data_3CEI
# 
_entry.id   3CEI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3CEI         
RCSB  RCSB046678   
WWPDB D_1000046678 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3CEI 
_pdbx_database_status.recvd_initial_deposition_date   2008-02-29 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Esposito, L.'   1 
'Seydel, A.'     2 
'Aiello, R.'     3 
'Sorrentino, G.' 4 
'Cendron, L.'    5 
'Zanotti, G.'    6 
'Zagari, A.'     7 
# 
_citation.id                        primary 
_citation.title                     
'The crystal structure of the superoxide dismutase from Helicobacter pylori reveals a structured C-terminal extension' 
_citation.journal_abbrev            Biochim.Biophys.Acta 
_citation.journal_volume            1784 
_citation.page_first                1601 
_citation.page_last                 1606 
_citation.year                      2008 
_citation.journal_id_ASTM           BBACAQ 
_citation.country                   NE 
_citation.journal_id_ISSN           0006-3002 
_citation.journal_id_CSD            0113 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18502213 
_citation.pdbx_database_id_DOI      10.1016/j.bbapap.2008.04.024 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Esposito, L.'   1 
primary 'Seydel, A.'     2 
primary 'Aiello, R.'     3 
primary 'Sorrentino, G.' 4 
primary 'Cendron, L.'    5 
primary 'Zanotti, G.'    6 
primary 'Zagari, A.'     7 
# 
_cell.entry_id           3CEI 
_cell.length_a           108.716 
_cell.length_b           108.716 
_cell.length_c           158.031 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3CEI 
_symmetry.space_group_name_H-M             'P 63 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                182 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Superoxide dismutase' 24547.664 2   1.15.1.1 ? ? ? 
2 non-polymer syn 'FE (III) ION'         55.845    2   ?        ? ? ? 
3 non-polymer syn 'SULFATE ION'          96.063    1   ?        ? ? ? 
4 water       nat water                  18.015    206 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MFTLRELPFAKDSMGDFLSPVAFDFHHGKHHQTYVNNLNNLIKGTDFEKSSLFAILTKSSGGVFNNAAQIYNHDFYWDCL
SPKATALSDELKGALEKDFGSLEKFKEDFIKSATTLFGSGWNWAAYNLDTQKIEIIQTSNAQTPVTDKKVPLLVVDVWEH
AYYIDHKNARPVYLEKFYGHINWHFVSQCYEWAKKEGLGSVDYYINELVHKKL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MFTLRELPFAKDSMGDFLSPVAFDFHHGKHHQTYVNNLNNLIKGTDFEKSSLFAILTKSSGGVFNNAAQIYNHDFYWDCL
SPKATALSDELKGALEKDFGSLEKFKEDFIKSATTLFGSGWNWAAYNLDTQKIEIIQTSNAQTPVTDKKVPLLVVDVWEH
AYYIDHKNARPVYLEKFYGHINWHFVSQCYEWAKKEGLGSVDYYINELVHKKL
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PHE n 
1 3   THR n 
1 4   LEU n 
1 5   ARG n 
1 6   GLU n 
1 7   LEU n 
1 8   PRO n 
1 9   PHE n 
1 10  ALA n 
1 11  LYS n 
1 12  ASP n 
1 13  SER n 
1 14  MET n 
1 15  GLY n 
1 16  ASP n 
1 17  PHE n 
1 18  LEU n 
1 19  SER n 
1 20  PRO n 
1 21  VAL n 
1 22  ALA n 
1 23  PHE n 
1 24  ASP n 
1 25  PHE n 
1 26  HIS n 
1 27  HIS n 
1 28  GLY n 
1 29  LYS n 
1 30  HIS n 
1 31  HIS n 
1 32  GLN n 
1 33  THR n 
1 34  TYR n 
1 35  VAL n 
1 36  ASN n 
1 37  ASN n 
1 38  LEU n 
1 39  ASN n 
1 40  ASN n 
1 41  LEU n 
1 42  ILE n 
1 43  LYS n 
1 44  GLY n 
1 45  THR n 
1 46  ASP n 
1 47  PHE n 
1 48  GLU n 
1 49  LYS n 
1 50  SER n 
1 51  SER n 
1 52  LEU n 
1 53  PHE n 
1 54  ALA n 
1 55  ILE n 
1 56  LEU n 
1 57  THR n 
1 58  LYS n 
1 59  SER n 
1 60  SER n 
1 61  GLY n 
1 62  GLY n 
1 63  VAL n 
1 64  PHE n 
1 65  ASN n 
1 66  ASN n 
1 67  ALA n 
1 68  ALA n 
1 69  GLN n 
1 70  ILE n 
1 71  TYR n 
1 72  ASN n 
1 73  HIS n 
1 74  ASP n 
1 75  PHE n 
1 76  TYR n 
1 77  TRP n 
1 78  ASP n 
1 79  CYS n 
1 80  LEU n 
1 81  SER n 
1 82  PRO n 
1 83  LYS n 
1 84  ALA n 
1 85  THR n 
1 86  ALA n 
1 87  LEU n 
1 88  SER n 
1 89  ASP n 
1 90  GLU n 
1 91  LEU n 
1 92  LYS n 
1 93  GLY n 
1 94  ALA n 
1 95  LEU n 
1 96  GLU n 
1 97  LYS n 
1 98  ASP n 
1 99  PHE n 
1 100 GLY n 
1 101 SER n 
1 102 LEU n 
1 103 GLU n 
1 104 LYS n 
1 105 PHE n 
1 106 LYS n 
1 107 GLU n 
1 108 ASP n 
1 109 PHE n 
1 110 ILE n 
1 111 LYS n 
1 112 SER n 
1 113 ALA n 
1 114 THR n 
1 115 THR n 
1 116 LEU n 
1 117 PHE n 
1 118 GLY n 
1 119 SER n 
1 120 GLY n 
1 121 TRP n 
1 122 ASN n 
1 123 TRP n 
1 124 ALA n 
1 125 ALA n 
1 126 TYR n 
1 127 ASN n 
1 128 LEU n 
1 129 ASP n 
1 130 THR n 
1 131 GLN n 
1 132 LYS n 
1 133 ILE n 
1 134 GLU n 
1 135 ILE n 
1 136 ILE n 
1 137 GLN n 
1 138 THR n 
1 139 SER n 
1 140 ASN n 
1 141 ALA n 
1 142 GLN n 
1 143 THR n 
1 144 PRO n 
1 145 VAL n 
1 146 THR n 
1 147 ASP n 
1 148 LYS n 
1 149 LYS n 
1 150 VAL n 
1 151 PRO n 
1 152 LEU n 
1 153 LEU n 
1 154 VAL n 
1 155 VAL n 
1 156 ASP n 
1 157 VAL n 
1 158 TRP n 
1 159 GLU n 
1 160 HIS n 
1 161 ALA n 
1 162 TYR n 
1 163 TYR n 
1 164 ILE n 
1 165 ASP n 
1 166 HIS n 
1 167 LYS n 
1 168 ASN n 
1 169 ALA n 
1 170 ARG n 
1 171 PRO n 
1 172 VAL n 
1 173 TYR n 
1 174 LEU n 
1 175 GLU n 
1 176 LYS n 
1 177 PHE n 
1 178 TYR n 
1 179 GLY n 
1 180 HIS n 
1 181 ILE n 
1 182 ASN n 
1 183 TRP n 
1 184 HIS n 
1 185 PHE n 
1 186 VAL n 
1 187 SER n 
1 188 GLN n 
1 189 CYS n 
1 190 TYR n 
1 191 GLU n 
1 192 TRP n 
1 193 ALA n 
1 194 LYS n 
1 195 LYS n 
1 196 GLU n 
1 197 GLY n 
1 198 LEU n 
1 199 GLY n 
1 200 SER n 
1 201 VAL n 
1 202 ASP n 
1 203 TYR n 
1 204 TYR n 
1 205 ILE n 
1 206 ASN n 
1 207 GLU n 
1 208 LEU n 
1 209 VAL n 
1 210 HIS n 
1 211 LYS n 
1 212 LYS n 
1 213 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Campylobacter pylori' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 sod 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    CCUG17874 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Helicobacter pylori' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     210 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET-28b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    B1VJF0_HELPY 
_struct_ref.pdbx_db_accession          B1VJF0 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MFTLRELPFAKDSMGDFLSPVAFDFHHGKHHQTYVNNLNNLIKGTDFEKSSLFAILTKSSGGVFNNAAQIYNHDFYWDCL
SPKATALSDELKGALEKDFGSLEKFKEDFIKSATTLFGSGWNWAAYNLDTQKIEIIQTSNAQTPVTDKKVPLLVVDVWEH
AYYIDHKNARPVYLEKFYGHINWHFVSQCYEWAKKEGLGSVDYYINELVHKKL
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3CEI A 1 ? 213 ? B1VJF0 1 ? 213 ? 1 213 
2 1 3CEI B 1 ? 213 ? B1VJF0 1 ? 213 ? 1 213 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
FE  non-polymer         . 'FE (III) ION'  ? 'Fe 3'           55.845  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3CEI 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.75 
_exptl_crystal.density_percent_sol   55.2 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            296.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    '1.9M Ammonium sulfate, 0.1M Tris, PH8.0, VAPOR DIFFUSION, HANGING DROP, temperature 296.0K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2007-03-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si (111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.00 
# 
_reflns.entry_id                     3CEI 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             80. 
_reflns.d_resolution_high            2.4 
_reflns.number_obs                   22256 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.112 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        23.6 
_reflns.B_iso_Wilson_estimate        41.3 
_reflns.pdbx_redundancy              18.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.53 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.395 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    6.7 
_reflns_shell.pdbx_redundancy        19.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3CEI 
_refine.ls_number_reflns_obs                     22256 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               2205746.28 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             80.0 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    100.0 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.201 
_refine.ls_R_factor_R_free                       0.254 
_refine.ls_R_factor_R_free_error                 0.008 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.7 
_refine.ls_number_reflns_R_free                  1051 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               37.1 
_refine.aniso_B[1][1]                            5.03 
_refine.aniso_B[2][2]                            5.03 
_refine.aniso_B[3][3]                            -10.06 
_refine.aniso_B[1][2]                            7.27 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.375227 
_refine.solvent_model_param_bsol                 50.1507 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1ISB' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3453 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         7 
_refine_hist.number_atoms_solvent             206 
_refine_hist.number_atoms_total               3666 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        80.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.009 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 21.3  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.78  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.19  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       1.96  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.95  2.50 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       3.91  3.00 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.40 
_refine_ls_shell.d_res_low                        2.55 
_refine_ls_shell.number_reflns_R_work             3442 
_refine_ls_shell.R_factor_R_work                  0.254 
_refine_ls_shell.percent_reflns_obs               100.0 
_refine_ls_shell.R_factor_R_free                  0.317 
_refine_ls_shell.R_factor_R_free_error            0.024 
_refine_ls_shell.percent_reflns_R_free            4.7 
_refine_ls_shell.number_reflns_R_free             171 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                3613 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3CEI 
_struct.title                     'Crystal Structure of Superoxide Dismutase from Helicobacter pylori' 
_struct.pdbx_descriptor           'Superoxide dismutase (E.C.1.15.1.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3CEI 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 4 ? 
G N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 19  ? HIS A 27  ? SER A 19  HIS A 27  1 ? 9  
HELX_P HELX_P2  2  LYS A 29  ? LYS A 43  ? LYS A 29  LYS A 43  1 ? 15 
HELX_P HELX_P3  3  SER A 51  ? SER A 59  ? SER A 51  SER A 59  1 ? 9  
HELX_P HELX_P4  4  SER A 60  ? CYS A 79  ? SER A 60  CYS A 79  1 ? 20 
HELX_P HELX_P5  5  SER A 88  ? GLY A 100 ? SER A 88  GLY A 100 1 ? 13 
HELX_P HELX_P6  6  SER A 101 ? LEU A 116 ? SER A 101 LEU A 116 1 ? 16 
HELX_P HELX_P7  7  THR A 143 ? LYS A 148 ? THR A 143 LYS A 148 5 ? 6  
HELX_P HELX_P8  8  TRP A 158 ? ALA A 161 ? TRP A 158 ALA A 161 5 ? 4  
HELX_P HELX_P9  9  TYR A 162 ? LYS A 167 ? TYR A 162 LYS A 167 1 ? 6  
HELX_P HELX_P10 10 ALA A 169 ? HIS A 180 ? ALA A 169 HIS A 180 1 ? 12 
HELX_P HELX_P11 11 ASN A 182 ? GLY A 197 ? ASN A 182 GLY A 197 1 ? 16 
HELX_P HELX_P12 12 LEU A 198 ? VAL A 209 ? LEU A 198 VAL A 209 1 ? 12 
HELX_P HELX_P13 13 SER B 19  ? HIS B 27  ? SER B 19  HIS B 27  1 ? 9  
HELX_P HELX_P14 14 LYS B 29  ? LYS B 43  ? LYS B 29  LYS B 43  1 ? 15 
HELX_P HELX_P15 15 SER B 51  ? SER B 59  ? SER B 51  SER B 59  1 ? 9  
HELX_P HELX_P16 16 SER B 60  ? CYS B 79  ? SER B 60  CYS B 79  1 ? 20 
HELX_P HELX_P17 17 SER B 88  ? GLY B 100 ? SER B 88  GLY B 100 1 ? 13 
HELX_P HELX_P18 18 SER B 101 ? LEU B 116 ? SER B 101 LEU B 116 1 ? 16 
HELX_P HELX_P19 19 THR B 143 ? ASP B 147 ? THR B 143 ASP B 147 5 ? 5  
HELX_P HELX_P20 20 TRP B 158 ? ALA B 161 ? TRP B 158 ALA B 161 5 ? 4  
HELX_P HELX_P21 21 TYR B 162 ? LYS B 167 ? TYR B 162 LYS B 167 1 ? 6  
HELX_P HELX_P22 22 ALA B 169 ? HIS B 180 ? ALA B 169 HIS B 180 1 ? 12 
HELX_P HELX_P23 23 ASN B 182 ? GLY B 197 ? ASN B 182 GLY B 197 1 ? 16 
HELX_P HELX_P24 24 LEU B 198 ? LEU B 208 ? LEU B 198 LEU B 208 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A HIS 26  NE2 ? ? ? 1_555 C FE  . FE ? ? A HIS 26  A FE  500 1_555 ? ? ? ? ? ? ? 2.104 ? 
metalc2  metalc ? ? A HIS 73  NE2 ? ? ? 1_555 C FE  . FE ? ? A HIS 73  A FE  500 1_555 ? ? ? ? ? ? ? 2.088 ? 
metalc3  metalc ? ? A ASP 156 OD2 ? ? ? 1_555 C FE  . FE ? ? A ASP 156 A FE  500 1_555 ? ? ? ? ? ? ? 1.906 ? 
metalc4  metalc ? ? A HIS 160 NE2 ? ? ? 1_555 C FE  . FE ? ? A HIS 160 A FE  500 1_555 ? ? ? ? ? ? ? 2.096 ? 
metalc5  metalc ? ? B HIS 26  NE2 ? ? ? 1_555 E FE  . FE ? ? B HIS 26  B FE  500 1_555 ? ? ? ? ? ? ? 2.113 ? 
metalc6  metalc ? ? B HIS 73  NE2 ? ? ? 1_555 E FE  . FE ? ? B HIS 73  B FE  500 1_555 ? ? ? ? ? ? ? 2.119 ? 
metalc7  metalc ? ? B ASP 156 OD2 ? ? ? 1_555 E FE  . FE ? ? B ASP 156 B FE  500 1_555 ? ? ? ? ? ? ? 1.918 ? 
metalc8  metalc ? ? B HIS 160 NE2 ? ? ? 1_555 E FE  . FE ? ? B HIS 160 B FE  500 1_555 ? ? ? ? ? ? ? 2.103 ? 
metalc9  metalc ? ? C FE  .   FE  ? ? ? 1_555 F HOH . O  ? ? A FE  500 A HOH 600 1_555 ? ? ? ? ? ? ? 1.995 ? 
metalc10 metalc ? ? E FE  .   FE  ? ? ? 1_555 G HOH . O  ? ? B FE  500 B HOH 600 1_555 ? ? ? ? ? ? ? 2.039 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 133 ? SER A 139 ? ILE A 133 SER A 139 
A 2 GLY A 120 ? TYR A 126 ? GLY A 120 TYR A 126 
A 3 VAL A 150 ? ASP A 156 ? VAL A 150 ASP A 156 
B 1 ILE B 133 ? SER B 139 ? ILE B 133 SER B 139 
B 2 GLY B 120 ? ASN B 127 ? GLY B 120 ASN B 127 
B 3 LYS B 149 ? ASP B 156 ? LYS B 149 ASP B 156 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 136 ? O ILE A 136 N TRP A 123 ? N TRP A 123 
A 2 3 N ALA A 124 ? N ALA A 124 O LEU A 152 ? O LEU A 152 
B 1 2 O ILE B 136 ? O ILE B 136 N TRP B 123 ? N TRP B 123 
B 2 3 N TYR B 126 ? N TYR B 126 O VAL B 150 ? O VAL B 150 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE FE A 500' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE FE B 500' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 HIS A 26  ? HIS A 26  . ? 1_555 ? 
2 AC1 4 HIS A 73  ? HIS A 73  . ? 1_555 ? 
3 AC1 4 ASP A 156 ? ASP A 156 . ? 1_555 ? 
4 AC1 4 HIS A 160 ? HIS A 160 . ? 1_555 ? 
5 AC2 4 HIS B 26  ? HIS B 26  . ? 1_555 ? 
6 AC2 4 HIS B 73  ? HIS B 73  . ? 1_555 ? 
7 AC2 4 ASP B 156 ? ASP B 156 . ? 1_555 ? 
8 AC2 4 HIS B 160 ? HIS B 160 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3CEI 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3CEI 
_atom_sites.fract_transf_matrix[1][1]   0.009198 
_atom_sites.fract_transf_matrix[1][2]   0.005311 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010621 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006328 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 1   ? 13.597 69.056 79.286 1.00 57.31 ? 1   MET A N   1 
ATOM   2    C  CA  . MET A 1 1   ? 12.293 68.739 78.613 1.00 56.56 ? 1   MET A CA  1 
ATOM   3    C  C   . MET A 1 1   ? 12.317 69.420 77.246 1.00 54.01 ? 1   MET A C   1 
ATOM   4    O  O   . MET A 1 1   ? 12.077 70.630 77.155 1.00 54.65 ? 1   MET A O   1 
ATOM   5    C  CB  . MET A 1 1   ? 11.122 69.292 79.435 1.00 58.89 ? 1   MET A CB  1 
ATOM   6    C  CG  . MET A 1 1   ? 9.845  68.471 79.327 1.00 63.68 ? 1   MET A CG  1 
ATOM   7    S  SD  . MET A 1 1   ? 9.307  68.171 77.622 1.00 69.32 ? 1   MET A SD  1 
ATOM   8    C  CE  . MET A 1 1   ? 7.702  67.279 77.871 1.00 63.26 ? 1   MET A CE  1 
ATOM   9    N  N   . PHE A 1 2   ? 12.600 68.662 76.187 1.00 48.74 ? 2   PHE A N   1 
ATOM   10   C  CA  . PHE A 1 2   ? 12.670 69.278 74.880 1.00 44.01 ? 2   PHE A CA  1 
ATOM   11   C  C   . PHE A 1 2   ? 11.604 68.875 73.905 1.00 41.31 ? 2   PHE A C   1 
ATOM   12   O  O   . PHE A 1 2   ? 10.950 67.852 74.055 1.00 39.35 ? 2   PHE A O   1 
ATOM   13   C  CB  . PHE A 1 2   ? 14.047 69.044 74.285 1.00 42.63 ? 2   PHE A CB  1 
ATOM   14   C  CG  . PHE A 1 2   ? 15.147 69.250 75.267 1.00 41.77 ? 2   PHE A CG  1 
ATOM   15   C  CD1 . PHE A 1 2   ? 15.531 68.217 76.109 1.00 40.84 ? 2   PHE A CD1 1 
ATOM   16   C  CD2 . PHE A 1 2   ? 15.770 70.486 75.390 1.00 41.76 ? 2   PHE A CD2 1 
ATOM   17   C  CE1 . PHE A 1 2   ? 16.524 68.403 77.072 1.00 39.57 ? 2   PHE A CE1 1 
ATOM   18   C  CE2 . PHE A 1 2   ? 16.768 70.685 76.354 1.00 42.74 ? 2   PHE A CE2 1 
ATOM   19   C  CZ  . PHE A 1 2   ? 17.142 69.632 77.198 1.00 39.49 ? 2   PHE A CZ  1 
ATOM   20   N  N   . THR A 1 3   ? 11.433 69.716 72.897 1.00 40.58 ? 3   THR A N   1 
ATOM   21   C  CA  . THR A 1 3   ? 10.442 69.472 71.875 1.00 40.68 ? 3   THR A CA  1 
ATOM   22   C  C   . THR A 1 3   ? 11.119 69.667 70.503 1.00 39.82 ? 3   THR A C   1 
ATOM   23   O  O   . THR A 1 3   ? 12.030 70.489 70.354 1.00 38.67 ? 3   THR A O   1 
ATOM   24   C  CB  . THR A 1 3   ? 9.243  70.429 72.084 1.00 39.87 ? 3   THR A CB  1 
ATOM   25   O  OG1 . THR A 1 3   ? 8.200  70.118 71.156 1.00 44.55 ? 3   THR A OG1 1 
ATOM   26   C  CG2 . THR A 1 3   ? 9.676  71.859 71.880 1.00 41.84 ? 3   THR A CG2 1 
ATOM   27   N  N   . LEU A 1 4   ? 10.687 68.882 69.521 1.00 38.63 ? 4   LEU A N   1 
ATOM   28   C  CA  . LEU A 1 4   ? 11.239 68.941 68.172 1.00 37.27 ? 4   LEU A CA  1 
ATOM   29   C  C   . LEU A 1 4   ? 11.033 70.311 67.535 1.00 37.07 ? 4   LEU A C   1 
ATOM   30   O  O   . LEU A 1 4   ? 9.911  70.824 67.489 1.00 36.26 ? 4   LEU A O   1 
ATOM   31   C  CB  . LEU A 1 4   ? 10.582 67.866 67.302 1.00 35.89 ? 4   LEU A CB  1 
ATOM   32   C  CG  . LEU A 1 4   ? 10.990 67.834 65.828 1.00 35.10 ? 4   LEU A CG  1 
ATOM   33   C  CD1 . LEU A 1 4   ? 12.486 67.538 65.723 1.00 34.07 ? 4   LEU A CD1 1 
ATOM   34   C  CD2 . LEU A 1 4   ? 10.169 66.790 65.090 1.00 33.43 ? 4   LEU A CD2 1 
ATOM   35   N  N   . ARG A 1 5   ? 12.112 70.897 67.024 1.00 37.12 ? 5   ARG A N   1 
ATOM   36   C  CA  . ARG A 1 5   ? 12.013 72.211 66.403 1.00 36.73 ? 5   ARG A CA  1 
ATOM   37   C  C   . ARG A 1 5   ? 11.224 72.163 65.112 1.00 37.41 ? 5   ARG A C   1 
ATOM   38   O  O   . ARG A 1 5   ? 11.133 71.133 64.445 1.00 37.95 ? 5   ARG A O   1 
ATOM   39   C  CB  . ARG A 1 5   ? 13.393 72.779 66.084 1.00 37.77 ? 5   ARG A CB  1 
ATOM   40   C  CG  . ARG A 1 5   ? 14.129 72.036 64.956 1.00 36.84 ? 5   ARG A CG  1 
ATOM   41   C  CD  . ARG A 1 5   ? 15.338 72.820 64.475 1.00 35.50 ? 5   ARG A CD  1 
ATOM   42   N  NE  . ARG A 1 5   ? 14.929 74.054 63.809 1.00 34.42 ? 5   ARG A NE  1 
ATOM   43   C  CZ  . ARG A 1 5   ? 15.768 75.006 63.402 1.00 32.74 ? 5   ARG A CZ  1 
ATOM   44   N  NH1 . ARG A 1 5   ? 17.070 74.874 63.589 1.00 33.03 ? 5   ARG A NH1 1 
ATOM   45   N  NH2 . ARG A 1 5   ? 15.299 76.098 62.808 1.00 32.43 ? 5   ARG A NH2 1 
ATOM   46   N  N   . GLU A 1 6   ? 10.674 73.311 64.761 1.00 37.47 ? 6   GLU A N   1 
ATOM   47   C  CA  . GLU A 1 6   ? 9.908  73.466 63.541 1.00 38.66 ? 6   GLU A CA  1 
ATOM   48   C  C   . GLU A 1 6   ? 10.934 73.527 62.397 1.00 37.67 ? 6   GLU A C   1 
ATOM   49   O  O   . GLU A 1 6   ? 12.016 74.097 62.554 1.00 35.78 ? 6   GLU A O   1 
ATOM   50   C  CB  . GLU A 1 6   ? 9.141  74.786 63.622 1.00 41.24 ? 6   GLU A CB  1 
ATOM   51   C  CG  . GLU A 1 6   ? 7.985  74.920 62.678 1.00 49.89 ? 6   GLU A CG  1 
ATOM   52   C  CD  . GLU A 1 6   ? 6.845  74.020 63.074 1.00 54.62 ? 6   GLU A CD  1 
ATOM   53   O  OE1 . GLU A 1 6   ? 6.628  73.875 64.301 1.00 56.66 ? 6   GLU A OE1 1 
ATOM   54   O  OE2 . GLU A 1 6   ? 6.169  73.472 62.167 1.00 58.91 ? 6   GLU A OE2 1 
ATOM   55   N  N   . LEU A 1 7   ? 10.612 72.933 61.254 1.00 37.29 ? 7   LEU A N   1 
ATOM   56   C  CA  . LEU A 1 7   ? 11.521 72.992 60.120 1.00 36.30 ? 7   LEU A CA  1 
ATOM   57   C  C   . LEU A 1 7   ? 11.531 74.461 59.686 1.00 34.39 ? 7   LEU A C   1 
ATOM   58   O  O   . LEU A 1 7   ? 10.476 75.085 59.604 1.00 35.28 ? 7   LEU A O   1 
ATOM   59   C  CB  . LEU A 1 7   ? 10.998 72.090 59.008 1.00 38.02 ? 7   LEU A CB  1 
ATOM   60   C  CG  . LEU A 1 7   ? 11.969 71.120 58.320 1.00 42.64 ? 7   LEU A CG  1 
ATOM   61   C  CD1 . LEU A 1 7   ? 13.053 70.592 59.270 1.00 38.53 ? 7   LEU A CD1 1 
ATOM   62   C  CD2 . LEU A 1 7   ? 11.130 69.979 57.749 1.00 41.90 ? 7   LEU A CD2 1 
ATOM   63   N  N   . PRO A 1 8   ? 12.719 75.035 59.425 1.00 32.47 ? 8   PRO A N   1 
ATOM   64   C  CA  . PRO A 1 8   ? 12.819 76.441 59.010 1.00 31.07 ? 8   PRO A CA  1 
ATOM   65   C  C   . PRO A 1 8   ? 12.398 76.775 57.589 1.00 29.45 ? 8   PRO A C   1 
ATOM   66   O  O   . PRO A 1 8   ? 12.688 77.865 57.104 1.00 29.70 ? 8   PRO A O   1 
ATOM   67   C  CB  . PRO A 1 8   ? 14.284 76.775 59.268 1.00 30.18 ? 8   PRO A CB  1 
ATOM   68   C  CG  . PRO A 1 8   ? 14.971 75.470 59.013 1.00 31.32 ? 8   PRO A CG  1 
ATOM   69   C  CD  . PRO A 1 8   ? 14.057 74.456 59.658 1.00 31.03 ? 8   PRO A CD  1 
ATOM   70   N  N   . PHE A 1 9   ? 11.700 75.854 56.935 1.00 28.28 ? 9   PHE A N   1 
ATOM   71   C  CA  . PHE A 1 9   ? 11.246 76.057 55.561 1.00 28.27 ? 9   PHE A CA  1 
ATOM   72   C  C   . PHE A 1 9   ? 10.164 75.010 55.236 1.00 30.07 ? 9   PHE A C   1 
ATOM   73   O  O   . PHE A 1 9   ? 9.909  74.098 56.029 1.00 29.95 ? 9   PHE A O   1 
ATOM   74   C  CB  . PHE A 1 9   ? 12.439 75.924 54.618 1.00 27.42 ? 9   PHE A CB  1 
ATOM   75   C  CG  . PHE A 1 9   ? 13.309 74.735 54.930 1.00 28.31 ? 9   PHE A CG  1 
ATOM   76   C  CD1 . PHE A 1 9   ? 12.916 73.452 54.561 1.00 27.16 ? 9   PHE A CD1 1 
ATOM   77   C  CD2 . PHE A 1 9   ? 14.477 74.889 55.672 1.00 26.70 ? 9   PHE A CD2 1 
ATOM   78   C  CE1 . PHE A 1 9   ? 13.673 72.345 54.938 1.00 29.36 ? 9   PHE A CE1 1 
ATOM   79   C  CE2 . PHE A 1 9   ? 15.235 73.795 56.053 1.00 27.04 ? 9   PHE A CE2 1 
ATOM   80   C  CZ  . PHE A 1 9   ? 14.835 72.519 55.688 1.00 29.05 ? 9   PHE A CZ  1 
ATOM   81   N  N   . ALA A 1 10  ? 9.518  75.151 54.084 1.00 29.64 ? 10  ALA A N   1 
ATOM   82   C  CA  . ALA A 1 10  ? 8.464  74.225 53.679 1.00 29.61 ? 10  ALA A CA  1 
ATOM   83   C  C   . ALA A 1 10  ? 9.047  72.909 53.177 1.00 29.80 ? 10  ALA A C   1 
ATOM   84   O  O   . ALA A 1 10  ? 10.076 72.888 52.503 1.00 29.90 ? 10  ALA A O   1 
ATOM   85   C  CB  . ALA A 1 10  ? 7.601  74.859 52.585 1.00 27.06 ? 10  ALA A CB  1 
ATOM   86   N  N   . LYS A 1 11  ? 8.366  71.813 53.488 1.00 30.40 ? 11  LYS A N   1 
ATOM   87   C  CA  . LYS A 1 11  ? 8.836  70.500 53.080 1.00 30.12 ? 11  LYS A CA  1 
ATOM   88   C  C   . LYS A 1 11  ? 8.940  70.318 51.583 1.00 30.27 ? 11  LYS A C   1 
ATOM   89   O  O   . LYS A 1 11  ? 9.685  69.449 51.122 1.00 31.22 ? 11  LYS A O   1 
ATOM   90   C  CB  . LYS A 1 11  ? 7.955  69.406 53.684 1.00 30.39 ? 11  LYS A CB  1 
ATOM   91   C  CG  . LYS A 1 11  ? 8.159  69.247 55.184 1.00 30.39 ? 11  LYS A CG  1 
ATOM   92   C  CD  . LYS A 1 11  ? 7.366  68.090 55.746 1.00 30.29 ? 11  LYS A CD  1 
ATOM   93   C  CE  . LYS A 1 11  ? 7.757  67.878 57.193 1.00 32.96 ? 11  LYS A CE  1 
ATOM   94   N  NZ  . LYS A 1 11  ? 7.135  66.671 57.817 1.00 33.21 ? 11  LYS A NZ  1 
ATOM   95   N  N   . ASP A 1 12  ? 8.223  71.145 50.827 1.00 28.43 ? 12  ASP A N   1 
ATOM   96   C  CA  . ASP A 1 12  ? 8.249  71.056 49.372 1.00 30.29 ? 12  ASP A CA  1 
ATOM   97   C  C   . ASP A 1 12  ? 9.101  72.148 48.710 1.00 30.11 ? 12  ASP A C   1 
ATOM   98   O  O   . ASP A 1 12  ? 9.081  72.324 47.486 1.00 29.41 ? 12  ASP A O   1 
ATOM   99   C  CB  . ASP A 1 12  ? 6.813  71.105 48.829 1.00 34.76 ? 12  ASP A CB  1 
ATOM   100  C  CG  . ASP A 1 12  ? 6.084  72.399 49.194 1.00 39.14 ? 12  ASP A CG  1 
ATOM   101  O  OD1 . ASP A 1 12  ? 6.443  73.035 50.206 1.00 44.99 ? 12  ASP A OD1 1 
ATOM   102  O  OD2 . ASP A 1 12  ? 5.132  72.773 48.480 1.00 42.22 ? 12  ASP A OD2 1 
ATOM   103  N  N   . SER A 1 13  ? 9.898  72.836 49.509 1.00 28.94 ? 13  SER A N   1 
ATOM   104  C  CA  . SER A 1 13  ? 10.692 73.931 48.985 1.00 30.74 ? 13  SER A CA  1 
ATOM   105  C  C   . SER A 1 13  ? 12.074 73.569 48.482 1.00 32.28 ? 13  SER A C   1 
ATOM   106  O  O   . SER A 1 13  ? 12.757 74.428 47.903 1.00 32.00 ? 13  SER A O   1 
ATOM   107  C  CB  . SER A 1 13  ? 10.849 75.007 50.063 1.00 30.90 ? 13  SER A CB  1 
ATOM   108  O  OG  . SER A 1 13  ? 11.615 74.510 51.155 1.00 29.37 ? 13  SER A OG  1 
ATOM   109  N  N   . MET A 1 14  ? 12.488 72.315 48.684 1.00 31.21 ? 14  MET A N   1 
ATOM   110  C  CA  . MET A 1 14  ? 13.844 71.919 48.301 1.00 30.84 ? 14  MET A CA  1 
ATOM   111  C  C   . MET A 1 14  ? 14.055 71.203 46.978 1.00 30.88 ? 14  MET A C   1 
ATOM   112  O  O   . MET A 1 14  ? 14.955 70.371 46.875 1.00 30.04 ? 14  MET A O   1 
ATOM   113  C  CB  . MET A 1 14  ? 14.463 71.086 49.416 1.00 26.03 ? 14  MET A CB  1 
ATOM   114  C  CG  . MET A 1 14  ? 14.536 71.813 50.741 1.00 27.05 ? 14  MET A CG  1 
ATOM   115  S  SD  . MET A 1 14  ? 15.822 73.086 50.744 1.00 26.73 ? 14  MET A SD  1 
ATOM   116  C  CE  . MET A 1 14  ? 15.499 73.928 52.312 1.00 22.24 ? 14  MET A CE  1 
ATOM   117  N  N   . GLY A 1 15  ? 13.243 71.535 45.976 1.00 31.64 ? 15  GLY A N   1 
ATOM   118  C  CA  . GLY A 1 15  ? 13.375 70.935 44.657 1.00 30.61 ? 15  GLY A CA  1 
ATOM   119  C  C   . GLY A 1 15  ? 13.722 69.460 44.623 1.00 31.49 ? 15  GLY A C   1 
ATOM   120  O  O   . GLY A 1 15  ? 13.098 68.660 45.309 1.00 28.78 ? 15  GLY A O   1 
ATOM   121  N  N   . ASP A 1 16  ? 14.723 69.104 43.816 1.00 33.13 ? 16  ASP A N   1 
ATOM   122  C  CA  . ASP A 1 16  ? 15.165 67.713 43.678 1.00 34.66 ? 16  ASP A CA  1 
ATOM   123  C  C   . ASP A 1 16  ? 16.277 67.301 44.645 1.00 32.73 ? 16  ASP A C   1 
ATOM   124  O  O   . ASP A 1 16  ? 16.881 66.239 44.507 1.00 32.73 ? 16  ASP A O   1 
ATOM   125  C  CB  . ASP A 1 16  ? 15.620 67.445 42.243 1.00 37.97 ? 16  ASP A CB  1 
ATOM   126  C  CG  . ASP A 1 16  ? 14.460 67.409 41.267 1.00 44.79 ? 16  ASP A CG  1 
ATOM   127  O  OD1 . ASP A 1 16  ? 13.489 66.653 41.517 1.00 50.63 ? 16  ASP A OD1 1 
ATOM   128  O  OD2 . ASP A 1 16  ? 14.511 68.133 40.250 1.00 48.86 ? 16  ASP A OD2 1 
ATOM   129  N  N   . PHE A 1 17  ? 16.519 68.137 45.640 1.00 29.90 ? 17  PHE A N   1 
ATOM   130  C  CA  . PHE A 1 17  ? 17.541 67.874 46.632 1.00 27.29 ? 17  PHE A CA  1 
ATOM   131  C  C   . PHE A 1 17  ? 16.958 66.981 47.732 1.00 27.68 ? 17  PHE A C   1 
ATOM   132  O  O   . PHE A 1 17  ? 17.490 65.900 48.033 1.00 27.36 ? 17  PHE A O   1 
ATOM   133  C  CB  . PHE A 1 17  ? 18.021 69.210 47.193 1.00 23.74 ? 17  PHE A CB  1 
ATOM   134  C  CG  . PHE A 1 17  ? 18.789 69.089 48.457 1.00 21.50 ? 17  PHE A CG  1 
ATOM   135  C  CD1 . PHE A 1 17  ? 19.801 68.142 48.578 1.00 20.27 ? 17  PHE A CD1 1 
ATOM   136  C  CD2 . PHE A 1 17  ? 18.523 69.935 49.519 1.00 21.44 ? 17  PHE A CD2 1 
ATOM   137  C  CE1 . PHE A 1 17  ? 20.538 68.038 49.727 1.00 20.69 ? 17  PHE A CE1 1 
ATOM   138  C  CE2 . PHE A 1 17  ? 19.260 69.846 50.693 1.00 23.99 ? 17  PHE A CE2 1 
ATOM   139  C  CZ  . PHE A 1 17  ? 20.274 68.892 50.797 1.00 24.11 ? 17  PHE A CZ  1 
ATOM   140  N  N   . LEU A 1 18  ? 15.865 67.438 48.331 1.00 25.72 ? 18  LEU A N   1 
ATOM   141  C  CA  . LEU A 1 18  ? 15.195 66.677 49.366 1.00 26.31 ? 18  LEU A CA  1 
ATOM   142  C  C   . LEU A 1 18  ? 13.699 66.792 49.076 1.00 28.54 ? 18  LEU A C   1 
ATOM   143  O  O   . LEU A 1 18  ? 13.206 67.883 48.749 1.00 26.86 ? 18  LEU A O   1 
ATOM   144  C  CB  . LEU A 1 18  ? 15.555 67.224 50.754 1.00 25.16 ? 18  LEU A CB  1 
ATOM   145  C  CG  . LEU A 1 18  ? 17.007 66.945 51.218 1.00 24.60 ? 18  LEU A CG  1 
ATOM   146  C  CD1 . LEU A 1 18  ? 17.321 67.609 52.547 1.00 22.31 ? 18  LEU A CD1 1 
ATOM   147  C  CD2 . LEU A 1 18  ? 17.203 65.438 51.370 1.00 25.26 ? 18  LEU A CD2 1 
ATOM   148  N  N   . SER A 1 19  ? 12.990 65.660 49.150 1.00 27.65 ? 19  SER A N   1 
ATOM   149  C  CA  . SER A 1 19  ? 11.552 65.616 48.878 1.00 27.91 ? 19  SER A CA  1 
ATOM   150  C  C   . SER A 1 19  ? 10.763 65.732 50.178 1.00 27.50 ? 19  SER A C   1 
ATOM   151  O  O   . SER A 1 19  ? 11.319 65.561 51.265 1.00 28.71 ? 19  SER A O   1 
ATOM   152  C  CB  . SER A 1 19  ? 11.198 64.299 48.209 1.00 26.28 ? 19  SER A CB  1 
ATOM   153  O  OG  . SER A 1 19  ? 11.290 63.263 49.160 1.00 30.36 ? 19  SER A OG  1 
ATOM   154  N  N   . PRO A 1 20  ? 9.453  66.021 50.085 1.00 27.01 ? 20  PRO A N   1 
ATOM   155  C  CA  . PRO A 1 20  ? 8.653  66.140 51.309 1.00 25.60 ? 20  PRO A CA  1 
ATOM   156  C  C   . PRO A 1 20  ? 8.712  64.870 52.170 1.00 24.49 ? 20  PRO A C   1 
ATOM   157  O  O   . PRO A 1 20  ? 8.783  64.961 53.389 1.00 24.30 ? 20  PRO A O   1 
ATOM   158  C  CB  . PRO A 1 20  ? 7.240  66.430 50.781 1.00 25.79 ? 20  PRO A CB  1 
ATOM   159  C  CG  . PRO A 1 20  ? 7.502  67.207 49.506 1.00 24.81 ? 20  PRO A CG  1 
ATOM   160  C  CD  . PRO A 1 20  ? 8.676  66.433 48.895 1.00 29.09 ? 20  PRO A CD  1 
