1 
ATOM   7238  C CB  . ALA B 1 440 ? 40.117  104.501 127.018 1.00 50.89 ? 440 ALA A CB  1 
ATOM   7239  N N   . LEU B 1 441 ? 40.505  101.278 125.341 1.00 51.02 ? 441 LEU A N   1 
ATOM   7240  C CA  . LEU B 1 441 ? 39.965  100.436 124.278 1.00 51.06 ? 441 LEU A CA  1 
ATOM   7241  C C   . LEU B 1 441 ? 38.507  100.113 124.503 1.00 51.11 ? 441 LEU A C   1 
ATOM   7242  O O   . LEU B 1 441 ? 38.087  99.846  125.628 1.00 51.29 ? 441 LEU A O   1 
ATOM   7243  C CB  . LEU B 1 441 ? 40.735  99.119  124.185 1.00 50.96 ? 441 LEU A CB  1 
ATOM   7244  C CG  . LEU B 1 441 ? 41.867  99.018  123.171 1.00 50.95 ? 441 LEU A CG  1 
ATOM   7245  C CD1 . LEU B 1 441 ? 42.578  97.703  123.370 1.00 51.00 ? 441 LEU A CD1 1 
ATOM   7246  C CD2 . LEU B 1 441 ? 41.338  99.129  121.750 1.00 51.25 ? 441 LEU A CD2 1 
ATOM   7247  N N   . THR B 1 442 ? 37.740  100.133 123.422 1.00 51.15 ? 442 THR A N   1 
ATOM   7248  C CA  . THR B 1 442 ? 36.369  99.647  123.460 1.00 51.18 ? 442 THR A CA  1 
ATOM   7249  C C   . THR B 1 442 ? 36.070  98.787  122.231 1.00 51.25 ? 442 THR A C   1 
ATOM   7250  O O   . THR B 1 442 ? 36.076  99.266  121.093 1.00 51.09 ? 442 THR A O   1 
ATOM   7251  C CB  . THR B 1 442 ? 35.319  100.773 123.734 1.00 51.12 ? 442 THR A CB  1 
ATOM   7252  O OG1 . THR B 1 442 ? 34.085  100.456 123.083 1.00 51.34 ? 442 THR A OG1 1 
ATOM   7253  C CG2 . THR B 1 442 ? 35.807  102.134 123.266 1.00 51.12 ? 442 THR A CG2 1 
ATOM   7254  N N   . TYR B 1 443 ? 35.838  97.503  122.499 1.00 51.39 ? 443 TYR A N   1 
ATOM   7255  C CA  . TYR B 1 443 ? 35.670  96.476  121.475 1.00 51.55 ? 443 TYR A CA  1 
ATOM   7256  C C   . TYR B 1 443 ? 34.282  95.849  121.495 1.00 51.69 ? 443 TYR A C   1 
ATOM   7257  O O   . TYR B 1 443 ? 33.566  95.938  122.492 1.00 51.71 ? 443 TYR A O   1 
ATOM   7258  C CB  . TYR B 1 443 ? 36.724  95.380  121.662 1.00 51.54 ? 443 TYR A CB  1 
ATOM   7259  C CG  . TYR B 1 443 ? 37.880  95.451  120.691 1.00 51.52 ? 443 TYR A CG  1 
ATOM   7260  C CD1 . TYR B 1 443 ? 37.939  94.593  119.595 1.00 51.50 ? 443 TYR A CD1 1 
ATOM   7261  C CD2 . TYR B 1 443 ? 38.914  96.372  120.865 1.00 51.72 ? 443 TYR A CD2 1 
ATOM   7262  C CE1 . TYR B 1 443 ? 38.996  94.647  118.692 1.00 51.86 ? 443 TYR A CE1 1 
ATOM   7263  C CE2 . TYR B 1 443 ? 39.980  96.433  119.966 1.00 51.91 ? 443 TYR A CE2 1 
ATOM   7264  C CZ  . TYR B 1 443 ? 40.013  95.567  118.884 1.00 51.89 ? 443 TYR A CZ  1 
ATOM   7265  O OH  . TYR B 1 443 ? 41.056  95.621  117.989 1.00 51.86 ? 443 TYR A OH  1 
ATOM   7266  N N   . GLU B 1 444 ? 33.908  95.222  120.382 1.00 51.96 ? 444 GLU A N   1 
ATOM   7267  C CA  . GLU B 1 444 ? 32.669  94.451  120.307 1.00 52.25 ? 444 GLU A CA  1 
ATOM   7268  C C   . GLU B 1 444 ? 32.981  92.970  120.101 1.00 52.32 ? 444 GLU A C   1 
ATOM   7269  O O   . GLU B 1 444 ? 33.175  92.503  118.973 1.00 52.30 ? 444 GLU A O   1 
ATOM   7270  C CB  . GLU B 1 444 ? 31.736  94.995  119.224 1.00 52.25 ? 444 GLU A CB  1 
ATOM   7271  C CG  . GLU B 1 444 ? 31.056  96.305  119.612 1.00 52.84 ? 444 GLU A CG  1 
ATOM   7272  C CD  . GLU B 1 444 ? 29.790  96.584  118.815 1.00 53.73 ? 444 GLU A CD  1 
ATOM   7273  O OE1 . GLU B 1 444 ? 29.644  96.040  117.699 1.00 54.06 ? 444 GLU A OE1 1 
ATOM   7274  O OE2 . GLU B 1 444 ? 28.936  97.353  119.310 1.00 54.29 ? 444 GLU A OE2 1 
ATOM   7275  N N   . ILE B 1 445 ? 33.037  92.251  121.218 1.00 52.41 ? 445 ILE A N   1 
ATOM   7276  C CA  . ILE B 1 445 ? 33.418  90.844  121.246 1.00 52.49 ? 445 ILE A CA  1 
ATOM   7277  C C   . ILE B 1 445 ? 32.183  90.004  121.543 1.00 52.64 ? 445 ILE A C   1 
ATOM   7278  O O   . ILE B 1 445 ? 31.428  90.331  122.463 1.00 52.64 ? 445 ILE A O   1 
ATOM   7279  C CB  . ILE B 1 445 ? 34.501  90.573  122.328 1.00 52.58 ? 445 ILE A CB  1 
ATOM   7280  C CG1 . ILE B 1 445 ? 35.693  91.525  122.153 1.00 52.40 ? 445 ILE A CG1 1 
ATOM   7281  C CG2 . ILE B 1 445 ? 34.958  89.110  122.292 1.00 52.47 ? 445 ILE A CG2 1 
ATOM   7282  C CD1 . ILE B 1 445 ? 36.635  91.573  123.338 1.00 52.34 ? 445 ILE A CD1 1 
ATOM   7283  N N   . PRO B 1 446 ? 31.959  88.936  120.749 1.00 52.76 ? 446 PRO A N   1 
ATOM   7284  C CA  . PRO B 1 446 ? 30.889  87.964  120.977 1.00 52.94 ? 446 PRO A CA  1 
ATOM   7285  C C   . PRO B 1 446 ? 30.825  87.472  122.423 1.00 53.17 ? 446 PRO A C   1 
ATOM   7286  O O   . PRO B 1 446 ? 31.782  86.881  122.920 1.00 53.11 ? 446 PRO A O   1 
ATOM   7287  C CB  . PRO B 1 446 ? 31.275  86.815  120.048 1.00 52.88 ? 446 PRO A CB  1 
ATOM   7288  C CG  . PRO B 1 446 ? 31.944  87.483  118.917 1.00 52.74 ? 446 PRO A CG  1 
ATOM   7289  C CD  . PRO B 1 446 ? 32.724  88.611  119.530 1.00 52.77 ? 446 PRO A CD  1 
ATOM   7290  N N   . MET B 1 447 ? 29.695  87.731  123.078 1.00 53.54 ? 447 MET A N   1 
ATOM   7291  C CA  . MET B 1 447 ? 29.470  87.347  124.467 1.00 53.94 ? 447 MET A CA  1 
ATOM   7292  C C   . MET B 1 447 ? 29.884  85.903  124.735 1.00 54.16 ? 447 MET A C   1 
ATOM   7293  O O   . MET B 1 447 ? 30.624  85.633  125.686 1.00 54.15 ? 447 MET A O   1 
ATOM   7294  C CB  . MET B 1 447 ? 27.999  87.539  124.830 1.00 54.10 ? 447 MET A CB  1 
ATOM   7295  C CG  . MET B 1 447 ? 27.674  87.245  126.283 1.00 54.88 ? 447 MET A CG  1 
ATOM   7296  S SD  . MET B 1 447 ? 28.157  88.595  127.365 1.00 56.65 ? 447 MET A SD  1 
ATOM   7297  C CE  . MET B 1 447 ? 26.801  89.742  127.077 1.00 56.22 ? 447 MET A CE  1 
ATOM   7298  N N   . ALA B 1 448 ? 29.408  84.988  123.886 1.00 54.38 ? 448 ALA A N   1 
ATOM   7299  C CA  . ALA B 1 448 ? 29.753  83.566  123.962 1.00 54.52 ? 448 ALA A CA  1 
ATOM   7300  C C   . ALA B 1 448 ? 31.241  83.350  124.226 1.00 54.67 ? 448 ALA A C   1 
ATOM   7301  O O   . ALA B 1 448 ? 31.631  82.391  124.891 1.00 54.73 ? 448 ALA A O   1 
ATOM   7302  C CB  . ALA B 1 448 ? 29.336  82.857  122.682 1.00 54.45 ? 448 ALA A CB  1 
ATOM   7303  N N   . GLU B 1 449 ? 32.056  84.269  123.719 1.00 54.95 ? 449 GLU A N   1 
ATOM   7304  C CA  . GLU B 1 449 ? 33.506  84.173  123.805 1.00 55.24 ? 449 GLU A CA  1 
ATOM   7305  C C   . GLU B 1 449 ? 34.107  84.903  125.013 1.00 55.26 ? 449 GLU A C   1 
ATOM   7306  O O   . GLU B 1 449 ? 35.142  84.490  125.533 1.00 55.26 ? 449 GLU A O   1 
ATOM   7307  C CB  . GLU B 1 449 ? 34.128  84.693  122.511 1.00 55.24 ? 449 GLU A CB  1 
ATOM   7308  C CG  . GLU B 1 449 ? 35.365  83.945  122.084 1.00 55.96 ? 449 GLU A CG  1 
ATOM   7309  C CD  . GLU B 1 449 ? 35.059  82.642  121.371 1.00 56.73 ? 449 GLU A CD  1 
ATOM   7310  O OE1 . GLU B 1 449 ? 34.450  81.741  121.982 1.00 56.76 ? 449 GLU A OE1 1 
ATOM   7311  O OE2 . GLU B 1 449 ? 35.444  82.516  120.190 1.00 58.15 ? 449 GLU A OE2 1 
ATOM   7312  N N   . VAL B 1 450 ? 33.469  85.989  125.444 1.00 55.38 ? 450 VAL A N   1 
ATOM   7313  C CA  . VAL B 1 450 ? 33.906  86.728  126.634 1.00 55.55 ? 450 VAL A CA  1 
ATOM   7314  C C   . VAL B 1 450 ? 33.733  85.843  127.870 1.00 55.87 ? 450 VAL A C   1 
ATOM   7315  O O   . VAL B 1 450 ? 34.563  85.850  128.782 1.00 55.73 ? 450 VAL A O   1 
ATOM   7316  C CB  . VAL B 1 450 ? 33.111  88.057  126.809 1.00 55.44 ? 450 VAL A CB  1 
ATOM   7317  C CG1 . VAL B 1 450 ? 33.541  88.806  128.066 1.00 55.01 ? 450 VAL A CG1 1 
ATOM   7318  C CG2 . VAL B 1 450 ? 33.276  88.950  125.590 1.00 55.41 ? 450 VAL A CG2 1 
ATOM   7319  N N   . VAL B 1 451 ? 32.652  85.070  127.864 1.00 56.47 ? 451 VAL A N   1 
ATOM   7320  C CA  . VAL B 1 451 ? 32.238  84.241  128.995 1.00 56.97 ? 451 VAL A CA  1 
ATOM   7321  C C   . VAL B 1 451 ? 33.136  83.008  129.175 1.00 57.42 ? 451 VAL A C   1 
ATOM   7322  O O   . VAL B 1 451 ? 33.355  82.550  130.300 1.00 57.34 ? 451 VAL A O   1 
ATOM   7323  C CB  . VAL B 1 451 ? 30.749  83.855  128.849 1.00 56.82 ? 451 VAL A CB  1 
ATOM   7324  C CG1 . VAL B 1 451 ? 30.313  82.951  129.956 1.00 56.96 ? 451 VAL A CG1 1 
ATOM   7325  C CG2 . VAL B 1 451 ? 29.893  85.105  128.858 1.00 56.90 ? 451 VAL A CG2 1 
ATOM   7326  N N   . LEU B 1 452 ? 33.650  82.482  128.065 1.00 58.09 ? 452 LEU A N   1 
ATOM   7327  C CA  . LEU B 1 452 ? 34.667  81.437  128.103 1.00 58.78 ? 452 LEU A CA  1 
ATOM   7328  C C   . LEU B 1 452 ? 36.018  82.084  128.351 1.00 59.26 ? 452 LEU A C   1 
ATOM   7329  O O   . LEU B 1 452 ? 36.563  82.759  127.475 1.00 59.54 ? 452 LEU A O   1 
ATOM   7330  C CB  . LEU B 1 452 ? 34.689  80.637  126.796 1.00 58.78 ? 452 LEU A CB  1 
ATOM   7331  C CG  . LEU B 1 452 ? 33.908  79.321  126.677 1.00 59.34 ? 452 LEU A CG  1 
ATOM   7332  C CD1 . LEU B 1 452 ? 34.519  78.212  127.558 1.00 59.70 ? 452 LEU A CD1 1 
ATOM   7333  C CD2 . LEU B 1 452 ? 32.412  79.501  126.963 1.00 59.65 ? 452 LEU A CD2 1 
ATOM   7334  N N   . ASP B 1 453 ? 36.553  81.857  129.546 1.00 59.88 ? 453 ASP A N   1 
ATOM   7335  C CA  . ASP B 1 453 ? 37.724  82.577  130.060 1.00 60.57 ? 453 ASP A CA  1 
ATOM   7336  C C   . ASP B 1 453 ? 38.604  83.304  129.026 1.00 60.70 ? 453 ASP A C   1 
ATOM   7337  O O   . ASP B 1 453 ? 39.620  82.784  128.542 1.00 60.60 ? 453 ASP A O   1 
ATOM   7338  C CB  . ASP B 1 453 ? 38.556  81.674  130.973 1.00 60.85 ? 453 ASP A CB  1 
ATOM   7339  C CG  . ASP B 1 453 ? 38.688  82.240  132.379 1.00 61.82 ? 453 ASP A CG  1 
ATOM   7340  O OD1 . ASP B 1 453 ? 39.034  81.462  133.298 1.00 63.13 ? 453 ASP A OD1 1 
ATOM   7341  O OD2 . ASP B 1 453 ? 38.428  83.456  132.571 1.00 62.43 ? 453 ASP A OD2 1 
ATOM   7342  N N   . PHE B 1 454 ? 38.153  84.514  128.704 1.00 60.87 ? 454 PHE A N   1 
ATOM   7343  C CA  . PHE B 1 454 ? 38.866  85.487  127.891 1.00 60.99 ? 454 PHE A CA  1 
ATOM   7344  C C   . PHE B 1 454 ? 39.549  86.448  128.860 1.00 61.19 ? 454 PHE A C   1 
ATOM   7345  O O   . PHE B 1 454 ? 40.735  86.754  128.722 1.00 61.22 ? 454 PHE A O   1 
ATOM   7346  C CB  . PHE B 1 454 ? 37.857  86.209  126.976 1.00 60.86 ? 454 PHE A CB  1 
ATOM   7347  C CG  . PHE B 1 454 ? 38.222  87.636  126.633 1.00 60.70 ? 454 PHE A CG  1 
ATOM   7348  C CD1 . PHE B 1 454 ? 39.058  87.920  125.555 1.00 60.60 ? 454 PHE A CD1 1 
ATOM   7349  C CD2 . PHE B 1 454 ? 37.695  88.700  127.364 1.00 60.19 ? 454 PHE A CD2 1 
ATOM   7350  C CE1 . PHE B 1 454 ? 39.385  89.241  125.229 1.00 60.22 ? 454 PHE A CE1 1 
ATOM   7351  C CE2 . PHE B 1 454 ? 38.019  90.021  127.049 1.00 59.95 ? 454 PHE A CE2 1 
ATOM   7352  C CZ  . PHE B 1 454 ? 38.864  90.291  125.980 1.00 60.03 ? 454 PHE A CZ  1 
ATOM   7353  N N   . PHE B 1 455 ? 38.778  86.883  129.857 1.00 61.42 ? 455 PHE A N   1 
ATOM   7354  C CA  . PHE B 1 455 ? 39.230  87.752  130.946 1.00 61.69 ? 455 PHE A CA  1 
ATOM   7355  C C   . PHE B 1 455 ? 40.583  87.328  131.534 1.00 61.82 ? 455 PHE A C   1 
ATOM   7356  O O   . PHE B 1 455 ? 41.411  88.180  131.871 1.00 61.84 ? 455 PHE A O   1 
ATOM   7357  C CB  . PHE B 1 455 ? 38.138  87.798  132.031 1.00 61.84 ? 455 PHE A CB  1 
ATOM   7358  C CG  . PHE B 1 455 ? 38.535  88.527  133.289 1.00 61.96 ? 455 PHE A CG  1 
ATOM   7359  C CD1 . PHE B 1 455 ? 38.460  89.914  133.360 1.00 61.96 ? 455 PHE A CD1 1 
ATOM   7360  C CD2 . PHE B 1 455 ? 38.956  87.817  134.416 1.00 62.40 ? 455 PHE A CD2 1 
ATOM   7361  C CE1 . PHE B 1 455 ? 38.816  90.588  134.526 1.00 62.41 ? 455 PHE A CE1 1 
ATOM   7362  C CE2 . PHE B 1 455 ? 39.316  88.479  135.591 1.00 62.57 ? 455 PHE A CE2 1 
ATOM   7363  C CZ  . PHE B 1 455 ? 39.244  89.868  135.647 1.00 62.55 ? 455 PHE A CZ  1 
ATOM   7364  N N   . ASP B 1 456 ? 40.798  86.018  131.646 1.00 61.87 ? 456 ASP A N   1 
ATOM   7365  C CA  . ASP B 1 456 ? 42.049  85.474  132.173 1.00 61.93 ? 456 ASP A CA  1 
ATOM   7366  C C   . ASP B 1 456 ? 43.218  85.634  131.202 1.00 61.91 ? 456 ASP A C   1 
ATOM   7367  O O   . ASP B 1 456 ? 44.327  86.008  131.609 1.00 61.97 ? 456 ASP A O   1 
ATOM   7368  C CB  . ASP B 1 456 ? 41.878  84.001  132.550 1.00 61.98 ? 456 ASP A CB  1 
ATOM   7369  C CG  . ASP B 1 456 ? 41.155  83.815  133.870 1.00 62.25 ? 456 ASP A CG  1 
ATOM   7370  O OD1 . ASP B 1 456 ? 40.412  84.732  134.286 1.00 62.81 ? 456 ASP A OD1 1 
ATOM   7371  O OD2 . ASP B 1 456 ? 41.319  82.741  134.489 1.00 62.18 ? 456 ASP A OD2 1 
ATOM   7372  N N   . ARG B 1 457 ? 42.963  85.348  129.926 1.00 61.69 ? 457 ARG A N   1 
ATOM   7373  C CA  . ARG B 1 457 ? 43.974  85.461  128.878 1.00 61.48 ? 457 ARG A CA  1 
ATOM   7374  C C   . ARG B 1 457 ? 44.390  86.908  128.676 1.00 61.28 ? 457 ARG A C   1 
ATOM   7375  O O   . ARG B 1 457 ? 45.549  87.193  128.369 1.00 61.14 ? 457 ARG A O   1 
ATOM   7376  C CB  . ARG B 1 457 ? 43.446  84.882  127.571 1.00 61.56 ? 457 ARG A CB  1 
ATOM   7377  C CG  . ARG B 1 457 ? 43.249  83.377  127.611 1.00 62.00 ? 457 ARG A CG  1 
ATOM   7378  C CD  . ARG B 1 457 ? 42.464  82.861  126.406 1.00 62.76 ? 457 ARG A CD  1 
ATOM   7379  N NE  . ARG B 1 457 ? 42.921  83.420  125.132 1.00 63.07 ? 457 ARG A NE  1 
ATOM   7380  C CZ  . ARG B 1 457 ? 44.135  83.240  124.612 1.00 63.24 ? 457 ARG A CZ  1 
ATOM   7381  N NH1 . ARG B 1 457 ? 45.050  82.527  125.261 1.00 63.73 ? 457 ARG A NH1 1 
ATOM   7382  N NH2 . ARG B 1 457 ? 44.438  83.793  123.444 1.00 63.14 ? 457 ARG A NH2 1 
ATOM   7383  N N   . LEU B 1 458 ? 43.429  87.812  128.851 1.00 61.12 ? 458 LEU A N   1 
ATOM   7384  C CA  . LEU B 1 458 ? 43.680  89.245  128.809 1.00 60.93 ? 458 LEU A CA  1 
ATOM   7385  C C   . LEU B 1 458 ? 44.551  89.672  129.986 1.00 60.80 ? 458 LEU A C   1 
ATOM   7386  O O   . LEU B 1 458 ? 45.483  90.461  129.827 1.00 60.89 ? 458 LEU A O   1 
ATOM   7387  C CB  . LEU B 1 458 ? 42.356  90.018  128.780 1.00 60.86 ? 458 LEU A CB  1 
ATOM   7388  C CG  . LEU B 1 458 ? 42.343  91.472  129.261 1.00 61.02 ? 458 LEU A CG  1 
ATOM   7389  C CD1 . LEU B 1 458 ? 41.791  92.399  128.206 1.00 61.06 ? 458 LEU A CD1 1 
ATOM   7390  C CD2 . LEU B 1 458 ? 41.582  91.613  130.573 1.00 61.52 ? 458 LEU A CD2 1 
ATOM   7391  N N   . LYS B 1 459 ? 44.251  89.129  131.161 1.00 60.60 ? 459 LYS A N   1 
ATOM   7392  C CA  . LYS B 1 459 ? 44.973  89.483  132.374 1.00 60.41 ? 459 LYS A CA  1 
ATOM   7393  C C   . LYS B 1 459 ? 46.420  88.993  132.350 1.00 60.20 ? 459 LYS A C   1 
ATOM   7394  O O   . LYS B 1 459 ? 47.300  89.654  132.885 1.00 60.11 ? 459 LYS A O   1 
ATOM   7395  C CB  . LYS B 1 459 ? 44.239  88.947  133.604 1.00 60.47 ? 459 LYS A CB  1 
ATOM   7396  C CG  . LYS B 1 459 ? 44.298  89.875  134.798 1.00 60.62 ? 459 LYS A CG  1 
ATOM   7397  C CD  . LYS B 1 459 ? 43.003  89.827  135.597 1.00 61.11 ? 459 LYS A CD  1 
ATOM   7398  C CE  . LYS B 1 459 ? 42.763  91.142  136.337 1.00 61.36 ? 459 LYS A CE  1 
ATOM   7399  N NZ  . LYS B 1 459 ? 42.543  92.293  135.407 1.00 61.00 ? 459 LYS A NZ  1 
ATOM   7400  N N   . SER B 1 460 ? 46.664  87.846  131.720 1.00 59.99 ? 460 SER A N   1 
ATOM   7401  C CA  . SER B 1 460 ? 48.010  87.274  131.666 1.00 59.86 ? 460 SER A CA  1 
ATOM   7402  C C   . SER B 1 460 ? 48.858  87.822  130.514 1.00 59.71 ? 460 SER A C   1 
ATOM   7403  O O   . SER B 1 460 ? 50.083  87.681  130.525 1.00 59.69 ? 460 SER A O   1 
ATOM   7404  C CB  . SER B 1 460 ? 47.949  85.747  131.602 1.00 59.86 ? 460 SER A CB  1 
ATOM   7405  O OG  . SER B 1 460 ? 47.350  85.317  130.394 1.00 60.19 ? 460 SER A OG  1 
ATOM   7406  N N   . THR B 1 461 ? 48.208  88.436  129.526 1.00 59.57 ? 461 THR A N   1 
ATOM   7407  C CA  . THR B 1 461 ? 48.918  89.063  128.404 1.00 59.30 ? 461 THR A CA  1 
ATOM   7408  C C   . THR B 1 461 ? 49.194  90.551  128.663 1.00 59.27 ? 461 THR A C   1 
ATOM   7409  O O   . THR B 1 461 ? 50.075  91.148  128.040 1.00 59.25 ? 461 THR A O   1 
ATOM   7410  C CB  . THR B 1 461 ? 48.191  88.840  127.044 1.00 59.28 ? 461 THR A CB  1 
ATOM   7411  O OG1 . THR B 1 461 ? 49.080  89.148  125.964 1.00 58.95 ? 461 THR A OG1 1 
ATOM   7412  C CG2 . THR B 1 461 ? 46.931  89.698  126.922 1.00 59.25 ? 461 THR A CG2 1 
ATOM   7413  N N   . SER B 1 462 ? 48.431  91.135  129.583 1.00 59.25 ? 462 SER A N   1 
ATOM   7414  C CA  . SER B 1 462 ? 48.675  92.491  130.062 1.00 59.31 ? 462 SER A CA  1 
ATOM   7415  C C   . SER B 1 462 ? 49.268  92.435  131.470 1.00 59.49 ? 462 SER A C   1 
ATOM   7416  O O   . SER B 1 462 ? 49.569  93.466  132.076 1.00 59.37 ? 462 SER A O   1 
ATOM   7417  C CB  . SER B 1 462 ? 47.377  93.296  130.064 1.00 59.25 ? 462 SER A CB  1 
ATOM   7418  O OG  . SER B 1 462 ? 46.464  92.791  131.020 1.00 58.98 ? 462 SER A OG  1 
ATOM   7419  N N   . ARG B 1 463 ? 49.426  91.209  131.968 1.00 59.80 ? 463 ARG A N   1 
ATOM   7420  C CA  . ARG B 1 463 ? 49.935  90.924  133.313 1.00 60.09 ? 463 ARG A CA  1 
ATOM   7421  C C   . ARG B 1 463 ? 49.228  91.709  134.425 1.00 60.20 ? 463 ARG A C   1 
ATOM   7422  O O   . ARG B 1 463 ? 49.872  92.300  135.298 1.00 60.33 ? 463 ARG A O   1 
ATOM   7423  C CB  . ARG B 1 463 ? 51.464  91.051  133.366 1.00 60.18 ? 463 ARG A CB  1 
ATOM   7424  C CG  . ARG B 1 463 ? 52.170  89.899  132.656 1.00 60.50 ? 463 ARG A CG  1 
ATOM   7425  C CD  . ARG B 1 463 ? 53.669  89.907  132.889 1.00 61.15 ? 463 ARG A CD  1 
ATOM   7426  N NE  . ARG B 1 463 ? 54.342  90.936  132.101 1.00 61.58 ? 463 ARG A NE  1 
ATOM   7427  C CZ  . ARG B 1 463 ? 55.655  90.987  131.896 1.00 61.90 ? 463 ARG A CZ  1 
ATOM   7428  N NH1 . ARG B 1 463 ? 56.457  90.061  132.415 1.00 62.07 ? 463 ARG A NH1 1 
ATOM   7429  N NH2 . ARG B 1 463 ? 56.170  91.967  131.164 1.00 62.00 ? 463 ARG A NH2 1 
ATOM   7430  N N   . GLY B 1 464 ? 47.895  91.708  134.365 1.00 60.26 ? 464 GLY A N   1 
ATOM   7431  C CA  . GLY B 1 464 ? 47.041  92.328  135.381 1.00 60.28 ? 464 GLY A CA  1 
ATOM   7432  C C   . GLY B 1 464 ? 46.747  93.804  135.173 1.00 60.31 ? 464 GLY A C   1 
ATOM   7433  O O   . GLY B 1 464 ? 46.140  94.449  136.036 1.00 60.31 ? 464 GLY A O   1 
ATOM   7434  N N   . TYR B 1 465 ? 47.160  94.341  134.026 1.00 60.27 ? 465 TYR A N   1 
ATOM   7435  C CA  . TYR B 1 465 ? 47.070  95.781  133.782 1.00 60.20 ? 465 TYR A CA  1 
ATOM   7436  C C   . TYR B 1 465 ? 45.868  96.224  132.948 1.00 60.11 ? 465 TYR A C   1 
ATOM   7437  O O   . TYR B 1 465 ? 45.556  97.418  132.892 1.00 60.13 ? 465 TYR A O   1 
ATOM   7438  C CB  . TYR B 1 465 ? 48.379  96.302  133.186 1.00 60.19 ? 465 TYR A CB  1 
ATOM   7439  C CG  . TYR B 1 465 ? 49.428  96.596  134.233 1.00 60.34 ? 465 TYR A CG  1 
ATOM   7440  C CD1 . TYR B 1 465 ? 50.229  95.578  134.755 1.00 60.43 ? 465 TYR A CD1 1 
ATOM   7441  C CD2 . TYR B 1 465 ? 49.614  97.894  134.711 1.00 60.56 ? 465 TYR A CD2 1 
ATOM   7442  C CE1 . TYR B 1 465 ? 51.193  95.846  135.724 1.00 60.36 ? 465 TYR A CE1 1 
ATOM   7443  C CE2 . TYR B 1 465 ? 50.575  98.174  135.679 1.00 60.57 ? 465 TYR A CE2 1 
ATOM   7444  C CZ  . TYR B 1 465 ? 51.359  97.146  136.180 1.00 60.39 ? 465 TYR A CZ  1 
ATOM   7445  O OH  . TYR B 1 465 ? 52.308  97.422  137.137 1.00 60.33 ? 465 TYR A OH  1 
ATOM   7446  N N   . ALA B 1 466 ? 45.194  95.268  132.316 1.00 59.98 ? 466 ALA A N   1 
ATOM   7447  C CA  . ALA B 1 466 ? 43.994  95.564  131.540 1.00 59.95 ? 466 ALA A CA  1 
ATOM   7448  C C   . ALA B 1 466 ? 42.730  95.275  132.342 1.00 59.94 ? 466 ALA A C   1 
ATOM   7449  O O   . ALA B 1 466 ? 42.527  94.148  132.818 1.00 60.01 ? 466 ALA A O   1 
ATOM   7450  C CB  . ALA B 1 466 ? 43.990  94.789  130.233 1.00 59.95 ? 466 ALA A CB  1 
ATOM   7451  N N   . SER B 1 467 ? 41.891  96.303  132.489 1.00 59.85 ? 467 SER A N   1 
ATOM   7452  C CA  . SER B 1 467 ? 40.621  96.182  133.203 1.00 59.79 ? 467 SER A CA  1 
ATOM   7453  C C   . SER B 1 467 ? 39.465  95.922  132.240 1.00 59.69 ? 467 SER A C   1 
ATOM   7454  O O   . SER B 1 467 ? 39.232  96.700  131.313 1.00 59.74 ? 467 SER A O   1 
ATOM   7455  C CB  . SER B 1 467 ? 40.342  97.453  134.002 1.00 59.86 ? 467 SER A CB  1 
ATOM   7456  O OG  . SER B 1 467 ? 40.264  98.575  133.138 1.00 59.96 ? 467 SER A OG  1 
ATOM   7457  N N   . LEU B 1 468 ? 38.740  94.832  132.471 1.00 59.53 ? 468 LEU A N   1 
ATOM   7458  C CA  . LEU B 1 468 ? 37.581  94.489  131.652 1.00 59.29 ? 468 LEU A CA  1 
ATOM   7459  C C   . LEU B 1 468 ? 36.314  95.133  132.200 1.00 59.10 ? 468 LEU A C   1 
ATOM   7460  O O   . LEU B 1 468 ? 36.148  95.285  133.411 1.00 59.14 ? 468 LEU A O   1 
ATOM   7461  C CB  . LEU B 1 468 ? 37.391  92.973  131.593 1.00 59.30 ? 468 LEU A CB  1 
ATOM   7462  C CG  . LEU B 1 468 ? 37.016  92.265  130.282 1.00 59.23 ? 468 LEU A CG  1 
ATOM   7463  C CD1 . LEU B 1 468 ? 36.350  90.936  130.608 1.00 59.20 ? 468 LEU A CD1 1 
ATOM   7464  C CD2 . LEU B 1 468 ? 36.125  93.091  129.350 1.00 58.98 ? 468 LEU A CD2 1 
ATOM   7465  N N   . ASP B 1 469 ? 35.424  95.504  131.290 1.00 58.94 ? 469 ASP A N   1 
ATOM   7466  C CA  . ASP B 1 469 ? 34.125  96.056  131.630 1.00 58.76 ? 469 ASP A CA  1 
ATOM   7467  C C   . ASP B 1 469 ? 33.207  95.810  130.443 1.00 58.42 ? 469 ASP A C   1 
ATOM   7468  O O   . ASP B 1 469 ? 33.390  96.411  129.384 1.00 58.35 ? 469 ASP A O   1 
ATOM   7469  C CB  . ASP B 1 469 ? 34.245  97.556  131.900 1.00 58.97 ? 469 ASP A CB  1 
ATOM   7470  C CG  . ASP B 1 469 ? 32.966  98.152  132.443 1.00 59.76 ? 469 ASP A CG  1 
ATOM   7471  O OD1 . ASP B 1 469 ? 32.562  97.753  133.557 1.00 60.50 ? 469 ASP A OD1 1 
ATOM   7472  O OD2 . ASP B 1 469 ? 32.374  99.023  131.762 1.00 60.37 ? 469 ASP A OD2 1 
ATOM   7473  N N   . TYR B 1 470 ? 32.231  94.921  130.605 1.00 58.03 ? 470 TYR A N   1 
ATOM   7474  C CA  . TYR B 1 470 ? 31.362  94.561  129.483 1.00 57.68 ? 470 TYR A CA  1 
ATOM   7475  C C   . TYR B 1 470 ? 29.872  94.585  129.812 1.00 57.48 ? 470 TYR A C   1 
ATOM   7476  O O   . TYR B 1 470 ? 29.470  94.350  130.952 1.00 57.57 ? 470 TYR A O   1 
ATOM   7477  C CB  . TYR B 1 470 ? 31.759  93.199  128.898 1.00 57.51 ? 470 TYR A CB  1 
ATOM   7478  C CG  . TYR B 1 470 ? 31.426  92.024  129.784 1.00 57.33 ? 470 TYR A CG  1 
ATOM   7479  C CD1 . TYR B 1 470 ? 32.303  91.614  130.791 1.00 57.24 ? 470 TYR A CD1 1 
ATOM   7480  C CD2 . TYR B 1 470 ? 30.237  91.317  129.615 1.00 57.03 ? 470 TYR A CD2 1 
ATOM   7481  C CE1 . TYR B 1 470 ? 32.002  90.531  131.612 1.00 57.34 ? 470 TYR A CE1 1 
ATOM   7482  C CE2 . TYR B 1 470 ? 29.924  90.234  130.431 1.00 57.43 ? 470 TYR A CE2 1 
ATOM   7483  C CZ  . TYR B 1 470 ? 30.811  89.845  131.428 1.00 57.36 ? 470 TYR A CZ  1 
ATOM   7484  O OH  . TYR B 1 470 ? 30.505  88.775  132.238 1.00 57.22 ? 470 TYR A OH  1 
ATOM   7485  N N   . ASN B 1 471 ? 29.066  94.872  128.795 1.00 57.23 ? 471 ASN A N   1 
ATOM   7486  C CA  . ASN B 1 471 ? 27.616  94.736  128.877 1.00 57.07 ? 471 ASN A CA  1 
ATOM   7487  C C   . ASN B 1 471 ? 27.046  94.287  127.536 1.00 56.70 ? 471 ASN A C   1 
ATOM   7488  O O   . ASN B 1 471 ? 27.662  94.520  126.493 1.00 56.64 ? 471 ASN A O   1 
ATOM   7489  C CB  . ASN B 1 471 ? 26.956  96.041  129.354 1.00 57.25 ? 471 ASN A CB  1 
ATOM   7490  C CG  . ASN B 1 471 ? 27.363  97.253  128.523 1.00 58.04 ? 471 ASN A CG  1 
ATOM   7491  O OD1 . ASN B 1 471 ? 28.137  98.097  128.979 1.00 59.29 ? 471 ASN A OD1 1 
ATOM   7492  N ND2 . ASN B 1 471 ? 26.840  97.348  127.300 1.00 58.80 ? 471 ASN A ND2 1 
ATOM   7493  N N   . PHE B 1 472 ? 25.883  93.634  127.572 1.00 56.30 ? 472 PHE A N   1 
ATOM   7494  C CA  . PHE B 1 472 ? 25.179  93.218  126.358 1.00 55.88 ? 472 PHE A CA  1 
ATOM   7495  C C   . PHE B 1 472 ? 24.895  94.422  125.461 1.00 55.77 ? 472 PHE A C   1 
ATOM   7496  O O   . PHE B 1 472 ? 24.489  95.481  125.941 1.00 55.79 ? 472 PHE A O   1 
ATOM   7497  C CB  . PHE B 1 472 ? 23.875  92.499  126.714 1.00 55.64 ? 472 PHE A CB  1 
ATOM   7498  C CG  . PHE B 1 472 ? 22.980  92.234  125.532 1.00 55.51 ? 472 PHE A CG  1 
ATOM   7499  C CD1 . PHE B 1 472 ? 23.142  91.090  124.762 1.00 55.37 ? 472 PHE A CD1 1 
ATOM   7500  C CD2 . PHE B 1 472 ? 21.968  93.131  125.191 1.00 55.49 ? 472 PHE A CD2 1 
ATOM   7501  C CE1 . PHE B 1 472 ? 22.314  90.843  123.670 1.00 55.37 ? 472 PHE A CE1 1 
ATOM   7502  C CE2 . PHE B 1 472 ? 21.138  92.895  124.100 1.00 55.07 ? 472 PHE A CE2 1 
ATOM   7503  C CZ  . PHE B 1 472 ? 21.309  91.750  123.340 1.00 55.30 ? 472 PHE A CZ  1 
ATOM   7504  N N   . LYS B 1 473 ? 25.109  94.254  124.162 1.00 55.65 ? 473 LYS A N   1 
ATOM   7505  C CA  . LYS B 1 473 ? 24.909  95.341  123.212 1.00 55.68 ? 473 LYS A CA  1 
ATOM   7506  C C   . LYS B 1 473 ? 23.819  95.024  122.192 1.00 55.78 ? 473 LYS A C   1 
ATOM   7507  O O   . LYS B 1 473 ? 22.902  95.819  121.984 1.00 55.85 ? 473 LYS A O   1 
ATOM   7508  C CB  . LYS B 1 473 ? 26.227  95.672  122.502 1.00 55.60 ? 473 LYS A CB  1 
ATOM   7509  C CG  . LYS B 1 473 ? 26.157  96.809  121.485 1.00 55.56 ? 473 LYS A CG  1 
ATOM   7510  C CD  . LYS B 1 473 ? 26.279  98.178  122.135 1.00 55.54 ? 473 LYS A CD  1 
ATOM   7511  C CE  . LYS B 1 473 ? 26.545  99.250  121.092 1.00 55.72 ? 473 LYS A CE  1 
ATOM   7512  N NZ  . LYS B 1 473 ? 26.795  100.575 121.723 1.00 56.03 ? 473 LYS A NZ  1 
ATOM   7513  N N   . ARG B 1 474 ? 23.918  93.854  121.570 1.00 55.89 ? 474 ARG A N   1 
ATOM   7514  C CA  . ARG B 1 474 ? 23.114  93.533  120.403 1.00 56.02 ? 474 ARG A CA  1 
ATOM   7515  C C   . ARG B 1 474 ? 23.187  92.042  120.105 1.00 55.84 ? 474 ARG A C   1 
ATOM   7516  O O   . ARG B 1 474 ? 24.105  91.349  120.563 1.00 55.74 ? 474 ARG A O   1 
ATOM   7517  C CB  . ARG B 1 474 ? 23.659  94.308  119.201 1.00 56.14 ? 474 ARG A CB  1 
ATOM   7518  C CG  . ARG B 1 474 ? 22.697  94.493  118.037 1.00 57.34 ? 474 ARG A CG  1 
ATOM   7519  C CD  . ARG B 1 474 ? 23.452  94.776  116.727 1.00 59.18 ? 474 ARG A CD  1 
ATOM   7520  N NE  . ARG B 1 474 ? 24.672  95.563  116.938 1.00 60.11 ? 474 ARG A NE  1 
ATOM   7521  C CZ  . ARG B 1 474 ? 25.911  95.104  116.767 1.00 60.24 ? 474 ARG A CZ  1 
ATOM   7522  N NH1 . ARG B 1 474 ? 26.123  93.859  116.360 1.00 60.07 ? 474 ARG A NH1 1 
ATOM   7523  N NH2 . ARG B 1 474 ? 26.944  95.900  116.996 1.00 60.58 ? 474 ARG A NH2 1 
ATOM   7524  N N   . PHE B 1 475 ? 22.209  91.554  119.344 1.00 55.63 ? 475 PHE A N   1 
ATOM   7525  C CA  . PHE B 1 475 ? 22.301  90.243  118.715 1.00 55.36 ? 475 PHE A CA  1 
ATOM   7526  C C   . PHE B 1 475 ? 22.745  90.443  117.273 1.00 55.27 ? 475 PHE A C   1 
ATOM   7527  O O   . PHE B 1 475 ? 22.389  91.444  116.644 1.00 55.35 ? 475 PHE A O   1 
ATOM   7528  C CB  . PHE B 1 475 ? 20.955  89.516  118.752 1.00 55.29 ? 475 PHE A CB  1 
ATOM   7529  C CG  . PHE B 1 475 ? 20.586  88.978  120.107 1.00 55.29 ? 475 PHE A CG  1 
ATOM   7530  C CD1 . PHE B 1 475 ? 19.626  89.619  120.886 1.00 55.02 ? 475 PHE A CD1 1 
ATOM   7531  C CD2 . PHE B 1 475 ? 21.195  87.826  120.605 1.00 55.19 ? 475 PHE A CD2 1 
ATOM   7532  C CE1 . PHE B 1 475 ? 19.277  89.121  122.140 1.00 55.12 ? 475 PHE A CE1 1 
ATOM   7533  C CE2 . PHE B 1 475 ? 20.856  87.322  121.859 1.00 55.00 ? 475 PHE A CE2 1 
ATOM   7534  C CZ  . PHE B 1 475 ? 19.892  87.971  122.628 1.00 55.19 ? 475 PHE A CZ  1 
ATOM   7535  N N   . GLN B 1 476 ? 23.527  89.501  116.753 1.00 55.03 ? 476 GLN A N   1 
ATOM   7536  C CA  . GLN B 1 476 ? 23.969  89.560  115.364 1.00 54.80 ? 476 GLN A CA  1 
ATOM   7537  C C   . GLN B 1 476 ? 24.021  88.179  114.729 1.00 54.71 ? 476 GLN A C   1 
ATOM   7538  O O   . GLN B 1 476 ? 24.411  87.204  115.375 1.00 54.71 ? 476 GLN A O   1 
ATOM   7539  C CB  . GLN B 1 476 ? 25.334  90.245  115.253 1.00 54.78 ? 476 GLN A CB  1 
ATOM   7540  C CG  . GLN B 1 476 ? 25.727  90.613  113.822 1.00 54.85 ? 476 GLN A CG  1 
ATOM   7541  C CD  . GLN B 1 476 ? 26.750  91.729  113.750 1.00 55.24 ? 476 GLN A CD  1 
ATOM   7542  O OE1 . GLN B 1 476 ? 27.405  92.058  114.740 1.00 55.68 ? 476 GLN A OE1 1 
ATOM   7543  N NE2 . GLN B 1 476 ? 26.893  92.320  112.570 1.00 55.58 ? 476 GLN A NE2 1 
ATOM   7544  N N   . ALA B 1 477 ? 23.620  88.113  113.459 1.00 54.51 ? 477 ALA A N   1 
ATOM   7545  C CA  . ALA B 1 477 ? 23.700  86.896  112.659 1.00 54.16 ? 477 ALA A CA  1 
ATOM   7546  C C   . ALA B 1 477 ? 25.132  86.376  112.633 1.00 53.94 ? 477 ALA A C   1 
ATOM   7547  O O   . ALA B 1 477 ? 26.076  87.143  112.430 1.00 53.85 ? 477 ALA A O   1 
ATOM   7548  C CB  . ALA B 1 477 ? 23.211  87.168  111.252 1.00 54.18 ? 477 ALA A CB  1 
ATOM   7549  N N   . SER B 1 478 ? 25.288  85.072  112.848 1.00 53.70 ? 478 SER A N   1 
ATOM   7550  C CA  . SER B 1 478 ? 26.614  84.469  112.944 1.00 53.50 ? 478 SER A CA  1 
ATOM   7551  C C   . SER B 1 478 ? 26.607  82.962  112.678 1.00 53.29 ? 478 SER A C   1 
ATOM   7552  O O   . SER B 1 478 ? 25.701  82.246  113.112 1.00 53.25 ? 478 SER A O   1 
ATOM   7553  C CB  . SER B 1 478 ? 27.218  84.763  114.316 1.00 53.50 ? 478 SER A CB  1 
ATOM   7554  O OG  . SER B 1 478 ? 28.626  84.619  114.300 1.00 53.73 ? 478 SER A OG  1 
ATOM   7555  N N   . ASP B 1 479 ? 27.633  82.500  111.963 1.00 53.06 ? 479 ASP A N   1 
ATOM   7556  C CA  . ASP B 1 479 ? 27.797  81.095  111.600 1.00 52.81 ? 479 ASP A CA  1 
ATOM   7557  C C   . ASP B 1 479 ? 28.127  80.264  112.837 1.00 52.78 ? 479 ASP A C   1 
ATOM   7558  O O   . ASP B 1 479 ? 29.290  79.964  113.120 1.00 52.76 ? 479 ASP A O   1 
ATOM   7559  C CB  . ASP B 1 479 ? 28.891  80.956  110.536 1.00 52.74 ? 479 ASP A CB  1 
ATOM   7560  C CG  . ASP B 1 479 ? 28.893  79.595  109.865 1.00 52.46 ? 479 ASP A CG  1 
ATOM   7561  O OD1 . ASP B 1 479 ? 29.886  79.285  109.177 1.00 52.32 ? 479 ASP A OD1 1 
ATOM   7562  O OD2 . ASP B 1 479 ? 27.911  78.837  110.017 1.00 52.30 ? 479 ASP A OD2 1 
ATOM   7563  N N   . MET B 1 480 ? 27.080  79.893  113.564 1.00 52.74 ? 480 MET A N   1 
ATOM   7564  C CA  . MET B 1 480 ? 27.211  79.294  114.882 1.00 52.66 ? 480 MET A CA  1 
ATOM   7565  C C   . MET B 1 480 ? 26.705  77.854  114.854 1.00 52.56 ? 480 MET A C   1 
ATOM   7566  O O   . MET B 1 480 ? 25.596  77.586  114.381 1.00 52.55 ? 480 MET A O   1 
ATOM   7567  C CB  . MET B 1 480 ? 26.420  80.128  115.893 1.00 52.68 ? 480 MET A CB  1 
ATOM   7568  C CG  . MET B 1 480 ? 27.063  80.289  117.263 1.00 52.87 ? 480 MET A CG  1 
ATOM   7569  S SD  . MET B 1 480 ? 28.640  81.174  117.295 1.00 53.48 ? 480 MET A SD  1 
ATOM   7570  C CE  . MET B 1 480 ? 28.234  82.647  116.396 1.00 53.18 ? 480 MET A CE  1 
ATOM   7571  N N   . VAL B 1 481 ? 27.526  76.935  115.355 1.00 52.47 ? 481 VAL A N   1 
ATOM   7572  C CA  . VAL B 1 481 ? 27.206  75.503  115.336 1.00 52.36 ? 481 VAL A CA  1 
ATOM   7573  C C   . VAL B 1 481 ? 27.193  74.882  116.737 1.00 52.28 ? 481 VAL A C   1 
ATOM   7574  O O   . VAL B 1 481 ? 27.634  75.507  117.707 1.00 52.25 ? 481 VAL A O   1 
ATOM   7575  C CB  . VAL B 1 481 ? 28.151  74.704  114.399 1.00 52.36 ? 481 VAL A CB  1 
ATOM   7576  C CG1 . VAL B 1 481 ? 27.791  74.951  112.940 1.00 52.20 ? 481 VAL A CG1 1 
ATOM   7577  C CG2 . VAL B 1 481 ? 29.622  75.040  114.674 1.00 52.53 ? 481 VAL A CG2 1 
ATOM   7578  N N   . ARG B 1 482 ? 26.683  73.654  116.825 1.00 52.19 ? 482 ARG A N   1 
ATOM   7579  C CA  . ARG B 1 482 ? 26.497  72.962  118.098 1.00 52.02 ? 482 ARG A CA  1 
ATOM   7580  C C   . ARG B 1 482 ? 27.312  71.678  118.188 1.00 52.01 ? 482 ARG A C   1 
ATOM   7581  O O   . ARG B 1 482 ? 27.133  70.755  117.389 1.00 52.03 ? 482 ARG A O   1 
ATOM   7582  C CB  . ARG B 1 482 ? 25.012  72.670  118.317 1.00 52.05 ? 482 ARG A CB  1 
ATOM   7583  C CG  . ARG B 1 482 ? 24.703  71.615  119.363 1.00 51.93 ? 482 ARG A CG  1 
ATOM   7584  C CD  . ARG B 1 482 ? 23.258  71.705  119.766 1.00 52.22 ? 482 ARG A CD  1 
ATOM   7585  N NE  . ARG B 1 482 ? 22.673  70.395  120.024 1.00 53.25 ? 482 ARG A NE  1 
ATOM   7586  C CZ  . ARG B 1 482 ? 21.693  69.850  119.307 1.00 53.68 ? 482 ARG A CZ  1 
ATOM   7587  N NH1 . ARG B 1 482 ? 21.169  70.503  118.276 1.00 53.90 ? 482 ARG A NH1 1 
ATOM   7588  N NH2 . ARG B 1 482 ? 21.228  68.649  119.628 1.00 54.05 ? 482 ARG A NH2 1 
ATOM   7589  N N   . VAL B 1 483 ? 28.201  71.632  119.176 1.00 52.01 ? 483 VAL A N   1 
ATOM   7590  C CA  . VAL B 1 483 ? 29.026  70.458  119.434 1.00 51.96 ? 483 VAL A CA  1 
ATOM   7591  C C   . VAL B 1 483 ? 28.358  69.584  120.496 1.00 52.06 ? 483 VAL A C   1 
ATOM   7592  O O   . VAL B 1 483 ? 28.075  70.042  121.602 1.00 51.87 ? 483 VAL A O   1 
ATOM   7593  C CB  . VAL B 1 483 ? 30.459  70.860  119.863 1.00 51.88 ? 483 VAL A CB  1 
ATOM   7594  C CG1 . VAL B 1 483 ? 31.274  69.644  120.269 1.00 51.93 ? 483 VAL A CG1 1 
ATOM   7595  C CG2 . VAL B 1 483 ? 31.158  71.608  118.739 1.00 51.67 ? 483 VAL A CG2 1 
ATOM   7596  N N   . ASP B 1 484 ? 28.096  68.330  120.135 1.00 52.42 ? 484 ASP A N   1 
ATOM   7597  C CA  . ASP B 1 484 ? 27.461  67.366  121.029 1.00 52.82 ? 484 ASP A CA  1 
ATOM   7598  C C   . ASP B 1 484 ? 28.493  66.399  121.576 1.00 53.06 ? 484 ASP A C   1 
ATOM   7599  O O   . ASP B 1 484 ? 29.266  65.814  120.817 1.00 53.12 ? 484 ASP A O   1 
ATOM   7600  C CB  . ASP B 1 484 ? 26.382  66.566  120.294 1.00 52.85 ? 484 ASP A CB  1 
ATOM   7601  C CG  . ASP B 1 484 ? 25.367  67.451  119.598 1.00 53.30 ? 484 ASP A CG  1 
ATOM   7602  O OD1 . ASP B 1 484 ? 24.770  68.320  120.274 1.00 53.71 ? 484 ASP A OD1 1 
ATOM   7603  O OD2 . ASP B 1 484 ? 25.166  67.267  118.374 1.00 53.57 ? 484 ASP A OD2 1 
ATOM   7604  N N   . VAL B 1 485 ? 28.492  66.230  122.895 1.00 53.40 ? 485 VAL A N   1 
ATOM   7605  C CA  . VAL B 1 485 ? 29.363  65.262  123.554 1.00 53.67 ? 485 VAL A CA  1 
ATOM   7606  C C   . VAL B 1 485 ? 28.592  63.974  123.807 1.00 53.85 ? 485 VAL A C   1 
ATOM   7607  O O   . VAL B 1 485 ? 27.429  64.011  124.210 1.00 53.98 ? 485 VAL A O   1 
ATOM   7608  C CB  . VAL B 1 485 ? 29.882  65.791  124.904 1.00 53.66 ? 485 VAL A CB  1 
ATOM   7609  C CG1 . VAL B 1 485 ? 31.062  64.960  125.387 1.00 53.74 ? 485 VAL A CG1 1 
ATOM   7610  C CG2 . VAL B 1 485 ? 30.282  67.246  124.789 1.00 53.76 ? 485 VAL A CG2 1 
ATOM   7611  N N   . LEU B 1 486 ? 29.230  62.837  123.554 1.00 54.05 ? 486 LEU A N   1 
ATOM   7612  C CA  . LEU B 1 486 ? 28.672  61.561  123.986 1.00 54.42 ? 486 LEU A CA  1 
ATOM   7613  C C   . LEU B 1 486 ? 29.745  60.682  124.609 1.00 54.56 ? 486 LEU A C   1 
ATOM   7614  O O   . LEU B 1 486 ? 30.823  60.504  124.043 1.00 54.69 ? 486 LEU A O   1 
ATOM   7615  C CB  . LEU B 1 486 ? 27.921  60.833  122.857 1.00 54.45 ? 486 LEU A CB  1 
ATOM   7616  C CG  . LEU B 1 486 ? 28.598  60.495  121.526 1.00 54.74 ? 486 LEU A CG  1 
ATOM   7617  C CD1 . LEU B 1 486 ? 28.008  59.215  120.944 1.00 54.96 ? 486 LEU A CD1 1 
ATOM   7618  C CD2 . LEU B 1 486 ? 28.500  61.658  120.525 1.00 55.60 ? 486 LEU A CD2 1 
ATOM   7619  N N   . ILE B 1 487 ? 29.458  60.163  125.799 1.00 54.71 ? 487 ILE A N   1 
ATOM   7620  C CA  . ILE B 1 487 ? 30.392  59.267  126.473 1.00 54.87 ? 487 ILE A CA  1 
ATOM   7621  C C   . ILE B 1 487 ? 29.714  57.957  126.880 1.00 54.99 ? 487 ILE A C   1 
ATOM   7622  O O   . ILE B 1 487 ? 28.627  57.957  127.468 1.00 55.01 ? 487 ILE A O   1 
ATOM   7623  C CB  . ILE B 1 487 ? 31.145  59.942  127.659 1.00 54.80 ? 487 ILE A CB  1 
ATOM   7624  C CG1 . ILE B 1 487 ? 30.305  59.972  128.923 1.00 54.52 ? 487 ILE A CG1 1 
ATOM   7625  C CG2 . ILE B 1 487 ? 31.594  61.356  127.300 1.00 54.94 ? 487 ILE A CG2 1 
ATOM   7626  C CD1 . ILE B 1 487 ? 31.134  60.234  130.144 1.00 55.27 ? 487 ILE A CD1 1 
ATOM   7627  N N   . ASN B 1 488 ? 30.379  56.848  126.553 1.00 55.06 ? 488 ASN A N   1 
ATOM   7628  C CA  . ASN B 1 488 ? 29.780  55.515  126.582 1.00 54.99 ? 488 ASN A CA  1 
ATOM   7629  C C   . ASN B 1 488 ? 28.578  55.437  125.647 1.00 55.05 ? 488 ASN A C   1 
ATOM   7630  O O   . ASN B 1 488 ? 27.602  54.741  125.924 1.00 55.16 ? 488 ASN A O   1 
ATOM   7631  C CB  . ASN B 1 488 ? 29.411  55.090  128.007 1.00 54.88 ? 488 ASN A CB  1 
ATOM   7632  C CG  . ASN B 1 488 ? 30.597  54.546  128.784 1.00 55.03 ? 488 ASN A CG  1 
ATOM   7633  O OD1 . ASN B 1 488 ? 31.675  54.310  128.225 1.00 55.06 ? 488 ASN A OD1 1 
ATOM   7634  N ND2 . ASN B 1 488 ? 30.400  54.333  130.083 1.00 54.60 ? 488 ASN A ND2 1 
ATOM   7635  N N   . GLY B 1 489 ? 28.663  56.171  124.539 1.00 55.14 ? 489 GLY A N   1 
ATOM   7636  C CA  . GLY B 1 489 ? 27.589  56.231  123.552 1.00 55.25 ? 489 GLY A CA  1 
ATOM   7637  C C   . GLY B 1 489 ? 26.357  56.968  124.046 1.00 55.30 ? 489 GLY A C   1 
ATOM   7638  O O   . GLY B 1 489 ? 25.377  57.123  123.313 1.00 55.27 ? 489 GLY A O   1 
ATOM   7639  N N   . GLU B 1 490 ? 26.401  57.419  125.295 1.00 55.32 ? 490 GLU A N   1 
ATOM   7640  C CA  . GLU B 1 490 ? 25.275  58.123  125.879 1.00 55.40 ? 490 GLU A CA  1 
ATOM   7641  C C   . GLU B 1 490 ? 25.387  59.616  125.628 1.00 55.20 ? 490 GLU A C   1 
ATOM   7642  O O   . GLU B 1 490 ? 26.447  60.214  125.817 1.00 55.19 ? 490 GLU A O   1 
ATOM   7643  C CB  . GLU B 1 490 ? 25.149  57.819  127.369 1.00 55.56 ? 490 GLU A CB  1 
ATOM   7644  C CG  . GLU B 1 490 ? 24.816  56.356  127.669 1.00 56.51 ? 490 GLU A CG  1 
ATOM   7645  C CD  . GLU B 1 490 ? 23.939  56.199  128.899 1.00 57.81 ? 490 GLU A CD  1 
ATOM   7646  O OE1 . GLU B 1 490 ? 24.402  55.580  129.887 1.00 57.86 ? 490 GLU A OE1 1 
ATOM   7647  O OE2 . GLU B 1 490 ? 22.791  56.707  128.877 1.00 58.41 ? 490 GLU A OE2 1 
ATOM   7648  N N   . ARG B 1 491 ? 24.277  60.197  125.184 1.00 55.00 ? 491 ARG A N   1 
ATOM   7649  C CA  . ARG B 1 491 ? 24.184  61.615  124.871 1.00 54.72 ? 491 ARG A CA  1 
ATOM   7650  C C   . ARG B 1 491 ? 24.260  62.435  126.159 1.00 54.33 ? 491 ARG A C   1 
ATOM   7651  O O   . ARG B 1 491 ? 23.392  62.316  127.028 1.00 54.42 ? 491 ARG A O   1 
ATOM   7652  C CB  . ARG B 1 491 ? 22.861  61.870  124.148 1.00 54.83 ? 491 ARG A CB  1 
ATOM   7653  C CG  . ARG B 1 491 ? 22.783  63.169  123.376 1.00 55.66 ? 491 ARG A CG  1 
ATOM   7654  C CD  . ARG B 1 491 ? 21.520  63.198  122.506 1.00 56.71 ? 491 ARG A CD  1 
ATOM   7655  N NE  . ARG B 1 491 ? 21.601  64.208  121.449 1.00 57.22 ? 491 ARG A NE  1 
ATOM   7656  C CZ  . ARG B 1 491 ? 22.262  64.055  120.302 1.00 57.04 ? 491 ARG A CZ  1 
ATOM   7657  N NH1 . ARG B 1 491 ? 22.916  62.930  120.041 1.00 56.71 ? 491 ARG A NH1 1 
ATOM   7658  N NH2 . ARG B 1 491 ? 22.271  65.036  119.410 1.00 57.24 ? 491 ARG A NH2 1 
ATOM   7659  N N   . VAL B 1 492 ? 25.308  63.244  126.297 1.00 53.76 ? 492 VAL A N   1 
ATOM   7660  C CA  . VAL B 1 492 ? 25.440  64.105  127.476 1.00 53.32 ? 492 VAL A CA  1 
ATOM   7661  C C   . VAL B 1 492 ? 25.055  65.546  127.127 1.00 53.12 ? 492 VAL A C   1 
ATOM   7662  O O   . VAL B 1 492 ? 25.904  66.371  126.770 1.00 52.96 ? 492 VAL A O   1 
ATOM   7663  C CB  . VAL B 1 492 ? 26.844  64.018  128.134 1.00 53.30 ? 492 VAL A CB  1 
ATOM   7664  C CG1 . VAL B 1 492 ? 26.819  64.648  129.517 1.00 52.91 ? 492 VAL A CG1 1 
ATOM   7665  C CG2 . VAL B 1 492 ? 27.305  62.568  128.234 1.00 53.22 ? 492 VAL A CG2 1 
ATOM   7666  N N   . ASP B 1 493 ? 23.756  65.824  127.233 1.00 52.85 ? 493 ASP A N   1 
ATOM   7667  C CA  . ASP B 1 493 ? 23.178  67.110  126.857 1.00 52.63 ? 493 ASP A CA  1 
ATOM   7668  C C   . ASP B 1 493 ? 23.725  68.256  127.694 1.00 52.40 ? 493 ASP A C   1 
ATOM   7669  O O   . ASP B 1 493 ? 23.899  69.367  127.197 1.00 52.34 ? 493 ASP A O   1 
ATOM   7670  C CB  . ASP B 1 493 ? 21.649  67.060  126.965 1.00 52.72 ? 493 ASP A CB  1 
ATOM   7671  C CG  . ASP B 1 493 ? 20.999  66.342  125.792 1.00 52.91 ? 493 ASP A CG  1 
ATOM   7672  O OD1 . ASP B 1 493 ? 21.626  66.262  124.716 1.00 53.51 ? 493 ASP A OD1 1 
ATOM   7673  O OD2 . ASP B 1 493 ? 19.852  65.865  125.941 1.00 52.94 ? 493 ASP A OD2 1 
ATOM   7674  N N   . ALA B 1 494 ? 24.004  67.970  128.960 1.00 52.21 ? 494 ALA A N   1 
ATOM   7675  C CA  . ALA B 1 494 ? 24.529  68.959  129.892 1.00 52.17 ? 494 ALA A CA  1 
ATOM   7676  C C   . ALA B 1 494 ? 25.864  69.523  129.428 1.00 52.09 ? 494 ALA A C   1 
ATOM   7677  O O   . ALA B 1 494 ? 26.274  70.611  129.841 1.00 52.15 ? 494 ALA A O   1 
ATOM   7678  C CB  . ALA B 1 494 ? 24.682  68.339  131.268 1.00 52.25 ? 494 ALA A CB  1 
ATOM   7679  N N   . LEU B 1 495 ? 26.527  68.778  128.554 1.00 51.97 ? 495 LEU A N   1 
ATOM   7680  C CA  . LEU B 1 495 ? 27.900  69.059  128.184 1.00 51.81 ? 495 LEU A CA  1 
ATOM   7681  C C   . LEU B 1 495 ? 28.008  69.738  126.820 1.00 51.85 ? 495 LEU A C   1 
ATOM   7682  O O   . LEU B 1 495 ? 29.081  70.225  126.447 1.00 51.99 ? 495 LEU A O   1 
ATOM   7683  C CB  . LEU B 1 495 ? 28.687  67.750  128.201 1.00 51.71 ? 495 LEU A CB  1 
ATOM   7684  C CG  . LEU B 1 495 ? 30.056  67.671  128.870 1.00 51.27 ? 495 LEU A CG  1 
ATOM   7685  C CD1 . LEU B 1 495 ? 30.224  68.660  130.007 1.00 50.77 ? 495 LEU A CD1 1 
ATOM   7686  C CD2 . LEU B 1 495 ? 30.221  66.257  129.372 1.00 51.29 ? 495 LEU A CD2 1 
ATOM   7687  N N   . ALA B 1 496 ? 26.895  69.774  126.089 1.00 51.69 ? 496 ALA A N   1 
ATOM   7688  C CA  . ALA B 1 496 ? 26.848  70.372  124.755 1.00 51.66 ? 496 ALA A CA  1 
ATOM   7689  C C   . ALA B 1 496 ? 27.182  71.867  124.773 1.00 51.63 ? 496 ALA A C   1 
ATOM   7690  O O   . ALA B 1 496 ? 26.817  72.579  125.715 1.00 51.65 ? 496 ALA A O   1 
ATOM   7691  C CB  . ALA B 1 496 ? 25.481  70.136  124.123 1.00 51.66 ? 496 ALA A CB  1 
ATOM   7692  N N   . LEU B 1 497 ? 27.885  72.328  123.738 1.00 51.46 ? 497 LEU A N   1 
ATOM   7693  C CA  . LEU B 1 497 ? 28.224  73.746  123.604 1.00 51.33 ? 497 LEU A CA  1 
ATOM   7694  C C   . LEU B 1 497 ? 27.880  74.328  122.234 1.00 51.34 ? 497 LEU A C   1 
ATOM   7695  O O   . LEU B 1 497 ? 27.863  73.611  121.226 1.00 51.31 ? 497 LEU A O   1 
ATOM   7696  C CB  . LEU B 1 497 ? 29.700  74.008  123.951 1.00 51.33 ? 497 LEU A CB  1 
ATOM   7697  C CG  . LEU B 1 497 ? 30.898  73.343  123.252 1.00 51.33 ? 497 LEU A CG  1 
ATOM   7698  C CD1 . LEU B 1 497 ? 31.130  73.866  121.840 1.00 51.06 ? 497 LEU A CD1 1 
ATOM   7699  C CD2 . LEU B 1 497 ? 32.157  73.560  124.093 1.00 51.36 ? 497 LEU A CD2 1 
ATOM   7700  N N   . ILE B 1 498 ? 27.595  75.630  122.216 1.00 51.33 ? 498 ILE A N   1 
ATOM   7701  C CA  . ILE B 1 498 ? 27.427  76.377  120.968 1.00 51.22 ? 498 ILE A CA  1 
ATOM   7702  C C   . ILE B 1 498 ? 28.646  77.273  120.751 1.00 51.20 ? 498 ILE A C   1 
ATOM   7703  O O   . ILE B 1 498 ? 29.012  78.062  121.626 1.00 51.00 ? 498 ILE A O   1 