ATOM   161  N  N   . VAL A 1 21  ? 8.674  63.699 51.531 1.00 24.01 ? 21  VAL A N   1 
ATOM   162  C  CA  . VAL A 1 21  ? 8.717  62.424 52.253 1.00 23.54 ? 21  VAL A CA  1 
ATOM   163  C  C   . VAL A 1 21  ? 10.041 62.304 53.016 1.00 23.86 ? 21  VAL A C   1 
ATOM   164  O  O   . VAL A 1 21  ? 10.056 61.946 54.196 1.00 22.53 ? 21  VAL A O   1 
ATOM   165  C  CB  . VAL A 1 21  ? 8.571  61.209 51.293 1.00 26.37 ? 21  VAL A CB  1 
ATOM   166  C  CG1 . VAL A 1 21  ? 8.739  59.911 52.088 1.00 25.00 ? 21  VAL A CG1 1 
ATOM   167  C  CG2 . VAL A 1 21  ? 7.193  61.225 50.595 1.00 25.73 ? 21  VAL A CG2 1 
ATOM   168  N  N   . ALA A 1 22  ? 11.144 62.620 52.341 1.00 22.38 ? 22  ALA A N   1 
ATOM   169  C  CA  . ALA A 1 22  ? 12.458 62.580 52.966 1.00 23.12 ? 22  ALA A CA  1 
ATOM   170  C  C   . ALA A 1 22  ? 12.383 63.368 54.277 1.00 23.70 ? 22  ALA A C   1 
ATOM   171  O  O   . ALA A 1 22  ? 12.899 62.932 55.319 1.00 23.04 ? 22  ALA A O   1 
ATOM   172  C  CB  . ALA A 1 22  ? 13.493 63.208 52.037 1.00 22.56 ? 22  ALA A CB  1 
ATOM   173  N  N   . PHE A 1 23  ? 11.729 64.533 54.227 1.00 23.78 ? 23  PHE A N   1 
ATOM   174  C  CA  . PHE A 1 23  ? 11.598 65.358 55.425 1.00 23.42 ? 23  PHE A CA  1 
ATOM   175  C  C   . PHE A 1 23  ? 10.699 64.686 56.448 1.00 24.41 ? 23  PHE A C   1 
ATOM   176  O  O   . PHE A 1 23  ? 11.009 64.708 57.652 1.00 24.47 ? 23  PHE A O   1 
ATOM   177  C  CB  . PHE A 1 23  ? 11.071 66.761 55.085 1.00 24.55 ? 23  PHE A CB  1 
ATOM   178  C  CG  . PHE A 1 23  ? 12.112 67.676 54.495 1.00 22.22 ? 23  PHE A CG  1 
ATOM   179  C  CD1 . PHE A 1 23  ? 11.967 68.179 53.219 1.00 23.69 ? 23  PHE A CD1 1 
ATOM   180  C  CD2 . PHE A 1 23  ? 13.244 68.036 55.224 1.00 24.16 ? 23  PHE A CD2 1 
ATOM   181  C  CE1 . PHE A 1 23  ? 12.940 69.034 52.669 1.00 22.83 ? 23  PHE A CE1 1 
ATOM   182  C  CE2 . PHE A 1 23  ? 14.215 68.887 54.685 1.00 21.58 ? 23  PHE A CE2 1 
ATOM   183  C  CZ  . PHE A 1 23  ? 14.053 69.383 53.399 1.00 21.92 ? 23  PHE A CZ  1 
ATOM   184  N  N   . ASP A 1 24  ? 9.603  64.070 55.989 1.00 24.20 ? 24  ASP A N   1 
ATOM   185  C  CA  . ASP A 1 24  ? 8.700  63.379 56.923 1.00 26.30 ? 24  ASP A CA  1 
ATOM   186  C  C   . ASP A 1 24  ? 9.495  62.381 57.767 1.00 25.60 ? 24  ASP A C   1 
ATOM   187  O  O   . ASP A 1 24  ? 9.311  62.292 58.978 1.00 26.46 ? 24  ASP A O   1 
ATOM   188  C  CB  . ASP A 1 24  ? 7.590  62.604 56.195 1.00 28.26 ? 24  ASP A CB  1 
ATOM   189  C  CG  . ASP A 1 24  ? 6.592  63.510 55.480 1.00 32.09 ? 24  ASP A CG  1 
ATOM   190  O  OD1 . ASP A 1 24  ? 6.486  64.717 55.819 1.00 34.57 ? 24  ASP A OD1 1 
ATOM   191  O  OD2 . ASP A 1 24  ? 5.891  63.000 54.581 1.00 32.36 ? 24  ASP A OD2 1 
ATOM   192  N  N   . PHE A 1 25  ? 10.379 61.627 57.120 1.00 24.57 ? 25  PHE A N   1 
ATOM   193  C  CA  . PHE A 1 25  ? 11.180 60.649 57.844 1.00 26.67 ? 25  PHE A CA  1 
ATOM   194  C  C   . PHE A 1 25  ? 12.387 61.222 58.598 1.00 25.52 ? 25  PHE A C   1 
ATOM   195  O  O   . PHE A 1 25  ? 12.572 60.930 59.783 1.00 27.33 ? 25  PHE A O   1 
ATOM   196  C  CB  . PHE A 1 25  ? 11.660 59.536 56.901 1.00 28.83 ? 25  PHE A CB  1 
ATOM   197  C  CG  . PHE A 1 25  ? 10.602 58.532 56.561 1.00 30.57 ? 25  PHE A CG  1 
ATOM   198  C  CD1 . PHE A 1 25  ? 9.797  58.694 55.434 1.00 33.00 ? 25  PHE A CD1 1 
ATOM   199  C  CD2 . PHE A 1 25  ? 10.392 57.428 57.389 1.00 31.53 ? 25  PHE A CD2 1 
ATOM   200  C  CE1 . PHE A 1 25  ? 8.786  57.763 55.133 1.00 33.77 ? 25  PHE A CE1 1 
ATOM   201  C  CE2 . PHE A 1 25  ? 9.389  56.493 57.105 1.00 31.44 ? 25  PHE A CE2 1 
ATOM   202  C  CZ  . PHE A 1 25  ? 8.584  56.660 55.977 1.00 32.69 ? 25  PHE A CZ  1 
ATOM   203  N  N   . HIS A 1 26  ? 13.199 62.041 57.934 1.00 24.36 ? 26  HIS A N   1 
ATOM   204  C  CA  . HIS A 1 26  ? 14.389 62.557 58.590 1.00 24.93 ? 26  HIS A CA  1 
ATOM   205  C  C   . HIS A 1 26  ? 14.067 63.419 59.794 1.00 25.39 ? 26  HIS A C   1 
ATOM   206  O  O   . HIS A 1 26  ? 14.568 63.178 60.907 1.00 24.47 ? 26  HIS A O   1 
ATOM   207  C  CB  . HIS A 1 26  ? 15.276 63.338 57.605 1.00 23.83 ? 26  HIS A CB  1 
ATOM   208  C  CG  . HIS A 1 26  ? 16.708 63.452 58.053 1.00 23.80 ? 26  HIS A CG  1 
ATOM   209  N  ND1 . HIS A 1 26  ? 17.709 64.041 57.311 1.00 20.40 ? 26  HIS A ND1 1 
ATOM   210  C  CD2 . HIS A 1 26  ? 17.299 63.041 59.208 1.00 18.13 ? 26  HIS A CD2 1 
ATOM   211  C  CE1 . HIS A 1 26  ? 18.844 63.973 58.030 1.00 22.78 ? 26  HIS A CE1 1 
ATOM   212  N  NE2 . HIS A 1 26  ? 18.642 63.373 59.188 1.00 20.63 ? 26  HIS A NE2 1 
ATOM   213  N  N   . HIS A 1 27  ? 13.219 64.416 59.578 1.00 25.62 ? 27  HIS A N   1 
ATOM   214  C  CA  . HIS A 1 27  ? 12.824 65.313 60.652 1.00 26.61 ? 27  HIS A CA  1 
ATOM   215  C  C   . HIS A 1 27  ? 11.706 64.709 61.505 1.00 26.77 ? 27  HIS A C   1 
ATOM   216  O  O   . HIS A 1 27  ? 11.840 64.576 62.722 1.00 27.23 ? 27  HIS A O   1 
ATOM   217  C  CB  . HIS A 1 27  ? 12.372 66.653 60.055 1.00 27.15 ? 27  HIS A CB  1 
ATOM   218  C  CG  . HIS A 1 27  ? 11.739 67.578 61.047 1.00 30.27 ? 27  HIS A CG  1 
ATOM   219  N  ND1 . HIS A 1 27  ? 10.373 67.689 61.191 1.00 33.18 ? 27  HIS A ND1 1 
ATOM   220  C  CD2 . HIS A 1 27  ? 12.285 68.433 61.946 1.00 28.75 ? 27  HIS A CD2 1 
ATOM   221  C  CE1 . HIS A 1 27  ? 10.105 68.578 62.133 1.00 33.16 ? 27  HIS A CE1 1 
ATOM   222  N  NE2 . HIS A 1 27  ? 11.247 69.044 62.607 1.00 30.29 ? 27  HIS A NE2 1 
ATOM   223  N  N   . GLY A 1 28  ? 10.617 64.337 60.840 1.00 27.67 ? 28  GLY A N   1 
ATOM   224  C  CA  . GLY A 1 28  ? 9.447  63.789 61.502 1.00 28.26 ? 28  GLY A CA  1 
ATOM   225  C  C   . GLY A 1 28  ? 9.621  62.528 62.313 1.00 30.11 ? 28  GLY A C   1 
ATOM   226  O  O   . GLY A 1 28  ? 8.861  62.298 63.259 1.00 29.46 ? 28  GLY A O   1 
ATOM   227  N  N   . LYS A 1 29  ? 10.606 61.705 61.956 1.00 31.16 ? 29  LYS A N   1 
ATOM   228  C  CA  . LYS A 1 29  ? 10.850 60.472 62.702 1.00 30.13 ? 29  LYS A CA  1 
ATOM   229  C  C   . LYS A 1 29  ? 12.242 60.357 63.337 1.00 29.98 ? 29  LYS A C   1 
ATOM   230  O  O   . LYS A 1 29  ? 12.353 60.167 64.544 1.00 29.18 ? 29  LYS A O   1 
ATOM   231  C  CB  . LYS A 1 29  ? 10.567 59.272 61.802 1.00 32.98 ? 29  LYS A CB  1 
ATOM   232  C  CG  . LYS A 1 29  ? 9.085  59.116 61.465 1.00 33.33 ? 29  LYS A CG  1 
ATOM   233  C  CD  . LYS A 1 29  ? 8.924  58.276 60.228 1.00 37.58 ? 29  LYS A CD  1 
ATOM   234  C  CE  . LYS A 1 29  ? 7.473  57.941 59.938 1.00 41.71 ? 29  LYS A CE  1 
ATOM   235  N  NZ  . LYS A 1 29  ? 6.902  56.989 60.951 1.00 45.17 ? 29  LYS A NZ  1 
ATOM   236  N  N   . HIS A 1 30  ? 13.306 60.473 62.548 1.00 29.84 ? 30  HIS A N   1 
ATOM   237  C  CA  . HIS A 1 30  ? 14.642 60.357 63.136 1.00 29.96 ? 30  HIS A CA  1 
ATOM   238  C  C   . HIS A 1 30  ? 14.895 61.453 64.184 1.00 29.92 ? 30  HIS A C   1 
ATOM   239  O  O   . HIS A 1 30  ? 15.209 61.166 65.342 1.00 29.71 ? 30  HIS A O   1 
ATOM   240  C  CB  . HIS A 1 30  ? 15.734 60.413 62.045 1.00 29.95 ? 30  HIS A CB  1 
ATOM   241  C  CG  . HIS A 1 30  ? 15.825 59.171 61.210 1.00 30.66 ? 30  HIS A CG  1 
ATOM   242  N  ND1 . HIS A 1 30  ? 16.396 58.006 61.671 1.00 31.99 ? 30  HIS A ND1 1 
ATOM   243  C  CD2 . HIS A 1 30  ? 15.374 58.898 59.961 1.00 31.41 ? 30  HIS A CD2 1 
ATOM   244  C  CE1 . HIS A 1 30  ? 16.293 57.067 60.745 1.00 30.33 ? 30  HIS A CE1 1 
ATOM   245  N  NE2 . HIS A 1 30  ? 15.676 57.582 59.698 1.00 31.19 ? 30  HIS A NE2 1 
ATOM   246  N  N   . HIS A 1 31  ? 14.755 62.711 63.772 1.00 30.33 ? 31  HIS A N   1 
ATOM   247  C  CA  . HIS A 1 31  ? 14.985 63.832 64.668 1.00 29.95 ? 31  HIS A CA  1 
ATOM   248  C  C   . HIS A 1 31  ? 14.001 63.751 65.835 1.00 31.05 ? 31  HIS A C   1 
ATOM   249  O  O   . HIS A 1 31  ? 14.384 63.891 66.994 1.00 31.27 ? 31  HIS A O   1 
ATOM   250  C  CB  . HIS A 1 31  ? 14.811 65.125 63.895 1.00 30.80 ? 31  HIS A CB  1 
ATOM   251  C  CG  . HIS A 1 31  ? 15.474 66.302 64.531 1.00 30.11 ? 31  HIS A CG  1 
ATOM   252  N  ND1 . HIS A 1 31  ? 15.503 67.545 63.937 1.00 29.85 ? 31  HIS A ND1 1 
ATOM   253  C  CD2 . HIS A 1 31  ? 16.127 66.430 65.709 1.00 29.33 ? 31  HIS A CD2 1 
ATOM   254  C  CE1 . HIS A 1 31  ? 16.147 68.389 64.725 1.00 31.80 ? 31  HIS A CE1 1 
ATOM   255  N  NE2 . HIS A 1 31  ? 16.536 67.738 65.807 1.00 28.15 ? 31  HIS A NE2 1 
ATOM   256  N  N   . GLN A 1 32  ? 12.736 63.492 65.530 1.00 31.87 ? 32  GLN A N   1 
ATOM   257  C  CA  . GLN A 1 32  ? 11.725 63.363 66.576 1.00 33.02 ? 32  GLN A CA  1 
ATOM   258  C  C   . GLN A 1 32  ? 12.127 62.309 67.605 1.00 34.61 ? 32  GLN A C   1 
ATOM   259  O  O   . GLN A 1 32  ? 11.937 62.503 68.810 1.00 35.42 ? 32  GLN A O   1 
ATOM   260  C  CB  . GLN A 1 32  ? 10.375 62.948 65.994 1.00 32.68 ? 32  GLN A CB  1 
ATOM   261  C  CG  . GLN A 1 32  ? 9.316  62.760 67.064 1.00 30.30 ? 32  GLN A CG  1 
ATOM   262  C  CD  . GLN A 1 32  ? 8.901  64.092 67.651 1.00 31.60 ? 32  GLN A CD  1 
ATOM   263  O  OE1 . GLN A 1 32  ? 8.253  64.892 66.976 1.00 29.21 ? 32  GLN A OE1 1 
ATOM   264  N  NE2 . GLN A 1 32  ? 9.297  64.353 68.899 1.00 25.06 ? 32  GLN A NE2 1 
ATOM   265  N  N   . THR A 1 33  ? 12.669 61.189 67.126 1.00 33.37 ? 33  THR A N   1 
ATOM   266  C  CA  . THR A 1 33  ? 13.061 60.106 68.014 1.00 31.19 ? 33  THR A CA  1 
ATOM   267  C  C   . THR A 1 33  ? 14.203 60.473 68.958 1.00 30.71 ? 33  THR A C   1 
ATOM   268  O  O   . THR A 1 33  ? 14.239 60.006 70.099 1.00 31.21 ? 33  THR A O   1 
ATOM   269  C  CB  . THR A 1 33  ? 13.447 58.844 67.204 1.00 32.26 ? 33  THR A CB  1 
ATOM   270  O  OG1 . THR A 1 33  ? 12.298 58.381 66.478 1.00 30.95 ? 33  THR A OG1 1 
ATOM   271  C  CG2 . THR A 1 33  ? 13.950 57.728 68.142 1.00 25.58 ? 33  THR A CG2 1 
ATOM   272  N  N   . TYR A 1 34  ? 15.143 61.290 68.494 1.00 29.40 ? 34  TYR A N   1 
ATOM   273  C  CA  . TYR A 1 34  ? 16.269 61.674 69.355 1.00 29.27 ? 34  TYR A CA  1 
ATOM   274  C  C   . TYR A 1 34  ? 15.743 62.558 70.488 1.00 30.68 ? 34  TYR A C   1 
ATOM   275  O  O   . TYR A 1 34  ? 16.199 62.475 71.624 1.00 29.92 ? 34  TYR A O   1 
ATOM   276  C  CB  . TYR A 1 34  ? 17.350 62.418 68.558 1.00 27.43 ? 34  TYR A CB  1 
ATOM   277  C  CG  . TYR A 1 34  ? 18.122 61.565 67.554 1.00 28.14 ? 34  TYR A CG  1 
ATOM   278  C  CD1 . TYR A 1 34  ? 18.740 60.382 67.937 1.00 28.81 ? 34  TYR A CD1 1 
ATOM   279  C  CD2 . TYR A 1 34  ? 18.256 61.965 66.233 1.00 29.47 ? 34  TYR A CD2 1 
ATOM   280  C  CE1 . TYR A 1 34  ? 19.474 59.624 67.029 1.00 28.43 ? 34  TYR A CE1 1 
ATOM   281  C  CE2 . TYR A 1 34  ? 18.984 61.216 65.321 1.00 30.88 ? 34  TYR A CE2 1 
ATOM   282  C  CZ  . TYR A 1 34  ? 19.591 60.051 65.723 1.00 29.81 ? 34  TYR A CZ  1 
ATOM   283  O  OH  . TYR A 1 34  ? 20.325 59.328 64.808 1.00 30.14 ? 34  TYR A OH  1 
ATOM   284  N  N   . VAL A 1 35  ? 14.768 63.404 70.166 1.00 31.69 ? 35  VAL A N   1 
ATOM   285  C  CA  . VAL A 1 35  ? 14.147 64.274 71.158 1.00 32.52 ? 35  VAL A CA  1 
ATOM   286  C  C   . VAL A 1 35  ? 13.467 63.409 72.233 1.00 33.30 ? 35  VAL A C   1 
ATOM   287  O  O   . VAL A 1 35  ? 13.738 63.543 73.427 1.00 33.11 ? 35  VAL A O   1 
ATOM   288  C  CB  . VAL A 1 35  ? 13.077 65.173 70.494 1.00 33.33 ? 35  VAL A CB  1 
ATOM   289  C  CG1 . VAL A 1 35  ? 12.274 65.927 71.569 1.00 31.35 ? 35  VAL A CG1 1 
ATOM   290  C  CG2 . VAL A 1 35  ? 13.751 66.135 69.513 1.00 30.41 ? 35  VAL A CG2 1 
ATOM   291  N  N   . ASN A 1 36  ? 12.579 62.522 71.792 1.00 34.37 ? 36  ASN A N   1 
ATOM   292  C  CA  . ASN A 1 36  ? 11.869 61.630 72.692 1.00 34.77 ? 36  ASN A CA  1 
ATOM   293  C  C   . ASN A 1 36  ? 12.847 60.786 73.504 1.00 36.16 ? 36  ASN A C   1 
ATOM   294  O  O   . ASN A 1 36  ? 12.660 60.624 74.701 1.00 36.43 ? 36  ASN A O   1 
ATOM   295  C  CB  . ASN A 1 36  ? 10.938 60.713 71.906 1.00 34.44 ? 36  ASN A CB  1 
ATOM   296  C  CG  . ASN A 1 36  ? 9.850  61.470 71.174 1.00 36.38 ? 36  ASN A CG  1 
ATOM   297  O  OD1 . ASN A 1 36  ? 9.729  62.685 71.295 1.00 38.08 ? 36  ASN A OD1 1 
ATOM   298  N  ND2 . ASN A 1 36  ? 9.042  60.746 70.404 1.00 37.61 ? 36  ASN A ND2 1 
ATOM   299  N  N   . ASN A 1 37  ? 13.889 60.250 72.868 1.00 37.50 ? 37  ASN A N   1 
ATOM   300  C  CA  . ASN A 1 37  ? 14.864 59.433 73.604 1.00 37.65 ? 37  ASN A CA  1 
ATOM   301  C  C   . ASN A 1 37  ? 15.555 60.235 74.688 1.00 37.59 ? 37  ASN A C   1 
ATOM   302  O  O   . ASN A 1 37  ? 15.692 59.768 75.811 1.00 38.05 ? 37  ASN A O   1 
ATOM   303  C  CB  . ASN A 1 37  ? 15.944 58.865 72.679 1.00 36.23 ? 37  ASN A CB  1 
ATOM   304  C  CG  . ASN A 1 37  ? 15.416 57.798 71.770 1.00 34.68 ? 37  ASN A CG  1 
ATOM   305  O  OD1 . ASN A 1 37  ? 14.444 57.129 72.097 1.00 34.78 ? 37  ASN A OD1 1 
ATOM   306  N  ND2 . ASN A 1 37  ? 16.061 57.618 70.624 1.00 37.32 ? 37  ASN A ND2 1 
ATOM   307  N  N   . LEU A 1 38  ? 15.998 61.445 74.359 1.00 38.29 ? 38  LEU A N   1 
ATOM   308  C  CA  . LEU A 1 38  ? 16.686 62.245 75.363 1.00 38.47 ? 38  LEU A CA  1 
ATOM   309  C  C   . LEU A 1 38  ? 15.742 62.538 76.522 1.00 39.72 ? 38  LEU A C   1 
ATOM   310  O  O   . LEU A 1 38  ? 16.113 62.347 77.677 1.00 39.40 ? 38  LEU A O   1 
ATOM   311  C  CB  . LEU A 1 38  ? 17.214 63.557 74.780 1.00 33.67 ? 38  LEU A CB  1 
ATOM   312  C  CG  . LEU A 1 38  ? 18.033 64.393 75.788 1.00 33.27 ? 38  LEU A CG  1 
ATOM   313  C  CD1 . LEU A 1 38  ? 19.305 63.636 76.188 1.00 26.33 ? 38  LEU A CD1 1 
ATOM   314  C  CD2 . LEU A 1 38  ? 18.398 65.758 75.179 1.00 28.30 ? 38  LEU A CD2 1 
ATOM   315  N  N   . ASN A 1 39  ? 14.525 62.989 76.218 1.00 40.91 ? 39  ASN A N   1 
ATOM   316  C  CA  . ASN A 1 39  ? 13.562 63.292 77.277 1.00 42.66 ? 39  ASN A CA  1 
ATOM   317  C  C   . ASN A 1 39  ? 13.418 62.095 78.211 1.00 44.30 ? 39  ASN A C   1 
ATOM   318  O  O   . ASN A 1 39  ? 13.510 62.243 79.429 1.00 45.87 ? 39  ASN A O   1 
ATOM   319  C  CB  . ASN A 1 39  ? 12.181 63.669 76.707 1.00 39.78 ? 39  ASN A CB  1 
ATOM   320  C  CG  . ASN A 1 39  ? 12.151 65.063 76.094 1.00 37.82 ? 39  ASN A CG  1 
ATOM   321  O  OD1 . ASN A 1 39  ? 12.850 65.971 76.541 1.00 38.34 ? 39  ASN A OD1 1 
ATOM   322  N  ND2 . ASN A 1 39  ? 11.324 65.239 75.075 1.00 35.96 ? 39  ASN A ND2 1 
ATOM   323  N  N   . ASN A 1 40  ? 13.220 60.911 77.641 1.00 45.02 ? 40  ASN A N   1 
ATOM   324  C  CA  . ASN A 1 40  ? 13.062 59.705 78.444 1.00 46.83 ? 40  ASN A CA  1 
ATOM   325  C  C   . ASN A 1 40  ? 14.308 59.343 79.251 1.00 47.07 ? 40  ASN A C   1 
ATOM   326  O  O   . ASN A 1 40  ? 14.195 58.889 80.389 1.00 47.73 ? 40  ASN A O   1 
ATOM   327  C  CB  . ASN A 1 40  ? 12.669 58.529 77.549 1.00 48.45 ? 40  ASN A CB  1 
ATOM   328  C  CG  . ASN A 1 40  ? 11.282 58.695 76.944 1.00 50.76 ? 40  ASN A CG  1 
ATOM   329  O  OD1 . ASN A 1 40  ? 10.935 58.022 75.966 1.00 52.69 ? 40  ASN A OD1 1 
ATOM   330  N  ND2 . ASN A 1 40  ? 10.474 59.587 77.532 1.00 50.35 ? 40  ASN A ND2 1 
ATOM   331  N  N   . LEU A 1 41  ? 15.488 59.555 78.671 1.00 46.41 ? 41  LEU A N   1 
ATOM   332  C  CA  . LEU A 1 41  ? 16.739 59.222 79.340 1.00 46.41 ? 41  LEU A CA  1 
ATOM   333  C  C   . LEU A 1 41  ? 17.133 60.128 80.499 1.00 48.17 ? 41  LEU A C   1 
ATOM   334  O  O   . LEU A 1 41  ? 17.737 59.665 81.464 1.00 49.07 ? 41  LEU A O   1 
ATOM   335  C  CB  . LEU A 1 41  ? 17.885 59.192 78.332 1.00 45.77 ? 41  LEU A CB  1 
ATOM   336  C  CG  . LEU A 1 41  ? 17.900 58.025 77.350 1.00 44.48 ? 41  LEU A CG  1 
ATOM   337  C  CD1 . LEU A 1 41  ? 19.105 58.154 76.429 1.00 43.17 ? 41  LEU A CD1 1 
ATOM   338  C  CD2 . LEU A 1 41  ? 17.946 56.715 78.124 1.00 44.31 ? 41  LEU A CD2 1 
ATOM   339  N  N   . ILE A 1 42  ? 16.804 61.414 80.414 1.00 49.48 ? 42  ILE A N   1 
ATOM   340  C  CA  . ILE A 1 42  ? 17.158 62.350 81.481 1.00 50.32 ? 42  ILE A CA  1 
ATOM   341  C  C   . ILE A 1 42  ? 16.154 62.374 82.621 1.00 51.28 ? 42  ILE A C   1 
ATOM   342  O  O   . ILE A 1 42  ? 16.463 62.861 83.696 1.00 50.52 ? 42  ILE A O   1 
ATOM   343  C  CB  . ILE A 1 42  ? 17.294 63.800 80.968 1.00 49.59 ? 42  ILE A CB  1 
ATOM   344  C  CG1 . ILE A 1 42  ? 15.973 64.252 80.339 1.00 49.77 ? 42  ILE A CG1 1 
ATOM   345  C  CG2 . ILE A 1 42  ? 18.455 63.905 80.004 1.00 49.87 ? 42  ILE A CG2 1 
ATOM   346  C  CD1 . ILE A 1 42  ? 15.988 65.685 79.817 1.00 49.74 ? 42  ILE A CD1 1 
ATOM   347  N  N   . LYS A 1 43  ? 14.949 61.869 82.380 1.00 53.63 ? 43  LYS A N   1 
ATOM   348  C  CA  . LYS A 1 43  ? 13.912 61.853 83.411 1.00 55.68 ? 43  LYS A CA  1 
ATOM   349  C  C   . LYS A 1 43  ? 14.472 61.241 84.702 1.00 56.39 ? 43  LYS A C   1 
ATOM   350  O  O   . LYS A 1 43  ? 14.886 60.080 84.725 1.00 56.78 ? 43  LYS A O   1 
ATOM   351  C  CB  . LYS A 1 43  ? 12.707 61.037 82.936 1.00 56.53 ? 43  LYS A CB  1 
ATOM   352  C  CG  . LYS A 1 43  ? 11.359 61.632 83.291 1.00 59.65 ? 43  LYS A CG  1 
ATOM   353  C  CD  . LYS A 1 43  ? 11.206 61.860 84.782 1.00 61.49 ? 43  LYS A CD  1 
ATOM   354  C  CE  . LYS A 1 43  ? 9.875  62.538 85.097 1.00 63.89 ? 43  LYS A CE  1 
ATOM   355  N  NZ  . LYS A 1 43  ? 9.776  62.994 86.517 1.00 65.70 ? 43  LYS A NZ  1 
ATOM   356  N  N   . GLY A 1 44  ? 14.501 62.032 85.770 1.00 56.27 ? 44  GLY A N   1 
ATOM   357  C  CA  . GLY A 1 44  ? 15.008 61.533 87.034 1.00 55.39 ? 44  GLY A CA  1 
ATOM   358  C  C   . GLY A 1 44  ? 16.520 61.508 87.176 1.00 55.17 ? 44  GLY A C   1 
ATOM   359  O  O   . GLY A 1 44  ? 17.058 60.758 87.993 1.00 53.81 ? 44  GLY A O   1 
ATOM   360  N  N   . THR A 1 45  ? 17.217 62.326 86.393 1.00 55.56 ? 45  THR A N   1 
ATOM   361  C  CA  . THR A 1 45  ? 18.676 62.383 86.469 1.00 56.14 ? 45  THR A CA  1 
ATOM   362  C  C   . THR A 1 45  ? 19.146 63.815 86.634 1.00 57.62 ? 45  THR A C   1 
ATOM   363  O  O   . THR A 1 45  ? 18.342 64.750 86.628 1.00 58.36 ? 45  THR A O   1 
ATOM   364  C  CB  . THR A 1 45  ? 19.363 61.811 85.201 1.00 54.98 ? 45  THR A CB  1 
ATOM   365  O  OG1 . THR A 1 45  ? 18.959 62.565 84.049 1.00 53.02 ? 45  THR A OG1 1 
ATOM   366  C  CG2 . THR A 1 45  ? 18.999 60.355 85.010 1.00 54.52 ? 45  THR A CG2 1 
ATOM   367  N  N   . ASP A 1 46  ? 20.459 63.965 86.779 1.00 58.50 ? 46  ASP A N   1 
ATOM   368  C  CA  . ASP A 1 46  ? 21.117 65.261 86.941 1.00 59.30 ? 46  ASP A CA  1 
ATOM   369  C  C   . ASP A 1 46  ? 20.875 66.203 85.773 1.00 58.60 ? 46  ASP A C   1 
ATOM   370  O  O   . ASP A 1 46  ? 21.006 67.421 85.904 1.00 58.87 ? 46  ASP A O   1 
ATOM   371  C  CB  . ASP A 1 46  ? 22.624 65.054 87.069 1.00 63.05 ? 46  ASP A CB  1 
ATOM   372  C  CG  . ASP A 1 46  ? 23.108 65.171 88.489 1.00 66.35 ? 46  ASP A CG  1 
ATOM   373  O  OD1 . ASP A 1 46  ? 22.527 64.506 89.374 1.00 67.58 ? 46  ASP A OD1 1 
ATOM   374  O  OD2 . ASP A 1 46  ? 24.078 65.928 88.714 1.00 69.71 ? 46  ASP A OD2 1 
ATOM   375  N  N   . PHE A 1 47  ? 20.562 65.625 84.623 1.00 56.06 ? 47  PHE A N   1 
ATOM   376  C  CA  . PHE A 1 47  ? 20.332 66.404 83.429 1.00 53.97 ? 47  PHE A CA  1 
ATOM   377  C  C   . PHE A 1 47  ? 18.856 66.700 83.227 1.00 53.87 ? 47  PHE A C   1 
ATOM   378  O  O   . PHE A 1 47  ? 18.477 67.367 82.265 1.00 54.97 ? 47  PHE A O   1 
ATOM   379  C  CB  . PHE A 1 47  ? 20.882 65.646 82.224 1.00 51.02 ? 47  PHE A CB  1 
ATOM   380  C  CG  . PHE A 1 47  ? 22.379 65.511 82.222 1.00 47.29 ? 47  PHE A CG  1 
ATOM   381  C  CD1 . PHE A 1 47  ? 22.979 64.256 82.195 1.00 44.54 ? 47  PHE A CD1 1 
ATOM   382  C  CD2 . PHE A 1 47  ? 23.195 66.646 82.205 1.00 44.71 ? 47  PHE A CD2 1 
ATOM   383  C  CE1 . PHE A 1 47  ? 24.373 64.137 82.146 1.00 42.92 ? 47  PHE A CE1 1 
ATOM   384  C  CE2 . PHE A 1 47  ? 24.580 66.532 82.156 1.00 40.16 ? 47  PHE A CE2 1 
ATOM   385  C  CZ  . PHE A 1 47  ? 25.171 65.277 82.125 1.00 39.75 ? 47  PHE A CZ  1 
ATOM   386  N  N   . GLU A 1 48  ? 18.017 66.205 84.127 1.00 52.47 ? 48  GLU A N   1 
ATOM   387  C  CA  . GLU A 1 48  ? 16.594 66.436 83.986 1.00 52.48 ? 48  GLU A CA  1 
ATOM   388  C  C   . GLU A 1 48  ? 16.311 67.906 83.682 1.00 52.73 ? 48  GLU A C   1 
ATOM   389  O  O   . GLU A 1 48  ? 15.751 68.234 82.638 1.00 52.21 ? 48  GLU A O   1 
ATOM   390  C  CB  . GLU A 1 48  ? 15.854 65.991 85.250 1.00 53.04 ? 48  GLU A CB  1 
ATOM   391  C  CG  . GLU A 1 48  ? 14.346 66.199 85.205 1.00 56.00 ? 48  GLU A CG  1 
ATOM   392  C  CD  . GLU A 1 48  ? 13.569 65.124 85.966 1.00 60.63 ? 48  GLU A CD  1 
ATOM   393  O  OE1 . GLU A 1 48  ? 14.039 64.656 87.030 1.00 61.97 ? 48  GLU A OE1 1 
ATOM   394  O  OE2 . GLU A 1 48  ? 12.471 64.754 85.501 1.00 62.68 ? 48  GLU A OE2 1 
ATOM   395  N  N   . LYS A 1 49  ? 16.730 68.796 84.572 1.00 53.06 ? 49  LYS A N   1 
ATOM   396  C  CA  . LYS A 1 49  ? 16.475 70.216 84.372 1.00 52.74 ? 49  LYS A CA  1 
ATOM   397  C  C   . LYS A 1 49  ? 17.567 70.982 83.641 1.00 51.70 ? 49  LYS A C   1 
ATOM   398  O  O   . LYS A 1 49  ? 17.556 72.209 83.647 1.00 52.24 ? 49  LYS A O   1 
ATOM   399  C  CB  . LYS A 1 49  ? 16.198 70.890 85.720 1.00 52.44 ? 49  LYS A CB  1 
ATOM   400  C  CG  . LYS A 1 49  ? 14.877 70.480 86.339 1.00 52.99 ? 49  LYS A CG  1 
ATOM   401  C  CD  . LYS A 1 49  ? 14.688 71.055 87.737 1.00 54.06 ? 49  LYS A CD  1 
ATOM   402  C  CE  . LYS A 1 49  ? 15.695 70.483 88.713 1.00 53.58 ? 49  LYS A CE  1 
ATOM   403  N  NZ  . LYS A 1 49  ? 15.269 70.691 90.123 1.00 54.20 ? 49  LYS A NZ  1 
ATOM   404  N  N   . SER A 1 50  ? 18.497 70.279 83.003 1.00 50.52 ? 50  SER A N   1 
ATOM   405  C  CA  . SER A 1 50  ? 19.581 70.950 82.288 1.00 50.01 ? 50  SER A CA  1 
ATOM   406  C  C   . SER A 1 50  ? 19.186 71.407 80.874 1.00 49.54 ? 50  SER A C   1 
ATOM   407  O  O   . SER A 1 50  ? 18.181 70.943 80.309 1.00 48.40 ? 50  SER A O   1 
ATOM   408  C  CB  . SER A 1 50  ? 20.800 70.031 82.204 1.00 49.89 ? 50  SER A CB  1 
ATOM   409  O  OG  . SER A 1 50  ? 21.196 69.603 83.491 1.00 49.09 ? 50  SER A OG  1 
ATOM   410  N  N   . SER A 1 51  ? 19.973 72.336 80.328 1.00 48.35 ? 51  SER A N   1 
ATOM   411  C  CA  . SER A 1 51  ? 19.754 72.860 78.981 1.00 47.64 ? 51  SER A CA  1 
ATOM   412  C  C   . SER A 1 51  ? 20.449 71.910 78.010 1.00 47.20 ? 51  SER A C   1 
ATOM   413  O  O   . SER A 1 51  ? 21.371 71.174 78.391 1.00 46.28 ? 51  SER A O   1 
ATOM   414  C  CB  . SER A 1 51  ? 20.368 74.253 78.839 1.00 46.90 ? 51  SER A CB  1 
ATOM   415  O  OG  . SER A 1 51  ? 21.784 74.178 78.796 1.00 45.41 ? 51  SER A OG  1 
ATOM   416  N  N   . LEU A 1 52  ? 20.024 71.929 76.755 1.00 46.89 ? 52  LEU A N   1 
ATOM   417  C  CA  . LEU A 1 52  ? 20.632 71.043 75.778 1.00 46.49 ? 52  LEU A CA  1 
ATOM   418  C  C   . LEU A 1 52  ? 22.134 71.309 75.691 1.00 45.67 ? 52  LEU A C   1 
ATOM   419  O  O   . LEU A 1 52  ? 22.934 70.370 75.658 1.00 45.45 ? 52  LEU A O   1 
ATOM   420  C  CB  . LEU A 1 52  ? 19.971 71.224 74.409 1.00 46.59 ? 52  LEU A CB  1 
ATOM   421  C  CG  . LEU A 1 52  ? 20.363 70.190 73.345 1.00 46.58 ? 52  LEU A CG  1 
ATOM   422  C  CD1 . LEU A 1 52  ? 20.070 68.782 73.861 1.00 46.79 ? 52  LEU A CD1 1 
ATOM   423  C  CD2 . LEU A 1 52  ? 19.591 70.457 72.062 1.00 46.16 ? 52  LEU A CD2 1 
ATOM   424  N  N   . PHE A 1 53  ? 22.516 72.586 75.681 1.00 46.03 ? 53  PHE A N   1 
ATOM   425  C  CA  . PHE A 1 53  ? 23.933 72.939 75.603 1.00 45.34 ? 53  PHE A CA  1 
ATOM   426  C  C   . PHE A 1 53  ? 24.671 72.303 76.766 1.00 44.08 ? 53  PHE A C   1 
ATOM   427  O  O   . PHE A 1 53  ? 25.769 71.762 76.608 1.00 44.55 ? 53  PHE A O   1 
ATOM   428  C  CB  . PHE A 1 53  ? 24.127 74.460 75.626 1.00 45.06 ? 53  PHE A CB  1 
ATOM   429  C  CG  . PHE A 1 53  ? 25.568 74.881 75.572 1.00 47.00 ? 53  PHE A CG  1 
ATOM   430  C  CD1 . PHE A 1 53  ? 26.291 75.093 76.744 1.00 48.25 ? 53  PHE A CD1 1 
ATOM   431  C  CD2 . PHE A 1 53  ? 26.224 75.004 74.350 1.00 47.63 ? 53  PHE A CD2 1 
ATOM   432  C  CE1 . PHE A 1 53  ? 27.651 75.418 76.704 1.00 47.84 ? 53  PHE A CE1 1 
ATOM   433  C  CE2 . PHE A 1 53  ? 27.581 75.328 74.293 1.00 49.19 ? 53  PHE A CE2 1 
ATOM   434  C  CZ  . PHE A 1 53  ? 28.298 75.535 75.474 1.00 50.29 ? 53  PHE A CZ  1 
ATOM   435  N  N   . ALA A 1 54  ? 24.049 72.360 77.937 1.00 43.41 ? 54  ALA A N   1 
ATOM   436  C  CA  . ALA A 1 54  ? 24.635 71.779 79.134 1.00 42.87 ? 54  ALA A CA  1 
ATOM   437  C  C   . ALA A 1 54  ? 24.856 70.280 78.912 1.00 41.33 ? 54  ALA A C   1 
ATOM   438  O  O   . ALA A 1 54  ? 25.984 69.792 78.965 1.00 39.42 ? 54  ALA A O   1 
ATOM   439  C  CB  . ALA A 1 54  ? 23.708 72.018 80.338 1.00 40.13 ? 54  ALA A CB  1 
ATOM   440  N  N   . ILE A 1 55  ? 23.764 69.565 78.658 1.00 41.85 ? 55  ILE A N   1 
ATOM   441  C  CA  . ILE A 1 55  ? 23.806 68.125 78.422 1.00 42.28 ? 55  ILE A CA  1 
ATOM   442  C  C   . ILE A 1 55  ? 24.770 67.768 77.292 1.00 42.41 ? 55  ILE A C   1 
ATOM   443  O  O   . ILE A 1 55  ? 25.523 66.805 77.392 1.00 43.09 ? 55  ILE A O   1 
ATOM   444  C  CB  . ILE A 1 55  ? 22.413 67.613 78.053 1.00 42.24 ? 55  ILE A CB  1 
ATOM   445  C  CG1 . ILE A 1 55  ? 21.443 67.939 79.188 1.00 42.25 ? 55  ILE A CG1 1 
ATOM   446  C  CG2 . ILE A 1 55  ? 22.455 66.113 77.758 1.00 41.45 ? 55  ILE A CG2 1 
ATOM   447  C  CD1 . ILE A 1 55  ? 19.992 67.595 78.869 1.00 43.45 ? 55  ILE A CD1 1 
ATOM   448  N  N   . LEU A 1 56  ? 24.741 68.550 76.217 1.00 42.41 ? 56  LEU A N   1 
ATOM   449  C  CA  . LEU A 1 56  ? 25.609 68.305 75.061 1.00 43.92 ? 56  LEU A CA  1 
ATOM   450  C  C   . LEU A 1 56  ? 27.105 68.357 75.387 1.00 44.51 ? 56  LEU A C   1 
ATOM   451  O  O   . LEU A 1 56  ? 27.876 67.498 74.950 1.00 43.43 ? 56  LEU A O   1 
ATOM   452  C  CB  . LEU A 1 56  ? 25.308 69.321 73.949 1.00 42.93 ? 56  LEU A CB  1 
ATOM   453  C  CG  . LEU A 1 56  ? 26.208 69.271 72.706 1.00 43.03 ? 56  LEU A CG  1 
ATOM   454  C  CD1 . LEU A 1 56  ? 26.059 67.925 72.022 1.00 41.85 ? 56  LEU A CD1 1 
ATOM   455  C  CD2 . LEU A 1 56  ? 25.836 70.402 71.747 1.00 43.57 ? 56  LEU A CD2 1 
ATOM   456  N  N   . THR A 1 57  ? 27.501 69.374 76.151 1.00 45.27 ? 57  THR A N   1 
ATOM   457  C  CA  . THR A 1 57  ? 28.898 69.575 76.525 1.00 45.85 ? 57  THR A CA  1 
ATOM   458  C  C   . THR A 1 57  ? 29.347 68.800 77.752 1.00 45.35 ? 57  THR A C   1 
ATOM   459  O  O   . THR A 1 57  ? 30.531 68.735 78.026 1.00 45.62 ? 57  THR A O   1 
ATOM   460  C  CB  . THR A 1 57  ? 29.186 71.067 76.809 1.00 46.32 ? 57  THR A CB  1 
ATOM   461  O  OG1 . THR A 1 57  ? 28.209 71.567 77.730 1.00 48.55 ? 57  THR A OG1 1 
ATOM   462  C  CG2 . THR A 1 57  ? 29.132 71.892 75.537 1.00 46.80 ? 57  THR A CG2 1 
ATOM   463  N  N   . LYS A 1 58  ? 28.420 68.203 78.488 1.00 46.82 ? 58  LYS A N   1 
ATOM   464  C  CA  . LYS A 1 58  ? 28.809 67.490 79.703 1.00 48.65 ? 58  LYS A CA  1 
ATOM   465  C  C   . LYS A 1 58  ? 28.503 65.995 79.752 1.00 48.96 ? 58  LYS A C   1 
ATOM   466  O  O   . LYS A 1 58  ? 29.225 65.239 80.407 1.00 50.25 ? 58  LYS A O   1 
ATOM   467  C  CB  . LYS A 1 58  ? 28.157 68.157 80.921 1.00 49.21 ? 58  LYS A CB  1 
ATOM   468  C  CG  . LYS A 1 58  ? 28.485 69.642 81.099 1.00 54.02 ? 58  LYS A CG  1 
ATOM   469  C  CD  . LYS A 1 58  ? 27.689 70.275 82.261 1.00 55.34 ? 58  LYS A CD  1 
ATOM   470  C  CE  . LYS A 1 58  ? 27.963 71.777 82.385 1.00 56.53 ? 58  LYS A CE  1 
ATOM   471  N  NZ  . LYS A 1 58  ? 27.108 72.441 83.417 1.00 56.71 ? 58  LYS A NZ  1 
ATOM   472  N  N   . SER A 1 59  ? 27.442 65.561 79.074 1.00 47.19 ? 59  SER A N   1 
ATOM   473  C  CA  . SER A 1 59  ? 27.056 64.152 79.112 1.00 46.36 ? 59  SER A CA  1 
ATOM   474  C  C   . SER A 1 59  ? 27.910 63.232 78.250 1.00 44.73 ? 59  SER A C   1 
ATOM   475  O  O   . SER A 1 59  ? 28.869 63.654 77.615 1.00 44.79 ? 59  SER A O   1 
ATOM   476  C  CB  . SER A 1 59  ? 25.588 63.985 78.697 1.00 46.20 ? 59  SER A CB  1 
ATOM   477  O  OG  . SER A 1 59  ? 25.429 64.182 77.298 1.00 46.69 ? 59  SER A OG  1 
ATOM   478  N  N   . SER A 1 60  ? 27.544 61.958 78.257 1.00 43.79 ? 60  SER A N   1 
ATOM   479  C  CA  . SER A 1 60  ? 28.220 60.942 77.466 1.00 43.56 ? 60  SER A CA  1 
ATOM   480  C  C   . SER A 1 60  ? 27.248 59.780 77.308 1.00 42.20 ? 60  SER A C   1 
ATOM   481  O  O   . SER A 1 60  ? 26.098 59.865 77.745 1.00 41.48 ? 60  SER A O   1 
ATOM   482  C  CB  . SER A 1 60  ? 29.518 60.481 78.146 1.00 43.20 ? 60  SER A CB  1 
ATOM   483  O  OG  . SER A 1 60  ? 29.259 59.860 79.387 1.00 46.68 ? 60  SER A OG  1 
ATOM   484  N  N   . GLY A 1 61  ? 27.706 58.704 76.673 1.00 42.25 ? 61  GLY A N   1 
ATOM   485  C  CA  . GLY A 1 61  ? 26.852 57.546 76.451 1.00 41.20 ? 61  GLY A CA  1 
ATOM   486  C  C   . GLY A 1 61  ? 25.634 57.856 75.590 1.00 40.72 ? 61  GLY A C   1 
ATOM   487  O  O   . GLY A 1 61  ? 25.681 58.715 74.694 1.00 40.44 ? 61  GLY A O   1 
ATOM   488  N  N   . GLY A 1 62  ? 24.539 57.155 75.864 1.00 39.28 ? 62  GLY A N   1 
ATOM   489  C  CA  . GLY A 1 62  ? 23.321 57.365 75.107 1.00 40.02 ? 62  GLY A CA  1 
ATOM   490  C  C   . GLY A 1 62  ? 22.785 58.775 75.250 1.00 40.84 ? 62  GLY A C   1 
ATOM   491  O  O   . GLY A 1 62  ? 22.292 59.363 74.278 1.00 41.62 ? 62  GLY A O   1 