ATOM   7704  C CB  . ILE B 1 498 ? 26.120  77.215  120.946 1.00 51.25 ? 498 ILE A CB  1 
ATOM   7705  C CG1 . ILE B 1 498 ? 24.893  76.303  121.009 1.00 51.14 ? 498 ILE A CG1 1 
ATOM   7706  C CG2 . ILE B 1 498 ? 26.052  78.078  119.693 1.00 51.09 ? 498 ILE A CG2 1 
ATOM   7707  C CD1 . ILE B 1 498 ? 23.571  77.027  120.878 1.00 51.15 ? 498 ILE A CD1 1 
ATOM   7708  N N   . THR B 1 499 ? 29.273  77.127  119.586 1.00 51.27 ? 499 THR A N   1 
ATOM   7709  C CA  . THR B 1 499 ? 30.469  77.885  119.231 1.00 51.39 ? 499 THR A CA  1 
ATOM   7710  C C   . THR B 1 499 ? 30.483  78.201  117.736 1.00 51.74 ? 499 THR A C   1 
ATOM   7711  O O   . THR B 1 499 ? 29.678  77.662  116.973 1.00 51.75 ? 499 THR A O   1 
ATOM   7712  C CB  . THR B 1 499 ? 31.763  77.130  119.645 1.00 51.31 ? 499 THR A CB  1 
ATOM   7713  O OG1 . THR B 1 499 ? 32.890  78.012  119.571 1.00 50.97 ? 499 THR A OG1 1 
ATOM   7714  C CG2 . THR B 1 499 ? 32.004  75.916  118.755 1.00 51.32 ? 499 THR A CG2 1 
ATOM   7715  N N   . HIS B 1 500 ? 31.393  79.082  117.326 1.00 52.18 ? 500 HIS A N   1 
ATOM   7716  C CA  . HIS B 1 500 ? 31.542  79.442  115.922 1.00 52.63 ? 500 HIS A CA  1 
ATOM   7717  C C   . HIS B 1 500 ? 32.183  78.299  115.132 1.00 53.15 ? 500 HIS A C   1 
ATOM   7718  O O   . HIS B 1 500 ? 32.944  77.501  115.689 1.00 53.32 ? 500 HIS A O   1 
ATOM   7719  C CB  . HIS B 1 500 ? 32.363  80.726  115.788 1.00 52.51 ? 500 HIS A CB  1 
ATOM   7720  C CG  . HIS B 1 500 ? 32.463  81.231  114.383 1.00 52.49 ? 500 HIS A CG  1 
ATOM   7721  N ND1 . HIS B 1 500 ? 31.435  81.904  113.757 1.00 52.81 ? 500 HIS A ND1 1 
ATOM   7722  C CD2 . HIS B 1 500 ? 33.464  81.148  113.476 1.00 51.97 ? 500 HIS A CD2 1 
ATOM   7723  C CE1 . HIS B 1 500 ? 31.800  82.217  112.527 1.00 52.02 ? 500 HIS A CE1 1 
ATOM   7724  N NE2 . HIS B 1 500 ? 33.026  81.768  112.331 1.00 51.89 ? 500 HIS A NE2 1 
ATOM   7725  N N   . ARG B 1 501 ? 31.858  78.226  113.841 1.00 53.71 ? 501 ARG A N   1 
ATOM   7726  C CA  . ARG B 1 501 ? 32.415  77.226  112.925 1.00 54.29 ? 501 ARG A CA  1 
ATOM   7727  C C   . ARG B 1 501 ? 33.931  77.142  112.983 1.00 54.78 ? 501 ARG A C   1 
ATOM   7728  O O   . ARG B 1 501 ? 34.485  76.077  113.246 1.00 54.85 ? 501 ARG A O   1 
ATOM   7729  C CB  . ARG B 1 501 ? 31.998  77.542  111.487 1.00 54.30 ? 501 ARG A CB  1 
ATOM   7730  C CG  . ARG B 1 501 ? 30.753  76.832  111.028 1.00 53.96 ? 501 ARG A CG  1 
ATOM   7731  C CD  . ARG B 1 501 ? 31.030  75.863  109.890 1.00 52.61 ? 501 ARG A CD  1 
ATOM   7732  N NE  . ARG B 1 501 ? 30.060  74.772  109.898 1.00 51.99 ? 501 ARG A NE  1 
ATOM   7733  C CZ  . ARG B 1 501 ? 28.788  74.885  109.525 1.00 51.53 ? 501 ARG A CZ  1 
ATOM   7734  N NH1 . ARG B 1 501 ? 28.313  76.049  109.099 1.00 51.25 ? 501 ARG A NH1 1 
ATOM   7735  N NH2 . ARG B 1 501 ? 27.987  73.829  109.586 1.00 51.52 ? 501 ARG A NH2 1 
ATOM   7736  N N   . ASP B 1 502 ? 34.584  78.281  112.753 1.00 55.52 ? 502 ASP A N   1 
ATOM   7737  C CA  . ASP B 1 502 ? 36.040  78.365  112.559 1.00 56.18 ? 502 ASP A CA  1 
ATOM   7738  C C   . ASP B 1 502 ? 36.884  77.770  113.686 1.00 56.67 ? 502 ASP A C   1 
ATOM   7739  O O   . ASP B 1 502 ? 38.030  77.373  113.460 1.00 56.82 ? 502 ASP A O   1 
ATOM   7740  C CB  . ASP B 1 502 ? 36.465  79.814  112.289 1.00 56.10 ? 502 ASP A CB  1 
ATOM   7741  C CG  . ASP B 1 502 ? 35.903  80.357  110.985 1.00 56.01 ? 502 ASP A CG  1 
ATOM   7742  O OD1 . ASP B 1 502 ? 34.917  79.790  110.459 1.00 55.39 ? 502 ASP A OD1 1 
ATOM   7743  O OD2 . ASP B 1 502 ? 36.451  81.363  110.487 1.00 56.25 ? 502 ASP A OD2 1 
ATOM   7744  N N   . ASN B 1 503 ? 36.319  77.714  114.890 1.00 57.18 ? 503 ASN A N   1 
ATOM   7745  C CA  . ASN B 1 503 ? 36.978  77.049  116.007 1.00 57.70 ? 503 ASN A CA  1 
ATOM   7746  C C   . ASN B 1 503 ? 36.079  76.036  116.717 1.00 57.84 ? 503 ASN A C   1 
ATOM   7747  O O   . ASN B 1 503 ? 36.126  75.892  117.942 1.00 58.01 ? 503 ASN A O   1 
ATOM   7748  C CB  . ASN B 1 503 ? 37.557  78.078  116.983 1.00 57.86 ? 503 ASN A CB  1 
ATOM   7749  C CG  . ASN B 1 503 ? 38.951  78.544  116.585 1.00 58.34 ? 503 ASN A CG  1 
ATOM   7750  O OD1 . ASN B 1 503 ? 39.125  79.651  116.068 1.00 58.27 ? 503 ASN A OD1 1 
ATOM   7751  N ND2 . ASN B 1 503 ? 39.953  77.696  116.823 1.00 58.63 ? 503 ASN A ND2 1 
ATOM   7752  N N   . SER B 1 504 ? 35.261  75.338  115.933 1.00 57.97 ? 504 SER A N   1 
ATOM   7753  C CA  . SER B 1 504 ? 34.464  74.225  116.435 1.00 58.02 ? 504 SER A CA  1 
ATOM   7754  C C   . SER B 1 504 ? 35.334  72.979  116.544 1.00 58.17 ? 504 SER A C   1 
ATOM   7755  O O   . SER B 1 504 ? 35.118  72.132  117.409 1.00 58.09 ? 504 SER A O   1 
ATOM   7756  C CB  . SER B 1 504 ? 33.264  73.959  115.521 1.00 58.01 ? 504 SER A CB  1 
ATOM   7757  O OG  . SER B 1 504 ? 33.674  73.471  114.253 1.00 57.83 ? 504 SER A OG  1 
ATOM   7758  N N   . GLN B 1 505 ? 36.316  72.879  115.652 1.00 58.52 ? 505 GLN A N   1 
ATOM   7759  C CA  . GLN B 1 505 ? 37.259  71.769  115.645 1.00 58.83 ? 505 GLN A CA  1 
ATOM   7760  C C   . GLN B 1 505 ? 38.124  71.818  116.898 1.00 58.75 ? 505 GLN A C   1 
ATOM   7761  O O   . GLN B 1 505 ? 38.442  70.784  117.489 1.00 58.69 ? 505 GLN A O   1 
ATOM   7762  C CB  . GLN B 1 505 ? 38.119  71.824  114.377 1.00 59.02 ? 505 GLN A CB  1 
ATOM   7763  C CG  . GLN B 1 505 ? 39.242  70.775  114.274 1.00 60.19 ? 505 GLN A CG  1 
ATOM   7764  C CD  . GLN B 1 505 ? 38.740  69.360  113.994 1.00 61.38 ? 505 GLN A CD  1 
ATOM   7765  O OE1 . GLN B 1 505 ? 38.179  68.700  114.874 1.00 61.71 ? 505 GLN A OE1 1 
ATOM   7766  N NE2 . GLN B 1 505 ? 38.966  68.882  112.769 1.00 61.68 ? 505 GLN A NE2 1 
ATOM   7767  N N   . ASN B 1 506 ? 38.479  73.030  117.310 1.00 58.80 ? 506 ASN A N   1 
ATOM   7768  C CA  . ASN B 1 506 ? 39.337  73.214  118.468 1.00 58.90 ? 506 ASN A CA  1 
ATOM   7769  C C   . ASN B 1 506 ? 38.588  73.115  119.796 1.00 58.96 ? 506 ASN A C   1 
ATOM   7770  O O   . ASN B 1 506 ? 39.072  72.471  120.727 1.00 59.05 ? 506 ASN A O   1 
ATOM   7771  C CB  . ASN B 1 506 ? 40.099  74.533  118.367 1.00 58.95 ? 506 ASN A CB  1 
ATOM   7772  C CG  . ASN B 1 506 ? 41.542  74.398  118.806 1.00 59.09 ? 506 ASN A CG  1 
ATOM   7773  O OD1 . ASN B 1 506 ? 42.437  74.212  117.979 1.00 58.79 ? 506 ASN A OD1 1 
ATOM   7774  N ND2 . ASN B 1 506 ? 41.775  74.470  120.112 1.00 59.37 ? 506 ASN A ND2 1 
ATOM   7775  N N   . ARG B 1 507 ? 37.413  73.743  119.877 1.00 58.94 ? 507 ARG A N   1 
ATOM   7776  C CA  . ARG B 1 507 ? 36.566  73.673  121.076 1.00 58.87 ? 507 ARG A CA  1 
ATOM   7777  C C   . ARG B 1 507 ? 36.073  72.262  121.370 1.00 58.59 ? 507 ARG A C   1 
ATOM   7778  O O   . ARG B 1 507 ? 35.924  71.886  122.535 1.00 58.77 ? 507 ARG A O   1 
ATOM   7779  C CB  . ARG B 1 507 ? 35.378  74.640  120.983 1.00 59.06 ? 507 ARG A CB  1 
ATOM   7780  C CG  . ARG B 1 507 ? 35.392  75.786  122.011 1.00 60.17 ? 507 ARG A CG  1 
ATOM   7781  C CD  . ARG B 1 507 ? 36.594  76.720  121.842 1.00 61.95 ? 507 ARG A CD  1 
ATOM   7782  N NE  . ARG B 1 507 ? 36.599  77.409  120.546 1.00 63.28 ? 507 ARG A NE  1 
ATOM   7783  C CZ  . ARG B 1 507 ? 36.237  78.679  120.361 1.00 63.71 ? 507 ARG A CZ  1 
ATOM   7784  N NH1 . ARG B 1 507 ? 35.837  79.425  121.389 1.00 63.43 ? 507 ARG A NH1 1 
ATOM   7785  N NH2 . ARG B 1 507 ? 36.277  79.208  119.144 1.00 63.37 ? 507 ARG A NH2 1 
ATOM   7786  N N   . GLY B 1 508 ? 35.822  71.490  120.314 1.00 58.22 ? 508 GLY A N   1 
ATOM   7787  C CA  . GLY B 1 508 ? 35.464  70.080  120.449 1.00 57.68 ? 508 GLY A CA  1 
ATOM   7788  C C   . GLY B 1 508 ? 36.623  69.267  120.992 1.00 57.32 ? 508 GLY A C   1 
ATOM   7789  O O   . GLY B 1 508 ? 36.437  68.395  121.836 1.00 57.25 ? 508 GLY A O   1 
ATOM   7790  N N   . ARG B 1 509 ? 37.825  69.573  120.510 1.00 57.07 ? 509 ARG A N   1 
ATOM   7791  C CA  . ARG B 1 509 ? 39.043  68.870  120.906 1.00 56.84 ? 509 ARG A CA  1 
ATOM   7792  C C   . ARG B 1 509 ? 39.435  69.195  122.349 1.00 56.44 ? 509 ARG A C   1 
ATOM   7793  O O   . ARG B 1 509 ? 39.868  68.312  123.093 1.00 56.44 ? 509 ARG A O   1 
ATOM   7794  C CB  . ARG B 1 509 ? 40.177  69.220  119.939 1.00 56.98 ? 509 ARG A CB  1 
ATOM   7795  C CG  . ARG B 1 509 ? 41.278  68.161  119.784 1.00 57.73 ? 509 ARG A CG  1 
ATOM   7796  C CD  . ARG B 1 509 ? 42.460  68.337  120.765 1.00 59.04 ? 509 ARG A CD  1 
ATOM   7797  N NE  . ARG B 1 509 ? 42.643  69.714  121.242 1.00 59.65 ? 509 ARG A NE  1 
ATOM   7798  C CZ  . ARG B 1 509 ? 43.122  70.723  120.516 1.00 60.03 ? 509 ARG A CZ  1 
ATOM   7799  N NH1 . ARG B 1 509 ? 43.471  70.543  119.245 1.00 60.17 ? 509 ARG A NH1 1 
ATOM   7800  N NH2 . ARG B 1 509 ? 43.237  71.927  121.062 1.00 59.97 ? 509 ARG A NH2 1 
ATOM   7801  N N   . GLU B 1 510 ? 39.273  70.460  122.735 1.00 55.98 ? 510 GLU A N   1 
ATOM   7802  C CA  . GLU B 1 510 ? 39.537  70.909  124.106 1.00 55.46 ? 510 GLU A CA  1 
ATOM   7803  C C   . GLU B 1 510 ? 38.581  70.257  125.102 1.00 55.12 ? 510 GLU A C   1 
ATOM   7804  O O   . GLU B 1 510 ? 38.964  69.954  126.231 1.00 55.07 ? 510 GLU A O   1 
ATOM   7805  C CB  . GLU B 1 510 ? 39.442  72.437  124.206 1.00 55.46 ? 510 GLU A CB  1 
ATOM   7806  C CG  . GLU B 1 510 ? 40.583  73.182  123.507 1.00 55.49 ? 510 GLU A CG  1 
ATOM   7807  C CD  . GLU B 1 510 ? 40.344  74.684  123.358 1.00 55.36 ? 510 GLU A CD  1 
ATOM   7808  O OE1 . GLU B 1 510 ? 39.221  75.165  123.622 1.00 54.99 ? 510 GLU A OE1 1 
ATOM   7809  O OE2 . GLU B 1 510 ? 41.297  75.390  122.969 1.00 55.09 ? 510 GLU A OE2 1 
ATOM   7810  N N   . LEU B 1 511 ? 37.342  70.039  124.665 1.00 54.78 ? 511 LEU A N   1 
ATOM   7811  C CA  . LEU B 1 511 ? 36.305  69.422  125.487 1.00 54.49 ? 511 LEU A CA  1 
ATOM   7812  C C   . LEU B 1 511 ? 36.670  67.985  125.847 1.00 54.44 ? 511 LEU A C   1 
ATOM   7813  O O   . LEU B 1 511 ? 36.616  67.597  127.015 1.00 54.38 ? 511 LEU A O   1 
ATOM   7814  C CB  . LEU B 1 511 ? 34.968  69.440  124.744 1.00 54.37 ? 511 LEU A CB  1 
ATOM   7815  C CG  . LEU B 1 511 ? 33.676  69.748  125.505 1.00 54.16 ? 511 LEU A CG  1 
ATOM   7816  C CD1 . LEU B 1 511 ? 32.529  69.826  124.516 1.00 53.71 ? 511 LEU A CD1 1 
ATOM   7817  C CD2 . LEU B 1 511 ? 33.369  68.747  126.609 1.00 53.74 ? 511 LEU A CD2 1 
ATOM   7818  N N   . VAL B 1 512 ? 37.047  67.205  124.836 1.00 54.38 ? 512 VAL A N   1 
ATOM   7819  C CA  . VAL B 1 512 ? 37.434  65.811  125.024 1.00 54.29 ? 512 VAL A CA  1 
ATOM   7820  C C   . VAL B 1 512 ? 38.640  65.715  125.954 1.00 54.33 ? 512 VAL A C   1 
ATOM   7821  O O   . VAL B 1 512 ? 38.766  64.758  126.715 1.00 54.36 ? 512 VAL A O   1 
ATOM   7822  C CB  . VAL B 1 512 ? 37.725  65.116  123.674 1.00 54.31 ? 512 VAL A CB  1 
ATOM   7823  C CG1 . VAL B 1 512 ? 38.224  63.699  123.889 1.00 54.08 ? 512 VAL A CG1 1 
ATOM   7824  C CG2 . VAL B 1 512 ? 36.475  65.103  122.799 1.00 54.26 ? 512 VAL A CG2 1 
ATOM   7825  N N   . GLU B 1 513 ? 39.510  66.720  125.899 1.00 54.48 ? 513 GLU A N   1 
ATOM   7826  C CA  . GLU B 1 513 ? 40.654  66.812  126.805 1.00 54.57 ? 513 GLU A CA  1 
ATOM   7827  C C   . GLU B 1 513 ? 40.247  67.170  128.228 1.00 54.41 ? 513 GLU A C   1 
ATOM   7828  O O   . GLU B 1 513 ? 40.728  66.564  129.185 1.00 54.46 ? 513 GLU A O   1 
ATOM   7829  C CB  . GLU B 1 513 ? 41.694  67.805  126.279 1.00 54.69 ? 513 GLU A CB  1 
ATOM   7830  C CG  . GLU B 1 513 ? 42.640  67.193  125.268 1.00 55.39 ? 513 GLU A CG  1 
ATOM   7831  C CD  . GLU B 1 513 ? 43.230  65.885  125.761 1.00 56.61 ? 513 GLU A CD  1 
ATOM   7832  O OE1 . GLU B 1 513 ? 42.916  64.833  125.160 1.00 57.16 ? 513 GLU A OE1 1 
ATOM   7833  O OE2 . GLU B 1 513 ? 43.981  65.908  126.764 1.00 56.70 ? 513 GLU A OE2 1 
ATOM   7834  N N   . LYS B 1 514 ? 39.363  68.157  128.356 1.00 54.25 ? 514 LYS A N   1 
ATOM   7835  C CA  . LYS B 1 514 ? 38.813  68.558  129.647 1.00 54.20 ? 514 LYS A CA  1 
ATOM   7836  C C   . LYS B 1 514 ? 38.202  67.352  130.376 1.00 53.98 ? 514 LYS A C   1 
ATOM   7837  O O   . LYS B 1 514 ? 38.438  67.165  131.573 1.00 54.07 ? 514 LYS A O   1 
ATOM   7838  C CB  . LYS B 1 514 ? 37.775  69.672  129.449 1.00 54.23 ? 514 LYS A CB  1 
ATOM   7839  C CG  . LYS B 1 514 ? 37.058  70.149  130.711 1.00 54.47 ? 514 LYS A CG  1 
ATOM   7840  C CD  . LYS B 1 514 ? 35.896  71.073  130.351 1.00 54.62 ? 514 LYS A CD  1 
ATOM   7841  C CE  . LYS B 1 514 ? 35.308  71.757  131.582 1.00 55.50 ? 514 LYS A CE  1 
ATOM   7842  N NZ  . LYS B 1 514 ? 34.265  72.753  131.204 1.00 55.28 ? 514 LYS A NZ  1 
ATOM   7843  N N   . MET B 1 515 ? 37.437  66.537  129.644 1.00 53.55 ? 515 MET A N   1 
ATOM   7844  C CA  . MET B 1 515 ? 36.804  65.338  130.197 1.00 53.12 ? 515 MET A CA  1 
ATOM   7845  C C   . MET B 1 515 ? 37.817  64.304  130.682 1.00 52.86 ? 515 MET A C   1 
ATOM   7846  O O   . MET B 1 515 ? 37.588  63.645  131.704 1.00 52.88 ? 515 MET A O   1 
ATOM   7847  C CB  . MET B 1 515 ? 35.854  64.694  129.184 1.00 53.19 ? 515 MET A CB  1 
ATOM   7848  C CG  . MET B 1 515 ? 34.634  65.533  128.825 1.00 53.58 ? 515 MET A CG  1 
ATOM   7849  S SD  . MET B 1 515 ? 33.803  66.281  130.240 1.00 54.77 ? 515 MET A SD  1 
ATOM   7850  C CE  . MET B 1 515 ? 33.070  64.841  131.018 1.00 54.62 ? 515 MET A CE  1 
ATOM   7851  N N   . LYS B 1 516 ? 38.929  64.165  129.956 1.00 52.31 ? 516 LYS A N   1 
ATOM   7852  C CA  . LYS B 1 516 ? 39.981  63.220  130.336 1.00 51.85 ? 516 LYS A CA  1 
ATOM   7853  C C   . LYS B 1 516 ? 40.579  63.550  131.699 1.00 51.59 ? 516 LYS A C   1 
ATOM   7854  O O   . LYS B 1 516 ? 41.140  62.680  132.367 1.00 51.61 ? 516 LYS A O   1 
ATOM   7855  C CB  . LYS B 1 516 ? 41.073  63.114  129.265 1.00 51.83 ? 516 LYS A CB  1 
ATOM   7856  C CG  . LYS B 1 516 ? 40.668  62.255  128.069 1.00 52.02 ? 516 LYS A CG  1 
ATOM   7857  C CD  . LYS B 1 516 ? 41.720  61.201  127.714 1.00 52.52 ? 516 LYS A CD  1 
ATOM   7858  C CE  . LYS B 1 516 ? 42.685  61.674  126.633 1.00 52.66 ? 516 LYS A CE  1 
ATOM   7859  N NZ  . LYS B 1 516 ? 43.793  62.499  127.169 1.00 52.90 ? 516 LYS A NZ  1 
ATOM   7860  N N   . ASP B 1 517 ? 40.443  64.808  132.109 1.00 51.31 ? 517 ASP A N   1 
ATOM   7861  C CA  . ASP B 1 517 ? 40.834  65.226  133.448 1.00 51.05 ? 517 ASP A CA  1 
ATOM   7862  C C   . ASP B 1 517 ? 39.773  64.838  134.484 1.00 50.82 ? 517 ASP A C   1 
ATOM   7863  O O   . ASP B 1 517 ? 40.112  64.362  135.568 1.00 50.85 ? 517 ASP A O   1 
ATOM   7864  C CB  . ASP B 1 517 ? 41.131  66.731  133.489 1.00 51.00 ? 517 ASP A CB  1 
ATOM   7865  C CG  . ASP B 1 517 ? 42.407  67.105  132.729 1.00 51.40 ? 517 ASP A CG  1 
ATOM   7866  O OD1 . ASP B 1 517 ? 43.291  66.235  132.550 1.00 51.67 ? 517 ASP A OD1 1 
ATOM   7867  O OD2 . ASP B 1 517 ? 42.531  68.279  132.314 1.00 51.29 ? 517 ASP A OD2 1 
ATOM   7868  N N   . LEU B 1 518 ? 38.499  65.016  134.136 1.00 50.44 ? 518 LEU A N   1 
ATOM   7869  C CA  . LEU B 1 518 ? 37.387  64.705  135.043 1.00 50.14 ? 518 LEU A CA  1 
ATOM   7870  C C   . LEU B 1 518 ? 37.127  63.217  135.187 1.00 49.68 ? 518 LEU A C   1 
ATOM   7871  O O   . LEU B 1 518 ? 36.556  62.780  136.184 1.00 49.59 ? 518 LEU A O   1 
ATOM   7872  C CB  . LEU B 1 518 ? 36.095  65.389  134.591 1.00 50.32 ? 518 LEU A CB  1 
ATOM   7873  C CG  . LEU B 1 518 ? 36.091  66.917  134.524 1.00 51.22 ? 518 LEU A CG  1 
ATOM   7874  C CD1 . LEU B 1 518 ? 34.711  67.408  134.129 1.00 51.78 ? 518 LEU A CD1 1 
ATOM   7875  C CD2 . LEU B 1 518 ? 36.540  67.552  135.847 1.00 52.34 ? 518 LEU A CD2 1 
ATOM   7876  N N   . ILE B 1 519 ? 37.535  62.446  134.184 1.00 49.23 ? 519 ILE A N   1 
ATOM   7877  C CA  . ILE B 1 519 ? 37.318  61.003  134.178 1.00 48.62 ? 519 ILE A CA  1 
ATOM   7878  C C   . ILE B 1 519 ? 38.643  60.235  134.249 1.00 48.28 ? 519 ILE A C   1 
ATOM   7879  O O   . ILE B 1 519 ? 39.367  60.140  133.255 1.00 48.43 ? 519 ILE A O   1 
ATOM   7880  C CB  . ILE B 1 519 ? 36.497  60.568  132.952 1.00 48.51 ? 519 ILE A CB  1 
ATOM   7881  C CG1 . ILE B 1 519 ? 35.116  61.228  132.978 1.00 48.48 ? 519 ILE A CG1 1 
ATOM   7882  C CG2 . ILE B 1 519 ? 36.352  59.060  132.920 1.00 48.63 ? 519 ILE A CG2 1 
ATOM   7883  C CD1 . ILE B 1 519 ? 34.396  61.217  131.638 1.00 48.57 ? 519 ILE A CD1 1 
ATOM   7884  N N   . PRO B 1 520 ? 38.964  59.684  135.431 1.00 47.89 ? 520 PRO A N   1 
ATOM   7885  C CA  . PRO B 1 520 ? 40.187  58.915  135.611 1.00 47.79 ? 520 PRO A CA  1 
ATOM   7886  C C   . PRO B 1 520 ? 40.078  57.545  134.960 1.00 47.64 ? 520 PRO A C   1 
ATOM   7887  O O   . PRO B 1 520 ? 38.976  57.115  134.628 1.00 47.61 ? 520 PRO A O   1 
ATOM   7888  C CB  . PRO B 1 520 ? 40.270  58.762  137.132 1.00 47.88 ? 520 PRO A CB  1 
ATOM   7889  C CG  . PRO B 1 520 ? 38.859  58.786  137.581 1.00 47.58 ? 520 PRO A CG  1 
ATOM   7890  C CD  . PRO B 1 520 ? 38.179  59.761  136.676 1.00 47.92 ? 520 PRO A CD  1 
ATOM   7891  N N   . ARG B 1 521 ? 41.213  56.872  134.774 1.00 47.54 ? 521 ARG A N   1 
ATOM   7892  C CA  . ARG B 1 521 ? 41.213  55.489  134.308 1.00 47.40 ? 521 ARG A CA  1 
ATOM   7893  C C   . ARG B 1 521 ? 40.494  54.648  135.356 1.00 47.61 ? 521 ARG A C   1 
ATOM   7894  O O   . ARG B 1 521 ? 40.790  54.755  136.546 1.00 47.69 ? 521 ARG A O   1 
ATOM   7895  C CB  . ARG B 1 521 ? 42.639  54.980  134.065 1.00 47.09 ? 521 ARG A CB  1 
ATOM   7896  C CG  . ARG B 1 521 ? 43.443  55.818  133.090 1.00 46.62 ? 521 ARG A CG  1 
ATOM   7897  C CD  . ARG B 1 521 ? 44.190  54.970  132.070 1.00 46.11 ? 521 ARG A CD  1 
ATOM   7898  N NE  . ARG B 1 521 ? 45.469  54.458  132.559 1.00 45.67 ? 521 ARG A NE  1 
ATOM   7899  C CZ  . ARG B 1 521 ? 45.814  53.172  132.589 1.00 44.97 ? 521 ARG A CZ  1 
ATOM   7900  N NH1 . ARG B 1 521 ? 44.979  52.237  132.157 1.00 44.28 ? 521 ARG A NH1 1 
ATOM   7901  N NH2 . ARG B 1 521 ? 47.007  52.822  133.048 1.00 44.90 ? 521 ARG A NH2 1 
ATOM   7902  N N   . GLN B 1 522 ? 39.534  53.838  134.917 1.00 47.90 ? 522 GLN A N   1 
ATOM   7903  C CA  . GLN B 1 522 ? 38.617  53.163  135.837 1.00 48.18 ? 522 GLN A CA  1 
ATOM   7904  C C   . GLN B 1 522 ? 38.507  51.665  135.619 1.00 48.52 ? 522 GLN A C   1 
ATOM   7905  O O   . GLN B 1 522 ? 39.412  51.025  135.087 1.00 48.66 ? 522 GLN A O   1 
ATOM   7906  C CB  . GLN B 1 522 ? 37.218  53.746  135.698 1.00 48.12 ? 522 GLN A CB  1 
ATOM   7907  C CG  . GLN B 1 522 ? 37.055  55.143  136.196 1.00 47.99 ? 522 GLN A CG  1 
ATOM   7908  C CD  . GLN B 1 522 ? 35.725  55.719  135.798 1.00 47.81 ? 522 GLN A CD  1 
ATOM   7909  O OE1 . GLN B 1 522 ? 34.702  55.029  135.813 1.00 46.94 ? 522 GLN A OE1 1 
ATOM   7910  N NE2 . GLN B 1 522 ? 35.723  56.996  135.441 1.00 48.16 ? 522 GLN A NE2 1 
ATOM   7911  N N   . GLN B 1 523 ? 37.367  51.123  136.037 1.00 48.86 ? 523 GLN A N   1 
ATOM   7912  C CA  . GLN B 1 523 ? 37.041  49.723  135.839 1.00 49.27 ? 523 GLN A CA  1 
ATOM   7913  C C   . GLN B 1 523 ? 36.780  49.415  134.366 1.00 49.58 ? 523 GLN A C   1 
ATOM   7914  O O   . GLN B 1 523 ? 37.325  48.446  133.830 1.00 49.87 ? 523 GLN A O   1 
ATOM   7915  C CB  . GLN B 1 523 ? 35.826  49.355  136.684 1.00 49.22 ? 523 GLN A CB  1 
ATOM   7916  C CG  . GLN B 1 523 ? 35.266  47.978  136.406 1.00 49.18 ? 523 GLN A CG  1 
ATOM   7917  C CD  . GLN B 1 523 ? 34.135  47.610  137.336 1.00 49.53 ? 523 GLN A CD  1 
ATOM   7918  O OE1 . GLN B 1 523 ? 33.760  46.446  137.430 1.00 50.10 ? 523 GLN A OE1 1 
ATOM   7919  N NE2 . GLN B 1 523 ? 33.585  48.599  138.033 1.00 49.86 ? 523 GLN A NE2 1 
ATOM   7920  N N   . PHE B 1 524 ? 35.947  50.237  133.722 1.00 49.78 ? 524 PHE A N   1 
ATOM   7921  C CA  . PHE B 1 524 ? 35.579  50.035  132.315 1.00 49.90 ? 524 PHE A CA  1 
ATOM   7922  C C   . PHE B 1 524 ? 36.252  51.057  131.400 1.00 49.72 ? 524 PHE A C   1 
ATOM   7923  O O   . PHE B 1 524 ? 36.661  52.131  131.849 1.00 49.77 ? 524 PHE A O   1 
ATOM   7924  C CB  . PHE B 1 524 ? 34.060  50.135  132.112 1.00 50.09 ? 524 PHE A CB  1 
ATOM   7925  C CG  . PHE B 1 524 ? 33.242  49.455  133.175 1.00 50.56 ? 524 PHE A CG  1 
ATOM   7926  C CD1 . PHE B 1 524 ? 32.719  50.186  134.242 1.00 51.36 ? 524 PHE A CD1 1 
ATOM   7927  C CD2 . PHE B 1 524 ? 32.962  48.097  133.098 1.00 50.75 ? 524 PHE A CD2 1 
ATOM   7928  C CE1 . PHE B 1 524 ? 31.944  49.565  135.229 1.00 51.30 ? 524 PHE A CE1 1 
ATOM   7929  C CE2 . PHE B 1 524 ? 32.189  47.464  134.082 1.00 50.90 ? 524 PHE A CE2 1 
ATOM   7930  C CZ  . PHE B 1 524 ? 31.681  48.201  135.146 1.00 50.98 ? 524 PHE A CZ  1 
ATOM   7931  N N   . ASP B 1 525 ? 36.355  50.713  130.117 1.00 49.52 ? 525 ASP A N   1 
ATOM   7932  C CA  . ASP B 1 525 ? 36.737  51.671  129.084 1.00 49.37 ? 525 ASP A CA  1 
ATOM   7933  C C   . ASP B 1 525 ? 35.676  52.752  128.949 1.00 49.29 ? 525 ASP A C   1 
ATOM   7934  O O   . ASP B 1 525 ? 34.476  52.460  128.942 1.00 49.29 ? 525 ASP A O   1 
ATOM   7935  C CB  . ASP B 1 525 ? 36.909  50.970  127.737 1.00 49.33 ? 525 ASP A CB  1 
ATOM   7936  C CG  . ASP B 1 525 ? 38.212  50.216  127.633 1.00 49.32 ? 525 ASP A CG  1 
ATOM   7937  O OD1 . ASP B 1 525 ? 39.083  50.400  128.510 1.00 49.54 ? 525 ASP A OD1 1 
ATOM   7938  O OD2 . ASP B 1 525 ? 38.369  49.445  126.663 1.00 49.09 ? 525 ASP A OD2 1 
ATOM   7939  N N   . ILE B 1 526 ? 36.121  54.001  128.850 1.00 49.14 ? 526 ILE A N   1 
ATOM   7940  C CA  . ILE B 1 526 ? 35.206  55.121  128.666 1.00 48.97 ? 526 ILE A CA  1 
ATOM   7941  C C   . ILE B 1 526 ? 35.510  55.877  127.374 1.00 48.86 ? 526 ILE A C   1 
ATOM   7942  O O   . ILE B 1 526 ? 36.518  56.583  127.270 1.00 48.64 ? 526 ILE A O   1 
ATOM   7943  C CB  . ILE B 1 526 ? 35.183  56.058  129.895 1.00 48.93 ? 526 ILE A CB  1 
ATOM   7944  C CG1 . ILE B 1 526 ? 34.664  55.290  131.114 1.00 48.90 ? 526 ILE A CG1 1 
ATOM   7945  C CG2 . ILE B 1 526 ? 34.302  57.276  129.626 1.00 48.98 ? 526 ILE A CG2 1 
ATOM   7946  C CD1 . ILE B 1 526 ? 34.807  56.011  132.419 1.00 48.80 ? 526 ILE A CD1 1 
ATOM   7947  N N   . ALA B 1 527 ? 34.626  55.703  126.394 1.00 48.90 ? 527 ALA A N   1 
ATOM   7948  C CA  . ALA B 1 527 ? 34.762  56.347  125.092 1.00 48.92 ? 527 ALA A CA  1 
ATOM   7949  C C   . ALA B 1 527 ? 34.099  57.722  125.089 1.00 48.99 ? 527 ALA A C   1 
ATOM   7950  O O   . ALA B 1 527 ? 32.884  57.846  125.271 1.00 48.99 ? 527 ALA A O   1 
ATOM   7951  C CB  . ALA B 1 527 ? 34.186  55.463  123.996 1.00 48.92 ? 527 ALA A CB  1 
ATOM   7952  N N   . ILE B 1 528 ? 34.923  58.746  124.892 1.00 49.02 ? 528 ILE A N   1 
ATOM   7953  C CA  . ILE B 1 528 ? 34.481  60.135  124.858 1.00 49.01 ? 528 ILE A CA  1 
ATOM   7954  C C   . ILE B 1 528 ? 34.612  60.633  123.429 1.00 49.15 ? 528 ILE A C   1 
ATOM   7955  O O   . ILE B 1 528 ? 35.629  60.397  122.774 1.00 49.21 ? 528 ILE A O   1 
ATOM   7956  C CB  . ILE B 1 528 ? 35.346  61.024  125.791 1.00 48.90 ? 528 ILE A CB  1 
ATOM   7957  C CG1 . ILE B 1 528 ? 35.387  60.437  127.202 1.00 48.69 ? 528 ILE A CG1 1 
ATOM   7958  C CG2 . ILE B 1 528 ? 34.828  62.464  125.822 1.00 48.78 ? 528 ILE A CG2 1 
ATOM   7959  C CD1 . ILE B 1 528 ? 36.646  60.757  127.954 1.00 48.73 ? 528 ILE A CD1 1 
ATOM   7960  N N   . GLN B 1 529 ? 33.579  61.307  122.938 1.00 49.32 ? 529 GLN A N   1 
ATOM   7961  C CA  . GLN B 1 529 ? 33.661  61.943  121.628 1.00 49.52 ? 529 GLN A CA  1 
ATOM   7962  C C   . GLN B 1 529 ? 32.824  63.201  121.516 1.00 49.54 ? 529 GLN A C   1 
ATOM   7963  O O   . GLN B 1 529 ? 31.776  63.331  122.152 1.00 49.59 ? 529 GLN A O   1 
ATOM   7964  C CB  . GLN B 1 529 ? 33.323  60.973  120.487 1.00 49.53 ? 529 GLN A CB  1 
ATOM   7965  C CG  . GLN B 1 529 ? 31.988  60.279  120.600 1.00 49.96 ? 529 GLN A CG  1 
ATOM   7966  C CD  . GLN B 1 529 ? 31.447  59.858  119.250 1.00 50.68 ? 529 GLN A CD  1 
ATOM   7967  O OE1 . GLN B 1 529 ? 31.059  60.697  118.435 1.00 50.43 ? 529 GLN A OE1 1 
ATOM   7968  N NE2 . GLN B 1 529 ? 31.410  58.551  119.009 1.00 50.88 ? 529 GLN A NE2 1 
ATOM   7969  N N   . ALA B 1 530 ? 33.326  64.128  120.708 1.00 49.64 ? 530 ALA A N   1 
ATOM   7970  C CA  . ALA B 1 530 ? 32.589  65.309  120.309 1.00 49.74 ? 530 ALA A CA  1 
ATOM   7971  C C   . ALA B 1 530 ? 32.256  65.174  118.829 1.00 49.96 ? 530 ALA A C   1 
ATOM   7972  O O   . ALA B 1 530 ? 33.041  64.616  118.051 1.00 50.05 ? 530 ALA A O   1 
ATOM   7973  C CB  . ALA B 1 530 ? 33.408  66.556  120.567 1.00 49.61 ? 530 ALA A CB  1 
ATOM   7974  N N   . ALA B 1 531 ? 31.083  65.669  118.448 1.00 50.15 ? 531 ALA A N   1 
ATOM   7975  C CA  . ALA B 1 531 ? 30.648  65.632  117.056 1.00 50.32 ? 531 ALA A CA  1 
ATOM   7976  C C   . ALA B 1 531 ? 29.824  66.864  116.707 1.00 50.44 ? 531 ALA A C   1 
ATOM   7977  O O   . ALA B 1 531 ? 29.363  67.583  117.596 1.00 50.40 ? 531 ALA A O   1 
ATOM   7978  C CB  . ALA B 1 531 ? 29.845  64.362  116.793 1.00 50.28 ? 531 ALA A CB  1 
ATOM   7979  N N   . ILE B 1 532 ? 29.666  67.117  115.410 1.00 50.64 ? 532 ILE A N   1 
ATOM   7980  C CA  . ILE B 1 532 ? 28.650  68.049  114.928 1.00 50.96 ? 532 ILE A CA  1 
ATOM   7981  C C   . ILE B 1 532 ? 27.609  67.225  114.171 1.00 51.16 ? 532 ILE A C   1 
ATOM   7982  O O   . ILE B 1 532 ? 27.845  66.790  113.043 1.00 51.11 ? 532 ILE A O   1 
ATOM   7983  C CB  . ILE B 1 532 ? 29.236  69.187  114.050 1.00 50.94 ? 532 ILE A CB  1 
ATOM   7984  C CG1 . ILE B 1 532 ? 30.292  69.979  114.829 1.00 51.03 ? 532 ILE A CG1 1 
ATOM   7985  C CG2 . ILE B 1 532 ? 28.127  70.122  113.566 1.00 50.95 ? 532 ILE A CG2 1 
ATOM   7986  C CD1 . ILE B 1 532 ? 31.141  70.912  113.974 1.00 51.03 ? 532 ILE A CD1 1 
ATOM   7987  N N   . GLY B 1 533 ? 26.470  66.997  114.821 1.00 51.51 ? 533 GLY A N   1 
ATOM   7988  C CA  . GLY B 1 533 ? 25.419  66.139  114.286 1.00 51.95 ? 533 GLY A CA  1 
ATOM   7989  C C   . GLY B 1 533 ? 25.886  64.701  114.165 1.00 52.30 ? 533 GLY A C   1 
ATOM   7990  O O   . GLY B 1 533 ? 25.818  63.932  115.124 1.00 52.30 ? 533 GLY A O   1 
ATOM   7991  N N   . THR B 1 534 ? 26.380  64.354  112.980 1.00 52.66 ? 534 THR A N   1 
ATOM   7992  C CA  . THR B 1 534 ? 26.837  63.003  112.678 1.00 53.04 ? 534 THR A CA  1 
ATOM   7993  C C   . THR B 1 534 ? 28.355  62.955  112.555 1.00 53.30 ? 534 THR A C   1 
ATOM   7994  O O   . THR B 1 534 ? 28.976  61.923  112.817 1.00 53.31 ? 534 THR A O   1 
ATOM   7995  C CB  . THR B 1 534 ? 26.242  62.497  111.348 1.00 53.06 ? 534 THR A CB  1 
ATOM   7996  O OG1 . THR B 1 534 ? 25.025  63.197  111.060 1.00 53.25 ? 534 THR A OG1 1 
ATOM   7997  C CG2 . THR B 1 534 ? 25.979  60.994  111.408 1.00 53.12 ? 534 THR A CG2 1 
ATOM   7998  N N   . HIS B 1 535 ? 28.947  64.076  112.151 1.00 53.68 ? 535 HIS A N   1 
ATOM   7999  C CA  . HIS B 1 535 ? 30.372  64.121  111.838 1.00 54.09 ? 535 HIS A CA  1 
ATOM   8000  C C   . HIS B 1 535 ? 31.257  64.383  113.057 1.00 54.06 ? 535 HIS A C   1 
ATOM   8001  O O   . HIS B 1 535 ? 31.190  65.440  113.690 1.00 54.21 ? 535 HIS A O   1 
ATOM   8002  C CB  . HIS B 1 535 ? 30.640  65.100  110.692 1.00 54.26 ? 535 HIS A CB  1 
ATOM   8003  C CG  . HIS B 1 535 ? 30.240  64.564  109.349 1.00 55.30 ? 535 HIS A CG  1 
ATOM   8004  N ND1 . HIS B 1 535 ? 28.923  64.400  108.973 1.00 55.85 ? 535 HIS A ND1 1 
ATOM   8005  C CD2 . HIS B 1 535 ? 30.986  64.137  108.300 1.00 55.91 ? 535 HIS A CD2 1 
ATOM   8006  C CE1 . HIS B 1 535 ? 28.875  63.907  107.748 1.00 56.46 ? 535 HIS A CE1 1 
ATOM   8007  N NE2 . HIS B 1 535 ? 30.113  63.738  107.317 1.00 56.49 ? 535 HIS A NE2 1 
ATOM   8008  N N   . ILE B 1 536 ? 32.082  63.387  113.367 1.00 53.93 ? 536 ILE A N   1 
ATOM   8009  C CA  . ILE B 1 536 ? 32.903  63.354  114.572 1.00 53.68 ? 536 ILE A CA  1 
ATOM   8010  C C   . ILE B 1 536 ? 34.138  64.237  114.428 1.00 53.41 ? 536 ILE A C   1 
ATOM   8011  O O   . ILE B 1 536 ? 34.867  64.136  113.445 1.00 53.36 ? 536 ILE A O   1 
ATOM   8012  C CB  . ILE B 1 536 ? 33.276  61.883  114.915 1.00 53.70 ? 536 ILE A CB  1 
ATOM   8013  C CG1 . ILE B 1 536 ? 32.032  61.159  115.447 1.00 54.01 ? 536 ILE A CG1 1 
ATOM   8014  C CG2 . ILE B 1 536 ? 34.437  61.808  115.913 1.00 53.72 ? 536 ILE A CG2 1 
ATOM   8015  C CD1 . ILE B 1 536 ? 32.076  59.647  115.372 1.00 54.88 ? 536 ILE A CD1 1 
ATOM   8016  N N   . ILE B 1 537 ? 34.359  65.110  115.407 1.00 53.22 ? 537 ILE A N   1 
ATOM   8017  C CA  . ILE B 1 537 ? 35.509  66.020  115.376 1.00 53.15 ? 537 ILE A CA  1 
ATOM   8018  C C   . ILE B 1 537 ? 36.675  65.597  116.282 1.00 52.95 ? 537 ILE A C   1 
ATOM   8019  O O   . ILE B 1 537 ? 37.833  65.893  115.984 1.00 52.95 ? 537 ILE A O   1 
ATOM   8020  C CB  . ILE B 1 537 ? 35.108  67.497  115.640 1.00 53.15 ? 537 ILE A CB  1 
ATOM   8021  C CG1 . ILE B 1 537 ? 33.991  67.584  116.687 1.00 53.26 ? 537 ILE A CG1 1 
ATOM   8022  C CG2 . ILE B 1 537 ? 34.692  68.170  114.329 1.00 53.27 ? 537 ILE A CG2 1 
ATOM   8023  C CD1 . ILE B 1 537 ? 33.691  68.996  117.166 1.00 53.28 ? 537 ILE A CD1 1 
ATOM   8024  N N   . ALA B 1 538 ? 36.365  64.907  117.376 1.00 52.76 ? 538 ALA A N   1 
ATOM   8025  C CA  . ALA B 1 538 ? 37.385  64.361  118.272 1.00 52.51 ? 538 ALA A CA  1 
ATOM   8026  C C   . ALA B 1 538 ? 36.835  63.160  119.029 1.00 52.37 ? 538 ALA A C   1 
ATOM   8027  O O   . ALA B 1 538 ? 35.691  63.167  119.473 1.00 52.26 ? 538 ALA A O   1 
ATOM   8028  C CB  . ALA B 1 538 ? 37.878  65.425  119.245 1.00 52.58 ? 538 ALA A CB  1 
ATOM   8029  N N   . ARG B 1 539 ? 37.654  62.127  119.170 1.00 52.27 ? 539 ARG A N   1 
ATOM   8030  C CA  . ARG B 1 539 ? 37.240  60.915  119.859 1.00 52.25 ? 539 ARG A CA  1 
ATOM   8031  C C   . ARG B 1 539 ? 38.420  60.329  120.617 1.00 51.94 ? 539 ARG A C   1 
ATOM   8032  O O   . ARG B 1 539 ? 39.427  59.953  120.016 1.00 51.97 ? 539 ARG A O   1 
ATOM   8033  C CB  . ARG B 1 539 ? 36.691  59.890  118.862 1.00 52.45 ? 539 ARG A CB  1 
ATOM   8034  C CG  . ARG B 1 539 ? 36.096  58.647  119.504 1.00 53.43 ? 539 ARG A CG  1 
ATOM   8035  C CD  . ARG B 1 539 ? 36.378  57.395  118.682 1.00 55.32 ? 539 ARG A CD  1 
ATOM   8036  N NE  . ARG B 1 539 ? 35.801  57.440  117.336 1.00 56.80 ? 539 ARG A NE  1 
ATOM   8037  C CZ  . ARG B 1 539 ? 34.552  57.091  117.034 1.00 57.40 ? 539 ARG A CZ  1 
ATOM   8038  N NH1 . ARG B 1 539 ? 33.723  56.675  117.986 1.00 58.27 ? 539 ARG A NH1 1 
ATOM   8039  N NH2 . ARG B 1 539 ? 34.130  57.160  115.777 1.00 56.42 ? 539 ARG A NH2 1 
ATOM   8040  N N   . SER B 1 540 ? 38.293  60.259  121.938 1.00 51.48 ? 540 SER A N   1 
ATOM   8041  C CA  . SER B 1 540 ? 39.343  59.697  122.772 1.00 51.04 ? 540 SER A CA  1 
ATOM   8042  C C   . SER B 1 540 ? 38.770  58.739  123.798 1.00 50.74 ? 540 SER A C   1 
ATOM   8043  O O   . SER B 1 540 ? 37.705  58.976  124.357 1.00 50.67 ? 540 SER A O   1 
ATOM   8044  C CB  . SER B 1 540 ? 40.136  60.803  123.466 1.00 51.09 ? 540 SER A CB  1 
ATOM   8045  O OG  . SER B 1 540 ? 41.159  60.263  124.283 1.00 51.11 ? 540 SER A OG  1 
ATOM   8046  N N   . THR B 1 541 ? 39.494  57.656  124.043 1.00 50.48 ? 541 THR A N   1 
ATOM   8047  C CA  . THR B 1 541 ? 39.055  56.648  124.993 1.00 50.21 ? 541 THR A CA  1 
ATOM   8048  C C   . THR B 1 541 ? 39.947  56.598  126.241 1.00 50.03 ? 541 THR A C   1 
ATOM   8049  O O   . THR B 1 541 ? 41.177  56.585  126.147 1.00 49.89 ? 541 THR A O   1 
ATOM   8050  C CB  . THR B 1 541 ? 38.905  55.254  124.321 1.00 50.19 ? 541 THR A CB  1 
ATOM   8051  O OG1 . THR B 1 541 ? 38.906  54.228  125.323 1.00 50.15 ? 541 THR A OG1 1 
ATOM   8052  C CG2 . THR B 1 541 ? 40.031  54.997  123.320 1.00 50.15 ? 541 THR A CG2 1 
ATOM   8053  N N   . VAL B 1 542 ? 39.301  56.599  127.405 1.00 49.82 ? 542 VAL A N   1 
ATOM   8054  C CA  . VAL B 1 542 ? 39.984  56.510  128.691 1.00 49.73 ? 542 VAL A CA  1 
ATOM   8055  C C   . VAL B 1 542 ? 40.151  55.040  129.054 1.00 49.79 ? 542 VAL A C   1 
ATOM   8056  O O   . VAL B 1 542 ? 39.191  54.377  129.460 1.00 49.89 ? 542 VAL A O   1 
ATOM   8057  C CB  . VAL B 1 542 ? 39.212  57.269  129.802 1.00 49.67 ? 542 VAL A CB  1 
ATOM   8058  C CG1 . VAL B 1 542 ? 39.841  57.034  131.169 1.00 49.75 ? 542 VAL A CG1 1 
ATOM   8059  C CG2 . VAL B 1 542 ? 39.178  58.753  129.497 1.00 49.48 ? 542 VAL A CG2 1 
ATOM   8060  N N   . LYS B 1 543 ? 41.376  54.546  128.897 1.00 49.88 ? 543 LYS A N   1 
ATOM   8061  C CA  . LYS B 1 543 ? 41.689  53.125  129.055 1.00 50.11 ? 543 LYS A CA  1 
ATOM   8062  C C   . LYS B 1 543 ? 41.363  52.599  130.449 1.00 50.18 ? 543 LYS A C   1 
ATOM   8063  O O   . LYS B 1 543 ? 41.612  53.273  131.440 1.00 50.29 ? 543 LYS A O   1 
ATOM   8064  C CB  . LYS B 1 543 ? 43.166  52.869  128.732 1.00 50.24 ? 543 LYS A CB  1 
ATOM   8065  C CG  . LYS B 1 543 ? 43.560  53.132  127.274 1.00 50.82 ? 543 LYS A CG  1 
ATOM   8066  C CD  . LYS B 1 543 ? 43.001  52.059  126.340 1.00 51.69 ? 543 LYS A CD  1 
ATOM   8067  C CE  . LYS B 1 543 ? 43.034  52.498  124.886 1.00 51.52 ? 543 LYS A CE  1 
ATOM   8068  N NZ  . LYS B 1 543 ? 42.216  51.577  124.057 1.00 51.59 ? 543 LYS A NZ  1 
ATOM   8069  N N   . GLN B 1 544 ? 40.799  51.397  130.516 1.00 50.27 ? 544 GLN A N   1 
ATOM   8070  C CA  . GLN B 1 544 ? 40.471  50.777  131.795 1.00 50.48 ? 544 GLN A CA  1 
ATOM   8071  C C   . GLN B 1 544 ? 41.722  50.402  132.584 1.00 50.56 ? 544 GLN A C   1 
ATOM   8072  O O   . GLN B 1 544 ? 42.776  50.137  132.010 1.00 50.57 ? 544 GLN A O   1 
ATOM   8073  C CB  . GLN B 1 544 ? 39.589  49.537  131.595 1.00 50.57 ? 544 GLN A CB  1 
ATOM   8074  C CG  . GLN B 1 544 ? 40.252  48.382  130.827 1.00 50.89 ? 544 GLN A CG  1 
ATOM   8075  C CD  . GLN B 1 544 ? 39.405  47.117  130.797 1.00 50.72 ? 544 GLN A CD  1 
ATOM   8076  O OE1 . GLN B 1 544 ? 39.867  46.046  131.187 1.00 50.81 ? 544 GLN A OE1 1 
ATOM   8077  N NE2 . GLN B 1 544 ? 38.161  47.237  130.337 1.00 51.01 ? 544 GLN A NE2 1 
ATOM   8078  N N   . LEU B 1 545 ? 41.587  50.391  133.905 1.00 50.76 ? 545 LEU A N   1 
ATOM   8079  C CA  . LEU B 1 545 ? 42.627  49.910  134.803 1.00 51.04 ? 545 LEU A CA  1 
ATOM   8080  C C   . LEU B 1 545 ? 42.834  48.417  134.631 1.00 51.36 ? 545 LEU A C   1 
ATOM   8081  O O   . LEU B 1 545 ? 41.930  47.703  134.183 1.00 51.44 ? 545 LEU A O   1 
ATOM   8082  C CB  . LEU B 1 545 ? 42.207  50.161  136.252 1.00 50.95 ? 545 LEU A CB  1 
ATOM   8083  C CG  . LEU B 1 545 ? 42.644  51.373  137.078 1.00 50.79 ? 545 LEU A CG  1 
ATOM   8084  C CD1 . LEU B 1 545 ? 43.250  52.492  136.255 1.00 50.41 ? 545 LEU A CD1 1 
ATOM   8085  C CD2 . LEU B 1 545 ? 41.456  51.867  137.889 1.00 50.58 ? 545 LEU A CD2 1 
ATOM   8086  N N   . ARG B 1 546 ? 44.025  47.948  134.997 1.00 51.69 ? 546 ARG A N   1 
ATOM   8087  C CA  . ARG B 1 546 ? 44.244  46.523  135.223 1.00 52.10 ? 546 ARG A CA  1 
ATOM   8088  C C   . ARG B 1 546 ? 43.607  46.142  136.553 1.00 52.24 ? 546 ARG A C   1 
ATOM   8089  O O   . ARG B 1 546 ? 43.252  47.015  137.354 1.00 52.36 ? 546 ARG A O   1 
ATOM   8090  C CB  . ARG B 1 546 ? 45.733  46.196  135.230 1.00 52.09 ? 546 ARG A CB  1 
ATOM   8091  C CG  . ARG B 1 546 ? 46.234  45.654  133.916 1.00 52.66 ? 546 ARG A CG  1 
ATOM   8092  C CD  . ARG B 1 546 ? 47.671  46.059  133.674 1.00 53.88 ? 546 ARG A CD  1 
ATOM   8093  N NE  . ARG B 1 546 ? 47.748  47.405  133.110 1.00 54.63 ? 546 ARG A NE  1 
ATOM   8094  C CZ  . ARG B 1 546 ? 48.864  47.983  132.670 1.00 54.86 ? 546 ARG A CZ  1 
ATOM   8095  N NH1 . ARG B 1 546 ? 50.027  47.338  132.722 1.00 54.96 ? 546 ARG A NH1 1 
ATOM   8096  N NH2 . ARG B 1 546 ? 48.811  49.215  132.174 1.00 54.59 ? 546 ARG A NH2 1 
ATOM   8097  N N   . LYS B 1 547 ? 43.448  44.846  136.785 1.00 52.38 ? 547 LYS A N   1 
ATOM   8098  C CA  . LYS B 1 547 ? 42.855  44.379  138.032 1.00 52.68 ? 547 LYS A CA  1 
ATOM   8099  C C   . LYS B 1 547 ? 43.796  44.660  139.199 1.00 52.30 ? 547 LYS A C   1 
ATOM   8100  O O   . LYS B 1 547 ? 45.014  44.710  139.018 1.00 52.30 ? 547 LYS A O   1 
ATOM   8101  C CB  . LYS B 1 547 ? 42.477  42.894  137.944 1.00 53.05 ? 547 LYS A CB  1 
ATOM   8102  C CG  . LYS B 1 547 ? 43.622  41.951  137.537 1.00 54.95 ? 547 LYS A CG  1 
ATOM   8103  C CD  . LYS B 1 547 ? 43.127  40.814  136.631 1.00 57.47 ? 547 LYS A CD  1 
ATOM   8104  C CE  . LYS B 1 547 ? 42.225  39.821  137.376 1.00 59.07 ? 547 LYS A CE  1 
ATOM   8105  N NZ  . LYS B 1 547 ? 41.482  38.941  136.416 1.00 60.18 ? 547 LYS A NZ  1 
ATOM   8106  N N   . ASN B 1 548 ? 43.213  44.876  140.380 1.00 51.96 ? 548 ASN A N   1 
ATOM   8107  C CA  . ASN B 1 548 ? 43.955  45.193  141.617 1.00 51.65 ? 548 ASN A CA  1 
ATOM   8108  C C   . ASN B 1 548 ? 44.634  46.572  141.629 1.00 51.11 ? 548 ASN A C   1 
ATOM   8109  O O   . ASN B 1 548 ? 45.453  46.862  142.504 1.00 51.09 ? 548 ASN A O   1 
ATOM   8110  C CB  . ASN B 1 548 ? 44.960  44.079  141.977 1.00 51.72 ? 548 ASN A CB  1 
ATOM   8111  C CG  . ASN B 1 548 ? 44.347  42.684  141.906 1.00 52.30 ? 548 ASN A CG  1 
ATOM   8112  O OD1 . ASN B 1 548 ? 43.176  42.485  142.240 1.00 52.77 ? 548 ASN A OD1 1 
ATOM   8113  N ND2 . ASN B 1 548 ? 45.140  41.712  141.467 1.00 53.05 ? 548 ASN A ND2 1 
ATOM   8114  N N   . VAL B 1 549 ? 44.273  47.417  140.665 1.00 50.35 ? 549 VAL A N   1 
ATOM   8115  C CA  . VAL B 1 549 ? 44.794  48.778  140.580 1.00 49.55 ? 549 VAL A CA  1 
ATOM   8116  C C   . VAL B 1 549 ? 43.676  49.777  140.900 1.00 49.14 ? 549 VAL A C   1 
ATOM   8117  O O   . VAL B 1 549 ? 42.589  49.716  140.315 1.00 48.87 ? 549 VAL A O   1 
ATOM   8118  C CB  . VAL B 1 549 ? 45.415  49.074  139.182 1.00 49.50 ? 549 VAL A CB  1 
ATOM   8119  C CG1 . VAL B 1 549 ? 46.061  50.451  139.150 1.00 49.37 ? 549 VAL A CG1 1 
ATOM   8120  C CG2 . VAL B 1 549 ? 46.439  48.014  138.809 1.00 49.18 ? 549 VAL A CG2 1 
ATOM   8121  N N   . LEU B 1 550 ? 43.953  50.685  141.837 1.00 48.54 ? 550 LEU A N   1 
ATOM   8122  C CA  . LEU B 1 550 ? 42.995  51.711  142.249 1.00 47.98 ? 550 LEU A CA  1 
ATOM   8123  C C   . LEU B 1 550 ? 42.952  52.902  141.290 1.00 47.74 ? 550 LEU A C   1 
ATOM   8124  O O   . LEU B 1 550 ? 43.985  53.316  140.756 1.00 47.71 ? 550 LEU A O   1 
ATOM   8125  C CB  . LEU B 1 550 ? 43.339  52.216  143.651 1.00 47.89 ? 550 LEU A CB  1 
ATOM   8126  C CG  . LEU B 1 550 ? 43.374  51.250  144.833 1.00 47.56 ? 550 LEU A CG  1 
ATOM   8127  C CD1 . LEU B 1 550 ? 43.808  52.020  146.053 1.00 47.07 ? 550 LEU A CD1 1 
ATOM   8128  C CD2 . LEU B 1 550 ? 42.027  50.579  145.075 1.00 46.83 ? 550 LEU A CD2 1 
ATOM   8129  N N   . ALA B 1 551 ? 41.759  53.461  141.088 1.00 47.34 ? 551 ALA A N   1 
ATOM   8130  C CA  . ALA B 1 551 ? 41.603  54.676  140.283 1.00 47.02 ? 551 ALA A CA  1 
ATOM   8131  C C   . ALA B 1 551 ? 42.130  55.897  141.035 1.00 46.84 ? 551 ALA A C   1 
ATOM   8132  O O   . ALA B 1 551 ? 41.656  56.220  142.118 1.00 46.80 ? 551 ALA A O   1 
ATOM   8133  C CB  . ALA B 1 551 ? 40.153  54.874  139.880 1.00 46.82 ? 551 ALA A CB  1 
ATOM   8134  N N   . LYS B 1 552 ? 43.121  56.562  140.452 1.00 46.73 ? 552 LYS A N   1 
ATOM   8135  C CA  . LYS B 1 552 ? 43.763  57.707  141.082 1.00 46.59 ? 552 LYS A CA  1 
ATOM   8136  C C   . LYS B 1 552 ? 43.445  59.001  140.342 1.00 46.75 ? 552 LYS A C   1 
ATOM   8137  O O   . LYS B 1 552 ? 42.927  58.974  139.226 1.00 46.50 ? 552 LYS A O   1 
ATOM   8138  C CB  . LYS B 1 552 ? 45.278  57.502  141.138 1.00 46.58 ? 552 LYS A CB  1 
ATOM   8139  C CG  . LYS B 1 552 ? 45.726  56.248  141.864 1.00 46.16 ? 552 LYS A CG  1 
ATOM   8140  C CD  . LYS B 1 552 ? 47.124  55.847  141.423 1.00 45.74 ? 552 LYS A CD  1 
ATOM   8141  C CE  . LYS B 1 552 ? 47.434  54.403  141.781 1.00 45.54 ? 552 LYS A CE  1 
ATOM   8142  N NZ  . LYS B 1 552 ? 46.729  53.412  140.918 1.00 45.37 ? 552 LYS A NZ  1 
ATOM   8143  N N   . CYS B 1 553 ? 43.762  60.131  140.975 1.00 47.25 ? 553 CYS A N   1 
ATOM   8144  C CA  . CYS B 1 553 ? 43.565  61.451  140.377 1.00 47.76 ? 553 CYS A CA  1 
ATOM   8145  C C   . CYS B 1 553 ? 44.691  62.440  140.633 1.00 47.85 ? 553 CYS A C   1 
ATOM   8146  O O   . CYS B 1 553 ? 45.366  62.386  141.661 1.00 47.96 ? 553 CYS A O   1 
ATOM   8147  C CB  . CYS B 1 553 ? 42.233  62.035  140.815 1.00 47.93 ? 553 CYS A CB  1 
ATOM   8148  S SG  . CYS B 1 553 ? 40.890  61.384  139.825 1.00 49.43 ? 553 CYS A SG  1 
ATOM   8149  N N   . TYR B 1 554 ? 44.861  63.355  139.681 1.00 48.07 ? 554 TYR A N   1 
ATOM   8150  C CA  . TYR B 1 554 ? 45.969  64.312  139.656 1.00 48.23 ? 554 TYR A CA  1 
ATOM   8151  C C   . TYR B 1 554 ? 45.735  65.508  140.592 1.00 48.25 ? 554 TYR A C   1 
ATOM   8152  O O   . TYR B 1 554 ? 44.596  65.912  140.827 1.00 48.15 ? 554 TYR A O   1 
ATOM   8153  C CB  . TYR B 1 554 ? 46.207  64.756  138.203 1.00 48.43 ? 554 TYR A CB  1 
ATOM   8154  C CG  . TYR B 1 554 ? 47.404  65.647  137.961 1.00 48.75 ? 554 TYR A CG  1 
ATOM   8155  C CD1 . TYR B 1 554 ? 48.641  65.380  138.559 1.00 48.84 ? 554 TYR A CD1 1 
ATOM   8156  C CD2 . TYR B 1 554 ? 47.309  66.746  137.101 1.00 49.05 ? 554 TYR A CD2 1 
ATOM   8157  C CE1 . TYR B 1 554 ? 49.740  66.204  138.332 1.00 49.05 ? 554 TYR A CE1 1 
ATOM   8158  C CE2 . TYR B 1 554 ? 48.405  67.574  136.861 1.00 49.22 ? 554 TYR A CE2 1 
ATOM   8159  C CZ  . TYR B 1 554 ? 49.616  67.295  137.480 1.00 49.09 ? 554 TYR A CZ  1 
ATOM   8160  O OH  . TYR B 1 554 ? 50.701  68.108  137.250 1.00 49.03 ? 554 TYR A OH  1 
ATOM   8161  N N   . GLY B 1 555 ? 46.824  66.056  141.128 1.00 48.45 ? 555 GLY A N   1 
ATOM   8162  C CA  . GLY B 1 555 ? 46.770  67.133  142.126 1.00 48.56 ? 555 GLY A CA  1 
ATOM   8163  C C   . GLY B 1 555 ? 46.281  68.474  141.608 1.00 48.56 ? 555 GLY A C   1 
ATOM   8164  O O   . GLY B 1 555 ? 46.539  68.843  140.463 1.00 48.60 ? 555 GLY A O   1 
ATOM   8165  N N   . MET C 1 1   ? 98.279  86.113  133.764 1.00 52.91 ? 1   MET B N   1 
ATOM   8166  C CA  . MET C 1 1   ? 97.743  86.246  135.147 1.00 52.79 ? 1   MET B CA  1 
ATOM   8167  C C   . MET C 1 1   ? 97.494  87.701  135.497 1.00 52.71 ? 1   MET B C   1 
ATOM   8168  O O   . MET C 1 1   ? 96.383  88.074  135.868 1.00 52.84 ? 1   MET B O   1 
ATOM   8169  C CB  . MET C 1 1   ? 98.695  85.618  136.160 1.00 52.70 ? 1   MET B CB  1 
ATOM   8170  C CG  . MET C 1 1   ? 98.903  84.132  135.969 1.00 52.76 ? 1   MET B CG  1 