ATOM   492  N  N   . VAL A 1 63  ? 22.872 59.322 76.461 1.00 39.58 ? 63  VAL A N   1 
ATOM   493  C  CA  . VAL A 1 63  ? 22.397 60.674 76.704 1.00 38.44 ? 63  VAL A CA  1 
ATOM   494  C  C   . VAL A 1 63  ? 23.074 61.610 75.719 1.00 37.50 ? 63  VAL A C   1 
ATOM   495  O  O   . VAL A 1 63  ? 22.428 62.465 75.109 1.00 36.99 ? 63  VAL A O   1 
ATOM   496  C  CB  . VAL A 1 63  ? 22.712 61.120 78.147 1.00 40.51 ? 63  VAL A CB  1 
ATOM   497  C  CG1 . VAL A 1 63  ? 22.506 62.625 78.299 1.00 40.11 ? 63  VAL A CG1 1 
ATOM   498  C  CG2 . VAL A 1 63  ? 21.803 60.369 79.117 1.00 40.70 ? 63  VAL A CG2 1 
ATOM   499  N  N   . PHE A 1 64  ? 24.378 61.435 75.548 1.00 36.60 ? 64  PHE A N   1 
ATOM   500  C  CA  . PHE A 1 64  ? 25.113 62.285 74.639 1.00 35.44 ? 64  PHE A CA  1 
ATOM   501  C  C   . PHE A 1 64  ? 24.709 62.024 73.197 1.00 37.48 ? 64  PHE A C   1 
ATOM   502  O  O   . PHE A 1 64  ? 24.468 62.967 72.424 1.00 38.01 ? 64  PHE A O   1 
ATOM   503  C  CB  . PHE A 1 64  ? 26.606 62.054 74.748 1.00 34.71 ? 64  PHE A CB  1 
ATOM   504  C  CG  . PHE A 1 64  ? 27.390 62.838 73.743 1.00 34.88 ? 64  PHE A CG  1 
ATOM   505  C  CD1 . PHE A 1 64  ? 27.578 64.213 73.904 1.00 33.14 ? 64  PHE A CD1 1 
ATOM   506  C  CD2 . PHE A 1 64  ? 27.901 62.216 72.603 1.00 34.93 ? 64  PHE A CD2 1 
ATOM   507  C  CE1 . PHE A 1 64  ? 28.266 64.962 72.945 1.00 32.89 ? 64  PHE A CE1 1 
ATOM   508  C  CE2 . PHE A 1 64  ? 28.592 62.948 71.632 1.00 32.30 ? 64  PHE A CE2 1 
ATOM   509  C  CZ  . PHE A 1 64  ? 28.777 64.325 71.800 1.00 35.09 ? 64  PHE A CZ  1 
ATOM   510  N  N   . ASN A 1 65  ? 24.652 60.746 72.827 1.00 34.61 ? 65  ASN A N   1 
ATOM   511  C  CA  . ASN A 1 65  ? 24.294 60.410 71.466 1.00 32.53 ? 65  ASN A CA  1 
ATOM   512  C  C   . ASN A 1 65  ? 23.037 61.161 71.067 1.00 32.50 ? 65  ASN A C   1 
ATOM   513  O  O   . ASN A 1 65  ? 23.028 61.863 70.057 1.00 33.57 ? 65  ASN A O   1 
ATOM   514  C  CB  . ASN A 1 65  ? 24.096 58.897 71.309 1.00 30.35 ? 65  ASN A CB  1 
ATOM   515  C  CG  . ASN A 1 65  ? 25.417 58.142 71.165 1.00 28.25 ? 65  ASN A CG  1 
ATOM   516  O  OD1 . ASN A 1 65  ? 26.467 58.740 70.928 1.00 25.71 ? 65  ASN A OD1 1 
ATOM   517  N  ND2 . ASN A 1 65  ? 25.361 56.825 71.288 1.00 25.14 ? 65  ASN A ND2 1 
ATOM   518  N  N   . ASN A 1 66  ? 21.986 61.042 71.870 1.00 31.22 ? 66  ASN A N   1 
ATOM   519  C  CA  . ASN A 1 66  ? 20.734 61.718 71.558 1.00 31.44 ? 66  ASN A CA  1 
ATOM   520  C  C   . ASN A 1 66  ? 20.839 63.231 71.641 1.00 30.78 ? 66  ASN A C   1 
ATOM   521  O  O   . ASN A 1 66  ? 20.364 63.938 70.750 1.00 30.12 ? 66  ASN A O   1 
ATOM   522  C  CB  . ASN A 1 66  ? 19.619 61.220 72.473 1.00 30.75 ? 66  ASN A CB  1 
ATOM   523  C  CG  . ASN A 1 66  ? 19.230 59.798 72.164 1.00 32.56 ? 66  ASN A CG  1 
ATOM   524  O  OD1 . ASN A 1 66  ? 18.561 59.533 71.162 1.00 34.22 ? 66  ASN A OD1 1 
ATOM   525  N  ND2 . ASN A 1 66  ? 19.666 58.862 73.011 1.00 32.58 ? 66  ASN A ND2 1 
ATOM   526  N  N   . ALA A 1 67  ? 21.471 63.733 72.695 1.00 30.74 ? 67  ALA A N   1 
ATOM   527  C  CA  . ALA A 1 67  ? 21.608 65.183 72.845 1.00 31.50 ? 67  ALA A CA  1 
ATOM   528  C  C   . ALA A 1 67  ? 22.299 65.787 71.618 1.00 30.52 ? 67  ALA A C   1 
ATOM   529  O  O   . ALA A 1 67  ? 21.798 66.736 71.018 1.00 30.95 ? 67  ALA A O   1 
ATOM   530  C  CB  . ALA A 1 67  ? 22.405 65.524 74.122 1.00 27.83 ? 67  ALA A CB  1 
ATOM   531  N  N   . ALA A 1 68  ? 23.461 65.236 71.272 1.00 30.21 ? 68  ALA A N   1 
ATOM   532  C  CA  . ALA A 1 68  ? 24.238 65.692 70.128 1.00 29.45 ? 68  ALA A CA  1 
ATOM   533  C  C   . ALA A 1 68  ? 23.450 65.544 68.823 1.00 30.04 ? 68  ALA A C   1 
ATOM   534  O  O   . ALA A 1 68  ? 23.448 66.455 67.994 1.00 30.01 ? 68  ALA A O   1 
ATOM   535  C  CB  . ALA A 1 68  ? 25.537 64.908 70.039 1.00 27.36 ? 68  ALA A CB  1 
ATOM   536  N  N   . GLN A 1 69  ? 22.793 64.402 68.626 1.00 28.78 ? 69  GLN A N   1 
ATOM   537  C  CA  . GLN A 1 69  ? 22.028 64.233 67.398 1.00 29.63 ? 69  GLN A CA  1 
ATOM   538  C  C   . GLN A 1 69  ? 20.941 65.298 67.286 1.00 31.24 ? 69  GLN A C   1 
ATOM   539  O  O   . GLN A 1 69  ? 20.644 65.761 66.176 1.00 32.74 ? 69  GLN A O   1 
ATOM   540  C  CB  . GLN A 1 69  ? 21.402 62.837 67.302 1.00 26.64 ? 69  GLN A CB  1 
ATOM   541  C  CG  . GLN A 1 69  ? 22.380 61.742 66.873 1.00 25.20 ? 69  GLN A CG  1 
ATOM   542  C  CD  . GLN A 1 69  ? 23.043 62.021 65.524 1.00 28.17 ? 69  GLN A CD  1 
ATOM   543  O  OE1 . GLN A 1 69  ? 23.925 62.883 65.403 1.00 25.98 ? 69  GLN A OE1 1 
ATOM   544  N  NE2 . GLN A 1 69  ? 22.607 61.296 64.497 1.00 27.18 ? 69  GLN A NE2 1 
ATOM   545  N  N   . ILE A 1 70  ? 20.346 65.697 68.414 1.00 30.88 ? 70  ILE A N   1 
ATOM   546  C  CA  . ILE A 1 70  ? 19.308 66.732 68.359 1.00 30.76 ? 70  ILE A CA  1 
ATOM   547  C  C   . ILE A 1 70  ? 19.935 68.027 67.848 1.00 30.43 ? 70  ILE A C   1 
ATOM   548  O  O   . ILE A 1 70  ? 19.395 68.699 66.964 1.00 28.32 ? 70  ILE A O   1 
ATOM   549  C  CB  . ILE A 1 70  ? 18.687 67.014 69.736 1.00 30.00 ? 70  ILE A CB  1 
ATOM   550  C  CG1 . ILE A 1 70  ? 17.863 65.813 70.194 1.00 30.56 ? 70  ILE A CG1 1 
ATOM   551  C  CG2 . ILE A 1 70  ? 17.790 68.252 69.655 1.00 28.47 ? 70  ILE A CG2 1 
ATOM   552  C  CD1 . ILE A 1 70  ? 17.427 65.914 71.641 1.00 32.65 ? 70  ILE A CD1 1 
ATOM   553  N  N   . TYR A 1 71  ? 21.094 68.357 68.403 1.00 30.88 ? 71  TYR A N   1 
ATOM   554  C  CA  . TYR A 1 71  ? 21.792 69.573 68.015 1.00 31.75 ? 71  TYR A CA  1 
ATOM   555  C  C   . TYR A 1 71  ? 22.250 69.539 66.556 1.00 30.40 ? 71  TYR A C   1 
ATOM   556  O  O   . TYR A 1 71  ? 22.024 70.480 65.794 1.00 30.86 ? 71  TYR A O   1 
ATOM   557  C  CB  . TYR A 1 71  ? 23.011 69.782 68.912 1.00 31.60 ? 71  TYR A CB  1 
ATOM   558  C  CG  . TYR A 1 71  ? 23.942 70.837 68.379 1.00 31.36 ? 71  TYR A CG  1 
ATOM   559  C  CD1 . TYR A 1 71  ? 23.572 72.183 68.391 1.00 31.58 ? 71  TYR A CD1 1 
ATOM   560  C  CD2 . TYR A 1 71  ? 25.185 70.494 67.850 1.00 29.67 ? 71  TYR A CD2 1 
ATOM   561  C  CE1 . TYR A 1 71  ? 24.420 73.170 67.893 1.00 33.00 ? 71  TYR A CE1 1 
ATOM   562  C  CE2 . TYR A 1 71  ? 26.045 71.475 67.346 1.00 33.78 ? 71  TYR A CE2 1 
ATOM   563  C  CZ  . TYR A 1 71  ? 25.652 72.818 67.374 1.00 33.17 ? 71  TYR A CZ  1 
ATOM   564  O  OH  . TYR A 1 71  ? 26.494 73.808 66.906 1.00 33.90 ? 71  TYR A OH  1 
ATOM   565  N  N   . ASN A 1 72  ? 22.907 68.449 66.187 1.00 29.48 ? 72  ASN A N   1 
ATOM   566  C  CA  . ASN A 1 72  ? 23.428 68.294 64.841 1.00 28.70 ? 72  ASN A CA  1 
ATOM   567  C  C   . ASN A 1 72  ? 22.364 68.499 63.791 1.00 27.49 ? 72  ASN A C   1 
ATOM   568  O  O   . ASN A 1 72  ? 22.613 69.163 62.788 1.00 28.23 ? 72  ASN A O   1 
ATOM   569  C  CB  . ASN A 1 72  ? 24.062 66.915 64.663 1.00 27.07 ? 72  ASN A CB  1 
ATOM   570  C  CG  . ASN A 1 72  ? 25.247 66.697 65.574 1.00 28.02 ? 72  ASN A CG  1 
ATOM   571  O  OD1 . ASN A 1 72  ? 25.919 67.655 65.981 1.00 26.67 ? 72  ASN A OD1 1 
ATOM   572  N  ND2 . ASN A 1 72  ? 25.534 65.432 65.882 1.00 24.67 ? 72  ASN A ND2 1 
ATOM   573  N  N   . HIS A 1 73  ? 21.183 67.935 64.018 1.00 26.27 ? 73  HIS A N   1 
ATOM   574  C  CA  . HIS A 1 73  ? 20.106 68.076 63.050 1.00 26.58 ? 73  HIS A CA  1 
ATOM   575  C  C   . HIS A 1 73  ? 19.542 69.483 63.053 1.00 26.85 ? 73  HIS A C   1 
ATOM   576  O  O   . HIS A 1 73  ? 19.248 70.044 61.988 1.00 26.97 ? 73  HIS A O   1 
ATOM   577  C  CB  . HIS A 1 73  ? 18.994 67.069 63.326 1.00 25.33 ? 73  HIS A CB  1 
ATOM   578  C  CG  . HIS A 1 73  ? 19.339 65.673 62.918 1.00 26.50 ? 73  HIS A CG  1 
ATOM   579  N  ND1 . HIS A 1 73  ? 20.055 64.795 63.702 1.00 28.36 ? 73  HIS A ND1 1 
ATOM   580  C  CD2 . HIS A 1 73  ? 19.074 65.005 61.766 1.00 23.91 ? 73  HIS A CD2 1 
ATOM   581  C  CE1 . HIS A 1 73  ? 20.194 63.653 63.021 1.00 26.61 ? 73  HIS A CE1 1 
ATOM   582  N  NE2 . HIS A 1 73  ? 19.616 63.734 61.841 1.00 26.23 ? 73  HIS A NE2 1 
ATOM   583  N  N   . ASP A 1 74  ? 19.383 70.053 64.248 1.00 26.43 ? 74  ASP A N   1 
ATOM   584  C  CA  . ASP A 1 74  ? 18.872 71.420 64.364 1.00 26.69 ? 74  ASP A CA  1 
ATOM   585  C  C   . ASP A 1 74  ? 19.777 72.317 63.511 1.00 26.09 ? 74  ASP A C   1 
ATOM   586  O  O   . ASP A 1 74  ? 19.290 73.140 62.715 1.00 26.03 ? 74  ASP A O   1 
ATOM   587  C  CB  . ASP A 1 74  ? 18.955 71.944 65.807 1.00 27.97 ? 74  ASP A CB  1 
ATOM   588  C  CG  . ASP A 1 74  ? 17.902 71.361 66.731 1.00 29.76 ? 74  ASP A CG  1 
ATOM   589  O  OD1 . ASP A 1 74  ? 16.778 71.017 66.281 1.00 30.89 ? 74  ASP A OD1 1 
ATOM   590  O  OD2 . ASP A 1 74  ? 18.212 71.287 67.938 1.00 27.97 ? 74  ASP A OD2 1 
ATOM   591  N  N   . PHE A 1 75  ? 21.091 72.149 63.696 1.00 22.05 ? 75  PHE A N   1 
ATOM   592  C  CA  . PHE A 1 75  ? 22.078 72.949 62.984 1.00 23.72 ? 75  PHE A CA  1 
ATOM   593  C  C   . PHE A 1 75  ? 21.999 72.687 61.479 1.00 24.76 ? 75  PHE A C   1 
ATOM   594  O  O   . PHE A 1 75  ? 22.030 73.619 60.656 1.00 25.62 ? 75  PHE A O   1 
ATOM   595  C  CB  . PHE A 1 75  ? 23.489 72.625 63.487 1.00 22.61 ? 75  PHE A CB  1 
ATOM   596  C  CG  . PHE A 1 75  ? 24.519 73.662 63.116 1.00 24.46 ? 75  PHE A CG  1 
ATOM   597  C  CD1 . PHE A 1 75  ? 24.654 74.837 63.869 1.00 23.92 ? 75  PHE A CD1 1 
ATOM   598  C  CD2 . PHE A 1 75  ? 25.345 73.483 62.001 1.00 23.51 ? 75  PHE A CD2 1 
ATOM   599  C  CE1 . PHE A 1 75  ? 25.589 75.817 63.520 1.00 22.71 ? 75  PHE A CE1 1 
ATOM   600  C  CE2 . PHE A 1 75  ? 26.281 74.454 61.641 1.00 21.06 ? 75  PHE A CE2 1 
ATOM   601  C  CZ  . PHE A 1 75  ? 26.402 75.630 62.407 1.00 25.65 ? 75  PHE A CZ  1 
ATOM   602  N  N   . TYR A 1 76  ? 21.880 71.412 61.129 1.00 23.70 ? 76  TYR A N   1 
ATOM   603  C  CA  . TYR A 1 76  ? 21.800 71.014 59.748 1.00 24.25 ? 76  TYR A CA  1 
ATOM   604  C  C   . TYR A 1 76  ? 20.617 71.704 59.054 1.00 25.27 ? 76  TYR A C   1 
ATOM   605  O  O   . TYR A 1 76  ? 20.786 72.309 57.983 1.00 23.43 ? 76  TYR A O   1 
ATOM   606  C  CB  . TYR A 1 76  ? 21.700 69.496 59.694 1.00 24.30 ? 76  TYR A CB  1 
ATOM   607  C  CG  . TYR A 1 76  ? 21.377 68.905 58.342 1.00 25.55 ? 76  TYR A CG  1 
ATOM   608  C  CD1 . TYR A 1 76  ? 22.243 69.055 57.259 1.00 23.05 ? 76  TYR A CD1 1 
ATOM   609  C  CD2 . TYR A 1 76  ? 20.211 68.138 58.166 1.00 25.69 ? 76  TYR A CD2 1 
ATOM   610  C  CE1 . TYR A 1 76  ? 21.955 68.445 56.028 1.00 27.07 ? 76  TYR A CE1 1 
ATOM   611  C  CE2 . TYR A 1 76  ? 19.917 67.525 56.953 1.00 23.81 ? 76  TYR A CE2 1 
ATOM   612  C  CZ  . TYR A 1 76  ? 20.787 67.676 55.893 1.00 25.22 ? 76  TYR A CZ  1 
ATOM   613  O  OH  . TYR A 1 76  ? 20.501 67.024 54.723 1.00 26.89 ? 76  TYR A OH  1 
ATOM   614  N  N   . TRP A 1 77  ? 19.434 71.655 59.671 1.00 25.65 ? 77  TRP A N   1 
ATOM   615  C  CA  . TRP A 1 77  ? 18.264 72.294 59.069 1.00 25.75 ? 77  TRP A CA  1 
ATOM   616  C  C   . TRP A 1 77  ? 18.505 73.791 58.782 1.00 26.71 ? 77  TRP A C   1 
ATOM   617  O  O   . TRP A 1 77  ? 18.128 74.286 57.707 1.00 27.27 ? 77  TRP A O   1 
ATOM   618  C  CB  . TRP A 1 77  ? 17.028 72.112 59.961 1.00 23.96 ? 77  TRP A CB  1 
ATOM   619  C  CG  . TRP A 1 77  ? 16.661 70.674 60.215 1.00 25.50 ? 77  TRP A CG  1 
ATOM   620  C  CD1 . TRP A 1 77  ? 16.333 70.117 61.419 1.00 27.36 ? 77  TRP A CD1 1 
ATOM   621  C  CD2 . TRP A 1 77  ? 16.567 69.611 59.249 1.00 24.57 ? 77  TRP A CD2 1 
ATOM   622  N  NE1 . TRP A 1 77  ? 16.041 68.776 61.266 1.00 25.11 ? 77  TRP A NE1 1 
ATOM   623  C  CE2 . TRP A 1 77  ? 16.176 68.440 59.947 1.00 26.02 ? 77  TRP A CE2 1 
ATOM   624  C  CE3 . TRP A 1 77  ? 16.769 69.533 57.869 1.00 23.48 ? 77  TRP A CE3 1 
ATOM   625  C  CZ2 . TRP A 1 77  ? 15.987 67.202 59.305 1.00 27.40 ? 77  TRP A CZ2 1 
ATOM   626  C  CZ3 . TRP A 1 77  ? 16.577 68.296 57.225 1.00 25.33 ? 77  TRP A CZ3 1 
ATOM   627  C  CH2 . TRP A 1 77  ? 16.190 67.149 57.949 1.00 24.85 ? 77  TRP A CH2 1 
ATOM   628  N  N   . ASP A 1 78  ? 19.132 74.515 59.718 1.00 26.83 ? 78  ASP A N   1 
ATOM   629  C  CA  . ASP A 1 78  ? 19.401 75.942 59.488 1.00 26.80 ? 78  ASP A CA  1 
ATOM   630  C  C   . ASP A 1 78  ? 20.458 76.183 58.390 1.00 26.46 ? 78  ASP A C   1 
ATOM   631  O  O   . ASP A 1 78  ? 20.559 77.280 57.851 1.00 23.09 ? 78  ASP A O   1 
ATOM   632  C  CB  . ASP A 1 78  ? 19.842 76.642 60.783 1.00 29.78 ? 78  ASP A CB  1 
ATOM   633  C  CG  . ASP A 1 78  ? 18.679 76.884 61.751 1.00 30.27 ? 78  ASP A CG  1 
ATOM   634  O  OD1 . ASP A 1 78  ? 17.619 77.366 61.314 1.00 31.13 ? 78  ASP A OD1 1 
ATOM   635  O  OD2 . ASP A 1 78  ? 18.829 76.598 62.950 1.00 32.36 ? 78  ASP A OD2 1 
ATOM   636  N  N   . CYS A 1 79  ? 21.242 75.160 58.060 1.00 27.27 ? 79  CYS A N   1 
ATOM   637  C  CA  . CYS A 1 79  ? 22.259 75.303 57.017 1.00 29.04 ? 79  CYS A CA  1 
ATOM   638  C  C   . CYS A 1 79  ? 21.628 75.170 55.642 1.00 28.47 ? 79  CYS A C   1 
ATOM   639  O  O   . CYS A 1 79  ? 22.280 75.405 54.629 1.00 27.52 ? 79  CYS A O   1 
ATOM   640  C  CB  . CYS A 1 79  ? 23.361 74.248 57.155 1.00 28.48 ? 79  CYS A CB  1 
ATOM   641  S  SG  . CYS A 1 79  ? 24.429 74.415 58.597 1.00 30.45 ? 79  CYS A SG  1 
ATOM   642  N  N   . LEU A 1 80  ? 20.353 74.798 55.612 1.00 28.92 ? 80  LEU A N   1 
ATOM   643  C  CA  . LEU A 1 80  ? 19.645 74.627 54.351 1.00 29.77 ? 80  LEU A CA  1 
ATOM   644  C  C   . LEU A 1 80  ? 18.740 75.798 54.017 1.00 31.78 ? 80  LEU A C   1 
ATOM   645  O  O   . LEU A 1 80  ? 18.175 76.436 54.913 1.00 31.89 ? 80  LEU A O   1 
ATOM   646  C  CB  . LEU A 1 80  ? 18.798 73.354 54.392 1.00 28.61 ? 80  LEU A CB  1 
ATOM   647  C  CG  . LEU A 1 80  ? 19.553 72.069 54.718 1.00 24.75 ? 80  LEU A CG  1 
ATOM   648  C  CD1 . LEU A 1 80  ? 18.569 70.900 54.750 1.00 24.83 ? 80  LEU A CD1 1 
ATOM   649  C  CD2 . LEU A 1 80  ? 20.614 71.843 53.684 1.00 18.49 ? 80  LEU A CD2 1 
ATOM   650  N  N   . SER A 1 81  ? 18.585 76.053 52.718 1.00 32.07 ? 81  SER A N   1 
ATOM   651  C  CA  . SER A 1 81  ? 17.736 77.141 52.262 1.00 33.81 ? 81  SER A CA  1 
ATOM   652  C  C   . SER A 1 81  ? 17.112 76.833 50.902 1.00 32.49 ? 81  SER A C   1 
ATOM   653  O  O   . SER A 1 81  ? 17.776 76.323 50.002 1.00 33.30 ? 81  SER A O   1 
ATOM   654  C  CB  . SER A 1 81  ? 18.547 78.446 52.190 1.00 35.03 ? 81  SER A CB  1 
ATOM   655  O  OG  . SER A 1 81  ? 17.744 79.512 51.712 1.00 40.24 ? 81  SER A OG  1 
ATOM   656  N  N   . PRO A 1 82  ? 15.818 77.133 50.743 1.00 31.45 ? 82  PRO A N   1 
ATOM   657  C  CA  . PRO A 1 82  ? 15.127 76.883 49.481 1.00 32.46 ? 82  PRO A CA  1 
ATOM   658  C  C   . PRO A 1 82  ? 15.918 77.427 48.300 1.00 34.20 ? 82  PRO A C   1 
ATOM   659  O  O   . PRO A 1 82  ? 15.801 76.926 47.188 1.00 35.29 ? 82  PRO A O   1 
ATOM   660  C  CB  . PRO A 1 82  ? 13.799 77.590 49.684 1.00 31.56 ? 82  PRO A CB  1 
ATOM   661  C  CG  . PRO A 1 82  ? 13.548 77.377 51.124 1.00 30.96 ? 82  PRO A CG  1 
ATOM   662  C  CD  . PRO A 1 82  ? 14.889 77.680 51.743 1.00 31.18 ? 82  PRO A CD  1 
ATOM   663  N  N   . LYS A 1 83  ? 16.731 78.445 48.550 1.00 34.07 ? 83  LYS A N   1 
ATOM   664  C  CA  . LYS A 1 83  ? 17.579 79.026 47.523 1.00 34.07 ? 83  LYS A CA  1 
ATOM   665  C  C   . LYS A 1 83  ? 18.814 79.466 48.280 1.00 34.07 ? 83  LYS A C   1 
ATOM   666  O  O   . LYS A 1 83  ? 18.699 79.999 49.389 1.00 35.42 ? 83  LYS A O   1 
ATOM   667  C  CB  . LYS A 1 83  ? 16.915 80.239 46.871 1.00 37.89 ? 83  LYS A CB  1 
ATOM   668  C  CG  . LYS A 1 83  ? 15.462 80.014 46.441 1.00 46.14 ? 83  LYS A CG  1 
ATOM   669  C  CD  . LYS A 1 83  ? 14.441 80.746 47.374 1.00 50.36 ? 83  LYS A CD  1 
ATOM   670  C  CE  . LYS A 1 83  ? 14.160 82.224 46.962 1.00 50.44 ? 83  LYS A CE  1 
ATOM   671  N  NZ  . LYS A 1 83  ? 15.348 83.147 46.871 1.00 44.69 ? 83  LYS A NZ  1 
ATOM   672  N  N   . ALA A 1 84  ? 19.991 79.243 47.705 1.00 32.96 ? 84  ALA A N   1 
ATOM   673  C  CA  . ALA A 1 84  ? 21.236 79.625 48.369 1.00 31.71 ? 84  ALA A CA  1 
ATOM   674  C  C   . ALA A 1 84  ? 21.173 81.107 48.708 1.00 31.93 ? 84  ALA A C   1 
ATOM   675  O  O   . ALA A 1 84  ? 20.693 81.906 47.908 1.00 29.61 ? 84  ALA A O   1 
ATOM   676  C  CB  . ALA A 1 84  ? 22.432 79.347 47.470 1.00 27.39 ? 84  ALA A CB  1 
ATOM   677  N  N   . THR A 1 85  ? 21.629 81.467 49.903 1.00 31.16 ? 85  THR A N   1 
ATOM   678  C  CA  . THR A 1 85  ? 21.624 82.864 50.303 1.00 33.67 ? 85  THR A CA  1 
ATOM   679  C  C   . THR A 1 85  ? 23.055 83.409 50.165 1.00 35.57 ? 85  THR A C   1 
ATOM   680  O  O   . THR A 1 85  ? 23.978 82.653 49.853 1.00 36.59 ? 85  THR A O   1 
ATOM   681  C  CB  . THR A 1 85  ? 21.118 83.015 51.744 1.00 32.62 ? 85  THR A CB  1 
ATOM   682  O  OG1 . THR A 1 85  ? 21.755 82.036 52.573 1.00 31.16 ? 85  THR A OG1 1 
ATOM   683  C  CG2 . THR A 1 85  ? 19.608 82.829 51.799 1.00 32.73 ? 85  THR A CG2 1 
ATOM   684  N  N   . ALA A 1 86  ? 23.247 84.700 50.417 1.00 35.43 ? 86  ALA A N   1 
ATOM   685  C  CA  . ALA A 1 86  ? 24.568 85.319 50.255 1.00 36.19 ? 86  ALA A CA  1 
ATOM   686  C  C   . ALA A 1 86  ? 25.556 85.195 51.418 1.00 35.93 ? 86  ALA A C   1 
ATOM   687  O  O   . ALA A 1 86  ? 25.161 85.024 52.575 1.00 36.57 ? 86  ALA A O   1 
ATOM   688  C  CB  . ALA A 1 86  ? 24.386 86.795 49.895 1.00 34.51 ? 86  ALA A CB  1 
ATOM   689  N  N   . LEU A 1 87  ? 26.847 85.278 51.096 1.00 35.98 ? 87  LEU A N   1 
ATOM   690  C  CA  . LEU A 1 87  ? 27.886 85.220 52.113 1.00 37.48 ? 87  LEU A CA  1 
ATOM   691  C  C   . LEU A 1 87  ? 28.241 86.630 52.570 1.00 37.35 ? 87  LEU A C   1 
ATOM   692  O  O   . LEU A 1 87  ? 28.170 87.583 51.797 1.00 37.37 ? 87  LEU A O   1 
ATOM   693  C  CB  . LEU A 1 87  ? 29.168 84.569 51.587 1.00 37.06 ? 87  LEU A CB  1 
ATOM   694  C  CG  . LEU A 1 87  ? 29.192 83.071 51.306 1.00 39.13 ? 87  LEU A CG  1 
ATOM   695  C  CD1 . LEU A 1 87  ? 28.463 82.802 49.985 1.00 35.61 ? 87  LEU A CD1 1 
ATOM   696  C  CD2 . LEU A 1 87  ? 30.661 82.592 51.248 1.00 36.73 ? 87  LEU A CD2 1 
ATOM   697  N  N   . SER A 1 88  ? 28.608 86.760 53.834 1.00 38.52 ? 88  SER A N   1 
ATOM   698  C  CA  . SER A 1 88  ? 29.023 88.053 54.345 1.00 40.59 ? 88  SER A CA  1 
ATOM   699  C  C   . SER A 1 88  ? 30.438 88.222 53.803 1.00 41.50 ? 88  SER A C   1 
ATOM   700  O  O   . SER A 1 88  ? 31.133 87.233 53.544 1.00 41.88 ? 88  SER A O   1 
ATOM   701  C  CB  . SER A 1 88  ? 29.061 88.043 55.875 1.00 38.40 ? 88  SER A CB  1 
ATOM   702  O  OG  . SER A 1 88  ? 30.073 87.169 56.341 1.00 40.60 ? 88  SER A OG  1 
ATOM   703  N  N   . ASP A 1 89  ? 30.870 89.461 53.621 1.00 43.56 ? 89  ASP A N   1 
ATOM   704  C  CA  . ASP A 1 89  ? 32.218 89.704 53.128 1.00 45.09 ? 89  ASP A CA  1 
ATOM   705  C  C   . ASP A 1 89  ? 33.268 89.087 54.055 1.00 45.67 ? 89  ASP A C   1 
ATOM   706  O  O   . ASP A 1 89  ? 34.291 88.594 53.584 1.00 44.30 ? 89  ASP A O   1 
ATOM   707  C  CB  . ASP A 1 89  ? 32.456 91.204 52.982 1.00 48.74 ? 89  ASP A CB  1 
ATOM   708  C  CG  . ASP A 1 89  ? 31.683 91.803 51.818 1.00 51.30 ? 89  ASP A CG  1 
ATOM   709  O  OD1 . ASP A 1 89  ? 30.525 91.405 51.604 1.00 55.38 ? 89  ASP A OD1 1 
ATOM   710  O  OD2 . ASP A 1 89  ? 32.226 92.678 51.120 1.00 54.11 ? 89  ASP A OD2 1 
ATOM   711  N  N   . GLU A 1 90  ? 33.012 89.097 55.366 1.00 47.08 ? 90  GLU A N   1 
ATOM   712  C  CA  . GLU A 1 90  ? 33.960 88.518 56.319 1.00 48.88 ? 90  GLU A CA  1 
ATOM   713  C  C   . GLU A 1 90  ? 34.111 87.017 56.079 1.00 47.81 ? 90  GLU A C   1 
ATOM   714  O  O   . GLU A 1 90  ? 35.230 86.508 55.981 1.00 48.37 ? 90  GLU A O   1 
ATOM   715  C  CB  . GLU A 1 90  ? 33.505 88.696 57.766 1.00 53.15 ? 90  GLU A CB  1 
ATOM   716  C  CG  . GLU A 1 90  ? 32.505 89.790 58.048 1.00 62.26 ? 90  GLU A CG  1 
ATOM   717  C  CD  . GLU A 1 90  ? 31.630 89.434 59.263 1.00 69.54 ? 90  GLU A CD  1 
ATOM   718  O  OE1 . GLU A 1 90  ? 32.164 88.875 60.260 1.00 69.73 ? 90  GLU A OE1 1 
ATOM   719  O  OE2 . GLU A 1 90  ? 30.406 89.713 59.222 1.00 74.29 ? 90  GLU A OE2 1 
ATOM   720  N  N   . LEU A 1 91  ? 32.983 86.310 56.012 1.00 45.90 ? 91  LEU A N   1 
ATOM   721  C  CA  . LEU A 1 91  ? 33.017 84.873 55.787 1.00 44.18 ? 91  LEU A CA  1 
ATOM   722  C  C   . LEU A 1 91  ? 33.733 84.609 54.473 1.00 43.44 ? 91  LEU A C   1 
ATOM   723  O  O   . LEU A 1 91  ? 34.645 83.787 54.410 1.00 43.46 ? 91  LEU A O   1 
ATOM   724  C  CB  . LEU A 1 91  ? 31.603 84.278 55.725 1.00 42.53 ? 91  LEU A CB  1 
ATOM   725  C  CG  . LEU A 1 91  ? 31.543 82.763 55.453 1.00 38.55 ? 91  LEU A CG  1 
ATOM   726  C  CD1 . LEU A 1 91  ? 32.074 81.996 56.654 1.00 35.31 ? 91  LEU A CD1 1 
ATOM   727  C  CD2 . LEU A 1 91  ? 30.118 82.340 55.167 1.00 36.47 ? 91  LEU A CD2 1 
ATOM   728  N  N   . LYS A 1 92  ? 33.323 85.298 53.417 1.00 42.12 ? 92  LYS A N   1 
ATOM   729  C  CA  . LYS A 1 92  ? 33.993 85.097 52.143 1.00 42.15 ? 92  LYS A CA  1 
ATOM   730  C  C   . LYS A 1 92  ? 35.507 85.283 52.299 1.00 42.04 ? 92  LYS A C   1 
ATOM   731  O  O   . LYS A 1 92  ? 36.302 84.408 51.937 1.00 42.00 ? 92  LYS A O   1 
ATOM   732  C  CB  . LYS A 1 92  ? 33.462 86.072 51.098 1.00 42.14 ? 92  LYS A CB  1 
ATOM   733  C  CG  . LYS A 1 92  ? 34.273 86.024 49.832 1.00 44.04 ? 92  LYS A CG  1 
ATOM   734  C  CD  . LYS A 1 92  ? 33.571 86.706 48.698 1.00 46.01 ? 92  LYS A CD  1 
ATOM   735  C  CE  . LYS A 1 92  ? 34.461 86.715 47.479 1.00 47.09 ? 92  LYS A CE  1 
ATOM   736  N  NZ  . LYS A 1 92  ? 33.669 87.093 46.290 1.00 51.60 ? 92  LYS A NZ  1 
ATOM   737  N  N   . GLY A 1 93  ? 35.904 86.426 52.852 1.00 42.71 ? 93  GLY A N   1 
ATOM   738  C  CA  . GLY A 1 93  ? 37.318 86.692 53.041 1.00 42.17 ? 93  GLY A CA  1 
ATOM   739  C  C   . GLY A 1 93  ? 37.992 85.572 53.804 1.00 41.86 ? 93  GLY A C   1 
ATOM   740  O  O   . GLY A 1 93  ? 39.040 85.063 53.401 1.00 43.56 ? 93  GLY A O   1 
ATOM   741  N  N   . ALA A 1 94  ? 37.373 85.171 54.905 1.00 40.58 ? 94  ALA A N   1 
ATOM   742  C  CA  . ALA A 1 94  ? 37.917 84.116 55.742 1.00 40.49 ? 94  ALA A CA  1 
ATOM   743  C  C   . ALA A 1 94  ? 38.082 82.782 55.000 1.00 40.80 ? 94  ALA A C   1 
ATOM   744  O  O   . ALA A 1 94  ? 39.062 82.060 55.203 1.00 41.51 ? 94  ALA A O   1 
ATOM   745  C  CB  . ALA A 1 94  ? 37.027 83.939 56.971 1.00 38.42 ? 94  ALA A CB  1 
ATOM   746  N  N   . LEU A 1 95  ? 37.126 82.460 54.134 1.00 40.83 ? 95  LEU A N   1 
ATOM   747  C  CA  . LEU A 1 95  ? 37.171 81.208 53.386 1.00 40.38 ? 95  LEU A CA  1 
ATOM   748  C  C   . LEU A 1 95  ? 38.253 81.263 52.317 1.00 40.47 ? 95  LEU A C   1 
ATOM   749  O  O   . LEU A 1 95  ? 38.961 80.288 52.071 1.00 39.03 ? 95  LEU A O   1 
ATOM   750  C  CB  . LEU A 1 95  ? 35.794 80.920 52.761 1.00 37.83 ? 95  LEU A CB  1 
ATOM   751  C  CG  . LEU A 1 95  ? 34.700 80.525 53.772 1.00 39.00 ? 95  LEU A CG  1 
ATOM   752  C  CD1 . LEU A 1 95  ? 33.356 80.419 53.074 1.00 37.70 ? 95  LEU A CD1 1 
ATOM   753  C  CD2 . LEU A 1 95  ? 35.070 79.193 54.448 1.00 37.04 ? 95  LEU A CD2 1 
ATOM   754  N  N   . GLU A 1 96  ? 38.384 82.411 51.677 1.00 42.47 ? 96  GLU A N   1 
ATOM   755  C  CA  . GLU A 1 96  ? 39.399 82.539 50.655 1.00 45.24 ? 96  GLU A CA  1 
ATOM   756  C  C   . GLU A 1 96  ? 40.773 82.455 51.309 1.00 46.14 ? 96  GLU A C   1 
ATOM   757  O  O   . GLU A 1 96  ? 41.696 81.849 50.759 1.00 46.49 ? 96  GLU A O   1 
ATOM   758  C  CB  . GLU A 1 96  ? 39.207 83.848 49.907 1.00 44.06 ? 96  GLU A CB  1 
ATOM   759  C  CG  . GLU A 1 96  ? 37.837 83.907 49.310 1.00 45.69 ? 96  GLU A CG  1 
ATOM   760  C  CD  . GLU A 1 96  ? 37.606 85.141 48.498 1.00 46.94 ? 96  GLU A CD  1 
ATOM   761  O  OE1 . GLU A 1 96  ? 37.909 86.243 49.010 1.00 49.62 ? 96  GLU A OE1 1 
ATOM   762  O  OE2 . GLU A 1 96  ? 37.106 85.007 47.359 1.00 46.55 ? 96  GLU A OE2 1 
ATOM   763  N  N   . LYS A 1 97  ? 40.893 83.020 52.505 1.00 46.38 ? 97  LYS A N   1 
ATOM   764  C  CA  . LYS A 1 97  ? 42.167 82.984 53.213 1.00 48.48 ? 97  LYS A CA  1 
ATOM   765  C  C   . LYS A 1 97  ? 42.535 81.577 53.659 1.00 47.74 ? 97  LYS A C   1 
ATOM   766  O  O   . LYS A 1 97  ? 43.643 81.098 53.408 1.00 47.99 ? 97  LYS A O   1 
ATOM   767  C  CB  . LYS A 1 97  ? 42.132 83.899 54.438 1.00 50.43 ? 97  LYS A CB  1 
ATOM   768  C  CG  . LYS A 1 97  ? 43.391 83.827 55.293 1.00 53.92 ? 97  LYS A CG  1 
ATOM   769  C  CD  . LYS A 1 97  ? 43.329 84.801 56.476 1.00 57.50 ? 97  LYS A CD  1 
ATOM   770  C  CE  . LYS A 1 97  ? 42.253 84.420 57.511 1.00 60.75 ? 97  LYS A CE  1 
ATOM   771  N  NZ  . LYS A 1 97  ? 42.586 83.197 58.325 1.00 60.67 ? 97  LYS A NZ  1 
ATOM   772  N  N   . ASP A 1 98  ? 41.600 80.907 54.317 1.00 46.46 ? 98  ASP A N   1 
ATOM   773  C  CA  . ASP A 1 98  ? 41.874 79.569 54.804 1.00 45.10 ? 98  ASP A CA  1 
ATOM   774  C  C   . ASP A 1 98  ? 41.818 78.467 53.748 1.00 44.00 ? 98  ASP A C   1 
ATOM   775  O  O   . ASP A 1 98  ? 42.300 77.356 53.988 1.00 43.85 ? 98  ASP A O   1 
ATOM   776  C  CB  . ASP A 1 98  ? 40.928 79.239 55.959 1.00 47.40 ? 98  ASP A CB  1 
ATOM   777  C  CG  . ASP A 1 98  ? 41.056 80.224 57.111 1.00 50.55 ? 98  ASP A CG  1 
ATOM   778  O  OD1 . ASP A 1 98  ? 42.153 80.798 57.262 1.00 51.67 ? 98  ASP A OD1 1 
ATOM   779  O  OD2 . ASP A 1 98  ? 40.076 80.420 57.870 1.00 52.69 ? 98  ASP A OD2 1 
ATOM   780  N  N   . PHE A 1 99  ? 41.267 78.763 52.572 1.00 42.47 ? 99  PHE A N   1 
ATOM   781  C  CA  . PHE A 1 99  ? 41.160 77.733 51.536 1.00 41.13 ? 99  PHE A CA  1 
ATOM   782  C  C   . PHE A 1 99  ? 41.614 78.145 50.146 1.00 40.60 ? 99  PHE A C   1 
ATOM   783  O  O   . PHE A 1 99  ? 41.662 77.325 49.232 1.00 41.16 ? 99  PHE A O   1 
ATOM   784  C  CB  . PHE A 1 99  ? 39.721 77.198 51.499 1.00 37.92 ? 99  PHE A CB  1 
ATOM   785  C  CG  . PHE A 1 99  ? 39.348 76.446 52.734 1.00 36.31 ? 99  PHE A CG  1 
ATOM   786  C  CD1 . PHE A 1 99  ? 39.653 75.093 52.864 1.00 35.89 ? 99  PHE A CD1 1 
ATOM   787  C  CD2 . PHE A 1 99  ? 38.789 77.115 53.814 1.00 34.58 ? 99  PHE A CD2 1 
ATOM   788  C  CE1 . PHE A 1 99  ? 39.412 74.419 54.062 1.00 35.91 ? 99  PHE A CE1 1 
ATOM   789  C  CE2 . PHE A 1 99  ? 38.539 76.458 55.015 1.00 36.09 ? 99  PHE A CE2 1 
ATOM   790  C  CZ  . PHE A 1 99  ? 38.855 75.105 55.143 1.00 36.70 ? 99  PHE A CZ  1 
ATOM   791  N  N   . GLY A 1 100 ? 41.950 79.414 49.982 1.00 40.96 ? 100 GLY A N   1 
ATOM   792  C  CA  . GLY A 1 100 ? 42.406 79.865 48.686 1.00 41.27 ? 100 GLY A CA  1 
ATOM   793  C  C   . GLY A 1 100 ? 41.311 80.535 47.896 1.00 42.17 ? 100 GLY A C   1 
ATOM   794  O  O   . GLY A 1 100 ? 41.512 81.625 47.348 1.00 43.09 ? 100 GLY A O   1 
ATOM   795  N  N   . SER A 1 101 ? 40.153 79.885 47.825 1.00 40.38 ? 101 SER A N   1 
ATOM   796  C  CA  . SER A 1 101 ? 39.018 80.438 47.095 1.00 38.77 ? 101 SER A CA  1 
ATOM   797  C  C   . SER A 1 101 ? 37.776 79.672 47.502 1.00 38.26 ? 101 SER A C   1 
ATOM   798  O  O   . SER A 1 101 ? 37.870 78.579 48.055 1.00 38.12 ? 101 SER A O   1 
ATOM   799  C  CB  . SER A 1 101 ? 39.218 80.297 45.579 1.00 38.04 ? 101 SER A CB  1 
ATOM   800  O  OG  . SER A 1 101 ? 39.179 78.934 45.164 1.00 39.58 ? 101 SER A OG  1 
ATOM   801  N  N   . LEU A 1 102 ? 36.618 80.251 47.224 1.00 37.80 ? 102 LEU A N   1 
ATOM   802  C  CA  . LEU A 1 102 ? 35.354 79.618 47.549 1.00 38.78 ? 102 LEU A CA  1 
ATOM   803  C  C   . LEU A 1 102 ? 35.242 78.281 46.842 1.00 38.20 ? 102 LEU A C   1 
ATOM   804  O  O   . LEU A 1 102 ? 34.801 77.299 47.430 1.00 38.01 ? 102 LEU A O   1 
ATOM   805  C  CB  . LEU A 1 102 ? 34.188 80.516 47.131 1.00 36.30 ? 102 LEU A CB  1 
ATOM   806  C  CG  . LEU A 1 102 ? 34.186 81.859 47.848 1.00 33.18 ? 102 LEU A CG  1 
ATOM   807  C  CD1 . LEU A 1 102 ? 32.962 82.638 47.454 1.00 35.71 ? 102 LEU A CD1 1 
ATOM   808  C  CD2 . LEU A 1 102 ? 34.200 81.642 49.329 1.00 32.38 ? 102 LEU A CD2 1 
ATOM   809  N  N   . GLU A 1 103 ? 35.661 78.256 45.583 1.00 39.31 ? 103 GLU A N   1 
ATOM   810  C  CA  . GLU A 1 103 ? 35.597 77.054 44.763 1.00 41.00 ? 103 GLU A CA  1 
ATOM   811  C  C   . GLU A 1 103 ? 36.457 75.942 45.348 1.00 40.86 ? 103 GLU A C   1 
ATOM   812  O  O   . GLU A 1 103 ? 36.112 74.762 45.267 1.00 41.12 ? 103 GLU A O   1 
ATOM   813  C  CB  . GLU A 1 103 ? 36.045 77.370 43.331 1.00 41.61 ? 103 GLU A CB  1 
ATOM   814  C  CG  . GLU A 1 103 ? 35.270 78.520 42.680 1.00 50.71 ? 103 GLU A CG  1 
ATOM   815  C  CD  . GLU A 1 103 ? 35.604 79.907 43.280 1.00 54.64 ? 103 GLU A CD  1 
ATOM   816  O  OE1 . GLU A 1 103 ? 34.844 80.875 43.032 1.00 57.65 ? 103 GLU A OE1 1 
ATOM   817  O  OE2 . GLU A 1 103 ? 36.629 80.036 43.990 1.00 56.62 ? 103 GLU A OE2 1 
ATOM   818  N  N   . LYS A 1 104 ? 37.581 76.322 45.940 1.00 41.13 ? 104 LYS A N   1 
ATOM   819  C  CA  . LYS A 1 104 ? 38.470 75.334 46.521 1.00 41.30 ? 104 LYS A CA  1 
ATOM   820  C  C   . LYS A 1 104 ? 37.869 74.811 47.825 1.00 39.63 ? 104 LYS A C   1 
ATOM   821  O  O   . LYS A 1 104 ? 37.980 73.619 48.158 1.00 39.46 ? 104 LYS A O   1 
ATOM   822  C  CB  . LYS A 1 104 ? 39.843 75.948 46.773 1.00 42.38 ? 104 LYS A CB  1 
ATOM   823  C  CG  . LYS A 1 104 ? 40.868 74.903 47.137 1.00 49.86 ? 104 LYS A CG  1 
ATOM   824  C  CD  . LYS A 1 104 ? 40.930 73.820 46.049 1.00 54.55 ? 104 LYS A CD  1 
ATOM   825  C  CE  . LYS A 1 104 ? 41.410 72.486 46.614 1.00 57.15 ? 104 LYS A CE  1 
ATOM   826  N  NZ  . LYS A 1 104 ? 42.720 72.613 47.340 1.00 60.66 ? 104 LYS A NZ  1 
ATOM   827  N  N   . PHE A 1 105 ? 37.231 75.709 48.567 1.00 37.45 ? 105 PHE A N   1 
ATOM   828  C  CA  . PHE A 1 105 ? 36.593 75.309 49.809 1.00 35.72 ? 105 PHE A CA  1 
ATOM   829  C  C   . PHE A 1 105 ? 35.529 74.260 49.450 1.00 34.97 ? 105 PHE A C   1 
ATOM   830  O  O   . PHE A 1 105 ? 35.510 73.166 50.025 1.00 33.44 ? 105 PHE A O   1 
ATOM   831  C  CB  . PHE A 1 105 ? 35.935 76.511 50.505 1.00 34.53 ? 105 PHE A CB  1 
ATOM   832  C  CG  . PHE A 1 105 ? 35.094 76.126 51.692 1.00 33.42 ? 105 PHE A CG  1 
ATOM   833  C  CD1 . PHE A 1 105 ? 35.681 75.564 52.823 1.00 30.02 ? 105 PHE A CD1 1 
ATOM   834  C  CD2 . PHE A 1 105 ? 33.707 76.242 51.642 1.00 30.82 ? 105 PHE A CD2 1 
ATOM   835  C  CE1 . PHE A 1 105 ? 34.893 75.115 53.888 1.00 31.62 ? 105 PHE A CE1 1 
ATOM   836  C  CE2 . PHE A 1 105 ? 32.911 75.796 52.705 1.00 29.83 ? 105 PHE A CE2 1 
ATOM   837  C  CZ  . PHE A 1 105 ? 33.506 75.232 53.825 1.00 27.72 ? 105 PHE A CZ  1 
ATOM   838  N  N   . LYS A 1 106 ? 34.668 74.589 48.485 1.00 33.66 ? 106 LYS A N   1 
ATOM   839  C  CA  . LYS A 1 106 ? 33.612 73.672 48.058 1.00 35.74 ? 106 LYS A CA  1 
ATOM   840  C  C   . LYS A 1 106 ? 34.206 72.308 47.734 1.00 37.18 ? 106 LYS A C   1 
ATOM   841  O  O   . LYS A 1 106 ? 33.749 71.256 48.213 1.00 36.65 ? 106 LYS A O   1 
ATOM   842  C  CB  . LYS A 1 106 ? 32.904 74.201 46.812 1.00 35.02 ? 106 LYS A CB  1 
ATOM   843  C  CG  . LYS A 1 106 ? 31.949 73.187 46.224 1.00 34.42 ? 106 LYS A CG  1 
ATOM   844  C  CD  . LYS A 1 106 ? 31.238 73.696 44.978 1.00 35.25 ? 106 LYS A CD  1 
ATOM   845  C  CE  . LYS A 1 106 ? 30.208 72.663 44.489 1.00 34.22 ? 106 LYS A CE  1 
ATOM   846  N  NZ  . LYS A 1 106 ? 29.389 73.187 43.353 1.00 32.44 ? 106 LYS A NZ  1 
ATOM   847  N  N   . GLU A 1 107 ? 35.236 72.348 46.902 1.00 37.66 ? 107 GLU A N   1 
ATOM   848  C  CA  . GLU A 1 107 ? 35.934 71.158 46.477 1.00 38.85 ? 107 GLU A CA  1 
ATOM   849  C  C   . GLU A 1 107 ? 36.402 70.349 47.693 1.00 36.87 ? 107 GLU A C   1 
ATOM   850  O  O   . GLU A 1 107 ? 36.119 69.160 47.807 1.00 34.51 ? 107 GLU A O   1 
ATOM   851  C  CB  . GLU A 1 107 ? 37.101 71.592 45.609 1.00 42.62 ? 107 GLU A CB  1 
ATOM   852  C  CG  . GLU A 1 107 ? 37.705 70.514 44.744 1.00 53.75 ? 107 GLU A CG  1 
ATOM   853  C  CD  . GLU A 1 107 ? 38.670 71.098 43.713 1.00 59.22 ? 107 GLU A CD  1 
ATOM   854  O  OE1 . GLU A 1 107 ? 39.636 71.793 44.122 1.00 58.75 ? 107 GLU A OE1 1 
ATOM   855  O  OE2 . GLU A 1 107 ? 38.450 70.865 42.496 1.00 62.64 ? 107 GLU A OE2 1 
ATOM   856  N  N   . ASP A 1 108 ? 37.099 71.000 48.613 1.00 36.19 ? 108 ASP A N   1 
ATOM   857  C  CA  . ASP A 1 108 ? 37.578 70.308 49.806 1.00 36.81 ? 108 ASP A CA  1 
ATOM   858  C  C   . ASP A 1 108 ? 36.456 69.803 50.712 1.00 36.30 ? 108 ASP A C   1 
ATOM   859  O  O   . ASP A 1 108 ? 36.521 68.688 51.239 1.00 36.62 ? 108 ASP A O   1 
ATOM   860  C  CB  . ASP A 1 108 ? 38.484 71.223 50.638 1.00 40.03 ? 108 ASP A CB  1 
ATOM   861  C  CG  . ASP A 1 108 ? 39.725 71.671 49.886 1.00 41.16 ? 108 ASP A CG  1 
ATOM   862  O  OD1 . ASP A 1 108 ? 40.068 71.047 48.858 1.00 39.10 ? 108 ASP A OD1 1 
ATOM   863  O  OD2 . ASP A 1 108 ? 40.361 72.646 50.346 1.00 44.00 ? 108 ASP A OD2 1 
ATOM   864  N  N   . PHE A 1 109 ? 35.435 70.634 50.910 1.00 35.70 ? 109 PHE A N   1 
ATOM   865  C  CA  . PHE A 1 109 ? 34.321 70.269 51.775 1.00 33.73 ? 109 PHE A CA  1 
ATOM   866  C  C   . PHE A 1 109 ? 33.596 69.053 51.234 1.00 33.11 ? 109 PHE A C   1 
ATOM   867  O  O   . PHE A 1 109 ? 33.372 68.084 51.954 1.00 33.37 ? 109 PHE A O   1 
ATOM   868  C  CB  . PHE A 1 109 ? 33.352 71.447 51.917 1.00 32.63 ? 109 PHE A CB  1 
ATOM   869  C  CG  . PHE A 1 109 ? 32.204 71.174 52.847 1.00 32.26 ? 109 PHE A CG  1 
ATOM   870  C  CD1 . PHE A 1 109 ? 31.059 70.527 52.393 1.00 29.75 ? 109 PHE A CD1 1 
ATOM   871  C  CD2 . PHE A 1 109 ? 32.286 71.527 54.187 1.00 31.51 ? 109 PHE A CD2 1 
ATOM   872  C  CE1 . PHE A 1 109 ? 30.032 70.236 53.249 1.00 25.21 ? 109 PHE A CE1 1 
ATOM   873  C  CE2 . PHE A 1 109 ? 31.251 71.234 55.052 1.00 29.29 ? 109 PHE A CE2 1 
ATOM   874  C  CZ  . PHE A 1 109 ? 30.121 70.587 54.576 1.00 27.73 ? 109 PHE A CZ  1 
ATOM   875  N  N   . ILE A 1 110 ? 33.253 69.100 49.953 1.00 32.93 ? 110 ILE A N   1 
ATOM   876  C  CA  . ILE A 1 110 ? 32.541 68.003 49.330 1.00 32.74 ? 110 ILE A CA  1 
ATOM   877  C  C   . ILE A 1 110 ? 33.353 66.711 49.337 1.00 33.58 ? 110 ILE A C   1 
ATOM   878  O  O   . ILE A 1 110 ? 32.817 65.638 49.630 1.00 32.65 ? 110 ILE A O   1 
ATOM   879  C  CB  . ILE A 1 110 ? 32.120 68.377 47.892 1.00 31.93 ? 110 ILE A CB  1 
ATOM   880  C  CG1 . ILE A 1 110 ? 31.014 69.442 47.956 1.00 31.46 ? 110 ILE A CG1 1 
ATOM   881  C  CG2 . ILE A 1 110 ? 31.653 67.129 47.142 1.00 34.00 ? 110 ILE A CG2 1 
ATOM   882  C  CD1 . ILE A 1 110 ? 30.313 69.738 46.634 1.00 29.73 ? 110 ILE A CD1 1 
ATOM   883  N  N   . LYS A 1 111 ? 34.645 66.809 49.033 1.00 33.44 ? 111 LYS A N   1 
ATOM   884  C  CA  . LYS A 1 111 ? 35.493 65.624 49.016 1.00 33.74 ? 111 LYS A CA  1 
ATOM   885  C  C   . LYS A 1 111 ? 35.553 64.967 50.397 1.00 32.51 ? 111 LYS A C   1 
ATOM   886  O  O   . LYS A 1 111 ? 35.489 63.746 50.520 1.00 32.33 ? 111 LYS A O   1 
ATOM   887  C  CB  . LYS A 1 111 ? 36.910 65.975 48.548 1.00 37.27 ? 111 LYS A CB  1 
ATOM   888  C  CG  . LYS A 1 111 ? 37.821 64.757 48.541 1.00 42.59 ? 111 LYS A CG  1 
ATOM   889  C  CD  . LYS A 1 111 ? 39.278 65.122 48.397 1.00 48.99 ? 111 LYS A CD  1 
ATOM   890  C  CE  . LYS A 1 111 ? 40.169 63.914 48.698 1.00 50.93 ? 111 LYS A CE  1 
ATOM   891  N  NZ  . LYS A 1 111 ? 41.619 64.303 48.736 1.00 53.64 ? 111 LYS A NZ  1 
ATOM   892  N  N   . SER A 1 112 ? 35.677 65.784 51.434 1.00 30.97 ? 112 SER A N   1 
ATOM   893  C  CA  . SER A 1 112 ? 35.724 65.278 52.803 1.00 30.20 ? 112 SER A CA  1 
ATOM   894  C  C   . SER A 1 112 ? 34.389 64.611 53.188 1.00 29.38 ? 112 SER A C   1 
ATOM   895  O  O   . SER A 1 112 ? 34.358 63.617 53.915 1.00 30.33 ? 112 SER A O   1 
ATOM   896  C  CB  . SER A 1 112 ? 36.026 66.437 53.775 1.00 28.86 ? 112 SER A CB  1 
ATOM   897  O  OG  . SER A 1 112 ? 36.054 65.991 55.118 1.00 27.15 ? 112 SER A OG  1 
ATOM   898  N  N   . ALA A 1 113 ? 33.287 65.170 52.706 1.00 28.36 ? 113 ALA A N   1 
ATOM   899  C  CA  . ALA A 1 113 ? 31.963 64.629 53.010 1.00 27.85 ? 113 ALA A CA  1 
ATOM   900  C  C   . ALA A 1 113 ? 31.742 63.329 52.242 1.00 26.77 ? 113 ALA A C   1 
ATOM   901  O  O   . ALA A 1 113 ? 31.010 62.434 52.690 1.00 24.72 ? 113 ALA A O   1 
ATOM   902  C  CB  . ALA A 1 113 ? 30.879 65.657 52.646 1.00 24.80 ? 113 ALA A CB  1 
ATOM   903  N  N   . THR A 1 114 ? 32.399 63.235 51.088 1.00 27.82 ? 114 THR A N   1 
ATOM   904  C  CA  . THR A 1 114 ? 32.302 62.067 50.220 1.00 28.57 ? 114 THR A CA  1 
ATOM   905  C  C   . THR A 1 114 ? 33.028 60.836 50.781 1.00 29.93 ? 114 THR A C   1 
ATOM   906  O  O   . THR A 1 114 ? 32.513 59.720 50.707 1.00 30.56 ? 114 THR A O   1 
ATOM   907  C  CB  . THR A 1 114 ? 32.883 62.379 48.814 1.00 31.26 ? 114 THR A CB  1 
ATOM   908  O  OG1 . THR A 1 114 ? 32.118 63.423 48.201 1.00 31.76 ? 114 THR A OG1 1 
ATOM   909  C  CG2 . THR A 1 114 ? 32.859 61.128 47.913 1.00 28.08 ? 114 THR A CG2 1 
ATOM   910  N  N   . THR A 1 115 ? 34.210 61.039 51.355 1.00 30.87 ? 115 THR A N   1 
ATOM   911  C  CA  . THR A 1 115 ? 34.996 59.923 51.873 1.00 29.96 ? 115 THR A CA  1 
ATOM   912  C  C   . THR A 1 115 ? 34.725 59.535 53.323 1.00 30.90 ? 115 THR A C   1 
ATOM   913  O  O   . THR A 1 115 ? 35.209 58.495 53.777 1.00 31.49 ? 115 THR A O   1 
ATOM   914  C  CB  . THR A 1 115 ? 36.504 60.201 51.730 1.00 29.32 ? 115 THR A CB  1 
ATOM   915  O  OG1 . THR A 1 115 ? 36.858 61.325 52.536 1.00 28.35 ? 115 THR A OG1 1 
ATOM   916  C  CG2 . THR A 1 115 ? 36.853 60.514 50.284 1.00 28.36 ? 115 THR A CG2 1 
ATOM   917  N  N   . LEU A 1 116 ? 33.978 60.356 54.058 1.00 29.44 ? 116 LEU A N   1 
ATOM   918  C  CA  . LEU A 1 116 ? 33.670 60.017 55.442 1.00 28.54 ? 116 LEU A CA  1 
ATOM   919  C  C   . LEU A 1 116 ? 33.030 58.628 55.396 1.00 29.69 ? 116 LEU A C   1 
ATOM   920  O  O   . LEU A 1 116 ? 31.987 58.445 54.769 1.00 31.68 ? 116 LEU A O   1 
ATOM   921  C  CB  . LEU A 1 116 ? 32.708 61.046 56.027 1.00 26.11 ? 116 LEU A CB  1 
ATOM   922  C  CG  . LEU A 1 116 ? 32.591 61.066 57.552 1.00 28.41 ? 116 LEU A CG  1 
ATOM   923  C  CD1 . LEU A 1 116 ? 31.930 62.363 57.999 1.00 25.45 ? 116 LEU A CD1 1 
ATOM   924  C  CD2 . LEU A 1 116 ? 31.814 59.855 58.033 1.00 26.83 ? 116 LEU A CD2 1 
ATOM   925  N  N   . PHE A 1 117 ? 33.658 57.654 56.049 1.00 29.57 ? 117 PHE A N   1 
ATOM   926  C  CA  . PHE A 1 117 ? 33.185 56.268 56.044 1.00 28.85 ? 117 PHE A CA  1 
ATOM   927  C  C   . PHE A 1 117 ? 32.162 55.970 57.144 1.00 29.27 ? 117 PHE A C   1 
ATOM   928  O  O   . PHE A 1 117 ? 32.369 56.326 58.307 1.00 30.50 ? 117 PHE A O   1 
ATOM   929  C  CB  . PHE A 1 117 ? 34.388 55.332 56.177 1.00 26.62 ? 117 PHE A CB  1 
ATOM   930  C  CG  . PHE A 1 117 ? 34.076 53.894 55.890 1.00 24.43 ? 117 PHE A CG  1 
ATOM   931  C  CD1 . PHE A 1 117 ? 33.862 53.465 54.591 1.00 21.25 ? 117 PHE A CD1 1 
ATOM   932  C  CD2 . PHE A 1 117 ? 33.972 52.971 56.929 1.00 21.65 ? 117 PHE A CD2 1 
ATOM   933  C  CE1 . PHE A 1 117 ? 33.542 52.127 54.327 1.00 21.51 ? 117 PHE A CE1 1 
ATOM   934  C  CE2 . PHE A 1 117 ? 33.654 51.636 56.674 1.00 22.07 ? 117 PHE A CE2 1 
ATOM   935  C  CZ  . PHE A 1 117 ? 33.437 51.216 55.368 1.00 19.48 ? 117 PHE A CZ  1 
ATOM   936  N  N   . GLY A 1 118 ? 31.061 55.309 56.784 1.00 27.79 ? 118 GLY A N   1 
ATOM   937  C  CA  . GLY A 1 118 ? 30.038 55.008 57.777 1.00 27.38 ? 118 GLY A CA  1 
ATOM   938  C  C   . GLY A 1 118 ? 29.183 56.227 58.092 1.00 27.01 ? 118 GLY A C   1 
ATOM   939  O  O   . GLY A 1 118 ? 29.178 57.189 57.326 1.00 27.11 ? 118 GLY A O   1 
ATOM   940  N  N   . SER A 1 119 ? 28.482 56.208 59.221 1.00 26.25 ? 119 SER A N   1 
ATOM   941  C  CA  . SER A 1 119 ? 27.624 57.326 59.595 1.00 26.46 ? 119 SER A CA  1 
ATOM   942  C  C   . SER A 1 119 ? 28.409 58.477 60.210 1.00 27.24 ? 119 SER A C   1 
ATOM   943  O  O   . SER A 1 119 ? 29.337 58.269 60.991 1.00 27.14 ? 119 SER A O   1 
ATOM   944  C  CB  . SER A 1 119 ? 26.566 56.876 60.598 1.00 26.08 ? 119 SER A CB  1 
ATOM   945  O  OG  . SER A 1 119 ? 25.921 55.689 60.174 1.00 26.11 ? 119 SER A OG  1 
ATOM   946  N  N   . GLY A 1 120 ? 28.023 59.699 59.867 1.00 26.11 ? 120 GLY A N   1 
ATOM   947  C  CA  . GLY A 1 120 ? 28.713 60.840 60.418 1.00 25.05 ? 120 GLY A CA  1 
ATOM   948  C  C   . GLY A 1 120 ? 28.265 62.182 59.888 1.00 26.27 ? 120 GLY A C   1 
ATOM   949  O  O   . GLY A 1 120 ? 27.238 62.315 59.206 1.00 25.38 ? 120 GLY A O   1 
ATOM   950  N  N   . TRP A 1 121 ? 29.055 63.197 60.214 1.00 26.57 ? 121 TRP A N   1 
ATOM   951  C  CA  . TRP A 1 121 ? 28.758 64.553 59.792 1.00 25.90 ? 121 TRP A CA  1 
ATOM   952  C  C   . TRP A 1 121 ? 30.004 65.208 59.214 1.00 25.91 ? 121 TRP A C   1 
ATOM   953  O  O   . TRP A 1 121 ? 31.133 64.900 59.624 1.00 28.24 ? 121 TRP A O   1 
ATOM   954  C  CB  . TRP A 1 121 ? 28.259 65.374 60.992 1.00 24.64 ? 121 TRP A CB  1 
ATOM   955  C  CG  . TRP A 1 121 ? 27.076 64.798 61.704 1.00 20.77 ? 121 TRP A CG  1 
ATOM   956  C  CD1 . TRP A 1 121 ? 27.074 63.744 62.562 1.00 19.96 ? 121 TRP A CD1 1 
ATOM   957  C  CD2 . TRP A 1 121 ? 25.706 65.209 61.561 1.00 22.13 ? 121 TRP A CD2 1 
ATOM   958  N  NE1 . TRP A 1 121 ? 25.791 63.463 62.961 1.00 23.84 ? 121 TRP A NE1 1 
ATOM   959  C  CE2 . TRP A 1 121 ? 24.931 64.350 62.360 1.00 22.61 ? 121 TRP A CE2 1 
ATOM   960  C  CE3 . TRP A 1 121 ? 25.062 66.226 60.828 1.00 22.44 ? 121 TRP A CE3 1 
ATOM   961  C  CZ2 . TRP A 1 121 ? 23.529 64.464 62.453 1.00 23.75 ? 121 TRP A CZ2 1 
ATOM   962  C  CZ3 . TRP A 1 121 ? 23.681 66.343 60.918 1.00 22.07 ? 121 TRP A CZ3 1 
ATOM   963  C  CH2 . TRP A 1 121 ? 22.926 65.459 61.730 1.00 23.00 ? 121 TRP A CH2 1 
ATOM   964  N  N   . ASN A 1 122 ? 29.802 66.100 58.249 1.00 26.53 ? 122 ASN A N   1 
ATOM   965  C  CA  . ASN A 1 122 ? 30.912 66.832 57.650 1.00 27.33 ? 122 ASN A CA  1 
ATOM   966  C  C   . ASN A 1 122 ? 30.751 68.312 57.959 1.00 27.85 ? 122 ASN A C   1 
ATOM   967  O  O   . ASN A 1 122 ? 29.858 68.965 57.422 1.00 28.27 ? 122 ASN A O   1 
ATOM   968  C  CB  . ASN A 1 122 ? 30.964 66.665 56.148 1.00 23.60 ? 122 ASN A CB  1 
ATOM   969  C  CG  . ASN A 1 122 ? 32.319 67.015 55.611 1.00 26.83 ? 122 ASN A CG  1 
ATOM   970  O  OD1 . ASN A 1 122 ? 33.296 66.325 55.911 1.00 28.16 ? 122 ASN A OD1 1 
ATOM   971  N  ND2 . ASN A 1 122 ? 32.410 68.101 54.847 1.00 24.45 ? 122 ASN A ND2 1 
ATOM   972  N  N   . TRP A 1 123 ? 31.636 68.836 58.803 1.00 29.56 ? 123 TRP A N   1 
ATOM   973  C  CA  . TRP A 1 123 ? 31.587 70.228 59.240 1.00 29.82 ? 123 TRP A CA  1 
ATOM   974  C  C   . TRP A 1 123 ? 32.646 71.182 58.688 1.00 32.15 ? 123 TRP A C   1 
ATOM   975  O  O   . TRP A 1 123 ? 33.657 70.779 58.118 1.00 32.94 ? 123 TRP A O   1 
ATOM   976  C  CB  . TRP A 1 123 ? 31.735 70.311 60.764 1.00 28.30 ? 123 TRP A CB  1 
ATOM   977  C  CG  . TRP A 1 123 ? 30.982 69.309 61.572 1.00 25.75 ? 123 TRP A CG  1 
ATOM   978  C  CD1 . TRP A 1 123 ? 31.295 67.993 61.756 1.00 24.86 ? 123 TRP A CD1 1 
ATOM   979  C  CD2 . TRP A 1 123 ? 29.829 69.567 62.378 1.00 23.37 ? 123 TRP A CD2 1 
ATOM   980  N  NE1 . TRP A 1 123 ? 30.411 67.413 62.641 1.00 24.06 ? 123 TRP A NE1 1 
ATOM   981  C  CE2 . TRP A 1 123 ? 29.501 68.359 63.036 1.00 22.79 ? 123 TRP A CE2 1 
ATOM   982  C  CE3 . TRP A 1 123 ? 29.045 70.708 62.613 1.00 20.58 ? 123 TRP A CE3 1 
ATOM   983  C  CZ2 . TRP A 1 123 ? 28.416 68.256 63.921 1.00 22.60 ? 123 TRP A CZ2 1 
ATOM   984  C  CZ3 . TRP A 1 123 ? 27.971 70.607 63.491 1.00 21.59 ? 123 TRP A CZ3 1 
ATOM   985  C  CH2 . TRP A 1 123 ? 27.668 69.385 64.137 1.00 20.69 ? 123 TRP A CH2 1 
ATOM   986  N  N   . ALA A 1 124 ? 32.372 72.464 58.918 1.00 33.61 ? 124 ALA A N   1 
ATOM   987  C  CA  . ALA A 1 124 ? 33.238 73.595 58.622 1.00 35.22 ? 124 ALA A CA  1 
ATOM   988  C  C   . ALA A 1 124 ? 33.109 74.234 60.004 1.00 37.18 ? 124 ALA A C   1 
ATOM   989  O  O   . ALA A 1 124 ? 32.028 74.696 60.377 1.00 37.24 ? 124 ALA A O   1 
ATOM   990  C  CB  . ALA A 1 124 ? 32.635 74.507 57.572 1.00 33.71 ? 124 ALA A CB  1 
ATOM   991  N  N   . ALA A 1 125 ? 34.182 74.216 60.787 1.00 38.98 ? 125 ALA A N   1 
ATOM   992  C  CA  . ALA A 1 125 ? 34.130 74.783 62.133 1.00 41.34 ? 125 ALA A CA  1 
ATOM   993  C  C   . ALA A 1 125 ? 35.246 75.779 62.386 1.00 42.97 ? 125 ALA A C   1 
ATOM   994  O  O   . ALA A 1 125 ? 36.362 75.611 61.896 1.00 44.31 ? 125 ALA A O   1 
ATOM   995  C  CB  . ALA A 1 125 ? 34.193 73.664 63.187 1.00 41.63 ? 125 ALA A CB  1 
ATOM   996  N  N   . TYR A 1 126 ? 34.936 76.807 63.172 1.00 44.03 ? 126 TYR A N   1 
ATOM   997  C  CA  . TYR A 1 126 ? 35.901 77.840 63.513 1.00 45.51 ? 126 TYR A CA  1 
ATOM   998  C  C   . TYR A 1 126 ? 36.762 77.412 64.704 1.00 47.00 ? 126 TYR A C   1 
ATOM   999  O  O   . TYR A 1 126 ? 36.242 77.065 65.765 1.00 46.37 ? 126 TYR A O   1 
ATOM   1000 C  CB  . TYR A 1 126 ? 35.173 79.133 63.867 1.00 46.68 ? 126 TYR A CB  1 
ATOM   1001 C  CG  . TYR A 1 126 ? 36.103 80.294 64.095 1.00 48.36 ? 126 TYR A CG  1 
ATOM   1002 C  CD1 . TYR A 1 126 ? 36.839 80.832 63.041 1.00 48.50 ? 126 TYR A CD1 1 
ATOM   1003 C  CD2 . TYR A 1 126 ? 36.264 80.849 65.365 1.00 48.82 ? 126 TYR A CD2 1 
ATOM   1004 C  CE1 . TYR A 1 126 ? 37.711 81.894 63.240 1.00 49.98 ? 126 TYR A CE1 1 
ATOM   1005 C  CE2 . TYR A 1 126 ? 37.142 81.916 65.575 1.00 50.35 ? 126 TYR A CE2 1 
ATOM   1006 C  CZ  . TYR A 1 126 ? 37.860 82.430 64.503 1.00 49.24 ? 126 TYR A CZ  1 
ATOM   1007 O  OH  . TYR A 1 126 ? 38.729 83.473 64.679 1.00 50.10 ? 126 TYR A OH  1 
ATOM   1008 N  N   . ASN A 1 127 ? 38.076 77.425 64.520 1.00 48.88 ? 127 ASN A N   1 
ATOM   1009 C  CA  . ASN A 1 127 ? 38.989 77.064 65.598 1.00 51.16 ? 127 ASN A CA  1 
ATOM   1010 C  C   . ASN A 1 127 ? 39.271 78.347 66.377 1.00 51.78 ? 127 ASN A C   1 
ATOM   1011 O  O   . ASN A 1 127 ? 39.700 79.338 65.794 1.00 52.29 ? 127 ASN A O   1 
ATOM   1012 C  CB  . ASN A 1 127 ? 40.295 76.510 65.028 1.00 51.98 ? 127 ASN A CB  1 
ATOM   1013 C  CG  . ASN A 1 127 ? 41.209 75.979 66.104 1.00 51.68 ? 127 ASN A CG  1 
ATOM   1014 O  OD1 . ASN A 1 127 ? 41.493 76.666 67.079 1.00 53.26 ? 127 ASN A OD1 1 
ATOM   1015 N  ND2 . ASN A 1 127 ? 41.675 74.750 65.935 1.00 52.58 ? 127 ASN A ND2 1 
ATOM   1016 N  N   . LEU A 1 128 ? 39.021 78.343 67.684 1.00 53.58 ? 128 LEU A N   1 
ATOM   1017 C  CA  . LEU A 1 128 ? 39.255 79.546 68.493 1.00 55.75 ? 128 LEU A CA  1 
ATOM   1018 C  C   . LEU A 1 128 ? 40.740 79.857 68.735 1.00 56.80 ? 128 LEU A C   1 
ATOM   1019 O  O   . LEU A 1 128 ? 41.132 81.025 68.801 1.00 57.14 ? 128 LEU A O   1 
ATOM   1020 C  CB  . LEU A 1 128 ? 38.524 79.452 69.845 1.00 55.41 ? 128 LEU A CB  1 
ATOM   1021 C  CG  . LEU A 1 128 ? 37.000 79.670 69.939 1.00 54.69 ? 128 LEU A CG  1 
ATOM   1022 C  CD1 . LEU A 1 128 ? 36.606 80.982 69.284 1.00 53.11 ? 128 LEU A CD1 1 
ATOM   1023 C  CD2 . LEU A 1 128 ? 36.271 78.532 69.277 1.00 55.86 ? 128 LEU A CD2 1 
ATOM   1024 N  N   . ASP A 1 129 ? 41.563 78.818 68.862 1.00 57.75 ? 129 ASP A N   1 
ATOM   1025 C  CA  . ASP A 1 129 ? 42.997 79.006 69.083 1.00 59.32 ? 129 ASP A CA  1 
ATOM   1026 C  C   . ASP A 1 129 ? 43.715 79.435 67.807 1.00 59.39 ? 129 ASP A C   1 
ATOM   1027 O  O   . ASP A 1 129 ? 44.557 80.333 67.825 1.00 59.90 ? 129 ASP A O   1 
ATOM   1028 C  CB  . ASP A 1 129 ? 43.621 77.712 69.591 1.00 61.21 ? 129 ASP A CB  1 
ATOM   1029 C  CG  . ASP A 1 129 ? 42.935 77.192 70.830 1.00 64.13 ? 129 ASP A CG  1 
ATOM   1030 O  OD1 . ASP A 1 129 ? 43.343 76.117 71.324 1.00 68.02 ? 129 ASP A OD1 1 
ATOM   1031 O  OD2 . ASP A 1 129 ? 41.988 77.857 71.309 1.00 63.88 ? 129 ASP A OD2 1 
ATOM   1032 N  N   . THR A 1 130 ? 43.367 78.786 66.702 1.00 58.37 ? 130 THR A N   1 
ATOM   1033 C  CA  . THR A 1 130 ? 43.975 79.071 65.415 1.00 57.88 ? 130 THR A CA  1 
ATOM   1034 C  C   . THR A 1 130 ? 43.286 80.205 64.680 1.00 57.27 ? 130 THR A C   1 
ATOM   1035 O  O   . THR A 1 130 ? 43.877 80.840 63.801 1.00 57.51 ? 130 THR A O   1 
ATOM   1036 C  CB  . THR A 1 130 ? 43.918 77.842 64.529 1.00 58.40 ? 130 THR A CB  1 
ATOM   1037 O  OG1 . THR A 1 130 ? 44.514 76.749 65.230 1.00 60.56 ? 130 THR A OG1 1 
ATOM   1038 C  CG2 . THR A 1 130 ? 44.664 78.088 63.221 1.00 59.60 ? 130 THR A CG2 1 
ATOM   1039 N  N   . GLN A 1 131 ? 42.031 80.449 65.042 1.00 56.39 ? 131 GLN A N   1 
ATOM   1040 C  CA  . GLN A 1 131 ? 41.224 81.488 64.406 1.00 55.85 ? 131 GLN A CA  1 
ATOM   1041 C  C   . GLN A 1 131 ? 41.117 81.181 62.915 1.00 54.69 ? 131 GLN A C   1 
ATOM   1042 O  O   . GLN A 1 131 ? 40.981 82.077 62.071 1.00 54.89 ? 131 GLN A O   1 
ATOM   1043 C  CB  . GLN A 1 131 ? 41.844 82.865 64.648 1.00 56.91 ? 131 GLN A CB  1 
ATOM   1044 C  CG  . GLN A 1 131 ? 41.814 83.266 66.114 1.00 58.16 ? 131 GLN A CG  1 
ATOM   1045 C  CD  . GLN A 1 131 ? 42.654 84.482 66.392 1.00 59.95 ? 131 GLN A CD  1 
ATOM   1046 O  OE1 . GLN A 1 131 ? 43.856 84.490 66.123 1.00 60.56 ? 131 GLN A OE1 1 
ATOM   1047 N  NE2 . GLN A 1 131 ? 42.029 85.526 66.933 1.00 61.66 ? 131 GLN A NE2 1 
ATOM   1048 N  N   . LYS A 1 132 ? 41.190 79.890 62.610 1.00 52.61 ? 132 LYS A N   1 
ATOM   1049 C  CA  . LYS A 1 132 ? 41.084 79.412 61.248 1.00 51.30 ? 132 LYS A CA  1 
ATOM   1050 C  C   . LYS A 1 132 ? 39.857 78.515 61.112 1.00 48.96 ? 132 LYS A C   1 
ATOM   1051 O  O   . LYS A 1 132 ? 39.406 77.905 62.091 1.00 47.40 ? 132 LYS A O   1 
ATOM   1052 C  CB  . LYS A 1 132 ? 42.350 78.645 60.861 1.00 53.34 ? 132 LYS A CB  1 
ATOM   1053 C  CG  . LYS A 1 132 ? 43.332 79.481 60.057 1.00 57.71 ? 132 LYS A CG  1 
ATOM   1054 C  CD  . LYS A 1 132 ? 44.498 78.651 59.536 1.00 62.66 ? 132 LYS A CD  1 
ATOM   1055 C  CE  . LYS A 1 132 ? 44.854 79.019 58.083 1.00 66.93 ? 132 LYS A CE  1 
ATOM   1056 N  NZ  . LYS A 1 132 ? 45.104 80.485 57.852 1.00 68.75 ? 132 LYS A NZ  1 
ATOM   1057 N  N   . ILE A 1 133 ? 39.302 78.465 59.904 1.00 46.73 ? 133 ILE A N   1 
ATOM   1058 C  CA  . ILE A 1 133 ? 38.147 77.623 59.633 1.00 43.60 ? 133 ILE A CA  1 
ATOM   1059 C  C   . ILE A 1 133 ? 38.674 76.265 59.172 1.00 42.69 ? 133 ILE A C   1 
ATOM   1060 O  O   . ILE A 1 133 ? 39.460 76.187 58.223 1.00 41.73 ? 133 ILE A O   1 
ATOM   1061 C  CB  . ILE A 1 133 ? 37.255 78.231 58.538 1.00 41.95 ? 133 ILE A CB  1 
ATOM   1062 C  CG1 . ILE A 1 133 ? 36.683 79.562 59.035 1.00 38.66 ? 133 ILE A CG1 1 
ATOM   1063 C  CG2 . ILE A 1 133 ? 36.154 77.235 58.159 1.00 39.23 ? 133 ILE A CG2 1 
ATOM   1064 C  CD1 . ILE A 1 133 ? 35.838 80.314 58.029 1.00 39.18 ? 133 ILE A CD1 1 
ATOM   1065 N  N   . GLU A 1 134 ? 38.260 75.206 59.868 1.00 41.38 ? 134 GLU A N   1 
ATOM   1066 C  CA  . GLU A 1 134 ? 38.685 73.844 59.545 1.00 41.20 ? 134 GLU A CA  1 
ATOM   1067 C  C   . GLU A 1 134 ? 37.524 73.017 59.002 1.00 39.89 ? 134 GLU A C   1 
ATOM   1068 O  O   . GLU A 1 134 ? 36.368 73.218 59.399 1.00 40.35 ? 134 GLU A O   1 
ATOM   1069 C  CB  . GLU A 1 134 ? 39.206 73.132 60.796 1.00 42.30 ? 134 GLU A CB  1 
ATOM   1070 C  CG  . GLU A 1 134 ? 40.224 73.911 61.597 1.00 49.50 ? 134 GLU A CG  1 
ATOM   1071 C  CD  . GLU A 1 134 ? 40.573 73.247 62.931 1.00 52.36 ? 134 GLU A CD  1 
ATOM   1072 O  OE1 . GLU A 1 134 ? 39.641 72.925 63.705 1.00 53.19 ? 134 GLU A OE1 1 
ATOM   1073 O  OE2 . GLU A 1 134 ? 41.779 73.061 63.213 1.00 53.45 ? 134 GLU A OE2 1 
ATOM   1074 N  N   . ILE A 1 135 ? 37.835 72.093 58.095 1.00 37.54 ? 135 ILE A N   1 
ATOM   1075 C  CA  . ILE A 1 135 ? 36.836 71.176 57.545 1.00 35.70 ? 135 ILE A CA  1 
ATOM   1076 C  C   . ILE A 1 135 ? 37.035 69.914 58.382 1.00 34.81 ? 135 ILE A C   1 
ATOM   1077 O  O   . ILE A 1 135 ? 38.076 69.267 58.302 1.00 34.75 ? 135 ILE A O   1 
ATOM   1078 C  CB  . ILE A 1 135 ? 37.083 70.866 56.049 1.00 33.69 ? 135 ILE A CB  1 
ATOM   1079 C  CG1 . ILE A 1 135 ? 36.737 72.092 55.201 1.00 32.36 ? 135 ILE A CG1 1 
ATOM   1080 C  CG2 . ILE A 1 135 ? 36.264 69.658 55.640 1.00 33.55 ? 135 ILE A CG2 1 
ATOM   1081 C  CD1 . ILE A 1 135 ? 36.926 71.899 53.722 1.00 33.52 ? 135 ILE A CD1 1 
ATOM   1082 N  N   . ILE A 1 136 ? 36.039 69.576 59.188 1.00 33.20 ? 136 ILE A N   1 
ATOM   1083 C  CA  . ILE A 1 136 ? 36.147 68.439 60.086 1.00 32.92 ? 136 ILE A CA  1 
ATOM   1084 C  C   . ILE A 1 136 ? 35.090 67.379 59.855 1.00 33.85 ? 136 ILE A C   1 
ATOM   1085 O  O   . ILE A 1 136 ? 33.922 67.697 59.650 1.00 33.94 ? 136 ILE A O   1 
ATOM   1086 C  CB  . ILE A 1 136 ? 35.989 68.900 61.540 1.00 31.84 ? 136 ILE A CB  1 
ATOM   1087 C  CG1 . ILE A 1 136 ? 36.950 70.063 61.828 1.00 34.07 ? 136 ILE A CG1 1 
ATOM   1088 C  CG2 . ILE A 1 136 ? 36.203 67.726 62.481 1.00 31.50 ? 136 ILE A CG2 1 
ATOM   1089 C  CD1 . ILE A 1 136 ? 36.760 70.684 63.208 1.00 29.66 ? 136 ILE A CD1 1 
ATOM   1090 N  N   . GLN A 1 137 ? 35.489 66.115 59.909 1.00 33.94 ? 137 GLN A N   1 
ATOM   1091 C  CA  . GLN A 1 137 ? 34.523 65.055 59.742 1.00 34.82 ? 137 GLN A CA  1 
ATOM   1092 C  C   . GLN A 1 137 ? 34.413 64.298 61.054 1.00 34.83 ? 137 GLN A C   1 
ATOM   1093 O  O   . GLN A 1 137 ? 35.413 63.974 61.672 1.00 35.48 ? 137 GLN A O   1 
ATOM   1094 C  CB  . GLN A 1 137 ? 34.907 64.147 58.574 1.00 33.51 ? 137 GLN A CB  1 
ATOM   1095 C  CG  . GLN A 1 137 ? 36.203 63.450 58.692 1.00 38.39 ? 137 GLN A CG  1 
ATOM   1096 C  CD  . GLN A 1 137 ? 36.517 62.611 57.460 1.00 36.94 ? 137 GLN A CD  1 
ATOM   1097 O  OE1 . GLN A 1 137 ? 37.298 61.681 57.535 1.00 38.08 ? 137 GLN A OE1 1 
ATOM   1098 N  NE2 . GLN A 1 137 ? 35.916 62.947 56.326 1.00 39.15 ? 137 GLN A NE2 1 
ATOM   1099 N  N   . THR A 1 138 ? 33.182 64.078 61.506 1.00 33.65 ? 138 THR A N   1 
ATOM   1100 C  CA  . THR A 1 138 ? 32.955 63.368 62.757 1.00 33.60 ? 138 THR A CA  1 
ATOM   1101 C  C   . THR A 1 138 ? 32.087 62.149 62.501 1.00 33.69 ? 138 THR A C   1 
ATOM   1102 O  O   . THR A 1 138 ? 31.247 62.127 61.597 1.00 33.65 ? 138 THR A O   1 
ATOM   1103 C  CB  . THR A 1 138 ? 32.258 64.249 63.830 1.00 33.67 ? 138 THR A CB  1 
ATOM   1104 O  OG1 . THR A 1 138 ? 30.927 64.568 63.405 1.00 32.98 ? 138 THR A OG1 1 
ATOM   1105 C  CG2 . THR A 1 138 ? 33.034 65.543 64.051 1.00 33.64 ? 138 THR A CG2 1 
ATOM   1106 N  N   . SER A 1 139 ? 32.308 61.128 63.307 1.00 33.20 ? 139 SER A N   1 
ATOM   1107 C  CA  . SER A 1 139 ? 31.574 59.888 63.188 1.00 32.84 ? 139 SER A CA  1 
ATOM   1108 C  C   . SER A 1 139 ? 30.312 59.838 64.069 1.00 31.25 ? 139 SER A C   1 
ATOM   1109 O  O   . SER A 1 139 ? 30.272 60.389 65.176 1.00 30.51 ? 139 SER A O   1 
ATOM   1110 C  CB  . SER A 1 139 ? 32.524 58.736 63.524 1.00 33.31 ? 139 SER A CB  1 
ATOM   1111 O  OG  . SER A 1 139 ? 31.831 57.520 63.665 1.00 40.96 ? 139 SER A OG  1 
ATOM   1112 N  N   . ASN A 1 140 ? 29.278 59.188 63.543 1.00 29.71 ? 140 ASN A N   1 
ATOM   1113 C  CA  . ASN A 1 140 ? 28.023 59.010 64.246 1.00 29.69 ? 140 ASN A CA  1 
ATOM   1114 C  C   . ASN A 1 140 ? 27.429 60.281 64.828 1.00 30.44 ? 140 ASN A C   1 
ATOM   1115 O  O   . ASN A 1 140 ? 26.952 61.129 64.086 1.00 31.94 ? 140 ASN A O   1 
ATOM   1116 C  CB  . ASN A 1 140 ? 28.210 57.945 65.333 1.00 28.47 ? 140 ASN A CB  1 
ATOM   1117 C  CG  . ASN A 1 140 ? 28.530 56.567 64.749 1.00 29.04 ? 140 ASN A CG  1 
ATOM   1118 O  OD1 . ASN A 1 140 ? 28.872 55.639 65.476 1.00 31.41 ? 140 ASN A OD1 1 
ATOM   1119 N  ND2 . ASN A 1 140 ? 28.412 56.433 63.433 1.00 23.43 ? 140 ASN A ND2 1 
ATOM   1120 N  N   . ALA A 1 141 ? 27.473 60.437 66.147 1.00 31.26 ? 141 ALA A N   1 
ATOM   1121 C  CA  . ALA A 1 141 ? 26.888 61.616 66.784 1.00 31.79 ? 141 ALA A CA  1 
ATOM   1122 C  C   . ALA A 1 141 ? 27.862 62.723 67.192 1.00 31.75 ? 141 ALA A C   1 
ATOM   1123 O  O   . ALA A 1 141 ? 27.428 63.804 67.586 1.00 31.05 ? 141 ALA A O   1 
ATOM   1124 C  CB  . ALA A 1 141 ? 26.073 61.184 68.004 1.00 32.11 ? 141 ALA A CB  1 
ATOM   1125 N  N   . GLN A 1 142 ? 29.163 62.468 67.091 1.00 32.00 ? 142 GLN A N   1 
ATOM   1126 C  CA  . GLN A 1 142 ? 30.150 63.465 67.490 1.00 33.78 ? 142 GLN A CA  1 
ATOM   1127 C  C   . GLN A 1 142 ? 29.980 64.800 66.785 1.00 34.27 ? 142 GLN A C   1 
ATOM   1128 O  O   . GLN A 1 142 ? 29.436 64.881 65.682 1.00 32.89 ? 142 GLN A O   1 
ATOM   1129 C  CB  . GLN A 1 142 ? 31.575 62.953 67.253 1.00 34.71 ? 142 GLN A CB  1 
ATOM   1130 C  CG  . GLN A 1 142 ? 31.917 61.727 68.069 1.00 39.85 ? 142 GLN A CG  1 
ATOM   1131 C  CD  . GLN A 1 142 ? 31.527 61.876 69.541 1.00 43.96 ? 142 GLN A CD  1 
ATOM   1132 O  OE1 . GLN A 1 142 ? 31.984 62.795 70.238 1.00 44.05 ? 142 GLN A OE1 1 
ATOM   1133 N  NE2 . GLN A 1 142 ? 30.679 60.963 70.021 1.00 44.10 ? 142 GLN A NE2 1 
ATOM   1134 N  N   . THR A 1 143 ? 30.457 65.850 67.440 1.00 35.44 ? 143 THR A N   1 
ATOM   1135 C  CA  . THR A 1 143 ? 30.380 67.190 66.901 1.00 36.95 ? 143 THR A CA  1 
ATOM   1136 C  C   . THR A 1 143 ? 31.554 67.999 67.423 1.00 37.63 ? 143 THR A C   1 
ATOM   1137 O  O   . THR A 1 143 ? 31.943 67.859 68.575 1.00 39.83 ? 143 THR A O   1 
ATOM   1138 C  CB  . THR A 1 143 ? 29.042 67.867 67.288 1.00 36.90 ? 143 THR A CB  1 
ATOM   1139 O  OG1 . THR A 1 143 ? 29.100 69.265 66.976 1.00 37.68 ? 143 THR A OG1 1 
ATOM   1140 C  CG2 . THR A 1 143 ? 28.740 67.668 68.764 1.00 37.29 ? 143 THR A CG2 1 
ATOM   1141 N  N   . PRO A 1 144 ? 32.145 68.849 66.570 1.00 38.59 ? 144 PRO A N   1 
ATOM   1142 C  CA  . PRO A 1 144 ? 33.290 69.696 66.926 1.00 38.85 ? 144 PRO A CA  1 
ATOM   1143 C  C   . PRO A 1 144 ? 33.084 70.469 68.228 1.00 40.07 ? 144 PRO A C   1 
ATOM   1144 O  O   . PRO A 1 144 ? 34.051 70.825 68.899 1.00 40.56 ? 144 PRO A O   1 
ATOM   1145 C  CB  . PRO A 1 144 ? 33.408 70.638 65.732 1.00 38.33 ? 144 PRO A CB  1 
ATOM   1146 C  CG  . PRO A 1 144 ? 32.881 69.808 64.599 1.00 38.23 ? 144 PRO A CG  1 
ATOM   1147 C  CD  . PRO A 1 144 ? 31.680 69.145 65.204 1.00 36.69 ? 144 PRO A CD  1 
ATOM   1148 N  N   . VAL A 1 145 ? 31.829 70.738 68.575 1.00 40.68 ? 145 VAL A N   1 
ATOM   1149 C  CA  . VAL A 1 145 ? 31.535 71.473 69.800 1.00 42.18 ? 145 VAL A CA  1 
ATOM   1150 C  C   . VAL A 1 145 ? 32.265 70.902 71.016 1.00 43.12 ? 145 VAL A C   1 
ATOM   1151 O  O   . VAL A 1 145 ? 32.699 71.653 71.882 1.00 43.62 ? 145 VAL A O   1 
ATOM   1152 C  CB  . VAL A 1 145 ? 30.011 71.500 70.109 1.00 42.03 ? 145 VAL A CB  1 
ATOM   1153 C  CG1 . VAL A 1 145 ? 29.773 72.018 71.526 1.00 40.97 ? 145 VAL A CG1 1 