ATOM   8171  S SD  . MET C 1 1   ? 99.660  83.384  137.414 1.00 53.11 ? 1   MET B SD  1 
ATOM   8172  C CE  . MET C 1 1   ? 98.250  83.293  138.515 1.00 53.13 ? 1   MET B CE  1 
ATOM   8173  N N   . LYS C 1 2   ? 98.529  88.523  135.357 1.00 52.60 ? 2   LYS B N   1 
ATOM   8174  C CA  . LYS C 1 2   ? 98.461  89.936  135.717 1.00 52.57 ? 2   LYS B CA  1 
ATOM   8175  C C   . LYS C 1 2   ? 97.241  90.636  135.110 1.00 52.50 ? 2   LYS B C   1 
ATOM   8176  O O   . LYS C 1 2   ? 96.645  91.519  135.735 1.00 52.27 ? 2   LYS B O   1 
ATOM   8177  C CB  . LYS C 1 2   ? 99.759  90.638  135.317 1.00 52.57 ? 2   LYS B CB  1 
ATOM   8178  C CG  . LYS C 1 2   ? 101.016 89.797  135.606 1.00 53.39 ? 2   LYS B CG  1 
ATOM   8179  C CD  . LYS C 1 2   ? 102.143 90.608  136.278 1.00 53.84 ? 2   LYS B CD  1 
ATOM   8180  C CE  . LYS C 1 2   ? 102.964 91.413  135.276 1.00 53.27 ? 2   LYS B CE  1 
ATOM   8181  N NZ  . LYS C 1 2   ? 103.839 92.393  135.968 1.00 53.57 ? 2   LYS B NZ  1 
ATOM   8182  N N   . ASN C 1 3   ? 96.862  90.205  133.907 1.00 52.60 ? 3   ASN B N   1 
ATOM   8183  C CA  . ASN C 1 3   ? 95.743  90.794  133.172 1.00 52.53 ? 3   ASN B CA  1 
ATOM   8184  C C   . ASN C 1 3   ? 94.474  89.938  133.137 1.00 52.52 ? 3   ASN B C   1 
ATOM   8185  O O   . ASN C 1 3   ? 93.647  90.090  132.237 1.00 52.55 ? 3   ASN B O   1 
ATOM   8186  C CB  . ASN C 1 3   ? 96.174  91.144  131.743 1.00 52.64 ? 3   ASN B CB  1 
ATOM   8187  C CG  . ASN C 1 3   ? 96.883  92.487  131.652 1.00 52.58 ? 3   ASN B CG  1 
ATOM   8188  O OD1 . ASN C 1 3   ? 97.700  92.838  132.509 1.00 52.67 ? 3   ASN B OD1 1 
ATOM   8189  N ND2 . ASN C 1 3   ? 96.577  93.244  130.601 1.00 51.91 ? 3   ASN B ND2 1 
ATOM   8190  N N   . ILE C 1 4   ? 94.316  89.051  134.114 1.00 52.39 ? 4   ILE B N   1 
ATOM   8191  C CA  . ILE C 1 4   ? 93.124  88.215  134.199 1.00 52.38 ? 4   ILE B CA  1 
ATOM   8192  C C   . ILE C 1 4   ? 92.223  88.718  135.322 1.00 52.82 ? 4   ILE B C   1 
ATOM   8193  O O   . ILE C 1 4   ? 92.713  89.218  136.333 1.00 52.83 ? 4   ILE B O   1 
ATOM   8194  C CB  . ILE C 1 4   ? 93.483  86.724  134.439 1.00 52.36 ? 4   ILE B CB  1 
ATOM   8195  C CG1 . ILE C 1 4   ? 94.320  86.168  133.281 1.00 51.96 ? 4   ILE B CG1 1 
ATOM   8196  C CG2 . ILE C 1 4   ? 92.221  85.880  134.668 1.00 52.11 ? 4   ILE B CG2 1 
ATOM   8197  C CD1 . ILE C 1 4   ? 94.910  84.784  133.534 1.00 52.00 ? 4   ILE B CD1 1 
ATOM   8198  N N   . ARG C 1 5   ? 90.907  88.605  135.127 1.00 53.17 ? 5   ARG B N   1 
ATOM   8199  C CA  . ARG C 1 5   ? 89.935  88.876  136.187 1.00 53.49 ? 5   ARG B CA  1 
ATOM   8200  C C   . ARG C 1 5   ? 88.867  87.788  136.226 1.00 53.83 ? 5   ARG B C   1 
ATOM   8201  O O   . ARG C 1 5   ? 88.019  87.701  135.330 1.00 53.97 ? 5   ARG B O   1 
ATOM   8202  C CB  . ARG C 1 5   ? 89.274  90.248  136.013 1.00 53.32 ? 5   ARG B CB  1 
ATOM   8203  C CG  . ARG C 1 5   ? 90.214  91.451  136.043 1.00 53.56 ? 5   ARG B CG  1 
ATOM   8204  C CD  . ARG C 1 5   ? 90.914  91.648  137.385 1.00 53.05 ? 5   ARG B CD  1 
ATOM   8205  N NE  . ARG C 1 5   ? 91.731  92.866  137.403 1.00 53.26 ? 5   ARG B NE  1 
ATOM   8206  C CZ  . ARG C 1 5   ? 92.955  92.970  136.885 1.00 53.28 ? 5   ARG B CZ  1 
ATOM   8207  N NH1 . ARG C 1 5   ? 93.529  91.930  136.292 1.00 53.69 ? 5   ARG B NH1 1 
ATOM   8208  N NH2 . ARG C 1 5   ? 93.610  94.123  136.954 1.00 52.57 ? 5   ARG B NH2 1 
ATOM   8209  N N   . ASN C 1 6   ? 88.918  86.955  137.263 1.00 54.18 ? 6   ASN B N   1 
ATOM   8210  C CA  . ASN C 1 6   ? 87.916  85.912  137.467 1.00 54.38 ? 6   ASN B CA  1 
ATOM   8211  C C   . ASN C 1 6   ? 86.877  86.373  138.472 1.00 54.66 ? 6   ASN B C   1 
ATOM   8212  O O   . ASN C 1 6   ? 87.176  86.527  139.664 1.00 54.92 ? 6   ASN B O   1 
ATOM   8213  C CB  . ASN C 1 6   ? 88.569  84.622  137.955 1.00 54.33 ? 6   ASN B CB  1 
ATOM   8214  C CG  . ASN C 1 6   ? 89.709  84.190  137.082 1.00 54.17 ? 6   ASN B CG  1 
ATOM   8215  O OD1 . ASN C 1 6   ? 89.558  84.060  135.870 1.00 54.91 ? 6   ASN B OD1 1 
ATOM   8216  N ND2 . ASN C 1 6   ? 90.864  83.966  137.687 1.00 53.89 ? 6   ASN B ND2 1 
ATOM   8217  N N   . PHE C 1 7   ? 85.661  86.594  137.985 1.00 54.73 ? 7   PHE B N   1 
ATOM   8218  C CA  . PHE C 1 7   ? 84.592  87.140  138.806 1.00 54.91 ? 7   PHE B CA  1 
ATOM   8219  C C   . PHE C 1 7   ? 83.250  86.505  138.460 1.00 55.10 ? 7   PHE B C   1 
ATOM   8220  O O   . PHE C 1 7   ? 83.023  86.090  137.323 1.00 55.04 ? 7   PHE B O   1 
ATOM   8221  C CB  . PHE C 1 7   ? 84.521  88.663  138.631 1.00 54.87 ? 7   PHE B CB  1 
ATOM   8222  C CG  . PHE C 1 7   ? 83.944  89.101  137.309 1.00 55.07 ? 7   PHE B CG  1 
ATOM   8223  C CD1 . PHE C 1 7   ? 84.696  89.018  136.140 1.00 55.05 ? 7   PHE B CD1 1 
ATOM   8224  C CD2 . PHE C 1 7   ? 82.640  89.593  137.233 1.00 55.12 ? 7   PHE B CD2 1 
ATOM   8225  C CE1 . PHE C 1 7   ? 84.152  89.416  134.912 1.00 55.55 ? 7   PHE B CE1 1 
ATOM   8226  C CE2 . PHE C 1 7   ? 82.089  89.994  136.012 1.00 54.86 ? 7   PHE B CE2 1 
ATOM   8227  C CZ  . PHE C 1 7   ? 82.846  89.907  134.852 1.00 54.95 ? 7   PHE B CZ  1 
ATOM   8228  N N   . SER C 1 8   ? 82.364  86.433  139.446 1.00 55.34 ? 8   SER B N   1 
ATOM   8229  C CA  . SER C 1 8   ? 80.994  85.995  139.204 1.00 55.70 ? 8   SER B CA  1 
ATOM   8230  C C   . SER C 1 8   ? 80.008  87.120  139.494 1.00 55.79 ? 8   SER B C   1 
ATOM   8231  O O   . SER C 1 8   ? 80.380  88.151  140.057 1.00 55.80 ? 8   SER B O   1 
ATOM   8232  C CB  . SER C 1 8   ? 80.659  84.730  140.003 1.00 55.67 ? 8   SER B CB  1 
ATOM   8233  O OG  . SER C 1 8   ? 81.089  84.828  141.344 1.00 56.30 ? 8   SER B OG  1 
ATOM   8234  N N   . ILE C 1 9   ? 78.757  86.922  139.090 1.00 55.93 ? 9   ILE B N   1 
ATOM   8235  C CA  . ILE C 1 9   ? 77.739  87.959  139.209 1.00 56.07 ? 9   ILE B CA  1 
ATOM   8236  C C   . ILE C 1 9   ? 76.613  87.497  140.126 1.00 56.28 ? 9   ILE B C   1 
ATOM   8237  O O   . ILE C 1 9   ? 76.014  86.447  139.905 1.00 56.33 ? 9   ILE B O   1 
ATOM   8238  C CB  . ILE C 1 9   ? 77.190  88.376  137.822 1.00 55.94 ? 9   ILE B CB  1 
ATOM   8239  C CG1 . ILE C 1 9   ? 78.292  89.043  136.992 1.00 55.78 ? 9   ILE B CG1 1 
ATOM   8240  C CG2 . ILE C 1 9   ? 75.999  89.313  137.970 1.00 56.13 ? 9   ILE B CG2 1 
ATOM   8241  C CD1 . ILE C 1 9   ? 77.978  89.168  135.501 1.00 55.36 ? 9   ILE B CD1 1 
ATOM   8242  N N   . ILE C 1 10  ? 76.352  88.288  141.163 1.00 56.68 ? 10  ILE B N   1 
ATOM   8243  C CA  . ILE C 1 10  ? 75.282  88.016  142.117 1.00 57.08 ? 10  ILE B CA  1 
ATOM   8244  C C   . ILE C 1 10  ? 74.184  89.044  141.874 1.00 57.61 ? 10  ILE B C   1 
ATOM   8245  O O   . ILE C 1 10  ? 74.410  90.246  142.038 1.00 57.76 ? 10  ILE B O   1 
ATOM   8246  C CB  . ILE C 1 10  ? 75.785  88.099  143.582 1.00 56.90 ? 10  ILE B CB  1 
ATOM   8247  C CG1 . ILE C 1 10  ? 77.130  87.382  143.732 1.00 56.56 ? 10  ILE B CG1 1 
ATOM   8248  C CG2 . ILE C 1 10  ? 74.751  87.513  144.537 1.00 56.89 ? 10  ILE B CG2 1 
ATOM   8249  C CD1 . ILE C 1 10  ? 77.887  87.722  144.993 1.00 56.17 ? 10  ILE B CD1 1 
ATOM   8250  N N   . ALA C 1 11  ? 73.009  88.564  141.464 1.00 58.24 ? 11  ALA B N   1 
ATOM   8251  C CA  . ALA C 1 11  ? 71.891  89.426  141.050 1.00 58.82 ? 11  ALA B CA  1 
ATOM   8252  C C   . ALA C 1 11  ? 70.571  88.658  141.014 1.00 59.23 ? 11  ALA B C   1 
ATOM   8253  O O   . ALA C 1 11  ? 70.566  87.427  140.938 1.00 59.25 ? 11  ALA B O   1 
ATOM   8254  C CB  . ALA C 1 11  ? 72.177  90.051  139.681 1.00 58.74 ? 11  ALA B CB  1 
ATOM   8255  N N   . HIS C 1 12  ? 69.455  89.386  141.044 1.00 59.81 ? 12  HIS B N   1 
ATOM   8256  C CA  . HIS C 1 12  ? 68.139  88.750  141.117 1.00 60.45 ? 12  HIS B CA  1 
ATOM   8257  C C   . HIS C 1 12  ? 67.420  88.594  139.766 1.00 60.81 ? 12  HIS B C   1 
ATOM   8258  O O   . HIS C 1 12  ? 67.363  87.485  139.219 1.00 60.82 ? 12  HIS B O   1 
ATOM   8259  C CB  . HIS C 1 12  ? 67.240  89.460  142.134 1.00 60.45 ? 12  HIS B CB  1 
ATOM   8260  C CG  . HIS C 1 12  ? 65.902  88.810  142.303 1.00 60.72 ? 12  HIS B CG  1 
ATOM   8261  N ND1 . HIS C 1 12  ? 64.764  89.275  141.679 1.00 60.89 ? 12  HIS B ND1 1 
ATOM   8262  C CD2 . HIS C 1 12  ? 65.526  87.715  143.006 1.00 60.84 ? 12  HIS B CD2 1 
ATOM   8263  C CE1 . HIS C 1 12  ? 63.741  88.504  142.003 1.00 61.04 ? 12  HIS B CE1 1 
ATOM   8264  N NE2 . HIS C 1 12  ? 64.177  87.551  142.807 1.00 61.13 ? 12  HIS B NE2 1 
ATOM   8265  N N   . ILE C 1 13  ? 66.865  89.692  139.247 1.00 61.25 ? 13  ILE B N   1 
ATOM   8266  C CA  . ILE C 1 13  ? 66.034  89.651  138.029 1.00 61.45 ? 13  ILE B CA  1 
ATOM   8267  C C   . ILE C 1 13  ? 66.885  89.453  136.764 1.00 61.50 ? 13  ILE B C   1 
ATOM   8268  O O   . ILE C 1 13  ? 66.560  88.626  135.909 1.00 61.63 ? 13  ILE B O   1 
ATOM   8269  C CB  . ILE C 1 13  ? 65.106  90.909  137.898 1.00 61.46 ? 13  ILE B CB  1 
ATOM   8270  C CG1 . ILE C 1 13  ? 63.976  90.648  136.886 1.00 61.58 ? 13  ILE B CG1 1 
ATOM   8271  C CG2 . ILE C 1 13  ? 65.922  92.178  137.566 1.00 61.51 ? 13  ILE B CG2 1 
ATOM   8272  C CD1 . ILE C 1 13  ? 62.720  91.500  137.087 1.00 61.46 ? 13  ILE B CD1 1 
ATOM   8273  N N   . SER C 1 18  ? 67.455  92.281  129.276 1.00 56.01 ? 18  SER B N   1 
ATOM   8274  C CA  . SER C 1 18  ? 68.913  92.122  129.285 1.00 55.96 ? 18  SER B CA  1 
ATOM   8275  C C   . SER C 1 18  ? 69.544  92.300  130.669 1.00 55.77 ? 18  SER B C   1 
ATOM   8276  O O   . SER C 1 18  ? 69.472  93.377  131.264 1.00 55.67 ? 18  SER B O   1 
ATOM   8277  C CB  . SER C 1 18  ? 69.576  93.076  128.279 1.00 56.00 ? 18  SER B CB  1 
ATOM   8278  O OG  . SER C 1 18  ? 69.438  92.592  126.954 1.00 56.09 ? 18  SER B OG  1 
ATOM   8279  N N   . THR C 1 19  ? 70.161  91.228  131.162 1.00 55.72 ? 19  THR B N   1 
ATOM   8280  C CA  . THR C 1 19  ? 70.972  91.264  132.381 1.00 55.85 ? 19  THR B CA  1 
ATOM   8281  C C   . THR C 1 19  ? 72.285  91.993  132.105 1.00 55.76 ? 19  THR B C   1 
ATOM   8282  O O   . THR C 1 19  ? 72.666  92.169  130.944 1.00 55.73 ? 19  THR B O   1 
ATOM   8283  C CB  . THR C 1 19  ? 71.303  89.840  132.884 1.00 55.94 ? 19  THR B CB  1 
ATOM   8284  O OG1 . THR C 1 19  ? 71.745  89.032  131.781 1.00 56.39 ? 19  THR B OG1 1 
ATOM   8285  C CG2 . THR C 1 19  ? 70.086  89.190  133.541 1.00 55.85 ? 19  THR B CG2 1 
ATOM   8286  N N   . LEU C 1 20  ? 72.977  92.408  133.167 1.00 55.69 ? 20  LEU B N   1 
ATOM   8287  C CA  . LEU C 1 20  ? 74.293  93.043  133.034 1.00 55.64 ? 20  LEU B CA  1 
ATOM   8288  C C   . LEU C 1 20  ? 75.277  92.112  132.330 1.00 55.67 ? 20  LEU B C   1 
ATOM   8289  O O   . LEU C 1 20  ? 76.101  92.554  131.529 1.00 55.71 ? 20  LEU B O   1 
ATOM   8290  C CB  . LEU C 1 20  ? 74.847  93.472  134.400 1.00 55.63 ? 20  LEU B CB  1 
ATOM   8291  C CG  . LEU C 1 20  ? 76.166  94.260  134.396 1.00 55.63 ? 20  LEU B CG  1 
ATOM   8292  C CD1 . LEU C 1 20  ? 75.983  95.667  133.828 1.00 56.43 ? 20  LEU B CD1 1 
ATOM   8293  C CD2 . LEU C 1 20  ? 76.762  94.334  135.778 1.00 55.54 ? 20  LEU B CD2 1 
ATOM   8294  N N   . SER C 1 21  ? 75.174  90.824  132.638 1.00 55.72 ? 21  SER B N   1 
ATOM   8295  C CA  . SER C 1 21  ? 75.953  89.782  131.985 1.00 55.81 ? 21  SER B CA  1 
ATOM   8296  C C   . SER C 1 21  ? 75.911  89.893  130.452 1.00 55.82 ? 21  SER B C   1 
ATOM   8297  O O   . SER C 1 21  ? 76.924  89.676  129.782 1.00 55.73 ? 21  SER B O   1 
ATOM   8298  C CB  . SER C 1 21  ? 75.443  88.413  132.450 1.00 55.89 ? 21  SER B CB  1 
ATOM   8299  O OG  . SER C 1 21  ? 75.833  87.379  131.567 1.00 56.37 ? 21  SER B OG  1 
ATOM   8300  N N   . ASP C 1 22  ? 74.743  90.245  129.914 1.00 55.83 ? 22  ASP B N   1 
ATOM   8301  C CA  . ASP C 1 22  ? 74.539  90.345  128.463 1.00 55.82 ? 22  ASP B CA  1 
ATOM   8302  C C   . ASP C 1 22  ? 75.065  91.634  127.842 1.00 55.65 ? 22  ASP B C   1 
ATOM   8303  O O   . ASP C 1 22  ? 75.463  91.643  126.676 1.00 55.64 ? 22  ASP B O   1 
ATOM   8304  C CB  . ASP C 1 22  ? 73.060  90.155  128.110 1.00 55.92 ? 22  ASP B CB  1 
ATOM   8305  C CG  . ASP C 1 22  ? 72.634  88.700  128.153 1.00 56.40 ? 22  ASP B CG  1 
ATOM   8306  O OD1 . ASP C 1 22  ? 73.416  87.860  128.658 1.00 57.22 ? 22  ASP B OD1 1 
ATOM   8307  O OD2 . ASP C 1 22  ? 71.517  88.394  127.680 1.00 56.42 ? 22  ASP B OD2 1 
ATOM   8308  N N   . ARG C 1 23  ? 75.052  92.721  128.608 1.00 55.48 ? 23  ARG B N   1 
ATOM   8309  C CA  . ARG C 1 23  ? 75.617  93.980  128.131 1.00 55.39 ? 23  ARG B CA  1 
ATOM   8310  C C   . ARG C 1 23  ? 77.148  93.959  128.145 1.00 55.40 ? 23  ARG B C   1 
ATOM   8311  O O   . ARG C 1 23  ? 77.785  94.547  127.266 1.00 55.38 ? 23  ARG B O   1 
ATOM   8312  C CB  . ARG C 1 23  ? 75.074  95.175  128.915 1.00 55.26 ? 23  ARG B CB  1 
ATOM   8313  C CG  . ARG C 1 23  ? 73.665  95.572  128.517 1.00 55.35 ? 23  ARG B CG  1 
ATOM   8314  C CD  . ARG C 1 23  ? 72.668  95.328  129.625 1.00 55.50 ? 23  ARG B CD  1 
ATOM   8315  N NE  . ARG C 1 23  ? 72.783  96.367  130.642 1.00 55.50 ? 23  ARG B NE  1 
ATOM   8316  C CZ  . ARG C 1 23  ? 72.333  96.265  131.887 1.00 55.41 ? 23  ARG B CZ  1 
ATOM   8317  N NH1 . ARG C 1 23  ? 71.721  95.163  132.298 1.00 55.11 ? 23  ARG B NH1 1 
ATOM   8318  N NH2 . ARG C 1 23  ? 72.504  97.275  132.725 1.00 55.31 ? 23  ARG B NH2 1 
ATOM   8319  N N   . ILE C 1 24  ? 77.727  93.275  129.135 1.00 55.40 ? 24  ILE B N   1 
ATOM   8320  C CA  . ILE C 1 24  ? 79.182  93.107  129.230 1.00 55.33 ? 24  ILE B CA  1 
ATOM   8321  C C   . ILE C 1 24  ? 79.726  92.384  127.992 1.00 55.45 ? 24  ILE B C   1 
ATOM   8322  O O   . ILE C 1 24  ? 80.762  92.772  127.440 1.00 55.53 ? 24  ILE B O   1 
ATOM   8323  C CB  . ILE C 1 24  ? 79.599  92.369  130.531 1.00 55.39 ? 24  ILE B CB  1 
ATOM   8324  C CG1 . ILE C 1 24  ? 79.310  93.237  131.763 1.00 55.21 ? 24  ILE B CG1 1 
ATOM   8325  C CG2 . ILE C 1 24  ? 81.080  92.000  130.493 1.00 55.77 ? 24  ILE B CG2 1 
ATOM   8326  C CD1 . ILE C 1 24  ? 79.496  92.529  133.093 1.00 54.90 ? 24  ILE B CD1 1 
ATOM   8327  N N   . ILE C 1 25  ? 79.007  91.354  127.549 1.00 55.47 ? 25  ILE B N   1 
ATOM   8328  C CA  . ILE C 1 25  ? 79.371  90.612  126.343 1.00 55.50 ? 25  ILE B CA  1 
ATOM   8329  C C   . ILE C 1 25  ? 79.318  91.500  125.096 1.00 55.77 ? 25  ILE B C   1 
ATOM   8330  O O   . ILE C 1 25  ? 80.199  91.416  124.239 1.00 55.90 ? 25  ILE B O   1 
ATOM   8331  C CB  . ILE C 1 25  ? 78.509  89.332  126.183 1.00 55.39 ? 25  ILE B CB  1 
ATOM   8332  C CG1 . ILE C 1 25  ? 78.868  88.330  127.286 1.00 55.13 ? 25  ILE B CG1 1 
ATOM   8333  C CG2 . ILE C 1 25  ? 78.713  88.693  124.809 1.00 55.17 ? 25  ILE B CG2 1 
ATOM   8334  C CD1 . ILE C 1 25  ? 77.840  87.253  127.532 1.00 54.86 ? 25  ILE B CD1 1 
ATOM   8335  N N   . GLN C 1 26  ? 78.306  92.363  125.018 1.00 56.05 ? 26  GLN B N   1 
ATOM   8336  C CA  . GLN C 1 26  ? 78.107  93.246  123.859 1.00 56.39 ? 26  GLN B CA  1 
ATOM   8337  C C   . GLN C 1 26  ? 79.250  94.231  123.623 1.00 56.43 ? 26  GLN B C   1 
ATOM   8338  O O   . GLN C 1 26  ? 79.544  94.580  122.479 1.00 56.33 ? 26  GLN B O   1 
ATOM   8339  C CB  . GLN C 1 26  ? 76.777  93.998  123.970 1.00 56.32 ? 26  GLN B CB  1 
ATOM   8340  C CG  . GLN C 1 26  ? 75.603  93.297  123.294 1.00 56.46 ? 26  GLN B CG  1 
ATOM   8341  C CD  . GLN C 1 26  ? 74.260  93.911  123.663 1.00 56.83 ? 26  GLN B CD  1 
ATOM   8342  O OE1 . GLN C 1 26  ? 73.570  94.488  122.818 1.00 57.22 ? 26  GLN B OE1 1 
ATOM   8343  N NE2 . GLN C 1 26  ? 73.885  93.795  124.935 1.00 57.66 ? 26  GLN B NE2 1 
ATOM   8344  N N   . ILE C 1 27  ? 79.882  94.676  124.706 1.00 56.75 ? 27  ILE B N   1 
ATOM   8345  C CA  . ILE C 1 27  ? 80.993  95.628  124.618 1.00 57.04 ? 27  ILE B CA  1 
ATOM   8346  C C   . ILE C 1 27  ? 82.349  94.917  124.572 1.00 57.13 ? 27  ILE B C   1 
ATOM   8347  O O   . ILE C 1 27  ? 83.385  95.546  124.351 1.00 57.23 ? 27  ILE B O   1 
ATOM   8348  C CB  . ILE C 1 27  ? 80.950  96.698  125.745 1.00 56.96 ? 27  ILE B CB  1 
ATOM   8349  C CG1 . ILE C 1 27  ? 81.190  96.079  127.116 1.00 57.03 ? 27  ILE B CG1 1 
ATOM   8350  C CG2 . ILE C 1 27  ? 79.620  97.426  125.750 1.00 56.92 ? 27  ILE B CG2 1 
ATOM   8351  C CD1 . ILE C 1 27  ? 81.025  97.073  128.248 1.00 57.43 ? 27  ILE B CD1 1 
ATOM   8352  N N   . CYS C 1 28  ? 82.329  93.604  124.787 1.00 57.26 ? 28  CYS B N   1 
ATOM   8353  C CA  . CYS C 1 28  ? 83.493  92.762  124.547 1.00 57.45 ? 28  CYS B CA  1 
ATOM   8354  C C   . CYS C 1 28  ? 83.176  91.846  123.360 1.00 57.68 ? 28  CYS B C   1 
ATOM   8355  O O   . CYS C 1 28  ? 82.546  92.292  122.407 1.00 57.66 ? 28  CYS B O   1 
ATOM   8356  C CB  . CYS C 1 28  ? 83.848  91.975  125.808 1.00 57.52 ? 28  CYS B CB  1 
ATOM   8357  S SG  . CYS C 1 28  ? 84.106  93.001  127.294 1.00 57.35 ? 28  CYS B SG  1 
ATOM   8358  N N   . GLY C 1 29  ? 83.596  90.581  123.418 1.00 58.05 ? 29  GLY B N   1 
ATOM   8359  C CA  . GLY C 1 29  ? 83.347  89.594  122.348 1.00 58.52 ? 29  GLY B CA  1 
ATOM   8360  C C   . GLY C 1 29  ? 82.344  89.958  121.254 1.00 58.91 ? 29  GLY B C   1 
ATOM   8361  O O   . GLY C 1 29  ? 82.722  90.493  120.203 1.00 59.06 ? 29  GLY B O   1 
ATOM   8362  N N   . GLY C 1 30  ? 81.065  89.664  121.495 1.00 59.04 ? 30  GLY B N   1 
ATOM   8363  C CA  . GLY C 1 30  ? 80.009  89.942  120.519 1.00 59.10 ? 30  GLY B CA  1 
ATOM   8364  C C   . GLY C 1 30  ? 78.618  89.925  121.129 1.00 59.15 ? 30  GLY B C   1 
ATOM   8365  O O   . GLY C 1 30  ? 77.993  88.868  121.250 1.00 59.19 ? 30  GLY B O   1 
ATOM   8366  N N   . GLN C 1 57  ? 76.400  80.844  130.819 1.00 61.95 ? 57  GLN B N   1 
ATOM   8367  C CA  . GLN C 1 57  ? 76.803  80.122  132.023 1.00 62.06 ? 57  GLN B CA  1 
ATOM   8368  C C   . GLN C 1 57  ? 78.254  80.425  132.431 1.00 61.80 ? 57  GLN B C   1 
ATOM   8369  O O   . GLN C 1 57  ? 78.574  80.505  133.623 1.00 62.06 ? 57  GLN B O   1 
ATOM   8370  C CB  . GLN C 1 57  ? 76.600  78.615  131.849 1.00 62.26 ? 57  GLN B CB  1 
ATOM   8371  C CG  . GLN C 1 57  ? 76.468  77.858  133.171 1.00 63.18 ? 57  GLN B CG  1 
ATOM   8372  C CD  . GLN C 1 57  ? 77.213  76.530  133.172 1.00 64.34 ? 57  GLN B CD  1 
ATOM   8373  O OE1 . GLN C 1 57  ? 78.195  76.360  133.905 1.00 64.45 ? 57  GLN B OE1 1 
ATOM   8374  N NE2 . GLN C 1 57  ? 76.756  75.585  132.345 1.00 64.39 ? 57  GLN B NE2 1 
ATOM   8375  N N   . SER C 1 58  ? 79.134  80.567  131.446 1.00 61.23 ? 58  SER B N   1 
ATOM   8376  C CA  . SER C 1 58  ? 80.472  81.094  131.695 1.00 60.62 ? 58  SER B CA  1 
ATOM   8377  C C   . SER C 1 58  ? 81.008  81.701  130.412 1.00 60.06 ? 58  SER B C   1 
ATOM   8378  O O   . SER C 1 58  ? 80.834  81.142  129.332 1.00 59.93 ? 58  SER B O   1 
ATOM   8379  C CB  . SER C 1 58  ? 81.425  80.017  132.233 1.00 60.67 ? 58  SER B CB  1 
ATOM   8380  O OG  . SER C 1 58  ? 82.258  79.487  131.213 1.00 60.99 ? 58  SER B OG  1 
ATOM   8381  N N   . VAL C 1 59  ? 81.652  82.854  130.535 1.00 59.40 ? 59  VAL B N   1 
ATOM   8382  C CA  . VAL C 1 59  ? 82.145  83.572  129.369 1.00 58.73 ? 59  VAL B CA  1 
ATOM   8383  C C   . VAL C 1 59  ? 83.571  84.048  129.617 1.00 58.14 ? 59  VAL B C   1 
ATOM   8384  O O   . VAL C 1 59  ? 83.891  84.520  130.705 1.00 58.02 ? 59  VAL B O   1 
ATOM   8385  C CB  . VAL C 1 59  ? 81.233  84.779  129.008 1.00 58.70 ? 59  VAL B CB  1 
ATOM   8386  C CG1 . VAL C 1 59  ? 81.473  85.215  127.573 1.00 58.88 ? 59  VAL B CG1 1 
ATOM   8387  C CG2 . VAL C 1 59  ? 79.758  84.431  129.193 1.00 58.62 ? 59  VAL B CG2 1 
ATOM   8388  N N   . THR C 1 60  ? 84.421  83.895  128.605 1.00 57.55 ? 60  THR B N   1 
ATOM   8389  C CA  . THR C 1 60  ? 85.777  84.437  128.620 1.00 57.09 ? 60  THR B CA  1 
ATOM   8390  C C   . THR C 1 60  ? 85.900  85.555  127.583 1.00 56.79 ? 60  THR B C   1 
ATOM   8391  O O   . THR C 1 60  ? 85.807  85.314  126.379 1.00 56.79 ? 60  THR B O   1 
ATOM   8392  C CB  . THR C 1 60  ? 86.823  83.348  128.344 1.00 57.04 ? 60  THR B CB  1 
ATOM   8393  O OG1 . THR C 1 60  ? 86.762  82.363  129.379 1.00 56.97 ? 60  THR B OG1 1 
ATOM   8394  C CG2 . THR C 1 60  ? 88.225  83.946  128.302 1.00 57.28 ? 60  THR B CG2 1 
ATOM   8395  N N   . LEU C 1 61  ? 86.113  86.776  128.058 1.00 56.38 ? 61  LEU B N   1 
ATOM   8396  C CA  . LEU C 1 61  ? 86.099  87.939  127.182 1.00 56.01 ? 61  LEU B CA  1 
ATOM   8397  C C   . LEU C 1 61  ? 87.396  88.729  127.237 1.00 55.84 ? 61  LEU B C   1 
ATOM   8398  O O   . LEU C 1 61  ? 88.118  88.690  128.234 1.00 55.83 ? 61  LEU B O   1 
ATOM   8399  C CB  . LEU C 1 61  ? 84.934  88.861  127.546 1.00 55.93 ? 61  LEU B CB  1 
ATOM   8400  C CG  . LEU C 1 61  ? 83.502  88.336  127.461 1.00 55.59 ? 61  LEU B CG  1 
ATOM   8401  C CD1 . LEU C 1 61  ? 82.604  89.152  128.384 1.00 55.11 ? 61  LEU B CD1 1 
ATOM   8402  C CD2 . LEU C 1 61  ? 82.985  88.348  126.027 1.00 55.19 ? 61  LEU B CD2 1 
ATOM   8403  N N   . ASP C 1 62  ? 87.677  89.438  126.147 1.00 55.64 ? 62  ASP B N   1 
ATOM   8404  C CA  . ASP C 1 62  ? 88.753  90.415  126.098 1.00 55.37 ? 62  ASP B CA  1 
ATOM   8405  C C   . ASP C 1 62  ? 88.185  91.810  126.283 1.00 55.10 ? 62  ASP B C   1 
ATOM   8406  O O   . ASP C 1 62  ? 87.229  92.192  125.601 1.00 55.02 ? 62  ASP B O   1 
ATOM   8407  C CB  . ASP C 1 62  ? 89.482  90.346  124.758 1.00 55.39 ? 62  ASP B CB  1 
ATOM   8408  C CG  . ASP C 1 62  ? 90.477  89.211  124.690 1.00 55.85 ? 62  ASP B CG  1 
ATOM   8409  O OD1 . ASP C 1 62  ? 91.141  88.923  125.715 1.00 56.40 ? 62  ASP B OD1 1 
ATOM   8410  O OD2 . ASP C 1 62  ? 90.603  88.615  123.599 1.00 56.30 ? 62  ASP B OD2 1 
ATOM   8411  N N   . TYR C 1 63  ? 88.769  92.561  127.211 1.00 54.84 ? 63  TYR B N   1 
ATOM   8412  C CA  . TYR C 1 63  ? 88.438  93.969  127.368 1.00 54.68 ? 63  TYR B CA  1 
ATOM   8413  C C   . TYR C 1 63  ? 89.685  94.845  127.329 1.00 54.66 ? 63  TYR B C   1 
ATOM   8414  O O   . TYR C 1 63  ? 90.537  94.763  128.211 1.00 54.79 ? 63  TYR B O   1 
ATOM   8415  C CB  . TYR C 1 63  ? 87.635  94.227  128.648 1.00 54.52 ? 63  TYR B CB  1 
ATOM   8416  C CG  . TYR C 1 63  ? 87.413  95.702  128.915 1.00 54.58 ? 63  TYR B CG  1 
ATOM   8417  C CD1 . TYR C 1 63  ? 86.609  96.469  128.069 1.00 54.47 ? 63  TYR B CD1 1 
ATOM   8418  C CD2 . TYR C 1 63  ? 88.017  96.337  130.003 1.00 54.53 ? 63  TYR B CD2 1 
ATOM   8419  C CE1 . TYR C 1 63  ? 86.409  97.829  128.295 1.00 54.18 ? 63  TYR B CE1 1 
ATOM   8420  C CE2 . TYR C 1 63  ? 87.819  97.697  130.242 1.00 54.50 ? 63  TYR B CE2 1 
ATOM   8421  C CZ  . TYR C 1 63  ? 87.014  98.439  129.377 1.00 54.49 ? 63  TYR B CZ  1 
ATOM   8422  O OH  . TYR C 1 63  ? 86.806  99.788  129.592 1.00 54.45 ? 63  TYR B OH  1 
ATOM   8423  N N   . LYS C 1 64  ? 89.780  95.672  126.290 1.00 54.65 ? 64  LYS B N   1 
ATOM   8424  C CA  . LYS C 1 64  ? 90.803  96.705  126.200 1.00 54.71 ? 64  LYS B CA  1 
ATOM   8425  C C   . LYS C 1 64  ? 90.457  97.854  127.137 1.00 54.63 ? 64  LYS B C   1 
ATOM   8426  O O   . LYS C 1 64  ? 89.483  98.578  126.913 1.00 54.53 ? 64  LYS B O   1 
ATOM   8427  C CB  . LYS C 1 64  ? 90.939  97.217  124.764 1.00 54.68 ? 64  LYS B CB  1 
ATOM   8428  C CG  . LYS C 1 64  ? 92.024  96.517  123.951 1.00 54.86 ? 64  LYS B CG  1 
ATOM   8429  C CD  . LYS C 1 64  ? 92.331  97.236  122.624 1.00 55.06 ? 64  LYS B CD  1 
ATOM   8430  C CE  . LYS C 1 64  ? 92.827  98.673  122.824 1.00 55.17 ? 64  LYS B CE  1 
ATOM   8431  N NZ  . LYS C 1 64  ? 93.897  98.765  123.858 1.00 54.90 ? 64  LYS B NZ  1 
ATOM   8432  N N   . ALA C 1 65  ? 91.254  98.007  128.191 1.00 54.66 ? 65  ALA B N   1 
ATOM   8433  C CA  . ALA C 1 65  ? 91.023  99.048  129.190 1.00 54.68 ? 65  ALA B CA  1 
ATOM   8434  C C   . ALA C 1 65  ? 91.563  100.392 128.722 1.00 54.66 ? 65  ALA B C   1 
ATOM   8435  O O   . ALA C 1 65  ? 92.403  100.451 127.819 1.00 54.70 ? 65  ALA B O   1 
ATOM   8436  C CB  . ALA C 1 65  ? 91.641  98.658  130.521 1.00 54.65 ? 65  ALA B CB  1 
ATOM   8437  N N   . SER C 1 66  ? 91.077  101.463 129.347 1.00 54.59 ? 66  SER B N   1 
ATOM   8438  C CA  . SER C 1 66  ? 91.503  102.823 129.021 1.00 54.59 ? 66  SER B CA  1 
ATOM   8439  C C   . SER C 1 66  ? 92.988  103.074 129.313 1.00 54.55 ? 66  SER B C   1 
ATOM   8440  O O   . SER C 1 66  ? 93.535  104.097 128.903 1.00 54.56 ? 66  SER B O   1 
ATOM   8441  C CB  . SER C 1 66  ? 90.631  103.845 129.751 1.00 54.56 ? 66  SER B CB  1 
ATOM   8442  O OG  . SER C 1 66  ? 90.683  103.640 131.150 1.00 55.13 ? 66  SER B OG  1 
ATOM   8443  N N   . ASP C 1 67  ? 93.635  102.143 130.014 1.00 54.50 ? 67  ASP B N   1 
ATOM   8444  C CA  . ASP C 1 67  ? 95.088  102.186 130.178 1.00 54.55 ? 67  ASP B CA  1 
ATOM   8445  C C   . ASP C 1 67  ? 95.801  101.644 128.932 1.00 54.63 ? 67  ASP B C   1 
ATOM   8446  O O   . ASP C 1 67  ? 97.030  101.713 128.825 1.00 54.64 ? 67  ASP B O   1 
ATOM   8447  C CB  . ASP C 1 67  ? 95.534  101.448 131.449 1.00 54.46 ? 67  ASP B CB  1 
ATOM   8448  C CG  . ASP C 1 67  ? 95.115  99.982  131.468 1.00 54.61 ? 67  ASP B CG  1 
ATOM   8449  O OD1 . ASP C 1 67  ? 95.011  99.361  130.390 1.00 54.81 ? 67  ASP B OD1 1 
ATOM   8450  O OD2 . ASP C 1 67  ? 94.905  99.442  132.577 1.00 54.28 ? 67  ASP B OD2 1 
ATOM   8451  N N   . GLY C 1 68  ? 95.014  101.102 128.002 1.00 54.67 ? 68  GLY B N   1 
ATOM   8452  C CA  . GLY C 1 68  ? 95.511  100.666 126.698 1.00 54.79 ? 68  GLY B CA  1 
ATOM   8453  C C   . GLY C 1 68  ? 95.811  99.182  126.585 1.00 54.87 ? 68  GLY B C   1 
ATOM   8454  O O   . GLY C 1 68  ? 96.212  98.702  125.522 1.00 54.97 ? 68  GLY B O   1 
ATOM   8455  N N   . GLU C 1 69  ? 95.604  98.451  127.674 1.00 54.84 ? 69  GLU B N   1 
ATOM   8456  C CA  . GLU C 1 69  ? 95.971  97.042  127.736 1.00 54.88 ? 69  GLU B CA  1 
ATOM   8457  C C   . GLU C 1 69  ? 94.742  96.135  127.686 1.00 54.71 ? 69  GLU B C   1 
ATOM   8458  O O   . GLU C 1 69  ? 93.630  96.581  127.967 1.00 54.69 ? 69  GLU B O   1 
ATOM   8459  C CB  . GLU C 1 69  ? 96.769  96.792  129.010 1.00 54.99 ? 69  GLU B CB  1 
ATOM   8460  C CG  . GLU C 1 69  ? 98.011  95.958  128.802 1.00 55.50 ? 69  GLU B CG  1 
ATOM   8461  C CD  . GLU C 1 69  ? 99.005  96.138  129.923 1.00 56.16 ? 69  GLU B CD  1 
ATOM   8462  O OE1 . GLU C 1 69  ? 98.573  96.375  131.072 1.00 56.30 ? 69  GLU B OE1 1 
ATOM   8463  O OE2 . GLU C 1 69  ? 100.220 96.049  129.655 1.00 57.08 ? 69  GLU B OE2 1 
ATOM   8464  N N   . THR C 1 70  ? 94.950  94.868  127.332 1.00 54.63 ? 70  THR B N   1 
ATOM   8465  C CA  . THR C 1 70  ? 93.857  93.903  127.192 1.00 54.74 ? 70  THR B CA  1 
ATOM   8466  C C   . THR C 1 70  ? 93.714  92.989  128.412 1.00 54.74 ? 70  THR B C   1 
ATOM   8467  O O   . THR C 1 70  ? 94.667  92.316  128.814 1.00 54.67 ? 70  THR B O   1 
ATOM   8468  C CB  . THR C 1 70  ? 94.027  93.049  125.917 1.00 54.76 ? 70  THR B CB  1 
ATOM   8469  O OG1 . THR C 1 70  ? 93.930  93.893  124.765 1.00 55.22 ? 70  THR B OG1 1 
ATOM   8470  C CG2 . THR C 1 70  ? 92.954  91.969  125.827 1.00 54.94 ? 70  THR B CG2 1 
ATOM   8471  N N   . TYR C 1 71  ? 92.508  92.961  128.979 1.00 54.77 ? 71  TYR B N   1 
ATOM   8472  C CA  . TYR C 1 71  ? 92.203  92.116  130.135 1.00 54.91 ? 71  TYR B CA  1 
ATOM   8473  C C   . TYR C 1 71  ? 91.295  90.939  129.788 1.00 54.94 ? 71  TYR B C   1 
ATOM   8474  O O   . TYR C 1 71  ? 90.257  91.104  129.147 1.00 55.02 ? 71  TYR B O   1 
ATOM   8475  C CB  . TYR C 1 71  ? 91.597  92.948  131.274 1.00 54.88 ? 71  TYR B CB  1 
ATOM   8476  C CG  . TYR C 1 71  ? 92.573  93.945  131.853 1.00 55.14 ? 71  TYR B CG  1 
ATOM   8477  C CD1 . TYR C 1 71  ? 92.681  95.231  131.326 1.00 55.13 ? 71  TYR B CD1 1 
ATOM   8478  C CD2 . TYR C 1 71  ? 93.407  93.595  132.911 1.00 54.85 ? 71  TYR B CD2 1 
ATOM   8479  C CE1 . TYR C 1 71  ? 93.589  96.141  131.843 1.00 54.88 ? 71  TYR B CE1 1 
ATOM   8480  C CE2 . TYR C 1 71  ? 94.315  94.501  133.433 1.00 54.60 ? 71  TYR B CE2 1 
ATOM   8481  C CZ  . TYR C 1 71  ? 94.399  95.771  132.896 1.00 54.71 ? 71  TYR B CZ  1 
ATOM   8482  O OH  . TYR C 1 71  ? 95.299  96.675  133.412 1.00 55.09 ? 71  TYR B OH  1 
ATOM   8483  N N   . GLN C 1 72  ? 91.709  89.749  130.209 1.00 54.93 ? 72  GLN B N   1 
ATOM   8484  C CA  . GLN C 1 72  ? 90.914  88.546  130.047 1.00 54.97 ? 72  GLN B CA  1 
ATOM   8485  C C   . GLN C 1 72  ? 89.911  88.456  131.198 1.00 55.00 ? 72  GLN B C   1 
ATOM   8486  O O   . GLN C 1 72  ? 90.275  88.168  132.347 1.00 54.84 ? 72  GLN B O   1 
ATOM   8487  C CB  . GLN C 1 72  ? 91.820  87.314  130.001 1.00 54.94 ? 72  GLN B CB  1 
ATOM   8488  C CG  . GLN C 1 72  ? 91.085  85.988  129.867 1.00 55.18 ? 72  GLN B CG  1 
ATOM   8489  C CD  . GLN C 1 72  ? 92.019  84.789  129.905 1.00 55.24 ? 72  GLN B CD  1 
ATOM   8490  O OE1 . GLN C 1 72  ? 92.929  84.719  130.729 1.00 55.19 ? 72  GLN B OE1 1 
ATOM   8491  N NE2 . GLN C 1 72  ? 91.790  83.835  129.010 1.00 56.18 ? 72  GLN B NE2 1 
ATOM   8492  N N   . LEU C 1 73  ? 88.649  88.729  130.882 1.00 55.07 ? 73  LEU B N   1 
ATOM   8493  C CA  . LEU C 1 73  ? 87.577  88.657  131.867 1.00 55.08 ? 73  LEU B CA  1 
ATOM   8494  C C   . LEU C 1 73  ? 86.934  87.283  131.824 1.00 55.15 ? 73  LEU B C   1 
ATOM   8495  O O   . LEU C 1 73  ? 86.384  86.878  130.797 1.00 55.17 ? 73  LEU B O   1 
ATOM   8496  C CB  . LEU C 1 73  ? 86.528  89.743  131.619 1.00 54.97 ? 73  LEU B CB  1 
ATOM   8497  C CG  . LEU C 1 73  ? 86.997  91.199  131.566 1.00 54.85 ? 73  LEU B CG  1 
ATOM   8498  C CD1 . LEU C 1 73  ? 85.826  92.085  131.188 1.00 54.78 ? 73  LEU B CD1 1 
ATOM   8499  C CD2 . LEU C 1 73  ? 87.612  91.650  132.890 1.00 54.39 ? 73  LEU B CD2 1 
ATOM   8500  N N   . ASN C 1 74  ? 87.036  86.565  132.938 1.00 55.23 ? 74  ASN B N   1 
ATOM   8501  C CA  . ASN C 1 74  ? 86.420  85.255  133.079 1.00 55.37 ? 74  ASN B CA  1 
ATOM   8502  C C   . ASN C 1 74  ? 85.240  85.347  134.026 1.00 55.57 ? 74  ASN B C   1 
ATOM   8503  O O   . ASN C 1 74  ? 85.411  85.381  135.246 1.00 55.59 ? 74  ASN B O   1 
ATOM   8504  C CB  . ASN C 1 74  ? 87.435  84.230  133.590 1.00 55.36 ? 74  ASN B CB  1 
ATOM   8505  C CG  . ASN C 1 74  ? 88.489  83.880  132.557 1.00 55.29 ? 74  ASN B CG  1 
ATOM   8506  O OD1 . ASN C 1 74  ? 88.172  83.463  131.442 1.00 55.23 ? 74  ASN B OD1 1 
ATOM   8507  N ND2 . ASN C 1 74  ? 89.753  84.033  132.929 1.00 55.13 ? 74  ASN B ND2 1 
ATOM   8508  N N   . PHE C 1 75  ? 84.042  85.409  133.455 1.00 55.98 ? 75  PHE B N   1 
ATOM   8509  C CA  . PHE C 1 75  ? 82.818  85.518  134.240 1.00 56.37 ? 75  PHE B CA  1 
ATOM   8510  C C   . PHE C 1 75  ? 82.154  84.158  134.382 1.00 56.46 ? 75  PHE B C   1 
ATOM   8511  O O   . PHE C 1 75  ? 81.857  83.507  133.386 1.00 56.50 ? 75  PHE B O   1 
ATOM   8512  C CB  . PHE C 1 75  ? 81.877  86.588  133.633 1.00 56.41 ? 75  PHE B CB  1 
ATOM   8513  C CG  . PHE C 1 75  ? 80.415  86.208  133.652 1.00 56.72 ? 75  PHE B CG  1 
ATOM   8514  C CD1 . PHE C 1 75  ? 79.698  86.145  132.454 1.00 57.43 ? 75  PHE B CD1 1 
ATOM   8515  C CD2 . PHE C 1 75  ? 79.746  85.927  134.858 1.00 57.37 ? 75  PHE B CD2 1 
ATOM   8516  C CE1 . PHE C 1 75  ? 78.333  85.791  132.447 1.00 57.60 ? 75  PHE B CE1 1 
ATOM   8517  C CE2 . PHE C 1 75  ? 78.383  85.566  134.864 1.00 57.52 ? 75  PHE B CE2 1 
ATOM   8518  C CZ  . PHE C 1 75  ? 77.675  85.503  133.654 1.00 57.08 ? 75  PHE B CZ  1 
ATOM   8519  N N   . ILE C 1 76  ? 81.957  83.731  135.628 1.00 56.91 ? 76  ILE B N   1 
ATOM   8520  C CA  . ILE C 1 76  ? 81.250  82.480  135.939 1.00 57.51 ? 76  ILE B CA  1 
ATOM   8521  C C   . ILE C 1 76  ? 79.852  82.784  136.491 1.00 57.91 ? 76  ILE B C   1 
ATOM   8522  O O   . ILE C 1 76  ? 79.705  83.595  137.404 1.00 57.96 ? 76  ILE B O   1 
ATOM   8523  C CB  . ILE C 1 76  ? 82.037  81.589  136.949 1.00 57.40 ? 76  ILE B CB  1 
ATOM   8524  C CG1 . ILE C 1 76  ? 83.365  81.108  136.355 1.00 57.46 ? 76  ILE B CG1 1 
ATOM   8525  C CG2 . ILE C 1 76  ? 81.218  80.373  137.366 1.00 57.64 ? 76  ILE B CG2 1 
ATOM   8526  C CD1 . ILE C 1 76  ? 84.572  81.896  136.811 1.00 57.42 ? 76  ILE B CD1 1 
ATOM   8527  N N   . ASP C 1 77  ? 78.830  82.142  135.931 1.00 58.40 ? 77  ASP B N   1 
ATOM   8528  C CA  . ASP C 1 77  ? 77.463  82.341  136.405 1.00 59.04 ? 77  ASP B CA  1 
ATOM   8529  C C   . ASP C 1 77  ? 77.275  81.751  137.803 1.00 59.24 ? 77  ASP B C   1 
ATOM   8530  O O   . ASP C 1 77  ? 77.880  80.733  138.152 1.00 59.25 ? 77  ASP B O   1 
ATOM   8531  C CB  . ASP C 1 77  ? 76.451  81.737  135.431 1.00 59.19 ? 77  ASP B CB  1 
ATOM   8532  C CG  . ASP C 1 77  ? 75.046  82.267  135.639 1.00 60.10 ? 77  ASP B CG  1 
ATOM   8533  O OD1 . ASP C 1 77  ? 74.879  83.283  136.353 1.00 60.74 ? 77  ASP B OD1 1 
ATOM   8534  O OD2 . ASP C 1 77  ? 74.102  81.665  135.076 1.00 61.55 ? 77  ASP B OD2 1 
ATOM   8535  N N   . THR C 1 78  ? 76.432  82.405  138.596 1.00 59.54 ? 78  THR B N   1 
ATOM   8536  C CA  . THR C 1 78  ? 76.212  82.017  139.982 1.00 59.80 ? 78  THR B CA  1 
ATOM   8537  C C   . THR C 1 78  ? 74.721  82.078  140.339 1.00 59.84 ? 78  THR B C   1 
ATOM   8538  O O   . THR C 1 78  ? 74.202  83.158  140.651 1.00 59.85 ? 78  THR B O   1 
ATOM   8539  C CB  . THR C 1 78  ? 77.055  82.902  140.933 1.00 59.87 ? 78  THR B CB  1 
ATOM   8540  O OG1 . THR C 1 78  ? 78.447  82.658  140.694 1.00 60.30 ? 78  THR B OG1 1 
ATOM   8541  C CG2 . THR C 1 78  ? 76.747  82.608  142.396 1.00 60.09 ? 78  THR B CG2 1 
ATOM   8542  N N   . PRO C 1 79  ? 74.020  80.922  140.259 1.00 59.83 ? 79  PRO B N   1 
ATOM   8543  C CA  . PRO C 1 79  ? 72.640  80.786  140.751 1.00 59.75 ? 79  PRO B CA  1 
ATOM   8544  C C   . PRO C 1 79  ? 72.438  81.447  142.119 1.00 59.68 ? 79  PRO B C   1 
ATOM   8545  O O   . PRO C 1 79  ? 73.350  81.449  142.952 1.00 59.68 ? 79  PRO B O   1 
ATOM   8546  C CB  . PRO C 1 79  ? 72.439  79.262  140.857 1.00 59.74 ? 79  PRO B CB  1 
ATOM   8547  C CG  . PRO C 1 79  ? 73.725  78.624  140.378 1.00 59.86 ? 79  PRO B CG  1 
ATOM   8548  C CD  . PRO C 1 79  ? 74.498  79.672  139.644 1.00 59.81 ? 79  PRO B CD  1 
ATOM   8549  N N   . GLY C 1 80  ? 71.250  82.001  142.343 1.00 59.54 ? 80  GLY B N   1 
ATOM   8550  C CA  . GLY C 1 80  ? 70.983  82.776  143.548 1.00 59.32 ? 80  GLY B CA  1 
ATOM   8551  C C   . GLY C 1 80  ? 70.300  82.051  144.693 1.00 59.16 ? 80  GLY B C   1 
ATOM   8552  O O   . GLY C 1 80  ? 69.688  82.699  145.543 1.00 59.20 ? 80  GLY B O   1 
ATOM   8553  N N   . HIS C 1 81  ? 70.408  80.721  144.741 1.00 58.97 ? 81  HIS B N   1 
ATOM   8554  C CA  . HIS C 1 81  ? 69.738  79.953  145.803 1.00 58.78 ? 81  HIS B CA  1 
ATOM   8555  C C   . HIS C 1 81  ? 70.652  79.096  146.692 1.00 58.42 ? 81  HIS B C   1 
ATOM   8556  O O   . HIS C 1 81  ? 71.724  78.655  146.262 1.00 58.55 ? 81  HIS B O   1 
ATOM   8557  C CB  . HIS C 1 81  ? 68.591  79.109  145.245 1.00 58.77 ? 81  HIS B CB  1 
ATOM   8558  C CG  . HIS C 1 81  ? 67.497  78.871  146.239 1.00 59.44 ? 81  HIS B CG  1 
ATOM   8559  N ND1 . HIS C 1 81  ? 66.361  79.650  146.296 1.00 59.79 ? 81  HIS B ND1 1 
ATOM   8560  C CD2 . HIS C 1 81  ? 67.380  77.961  147.237 1.00 59.76 ? 81  HIS B CD2 1 
ATOM   8561  C CE1 . HIS C 1 81  ? 65.585  79.222  147.276 1.00 59.77 ? 81  HIS B CE1 1 
ATOM   8562  N NE2 . HIS C 1 81  ? 66.181  78.199  147.864 1.00 59.68 ? 81  HIS B NE2 1 
ATOM   8563  N N   . VAL C 1 82  ? 70.206  78.873  147.931 1.00 57.86 ? 82  VAL B N   1 
ATOM   8564  C CA  . VAL C 1 82  ? 70.956  78.109  148.941 1.00 57.41 ? 82  VAL B CA  1 
ATOM   8565  C C   . VAL C 1 82  ? 70.670  76.607  148.951 1.00 56.94 ? 82  VAL B C   1 
ATOM   8566  O O   . VAL C 1 82  ? 71.232  75.873  149.772 1.00 56.97 ? 82  VAL B O   1 
ATOM   8567  C CB  . VAL C 1 82  ? 70.737  78.649  150.376 1.00 57.47 ? 82  VAL B CB  1 
ATOM   8568  C CG1 . VAL C 1 82  ? 71.696  79.804  150.670 1.00 57.52 ? 82  VAL B CG1 1 
ATOM   8569  C CG2 . VAL C 1 82  ? 69.271  79.033  150.599 1.00 57.51 ? 82  VAL B CG2 1 
ATOM   8570  N N   . ASP C 1 83  ? 69.790  76.154  148.061 1.00 56.19 ? 83  ASP B N   1 
ATOM   8571  C CA  . ASP C 1 83  ? 69.644  74.728  147.806 1.00 55.36 ? 83  ASP B CA  1 
ATOM   8572  C C   . ASP C 1 83  ? 70.896  74.235  147.088 1.00 54.81 ? 83  ASP B C   1 
ATOM   8573  O O   . ASP C 1 83  ? 71.328  73.103  147.291 1.00 54.76 ? 83  ASP B O   1 
ATOM   8574  C CB  . ASP C 1 83  ? 68.386  74.436  146.984 1.00 55.40 ? 83  ASP B CB  1 
ATOM   8575  C CG  . ASP C 1 83  ? 67.189  74.046  147.849 1.00 55.36 ? 83  ASP B CG  1 
ATOM   8576  O OD1 . ASP C 1 83  ? 67.259  74.187  149.088 1.00 55.55 ? 83  ASP B OD1 1 
ATOM   8577  O OD2 . ASP C 1 83  ? 66.169  73.593  147.285 1.00 55.04 ? 83  ASP B OD2 1 
ATOM   8578  N N   . PHE C 1 84  ? 71.481  75.106  146.267 1.00 54.13 ? 84  PHE B N   1 
ATOM   8579  C CA  . PHE C 1 84  ? 72.718  74.801  145.549 1.00 53.55 ? 84  PHE B CA  1 
ATOM   8580  C C   . PHE C 1 84  ? 73.905  75.471  146.229 1.00 53.10 ? 84  PHE B C   1 
ATOM   8581  O O   . PHE C 1 84  ? 74.871  75.857  145.569 1.00 53.09 ? 84  PHE B O   1 
ATOM   8582  C CB  . PHE C 1 84  ? 72.628  75.248  144.083 1.00 53.47 ? 84  PHE B CB  1 
ATOM   8583  C CG  . PHE C 1 84  ? 71.306  74.960  143.437 1.00 53.50 ? 84  PHE B CG  1 
ATOM   8584  C CD1 . PHE C 1 84  ? 70.452  76.003  143.086 1.00 53.72 ? 84  PHE B CD1 1 
ATOM   8585  C CD2 . PHE C 1 84  ? 70.906  73.647  143.186 1.00 53.57 ? 84  PHE B CD2 1 
ATOM   8586  C CE1 . PHE C 1 84  ? 69.218  75.745  142.491 1.00 53.70 ? 84  PHE B CE1 1 
ATOM   8587  C CE2 . PHE C 1 84  ? 69.674  73.377  142.593 1.00 53.52 ? 84  PHE B CE2 1 
ATOM   8588  C CZ  . PHE C 1 84  ? 68.828  74.428  142.245 1.00 53.63 ? 84  PHE B CZ  1 
ATOM   8589  N N   . SER C 1 85  ? 73.828  75.590  147.552 1.00 52.53 ? 85  SER B N   1 
ATOM   8590  C CA  . SER C 1 85  ? 74.832  76.297  148.351 1.00 51.92 ? 85  SER B CA  1 
ATOM   8591  C C   . SER C 1 85  ? 76.260  75.873  148.007 1.00 51.47 ? 85  SER B C   1 
ATOM   8592  O O   . SER C 1 85  ? 77.118  76.719  147.735 1.00 51.34 ? 85  SER B O   1 
ATOM   8593  C CB  . SER C 1 85  ? 74.562  76.085  149.842 1.00 51.88 ? 85  SER B CB  1 
ATOM   8594  O OG  . SER C 1 85  ? 74.851  77.257  150.579 1.00 51.94 ? 85  SER B OG  1 
ATOM   8595  N N   . TYR C 1 86  ? 76.493  74.562  148.000 1.00 50.97 ? 86  TYR B N   1 
ATOM   8596  C CA  . TYR C 1 86  ? 77.805  73.992  147.703 1.00 50.58 ? 86  TYR B CA  1 
ATOM   8597  C C   . TYR C 1 86  ? 78.292  74.289  146.282 1.00 50.30 ? 86  TYR B C   1 
ATOM   8598  O O   . TYR C 1 86  ? 79.445  74.674  146.093 1.00 50.29 ? 86  TYR B O   1 
ATOM   8599  C CB  . TYR C 1 86  ? 77.806  72.483  147.960 1.00 50.57 ? 86  TYR B CB  1 
ATOM   8600  C CG  . TYR C 1 86  ? 79.088  71.798  147.546 1.00 50.61 ? 86  TYR B CG  1 
ATOM   8601  C CD1 . TYR C 1 86  ? 80.258  71.960  148.286 1.00 50.81 ? 86  TYR B CD1 1 
ATOM   8602  C CD2 . TYR C 1 86  ? 79.133  70.996  146.411 1.00 50.69 ? 86  TYR B CD2 1 
ATOM   8603  C CE1 . TYR C 1 86  ? 81.437  71.340  147.905 1.00 50.76 ? 86  TYR B CE1 1 
ATOM   8604  C CE2 . TYR C 1 86  ? 80.308  70.368  146.024 1.00 50.67 ? 86  TYR B CE2 1 
ATOM   8605  C CZ  . TYR C 1 86  ? 81.455  70.545  146.774 1.00 50.62 ? 86  TYR B CZ  1 
ATOM   8606  O OH  . TYR C 1 86  ? 82.621  69.925  146.393 1.00 50.56 ? 86  TYR B OH  1 
ATOM   8607  N N   . GLU C 1 87  ? 77.419  74.098  145.294 1.00 49.86 ? 87  GLU B N   1 
ATOM   8608  C CA  . GLU C 1 87  ? 77.740  74.405  143.899 1.00 49.46 ? 87  GLU B CA  1 
ATOM   8609  C C   . GLU C 1 87  ? 78.173  75.856  143.754 1.00 49.05 ? 87  GLU B C   1 
ATOM   8610  O O   . GLU C 1 87  ? 79.123  76.160  143.033 1.00 49.10 ? 87  GLU B O   1 
ATOM   8611  C CB  . GLU C 1 87  ? 76.540  74.132  142.988 1.00 49.42 ? 87  GLU B CB  1 
ATOM   8612  C CG  . GLU C 1 87  ? 76.228  72.653  142.800 1.00 49.90 ? 87  GLU B CG  1 
ATOM   8613  C CD  . GLU C 1 87  ? 74.961  72.414  141.985 1.00 49.86 ? 87  GLU B CD  1 
ATOM   8614  O OE1 . GLU C 1 87  ? 74.792  73.057  140.919 1.00 49.72 ? 87  GLU B OE1 1 
ATOM   8615  O OE2 . GLU C 1 87  ? 74.137  71.567  142.415 1.00 50.61 ? 87  GLU B OE2 1 
ATOM   8616  N N   . VAL C 1 88  ? 77.472  76.741  144.456 1.00 48.57 ? 88  VAL B N   1 
ATOM   8617  C CA  . VAL C 1 88  ? 77.754  78.166  144.420 1.00 48.08 ? 88  VAL B CA  1 
ATOM   8618  C C   . VAL C 1 88  ? 79.144  78.445  144.977 1.00 47.89 ? 88  VAL B C   1 
ATOM   8619  O O   . VAL C 1 88  ? 79.939  79.136  144.340 1.00 47.91 ? 88  VAL B O   1 
ATOM   8620  C CB  . VAL C 1 88  ? 76.678  78.972  145.180 1.00 48.04 ? 88  VAL B CB  1 
ATOM   8621  C CG1 . VAL C 1 88  ? 77.097  80.422  145.342 1.00 47.89 ? 88  VAL B CG1 1 
ATOM   8622  C CG2 . VAL C 1 88  ? 75.347  78.888  144.452 1.00 48.12 ? 88  VAL B CG2 1 
ATOM   8623  N N   . SER C 1 89  ? 79.438  77.883  146.149 1.00 47.63 ? 89  SER B N   1 
ATOM   8624  C CA  . SER C 1 89  ? 80.718  78.110  146.821 1.00 47.39 ? 89  SER B CA  1 
ATOM   8625  C C   . SER C 1 89  ? 81.913  77.692  145.973 1.00 47.26 ? 89  SER B C   1 
ATOM   8626  O O   . SER C 1 89  ? 82.973  78.305  146.057 1.00 47.34 ? 89  SER B O   1 
ATOM   8627  C CB  . SER C 1 89  ? 80.760  77.402  148.176 1.00 47.31 ? 89  SER B CB  1 
ATOM   8628  O OG  . SER C 1 89  ? 80.639  76.001  148.023 1.00 47.57 ? 89  SER B OG  1 
ATOM   8629  N N   . ARG C 1 90  ? 81.736  76.657  145.159 1.00 47.18 ? 90  ARG B N   1 
ATOM   8630  C CA  . ARG C 1 90  ? 82.796  76.183  144.272 1.00 47.15 ? 90  ARG B CA  1 
ATOM   8631  C C   . ARG C 1 90  ? 83.091  77.177  143.147 1.00 47.40 ? 90  ARG B C   1 
ATOM   8632  O O   . ARG C 1 90  ? 84.248  77.390  142.787 1.00 47.39 ? 90  ARG B O   1 
ATOM   8633  C CB  . ARG C 1 90  ? 82.448  74.803  143.700 1.00 46.88 ? 90  ARG B CB  1 
ATOM   8634  C CG  . ARG C 1 90  ? 82.142  73.727  144.744 1.00 46.53 ? 90  ARG B CG  1 
ATOM   8635  C CD  . ARG C 1 90  ? 83.308  73.467  145.694 1.00 46.03 ? 90  ARG B CD  1 
ATOM   8636  N NE  . ARG C 1 90  ? 83.483  74.541  146.672 1.00 45.30 ? 90  ARG B NE  1 