ATOM   1154 C  CG2 . VAL A 1 145 ? 29.288 72.405 69.115 1.00 40.13 ? 145 VAL A CG2 1 
ATOM   1155 N  N   . THR A 1 146 ? 32.414 69.583 71.086 1.00 43.80 ? 146 THR A N   1 
ATOM   1156 C  CA  . THR A 1 146 ? 33.089 69.002 72.241 1.00 45.25 ? 146 THR A CA  1 
ATOM   1157 C  C   . THR A 1 146 ? 34.591 69.224 72.186 1.00 46.43 ? 146 THR A C   1 
ATOM   1158 O  O   . THR A 1 146 ? 35.308 68.910 73.133 1.00 47.13 ? 146 THR A O   1 
ATOM   1159 C  CB  . THR A 1 146 ? 32.805 67.486 72.387 1.00 45.04 ? 146 THR A CB  1 
ATOM   1160 O  OG1 . THR A 1 146 ? 33.385 66.771 71.291 1.00 43.81 ? 146 THR A OG1 1 
ATOM   1161 C  CG2 . THR A 1 146 ? 31.304 67.231 72.436 1.00 46.68 ? 146 THR A CG2 1 
ATOM   1162 N  N   . ASP A 1 147 ? 35.072 69.761 71.073 1.00 47.39 ? 147 ASP A N   1 
ATOM   1163 C  CA  . ASP A 1 147 ? 36.496 70.038 70.942 1.00 48.23 ? 147 ASP A CA  1 
ATOM   1164 C  C   . ASP A 1 147 ? 36.669 71.539 70.993 1.00 48.59 ? 147 ASP A C   1 
ATOM   1165 O  O   . ASP A 1 147 ? 37.627 72.090 70.456 1.00 49.15 ? 147 ASP A O   1 
ATOM   1166 C  CB  . ASP A 1 147 ? 37.057 69.502 69.625 1.00 50.35 ? 147 ASP A CB  1 
ATOM   1167 C  CG  . ASP A 1 147 ? 36.996 67.992 69.537 1.00 53.22 ? 147 ASP A CG  1 
ATOM   1168 O  OD1 . ASP A 1 147 ? 37.368 67.321 70.526 1.00 55.73 ? 147 ASP A OD1 1 
ATOM   1169 O  OD2 . ASP A 1 147 ? 36.585 67.477 68.476 1.00 54.25 ? 147 ASP A OD2 1 
ATOM   1170 N  N   . LYS A 1 148 ? 35.710 72.201 71.625 1.00 48.88 ? 148 LYS A N   1 
ATOM   1171 C  CA  . LYS A 1 148 ? 35.761 73.644 71.772 1.00 49.24 ? 148 LYS A CA  1 
ATOM   1172 C  C   . LYS A 1 148 ? 35.785 74.394 70.448 1.00 48.61 ? 148 LYS A C   1 
ATOM   1173 O  O   . LYS A 1 148 ? 36.323 75.498 70.387 1.00 50.67 ? 148 LYS A O   1 
ATOM   1174 C  CB  . LYS A 1 148 ? 36.998 74.033 72.584 1.00 51.21 ? 148 LYS A CB  1 
ATOM   1175 C  CG  . LYS A 1 148 ? 37.096 73.386 73.956 1.00 52.61 ? 148 LYS A CG  1 
ATOM   1176 C  CD  . LYS A 1 148 ? 35.964 73.849 74.835 1.00 56.20 ? 148 LYS A CD  1 
ATOM   1177 C  CE  . LYS A 1 148 ? 36.222 73.534 76.290 1.00 58.44 ? 148 LYS A CE  1 
ATOM   1178 N  NZ  . LYS A 1 148 ? 35.063 73.989 77.113 1.00 60.67 ? 148 LYS A NZ  1 
ATOM   1179 N  N   . LYS A 1 149 ? 35.229 73.809 69.388 1.00 46.79 ? 149 LYS A N   1 
ATOM   1180 C  CA  . LYS A 1 149 ? 35.195 74.493 68.091 1.00 43.62 ? 149 LYS A CA  1 
ATOM   1181 C  C   . LYS A 1 149 ? 33.763 74.897 67.753 1.00 41.85 ? 149 LYS A C   1 
ATOM   1182 O  O   . LYS A 1 149 ? 32.809 74.263 68.201 1.00 40.91 ? 149 LYS A O   1 
ATOM   1183 C  CB  . LYS A 1 149 ? 35.787 73.602 67.000 1.00 43.71 ? 149 LYS A CB  1 
ATOM   1184 C  CG  . LYS A 1 149 ? 37.220 73.235 67.300 1.00 43.20 ? 149 LYS A CG  1 
ATOM   1185 C  CD  . LYS A 1 149 ? 37.847 72.406 66.216 1.00 44.18 ? 149 LYS A CD  1 
ATOM   1186 C  CE  . LYS A 1 149 ? 39.249 71.990 66.644 1.00 43.98 ? 149 LYS A CE  1 
ATOM   1187 N  NZ  . LYS A 1 149 ? 39.935 71.141 65.632 1.00 46.53 ? 149 LYS A NZ  1 
ATOM   1188 N  N   . VAL A 1 150 ? 33.611 75.959 66.972 1.00 39.97 ? 150 VAL A N   1 
ATOM   1189 C  CA  . VAL A 1 150 ? 32.284 76.438 66.634 1.00 38.72 ? 150 VAL A CA  1 
ATOM   1190 C  C   . VAL A 1 150 ? 31.818 76.064 65.225 1.00 38.38 ? 150 VAL A C   1 
ATOM   1191 O  O   . VAL A 1 150 ? 32.396 76.490 64.225 1.00 37.36 ? 150 VAL A O   1 
ATOM   1192 C  CB  . VAL A 1 150 ? 32.205 77.958 66.807 1.00 38.46 ? 150 VAL A CB  1 
ATOM   1193 C  CG1 . VAL A 1 150 ? 30.748 78.417 66.730 1.00 36.90 ? 150 VAL A CG1 1 
ATOM   1194 C  CG2 . VAL A 1 150 ? 32.824 78.349 68.139 1.00 38.86 ? 150 VAL A CG2 1 
ATOM   1195 N  N   . PRO A 1 151 ? 30.752 75.256 65.138 1.00 37.90 ? 151 PRO A N   1 
ATOM   1196 C  CA  . PRO A 1 151 ? 30.211 74.828 63.842 1.00 36.29 ? 151 PRO A CA  1 
ATOM   1197 C  C   . PRO A 1 151 ? 29.773 76.018 63.008 1.00 35.31 ? 151 PRO A C   1 
ATOM   1198 O  O   . PRO A 1 151 ? 29.104 76.936 63.507 1.00 36.12 ? 151 PRO A O   1 
ATOM   1199 C  CB  . PRO A 1 151 ? 29.019 73.943 64.230 1.00 35.40 ? 151 PRO A CB  1 
ATOM   1200 C  CG  . PRO A 1 151 ? 29.408 73.404 65.583 1.00 36.85 ? 151 PRO A CG  1 
ATOM   1201 C  CD  . PRO A 1 151 ? 30.011 74.632 66.251 1.00 37.88 ? 151 PRO A CD  1 
ATOM   1202 N  N   . LEU A 1 152 ? 30.163 76.020 61.742 1.00 33.01 ? 152 LEU A N   1 
ATOM   1203 C  CA  . LEU A 1 152 ? 29.756 77.098 60.852 1.00 32.92 ? 152 LEU A CA  1 
ATOM   1204 C  C   . LEU A 1 152 ? 28.830 76.535 59.769 1.00 33.19 ? 152 LEU A C   1 
ATOM   1205 O  O   . LEU A 1 152 ? 27.917 77.228 59.275 1.00 31.23 ? 152 LEU A O   1 
ATOM   1206 C  CB  . LEU A 1 152 ? 30.978 77.751 60.195 1.00 31.31 ? 152 LEU A CB  1 
ATOM   1207 C  CG  . LEU A 1 152 ? 31.997 78.401 61.141 1.00 31.43 ? 152 LEU A CG  1 
ATOM   1208 C  CD1 . LEU A 1 152 ? 33.081 79.087 60.317 1.00 29.60 ? 152 LEU A CD1 1 
ATOM   1209 C  CD2 . LEU A 1 152 ? 31.309 79.413 62.050 1.00 27.99 ? 152 LEU A CD2 1 
ATOM   1210 N  N   . LEU A 1 153 ? 29.072 75.267 59.419 1.00 31.61 ? 153 LEU A N   1 
ATOM   1211 C  CA  . LEU A 1 153 ? 28.308 74.579 58.382 1.00 30.89 ? 153 LEU A CA  1 
ATOM   1212 C  C   . LEU A 1 153 ? 28.431 73.077 58.550 1.00 30.11 ? 153 LEU A C   1 
ATOM   1213 O  O   . LEU A 1 153 ? 29.493 72.567 58.894 1.00 30.70 ? 153 LEU A O   1 
ATOM   1214 C  CB  . LEU A 1 153 ? 28.846 74.953 56.998 1.00 27.95 ? 153 LEU A CB  1 
ATOM   1215 C  CG  . LEU A 1 153 ? 28.250 74.183 55.818 1.00 27.54 ? 153 LEU A CG  1 
ATOM   1216 C  CD1 . LEU A 1 153 ? 26.823 74.659 55.593 1.00 28.61 ? 153 LEU A CD1 1 
ATOM   1217 C  CD2 . LEU A 1 153 ? 29.070 74.428 54.558 1.00 27.03 ? 153 LEU A CD2 1 
ATOM   1218 N  N   . VAL A 1 154 ? 27.349 72.361 58.294 1.00 29.62 ? 154 VAL A N   1 
ATOM   1219 C  CA  . VAL A 1 154 ? 27.400 70.912 58.410 1.00 28.92 ? 154 VAL A CA  1 
ATOM   1220 C  C   . VAL A 1 154 ? 26.444 70.262 57.428 1.00 28.51 ? 154 VAL A C   1 
ATOM   1221 O  O   . VAL A 1 154 ? 25.442 70.861 57.019 1.00 28.37 ? 154 VAL A O   1 
ATOM   1222 C  CB  . VAL A 1 154 ? 27.008 70.425 59.826 1.00 28.90 ? 154 VAL A CB  1 
ATOM   1223 C  CG1 . VAL A 1 154 ? 25.491 70.546 60.021 1.00 27.25 ? 154 VAL A CG1 1 
ATOM   1224 C  CG2 . VAL A 1 154 ? 27.486 68.997 60.032 1.00 24.68 ? 154 VAL A CG2 1 
ATOM   1225 N  N   . VAL A 1 155 ? 26.800 69.042 57.035 1.00 28.54 ? 155 VAL A N   1 
ATOM   1226 C  CA  . VAL A 1 155 ? 25.985 68.213 56.163 1.00 24.58 ? 155 VAL A CA  1 
ATOM   1227 C  C   . VAL A 1 155 ? 25.944 66.831 56.824 1.00 24.90 ? 155 VAL A C   1 
ATOM   1228 O  O   . VAL A 1 155 ? 26.969 66.301 57.263 1.00 24.80 ? 155 VAL A O   1 
ATOM   1229 C  CB  . VAL A 1 155 ? 26.549 68.126 54.717 1.00 24.48 ? 155 VAL A CB  1 
ATOM   1230 C  CG1 . VAL A 1 155 ? 27.916 67.491 54.702 1.00 24.34 ? 155 VAL A CG1 1 
ATOM   1231 C  CG2 . VAL A 1 155 ? 25.578 67.335 53.846 1.00 21.33 ? 155 VAL A CG2 1 
ATOM   1232 N  N   . ASP A 1 156 ? 24.739 66.284 56.930 1.00 23.78 ? 156 ASP A N   1 
ATOM   1233 C  CA  . ASP A 1 156 ? 24.489 64.980 57.532 1.00 23.62 ? 156 ASP A CA  1 
ATOM   1234 C  C   . ASP A 1 156 ? 24.838 63.943 56.468 1.00 23.04 ? 156 ASP A C   1 
ATOM   1235 O  O   . ASP A 1 156 ? 24.357 64.045 55.334 1.00 22.22 ? 156 ASP A O   1 
ATOM   1236 C  CB  . ASP A 1 156 ? 22.989 64.897 57.896 1.00 24.76 ? 156 ASP A CB  1 
ATOM   1237 C  CG  . ASP A 1 156 ? 22.636 63.681 58.734 1.00 26.52 ? 156 ASP A CG  1 
ATOM   1238 O  OD1 . ASP A 1 156 ? 23.526 62.828 58.922 1.00 26.05 ? 156 ASP A OD1 1 
ATOM   1239 O  OD2 . ASP A 1 156 ? 21.460 63.580 59.200 1.00 24.73 ? 156 ASP A OD2 1 
ATOM   1240 N  N   . VAL A 1 157 ? 25.698 62.979 56.794 1.00 22.00 ? 157 VAL A N   1 
ATOM   1241 C  CA  . VAL A 1 157 ? 26.015 61.956 55.805 1.00 23.30 ? 157 VAL A CA  1 
ATOM   1242 C  C   . VAL A 1 157 ? 25.619 60.568 56.266 1.00 23.82 ? 157 VAL A C   1 
ATOM   1243 O  O   . VAL A 1 157 ? 26.079 59.568 55.713 1.00 23.56 ? 157 VAL A O   1 
ATOM   1244 C  CB  . VAL A 1 157 ? 27.513 61.949 55.329 1.00 24.94 ? 157 VAL A CB  1 
ATOM   1245 C  CG1 . VAL A 1 157 ? 27.813 63.223 54.520 1.00 22.78 ? 157 VAL A CG1 1 
ATOM   1246 C  CG2 . VAL A 1 157 ? 28.451 61.805 56.504 1.00 26.17 ? 157 VAL A CG2 1 
ATOM   1247 N  N   . TRP A 1 158 ? 24.777 60.507 57.295 1.00 21.57 ? 158 TRP A N   1 
ATOM   1248 C  CA  . TRP A 1 158 ? 24.245 59.223 57.720 1.00 22.81 ? 158 TRP A CA  1 
ATOM   1249 C  C   . TRP A 1 158 ? 23.446 58.828 56.478 1.00 22.07 ? 158 TRP A C   1 
ATOM   1250 O  O   . TRP A 1 158 ? 22.886 59.697 55.809 1.00 24.23 ? 158 TRP A O   1 
ATOM   1251 C  CB  . TRP A 1 158 ? 23.263 59.387 58.875 1.00 21.50 ? 158 TRP A CB  1 
ATOM   1252 C  CG  . TRP A 1 158 ? 23.872 59.453 60.214 1.00 24.20 ? 158 TRP A CG  1 
ATOM   1253 C  CD1 . TRP A 1 158 ? 24.766 60.387 60.679 1.00 22.89 ? 158 TRP A CD1 1 
ATOM   1254 C  CD2 . TRP A 1 158 ? 23.583 58.583 61.312 1.00 23.94 ? 158 TRP A CD2 1 
ATOM   1255 N  NE1 . TRP A 1 158 ? 25.040 60.150 62.006 1.00 23.51 ? 158 TRP A NE1 1 
ATOM   1256 C  CE2 . TRP A 1 158 ? 24.331 59.049 62.421 1.00 23.26 ? 158 TRP A CE2 1 
ATOM   1257 C  CE3 . TRP A 1 158 ? 22.765 57.455 61.467 1.00 23.14 ? 158 TRP A CE3 1 
ATOM   1258 C  CZ2 . TRP A 1 158 ? 24.287 58.421 63.678 1.00 23.24 ? 158 TRP A CZ2 1 
ATOM   1259 C  CZ3 . TRP A 1 158 ? 22.722 56.826 62.727 1.00 27.91 ? 158 TRP A CZ3 1 
ATOM   1260 C  CH2 . TRP A 1 158 ? 23.482 57.316 63.812 1.00 21.86 ? 158 TRP A CH2 1 
ATOM   1261 N  N   . GLU A 1 159 ? 23.363 57.551 56.157 1.00 20.05 ? 159 GLU A N   1 
ATOM   1262 C  CA  . GLU A 1 159 ? 22.625 57.187 54.959 1.00 20.57 ? 159 GLU A CA  1 
ATOM   1263 C  C   . GLU A 1 159 ? 21.155 57.602 54.981 1.00 20.70 ? 159 GLU A C   1 
ATOM   1264 O  O   . GLU A 1 159 ? 20.617 57.962 53.939 1.00 19.90 ? 159 GLU A O   1 
ATOM   1265 C  CB  . GLU A 1 159 ? 22.754 55.687 54.694 1.00 22.42 ? 159 GLU A CB  1 
ATOM   1266 C  CG  . GLU A 1 159 ? 24.196 55.258 54.409 1.00 24.49 ? 159 GLU A CG  1 
ATOM   1267 C  CD  . GLU A 1 159 ? 24.341 53.771 54.154 1.00 23.39 ? 159 GLU A CD  1 
ATOM   1268 O  OE1 . GLU A 1 159 ? 23.922 52.956 55.000 1.00 19.44 ? 159 GLU A OE1 1 
ATOM   1269 O  OE2 . GLU A 1 159 ? 24.878 53.421 53.094 1.00 26.96 ? 159 GLU A OE2 1 
ATOM   1270 N  N   . HIS A 1 160 ? 20.499 57.582 56.150 1.00 20.41 ? 160 HIS A N   1 
ATOM   1271 C  CA  . HIS A 1 160 ? 19.096 57.982 56.179 1.00 19.96 ? 160 HIS A CA  1 
ATOM   1272 C  C   . HIS A 1 160 ? 18.886 59.410 55.710 1.00 20.91 ? 160 HIS A C   1 
ATOM   1273 O  O   . HIS A 1 160 ? 17.764 59.799 55.391 1.00 22.30 ? 160 HIS A O   1 
ATOM   1274 C  CB  . HIS A 1 160 ? 18.459 57.815 57.567 1.00 21.02 ? 160 HIS A CB  1 
ATOM   1275 C  CG  . HIS A 1 160 ? 18.959 58.782 58.593 1.00 24.65 ? 160 HIS A CG  1 
ATOM   1276 N  ND1 . HIS A 1 160 ? 19.434 58.406 59.833 1.00 22.37 ? 160 HIS A ND1 1 
ATOM   1277 C  CD2 . HIS A 1 160 ? 19.063 60.139 58.550 1.00 25.13 ? 160 HIS A CD2 1 
ATOM   1278 C  CE1 . HIS A 1 160 ? 19.810 59.525 60.494 1.00 30.22 ? 160 HIS A CE1 1 
ATOM   1279 N  NE2 . HIS A 1 160 ? 19.606 60.610 59.763 1.00 28.70 ? 160 HIS A NE2 1 
ATOM   1280 N  N   . ALA A 1 161 ? 19.942 60.208 55.647 1.00 21.17 ? 161 ALA A N   1 
ATOM   1281 C  CA  . ALA A 1 161 ? 19.747 61.582 55.209 1.00 21.43 ? 161 ALA A CA  1 
ATOM   1282 C  C   . ALA A 1 161 ? 19.540 61.711 53.706 1.00 22.73 ? 161 ALA A C   1 
ATOM   1283 O  O   . ALA A 1 161 ? 19.030 62.725 53.235 1.00 19.87 ? 161 ALA A O   1 
ATOM   1284 C  CB  . ALA A 1 161 ? 20.912 62.436 55.638 1.00 22.37 ? 161 ALA A CB  1 
ATOM   1285 N  N   . TYR A 1 162 ? 19.910 60.681 52.946 1.00 22.59 ? 162 TYR A N   1 
ATOM   1286 C  CA  . TYR A 1 162 ? 19.769 60.798 51.511 1.00 22.50 ? 162 TYR A CA  1 
ATOM   1287 C  C   . TYR A 1 162 ? 19.298 59.568 50.766 1.00 23.29 ? 162 TYR A C   1 
ATOM   1288 O  O   . TYR A 1 162 ? 19.126 59.631 49.543 1.00 23.95 ? 162 TYR A O   1 
ATOM   1289 C  CB  . TYR A 1 162 ? 21.110 61.233 50.918 1.00 25.09 ? 162 TYR A CB  1 
ATOM   1290 C  CG  . TYR A 1 162 ? 22.270 60.297 51.236 1.00 26.67 ? 162 TYR A CG  1 
ATOM   1291 C  CD1 . TYR A 1 162 ? 22.484 59.129 50.497 1.00 26.94 ? 162 TYR A CD1 1 
ATOM   1292 C  CD2 . TYR A 1 162 ? 23.165 60.589 52.270 1.00 28.27 ? 162 TYR A CD2 1 
ATOM   1293 C  CE1 . TYR A 1 162 ? 23.564 58.273 50.777 1.00 25.78 ? 162 TYR A CE1 1 
ATOM   1294 C  CE2 . TYR A 1 162 ? 24.244 59.742 52.558 1.00 27.86 ? 162 TYR A CE2 1 
ATOM   1295 C  CZ  . TYR A 1 162 ? 24.437 58.589 51.806 1.00 26.87 ? 162 TYR A CZ  1 
ATOM   1296 O  OH  . TYR A 1 162 ? 25.506 57.770 52.077 1.00 23.50 ? 162 TYR A OH  1 
ATOM   1297 N  N   . TYR A 1 163 ? 19.082 58.458 51.468 1.00 21.69 ? 163 TYR A N   1 
ATOM   1298 C  CA  . TYR A 1 163 ? 18.708 57.234 50.771 1.00 23.38 ? 163 TYR A CA  1 
ATOM   1299 C  C   . TYR A 1 163 ? 17.385 57.281 50.022 1.00 24.85 ? 163 TYR A C   1 
ATOM   1300 O  O   . TYR A 1 163 ? 17.258 56.705 48.936 1.00 24.76 ? 163 TYR A O   1 
ATOM   1301 C  CB  . TYR A 1 163 ? 18.717 56.024 51.718 1.00 22.82 ? 163 TYR A CB  1 
ATOM   1302 C  CG  . TYR A 1 163 ? 19.419 54.851 51.082 1.00 23.92 ? 163 TYR A CG  1 
ATOM   1303 C  CD1 . TYR A 1 163 ? 20.811 54.868 50.894 1.00 22.61 ? 163 TYR A CD1 1 
ATOM   1304 C  CD2 . TYR A 1 163 ? 18.693 53.774 50.572 1.00 22.53 ? 163 TYR A CD2 1 
ATOM   1305 C  CE1 . TYR A 1 163 ? 21.455 53.856 50.216 1.00 19.69 ? 163 TYR A CE1 1 
ATOM   1306 C  CE2 . TYR A 1 163 ? 19.330 52.749 49.882 1.00 22.46 ? 163 TYR A CE2 1 
ATOM   1307 C  CZ  . TYR A 1 163 ? 20.708 52.802 49.711 1.00 22.20 ? 163 TYR A CZ  1 
ATOM   1308 O  OH  . TYR A 1 163 ? 21.318 51.803 49.020 1.00 24.60 ? 163 TYR A OH  1 
ATOM   1309 N  N   . ILE A 1 164 ? 16.406 57.970 50.595 1.00 25.79 ? 164 ILE A N   1 
ATOM   1310 C  CA  . ILE A 1 164 ? 15.092 58.067 49.985 1.00 27.72 ? 164 ILE A CA  1 
ATOM   1311 C  C   . ILE A 1 164 ? 15.100 58.692 48.600 1.00 28.40 ? 164 ILE A C   1 
ATOM   1312 O  O   . ILE A 1 164 ? 14.532 58.123 47.660 1.00 31.19 ? 164 ILE A O   1 
ATOM   1313 C  CB  . ILE A 1 164 ? 14.127 58.840 50.900 1.00 28.76 ? 164 ILE A CB  1 
ATOM   1314 C  CG1 . ILE A 1 164 ? 13.757 57.953 52.092 1.00 25.97 ? 164 ILE A CG1 1 
ATOM   1315 C  CG2 . ILE A 1 164 ? 12.884 59.245 50.132 1.00 29.12 ? 164 ILE A CG2 1 
ATOM   1316 C  CD1 . ILE A 1 164 ? 12.975 58.652 53.167 1.00 27.61 ? 164 ILE A CD1 1 
ATOM   1317 N  N   . ASP A 1 165 ? 15.754 59.841 48.459 1.00 27.75 ? 165 ASP A N   1 
ATOM   1318 C  CA  . ASP A 1 165 ? 15.814 60.521 47.166 1.00 28.28 ? 165 ASP A CA  1 
ATOM   1319 C  C   . ASP A 1 165 ? 17.038 60.168 46.324 1.00 29.39 ? 165 ASP A C   1 
ATOM   1320 O  O   . ASP A 1 165 ? 17.020 60.324 45.098 1.00 30.71 ? 165 ASP A O   1 
ATOM   1321 C  CB  . ASP A 1 165 ? 15.828 62.047 47.357 1.00 25.92 ? 165 ASP A CB  1 
ATOM   1322 C  CG  . ASP A 1 165 ? 14.655 62.555 48.186 1.00 29.95 ? 165 ASP A CG  1 
ATOM   1323 O  OD1 . ASP A 1 165 ? 13.489 62.236 47.850 1.00 29.03 ? 165 ASP A OD1 1 
ATOM   1324 O  OD2 . ASP A 1 165 ? 14.901 63.290 49.175 1.00 29.90 ? 165 ASP A OD2 1 
ATOM   1325 N  N   . HIS A 1 166 ? 18.107 59.706 46.966 1.00 28.10 ? 166 HIS A N   1 
ATOM   1326 C  CA  . HIS A 1 166 ? 19.345 59.439 46.231 1.00 27.61 ? 166 HIS A CA  1 
ATOM   1327 C  C   . HIS A 1 166 ? 19.948 58.038 46.345 1.00 25.83 ? 166 HIS A C   1 
ATOM   1328 O  O   . HIS A 1 166 ? 20.942 57.743 45.695 1.00 24.97 ? 166 HIS A O   1 
ATOM   1329 C  CB  . HIS A 1 166 ? 20.355 60.495 46.671 1.00 26.44 ? 166 HIS A CB  1 
ATOM   1330 C  CG  . HIS A 1 166 ? 19.825 61.894 46.563 1.00 29.31 ? 166 HIS A CG  1 
ATOM   1331 N  ND1 . HIS A 1 166 ? 19.601 62.514 45.348 1.00 29.78 ? 166 HIS A ND1 1 
ATOM   1332 C  CD2 . HIS A 1 166 ? 19.440 62.783 47.512 1.00 27.81 ? 166 HIS A CD2 1 
ATOM   1333 C  CE1 . HIS A 1 166 ? 19.104 63.722 45.554 1.00 27.81 ? 166 HIS A CE1 1 
ATOM   1334 N  NE2 . HIS A 1 166 ? 18.996 63.910 46.859 1.00 28.58 ? 166 HIS A NE2 1 
ATOM   1335 N  N   . LYS A 1 167 ? 19.340 57.189 47.164 1.00 26.43 ? 167 LYS A N   1 
ATOM   1336 C  CA  . LYS A 1 167 ? 19.845 55.835 47.369 1.00 28.58 ? 167 LYS A CA  1 
ATOM   1337 C  C   . LYS A 1 167 ? 21.305 55.931 47.771 1.00 27.70 ? 167 LYS A C   1 
ATOM   1338 O  O   . LYS A 1 167 ? 21.637 56.733 48.645 1.00 27.78 ? 167 LYS A O   1 
ATOM   1339 C  CB  . LYS A 1 167 ? 19.685 55.004 46.094 1.00 28.53 ? 167 LYS A CB  1 
ATOM   1340 C  CG  . LYS A 1 167 ? 18.215 54.833 45.674 1.00 31.40 ? 167 LYS A CG  1 
ATOM   1341 C  CD  . LYS A 1 167 ? 17.462 53.989 46.677 1.00 32.47 ? 167 LYS A CD  1 
ATOM   1342 C  CE  . LYS A 1 167 ? 16.045 53.675 46.211 1.00 35.34 ? 167 LYS A CE  1 
ATOM   1343 N  NZ  . LYS A 1 167 ? 15.126 54.841 46.356 1.00 33.93 ? 167 LYS A NZ  1 
ATOM   1344 N  N   . ASN A 1 168 ? 22.166 55.151 47.114 1.00 25.21 ? 168 ASN A N   1 
ATOM   1345 C  CA  . ASN A 1 168 ? 23.592 55.121 47.430 1.00 25.67 ? 168 ASN A CA  1 
ATOM   1346 C  C   . ASN A 1 168 ? 24.431 56.276 46.886 1.00 24.17 ? 168 ASN A C   1 
ATOM   1347 O  O   . ASN A 1 168 ? 25.622 56.371 47.181 1.00 23.47 ? 168 ASN A O   1 
ATOM   1348 C  CB  . ASN A 1 168 ? 24.189 53.816 46.918 1.00 26.86 ? 168 ASN A CB  1 
ATOM   1349 C  CG  . ASN A 1 168 ? 24.148 53.723 45.403 1.00 30.96 ? 168 ASN A CG  1 
ATOM   1350 O  OD1 . ASN A 1 168 ? 25.184 53.517 44.745 1.00 33.11 ? 168 ASN A OD1 1 
ATOM   1351 N  ND2 . ASN A 1 168 ? 22.954 53.880 44.833 1.00 23.91 ? 168 ASN A ND2 1 
ATOM   1352 N  N   . ALA A 1 169 ? 23.809 57.157 46.115 1.00 23.48 ? 169 ALA A N   1 
ATOM   1353 C  CA  . ALA A 1 169 ? 24.511 58.272 45.477 1.00 23.34 ? 169 ALA A CA  1 
ATOM   1354 C  C   . ALA A 1 169 ? 24.816 59.473 46.355 1.00 23.82 ? 169 ALA A C   1 
ATOM   1355 O  O   . ALA A 1 169 ? 24.381 60.581 46.062 1.00 24.95 ? 169 ALA A O   1 
ATOM   1356 C  CB  . ALA A 1 169 ? 23.728 58.722 44.260 1.00 22.02 ? 169 ALA A CB  1 
ATOM   1357 N  N   . ARG A 1 170 ? 25.593 59.267 47.411 1.00 25.53 ? 170 ARG A N   1 
ATOM   1358 C  CA  . ARG A 1 170 ? 25.932 60.361 48.307 1.00 25.44 ? 170 ARG A CA  1 
ATOM   1359 C  C   . ARG A 1 170 ? 26.505 61.574 47.554 1.00 25.95 ? 170 ARG A C   1 
ATOM   1360 O  O   . ARG A 1 170 ? 26.186 62.717 47.876 1.00 27.10 ? 170 ARG A O   1 
ATOM   1361 C  CB  . ARG A 1 170 ? 26.925 59.894 49.385 1.00 25.02 ? 170 ARG A CB  1 
ATOM   1362 C  CG  . ARG A 1 170 ? 27.051 60.902 50.518 1.00 25.94 ? 170 ARG A CG  1 
ATOM   1363 C  CD  . ARG A 1 170 ? 28.248 60.668 51.415 1.00 26.49 ? 170 ARG A CD  1 
ATOM   1364 N  NE  . ARG A 1 170 ? 28.167 59.444 52.205 1.00 24.83 ? 170 ARG A NE  1 
ATOM   1365 C  CZ  . ARG A 1 170 ? 29.080 59.108 53.107 1.00 26.58 ? 170 ARG A CZ  1 
ATOM   1366 N  NH1 . ARG A 1 170 ? 30.112 59.921 53.320 1.00 25.35 ? 170 ARG A NH1 1 
ATOM   1367 N  NH2 . ARG A 1 170 ? 28.989 57.957 53.774 1.00 26.45 ? 170 ARG A NH2 1 
ATOM   1368 N  N   . PRO A 1 171 ? 27.351 61.345 46.536 1.00 26.73 ? 171 PRO A N   1 
ATOM   1369 C  CA  . PRO A 1 171 ? 27.918 62.481 45.794 1.00 26.68 ? 171 PRO A CA  1 
ATOM   1370 C  C   . PRO A 1 171 ? 26.867 63.400 45.176 1.00 27.77 ? 171 PRO A C   1 
ATOM   1371 O  O   . PRO A 1 171 ? 27.014 64.621 45.205 1.00 27.84 ? 171 PRO A O   1 
ATOM   1372 C  CB  . PRO A 1 171 ? 28.784 61.809 44.742 1.00 25.49 ? 171 PRO A CB  1 
ATOM   1373 C  CG  . PRO A 1 171 ? 29.251 60.581 45.438 1.00 25.24 ? 171 PRO A CG  1 
ATOM   1374 C  CD  . PRO A 1 171 ? 27.969 60.083 46.094 1.00 26.54 ? 171 PRO A CD  1 
ATOM   1375 N  N   . VAL A 1 172 ? 25.814 62.817 44.610 1.00 28.38 ? 172 VAL A N   1 
ATOM   1376 C  CA  . VAL A 1 172 ? 24.740 63.611 44.024 1.00 27.65 ? 172 VAL A CA  1 
ATOM   1377 C  C   . VAL A 1 172 ? 24.067 64.394 45.134 1.00 27.37 ? 172 VAL A C   1 
ATOM   1378 O  O   . VAL A 1 172 ? 23.791 65.584 44.995 1.00 28.32 ? 172 VAL A O   1 
ATOM   1379 C  CB  . VAL A 1 172 ? 23.697 62.718 43.348 1.00 29.83 ? 172 VAL A CB  1 
ATOM   1380 C  CG1 . VAL A 1 172 ? 22.500 63.560 42.874 1.00 27.90 ? 172 VAL A CG1 1 
ATOM   1381 C  CG2 . VAL A 1 172 ? 24.349 62.004 42.174 1.00 31.23 ? 172 VAL A CG2 1 
ATOM   1382 N  N   . TYR A 1 173 ? 23.806 63.715 46.241 1.00 26.30 ? 173 TYR A N   1 
ATOM   1383 C  CA  . TYR A 1 173 ? 23.185 64.363 47.391 1.00 27.38 ? 173 TYR A CA  1 
ATOM   1384 C  C   . TYR A 1 173 ? 24.056 65.543 47.875 1.00 28.32 ? 173 TYR A C   1 
ATOM   1385 O  O   . TYR A 1 173 ? 23.540 66.618 48.188 1.00 27.18 ? 173 TYR A O   1 
ATOM   1386 C  CB  . TYR A 1 173 ? 23.004 63.333 48.517 1.00 23.96 ? 173 TYR A CB  1 
ATOM   1387 C  CG  . TYR A 1 173 ? 22.872 63.916 49.902 1.00 24.14 ? 173 TYR A CG  1 
ATOM   1388 C  CD1 . TYR A 1 173 ? 21.686 64.542 50.321 1.00 24.66 ? 173 TYR A CD1 1 
ATOM   1389 C  CD2 . TYR A 1 173 ? 23.909 63.792 50.818 1.00 21.60 ? 173 TYR A CD2 1 
ATOM   1390 C  CE1 . TYR A 1 173 ? 21.542 65.020 51.634 1.00 22.47 ? 173 TYR A CE1 1 
ATOM   1391 C  CE2 . TYR A 1 173 ? 23.786 64.260 52.117 1.00 20.61 ? 173 TYR A CE2 1 
ATOM   1392 C  CZ  . TYR A 1 173 ? 22.604 64.871 52.528 1.00 23.09 ? 173 TYR A CZ  1 
ATOM   1393 O  OH  . TYR A 1 173 ? 22.499 65.309 53.831 1.00 17.61 ? 173 TYR A OH  1 
ATOM   1394 N  N   . LEU A 1 174 ? 25.379 65.346 47.911 1.00 28.37 ? 174 LEU A N   1 
ATOM   1395 C  CA  . LEU A 1 174 ? 26.282 66.392 48.383 1.00 28.38 ? 174 LEU A CA  1 
ATOM   1396 C  C   . LEU A 1 174 ? 26.305 67.607 47.466 1.00 28.71 ? 174 LEU A C   1 
ATOM   1397 O  O   . LEU A 1 174 ? 26.320 68.751 47.925 1.00 29.13 ? 174 LEU A O   1 
ATOM   1398 C  CB  . LEU A 1 174 ? 27.693 65.827 48.560 1.00 27.55 ? 174 LEU A CB  1 
ATOM   1399 C  CG  . LEU A 1 174 ? 27.790 64.803 49.701 1.00 28.27 ? 174 LEU A CG  1 
ATOM   1400 C  CD1 . LEU A 1 174 ? 29.173 64.180 49.712 1.00 25.04 ? 174 LEU A CD1 1 
ATOM   1401 C  CD2 . LEU A 1 174 ? 27.486 65.487 51.063 1.00 28.04 ? 174 LEU A CD2 1 
ATOM   1402 N  N   . GLU A 1 175 ? 26.291 67.360 46.164 1.00 30.08 ? 175 GLU A N   1 
ATOM   1403 C  CA  . GLU A 1 175 ? 26.302 68.440 45.184 1.00 30.19 ? 175 GLU A CA  1 
ATOM   1404 C  C   . GLU A 1 175 ? 25.008 69.246 45.292 1.00 29.93 ? 175 GLU A C   1 
ATOM   1405 O  O   . GLU A 1 175 ? 25.015 70.464 45.188 1.00 29.27 ? 175 GLU A O   1 
ATOM   1406 C  CB  . GLU A 1 175 ? 26.460 67.859 43.778 1.00 32.14 ? 175 GLU A CB  1 
ATOM   1407 C  CG  . GLU A 1 175 ? 26.528 68.902 42.683 1.00 36.76 ? 175 GLU A CG  1 
ATOM   1408 C  CD  . GLU A 1 175 ? 27.603 69.937 42.960 1.00 43.02 ? 175 GLU A CD  1 
ATOM   1409 O  OE1 . GLU A 1 175 ? 27.360 71.142 42.703 1.00 45.13 ? 175 GLU A OE1 1 
ATOM   1410 O  OE2 . GLU A 1 175 ? 28.693 69.544 43.438 1.00 44.60 ? 175 GLU A OE2 1 
ATOM   1411 N  N   . LYS A 1 176 ? 23.899 68.552 45.506 1.00 30.71 ? 176 LYS A N   1 
ATOM   1412 C  CA  . LYS A 1 176 ? 22.612 69.213 45.648 1.00 31.40 ? 176 LYS A CA  1 
ATOM   1413 C  C   . LYS A 1 176 ? 22.586 70.019 46.945 1.00 30.06 ? 176 LYS A C   1 
ATOM   1414 O  O   . LYS A 1 176 ? 22.075 71.136 46.975 1.00 31.05 ? 176 LYS A O   1 
ATOM   1415 C  CB  . LYS A 1 176 ? 21.476 68.178 45.645 1.00 33.73 ? 176 LYS A CB  1 
ATOM   1416 C  CG  . LYS A 1 176 ? 21.225 67.497 44.304 1.00 32.84 ? 176 LYS A CG  1 
ATOM   1417 C  CD  . LYS A 1 176 ? 20.923 68.535 43.260 1.00 41.31 ? 176 LYS A CD  1 
ATOM   1418 C  CE  . LYS A 1 176 ? 20.290 67.930 42.019 1.00 45.42 ? 176 LYS A CE  1 
ATOM   1419 N  NZ  . LYS A 1 176 ? 20.144 68.983 40.958 1.00 48.20 ? 176 LYS A NZ  1 
ATOM   1420 N  N   . PHE A 1 177 ? 23.134 69.442 48.010 1.00 29.29 ? 177 PHE A N   1 
ATOM   1421 C  CA  . PHE A 1 177 ? 23.190 70.099 49.307 1.00 27.21 ? 177 PHE A CA  1 
ATOM   1422 C  C   . PHE A 1 177 ? 23.881 71.432 49.134 1.00 28.58 ? 177 PHE A C   1 
ATOM   1423 O  O   . PHE A 1 177 ? 23.312 72.484 49.417 1.00 29.28 ? 177 PHE A O   1 
ATOM   1424 C  CB  . PHE A 1 177 ? 23.995 69.253 50.290 1.00 25.26 ? 177 PHE A CB  1 
ATOM   1425 C  CG  . PHE A 1 177 ? 24.470 70.010 51.516 1.00 27.32 ? 177 PHE A CG  1 
ATOM   1426 C  CD1 . PHE A 1 177 ? 23.667 70.128 52.646 1.00 26.13 ? 177 PHE A CD1 1 
ATOM   1427 C  CD2 . PHE A 1 177 ? 25.728 70.597 51.539 1.00 25.83 ? 177 PHE A CD2 1 
ATOM   1428 C  CE1 . PHE A 1 177 ? 24.121 70.822 53.787 1.00 27.33 ? 177 PHE A CE1 1 
ATOM   1429 C  CE2 . PHE A 1 177 ? 26.185 71.292 52.675 1.00 27.12 ? 177 PHE A CE2 1 
ATOM   1430 C  CZ  . PHE A 1 177 ? 25.376 71.401 53.801 1.00 23.05 ? 177 PHE A CZ  1 
ATOM   1431 N  N   . TYR A 1 178 ? 25.119 71.379 48.651 1.00 29.21 ? 178 TYR A N   1 
ATOM   1432 C  CA  . TYR A 1 178 ? 25.916 72.592 48.447 1.00 29.46 ? 178 TYR A CA  1 
ATOM   1433 C  C   . TYR A 1 178 ? 25.139 73.733 47.764 1.00 28.74 ? 178 TYR A C   1 
ATOM   1434 O  O   . TYR A 1 178 ? 25.270 74.894 48.160 1.00 28.67 ? 178 TYR A O   1 
ATOM   1435 C  CB  . TYR A 1 178 ? 27.189 72.273 47.646 1.00 27.58 ? 178 TYR A CB  1 
ATOM   1436 C  CG  . TYR A 1 178 ? 28.356 73.127 48.069 1.00 27.31 ? 178 TYR A CG  1 
ATOM   1437 C  CD1 . TYR A 1 178 ? 29.130 72.780 49.183 1.00 26.29 ? 178 TYR A CD1 1 
ATOM   1438 C  CD2 . TYR A 1 178 ? 28.632 74.343 47.417 1.00 25.51 ? 178 TYR A CD2 1 
ATOM   1439 C  CE1 . TYR A 1 178 ? 30.151 73.621 49.643 1.00 28.69 ? 178 TYR A CE1 1 
ATOM   1440 C  CE2 . TYR A 1 178 ? 29.635 75.192 47.870 1.00 26.12 ? 178 TYR A CE2 1 
ATOM   1441 C  CZ  . TYR A 1 178 ? 30.395 74.829 48.984 1.00 29.28 ? 178 TYR A CZ  1 
ATOM   1442 O  OH  . TYR A 1 178 ? 31.399 75.665 49.438 1.00 30.77 ? 178 TYR A OH  1 
ATOM   1443 N  N   . GLY A 1 179 ? 24.340 73.403 46.747 1.00 27.98 ? 179 GLY A N   1 
ATOM   1444 C  CA  . GLY A 1 179 ? 23.551 74.418 46.056 1.00 26.74 ? 179 GLY A CA  1 
ATOM   1445 C  C   . GLY A 1 179 ? 22.464 75.036 46.937 1.00 27.76 ? 179 GLY A C   1 
ATOM   1446 O  O   . GLY A 1 179 ? 21.912 76.097 46.612 1.00 27.77 ? 179 GLY A O   1 
ATOM   1447 N  N   . HIS A 1 180 ? 22.154 74.386 48.059 1.00 25.71 ? 180 HIS A N   1 
ATOM   1448 C  CA  . HIS A 1 180 ? 21.134 74.886 48.967 1.00 25.67 ? 180 HIS A CA  1 
ATOM   1449 C  C   . HIS A 1 180 ? 21.686 75.414 50.274 1.00 25.21 ? 180 HIS A C   1 
ATOM   1450 O  O   . HIS A 1 180 ? 20.935 75.609 51.222 1.00 25.04 ? 180 HIS A O   1 
ATOM   1451 C  CB  . HIS A 1 180 ? 20.111 73.794 49.256 1.00 26.15 ? 180 HIS A CB  1 
ATOM   1452 C  CG  . HIS A 1 180 ? 19.109 73.623 48.166 1.00 31.89 ? 180 HIS A CG  1 
ATOM   1453 N  ND1 . HIS A 1 180 ? 18.105 74.541 47.928 1.00 34.54 ? 180 HIS A ND1 1 
ATOM   1454 C  CD2 . HIS A 1 180 ? 18.993 72.678 47.201 1.00 32.62 ? 180 HIS A CD2 1 
ATOM   1455 C  CE1 . HIS A 1 180 ? 17.416 74.166 46.862 1.00 35.57 ? 180 HIS A CE1 1 
ATOM   1456 N  NE2 . HIS A 1 180 ? 17.934 73.040 46.402 1.00 31.23 ? 180 HIS A NE2 1 
ATOM   1457 N  N   . ILE A 1 181 ? 22.990 75.663 50.329 1.00 26.58 ? 181 ILE A N   1 
ATOM   1458 C  CA  . ILE A 1 181 ? 23.578 76.169 51.564 1.00 28.46 ? 181 ILE A CA  1 
ATOM   1459 C  C   . ILE A 1 181 ? 23.085 77.564 51.905 1.00 29.07 ? 181 ILE A C   1 
ATOM   1460 O  O   . ILE A 1 181 ? 23.088 78.471 51.069 1.00 29.88 ? 181 ILE A O   1 
ATOM   1461 C  CB  . ILE A 1 181 ? 25.125 76.173 51.509 1.00 27.00 ? 181 ILE A CB  1 
ATOM   1462 C  CG1 . ILE A 1 181 ? 25.624 74.726 51.516 1.00 27.03 ? 181 ILE A CG1 1 
ATOM   1463 C  CG2 . ILE A 1 181 ? 25.700 76.940 52.707 1.00 22.13 ? 181 ILE A CG2 1 
ATOM   1464 C  CD1 . ILE A 1 181 ? 27.085 74.578 51.211 1.00 28.50 ? 181 ILE A CD1 1 
ATOM   1465 N  N   . ASN A 1 182 ? 22.648 77.703 53.147 1.00 29.25 ? 182 ASN A N   1 
ATOM   1466 C  CA  . ASN A 1 182 ? 22.160 78.954 53.681 1.00 29.41 ? 182 ASN A CA  1 
ATOM   1467 C  C   . ASN A 1 182 ? 23.373 79.749 54.176 1.00 30.34 ? 182 ASN A C   1 
ATOM   1468 O  O   . ASN A 1 182 ? 23.648 79.827 55.382 1.00 29.74 ? 182 ASN A O   1 
ATOM   1469 C  CB  . ASN A 1 182 ? 21.203 78.664 54.834 1.00 29.24 ? 182 ASN A CB  1 
ATOM   1470 C  CG  . ASN A 1 182 ? 20.528 79.899 55.340 1.00 30.61 ? 182 ASN A CG  1 
ATOM   1471 O  OD1 . ASN A 1 182 ? 20.774 80.999 54.841 1.00 29.60 ? 182 ASN A OD1 1 
ATOM   1472 N  ND2 . ASN A 1 182 ? 19.661 79.735 56.337 1.00 29.05 ? 182 ASN A ND2 1 
ATOM   1473 N  N   . TRP A 1 183 ? 24.106 80.332 53.236 1.00 31.04 ? 183 TRP A N   1 
ATOM   1474 C  CA  . TRP A 1 183 ? 25.292 81.120 53.569 1.00 31.65 ? 183 TRP A CA  1 
ATOM   1475 C  C   . TRP A 1 183 ? 24.990 82.238 54.564 1.00 33.17 ? 183 TRP A C   1 
ATOM   1476 O  O   . TRP A 1 183 ? 25.840 82.581 55.396 1.00 33.60 ? 183 TRP A O   1 
ATOM   1477 C  CB  . TRP A 1 183 ? 25.915 81.693 52.293 1.00 30.35 ? 183 TRP A CB  1 
ATOM   1478 C  CG  . TRP A 1 183 ? 26.454 80.609 51.413 1.00 30.63 ? 183 TRP A CG  1 
ATOM   1479 C  CD1 . TRP A 1 183 ? 25.945 80.184 50.226 1.00 30.72 ? 183 TRP A CD1 1 
ATOM   1480 C  CD2 . TRP A 1 183 ? 27.576 79.767 51.692 1.00 29.44 ? 183 TRP A CD2 1 
ATOM   1481 N  NE1 . TRP A 1 183 ? 26.680 79.131 49.747 1.00 30.85 ? 183 TRP A NE1 1 
ATOM   1482 C  CE2 . TRP A 1 183 ? 27.688 78.856 50.629 1.00 30.50 ? 183 TRP A CE2 1 
ATOM   1483 C  CE3 . TRP A 1 183 ? 28.499 79.698 52.741 1.00 32.01 ? 183 TRP A CE3 1 
ATOM   1484 C  CZ2 . TRP A 1 183 ? 28.682 77.878 50.584 1.00 32.73 ? 183 TRP A CZ2 1 
ATOM   1485 C  CZ3 . TRP A 1 183 ? 29.486 78.730 52.699 1.00 32.82 ? 183 TRP A CZ3 1 
ATOM   1486 C  CH2 . TRP A 1 183 ? 29.572 77.832 51.624 1.00 32.61 ? 183 TRP A CH2 1 
ATOM   1487 N  N   . HIS A 1 184 ? 23.783 82.794 54.483 1.00 32.76 ? 184 HIS A N   1 
ATOM   1488 C  CA  . HIS A 1 184 ? 23.370 83.862 55.382 1.00 34.02 ? 184 HIS A CA  1 
ATOM   1489 C  C   . HIS A 1 184 ? 23.525 83.358 56.816 1.00 34.14 ? 184 HIS A C   1 
ATOM   1490 O  O   . HIS A 1 184 ? 24.046 84.060 57.683 1.00 35.42 ? 184 HIS A O   1 
ATOM   1491 C  CB  . HIS A 1 184 ? 21.912 84.243 55.098 1.00 35.22 ? 184 HIS A CB  1 
ATOM   1492 C  CG  . HIS A 1 184 ? 21.416 85.403 55.903 1.00 38.72 ? 184 HIS A CG  1 
ATOM   1493 N  ND1 . HIS A 1 184 ? 21.789 86.705 55.647 1.00 39.31 ? 184 HIS A ND1 1 
ATOM   1494 C  CD2 . HIS A 1 184 ? 20.585 85.451 56.973 1.00 38.60 ? 184 HIS A CD2 1 
ATOM   1495 C  CE1 . HIS A 1 184 ? 21.209 87.505 56.527 1.00 39.32 ? 184 HIS A CE1 1 
ATOM   1496 N  NE2 . HIS A 1 184 ? 20.473 86.768 57.341 1.00 38.95 ? 184 HIS A NE2 1 
ATOM   1497 N  N   . PHE A 1 185 ? 23.091 82.122 57.049 1.00 33.33 ? 185 PHE A N   1 
ATOM   1498 C  CA  . PHE A 1 185 ? 23.194 81.512 58.367 1.00 31.01 ? 185 PHE A CA  1 
ATOM   1499 C  C   . PHE A 1 185 ? 24.639 81.167 58.667 1.00 30.59 ? 185 PHE A C   1 
ATOM   1500 O  O   . PHE A 1 185 ? 25.103 81.351 59.788 1.00 31.87 ? 185 PHE A O   1 
ATOM   1501 C  CB  . PHE A 1 185 ? 22.332 80.244 58.452 1.00 29.32 ? 185 PHE A CB  1 
ATOM   1502 C  CG  . PHE A 1 185 ? 22.484 79.480 59.756 1.00 29.34 ? 185 PHE A CG  1 
ATOM   1503 C  CD1 . PHE A 1 185 ? 21.942 79.971 60.949 1.00 28.47 ? 185 PHE A CD1 1 
ATOM   1504 C  CD2 . PHE A 1 185 ? 23.172 78.268 59.785 1.00 25.35 ? 185 PHE A CD2 1 
ATOM   1505 C  CE1 . PHE A 1 185 ? 22.092 79.248 62.151 1.00 27.54 ? 185 PHE A CE1 1 
ATOM   1506 C  CE2 . PHE A 1 185 ? 23.322 77.551 60.960 1.00 25.55 ? 185 PHE A CE2 1 
ATOM   1507 C  CZ  . PHE A 1 185 ? 22.785 78.035 62.149 1.00 27.10 ? 185 PHE A CZ  1 
ATOM   1508 N  N   . VAL A 1 186 ? 25.364 80.664 57.675 1.00 31.13 ? 186 VAL A N   1 
ATOM   1509 C  CA  . VAL A 1 186 ? 26.758 80.316 57.922 1.00 31.44 ? 186 VAL A CA  1 
ATOM   1510 C  C   . VAL A 1 186 ? 27.523 81.576 58.330 1.00 33.18 ? 186 VAL A C   1 
ATOM   1511 O  O   . VAL A 1 186 ? 28.459 81.514 59.142 1.00 31.46 ? 186 VAL A O   1 
ATOM   1512 C  CB  . VAL A 1 186 ? 27.440 79.705 56.686 1.00 29.51 ? 186 VAL A CB  1 
ATOM   1513 C  CG1 . VAL A 1 186 ? 28.896 79.371 57.016 1.00 28.26 ? 186 VAL A CG1 1 
ATOM   1514 C  CG2 . VAL A 1 186 ? 26.711 78.460 56.250 1.00 30.42 ? 186 VAL A CG2 1 
ATOM   1515 N  N   . SER A 1 187 ? 27.119 82.715 57.765 1.00 34.02 ? 187 SER A N   1 
ATOM   1516 C  CA  . SER A 1 187 ? 27.767 83.986 58.073 1.00 35.19 ? 187 SER A CA  1 
ATOM   1517 C  C   . SER A 1 187 ? 27.480 84.391 59.514 1.00 37.01 ? 187 SER A C   1 
ATOM   1518 O  O   . SER A 1 187 ? 28.367 84.869 60.223 1.00 36.65 ? 187 SER A O   1 
ATOM   1519 C  CB  . SER A 1 187 ? 27.296 85.069 57.105 1.00 31.91 ? 187 SER A CB  1 
ATOM   1520 O  OG  . SER A 1 187 ? 27.751 84.764 55.800 1.00 31.43 ? 187 SER A OG  1 
ATOM   1521 N  N   . GLN A 1 188 ? 26.240 84.189 59.947 1.00 38.40 ? 188 GLN A N   1 
ATOM   1522 C  CA  . GLN A 1 188 ? 25.862 84.502 61.314 1.00 39.39 ? 188 GLN A CA  1 
ATOM   1523 C  C   . GLN A 1 188 ? 26.730 83.723 62.270 1.00 38.95 ? 188 GLN A C   1 
ATOM   1524 O  O   . GLN A 1 188 ? 27.282 84.273 63.218 1.00 40.09 ? 188 GLN A O   1 
ATOM   1525 C  CB  . GLN A 1 188 ? 24.426 84.090 61.603 1.00 44.39 ? 188 GLN A CB  1 
ATOM   1526 C  CG  . GLN A 1 188 ? 23.354 85.065 61.211 1.00 49.37 ? 188 GLN A CG  1 
ATOM   1527 C  CD  . GLN A 1 188 ? 22.045 84.752 61.919 1.00 53.49 ? 188 GLN A CD  1 
ATOM   1528 O  OE1 . GLN A 1 188 ? 20.978 85.222 61.514 1.00 53.13 ? 188 GLN A OE1 1 
ATOM   1529 N  NE2 . GLN A 1 188 ? 22.123 83.956 62.991 1.00 52.40 ? 188 GLN A NE2 1 
ATOM   1530 N  N   . CYS A 1 189 ? 26.814 82.420 62.032 1.00 38.50 ? 189 CYS A N   1 
ATOM   1531 C  CA  . CYS A 1 189 ? 27.596 81.544 62.890 1.00 37.95 ? 189 CYS A CA  1 
ATOM   1532 C  C   . CYS A 1 189 ? 29.035 81.998 63.007 1.00 38.46 ? 189 CYS A C   1 
ATOM   1533 O  O   . CYS A 1 189 ? 29.622 81.944 64.086 1.00 37.45 ? 189 CYS A O   1 
ATOM   1534 C  CB  . CYS A 1 189 ? 27.562 80.108 62.360 1.00 36.77 ? 189 CYS A CB  1 
ATOM   1535 S  SG  . CYS A 1 189 ? 25.957 79.324 62.469 1.00 37.94 ? 189 CYS A SG  1 
ATOM   1536 N  N   . TYR A 1 190 ? 29.600 82.437 61.888 1.00 39.95 ? 190 TYR A N   1 
ATOM   1537 C  CA  . TYR A 1 190 ? 30.983 82.883 61.853 1.00 42.26 ? 190 TYR A CA  1 
ATOM   1538 C  C   . TYR A 1 190 ? 31.144 84.148 62.685 1.00 42.72 ? 190 TYR A C   1 
ATOM   1539 O  O   . TYR A 1 190 ? 31.959 84.204 63.593 1.00 41.83 ? 190 TYR A O   1 
ATOM   1540 C  CB  . TYR A 1 190 ? 31.409 83.140 60.403 1.00 43.23 ? 190 TYR A CB  1 
ATOM   1541 C  CG  . TYR A 1 190 ? 32.829 83.620 60.268 1.00 45.16 ? 190 TYR A CG  1 
ATOM   1542 C  CD1 . TYR A 1 190 ? 33.892 82.837 60.715 1.00 45.76 ? 190 TYR A CD1 1 
ATOM   1543 C  CD2 . TYR A 1 190 ? 33.113 84.867 59.699 1.00 45.27 ? 190 TYR A CD2 1 
ATOM   1544 C  CE1 . TYR A 1 190 ? 35.212 83.283 60.598 1.00 48.30 ? 190 TYR A CE1 1 
ATOM   1545 C  CE2 . TYR A 1 190 ? 34.429 85.327 59.577 1.00 48.19 ? 190 TYR A CE2 1 
ATOM   1546 C  CZ  . TYR A 1 190 ? 35.474 84.529 60.027 1.00 48.90 ? 190 TYR A CZ  1 
ATOM   1547 O  OH  . TYR A 1 190 ? 36.777 84.977 59.898 1.00 53.21 ? 190 TYR A OH  1 
ATOM   1548 N  N   . GLU A 1 191 ? 30.359 85.165 62.361 1.00 44.43 ? 191 GLU A N   1 
ATOM   1549 C  CA  . GLU A 1 191 ? 30.418 86.418 63.090 1.00 47.18 ? 191 GLU A CA  1 
ATOM   1550 C  C   . GLU A 1 191 ? 30.352 86.164 64.590 1.00 48.56 ? 191 GLU A C   1 
ATOM   1551 O  O   . GLU A 1 191 ? 31.203 86.637 65.346 1.00 49.83 ? 191 GLU A O   1 
ATOM   1552 C  CB  . GLU A 1 191 ? 29.264 87.327 62.672 1.00 46.91 ? 191 GLU A CB  1 
ATOM   1553 C  CG  . GLU A 1 191 ? 28.918 88.406 63.677 1.00 50.14 ? 191 GLU A CG  1 
ATOM   1554 C  CD  . GLU A 1 191 ? 27.911 89.413 63.140 1.00 53.16 ? 191 GLU A CD  1 
ATOM   1555 O  OE1 . GLU A 1 191 ? 27.389 90.220 63.934 1.00 53.77 ? 191 GLU A OE1 1 
ATOM   1556 O  OE2 . GLU A 1 191 ? 27.641 89.414 61.921 1.00 57.83 ? 191 GLU A OE2 1 
ATOM   1557 N  N   . TRP A 1 192 ? 29.354 85.406 65.025 1.00 49.00 ? 192 TRP A N   1 
ATOM   1558 C  CA  . TRP A 1 192 ? 29.212 85.135 66.443 1.00 49.70 ? 192 TRP A CA  1 
ATOM   1559 C  C   . TRP A 1 192 ? 30.256 84.210 67.028 1.00 48.39 ? 192 TRP A C   1 
ATOM   1560 O  O   . TRP A 1 192 ? 30.477 84.218 68.228 1.00 49.15 ? 192 TRP A O   1 
ATOM   1561 C  CB  . TRP A 1 192 ? 27.828 84.597 66.734 1.00 54.06 ? 192 TRP A CB  1 
ATOM   1562 C  CG  . TRP A 1 192 ? 26.766 85.565 66.390 1.00 59.18 ? 192 TRP A CG  1 
ATOM   1563 C  CD1 . TRP A 1 192 ? 26.926 86.890 66.085 1.00 62.06 ? 192 TRP A CD1 1 
ATOM   1564 C  CD2 . TRP A 1 192 ? 25.362 85.305 66.334 1.00 63.29 ? 192 TRP A CD2 1 
ATOM   1565 N  NE1 . TRP A 1 192 ? 25.703 87.473 65.842 1.00 63.78 ? 192 TRP A NE1 1 
ATOM   1566 C  CE2 . TRP A 1 192 ? 24.724 86.524 65.988 1.00 64.07 ? 192 TRP A CE2 1 
ATOM   1567 C  CE3 . TRP A 1 192 ? 24.576 84.158 66.542 1.00 64.48 ? 192 TRP A CE3 1 
ATOM   1568 C  CZ2 . TRP A 1 192 ? 23.329 86.631 65.845 1.00 66.01 ? 192 TRP A CZ2 1 
ATOM   1569 C  CZ3 . TRP A 1 192 ? 23.183 84.264 66.400 1.00 66.08 ? 192 TRP A CZ3 1 
ATOM   1570 C  CH2 . TRP A 1 192 ? 22.576 85.497 66.054 1.00 66.29 ? 192 TRP A CH2 1 
ATOM   1571 N  N   . ALA A 1 193 ? 30.902 83.410 66.195 1.00 47.53 ? 193 ALA A N   1 
ATOM   1572 C  CA  . ALA A 1 193 ? 31.939 82.521 66.697 1.00 47.83 ? 193 ALA A CA  1 
ATOM   1573 C  C   . ALA A 1 193 ? 33.112 83.405 67.109 1.00 48.76 ? 193 ALA A C   1 
ATOM   1574 O  O   . ALA A 1 193 ? 33.760 83.170 68.132 1.00 49.31 ? 193 ALA A O   1 
ATOM   1575 C  CB  . ALA A 1 193 ? 32.374 81.545 65.611 1.00 46.32 ? 193 ALA A CB  1 
ATOM   1576 N  N   . LYS A 1 194 ? 33.368 84.428 66.298 1.00 48.48 ? 194 LYS A N   1 
ATOM   1577 C  CA  . LYS A 1 194 ? 34.455 85.364 66.543 1.00 49.96 ? 194 LYS A CA  1 
ATOM   1578 C  C   . LYS A 1 194 ? 34.170 86.264 67.736 1.00 51.23 ? 194 LYS A C   1 
ATOM   1579 O  O   . LYS A 1 194 ? 35.071 86.592 68.493 1.00 51.99 ? 194 LYS A O   1 
ATOM   1580 C  CB  . LYS A 1 194 ? 34.696 86.228 65.301 1.00 48.96 ? 194 LYS A CB  1 
ATOM   1581 C  CG  . LYS A 1 194 ? 35.683 85.644 64.295 1.00 47.35 ? 194 LYS A CG  1 
ATOM   1582 C  CD  . LYS A 1 194 ? 35.370 86.101 62.873 1.00 48.49 ? 194 LYS A CD  1 
ATOM   1583 C  CE  . LYS A 1 194 ? 35.395 87.612 62.697 1.00 48.86 ? 194 LYS A CE  1 
ATOM   1584 N  NZ  . LYS A 1 194 ? 34.815 88.030 61.378 1.00 48.27 ? 194 LYS A NZ  1 
ATOM   1585 N  N   . LYS A 1 195 ? 32.911 86.652 67.911 1.00 52.21 ? 195 LYS A N   1 
ATOM   1586 C  CA  . LYS A 1 195 ? 32.528 87.535 69.002 1.00 53.24 ? 195 LYS A CA  1 
ATOM   1587 C  C   . LYS A 1 195 ? 32.244 86.872 70.345 1.00 54.14 ? 195 LYS A C   1 
ATOM   1588 O  O   . LYS A 1 195 ? 32.665 87.370 71.387 1.00 55.61 ? 195 LYS A O   1 
ATOM   1589 C  CB  . LYS A 1 195 ? 31.316 88.364 68.589 1.00 54.85 ? 195 LYS A CB  1 
ATOM   1590 C  CG  . LYS A 1 195 ? 31.580 89.243 67.375 1.00 58.74 ? 195 LYS A CG  1 
ATOM   1591 C  CD  . LYS A 1 195 ? 30.377 90.102 67.031 1.00 61.44 ? 195 LYS A CD  1 
ATOM   1592 C  CE  . LYS A 1 195 ? 30.681 91.004 65.839 1.00 63.21 ? 195 LYS A CE  1 
ATOM   1593 N  NZ  . LYS A 1 195 ? 29.531 91.895 65.491 1.00 63.67 ? 195 LYS A NZ  1 
ATOM   1594 N  N   . GLU A 1 196 ? 31.528 85.758 70.335 1.00 53.87 ? 196 GLU A N   1 
ATOM   1595 C  CA  . GLU A 1 196 ? 31.192 85.080 71.577 1.00 53.62 ? 196 GLU A CA  1 
ATOM   1596 C  C   . GLU A 1 196 ? 31.864 83.737 71.732 1.00 52.98 ? 196 GLU A C   1 
ATOM   1597 O  O   . GLU A 1 196 ? 31.679 83.070 72.748 1.00 52.51 ? 196 GLU A O   1 
ATOM   1598 C  CB  . GLU A 1 196 ? 29.680 84.890 71.691 1.00 54.00 ? 196 GLU A CB  1 
ATOM   1599 C  CG  . GLU A 1 196 ? 28.916 86.178 71.893 1.00 59.74 ? 196 GLU A CG  1 
ATOM   1600 C  CD  . GLU A 1 196 ? 29.535 87.037 72.982 1.00 63.83 ? 196 GLU A CD  1 
ATOM   1601 O  OE1 . GLU A 1 196 ? 29.819 86.490 74.074 1.00 63.66 ? 196 GLU A OE1 1 
ATOM   1602 O  OE2 . GLU A 1 196 ? 29.740 88.252 72.744 1.00 66.44 ? 196 GLU A OE2 1 
ATOM   1603 N  N   . GLY A 1 197 ? 32.636 83.336 70.728 1.00 52.80 ? 197 GLY A N   1 
ATOM   1604 C  CA  . GLY A 1 197 ? 33.306 82.051 70.797 1.00 52.55 ? 197 GLY A CA  1 
ATOM   1605 C  C   . GLY A 1 197 ? 32.306 80.924 70.993 1.00 52.72 ? 197 GLY A C   1 
ATOM   1606 O  O   . GLY A 1 197 ? 31.179 80.968 70.475 1.00 52.54 ? 197 GLY A O   1 
ATOM   1607 N  N   . LEU A 1 198 ? 32.708 79.912 71.753 1.00 51.68 ? 198 LEU A N   1 
ATOM   1608 C  CA  . LEU A 1 198 ? 31.834 78.776 71.998 1.00 51.89 ? 198 LEU A CA  1 
ATOM   1609 C  C   . LEU A 1 198 ? 30.530 79.204 72.681 1.00 50.25 ? 198 LEU A C   1 
ATOM   1610 O  O   . LEU A 1 198 ? 29.585 78.428 72.781 1.00 50.71 ? 198 LEU A O   1 
ATOM   1611 C  CB  . LEU A 1 198 ? 32.555 77.742 72.853 1.00 53.51 ? 198 LEU A CB  1 
ATOM   1612 C  CG  . LEU A 1 198 ? 32.061 76.315 72.664 1.00 55.41 ? 198 LEU A CG  1 
ATOM   1613 C  CD1 . LEU A 1 198 ? 33.068 75.566 71.798 1.00 57.49 ? 198 LEU A CD1 1 
ATOM   1614 C  CD2 . LEU A 1 198 ? 31.907 75.637 74.021 1.00 55.87 ? 198 LEU A CD2 1 
ATOM   1615 N  N   . GLY A 1 199 ? 30.484 80.444 73.151 1.00 48.82 ? 199 GLY A N   1 
ATOM   1616 C  CA  . GLY A 1 199 ? 29.283 80.934 73.797 1.00 46.26 ? 199 GLY A CA  1 
ATOM   1617 C  C   . GLY A 1 199 ? 28.163 81.153 72.794 1.00 45.52 ? 199 GLY A C   1 
ATOM   1618 O  O   . GLY A 1 199 ? 26.979 81.112 73.148 1.00 45.42 ? 199 GLY A O   1 
ATOM   1619 N  N   . SER A 1 200 ? 28.525 81.390 71.535 1.00 44.16 ? 200 SER A N   1 
ATOM   1620 C  CA  . SER A 1 200 ? 27.523 81.603 70.491 1.00 43.31 ? 200 SER A CA  1 
ATOM   1621 C  C   . SER A 1 200 ? 26.682 80.339 70.308 1.00 42.92 ? 200 SER A C   1 
ATOM   1622 O  O   . SER A 1 200 ? 25.484 80.409 70.010 1.00 41.74 ? 200 SER A O   1 
ATOM   1623 C  CB  . SER A 1 200 ? 28.202 81.961 69.178 1.00 42.86 ? 200 SER A CB  1 
ATOM   1624 O  OG  . SER A 1 200 ? 29.139 80.964 68.821 1.00 44.82 ? 200 SER A OG  1 
ATOM   1625 N  N   . VAL A 1 201 ? 27.322 79.186 70.500 1.00 42.69 ? 201 VAL A N   1 
ATOM   1626 C  CA  . VAL A 1 201 ? 26.655 77.893 70.378 1.00 42.58 ? 201 VAL A CA  1 
ATOM   1627 C  C   . VAL A 1 201 ? 25.613 77.766 71.480 1.00 43.00 ? 201 VAL A C   1 
ATOM   1628 O  O   . VAL A 1 201 ? 24.481 77.317 71.246 1.00 42.71 ? 201 VAL A O   1 
ATOM   1629 C  CB  . VAL A 1 201 ? 27.676 76.732 70.489 1.00 42.25 ? 201 VAL A CB  1 
ATOM   1630 C  CG1 . VAL A 1 201 ? 26.960 75.398 70.529 1.00 42.04 ? 201 VAL A CG1 1 
ATOM   1631 C  CG2 . VAL A 1 201 ? 28.620 76.766 69.310 1.00 40.93 ? 201 VAL A CG2 1 
ATOM   1632 N  N   . ASP A 1 202 ? 26.006 78.174 72.682 1.00 42.85 ? 202 ASP A N   1 
ATOM   1633 C  CA  . ASP A 1 202 ? 25.134 78.150 73.851 1.00 43.16 ? 202 ASP A CA  1 
ATOM   1634 C  C   . ASP A 1 202 ? 23.879 78.974 73.542 1.00 43.82 ? 202 ASP A C   1 
ATOM   1635 O  O   . ASP A 1 202 ? 22.738 78.524 73.728 1.00 43.28 ? 202 ASP A O   1 
ATOM   1636 C  CB  . ASP A 1 202 ? 25.889 78.770 75.033 1.00 46.55 ? 202 ASP A CB  1 
ATOM   1637 C  CG  . ASP A 1 202 ? 25.156 78.626 76.360 1.00 47.32 ? 202 ASP A CG  1 
ATOM   1638 O  OD1 . ASP A 1 202 ? 23.914 78.751 76.403 1.00 49.19 ? 202 ASP A OD1 1 
ATOM   1639 O  OD2 . ASP A 1 202 ? 25.840 78.407 77.375 1.00 49.80 ? 202 ASP A OD2 1 
ATOM   1640 N  N   . TYR A 1 203 ? 24.102 80.195 73.067 1.00 44.24 ? 203 TYR A N   1 
ATOM   1641 C  CA  . TYR A 1 203 ? 23.006 81.094 72.729 1.00 44.60 ? 203 TYR A CA  1 
ATOM   1642 C  C   . TYR A 1 203 ? 22.124 80.466 71.647 1.00 43.66 ? 203 TYR A C   1 
ATOM   1643 O  O   . TYR A 1 203 ? 20.897 80.463 71.762 1.00 42.98 ? 203 TYR A O   1 
ATOM   1644 C  CB  . TYR A 1 203 ? 23.570 82.430 72.239 1.00 47.31 ? 203 TYR A CB  1 
ATOM   1645 C  CG  . TYR A 1 203 ? 22.516 83.415 71.786 1.00 50.89 ? 203 TYR A CG  1 
ATOM   1646 C  CD1 . TYR A 1 203 ? 21.625 83.984 72.698 1.00 52.28 ? 203 TYR A CD1 1 
ATOM   1647 C  CD2 . TYR A 1 203 ? 22.427 83.800 70.448 1.00 53.02 ? 203 TYR A CD2 1 
ATOM   1648 C  CE1 . TYR A 1 203 ? 20.671 84.925 72.290 1.00 54.04 ? 203 TYR A CE1 1 
ATOM   1649 C  CE2 . TYR A 1 203 ? 21.476 84.735 70.023 1.00 55.18 ? 203 TYR A CE2 1 
ATOM   1650 C  CZ  . TYR A 1 203 ? 20.606 85.297 70.950 1.00 56.57 ? 203 TYR A CZ  1 
ATOM   1651 O  OH  . TYR A 1 203 ? 19.701 86.253 70.538 1.00 56.50 ? 203 TYR A OH  1 
ATOM   1652 N  N   . TYR A 1 204 ? 22.761 79.943 70.599 1.00 43.26 ? 204 TYR A N   1 
ATOM   1653 C  CA  . TYR A 1 204 ? 22.061 79.301 69.481 1.00 42.85 ? 204 TYR A CA  1 
ATOM   1654 C  C   . TYR A 1 204 ? 21.079 78.237 69.971 1.00 42.92 ? 204 TYR A C   1 
ATOM   1655 O  O   . TYR A 1 204 ? 19.908 78.230 69.599 1.00 42.05 ? 204 TYR A O   1 
ATOM   1656 C  CB  . TYR A 1 204 ? 23.074 78.646 68.526 1.00 40.90 ? 204 TYR A CB  1 
ATOM   1657 C  CG  . TYR A 1 204 ? 22.431 77.839 67.421 1.00 38.89 ? 204 TYR A CG  1 
ATOM   1658 C  CD1 . TYR A 1 204 ? 21.832 78.472 66.334 1.00 38.61 ? 204 TYR A CD1 1 
ATOM   1659 C  CD2 . TYR A 1 204 ? 22.385 76.443 67.478 1.00 37.06 ? 204 TYR A CD2 1 
ATOM   1660 C  CE1 . TYR A 1 204 ? 21.201 77.745 65.334 1.00 36.38 ? 204 TYR A CE1 1 
ATOM   1661 C  CE2 . TYR A 1 204 ? 21.755 75.704 66.477 1.00 34.61 ? 204 TYR A CE2 1 
ATOM   1662 C  CZ  . TYR A 1 204 ? 21.167 76.365 65.412 1.00 36.01 ? 204 TYR A CZ  1 
ATOM   1663 O  OH  . TYR A 1 204 ? 20.530 75.665 64.415 1.00 36.63 ? 204 TYR A OH  1 
ATOM   1664 N  N   . ILE A 1 205 ? 21.570 77.338 70.814 1.00 44.82 ? 205 ILE A N   1 
ATOM   1665 C  CA  . ILE A 1 205 ? 20.745 76.262 71.353 1.00 47.05 ? 205 ILE A CA  1 
ATOM   1666 C  C   . ILE A 1 205 ? 19.646 76.718 72.321 1.00 50.02 ? 205 ILE A C   1 
ATOM   1667 O  O   . ILE A 1 205 ? 18.453 76.494 72.089 1.00 48.66 ? 205 ILE A O   1 
ATOM   1668 C  CB  . ILE A 1 205 ? 21.611 75.235 72.110 1.00 45.63 ? 205 ILE A CB  1 
ATOM   1669 C  CG1 . ILE A 1 205 ? 22.640 74.619 71.163 1.00 43.77 ? 205 ILE A CG1 1 
ATOM   1670 C  CG2 . ILE A 1 205 ? 20.720 74.164 72.732 1.00 43.53 ? 205 ILE A CG2 1 
ATOM   1671 C  CD1 . ILE A 1 205 ? 23.554 73.606 71.816 1.00 42.79 ? 205 ILE A CD1 1 
ATOM   1672 N  N   . ASN A 1 206 ? 20.063 77.347 73.414 1.00 53.68 ? 206 ASN A N   1 
ATOM   1673 C  CA  . ASN A 1 206 ? 19.132 77.777 74.449 1.00 57.41 ? 206 ASN A CA  1 
ATOM   1674 C  C   . ASN A 1 206 ? 18.269 78.974 74.170 1.00 59.34 ? 206 ASN A C   1 
ATOM   1675 O  O   . ASN A 1 206 ? 17.140 79.043 74.637 1.00 59.41 ? 206 ASN A O   1 
ATOM   1676 C  CB  . ASN A 1 206 ? 19.888 78.026 75.743 1.00 57.30 ? 206 ASN A CB  1 
ATOM   1677 C  CG  . ASN A 1 206 ? 20.689 76.830 76.162 1.00 59.69 ? 206 ASN A CG  1 
ATOM   1678 O  OD1 . ASN A 1 206 ? 20.159 75.719 76.259 1.00 61.62 ? 206 ASN A OD1 1 
ATOM   1679 N  ND2 . ASN A 1 206 ? 21.977 77.037 76.405 1.00 60.99 ? 206 ASN A ND2 1 
ATOM   1680 N  N   . GLU A 1 207 ? 18.779 79.911 73.393 1.00 63.36 ? 207 GLU A N   1 
ATOM   1681 C  CA  . GLU A 1 207 ? 18.029 81.125 73.148 1.00 67.18 ? 207 GLU A CA  1 
ATOM   1682 C  C   . GLU A 1 207 ? 17.209 81.229 71.881 1.00 67.94 ? 207 GLU A C   1 
ATOM   1683 O  O   . GLU A 1 207 ? 16.173 81.897 71.874 1.00 68.90 ? 207 GLU A O   1 
ATOM   1684 C  CB  . GLU A 1 207 ? 18.989 82.304 73.233 1.00 70.76 ? 207 GLU A CB  1 
ATOM   1685 C  CG  . GLU A 1 207 ? 19.743 82.358 74.560 1.00 76.77 ? 207 GLU A CG  1 
ATOM   1686 C  CD  . GLU A 1 207 ? 18.904 82.947 75.685 1.00 79.82 ? 207 GLU A CD  1 
ATOM   1687 O  OE1 . GLU A 1 207 ? 17.691 82.648 75.738 1.00 82.44 ? 207 GLU A OE1 1 
ATOM   1688 O  OE2 . GLU A 1 207 ? 19.459 83.704 76.518 1.00 83.54 ? 207 GLU A OE2 1 
ATOM   1689 N  N   . LEU A 1 208 ? 17.640 80.584 70.807 1.00 68.68 ? 208 LEU A N   1 
ATOM   1690 C  CA  . LEU A 1 208 ? 16.870 80.724 69.591 1.00 68.99 ? 208 LEU A CA  1 
ATOM   1691 C  C   . LEU A 1 208 ? 16.290 79.449 68.980 1.00 68.48 ? 208 LEU A C   1 
ATOM   1692 O  O   . LEU A 1 208 ? 15.519 79.523 68.025 1.00 69.68 ? 208 LEU A O   1 
ATOM   1693 C  CB  . LEU A 1 208 ? 17.683 81.539 68.569 1.00 70.47 ? 208 LEU A CB  1 
ATOM   1694 C  CG  . LEU A 1 208 ? 18.251 80.964 67.272 1.00 71.16 ? 208 LEU A CG  1 
ATOM   1695 C  CD1 . LEU A 1 208 ? 18.858 82.093 66.444 1.00 70.40 ? 208 LEU A CD1 1 
ATOM   1696 C  CD2 . LEU A 1 208 ? 19.287 79.916 67.584 1.00 71.41 ? 208 LEU A CD2 1 
ATOM   1697 N  N   . VAL A 1 209 ? 16.628 78.280 69.513 1.00 66.44 ? 209 VAL A N   1 
ATOM   1698 C  CA  . VAL A 1 209 ? 16.037 77.062 68.969 1.00 63.93 ? 209 VAL A CA  1 
ATOM   1699 C  C   . VAL A 1 209 ? 15.171 76.393 70.025 1.00 64.28 ? 209 VAL A C   1 
ATOM   1700 O  O   . VAL A 1 209 ? 13.979 76.142 69.815 1.00 63.25 ? 209 VAL A O   1 
ATOM   1701 C  CB  . VAL A 1 209 ? 17.095 76.040 68.511 1.00 61.55 ? 209 VAL A CB  1 
ATOM   1702 C  CG1 . VAL A 1 209 ? 16.411 74.795 67.993 1.00 60.30 ? 209 VAL A CG1 1 
ATOM   1703 C  CG2 . VAL A 1 209 ? 17.961 76.622 67.430 1.00 59.84 ? 209 VAL A CG2 1 
ATOM   1704 N  N   . HIS A 1 210 ? 15.786 76.126 71.172 1.00 64.52 ? 210 HIS A N   1 
ATOM   1705 C  CA  . HIS A 1 210 ? 15.113 75.461 72.281 1.00 65.70 ? 210 HIS A CA  1 
ATOM   1706 C  C   . HIS A 1 210 ? 14.771 76.391 73.422 1.00 66.92 ? 210 HIS A C   1 
ATOM   1707 O  O   . HIS A 1 210 ? 14.938 76.039 74.588 1.00 65.65 ? 210 HIS A O   1 
ATOM   1708 C  CB  . HIS A 1 210 ? 15.975 74.306 72.794 1.00 65.41 ? 210 HIS A CB  1 
ATOM   1709 C  CG  . HIS A 1 210 ? 16.190 73.225 71.775 1.00 66.40 ? 210 HIS A CG  1 
ATOM   1710 N  ND1 . HIS A 1 210 ? 15.204 72.325 71.425 1.00 66.07 ? 210 HIS A ND1 1 
ATOM   1711 C  CD2 . HIS A 1 210 ? 17.248 72.948 70.975 1.00 65.20 ? 210 HIS A CD2 1 
ATOM   1712 C  CE1 . HIS A 1 210 ? 15.643 71.544 70.455 1.00 65.54 ? 210 HIS A CE1 1 
ATOM   1713 N  NE2 . HIS A 1 210 ? 16.881 71.902 70.162 1.00 66.32 ? 210 HIS A NE2 1 
ATOM   1714 N  N   . LYS A 1 211 ? 14.315 77.592 73.083 1.00 69.23 ? 211 LYS A N   1 
ATOM   1715 C  CA  . LYS A 1 211 ? 13.906 78.549 74.100 1.00 71.70 ? 211 LYS A CA  1 
ATOM   1716 C  C   . LYS A 1 211 ? 12.654 77.910 74.688 1.00 74.40 ? 211 LYS A C   1 
ATOM   1717 O  O   . LYS A 1 211 ? 11.690 77.648 73.958 1.00 75.08 ? 211 LYS A O   1 
ATOM   1718 C  CB  . LYS A 1 211 ? 13.560 79.911 73.470 1.00 70.46 ? 211 LYS A CB  1 
ATOM   1719 C  CG  . LYS A 1 211 ? 12.454 79.856 72.398 1.00 71.27 ? 211 LYS A CG  1 
ATOM   1720 C  CD  . LYS A 1 211 ? 11.733 81.203 72.209 1.00 71.20 ? 211 LYS A CD  1 
ATOM   1721 C  CE  . LYS A 1 211 ? 12.634 82.260 71.587 1.00 70.39 ? 211 LYS A CE  1 
ATOM   1722 N  NZ  . LYS A 1 211 ? 12.973 81.939 70.175 1.00 68.86 ? 211 LYS A NZ  1 
ATOM   1723 N  N   . LYS A 1 212 ? 12.675 77.621 75.986 1.00 76.40 ? 212 LYS A N   1 
ATOM   1724 C  CA  . LYS A 1 212 ? 11.511 77.013 76.605 1.00 78.80 ? 212 LYS A CA  1 
ATOM   1725 C  C   . LYS A 1 212 ? 10.288 77.905 76.422 1.00 80.08 ? 212 LYS A C   1 
ATOM   1726 O  O   . LYS A 1 212 ? 10.113 78.907 77.127 1.00 80.55 ? 212 LYS A O   1 
ATOM   1727 C  CB  . LYS A 1 212 ? 11.769 76.729 78.087 1.00 78.54 ? 212 LYS A CB  1 
ATOM   1728 C  CG  . LYS A 1 212 ? 12.235 75.310 78.330 1.00 78.88 ? 212 LYS A CG  1 
ATOM   1729 C  CD  . LYS A 1 212 ? 12.282 74.967 79.800 1.00 80.72 ? 212 LYS A CD  1 
ATOM   1730 C  CE  . LYS A 1 212 ? 12.433 73.456 79.993 1.00 82.44 ? 212 LYS A CE  1 
ATOM   1731 N  NZ  . LYS A 1 212 ? 13.645 72.904 79.316 1.00 83.12 ? 212 LYS A NZ  1 
ATOM   1732 N  N   . LEU A 1 213 ? 9.456  77.531 75.450 1.00 81.08 ? 213 LEU A N   1 
ATOM   1733 C  CA  . LEU A 1 213 ? 8.250  78.276 75.118 1.00 82.12 ? 213 LEU A CA  1 
ATOM   1734 C  C   . LEU A 1 213 ? 8.624  79.664 74.572 1.00 83.39 ? 213 LEU A C   1 
ATOM   1735 O  O   . LEU A 1 213 ? 9.393  80.386 75.255 1.00 83.50 ? 213 LEU A O   1 
ATOM   1736 C  CB  . LEU A 1 213 ? 7.339  78.395 76.348 1.00 81.28 ? 213 LEU A CB  1 
ATOM   1737 C  CG  . LEU A 1 213 ? 6.114  79.306 76.222 1.00 80.64 ? 213 LEU A CG  1 
ATOM   1738 C  CD1 . LEU A 1 213 ? 5.273  78.886 75.017 1.00 80.33 ? 213 LEU A CD1 1 
ATOM   1739 C  CD2 . LEU A 1 213 ? 5.296  79.258 77.511 1.00 78.15 ? 213 LEU A CD2 1 
ATOM   1740 O  OXT . LEU A 1 213 ? 8.137  80.002 73.448 1.00 85.10 ? 213 LEU A OXT 1 
ATOM   1741 N  N   . MET B 1 1   ? 42.696 40.307 42.635 1.00 43.95 ? 1   MET B N   1 
ATOM   1742 C  CA  . MET B 1 1   ? 41.429 40.953 42.201 1.00 44.64 ? 1   MET B CA  1 
ATOM   1743 C  C   . MET B 1 1   ? 40.245 40.039 42.212 1.00 43.74 ? 1   MET B C   1 
ATOM   1744 O  O   . MET B 1 1   ? 40.164 39.057 41.463 1.00 44.77 ? 1   MET B O   1 
ATOM   1745 C  CB  . MET B 1 1   ? 41.563 41.577 40.823 1.00 45.88 ? 1   MET B CB  1 
ATOM   1746 C  CG  . MET B 1 1   ? 42.350 42.866 40.885 1.00 47.88 ? 1   MET B CG  1 
ATOM   1747 S  SD  . MET B 1 1   ? 42.008 43.929 39.519 1.00 53.95 ? 1   MET B SD  1 
ATOM   1748 C  CE  . MET B 1 1   ? 41.539 42.678 38.222 1.00 46.59 ? 1   MET B CE  1 
ATOM   1749 N  N   . PHE B 1 2   ? 39.294 40.432 43.045 1.00 41.43 ? 2   PHE B N   1 
ATOM   1750 C  CA  . PHE B 1 2   ? 38.085 39.680 43.272 1.00 38.47 ? 2   PHE B CA  1 
ATOM   1751 C  C   . PHE B 1 2   ? 36.879 40.069 42.439 1.00 37.84 ? 2   PHE B C   1 
ATOM   1752 O  O   . PHE B 1 2   ? 36.821 41.126 41.820 1.00 35.89 ? 2   PHE B O   1 
ATOM   1753 C  CB  . PHE B 1 2   ? 37.763 39.778 44.744 1.00 35.25 ? 2   PHE B CB  1 
ATOM   1754 C  CG  . PHE B 1 2   ? 38.977 39.729 45.603 1.00 33.94 ? 2   PHE B CG  1 
ATOM   1755 C  CD1 . PHE B 1 2   ? 39.782 40.858 45.759 1.00 32.48 ? 2   PHE B CD1 1 
ATOM   1756 C  CD2 . PHE B 1 2   ? 39.354 38.535 46.210 1.00 32.07 ? 2   PHE B CD2 1 
ATOM   1757 C  CE1 . PHE B 1 2   ? 40.948 40.794 46.510 1.00 33.42 ? 2   PHE B CE1 1 
ATOM   1758 C  CE2 . PHE B 1 2   ? 40.502 38.453 46.953 1.00 31.92 ? 2   PHE B CE2 1 
ATOM   1759 C  CZ  . PHE B 1 2   ? 41.310 39.582 47.110 1.00 36.20 ? 2   PHE B CZ  1 
ATOM   1760 N  N   . THR B 1 3   ? 35.911 39.175 42.433 1.00 37.43 ? 3   THR B N   1 
ATOM   1761 C  CA  . THR B 1 3   ? 34.699 39.389 41.687 1.00 37.16 ? 3   THR B CA  1 
ATOM   1762 C  C   . THR B 1 3   ? 33.526 39.198 42.654 1.00 37.52 ? 3   THR B C   1 
ATOM   1763 O  O   . THR B 1 3   ? 33.585 38.377 43.573 1.00 38.04 ? 3   THR B O   1 
ATOM   1764 C  CB  . THR B 1 3   ? 34.621 38.390 40.506 1.00 36.37 ? 3   THR B CB  1 
ATOM   1765 O  OG1 . THR B 1 3   ? 33.575 38.782 39.610 1.00 35.60 ? 3   THR B OG1 1 
ATOM   1766 C  CG2 . THR B 1 3   ? 34.358 36.990 41.004 1.00 30.85 ? 3   THR B CG2 1 
ATOM   1767 N  N   . LEU B 1 4   ? 32.472 39.978 42.452 1.00 36.40 ? 4   LEU B N   1 
ATOM   1768 C  CA  . LEU B 1 4   ? 31.291 39.918 43.299 1.00 34.88 ? 4   LEU B CA  1 
ATOM   1769 C  C   . LEU B 1 4   ? 30.676 38.525 43.300 1.00 33.21 ? 4   LEU B C   1 
ATOM   1770 O  O   . LEU B 1 4   ? 30.471 37.938 42.250 1.00 33.14 ? 4   LEU B O   1 
ATOM   1771 C  CB  . LEU B 1 4   ? 30.263 40.951 42.808 1.00 32.34 ? 4   LEU B CB  1 
ATOM   1772 C  CG  . LEU B 1 4   ? 28.919 41.000 43.533 1.00 32.21 ? 4   LEU B CG  1 
ATOM   1773 C  CD1 . LEU B 1 4   ? 29.157 41.299 45.016 1.00 31.19 ? 4   LEU B CD1 1 
ATOM   1774 C  CD2 . LEU B 1 4   ? 28.021 42.066 42.892 1.00 30.35 ? 4   LEU B CD2 1 
ATOM   1775 N  N   . ARG B 1 5   ? 30.373 37.995 44.477 1.00 33.45 ? 5   ARG B N   1 
ATOM   1776 C  CA  . ARG B 1 5   ? 29.768 36.678 44.548 1.00 34.89 ? 5   ARG B CA  1 
ATOM   1777 C  C   . ARG B 1 5   ? 28.333 36.730 44.059 1.00 37.21 ? 5   ARG B C   1 
ATOM   1778 O  O   . ARG B 1 5   ? 27.680 37.770 44.091 1.00 39.32 ? 5   ARG B O   1 
ATOM   1779 C  CB  . ARG B 1 5   ? 29.743 36.150 45.980 1.00 35.84 ? 5   ARG B CB  1 
ATOM   1780 C  CG  . ARG B 1 5   ? 28.766 36.903 46.899 1.00 37.42 ? 5   ARG B CG  1 
ATOM   1781 C  CD  . ARG B 1 5   ? 28.556 36.173 48.217 1.00 36.40 ? 5   ARG B CD  1 
ATOM   1782 N  NE  . ARG B 1 5   ? 27.941 34.864 48.000 1.00 39.38 ? 5   ARG B NE  1 
ATOM   1783 C  CZ  . ARG B 1 5   ? 27.718 33.967 48.955 1.00 36.68 ? 5   ARG B CZ  1 
ATOM   1784 N  NH1 . ARG B 1 5   ? 28.056 34.228 50.206 1.00 36.37 ? 5   ARG B NH1 1 
ATOM   1785 N  NH2 . ARG B 1 5   ? 27.159 32.805 48.654 1.00 37.61 ? 5   ARG B NH2 1 
ATOM   1786 N  N   . GLU B 1 6   ? 27.854 35.577 43.631 1.00 37.77 ? 6   GLU B N   1 
ATOM   1787 C  CA  . GLU B 1 6   ? 26.500 35.393 43.157 1.00 39.04 ? 6   GLU B CA  1 
ATOM   1788 C  C   . GLU B 1 6   ? 25.640 35.296 44.422 1.00 38.63 ? 6   GLU B C   1 
ATOM   1789 O  O   . GLU B 1 6   ? 26.076 34.747 45.433 1.00 37.96 ? 6   GLU B O   1 
ATOM   1790 C  CB  . GLU B 1 6   ? 26.436 34.073 42.397 1.00 42.16 ? 6   GLU B CB  1 
ATOM   1791 C  CG  . GLU B 1 6   ? 25.276 33.895 41.458 1.00 52.09 ? 6   GLU B CG  1 
ATOM   1792 C  CD  . GLU B 1 6   ? 25.424 34.731 40.205 1.00 57.68 ? 6   GLU B CD  1 
ATOM   1793 O  OE1 . GLU B 1 6   ? 26.558 34.823 39.687 1.00 62.03 ? 6   GLU B OE1 1 
ATOM   1794 O  OE2 . GLU B 1 6   ? 24.408 35.289 39.732 1.00 61.61 ? 6   GLU B OE2 1 
ATOM   1795 N  N   . LEU B 1 7   ? 24.429 35.837 44.386 1.00 37.04 ? 7   LEU B N   1 
ATOM   1796 C  CA  . LEU B 1 7   ? 23.553 35.749 45.551 1.00 35.36 ? 7   LEU B CA  1 
ATOM   1797 C  C   . LEU B 1 7   ? 23.161 34.262 45.675 1.00 34.06 ? 7   LEU B C   1 
ATOM   1798 O  O   . LEU B 1 7   ? 22.865 33.598 44.682 1.00 34.59 ? 7   LEU B O   1 
ATOM   1799 C  CB  . LEU B 1 7   ? 22.326 36.647 45.339 1.00 35.88 ? 7   LEU B CB  1 
ATOM   1800 C  CG  . LEU B 1 7   ? 21.921 37.696 46.390 1.00 38.74 ? 7   LEU B CG  1 
ATOM   1801 C  CD1 . LEU B 1 7   ? 23.112 38.248 47.176 1.00 34.78 ? 7   LEU B CD1 1 
ATOM   1802 C  CD2 . LEU B 1 7   ? 21.187 38.824 45.670 1.00 36.49 ? 7   LEU B CD2 1 
ATOM   1803 N  N   . PRO B 1 8   ? 23.175 33.713 46.894 1.00 32.72 ? 8   PRO B N   1 
ATOM   1804 C  CA  . PRO B 1 8   ? 22.826 32.302 47.084 1.00 31.73 ? 8   PRO B CA  1 
ATOM   1805 C  C   . PRO B 1 8   ? 21.342 31.965 47.017 1.00 30.38 ? 8   PRO B C   1 
ATOM   1806 O  O   . PRO B 1 8   ? 20.928 30.901 47.448 1.00 31.39 ? 8   PRO B O   1 
ATOM   1807 C  CB  . PRO B 1 8   ? 23.419 31.989 48.461 1.00 31.74 ? 8   PRO B CB  1 
ATOM   1808 C  CG  . PRO B 1 8   ? 23.202 33.264 49.192 1.00 32.61 ? 8   PRO B CG  1 
ATOM   1809 C  CD  . PRO B 1 8   ? 23.584 34.331 48.169 1.00 32.37 ? 8   PRO B CD  1 
ATOM   1810 N  N   . PHE B 1 9   ? 20.535 32.871 46.497 1.00 29.32 ? 9   PHE B N   1 
ATOM   1811 C  CA  . PHE B 1 9   ? 19.102 32.631 46.405 1.00 27.76 ? 9   PHE B CA  1 
ATOM   1812 C  C   . PHE B 1 9   ? 18.560 33.623 45.378 1.00 27.05 ? 9   PHE B C   1 
ATOM   1813 O  O   . PHE B 1 9   ? 19.309 34.466 44.899 1.00 25.80 ? 9   PHE B O   1 
ATOM   1814 C  CB  . PHE B 1 9   ? 18.476 32.832 47.788 1.00 26.13 ? 9   PHE B CB  1 