ATOM   8637  C CZ  . ARG C 1 90  ? 84.620  74.801  147.309 1.00 44.73 ? 90  ARG B CZ  1 
ATOM   8638  N NH1 . ARG C 1 90  ? 85.700  74.064  147.079 1.00 44.97 ? 90  ARG B NH1 1 
ATOM   8639  N NH2 . ARG C 1 90  ? 84.678  75.803  148.173 1.00 44.12 ? 90  ARG B NH2 1 
ATOM   8640  N N   . SER C 1 91  ? 82.036  77.781  142.603 1.00 47.69 ? 91  SER B N   1 
ATOM   8641  C CA  . SER C 1 91  ? 82.155  78.768  141.539 1.00 47.99 ? 91  SER B CA  1 
ATOM   8642  C C   . SER C 1 91  ? 82.784  80.042  142.072 1.00 48.26 ? 91  SER B C   1 
ATOM   8643  O O   . SER C 1 91  ? 83.568  80.695  141.376 1.00 48.45 ? 91  SER B O   1 
ATOM   8644  C CB  . SER C 1 91  ? 80.784  79.077  140.943 1.00 47.98 ? 91  SER B CB  1 
ATOM   8645  O OG  . SER C 1 91  ? 80.178  77.896  140.454 1.00 48.53 ? 91  SER B OG  1 
ATOM   8646  N N   . LEU C 1 92  ? 82.431  80.390  143.308 1.00 48.44 ? 92  LEU B N   1 
ATOM   8647  C CA  . LEU C 1 92  ? 83.028  81.528  143.998 1.00 48.60 ? 92  LEU B CA  1 
ATOM   8648  C C   . LEU C 1 92  ? 84.484  81.262  144.376 1.00 48.72 ? 92  LEU B C   1 
ATOM   8649  O O   . LEU C 1 92  ? 85.290  82.190  144.406 1.00 48.89 ? 92  LEU B O   1 
ATOM   8650  C CB  . LEU C 1 92  ? 82.217  81.899  145.246 1.00 48.58 ? 92  LEU B CB  1 
ATOM   8651  C CG  . LEU C 1 92  ? 80.854  82.579  145.071 1.00 48.49 ? 92  LEU B CG  1 
ATOM   8652  C CD1 . LEU C 1 92  ? 80.077  82.554  146.386 1.00 48.28 ? 92  LEU B CD1 1 
ATOM   8653  C CD2 . LEU C 1 92  ? 80.992  84.008  144.557 1.00 47.91 ? 92  LEU B CD2 1 
ATOM   8654  N N   . ALA C 1 93  ? 84.815  80.000  144.659 1.00 48.97 ? 93  ALA B N   1 
ATOM   8655  C CA  . ALA C 1 93  ? 86.190  79.598  144.983 1.00 49.23 ? 93  ALA B CA  1 
ATOM   8656  C C   . ALA C 1 93  ? 87.117  79.793  143.790 1.00 49.48 ? 93  ALA B C   1 
ATOM   8657  O O   . ALA C 1 93  ? 88.314  80.028  143.961 1.00 49.74 ? 93  ALA B O   1 
ATOM   8658  C CB  . ALA C 1 93  ? 86.237  78.150  145.471 1.00 49.12 ? 93  ALA B CB  1 
ATOM   8659  N N   . ALA C 1 94  ? 86.542  79.709  142.590 1.00 49.60 ? 94  ALA B N   1 
ATOM   8660  C CA  . ALA C 1 94  ? 87.247  79.949  141.333 1.00 49.83 ? 94  ALA B CA  1 
ATOM   8661  C C   . ALA C 1 94  ? 87.368  81.441  140.959 1.00 50.06 ? 94  ALA B C   1 
ATOM   8662  O O   . ALA C 1 94  ? 87.805  81.768  139.854 1.00 50.28 ? 94  ALA B O   1 
ATOM   8663  C CB  . ALA C 1 94  ? 86.554  79.183  140.214 1.00 49.81 ? 94  ALA B CB  1 
ATOM   8664  N N   . CYS C 1 95  ? 86.989  82.331  141.880 1.00 50.17 ? 95  CYS B N   1 
ATOM   8665  C CA  . CYS C 1 95  ? 86.919  83.771  141.619 1.00 50.24 ? 95  CYS B CA  1 
ATOM   8666  C C   . CYS C 1 95  ? 87.696  84.591  142.640 1.00 50.31 ? 95  CYS B C   1 
ATOM   8667  O O   . CYS C 1 95  ? 87.878  84.161  143.781 1.00 50.53 ? 95  CYS B O   1 
ATOM   8668  C CB  . CYS C 1 95  ? 85.466  84.234  141.640 1.00 50.24 ? 95  CYS B CB  1 
ATOM   8669  S SG  . CYS C 1 95  ? 84.463  83.624  140.284 1.00 51.06 ? 95  CYS B SG  1 
ATOM   8670  N N   . GLU C 1 96  ? 88.144  85.776  142.228 1.00 50.18 ? 96  GLU B N   1 
ATOM   8671  C CA  . GLU C 1 96  ? 88.793  86.718  143.144 1.00 50.02 ? 96  GLU B CA  1 
ATOM   8672  C C   . GLU C 1 96  ? 87.792  87.756  143.616 1.00 49.85 ? 96  GLU B C   1 
ATOM   8673  O O   . GLU C 1 96  ? 87.966  88.367  144.672 1.00 49.99 ? 96  GLU B O   1 
ATOM   8674  C CB  . GLU C 1 96  ? 89.980  87.423  142.480 1.00 50.05 ? 96  GLU B CB  1 
ATOM   8675  C CG  . GLU C 1 96  ? 91.256  86.599  142.412 1.00 50.43 ? 96  GLU B CG  1 
ATOM   8676  C CD  . GLU C 1 96  ? 91.136  85.409  141.480 1.00 51.21 ? 96  GLU B CD  1 
ATOM   8677  O OE1 . GLU C 1 96  ? 91.037  85.622  140.245 1.00 50.85 ? 96  GLU B OE1 1 
ATOM   8678  O OE2 . GLU C 1 96  ? 91.130  84.267  141.996 1.00 51.06 ? 96  GLU B OE2 1 
ATOM   8679  N N   . GLY C 1 97  ? 86.749  87.960  142.819 1.00 49.52 ? 97  GLY B N   1 
ATOM   8680  C CA  . GLY C 1 97  ? 85.704  88.903  143.163 1.00 49.35 ? 97  GLY B CA  1 
ATOM   8681  C C   . GLY C 1 97  ? 84.340  88.521  142.630 1.00 49.30 ? 97  GLY B C   1 
ATOM   8682  O O   . GLY C 1 97  ? 84.155  87.445  142.054 1.00 49.11 ? 97  GLY B O   1 
ATOM   8683  N N   . ALA C 1 98  ? 83.384  89.420  142.837 1.00 49.31 ? 98  ALA B N   1 
ATOM   8684  C CA  . ALA C 1 98  ? 82.024  89.255  142.346 1.00 49.37 ? 98  ALA B CA  1 
ATOM   8685  C C   . ALA C 1 98  ? 81.382  90.617  142.161 1.00 49.42 ? 98  ALA B C   1 
ATOM   8686  O O   . ALA C 1 98  ? 81.600  91.528  142.966 1.00 49.56 ? 98  ALA B O   1 
ATOM   8687  C CB  . ALA C 1 98  ? 81.203  88.422  143.314 1.00 49.30 ? 98  ALA B CB  1 
ATOM   8688  N N   . LEU C 1 99  ? 80.599  90.761  141.098 1.00 49.27 ? 99  LEU B N   1 
ATOM   8689  C CA  . LEU C 1 99  ? 79.799  91.959  140.922 1.00 49.16 ? 99  LEU B CA  1 
ATOM   8690  C C   . LEU C 1 99  ? 78.456  91.763  141.598 1.00 49.23 ? 99  LEU B C   1 
ATOM   8691  O O   . LEU C 1 99  ? 77.705  90.849  141.238 1.00 49.34 ? 99  LEU B O   1 
ATOM   8692  C CB  . LEU C 1 99  ? 79.576  92.262  139.443 1.00 49.17 ? 99  LEU B CB  1 
ATOM   8693  C CG  . LEU C 1 99  ? 80.705  92.731  138.526 1.00 48.97 ? 99  LEU B CG  1 
ATOM   8694  C CD1 . LEU C 1 99  ? 80.074  93.229  137.241 1.00 48.78 ? 99  LEU B CD1 1 
ATOM   8695  C CD2 . LEU C 1 99  ? 81.558  93.824  139.142 1.00 48.79 ? 99  LEU B CD2 1 
ATOM   8696  N N   . LEU C 1 100 ? 78.155  92.607  142.581 1.00 49.15 ? 100 LEU B N   1 
ATOM   8697  C CA  . LEU C 1 100 ? 76.818  92.627  143.166 1.00 49.18 ? 100 LEU B CA  1 
ATOM   8698  C C   . LEU C 1 100 ? 75.975  93.630  142.388 1.00 49.31 ? 100 LEU B C   1 
ATOM   8699  O O   . LEU C 1 100 ? 76.191  94.835  142.490 1.00 49.44 ? 100 LEU B O   1 
ATOM   8700  C CB  . LEU C 1 100 ? 76.862  92.980  144.660 1.00 49.11 ? 100 LEU B CB  1 
ATOM   8701  C CG  . LEU C 1 100 ? 75.525  93.099  145.407 1.00 49.03 ? 100 LEU B CG  1 
ATOM   8702  C CD1 . LEU C 1 100 ? 74.863  91.741  145.591 1.00 49.39 ? 100 LEU B CD1 1 
ATOM   8703  C CD2 . LEU C 1 100 ? 75.701  93.786  146.749 1.00 48.92 ? 100 LEU B CD2 1 
ATOM   8704  N N   . VAL C 1 101 ? 75.034  93.130  141.595 1.00 49.43 ? 101 VAL B N   1 
ATOM   8705  C CA  . VAL C 1 101 ? 74.184  93.999  140.781 1.00 49.80 ? 101 VAL B CA  1 
ATOM   8706  C C   . VAL C 1 101 ? 72.846  94.241  141.479 1.00 50.11 ? 101 VAL B C   1 
ATOM   8707  O O   . VAL C 1 101 ? 72.127  93.291  141.810 1.00 50.14 ? 101 VAL B O   1 
ATOM   8708  C CB  . VAL C 1 101 ? 73.942  93.419  139.367 1.00 49.77 ? 101 VAL B CB  1 
ATOM   8709  C CG1 . VAL C 1 101 ? 73.188  94.417  138.496 1.00 49.47 ? 101 VAL B CG1 1 
ATOM   8710  C CG2 . VAL C 1 101 ? 75.259  93.030  138.718 1.00 49.75 ? 101 VAL B CG2 1 
ATOM   8711  N N   . VAL C 1 102 ? 72.521  95.515  141.699 1.00 50.31 ? 102 VAL B N   1 
ATOM   8712  C CA  . VAL C 1 102 ? 71.289  95.890  142.393 1.00 50.57 ? 102 VAL B CA  1 
ATOM   8713  C C   . VAL C 1 102 ? 70.450  96.840  141.539 1.00 50.75 ? 102 VAL B C   1 
ATOM   8714  O O   . VAL C 1 102 ? 70.934  97.894  141.119 1.00 50.82 ? 102 VAL B O   1 
ATOM   8715  C CB  . VAL C 1 102 ? 71.575  96.539  143.779 1.00 50.51 ? 102 VAL B CB  1 
ATOM   8716  C CG1 . VAL C 1 102 ? 70.300  96.644  144.593 1.00 50.37 ? 102 VAL B CG1 1 
ATOM   8717  C CG2 . VAL C 1 102 ? 72.614  95.736  144.553 1.00 50.74 ? 102 VAL B CG2 1 
ATOM   8718  N N   . ASP C 1 103 ? 69.201  96.451  141.279 1.00 50.93 ? 103 ASP B N   1 
ATOM   8719  C CA  . ASP C 1 103 ? 68.240  97.314  140.599 1.00 51.09 ? 103 ASP B CA  1 
ATOM   8720  C C   . ASP C 1 103 ? 67.967  98.522  141.485 1.00 51.19 ? 103 ASP B C   1 
ATOM   8721  O O   . ASP C 1 103 ? 67.452  98.388  142.596 1.00 51.17 ? 103 ASP B O   1 
ATOM   8722  C CB  . ASP C 1 103 ? 66.936  96.554  140.300 1.00 51.17 ? 103 ASP B CB  1 
ATOM   8723  C CG  . ASP C 1 103 ? 65.967  97.339  139.399 1.00 51.24 ? 103 ASP B CG  1 
ATOM   8724  O OD1 . ASP C 1 103 ? 66.081  98.581  139.281 1.00 50.95 ? 103 ASP B OD1 1 
ATOM   8725  O OD2 . ASP C 1 103 ? 65.068  96.698  138.810 1.00 51.48 ? 103 ASP B OD2 1 
ATOM   8726  N N   . ALA C 1 104 ? 68.327  99.696  140.978 1.00 51.45 ? 104 ALA B N   1 
ATOM   8727  C CA  . ALA C 1 104 ? 68.148  100.956 141.692 1.00 51.71 ? 104 ALA B CA  1 
ATOM   8728  C C   . ALA C 1 104 ? 66.672  101.296 141.916 1.00 51.94 ? 104 ALA B C   1 
ATOM   8729  O O   . ALA C 1 104 ? 66.348  102.246 142.632 1.00 51.90 ? 104 ALA B O   1 
ATOM   8730  C CB  . ALA C 1 104 ? 68.849  102.083 140.945 1.00 51.69 ? 104 ALA B CB  1 
ATOM   8731  N N   . GLY C 1 105 ? 65.787  100.513 141.305 1.00 52.25 ? 105 GLY B N   1 
ATOM   8732  C CA  . GLY C 1 105 ? 64.346  100.705 141.448 1.00 52.73 ? 105 GLY B CA  1 
ATOM   8733  C C   . GLY C 1 105 ? 63.651  99.621  142.252 1.00 52.99 ? 105 GLY B C   1 
ATOM   8734  O O   . GLY C 1 105 ? 62.420  99.552  142.274 1.00 52.95 ? 105 GLY B O   1 
ATOM   8735  N N   . GLN C 1 106 ? 64.442  98.773  142.910 1.00 53.34 ? 106 GLN B N   1 
ATOM   8736  C CA  . GLN C 1 106 ? 63.908  97.665  143.702 1.00 53.75 ? 106 GLN B CA  1 
ATOM   8737  C C   . GLN C 1 106 ? 64.600  97.541  145.059 1.00 54.01 ? 106 GLN B C   1 
ATOM   8738  O O   . GLN C 1 106 ? 63.938  97.432  146.093 1.00 54.02 ? 106 GLN B O   1 
ATOM   8739  C CB  . GLN C 1 106 ? 63.996  96.337  142.927 1.00 53.71 ? 106 GLN B CB  1 
ATOM   8740  C CG  . GLN C 1 106 ? 63.074  96.232  141.699 1.00 53.83 ? 106 GLN B CG  1 
ATOM   8741  C CD  . GLN C 1 106 ? 61.588  96.412  142.031 1.00 54.21 ? 106 GLN B CD  1 
ATOM   8742  O OE1 . GLN C 1 106 ? 61.090  95.896  143.035 1.00 54.25 ? 106 GLN B OE1 1 
ATOM   8743  N NE2 . GLN C 1 106 ? 60.877  97.143  141.178 1.00 53.97 ? 106 GLN B NE2 1 
ATOM   8744  N N   . GLY C 1 107 ? 65.929  97.563  145.049 1.00 54.39 ? 107 GLY B N   1 
ATOM   8745  C CA  . GLY C 1 107 ? 66.710  97.380  146.267 1.00 54.86 ? 107 GLY B CA  1 
ATOM   8746  C C   . GLY C 1 107 ? 67.262  95.972  146.384 1.00 55.25 ? 107 GLY B C   1 
ATOM   8747  O O   . GLY C 1 107 ? 67.301  95.225  145.397 1.00 55.32 ? 107 GLY B O   1 
ATOM   8748  N N   . VAL C 1 108 ? 67.676  95.609  147.597 1.00 55.50 ? 108 VAL B N   1 
ATOM   8749  C CA  . VAL C 1 108 ? 68.354  94.337  147.853 1.00 55.82 ? 108 VAL B CA  1 
ATOM   8750  C C   . VAL C 1 108 ? 67.423  93.320  148.531 1.00 56.02 ? 108 VAL B C   1 
ATOM   8751  O O   . VAL C 1 108 ? 66.569  93.701  149.331 1.00 55.92 ? 108 VAL B O   1 
ATOM   8752  C CB  . VAL C 1 108 ? 69.672  94.563  148.669 1.00 55.82 ? 108 VAL B CB  1 
ATOM   8753  C CG1 . VAL C 1 108 ? 69.381  94.957  150.114 1.00 55.68 ? 108 VAL B CG1 1 
ATOM   8754  C CG2 . VAL C 1 108 ? 70.582  93.343  148.608 1.00 55.98 ? 108 VAL B CG2 1 
ATOM   8755  N N   . GLU C 1 109 ? 67.587  92.038  148.195 1.00 56.42 ? 109 GLU B N   1 
ATOM   8756  C CA  . GLU C 1 109 ? 66.749  90.961  148.759 1.00 56.84 ? 109 GLU B CA  1 
ATOM   8757  C C   . GLU C 1 109 ? 67.518  89.691  149.149 1.00 57.08 ? 109 GLU B C   1 
ATOM   8758  O O   . GLU C 1 109 ? 68.591  89.412  148.610 1.00 57.19 ? 109 GLU B O   1 
ATOM   8759  C CB  . GLU C 1 109 ? 65.551  90.641  147.849 1.00 56.86 ? 109 GLU B CB  1 
ATOM   8760  C CG  . GLU C 1 109 ? 65.827  90.718  146.348 1.00 56.96 ? 109 GLU B CG  1 
ATOM   8761  C CD  . GLU C 1 109 ? 64.618  91.198  145.556 1.00 56.99 ? 109 GLU B CD  1 
ATOM   8762  O OE1 . GLU C 1 109 ? 63.484  90.748  145.848 1.00 56.78 ? 109 GLU B OE1 1 
ATOM   8763  O OE2 . GLU C 1 109 ? 64.806  92.032  144.642 1.00 56.85 ? 109 GLU B OE2 1 
ATOM   8764  N N   . ALA C 1 110 ? 66.930  88.926  150.072 1.00 57.35 ? 110 ALA B N   1 
ATOM   8765  C CA  . ALA C 1 110 ? 67.601  87.850  150.825 1.00 57.67 ? 110 ALA B CA  1 
ATOM   8766  C C   . ALA C 1 110 ? 68.429  86.824  150.043 1.00 57.93 ? 110 ALA B C   1 
ATOM   8767  O O   . ALA C 1 110 ? 69.473  86.375  150.526 1.00 57.92 ? 110 ALA B O   1 
ATOM   8768  C CB  . ALA C 1 110 ? 66.595  87.131  151.725 1.00 57.73 ? 110 ALA B CB  1 
ATOM   8769  N N   . GLN C 1 111 ? 67.959  86.439  148.858 1.00 58.22 ? 111 GLN B N   1 
ATOM   8770  C CA  . GLN C 1 111 ? 68.639  85.402  148.070 1.00 58.44 ? 111 GLN B CA  1 
ATOM   8771  C C   . GLN C 1 111 ? 69.916  85.909  147.390 1.00 58.43 ? 111 GLN B C   1 
ATOM   8772  O O   . GLN C 1 111 ? 70.804  85.118  147.057 1.00 58.52 ? 111 GLN B O   1 
ATOM   8773  C CB  . GLN C 1 111 ? 67.685  84.723  147.069 1.00 58.49 ? 111 GLN B CB  1 
ATOM   8774  C CG  . GLN C 1 111 ? 67.162  85.603  145.931 1.00 58.83 ? 111 GLN B CG  1 
ATOM   8775  C CD  . GLN C 1 111 ? 65.945  86.420  146.326 1.00 59.13 ? 111 GLN B CD  1 
ATOM   8776  O OE1 . GLN C 1 111 ? 66.055  87.417  147.044 1.00 59.33 ? 111 GLN B OE1 1 
ATOM   8777  N NE2 . GLN C 1 111 ? 64.775  86.007  145.849 1.00 58.91 ? 111 GLN B NE2 1 
ATOM   8778  N N   . THR C 1 112 ? 70.005  87.223  147.193 1.00 58.40 ? 112 THR B N   1 
ATOM   8779  C CA  . THR C 1 112 ? 71.232  87.840  146.679 1.00 58.38 ? 112 THR B CA  1 
ATOM   8780  C C   . THR C 1 112 ? 72.208  88.121  147.826 1.00 58.31 ? 112 THR B C   1 
ATOM   8781  O O   . THR C 1 112 ? 73.353  88.520  147.598 1.00 58.41 ? 112 THR B O   1 
ATOM   8782  C CB  . THR C 1 112 ? 70.959  89.142  145.868 1.00 58.31 ? 112 THR B CB  1 
ATOM   8783  O OG1 . THR C 1 112 ? 70.638  90.219  146.756 1.00 58.23 ? 112 THR B OG1 1 
ATOM   8784  C CG2 . THR C 1 112 ? 69.819  88.946  144.868 1.00 58.44 ? 112 THR B CG2 1 
ATOM   8785  N N   . LEU C 1 113 ? 71.743  87.895  149.054 1.00 58.19 ? 113 LEU B N   1 
ATOM   8786  C CA  . LEU C 1 113 ? 72.514  88.191  150.256 1.00 58.12 ? 113 LEU B CA  1 
ATOM   8787  C C   . LEU C 1 113 ? 73.327  86.998  150.747 1.00 58.08 ? 113 LEU B C   1 
ATOM   8788  O O   . LEU C 1 113 ? 74.462  87.162  151.192 1.00 58.08 ? 113 LEU B O   1 
ATOM   8789  C CB  . LEU C 1 113 ? 71.590  88.688  151.374 1.00 58.16 ? 113 LEU B CB  1 
ATOM   8790  C CG  . LEU C 1 113 ? 70.873  90.028  151.189 1.00 58.32 ? 113 LEU B CG  1 
ATOM   8791  C CD1 . LEU C 1 113 ? 69.827  90.233  152.277 1.00 58.32 ? 113 LEU B CD1 1 
ATOM   8792  C CD2 . LEU C 1 113 ? 71.868  91.178  151.194 1.00 58.63 ? 113 LEU B CD2 1 
ATOM   8793  N N   . ALA C 1 114 ? 72.735  85.805  150.679 1.00 58.03 ? 114 ALA B N   1 
ATOM   8794  C CA  . ALA C 1 114 ? 73.398  84.569  151.099 1.00 57.92 ? 114 ALA B CA  1 
ATOM   8795  C C   . ALA C 1 114 ? 74.724  84.397  150.375 1.00 57.92 ? 114 ALA B C   1 
ATOM   8796  O O   . ALA C 1 114 ? 75.769  84.174  150.998 1.00 57.82 ? 114 ALA B O   1 
ATOM   8797  C CB  . ALA C 1 114 ? 72.506  83.383  150.827 1.00 57.92 ? 114 ALA B CB  1 
ATOM   8798  N N   . ASN C 1 115 ? 74.661  84.514  149.051 1.00 57.91 ? 115 ASN B N   1 
ATOM   8799  C CA  . ASN C 1 115 ? 75.831  84.431  148.194 1.00 57.85 ? 115 ASN B CA  1 
ATOM   8800  C C   . ASN C 1 115 ? 76.780  85.585  148.456 1.00 57.79 ? 115 ASN B C   1 
ATOM   8801  O O   . ASN C 1 115 ? 77.991  85.447  148.301 1.00 57.88 ? 115 ASN B O   1 
ATOM   8802  C CB  . ASN C 1 115 ? 75.410  84.418  146.725 1.00 57.77 ? 115 ASN B CB  1 
ATOM   8803  C CG  . ASN C 1 115 ? 74.485  83.265  146.394 1.00 57.82 ? 115 ASN B CG  1 
ATOM   8804  O OD1 . ASN C 1 115 ? 73.597  82.915  147.174 1.00 58.14 ? 115 ASN B OD1 1 
ATOM   8805  N ND2 . ASN C 1 115 ? 74.682  82.673  145.226 1.00 58.11 ? 115 ASN B ND2 1 
ATOM   8806  N N   . CYS C 1 116 ? 76.218  86.718  148.866 1.00 57.81 ? 116 CYS B N   1 
ATOM   8807  C CA  . CYS C 1 116 ? 77.000  87.908  149.154 1.00 57.63 ? 116 CYS B CA  1 
ATOM   8808  C C   . CYS C 1 116 ? 77.830  87.736  150.424 1.00 57.40 ? 116 CYS B C   1 
ATOM   8809  O O   . CYS C 1 116 ? 78.971  88.182  150.479 1.00 57.33 ? 116 CYS B O   1 
ATOM   8810  C CB  . CYS C 1 116 ? 76.082  89.118  149.280 1.00 57.73 ? 116 CYS B CB  1 
ATOM   8811  S SG  . CYS C 1 116 ? 76.772  90.631  148.618 1.00 58.38 ? 116 CYS B SG  1 
ATOM   8812  N N   . TYR C 1 117 ? 77.262  87.078  151.434 1.00 57.24 ? 117 TYR B N   1 
ATOM   8813  C CA  . TYR C 1 117 ? 77.978  86.856  152.692 1.00 57.17 ? 117 TYR B CA  1 
ATOM   8814  C C   . TYR C 1 117 ? 79.042  85.768  152.570 1.00 56.87 ? 117 TYR B C   1 
ATOM   8815  O O   . TYR C 1 117 ? 80.079  85.840  153.226 1.00 56.79 ? 117 TYR B O   1 
ATOM   8816  C CB  . TYR C 1 117 ? 77.027  86.535  153.858 1.00 57.43 ? 117 TYR B CB  1 
ATOM   8817  C CG  . TYR C 1 117 ? 75.868  87.502  154.060 1.00 57.94 ? 117 TYR B CG  1 
ATOM   8818  C CD1 . TYR C 1 117 ? 74.658  87.059  154.607 1.00 58.36 ? 117 TYR B CD1 1 
ATOM   8819  C CD2 . TYR C 1 117 ? 75.972  88.854  153.703 1.00 58.38 ? 117 TYR B CD2 1 
ATOM   8820  C CE1 . TYR C 1 117 ? 73.585  87.935  154.799 1.00 58.25 ? 117 TYR B CE1 1 
ATOM   8821  C CE2 . TYR C 1 117 ? 74.904  89.737  153.885 1.00 58.16 ? 117 TYR B CE2 1 
ATOM   8822  C CZ  . TYR C 1 117 ? 73.717  89.270  154.432 1.00 58.19 ? 117 TYR B CZ  1 
ATOM   8823  O OH  . TYR C 1 117 ? 72.664  90.136  154.611 1.00 58.08 ? 117 TYR B OH  1 
ATOM   8824  N N   . THR C 1 118 ? 78.785  84.761  151.738 1.00 56.63 ? 118 THR B N   1 
ATOM   8825  C CA  . THR C 1 118 ? 79.754  83.678  151.543 1.00 56.39 ? 118 THR B CA  1 
ATOM   8826  C C   . THR C 1 118 ? 80.920  84.143  150.685 1.00 56.21 ? 118 THR B C   1 
ATOM   8827  O O   . THR C 1 118 ? 82.046  83.672  150.851 1.00 56.10 ? 118 THR B O   1 
ATOM   8828  C CB  . THR C 1 118 ? 79.122  82.412  150.940 1.00 56.27 ? 118 THR B CB  1 
ATOM   8829  O OG1 . THR C 1 118 ? 78.315  82.772  149.820 1.00 56.44 ? 118 THR B OG1 1 
ATOM   8830  C CG2 . THR C 1 118 ? 78.258  81.691  151.976 1.00 56.36 ? 118 THR B CG2 1 
ATOM   8831  N N   . ALA C 1 119 ? 80.644  85.077  149.777 1.00 56.07 ? 119 ALA B N   1 
ATOM   8832  C CA  . ALA C 1 119 ? 81.691  85.721  148.996 1.00 56.00 ? 119 ALA B CA  1 
ATOM   8833  C C   . ALA C 1 119 ? 82.573  86.572  149.904 1.00 56.18 ? 119 ALA B C   1 
ATOM   8834  O O   . ALA C 1 119 ? 83.778  86.657  149.694 1.00 56.27 ? 119 ALA B O   1 
ATOM   8835  C CB  . ALA C 1 119 ? 81.098  86.567  147.887 1.00 55.73 ? 119 ALA B CB  1 
ATOM   8836  N N   . MET C 1 120 ? 81.977  87.192  150.917 1.00 56.24 ? 120 MET B N   1 
ATOM   8837  C CA  . MET C 1 120 ? 82.734  88.065  151.808 1.00 56.53 ? 120 MET B CA  1 
ATOM   8838  C C   . MET C 1 120 ? 83.537  87.301  152.869 1.00 56.47 ? 120 MET B C   1 
ATOM   8839  O O   . MET C 1 120 ? 84.631  87.731  153.241 1.00 56.47 ? 120 MET B O   1 
ATOM   8840  C CB  . MET C 1 120 ? 81.828  89.128  152.436 1.00 56.51 ? 120 MET B CB  1 
ATOM   8841  C CG  . MET C 1 120 ? 81.171  90.054  151.407 1.00 56.72 ? 120 MET B CG  1 
ATOM   8842  S SD  . MET C 1 120 ? 80.235  91.456  152.071 1.00 57.13 ? 120 MET B SD  1 
ATOM   8843  C CE  . MET C 1 120 ? 79.143  90.668  153.260 1.00 56.96 ? 120 MET B CE  1 
ATOM   8844  N N   . GLU C 1 121 ? 83.001  86.172  153.339 1.00 56.43 ? 121 GLU B N   1 
ATOM   8845  C CA  . GLU C 1 121 ? 83.726  85.272  154.249 1.00 56.39 ? 121 GLU B CA  1 
ATOM   8846  C C   . GLU C 1 121 ? 84.973  84.722  153.569 1.00 56.11 ? 121 GLU B C   1 
ATOM   8847  O O   . GLU C 1 121 ? 86.052  84.707  154.151 1.00 56.12 ? 121 GLU B O   1 
ATOM   8848  C CB  . GLU C 1 121 ? 82.833  84.121  154.717 1.00 56.38 ? 121 GLU B CB  1 
ATOM   8849  C CG  . GLU C 1 121 ? 81.838  84.495  155.806 1.00 56.74 ? 121 GLU B CG  1 
ATOM   8850  C CD  . GLU C 1 121 ? 80.842  83.383  156.101 1.00 56.83 ? 121 GLU B CD  1 
ATOM   8851  O OE1 . GLU C 1 121 ? 80.384  82.715  155.141 1.00 56.85 ? 121 GLU B OE1 1 
ATOM   8852  O OE2 . GLU C 1 121 ? 80.513  83.187  157.295 1.00 57.33 ? 121 GLU B OE2 1 
ATOM   8853  N N   . MET C 1 122 ? 84.808  84.262  152.332 1.00 56.05 ? 122 MET B N   1 
ATOM   8854  C CA  . MET C 1 122 ? 85.934  84.003  151.446 1.00 55.81 ? 122 MET B CA  1 
ATOM   8855  C C   . MET C 1 122 ? 86.469  85.380  151.068 1.00 55.82 ? 122 MET B C   1 
ATOM   8856  O O   . MET C 1 122 ? 85.716  86.350  151.073 1.00 55.98 ? 122 MET B O   1 
ATOM   8857  C CB  . MET C 1 122 ? 85.468  83.234  150.205 1.00 55.76 ? 122 MET B CB  1 
ATOM   8858  C CG  . MET C 1 122 ? 84.703  81.940  150.520 1.00 55.66 ? 122 MET B CG  1 
ATOM   8859  S SD  . MET C 1 122 ? 83.817  81.184  149.128 1.00 55.44 ? 122 MET B SD  1 
ATOM   8860  C CE  . MET C 1 122 ? 85.096  80.144  148.435 1.00 54.66 ? 122 MET B CE  1 
ATOM   8861  N N   . ASP C 1 123 ? 87.760  85.491  150.772 1.00 55.62 ? 123 ASP B N   1 
ATOM   8862  C CA  . ASP C 1 123 ? 88.321  86.797  150.405 1.00 55.43 ? 123 ASP B CA  1 
ATOM   8863  C C   . ASP C 1 123 ? 88.025  87.188  148.950 1.00 55.12 ? 123 ASP B C   1 
ATOM   8864  O O   . ASP C 1 123 ? 88.902  87.130  148.082 1.00 55.31 ? 123 ASP B O   1 
ATOM   8865  C CB  . ASP C 1 123 ? 89.823  86.867  150.705 1.00 55.42 ? 123 ASP B CB  1 
ATOM   8866  C CG  . ASP C 1 123 ? 90.127  87.674  151.944 1.00 55.99 ? 123 ASP B CG  1 
ATOM   8867  O OD1 . ASP C 1 123 ? 89.822  88.889  151.965 1.00 56.70 ? 123 ASP B OD1 1 
ATOM   8868  O OD2 . ASP C 1 123 ? 90.685  87.097  152.900 1.00 57.27 ? 123 ASP B OD2 1 
ATOM   8869  N N   . LEU C 1 124 ? 86.780  87.576  148.686 1.00 54.60 ? 124 LEU B N   1 
ATOM   8870  C CA  . LEU C 1 124 ? 86.400  88.042  147.354 1.00 54.07 ? 124 LEU B CA  1 
ATOM   8871  C C   . LEU C 1 124 ? 86.052  89.526  147.378 1.00 53.74 ? 124 LEU B C   1 
ATOM   8872  O O   . LEU C 1 124 ? 85.315  89.979  148.261 1.00 53.87 ? 124 LEU B O   1 
ATOM   8873  C CB  . LEU C 1 124 ? 85.221  87.238  146.772 1.00 53.98 ? 124 LEU B CB  1 
ATOM   8874  C CG  . LEU C 1 124 ? 85.183  85.717  146.546 1.00 53.68 ? 124 LEU B CG  1 
ATOM   8875  C CD1 . LEU C 1 124 ? 84.391  85.448  145.283 1.00 53.35 ? 124 LEU B CD1 1 
ATOM   8876  C CD2 . LEU C 1 124 ? 86.549  85.051  146.442 1.00 53.73 ? 124 LEU B CD2 1 
ATOM   8877  N N   . GLU C 1 125 ? 86.588  90.277  146.417 1.00 53.08 ? 125 GLU B N   1 
ATOM   8878  C CA  . GLU C 1 125 ? 86.209  91.671  146.235 1.00 52.59 ? 125 GLU B CA  1 
ATOM   8879  C C   . GLU C 1 125 ? 84.786  91.759  145.697 1.00 52.45 ? 125 GLU B C   1 
ATOM   8880  O O   . GLU C 1 125 ? 84.520  91.397  144.549 1.00 52.43 ? 125 GLU B O   1 
ATOM   8881  C CB  . GLU C 1 125 ? 87.175  92.387  145.288 1.00 52.55 ? 125 GLU B CB  1 
ATOM   8882  C CG  . GLU C 1 125 ? 88.248  93.205  145.979 1.00 52.34 ? 125 GLU B CG  1 
ATOM   8883  C CD  . GLU C 1 125 ? 87.689  94.366  146.789 1.00 52.15 ? 125 GLU B CD  1 
ATOM   8884  O OE1 . GLU C 1 125 ? 86.916  95.181  146.237 1.00 50.91 ? 125 GLU B OE1 1 
ATOM   8885  O OE2 . GLU C 1 125 ? 88.035  94.463  147.987 1.00 52.82 ? 125 GLU B OE2 1 
ATOM   8886  N N   . VAL C 1 126 ? 83.869  92.222  146.540 1.00 52.19 ? 126 VAL B N   1 
ATOM   8887  C CA  . VAL C 1 126 ? 82.493  92.437  146.113 1.00 51.91 ? 126 VAL B CA  1 
ATOM   8888  C C   . VAL C 1 126 ? 82.353  93.865  145.590 1.00 51.81 ? 126 VAL B C   1 
ATOM   8889  O O   . VAL C 1 126 ? 82.441  94.831  146.354 1.00 51.98 ? 126 VAL B O   1 
ATOM   8890  C CB  . VAL C 1 126 ? 81.477  92.149  147.244 1.00 51.90 ? 126 VAL B CB  1 
ATOM   8891  C CG1 . VAL C 1 126 ? 80.050  92.464  146.787 1.00 51.69 ? 126 VAL B CG1 1 
ATOM   8892  C CG2 . VAL C 1 126 ? 81.583  90.695  147.692 1.00 51.72 ? 126 VAL B CG2 1 
ATOM   8893  N N   . VAL C 1 127 ? 82.160  93.979  144.278 1.00 51.45 ? 127 VAL B N   1 
ATOM   8894  C CA  . VAL C 1 127 ? 81.989  95.265  143.614 1.00 51.11 ? 127 VAL B CA  1 
ATOM   8895  C C   . VAL C 1 127 ? 80.498  95.534  143.411 1.00 50.88 ? 127 VAL B C   1 
ATOM   8896  O O   . VAL C 1 127 ? 79.841  94.838  142.625 1.00 50.99 ? 127 VAL B O   1 
ATOM   8897  C CB  . VAL C 1 127 ? 82.705  95.290  142.250 1.00 51.09 ? 127 VAL B CB  1 
ATOM   8898  C CG1 . VAL C 1 127 ? 82.532  96.648  141.573 1.00 51.31 ? 127 VAL B CG1 1 
ATOM   8899  C CG2 . VAL C 1 127 ? 84.179  94.953  142.412 1.00 51.44 ? 127 VAL B CG2 1 
ATOM   8900  N N   . PRO C 1 128 ? 79.954  96.535  144.129 1.00 50.52 ? 128 PRO B N   1 
ATOM   8901  C CA  . PRO C 1 128 ? 78.537  96.873  143.982 1.00 50.25 ? 128 PRO B CA  1 
ATOM   8902  C C   . PRO C 1 128 ? 78.267  97.606  142.675 1.00 50.01 ? 128 PRO B C   1 
ATOM   8903  O O   . PRO C 1 128 ? 79.089  98.407  142.234 1.00 50.13 ? 128 PRO B O   1 
ATOM   8904  C CB  . PRO C 1 128 ? 78.266  97.787  145.179 1.00 50.22 ? 128 PRO B CB  1 
ATOM   8905  C CG  . PRO C 1 128 ? 79.584  98.389  145.504 1.00 50.22 ? 128 PRO B CG  1 
ATOM   8906  C CD  . PRO C 1 128 ? 80.632  97.392  145.119 1.00 50.38 ? 128 PRO B CD  1 
ATOM   8907  N N   . VAL C 1 129 ? 77.126  97.317  142.060 1.00 49.81 ? 129 VAL B N   1 
ATOM   8908  C CA  . VAL C 1 129 ? 76.726  97.951  140.806 1.00 49.57 ? 129 VAL B CA  1 
ATOM   8909  C C   . VAL C 1 129 ? 75.237  98.304  140.862 1.00 49.63 ? 129 VAL B C   1 
ATOM   8910  O O   . VAL C 1 129 ? 74.391  97.439  141.112 1.00 49.45 ? 129 VAL B O   1 
ATOM   8911  C CB  . VAL C 1 129 ? 77.019  97.039  139.578 1.00 49.51 ? 129 VAL B CB  1 
ATOM   8912  C CG1 . VAL C 1 129 ? 76.549  97.695  138.292 1.00 49.56 ? 129 VAL B CG1 1 
ATOM   8913  C CG2 . VAL C 1 129 ? 78.501  96.709  139.476 1.00 49.04 ? 129 VAL B CG2 1 
ATOM   8914  N N   . LEU C 1 130 ? 74.929  99.582  140.639 1.00 49.80 ? 130 LEU B N   1 
ATOM   8915  C CA  . LEU C 1 130 ? 73.545  100.063 140.604 1.00 49.96 ? 130 LEU B CA  1 
ATOM   8916  C C   . LEU C 1 130 ? 73.000  100.035 139.180 1.00 50.05 ? 130 LEU B C   1 
ATOM   8917  O O   . LEU C 1 130 ? 73.417  100.821 138.328 1.00 50.05 ? 130 LEU B O   1 
ATOM   8918  C CB  . LEU C 1 130 ? 73.450  101.483 141.168 1.00 49.95 ? 130 LEU B CB  1 
ATOM   8919  C CG  . LEU C 1 130 ? 73.842  101.723 142.625 1.00 50.12 ? 130 LEU B CG  1 
ATOM   8920  C CD1 . LEU C 1 130 ? 74.032  103.209 142.872 1.00 50.43 ? 130 LEU B CD1 1 
ATOM   8921  C CD2 . LEU C 1 130 ? 72.808  101.140 143.583 1.00 50.24 ? 130 LEU B CD2 1 
ATOM   8922  N N   . ASN C 1 131 ? 72.066  99.126  138.926 1.00 50.24 ? 131 ASN B N   1 
ATOM   8923  C CA  . ASN C 1 131 ? 71.532  98.950  137.584 1.00 50.49 ? 131 ASN B CA  1 
ATOM   8924  C C   . ASN C 1 131 ? 70.189  99.631  137.400 1.00 50.69 ? 131 ASN B C   1 
ATOM   8925  O O   . ASN C 1 131 ? 69.426  99.788  138.354 1.00 50.70 ? 131 ASN B O   1 
ATOM   8926  C CB  . ASN C 1 131 ? 71.419  97.463  137.227 1.00 50.46 ? 131 ASN B CB  1 
ATOM   8927  C CG  . ASN C 1 131 ? 71.565  97.198  135.727 1.00 50.56 ? 131 ASN B CG  1 
ATOM   8928  O OD1 . ASN C 1 131 ? 72.074  96.151  135.325 1.00 51.25 ? 131 ASN B OD1 1 
ATOM   8929  N ND2 . ASN C 1 131 ? 71.128  98.144  134.899 1.00 49.76 ? 131 ASN B ND2 1 
ATOM   8930  N N   . LYS C 1 132 ? 69.927  100.030 136.155 1.00 50.94 ? 132 LYS B N   1 
ATOM   8931  C CA  . LYS C 1 132 ? 68.643  100.569 135.705 1.00 51.28 ? 132 LYS B CA  1 
ATOM   8932  C C   . LYS C 1 132 ? 68.330  101.928 136.333 1.00 51.26 ? 132 LYS B C   1 
ATOM   8933  O O   . LYS C 1 132 ? 67.218  102.164 136.821 1.00 51.41 ? 132 LYS B O   1 
ATOM   8934  C CB  . LYS C 1 132 ? 67.504  99.551  135.906 1.00 51.18 ? 132 LYS B CB  1 
ATOM   8935  C CG  . LYS C 1 132 ? 67.765  98.187  135.256 1.00 51.58 ? 132 LYS B CG  1 
ATOM   8936  C CD  . LYS C 1 132 ? 66.537  97.280  135.291 1.00 51.91 ? 132 LYS B CD  1 
ATOM   8937  C CE  . LYS C 1 132 ? 66.918  95.800  135.192 1.00 53.01 ? 132 LYS B CE  1 
ATOM   8938  N NZ  . LYS C 1 132 ? 67.582  95.445  133.903 1.00 53.31 ? 132 LYS B NZ  1 
ATOM   8939  N N   . ILE C 1 133 ? 69.324  102.815 136.299 1.00 51.28 ? 133 ILE B N   1 
ATOM   8940  C CA  . ILE C 1 133 ? 69.178  104.192 136.782 1.00 51.35 ? 133 ILE B CA  1 
ATOM   8941  C C   . ILE C 1 133 ? 68.287  105.021 135.856 1.00 51.45 ? 133 ILE B C   1 
ATOM   8942  O O   . ILE C 1 133 ? 67.934  106.158 136.170 1.00 51.38 ? 133 ILE B O   1 
ATOM   8943  C CB  . ILE C 1 133 ? 70.560  104.892 137.002 1.00 51.36 ? 133 ILE B CB  1 
ATOM   8944  C CG1 . ILE C 1 133 ? 71.393  104.937 135.713 1.00 51.26 ? 133 ILE B CG1 1 
ATOM   8945  C CG2 . ILE C 1 133 ? 71.338  104.209 138.118 1.00 51.25 ? 133 ILE B CG2 1 
ATOM   8946  C CD1 . ILE C 1 133 ? 71.393  106.288 135.008 1.00 51.24 ? 133 ILE B CD1 1 
ATOM   8947  N N   . ASP C 1 134 ? 67.931  104.427 134.720 1.00 51.71 ? 134 ASP B N   1 
ATOM   8948  C CA  . ASP C 1 134 ? 67.085  105.059 133.714 1.00 51.96 ? 134 ASP B CA  1 
ATOM   8949  C C   . ASP C 1 134 ? 65.599  105.004 134.061 1.00 52.25 ? 134 ASP B C   1 
ATOM   8950  O O   . ASP C 1 134 ? 64.862  105.955 133.788 1.00 52.18 ? 134 ASP B O   1 
ATOM   8951  C CB  . ASP C 1 134 ? 67.325  104.415 132.343 1.00 51.84 ? 134 ASP B CB  1 
ATOM   8952  C CG  . ASP C 1 134 ? 68.538  104.983 131.634 1.00 51.50 ? 134 ASP B CG  1 
ATOM   8953  O OD1 . ASP C 1 134 ? 69.355  105.661 132.287 1.00 51.75 ? 134 ASP B OD1 1 
ATOM   8954  O OD2 . ASP C 1 134 ? 68.681  104.751 130.419 1.00 50.98 ? 134 ASP B OD2 1 
ATOM   8955  N N   . LEU C 1 135 ? 65.176  103.891 134.663 1.00 52.64 ? 135 LEU B N   1 
ATOM   8956  C CA  . LEU C 1 135 ? 63.765  103.629 134.977 1.00 53.03 ? 135 LEU B CA  1 
ATOM   8957  C C   . LEU C 1 135 ? 63.116  104.748 135.800 1.00 53.26 ? 135 LEU B C   1 
ATOM   8958  O O   . LEU C 1 135 ? 63.816  105.492 136.489 1.00 53.27 ? 135 LEU B O   1 
ATOM   8959  C CB  . LEU C 1 135 ? 63.616  102.286 135.706 1.00 53.08 ? 135 LEU B CB  1 
ATOM   8960  C CG  . LEU C 1 135 ? 64.107  100.988 135.053 1.00 53.18 ? 135 LEU B CG  1 
ATOM   8961  C CD1 . LEU C 1 135 ? 63.784  99.813  135.969 1.00 53.49 ? 135 LEU B CD1 1 
ATOM   8962  C CD2 . LEU C 1 135 ? 63.508  100.768 133.668 1.00 52.89 ? 135 LEU B CD2 1 
ATOM   8963  N N   . PRO C 1 136 ? 61.776  104.881 135.718 1.00 53.53 ? 136 PRO B N   1 
ATOM   8964  C CA  . PRO C 1 136 ? 61.090  105.935 136.470 1.00 53.75 ? 136 PRO B CA  1 
ATOM   8965  C C   . PRO C 1 136 ? 61.309  105.832 137.982 1.00 53.96 ? 136 PRO B C   1 
ATOM   8966  O O   . PRO C 1 136 ? 61.642  106.831 138.620 1.00 54.01 ? 136 PRO B O   1 
ATOM   8967  C CB  . PRO C 1 136 ? 59.609  105.720 136.118 1.00 53.73 ? 136 PRO B CB  1 
ATOM   8968  C CG  . PRO C 1 136 ? 59.526  104.322 135.598 1.00 53.67 ? 136 PRO B CG  1 
ATOM   8969  C CD  . PRO C 1 136 ? 60.831  104.080 134.917 1.00 53.56 ? 136 PRO B CD  1 
ATOM   8970  N N   . ALA C 1 137 ? 61.151  104.630 138.532 1.00 54.18 ? 137 ALA B N   1 
ATOM   8971  C CA  . ALA C 1 137 ? 61.256  104.405 139.975 1.00 54.41 ? 137 ALA B CA  1 
ATOM   8972  C C   . ALA C 1 137 ? 62.694  104.147 140.465 1.00 54.63 ? 137 ALA B C   1 
ATOM   8973  O O   . ALA C 1 137 ? 62.899  103.543 141.522 1.00 54.62 ? 137 ALA B O   1 
ATOM   8974  C CB  . ALA C 1 137 ? 60.316  103.272 140.399 1.00 54.31 ? 137 ALA B CB  1 
ATOM   8975  N N   . ALA C 1 138 ? 63.681  104.619 139.703 1.00 54.91 ? 138 ALA B N   1 
ATOM   8976  C CA  . ALA C 1 138 ? 65.091  104.475 140.075 1.00 55.20 ? 138 ALA B CA  1 
ATOM   8977  C C   . ALA C 1 138 ? 65.437  105.394 141.238 1.00 55.46 ? 138 ALA B C   1 
ATOM   8978  O O   . ALA C 1 138 ? 65.135  106.588 141.209 1.00 55.58 ? 138 ALA B O   1 
ATOM   8979  C CB  . ALA C 1 138 ? 65.996  104.755 138.883 1.00 55.09 ? 138 ALA B CB  1 
ATOM   8980  N N   . ASP C 1 139 ? 66.074  104.826 142.256 1.00 55.80 ? 139 ASP B N   1 
ATOM   8981  C CA  . ASP C 1 139 ? 66.362  105.538 143.495 1.00 56.18 ? 139 ASP B CA  1 
ATOM   8982  C C   . ASP C 1 139 ? 67.767  105.172 143.999 1.00 56.38 ? 139 ASP B C   1 
ATOM   8983  O O   . ASP C 1 139 ? 67.902  104.430 144.974 1.00 56.43 ? 139 ASP B O   1 
ATOM   8984  C CB  . ASP C 1 139 ? 65.293  105.182 144.537 1.00 56.23 ? 139 ASP B CB  1 
ATOM   8985  C CG  . ASP C 1 139 ? 65.253  106.152 145.705 1.00 56.43 ? 139 ASP B CG  1 
ATOM   8986  O OD1 . ASP C 1 139 ? 66.212  106.934 145.885 1.00 56.64 ? 139 ASP B OD1 1 
ATOM   8987  O OD2 . ASP C 1 139 ? 64.250  106.122 146.453 1.00 56.58 ? 139 ASP B OD2 1 
ATOM   8988  N N   . PRO C 1 140 ? 68.818  105.714 143.350 1.00 56.57 ? 140 PRO B N   1 
ATOM   8989  C CA  . PRO C 1 140 ? 70.196  105.258 143.567 1.00 56.66 ? 140 PRO B CA  1 
ATOM   8990  C C   . PRO C 1 140 ? 70.709  105.440 144.996 1.00 56.77 ? 140 PRO B C   1 
ATOM   8991  O O   . PRO C 1 140 ? 71.168  104.469 145.596 1.00 56.94 ? 140 PRO B O   1 
ATOM   8992  C CB  . PRO C 1 140 ? 71.016  106.113 142.592 1.00 56.65 ? 140 PRO B CB  1 
ATOM   8993  C CG  . PRO C 1 140 ? 70.034  106.635 141.605 1.00 56.73 ? 140 PRO B CG  1 
ATOM   8994  C CD  . PRO C 1 140 ? 68.765  106.816 142.373 1.00 56.67 ? 140 PRO B CD  1 
ATOM   8995  N N   . GLU C 1 141 ? 70.624  106.660 145.530 1.00 56.77 ? 141 GLU B N   1 
ATOM   8996  C CA  . GLU C 1 141 ? 71.168  106.969 146.860 1.00 56.78 ? 141 GLU B CA  1 
ATOM   8997  C C   . GLU C 1 141 ? 70.544  106.130 147.968 1.00 56.68 ? 141 GLU B C   1 
ATOM   8998  O O   . GLU C 1 141 ? 71.252  105.640 148.848 1.00 56.69 ? 141 GLU B O   1 
ATOM   8999  C CB  . GLU C 1 141 ? 71.025  108.458 147.196 1.00 56.86 ? 141 GLU B CB  1 
ATOM   9000  C CG  . GLU C 1 141 ? 71.973  109.368 146.435 1.00 57.20 ? 141 GLU B CG  1 
ATOM   9001  C CD  . GLU C 1 141 ? 71.435  109.756 145.074 1.00 57.79 ? 141 GLU B CD  1 
ATOM   9002  O OE1 . GLU C 1 141 ? 70.394  110.445 145.028 1.00 58.36 ? 141 GLU B OE1 1 
ATOM   9003  O OE2 . GLU C 1 141 ? 72.049  109.376 144.053 1.00 57.82 ? 141 GLU B OE2 1 
ATOM   9004  N N   . ARG C 1 142 ? 69.223  105.966 147.912 1.00 56.62 ? 142 ARG B N   1 
ATOM   9005  C CA  . ARG C 1 142 ? 68.485  105.193 148.913 1.00 56.56 ? 142 ARG B CA  1 
ATOM   9006  C C   . ARG C 1 142 ? 68.811  103.700 148.816 1.00 56.41 ? 142 ARG B C   1 
ATOM   9007  O O   . ARG C 1 142 ? 68.870  103.008 149.836 1.00 56.50 ? 142 ARG B O   1 
ATOM   9008  C CB  . ARG C 1 142 ? 66.974  105.448 148.787 1.00 56.58 ? 142 ARG B CB  1 
ATOM   9009  C CG  . ARG C 1 142 ? 66.113  104.959 149.963 1.00 56.77 ? 142 ARG B CG  1 
ATOM   9010  C CD  . ARG C 1 142 ? 65.498  103.585 149.688 1.00 57.14 ? 142 ARG B CD  1 
ATOM   9011  N NE  . ARG C 1 142 ? 64.622  103.599 148.513 1.00 57.24 ? 142 ARG B NE  1 
ATOM   9012  C CZ  . ARG C 1 142 ? 64.376  102.548 147.732 1.00 57.08 ? 142 ARG B CZ  1 
ATOM   9013  N NH1 . ARG C 1 142 ? 64.941  101.370 147.976 1.00 56.65 ? 142 ARG B NH1 1 
ATOM   9014  N NH2 . ARG C 1 142 ? 63.564  102.679 146.692 1.00 57.07 ? 142 ARG B NH2 1 
ATOM   9015  N N   . VAL C 1 143 ? 69.032  103.222 147.591 1.00 56.13 ? 143 VAL B N   1 
ATOM   9016  C CA  . VAL C 1 143 ? 69.409  101.827 147.347 1.00 55.90 ? 143 VAL B CA  1 
ATOM   9017  C C   . VAL C 1 143 ? 70.875  101.560 147.732 1.00 55.87 ? 143 VAL B C   1 
ATOM   9018  O O   . VAL C 1 143 ? 71.218  100.453 148.156 1.00 55.73 ? 143 VAL B O   1 
ATOM   9019  C CB  . VAL C 1 143 ? 69.102  101.399 145.880 1.00 55.85 ? 143 VAL B CB  1 
ATOM   9020  C CG1 . VAL C 1 143 ? 69.740  100.063 145.542 1.00 55.63 ? 143 VAL B CG1 1 
ATOM   9021  C CG2 . VAL C 1 143 ? 67.598  101.315 145.655 1.00 55.82 ? 143 VAL B CG2 1 
ATOM   9022  N N   . ALA C 1 144 ? 71.724  102.579 147.599 1.00 55.86 ? 144 ALA B N   1 
ATOM   9023  C CA  . ALA C 1 144 ? 73.130  102.487 148.009 1.00 55.87 ? 144 ALA B CA  1 
ATOM   9024  C C   . ALA C 1 144 ? 73.283  102.428 149.533 1.00 55.91 ? 144 ALA B C   1 
ATOM   9025  O O   . ALA C 1 144 ? 74.189  101.765 150.049 1.00 55.81 ? 144 ALA B O   1 
ATOM   9026  C CB  . ALA C 1 144 ? 73.928  103.645 147.438 1.00 55.87 ? 144 ALA B CB  1 
ATOM   9027  N N   . GLU C 1 145 ? 72.396  103.129 150.240 1.00 55.96 ? 145 GLU B N   1 
ATOM   9028  C CA  . GLU C 1 145 ? 72.335  103.063 151.696 1.00 56.11 ? 145 GLU B CA  1 
ATOM   9029  C C   . GLU C 1 145 ? 71.908  101.671 152.132 1.00 56.20 ? 145 GLU B C   1 
ATOM   9030  O O   . GLU C 1 145 ? 72.474  101.114 153.072 1.00 56.27 ? 145 GLU B O   1 
ATOM   9031  C CB  . GLU C 1 145 ? 71.359  104.096 152.249 1.00 56.14 ? 145 GLU B CB  1 
ATOM   9032  C CG  . GLU C 1 145 ? 71.859  105.524 152.182 1.00 56.56 ? 145 GLU B CG  1 
ATOM   9033  C CD  . GLU C 1 145 ? 70.872  106.506 152.780 1.00 57.28 ? 145 GLU B CD  1 
ATOM   9034  O OE1 . GLU C 1 145 ? 70.325  107.330 152.016 1.00 57.63 ? 145 GLU B OE1 1 
ATOM   9035  O OE2 . GLU C 1 145 ? 70.633  106.450 154.009 1.00 57.39 ? 145 GLU B OE2 1 
ATOM   9036  N N   . GLU C 1 146 ? 70.914  101.121 151.435 1.00 56.25 ? 146 GLU B N   1 
ATOM   9037  C CA  . GLU C 1 146 ? 70.454  99.749  151.649 1.00 56.36 ? 146 GLU B CA  1 
ATOM   9038  C C   . GLU C 1 146 ? 71.580  98.728  151.528 1.00 56.40 ? 146 GLU B C   1 
ATOM   9039  O O   . GLU C 1 146 ? 71.605  97.746  152.264 1.00 56.37 ? 146 GLU B O   1 
ATOM   9040  C CB  . GLU C 1 146 ? 69.352  99.387  150.657 1.00 56.37 ? 146 GLU B CB  1 
ATOM   9041  C CG  . GLU C 1 146 ? 67.961  99.836  151.050 1.00 56.65 ? 146 GLU B CG  1 
ATOM   9042  C CD  . GLU C 1 146 ? 66.883  99.152  150.228 1.00 56.96 ? 146 GLU B CD  1 
ATOM   9043  O OE1 . GLU C 1 146 ? 67.098  97.995  149.800 1.00 56.82 ? 146 GLU B OE1 1 
ATOM   9044  O OE2 . GLU C 1 146 ? 65.817  99.769  150.012 1.00 57.18 ? 146 GLU B OE2 1 
ATOM   9045  N N   . ILE C 1 147 ? 72.496  98.957  150.590 1.00 56.52 ? 147 ILE B N   1 
ATOM   9046  C CA  . ILE C 1 147 ? 73.641  98.071  150.400 1.00 56.65 ? 147 ILE B CA  1 
ATOM   9047  C C   . ILE C 1 147 ? 74.573  98.157  151.603 1.00 56.91 ? 147 ILE B C   1 
ATOM   9048  O O   . ILE C 1 147 ? 74.890  97.140  152.214 1.00 56.93 ? 147 ILE B O   1 
ATOM   9049  C CB  . ILE C 1 147 ? 74.414  98.375  149.086 1.00 56.63 ? 147 ILE B CB  1 
ATOM   9050  C CG1 . ILE C 1 147 ? 73.544  98.059  147.866 1.00 56.23 ? 147 ILE B CG1 1 
ATOM   9051  C CG2 . ILE C 1 147 ? 75.714  97.573  149.022 1.00 56.39 ? 147 ILE B CG2 1 
ATOM   9052  C CD1 . ILE C 1 147 ? 73.946  98.802  146.609 1.00 56.01 ? 147 ILE B CD1 1 
ATOM   9053  N N   . GLU C 1 148 ? 74.985  99.375  151.953 1.00 57.23 ? 148 GLU B N   1 
ATOM   9054  C CA  . GLU C 1 148 ? 75.931  99.588  153.051 1.00 57.48 ? 148 GLU B CA  1 
ATOM   9055  C C   . GLU C 1 148 ? 75.354  99.195  154.411 1.00 57.40 ? 148 GLU B C   1 
ATOM   9056  O O   . GLU C 1 148 ? 76.075  98.684  155.268 1.00 57.36 ? 148 GLU B O   1 
ATOM   9057  C CB  . GLU C 1 148 ? 76.430  101.037 153.064 1.00 57.61 ? 148 GLU B CB  1 
ATOM   9058  C CG  . GLU C 1 148 ? 77.767  101.231 153.785 1.00 58.42 ? 148 GLU B CG  1 
ATOM   9059  C CD  . GLU C 1 148 ? 78.695  102.219 153.079 1.00 59.47 ? 148 GLU B CD  1 
ATOM   9060  O OE1 . GLU C 1 148 ? 79.601  102.763 153.753 1.00 59.32 ? 148 GLU B OE1 1 
ATOM   9061  O OE2 . GLU C 1 148 ? 78.529  102.443 151.851 1.00 59.87 ? 148 GLU B OE2 1 
ATOM   9062  N N   . ASP C 1 149 ? 74.056  99.421  154.590 1.00 57.40 ? 149 ASP B N   1 
ATOM   9063  C CA  . ASP C 1 149 ? 73.368  99.095  155.835 1.00 57.48 ? 149 ASP B CA  1 
ATOM   9064  C C   . ASP C 1 149 ? 73.176  97.583  156.003 1.00 57.63 ? 149 ASP B C   1 
ATOM   9065  O O   . ASP C 1 149 ? 73.461  97.030  157.066 1.00 57.68 ? 149 ASP B O   1 
ATOM   9066  C CB  . ASP C 1 149 ? 72.016  99.820  155.891 1.00 57.43 ? 149 ASP B CB  1 
ATOM   9067  C CG  . ASP C 1 149 ? 71.554  100.109 157.311 1.00 57.20 ? 149 ASP B CG  1 
ATOM   9068  O OD1 . ASP C 1 149 ? 72.325  99.885  158.270 1.00 57.04 ? 149 ASP B OD1 1 
ATOM   9069  O OD2 . ASP C 1 149 ? 70.405  100.572 157.463 1.00 56.86 ? 149 ASP B OD2 1 
ATOM   9070  N N   . ILE C 1 150 ? 72.711  96.922  154.944 1.00 57.85 ? 150 ILE B N   1 
ATOM   9071  C CA  . ILE C 1 150 ? 72.369  95.495  154.993 1.00 58.04 ? 150 ILE B CA  1 
ATOM   9072  C C   . ILE C 1 150 ? 73.555  94.575  154.662 1.00 58.17 ? 150 ILE B C   1 
ATOM   9073  O O   . ILE C 1 150 ? 73.859  93.657  155.428 1.00 58.20 ? 150 ILE B O   1 
ATOM   9074  C CB  . ILE C 1 150 ? 71.139  95.175  154.093 1.00 58.02 ? 150 ILE B CB  1 
ATOM   9075  C CG1 . ILE C 1 150 ? 69.903  95.924  154.609 1.00 58.03 ? 150 ILE B CG1 1 
ATOM   9076  C CG2 . ILE C 1 150 ? 70.875  93.671  154.031 1.00 58.03 ? 150 ILE B CG2 1 
ATOM   9077  C CD1 . ILE C 1 150 ? 68.812  96.145  153.577 1.00 58.10 ? 150 ILE B CD1 1 
ATOM   9078  N N   . VAL C 1 151 ? 74.218  94.825  153.533 1.00 58.27 ? 151 VAL B N   1 
ATOM   9079  C CA  . VAL C 1 151 ? 75.359  94.009  153.102 1.00 58.43 ? 151 VAL B CA  1 
ATOM   9080  C C   . VAL C 1 151 ? 76.624  94.324  153.912 1.00 58.59 ? 151 VAL B C   1 
ATOM   9081  O O   . VAL C 1 151 ? 77.412  93.424  154.218 1.00 58.71 ? 151 VAL B O   1 
ATOM   9082  C CB  . VAL C 1 151 ? 75.643  94.170  151.581 1.00 58.39 ? 151 VAL B CB  1 
ATOM   9083  C CG1 . VAL C 1 151 ? 76.874  93.381  151.156 1.00 58.51 ? 151 VAL B CG1 1 
ATOM   9084  C CG2 . VAL C 1 151 ? 74.439  93.748  150.756 1.00 58.34 ? 151 VAL B CG2 1 
ATOM   9085  N N   . GLY C 1 152 ? 76.803  95.595  154.265 1.00 58.73 ? 152 GLY B N   1 
ATOM   9086  C CA  . GLY C 1 152 ? 78.016  96.048  154.945 1.00 58.89 ? 152 GLY B CA  1 
ATOM   9087  C C   . GLY C 1 152 ? 79.149  96.308  153.968 1.00 59.06 ? 152 GLY B C   1 
ATOM   9088  O O   . GLY C 1 152 ? 80.318  96.092  154.292 1.00 59.06 ? 152 GLY B O   1 
ATOM   9089  N N   . ILE C 1 153 ? 78.792  96.772  152.770 1.00 59.22 ? 153 ILE B N   1 
ATOM   9090  C CA  . ILE C 1 153 ? 79.754  97.069  151.706 1.00 59.40 ? 153 ILE B CA  1 
ATOM   9091  C C   . ILE C 1 153 ? 79.780  98.561  151.347 1.00 59.41 ? 153 ILE B C   1 
ATOM   9092  O O   . ILE C 1 153 ? 78.737  99.220  151.293 1.00 59.29 ? 153 ILE B O   1 
ATOM   9093  C CB  . ILE C 1 153 ? 79.525  96.152  150.453 1.00 59.48 ? 153 ILE B CB  1 
ATOM   9094  C CG1 . ILE C 1 153 ? 80.709  95.201  150.239 1.00 59.79 ? 153 ILE B CG1 1 
ATOM   9095  C CG2 . ILE C 1 153 ? 79.346  96.966  149.173 1.00 59.61 ? 153 ILE B CG2 1 
ATOM   9096  C CD1 . ILE C 1 153 ? 81.372  94.684  151.509 1.00 60.77 ? 153 ILE B CD1 1 
ATOM   9097  N N   . ASP C 1 154 ? 80.990  99.074  151.119 1.00 59.50 ? 154 ASP B N   1 
ATOM   9098  C CA  . ASP C 1 154 ? 81.209  100.467 150.745 1.00 59.60 ? 154 ASP B CA  1 
ATOM   9099  C C   . ASP C 1 154 ? 80.756  100.694 149.310 1.00 59.41 ? 154 ASP B C   1 
ATOM   9100  O O   . ASP C 1 154 ? 81.297  100.094 148.381 1.00 59.29 ? 154 ASP B O   1 
ATOM   9101  C CB  . ASP C 1 154 ? 82.691  100.825 150.904 1.00 59.87 ? 154 ASP B CB  1 
ATOM   9102  C CG  . ASP C 1 154 ? 82.958  102.323 150.796 1.00 60.57 ? 154 ASP B CG  1 
ATOM   9103  O OD1 . ASP C 1 154 ? 82.000  103.131 150.867 1.00 61.35 ? 154 ASP B OD1 1 