ATOM   1815 C  CG  . PHE B 1 9   ? 18.993 34.055 48.506 1.00 26.90 ? 9   PHE B CG  1 
ATOM   1816 C  CD1 . PHE B 1 9   ? 18.671 35.338 48.054 1.00 23.91 ? 9   PHE B CD1 1 
ATOM   1817 C  CD2 . PHE B 1 9   ? 19.837 33.929 49.608 1.00 27.98 ? 9   PHE B CD2 1 
ATOM   1818 C  CE1 . PHE B 1 9   ? 19.180 36.477 48.684 1.00 26.13 ? 9   PHE B CE1 1 
ATOM   1819 C  CE2 . PHE B 1 9   ? 20.362 35.072 50.254 1.00 28.47 ? 9   PHE B CE2 1 
ATOM   1820 C  CZ  . PHE B 1 9   ? 20.031 36.350 49.789 1.00 26.20 ? 9   PHE B CZ  1 
ATOM   1821 N  N   . ALA B 1 10  ? 17.284 33.512 45.019 1.00 27.99 ? 10  ALA B N   1 
ATOM   1822 C  CA  . ALA B 1 10  ? 16.694 34.423 44.027 1.00 29.26 ? 10  ALA B CA  1 
ATOM   1823 C  C   . ALA B 1 10  ? 16.258 35.725 44.690 1.00 28.76 ? 10  ALA B C   1 
ATOM   1824 O  O   . ALA B 1 10  ? 15.765 35.714 45.815 1.00 29.10 ? 10  ALA B O   1 
ATOM   1825 C  CB  . ALA B 1 10  ? 15.506 33.763 43.351 1.00 30.07 ? 10  ALA B CB  1 
ATOM   1826 N  N   . LYS B 1 11  ? 16.437 36.838 43.988 1.00 28.79 ? 11  LYS B N   1 
ATOM   1827 C  CA  . LYS B 1 11  ? 16.086 38.147 44.527 1.00 29.05 ? 11  LYS B CA  1 
ATOM   1828 C  C   . LYS B 1 11  ? 14.636 38.330 44.953 1.00 30.21 ? 11  LYS B C   1 
ATOM   1829 O  O   . LYS B 1 11  ? 14.339 39.229 45.742 1.00 30.75 ? 11  LYS B O   1 
ATOM   1830 C  CB  . LYS B 1 11  ? 16.458 39.236 43.526 1.00 29.55 ? 11  LYS B CB  1 
ATOM   1831 C  CG  . LYS B 1 11  ? 17.959 39.389 43.352 1.00 32.16 ? 11  LYS B CG  1 
ATOM   1832 C  CD  . LYS B 1 11  ? 18.329 40.595 42.520 1.00 32.30 ? 11  LYS B CD  1 
ATOM   1833 C  CE  . LYS B 1 11  ? 19.833 40.781 42.522 1.00 34.13 ? 11  LYS B CE  1 
ATOM   1834 N  NZ  . LYS B 1 11  ? 20.202 41.968 41.710 1.00 38.77 ? 11  LYS B NZ  1 
ATOM   1835 N  N   . ASP B 1 12  ? 13.745 37.473 44.453 1.00 29.27 ? 12  ASP B N   1 
ATOM   1836 C  CA  . ASP B 1 12  ? 12.327 37.552 44.764 1.00 29.56 ? 12  ASP B CA  1 
ATOM   1837 C  C   . ASP B 1 12  ? 11.872 36.458 45.715 1.00 30.13 ? 12  ASP B C   1 
ATOM   1838 O  O   . ASP B 1 12  ? 10.679 36.222 45.871 1.00 29.80 ? 12  ASP B O   1 
ATOM   1839 C  CB  . ASP B 1 12  ? 11.522 37.442 43.468 1.00 34.64 ? 12  ASP B CB  1 
ATOM   1840 C  CG  . ASP B 1 12  ? 11.658 36.068 42.809 1.00 40.19 ? 12  ASP B CG  1 
ATOM   1841 O  OD1 . ASP B 1 12  ? 12.691 35.394 43.010 1.00 41.97 ? 12  ASP B OD1 1 
ATOM   1842 O  OD2 . ASP B 1 12  ? 10.736 35.660 42.074 1.00 45.65 ? 12  ASP B OD2 1 
ATOM   1843 N  N   . SER B 1 13  ? 12.815 35.797 46.371 1.00 30.77 ? 13  SER B N   1 
ATOM   1844 C  CA  . SER B 1 13  ? 12.469 34.701 47.266 1.00 30.05 ? 13  SER B CA  1 
ATOM   1845 C  C   . SER B 1 13  ? 12.167 35.052 48.719 1.00 30.25 ? 13  SER B C   1 
ATOM   1846 O  O   . SER B 1 13  ? 11.826 34.169 49.496 1.00 31.03 ? 13  SER B O   1 
ATOM   1847 C  CB  . SER B 1 13  ? 13.582 33.650 47.240 1.00 31.25 ? 13  SER B CB  1 
ATOM   1848 O  OG  . SER B 1 13  ? 14.786 34.162 47.796 1.00 32.69 ? 13  SER B OG  1 
ATOM   1849 N  N   . MET B 1 14  ? 12.270 36.315 49.102 1.00 29.63 ? 14  MET B N   1 
ATOM   1850 C  CA  . MET B 1 14  ? 12.013 36.686 50.502 1.00 31.94 ? 14  MET B CA  1 
ATOM   1851 C  C   . MET B 1 14  ? 11.203 37.981 50.586 1.00 29.92 ? 14  MET B C   1 
ATOM   1852 O  O   . MET B 1 14  ? 11.622 38.932 51.239 1.00 28.61 ? 14  MET B O   1 
ATOM   1853 C  CB  . MET B 1 14  ? 13.342 36.886 51.241 1.00 33.72 ? 14  MET B CB  1 
ATOM   1854 C  CG  . MET B 1 14  ? 14.152 35.631 51.474 1.00 38.57 ? 14  MET B CG  1 
ATOM   1855 S  SD  . MET B 1 14  ? 15.893 36.032 51.832 1.00 42.19 ? 14  MET B SD  1 
ATOM   1856 C  CE  . MET B 1 14  ? 16.693 34.560 51.222 1.00 37.32 ? 14  MET B CE  1 
ATOM   1857 N  N   . GLY B 1 15  ? 10.043 37.989 49.939 1.00 29.80 ? 15  GLY B N   1 
ATOM   1858 C  CA  . GLY B 1 15  ? 9.188  39.166 49.885 1.00 28.01 ? 15  GLY B CA  1 
ATOM   1859 C  C   . GLY B 1 15  ? 8.676  39.809 51.152 1.00 26.16 ? 15  GLY B C   1 
ATOM   1860 O  O   . GLY B 1 15  ? 8.246  40.958 51.122 1.00 27.13 ? 15  GLY B O   1 
ATOM   1861 N  N   . ASP B 1 16  ? 8.688  39.081 52.257 1.00 25.12 ? 16  ASP B N   1 
ATOM   1862 C  CA  . ASP B 1 16  ? 8.234  39.644 53.516 1.00 24.74 ? 16  ASP B CA  1 
ATOM   1863 C  C   . ASP B 1 16  ? 9.385  40.386 54.209 1.00 25.73 ? 16  ASP B C   1 
ATOM   1864 O  O   . ASP B 1 16  ? 9.195  41.059 55.232 1.00 24.94 ? 16  ASP B O   1 
ATOM   1865 C  CB  . ASP B 1 16  ? 7.780  38.529 54.434 1.00 26.79 ? 16  ASP B CB  1 
ATOM   1866 C  CG  . ASP B 1 16  ? 8.914  37.585 54.785 1.00 30.58 ? 16  ASP B CG  1 
ATOM   1867 O  OD1 . ASP B 1 16  ? 9.523  37.010 53.860 1.00 30.12 ? 16  ASP B OD1 1 
ATOM   1868 O  OD2 . ASP B 1 16  ? 9.206  37.425 55.982 1.00 31.55 ? 16  ASP B OD2 1 
ATOM   1869 N  N   . PHE B 1 17  ? 10.577 40.286 53.631 1.00 26.09 ? 17  PHE B N   1 
ATOM   1870 C  CA  . PHE B 1 17  ? 11.778 40.844 54.248 1.00 25.47 ? 17  PHE B CA  1 
ATOM   1871 C  C   . PHE B 1 17  ? 12.530 41.837 53.354 1.00 24.81 ? 17  PHE B C   1 
ATOM   1872 O  O   . PHE B 1 17  ? 12.697 43.005 53.702 1.00 24.90 ? 17  PHE B O   1 
ATOM   1873 C  CB  . PHE B 1 17  ? 12.627 39.618 54.691 1.00 24.85 ? 17  PHE B CB  1 
ATOM   1874 C  CG  . PHE B 1 17  ? 14.056 39.918 55.061 1.00 23.75 ? 17  PHE B CG  1 
ATOM   1875 C  CD1 . PHE B 1 17  ? 14.376 40.931 55.955 1.00 23.53 ? 17  PHE B CD1 1 
ATOM   1876 C  CD2 . PHE B 1 17  ? 15.083 39.138 54.537 1.00 24.03 ? 17  PHE B CD2 1 
ATOM   1877 C  CE1 . PHE B 1 17  ? 15.705 41.167 56.329 1.00 22.23 ? 17  PHE B CE1 1 
ATOM   1878 C  CE2 . PHE B 1 17  ? 16.416 39.362 54.898 1.00 25.32 ? 17  PHE B CE2 1 
ATOM   1879 C  CZ  . PHE B 1 17  ? 16.727 40.384 55.800 1.00 24.65 ? 17  PHE B CZ  1 
ATOM   1880 N  N   . LEU B 1 18  ? 12.978 41.382 52.197 1.00 24.69 ? 18  LEU B N   1 
ATOM   1881 C  CA  . LEU B 1 18  ? 13.673 42.266 51.284 1.00 22.78 ? 18  LEU B CA  1 
ATOM   1882 C  C   . LEU B 1 18  ? 13.091 42.061 49.896 1.00 23.80 ? 18  LEU B C   1 
ATOM   1883 O  O   . LEU B 1 18  ? 12.731 40.945 49.503 1.00 22.48 ? 18  LEU B O   1 
ATOM   1884 C  CB  . LEU B 1 18  ? 15.169 41.972 51.277 1.00 22.93 ? 18  LEU B CB  1 
ATOM   1885 C  CG  . LEU B 1 18  ? 15.922 42.336 52.561 1.00 24.07 ? 18  LEU B CG  1 
ATOM   1886 C  CD1 . LEU B 1 18  ? 17.277 41.686 52.532 1.00 20.41 ? 18  LEU B CD1 1 
ATOM   1887 C  CD2 . LEU B 1 18  ? 16.055 43.848 52.693 1.00 21.33 ? 18  LEU B CD2 1 
ATOM   1888 N  N   . SER B 1 19  ? 12.988 43.156 49.158 1.00 22.61 ? 19  SER B N   1 
ATOM   1889 C  CA  . SER B 1 19  ? 12.454 43.120 47.809 1.00 22.31 ? 19  SER B CA  1 
ATOM   1890 C  C   . SER B 1 19  ? 13.585 43.047 46.790 1.00 21.23 ? 19  SER B C   1 
ATOM   1891 O  O   . SER B 1 19  ? 14.736 43.376 47.096 1.00 21.48 ? 19  SER B O   1 
ATOM   1892 C  CB  . SER B 1 19  ? 11.662 44.395 47.533 1.00 19.72 ? 19  SER B CB  1 
ATOM   1893 O  OG  . SER B 1 19  ? 12.562 45.483 47.498 1.00 24.38 ? 19  SER B OG  1 
ATOM   1894 N  N   . PRO B 1 20  ? 13.261 42.633 45.556 1.00 19.90 ? 20  PRO B N   1 
ATOM   1895 C  CA  . PRO B 1 20  ? 14.263 42.530 44.496 1.00 21.86 ? 20  PRO B CA  1 
ATOM   1896 C  C   . PRO B 1 20  ? 15.072 43.814 44.353 1.00 23.15 ? 20  PRO B C   1 
ATOM   1897 O  O   . PRO B 1 20  ? 16.297 43.764 44.197 1.00 24.96 ? 20  PRO B O   1 
ATOM   1898 C  CB  . PRO B 1 20  ? 13.426 42.204 43.265 1.00 19.77 ? 20  PRO B CB  1 
ATOM   1899 C  CG  . PRO B 1 20  ? 12.363 41.296 43.869 1.00 20.39 ? 20  PRO B CG  1 
ATOM   1900 C  CD  . PRO B 1 20  ? 11.977 42.045 45.128 1.00 19.44 ? 20  PRO B CD  1 
ATOM   1901 N  N   . VAL B 1 21  ? 14.396 44.961 44.432 1.00 23.42 ? 21  VAL B N   1 
ATOM   1902 C  CA  . VAL B 1 21  ? 15.075 46.251 44.327 1.00 22.58 ? 21  VAL B CA  1 
ATOM   1903 C  C   . VAL B 1 21  ? 16.066 46.436 45.480 1.00 21.14 ? 21  VAL B C   1 
ATOM   1904 O  O   . VAL B 1 21  ? 17.167 46.936 45.287 1.00 21.75 ? 21  VAL B O   1 
ATOM   1905 C  CB  . VAL B 1 21  ? 14.041 47.427 44.294 1.00 22.82 ? 21  VAL B CB  1 
ATOM   1906 C  CG1 . VAL B 1 21  ? 14.737 48.788 44.331 1.00 21.51 ? 21  VAL B CG1 1 
ATOM   1907 C  CG2 . VAL B 1 21  ? 13.253 47.350 42.997 1.00 28.82 ? 21  VAL B CG2 1 
ATOM   1908 N  N   . ALA B 1 22  ? 15.676 46.032 46.680 1.00 21.16 ? 22  ALA B N   1 
ATOM   1909 C  CA  . ALA B 1 22  ? 16.572 46.165 47.836 1.00 19.79 ? 22  ALA B CA  1 
ATOM   1910 C  C   . ALA B 1 22  ? 17.858 45.398 47.509 1.00 18.87 ? 22  ALA B C   1 
ATOM   1911 O  O   . ALA B 1 22  ? 18.967 45.906 47.733 1.00 18.64 ? 22  ALA B O   1 
ATOM   1912 C  CB  . ALA B 1 22  ? 15.886 45.605 49.121 1.00 15.18 ? 22  ALA B CB  1 
ATOM   1913 N  N   . PHE B 1 23  ? 17.705 44.199 46.940 1.00 18.55 ? 23  PHE B N   1 
ATOM   1914 C  CA  . PHE B 1 23  ? 18.863 43.397 46.552 1.00 19.21 ? 23  PHE B CA  1 
ATOM   1915 C  C   . PHE B 1 23  ? 19.677 44.064 45.446 1.00 21.32 ? 23  PHE B C   1 
ATOM   1916 O  O   . PHE B 1 23  ? 20.913 44.085 45.521 1.00 21.47 ? 23  PHE B O   1 
ATOM   1917 C  CB  . PHE B 1 23  ? 18.428 41.993 46.119 1.00 20.09 ? 23  PHE B CB  1 
ATOM   1918 C  CG  . PHE B 1 23  ? 18.035 41.104 47.266 1.00 19.39 ? 23  PHE B CG  1 
ATOM   1919 C  CD1 . PHE B 1 23  ? 16.734 40.656 47.409 1.00 21.81 ? 23  PHE B CD1 1 
ATOM   1920 C  CD2 . PHE B 1 23  ? 18.988 40.698 48.200 1.00 21.79 ? 23  PHE B CD2 1 
ATOM   1921 C  CE1 . PHE B 1 23  ? 16.383 39.798 48.477 1.00 20.31 ? 23  PHE B CE1 1 
ATOM   1922 C  CE2 . PHE B 1 23  ? 18.658 39.856 49.257 1.00 22.03 ? 23  PHE B CE2 1 
ATOM   1923 C  CZ  . PHE B 1 23  ? 17.352 39.400 49.397 1.00 23.08 ? 23  PHE B CZ  1 
ATOM   1924 N  N   . ASP B 1 24  ? 19.001 44.623 44.438 1.00 20.95 ? 24  ASP B N   1 
ATOM   1925 C  CA  . ASP B 1 24  ? 19.712 45.289 43.343 1.00 23.10 ? 24  ASP B CA  1 
ATOM   1926 C  C   . ASP B 1 24  ? 20.669 46.325 43.899 1.00 22.09 ? 24  ASP B C   1 
ATOM   1927 O  O   . ASP B 1 24  ? 21.807 46.439 43.458 1.00 22.77 ? 24  ASP B O   1 
ATOM   1928 C  CB  . ASP B 1 24  ? 18.759 46.016 42.388 1.00 21.91 ? 24  ASP B CB  1 
ATOM   1929 C  CG  . ASP B 1 24  ? 17.850 45.077 41.648 1.00 27.88 ? 24  ASP B CG  1 
ATOM   1930 O  OD1 . ASP B 1 24  ? 18.161 43.864 41.638 1.00 30.98 ? 24  ASP B OD1 1 
ATOM   1931 O  OD2 . ASP B 1 24  ? 16.837 45.551 41.065 1.00 27.80 ? 24  ASP B OD2 1 
ATOM   1932 N  N   . PHE B 1 25  ? 20.193 47.099 44.860 1.00 22.14 ? 25  PHE B N   1 
ATOM   1933 C  CA  . PHE B 1 25  ? 21.027 48.130 45.445 1.00 23.71 ? 25  PHE B CA  1 
ATOM   1934 C  C   . PHE B 1 25  ? 22.056 47.617 46.446 1.00 22.95 ? 25  PHE B C   1 
ATOM   1935 O  O   . PHE B 1 25  ? 23.233 47.970 46.353 1.00 25.27 ? 25  PHE B O   1 
ATOM   1936 C  CB  . PHE B 1 25  ? 20.155 49.215 46.111 1.00 25.09 ? 25  PHE B CB  1 
ATOM   1937 C  CG  . PHE B 1 25  ? 19.592 50.237 45.135 1.00 25.05 ? 25  PHE B CG  1 
ATOM   1938 C  CD1 . PHE B 1 25  ? 18.336 50.056 44.562 1.00 27.00 ? 25  PHE B CD1 1 
ATOM   1939 C  CD2 . PHE B 1 25  ? 20.342 51.354 44.770 1.00 22.83 ? 25  PHE B CD2 1 
ATOM   1940 C  CE1 . PHE B 1 25  ? 17.830 50.979 43.626 1.00 27.26 ? 25  PHE B CE1 1 
ATOM   1941 C  CE2 . PHE B 1 25  ? 19.857 52.289 43.835 1.00 23.62 ? 25  PHE B CE2 1 
ATOM   1942 C  CZ  . PHE B 1 25  ? 18.599 52.100 43.259 1.00 25.18 ? 25  PHE B CZ  1 
ATOM   1943 N  N   . HIS B 1 26  ? 21.627 46.784 47.393 1.00 21.93 ? 26  HIS B N   1 
ATOM   1944 C  CA  . HIS B 1 26  ? 22.551 46.302 48.419 1.00 22.88 ? 26  HIS B CA  1 
ATOM   1945 C  C   . HIS B 1 26  ? 23.665 45.428 47.842 1.00 22.65 ? 26  HIS B C   1 
ATOM   1946 O  O   . HIS B 1 26  ? 24.847 45.718 48.045 1.00 22.55 ? 26  HIS B O   1 
ATOM   1947 C  CB  . HIS B 1 26  ? 21.805 45.551 49.527 1.00 17.91 ? 26  HIS B CB  1 
ATOM   1948 C  CG  . HIS B 1 26  ? 22.577 45.460 50.808 1.00 22.10 ? 26  HIS B CG  1 
ATOM   1949 N  ND1 . HIS B 1 26  ? 22.100 44.870 51.962 1.00 21.01 ? 26  HIS B ND1 1 
ATOM   1950 C  CD2 . HIS B 1 26  ? 23.816 45.927 51.118 1.00 16.95 ? 26  HIS B CD2 1 
ATOM   1951 C  CE1 . HIS B 1 26  ? 23.041 45.000 52.911 1.00 19.57 ? 26  HIS B CE1 1 
ATOM   1952 N  NE2 . HIS B 1 26  ? 24.098 45.633 52.445 1.00 20.75 ? 26  HIS B NE2 1 
ATOM   1953 N  N   . HIS B 1 27  ? 23.288 44.390 47.106 1.00 22.51 ? 27  HIS B N   1 
ATOM   1954 C  CA  . HIS B 1 27  ? 24.258 43.488 46.493 1.00 23.90 ? 27  HIS B CA  1 
ATOM   1955 C  C   . HIS B 1 27  ? 24.849 44.086 45.229 1.00 23.98 ? 27  HIS B C   1 
ATOM   1956 O  O   . HIS B 1 27  ? 26.061 44.314 45.150 1.00 24.74 ? 27  HIS B O   1 
ATOM   1957 C  CB  . HIS B 1 27  ? 23.574 42.150 46.176 1.00 26.03 ? 27  HIS B CB  1 
ATOM   1958 C  CG  . HIS B 1 27  ? 24.401 41.215 45.344 1.00 30.37 ? 27  HIS B CG  1 
ATOM   1959 N  ND1 . HIS B 1 27  ? 24.242 41.093 43.979 1.00 31.97 ? 27  HIS B ND1 1 
ATOM   1960 C  CD2 . HIS B 1 27  ? 25.368 40.329 45.688 1.00 27.32 ? 27  HIS B CD2 1 
ATOM   1961 C  CE1 . HIS B 1 27  ? 25.065 40.168 43.521 1.00 28.10 ? 27  HIS B CE1 1 
ATOM   1962 N  NE2 . HIS B 1 27  ? 25.758 39.689 44.538 1.00 31.39 ? 27  HIS B NE2 1 
ATOM   1963 N  N   . GLY B 1 28  ? 23.980 44.378 44.260 1.00 25.93 ? 28  GLY B N   1 
ATOM   1964 C  CA  . GLY B 1 28  ? 24.401 44.923 42.976 1.00 24.41 ? 28  GLY B CA  1 
ATOM   1965 C  C   . GLY B 1 28  ? 25.153 46.235 42.968 1.00 25.36 ? 28  GLY B C   1 
ATOM   1966 O  O   . GLY B 1 28  ? 25.890 46.525 42.025 1.00 25.58 ? 28  GLY B O   1 
ATOM   1967 N  N   . LYS B 1 29  ? 24.976 47.055 43.995 1.00 25.77 ? 29  LYS B N   1 
ATOM   1968 C  CA  . LYS B 1 29  ? 25.690 48.322 44.019 1.00 26.52 ? 29  LYS B CA  1 
ATOM   1969 C  C   . LYS B 1 29  ? 26.652 48.478 45.191 1.00 26.65 ? 29  LYS B C   1 
ATOM   1970 O  O   . LYS B 1 29  ? 27.843 48.680 44.983 1.00 27.09 ? 29  LYS B O   1 
ATOM   1971 C  CB  . LYS B 1 29  ? 24.709 49.488 44.003 1.00 26.93 ? 29  LYS B CB  1 
ATOM   1972 C  CG  . LYS B 1 29  ? 24.060 49.729 42.648 1.00 30.98 ? 29  LYS B CG  1 
ATOM   1973 C  CD  . LYS B 1 29  ? 22.856 50.679 42.788 1.00 32.96 ? 29  LYS B CD  1 
ATOM   1974 C  CE  . LYS B 1 29  ? 22.162 50.957 41.467 1.00 33.96 ? 29  LYS B CE  1 
ATOM   1975 N  NZ  . LYS B 1 29  ? 22.929 51.928 40.639 1.00 38.00 ? 29  LYS B NZ  1 
ATOM   1976 N  N   . HIS B 1 30  ? 26.154 48.390 46.420 1.00 26.36 ? 30  HIS B N   1 
ATOM   1977 C  CA  . HIS B 1 30  ? 27.029 48.553 47.579 1.00 26.40 ? 30  HIS B CA  1 
ATOM   1978 C  C   . HIS B 1 30  ? 28.132 47.489 47.614 1.00 25.64 ? 30  HIS B C   1 
ATOM   1979 O  O   . HIS B 1 30  ? 29.315 47.818 47.636 1.00 24.70 ? 30  HIS B O   1 
ATOM   1980 C  CB  . HIS B 1 30  ? 26.213 48.510 48.876 1.00 25.90 ? 30  HIS B CB  1 
ATOM   1981 C  CG  . HIS B 1 30  ? 25.432 49.757 49.131 1.00 28.69 ? 30  HIS B CG  1 
ATOM   1982 N  ND1 . HIS B 1 30  ? 25.999 50.896 49.663 1.00 30.02 ? 30  HIS B ND1 1 
ATOM   1983 C  CD2 . HIS B 1 30  ? 24.128 50.052 48.911 1.00 28.19 ? 30  HIS B CD2 1 
ATOM   1984 C  CE1 . HIS B 1 30  ? 25.078 51.839 49.765 1.00 28.55 ? 30  HIS B CE1 1 
ATOM   1985 N  NE2 . HIS B 1 30  ? 23.934 51.351 49.315 1.00 30.45 ? 30  HIS B NE2 1 
ATOM   1986 N  N   . HIS B 1 31  ? 27.726 46.224 47.623 1.00 25.15 ? 31  HIS B N   1 
ATOM   1987 C  CA  . HIS B 1 31  ? 28.648 45.108 47.647 1.00 26.93 ? 31  HIS B CA  1 
ATOM   1988 C  C   . HIS B 1 31  ? 29.593 45.197 46.437 1.00 28.62 ? 31  HIS B C   1 
ATOM   1989 O  O   . HIS B 1 31  ? 30.815 45.110 46.576 1.00 29.01 ? 31  HIS B O   1 
ATOM   1990 C  CB  . HIS B 1 31  ? 27.854 43.813 47.624 1.00 27.20 ? 31  HIS B CB  1 
ATOM   1991 C  CG  . HIS B 1 31  ? 28.611 42.637 48.147 1.00 31.96 ? 31  HIS B CG  1 
ATOM   1992 N  ND1 . HIS B 1 31  ? 28.035 41.396 48.315 1.00 29.90 ? 31  HIS B ND1 1 
ATOM   1993 C  CD2 . HIS B 1 31  ? 29.908 42.507 48.514 1.00 32.37 ? 31  HIS B CD2 1 
ATOM   1994 C  CE1 . HIS B 1 31  ? 28.945 40.550 48.763 1.00 33.45 ? 31  HIS B CE1 1 
ATOM   1995 N  NE2 . HIS B 1 31  ? 30.091 41.199 48.893 1.00 32.11 ? 31  HIS B NE2 1 
ATOM   1996 N  N   . GLN B 1 32  ? 29.023 45.384 45.253 1.00 27.89 ? 32  GLN B N   1 
ATOM   1997 C  CA  . GLN B 1 32  ? 29.815 45.525 44.035 1.00 27.01 ? 32  GLN B CA  1 
ATOM   1998 C  C   . GLN B 1 32  ? 30.863 46.622 44.190 1.00 27.36 ? 32  GLN B C   1 
ATOM   1999 O  O   . GLN B 1 32  ? 32.001 46.477 43.740 1.00 27.75 ? 32  GLN B O   1 
ATOM   2000 C  CB  . GLN B 1 32  ? 28.916 45.889 42.844 1.00 25.40 ? 32  GLN B CB  1 
ATOM   2001 C  CG  . GLN B 1 32  ? 29.665 46.100 41.546 1.00 25.46 ? 32  GLN B CG  1 
ATOM   2002 C  CD  . GLN B 1 32  ? 30.246 44.806 41.025 1.00 27.01 ? 32  GLN B CD  1 
ATOM   2003 O  OE1 . GLN B 1 32  ? 29.514 43.935 40.536 1.00 25.87 ? 32  GLN B OE1 1 
ATOM   2004 N  NE2 . GLN B 1 32  ? 31.569 44.656 41.150 1.00 21.80 ? 32  GLN B NE2 1 
ATOM   2005 N  N   . THR B 1 33  ? 30.472 47.735 44.802 1.00 27.31 ? 33  THR B N   1 
ATOM   2006 C  CA  . THR B 1 33  ? 31.383 48.859 44.983 1.00 27.77 ? 33  THR B CA  1 
ATOM   2007 C  C   . THR B 1 33  ? 32.554 48.548 45.913 1.00 28.23 ? 33  THR B C   1 
ATOM   2008 O  O   . THR B 1 33  ? 33.648 49.086 45.729 1.00 27.79 ? 33  THR B O   1 
ATOM   2009 C  CB  . THR B 1 33  ? 30.628 50.135 45.489 1.00 28.18 ? 33  THR B CB  1 
ATOM   2010 O  OG1 . THR B 1 33  ? 29.812 50.642 44.429 1.00 29.79 ? 33  THR B OG1 1 
ATOM   2011 C  CG2 . THR B 1 33  ? 31.606 51.251 45.895 1.00 23.21 ? 33  THR B CG2 1 
ATOM   2012 N  N   . TYR B 1 34  ? 32.335 47.696 46.908 1.00 27.75 ? 34  TYR B N   1 
ATOM   2013 C  CA  . TYR B 1 34  ? 33.422 47.335 47.824 1.00 29.27 ? 34  TYR B CA  1 
ATOM   2014 C  C   . TYR B 1 34  ? 34.438 46.462 47.088 1.00 29.00 ? 34  TYR B C   1 
ATOM   2015 O  O   . TYR B 1 34  ? 35.650 46.584 47.286 1.00 27.16 ? 34  TYR B O   1 
ATOM   2016 C  CB  . TYR B 1 34  ? 32.875 46.585 49.033 1.00 29.05 ? 34  TYR B CB  1 
ATOM   2017 C  CG  . TYR B 1 34  ? 32.086 47.458 49.982 1.00 30.85 ? 34  TYR B CG  1 
ATOM   2018 C  CD1 . TYR B 1 34  ? 32.608 48.673 50.442 1.00 29.47 ? 34  TYR B CD1 1 
ATOM   2019 C  CD2 . TYR B 1 34  ? 30.842 47.049 50.460 1.00 28.21 ? 34  TYR B CD2 1 
ATOM   2020 C  CE1 . TYR B 1 34  ? 31.908 49.451 51.358 1.00 29.24 ? 34  TYR B CE1 1 
ATOM   2021 C  CE2 . TYR B 1 34  ? 30.137 47.818 51.378 1.00 29.82 ? 34  TYR B CE2 1 
ATOM   2022 C  CZ  . TYR B 1 34  ? 30.673 49.014 51.825 1.00 30.34 ? 34  TYR B CZ  1 
ATOM   2023 O  OH  . TYR B 1 34  ? 29.988 49.761 52.758 1.00 31.96 ? 34  TYR B OH  1 
ATOM   2024 N  N   . VAL B 1 35  ? 33.927 45.580 46.237 1.00 29.40 ? 35  VAL B N   1 
ATOM   2025 C  CA  . VAL B 1 35  ? 34.774 44.711 45.437 1.00 30.09 ? 35  VAL B CA  1 
ATOM   2026 C  C   . VAL B 1 35  ? 35.629 45.584 44.517 1.00 31.58 ? 35  VAL B C   1 
ATOM   2027 O  O   . VAL B 1 35  ? 36.851 45.488 44.518 1.00 32.88 ? 35  VAL B O   1 
ATOM   2028 C  CB  . VAL B 1 35  ? 33.919 43.766 44.581 1.00 30.71 ? 35  VAL B CB  1 
ATOM   2029 C  CG1 . VAL B 1 35  ? 34.796 43.032 43.568 1.00 31.56 ? 35  VAL B CG1 1 
ATOM   2030 C  CG2 . VAL B 1 35  ? 33.171 42.796 45.480 1.00 27.11 ? 35  VAL B CG2 1 
ATOM   2031 N  N   . ASN B 1 36  ? 34.984 46.452 43.744 1.00 31.89 ? 36  ASN B N   1 
ATOM   2032 C  CA  . ASN B 1 36  ? 35.710 47.322 42.823 1.00 33.00 ? 36  ASN B CA  1 
ATOM   2033 C  C   . ASN B 1 36  ? 36.712 48.221 43.540 1.00 33.49 ? 36  ASN B C   1 
ATOM   2034 O  O   . ASN B 1 36  ? 37.814 48.452 43.045 1.00 35.17 ? 36  ASN B O   1 
ATOM   2035 C  CB  . ASN B 1 36  ? 34.729 48.181 42.028 1.00 30.98 ? 36  ASN B CB  1 
ATOM   2036 C  CG  . ASN B 1 36  ? 33.892 47.363 41.081 1.00 30.71 ? 36  ASN B CG  1 
ATOM   2037 O  OD1 . ASN B 1 36  ? 33.981 46.135 41.071 1.00 29.87 ? 36  ASN B OD1 1 
ATOM   2038 N  ND2 . ASN B 1 36  ? 33.072 48.033 40.274 1.00 27.58 ? 36  ASN B ND2 1 
ATOM   2039 N  N   . ASN B 1 37  ? 36.331 48.741 44.698 1.00 33.14 ? 37  ASN B N   1 
ATOM   2040 C  CA  . ASN B 1 37  ? 37.236 49.604 45.442 1.00 33.70 ? 37  ASN B CA  1 
ATOM   2041 C  C   . ASN B 1 37  ? 38.462 48.841 45.929 1.00 34.06 ? 37  ASN B C   1 
ATOM   2042 O  O   . ASN B 1 37  ? 39.562 49.370 45.885 1.00 34.66 ? 37  ASN B O   1 
ATOM   2043 C  CB  . ASN B 1 37  ? 36.549 50.236 46.655 1.00 32.81 ? 37  ASN B CB  1 
ATOM   2044 C  CG  . ASN B 1 37  ? 35.560 51.325 46.277 1.00 35.10 ? 37  ASN B CG  1 
ATOM   2045 O  OD1 . ASN B 1 37  ? 35.656 51.934 45.207 1.00 34.79 ? 37  ASN B OD1 1 
ATOM   2046 N  ND2 . ASN B 1 37  ? 34.609 51.592 47.170 1.00 35.43 ? 37  ASN B ND2 1 
ATOM   2047 N  N   . LEU B 1 38  ? 38.281 47.610 46.404 1.00 33.26 ? 38  LEU B N   1 
ATOM   2048 C  CA  . LEU B 1 38  ? 39.429 46.852 46.878 1.00 33.02 ? 38  LEU B CA  1 
ATOM   2049 C  C   . LEU B 1 38  ? 40.342 46.588 45.699 1.00 34.03 ? 38  LEU B C   1 
ATOM   2050 O  O   . LEU B 1 38  ? 41.532 46.873 45.783 1.00 34.87 ? 38  LEU B O   1 
ATOM   2051 C  CB  . LEU B 1 38  ? 39.020 45.519 47.525 1.00 28.25 ? 38  LEU B CB  1 
ATOM   2052 C  CG  . LEU B 1 38  ? 40.173 44.663 48.090 1.00 29.55 ? 38  LEU B CG  1 
ATOM   2053 C  CD1 . LEU B 1 38  ? 40.858 45.433 49.223 1.00 27.01 ? 38  LEU B CD1 1 
ATOM   2054 C  CD2 . LEU B 1 38  ? 39.666 43.313 48.615 1.00 23.33 ? 38  LEU B CD2 1 
ATOM   2055 N  N   . ASN B 1 39  ? 39.789 46.066 44.601 1.00 35.34 ? 39  ASN B N   1 
ATOM   2056 C  CA  . ASN B 1 39  ? 40.601 45.756 43.414 1.00 38.29 ? 39  ASN B CA  1 
ATOM   2057 C  C   . ASN B 1 39  ? 41.445 46.964 42.997 1.00 40.17 ? 39  ASN B C   1 
ATOM   2058 O  O   . ASN B 1 39  ? 42.637 46.837 42.737 1.00 41.13 ? 39  ASN B O   1 
ATOM   2059 C  CB  . ASN B 1 39  ? 39.730 45.314 42.221 1.00 34.55 ? 39  ASN B CB  1 
ATOM   2060 C  CG  . ASN B 1 39  ? 39.116 43.941 42.413 1.00 34.92 ? 39  ASN B CG  1 
ATOM   2061 O  OD1 . ASN B 1 39  ? 39.644 43.113 43.147 1.00 35.88 ? 39  ASN B OD1 1 
ATOM   2062 N  ND2 . ASN B 1 39  ? 38.001 43.687 41.733 1.00 32.90 ? 39  ASN B ND2 1 
ATOM   2063 N  N   . ASN B 1 40  ? 40.825 48.136 42.948 1.00 41.79 ? 40  ASN B N   1 
ATOM   2064 C  CA  . ASN B 1 40  ? 41.535 49.349 42.562 1.00 43.53 ? 40  ASN B CA  1 
ATOM   2065 C  C   . ASN B 1 40  ? 42.605 49.765 43.569 1.00 45.36 ? 40  ASN B C   1 
ATOM   2066 O  O   . ASN B 1 40  ? 43.658 50.274 43.178 1.00 46.24 ? 40  ASN B O   1 
ATOM   2067 C  CB  . ASN B 1 40  ? 40.536 50.488 42.371 1.00 42.66 ? 40  ASN B CB  1 
ATOM   2068 C  CG  . ASN B 1 40  ? 39.622 50.261 41.173 1.00 45.40 ? 40  ASN B CG  1 
ATOM   2069 O  OD1 . ASN B 1 40  ? 38.559 50.877 41.053 1.00 43.63 ? 40  ASN B OD1 1 
ATOM   2070 N  ND2 . ASN B 1 40  ? 40.043 49.383 40.273 1.00 42.37 ? 40  ASN B ND2 1 
ATOM   2071 N  N   . LEU B 1 41  ? 42.335 49.549 44.855 1.00 45.46 ? 41  LEU B N   1 
ATOM   2072 C  CA  . LEU B 1 41  ? 43.269 49.911 45.918 1.00 46.91 ? 41  LEU B CA  1 
ATOM   2073 C  C   . LEU B 1 41  ? 44.497 49.003 46.060 1.00 48.04 ? 41  LEU B C   1 
ATOM   2074 O  O   . LEU B 1 41  ? 45.577 49.475 46.418 1.00 47.79 ? 41  LEU B O   1 
ATOM   2075 C  CB  . LEU B 1 41  ? 42.542 49.959 47.269 1.00 45.36 ? 41  LEU B CB  1 
ATOM   2076 C  CG  . LEU B 1 41  ? 41.634 51.161 47.535 1.00 44.79 ? 41  LEU B CG  1 
ATOM   2077 C  CD1 . LEU B 1 41  ? 41.014 51.035 48.911 1.00 44.40 ? 41  LEU B CD1 1 
ATOM   2078 C  CD2 . LEU B 1 41  ? 42.430 52.445 47.435 1.00 41.87 ? 41  LEU B CD2 1 
ATOM   2079 N  N   . ILE B 1 42  ? 44.335 47.710 45.797 1.00 48.60 ? 42  ILE B N   1 
ATOM   2080 C  CA  . ILE B 1 42  ? 45.448 46.786 45.931 1.00 50.39 ? 42  ILE B CA  1 
ATOM   2081 C  C   . ILE B 1 42  ? 46.356 46.753 44.702 1.00 53.52 ? 42  ILE B C   1 
ATOM   2082 O  O   . ILE B 1 42  ? 47.521 46.353 44.792 1.00 54.24 ? 42  ILE B O   1 
ATOM   2083 C  CB  . ILE B 1 42  ? 44.954 45.348 46.237 1.00 48.57 ? 42  ILE B CB  1 
ATOM   2084 C  CG1 . ILE B 1 42  ? 44.063 44.837 45.107 1.00 47.68 ? 42  ILE B CG1 1 
ATOM   2085 C  CG2 . ILE B 1 42  ? 44.216 45.329 47.564 1.00 47.25 ? 42  ILE B CG2 1 
ATOM   2086 C  CD1 . ILE B 1 42  ? 43.566 43.423 45.311 1.00 45.24 ? 42  ILE B CD1 1 
ATOM   2087 N  N   . LYS B 1 43  ? 45.829 47.179 43.558 1.00 55.72 ? 43  LYS B N   1 
ATOM   2088 C  CA  . LYS B 1 43  ? 46.601 47.186 42.319 1.00 58.36 ? 43  LYS B CA  1 
ATOM   2089 C  C   . LYS B 1 43  ? 47.976 47.843 42.533 1.00 58.98 ? 43  LYS B C   1 
ATOM   2090 O  O   . LYS B 1 43  ? 48.064 49.028 42.866 1.00 58.90 ? 43  LYS B O   1 
ATOM   2091 C  CB  . LYS B 1 43  ? 45.821 47.929 41.229 1.00 60.43 ? 43  LYS B CB  1 
ATOM   2092 C  CG  . LYS B 1 43  ? 45.879 47.266 39.859 1.00 64.49 ? 43  LYS B CG  1 
ATOM   2093 C  CD  . LYS B 1 43  ? 47.330 47.094 39.393 1.00 69.07 ? 43  LYS B CD  1 
ATOM   2094 C  CE  . LYS B 1 43  ? 47.423 46.340 38.064 1.00 69.81 ? 43  LYS B CE  1 
ATOM   2095 N  NZ  . LYS B 1 43  ? 48.837 46.012 37.692 1.00 69.05 ? 43  LYS B NZ  1 
ATOM   2096 N  N   . GLY B 1 44  ? 49.039 47.058 42.353 1.00 58.79 ? 44  GLY B N   1 
ATOM   2097 C  CA  . GLY B 1 44  ? 50.385 47.569 42.535 1.00 59.35 ? 44  GLY B CA  1 
ATOM   2098 C  C   . GLY B 1 44  ? 50.840 47.633 43.985 1.00 60.21 ? 44  GLY B C   1 
ATOM   2099 O  O   . GLY B 1 44  ? 51.702 48.443 44.337 1.00 60.29 ? 44  GLY B O   1 
ATOM   2100 N  N   . THR B 1 45  ? 50.268 46.797 44.843 1.00 60.50 ? 45  THR B N   1 
ATOM   2101 C  CA  . THR B 1 45  ? 50.671 46.799 46.249 1.00 61.19 ? 45  THR B CA  1 
ATOM   2102 C  C   . THR B 1 45  ? 50.932 45.387 46.739 1.00 62.26 ? 45  THR B C   1 
ATOM   2103 O  O   . THR B 1 45  ? 50.760 44.410 45.997 1.00 61.60 ? 45  THR B O   1 
ATOM   2104 C  CB  . THR B 1 45  ? 49.602 47.431 47.177 1.00 60.20 ? 45  THR B CB  1 
ATOM   2105 O  OG1 . THR B 1 45  ? 48.385 46.681 47.089 1.00 57.35 ? 45  THR B OG1 1 
ATOM   2106 C  CG2 . THR B 1 45  ? 49.350 48.877 46.797 1.00 58.98 ? 45  THR B CG2 1 
ATOM   2107 N  N   . ASP B 1 46  ? 51.340 45.294 48.000 1.00 63.36 ? 46  ASP B N   1 
ATOM   2108 C  CA  . ASP B 1 46  ? 51.643 44.018 48.619 1.00 64.76 ? 46  ASP B CA  1 
ATOM   2109 C  C   . ASP B 1 46  ? 50.497 43.025 48.594 1.00 64.28 ? 46  ASP B C   1 
ATOM   2110 O  O   . ASP B 1 46  ? 50.716 41.824 48.754 1.00 64.61 ? 46  ASP B O   1 
ATOM   2111 C  CB  . ASP B 1 46  ? 52.084 44.233 50.065 1.00 67.62 ? 46  ASP B CB  1 
ATOM   2112 C  CG  . ASP B 1 46  ? 53.574 44.084 50.232 1.00 71.12 ? 46  ASP B CG  1 
ATOM   2113 O  OD1 . ASP B 1 46  ? 54.316 44.775 49.494 1.00 73.39 ? 46  ASP B OD1 1 
ATOM   2114 O  OD2 . ASP B 1 46  ? 53.996 43.272 51.091 1.00 72.02 ? 46  ASP B OD2 1 
ATOM   2115 N  N   . PHE B 1 47  ? 49.279 43.514 48.380 1.00 63.61 ? 47  PHE B N   1 
ATOM   2116 C  CA  . PHE B 1 47  ? 48.113 42.639 48.382 1.00 62.45 ? 47  PHE B CA  1 
ATOM   2117 C  C   . PHE B 1 47  ? 47.550 42.314 47.007 1.00 62.36 ? 47  PHE B C   1 
ATOM   2118 O  O   . PHE B 1 47  ? 46.644 41.489 46.885 1.00 61.61 ? 47  PHE B O   1 
ATOM   2119 C  CB  . PHE B 1 47  ? 46.984 43.255 49.209 1.00 61.62 ? 47  PHE B CB  1 
ATOM   2120 C  CG  . PHE B 1 47  ? 47.387 43.697 50.590 1.00 60.77 ? 47  PHE B CG  1 
ATOM   2121 C  CD1 . PHE B 1 47  ? 47.823 44.995 50.818 1.00 59.59 ? 47  PHE B CD1 1 
ATOM   2122 C  CD2 . PHE B 1 47  ? 47.276 42.829 51.673 1.00 61.20 ? 47  PHE B CD2 1 
ATOM   2123 C  CE1 . PHE B 1 47  ? 48.137 45.427 52.106 1.00 60.56 ? 47  PHE B CE1 1 
ATOM   2124 C  CE2 . PHE B 1 47  ? 47.588 43.249 52.967 1.00 60.19 ? 47  PHE B CE2 1 
ATOM   2125 C  CZ  . PHE B 1 47  ? 48.018 44.552 53.183 1.00 60.26 ? 47  PHE B CZ  1 
ATOM   2126 N  N   . GLU B 1 48  ? 48.074 42.954 45.973 1.00 62.37 ? 48  GLU B N   1 
ATOM   2127 C  CA  . GLU B 1 48  ? 47.554 42.731 44.633 1.00 63.12 ? 48  GLU B CA  1 
ATOM   2128 C  C   . GLU B 1 48  ? 47.292 41.274 44.286 1.00 62.04 ? 48  GLU B C   1 
ATOM   2129 O  O   . GLU B 1 48  ? 46.498 40.982 43.391 1.00 62.19 ? 48  GLU B O   1 
ATOM   2130 C  CB  . GLU B 1 48  ? 48.480 43.359 43.589 1.00 66.34 ? 48  GLU B CB  1 
ATOM   2131 C  CG  . GLU B 1 48  ? 48.131 42.978 42.150 1.00 70.33 ? 48  GLU B CG  1 
ATOM   2132 C  CD  . GLU B 1 48  ? 48.467 44.073 41.154 1.00 72.06 ? 48  GLU B CD  1 
ATOM   2133 O  OE1 . GLU B 1 48  ? 49.528 44.720 41.305 1.00 73.51 ? 48  GLU B OE1 1 
ATOM   2134 O  OE2 . GLU B 1 48  ? 47.667 44.274 40.216 1.00 72.66 ? 48  GLU B OE2 1 
ATOM   2135 N  N   . LYS B 1 49  ? 47.947 40.358 44.989 1.00 61.11 ? 49  LYS B N   1 
ATOM   2136 C  CA  . LYS B 1 49  ? 47.747 38.939 44.719 1.00 60.05 ? 49  LYS B CA  1 
ATOM   2137 C  C   . LYS B 1 49  ? 47.410 38.153 45.982 1.00 57.98 ? 49  LYS B C   1 
ATOM   2138 O  O   . LYS B 1 49  ? 47.286 36.930 45.949 1.00 56.97 ? 49  LYS B O   1 
ATOM   2139 C  CB  . LYS B 1 49  ? 48.990 38.349 44.036 1.00 62.94 ? 49  LYS B CB  1 
ATOM   2140 C  CG  . LYS B 1 49  ? 49.256 38.942 42.651 1.00 66.47 ? 49  LYS B CG  1 
ATOM   2141 C  CD  . LYS B 1 49  ? 50.340 38.186 41.886 1.00 69.15 ? 49  LYS B CD  1 
ATOM   2142 C  CE  . LYS B 1 49  ? 50.518 38.765 40.477 1.00 70.46 ? 49  LYS B CE  1 
ATOM   2143 N  NZ  . LYS B 1 49  ? 51.476 37.973 39.641 1.00 71.43 ? 49  LYS B NZ  1 
ATOM   2144 N  N   . SER B 1 50  ? 47.255 38.865 47.095 1.00 55.87 ? 50  SER B N   1 
ATOM   2145 C  CA  . SER B 1 50  ? 46.915 38.230 48.365 1.00 53.95 ? 50  SER B CA  1 