ATOM   9104  O OD2 . ASP C 1 154 ? 84.144  102.692 150.646 1.00 61.11 ? 154 ASP B OD2 1 
ATOM   9105  N N   . ALA C 1 155 ? 79.762  101.564 149.141 1.00 59.32 ? 155 ALA B N   1 
ATOM   9106  C CA  . ALA C 1 155 ? 79.107  101.756 147.846 1.00 59.21 ? 155 ALA B CA  1 
ATOM   9107  C C   . ALA C 1 155 ? 78.801  103.220 147.506 1.00 59.18 ? 155 ALA B C   1 
ATOM   9108  O O   . ALA C 1 155 ? 78.003  103.495 146.599 1.00 59.13 ? 155 ALA B O   1 
ATOM   9109  C CB  . ALA C 1 155 ? 77.832  100.913 147.777 1.00 59.15 ? 155 ALA B CB  1 
ATOM   9110  N N   . THR C 1 156 ? 79.431  104.154 148.220 1.00 59.04 ? 156 THR B N   1 
ATOM   9111  C CA  . THR C 1 156 ? 79.252  105.586 147.932 1.00 58.92 ? 156 THR B CA  1 
ATOM   9112  C C   . THR C 1 156 ? 79.847  105.959 146.572 1.00 58.76 ? 156 THR B C   1 
ATOM   9113  O O   . THR C 1 156 ? 79.530  107.011 146.010 1.00 58.71 ? 156 THR B O   1 
ATOM   9114  C CB  . THR C 1 156 ? 79.840  106.509 149.038 1.00 58.86 ? 156 THR B CB  1 
ATOM   9115  O OG1 . THR C 1 156 ? 81.116  106.016 149.463 1.00 59.02 ? 156 THR B OG1 1 
ATOM   9116  C CG2 . THR C 1 156 ? 78.904  106.578 150.238 1.00 58.91 ? 156 THR B CG2 1 
ATOM   9117  N N   . ASP C 1 157 ? 80.695  105.079 146.047 1.00 58.57 ? 157 ASP B N   1 
ATOM   9118  C CA  . ASP C 1 157 ? 81.344  105.298 144.763 1.00 58.43 ? 157 ASP B CA  1 
ATOM   9119  C C   . ASP C 1 157 ? 80.847  104.338 143.674 1.00 58.04 ? 157 ASP B C   1 
ATOM   9120  O O   . ASP C 1 157 ? 81.193  104.497 142.504 1.00 58.03 ? 157 ASP B O   1 
ATOM   9121  C CB  . ASP C 1 157 ? 82.865  105.185 144.925 1.00 58.70 ? 157 ASP B CB  1 
ATOM   9122  C CG  . ASP C 1 157 ? 83.626  105.728 143.726 1.00 59.21 ? 157 ASP B CG  1 
ATOM   9123  O OD1 . ASP C 1 157 ? 83.169  106.729 143.126 1.00 59.29 ? 157 ASP B OD1 1 
ATOM   9124  O OD2 . ASP C 1 157 ? 84.684  105.149 143.390 1.00 60.09 ? 157 ASP B OD2 1 
ATOM   9125  N N   . ALA C 1 158 ? 80.030  103.359 144.065 1.00 57.63 ? 158 ALA B N   1 
ATOM   9126  C CA  . ALA C 1 158 ? 79.528  102.313 143.160 1.00 57.11 ? 158 ALA B CA  1 
ATOM   9127  C C   . ALA C 1 158 ? 79.086  102.841 141.801 1.00 56.74 ? 158 ALA B C   1 
ATOM   9128  O O   . ALA C 1 158 ? 78.359  103.835 141.714 1.00 56.66 ? 158 ALA B O   1 
ATOM   9129  C CB  . ALA C 1 158 ? 78.392  101.545 143.815 1.00 57.20 ? 158 ALA B CB  1 
ATOM   9130  N N   . VAL C 1 159 ? 79.533  102.161 140.748 1.00 56.24 ? 159 VAL B N   1 
ATOM   9131  C CA  . VAL C 1 159 ? 79.219  102.548 139.375 1.00 55.75 ? 159 VAL B CA  1 
ATOM   9132  C C   . VAL C 1 159 ? 77.750  102.276 139.062 1.00 55.36 ? 159 VAL B C   1 
ATOM   9133  O O   . VAL C 1 159 ? 77.238  101.191 139.341 1.00 55.40 ? 159 VAL B O   1 
ATOM   9134  C CB  . VAL C 1 159 ? 80.131  101.816 138.348 1.00 55.83 ? 159 VAL B CB  1 
ATOM   9135  C CG1 . VAL C 1 159 ? 79.738  102.171 136.917 1.00 55.40 ? 159 VAL B CG1 1 
ATOM   9136  C CG2 . VAL C 1 159 ? 81.604  102.157 138.595 1.00 55.82 ? 159 VAL B CG2 1 
ATOM   9137  N N   . ARG C 1 160 ? 77.073  103.275 138.504 1.00 54.83 ? 160 ARG B N   1 
ATOM   9138  C CA  . ARG C 1 160 ? 75.691  103.101 138.076 1.00 54.32 ? 160 ARG B CA  1 
ATOM   9139  C C   . ARG C 1 160 ? 75.558  103.112 136.565 1.00 53.93 ? 160 ARG B C   1 
ATOM   9140  O O   . ARG C 1 160 ? 76.286  103.821 135.872 1.00 53.83 ? 160 ARG B O   1 
ATOM   9141  C CB  . ARG C 1 160 ? 74.743  104.104 138.744 1.00 54.41 ? 160 ARG B CB  1 
ATOM   9142  C CG  . ARG C 1 160 ? 75.275  105.505 138.967 1.00 54.44 ? 160 ARG B CG  1 
ATOM   9143  C CD  . ARG C 1 160 ? 74.986  105.918 140.406 1.00 54.73 ? 160 ARG B CD  1 
ATOM   9144  N NE  . ARG C 1 160 ? 74.230  107.167 140.507 1.00 55.01 ? 160 ARG B NE  1 
ATOM   9145  C CZ  . ARG C 1 160 ? 73.909  107.765 141.653 1.00 54.53 ? 160 ARG B CZ  1 
ATOM   9146  N NH1 . ARG C 1 160 ? 74.278  107.243 142.815 1.00 54.43 ? 160 ARG B NH1 1 
ATOM   9147  N NH2 . ARG C 1 160 ? 73.216  108.892 141.638 1.00 54.47 ? 160 ARG B NH2 1 
ATOM   9148  N N   . CYS C 1 161 ? 74.629  102.305 136.064 1.00 53.53 ? 161 CYS B N   1 
ATOM   9149  C CA  . CYS C 1 161 ? 74.515  102.068 134.633 1.00 53.24 ? 161 CYS B CA  1 
ATOM   9150  C C   . CYS C 1 161 ? 73.078  101.866 134.165 1.00 53.02 ? 161 CYS B C   1 
ATOM   9151  O O   . CYS C 1 161 ? 72.146  101.833 134.971 1.00 53.10 ? 161 CYS B O   1 
ATOM   9152  C CB  . CYS C 1 161 ? 75.388  100.878 134.224 1.00 53.25 ? 161 CYS B CB  1 
ATOM   9153  S SG  . CYS C 1 161 ? 75.141  99.407  135.213 1.00 53.30 ? 161 CYS B SG  1 
ATOM   9154  N N   . SER C 1 162 ? 72.918  101.726 132.852 1.00 52.69 ? 162 SER B N   1 
ATOM   9155  C CA  . SER C 1 162 ? 71.611  101.608 132.228 1.00 52.34 ? 162 SER B CA  1 
ATOM   9156  C C   . SER C 1 162 ? 71.504  100.374 131.348 1.00 52.13 ? 162 SER B C   1 
ATOM   9157  O O   . SER C 1 162 ? 72.468  99.975  130.700 1.00 52.01 ? 162 SER B O   1 
ATOM   9158  C CB  . SER C 1 162 ? 71.318  102.851 131.394 1.00 52.34 ? 162 SER B CB  1 
ATOM   9159  O OG  . SER C 1 162 ? 70.242  102.617 130.503 1.00 52.51 ? 162 SER B OG  1 
ATOM   9160  N N   . ALA C 1 163 ? 70.315  99.782  131.334 1.00 52.06 ? 163 ALA B N   1 
ATOM   9161  C CA  . ALA C 1 163 ? 70.007  98.676  130.442 1.00 51.95 ? 163 ALA B CA  1 
ATOM   9162  C C   . ALA C 1 163 ? 69.558  99.220  129.090 1.00 51.87 ? 163 ALA B C   1 
ATOM   9163  O O   . ALA C 1 163 ? 69.807  98.608  128.055 1.00 51.85 ? 163 ALA B O   1 
ATOM   9164  C CB  . ALA C 1 163 ? 68.934  97.790  131.048 1.00 51.91 ? 163 ALA B CB  1 
ATOM   9165  N N   . LYS C 1 164 ? 68.904  100.378 129.113 1.00 51.82 ? 164 LYS B N   1 
ATOM   9166  C CA  . LYS C 1 164 ? 68.401  101.015 127.901 1.00 51.80 ? 164 LYS B CA  1 
ATOM   9167  C C   . LYS C 1 164 ? 69.530  101.448 126.970 1.00 51.94 ? 164 LYS B C   1 
ATOM   9168  O O   . LYS C 1 164 ? 69.502  101.151 125.772 1.00 51.99 ? 164 LYS B O   1 
ATOM   9169  C CB  . LYS C 1 164 ? 67.530  102.230 128.245 1.00 51.77 ? 164 LYS B CB  1 
ATOM   9170  C CG  . LYS C 1 164 ? 66.169  101.908 128.850 1.00 51.65 ? 164 LYS B CG  1 
ATOM   9171  C CD  . LYS C 1 164 ? 65.343  103.179 129.011 1.00 51.60 ? 164 LYS B CD  1 
ATOM   9172  C CE  . LYS C 1 164 ? 63.978  102.891 129.607 1.00 51.26 ? 164 LYS B CE  1 
ATOM   9173  N NZ  . LYS C 1 164 ? 63.125  104.107 129.607 1.00 50.98 ? 164 LYS B NZ  1 
ATOM   9174  N N   . THR C 1 165 ? 70.519  102.143 127.531 1.00 51.96 ? 165 THR B N   1 
ATOM   9175  C CA  . THR C 1 165 ? 71.571  102.779 126.740 1.00 51.91 ? 165 THR B CA  1 
ATOM   9176  C C   . THR C 1 165 ? 72.860  101.972 126.726 1.00 52.10 ? 165 THR B C   1 
ATOM   9177  O O   . THR C 1 165 ? 73.521  101.878 125.694 1.00 52.30 ? 165 THR B O   1 
ATOM   9178  C CB  . THR C 1 165 ? 71.879  104.218 127.227 1.00 51.86 ? 165 THR B CB  1 
ATOM   9179  O OG1 . THR C 1 165 ? 72.365  104.187 128.575 1.00 51.53 ? 165 THR B OG1 1 
ATOM   9180  C CG2 . THR C 1 165 ? 70.636  105.097 127.154 1.00 51.92 ? 165 THR B CG2 1 
ATOM   9181  N N   . GLY C 1 166 ? 73.215  101.400 127.872 1.00 52.21 ? 166 GLY B N   1 
ATOM   9182  C CA  . GLY C 1 166 ? 74.468  100.670 128.009 1.00 52.17 ? 166 GLY B CA  1 
ATOM   9183  C C   . GLY C 1 166 ? 75.590  101.504 128.598 1.00 52.32 ? 166 GLY B C   1 
ATOM   9184  O O   . GLY C 1 166 ? 76.680  100.983 128.848 1.00 52.42 ? 166 GLY B O   1 
ATOM   9185  N N   . VAL C 1 167 ? 75.340  102.796 128.820 1.00 52.32 ? 167 VAL B N   1 
ATOM   9186  C CA  . VAL C 1 167 ? 76.341  103.658 129.464 1.00 52.39 ? 167 VAL B CA  1 
ATOM   9187  C C   . VAL C 1 167 ? 76.529  103.244 130.920 1.00 52.28 ? 167 VAL B C   1 
ATOM   9188  O O   . VAL C 1 167 ? 75.570  102.851 131.588 1.00 52.19 ? 167 VAL B O   1 
ATOM   9189  C CB  . VAL C 1 167 ? 76.020  105.185 129.366 1.00 52.41 ? 167 VAL B CB  1 
ATOM   9190  C CG1 . VAL C 1 167 ? 75.702  105.581 127.928 1.00 52.81 ? 167 VAL B CG1 1 
ATOM   9191  C CG2 . VAL C 1 167 ? 74.887  105.598 130.314 1.00 52.62 ? 167 VAL B CG2 1 
ATOM   9192  N N   . GLY C 1 168 ? 77.772  103.319 131.391 1.00 52.24 ? 168 GLY B N   1 
ATOM   9193  C CA  . GLY C 1 168 ? 78.115  102.898 132.745 1.00 52.06 ? 168 GLY B CA  1 
ATOM   9194  C C   . GLY C 1 168 ? 78.617  101.467 132.804 1.00 51.95 ? 168 GLY B C   1 
ATOM   9195  O O   . GLY C 1 168 ? 79.388  101.118 133.696 1.00 51.95 ? 168 GLY B O   1 
ATOM   9196  N N   . VAL C 1 169 ? 78.183  100.639 131.855 1.00 51.79 ? 169 VAL B N   1 
ATOM   9197  C CA  . VAL C 1 169 ? 78.610  99.241  131.795 1.00 51.68 ? 169 VAL B CA  1 
ATOM   9198  C C   . VAL C 1 169 ? 80.112  99.137  131.514 1.00 51.64 ? 169 VAL B C   1 
ATOM   9199  O O   . VAL C 1 169 ? 80.784  98.257  132.044 1.00 51.69 ? 169 VAL B O   1 
ATOM   9200  C CB  . VAL C 1 169 ? 77.785  98.416  130.770 1.00 51.64 ? 169 VAL B CB  1 
ATOM   9201  C CG1 . VAL C 1 169 ? 78.279  96.977  130.693 1.00 51.40 ? 169 VAL B CG1 1 
ATOM   9202  C CG2 . VAL C 1 169 ? 76.311  98.432  131.137 1.00 51.63 ? 169 VAL B CG2 1 
ATOM   9203  N N   . GLN C 1 170 ? 80.636  100.043 130.694 1.00 51.64 ? 170 GLN B N   1 
ATOM   9204  C CA  . GLN C 1 170 ? 82.076  100.111 130.469 1.00 51.65 ? 170 GLN B CA  1 
ATOM   9205  C C   . GLN C 1 170 ? 82.764  100.565 131.750 1.00 51.69 ? 170 GLN B C   1 
ATOM   9206  O O   . GLN C 1 170 ? 83.846  100.080 132.095 1.00 51.80 ? 170 GLN B O   1 
ATOM   9207  C CB  . GLN C 1 170 ? 82.410  101.067 129.326 1.00 51.73 ? 170 GLN B CB  1 
ATOM   9208  C CG  . GLN C 1 170 ? 83.860  100.987 128.864 1.00 51.73 ? 170 GLN B CG  1 
ATOM   9209  C CD  . GLN C 1 170 ? 84.275  102.157 127.993 1.00 51.98 ? 170 GLN B CD  1 
ATOM   9210  O OE1 . GLN C 1 170 ? 83.448  102.957 127.566 1.00 52.28 ? 170 GLN B OE1 1 
ATOM   9211  N NE2 . GLN C 1 170 ? 85.568  102.262 127.726 1.00 52.31 ? 170 GLN B NE2 1 
ATOM   9212  N N   . ASP C 1 171 ? 82.120  101.490 132.458 1.00 51.61 ? 171 ASP B N   1 
ATOM   9213  C CA  . ASP C 1 171 ? 82.627  101.985 133.733 1.00 51.42 ? 171 ASP B CA  1 
ATOM   9214  C C   . ASP C 1 171 ? 82.619  100.900 134.810 1.00 51.31 ? 171 ASP B C   1 
ATOM   9215  O O   . ASP C 1 171 ? 83.430  100.941 135.740 1.00 51.38 ? 171 ASP B O   1 
ATOM   9216  C CB  . ASP C 1 171 ? 81.832  103.217 134.195 1.00 51.43 ? 171 ASP B CB  1 
ATOM   9217  C CG  . ASP C 1 171 ? 82.262  104.504 133.492 1.00 51.31 ? 171 ASP B CG  1 
ATOM   9218  O OD1 . ASP C 1 171 ? 83.310  104.513 132.807 1.00 51.06 ? 171 ASP B OD1 1 
ATOM   9219  O OD2 . ASP C 1 171 ? 81.547  105.519 133.635 1.00 51.21 ? 171 ASP B OD2 1 
ATOM   9220  N N   . VAL C 1 172 ? 81.705  99.936  134.682 1.00 51.12 ? 172 VAL B N   1 
ATOM   9221  C CA  . VAL C 1 172 ? 81.672  98.778  135.580 1.00 50.98 ? 172 VAL B CA  1 
ATOM   9222  C C   . VAL C 1 172 ? 82.898  97.900  135.331 1.00 50.85 ? 172 VAL B C   1 
ATOM   9223  O O   . VAL C 1 172 ? 83.566  97.474  136.276 1.00 50.78 ? 172 VAL B O   1 
ATOM   9224  C CB  . VAL C 1 172 ? 80.376  97.937  135.429 1.00 51.02 ? 172 VAL B CB  1 
ATOM   9225  C CG1 . VAL C 1 172 ? 80.431  96.699  136.306 1.00 50.79 ? 172 VAL B CG1 1 
ATOM   9226  C CG2 . VAL C 1 172 ? 79.152  98.758  135.789 1.00 51.20 ? 172 VAL B CG2 1 
ATOM   9227  N N   . LEU C 1 173 ? 83.193  97.656  134.056 1.00 50.63 ? 173 LEU B N   1 
ATOM   9228  C CA  . LEU C 1 173 ? 84.369  96.892  133.657 1.00 50.53 ? 173 LEU B CA  1 
ATOM   9229  C C   . LEU C 1 173 ? 85.679  97.548  134.089 1.00 50.69 ? 173 LEU B C   1 
ATOM   9230  O O   . LEU C 1 173 ? 86.636  96.857  134.436 1.00 50.71 ? 173 LEU B O   1 
ATOM   9231  C CB  . LEU C 1 173 ? 84.357  96.644  132.149 1.00 50.48 ? 173 LEU B CB  1 
ATOM   9232  C CG  . LEU C 1 173 ? 83.895  95.268  131.640 1.00 50.42 ? 173 LEU B CG  1 
ATOM   9233  C CD1 . LEU C 1 173 ? 82.668  94.718  132.363 1.00 49.82 ? 173 LEU B CD1 1 
ATOM   9234  C CD2 . LEU C 1 173 ? 83.654  95.316  130.141 1.00 50.31 ? 173 LEU B CD2 1 
ATOM   9235  N N   . GLU C 1 174 ? 85.717  98.878  134.078 1.00 50.88 ? 174 GLU B N   1 
ATOM   9236  C CA  . GLU C 1 174 ? 86.888  99.612  134.556 1.00 50.92 ? 174 GLU B CA  1 
ATOM   9237  C C   . GLU C 1 174 ? 87.063  99.410  136.055 1.00 50.98 ? 174 GLU B C   1 
ATOM   9238  O O   . GLU C 1 174 ? 88.151  99.057  136.515 1.00 51.34 ? 174 GLU B O   1 
ATOM   9239  C CB  . GLU C 1 174 ? 86.779  101.098 134.218 1.00 50.79 ? 174 GLU B CB  1 
ATOM   9240  C CG  . GLU C 1 174 ? 86.940  101.408 132.736 1.00 51.20 ? 174 GLU B CG  1 
ATOM   9241  C CD  . GLU C 1 174 ? 88.383  101.351 132.268 1.00 51.31 ? 174 GLU B CD  1 
ATOM   9242  O OE1 . GLU C 1 174 ? 89.212  102.116 132.796 1.00 52.06 ? 174 GLU B OE1 1 
ATOM   9243  O OE2 . GLU C 1 174 ? 88.689  100.555 131.360 1.00 51.27 ? 174 GLU B OE2 1 
ATOM   9244  N N   . ARG C 1 175 ? 85.980  99.615  136.804 1.00 50.87 ? 175 ARG B N   1 
ATOM   9245  C CA  . ARG C 1 175 ? 85.969  99.433  138.256 1.00 50.60 ? 175 ARG B CA  1 
ATOM   9246  C C   . ARG C 1 175 ? 86.357  98.008  138.619 1.00 50.45 ? 175 ARG B C   1 
ATOM   9247  O O   . ARG C 1 175 ? 87.155  97.785  139.525 1.00 50.42 ? 175 ARG B O   1 
ATOM   9248  C CB  . ARG C 1 175 ? 84.581  99.755  138.812 1.00 50.61 ? 175 ARG B CB  1 
ATOM   9249  C CG  . ARG C 1 175 ? 84.464  99.695  140.328 1.00 50.49 ? 175 ARG B CG  1 
ATOM   9250  C CD  . ARG C 1 175 ? 85.410  100.672 141.016 1.00 50.60 ? 175 ARG B CD  1 
ATOM   9251  N NE  . ARG C 1 175 ? 85.302  102.039 140.501 1.00 50.22 ? 175 ARG B NE  1 
ATOM   9252  C CZ  . ARG C 1 175 ? 84.394  102.929 140.895 1.00 50.01 ? 175 ARG B CZ  1 
ATOM   9253  N NH1 . ARG C 1 175 ? 84.391  104.144 140.368 1.00 49.97 ? 175 ARG B NH1 1 
ATOM   9254  N NH2 . ARG C 1 175 ? 83.488  102.612 141.812 1.00 50.18 ? 175 ARG B NH2 1 
ATOM   9255  N N   . LEU C 1 176 ? 85.773  97.060  137.891 1.00 50.38 ? 176 LEU B N   1 
ATOM   9256  C CA  . LEU C 1 176 ? 86.059  95.634  138.008 1.00 50.24 ? 176 LEU B CA  1 
ATOM   9257  C C   . LEU C 1 176 ? 87.556  95.370  137.943 1.00 50.04 ? 176 LEU B C   1 
ATOM   9258  O O   . LEU C 1 176 ? 88.113  94.711  138.819 1.00 50.10 ? 176 LEU B O   1 
ATOM   9259  C CB  . LEU C 1 176 ? 85.357  94.900  136.861 1.00 50.34 ? 176 LEU B CB  1 
ATOM   9260  C CG  . LEU C 1 176 ? 85.138  93.389  136.815 1.00 50.65 ? 176 LEU B CG  1 
ATOM   9261  C CD1 . LEU C 1 176 ? 84.113  93.095  135.734 1.00 50.02 ? 176 LEU B CD1 1 
ATOM   9262  C CD2 . LEU C 1 176 ? 86.431  92.616  136.557 1.00 51.05 ? 176 LEU B CD2 1 
ATOM   9263  N N   . VAL C 1 177 ? 88.192  95.898  136.898 1.00 49.75 ? 177 VAL B N   1 
ATOM   9264  C CA  . VAL C 1 177 ? 89.615  95.702  136.645 1.00 49.45 ? 177 VAL B CA  1 
ATOM   9265  C C   . VAL C 1 177 ? 90.474  96.303  137.764 1.00 49.45 ? 177 VAL B C   1 
ATOM   9266  O O   . VAL C 1 177 ? 91.525  95.756  138.118 1.00 49.48 ? 177 VAL B O   1 
ATOM   9267  C CB  . VAL C 1 177 ? 90.002  96.280  135.259 1.00 49.38 ? 177 VAL B CB  1 
ATOM   9268  C CG1 . VAL C 1 177 ? 91.517  96.350  135.072 1.00 49.28 ? 177 VAL B CG1 1 
ATOM   9269  C CG2 . VAL C 1 177 ? 89.387  95.441  134.158 1.00 49.30 ? 177 VAL B CG2 1 
ATOM   9270  N N   . ARG C 1 178 ? 90.000  97.408  138.334 1.00 49.32 ? 178 ARG B N   1 
ATOM   9271  C CA  . ARG C 1 178 ? 90.748  98.154  139.342 1.00 49.24 ? 178 ARG B CA  1 
ATOM   9272  C C   . ARG C 1 178 ? 90.741  97.483  140.714 1.00 49.29 ? 178 ARG B C   1 
ATOM   9273  O O   . ARG C 1 178 ? 91.766  97.425  141.381 1.00 49.23 ? 178 ARG B O   1 
ATOM   9274  C CB  . ARG C 1 178 ? 90.197  99.582  139.453 1.00 49.16 ? 178 ARG B CB  1 
ATOM   9275  C CG  . ARG C 1 178 ? 91.064  100.543 140.256 1.00 48.64 ? 178 ARG B CG  1 
ATOM   9276  C CD  . ARG C 1 178 ? 90.300  101.804 140.616 1.00 48.12 ? 178 ARG B CD  1 
ATOM   9277  N NE  . ARG C 1 178 ? 89.307  101.557 141.660 1.00 47.89 ? 178 ARG B NE  1 
ATOM   9278  C CZ  . ARG C 1 178 ? 88.436  102.458 142.108 1.00 47.80 ? 178 ARG B CZ  1 
ATOM   9279  N NH1 . ARG C 1 178 ? 88.421  103.689 141.610 1.00 47.44 ? 178 ARG B NH1 1 
ATOM   9280  N NH2 . ARG C 1 178 ? 87.576  102.127 143.063 1.00 47.68 ? 178 ARG B NH2 1 
ATOM   9281  N N   . ASP C 1 179 ? 89.584  96.975  141.124 1.00 49.50 ? 179 ASP B N   1 
ATOM   9282  C CA  . ASP C 1 179 ? 89.391  96.508  142.498 1.00 49.69 ? 179 ASP B CA  1 
ATOM   9283  C C   . ASP C 1 179 ? 89.504  95.004  142.694 1.00 49.68 ? 179 ASP B C   1 
ATOM   9284  O O   . ASP C 1 179 ? 90.079  94.559  143.687 1.00 49.52 ? 179 ASP B O   1 
ATOM   9285  C CB  . ASP C 1 179 ? 88.072  97.040  143.065 1.00 49.80 ? 179 ASP B CB  1 
ATOM   9286  C CG  . ASP C 1 179 ? 88.125  98.534  143.362 1.00 50.33 ? 179 ASP B CG  1 
ATOM   9287  O OD1 . ASP C 1 179 ? 89.094  99.207  142.937 1.00 50.67 ? 179 ASP B OD1 1 
ATOM   9288  O OD2 . ASP C 1 179 ? 87.193  99.035  144.026 1.00 51.04 ? 179 ASP B OD2 1 
ATOM   9289  N N   . ILE C 1 180 ? 88.951  94.225  141.765 1.00 49.86 ? 180 ILE B N   1 
ATOM   9290  C CA  . ILE C 1 180 ? 89.125  92.773  141.794 1.00 50.04 ? 180 ILE B CA  1 
ATOM   9291  C C   . ILE C 1 180 ? 90.572  92.457  141.418 1.00 50.24 ? 180 ILE B C   1 
ATOM   9292  O O   . ILE C 1 180 ? 91.033  92.864  140.355 1.00 50.26 ? 180 ILE B O   1 
ATOM   9293  C CB  . ILE C 1 180 ? 88.130  92.034  140.861 1.00 50.04 ? 180 ILE B CB  1 
ATOM   9294  C CG1 . ILE C 1 180 ? 86.702  92.158  141.403 1.00 50.04 ? 180 ILE B CG1 1 
ATOM   9295  C CG2 . ILE C 1 180 ? 88.510  90.554  140.710 1.00 50.03 ? 180 ILE B CG2 1 
ATOM   9296  C CD1 . ILE C 1 180 ? 85.627  91.659  140.457 1.00 49.82 ? 180 ILE B CD1 1 
ATOM   9297  N N   . PRO C 1 181 ? 91.300  91.753  142.305 1.00 50.48 ? 181 PRO B N   1 
ATOM   9298  C CA  . PRO C 1 181 ? 92.693  91.441  142.012 1.00 50.66 ? 181 PRO B CA  1 
ATOM   9299  C C   . PRO C 1 181 ? 92.778  90.343  140.961 1.00 51.02 ? 181 PRO B C   1 
ATOM   9300  O O   . PRO C 1 181 ? 91.809  89.602  140.782 1.00 51.24 ? 181 PRO B O   1 
ATOM   9301  C CB  . PRO C 1 181 ? 93.238  90.951  143.357 1.00 50.47 ? 181 PRO B CB  1 
ATOM   9302  C CG  . PRO C 1 181 ? 92.073  90.440  144.085 1.00 50.38 ? 181 PRO B CG  1 
ATOM   9303  C CD  . PRO C 1 181 ? 90.870  91.207  143.606 1.00 50.56 ? 181 PRO B CD  1 
ATOM   9304  N N   . PRO C 1 182 ? 93.907  90.265  140.231 1.00 51.27 ? 182 PRO B N   1 
ATOM   9305  C CA  . PRO C 1 182 ? 94.158  89.152  139.318 1.00 51.41 ? 182 PRO B CA  1 
ATOM   9306  C C   . PRO C 1 182 ? 94.360  87.840  140.072 1.00 51.54 ? 182 PRO B C   1 
ATOM   9307  O O   . PRO C 1 182 ? 94.548  87.862  141.288 1.00 51.50 ? 182 PRO B O   1 
ATOM   9308  C CB  . PRO C 1 182 ? 95.453  89.567  138.616 1.00 51.37 ? 182 PRO B CB  1 
ATOM   9309  C CG  . PRO C 1 182 ? 96.101  90.482  139.550 1.00 51.51 ? 182 PRO B CG  1 
ATOM   9310  C CD  . PRO C 1 182 ? 95.000  91.248  140.190 1.00 51.29 ? 182 PRO B CD  1 
ATOM   9311  N N   . PRO C 1 183 ? 94.328  86.700  139.358 1.00 51.75 ? 183 PRO B N   1 
ATOM   9312  C CA  . PRO C 1 183 ? 94.493  85.387  139.988 1.00 52.06 ? 183 PRO B CA  1 
ATOM   9313  C C   . PRO C 1 183 ? 95.888  85.204  140.592 1.00 52.39 ? 183 PRO B C   1 
ATOM   9314  O O   . PRO C 1 183 ? 96.774  86.026  140.364 1.00 52.40 ? 183 PRO B O   1 
ATOM   9315  C CB  . PRO C 1 183 ? 94.295  84.418  138.819 1.00 51.97 ? 183 PRO B CB  1 
ATOM   9316  C CG  . PRO C 1 183 ? 94.655  85.208  137.615 1.00 51.67 ? 183 PRO B CG  1 
ATOM   9317  C CD  . PRO C 1 183 ? 94.142  86.578  137.903 1.00 51.59 ? 183 PRO B CD  1 
ATOM   9318  N N   . GLU C 1 184 ? 96.078  84.130  141.351 1.00 52.82 ? 184 GLU B N   1 
ATOM   9319  C CA  . GLU C 1 184 ? 97.373  83.869  141.969 1.00 53.29 ? 184 GLU B CA  1 
ATOM   9320  C C   . GLU C 1 184 ? 97.715  82.384  141.987 1.00 53.30 ? 184 GLU B C   1 
ATOM   9321  O O   . GLU C 1 184 ? 96.871  81.548  142.307 1.00 53.41 ? 184 GLU B O   1 
ATOM   9322  C CB  . GLU C 1 184 ? 97.418  84.459  143.377 1.00 53.36 ? 184 GLU B CB  1 
ATOM   9323  C CG  . GLU C 1 184 ? 98.811  84.585  143.940 1.00 54.48 ? 184 GLU B CG  1 
ATOM   9324  C CD  . GLU C 1 184 ? 99.035  85.923  144.601 1.00 56.12 ? 184 GLU B CD  1 
ATOM   9325  O OE1 . GLU C 1 184 ? 99.235  85.953  145.837 1.00 56.14 ? 184 GLU B OE1 1 
ATOM   9326  O OE2 . GLU C 1 184 ? 98.999  86.947  143.877 1.00 57.24 ? 184 GLU B OE2 1 
ATOM   9327  N N   . GLY C 1 185 ? 98.959  82.070  141.636 1.00 53.40 ? 185 GLY B N   1 
ATOM   9328  C CA  . GLY C 1 185 ? 99.438  80.693  141.617 1.00 53.59 ? 185 GLY B CA  1 
ATOM   9329  C C   . GLY C 1 185 ? 100.742 80.552  140.859 1.00 53.79 ? 185 GLY B C   1 
ATOM   9330  O O   . GLY C 1 185 ? 101.282 81.541  140.347 1.00 53.84 ? 185 GLY B O   1 
ATOM   9331  N N   . ASP C 1 186 ? 101.240 79.317  140.785 1.00 53.83 ? 186 ASP B N   1 
ATOM   9332  C CA  . ASP C 1 186 ? 102.510 79.015  140.121 1.00 53.87 ? 186 ASP B CA  1 
ATOM   9333  C C   . ASP C 1 186 ? 102.280 78.260  138.803 1.00 53.91 ? 186 ASP B C   1 
ATOM   9334  O O   . ASP C 1 186 ? 101.821 77.114  138.818 1.00 54.03 ? 186 ASP B O   1 
ATOM   9335  C CB  . ASP C 1 186 ? 103.415 78.203  141.060 1.00 53.80 ? 186 ASP B CB  1 
ATOM   9336  C CG  . ASP C 1 186 ? 104.880 78.193  140.625 1.00 53.81 ? 186 ASP B CG  1 
ATOM   9337  O OD1 . ASP C 1 186 ? 105.671 77.508  141.304 1.00 54.16 ? 186 ASP B OD1 1 
ATOM   9338  O OD2 . ASP C 1 186 ? 105.255 78.854  139.628 1.00 53.82 ? 186 ASP B OD2 1 
ATOM   9339  N N   . PRO C 1 187 ? 102.588 78.907  137.657 1.00 53.94 ? 187 PRO B N   1 
ATOM   9340  C CA  . PRO C 1 187 ? 102.471 78.271  136.333 1.00 54.01 ? 187 PRO B CA  1 
ATOM   9341  C C   . PRO C 1 187 ? 103.353 77.030  136.179 1.00 54.10 ? 187 PRO B C   1 
ATOM   9342  O O   . PRO C 1 187 ? 102.999 76.109  135.439 1.00 54.00 ? 187 PRO B O   1 
ATOM   9343  C CB  . PRO C 1 187 ? 102.942 79.368  135.371 1.00 53.96 ? 187 PRO B CB  1 
ATOM   9344  C CG  . PRO C 1 187 ? 102.758 80.643  136.125 1.00 53.95 ? 187 PRO B CG  1 
ATOM   9345  C CD  . PRO C 1 187 ? 103.049 80.303  137.550 1.00 53.87 ? 187 PRO B CD  1 
ATOM   9346  N N   . GLU C 1 188 ? 104.488 77.026  136.876 1.00 54.27 ? 188 GLU B N   1 
ATOM   9347  C CA  . GLU C 1 188 ? 105.436 75.915  136.848 1.00 54.39 ? 188 GLU B CA  1 
ATOM   9348  C C   . GLU C 1 188 ? 105.131 74.861  137.906 1.00 54.24 ? 188 GLU B C   1 
ATOM   9349  O O   . GLU C 1 188 ? 105.672 73.753  137.859 1.00 54.30 ? 188 GLU B O   1 
ATOM   9350  C CB  . GLU C 1 188 ? 106.871 76.434  137.006 1.00 54.50 ? 188 GLU B CB  1 
ATOM   9351  C CG  . GLU C 1 188 ? 107.568 76.743  135.687 1.00 55.26 ? 188 GLU B CG  1 
ATOM   9352  C CD  . GLU C 1 188 ? 106.737 77.634  134.778 1.00 56.32 ? 188 GLU B CD  1 
ATOM   9353  O OE1 . GLU C 1 188 ? 106.759 78.870  134.968 1.00 56.83 ? 188 GLU B OE1 1 
ATOM   9354  O OE2 . GLU C 1 188 ? 106.059 77.094  133.875 1.00 56.66 ? 188 GLU B OE2 1 
ATOM   9355  N N   . GLY C 1 189 ? 104.262 75.208  138.852 1.00 54.02 ? 189 GLY B N   1 
ATOM   9356  C CA  . GLY C 1 189 ? 103.879 74.296  139.926 1.00 53.88 ? 189 GLY B CA  1 
ATOM   9357  C C   . GLY C 1 189 ? 103.048 73.126  139.431 1.00 53.68 ? 189 GLY B C   1 
ATOM   9358  O O   . GLY C 1 189 ? 102.517 73.171  138.321 1.00 53.73 ? 189 GLY B O   1 
ATOM   9359  N N   . PRO C 1 190 ? 102.937 72.063  140.247 1.00 53.53 ? 190 PRO B N   1 
ATOM   9360  C CA  . PRO C 1 190 ? 102.096 70.911  139.898 1.00 53.43 ? 190 PRO B CA  1 
ATOM   9361  C C   . PRO C 1 190 ? 100.635 71.317  139.677 1.00 53.24 ? 190 PRO B C   1 
ATOM   9362  O O   . PRO C 1 190 ? 100.104 72.138  140.427 1.00 53.22 ? 190 PRO B O   1 
ATOM   9363  C CB  . PRO C 1 190 ? 102.229 69.991  141.120 1.00 53.49 ? 190 PRO B CB  1 
ATOM   9364  C CG  . PRO C 1 190 ? 102.749 70.868  142.221 1.00 53.49 ? 190 PRO B CG  1 
ATOM   9365  C CD  . PRO C 1 190 ? 103.604 71.884  141.548 1.00 53.45 ? 190 PRO B CD  1 
ATOM   9366  N N   . LEU C 1 191 ? 100.006 70.741  138.652 1.00 53.08 ? 191 LEU B N   1 
ATOM   9367  C CA  . LEU C 1 191 ? 98.661  71.134  138.220 1.00 52.85 ? 191 LEU B CA  1 
ATOM   9368  C C   . LEU C 1 191 ? 97.623  71.030  139.327 1.00 52.67 ? 191 LEU B C   1 
ATOM   9369  O O   . LEU C 1 191 ? 97.512  70.006  139.996 1.00 52.68 ? 191 LEU B O   1 
ATOM   9370  C CB  . LEU C 1 191 ? 98.203  70.276  137.035 1.00 52.92 ? 191 LEU B CB  1 
ATOM   9371  C CG  . LEU C 1 191 ? 97.248  70.780  135.931 1.00 53.19 ? 191 LEU B CG  1 
ATOM   9372  C CD1 . LEU C 1 191 ? 96.306  69.657  135.527 1.00 52.89 ? 191 LEU B CD1 1 
ATOM   9373  C CD2 . LEU C 1 191 ? 96.433  72.027  136.273 1.00 53.31 ? 191 LEU B CD2 1 
ATOM   9374  N N   . GLN C 1 192 ? 96.876  72.111  139.519 1.00 52.53 ? 192 GLN B N   1 
ATOM   9375  C CA  . GLN C 1 192 ? 95.681  72.096  140.353 1.00 52.48 ? 192 GLN B CA  1 
ATOM   9376  C C   . GLN C 1 192 ? 94.549  72.797  139.611 1.00 52.54 ? 192 GLN B C   1 
ATOM   9377  O O   . GLN C 1 192 ? 94.526  74.024  139.498 1.00 52.70 ? 192 GLN B O   1 
ATOM   9378  C CB  . GLN C 1 192 ? 95.938  72.751  141.711 1.00 52.45 ? 192 GLN B CB  1 
ATOM   9379  C CG  . GLN C 1 192 ? 96.890  71.960  142.607 1.00 52.57 ? 192 GLN B CG  1 
ATOM   9380  C CD  . GLN C 1 192 ? 96.991  72.517  144.011 1.00 52.33 ? 192 GLN B CD  1 
ATOM   9381  O OE1 . GLN C 1 192 ? 97.146  73.723  144.211 1.00 52.36 ? 192 GLN B OE1 1 
ATOM   9382  N NE2 . GLN C 1 192 ? 96.915  71.634  144.993 1.00 52.13 ? 192 GLN B NE2 1 
ATOM   9383  N N   . ALA C 1 193 ? 93.625  72.006  139.079 1.00 52.47 ? 193 ALA B N   1 
ATOM   9384  C CA  . ALA C 1 193 ? 92.480  72.543  138.363 1.00 52.41 ? 193 ALA B CA  1 
ATOM   9385  C C   . ALA C 1 193 ? 91.186  72.197  139.098 1.00 52.42 ? 193 ALA B C   1 
ATOM   9386  O O   . ALA C 1 193 ? 90.863  71.024  139.287 1.00 52.45 ? 193 ALA B O   1 
ATOM   9387  C CB  . ALA C 1 193 ? 92.460  72.024  136.929 1.00 52.23 ? 193 ALA B CB  1 
ATOM   9388  N N   . LEU C 1 194 ? 90.457  73.227  139.517 1.00 52.46 ? 194 LEU B N   1 
ATOM   9389  C CA  . LEU C 1 194 ? 89.212  73.052  140.264 1.00 52.57 ? 194 LEU B CA  1 
ATOM   9390  C C   . LEU C 1 194 ? 88.010  72.854  139.340 1.00 52.63 ? 194 LEU B C   1 
ATOM   9391  O O   . LEU C 1 194 ? 87.767  73.674  138.454 1.00 52.82 ? 194 LEU B O   1 
ATOM   9392  C CB  . LEU C 1 194 ? 88.985  74.256  141.187 1.00 52.50 ? 194 LEU B CB  1 
ATOM   9393  C CG  . LEU C 1 194 ? 87.648  74.419  141.911 1.00 52.61 ? 194 LEU B CG  1 
ATOM   9394  C CD1 . LEU C 1 194 ? 87.437  73.322  142.945 1.00 53.01 ? 194 LEU B CD1 1 
ATOM   9395  C CD2 . LEU C 1 194 ? 87.568  75.790  142.561 1.00 52.54 ? 194 LEU B CD2 1 
ATOM   9396  N N   . ILE C 1 195 ? 87.268  71.765  139.547 1.00 52.67 ? 195 ILE B N   1 
ATOM   9397  C CA  . ILE C 1 195 ? 86.034  71.518  138.792 1.00 52.83 ? 195 ILE B CA  1 
ATOM   9398  C C   . ILE C 1 195 ? 84.914  72.435  139.289 1.00 52.90 ? 195 ILE B C   1 
ATOM   9399  O O   . ILE C 1 195 ? 84.413  72.279  140.409 1.00 52.98 ? 195 ILE B O   1 
ATOM   9400  C CB  . ILE C 1 195 ? 85.574  70.025  138.844 1.00 52.89 ? 195 ILE B CB  1 
ATOM   9401  C CG1 . ILE C 1 195 ? 86.482  69.133  137.996 1.00 53.20 ? 195 ILE B CG1 1 
ATOM   9402  C CG2 . ILE C 1 195 ? 84.157  69.869  138.308 1.00 52.79 ? 195 ILE B CG2 1 
ATOM   9403  C CD1 . ILE C 1 195 ? 87.586  68.450  138.765 1.00 54.19 ? 195 ILE B CD1 1 
ATOM   9404  N N   . ILE C 1 196 ? 84.531  73.393  138.449 1.00 52.86 ? 196 ILE B N   1 
ATOM   9405  C CA  . ILE C 1 196 ? 83.449  74.322  138.774 1.00 52.80 ? 196 ILE B CA  1 
ATOM   9406  C C   . ILE C 1 196 ? 82.093  73.655  138.555 1.00 52.84 ? 196 ILE B C   1 
ATOM   9407  O O   . ILE C 1 196 ? 81.216  73.718  139.417 1.00 52.69 ? 196 ILE B O   1 
ATOM   9408  C CB  . ILE C 1 196 ? 83.540  75.625  137.937 1.00 52.77 ? 196 ILE B CB  1 
ATOM   9409  C CG1 . ILE C 1 196 ? 84.926  76.265  138.082 1.00 52.65 ? 196 ILE B CG1 1 
ATOM   9410  C CG2 . ILE C 1 196 ? 82.448  76.607  138.347 1.00 52.73 ? 196 ILE B CG2 1 
ATOM   9411  C CD1 . ILE C 1 196 ? 85.288  77.238  136.975 1.00 52.51 ? 196 ILE B CD1 1 
ATOM   9412  N N   . ASP C 1 197 ? 81.942  73.014  137.396 1.00 53.15 ? 197 ASP B N   1 
ATOM   9413  C CA  . ASP C 1 197 ? 80.691  72.366  136.990 1.00 53.27 ? 197 ASP B CA  1 
ATOM   9414  C C   . ASP C 1 197 ? 80.978  71.271  135.960 1.00 53.06 ? 197 ASP B C   1 
ATOM   9415  O O   . ASP C 1 197 ? 81.944  71.372  135.206 1.00 53.23 ? 197 ASP B O   1 
ATOM   9416  C CB  . ASP C 1 197 ? 79.730  73.415  136.413 1.00 53.33 ? 197 ASP B CB  1 
ATOM   9417  C CG  . ASP C 1 197 ? 78.382  72.836  136.019 1.00 54.25 ? 197 ASP B CG  1 
ATOM   9418  O OD1 . ASP C 1 197 ? 77.959  71.809  136.596 1.00 54.89 ? 197 ASP B OD1 1 
ATOM   9419  O OD2 . ASP C 1 197 ? 77.737  73.422  135.124 1.00 55.50 ? 197 ASP B OD2 1 
ATOM   9420  N N   . SER C 1 198 ? 80.151  70.226  135.948 1.00 52.93 ? 198 SER B N   1 
ATOM   9421  C CA  . SER C 1 198 ? 80.237  69.153  134.938 1.00 52.80 ? 198 SER B CA  1 
ATOM   9422  C C   . SER C 1 198 ? 78.868  68.820  134.347 1.00 52.51 ? 198 SER B C   1 
ATOM   9423  O O   . SER C 1 198 ? 77.871  68.741  135.068 1.00 52.36 ? 198 SER B O   1 
ATOM   9424  C CB  . SER C 1 198 ? 80.856  67.878  135.521 1.00 52.85 ? 198 SER B CB  1 
ATOM   9425  O OG  . SER C 1 198 ? 82.271  67.913  135.480 1.00 53.16 ? 198 SER B OG  1 
ATOM   9426  N N   . TRP C 1 199 ? 78.839  68.618  133.031 1.00 52.26 ? 199 TRP B N   1 
ATOM   9427  C CA  . TRP C 1 199 ? 77.611  68.294  132.306 1.00 51.90 ? 199 TRP B CA  1 
ATOM   9428  C C   . TRP C 1 199 ? 77.891  67.327  131.160 1.00 51.83 ? 199 TRP B C   1 
ATOM   9429  O O   . TRP C 1 199 ? 79.029  67.207  130.699 1.00 51.78 ? 199 TRP B O   1 
ATOM   9430  C CB  . TRP C 1 199 ? 76.937  69.563  131.771 1.00 51.63 ? 199 TRP B CB  1 
ATOM   9431  C CG  . TRP C 1 199 ? 77.736  70.285  130.726 1.00 51.45 ? 199 TRP B CG  1 
ATOM   9432  C CD1 . TRP C 1 199 ? 77.599  70.187  129.370 1.00 51.04 ? 199 TRP B CD1 1 
ATOM   9433  C CD2 . TRP C 1 199 ? 78.794  71.223  130.954 1.00 51.53 ? 199 TRP B CD2 1 
ATOM   9434  N NE1 . TRP C 1 199 ? 78.506  71.004  128.738 1.00 50.67 ? 199 TRP B NE1 1 
ATOM   9435  C CE2 . TRP C 1 199 ? 79.251  71.653  129.687 1.00 51.34 ? 199 TRP B CE2 1 
ATOM   9436  C CE3 . TRP C 1 199 ? 79.401  71.743  132.107 1.00 51.01 ? 199 TRP B CE3 1 
ATOM   9437  C CZ2 . TRP C 1 199 ? 80.287  72.580  129.540 1.00 51.57 ? 199 TRP B CZ2 1 
ATOM   9438  C CZ3 . TRP C 1 199 ? 80.433  72.658  131.959 1.00 51.19 ? 199 TRP B CZ3 1 
ATOM   9439  C CH2 . TRP C 1 199 ? 80.865  73.069  130.684 1.00 51.37 ? 199 TRP B CH2 1 
ATOM   9440  N N   . PHE C 1 200 ? 76.839  66.645  130.714 1.00 51.82 ? 200 PHE B N   1 
ATOM   9441  C CA  . PHE C 1 200 ? 76.902  65.741  129.572 1.00 51.62 ? 200 PHE B CA  1 
ATOM   9442  C C   . PHE C 1 200 ? 76.515  66.477  128.292 1.00 51.66 ? 200 PHE B C   1 
ATOM   9443  O O   . PHE C 1 200 ? 75.417  67.019  128.185 1.00 51.68 ? 200 PHE B O   1 
ATOM   9444  C CB  . PHE C 1 200 ? 75.979  64.534  129.797 1.00 51.38 ? 200 PHE B CB  1 
ATOM   9445  C CG  . PHE C 1 200 ? 76.147  63.438  128.780 1.00 50.93 ? 200 PHE B CG  1 
ATOM   9446  C CD1 . PHE C 1 200 ? 77.162  62.493  128.916 1.00 50.37 ? 200 PHE B CD1 1 
ATOM   9447  C CD2 . PHE C 1 200 ? 75.287  63.346  127.687 1.00 50.88 ? 200 PHE B CD2 1 
ATOM   9448  C CE1 . PHE C 1 200 ? 77.322  61.475  127.974 1.00 50.48 ? 200 PHE B CE1 1 
ATOM   9449  C CE2 . PHE C 1 200 ? 75.439  62.328  126.736 1.00 50.59 ? 200 PHE B CE2 1 
ATOM   9450  C CZ  . PHE C 1 200 ? 76.456  61.392  126.881 1.00 50.41 ? 200 PHE B CZ  1 
ATOM   9451  N N   . ASP C 1 201 ? 77.439  66.510  127.337 1.00 51.86 ? 201 ASP B N   1 
ATOM   9452  C CA  . ASP C 1 201 ? 77.165  66.995  125.992 1.00 52.06 ? 201 ASP B CA  1 
ATOM   9453  C C   . ASP C 1 201 ? 76.837  65.785  125.131 1.00 52.10 ? 201 ASP B C   1 
ATOM   9454  O O   . ASP C 1 201 ? 77.586  64.803  125.108 1.00 51.93 ? 201 ASP B O   1 
ATOM   9455  C CB  . ASP C 1 201 ? 78.385  67.732  125.432 1.00 52.19 ? 201 ASP B CB  1 
ATOM   9456  C CG  . ASP C 1 201 ? 78.145  68.326  124.045 1.00 53.01 ? 201 ASP B CG  1 
ATOM   9457  O OD1 . ASP C 1 201 ? 77.747  67.595  123.107 1.00 52.67 ? 201 ASP B OD1 1 
ATOM   9458  O OD2 . ASP C 1 201 ? 78.388  69.543  123.888 1.00 54.70 ? 201 ASP B OD2 1 
ATOM   9459  N N   . ASN C 1 202 ? 75.715  65.869  124.423 1.00 52.24 ? 202 ASN B N   1 
ATOM   9460  C CA  . ASN C 1 202 ? 75.246  64.792  123.557 1.00 52.34 ? 202 ASN B CA  1 
ATOM   9461  C C   . ASN C 1 202 ? 76.283  64.289  122.547 1.00 52.54 ? 202 ASN B C   1 
ATOM   9462  O O   . ASN C 1 202 ? 76.337  63.091  122.256 1.00 52.78 ? 202 ASN B O   1 
ATOM   9463  C CB  . ASN C 1 202 ? 73.972  65.222  122.831 1.00 52.30 ? 202 ASN B CB  1 
ATOM   9464  C CG  . ASN C 1 202 ? 72.811  65.469  123.780 1.00 52.41 ? 202 ASN B CG  1 
ATOM   9465  O OD1 . ASN C 1 202 ? 72.459  64.611  124.593 1.00 52.55 ? 202 ASN B OD1 1 
ATOM   9466  N ND2 . ASN C 1 202 ? 72.204  66.646  123.672 1.00 52.12 ? 202 ASN B ND2 1 
ATOM   9467  N N   . TYR C 1 203 ? 77.105  65.201  122.029 1.00 52.58 ? 203 TYR B N   1 
ATOM   9468  C CA  . TYR C 1 203 ? 78.103  64.866  121.010 1.00 52.55 ? 203 TYR B CA  1 
ATOM   9469  C C   . TYR C 1 203 ? 79.511  64.736  121.593 1.00 52.53 ? 203 TYR B C   1 
ATOM   9470  O O   . TYR C 1 203 ? 80.243  63.803  121.264 1.00 52.50 ? 203 TYR B O   1 
ATOM   9471  C CB  . TYR C 1 203 ? 78.075  65.907  119.884 1.00 52.58 ? 203 TYR B CB  1 
ATOM   9472  C CG  . TYR C 1 203 ? 79.092  65.687  118.782 1.00 52.81 ? 203 TYR B CG  1 
ATOM   9473  C CD1 . TYR C 1 203 ? 78.895  64.710  117.799 1.00 52.64 ? 203 TYR B CD1 1 
ATOM   9474  C CD2 . TYR C 1 203 ? 80.243  66.472  118.707 1.00 52.77 ? 203 TYR B CD2 1 
ATOM   9475  C CE1 . TYR C 1 203 ? 79.829  64.514  116.781 1.00 52.33 ? 203 TYR B CE1 1 
ATOM   9476  C CE2 . TYR C 1 203 ? 81.178  66.284  117.699 1.00 52.94 ? 203 TYR B CE2 1 
ATOM   9477  C CZ  . TYR C 1 203 ? 80.965  65.305  116.739 1.00 52.67 ? 203 TYR B CZ  1 
ATOM   9478  O OH  . TYR C 1 203 ? 81.897  65.127  115.743 1.00 52.88 ? 203 TYR B OH  1 
ATOM   9479  N N   . LEU C 1 204 ? 79.878  65.673  122.459 1.00 52.56 ? 204 LEU B N   1 
ATOM   9480  C CA  . LEU C 1 204 ? 81.211  65.716  123.052 1.00 52.60 ? 204 LEU B CA  1 
ATOM   9481  C C   . LEU C 1 204 ? 81.391  64.734  124.206 1.00 52.74 ? 204 LEU B C   1 
ATOM   9482  O O   . LEU C 1 204 ? 82.522  64.401  124.560 1.00 52.83 ? 204 LEU B O   1 
ATOM   9483  C CB  . LEU C 1 204 ? 81.516  67.136  123.538 1.00 52.66 ? 204 LEU B CB  1 
ATOM   9484  C CG  . LEU C 1 204 ? 82.257  68.175  122.682 1.00 52.51 ? 204 LEU B CG  1 
ATOM   9485  C CD1 . LEU C 1 204 ? 82.289  67.862  121.194 1.00 52.13 ? 204 LEU B CD1 1 
ATOM   9486  C CD2 . LEU C 1 204 ? 81.663  69.559  122.933 1.00 52.45 ? 204 LEU B CD2 1 
ATOM   9487  N N   . GLY C 1 205 ? 80.284  64.273  124.787 1.00 52.92 ? 205 GLY B N   1 
ATOM   9488  C CA  . GLY C 1 205 ? 80.324  63.417  125.975 1.00 52.97 ? 205 GLY B CA  1 
ATOM   9489  C C   . GLY C 1 205 ? 80.380  64.278  127.221 1.00 53.15 ? 205 GLY B C   1 
ATOM   9490  O O   . GLY C 1 205 ? 79.840  65.382  127.236 1.00 53.24 ? 205 GLY B O   1 
ATOM   9491  N N   . VAL C 1 206 ? 81.043  63.788  128.264 1.00 53.28 ? 206 VAL B N   1 
ATOM   9492  C CA  . VAL C 1 206 ? 81.180  64.553  129.505 1.00 53.33 ? 206 VAL B CA  1 
ATOM   9493  C C   . VAL C 1 206 ? 82.120  65.744  129.314 1.00 53.52 ? 206 VAL B C   1 
ATOM   9494  O O   . VAL C 1 206 ? 83.232  65.591  128.793 1.00 53.57 ? 206 VAL B O   1 
ATOM   9495  C CB  . VAL C 1 206 ? 81.652  63.665  130.677 1.00 53.23 ? 206 VAL B CB  1 
ATOM   9496  C CG1 . VAL C 1 206 ? 81.968  64.503  131.900 1.00 53.34 ? 206 VAL B CG1 1 
ATOM   9497  C CG2 . VAL C 1 206 ? 80.584  62.648  131.022 1.00 53.34 ? 206 VAL B CG2 1 
ATOM   9498  N N   . VAL C 1 207 ? 81.645  66.925  129.719 1.00 53.71 ? 207 VAL B N   1 
ATOM   9499  C CA  . VAL C 1 207 ? 82.411  68.174  129.633 1.00 53.98 ? 207 VAL B CA  1 
ATOM   9500  C C   . VAL C 1 207 ? 82.418  68.861  130.995 1.00 54.36 ? 207 VAL B C   1 
ATOM   9501  O O   . VAL C 1 207 ? 81.366  69.047  131.606 1.00 54.57 ? 207 VAL B O   1 
ATOM   9502  C CB  . VAL C 1 207 ? 81.837  69.160  128.568 1.00 53.78 ? 207 VAL B CB  1 
ATOM   9503  C CG1 . VAL C 1 207 ? 82.777  70.328  128.348 1.00 53.30 ? 207 VAL B CG1 1 
ATOM   9504  C CG2 . VAL C 1 207 ? 81.585  68.461  127.247 1.00 53.83 ? 207 VAL B CG2 1 
ATOM   9505  N N   . SER C 1 208 ? 83.606  69.237  131.462 1.00 54.74 ? 208 SER B N   1 
ATOM   9506  C CA  . SER C 1 208 ? 83.754  69.891  132.761 1.00 55.03 ? 208 SER B CA  1 
ATOM   9507  C C   . SER C 1 208 ? 84.305  71.299  132.609 1.00 55.25 ? 208 SER B C   1 
ATOM   9508  O O   . SER C 1 208 ? 85.184  71.533  131.782 1.00 55.46 ? 208 SER B O   1 
ATOM   9509  C CB  . SER C 1 208 ? 84.685  69.083  133.666 1.00 54.99 ? 208 SER B CB  1 
ATOM   9510  O OG  . SER C 1 208 ? 84.268  67.731  133.751 1.00 55.03 ? 208 SER B OG  1 
ATOM   9511  N N   . LEU C 1 209 ? 83.779  72.229  133.406 1.00 55.51 ? 209 LEU B N   1 
ATOM   9512  C CA  . LEU C 1 209 ? 84.324  73.586  133.503 1.00 55.57 ? 209 LEU B CA  1 
ATOM   9513  C C   . LEU C 1 209 ? 85.356  73.654  134.632 1.00 55.69 ? 209 LEU B C   1 
ATOM   9514  O O   . LEU C 1 209 ? 85.174  73.055  135.702 1.00 55.74 ? 209 LEU B O   1 
ATOM   9515  C CB  . LEU C 1 209 ? 83.211  74.606  133.729 1.00 55.58 ? 209 LEU B CB  1 
ATOM   9516  C CG  . LEU C 1 209 ? 83.599  76.075  133.558 1.00 55.85 ? 209 LEU B CG  1 
ATOM   9517  C CD1 . LEU C 1 209 ? 83.836  76.412  132.093 1.00 56.25 ? 209 LEU B CD1 1 
ATOM   9518  C CD2 . LEU C 1 209 ? 82.531  76.976  134.150 1.00 55.97 ? 209 LEU B CD2 1 
ATOM   9519  N N   . ILE C 1 210 ? 86.426  74.406  134.390 1.00 55.68 ? 210 ILE B N   1 
ATOM   9520  C CA  . ILE C 1 210 ? 87.652  74.295  135.174 1.00 55.60 ? 210 ILE B CA  1 
ATOM   9521  C C   . ILE C 1 210 ? 88.298  75.641  135.482 1.00 55.42 ? 210 ILE B C   1 
ATOM   9522  O O   . ILE C 1 210 ? 88.258  76.560  134.661 1.00 55.27 ? 210 ILE B O   1 
ATOM   9523  C CB  . ILE C 1 210 ? 88.668  73.416  134.418 1.00 55.59 ? 210 ILE B CB  1 
ATOM   9524  C CG1 . ILE C 1 210 ? 88.454  71.948  134.752 1.00 55.78 ? 210 ILE B CG1 1 
ATOM   9525  C CG2 . ILE C 1 210 ? 90.100  73.787  134.751 1.00 56.18 ? 210 ILE B CG2 1 
ATOM   9526  C CD1 . ILE C 1 210 ? 89.304  71.052  133.883 1.00 57.36 ? 210 ILE B CD1 1 
ATOM   9527  N N   . ARG C 1 211 ? 88.896  75.737  136.670 1.00 55.26 ? 211 ARG B N   1 
ATOM   9528  C CA  . ARG C 1 211 ? 89.760  76.858  137.028 1.00 55.13 ? 211 ARG B CA  1 
ATOM   9529  C C   . ARG C 1 211 ? 91.162  76.354  137.366 1.00 54.95 ? 211 ARG B C   1 
ATOM   9530  O O   . ARG C 1 211 ? 91.334  75.558  138.290 1.00 54.88 ? 211 ARG B O   1 
ATOM   9531  C CB  . ARG C 1 211 ? 89.184  77.627  138.217 1.00 55.03 ? 211 ARG B CB  1 
ATOM   9532  C CG  . ARG C 1 211 ? 89.549  79.111  138.251 1.00 55.36 ? 211 ARG B CG  1 
ATOM   9533  C CD  . ARG C 1 211 ? 90.997  79.396  138.632 1.00 54.50 ? 211 ARG B CD  1 
ATOM   9534  N NE  . ARG C 1 211 ? 91.094  80.694  139.290 1.00 54.87 ? 211 ARG B NE  1 
ATOM   9535  C CZ  . ARG C 1 211 ? 92.220  81.247  139.733 1.00 55.97 ? 211 ARG B CZ  1 
ATOM   9536  N NH1 . ARG C 1 211 ? 93.393  80.637  139.591 1.00 56.47 ? 211 ARG B NH1 1 
ATOM   9537  N NH2 . ARG C 1 211 ? 92.172  82.432  140.320 1.00 56.78 ? 211 ARG B NH2 1 
ATOM   9538  N N   . ILE C 1 212 ? 92.158  76.819  136.618 1.00 54.75 ? 212 ILE B N   1 
ATOM   9539  C CA  . ILE C 1 212 ? 93.545  76.452  136.892 1.00 54.68 ? 212 ILE B CA  1 
ATOM   9540  C C   . ILE C 1 212 ? 94.082  77.326  138.026 1.00 54.70 ? 212 ILE B C   1 
ATOM   9541  O O   . ILE C 1 212 ? 94.389  78.503  137.825 1.00 54.90 ? 212 ILE B O   1 
ATOM   9542  C CB  . ILE C 1 212 ? 94.463  76.583  135.636 1.00 54.63 ? 212 ILE B CB  1 
ATOM   9543  C CG1 . ILE C 1 212 ? 93.769  76.058  134.367 1.00 54.32 ? 212 ILE B CG1 1 
ATOM   9544  C CG2 . ILE C 1 212 ? 95.822  75.913  135.884 1.00 54.39 ? 212 ILE B CG2 1 
ATOM   9545  C CD1 . ILE C 1 212 ? 93.719  74.544  134.224 1.00 53.76 ? 212 ILE B CD1 1 
ATOM   9546  N N   . LYS C 1 213 ? 94.173  76.751  139.220 1.00 54.53 ? 213 LYS B N   1 
ATOM   9547  C CA  . LYS C 1 213 ? 94.708  77.467  140.375 1.00 54.37 ? 213 LYS B CA  1 
ATOM   9548  C C   . LYS C 1 213 ? 96.226  77.400  140.378 1.00 54.08 ? 213 LYS B C   1 
ATOM   9549  O O   . LYS C 1 213 ? 96.894  78.350  140.775 1.00 53.97 ? 213 LYS B O   1 
ATOM   9550  C CB  . LYS C 1 213 ? 94.153  76.886  141.676 1.00 54.46 ? 213 LYS B CB  1 
ATOM   9551  C CG  . LYS C 1 213 ? 92.685  77.169  141.910 1.00 55.16 ? 213 LYS B CG  1 
ATOM   9552  C CD  . LYS C 1 213 ? 92.469  78.345  142.852 1.00 56.75 ? 213 LYS B CD  1 
ATOM   9553  C CE  . LYS C 1 213 ? 90.985  78.502  143.182 1.00 57.33 ? 213 LYS B CE  1 
ATOM   9554  N NZ  . LYS C 1 213 ? 90.757  79.095  144.534 1.00 57.56 ? 213 LYS B NZ  1 
ATOM   9555  N N   . ASN C 1 214 ? 96.753  76.263  139.939 1.00 53.90 ? 214 ASN B N   1 
ATOM   9556  C CA  . ASN C 1 214 ? 98.186  76.031  139.857 1.00 54.02 ? 214 ASN B CA  1 
ATOM   9557  C C   . ASN C 1 214 ? 98.543  75.188  138.645 1.00 53.86 ? 214 ASN B C   1 
ATOM   9558  O O   . ASN C 1 214 ? 97.772  74.321  138.236 1.00 53.94 ? 214 ASN B O   1 
ATOM   9559  C CB  . ASN C 1 214 ? 98.701  75.345  141.127 1.00 54.21 ? 214 ASN B CB  1 
ATOM   9560  C CG  . ASN C 1 214 ? 99.553  76.264  141.989 1.00 54.66 ? 214 ASN B CG  1 
ATOM   9561  O OD1 . ASN C 1 214 ? 99.125  77.354  142.378 1.00 55.26 ? 214 ASN B OD1 1 
ATOM   9562  N ND2 . ASN C 1 214 ? 100.770 75.820  142.299 1.00 54.98 ? 214 ASN B ND2 1 
ATOM   9563  N N   . GLY C 1 215 ? 99.713  75.452  138.074 1.00 53.63 ? 215 GLY B N   1 
ATOM   9564  C CA  . GLY C 1 215 ? 100.222 74.665  136.960 1.00 53.27 ? 215 GLY B CA  1 
ATOM   9565  C C   . GLY C 1 215 ? 99.764  75.131  135.596 1.00 53.04 ? 215 GLY B C   1 
ATOM   9566  O O   . GLY C 1 215 ? 99.302  76.261  135.430 1.00 52.93 ? 215 GLY B O   1 
ATOM   9567  N N   . THR C 1 216 ? 99.912  74.240  134.620 1.00 52.91 ? 216 THR B N   1 
ATOM   9568  C CA  . THR C 1 216 ? 99.551  74.496  133.232 1.00 52.61 ? 216 THR B CA  1 
ATOM   9569  C C   . THR C 1 216 ? 99.025  73.197  132.634 1.00 52.69 ? 216 THR B C   1 
ATOM   9570  O O   . THR C 1 216 ? 99.722  72.180  132.627 1.00 52.70 ? 216 THR B O   1 
ATOM   9571  C CB  . THR C 1 216 ? 100.764 74.979  132.404 1.00 52.46 ? 216 THR B CB  1 
ATOM   9572  O OG1 . THR C 1 216 ? 101.603 75.818  133.208 1.00 52.31 ? 216 THR B OG1 1 
ATOM   9573  C CG2 . THR C 1 216 ? 100.307 75.750  131.177 1.00 52.13 ? 216 THR B CG2 1 
ATOM   9574  N N   . LEU C 1 217 ? 97.789  73.233  132.145 1.00 52.78 ? 217 LEU B N   1 
ATOM   9575  C CA  . LEU C 1 217 ? 97.177  72.082  131.494 1.00 52.68 ? 217 LEU B CA  1 
ATOM   9576  C C   . LEU C 1 217 ? 97.357  72.181  129.983 1.00 52.78 ? 217 LEU B C   1 
ATOM   9577  O O   . LEU C 1 217 ? 96.994  73.188  129.378 1.00 52.86 ? 217 LEU B O   1 
ATOM   9578  C CB  . LEU C 1 217 ? 95.696  72.001  131.866 1.00 52.62 ? 217 LEU B CB  1 
ATOM   9579  C CG  . LEU C 1 217 ? 94.812  70.909  131.259 1.00 52.63 ? 217 LEU B CG  1 
ATOM   9580  C CD1 . LEU C 1 217 ? 95.447  69.526  131.361 1.00 52.57 ? 217 LEU B CD1 1 
ATOM   9581  C CD2 . LEU C 1 217 ? 93.451  70.932  131.933 1.00 52.54 ? 217 LEU B CD2 1 
ATOM   9582  N N   . ARG C 1 218 ? 97.932  71.140  129.385 1.00 52.98 ? 218 ARG B N   1 
ATOM   9583  C CA  . ARG C 1 218 ? 98.147  71.089  127.929 1.00 53.16 ? 218 ARG B CA  1 
ATOM   9584  C C   . ARG C 1 218 ? 97.306  69.976  127.293 1.00 53.22 ? 218 ARG B C   1 
ATOM   9585  O O   . ARG C 1 218 ? 96.640  69.221  128.005 1.00 53.23 ? 218 ARG B O   1 
ATOM   9586  C CB  . ARG C 1 218 ? 99.637  70.921  127.603 1.00 53.11 ? 218 ARG B CB  1 
ATOM   9587  C CG  . ARG C 1 218 ? 100.520 72.040  128.136 1.00 53.09 ? 218 ARG B CG  1 
ATOM   9588  C CD  . ARG C 1 218 ? 101.993 71.654  128.110 1.00 53.50 ? 218 ARG B CD  1 
ATOM   9589  N NE  . ARG C 1 218 ? 102.743 72.315  129.180 1.00 53.73 ? 218 ARG B NE  1 
ATOM   9590  C CZ  . ARG C 1 218 ? 103.323 73.510  129.078 1.00 53.64 ? 218 ARG B CZ  1 
ATOM   9591  N NH1 . ARG C 1 218 ? 103.254 74.198  127.946 1.00 53.99 ? 218 ARG B NH1 1 
ATOM   9592  N NH2 . ARG C 1 218 ? 103.977 74.019  130.114 1.00 53.33 ? 218 ARG B NH2 1 
ATOM   9593  N N   . LYS C 1 219 ? 97.332  69.873  125.965 1.00 53.31 ? 219 LYS B N   1 
ATOM   9594  C CA  . LYS C 1 219 ? 96.434  68.958  125.259 1.00 53.46 ? 219 LYS B CA  1 
ATOM   9595  C C   . LYS C 1 219 ? 96.775  67.475  125.448 1.00 53.71 ? 219 LYS B C   1 
ATOM   9596  O O   . LYS C 1 219 ? 95.941  66.696  125.899 1.00 53.70 ? 219 LYS B O   1 
ATOM   9597  C CB  . LYS C 1 219 ? 96.323  69.312  123.773 1.00 53.39 ? 219 LYS B CB  1 
ATOM   9598  C CG  . LYS C 1 219 ? 94.995  68.891  123.170 1.00 53.27 ? 219 LYS B CG  1 
ATOM   9599  C CD  . LYS C 1 219 ? 94.745  69.482  121.796 1.00 52.76 ? 219 LYS B CD  1 
ATOM   9600  C CE  . LYS C 1 219 ? 93.247  69.640  121.585 1.00 53.30 ? 219 LYS B CE  1 
ATOM   9601  N NZ  . LYS C 1 219 ? 92.803  69.298  120.211 1.00 53.74 ? 219 LYS B NZ  1 
ATOM   9602  N N   . GLY C 1 220 ? 98.000  67.086  125.122 1.00 54.09 ? 220 GLY B N   1 
ATOM   9603  C CA  . GLY C 1 220 ? 98.393  65.678  125.229 1.00 54.56 ? 220 GLY B CA  1 
ATOM   9604  C C   . GLY C 1 220 ? 98.461  65.117  126.644 1.00 54.74 ? 220 GLY B C   1 
ATOM   9605  O O   . GLY C 1 220 ? 98.746  63.930  126.831 1.00 54.79 ? 220 GLY B O   1 
ATOM   9606  N N   . ASP C 1 221 ? 98.186  65.969  127.634 1.00 54.77 ? 221 ASP B N   1 
ATOM   9607  C CA  . ASP C 1 221 ? 98.373  65.629  129.044 1.00 54.82 ? 221 ASP B CA  1 
ATOM   9608  C C   . ASP C 1 221 ? 97.395  64.570  129.534 1.00 54.87 ? 221 ASP B C   1 
ATOM   9609  O O   . ASP C 1 221 ? 96.225  64.571  129.143 1.00 55.04 ? 221 ASP B O   1 
ATOM   9610  C CB  . ASP C 1 221 ? 98.253  66.889  129.913 1.00 54.68 ? 221 ASP B CB  1 
ATOM   9611  C CG  . ASP C 1 221 ? 99.399  67.871  129.694 1.00 54.88 ? 221 ASP B CG  1 
ATOM   9612  O OD1 . ASP C 1 221 ? 100.335 67.558  128.925 1.00 55.15 ? 221 ASP B OD1 1 
ATOM   9613  O OD2 . ASP C 1 221 ? 99.369  68.964  130.298 1.00 54.91 ? 221 ASP B OD2 1 
ATOM   9614  N N   . LYS C 1 222 ? 97.882  63.661  130.376 1.00 54.85 ? 222 LYS B N   1 
ATOM   9615  C CA  . LYS C 1 222 ? 96.992  62.757  131.102 1.00 55.02 ? 222 LYS B CA  1 
ATOM   9616  C C   . LYS C 1 222 ? 96.701  63.287  132.513 1.00 55.03 ? 222 LYS B C   1 
ATOM   9617  O O   . LYS C 1 222 ? 97.601  63.417  133.354 1.00 54.92 ? 222 LYS B O   1 
ATOM   9618  C CB  . LYS C 1 222 ? 97.488  61.299  131.102 1.00 54.91 ? 222 LYS B CB  1 
ATOM   9619  C CG  . LYS C 1 222 ? 98.833  61.047  131.770 1.00 55.25 ? 222 LYS B CG  1 
ATOM   9620  C CD  . LYS C 1 222 ? 99.086  59.552  132.000 1.00 55.26 ? 222 LYS B CD  1 
ATOM   9621  C CE  . LYS C 1 222 ? 99.733  58.884  130.790 1.00 55.50 ? 222 LYS B CE  1 
ATOM   9622  N NZ  . LYS C 1 222 ? 100.060 57.456  131.051 1.00 55.07 ? 222 LYS B NZ  1 
ATOM   9623  N N   . VAL C 1 223 ? 95.429  63.616  132.735 1.00 55.02 ? 223 VAL B N   1 
ATOM   9624  C CA  . VAL C 1 223 ? 94.961  64.219  133.980 1.00 54.99 ? 223 VAL B CA  1 
ATOM   9625  C C   . VAL C 1 223 ? 94.543  63.177  135.018 1.00 54.99 ? 223 VAL B C   1 
ATOM   9626  O O   . VAL C 1 223 ? 94.285  62.019  134.686 1.00 54.94 ? 223 VAL B O   1 
ATOM   9627  C CB  . VAL C 1 223 ? 93.781  65.194  133.736 1.00 55.00 ? 223 VAL B CB  1 
ATOM   9628  C CG1 . VAL C 1 223 ? 94.220  66.371  132.881 1.00 55.16 ? 223 VAL B CG1 1 
ATOM   9629  C CG2 . VAL C 1 223 ? 92.602  64.476  133.093 1.00 54.98 ? 223 VAL B CG2 1 
ATOM   9630  N N   . LYS C 1 224 ? 94.481  63.607  136.275 1.00 54.92 ? 224 LYS B N   1 
ATOM   9631  C CA  . LYS C 1 224 ? 94.056  62.755  137.373 1.00 54.78 ? 224 LYS B CA  1 
ATOM   9632  C C   . LYS C 1 224 ? 92.984  63.474  138.185 1.00 54.76 ? 224 LYS B C   1 
ATOM   9633  O O   . LYS C 1 224 ? 93.191  64.594  138.655 1.00 54.75 ? 224 LYS B O   1 
ATOM   9634  C CB  . LYS C 1 224 ? 95.251  62.390  138.257 1.00 54.79 ? 224 LYS B CB  1 
ATOM   9635  C CG  . LYS C 1 224 ? 94.997  61.234  139.218 1.00 54.84 ? 224 LYS B CG  1 
ATOM   9636  C CD  . LYS C 1 224 ? 96.240  60.899  140.029 1.00 54.69 ? 224 LYS B CD  1 
ATOM   9637  C CE  . LYS C 1 224 ? 95.939  59.852  141.083 1.00 54.61 ? 224 LYS B CE  1 
ATOM   9638  N NZ  . LYS C 1 224 ? 97.152  59.509  141.867 1.00 54.63 ? 224 LYS B NZ  1 
ATOM   9639  N N   . VAL C 1 225 ? 91.832  62.830  138.326 1.00 54.79 ? 225 VAL B N   1 
ATOM   9640  C CA  . VAL C 1 225 ? 90.754  63.351  139.155 1.00 54.93 ? 225 VAL B CA  1 
ATOM   9641  C C   . VAL C 1 225 ? 91.009  62.863  140.580 1.00 55.07 ? 225 VAL B C   1 
ATOM   9642  O O   . VAL C 1 225 ? 90.784  61.694  140.894 1.00 55.09 ? 225 VAL B O   1 
ATOM   9643  C CB  . VAL C 1 225 ? 89.364  62.893  138.646 1.00 54.90 ? 225 VAL B CB  1 
ATOM   9644  C CG1 . VAL C 1 225 ? 88.249  63.614  139.396 1.00 54.81 ? 225 VAL B CG1 1 
ATOM   9645  C CG2 . VAL C 1 225 ? 89.230  63.127  137.144 1.00 54.83 ? 225 VAL B CG2 1 
ATOM   9646  N N   . MET C 1 226 ? 91.477  63.772  141.432 1.00 55.27 ? 226 MET B N   1 
ATOM   9647  C CA  . MET C 1 226 ? 92.065  63.413  142.731 1.00 55.44 ? 226 MET B CA  1 
ATOM   9648  C C   . MET C 1 226 ? 91.194  62.565  143.680 1.00 55.93 ? 226 MET B C   1 
ATOM   9649  O O   . MET C 1 226 ? 91.735  61.822  144.502 1.00 55.89 ? 226 MET B O   1 
ATOM   9650  C CB  . MET C 1 226 ? 92.624  64.657  143.440 1.00 55.40 ? 226 MET B CB  1 
ATOM   9651  C CG  . MET C 1 226 ? 93.788  65.311  142.690 1.00 55.19 ? 226 MET B CG  1 
ATOM   9652  S SD  . MET C 1 226 ? 94.754  66.531  143.611 1.00 54.65 ? 226 MET B SD  1 
ATOM   9653  C CE  . MET C 1 226 ? 95.773  65.483  144.647 1.00 54.74 ? 226 MET B CE  1 
ATOM   9654  N N   . SER C 1 227 ? 89.868  62.656  143.556 1.00 56.37 ? 227 SER B N   1 
ATOM   9655  C CA  . SER C 1 227 ? 88.957  61.824  144.358 1.00 56.77 ? 227 SER B CA  1 
ATOM   9656  C C   . SER C 1 227 ? 88.947  60.381  143.877 1.00 56.95 ? 227 SER B C   1 
ATOM   9657  O O   . SER C 1 227 ? 89.175  59.459  144.659 1.00 56.97 ? 227 SER B O   1 
ATOM   9658  C CB  . SER C 1 227 ? 87.526  62.363  144.316 1.00 56.80 ? 227 SER B CB  1 
ATOM   9659  O OG  . SER C 1 227 ? 87.474  63.709  144.739 1.00 57.37 ? 227 SER B OG  1 
ATOM   9660  N N   . THR C 1 228 ? 88.668  60.200  142.587 1.00 57.14 ? 228 THR B N   1 
ATOM   9661  C CA  . THR C 1 228 ? 88.564  58.875  141.986 1.00 57.36 ? 228 THR B CA  1 
ATOM   9662  C C   . THR C 1 228 ? 89.931  58.224  141.753 1.00 57.29 ? 228 THR B C   1 
ATOM   9663  O O   . THR C 1 228 ? 90.036  56.998  141.686 1.00 57.26 ? 228 THR B O   1 
ATOM   9664  C CB  . THR C 1 228 ? 87.722  58.896  140.676 1.00 57.43 ? 228 THR B CB  1 
ATOM   9665  O OG1 . THR C 1 228 ? 87.721  57.595  140.074 1.00 58.49 ? 228 THR B OG1 1 
ATOM   9666  C CG2 . THR C 1 228 ? 88.262  59.892  139.673 1.00 57.58 ? 228 THR B CG2 1 
ATOM   9667  N N   . GLY C 1 229 ? 90.970  59.049  141.639 1.00 57.35 ? 229 GLY B N   1 
ATOM   9668  C CA  . GLY C 1 229 ? 92.318  58.569  141.349 1.00 57.33 ? 229 GLY B CA  1 
ATOM   9669  C C   . GLY C 1 229 ? 92.507  58.169  139.895 1.00 57.38 ? 229 GLY B C   1 
ATOM   9670  O O   . GLY C 1 229 ? 93.639  58.026  139.431 1.00 57.44 ? 229 GLY B O   1 
ATOM   9671  N N   . GLN C 1 230 ? 91.396  57.997  139.177 1.00 57.41 ? 230 GLN B N   1 
ATOM   9672  C CA  . GLN C 1 230 ? 91.411  57.537  137.785 1.00 57.47 ? 230 GLN B CA  1 
ATOM   9673  C C   . GLN C 1 230 ? 91.907  58.601  136.814 1.00 57.36 ? 230 GLN B C   1 
ATOM   9674  O O   . GLN C 1 230 ? 91.735  59.799  137.054 1.00 57.40 ? 230 GLN B O   1 
ATOM   9675  C CB  . GLN C 1 230 ? 90.030  57.036  137.362 1.00 57.53 ? 230 GLN B CB  1 
ATOM   9676  C CG  . GLN C 1 230 ? 89.754  55.593  137.764 1.00 57.83 ? 230 GLN B CG  1 
ATOM   9677  C CD  . GLN C 1 230 ? 88.874  54.863  136.764 1.00 58.37 ? 230 GLN B CD  1 
ATOM   9678  O OE1 . GLN C 1 230 ? 88.623  55.351  135.659 1.00 58.60 ? 230 GLN B OE1 1 
ATOM   9679  N NE2 . GLN C 1 230 ? 88.405  53.680  137.145 1.00 58.65 ? 230 GLN B NE2 1 
ATOM   9680  N N   . THR C 1 231 ? 92.518  58.152  135.717 1.00 57.18 ? 231 THR B N   1 
ATOM   9681  C CA  . THR C 1 231 ? 93.186  59.058  134.777 1.00 57.07 ? 231 THR B CA  1 
ATOM   9682  C C   . THR C 1 231 ? 92.595  59.032  133.365 1.00 56.93 ? 231 THR B C   1 
ATOM   9683  O O   . THR C 1 231 ? 92.111  58.000  132.899 1.00 56.89 ? 231 THR B O   1 
ATOM   9684  C CB  . THR C 1 231 ? 94.712  58.804  134.706 1.00 57.06 ? 231 THR B CB  1 
ATOM   9685  O OG1 . THR C 1 231 ? 94.961  57.498  134.175 1.00 57.12 ? 231 THR B OG1 1 
ATOM   9686  C CG2 . THR C 1 231 ? 95.356  58.934  136.087 1.00 56.99 ? 231 THR B CG2 1 
ATOM   9687  N N   . TYR C 1 232 ? 92.644  60.184  132.698 1.00 56.72 ? 232 TYR B N   1 
ATOM   9688  C CA  . TYR C 1 232 ? 92.057  60.359  131.375 1.00 56.58 ? 232 TYR B CA  1 
ATOM   9689  C C   . TYR C 1 232 ? 92.952  61.266  130.529 1.00 56.52 ? 232 TYR B C   1 
ATOM   9690  O O   . TYR C 1 232 ? 93.614  62.155  131.066 1.00 56.59 ? 232 TYR B O   1 
ATOM   9691  C CB  . TYR C 1 232 ? 90.657  60.981  131.494 1.00 56.60 ? 232 TYR B CB  1 
ATOM   9692  C CG  . TYR C 1 232 ? 89.760  60.350  132.542 1.00 56.48 ? 232 TYR B CG  1 
ATOM   9693  C CD1 . TYR C 1 232 ? 89.692  60.873  133.831 1.00 56.21 ? 232 TYR B CD1 1 
ATOM   9694  C CD2 . TYR C 1 232 ? 88.978  59.232  132.243 1.00 56.65 ? 232 TYR B CD2 1 
ATOM   9695  C CE1 . TYR C 1 232 ? 88.875  60.300  134.794 1.00 56.40 ? 232 TYR B CE1 1 
ATOM   9696  C CE2 . TYR C 1 232 ? 88.156  58.651  133.200 1.00 56.42 ? 232 TYR B CE2 1 
ATOM   9697  C CZ  . TYR C 1 232 ? 88.110  59.191  134.473 1.00 56.55 ? 232 TYR B CZ  1 
ATOM   9698  O OH  . TYR C 1 232 ? 87.303  58.625  135.433 1.00 56.67 ? 232 TYR B OH  1 
ATOM   9699  N N   . ASN C 1 233 ? 92.980  61.036  129.215 1.00 56.34 ? 233 ASN B N   1 
ATOM   9700  C CA  . ASN C 1 233 ? 93.718  61.909  128.293 1.00 56.23 ? 233 ASN B CA  1 
ATOM   9701  C C   . ASN C 1 233 ? 92.926  63.176  128.001 1.00 56.00 ? 233 ASN B C   1 
ATOM   9702  O O   . ASN C 1 233 ? 91.734  63.106  127.704 1.00 56.10 ? 233 ASN B O   1 
ATOM   9703  C CB  . ASN C 1 233 ? 94.050  61.186  126.977 1.00 56.28 ? 233 ASN B CB  1 
ATOM   9704  C CG  . ASN C 1 233 ? 95.347  60.379  127.049 1.00 56.61 ? 233 ASN B CG  1 
ATOM   9705  O OD1 . ASN C 1 233 ? 96.325  60.795  127.676 1.00 57.17 ? 233 ASN B OD1 1 
ATOM   9706  N ND2 . ASN C 1 233 ? 95.361  59.225  126.389 1.00 56.63 ? 233 ASN B ND2 1 
ATOM   9707  N N   . ALA C 1 234 ? 93.586  64.331  128.085 1.00 55.63 ? 234 ALA B N   1 
ATOM   9708  C CA  . ALA C 1 234 ? 92.938  65.609  127.787 1.00 55.22 ? 234 ALA B CA  1 
ATOM   9709  C C   . ALA C 1 234 ? 92.712  65.758  126.280 1.00 54.98 ? 234 ALA B C   1 
ATOM   9710  O O   . ALA C 1 234 ? 93.453  66.461  125.595 1.00 54.81 ? 234 ALA B O   1 
ATOM   9711  C CB  . ALA C 1 234 ? 93.755  66.771  128.341 1.00 55.12 ? 234 ALA B CB  1 
ATOM   9712  N N   . ASP C 1 235 ? 91.674  65.088  125.779 1.00 54.73 ? 235 ASP B N   1 
ATOM   9713  C CA  . ASP C 1 235 ? 91.396  65.032  124.347 1.00 54.55 ? 235 ASP B CA  1 
ATOM   9714  C C   . ASP C 1 235 ? 91.254  66.427  123.750 1.00 54.32 ? 235 ASP B C   1 
ATOM   9715  O O   . ASP C 1 235 ? 92.025  66.808  122.866 1.00 54.38 ? 235 ASP B O   1 
ATOM   9716  C CB  . ASP C 1 235 ? 90.146  64.188  124.063 1.00 54.71 ? 235 ASP B CB  1 
ATOM   9717  C CG  . ASP C 1 235 ? 90.247  62.771  124.623 1.00 55.19 ? 235 ASP B CG  1 
ATOM   9718  O OD1 . ASP C 1 235 ? 91.373  62.233  124.730 1.00 55.71 ? 235 ASP B OD1 1 
ATOM   9719  O OD2 . ASP C 1 235 ? 89.187  62.193  124.952 1.00 55.67 ? 235 ASP B OD2 1 
ATOM   9720  N N   . ARG C 1 236 ? 90.281  67.188  124.246 1.00 53.98 ? 236 ARG B N   1 
ATOM   9721  C CA  . ARG C 1 236 ? 90.077  68.571  123.810 1.00 53.61 ? 236 ARG B CA  1 
ATOM   9722  C C   . ARG C 1 236 ? 89.859  69.509  124.997 1.00 53.38 ? 236 ARG B C   1 
ATOM   9723  O O   . ARG C 1 236 ? 89.520  69.066  126.094 1.00 53.41 ? 236 ARG B O   1 
ATOM   9724  C CB  . ARG C 1 236 ? 88.917  68.666  122.813 1.00 53.57 ? 236 ARG B CB  1 
ATOM   9725  C CG  . ARG C 1 236 ? 89.248  68.136  121.418 1.00 52.92 ? 236 ARG B CG  1 
ATOM   9726  C CD  . ARG C 1 236 ? 88.007  68.002  120.553 1.00 51.89 ? 236 ARG B CD  1 
ATOM   9727  N NE  . ARG C 1 236 ? 87.356  69.290  120.329 1.00 51.46 ? 236 ARG B NE  1 
ATOM   9728  C CZ  . ARG C 1 236 ? 86.167  69.448  119.756 1.00 51.11 ? 236 ARG B CZ  1 
ATOM   9729  N NH1 . ARG C 1 236 ? 85.473  68.400  119.338 1.00 51.33 ? 236 ARG B NH1 1 
ATOM   9730  N NH2 . ARG C 1 236 ? 85.667  70.664  119.600 1.00 51.00 ? 236 ARG B NH2 1 
ATOM   9731  N N   . LEU C 1 237 ? 90.076  70.801  124.766 1.00 53.26 ? 237 LEU B N   1 
ATOM   9732  C CA  . LEU C 1 237 ? 89.964  71.832  125.804 1.00 53.13 ? 237 LEU B CA  1 
ATOM   9733  C C   . LEU C 1 237 ? 89.931  73.225  125.181 1.00 53.04 ? 237 LEU B C   1 
ATOM   9734  O O   . LEU C 1 237 ? 90.507  73.452  124.110 1.00 52.89 ? 237 LEU B O   1 
ATOM   9735  C CB  . LEU C 1 237 ? 91.119  71.733  126.819 1.00 53.20 ? 237 LEU B CB  1 
ATOM   9736  C CG  . LEU C 1 237 ? 92.566  71.974  126.374 1.00 52.97 ? 237 LEU B CG  1 
ATOM   9737  C CD1 . LEU C 1 237 ? 92.957  73.407  126.616 1.00 53.25 ? 237 LEU B CD1 1 
ATOM   9738  C CD2 . LEU C 1 237 ? 93.509  71.063  127.125 1.00 53.37 ? 237 LEU B CD2 1 
ATOM   9739  N N   . GLY C 1 238 ? 89.262  74.154  125.858 1.00 52.84 ? 238 GLY B N   1 
ATOM   9740  C CA  . GLY C 1 238 ? 89.192  75.528  125.377 1.00 52.73 ? 238 GLY B CA  1 
ATOM   9741  C C   . GLY C 1 238 ? 88.413  76.453  126.279 1.00 52.58 ? 238 GLY B C   1 
ATOM   9742  O O   . GLY C 1 238 ? 88.288  76.195  127.473 1.00 52.68 ? 238 GLY B O   1 
ATOM   9743  N N   . ILE C 1 239 ? 87.883  77.526  125.693 1.00 52.52 ? 239 ILE B N   1 
ATOM   9744  C CA  . ILE C 1 239 ? 87.115  78.538  126.422 1.00 52.40 ? 239 ILE B CA  1 
ATOM   9745  C C   . ILE C 1 239 ? 85.801  78.886  125.725 1.00 52.36 ? 239 ILE B C   1 
ATOM   9746  O O   . ILE C 1 239 ? 85.663  78.692  124.518 1.00 52.22 ? 239 ILE B O   1 
ATOM   9747  C CB  . ILE C 1 239 ? 87.931  79.838  126.620 1.00 52.38 ? 239 ILE B CB  1 
ATOM   9748  C CG1 . ILE C 1 239 ? 88.430  80.379  125.273 1.00 52.33 ? 239 ILE B CG1 1 
ATOM   9749  C CG2 . ILE C 1 239 ? 89.088  79.599  127.581 1.00 52.31 ? 239 ILE B CG2 1 
ATOM   9750  C CD1 . ILE C 1 239 ? 88.554  81.894  125.210 1.00 52.05 ? 239 ILE B CD1 1 
ATOM   9751  N N   . PHE C 1 240 ? 84.846  79.403  126.496 1.00 52.61 ? 240 PHE B N   1 
ATOM   9752  C CA  . PHE C 1 240 ? 83.570  79.891  125.952 1.00 52.95 ? 240 PHE B CA  1 
ATOM   9753  C C   . PHE C 1 240 ? 83.573  81.410  125.760 1.00 53.22 ? 240 PHE B C   1 
ATOM   9754  O O   . PHE C 1 240 ? 84.094  82.154  126.589 1.00 53.32 ? 240 PHE B O   1 
ATOM   9755  C CB  . PHE C 1 240 ? 82.390  79.468  126.831 1.00 52.75 ? 240 PHE B CB  1 
ATOM   9756  C CG  . PHE C 1 240 ? 82.179  77.982  126.897 1.00 52.54 ? 240 PHE B CG  1 
ATOM   9757  C CD1 . PHE C 1 240 ? 82.372  77.295  128.090 1.00 52.56 ? 240 PHE B CD1 1 
ATOM   9758  C CD2 . PHE C 1 240 ? 81.783  77.266  125.769 1.00 52.64 ? 240 PHE B CD2 1 
ATOM   9759  C CE1 . PHE C 1 240 ? 82.174  75.915  128.162 1.00 52.84 ? 240 PHE B CE1 1 
ATOM   9760  C CE2 . PHE C 1 240 ? 81.582  75.887  125.827 1.00 52.49 ? 240 PHE B CE2 1 
ATOM   9761  C CZ  . PHE C 1 240 ? 81.780  75.210  127.027 1.00 52.89 ? 240 PHE B CZ  1 
ATOM   9762  N N   . THR C 1 241 ? 82.941  81.856  124.682 1.00 53.54 ? 241 THR B N   1 
ATOM   9763  C CA  . THR C 1 241 ? 83.145  83.198  124.149 1.00 53.93 ? 241 THR B CA  1 
ATOM   9764  C C   . THR C 1 241 ? 81.897  84.119  124.036 1.00 54.24 ? 241 THR B C   1 
ATOM   9765  O O   . THR C 1 241 ? 82.055  85.323  123.829 1.00 54.30 ? 241 THR B O   1 
ATOM   9766  C CB  . THR C 1 241 ? 83.909  83.072  122.788 1.00 54.03 ? 241 THR B CB  1 
ATOM   9767  O OG1 . THR C 1 241 ? 85.271  82.699  123.052 1.00 53.91 ? 241 THR B OG1 1 
ATOM   9768  C CG2 . THR C 1 241 ? 83.877  84.355  121.950 1.00 54.10 ? 241 THR B CG2 1 
ATOM   9769  N N   . PRO C 1 242 ? 80.664  83.594  124.232 1.00 54.51 ? 242 PRO B N   1 
ATOM   9770  C CA  . PRO C 1 242 ? 80.202  82.313  124.771 1.00 54.75 ? 242 PRO B CA  1 
ATOM   9771  C C   . PRO C 1 242 ? 80.337  81.150  123.793 1.00 55.06 ? 242 PRO B C   1 
ATOM   9772  O O   . PRO C 1 242 ? 80.160  79.995  124.194 1.00 55.32 ? 242 PRO B O   1 
ATOM   9773  C CB  . PRO C 1 242 ? 78.725  82.582  125.075 1.00 54.73 ? 242 PRO B CB  1 
ATOM   9774  C CG  . PRO C 1 242 ? 78.320  83.561  124.047 1.00 54.51 ? 242 PRO B CG  1 
ATOM   9775  C CD  . PRO C 1 242 ? 79.526  84.439  123.816 1.00 54.41 ? 242 PRO B CD  1 
ATOM   9776  N N   . LYS C 1 243 ? 80.649  81.451  122.534 1.00 55.23 ? 243 LYS B N   1 
ATOM   9777  C CA  . LYS C 1 243 ? 80.898  80.416  121.540 1.00 55.59 ? 243 LYS B CA  1 
ATOM   9778  C C   . LYS C 1 243 ? 82.019  79.494  122.000 1.00 55.61 ? 243 LYS B C   1 
ATOM   9779  O O   . LYS C 1 243 ? 83.021  79.954  122.549 1.00 55.74 ? 243 LYS B O   1 
ATOM   9780  C CB  . LYS C 1 243 ? 81.229  81.024  120.173 1.00 55.74 ? 243 LYS B CB  1 
ATOM   9781  C CG  . LYS C 1 243 ? 79.992  81.452  119.371 1.00 56.45 ? 243 LYS B CG  1 
ATOM   9782  C CD  . LYS C 1 243 ? 80.171  81.268  117.858 1.00 57.45 ? 243 LYS B CD  1 
ATOM   9783  C CE  . LYS C 1 243 ? 80.743  82.512  117.171 1.00 58.17 ? 243 LYS B CE  1 
ATOM   9784  N NZ  . LYS C 1 243 ? 82.184  82.748  117.494 1.00 58.59 ? 243 LYS B NZ  1 
ATOM   9785  N N   . GLN C 1 244 ? 81.829  78.192  121.801 1.00 55.57 ? 244 GLN B N   1 
ATOM   9786  C CA  . GLN C 1 244 ? 82.835  77.201  122.165 1.00 55.37 ? 244 GLN B CA  1 
ATOM   9787  C C   . GLN C 1 244 ? 84.044  77.341  121.255 1.00 55.26 ? 244 GLN B C   1 
ATOM   9788  O O   . GLN C 1 244 ? 83.907  77.347  120.035 1.00 55.31 ? 244 GLN B O   1 
ATOM   9789  C CB  . GLN C 1 244 ? 82.261  75.794  122.056 1.00 55.30 ? 244 GLN B CB  1 
ATOM   9790  C CG  . GLN C 1 244 ? 83.166  74.733  122.637 1.00 55.40 ? 244 GLN B CG  1 
ATOM   9791  C CD  . GLN C 1 244 ? 82.582  73.352  122.513 1.00 55.74 ? 244 GLN B CD  1 
ATOM   9792  O OE1 . GLN C 1 244 ? 82.941  72.600  121.612 1.00 56.15 ? 244 GLN B OE1 1 
ATOM   9793  N NE2 . GLN C 1 244 ? 81.665  73.010  123.411 1.00 56.19 ? 244 GLN B NE2 1 
ATOM   9794  N N   . VAL C 1 245 ? 85.223  77.472  121.849 1.00 55.20 ? 245 VAL B N   1 
ATOM   9795  C CA  . VAL C 1 245 ? 86.446  77.671  121.072 1.00 55.28 ? 245 VAL B CA  1 
ATOM   9796  C C   . VAL C 1 245 ? 87.537  76.740  121.580 1.00 55.29 ? 245 VAL B C   1 
ATOM   9797  O O   . VAL C 1 245 ? 87.810  76.696  122.775 1.00 55.48 ? 245 VAL B O   1 
ATOM   9798  C CB  . VAL C 1 245 ? 86.935  79.143  121.125 1.00 55.22 ? 245 VAL B CB  1 
ATOM   9799  C CG1 . VAL C 1 245 ? 88.224  79.309  120.344 1.00 55.40 ? 245 VAL B CG1 1 
ATOM   9800  C CG2 . VAL C 1 245 ? 85.870  80.096  120.583 1.00 55.25 ? 245 VAL B CG2 1 
ATOM   9801  N N   . ASP C 1 246 ? 88.146  75.987  120.670 1.00 55.28 ? 246 ASP B N   1 
ATOM   9802  C CA  . ASP C 1 246 ? 89.215  75.068  121.037 1.00 55.15 ? 246 ASP B CA  1 
ATOM   9803  C C   . ASP C 1 246 ? 90.499  75.830  121.322 1.00 55.01 ? 246 ASP B C   1 
ATOM   9804  O O   . ASP C 1 246 ? 90.770  76.864  120.710 1.00 54.96 ? 246 ASP B O   1 
ATOM   9805  C CB  . ASP C 1 246 ? 89.438  74.014  119.947 1.00 55.24 ? 246 ASP B CB  1 
ATOM   9806  C CG  . ASP C 1 246 ? 88.470  72.843  120.055 1.00 55.52 ? 246 ASP B CG  1 
ATOM   9807  O OD1 . ASP C 1 246 ? 87.241  73.063  119.938 1.00 55.85 ? 246 ASP B OD1 1 
ATOM   9808  O OD2 . ASP C 1 246 ? 88.942  71.699  120.256 1.00 56.04 ? 246 ASP B OD2 1 
ATOM   9809  N N   . ARG C 1 247 ? 91.273  75.319  122.273 1.00 54.94 ? 247 ARG B N   1 
ATOM   9810  C CA  . ARG C 1 247 ? 92.552  75.910  122.640 1.00 54.73 ? 247 ARG B CA  1 
ATOM   9811  C C   . ARG C 1 247 ? 93.631  74.841  122.700 1.00 54.86 ? 247 ARG B C   1 
ATOM   9812  O O   . ARG C 1 247 ? 93.335  73.656  122.838 1.00 54.91 ? 247 ARG B O   1 
ATOM   9813  C CB  . ARG C 1 247 ? 92.444  76.621  123.991 1.00 54.58 ? 247 ARG B CB  1 
ATOM   9814  C CG  . ARG C 1 247 ? 91.757  77.971  123.942 1.00 53.81 ? 247 ARG B CG  1 
ATOM   9815  C CD  . ARG C 1 247 ? 92.702  79.043  123.438 1.00 53.12 ? 247 ARG B CD  1 
ATOM   9816  N NE  . ARG C 1 247 ? 92.054  80.350  123.368 1.00 52.60 ? 247 ARG B NE  1 
ATOM   9817  C CZ  . ARG C 1 247 ? 91.407  80.821  122.304 1.00 51.85 ? 247 ARG B CZ  1 
ATOM   9818  N NH1 . ARG C 1 247 ? 91.309  80.095  121.197 1.00 51.11 ? 247 ARG B NH1 1 
ATOM   9819  N NH2 . ARG C 1 247 ? 90.853  82.025  122.348 1.00 51.47 ? 247 ARG B NH2 1 
ATOM   9820  N N   . THR C 1 248 ? 94.883  75.266  122.590 1.00 55.05 ? 248 THR B N   1 
ATOM   9821  C CA  . THR C 1 248 ? 96.019  74.369  122.753 1.00 55.23 ? 248 THR B CA  1 
ATOM   9822  C C   . THR C 1 248 ? 96.311  74.087  124.231 1.00 55.35 ? 248 THR B C   1 
ATOM   9823  O O   . THR C 1 248 ? 96.839  73.022  124.572 1.00 55.40 ? 248 THR B O   1 
ATOM   9824  C CB  . THR C 1 248 ? 97.283  74.932  122.077 1.00 55.22 ? 248 THR B CB  1 
ATOM   9825  O OG1 . THR C 1 248 ? 98.446  74.457  122.769 1.00 55.52 ? 248 THR B OG1 1 
ATOM   9826  C CG2 . THR C 1 248 ? 97.282  76.457  122.113 1.00 55.43 ? 248 THR B CG2 1 
ATOM   9827  N N   . GLU C 1 249 ? 95.963  75.040  125.096 1.00 55.40 ? 249 GLU B N   1 
ATOM   9828  C CA  . GLU C 1 249 ? 96.330  74.995  126.518 1.00 55.51 ? 249 GLU B CA  1 
ATOM   9829  C C   . GLU C 1 249 ? 95.464  75.915  127.368 1.00 55.34 ? 249 GLU B C   1 
ATOM   9830  O O   . GLU C 1 249 ? 95.012  76.959  126.900 1.00 55.54 ? 249 GLU B O   1 
ATOM   9831  C CB  . GLU C 1 249 ? 97.803  75.389  126.709 1.00 55.44 ? 249 GLU B CB  1 
ATOM   9832  C CG  . GLU C 1 249 ? 98.192  76.723  126.062 1.00 55.67 ? 249 GLU B CG  1 
ATOM   9833  C CD  . GLU C 1 249 ? 99.535  77.243  126.533 1.00 56.02 ? 249 GLU B CD  1 
ATOM   9834  O OE1 . GLU C 1 249 ? 100.423 77.465  125.677 1.00 56.66 ? 249 GLU B OE1 1 
ATOM   9835  O OE2 . GLU C 1 249 ? 99.704  77.432  127.759 1.00 56.99 ? 249 GLU B OE2 1 
ATOM   9836  N N   . LEU C 1 250 ? 95.232  75.514  128.615 1.00 55.17 ? 250 LEU B N   1 
ATOM   9837  C CA  . LEU C 1 250 ? 94.676  76.404  129.628 1.00 54.92 ? 250 LEU B CA  1 
ATOM   9838  C C   . LEU C 1 250 ? 95.755  76.660  130.678 1.00 55.16 ? 250 LEU B C   1 
ATOM   9839  O O   . LEU C 1 250 ? 96.136  75.761  131.431 1.00 55.27 ? 250 LEU B O   1 
ATOM   9840  C CB  . LEU C 1 250 ? 93.413  75.815  130.265 1.00 54.64 ? 250 LEU B CB  1 
ATOM   9841  C CG  . LEU C 1 250 ? 92.129  75.663  129.432 1.00 54.17 ? 250 LEU B CG  1 
ATOM   9842  C CD1 . LEU C 1 250 ? 91.035  75.002  130.257 1.00 53.03 ? 250 LEU B CD1 1 
ATOM   9843  C CD2 . LEU C 1 250 ? 91.624  76.983  128.861 1.00 53.03 ? 250 LEU B CD2 1 
ATOM   9844  N N   . LYS C 1 251 ? 96.268  77.886  130.705 1.00 55.29 ? 251 LYS B N   1 
ATOM   9845  C CA  . LYS C 1 251 ? 97.367  78.232  131.603 1.00 55.33 ? 251 LYS B CA  1 
ATOM   9846  C C   . LYS C 1 251 ? 96.884  78.720  132.972 1.00 55.32 ? 251 LYS B C   1 
ATOM   9847  O O   . LYS C 1 251 ? 95.688  78.922  133.183 1.00 55.47 ? 251 LYS B O   1 
ATOM   9848  C CB  . LYS C 1 251 ? 98.314  79.242  130.941 1.00 55.36 ? 251 LYS B CB  1 
ATOM   9849  C CG  . LYS C 1 251 ? 97.653  80.520  130.453 1.00 55.29 ? 251 LYS B CG  1 
ATOM   9850  C CD  . LYS C 1 251 ? 98.592  81.355  129.596 1.00 55.41 ? 251 LYS B CD  1 
ATOM   9851  C CE  . LYS C 1 251 ? 98.736  80.776  128.195 1.00 55.71 ? 251 LYS B CE  1 
ATOM   9852  N NZ  . LYS C 1 251 ? 99.461  81.710  127.289 1.00 56.17 ? 251 LYS B NZ  1 
ATOM   9853  N N   . CYS C 1 252 ? 97.829  78.896  133.892 1.00 55.23 ? 252 CYS B N   1 
ATOM   9854  C CA  . CYS C 1 252 ? 97.542  79.257  135.282 1.00 55.13 ? 252 CYS B CA  1 
ATOM   9855  C C   . CYS C 1 252 ? 96.643  80.484  135.399 1.00 55.03 ? 252 CYS B C   1 
ATOM   9856  O O   . CYS C 1 252 ? 96.922  81.527  134.807 1.00 55.05 ? 252 CYS B O   1 
ATOM   9857  C CB  . CYS C 1 252 ? 98.856  79.493  136.035 1.00 55.15 ? 252 CYS B CB  1 
ATOM   9858  S SG  . CYS C 1 252 ? 98.731  79.460  137.833 1.00 54.99 ? 252 CYS B SG  1 
ATOM   9859  N N   . GLY C 1 253 ? 95.560  80.344  136.156 1.00 54.98 ? 253 GLY B N   1 
ATOM   9860  C CA  . GLY C 1 253 ? 94.655  81.457  136.435 1.00 54.96 ? 253 GLY B CA  1 
ATOM   9861  C C   . GLY C 1 253 ? 93.562  81.657  135.405 1.00 55.03 ? 253 GLY B C   1 
ATOM   9862  O O   . GLY C 1 253 ? 92.884  82.685  135.413 1.00 54.90 ? 253 GLY B O   1 
ATOM   9863  N N   . GLU C 1 254 ? 93.389  80.671  134.524 1.00 55.22 ? 254 GLU B N   1 
ATOM   9864  C CA  . GLU C 1 254 ? 92.383  80.726  133.458 1.00 55.25 ? 254 GLU B CA  1 
ATOM   9865  C C   . GLU C 1 254 ? 91.158  79.874  133.778 1.00 55.12 ? 254 GLU B C   1 
ATOM   9866  O O   . GLU C 1 254 ? 91.217  78.970  134.613 1.00 55.06 ? 254 GLU B O   1 
ATOM   9867  C CB  . GLU C 1 254 ? 92.983  80.285  132.116 1.00 55.19 ? 254 GLU B CB  1 
ATOM   9868  C CG  . GLU C 1 254 ? 93.914  81.308  131.463 1.00 55.33 ? 254 GLU B CG  1 
ATOM   9869  C CD  . GLU C 1 254 ? 94.314  80.936  130.033 1.00 55.55 ? 254 GLU B CD  1 
ATOM   9870  O OE1 . GLU C 1 254 ? 94.791  81.825  129.295 1.00 56.09 ? 254 GLU B OE1 1 
ATOM   9871  O OE2 . GLU C 1 254 ? 94.160  79.760  129.641 1.00 56.01 ? 254 GLU B OE2 1 
ATOM   9872  N N   . VAL C 1 255 ? 90.053  80.178  133.100 1.00 55.21 ? 255 VAL B N   1 
ATOM   9873  C CA  . VAL C 1 255 ? 88.800  79.433  133.233 1.00 55.23 ? 255 VAL B CA  1 
ATOM   9874  C C   . VAL C 1 255 ? 88.377  78.907  131.867 1.00 55.15 ? 255 VAL B C   1 
ATOM   9875  O O   . VAL C 1 255 ? 88.211  79.686  130.929 1.00 55.32 ? 255 VAL B O   1 
ATOM   9876  C CB  . VAL C 1 255 ? 87.663  80.316  133.824 1.00 55.21 ? 255 VAL B CB  1 
ATOM   9877  C CG1 . VAL C 1 255 ? 86.319  79.601  133.753 1.00 55.44 ? 255 VAL B CG1 1 
ATOM   9878  C CG2 . VAL C 1 255 ? 87.975  80.708  135.258 1.00 55.10 ? 255 VAL B CG2 1 
ATOM   9879  N N   . GLY C 1 256 ? 88.205  77.590  131.763 1.00 55.13 ? 256 GLY B N   1 
ATOM   9880  C CA  . GLY C 1 256 ? 87.789  76.961  130.508 1.00 55.08 ? 256 GLY B CA  1 
ATOM   9881  C C   . GLY C 1 256 ? 87.220  75.559  130.649 1.00 55.10 ? 256 GLY B C   1 
ATOM   9882  O O   . GLY C 1 256 ? 87.190  74.993  131.747 1.00 55.26 ? 256 GLY B O   1 
ATOM   9883  N N   . TRP C 1 257 ? 86.772  74.998  129.528 1.00 54.94 ? 257 TRP B N   1 
ATOM   9884  C CA  . TRP C 1 257 ? 86.178  73.662  129.505 1.00 54.81 ? 257 TRP B CA  1 
ATOM   9885  C C   . TRP C 1 257 ? 87.206  72.599  129.139 1.00 54.93 ? 257 TRP B C   1 
ATOM   9886  O O   . TRP C 1 257 ? 88.229  72.900  128.517 1.00 55.00 ? 257 TRP B O   1 
ATOM   9887  C CB  . TRP C 1 257 ? 84.980  73.606  128.542 1.00 54.63 ? 257 TRP B CB  1 
ATOM   9888  C CG  . TRP C 1 257 ? 85.306  74.010  127.129 1.00 54.29 ? 257 TRP B CG  1 
ATOM   9889  C CD1 . TRP C 1 257 ? 85.245  75.267  126.605 1.00 53.87 ? 257 TRP B CD1 1 
ATOM   9890  C CD2 . TRP C 1 257 ? 85.744  73.152  126.065 1.00 53.93 ? 257 TRP B CD2 1 
ATOM   9891  N NE1 . TRP C 1 257 ? 85.617  75.249  125.284 1.00 54.02 ? 257 TRP B NE1 1 
ATOM   9892  C CE2 . TRP C 1 257 ? 85.931  73.964  124.925 1.00 54.03 ? 257 TRP B CE2 1 
ATOM   9893  C CE3 . TRP C 1 257 ? 85.999  71.776  125.965 1.00 53.99 ? 257 TRP B CE3 1 
ATOM   9894  C CZ2 . TRP C 1 257 ? 86.367  73.450  123.696 1.00 54.34 ? 257 TRP B CZ2 1 
ATOM   9895  C CZ3 . TRP C 1 257 ? 86.431  71.262  124.740 1.00 54.04 ? 257 TRP B CZ3 1 
ATOM   9896  C CH2 . TRP C 1 257 ? 86.609  72.100  123.624 1.00 54.28 ? 257 TRP B CH2 1 
ATOM   9897  N N   . LEU C 1 258 ? 86.916  71.356  129.525 1.00 55.01 ? 258 LEU B N   1 
ATOM   9898  C CA  . LEU C 1 258 ? 87.794  70.216  129.258 1.00 54.82 ? 258 LEU B CA  1 
ATOM   9899  C C   . LEU C 1 258 ? 86.985  68.971  128.906 1.00 54.79 ? 258 LEU B C   1 
ATOM   9900  O O   . LEU C 1 258 ? 86.026  68.617  129.603 1.00 54.58 ? 258 LEU B O   1 
ATOM   9901  C CB  . LEU C 1 258 ? 88.689  69.925  130.470 1.00 54.75 ? 258 LEU B CB  1 
ATOM   9902  C CG  . LEU C 1 258 ? 89.649  68.730  130.394 1.00 54.52 ? 258 LEU B CG  1 
ATOM   9903  C CD1 . LEU C 1 258 ? 90.902  69.085  129.611 1.00 54.29 ? 258 LEU B CD1 1 
ATOM   9904  C CD2 . LEU C 1 258 ? 90.017  68.239  131.777 1.00 53.99 ? 258 LEU B CD2 1 
ATOM   9905  N N   . VAL C 1 259 ? 87.391  68.316  127.823 1.00 54.74 ? 259 VAL B N   1 
ATOM   9906  C CA  . VAL C 1 259 ? 86.784  67.068  127.390 1.00 54.83 ? 259 VAL B CA  1 
ATOM   9907  C C   . VAL C 1 259 ? 87.817  65.949  127.416 1.00 54.93 ? 259 VAL B C   1 
ATOM   9908  O O   . VAL C 1 259 ? 88.694  65.865  126.550 1.00 55.01 ? 259 VAL B O   1 
ATOM   9909  C CB  . VAL C 1 259 ? 86.163  67.176  125.966 1.00 54.91 ? 259 VAL B CB  1 
ATOM   9910  C CG1 . VAL C 1 259 ? 85.698  65.808  125.460 1.00 54.81 ? 259 VAL B CG1 1 
ATOM   9911  C CG2 . VAL C 1 259 ? 85.005  68.162  125.951 1.00 55.02 ? 259 VAL B CG2 1 
ATOM   9912  N N   . CYS C 1 260 ? 87.722  65.115  128.443 1.00 55.03 ? 260 CYS B N   1 
ATOM   9913  C CA  . CYS C 1 260 ? 88.344  63.798  128.434 1.00 55.15 ? 260 CYS B CA  1 
ATOM   9914  C C   . CYS C 1 260 ? 87.243  62.776  128.682 1.00 55.16 ? 260 CYS B C   1 
ATOM   9915  O O   . CYS C 1 260 ? 86.335  63.023  129.489 1.00 55.39 ? 260 CYS B O   1 
ATOM   9916  C CB  . CYS C 1 260 ? 89.460  63.686  129.471 1.00 55.30 ? 260 CYS B CB  1 
ATOM   9917  S SG  . CYS C 1 260 ? 89.135  64.430  131.071 1.00 55.26 ? 260 CYS B SG  1 
ATOM   9918  N N   . ALA C 1 261 ? 87.323  61.645  127.981 1.00 54.83 ? 261 ALA B N   1 
ATOM   9919  C CA  . ALA C 1 261 ? 86.219  60.687  127.891 1.00 54.38 ? 261 ALA B CA  1 
ATOM   9920  C C   . ALA C 1 261 ? 85.845  60.041  129.229 1.00 54.19 ? 261 ALA B C   1 
ATOM   9921  O O   . ALA C 1 261 ? 85.962  58.825  129.407 1.00 54.27 ? 261 ALA B O   1 
ATOM   9922  C CB  . ALA C 1 261 ? 86.525  59.628  126.834 1.00 54.43 ? 261 ALA B CB  1 
ATOM   9923  N N   . ILE C 1 262 ? 85.386  60.873  130.159 1.00 53.78 ? 262 ILE B N   1 
ATOM   9924  C CA  . ILE C 1 262 ? 84.916  60.428  131.463 1.00 53.44 ? 262 ILE B CA  1 
ATOM   9925  C C   . ILE C 1 262 ? 83.513  59.841  131.296 1.00 53.32 ? 262 ILE B C   1 
ATOM   9926  O O   . ILE C 1 262 ? 82.701  60.386  130.549 1.00 53.22 ? 262 ILE B O   1 
ATOM   9927  C CB  . ILE C 1 262 ? 84.947  61.592  132.485 1.00 53.50 ? 262 ILE B CB  1 
ATOM   9928  C CG1 . ILE C 1 262 ? 86.399  61.992  132.775 1.00 53.39 ? 262 ILE B CG1 1 
ATOM   9929  C CG2 . ILE C 1 262 ? 84.231  61.219  133.780 1.00 53.55 ? 262 ILE B CG2 1 
ATOM   9930  C CD1 . ILE C 1 262 ? 86.564  63.296  133.539 1.00 53.18 ? 262 ILE B CD1 1 
ATOM   9931  N N   . LYS C 1 263 ? 83.249  58.727  131.982 1.00 53.16 ? 263 LYS B N   1 
ATOM   9932  C CA  . LYS C 1 263 ? 82.024  57.939  131.779 1.00 53.11 ? 263 LYS B CA  1 
ATOM   9933  C C   . LYS C 1 263 ? 80.749  58.754  132.018 1.00 52.98 ? 263 LYS B C   1 
ATOM   9934  O O   . LYS C 1 263 ? 79.902  58.855  131.132 1.00 53.00 ? 263 LYS B O   1 
ATOM   9935  C CB  . LYS C 1 263 ? 82.028  56.654  132.645 1.00 53.19 ? 263 LYS B CB  1 
ATOM   9936  C CG  . LYS C 1 263 ? 83.411  55.995  132.795 1.00 53.71 ? 263 LYS B CG  1 
ATOM   9937  C CD  . LYS C 1 263 ? 83.331  54.438  132.713 1.00 54.42 ? 263 LYS B CD  1 
ATOM   9938  C CE  . LYS C 1 263 ? 82.855  53.785  134.036 1.00 54.47 ? 263 LYS B CE  1 
ATOM   9939  N NZ  . LYS C 1 263 ? 82.731  52.288  133.912 1.00 53.56 ? 263 LYS B NZ  1 
ATOM   9940  N N   . ASP C 1 264 ? 80.628  59.335  133.210 1.00 52.79 ? 264 ASP B N   1 
ATOM   9941  C CA  . ASP C 1 264 ? 79.486  60.176  133.574 1.00 52.48 ? 264 ASP B CA  1 
ATOM   9942  C C   . ASP C 1 264 ? 79.957  61.400  134.355 1.00 52.37 ? 264 ASP B C   1 
ATOM   9943  O O   . ASP C 1 264 ? 81.150  61.559  134.607 1.00 52.43 ? 264 ASP B O   1 
ATOM   9944  C CB  . ASP C 1 264 ? 78.449  59.377  134.375 1.00 52.44 ? 264 ASP B CB  1 
ATOM   9945  C CG  . ASP C 1 264 ? 79.057  58.625  135.555 1.00 52.38 ? 264 ASP B CG  1 
ATOM   9946  O OD1 . ASP C 1 264 ? 79.972  59.162  136.222 1.00 52.42 ? 264 ASP B OD1 1 
ATOM   9947  O OD2 . ASP C 1 264 ? 78.602  57.492  135.825 1.00 51.49 ? 264 ASP B OD2 1 
ATOM   9948  N N   . ILE C 1 265 ? 79.025  62.261  134.748 1.00 52.18 ? 265 ILE B N   1 
ATOM   9949  C CA  . ILE C 1 265 ? 79.394  63.506  135.426 1.00 51.97 ? 265 ILE B CA  1 
ATOM   9950  C C   . ILE C 1 265 ? 79.852  63.310  136.873 1.00 51.97 ? 265 ILE B C   1 
ATOM   9951  O O   . ILE C 1 265 ? 80.429  64.218  137.481 1.00 51.91 ? 265 ILE B O   1 
ATOM   9952  C CB  . ILE C 1 265 ? 78.281  64.566  135.344 1.00 51.79 ? 265 ILE B CB  1 
ATOM   9953  C CG1 . ILE C 1 265 ? 77.014  64.087  136.051 1.00 51.47 ? 265 ILE B CG1 1 
ATOM   9954  C CG2 . ILE C 1 265 ? 78.004  64.909  133.889 1.00 52.45 ? 265 ILE B CG2 1 
ATOM   9955  C CD1 . ILE C 1 265 ? 76.043  65.194  136.346 1.00 51.14 ? 265 ILE B CD1 1 
ATOM   9956  N N   . HIS C 1 266 ? 79.597  62.120  137.412 1.00 51.94 ? 266 HIS B N   1 
ATOM   9957  C CA  . HIS C 1 266 ? 80.066  61.754  138.747 1.00 51.93 ? 266 HIS B CA  1 
ATOM   9958  C C   . HIS C 1 266 ? 81.571  61.469  138.766 1.00 51.93 ? 266 HIS B C   1 
ATOM   9959  O O   . HIS C 1 266 ? 82.202  61.516  139.824 1.00 52.00 ? 266 HIS B O   1 
ATOM   9960  C CB  . HIS C 1 266 ? 79.298  60.545  139.269 1.00 51.84 ? 266 HIS B CB  1 
ATOM   9961  C CG  . HIS C 1 266 ? 77.815  60.733  139.271 1.00 52.08 ? 266 HIS B CG  1 
ATOM   9962  N ND1 . HIS C 1 266 ? 77.160  61.465  140.237 1.00 51.94 ? 266 HIS B ND1 1 
ATOM   9963  C CD2 . HIS C 1 266 ? 76.858  60.283  138.425 1.00 52.26 ? 266 HIS B CD2 1 
ATOM   9964  C CE1 . HIS C 1 266 ? 75.862  61.457  139.987 1.00 52.08 ? 266 HIS B CE1 1 
ATOM   9965  N NE2 . HIS C 1 266 ? 75.653  60.748  138.893 1.00 52.13 ? 266 HIS B NE2 1 
ATOM   9966  N N   . GLY C 1 267 ? 82.134  61.171  137.596 1.00 51.79 ? 267 GLY B N   1 
ATOM   9967  C CA  . GLY C 1 267 ? 83.560  60.891  137.460 1.00 51.48 ? 267 GLY B CA  1 
ATOM   9968  C C   . GLY C 1 267 ? 84.386  62.159  137.526 1.00 51.37 ? 267 GLY B C   1 
ATOM   9969  O O   . GLY C 1 267 ? 85.600  62.107  137.751 1.00 51.58 ? 267 GLY B O   1 
ATOM   9970  N N   . ALA C 1 268 ? 83.719  63.295  137.317 1.00 51.02 ? 268 ALA B N   1 
ATOM   9971  C CA  . ALA C 1 268 ? 84.311  64.622  137.483 1.00 50.53 ? 268 ALA B CA  1 
ATOM   9972  C C   . ALA C 1 268 ? 83.399  65.461  138.379 1.00 50.33 ? 268 ALA B C   1 
ATOM   9973  O O   . ALA C 1 268 ? 82.641  66.299  137.886 1.00 50.18 ? 268 ALA B O   1 
ATOM   9974  C CB  . ALA C 1 268 ? 84.494  65.288  136.135 1.00 50.46 ? 268 ALA B CB  1 
ATOM   9975  N N   . PRO C 1 269 ? 83.455  65.223  139.703 1.00 50.27 ? 269 PRO B N   1 
ATOM   9976  C CA  . PRO C 1 269 ? 82.526  65.851  140.643 1.00 50.33 ? 269 PRO B CA  1 
ATOM   9977  C C   . PRO C 1 269 ? 82.824  67.328  140.832 1.00 50.54 ? 269 PRO B C   1 
ATOM   9978  O O   . PRO C 1 269 ? 83.990  67.728  140.831 1.00 50.80 ? 269 PRO B O   1 
ATOM   9979  C CB  . PRO C 1 269 ? 82.785  65.105  141.958 1.00 50.20 ? 269 PRO B CB  1 
ATOM   9980  C CG  . PRO C 1 269 ? 83.651  63.946  141.610 1.00 50.13 ? 269 PRO B CG  1 
ATOM   9981  C CD  . PRO C 1 269 ? 84.408  64.344  140.398 1.00 50.27 ? 269 PRO B CD  1 
ATOM   9982  N N   . VAL C 1 270 ? 81.772  68.130  140.982 1.00 50.64 ? 270 VAL B N   1 
ATOM   9983  C CA  . VAL C 1 270 ? 81.921  69.566  141.231 1.00 50.49 ? 270 VAL B CA  1 
ATOM   9984  C C   . VAL C 1 270 ? 82.644  69.789  142.561 1.00 50.51 ? 270 VAL B C   1 
ATOM   9985  O O   . VAL C 1 270 ? 82.233  69.260  143.594 1.00 50.50 ? 270 VAL B O   1 
ATOM   9986  C CB  . VAL C 1 270 ? 80.556  70.327  141.127 1.00 50.34 ? 270 VAL B CB  1 
ATOM   9987  C CG1 . VAL C 1 270 ? 79.374  69.400  141.439 1.00 50.66 ? 270 VAL B CG1 1 
ATOM   9988  C CG2 . VAL C 1 270 ? 80.536  71.591  141.992 1.00 49.75 ? 270 VAL B CG2 1 
ATOM   9989  N N   . GLY C 1 271 ? 83.751  70.526  142.503 1.00 50.62 ? 271 GLY B N   1 
ATOM   9990  C CA  . GLY C 1 271 ? 84.576  70.798  143.678 1.00 50.82 ? 271 GLY B CA  1 
ATOM   9991  C C   . GLY C 1 271 ? 85.872  70.005  143.739 1.00 51.00 ? 271 GLY B C   1 
ATOM   9992  O O   . GLY C 1 271 ? 86.789  70.357  144.488 1.00 51.12 ? 271 GLY B O   1 
ATOM   9993  N N   . ASP C 1 272 ? 85.941  68.929  142.956 1.00 51.18 ? 272 ASP B N   1 
ATOM   9994  C CA  . ASP C 1 272 ? 87.125  68.069  142.882 1.00 51.25 ? 272 ASP B CA  1 
ATOM   9995  C C   . ASP C 1 272 ? 88.267  68.830  142.225 1.00 51.30 ? 272 ASP B C   1 
ATOM   9996  O O   . ASP C 1 272 ? 88.050  69.872  141.609 1.00 51.43 ? 272 ASP B O   1 
ATOM   9997  C CB  . ASP C 1 272 ? 86.795  66.811  142.073 1.00 51.28 ? 272 ASP B CB  1 
ATOM   9998  C CG  . ASP C 1 272 ? 87.671  65.618  142.431 1.00 51.60 ? 272 ASP B CG  1 
ATOM   9999  O OD1 . ASP C 1 272 ? 88.839  65.805  142.842 1.00 52.06 ? 272 ASP B OD1 1 
ATOM   10000 O OD2 . ASP C 1 272 ? 87.180  64.477  142.284 1.00 51.17 ? 272 ASP B OD2 1 
ATOM   10001 N N   . THR C 1 273 ? 89.485  68.324  142.362 1.00 51.42 ? 273 THR B N   1 
ATOM   10002 C CA  . THR C 1 273 ? 90.628  68.979  141.736 1.00 51.57 ? 273 THR B CA  1 
ATOM   10003 C C   . THR C 1 273 ? 91.308  68.047  140.732 1.00 51.71 ? 273 THR B C   1 
ATOM   10004 O O   . THR C 1 273 ? 91.292  66.821  140.892 1.00 51.77 ? 273 THR B O   1 
ATOM   10005 C CB  . THR C 1 273 ? 91.637  69.526  142.778 1.00 51.52 ? 273 THR B CB  1 
ATOM   10006 O OG1 . THR C 1 273 ? 92.735  68.621  142.920 1.00 51.85 ? 273 THR B OG1 1 
ATOM   10007 C CG2 . THR C 1 273 ? 90.967  69.733  144.133 1.00 51.51 ? 273 THR B CG2 1 
ATOM   10008 N N   . LEU C 1 274 ? 91.886  68.640  139.691 1.00 51.78 ? 274 LEU B N   1 
ATOM   10009 C CA  . LEU C 1 274 ? 92.555  67.892  138.637 1.00 51.87 ? 274 LEU B CA  1 
ATOM   10010 C C   . LEU C 1 274 ? 94.046  68.176  138.623 1.00 52.06 ? 274 LEU B C   1 
ATOM   10011 O O   . LEU C 1 274 ? 94.473  69.319  138.796 1.00 52.24 ? 274 LEU B O   1 
ATOM   10012 C CB  . LEU C 1 274 ? 91.948  68.226  137.276 1.00 51.75 ? 274 LEU B CB  1 
ATOM   10013 C CG  . LEU C 1 274 ? 90.734  67.402  136.845 1.00 51.86 ? 274 LEU B CG  1 
ATOM   10014 C CD1 . LEU C 1 274 ? 89.924  68.140  135.801 1.00 51.32 ? 274 LEU B CD1 1 
ATOM   10015 C CD2 . LEU C 1 274 ? 91.171  66.045  136.311 1.00 52.14 ? 274 LEU B CD2 1 
ATOM   10016 N N   . THR C 1 275 ? 94.834  67.128  138.411 1.00 52.22 ? 275 THR B N   1 
ATOM   10017 C CA  . THR C 1 275 ? 96.287  67.247  138.393 1.00 52.39 ? 275 THR B CA  1 
ATOM   10018 C C   . THR C 1 275 ? 96.893  66.351  137.311 1.00 52.62 ? 275 THR B C   1 
ATOM   10019 O O   . THR C 1 275 ? 96.235  65.427  136.835 1.00 52.75 ? 275 THR B O   1 
ATOM   10020 C CB  . THR C 1 275 ? 96.898  66.942  139.792 1.00 52.34 ? 275 THR B CB  1 
ATOM   10021 O OG1 . THR C 1 275 ? 98.292  67.267  139.789 1.00 52.11 ? 275 THR B OG1 1 
ATOM   10022 C CG2 . THR C 1 275 ? 96.705  65.477  140.192 1.00 52.28 ? 275 THR B CG2 1 
ATOM   10023 N N   . LEU C 1 276 ? 98.136  66.631  136.918 1.00 52.83 ? 276 LEU B N   1 
ATOM   10024 C CA  . LEU C 1 276 ? 98.835  65.801  135.935 1.00 53.04 ? 276 LEU B CA  1 
ATOM   10025 C C   . LEU C 1 276 ? 99.250  64.481  136.567 1.00 53.18 ? 276 LEU B C   1 
ATOM   10026 O O   . LEU C 1 276 ? 99.712  64.456  137.712 1.00 53.25 ? 276 LEU B O   1 
ATOM   10027 C CB  . LEU C 1 276 ? 100.070 66.516  135.378 1.00 53.09 ? 276 LEU B CB  1 
ATOM   10028 C CG  . LEU C 1 276 ? 99.916  67.868  134.673 1.00 53.26 ? 276 LEU B CG  1 
ATOM   10029 C CD1 . LEU C 1 276 ? 101.283 68.397  134.241 1.00 53.43 ? 276 LEU B CD1 1 
ATOM   10030 C CD2 . LEU C 1 276 ? 98.965  67.788  133.486 1.00 53.22 ? 276 LEU B CD2 1 
ATOM   10031 N N   . ALA C 1 277 ? 99.082  63.389  135.822 1.00 53.28 ? 277 ALA B N   1 
ATOM   10032 C CA  . ALA C 1 277 ? 99.418  62.057  136.334 1.00 53.30 ? 277 ALA B CA  1 
ATOM   10033 C C   . ALA C 1 277 ? 100.920 61.885  136.541 1.00 53.28 ? 277 ALA B C   1 
ATOM   10034 O O   . ALA C 1 277 ? 101.344 61.227  137.492 1.00 53.28 ? 277 ALA B O   1 
ATOM   10035 C CB  . ALA C 1 277 ? 98.874  60.971  135.421 1.00 53.27 ? 277 ALA B CB  1 
ATOM   10036 N N   . ARG C 1 278 ? 101.713 62.489  135.658 1.00 53.28 ? 278 ARG B N   1 
ATOM   10037 C CA  . ARG C 1 278 ? 103.175 62.425  135.747 1.00 53.30 ? 278 ARG B CA  1 
ATOM   10038 C C   . ARG C 1 278 ? 103.745 63.230  136.922 1.00 53.10 ? 278 ARG B C   1 
ATOM   10039 O O   . ARG C 1 278 ? 104.801 62.886  137.453 1.00 53.10 ? 278 ARG B O   1 
ATOM   10040 C CB  . ARG C 1 278 ? 103.831 62.855  134.424 1.00 53.36 ? 278 ARG B CB  1 
ATOM   10041 C CG  . ARG C 1 278 ? 103.570 64.304  134.013 1.00 53.52 ? 278 ARG B CG  1 
ATOM   10042 C CD  . ARG C 1 278 ? 104.446 64.725  132.839 1.00 53.58 ? 278 ARG B CD  1 
ATOM   10043 N NE  . ARG C 1 278 ? 104.210 66.119  132.465 1.00 54.20 ? 278 ARG B NE  1 
ATOM   10044 C CZ  . ARG C 1 278 ? 103.300 66.523  131.580 1.00 54.64 ? 278 ARG B CZ  1 
ATOM   10045 N NH1 . ARG C 1 278 ? 102.523 65.643  130.957 1.00 55.05 ? 278 ARG B NH1 1 
ATOM   10046 N NH2 . ARG C 1 278 ? 103.163 67.817  131.318 1.00 54.64 ? 278 ARG B NH2 1 
ATOM   10047 N N   . ASN C 1 279 ? 103.045 64.294  137.318 1.00 52.89 ? 279 ASN B N   1 
ATOM   10048 C CA  . ASN C 1 279 ? 103.481 65.153  138.420 1.00 52.69 ? 279 ASN B CA  1 
ATOM   10049 C C   . ASN C 1 279 ? 102.310 65.592  139.311 1.00 52.62 ? 279 ASN B C   1 
ATOM   10050 O O   . ASN C 1 279 ? 101.942 66.766  139.322 1.00 52.65 ? 279 ASN B O   1 
ATOM   10051 C CB  . ASN C 1 279 ? 104.245 66.367  137.870 1.00 52.65 ? 279 ASN B CB  1 
ATOM   10052 C CG  . ASN C 1 279 ? 104.852 67.230  138.964 1.00 52.50 ? 279 ASN B CG  1 
ATOM   10053 O OD1 . ASN C 1 279 ? 105.576 66.740  139.832 1.00 52.79 ? 279 ASN B OD1 1 
ATOM   10054 N ND2 . ASN C 1 279 ? 104.559 68.524  138.923 1.00 52.20 ? 279 ASN B ND2 1 
ATOM   10055 N N   . PRO C 1 280 ? 101.727 64.650  140.077 1.00 52.61 ? 280 PRO B N   1 
ATOM   10056 C CA  . PRO C 1 280 ? 100.518 64.975  140.832 1.00 52.64 ? 280 PRO B CA  1 
ATOM   10057 C C   . PRO C 1 280 ? 100.779 65.910  142.005 1.00 52.72 ? 280 PRO B C   1 
ATOM   10058 O O   . PRO C 1 280 ? 101.836 65.839  142.633 1.00 52.71 ? 280 PRO B O   1 
ATOM   10059 C CB  . PRO C 1 280 ? 100.041 63.612  141.337 1.00 52.57 ? 280 PRO B CB  1 
ATOM   10060 C CG  . PRO C 1 280 ? 101.270 62.789  141.417 1.00 52.57 ? 280 PRO B CG  1 
ATOM   10061 C CD  . PRO C 1 280 ? 102.155 63.256  140.298 1.00 52.64 ? 280 PRO B CD  1 
ATOM   10062 N N   . ALA C 1 281 ? 99.815  66.786  142.277 1.00 52.92 ? 281 ALA B N   1 
ATOM   10063 C CA  . ALA C 1 281 ? 99.847  67.643  143.455 1.00 53.14 ? 281 ALA B CA  1 
ATOM   10064 C C   . ALA C 1 281 ? 99.807  66.766  144.698 1.00 53.37 ? 281 ALA B C   1 
ATOM   10065 O O   . ALA C 1 281 ? 99.117  65.744  144.723 1.00 53.54 ? 281 ALA B O   1 
ATOM   10066 C CB  . ALA C 1 281 ? 98.668  68.602  143.444 1.00 53.05 ? 281 ALA B CB  1 
ATOM   10067 N N   . GLU C 1 282 ? 100.558 67.156  145.724 1.00 53.56 ? 282 GLU B N   1 
ATOM   10068 C CA  . GLU C 1 282 ? 100.573 66.403  146.971 1.00 53.72 ? 282 GLU B CA  1 
ATOM   10069 C C   . GLU C 1 282 ? 99.227  66.526  147.684 1.00 53.80 ? 282 GLU B C   1 
ATOM   10070 O O   . GLU C 1 282 ? 98.784  65.589  148.342 1.00 53.97 ? 282 GLU B O   1 
ATOM   10071 C CB  . GLU C 1 282 ? 101.718 66.868  147.875 1.00 53.70 ? 282 GLU B CB  1 
ATOM   10072 C CG  . GLU C 1 282 ? 102.161 65.831  148.907 1.00 53.76 ? 282 GLU B CG  1 
ATOM   10073 C CD  . GLU C 1 282 ? 103.276 66.328  149.823 1.00 53.89 ? 282 GLU B CD  1 
ATOM   10074 O OE1 . GLU C 1 282 ? 103.681 65.570  150.731 1.00 53.73 ? 282 GLU B OE1 1 
ATOM   10075 O OE2 . GLU C 1 282 ? 103.749 67.471  149.643 1.00 54.33 ? 282 GLU B OE2 1 
ATOM   10076 N N   . LYS C 1 283 ? 98.572  67.675  147.532 1.00 53.89 ? 283 LYS B N   1 
ATOM   10077 C CA  . LYS C 1 283 ? 97.282  67.919  148.176 1.00 53.92 ? 283 LYS B CA  1 
ATOM   10078 C C   . LYS C 1 283 ? 96.238  68.464  147.208 1.00 53.58 ? 283 LYS B C   1 
ATOM   10079 O O   . LYS C 1 283 ? 96.539  69.301  146.364 1.00 53.50 ? 283 LYS B O   1 
ATOM   10080 C CB  . LYS C 1 283 ? 97.451  68.881  149.359 1.00 54.18 ? 283 LYS B CB  1 
ATOM   10081 C CG  . LYS C 1 283 ? 96.239  68.964  150.281 1.00 54.67 ? 283 LYS B CG  1 
ATOM   10082 C CD  . LYS C 1 283 ? 96.531  69.834  151.482 1.00 55.45 ? 283 LYS B CD  1 
ATOM   10083 C CE  . LYS C 1 283 ? 95.498  69.610  152.575 1.00 55.60 ? 283 LYS B CE  1 
ATOM   10084 N NZ  . LYS C 1 283 ? 96.028  70.060  153.889 1.00 55.74 ? 283 LYS B NZ  1 
ATOM   10085 N N   . ALA C 1 284 ? 95.010  67.973  147.343 1.00 53.39 ? 284 ALA B N   1 
ATOM   10086 C CA  . ALA C 1 284 ? 93.868  68.510  146.616 1.00 53.23 ? 284 ALA B CA  1 
ATOM   10087 C C   . ALA C 1 284 ? 93.477  69.854  147.213 1.00 53.23 ? 284 ALA B C   1 
ATOM   10088 O O   . ALA C 1 284 ? 93.733  70.108  148.389 1.00 53.47 ? 284 ALA B O   1 
ATOM   10089 C CB  . ALA C 1 284 ? 92.707  67.544  146.689 1.00 53.08 ? 284 ALA B CB  1 
ATOM   10090 N N   . LEU C 1 285 ? 92.871  70.718  146.405 1.00 53.27 ? 285 LEU B N   1 
ATOM   10091 C CA  . LEU C 1 285 ? 92.387  72.015  146.886 1.00 53.29 ? 285 LEU B CA  1 
ATOM   10092 C C   . LEU C 1 285 ? 91.323  71.821  147.967 1.00 53.30 ? 285 LEU B C   1 
ATOM   10093 O O   . LEU C 1 285 ? 90.569  70.843  147.925 1.00 53.26 ? 285 LEU B O   1 
ATOM   10094 C CB  . LEU C 1 285 ? 91.815  72.852  145.737 1.00 53.26 ? 285 LEU B CB  1 
ATOM   10095 C CG  . LEU C 1 285 ? 92.726  73.254  144.576 1.00 53.28 ? 285 LEU B CG  1 
ATOM   10096 C CD1 . LEU C 1 285 ? 91.879  73.768  143.420 1.00 53.32 ? 285 LEU B CD1 1 
ATOM   10097 C CD2 . LEU C 1 285 ? 93.767  74.291  144.989 1.00 52.87 ? 285 LEU B CD2 1 
ATOM   10098 N N   . PRO C 1 286 ? 91.262  72.748  148.944 1.00 53.26 ? 286 PRO B N   1 
ATOM   10099 C CA  . PRO C 1 286 ? 90.295  72.613  150.035 1.00 53.26 ? 286 PRO B CA  1 
ATOM   10100 C C   . PRO C 1 286 ? 88.861  72.836  149.561 1.00 53.27 ? 286 PRO B C   1 
ATOM   10101 O O   . PRO C 1 286 ? 88.648  73.504  148.546 1.00 53.28 ? 286 PRO B O   1 
ATOM   10102 C CB  . PRO C 1 286 ? 90.698  73.730  151.008 1.00 53.15 ? 286 PRO B CB  1 
ATOM   10103 C CG  . PRO C 1 286 ? 92.033  74.207  150.555 1.00 53.12 ? 286 PRO B CG  1 
ATOM   10104 C CD  . PRO C 1 286 ? 92.078  73.965  149.092 1.00 53.11 ? 286 PRO B CD  1 
ATOM   10105 N N   . GLY C 1 287 ? 87.896  72.268  150.283 1.00 53.28 ? 287 GLY B N   1 
ATOM   10106 C CA  . GLY C 1 287 ? 86.480  72.558  150.051 1.00 53.31 ? 287 GLY B CA  1 
ATOM   10107 C C   . GLY C 1 287 ? 85.624  71.443  149.475 1.00 53.40 ? 287 GLY B C   1 
ATOM   10108 O O   . GLY C 1 287 ? 84.406  71.595  149.372 1.00 53.33 ? 287 GLY B O   1 
ATOM   10109 N N   . PHE C 1 288 ? 86.252  70.323  149.116 1.00 53.57 ? 288 PHE B N   1 
ATOM   10110 C CA  . PHE C 1 288 ? 85.566  69.219  148.439 1.00 53.74 ? 288 PHE B CA  1 
ATOM   10111 C C   . PHE C 1 288 ? 84.625  68.411  149.335 1.00 53.94 ? 288 PHE B C   1 
ATOM   10112 O O   . PHE C 1 288 ? 84.967  68.064  150.469 1.00 53.96 ? 288 PHE B O   1 
ATOM   10113 C CB  . PHE C 1 288 ? 86.575  68.282  147.762 1.00 53.68 ? 288 PHE B CB  1 
ATOM   10114 C CG  . PHE C 1 288 ? 85.937  67.110  147.054 1.00 53.99 ? 288 PHE B CG  1 
ATOM   10115 C CD1 . PHE C 1 288 ? 85.926  65.842  147.640 1.00 53.94 ? 288 PHE B CD1 1 
ATOM   10116 C CD2 . PHE C 1 288 ? 85.331  67.276  145.808 1.00 53.77 ? 288 PHE B CD2 1 
ATOM   10117 C CE1 . PHE C 1 288 ? 85.328  64.757  146.989 1.00 53.78 ? 288 PHE B CE1 1 
ATOM   10118 C CE2 . PHE C 1 288 ? 84.731  66.199  145.150 1.00 53.68 ? 288 PHE B CE2 1 
ATOM   10119 C CZ  . PHE C 1 288 ? 84.727  64.938  145.743 1.00 53.80 ? 288 PHE B CZ  1 
ATOM   10120 N N   . LYS C 1 289 ? 83.440  68.117  148.800 1.00 54.20 ? 289 LYS B N   1 
ATOM   10121 C CA  . LYS C 1 289 ? 82.485  67.190  149.412 1.00 54.57 ? 289 LYS B CA  1 
ATOM   10122 C C   . LYS C 1 289 ? 81.400  66.782  148.416 1.00 54.66 ? 289 LYS B C   1 
ATOM   10123 O O   . LYS C 1 289 ? 81.101  67.526  147.480 1.00 54.69 ? 289 LYS B O   1 
ATOM   10124 C CB  . LYS C 1 289 ? 81.863  67.770  150.699 1.00 54.61 ? 289 LYS B CB  1 
ATOM   10125 C CG  . LYS C 1 289 ? 81.102  69.089  150.537 1.00 54.82 ? 289 LYS B CG  1 
ATOM   10126 C CD  . LYS C 1 289 ? 81.069  69.890  151.840 1.00 55.43 ? 289 LYS B CD  1 
ATOM   10127 C CE  . LYS C 1 289 ? 82.436  70.524  152.145 1.00 56.33 ? 289 LYS B CE  1 
ATOM   10128 N NZ  . LYS C 1 289 ? 82.439  71.416  153.345 1.00 56.13 ? 289 LYS B NZ  1 
ATOM   10129 N N   . LYS C 1 290 ? 80.845  65.585  148.608 1.00 54.76 ? 290 LYS B N   1 
ATOM   10130 C CA  . LYS C 1 290 ? 79.647  65.161  147.893 1.00 54.95 ? 290 LYS B CA  1 
ATOM   10131 C C   . LYS C 1 290 ? 78.450  65.415  148.786 1.00 55.04 ? 290 LYS B C   1 
ATOM   10132 O O   . LYS C 1 290 ? 78.263  64.729  149.795 1.00 55.17 ? 290 LYS B O   1 
ATOM   10133 C CB  . LYS C 1 290 ? 79.705  63.675  147.517 1.00 54.88 ? 290 LYS B CB  1 
ATOM   10134 C CG  . LYS C 1 290 ? 80.268  63.378  146.128 1.00 55.62 ? 290 LYS B CG  1 
ATOM   10135 C CD  . LYS C 1 290 ? 79.365  63.875  144.979 1.00 56.41 ? 290 LYS B CD  1 
ATOM   10136 C CE  . LYS C 1 290 ? 78.237  62.895  144.633 1.00 56.37 ? 290 LYS B CE  1 
ATOM   10137 N NZ  . LYS C 1 290 ? 77.056  63.040  145.525 1.00 55.99 ? 290 LYS B NZ  1 
ATOM   10138 N N   . VAL C 1 291 ? 77.650  66.414  148.426 1.00 55.18 ? 291 VAL B N   1 
ATOM   10139 C CA  . VAL C 1 291 ? 76.444  66.733  149.189 1.00 55.27 ? 291 VAL B CA  1 
ATOM   10140 C C   . VAL C 1 291 ? 75.419  65.620  149.014 1.00 55.24 ? 291 VAL B C   1 
ATOM   10141 O O   . VAL C 1 291 ? 75.179  65.145  147.900 1.00 55.22 ? 291 VAL B O   1 
ATOM   10142 C CB  . VAL C 1 291 ? 75.827  68.105  148.798 1.00 55.31 ? 291 VAL B CB  1 
ATOM   10143 C CG1 . VAL C 1 291 ? 74.682  68.470  149.742 1.00 55.34 ? 291 VAL B CG1 1 
ATOM   10144 C CG2 . VAL C 1 291 ? 76.886  69.198  148.823 1.00 55.42 ? 291 VAL B CG2 1 
ATOM   10145 N N   . LYS C 1 292 ? 74.843  65.198  150.135 1.00 55.27 ? 292 LYS B N   1 
ATOM   10146 C CA  . LYS C 1 292 ? 73.810  64.174  150.150 1.00 55.24 ? 292 LYS B CA  1 
ATOM   10147 C C   . LYS C 1 292 ? 72.447  64.855  150.115 1.00 55.02 ? 292 LYS B C   1 
ATOM   10148 O O   . LYS C 1 292 ? 72.293  65.942  150.668 1.00 55.16 ? 292 LYS B O   1 
ATOM   10149 C CB  . LYS C 1 292 ? 73.959  63.302  151.401 1.00 55.36 ? 292 LYS B CB  1 
ATOM   10150 C CG  . LYS C 1 292 ? 75.395  62.872  151.649 1.00 55.74 ? 292 LYS B CG  1 
ATOM   10151 C CD  . LYS C 1 292 ? 75.526  61.818  152.728 1.00 56.65 ? 292 LYS B CD  1 
ATOM   10152 C CE  . LYS C 1 292 ? 77.006  61.536  152.992 1.00 56.91 ? 292 LYS B CE  1 
ATOM   10153 N NZ  . LYS C 1 292 ? 77.236  60.249  153.698 1.00 57.49 ? 292 LYS B NZ  1 
ATOM   10154 N N   . PRO C 1 293 ? 71.466  64.248  149.425 1.00 54.88 ? 293 PRO B N   1 
ATOM   10155 C CA  . PRO C 1 293 ? 70.099  64.784  149.430 1.00 54.70 ? 293 PRO B CA  1 
ATOM   10156 C C   . PRO C 1 293 ? 69.612  65.189  150.823 1.00 54.55 ? 293 PRO B C   1 
ATOM   10157 O O   . PRO C 1 293 ? 69.822  64.463  151.797 1.00 54.44 ? 293 PRO B O   1 
ATOM   10158 C CB  . PRO C 1 293 ? 69.248  63.636  148.873 1.00 54.62 ? 293 PRO B CB  1 
ATOM   10159 C CG  . PRO C 1 293 ? 70.205  62.582  148.391 1.00 54.85 ? 293 PRO B CG  1 
ATOM   10160 C CD  . PRO C 1 293 ? 71.606  63.074  148.545 1.00 54.95 ? 293 PRO B CD  1 
ATOM   10161 N N   . GLN C 1 294 ? 68.981  66.359  150.890 1.00 54.42 ? 294 GLN B N   1 
ATOM   10162 C CA  . GLN C 1 294 ? 68.481  66.942  152.135 1.00 54.43 ? 294 GLN B CA  1 
ATOM   10163 C C   . GLN C 1 294 ? 66.986  66.639  152.345 1.00 53.89 ? 294 GLN B C   1 
ATOM   10164 O O   . GLN C 1 294 ? 66.522  66.520  153.485 1.00 53.94 ? 294 GLN B O   1 
ATOM   10165 C CB  . GLN C 1 294 ? 68.741  68.459  152.130 1.00 54.42 ? 294 GLN B CB  1 
ATOM   10166 C CG  . GLN C 1 294 ? 68.037  69.265  153.233 1.00 55.16 ? 294 GLN B CG  1 
ATOM   10167 C CD  . GLN C 1 294 ? 67.953  70.770  152.931 1.00 55.23 ? 294 GLN B CD  1 
ATOM   10168 O OE1 . GLN C 1 294 ? 68.966  71.424  152.658 1.00 55.99 ? 294 GLN B OE1 1 
ATOM   10169 N NE2 . GLN C 1 294 ? 66.738  71.322  152.995 1.00 55.41 ? 294 GLN B NE2 1 
ATOM   10170 N N   . VAL C 1 295 ? 66.243  66.519  151.243 1.00 53.16 ? 295 VAL B N   1 
ATOM   10171 C CA  . VAL C 1 295 ? 64.793  66.317  151.284 1.00 52.36 ? 295 VAL B CA  1 
ATOM   10172 C C   . VAL C 1 295 ? 64.382  65.168  150.370 1.00 51.79 ? 295 VAL B C   1 
ATOM   10173 O O   . VAL C 1 295 ? 64.874  65.054  149.249 1.00 51.67 ? 295 VAL B O   1 
ATOM   10174 C CB  . VAL C 1 295 ? 64.039  67.603  150.877 1.00 52.42 ? 295 VAL B CB  1 
ATOM   10175 C CG1 . VAL C 1 295 ? 62.545  67.372  150.842 1.00 52.34 ? 295 VAL B CG1 1 
ATOM   10176 C CG2 . VAL C 1 295 ? 64.361  68.735  151.838 1.00 52.92 ? 295 VAL B CG2 1 
ATOM   10177 N N   . TYR C 1 296 ? 63.474  64.325  150.859 1.00 51.19 ? 296 TYR B N   1 
ATOM   10178 C CA  . TYR C 1 296 ? 63.018  63.141  150.134 1.00 50.68 ? 296 TYR B CA  1 
ATOM   10179 C C   . TYR C 1 296 ? 61.514  63.132  149.889 1.00 50.73 ? 296 TYR B C   1 
ATOM   10180 O O   . TYR C 1 296 ? 60.740  63.604  150.726 1.00 50.82 ? 296 TYR B O   1 
ATOM   10181 C CB  . TYR C 1 296 ? 63.385  61.880  150.906 1.00 50.22 ? 296 TYR B CB  1 
ATOM   10182 C CG  . TYR C 1 296 ? 64.825  61.473  150.795 1.00 49.62 ? 296 TYR B CG  1 
ATOM   10183 C CD1 . TYR C 1 296 ? 65.225  60.520  149.862 1.00 49.02 ? 296 TYR B CD1 1 
ATOM   10184 C CD2 . TYR C 1 296 ? 65.790  62.023  151.637 1.00 49.17 ? 296 TYR B CD2 1 
ATOM   10185 C CE1 . TYR C 1 296 ? 66.550  60.130  149.765 1.00 48.92 ? 296 TYR B CE1 1 
ATOM   10186 C CE2 . TYR C 1 296 ? 67.118  61.640  151.548 1.00 49.04 ? 296 TYR B CE2 1 
ATOM   10187 C CZ  . TYR C 1 296 ? 67.491  60.693  150.612 1.00 48.98 ? 296 TYR B CZ  1 
ATOM   10188 O OH  . TYR C 1 296 ? 68.807  60.312  150.523 1.00 49.04 ? 296 TYR B OH  1 
ATOM   10189 N N   . ALA C 1 297 ? 61.110  62.567  148.752 1.00 50.61 ? 297 ALA B N   1 
ATOM   10190 C CA  . ALA C 1 297 ? 59.699  62.448  148.396 1.00 50.64 ? 297 ALA B CA  1 
ATOM   10191 C C   . ALA C 1 297 ? 59.449  61.224  147.529 1.00 50.70 ? 297 ALA B C   1 
ATOM   10192 O O   . ALA C 1 297 ? 60.360  60.728  146.865 1.00 50.71 ? 297 ALA B O   1 
ATOM   10193 C CB  . ALA C 1 297 ? 59.221  63.706  147.680 1.00 50.71 ? 297 ALA B CB  1 
ATOM   10194 N N   . GLY C 1 298 ? 58.208  60.744  147.543 1.00 50.78 ? 298 GLY B N   1 
ATOM   10195 C CA  . GLY C 1 298 ? 57.799  59.632  146.694 1.00 51.02 ? 298 GLY B CA  1 
ATOM   10196 C C   . GLY C 1 298 ? 57.037  60.120  145.478 1.00 51.19 ? 298 GLY B C   1 
ATOM   10197 O O   . GLY C 1 298 ? 56.052  60.845  145.605 1.00 51.41 ? 298 GLY B O   1 
ATOM   10198 N N   . LEU C 1 299 ? 57.496  59.729  144.295 1.00 51.26 ? 299 LEU B N   1 
ATOM   10199 C CA  . LEU C 1 299 ? 56.837  60.129  143.057 1.00 51.35 ? 299 LEU B CA  1 
ATOM   10200 C C   . LEU C 1 299 ? 56.277  58.917  142.322 1.00 51.40 ? 299 LEU B C   1 
ATOM   10201 O O   . LEU C 1 299 ? 56.971  57.923  142.109 1.00 51.45 ? 299 LEU B O   1 
ATOM   10202 C CB  . LEU C 1 299 ? 57.790  60.924  142.159 1.00 51.37 ? 299 LEU B CB  1 
ATOM   10203 C CG  . LEU C 1 299 ? 58.348  62.250  142.692 1.00 51.40 ? 299 LEU B CG  1 
ATOM   10204 C CD1 . LEU C 1 299 ? 59.492  62.712  141.823 1.00 51.17 ? 299 LEU B CD1 1 
ATOM   10205 C CD2 . LEU C 1 299 ? 57.283  63.324  142.755 1.00 51.35 ? 299 LEU B CD2 1 
ATOM   10206 N N   . PHE C 1 300 ? 55.005  59.009  141.958 1.00 51.49 ? 300 PHE B N   1 
ATOM   10207 C CA  . PHE C 1 300 ? 54.285  57.914  141.326 1.00 51.60 ? 300 PHE B CA  1 
ATOM   10208 C C   . PHE C 1 300 ? 53.394  58.476  140.223 1.00 51.75 ? 300 PHE B C   1 
ATOM   10209 O O   . PHE C 1 300 ? 52.755  59.515  140.412 1.00 51.84 ? 300 PHE B O   1 
ATOM   10210 C CB  . PHE C 1 300 ? 53.442  57.164  142.366 1.00 51.57 ? 300 PHE B CB  1 
ATOM   10211 C CG  . PHE C 1 300 ? 54.242  56.640  143.531 1.00 51.77 ? 300 PHE B CG  1 
ATOM   10212 C CD1 . PHE C 1 300 ? 54.389  57.396  144.690 1.00 51.67 ? 300 PHE B CD1 1 
ATOM   10213 C CD2 . PHE C 1 300 ? 54.860  55.394  143.463 1.00 51.73 ? 300 PHE B CD2 1 
ATOM   10214 C CE1 . PHE C 1 300 ? 55.142  56.918  145.757 1.00 51.32 ? 300 PHE B CE1 1 
ATOM   10215 C CE2 . PHE C 1 300 ? 55.613  54.908  144.527 1.00 51.13 ? 300 PHE B CE2 1 
ATOM   10216 C CZ  . PHE C 1 300 ? 55.751  55.670  145.674 1.00 51.31 ? 300 PHE B CZ  1 
ATOM   10217 N N   . PRO C 1 301 ? 53.357  57.805  139.059 1.00 51.76 ? 301 PRO B N   1 
ATOM   10218 C CA  . PRO C 1 301 ? 52.515  58.265  137.955 1.00 51.88 ? 301 PRO B CA  1 
ATOM   10219 C C   . PRO C 1 301 ? 51.038  58.009  138.230 1.00 51.97 ? 301 PRO B C   1 
ATOM   10220 O O   . PRO C 1 301 ? 50.689  56.983  138.819 1.00 52.13 ? 301 PRO B O   1 
ATOM   10221 C CB  . PRO C 1 301 ? 52.978  57.410  136.770 1.00 51.83 ? 301 PRO B CB  1 
ATOM   10222 C CG  . PRO C 1 301 ? 54.223  56.710  137.234 1.00 52.17 ? 301 PRO B CG  1 
ATOM   10223 C CD  . PRO C 1 301 ? 54.097  56.587  138.707 1.00 51.71 ? 301 PRO B CD  1 
ATOM   10224 N N   . VAL C 1 302 ? 50.187  58.944  137.812 1.00 51.98 ? 302 VAL B N   1 
ATOM   10225 C CA  . VAL C 1 302 ? 48.739  58.787  137.923 1.00 51.99 ? 302 VAL B CA  1 
ATOM   10226 C C   . VAL C 1 302 ? 48.275  57.580  137.107 1.00 52.03 ? 302 VAL B C   1 
ATOM   10227 O O   . VAL C 1 302 ? 47.557  56.724  137.618 1.00 52.10 ? 302 VAL B O   1 
ATOM   10228 C CB  . VAL C 1 302 ? 47.994  60.082  137.502 1.00 52.01 ? 302 VAL B CB  1 
ATOM   10229 C CG1 . VAL C 1 302 ? 46.502  59.822  137.260 1.00 51.76 ? 302 VAL B CG1 1 
ATOM   10230 C CG2 . VAL C 1 302 ? 48.191  61.164  138.556 1.00 51.80 ? 302 VAL B CG2 1 
ATOM   10231 N N   . SER C 1 303 ? 48.705  57.521  135.849 1.00 52.12 ? 303 SER B N   1 
ATOM   10232 C CA  . SER C 1 303 ? 48.452  56.383  134.975 1.00 52.31 ? 303 SER B CA  1 
ATOM   10233 C C   . SER C 1 303 ? 49.723  55.554  134.824 1.00 52.45 ? 303 SER B C   1 
ATOM   10234 O O   . SER C 1 303 ? 50.760  56.071  134.404 1.00 52.47 ? 303 SER B O   1 
ATOM   10235 C CB  . SER C 1 303 ? 47.973  56.866  133.604 1.00 52.37 ? 303 SER B CB  1 
ATOM   10236 O OG  . SER C 1 303 ? 48.182  55.883  132.602 1.00 52.62 ? 303 SER B OG  1 
ATOM   10237 N N   . SER C 1 304 ? 49.630  54.265  135.150 1.00 52.63 ? 304 SER B N   1 
ATOM   10238 C CA  . SER C 1 304 ? 50.782  53.355  135.097 1.00 52.77 ? 304 SER B CA  1 
ATOM   10239 C C   . SER C 1 304 ? 51.427  53.253  133.711 1.00 52.85 ? 304 SER B C   1 
ATOM   10240 O O   . SER C 1 304 ? 52.610  52.924  133.601 1.00 52.97 ? 304 SER B O   1 
ATOM   10241 C CB  . SER C 1 304 ? 50.387  51.964  135.589 1.00 52.70 ? 304 SER B CB  1 
ATOM   10242 O OG  . SER C 1 304 ? 49.474  51.363  134.691 1.00 53.02 ? 304 SER B OG  1 
ATOM   10243 N N   . ASP C 1 305 ? 50.651  53.537  132.664 1.00 52.87 ? 305 ASP B N   1 
ATOM   10244 C CA  . ASP C 1 305 ? 51.159  53.546  131.289 1.00 52.90 ? 305 ASP B CA  1 
ATOM   10245 C C   . ASP C 1 305 ? 52.280  54.575  131.084 1.00 52.92 ? 305 ASP B C   1 
ATOM   10246 O O   . ASP C 1 305 ? 52.858  54.667  130.000 1.00 52.94 ? 305 ASP B O   1 
ATOM   10247 C CB  . ASP C 1 305 ? 50.013  53.800  130.296 1.00 52.97 ? 305 ASP B CB  1 
ATOM   10248 C CG  . ASP C 1 305 ? 49.040  52.618  130.187 1.00 53.06 ? 305 ASP B CG  1 
ATOM   10249 O OD1 . ASP C 1 305 ? 49.245  51.589  130.870 1.00 53.77 ? 305 ASP B OD1 1 
ATOM   10250 O OD2 . ASP C 1 305 ? 48.064  52.720  129.412 1.00 52.01 ? 305 ASP B OD2 1 
ATOM   10251 N N   . ASP C 1 306 ? 52.582  55.333  132.138 1.00 52.98 ? 306 ASP B N   1 
ATOM   10252 C CA  . ASP C 1 306 ? 53.595  56.392  132.103 1.00 52.97 ? 306 ASP B CA  1 
ATOM   10253 C C   . ASP C 1 306 ? 54.903  56.034  132.818 1.00 52.99 ? 306 ASP B C   1 
ATOM   10254 O O   . ASP C 1 306 ? 55.854  56.826  132.814 1.00 52.84 ? 306 ASP B O   1 
ATOM   10255 C CB  . ASP C 1 306 ? 53.026  57.676  132.708 1.00 52.91 ? 306 ASP B CB  1 
ATOM   10256 C CG  . ASP C 1 306 ? 52.003  58.335  131.817 1.00 53.08 ? 306 ASP B CG  1 
ATOM   10257 O OD1 . ASP C 1 306 ? 52.189  58.311  130.581 1.00 53.58 ? 306 ASP B OD1 1 
ATOM   10258 O OD2 . ASP C 1 306 ? 51.019  58.887  132.355 1.00 53.08 ? 306 ASP B OD2 1 
ATOM   10259 N N   . TYR C 1 307 ? 54.946  54.851  133.429 1.00 53.05 ? 307 TYR B N   1 
ATOM   10260 C CA  . TYR C 1 307 ? 56.118  54.406  134.177 1.00 53.28 ? 307 TYR B CA  1 
ATOM   10261 C C   . TYR C 1 307 ? 57.381  54.477  133.322 1.00 53.58 ? 307 TYR B C   1 
ATOM   10262 O O   . TYR C 1 307 ? 58.451  54.889  133.793 1.00 53.38 ? 307 TYR B O   1 
ATOM   10263 C CB  . TYR C 1 307 ? 55.927  52.978  134.698 1.00 53.18 ? 307 TYR B CB  1 
ATOM   10264 C CG  . TYR C 1 307 ? 57.045  52.532  135.608 1.00 53.05 ? 307 TYR B CG  1 
ATOM   10265 C CD1 . TYR C 1 307 ? 57.072  52.922  136.949 1.00 53.13 ? 307 TYR B CD1 1 
ATOM   10266 C CD2 . TYR C 1 307 ? 58.088  51.740  135.128 1.00 52.58 ? 307 TYR B CD2 1 
ATOM   10267 C CE1 . TYR C 1 307 ? 58.103  52.532  137.789 1.00 53.07 ? 307 TYR B CE1 1 
ATOM   10268 C CE2 . TYR C 1 307 ? 59.123  51.340  135.962 1.00 52.84 ? 307 TYR B CE2 1 
ATOM   10269 C CZ  . TYR C 1 307 ? 59.119  51.740  137.289 1.00 53.21 ? 307 TYR B CZ  1 
ATOM   10270 O OH  . TYR C 1 307 ? 60.133  51.351  138.125 1.00 54.17 ? 307 TYR B OH  1 
ATOM   10271 N N   . GLU C 1 308 ? 57.229  54.077  132.062 1.00 53.88 ? 308 GLU B N   1 
ATOM   10272 C CA  . GLU C 1 308 ? 58.319  54.036  131.104 1.00 54.17 ? 308 GLU B CA  1 
ATOM   10273 C C   . GLU C 1 308 ? 58.913  55.426  130.884 1.00 54.10 ? 308 GLU B C   1 
ATOM   10274 O O   . GLU C 1 308 ? 60.119  55.627  131.067 1.00 54.07 ? 308 GLU B O   1 
ATOM   10275 C CB  . GLU C 1 308 ? 57.820  53.443  129.784 1.00 54.44 ? 308 GLU B CB  1 
ATOM   10276 C CG  . GLU C 1 308 ? 56.964  52.179  129.943 1.00 55.39 ? 308 GLU B CG  1 
ATOM   10277 C CD  . GLU C 1 308 ? 57.775  50.933  130.286 1.00 56.80 ? 308 GLU B CD  1 
ATOM   10278 O OE1 . GLU C 1 308 ? 59.027  50.984  130.238 1.00 57.80 ? 308 GLU B OE1 1 
ATOM   10279 O OE2 . GLU C 1 308 ? 57.154  49.893  130.596 1.00 57.10 ? 308 GLU B OE2 1 
ATOM   10280 N N   . ALA C 1 309 ? 58.058  56.379  130.513 1.00 54.04 ? 309 ALA B N   1 
ATOM   10281 C CA  . ALA C 1 309 ? 58.473  57.764  130.270 1.00 54.04 ? 309 ALA B CA  1 
ATOM   10282 C C   . ALA C 1 309 ? 59.025  58.437  131.533 1.00 54.04 ? 309 ALA B C   1 
ATOM   10283 O O   . ALA C 1 309 ? 59.973  59.228  131.464 1.00 53.98 ? 309 ALA B O   1 
ATOM   10284 C CB  . ALA C 1 309 ? 57.315  58.570  129.697 1.00 54.02 ? 309 ALA B CB  1 
ATOM   10285 N N   . PHE C 1 310 ? 58.424  58.114  132.676 1.00 53.84 ? 310 PHE B N   1 
ATOM   10286 C CA  . PHE C 1 310 ? 58.878  58.615  133.967 1.00 53.74 ? 310 PHE B CA  1 
ATOM   10287 C C   . PHE C 1 310 ? 60.284  58.084  134.277 1.00 53.67 ? 310 PHE B C   1 
ATOM   10288 O O   . PHE C 1 310 ? 61.171  58.853  134.661 1.00 53.66 ? 310 PHE B O   1 
ATOM   10289 C CB  . PHE C 1 310 ? 57.852  58.248  135.055 1.00 53.81 ? 310 PHE B CB  1 
ATOM   10290 C CG  . PHE C 1 310 ? 58.160  58.799  136.431 1.00 53.80 ? 310 PHE B CG  1 
ATOM   10291 C CD1 . PHE C 1 310 ? 58.859  59.999  136.598 1.00 53.81 ? 310 PHE B CD1 1 
ATOM   10292 C CD2 . PHE C 1 310 ? 57.709  58.124  137.567 1.00 53.62 ? 310 PHE B CD2 1 
ATOM   10293 C CE1 . PHE C 1 310 ? 59.135  60.495  137.872 1.00 53.34 ? 310 PHE B CE1 1 
ATOM   10294 C CE2 . PHE C 1 310 ? 57.973  58.613  138.842 1.00 53.39 ? 310 PHE B CE2 1 
ATOM   10295 C CZ  . PHE C 1 310 ? 58.688  59.801  138.993 1.00 53.64 ? 310 PHE B CZ  1 
ATOM   10296 N N   . ARG C 1 311 ? 60.488  56.782  134.074 1.00 53.44 ? 311 ARG B N   1 
ATOM   10297 C CA  . ARG C 1 311 ? 61.800  56.163  134.266 1.00 53.16 ? 311 ARG B CA  1 
ATOM   10298 C C   . ARG C 1 311 ? 62.839  56.763  133.327 1.00 53.01 ? 311 ARG B C   1 
ATOM   10299 O O   . ARG C 1 311 ? 63.985  56.992  133.721 1.00 53.08 ? 311 ARG B O   1 
ATOM   10300 C CB  . ARG C 1 311 ? 61.719  54.654  134.056 1.00 53.12 ? 311 ARG B CB  1 
ATOM   10301 C CG  . ARG C 1 311 ? 62.955  53.892  134.497 1.00 53.51 ? 311 ARG B CG  1 
ATOM   10302 C CD  . ARG C 1 311 ? 62.717  52.397  134.434 1.00 54.99 ? 311 ARG B CD  1 
ATOM   10303 N NE  . ARG C 1 311 ? 62.490  51.943  133.062 1.00 56.30 ? 311 ARG B NE  1 
ATOM   10304 C CZ  . ARG C 1 311 ? 62.127  50.709  132.718 1.00 56.54 ? 311 ARG B CZ  1 
ATOM   10305 N NH1 . ARG C 1 311 ? 61.937  49.773  133.645 1.00 56.70 ? 311 ARG B NH1 1 
ATOM   10306 N NH2 . ARG C 1 311 ? 61.951  50.413  131.436 1.00 56.43 ? 311 ARG B NH2 1 
ATOM   10307 N N   . ASP C 1 312 ? 62.428  57.017  132.086 1.00 52.82 ? 312 ASP B N   1 
ATOM   10308 C CA  . ASP C 1 312 ? 63.310  57.596  131.071 1.00 52.43 ? 312 ASP B CA  1 
ATOM   10309 C C   . ASP C 1 312 ? 63.650  59.057  131.346 1.00 52.20 ? 312 ASP B C   1 
ATOM   10310 O O   . ASP C 1 312 ? 64.770  59.492  131.085 1.00 52.18 ? 312 ASP B O   1 
ATOM   10311 C CB  . ASP C 1 312 ? 62.697  57.437  129.679 1.00 52.42 ? 312 ASP B CB  1 
ATOM   10312 C CG  . ASP C 1 312 ? 62.695  55.998  129.207 1.00 52.27 ? 312 ASP B CG  1 
ATOM   10313 O OD1 . ASP C 1 312 ? 63.391  55.170  129.829 1.00 52.48 ? 312 ASP B OD1 1 
ATOM   10314 O OD2 . ASP C 1 312 ? 62.002  55.693  128.215 1.00 52.25 ? 312 ASP B OD2 1 
ATOM   10315 N N   . ALA C 1 313 ? 62.683  59.802  131.882 1.00 51.88 ? 313 ALA B N   1 
ATOM   10316 C CA  . ALA C 1 313 ? 62.883  61.207  132.229 1.00 51.46 ? 313 ALA B CA  1 
ATOM   10317 C C   . ALA C 1 313 ? 63.923  61.364  133.329 1.00 51.24 ? 313 ALA B C   1 
ATOM   10318 O O   . ALA C 1 313 ? 64.795  62.227  133.239 1.00 51.31 ? 313 ALA B O   1 
ATOM   10319 C CB  . ALA C 1 313 ? 61.571  61.847  132.642 1.00 51.48 ? 313 ALA B CB  1 
ATOM   10320 N N   . LEU C 1 314 ? 63.827  60.521  134.357 1.00 51.02 ? 314 LEU B N   1 
ATOM   10321 C CA  . LEU C 1 314 ? 64.776  60.532  135.469 1.00 50.79 ? 314 LEU B CA  1 
ATOM   10322 C C   . LEU C 1 314 ? 66.191  60.196  135.006 1.00 50.85 ? 314 LEU B C   1 
ATOM   10323 O O   . LEU C 1 314 ? 67.154  60.812  135.458 1.00 50.86 ? 314 LEU B O   1 
ATOM   10324 C CB  . LEU C 1 314 ? 64.327  59.581  136.583 1.00 50.64 ? 314 LEU B CB  1 
ATOM   10325 C CG  . LEU C 1 314 ? 63.115  60.009  137.420 1.00 50.67 ? 314 LEU B CG  1 
ATOM   10326 C CD1 . LEU C 1 314 ? 62.583  58.848  138.232 1.00 50.36 ? 314 LEU B CD1 1 
ATOM   10327 C CD2 . LEU C 1 314 ? 63.435  61.182  138.338 1.00 50.65 ? 314 LEU B CD2 1 
ATOM   10328 N N   . GLY C 1 315 ? 66.307  59.229  134.100 1.00 50.96 ? 315 GLY B N   1 
ATOM   10329 C CA  . GLY C 1 315 ? 67.583  58.915  133.461 1.00 51.08 ? 315 GLY B CA  1 
ATOM   10330 C C   . GLY C 1 315 ? 68.133  60.100  132.685 1.00 51.15 ? 315 GLY B C   1 
ATOM   10331 O O   . GLY C 1 315 ? 69.321  60.410  132.775 1.00 51.13 ? 315 GLY B O   1 
ATOM   10332 N N   . LYS C 1 316 ? 67.259  60.763  131.930 1.00 51.20 ? 316 LYS B N   1 
ATOM   10333 C CA  . LYS C 1 316 ? 67.627  61.937  131.140 1.00 51.42 ? 316 LYS B CA  1 
ATOM   10334 C C   . LYS C 1 316 ? 68.098  63.081  132.025 1.00 51.44 ? 316 LYS B C   1 
ATOM   10335 O O   . LYS C 1 316 ? 69.156  63.668  131.785 1.00 51.47 ? 316 LYS B O   1 
ATOM   10336 C CB  . LYS C 1 316 ? 66.451  62.398  130.282 1.00 51.38 ? 316 LYS B CB  1 
ATOM   10337 C CG  . LYS C 1 316 ? 66.235  61.556  129.047 1.00 52.21 ? 316 LYS B CG  1 
ATOM   10338 C CD  . LYS C 1 316 ? 64.970  61.959  128.305 1.00 53.46 ? 316 LYS B CD  1 
ATOM   10339 C CE  . LYS C 1 316 ? 64.674  61.003  127.160 1.00 53.60 ? 316 LYS B CE  1 
ATOM   10340 N NZ  . LYS C 1 316 ? 63.629  61.546  126.254 1.00 54.41 ? 316 LYS B NZ  1 
ATOM   10341 N N   . LEU C 1 317 ? 67.304  63.387  133.046 1.00 51.48 ? 317 LEU B N   1 
ATOM   10342 C CA  . LEU C 1 317 ? 67.641  64.411  134.024 1.00 51.53 ? 317 LEU B CA  1 
ATOM   10343 C C   . LEU C 1 317 ? 68.905  64.056  134.783 1.00 51.68 ? 317 LEU B C   1 
ATOM   10344 O O   . LEU C 1 317 ? 69.647  64.941  135.202 1.00 51.71 ? 317 LEU B O   1 
ATOM   10345 C CB  . LEU C 1 317 ? 66.491  64.593  135.010 1.00 51.38 ? 317 LEU B CB  1 
ATOM   10346 C CG  . LEU C 1 317 ? 65.513  65.748  134.796 1.00 51.37 ? 317 LEU B CG  1 
ATOM   10347 C CD1 . LEU C 1 317 ? 65.129  65.916  133.345 1.00 51.78 ? 317 LEU B CD1 1 
ATOM   10348 C CD2 . LEU C 1 317 ? 64.278  65.526  135.642 1.00 51.95 ? 317 LEU B CD2 1 
ATOM   10349 N N   . SER C 1 318 ? 69.142  62.754  134.934 1.00 51.93 ? 318 SER B N   1 
ATOM   10350 C CA  . SER C 1 318 ? 70.236  62.223  135.745 1.00 52.10 ? 318 SER B CA  1 
ATOM   10351 C C   . SER C 1 318 ? 71.606  62.429  135.116 1.00 51.89 ? 318 SER B C   1 
ATOM   10352 O O   . SER C 1 318 ? 72.622  62.341  135.798 1.00 51.83 ? 318 SER B O   1 
ATOM   10353 C CB  . SER C 1 318 ? 70.013  60.735  136.004 1.00 52.16 ? 318 SER B CB  1 
ATOM   10354 O OG  . SER C 1 318 ? 70.509  60.371  137.275 1.00 53.48 ? 318 SER B OG  1 
ATOM   10355 N N   . LEU C 1 319 ? 71.621  62.707  133.816 1.00 51.94 ? 319 LEU B N   1 
ATOM   10356 C CA  . LEU C 1 319 ? 72.857  62.881  133.059 1.00 51.95 ? 319 LEU B CA  1 
ATOM   10357 C C   . LEU C 1 319 ? 73.521  64.231  133.314 1.00 51.98 ? 319 LEU B C   1 
ATOM   10358 O O   . LEU C 1 319 ? 74.720  64.392  133.084 1.00 51.90 ? 319 LEU B O   1 
ATOM   10359 C CB  . LEU C 1 319 ? 72.585  62.711  131.563 1.00 51.97 ? 319 LEU B CB  1 
ATOM   10360 C CG  . LEU C 1 319 ? 72.230  61.314  131.042 1.00 52.17 ? 319 LEU B CG  1 
ATOM   10361 C CD1 . LEU C 1 319 ? 71.510  61.411  129.701 1.00 52.39 ? 319 LEU B CD1 1 
ATOM   10362 C CD2 . LEU C 1 319 ? 73.469  60.429  130.930 1.00 52.18 ? 319 LEU B CD2 1 
ATOM   10363 N N   . ASN C 1 320 ? 72.734  65.196  133.781 1.00 52.11 ? 320 ASN B N   1 
ATOM   10364 C CA  . ASN C 1 320 ? 73.227  66.545  134.050 1.00 52.26 ? 320 ASN B CA  1 
ATOM   10365 C C   . ASN C 1 320 ? 73.039  66.978  135.503 1.00 52.35 ? 320 ASN B C   1 
ATOM   10366 O O   . ASN C 1 320 ? 73.591  67.999  135.932 1.00 52.43 ? 320 ASN B O   1 
ATOM   10367 C CB  . ASN C 1 320 ? 72.569  67.548  133.104 1.00 52.20 ? 320 ASN B CB  1 
ATOM   10368 C CG  . ASN C 1 320 ? 73.003  67.357  131.663 1.00 52.40 ? 320 ASN B CG  1 
ATOM   10369 O OD1 . ASN C 1 320 ? 72.269  66.791  130.853 1.00 52.91 ? 320 ASN B OD1 1 
ATOM   10370 N ND2 . ASN C 1 320 ? 74.204  67.822  131.338 1.00 52.00 ? 320 ASN B ND2 1 
ATOM   10371 N N   . ASP C 1 321 ? 72.273  66.187  136.254 1.00 52.38 ? 321 ASP B N   1 
ATOM   10372 C CA  . ASP C 1 321 ? 71.983  66.477  137.653 1.00 52.42 ? 321 ASP B CA  1 
ATOM   10373 C C   . ASP C 1 321 ? 72.739  65.510  138.564 1.00 52.50 ? 321 ASP B C   1 
ATOM   10374 O O   . ASP C 1 321 ? 72.315  64.371  138.772 1.00 52.50 ? 321 ASP B O   1 
ATOM   10375 C CB  . ASP C 1 321 ? 70.477  66.396  137.904 1.00 52.39 ? 321 ASP B CB  1 
ATOM   10376 C CG  . ASP C 1 321 ? 70.034  67.197  139.115 1.00 52.36 ? 321 ASP B CG  1 
ATOM   10377 O OD1 . ASP C 1 321 ? 68.858  67.614  139.126 1.00 52.26 ? 321 ASP B OD1 1 
ATOM   10378 O OD2 . ASP C 1 321 ? 70.842  67.409  140.048 1.00 51.68 ? 321 ASP B OD2 1 
ATOM   10379 N N   . ALA C 1 322 ? 73.858  65.988  139.105 1.00 52.67 ? 322 ALA B N   1 
ATOM   10380 C CA  . ALA C 1 322 ? 74.781  65.172  139.899 1.00 52.77 ? 322 ALA B CA  1 
ATOM   10381 C C   . ALA C 1 322 ? 74.238  64.763  141.266 1.00 52.87 ? 322 ALA B C   1 
ATOM   10382 O O   . ALA C 1 322 ? 74.662  63.755  141.834 1.00 52.84 ? 322 ALA B O   1 
ATOM   10383 C CB  . ALA C 1 322 ? 76.107  65.900  140.062 1.00 52.71 ? 322 ALA B CB  1 
ATOM   10384 N N   . SER C 1 323 ? 73.306  65.546  141.797 1.00 52.99 ? 323 SER B N   1 
ATOM   10385 C CA  . SER C 1 323 ? 72.826  65.312  143.152 1.00 53.13 ? 323 SER B CA  1 
ATOM   10386 C C   . SER C 1 323 ? 71.373  64.849  143.212 1.00 53.21 ? 323 SER B C   1 
ATOM   10387 O O   . SER C 1 323 ? 70.813  64.704  144.300 1.00 53.38 ? 323 SER B O   1 
ATOM   10388 C CB  . SER C 1 323 ? 73.059  66.547  144.032 1.00 53.18 ? 323 SER B CB  1 
ATOM   10389 O OG  . SER C 1 323 ? 72.482  67.704  143.456 1.00 53.14 ? 323 SER B OG  1 
ATOM   10390 N N   . LEU C 1 324 ? 70.774  64.607  142.046 1.00 53.24 ? 324 LEU B N   1 
ATOM   10391 C CA  . LEU C 1 324 ? 69.466  63.962  141.971 1.00 53.22 ? 324 LEU B CA  1 
ATOM   10392 C C   . LEU C 1 324 ? 69.618  62.516  142.415 1.00 53.25 ? 324 LEU B C   1 
ATOM   10393 O O   . LEU C 1 324 ? 70.474  61.787  141.906 1.00 53.25 ? 324 LEU B O   1 
ATOM   10394 C CB  . LEU C 1 324 ? 68.921  63.991  140.538 1.00 53.11 ? 324 LEU B CB  1 
ATOM   10395 C CG  . LEU C 1 324 ? 67.412  63.889  140.229 1.00 53.37 ? 324 LEU B CG  1 
ATOM   10396 C CD1 . LEU C 1 324 ? 67.180  63.344  138.816 1.00 53.30 ? 324 LEU B CD1 1 
ATOM   10397 C CD2 . LEU C 1 324 ? 66.572  63.102  141.240 1.00 53.04 ? 324 LEU B CD2 1 
ATOM   10398 N N   . PHE C 1 325 ? 68.800  62.110  143.378 1.00 53.40 ? 325 PHE B N   1 
ATOM   10399 C CA  . PHE C 1 325 ? 68.708  60.708  143.748 1.00 53.52 ? 325 PHE B CA  1 
ATOM   10400 C C   . PHE C 1 325 ? 67.333  60.142  143.385 1.00 53.66 ? 325 PHE B C   1 
ATOM   10401 O O   . PHE C 1 325 ? 66.298  60.735  143.694 1.00 53.56 ? 325 PHE B O   1 
ATOM   10402 C CB  . PHE C 1 325 ? 69.011  60.501  145.238 1.00 53.50 ? 325 PHE B CB  1 
ATOM   10403 C CG  . PHE C 1 325 ? 68.894  59.065  145.683 1.00 53.49 ? 325 PHE B CG  1 
ATOM   10404 C CD1 . PHE C 1 325 ? 69.862  58.129  145.325 1.00 53.69 ? 325 PHE B CD1 1 
ATOM   10405 C CD2 . PHE C 1 325 ? 67.807  58.646  146.446 1.00 53.29 ? 325 PHE B CD2 1 
ATOM   10406 C CE1 . PHE C 1 325 ? 69.753  56.798  145.726 1.00 53.75 ? 325 PHE B CE1 1 
ATOM   10407 C CE2 . PHE C 1 325 ? 67.687  57.320  146.852 1.00 53.04 ? 325 PHE B CE2 1 
ATOM   10408 C CZ  . PHE C 1 325 ? 68.662  56.396  146.493 1.00 53.69 ? 325 PHE B CZ  1 
ATOM   10409 N N   . TYR C 1 326 ? 67.337  59.001  142.705 1.00 53.83 ? 326 TYR B N   1 
ATOM   10410 C CA  . TYR C 1 326 ? 66.112  58.251  142.462 1.00 53.96 ? 326 TYR B CA  1 
ATOM   10411 C C   . TYR C 1 326 ? 66.348  56.754  142.614 1.00 54.11 ? 326 TYR B C   1 
ATOM   10412 O O   . TYR C 1 326 ? 67.374  56.220  142.185 1.00 54.15 ? 326 TYR B O   1 
ATOM   10413 C CB  . TYR C 1 326 ? 65.466  58.601  141.110 1.00 53.93 ? 326 TYR B CB  1 
ATOM   10414 C CG  . TYR C 1 326 ? 66.211  58.157  139.865 1.00 53.80 ? 326 TYR B CG  1 
ATOM   10415 C CD1 . TYR C 1 326 ? 67.193  58.964  139.292 1.00 54.13 ? 326 TYR B CD1 1 
ATOM   10416 C CD2 . TYR C 1 326 ? 65.903  56.952  139.235 1.00 53.69 ? 326 TYR B CD2 1 
ATOM   10417 C CE1 . TYR C 1 326 ? 67.871  58.569  138.136 1.00 54.22 ? 326 TYR B CE1 1 
ATOM   10418 C CE2 . TYR C 1 326 ? 66.572  56.548  138.078 1.00 53.78 ? 326 TYR B CE2 1 
ATOM   10419 C CZ  . TYR C 1 326 ? 67.552  57.362  137.535 1.00 54.02 ? 326 TYR B CZ  1 
ATOM   10420 O OH  . TYR C 1 326 ? 68.216  56.975  136.393 1.00 53.92 ? 326 TYR B OH  1 
ATOM   10421 N N   . GLU C 1 327 ? 65.373  56.098  143.229 1.00 54.25 ? 327 GLU B N   1 
ATOM   10422 C CA  . GLU C 1 327 ? 65.465  54.707  143.631 1.00 54.44 ? 327 GLU B CA  1 
ATOM   10423 C C   . GLU C 1 327 ? 64.078  54.107  143.405 1.00 54.36 ? 327 GLU B C   1 
ATOM   10424 O O   . GLU C 1 327 ? 63.076  54.731  143.766 1.00 54.47 ? 327 GLU B O   1 
ATOM   10425 C CB  . GLU C 1 327 ? 65.885  54.661  145.108 1.00 54.45 ? 327 GLU B CB  1 
ATOM   10426 C CG  . GLU C 1 327 ? 65.759  53.336  145.850 1.00 54.75 ? 327 GLU B CG  1 
ATOM   10427 C CD  . GLU C 1 327 ? 66.185  53.465  147.317 1.00 54.91 ? 327 GLU B CD  1 
ATOM   10428 O OE1 . GLU C 1 327 ? 67.390  53.274  147.601 1.00 55.34 ? 327 GLU B OE1 1 
ATOM   10429 O OE2 . GLU C 1 327 ? 65.320  53.757  148.182 1.00 54.76 ? 327 GLU B OE2 1 
ATOM   10430 N N   . PRO C 1 328 ? 64.007  52.917  142.774 1.00 54.27 ? 328 PRO B N   1 
ATOM   10431 C CA  . PRO C 1 328 ? 62.706  52.294  142.509 1.00 54.18 ? 328 PRO B CA  1 
ATOM   10432 C C   . PRO C 1 328 ? 61.909  52.034  143.788 1.00 54.18 ? 328 PRO B C   1 
ATOM   10433 O O   . PRO C 1 328 ? 62.464  51.544  144.774 1.00 54.20 ? 328 PRO B O   1 
ATOM   10434 C CB  . PRO C 1 328 ? 63.074  50.975  141.816 1.00 54.05 ? 328 PRO B CB  1 
ATOM   10435 C CG  . PRO C 1 328 ? 64.503  50.744  142.133 1.00 54.09 ? 328 PRO B CG  1 
ATOM   10436 C CD  . PRO C 1 328 ? 65.119  52.096  142.262 1.00 54.23 ? 328 PRO B CD  1 
ATOM   10437 N N   . GLU C 1 329 ? 60.626  52.392  143.765 1.00 54.21 ? 329 GLU B N   1 
ATOM   10438 C CA  . GLU C 1 329 ? 59.719  52.174  144.893 1.00 54.42 ? 329 GLU B CA  1 
ATOM   10439 C C   . GLU C 1 329 ? 58.312  51.871  144.395 1.00 54.13 ? 329 GLU B C   1 
ATOM   10440 O O   . GLU C 1 329 ? 57.790  52.564  143.518 1.00 54.12 ? 329 GLU B O   1 
ATOM   10441 C CB  . GLU C 1 329 ? 59.698  53.392  145.825 1.00 54.41 ? 329 GLU B CB  1 
ATOM   10442 C CG  . GLU C 1 329 ? 58.578  53.373  146.872 1.00 55.01 ? 329 GLU B CG  1 
ATOM   10443 C CD  . GLU C 1 329 ? 58.870  54.250  148.085 1.00 55.48 ? 329 GLU B CD  1 
ATOM   10444 O OE1 . GLU C 1 329 ? 58.843  55.501  147.956 1.00 56.45 ? 329 GLU B OE1 1 
ATOM   10445 O OE2 . GLU C 1 329 ? 59.112  53.676  149.174 1.00 56.65 ? 329 GLU B OE2 1 
ATOM   10446 N N   . SER C 1 330 ? 57.697  50.840  144.966 1.00 53.89 ? 330 SER B N   1 
ATOM   10447 C CA  . SER C 1 330 ? 56.344  50.463  144.587 1.00 53.56 ? 330 SER B CA  1 
ATOM   10448 C C   . SER C 1 330 ? 55.452  50.183  145.785 1.00 53.46 ? 330 SER B C   1 
ATOM   10449 O O   . SER C 1 330 ? 55.827  49.449  146.704 1.00 53.37 ? 330 SER B O   1 
ATOM   10450 C CB  . SER C 1 330 ? 56.360  49.263  143.645 1.00 53.43 ? 330 SER B CB  1 
ATOM   10451 O OG  . SER C 1 330 ? 57.087  48.194  144.204 1.00 53.23 ? 330 SER B OG  1 
ATOM   10452 N N   . SER C 1 331 ? 54.270  50.788  145.759 1.00 53.38 ? 331 SER B N   1 
ATOM   10453 C CA  . SER C 1 331 ? 53.249  50.544  146.767 1.00 53.25 ? 331 SER B CA  1 
ATOM   10454 C C   . SER C 1 331 ? 52.154  49.694  146.158 1.00 53.10 ? 331 SER B C   1 
ATOM   10455 O O   . SER C 1 331 ? 51.837  49.815  144.974 1.00 52.88 ? 331 SER B O   1 
ATOM   10456 C CB  . SER C 1 331 ? 52.649  51.857  147.290 1.00 53.18 ? 331 SER B CB  1 
ATOM   10457 O OG  . SER C 1 331 ? 53.651  52.829  147.555 1.00 53.24 ? 331 SER B OG  1 
ATOM   10458 N N   . SER C 1 332 ? 51.591  48.827  146.991 1.00 53.27 ? 332 SER B N   1 
ATOM   10459 C CA  . SER C 1 332 ? 50.391  48.057  146.675 1.00 53.20 ? 332 SER B CA  1 
ATOM   10460 C C   . SER C 1 332 ? 49.320  48.931  146.012 1.00 53.08 ? 332 SER B C   1 
ATOM   10461 O O   . SER C 1 332 ? 48.771  48.585  144.966 1.00 52.90 ? 332 SER B O   1 
ATOM   10462 C CB  . SER C 1 332 ? 49.837  47.452  147.972 1.00 53.40 ? 332 SER B CB  1 
ATOM   10463 O OG  . SER C 1 332 ? 49.706  48.445  148.990 1.00 52.93 ? 332 SER B OG  1 
ATOM   10464 N N   . ALA C 1 333 ? 49.061  50.079  146.632 1.00 52.90 ? 333 ALA B N   1 
ATOM   10465 C CA  . ALA C 1 333 ? 47.968  50.960  146.254 1.00 52.65 ? 333 ALA B CA  1 
ATOM   10466 C C   . ALA C 1 333 ? 48.355  52.018  145.228 1.00 52.50 ? 333 ALA B C   1 
ATOM   10467 O O   . ALA C 1 333 ? 47.587  52.297  144.308 1.00 52.57 ? 333 ALA B O   1 
ATOM   10468 C CB  . ALA C 1 333 ? 47.423  51.620  147.484 1.00 52.68 ? 333 ALA B CB  1 
ATOM   10469 N N   . LEU C 1 334 ? 49.536  52.606  145.398 1.00 52.30 ? 334 LEU B N   1 
ATOM   10470 C CA  . LEU C 1 334 ? 49.984  53.724  144.570 1.00 52.00 ? 334 LEU B CA  1 
ATOM   10471 C C   . LEU C 1 334 ? 50.578  53.298  143.230 1.00 51.82 ? 334 LEU B C   1 
ATOM   10472 O O   . LEU C 1 334 ? 50.723  54.121  142.328 1.00 51.80 ? 334 LEU B O   1 
ATOM   10473 C CB  . LEU C 1 334 ? 51.009  54.567  145.331 1.00 52.14 ? 334 LEU B CB  1 
ATOM   10474 C CG  . LEU C 1 334 ? 50.554  55.394  146.532 1.00 52.47 ? 334 LEU B CG  1 
ATOM   10475 C CD1 . LEU C 1 334 ? 51.761  55.904  147.301 1.00 52.36 ? 334 LEU B CD1 1 
ATOM   10476 C CD2 . LEU C 1 334 ? 49.662  56.552  146.090 1.00 53.45 ? 334 LEU B CD2 1 
ATOM   10477 N N   . GLY C 1 335 ? 50.931  52.022  143.105 1.00 51.69 ? 335 GLY B N   1 
ATOM   10478 C CA  . GLY C 1 335 ? 51.558  51.512  141.888 1.00 51.66 ? 335 GLY B CA  1 
ATOM   10479 C C   . GLY C 1 335 ? 53.070  51.647  141.913 1.00 51.69 ? 335 GLY B C   1 
ATOM   10480 O O   . GLY C 1 335 ? 53.652  51.988  142.945 1.00 51.73 ? 335 GLY B O   1 
ATOM   10481 N N   . PHE C 1 336 ? 53.705  51.365  140.778 1.00 51.63 ? 336 PHE B N   1 
ATOM   10482 C CA  . PHE C 1 336 ? 55.153  51.477  140.657 1.00 51.60 ? 336 PHE B CA  1 
ATOM   10483 C C   . PHE C 1 336 ? 55.539  52.923  140.417 1.00 51.72 ? 336 PHE B C   1 
ATOM   10484 O O   . PHE C 1 336 ? 54.956  53.592  139.564 1.00 51.76 ? 336 PHE B O   1 
ATOM   10485 C CB  . PHE C 1 336 ? 55.675  50.636  139.489 1.00 51.60 ? 336 PHE B CB  1 
ATOM   10486 C CG  . PHE C 1 336 ? 55.492  49.162  139.664 1.00 51.48 ? 336 PHE B CG  1 
ATOM   10487 C CD1 . PHE C 1 336 ? 56.368  48.431  140.457 1.00 50.82 ? 336 PHE B CD1 1 
ATOM   10488 C CD2 . PHE C 1 336 ? 54.451  48.498  139.015 1.00 51.47 ? 336 PHE B CD2 1 
ATOM   10489 C CE1 . PHE C 1 336 ? 56.201  47.063  140.620 1.00 51.13 ? 336 PHE B CE1 1 
ATOM   10490 C CE2 . PHE C 1 336 ? 54.276  47.128  139.170 1.00 51.34 ? 336 PHE B CE2 1 
ATOM   10491 C CZ  . PHE C 1 336 ? 55.152  46.408  139.974 1.00 51.34 ? 336 PHE B CZ  1 
ATOM   10492 N N   . GLY C 1 337 ? 56.536  53.393  141.159 1.00 51.77 ? 337 GLY B N   1 
ATOM   10493 C CA  . GLY C 1 337 ? 57.080  54.730  140.962 1.00 51.82 ? 337 GLY B CA  1 
ATOM   10494 C C   . GLY C 1 337 ? 58.516  54.821  141.425 1.00 51.97 ? 337 GLY B C   1 
ATOM   10495 O O   . GLY C 1 337 ? 59.281  53.861  141.288 1.00 52.13 ? 337 GLY B O   1 
ATOM   10496 N N   . PHE C 1 338 ? 58.880  55.977  141.979 1.00 51.93 ? 338 PHE B N   1 
ATOM   10497 C CA  . PHE C 1 338 ? 60.257  56.252  142.370 1.00 51.93 ? 338 PHE B CA  1 
ATOM   10498 C C   . PHE C 1 338 ? 60.367  57.092  143.635 1.00 52.26 ? 338 PHE B C   1 
ATOM   10499 O O   . PHE C 1 338 ? 59.647  58.078  143.813 1.00 52.12 ? 338 PHE B O   1 
ATOM   10500 C CB  . PHE C 1 338 ? 61.004  56.945  141.230 1.00 51.62 ? 338 PHE B CB  1 
ATOM   10501 C CG  . PHE C 1 338 ? 61.270  56.056  140.059 1.00 51.19 ? 338 PHE B CG  1 
ATOM   10502 C CD1 . PHE C 1 338 ? 62.370  55.209  140.051 1.00 50.84 ? 338 PHE B CD1 1 
ATOM   10503 C CD2 . PHE C 1 338 ? 60.418  56.059  138.962 1.00 50.90 ? 338 PHE B CD2 1 
ATOM   10504 C CE1 . PHE C 1 338 ? 62.618  54.380  138.970 1.00 50.83 ? 338 PHE B CE1 1 
ATOM   10505 C CE2 . PHE C 1 338 ? 60.656  55.231  137.874 1.00 50.47 ? 338 PHE B CE2 1 
ATOM   10506 C CZ  . PHE C 1 338 ? 61.756  54.390  137.879 1.00 50.87 ? 338 PHE B CZ  1 
ATOM   10507 N N   . ARG C 1 339 ? 61.281  56.683  144.508 1.00 52.69 ? 339 ARG B N   1 
ATOM   10508 C CA  . ARG C 1 339 ? 61.620  57.445  145.695 1.00 53.11 ? 339 ARG B CA  1 
ATOM   10509 C C   . ARG C 1 339 ? 62.753  58.384  145.329 1.00 53.10 ? 339 ARG B C   1 
ATOM   10510 O O   . ARG C 1 339 ? 63.770  57.955  144.780 1.00 53.11 ? 339 ARG B O   1 
ATOM   10511 C CB  . ARG C 1 339 ? 62.051  56.514  146.821 1.00 53.23 ? 339 ARG B CB  1 
ATOM   10512 C CG  . ARG C 1 339 ? 61.932  57.127  148.198 1.00 54.36 ? 339 ARG B CG  1 
ATOM   10513 C CD  . ARG C 1 339 ? 62.435  56.165  149.250 1.00 56.97 ? 339 ARG B CD  1 
ATOM   10514 N NE  . ARG C 1 339 ? 63.896  56.148  149.323 1.00 58.44 ? 339 ARG B NE  1 
ATOM   10515 C CZ  . ARG C 1 339 ? 64.601  56.699  150.307 1.00 59.60 ? 339 ARG B CZ  1 
ATOM   10516 N NH1 . ARG C 1 339 ? 63.982  57.310  151.315 1.00 60.18 ? 339 ARG B NH1 1 
ATOM   10517 N NH2 . ARG C 1 339 ? 65.927  56.635  150.286 1.00 59.77 ? 339 ARG B NH2 1 
ATOM   10518 N N   . CYS C 1 340 ? 62.581  59.663  145.639 1.00 53.20 ? 340 CYS B N   1 
ATOM   10519 C CA  . CYS C 1 340 ? 63.497  60.679  145.147 1.00 53.32 ? 340 CYS B CA  1 
ATOM   10520 C C   . CYS C 1 340 ? 64.151  61.546  146.221 1.00 53.46 ? 340 CYS B C   1 
ATOM   10521 O O   . CYS C 1 340 ? 63.511  61.930  147.199 1.00 53.31 ? 340 CYS B O   1 
ATOM   10522 C CB  . CYS C 1 340 ? 62.793  61.546  144.108 1.00 53.33 ? 340 CYS B CB  1 
ATOM   10523 S SG  . CYS C 1 340 ? 62.465  60.672  142.572 1.00 52.97 ? 340 CYS B SG  1 
ATOM   10524 N N   . GLY C 1 341 ? 65.434  61.844  146.009 1.00 53.63 ? 341 GLY B N   1 
ATOM   10525 C CA  . GLY C 1 341 ? 66.211  62.706  146.894 1.00 53.73 ? 341 GLY B CA  1 
ATOM   10526 C C   . GLY C 1 341 ? 66.605  64.019  146.240 1.00 53.82 ? 341 GLY B C   1 
ATOM   10527 O O   . GLY C 1 341 ? 67.037  64.043  145.087 1.00 53.68 ? 341 GLY B O   1 
ATOM   10528 N N   . PHE C 1 342 ? 66.457  65.109  146.991 1.00 53.94 ? 342 PHE B N   1 
ATOM   10529 C CA  . PHE C 1 342 ? 66.742  66.454  146.500 1.00 54.18 ? 342 PHE B CA  1 
ATOM   10530 C C   . PHE C 1 342 ? 67.561  67.261  147.503 1.00 54.50 ? 342 PHE B C   1 
ATOM   10531 O O   . PHE C 1 342 ? 67.615  66.931  148.690 1.00 54.68 ? 342 PHE B O   1 
ATOM   10532 C CB  . PHE C 1 342 ? 65.440  67.200  146.193 1.00 54.16 ? 342 PHE B CB  1 
ATOM   10533 C CG  . PHE C 1 342 ? 64.517  66.456  145.274 1.00 54.34 ? 342 PHE B CG  1 
ATOM   10534 C CD1 . PHE C 1 342 ? 64.668  66.543  143.894 1.00 54.34 ? 342 PHE B CD1 1 
ATOM   10535 C CD2 . PHE C 1 342 ? 63.500  65.660  145.786 1.00 54.16 ? 342 PHE B CD2 1 
ATOM   10536 C CE1 . PHE C 1 342 ? 63.819  65.848  143.042 1.00 54.23 ? 342 PHE B CE1 1 
ATOM   10537 C CE2 . PHE C 1 342 ? 62.652  64.964  144.940 1.00 54.03 ? 342 PHE B CE2 1 
ATOM   10538 C CZ  . PHE C 1 342 ? 62.811  65.059  143.565 1.00 53.86 ? 342 PHE B CZ  1 
ATOM   10539 N N   . LEU C 1 343 ? 68.184  68.331  147.017 1.00 54.73 ? 343 LEU B N   1 
ATOM   10540 C CA  . LEU C 1 343 ? 68.975  69.224  147.858 1.00 54.99 ? 343 LEU B CA  1 
ATOM   10541 C C   . LEU C 1 343 ? 68.094  70.148  148.711 1.00 55.31 ? 343 LEU B C   1 
ATOM   10542 O O   . LEU C 1 343 ? 68.589  70.854  149.597 1.00 55.31 ? 343 LEU B O   1 
ATOM   10543 C CB  . LEU C 1 343 ? 69.935  70.051  146.998 1.00 54.88 ? 343 LEU B CB  1 
ATOM   10544 C CG  . LEU C 1 343 ? 70.962  69.310  146.140 1.00 54.58 ? 343 LEU B CG  1 
ATOM   10545 C CD1 . LEU C 1 343 ? 71.549  70.255  145.105 1.00 54.42 ? 343 LEU B CD1 1 
ATOM   10546 C CD2 . LEU C 1 343 ? 72.054  68.695  146.995 1.00 54.26 ? 343 LEU B CD2 1 
ATOM   10547 N N   . GLY C 1 344 ? 66.791  70.132  148.438 1.00 55.59 ? 344 GLY B N   1 
ATOM   10548 C CA  . GLY C 1 344 ? 65.830  70.939  149.178 1.00 55.85 ? 344 GLY B CA  1 
ATOM   10549 C C   . GLY C 1 344 ? 64.515  71.063  148.440 1.00 56.06 ? 344 GLY B C   1 
ATOM   10550 O O   . GLY C 1 344 ? 64.203  70.248  147.570 1.00 55.98 ? 344 GLY B O   1 
ATOM   10551 N N   . LEU C 1 345 ? 63.755  72.101  148.783 1.00 56.33 ? 345 LEU B N   1 
ATOM   10552 C CA  . LEU C 1 345 ? 62.418  72.309  148.237 1.00 56.52 ? 345 LEU B CA  1 
ATOM   10553 C C   . LEU C 1 345 ? 62.380  72.618  146.743 1.00 56.65 ? 345 LEU B C   1 
ATOM   10554 O O   . LEU C 1 345 ? 61.783  71.857  145.983 1.00 56.80 ? 345 LEU B O   1 
ATOM   10555 C CB  . LEU C 1 345 ? 61.661  73.388  149.016 1.00 56.61 ? 345 LEU B CB  1 
ATOM   10556 C CG  . LEU C 1 345 ? 60.693  72.959  150.123 1.00 56.89 ? 345 LEU B CG  1 
ATOM   10557 C CD1 . LEU C 1 345 ? 60.088  74.204  150.774 1.00 57.58 ? 345 LEU B CD1 1 
ATOM   10558 C CD2 . LEU C 1 345 ? 59.592  72.032  149.602 1.00 56.62 ? 345 LEU B CD2 1 
ATOM   10559 N N   . LEU C 1 346 ? 62.996  73.723  146.317 1.00 56.60 ? 346 LEU B N   1 
ATOM   10560 C CA  . LEU C 1 346 ? 62.889  74.124  144.907 1.00 56.62 ? 346 LEU B CA  1 
ATOM   10561 C C   . LEU C 1 346 ? 63.749  73.306  143.934 1.00 56.40 ? 346 LEU B C   1 
ATOM   10562 O O   . LEU C 1 346 ? 63.480  73.307  142.731 1.00 56.60 ? 346 LEU B O   1 
ATOM   10563 C CB  . LEU C 1 346 ? 63.029  75.640  144.683 1.00 56.77 ? 346 LEU B CB  1 
ATOM   10564 C CG  . LEU C 1 346 ? 64.050  76.510  145.406 1.00 57.47 ? 346 LEU B CG  1 
ATOM   10565 C CD1 . LEU C 1 346 ? 63.754  76.535  146.910 1.00 57.93 ? 346 LEU B CD1 1 
ATOM   10566 C CD2 . LEU C 1 346 ? 65.480  76.069  145.096 1.00 57.89 ? 346 LEU B CD2 1 
ATOM   10567 N N   . HIS C 1 347 ? 64.766  72.612  144.443 1.00 55.94 ? 347 HIS B N   1 
ATOM   10568 C CA  . HIS C 1 347 ? 65.432  71.592  143.639 1.00 55.56 ? 347 HIS B CA  1 
ATOM   10569 C C   . HIS C 1 347 ? 64.390  70.543  143.249 1.00 55.80 ? 347 HIS B C   1 
ATOM   10570 O O   . HIS C 1 347 ? 64.320  70.130  142.087 1.00 55.78 ? 347 HIS B O   1 
ATOM   10571 C CB  . HIS C 1 347 ? 66.613  70.957  144.383 1.00 55.29 ? 347 HIS B CB  1 
ATOM   10572 C CG  . HIS C 1 347 ? 67.312  69.880  143.609 1.00 54.08 ? 347 HIS B CG  1 
ATOM   10573 N ND1 . HIS C 1 347 ? 67.512  69.947  142.246 1.00 52.99 ? 347 HIS B ND1 1 
ATOM   10574 C CD2 . HIS C 1 347 ? 67.873  68.716  144.011 1.00 52.92 ? 347 HIS B CD2 1 
ATOM   10575 C CE1 . HIS C 1 347 ? 68.154  68.867  141.843 1.00 52.12 ? 347 HIS B CE1 1 
ATOM   10576 N NE2 . HIS C 1 347 ? 68.384  68.103  142.894 1.00 52.11 ? 347 HIS B NE2 1 
ATOM   10577 N N   . MET C 1 348 ? 63.569  70.149  144.227 1.00 56.01 ? 348 MET B N   1 
ATOM   10578 C CA  . MET C 1 348 ? 62.410  69.279  144.001 1.00 56.23 ? 348 MET B CA  1 
ATOM   10579 C C   . MET C 1 348 ? 61.413  69.953  143.056 1.00 56.12 ? 348 MET B C   1 
ATOM   10580 O O   . MET C 1 348 ? 60.912  69.321  142.129 1.00 56.28 ? 348 MET B O   1 
ATOM   10581 C CB  . MET C 1 348 ? 61.742  68.897  145.338 1.00 56.19 ? 348 MET B CB  1 
ATOM   10582 C CG  . MET C 1 348 ? 60.477  68.035  145.218 1.00 56.49 ? 348 MET B CG  1 
ATOM   10583 S SD  . MET C 1 348 ? 59.812  67.388  146.783 1.00 56.55 ? 348 MET B SD  1 
ATOM   10584 C CE  . MET C 1 348 ? 59.175  68.876  147.552 1.00 57.13 ? 348 MET B CE  1 
ATOM   10585 N N   . GLU C 1 349 ? 61.165  71.241  143.276 1.00 56.09 ? 349 GLU B N   1 
ATOM   10586 C CA  . GLU C 1 349 ? 60.166  71.987  142.506 1.00 56.16 ? 349 GLU B CA  1 
ATOM   10587 C C   . GLU C 1 349 ? 60.561  72.255  141.058 1.00 55.96 ? 349 GLU B C   1 
ATOM   10588 O O   . GLU C 1 349 ? 59.696  72.313  140.186 1.00 55.78 ? 349 GLU B O   1 
ATOM   10589 C CB  . GLU C 1 349 ? 59.794  73.288  143.218 1.00 56.29 ? 349 GLU B CB  1 
ATOM   10590 C CG  . GLU C 1 349 ? 58.945  73.053  144.463 1.00 57.03 ? 349 GLU B CG  1 
ATOM   10591 C CD  . GLU C 1 349 ? 58.937  74.230  145.417 1.00 57.81 ? 349 GLU B CD  1 
ATOM   10592 O OE1 . GLU C 1 349 ? 59.432  75.319  145.044 1.00 58.31 ? 349 GLU B OE1 1 
ATOM   10593 O OE2 . GLU C 1 349 ? 58.422  74.060  146.545 1.00 58.17 ? 349 GLU B OE2 1 
ATOM   10594 N N   . ILE C 1 350 ? 61.860  72.430  140.814 1.00 55.86 ? 350 ILE B N   1 
ATOM   10595 C CA  . ILE C 1 350 ? 62.386  72.542  139.451 1.00 55.68 ? 350 ILE B CA  1 
ATOM   10596 C C   . ILE C 1 350 ? 62.235  71.208  138.725 1.00 55.58 ? 350 ILE B C   1 
ATOM   10597 O O   . ILE C 1 350 ? 61.833  71.171  137.566 1.00 55.71 ? 350 ILE B O   1 
ATOM   10598 C CB  . ILE C 1 350 ? 63.864  73.015  139.425 1.00 55.63 ? 350 ILE B CB  1 
ATOM   10599 C CG1 . ILE C 1 350 ? 63.938  74.524  139.680 1.00 55.62 ? 350 ILE B CG1 1 
ATOM   10600 C CG2 . ILE C 1 350 ? 64.533  72.671  138.088 1.00 55.53 ? 350 ILE B CG2 1 
ATOM   10601 C CD1 . ILE C 1 350 ? 65.350  75.079  139.789 1.00 55.70 ? 350 ILE B CD1 1 
ATOM   10602 N N   . ILE C 1 351 ? 62.544  70.118  139.419 1.00 55.43 ? 351 ILE B N   1 
ATOM   10603 C CA  . ILE C 1 351 ? 62.440  68.788  138.833 1.00 55.27 ? 351 ILE B CA  1 
ATOM   10604 C C   . ILE C 1 351 ? 60.988  68.390  138.589 1.00 55.28 ? 351 ILE B C   1 
ATOM   10605 O O   . ILE C 1 351 ? 60.687  67.733  137.592 1.00 55.42 ? 351 ILE B O   1 
ATOM   10606 C CB  . ILE C 1 351 ? 63.212  67.740  139.663 1.00 55.24 ? 351 ILE B CB  1 
ATOM   10607 C CG1 . ILE C 1 351 ? 64.664  67.703  139.185 1.00 54.98 ? 351 ILE B CG1 1 
ATOM   10608 C CG2 . ILE C 1 351 ? 62.582  66.350  139.545 1.00 55.16 ? 351 ILE B CG2 1 
ATOM   10609 C CD1 . ILE C 1 351 ? 65.614  67.073  140.154 1.00 55.50 ? 351 ILE B CD1 1 
ATOM   10610 N N   . GLN C 1 352 ? 60.096  68.803  139.485 1.00 55.15 ? 352 GLN B N   1 
ATOM   10611 C CA  . GLN C 1 352 ? 58.668  68.549  139.315 1.00 55.06 ? 352 GLN B CA  1 
ATOM   10612 C C   . GLN C 1 352 ? 58.091  69.326  138.134 1.00 55.06 ? 352 GLN B C   1 
ATOM   10613 O O   . GLN C 1 352 ? 57.296  68.795  137.358 1.00 55.09 ? 352 GLN B O   1 
ATOM   10614 C CB  . GLN C 1 352 ? 57.908  68.888  140.593 1.00 54.99 ? 352 GLN B CB  1 
ATOM   10615 C CG  . GLN C 1 352 ? 58.035  67.830  141.665 1.00 54.94 ? 352 GLN B CG  1 
ATOM   10616 C CD  . GLN C 1 352 ? 57.272  68.181  142.913 1.00 54.87 ? 352 GLN B CD  1 
ATOM   10617 O OE1 . GLN C 1 352 ? 57.516  69.215  143.543 1.00 54.95 ? 352 GLN B OE1 1 
ATOM   10618 N NE2 . GLN C 1 352 ? 56.340  67.319  143.287 1.00 55.11 ? 352 GLN B NE2 1 
ATOM   10619 N N   . GLU C 1 353 ? 58.511  70.581  138.008 1.00 55.09 ? 353 GLU B N   1 
ATOM   10620 C CA  . GLU C 1 353 ? 58.087  71.466  136.930 1.00 55.10 ? 353 GLU B CA  1 
ATOM   10621 C C   . GLU C 1 353 ? 58.598  70.935  135.595 1.00 54.91 ? 353 GLU B C   1 
ATOM   10622 O O   . GLU C 1 353 ? 57.905  70.998  134.581 1.00 54.94 ? 353 GLU B O   1 
ATOM   10623 C CB  . GLU C 1 353 ? 58.627  72.876  137.194 1.00 55.20 ? 353 GLU B CB  1 
ATOM   10624 C CG  . GLU C 1 353 ? 57.754  74.013  136.689 1.00 56.03 ? 353 GLU B CG  1 
ATOM   10625 C CD  . GLU C 1 353 ? 58.205  74.573  135.345 1.00 57.19 ? 353 GLU B CD  1 
ATOM   10626 O OE1 . GLU C 1 353 ? 59.352  74.301  134.915 1.00 57.42 ? 353 GLU B OE1 1 
ATOM   10627 O OE2 . GLU C 1 353 ? 57.404  75.304  134.722 1.00 57.63 ? 353 GLU B OE2 1 
ATOM   10628 N N   . ARG C 1 354 ? 59.810  70.391  135.625 1.00 54.79 ? 354 ARG B N   1 
ATOM   10629 C CA  . ARG C 1 354 ? 60.456  69.802  134.463 1.00 54.81 ? 354 ARG B CA  1 
ATOM   10630 C C   . ARG C 1 354 ? 59.756  68.501  134.043 1.00 54.79 ? 354 ARG B C   1 
ATOM   10631 O O   . ARG C 1 354 ? 59.444  68.308  132.867 1.00 54.66 ? 354 ARG B O   1 
ATOM   10632 C CB  . ARG C 1 354 ? 61.932  69.557  134.783 1.00 54.76 ? 354 ARG B CB  1 
ATOM   10633 C CG  . ARG C 1 354 ? 62.845  69.674  133.602 1.00 55.20 ? 354 ARG B CG  1 
ATOM   10634 C CD  . ARG C 1 354 ? 64.177  70.304  133.979 1.00 55.98 ? 354 ARG B CD  1 
ATOM   10635 N NE  . ARG C 1 354 ? 64.929  70.651  132.771 1.00 56.58 ? 354 ARG B NE  1 
ATOM   10636 C CZ  . ARG C 1 354 ? 65.951  69.950  132.282 1.00 56.72 ? 354 ARG B CZ  1 
ATOM   10637 N NH1 . ARG C 1 354 ? 66.386  68.860  132.906 1.00 57.13 ? 354 ARG B NH1 1 
ATOM   10638 N NH2 . ARG C 1 354 ? 66.553  70.352  131.170 1.00 56.75 ? 354 ARG B NH2 1 
ATOM   10639 N N   . LEU C 1 355 ? 59.503  67.629  135.019 1.00 54.91 ? 355 LEU B N   1 
ATOM   10640 C CA  . LEU C 1 355 ? 58.747  66.384  134.831 1.00 54.93 ? 355 LEU B CA  1 
ATOM   10641 C C   . LEU C 1 355 ? 57.351  66.597  134.256 1.00 55.09 ? 355 LEU B C   1 
ATOM   10642 O O   . LEU C 1 355 ? 56.847  65.769  133.497 1.00 54.98 ? 355 LEU B O   1 
ATOM   10643 C CB  . LEU C 1 355 ? 58.617  65.658  136.168 1.00 54.80 ? 355 LEU B CB  1 
ATOM   10644 C CG  . LEU C 1 355 ? 59.475  64.429  136.468 1.00 54.60 ? 355 LEU B CG  1 
ATOM   10645 C CD1 . LEU C 1 355 ? 60.730  64.336  135.602 1.00 54.14 ? 355 LEU B CD1 1 
ATOM   10646 C CD2 . LEU C 1 355 ? 59.814  64.401  137.957 1.00 54.39 ? 355 LEU B CD2 1 
ATOM   10647 N N   . GLU C 1 356 ? 56.738  67.710  134.637 1.00 55.37 ? 356 GLU B N   1 
ATOM   10648 C CA  . GLU C 1 356 ? 55.390  68.041  134.219 1.00 55.74 ? 356 GLU B CA  1 
ATOM   10649 C C   . GLU C 1 356 ? 55.369  68.710  132.850 1.00 55.77 ? 356 GLU B C   1 
ATOM   10650 O O   . GLU C 1 356 ? 54.536  68.370  132.015 1.00 55.82 ? 356 GLU B O   1 
ATOM   10651 C CB  . GLU C 1 356 ? 54.741  68.940  135.271 1.00 55.92 ? 356 GLU B CB  1 
ATOM   10652 C CG  . GLU C 1 356 ? 53.366  69.474  134.920 1.00 56.49 ? 356 GLU B CG  1 
ATOM   10653 C CD  . GLU C 1 356 ? 53.087  70.783  135.622 1.00 57.59 ? 356 GLU B CD  1 
ATOM   10654 O OE1 . GLU C 1 356 ? 53.179  70.818  136.870 1.00 57.60 ? 356 GLU B OE1 1 
ATOM   10655 O OE2 . GLU C 1 356 ? 52.791  71.781  134.924 1.00 58.52 ? 356 GLU B OE2 1 
ATOM   10656 N N   . ARG C 1 357 ? 56.283  69.652  132.620 1.00 55.99 ? 357 ARG B N   1 
ATOM   10657 C CA  . ARG C 1 357 ? 56.294  70.426  131.368 1.00 56.20 ? 357 ARG B CA  1 
ATOM   10658 C C   . ARG C 1 357 ? 57.084  69.783  130.218 1.00 56.05 ? 357 ARG B C   1 
ATOM   10659 O O   . ARG C 1 357 ? 56.546  69.609  129.124 1.00 56.02 ? 357 ARG B O   1 
ATOM   10660 C CB  . ARG C 1 357 ? 56.751  71.871  131.605 1.00 56.28 ? 357 ARG B CB  1 
ATOM   10661 C CG  . ARG C 1 357 ? 55.810  72.682  132.500 1.00 57.37 ? 357 ARG B CG  1 
ATOM   10662 C CD  . ARG C 1 357 ? 55.727  74.153  132.076 1.00 58.71 ? 357 ARG B CD  1 
ATOM   10663 N NE  . ARG C 1 357 ? 57.008  74.848  132.206 1.00 59.48 ? 357 ARG B NE  1 
ATOM   10664 C CZ  . ARG C 1 357 ? 57.787  75.210  131.188 1.00 60.00 ? 357 ARG B CZ  1 
ATOM   10665 N NH1 . ARG C 1 357 ? 57.430  74.959  129.933 1.00 59.80 ? 357 ARG B NH1 1 
ATOM   10666 N NH2 . ARG C 1 357 ? 58.932  75.834  131.429 1.00 60.49 ? 357 ARG B NH2 1 
ATOM   10667 N N   . GLU C 1 358 ? 58.347  69.436  130.460 1.00 55.90 ? 358 GLU B N   1 
ATOM   10668 C CA  . GLU C 1 358 ? 59.198  68.869  129.411 1.00 55.94 ? 358 GLU B CA  1 
ATOM   10669 C C   . GLU C 1 358 ? 58.783  67.465  128.984 1.00 55.74 ? 358 GLU B C   1 
ATOM   10670 O O   . GLU C 1 358 ? 58.893  67.120  127.803 1.00 55.96 ? 358 GLU B O   1 
ATOM   10671 C CB  . GLU C 1 358 ? 60.664  68.853  129.835 1.00 55.93 ? 358 GLU B CB  1 
ATOM   10672 C CG  . GLU C 1 358 ? 61.336  70.215  129.842 1.00 56.56 ? 358 GLU B CG  1 
ATOM   10673 C CD  . GLU C 1 358 ? 62.853  70.119  129.949 1.00 56.60 ? 358 GLU B CD  1 
ATOM   10674 O OE1 . GLU C 1 358 ? 63.359  69.096  130.467 1.00 57.46 ? 358 GLU B OE1 1 
ATOM   10675 O OE2 . GLU C 1 358 ? 63.540  71.072  129.512 1.00 57.32 ? 358 GLU B OE2 1 
ATOM   10676 N N   . TYR C 1 359 ? 58.307  66.664  129.940 1.00 55.29 ? 359 TYR B N   1 
ATOM   10677 C CA  . TYR C 1 359 ? 57.971  65.261  129.686 1.00 54.80 ? 359 TYR B CA  1 
ATOM   10678 C C   . TYR C 1 359 ? 56.476  64.944  129.755 1.00 54.49 ? 359 TYR B C   1 
ATOM   10679 O O   . TYR C 1 359 ? 56.081  63.785  129.603 1.00 54.39 ? 359 TYR B O   1 
ATOM   10680 C CB  . TYR C 1 359 ? 58.752  64.351  130.636 1.00 54.93 ? 359 TYR B CB  1 
ATOM   10681 C CG  . TYR C 1 359 ? 60.240  64.537  130.535 1.00 54.99 ? 359 TYR B CG  1 
ATOM   10682 C CD1 . TYR C 1 359 ? 60.941  64.085  129.419 1.00 55.27 ? 359 TYR B CD1 1 
ATOM   10683 C CD2 . TYR C 1 359 ? 60.950  65.178  131.544 1.00 55.27 ? 359 TYR B CD2 1 
ATOM   10684 C CE1 . TYR C 1 359 ? 62.313  64.262  129.312 1.00 55.12 ? 359 TYR B CE1 1 
ATOM   10685 C CE2 . TYR C 1 359 ? 62.327  65.358  131.447 1.00 55.16 ? 359 TYR B CE2 1 
ATOM   10686 C CZ  . TYR C 1 359 ? 62.999  64.895  130.329 1.00 55.06 ? 359 TYR B CZ  1 
ATOM   10687 O OH  . TYR C 1 359 ? 64.354  65.064  130.218 1.00 55.29 ? 359 TYR B OH  1 
ATOM   10688 N N   . ASP C 1 360 ? 55.660  65.972  129.989 1.00 54.04 ? 360 ASP B N   1 
ATOM   10689 C CA  . ASP C 1 360 ? 54.198  65.842  130.024 1.00 53.72 ? 360 ASP B CA  1 
ATOM   10690 C C   . ASP C 1 360 ? 53.705  64.709  130.952 1.00 53.49 ? 360 ASP B C   1 
ATOM   10691 O O   . ASP C 1 360 ? 52.970  63.819  130.525 1.00 53.55 ? 360 ASP B O   1 
ATOM   10692 C CB  . ASP C 1 360 ? 53.645  65.695  128.592 1.00 53.56 ? 360 ASP B CB  1 
ATOM   10693 C CG  . ASP C 1 360 ? 52.134  65.891  128.511 1.00 53.45 ? 360 ASP B CG  1 
ATOM   10694 O OD1 . ASP C 1 360 ? 51.504  66.271  129.523 1.00 53.10 ? 360 ASP B OD1 1 
ATOM   10695 O OD2 . ASP C 1 360 ? 51.573  65.658  127.421 1.00 53.28 ? 360 ASP B OD2 1 
ATOM   10696 N N   . LEU C 1 361 ? 54.104  64.760  132.220 1.00 53.23 ? 361 LEU B N   1 
ATOM   10697 C CA  . LEU C 1 361 ? 53.740  63.718  133.182 1.00 53.10 ? 361 LEU B CA  1 
ATOM   10698 C C   . LEU C 1 361 ? 52.873  64.213  134.337 1.00 53.15 ? 361 LEU B C   1 
ATOM   10699 O O   . LEU C 1 361 ? 53.250  65.147  135.055 1.00 53.14 ? 361 LEU B O   1 
ATOM   10700 C CB  . LEU C 1 361 ? 54.992  63.050  133.751 1.00 53.03 ? 361 LEU B CB  1 
ATOM   10701 C CG  . LEU C 1 361 ? 55.846  62.202  132.812 1.00 53.11 ? 361 LEU B CG  1 
ATOM   10702 C CD1 . LEU C 1 361 ? 57.233  62.013  133.406 1.00 52.74 ? 361 LEU B CD1 1 
ATOM   10703 C CD2 . LEU C 1 361 ? 55.183  60.859  132.530 1.00 52.81 ? 361 LEU B CD2 1 
ATOM   10704 N N   . ASP C 1 362 ? 51.715  63.577  134.510 1.00 53.01 ? 362 ASP B N   1 
ATOM   10705 C CA  . ASP C 1 362 ? 50.868  63.810  135.676 1.00 52.86 ? 362 ASP B CA  1 
ATOM   10706 C C   . ASP C 1 362 ? 51.328  62.891  136.809 1.00 52.72 ? 362 ASP B C   1 
ATOM   10707 O O   . ASP C 1 362 ? 51.184  61.676  136.716 1.00 52.93 ? 362 ASP B O   1 
ATOM   10708 C CB  . ASP C 1 362 ? 49.390  63.543  135.342 1.00 52.84 ? 362 ASP B CB  1 
ATOM   10709 C CG  . ASP C 1 362 ? 48.822  64.510  134.298 1.00 53.02 ? 362 ASP B CG  1 
ATOM   10710 O OD1 . ASP C 1 362 ? 49.351  65.631  134.127 1.00 53.14 ? 362 ASP B OD1 1 
ATOM   10711 O OD2 . ASP C 1 362 ? 47.822  64.144  133.647 1.00 53.12 ? 362 ASP B OD2 1 
ATOM   10712 N N   . LEU C 1 363 ? 51.882  63.463  137.875 1.00 52.64 ? 363 LEU B N   1 
ATOM   10713 C CA  . LEU C 1 363 ? 52.432  62.649  138.967 1.00 52.53 ? 363 LEU B CA  1 
ATOM   10714 C C   . LEU C 1 363 ? 51.766  62.829  140.332 1.00 52.51 ? 363 LEU B C   1 
ATOM   10715 O O   . LEU C 1 363 ? 51.352  63.933  140.704 1.00 52.32 ? 363 LEU B O   1 
ATOM   10716 C CB  . LEU C 1 363 ? 53.943  62.865  139.096 1.00 52.44 ? 363 LEU B CB  1 
ATOM   10717 C CG  . LEU C 1 363 ? 54.805  62.666  137.846 1.00 52.38 ? 363 LEU B CG  1 
ATOM   10718 C CD1 . LEU C 1 363 ? 56.254  62.971  138.162 1.00 52.16 ? 363 LEU B CD1 1 
ATOM   10719 C CD2 . LEU C 1 363 ? 54.670  61.261  137.274 1.00 52.19 ? 363 LEU B CD2 1 
ATOM   10720 N N   . ILE C 1 364 ? 51.658  61.719  141.061 1.00 52.57 ? 364 ILE B N   1 
ATOM   10721 C CA  . ILE C 1 364 ? 51.265  61.724  142.464 1.00 52.52 ? 364 ILE B CA  1 
ATOM   10722 C C   . ILE C 1 364 ? 52.557  61.912  143.228 1.00 52.71 ? 364 ILE B C   1 
ATOM   10723 O O   . ILE C 1 364 ? 53.527  61.180  143.011 1.00 52.95 ? 364 ILE B O   1 
ATOM   10724 C CB  . ILE C 1 364 ? 50.631  60.379  142.917 1.00 52.45 ? 364 ILE B CB  1 
ATOM   10725 C CG1 . ILE C 1 364 ? 49.448  59.964  142.027 1.00 52.60 ? 364 ILE B CG1 1 
ATOM   10726 C CG2 . ILE C 1 364 ? 50.239  60.429  144.401 1.00 52.14 ? 364 ILE B CG2 1 
ATOM   10727 C CD1 . ILE C 1 364 ? 48.147  60.718  142.273 1.00 53.52 ? 364 ILE B CD1 1 
ATOM   10728 N N   . THR C 1 365 ? 52.585  62.886  144.124 1.00 52.67 ? 365 THR B N   1 
ATOM   10729 C CA  . THR C 1 365 ? 53.800  63.133  144.873 1.00 52.74 ? 365 THR B CA  1 
ATOM   10730 C C   . THR C 1 365 ? 53.545  63.221  146.382 1.00 52.68 ? 365 THR B C   1 
ATOM   10731 O O   . THR C 1 365 ? 52.859  64.131  146.861 1.00 52.69 ? 365 THR B O   1 
ATOM   10732 C CB  . THR C 1 365 ? 54.577  64.347  144.308 1.00 52.70 ? 365 THR B CB  1 
ATOM   10733 O OG1 . THR C 1 365 ? 55.534  64.800  145.272 1.00 52.75 ? 365 THR B OG1 1 
ATOM   10734 C CG2 . THR C 1 365 ? 53.632  65.486  143.938 1.00 53.41 ? 365 THR B CG2 1 
ATOM   10735 N N   . THR C 1 366 ? 54.099  62.249  147.113 1.00 52.57 ? 366 THR B N   1 
ATOM   10736 C CA  . THR C 1 366 ? 53.933  62.144  148.569 1.00 52.47 ? 366 THR B CA  1 
ATOM   10737 C C   . THR C 1 366 ? 54.549  63.345  149.277 1.00 52.44 ? 366 THR B C   1 
ATOM   10738 O O   . THR C 1 366 ? 55.421  64.012  148.725 1.00 52.71 ? 366 THR B O   1 
ATOM   10739 C CB  . THR C 1 366 ? 54.582  60.854  149.147 1.00 52.39 ? 366 THR B CB  1 
ATOM   10740 O OG1 . THR C 1 366 ? 55.994  61.040  149.302 1.00 52.35 ? 366 THR B OG1 1 
ATOM   10741 C CG2 . THR C 1 366 ? 54.323  59.649  148.252 1.00 52.24 ? 366 THR B CG2 1 
ATOM   10742 N N   . ALA C 1 367 ? 54.099  63.612  150.499 1.00 52.37 ? 367 ALA B N   1 
ATOM   10743 C CA  . ALA C 1 367 ? 54.681  64.675  151.317 1.00 52.27 ? 367 ALA B CA  1 
ATOM   10744 C C   . ALA C 1 367 ? 56.193  64.468  151.517 1.00 52.18 ? 367 ALA B C   1 
ATOM   10745 O O   . ALA C 1 367 ? 56.646  63.345  151.774 1.00 52.26 ? 367 ALA B O   1 
ATOM   10746 C CB  . ALA C 1 367 ? 53.963  64.766  152.657 1.00 52.26 ? 367 ALA B CB  1 
ATOM   10747 N N   . PRO C 1 368 ? 56.980  65.546  151.361 1.00 51.93 ? 368 PRO B N   1 
ATOM   10748 C CA  . PRO C 1 368 ? 58.430  65.505  151.584 1.00 51.77 ? 368 PRO B CA  1 
ATOM   10749 C C   . PRO C 1 368 ? 58.838  65.204  153.036 1.00 51.56 ? 368 PRO B C   1 
ATOM   10750 O O   . PRO C 1 368 ? 58.103  65.524  153.978 1.00 51.42 ? 368 PRO B O   1 
ATOM   10751 C CB  . PRO C 1 368 ? 58.892  66.905  151.169 1.00 51.84 ? 368 PRO B CB  1 
ATOM   10752 C CG  . PRO C 1 368 ? 57.674  67.761  151.258 1.00 52.04 ? 368 PRO B CG  1 
ATOM   10753 C CD  . PRO C 1 368 ? 56.523  66.875  150.920 1.00 51.98 ? 368 PRO B CD  1 
ATOM   10754 N N   . THR C 1 369 ? 60.006  64.584  153.193 1.00 51.23 ? 369 THR B N   1 
ATOM   10755 C CA  . THR C 1 369 ? 60.491  64.115  154.494 1.00 51.07 ? 369 THR B CA  1 
ATOM   10756 C C   . THR C 1 369 ? 62.009  64.280  154.629 1.00 50.88 ? 369 THR B C   1 
ATOM   10757 O O   . THR C 1 369 ? 62.760  63.979  153.700 1.00 50.95 ? 369 THR B O   1 
ATOM   10758 C CB  . THR C 1 369 ? 60.061  62.643  154.779 1.00 51.02 ? 369 THR B CB  1 
ATOM   10759 O OG1 . THR C 1 369 ? 61.049  61.992  155.587 1.00 51.45 ? 369 THR B OG1 1 
ATOM   10760 C CG2 . THR C 1 369 ? 59.892  61.856  153.491 1.00 51.05 ? 369 THR B CG2 1 
ATOM   10761 N N   . VAL C 1 370 ? 62.449  64.747  155.796 1.00 50.62 ? 370 VAL B N   1 
ATOM   10762 C CA  . VAL C 1 370 ? 63.848  65.154  156.007 1.00 50.39 ? 370 VAL B CA  1 
ATOM   10763 C C   . VAL C 1 370 ? 64.721  64.087  156.679 1.00 50.29 ? 370 VAL B C   1 
ATOM   10764 O O   . VAL C 1 370 ? 64.216  63.076  157.156 1.00 50.36 ? 370 VAL B O   1 
ATOM   10765 C CB  . VAL C 1 370 ? 63.926  66.459  156.824 1.00 50.36 ? 370 VAL B CB  1 
ATOM   10766 C CG1 . VAL C 1 370 ? 63.271  67.603  156.067 1.00 49.95 ? 370 VAL B CG1 1 
ATOM   10767 C CG2 . VAL C 1 370 ? 63.275  66.273  158.183 1.00 50.41 ? 370 VAL B CG2 1 
ATOM   10768 N N   . VAL C 1 371 ? 66.030  64.325  156.715 1.00 50.22 ? 371 VAL B N   1 
ATOM   10769 C CA  . VAL C 1 371 ? 66.974  63.394  157.342 1.00 50.26 ? 371 VAL B CA  1 
ATOM   10770 C C   . VAL C 1 371 ? 67.097  63.680  158.840 1.00 50.25 ? 371 VAL B C   1 
ATOM   10771 O O   . VAL C 1 371 ? 67.374  64.813  159.240 1.00 50.27 ? 371 VAL B O   1 
ATOM   10772 C CB  . VAL C 1 371 ? 68.382  63.466  156.692 1.00 50.33 ? 371 VAL B CB  1 
ATOM   10773 C CG1 . VAL C 1 371 ? 69.285  62.372  157.241 1.00 50.17 ? 371 VAL B CG1 1 
ATOM   10774 C CG2 . VAL C 1 371 ? 68.291  63.357  155.178 1.00 50.39 ? 371 VAL B CG2 1 
ATOM   10775 N N   . TYR C 1 372 ? 66.893  62.645  159.654 1.00 50.21 ? 372 TYR B N   1 
ATOM   10776 C CA  . TYR C 1 372 ? 66.990  62.750  161.111 1.00 50.13 ? 372 TYR B CA  1 
ATOM   10777 C C   . TYR C 1 372 ? 68.222  62.025  161.645 1.00 50.23 ? 372 TYR B C   1 
ATOM   10778 O O   . TYR C 1 372 ? 68.567  60.946  161.166 1.00 50.26 ? 372 TYR B O   1 
ATOM   10779 C CB  . TYR C 1 372 ? 65.743  62.165  161.776 1.00 49.98 ? 372 TYR B CB  1 
ATOM   10780 C CG  . TYR C 1 372 ? 64.455  62.864  161.417 1.00 49.87 ? 372 TYR B CG  1 
ATOM   10781 C CD1 . TYR C 1 372 ? 63.987  63.934  162.176 1.00 49.64 ? 372 TYR B CD1 1 
ATOM   10782 C CD2 . TYR C 1 372 ? 63.693  62.448  160.325 1.00 49.72 ? 372 TYR B CD2 1 
ATOM   10783 C CE1 . TYR C 1 372 ? 62.802  64.580  161.852 1.00 49.39 ? 372 TYR B CE1 1 
ATOM   10784 C CE2 . TYR C 1 372 ? 62.506  63.087  159.993 1.00 49.54 ? 372 TYR B CE2 1 
ATOM   10785 C CZ  . TYR C 1 372 ? 62.069  64.150  160.762 1.00 49.62 ? 372 TYR B CZ  1 
ATOM   10786 O OH  . TYR C 1 372 ? 60.896  64.784  160.438 1.00 49.99 ? 372 TYR B OH  1 
ATOM   10787 N N   . GLU C 1 373 ? 68.877  62.623  162.637 1.00 50.40 ? 373 GLU B N   1 
ATOM   10788 C CA  . GLU C 1 373 ? 69.998  61.995  163.330 1.00 50.62 ? 373 GLU B CA  1 
ATOM   10789 C C   . GLU C 1 373 ? 69.454  61.180  164.498 1.00 50.76 ? 373 GLU B C   1 
ATOM   10790 O O   . GLU C 1 373 ? 68.991  61.738  165.489 1.00 50.79 ? 373 GLU B O   1 
ATOM   10791 C CB  . GLU C 1 373 ? 70.983  63.062  163.820 1.00 50.55 ? 373 GLU B CB  1 
ATOM   10792 C CG  . GLU C 1 373 ? 72.295  62.521  164.354 1.00 50.60 ? 373 GLU B CG  1 
ATOM   10793 C CD  . GLU C 1 373 ? 73.379  63.587  164.486 1.00 50.81 ? 373 GLU B CD  1 
ATOM   10794 O OE1 . GLU C 1 373 ? 73.276  64.449  165.389 1.00 50.80 ? 373 GLU B OE1 1 
ATOM   10795 O OE2 . GLU C 1 373 ? 74.347  63.548  163.693 1.00 50.70 ? 373 GLU B OE2 1 
ATOM   10796 N N   . VAL C 1 374 ? 69.494  59.859  164.377 1.00 51.05 ? 374 VAL B N   1 
ATOM   10797 C CA  . VAL C 1 374 ? 68.901  58.996  165.397 1.00 51.51 ? 374 VAL B CA  1 
ATOM   10798 C C   . VAL C 1 374 ? 69.964  58.282  166.236 1.00 51.94 ? 374 VAL B C   1 
ATOM   10799 O O   . VAL C 1 374 ? 70.877  57.657  165.695 1.00 51.99 ? 374 VAL B O   1 
ATOM   10800 C CB  . VAL C 1 374 ? 67.914  57.976  164.776 1.00 51.39 ? 374 VAL B CB  1 
ATOM   10801 C CG1 . VAL C 1 374 ? 67.184  57.201  165.861 1.00 51.36 ? 374 VAL B CG1 1 
ATOM   10802 C CG2 . VAL C 1 374 ? 66.907  58.687  163.883 1.00 51.28 ? 374 VAL B CG2 1 
ATOM   10803 N N   . GLU C 1 375 ? 69.840  58.394  167.559 1.00 52.51 ? 375 GLU B N   1 
ATOM   10804 C CA  . GLU C 1 375 ? 70.711  57.672  168.483 1.00 53.03 ? 375 GLU B CA  1 
ATOM   10805 C C   . GLU C 1 375 ? 70.014  56.450  169.082 1.00 53.31 ? 375 GLU B C   1 
ATOM   10806 O O   . GLU C 1 375 ? 69.012  56.572  169.797 1.00 53.25 ? 375 GLU B O   1 
ATOM   10807 C CB  . GLU C 1 375 ? 71.244  58.593  169.586 1.00 53.10 ? 375 GLU B CB  1 
ATOM   10808 C CG  . GLU C 1 375 ? 72.282  57.920  170.492 1.00 53.84 ? 375 GLU B CG  1 
ATOM   10809 C CD  . GLU C 1 375 ? 73.078  58.903  171.339 1.00 54.48 ? 375 GLU B CD  1 
ATOM   10810 O OE1 . GLU C 1 375 ? 73.260  58.635  172.545 1.00 55.03 ? 375 GLU B OE1 1 
ATOM   10811 O OE2 . GLU C 1 375 ? 73.533  59.936  170.805 1.00 54.94 ? 375 GLU B OE2 1 
ATOM   10812 N N   . THR C 1 376 ? 70.570  55.278  168.774 1.00 53.80 ? 376 THR B N   1 
ATOM   10813 C CA  . THR C 1 376 ? 70.083  53.983  169.253 1.00 54.30 ? 376 THR B CA  1 
ATOM   10814 C C   . THR C 1 376 ? 70.199  53.881  170.775 1.00 54.52 ? 376 THR B C   1 
ATOM   10815 O O   . THR C 1 376 ? 71.076  54.502  171.383 1.00 54.63 ? 376 THR B O   1 
ATOM   10816 C CB  . THR C 1 376 ? 70.874  52.817  168.576 1.00 54.29 ? 376 THR B CB  1 
ATOM   10817 O OG1 . THR C 1 376 ? 70.701  52.881  167.157 1.00 54.76 ? 376 THR B OG1 1 
ATOM   10818 C CG2 . THR C 1 376 ? 70.410  51.444  169.058 1.00 54.46 ? 376 THR B CG2 1 
ATOM   10819 N N   . THR C 1 377 ? 69.296  53.110  171.379 1.00 54.78 ? 377 THR B N   1 
ATOM   10820 C CA  . THR C 1 377 ? 69.391  52.740  172.790 1.00 55.06 ? 377 THR B CA  1 
ATOM   10821 C C   . THR C 1 377 ? 70.810  52.227  173.101 1.00 55.21 ? 377 THR B C   1 
ATOM   10822 O O   . THR C 1 377 ? 71.486  52.751  173.989 1.00 55.16 ? 377 THR B O   1 
ATOM   10823 C CB  . THR C 1 377 ? 68.279  51.720  173.197 1.00 55.00 ? 377 THR B CB  1 
ATOM   10824 O OG1 . THR C 1 377 ? 68.384  51.413  174.590 1.00 55.31 ? 377 THR B OG1 1 
ATOM   10825 C CG2 . THR C 1 377 ? 68.363  50.420  172.383 1.00 55.15 ? 377 THR B CG2 1 
ATOM   10826 N N   . SER C 1 378 ? 71.253  51.221  172.344 1.00 55.44 ? 378 SER B N   1 
ATOM   10827 C CA  . SER C 1 378 ? 72.654  50.814  172.310 1.00 55.61 ? 378 SER B CA  1 
ATOM   10828 C C   . SER C 1 378 ? 73.419  51.906  171.571 1.00 55.57 ? 378 SER B C   1 
ATOM   10829 O O   . SER C 1 378 ? 73.506  51.889  170.342 1.00 55.73 ? 378 SER B O   1 
ATOM   10830 C CB  . SER C 1 378 ? 72.795  49.465  171.595 1.00 55.70 ? 378 SER B CB  1 
ATOM   10831 O OG  . SER C 1 378 ? 74.147  49.190  171.259 1.00 55.90 ? 378 SER B OG  1 
ATOM   10832 N N   . ARG C 1 379 ? 73.968  52.849  172.333 1.00 55.51 ? 379 ARG B N   1 
ATOM   10833 C CA  . ARG C 1 379 ? 74.418  54.143  171.802 1.00 55.65 ? 379 ARG B CA  1 
ATOM   10834 C C   . ARG C 1 379 ? 75.263  54.119  170.527 1.00 55.66 ? 379 ARG B C   1 
ATOM   10835 O O   . ARG C 1 379 ? 76.367  53.564  170.499 1.00 55.78 ? 379 ARG B O   1 
ATOM   10836 C CB  . ARG C 1 379 ? 75.120  54.958  172.885 1.00 55.68 ? 379 ARG B CB  1 
ATOM   10837 C CG  . ARG C 1 379 ? 74.173  55.546  173.896 1.00 55.85 ? 379 ARG B CG  1 
ATOM   10838 C CD  . ARG C 1 379 ? 74.946  56.125  175.044 1.00 56.67 ? 379 ARG B CD  1 
ATOM   10839 N NE  . ARG C 1 379 ? 74.069  56.748  176.025 1.00 57.36 ? 379 ARG B NE  1 
ATOM   10840 C CZ  . ARG C 1 379 ? 73.674  58.016  175.985 1.00 57.65 ? 379 ARG B CZ  1 
ATOM   10841 N NH1 . ARG C 1 379 ? 74.070  58.822  175.005 1.00 57.19 ? 379 ARG B NH1 1 
ATOM   10842 N NH2 . ARG C 1 379 ? 72.881  58.480  176.938 1.00 58.12 ? 379 ARG B NH2 1 
ATOM   10843 N N   . GLU C 1 380 ? 74.701  54.724  169.483 1.00 55.49 ? 380 GLU B N   1 
ATOM   10844 C CA  . GLU C 1 380 ? 75.360  54.960  168.197 1.00 55.40 ? 380 GLU B CA  1 
ATOM   10845 C C   . GLU C 1 380 ? 74.428  55.790  167.318 1.00 55.03 ? 380 GLU B C   1 
ATOM   10846 O O   . GLU C 1 380 ? 73.207  55.619  167.356 1.00 55.09 ? 380 GLU B O   1 
ATOM   10847 C CB  . GLU C 1 380 ? 75.755  53.653  167.494 1.00 55.45 ? 380 GLU B CB  1 
ATOM   10848 C CG  . GLU C 1 380 ? 74.597  52.749  167.076 1.00 55.75 ? 380 GLU B CG  1 
ATOM   10849 C CD  . GLU C 1 380 ? 75.065  51.378  166.612 1.00 55.95 ? 380 GLU B CD  1 
ATOM   10850 O OE1 . GLU C 1 380 ? 75.947  50.779  167.278 1.00 56.61 ? 380 GLU B OE1 1 
ATOM   10851 O OE2 . GLU C 1 380 ? 74.543  50.898  165.581 1.00 56.39 ? 380 GLU B OE2 1 
ATOM   10852 N N   . VAL C 1 381 ? 75.013  56.684  166.529 1.00 54.57 ? 381 VAL B N   1 
ATOM   10853 C CA  . VAL C 1 381 ? 74.255  57.656  165.755 1.00 54.07 ? 381 VAL B CA  1 
ATOM   10854 C C   . VAL C 1 381 ? 74.029  57.163  164.326 1.00 53.79 ? 381 VAL B C   1 
ATOM   10855 O O   . VAL C 1 381 ? 74.982  56.823  163.627 1.00 53.78 ? 381 VAL B O   1 
ATOM   10856 C CB  . VAL C 1 381 ? 74.984  59.020  165.756 1.00 54.19 ? 381 VAL B CB  1 
ATOM   10857 C CG1 . VAL C 1 381 ? 74.354  59.986  164.773 1.00 54.17 ? 381 VAL B CG1 1 
ATOM   10858 C CG2 . VAL C 1 381 ? 75.009  59.616  167.167 1.00 54.17 ? 381 VAL B CG2 1 
ATOM   10859 N N   . ILE C 1 382 ? 72.765  57.111  163.907 1.00 53.47 ? 382 ILE B N   1 
ATOM   10860 C CA  . ILE C 1 382 ? 72.407  56.737  162.527 1.00 53.18 ? 382 ILE B CA  1 
ATOM   10861 C C   . ILE C 1 382 ? 71.451  57.753  161.882 1.00 52.99 ? 382 ILE B C   1 
ATOM   10862 O O   . ILE C 1 382 ? 70.843  58.572  162.578 1.00 52.90 ? 382 ILE B O   1 
ATOM   10863 C CB  . ILE C 1 382 ? 71.810  55.304  162.426 1.00 53.18 ? 382 ILE B CB  1 
ATOM   10864 C CG1 . ILE C 1 382 ? 70.535  55.178  163.265 1.00 53.03 ? 382 ILE B CG1 1 
ATOM   10865 C CG2 . ILE C 1 382 ? 72.855  54.240  162.810 1.00 53.14 ? 382 ILE B CG2 1 
ATOM   10866 C CD1 . ILE C 1 382 ? 69.566  54.145  162.734 1.00 53.28 ? 382 ILE B CD1 1 
ATOM   10867 N N   . TYR C 1 383 ? 71.317  57.688  160.556 1.00 52.64 ? 383 TYR B N   1 
ATOM   10868 C CA  . TYR C 1 383 ? 70.526  58.670  159.808 1.00 52.23 ? 383 TYR B CA  1 
ATOM   10869 C C   . TYR C 1 383 ? 69.377  58.036  159.038 1.00 52.17 ? 383 TYR B C   1 
ATOM   10870 O O   . TYR C 1 383 ? 69.530  56.963  158.458 1.00 52.17 ? 383 TYR B O   1 
ATOM   10871 C CB  . TYR C 1 383 ? 71.432  59.487  158.882 1.00 52.07 ? 383 TYR B CB  1 
ATOM   10872 C CG  . TYR C 1 383 ? 72.519  60.218  159.635 1.00 51.71 ? 383 TYR B CG  1 
ATOM   10873 C CD1 . TYR C 1 383 ? 73.788  59.660  159.784 1.00 51.47 ? 383 TYR B CD1 1 
ATOM   10874 C CD2 . TYR C 1 383 ? 72.269  61.454  160.227 1.00 51.54 ? 383 TYR B CD2 1 
ATOM   10875 C CE1 . TYR C 1 383 ? 74.783  60.320  160.491 1.00 51.48 ? 383 TYR B CE1 1 
ATOM   10876 C CE2 . TYR C 1 383 ? 73.257  62.123  160.936 1.00 51.69 ? 383 TYR B CE2 1 
ATOM   10877 C CZ  . TYR C 1 383 ? 74.510  61.550  161.066 1.00 51.62 ? 383 TYR B CZ  1 
ATOM   10878 O OH  . TYR C 1 383 ? 75.489  62.209  161.770 1.00 51.55 ? 383 TYR B OH  1 
ATOM   10879 N N   . VAL C 1 384 ? 68.226  58.707  159.036 1.00 52.18 ? 384 VAL B N   1 
ATOM   10880 C CA  . VAL C 1 384 ? 66.996  58.130  158.485 1.00 52.29 ? 384 VAL B CA  1 
ATOM   10881 C C   . VAL C 1 384 ? 66.364  58.957  157.358 1.00 52.52 ? 384 VAL B C   1 
ATOM   10882 O O   . VAL C 1 384 ? 65.937  60.096  157.571 1.00 52.48 ? 384 VAL B O   1 
ATOM   10883 C CB  . VAL C 1 384 ? 65.950  57.850  159.595 1.00 52.17 ? 384 VAL B CB  1 
ATOM   10884 C CG1 . VAL C 1 384 ? 64.711  57.203  159.010 1.00 51.88 ? 384 VAL B CG1 1 
ATOM   10885 C CG2 . VAL C 1 384 ? 66.542  56.953  160.671 1.00 51.95 ? 384 VAL B CG2 1 
ATOM   10886 N N   . ASP C 1 385 ? 66.307  58.356  156.168 1.00 52.78 ? 385 ASP B N   1 
ATOM   10887 C CA  . ASP C 1 385 ? 65.706  58.972  154.985 1.00 53.07 ? 385 ASP B CA  1 
ATOM   10888 C C   . ASP C 1 385 ? 64.198  58.784  155.013 1.00 53.24 ? 385 ASP B C   1 
ATOM   10889 O O   . ASP C 1 385 ? 63.438  59.752  154.946 1.00 53.33 ? 385 ASP B O   1 
ATOM   10890 C CB  . ASP C 1 385 ? 66.253  58.337  153.698 1.00 53.07 ? 385 ASP B CB  1 
ATOM   10891 C CG  . ASP C 1 385 ? 67.768  58.305  153.652 1.00 53.72 ? 385 ASP B CG  1 
ATOM   10892 O OD1 . ASP C 1 385 ? 68.396  59.371  153.813 1.00 55.03 ? 385 ASP B OD1 1 
ATOM   10893 O OD2 . ASP C 1 385 ? 68.336  57.211  153.442 1.00 53.96 ? 385 ASP B OD2 1 
ATOM   10894 N N   . SER C 1 386 ? 63.771  57.526  155.096 1.00 53.35 ? 386 SER B N   1 
ATOM   10895 C CA  . SER C 1 386 ? 62.356  57.195  155.050 1.00 53.36 ? 386 SER B CA  1 
ATOM   10896 C C   . SER C 1 386 ? 61.873  56.742  156.419 1.00 53.34 ? 386 SER B C   1 
ATOM   10897 O O   . SER C 1 386 ? 62.497  55.881  157.040 1.00 53.19 ? 386 SER B O   1 
ATOM   10898 C CB  . SER C 1 386 ? 62.065  56.133  153.982 1.00 53.46 ? 386 SER B CB  1 
ATOM   10899 O OG  . SER C 1 386 ? 62.819  54.952  154.196 1.00 53.58 ? 386 SER B OG  1 
ATOM   10900 N N   . PRO C 1 387 ? 60.765  57.344  156.898 1.00 53.41 ? 387 PRO B N   1 
ATOM   10901 C CA  . PRO C 1 387 ? 60.117  57.048  158.175 1.00 53.40 ? 387 PRO B CA  1 
ATOM   10902 C C   . PRO C 1 387 ? 59.997  55.559  158.490 1.00 53.36 ? 387 PRO B C   1 
ATOM   10903 O O   . PRO C 1 387 ? 60.217  55.153  159.631 1.00 53.25 ? 387 PRO B O   1 
ATOM   10904 C CB  . PRO C 1 387 ? 58.736  57.674  157.995 1.00 53.52 ? 387 PRO B CB  1 
ATOM   10905 C CG  . PRO C 1 387 ? 59.017  58.870  157.168 1.00 53.33 ? 387 PRO B CG  1 
ATOM   10906 C CD  . PRO C 1 387 ? 60.063  58.432  156.187 1.00 53.35 ? 387 PRO B CD  1 
ATOM   10907 N N   . SER C 1 388 ? 59.676  54.757  157.478 1.00 53.38 ? 388 SER B N   1 
ATOM   10908 C CA  . SER C 1 388 ? 59.524  53.308  157.642 1.00 53.25 ? 388 SER B CA  1 
ATOM   10909 C C   . SER C 1 388 ? 60.817  52.586  158.042 1.00 53.00 ? 388 SER B C   1 
ATOM   10910 O O   . SER C 1 388 ? 60.830  51.364  158.165 1.00 53.00 ? 388 SER B O   1 
ATOM   10911 C CB  . SER C 1 388 ? 58.924  52.687  156.370 1.00 53.29 ? 388 SER B CB  1 
ATOM   10912 O OG  . SER C 1 388 ? 59.655  53.056  155.211 1.00 53.46 ? 388 SER B OG  1 
ATOM   10913 N N   . LYS C 1 389 ? 61.894  53.341  158.250 1.00 52.93 ? 389 LYS B N   1 
ATOM   10914 C CA  . LYS C 1 389 ? 63.183  52.768  158.658 1.00 52.89 ? 389 LYS B CA  1 
ATOM   10915 C C   . LYS C 1 389 ? 63.658  53.272  160.025 1.00 52.89 ? 389 LYS B C   1 
ATOM   10916 O O   . LYS C 1 389 ? 64.757  52.938  160.478 1.00 52.96 ? 389 LYS B O   1 
ATOM   10917 C CB  . LYS C 1 389 ? 64.248  53.012  157.586 1.00 52.86 ? 389 LYS B CB  1 
ATOM   10918 C CG  . LYS C 1 389 ? 64.122  52.092  156.391 1.00 52.73 ? 389 LYS B CG  1 
ATOM   10919 C CD  . LYS C 1 389 ? 64.974  52.578  155.247 1.00 52.93 ? 389 LYS B CD  1 
ATOM   10920 C CE  . LYS C 1 389 ? 64.587  51.888  153.953 1.00 52.99 ? 389 LYS B CE  1 
ATOM   10921 N NZ  . LYS C 1 389 ? 65.205  52.563  152.784 1.00 52.98 ? 389 LYS B NZ  1 
ATOM   10922 N N   . LEU C 1 390 ? 62.820  54.077  160.672 1.00 52.90 ? 390 LEU B N   1 
ATOM   10923 C CA  . LEU C 1 390 ? 63.057  54.517  162.039 1.00 52.91 ? 390 LEU B CA  1 
ATOM   10924 C C   . LEU C 1 390 ? 63.050  53.289  162.950 1.00 53.05 ? 390 LEU B C   1 
ATOM   10925 O O   . LEU C 1 390 ? 62.122  52.476  162.884 1.00 53.00 ? 390 LEU B O   1 
ATOM   10926 C CB  . LEU C 1 390 ? 61.969  55.502  162.467 1.00 52.79 ? 390 LEU B CB  1 
ATOM   10927 C CG  . LEU C 1 390 ? 62.247  56.466  163.619 1.00 52.91 ? 390 LEU B CG  1 
ATOM   10928 C CD1 . LEU C 1 390 ? 63.249  57.533  163.210 1.00 53.09 ? 390 LEU B CD1 1 
ATOM   10929 C CD2 . LEU C 1 390 ? 60.952  57.118  164.071 1.00 52.94 ? 390 LEU B CD2 1 
ATOM   10930 N N   . PRO C 1 391 ? 64.093  53.142  163.792 1.00 53.17 ? 391 PRO B N   1 
ATOM   10931 C CA  . PRO C 1 391 ? 64.182  52.014  164.720 1.00 53.24 ? 391 PRO B CA  1 
ATOM   10932 C C   . PRO C 1 391 ? 63.005  52.012  165.690 1.00 53.39 ? 391 PRO B C   1 
ATOM   10933 O O   . PRO C 1 391 ? 62.373  53.055  165.885 1.00 53.43 ? 391 PRO B O   1 
ATOM   10934 C CB  . PRO C 1 391 ? 65.495  52.275  165.468 1.00 53.12 ? 391 PRO B CB  1 
ATOM   10935 C CG  . PRO C 1 391 ? 65.775  53.721  165.274 1.00 53.12 ? 391 PRO B CG  1 
ATOM   10936 C CD  . PRO C 1 391 ? 65.249  54.047  163.922 1.00 53.16 ? 391 PRO B CD  1 
ATOM   10937 N N   . ALA C 1 392 ? 62.710  50.853  166.281 1.00 53.55 ? 392 ALA B N   1 
ATOM   10938 C CA  . ALA C 1 392 ? 61.565  50.707  167.187 1.00 53.73 ? 392 ALA B CA  1 
ATOM   10939 C C   . ALA C 1 392 ? 61.598  51.743  168.308 1.00 53.93 ? 392 ALA B C   1 
ATOM   10940 O O   . ALA C 1 392 ? 62.675  52.162  168.739 1.00 54.11 ? 392 ALA B O   1 
ATOM   10941 C CB  . ALA C 1 392 ? 61.509  49.301  167.756 1.00 53.60 ? 392 ALA B CB  1 
ATOM   10942 N N   . VAL C 1 393 ? 60.416  52.156  168.765 1.00 54.11 ? 393 VAL B N   1 
ATOM   10943 C CA  . VAL C 1 393 ? 60.281  53.172  169.818 1.00 54.18 ? 393 VAL B CA  1 
ATOM   10944 C C   . VAL C 1 393 ? 61.117  52.836  171.055 1.00 54.25 ? 393 VAL B C   1 
ATOM   10945 O O   . VAL C 1 393 ? 61.707  53.722  171.670 1.00 54.29 ? 393 VAL B O   1 
ATOM   10946 C CB  . VAL C 1 393 ? 58.808  53.371  170.244 1.00 54.24 ? 393 VAL B CB  1 
ATOM   10947 C CG1 . VAL C 1 393 ? 58.615  54.760  170.848 1.00 54.00 ? 393 VAL B CG1 1 
ATOM   10948 C CG2 . VAL C 1 393 ? 57.858  53.159  169.054 1.00 54.23 ? 393 VAL B CG2 1 
ATOM   10949 N N   . ASN C 1 394 ? 61.167  51.550  171.394 1.00 54.36 ? 394 ASN B N   1 
ATOM   10950 C CA  . ASN C 1 394 ? 61.954  51.032  172.518 1.00 54.46 ? 394 ASN B CA  1 
ATOM   10951 C C   . ASN C 1 394 ? 63.465  51.209  172.331 1.00 54.32 ? 394 ASN B C   1 
ATOM   10952 O O   . ASN C 1 394 ? 64.221  51.221  173.305 1.00 54.36 ? 394 ASN B O   1 
ATOM   10953 C CB  . ASN C 1 394 ? 61.662  49.538  172.734 1.00 54.54 ? 394 ASN B CB  1 
ATOM   10954 C CG  . ASN C 1 394 ? 60.245  49.142  172.330 1.00 55.28 ? 394 ASN B CG  1 
ATOM   10955 O OD1 . ASN C 1 394 ? 59.789  49.424  171.213 1.00 55.91 ? 394 ASN B OD1 1 
ATOM   10956 N ND2 . ASN C 1 394 ? 59.547  48.465  173.236 1.00 55.82 ? 394 ASN B ND2 1 
ATOM   10957 N N   . ASN C 1 395 ? 63.893  51.329  171.076 1.00 54.12 ? 395 ASN B N   1 
ATOM   10958 C CA  . ASN C 1 395 ? 65.312  51.392  170.735 1.00 53.85 ? 395 ASN B CA  1 
ATOM   10959 C C   . ASN C 1 395 ? 65.828  52.799  170.466 1.00 53.59 ? 395 ASN B C   1 
ATOM   10960 O O   . ASN C 1 395 ? 67.029  53.004  170.311 1.00 53.57 ? 395 ASN B O   1 
ATOM   10961 C CB  . ASN C 1 395 ? 65.617  50.479  169.546 1.00 53.88 ? 395 ASN B CB  1 
ATOM   10962 C CG  . ASN C 1 395 ? 65.421  49.015  169.875 1.00 54.34 ? 395 ASN B CG  1 
ATOM   10963 O OD1 . ASN C 1 395 ? 66.034  48.486  170.803 1.00 55.14 ? 395 ASN B OD1 1 
ATOM   10964 N ND2 . ASN C 1 395 ? 64.562  48.349  169.112 1.00 54.73 ? 395 ASN B ND2 1 
ATOM   10965 N N   . ILE C 1 396 ? 64.921  53.765  170.410 1.00 53.34 ? 396 ILE B N   1 
ATOM   10966 C CA  . ILE C 1 396 ? 65.323  55.155  170.233 1.00 53.26 ? 396 ILE B CA  1 
ATOM   10967 C C   . ILE C 1 396 ? 65.696  55.774  171.585 1.00 53.14 ? 396 ILE B C   1 
ATOM   10968 O O   . ILE C 1 396 ? 64.829  55.979  172.444 1.00 53.18 ? 396 ILE B O   1 
ATOM   10969 C CB  . ILE C 1 396 ? 64.225  55.995  169.527 1.00 53.21 ? 396 ILE