ATOM   2146 C  C   . SER B 1 50  ? 45.472 37.715 48.354 1.00 52.65 ? 50  SER B C   1 
ATOM   2147 O  O   . SER B 1 50  ? 44.659 38.125 47.529 1.00 53.42 ? 50  SER B O   1 
ATOM   2148 C  CB  . SER B 1 50  ? 47.077 39.228 49.511 1.00 54.10 ? 50  SER B CB  1 
ATOM   2149 O  OG  . SER B 1 50  ? 48.355 39.845 49.489 1.00 55.94 ? 50  SER B OG  1 
ATOM   2150 N  N   . SER B 1 51  ? 45.155 36.804 49.265 1.00 50.65 ? 51  SER B N   1 
ATOM   2151 C  CA  . SER B 1 51  ? 43.799 36.291 49.346 1.00 49.14 ? 51  SER B CA  1 
ATOM   2152 C  C   . SER B 1 51  ? 43.011 37.284 50.207 1.00 48.54 ? 51  SER B C   1 
ATOM   2153 O  O   . SER B 1 51  ? 43.600 38.096 50.938 1.00 47.50 ? 51  SER B O   1 
ATOM   2154 C  CB  . SER B 1 51  ? 43.777 34.909 49.996 1.00 49.39 ? 51  SER B CB  1 
ATOM   2155 O  OG  . SER B 1 51  ? 43.941 35.003 51.398 1.00 48.43 ? 51  SER B OG  1 
ATOM   2156 N  N   . LEU B 1 52  ? 41.686 37.225 50.124 1.00 47.53 ? 52  LEU B N   1 
ATOM   2157 C  CA  . LEU B 1 52  ? 40.848 38.148 50.890 1.00 45.91 ? 52  LEU B CA  1 
ATOM   2158 C  C   . LEU B 1 52  ? 41.096 37.940 52.373 1.00 45.46 ? 52  LEU B C   1 
ATOM   2159 O  O   . LEU B 1 52  ? 41.201 38.900 53.146 1.00 43.96 ? 52  LEU B O   1 
ATOM   2160 C  CB  . LEU B 1 52  ? 39.363 37.931 50.575 1.00 44.05 ? 52  LEU B CB  1 
ATOM   2161 C  CG  . LEU B 1 52  ? 38.401 38.955 51.199 1.00 42.39 ? 52  LEU B CG  1 
ATOM   2162 C  CD1 . LEU B 1 52  ? 38.771 40.369 50.757 1.00 37.43 ? 52  LEU B CD1 1 
ATOM   2163 C  CD2 . LEU B 1 52  ? 36.970 38.616 50.788 1.00 41.82 ? 52  LEU B CD2 1 
ATOM   2164 N  N   . PHE B 1 53  ? 41.199 36.677 52.762 1.00 45.64 ? 53  PHE B N   1 
ATOM   2165 C  CA  . PHE B 1 53  ? 41.449 36.339 54.153 1.00 46.92 ? 53  PHE B CA  1 
ATOM   2166 C  C   . PHE B 1 53  ? 42.746 37.003 54.608 1.00 45.84 ? 53  PHE B C   1 
ATOM   2167 O  O   . PHE B 1 53  ? 42.835 37.545 55.716 1.00 43.90 ? 53  PHE B O   1 
ATOM   2168 C  CB  . PHE B 1 53  ? 41.541 34.820 54.331 1.00 47.18 ? 53  PHE B CB  1 
ATOM   2169 C  CG  . PHE B 1 53  ? 41.829 34.413 55.733 1.00 50.38 ? 53  PHE B CG  1 
ATOM   2170 C  CD1 . PHE B 1 53  ? 43.140 34.300 56.183 1.00 51.52 ? 53  PHE B CD1 1 
ATOM   2171 C  CD2 . PHE B 1 53  ? 40.790 34.216 56.636 1.00 51.61 ? 53  PHE B CD2 1 
ATOM   2172 C  CE1 . PHE B 1 53  ? 43.410 33.997 57.520 1.00 52.40 ? 53  PHE B CE1 1 
ATOM   2173 C  CE2 . PHE B 1 53  ? 41.048 33.915 57.972 1.00 51.85 ? 53  PHE B CE2 1 
ATOM   2174 C  CZ  . PHE B 1 53  ? 42.358 33.805 58.415 1.00 52.02 ? 53  PHE B CZ  1 
ATOM   2175 N  N   . ALA B 1 54  ? 43.740 36.963 53.727 1.00 45.19 ? 54  ALA B N   1 
ATOM   2176 C  CA  . ALA B 1 54  ? 45.031 37.557 54.000 1.00 44.63 ? 54  ALA B CA  1 
ATOM   2177 C  C   . ALA B 1 54  ? 44.855 39.049 54.232 1.00 43.98 ? 54  ALA B C   1 
ATOM   2178 O  O   . ALA B 1 54  ? 45.189 39.566 55.308 1.00 43.61 ? 54  ALA B O   1 
ATOM   2179 C  CB  . ALA B 1 54  ? 45.977 37.313 52.823 1.00 45.13 ? 54  ALA B CB  1 
ATOM   2180 N  N   . ILE B 1 55  ? 44.342 39.735 53.210 1.00 43.29 ? 55  ILE B N   1 
ATOM   2181 C  CA  . ILE B 1 55  ? 44.111 41.186 53.265 1.00 41.99 ? 55  ILE B CA  1 
ATOM   2182 C  C   . ILE B 1 55  ? 43.220 41.550 54.454 1.00 41.86 ? 55  ILE B C   1 
ATOM   2183 O  O   . ILE B 1 55  ? 43.481 42.519 55.168 1.00 41.90 ? 55  ILE B O   1 
ATOM   2184 C  CB  . ILE B 1 55  ? 43.415 41.686 51.982 1.00 42.26 ? 55  ILE B CB  1 
ATOM   2185 C  CG1 . ILE B 1 55  ? 44.215 41.240 50.756 1.00 42.48 ? 55  ILE B CG1 1 
ATOM   2186 C  CG2 . ILE B 1 55  ? 43.252 43.200 52.034 1.00 38.53 ? 55  ILE B CG2 1 
ATOM   2187 C  CD1 . ILE B 1 55  ? 43.555 41.560 49.433 1.00 43.49 ? 55  ILE B CD1 1 
ATOM   2188 N  N   . LEU B 1 56  ? 42.165 40.769 54.658 1.00 40.84 ? 56  LEU B N   1 
ATOM   2189 C  CA  . LEU B 1 56  ? 41.242 41.011 55.759 1.00 41.61 ? 56  LEU B CA  1 
ATOM   2190 C  C   . LEU B 1 56  ? 41.935 41.016 57.130 1.00 42.20 ? 56  LEU B C   1 
ATOM   2191 O  O   . LEU B 1 56  ? 41.746 41.936 57.926 1.00 41.00 ? 56  LEU B O   1 
ATOM   2192 C  CB  . LEU B 1 56  ? 40.128 39.956 55.737 1.00 40.34 ? 56  LEU B CB  1 
ATOM   2193 C  CG  . LEU B 1 56  ? 39.086 39.957 56.855 1.00 39.70 ? 56  LEU B CG  1 
ATOM   2194 C  CD1 . LEU B 1 56  ? 38.360 41.288 56.858 1.00 40.32 ? 56  LEU B CD1 1 
ATOM   2195 C  CD2 . LEU B 1 56  ? 38.102 38.803 56.651 1.00 37.82 ? 56  LEU B CD2 1 
ATOM   2196 N  N   . THR B 1 57  ? 42.746 39.993 57.388 1.00 43.90 ? 57  THR B N   1 
ATOM   2197 C  CA  . THR B 1 57  ? 43.444 39.853 58.667 1.00 45.08 ? 57  THR B CA  1 
ATOM   2198 C  C   . THR B 1 57  ? 44.734 40.657 58.791 1.00 45.50 ? 57  THR B C   1 
ATOM   2199 O  O   . THR B 1 57  ? 45.259 40.824 59.888 1.00 44.54 ? 57  THR B O   1 
ATOM   2200 C  CB  . THR B 1 57  ? 43.808 38.369 58.953 1.00 46.34 ? 57  THR B CB  1 
ATOM   2201 O  OG1 . THR B 1 57  ? 44.576 37.847 57.859 1.00 46.62 ? 57  THR B OG1 1 
ATOM   2202 C  CG2 . THR B 1 57  ? 42.550 37.519 59.147 1.00 45.70 ? 57  THR B CG2 1 
ATOM   2203 N  N   . LYS B 1 58  ? 45.242 41.175 57.683 1.00 46.24 ? 58  LYS B N   1 
ATOM   2204 C  CA  . LYS B 1 58  ? 46.496 41.907 57.744 1.00 48.49 ? 58  LYS B CA  1 
ATOM   2205 C  C   . LYS B 1 58  ? 46.462 43.389 57.399 1.00 48.86 ? 58  LYS B C   1 
ATOM   2206 O  O   . LYS B 1 58  ? 47.298 44.152 57.880 1.00 50.43 ? 58  LYS B O   1 
ATOM   2207 C  CB  . LYS B 1 58  ? 47.518 41.223 56.840 1.00 50.90 ? 58  LYS B CB  1 
ATOM   2208 C  CG  . LYS B 1 58  ? 47.747 39.748 57.156 1.00 55.59 ? 58  LYS B CG  1 
ATOM   2209 C  CD  . LYS B 1 58  ? 48.732 39.124 56.162 1.00 59.84 ? 58  LYS B CD  1 
ATOM   2210 C  CE  . LYS B 1 58  ? 49.008 37.659 56.482 1.00 61.54 ? 58  LYS B CE  1 
ATOM   2211 N  NZ  . LYS B 1 58  ? 49.871 37.005 55.444 1.00 62.92 ? 58  LYS B NZ  1 
ATOM   2212 N  N   . SER B 1 59  ? 45.510 43.805 56.571 1.00 47.63 ? 59  SER B N   1 
ATOM   2213 C  CA  . SER B 1 59  ? 45.446 45.201 56.153 1.00 45.98 ? 59  SER B CA  1 
ATOM   2214 C  C   . SER B 1 59  ? 44.793 46.143 57.157 1.00 44.57 ? 59  SER B C   1 
ATOM   2215 O  O   . SER B 1 59  ? 44.416 45.746 58.256 1.00 43.87 ? 59  SER B O   1 
ATOM   2216 C  CB  . SER B 1 59  ? 44.716 45.310 54.807 1.00 45.51 ? 59  SER B CB  1 
ATOM   2217 O  OG  . SER B 1 59  ? 43.333 45.053 54.966 1.00 43.57 ? 59  SER B OG  1 
ATOM   2218 N  N   . SER B 1 60  ? 44.669 47.400 56.750 1.00 43.48 ? 60  SER B N   1 
ATOM   2219 C  CA  . SER B 1 60  ? 44.063 48.434 57.570 1.00 44.13 ? 60  SER B CA  1 
ATOM   2220 C  C   . SER B 1 60  ? 43.685 49.593 56.648 1.00 42.35 ? 60  SER B C   1 
ATOM   2221 O  O   . SER B 1 60  ? 43.930 49.533 55.447 1.00 42.56 ? 60  SER B O   1 
ATOM   2222 C  CB  . SER B 1 60  ? 45.058 48.915 58.618 1.00 45.84 ? 60  SER B CB  1 
ATOM   2223 O  OG  . SER B 1 60  ? 46.215 49.432 57.985 1.00 48.55 ? 60  SER B OG  1 
ATOM   2224 N  N   . GLY B 1 61  ? 43.096 50.642 57.213 1.00 40.46 ? 61  GLY B N   1 
ATOM   2225 C  CA  . GLY B 1 61  ? 42.696 51.784 56.408 1.00 38.02 ? 61  GLY B CA  1 
ATOM   2226 C  C   . GLY B 1 61  ? 41.600 51.435 55.415 1.00 37.84 ? 61  GLY B C   1 
ATOM   2227 O  O   . GLY B 1 61  ? 40.747 50.577 55.678 1.00 37.94 ? 61  GLY B O   1 
ATOM   2228 N  N   . GLY B 1 62  ? 41.629 52.097 54.266 1.00 36.06 ? 62  GLY B N   1 
ATOM   2229 C  CA  . GLY B 1 62  ? 40.631 51.850 53.246 1.00 36.08 ? 62  GLY B CA  1 
ATOM   2230 C  C   . GLY B 1 62  ? 40.668 50.422 52.747 1.00 37.03 ? 62  GLY B C   1 
ATOM   2231 O  O   . GLY B 1 62  ? 39.625 49.790 52.566 1.00 37.61 ? 62  GLY B O   1 
ATOM   2232 N  N   . VAL B 1 63  ? 41.869 49.906 52.523 1.00 36.43 ? 63  VAL B N   1 
ATOM   2233 C  CA  . VAL B 1 63  ? 42.008 48.546 52.044 1.00 35.47 ? 63  VAL B CA  1 
ATOM   2234 C  C   . VAL B 1 63  ? 41.230 47.621 52.966 1.00 35.33 ? 63  VAL B C   1 
ATOM   2235 O  O   . VAL B 1 63  ? 40.520 46.720 52.511 1.00 35.04 ? 63  VAL B O   1 
ATOM   2236 C  CB  . VAL B 1 63  ? 43.491 48.124 52.013 1.00 37.56 ? 63  VAL B CB  1 
ATOM   2237 C  CG1 . VAL B 1 63  ? 43.629 46.617 51.758 1.00 34.69 ? 63  VAL B CG1 1 
ATOM   2238 C  CG2 . VAL B 1 63  ? 44.204 48.895 50.921 1.00 38.73 ? 63  VAL B CG2 1 
ATOM   2239 N  N   . PHE B 1 64  ? 41.351 47.851 54.270 1.00 35.64 ? 64  PHE B N   1 
ATOM   2240 C  CA  . PHE B 1 64  ? 40.642 47.008 55.214 1.00 33.77 ? 64  PHE B CA  1 
ATOM   2241 C  C   . PHE B 1 64  ? 39.143 47.228 55.105 1.00 32.67 ? 64  PHE B C   1 
ATOM   2242 O  O   . PHE B 1 64  ? 38.365 46.267 55.000 1.00 32.56 ? 64  PHE B O   1 
ATOM   2243 C  CB  . PHE B 1 64  ? 41.071 47.288 56.655 1.00 32.71 ? 64  PHE B CB  1 
ATOM   2244 C  CG  . PHE B 1 64  ? 40.278 46.509 57.659 1.00 29.21 ? 64  PHE B CG  1 
ATOM   2245 C  CD1 . PHE B 1 64  ? 40.514 45.151 57.842 1.00 27.79 ? 64  PHE B CD1 1 
ATOM   2246 C  CD2 . PHE B 1 64  ? 39.244 47.119 58.372 1.00 28.30 ? 64  PHE B CD2 1 
ATOM   2247 C  CE1 . PHE B 1 64  ? 39.722 44.395 58.729 1.00 28.91 ? 64  PHE B CE1 1 
ATOM   2248 C  CE2 . PHE B 1 64  ? 38.443 46.382 59.258 1.00 27.30 ? 64  PHE B CE2 1 
ATOM   2249 C  CZ  . PHE B 1 64  ? 38.683 45.015 59.436 1.00 28.54 ? 64  PHE B CZ  1 
ATOM   2250 N  N   . ASN B 1 65  ? 38.743 48.495 55.136 1.00 31.10 ? 65  ASN B N   1 
ATOM   2251 C  CA  . ASN B 1 65  ? 37.332 48.831 55.063 1.00 31.32 ? 65  ASN B CA  1 
ATOM   2252 C  C   . ASN B 1 65  ? 36.658 48.054 53.940 1.00 31.31 ? 65  ASN B C   1 
ATOM   2253 O  O   . ASN B 1 65  ? 35.677 47.339 54.160 1.00 31.92 ? 65  ASN B O   1 
ATOM   2254 C  CB  . ASN B 1 65  ? 37.160 50.344 54.880 1.00 28.55 ? 65  ASN B CB  1 
ATOM   2255 C  CG  . ASN B 1 65  ? 37.337 51.099 56.176 1.00 29.25 ? 65  ASN B CG  1 
ATOM   2256 O  OD1 . ASN B 1 65  ? 37.323 50.498 57.247 1.00 27.74 ? 65  ASN B OD1 1 
ATOM   2257 N  ND2 . ASN B 1 65  ? 37.485 52.425 56.096 1.00 29.62 ? 65  ASN B ND2 1 
ATOM   2258 N  N   . ASN B 1 66  ? 37.214 48.156 52.741 1.00 30.76 ? 66  ASN B N   1 
ATOM   2259 C  CA  . ASN B 1 66  ? 36.651 47.452 51.602 1.00 30.62 ? 66  ASN B CA  1 
ATOM   2260 C  C   . ASN B 1 66  ? 36.755 45.948 51.722 1.00 29.59 ? 66  ASN B C   1 
ATOM   2261 O  O   . ASN B 1 66  ? 35.783 45.232 51.465 1.00 30.21 ? 66  ASN B O   1 
ATOM   2262 C  CB  . ASN B 1 66  ? 37.318 47.948 50.310 1.00 28.60 ? 66  ASN B CB  1 
ATOM   2263 C  CG  . ASN B 1 66  ? 36.914 49.372 49.981 1.00 30.17 ? 66  ASN B CG  1 
ATOM   2264 O  OD1 . ASN B 1 66  ? 35.786 49.616 49.554 1.00 35.27 ? 66  ASN B OD1 1 
ATOM   2265 N  ND2 . ASN B 1 66  ? 37.807 50.324 50.215 1.00 29.92 ? 66  ASN B ND2 1 
ATOM   2266 N  N   . ALA B 1 67  ? 37.919 45.461 52.137 1.00 30.42 ? 67  ALA B N   1 
ATOM   2267 C  CA  . ALA B 1 67  ? 38.119 44.017 52.242 1.00 29.55 ? 67  ALA B CA  1 
ATOM   2268 C  C   . ALA B 1 67  ? 37.116 43.408 53.210 1.00 28.11 ? 67  ALA B C   1 
ATOM   2269 O  O   . ALA B 1 67  ? 36.424 42.433 52.891 1.00 25.90 ? 67  ALA B O   1 
ATOM   2270 C  CB  . ALA B 1 67  ? 39.555 43.718 52.698 1.00 32.77 ? 67  ALA B CB  1 
ATOM   2271 N  N   . ALA B 1 68  ? 37.043 44.005 54.396 1.00 27.32 ? 68  ALA B N   1 
ATOM   2272 C  CA  . ALA B 1 68  ? 36.135 43.538 55.426 1.00 26.65 ? 68  ALA B CA  1 
ATOM   2273 C  C   . ALA B 1 68  ? 34.678 43.617 54.940 1.00 26.74 ? 68  ALA B C   1 
ATOM   2274 O  O   . ALA B 1 68  ? 33.923 42.648 55.093 1.00 26.65 ? 68  ALA B O   1 
ATOM   2275 C  CB  . ALA B 1 68  ? 36.330 44.362 56.680 1.00 23.34 ? 68  ALA B CB  1 
ATOM   2276 N  N   . GLN B 1 69  ? 34.283 44.757 54.361 1.00 25.99 ? 69  GLN B N   1 
ATOM   2277 C  CA  . GLN B 1 69  ? 32.909 44.891 53.864 1.00 26.54 ? 69  GLN B CA  1 
ATOM   2278 C  C   . GLN B 1 69  ? 32.578 43.770 52.868 1.00 26.52 ? 69  GLN B C   1 
ATOM   2279 O  O   . GLN B 1 69  ? 31.472 43.225 52.879 1.00 26.36 ? 69  GLN B O   1 
ATOM   2280 C  CB  . GLN B 1 69  ? 32.685 46.267 53.229 1.00 23.59 ? 69  GLN B CB  1 
ATOM   2281 C  CG  . GLN B 1 69  ? 32.496 47.404 54.265 1.00 24.57 ? 69  GLN B CG  1 
ATOM   2282 C  CD  . GLN B 1 69  ? 31.321 47.156 55.244 1.00 26.32 ? 69  GLN B CD  1 
ATOM   2283 O  OE1 . GLN B 1 69  ? 31.388 46.302 56.134 1.00 28.47 ? 69  GLN B OE1 1 
ATOM   2284 N  NE2 . GLN B 1 69  ? 30.242 47.908 55.065 1.00 28.36 ? 69  GLN B NE2 1 
ATOM   2285 N  N   . ILE B 1 70  ? 33.537 43.394 52.026 1.00 27.29 ? 70  ILE B N   1 
ATOM   2286 C  CA  . ILE B 1 70  ? 33.266 42.317 51.065 1.00 27.62 ? 70  ILE B CA  1 
ATOM   2287 C  C   . ILE B 1 70  ? 32.971 41.043 51.841 1.00 27.44 ? 70  ILE B C   1 
ATOM   2288 O  O   . ILE B 1 70  ? 32.025 40.320 51.538 1.00 28.21 ? 70  ILE B O   1 
ATOM   2289 C  CB  . ILE B 1 70  ? 34.456 42.059 50.115 1.00 26.24 ? 70  ILE B CB  1 
ATOM   2290 C  CG1 . ILE B 1 70  ? 34.647 43.258 49.195 1.00 25.52 ? 70  ILE B CG1 1 
ATOM   2291 C  CG2 . ILE B 1 70  ? 34.209 40.784 49.296 1.00 24.52 ? 70  ILE B CG2 1 
ATOM   2292 C  CD1 . ILE B 1 70  ? 35.930 43.212 48.370 1.00 26.72 ? 70  ILE B CD1 1 
ATOM   2293 N  N   . TYR B 1 71  ? 33.769 40.787 52.870 1.00 28.23 ? 71  TYR B N   1 
ATOM   2294 C  CA  . TYR B 1 71  ? 33.577 39.585 53.683 1.00 28.71 ? 71  TYR B CA  1 
ATOM   2295 C  C   . TYR B 1 71  ? 32.258 39.589 54.442 1.00 27.47 ? 71  TYR B C   1 
ATOM   2296 O  O   . TYR B 1 71  ? 31.493 38.618 54.387 1.00 27.81 ? 71  TYR B O   1 
ATOM   2297 C  CB  . TYR B 1 71  ? 34.726 39.426 54.689 1.00 28.64 ? 71  TYR B CB  1 
ATOM   2298 C  CG  . TYR B 1 71  ? 34.436 38.364 55.719 1.00 29.54 ? 71  TYR B CG  1 
ATOM   2299 C  CD1 . TYR B 1 71  ? 34.416 37.013 55.367 1.00 26.73 ? 71  TYR B CD1 1 
ATOM   2300 C  CD2 . TYR B 1 71  ? 34.134 38.715 57.039 1.00 26.64 ? 71  TYR B CD2 1 
ATOM   2301 C  CE1 . TYR B 1 71  ? 34.102 36.025 56.310 1.00 29.46 ? 71  TYR B CE1 1 
ATOM   2302 C  CE2 . TYR B 1 71  ? 33.819 37.733 57.990 1.00 30.00 ? 71  TYR B CE2 1 
ATOM   2303 C  CZ  . TYR B 1 71  ? 33.810 36.393 57.616 1.00 28.28 ? 71  TYR B CZ  1 
ATOM   2304 O  OH  . TYR B 1 71  ? 33.555 35.428 58.553 1.00 28.74 ? 71  TYR B OH  1 
ATOM   2305 N  N   . ASN B 1 72  ? 32.018 40.678 55.169 1.00 26.79 ? 72  ASN B N   1 
ATOM   2306 C  CA  . ASN B 1 72  ? 30.795 40.824 55.954 1.00 27.43 ? 72  ASN B CA  1 
ATOM   2307 C  C   . ASN B 1 72  ? 29.539 40.574 55.120 1.00 26.40 ? 72  ASN B C   1 
ATOM   2308 O  O   . ASN B 1 72  ? 28.647 39.842 55.545 1.00 26.52 ? 72  ASN B O   1 
ATOM   2309 C  CB  . ASN B 1 72  ? 30.735 42.225 56.588 1.00 27.05 ? 72  ASN B CB  1 
ATOM   2310 C  CG  . ASN B 1 72  ? 31.937 42.519 57.478 1.00 28.60 ? 72  ASN B CG  1 
ATOM   2311 O  OD1 . ASN B 1 72  ? 32.550 41.596 58.043 1.00 26.13 ? 72  ASN B OD1 1 
ATOM   2312 N  ND2 . ASN B 1 72  ? 32.267 43.808 57.629 1.00 24.07 ? 72  ASN B ND2 1 
ATOM   2313 N  N   . HIS B 1 73  ? 29.477 41.169 53.929 1.00 27.07 ? 73  HIS B N   1 
ATOM   2314 C  CA  . HIS B 1 73  ? 28.313 40.990 53.067 1.00 26.28 ? 73  HIS B CA  1 
ATOM   2315 C  C   . HIS B 1 73  ? 28.216 39.560 52.570 1.00 26.09 ? 73  HIS B C   1 
ATOM   2316 O  O   . HIS B 1 73  ? 27.133 38.959 52.591 1.00 26.58 ? 73  HIS B O   1 
ATOM   2317 C  CB  . HIS B 1 73  ? 28.349 41.977 51.888 1.00 25.79 ? 73  HIS B CB  1 
ATOM   2318 C  CG  . HIS B 1 73  ? 28.054 43.394 52.285 1.00 23.79 ? 73  HIS B CG  1 
ATOM   2319 N  ND1 . HIS B 1 73  ? 28.993 44.273 52.776 1.00 24.15 ? 73  HIS B ND1 1 
ATOM   2320 C  CD2 . HIS B 1 73  ? 26.868 44.048 52.364 1.00 22.87 ? 73  HIS B CD2 1 
ATOM   2321 C  CE1 . HIS B 1 73  ? 28.368 45.404 53.137 1.00 24.20 ? 73  HIS B CE1 1 
ATOM   2322 N  NE2 . HIS B 1 73  ? 27.071 45.318 52.911 1.00 27.39 ? 73  HIS B NE2 1 
ATOM   2323 N  N   . ASP B 1 74  ? 29.342 39.000 52.139 1.00 26.75 ? 74  ASP B N   1 
ATOM   2324 C  CA  . ASP B 1 74  ? 29.338 37.612 51.661 1.00 26.52 ? 74  ASP B CA  1 
ATOM   2325 C  C   . ASP B 1 74  ? 28.764 36.742 52.763 1.00 25.36 ? 74  ASP B C   1 
ATOM   2326 O  O   . ASP B 1 74  ? 27.914 35.893 52.511 1.00 26.52 ? 74  ASP B O   1 
ATOM   2327 C  CB  . ASP B 1 74  ? 30.746 37.106 51.349 1.00 25.72 ? 74  ASP B CB  1 
ATOM   2328 C  CG  . ASP B 1 74  ? 31.339 37.714 50.092 1.00 30.60 ? 74  ASP B CG  1 
ATOM   2329 O  OD1 . ASP B 1 74  ? 30.592 37.958 49.115 1.00 29.44 ? 74  ASP B OD1 1 
ATOM   2330 O  OD2 . ASP B 1 74  ? 32.575 37.923 50.070 1.00 34.49 ? 74  ASP B OD2 1 
ATOM   2331 N  N   . PHE B 1 75  ? 29.225 36.964 53.993 1.00 24.80 ? 75  PHE B N   1 
ATOM   2332 C  CA  . PHE B 1 75  ? 28.762 36.161 55.134 1.00 25.89 ? 75  PHE B CA  1 
ATOM   2333 C  C   . PHE B 1 75  ? 27.266 36.390 55.399 1.00 24.01 ? 75  PHE B C   1 
ATOM   2334 O  O   . PHE B 1 75  ? 26.503 35.459 55.666 1.00 24.30 ? 75  PHE B O   1 
ATOM   2335 C  CB  . PHE B 1 75  ? 29.586 36.510 56.393 1.00 26.27 ? 75  PHE B CB  1 
ATOM   2336 C  CG  . PHE B 1 75  ? 29.447 35.500 57.510 1.00 27.32 ? 75  PHE B CG  1 
ATOM   2337 C  CD1 . PHE B 1 75  ? 30.163 34.299 57.476 1.00 26.15 ? 75  PHE B CD1 1 
ATOM   2338 C  CD2 . PHE B 1 75  ? 28.563 35.726 58.572 1.00 24.41 ? 75  PHE B CD2 1 
ATOM   2339 C  CE1 . PHE B 1 75  ? 29.993 33.340 58.487 1.00 25.58 ? 75  PHE B CE1 1 
ATOM   2340 C  CE2 . PHE B 1 75  ? 28.393 34.783 59.572 1.00 23.32 ? 75  PHE B CE2 1 
ATOM   2341 C  CZ  . PHE B 1 75  ? 29.112 33.582 59.530 1.00 24.66 ? 75  PHE B CZ  1 
ATOM   2342 N  N   . TYR B 1 76  ? 26.872 37.653 55.329 1.00 24.23 ? 76  TYR B N   1 
ATOM   2343 C  CA  . TYR B 1 76  ? 25.493 38.063 55.530 1.00 23.79 ? 76  TYR B CA  1 
ATOM   2344 C  C   . TYR B 1 76  ? 24.572 37.333 54.552 1.00 23.65 ? 76  TYR B C   1 
ATOM   2345 O  O   . TYR B 1 76  ? 23.559 36.760 54.956 1.00 22.07 ? 76  TYR B O   1 
ATOM   2346 C  CB  . TYR B 1 76  ? 25.406 39.583 55.348 1.00 25.34 ? 76  TYR B CB  1 
ATOM   2347 C  CG  . TYR B 1 76  ? 24.012 40.178 55.342 1.00 26.78 ? 76  TYR B CG  1 
ATOM   2348 C  CD1 . TYR B 1 76  ? 23.199 40.121 56.472 1.00 24.23 ? 76  TYR B CD1 1 
ATOM   2349 C  CD2 . TYR B 1 76  ? 23.532 40.861 54.205 1.00 27.89 ? 76  TYR B CD2 1 
ATOM   2350 C  CE1 . TYR B 1 76  ? 21.938 40.736 56.485 1.00 28.40 ? 76  TYR B CE1 1 
ATOM   2351 C  CE2 . TYR B 1 76  ? 22.280 41.479 54.203 1.00 27.49 ? 76  TYR B CE2 1 
ATOM   2352 C  CZ  . TYR B 1 76  ? 21.488 41.419 55.345 1.00 28.18 ? 76  TYR B CZ  1 
ATOM   2353 O  OH  . TYR B 1 76  ? 20.278 42.073 55.360 1.00 26.78 ? 76  TYR B OH  1 
ATOM   2354 N  N   . TRP B 1 77  ? 24.927 37.328 53.268 1.00 23.93 ? 77  TRP B N   1 
ATOM   2355 C  CA  . TRP B 1 77  ? 24.080 36.651 52.279 1.00 25.07 ? 77  TRP B CA  1 
ATOM   2356 C  C   . TRP B 1 77  ? 23.866 35.165 52.593 1.00 26.45 ? 77  TRP B C   1 
ATOM   2357 O  O   . TRP B 1 77  ? 22.748 34.648 52.462 1.00 25.06 ? 77  TRP B O   1 
ATOM   2358 C  CB  . TRP B 1 77  ? 24.664 36.808 50.876 1.00 21.84 ? 77  TRP B CB  1 
ATOM   2359 C  CG  . TRP B 1 77  ? 24.787 38.235 50.425 1.00 21.15 ? 77  TRP B CG  1 
ATOM   2360 C  CD1 . TRP B 1 77  ? 25.877 38.806 49.852 1.00 22.48 ? 77  TRP B CD1 1 
ATOM   2361 C  CD2 . TRP B 1 77  ? 23.792 39.270 50.511 1.00 21.98 ? 77  TRP B CD2 1 
ATOM   2362 N  NE1 . TRP B 1 77  ? 25.637 40.125 49.578 1.00 24.86 ? 77  TRP B NE1 1 
ATOM   2363 C  CE2 . TRP B 1 77  ? 24.363 40.439 49.970 1.00 23.14 ? 77  TRP B CE2 1 
ATOM   2364 C  CE3 . TRP B 1 77  ? 22.472 39.322 50.992 1.00 22.54 ? 77  TRP B CE3 1 
ATOM   2365 C  CZ2 . TRP B 1 77  ? 23.662 41.660 49.887 1.00 24.88 ? 77  TRP B CZ2 1 
ATOM   2366 C  CZ3 . TRP B 1 77  ? 21.773 40.534 50.909 1.00 22.32 ? 77  TRP B CZ3 1 
ATOM   2367 C  CH2 . TRP B 1 77  ? 22.375 41.690 50.360 1.00 21.30 ? 77  TRP B CH2 1 
ATOM   2368 N  N   . ASP B 1 78  ? 24.923 34.480 53.024 1.00 27.28 ? 78  ASP B N   1 
ATOM   2369 C  CA  . ASP B 1 78  ? 24.801 33.054 53.358 1.00 26.92 ? 78  ASP B CA  1 
ATOM   2370 C  C   . ASP B 1 78  ? 23.984 32.811 54.619 1.00 26.96 ? 78  ASP B C   1 
ATOM   2371 O  O   . ASP B 1 78  ? 23.538 31.683 54.854 1.00 24.71 ? 78  ASP B O   1 
ATOM   2372 C  CB  . ASP B 1 78  ? 26.181 32.404 53.541 1.00 26.72 ? 78  ASP B CB  1 
ATOM   2373 C  CG  . ASP B 1 78  ? 26.869 32.118 52.229 1.00 25.31 ? 78  ASP B CG  1 
ATOM   2374 O  OD1 . ASP B 1 78  ? 26.220 31.559 51.321 1.00 28.97 ? 78  ASP B OD1 1 
ATOM   2375 O  OD2 . ASP B 1 78  ? 28.065 32.438 52.107 1.00 26.24 ? 78  ASP B OD2 1 
ATOM   2376 N  N   . CYS B 1 79  ? 23.806 33.854 55.434 1.00 26.67 ? 79  CYS B N   1 
ATOM   2377 C  CA  . CYS B 1 79  ? 23.041 33.714 56.673 1.00 27.82 ? 79  CYS B CA  1 
ATOM   2378 C  C   . CYS B 1 79  ? 21.560 33.791 56.421 1.00 27.63 ? 79  CYS B C   1 
ATOM   2379 O  O   . CYS B 1 79  ? 20.767 33.572 57.332 1.00 26.97 ? 79  CYS B O   1 
ATOM   2380 C  CB  . CYS B 1 79  ? 23.419 34.800 57.681 1.00 29.15 ? 79  CYS B CB  1 
ATOM   2381 S  SG  . CYS B 1 79  ? 25.007 34.566 58.516 1.00 33.46 ? 79  CYS B SG  1 
ATOM   2382 N  N   . LEU B 1 80  ? 21.202 34.114 55.179 1.00 28.47 ? 80  LEU B N   1 
ATOM   2383 C  CA  . LEU B 1 80  ? 19.814 34.250 54.763 1.00 29.70 ? 80  LEU B CA  1 
ATOM   2384 C  C   . LEU B 1 80  ? 19.320 33.057 53.952 1.00 31.45 ? 80  LEU B C   1 
ATOM   2385 O  O   . LEU B 1 80  ? 20.070 32.470 53.166 1.00 32.26 ? 80  LEU B O   1 
ATOM   2386 C  CB  . LEU B 1 80  ? 19.634 35.511 53.900 1.00 28.01 ? 80  LEU B CB  1 
ATOM   2387 C  CG  . LEU B 1 80  ? 19.992 36.866 54.510 1.00 28.28 ? 80  LEU B CG  1 
ATOM   2388 C  CD1 . LEU B 1 80  ? 19.752 37.967 53.481 1.00 20.54 ? 80  LEU B CD1 1 
ATOM   2389 C  CD2 . LEU B 1 80  ? 19.154 37.100 55.769 1.00 24.78 ? 80  LEU B CD2 1 
ATOM   2390 N  N   . SER B 1 81  ? 18.048 32.718 54.127 1.00 31.30 ? 81  SER B N   1 
ATOM   2391 C  CA  . SER B 1 81  ? 17.447 31.634 53.374 1.00 32.31 ? 81  SER B CA  1 
ATOM   2392 C  C   . SER B 1 81  ? 15.950 31.855 53.134 1.00 33.08 ? 81  SER B C   1 
ATOM   2393 O  O   . SER B 1 81  ? 15.234 32.300 54.030 1.00 33.94 ? 81  SER B O   1 
ATOM   2394 C  CB  . SER B 1 81  ? 17.641 30.321 54.101 1.00 34.65 ? 81  SER B CB  1 
ATOM   2395 O  OG  . SER B 1 81  ? 16.954 29.296 53.413 1.00 38.92 ? 81  SER B OG  1 
ATOM   2396 N  N   . PRO B 1 82  ? 15.456 31.531 51.920 1.00 33.11 ? 82  PRO B N   1 
ATOM   2397 C  CA  . PRO B 1 82  ? 14.040 31.690 51.553 1.00 33.79 ? 82  PRO B CA  1 
ATOM   2398 C  C   . PRO B 1 82  ? 13.121 30.928 52.498 1.00 37.21 ? 82  PRO B C   1 
ATOM   2399 O  O   . PRO B 1 82  ? 12.072 31.433 52.941 1.00 39.79 ? 82  PRO B O   1 
ATOM   2400 C  CB  . PRO B 1 82  ? 13.982 31.115 50.145 1.00 29.82 ? 82  PRO B CB  1 
ATOM   2401 C  CG  . PRO B 1 82  ? 15.333 31.401 49.606 1.00 29.31 ? 82  PRO B CG  1 
ATOM   2402 C  CD  . PRO B 1 82  ? 16.237 31.062 50.764 1.00 30.17 ? 82  PRO B CD  1 
ATOM   2403 N  N   . LYS B 1 83  ? 13.513 29.685 52.770 1.00 39.06 ? 83  LYS B N   1 
ATOM   2404 C  CA  . LYS B 1 83  ? 12.767 28.797 53.660 1.00 42.30 ? 83  LYS B CA  1 
ATOM   2405 C  C   . LYS B 1 83  ? 13.558 28.439 54.936 1.00 42.89 ? 83  LYS B C   1 
ATOM   2406 O  O   . LYS B 1 83  ? 14.796 28.374 54.934 1.00 41.26 ? 83  LYS B O   1 
ATOM   2407 C  CB  . LYS B 1 83  ? 12.381 27.516 52.912 1.00 44.32 ? 83  LYS B CB  1 
ATOM   2408 C  CG  . LYS B 1 83  ? 11.603 27.788 51.633 1.00 48.72 ? 83  LYS B CG  1 
ATOM   2409 C  CD  . LYS B 1 83  ? 11.351 26.523 50.815 1.00 52.55 ? 83  LYS B CD  1 
ATOM   2410 C  CE  . LYS B 1 83  ? 10.461 25.532 51.554 1.00 53.41 ? 83  LYS B CE  1 
ATOM   2411 N  NZ  . LYS B 1 83  ? 10.049 24.416 50.649 1.00 56.85 ? 83  LYS B NZ  1 
ATOM   2412 N  N   . ALA B 1 84  ? 12.831 28.216 56.025 1.00 42.94 ? 84  ALA B N   1 
ATOM   2413 C  CA  . ALA B 1 84  ? 13.462 27.865 57.285 1.00 44.34 ? 84  ALA B CA  1 
ATOM   2414 C  C   . ALA B 1 84  ? 14.192 26.520 57.196 1.00 45.00 ? 84  ALA B C   1 
ATOM   2415 O  O   . ALA B 1 84  ? 13.755 25.594 56.508 1.00 45.01 ? 84  ALA B O   1 
ATOM   2416 C  CB  . ALA B 1 84  ? 12.421 27.831 58.397 1.00 42.28 ? 84  ALA B CB  1 
ATOM   2417 N  N   . THR B 1 85  ? 15.325 26.446 57.887 1.00 46.48 ? 85  THR B N   1 
ATOM   2418 C  CA  . THR B 1 85  ? 16.161 25.251 57.952 1.00 46.31 ? 85  THR B CA  1 
ATOM   2419 C  C   . THR B 1 85  ? 16.333 24.975 59.430 1.00 45.82 ? 85  THR B C   1 
ATOM   2420 O  O   . THR B 1 85  ? 16.150 25.874 60.253 1.00 46.64 ? 85  THR B O   1 
ATOM   2421 C  CB  . THR B 1 85  ? 17.549 25.488 57.337 1.00 47.43 ? 85  THR B CB  1 
ATOM   2422 O  OG1 . THR B 1 85  ? 18.118 26.687 57.882 1.00 46.32 ? 85  THR B OG1 1 
ATOM   2423 C  CG2 . THR B 1 85  ? 17.439 25.608 55.831 1.00 47.37 ? 85  THR B CG2 1 
ATOM   2424 N  N   . ALA B 1 86  ? 16.693 23.745 59.775 1.00 45.05 ? 86  ALA B N   1 
ATOM   2425 C  CA  . ALA B 1 86  ? 16.846 23.396 61.178 1.00 42.65 ? 86  ALA B CA  1 
ATOM   2426 C  C   . ALA B 1 86  ? 18.263 23.569 61.698 1.00 41.27 ? 86  ALA B C   1 
ATOM   2427 O  O   . ALA B 1 86  ? 19.241 23.525 60.946 1.00 39.67 ? 86  ALA B O   1 
ATOM   2428 C  CB  . ALA B 1 86  ? 16.384 21.968 61.410 1.00 43.87 ? 86  ALA B CB  1 
ATOM   2429 N  N   . LEU B 1 87  ? 18.357 23.780 63.002 1.00 40.02 ? 87  LEU B N   1 
ATOM   2430 C  CA  . LEU B 1 87  ? 19.645 23.929 63.646 1.00 40.30 ? 87  LEU B CA  1 
ATOM   2431 C  C   . LEU B 1 87  ? 20.217 22.542 63.922 1.00 39.82 ? 87  LEU B C   1 
ATOM   2432 O  O   . LEU B 1 87  ? 19.478 21.587 64.158 1.00 39.48 ? 87  LEU B O   1 
ATOM   2433 C  CB  . LEU B 1 87  ? 19.504 24.671 64.971 1.00 39.10 ? 87  LEU B CB  1 
ATOM   2434 C  CG  . LEU B 1 87  ? 19.151 26.156 64.992 1.00 40.78 ? 87  LEU B CG  1 
ATOM   2435 C  CD1 . LEU B 1 87  ? 17.667 26.367 64.660 1.00 38.89 ? 87  LEU B CD1 1 
ATOM   2436 C  CD2 . LEU B 1 87  ? 19.468 26.700 66.383 1.00 38.80 ? 87  LEU B CD2 1 
ATOM   2437 N  N   . SER B 1 88  ? 21.534 22.423 63.870 1.00 39.90 ? 88  SER B N   1 
ATOM   2438 C  CA  . SER B 1 88  ? 22.155 21.145 64.169 1.00 40.97 ? 88  SER B CA  1 
ATOM   2439 C  C   . SER B 1 88  ? 21.936 21.003 65.670 1.00 42.54 ? 88  SER B C   1 
ATOM   2440 O  O   . SER B 1 88  ? 21.758 22.006 66.371 1.00 42.48 ? 88  SER B O   1 
ATOM   2441 C  CB  . SER B 1 88  ? 23.654 21.190 63.866 1.00 39.07 ? 88  SER B CB  1 
ATOM   2442 O  OG  . SER B 1 88  ? 24.338 22.046 64.773 1.00 38.99 ? 88  SER B OG  1 
ATOM   2443 N  N   . ASP B 1 89  ? 21.941 19.776 66.174 1.00 44.62 ? 89  ASP B N   1 
ATOM   2444 C  CA  . ASP B 1 89  ? 21.731 19.582 67.602 1.00 46.39 ? 89  ASP B CA  1 
ATOM   2445 C  C   . ASP B 1 89  ? 22.835 20.227 68.424 1.00 45.69 ? 89  ASP B C   1 
ATOM   2446 O  O   . ASP B 1 89  ? 22.573 20.727 69.516 1.00 45.81 ? 89  ASP B O   1 
ATOM   2447 C  CB  . ASP B 1 89  ? 21.617 18.095 67.923 1.00 49.87 ? 89  ASP B CB  1 
ATOM   2448 C  CG  . ASP B 1 89  ? 20.269 17.527 67.533 1.00 53.54 ? 89  ASP B CG  1 
ATOM   2449 O  OD1 . ASP B 1 89  ? 19.821 17.792 66.400 1.00 57.67 ? 89  ASP B OD1 1 
ATOM   2450 O  OD2 . ASP B 1 89  ? 19.657 16.813 68.353 1.00 56.86 ? 89  ASP B OD2 1 
ATOM   2451 N  N   . GLU B 1 90  ? 24.058 20.234 67.898 1.00 45.96 ? 90  GLU B N   1 
ATOM   2452 C  CA  . GLU B 1 90  ? 25.179 20.843 68.612 1.00 47.02 ? 90  GLU B CA  1 
ATOM   2453 C  C   . GLU B 1 90  ? 24.978 22.347 68.774 1.00 45.77 ? 90  GLU B C   1 
ATOM   2454 O  O   . GLU B 1 90  ? 25.208 22.893 69.857 1.00 45.50 ? 90  GLU B O   1 
ATOM   2455 C  CB  . GLU B 1 90  ? 26.496 20.645 67.877 1.00 51.05 ? 90  GLU B CB  1 
ATOM   2456 C  CG  . GLU B 1 90  ? 26.506 19.602 66.791 1.00 59.93 ? 90  GLU B CG  1 
ATOM   2457 C  CD  . GLU B 1 90  ? 27.517 19.974 65.709 1.00 66.49 ? 90  GLU B CD  1 
ATOM   2458 O  OE1 . GLU B 1 90  ? 28.578 20.555 66.070 1.00 66.91 ? 90  GLU B OE1 1 
ATOM   2459 O  OE2 . GLU B 1 90  ? 27.253 19.693 64.512 1.00 70.13 ? 90  GLU B OE2 1 
ATOM   2460 N  N   . LEU B 1 91  ? 24.579 23.016 67.689 1.00 44.21 ? 91  LEU B N   1 
ATOM   2461 C  CA  . LEU B 1 91  ? 24.354 24.457 67.725 1.00 41.41 ? 91  LEU B CA  1 
ATOM   2462 C  C   . LEU B 1 91  ? 23.224 24.731 68.682 1.00 40.35 ? 91  LEU B C   1 
ATOM   2463 O  O   . LEU B 1 91  ? 23.323 25.614 69.530 1.00 39.59 ? 91  LEU B O   1 
ATOM   2464 C  CB  . LEU B 1 91  ? 23.981 25.013 66.352 1.00 40.86 ? 91  LEU B CB  1 
ATOM   2465 C  CG  . LEU B 1 91  ? 23.702 26.528 66.329 1.00 41.57 ? 91  LEU B CG  1 
ATOM   2466 C  CD1 . LEU B 1 91  ? 24.980 27.316 66.627 1.00 37.57 ? 91  LEU B CD1 1 
ATOM   2467 C  CD2 . LEU B 1 91  ? 23.155 26.930 64.965 1.00 40.85 ? 91  LEU B CD2 1 
ATOM   2468 N  N   . LYS B 1 92  ? 22.148 23.965 68.564 1.00 38.67 ? 92  LYS B N   1 
ATOM   2469 C  CA  . LYS B 1 92  ? 21.035 24.183 69.465 1.00 39.50 ? 92  LYS B CA  1 
ATOM   2470 C  C   . LYS B 1 92  ? 21.500 24.050 70.920 1.00 40.40 ? 92  LYS B C   1 
ATOM   2471 O  O   . LYS B 1 92  ? 21.224 24.917 71.759 1.00 40.92 ? 92  LYS B O   1 
ATOM   2472 C  CB  . LYS B 1 92  ? 19.911 23.195 69.194 1.00 37.02 ? 92  LYS B CB  1 
ATOM   2473 C  CG  . LYS B 1 92  ? 18.866 23.240 70.279 1.00 39.78 ? 92  LYS B CG  1 
ATOM   2474 C  CD  . LYS B 1 92  ? 17.550 22.653 69.842 1.00 41.80 ? 92  LYS B CD  1 
ATOM   2475 C  CE  . LYS B 1 92  ? 16.593 22.606 71.032 1.00 43.66 ? 92  LYS B CE  1 
ATOM   2476 N  NZ  . LYS B 1 92  ? 15.195 22.290 70.622 1.00 45.30 ? 92  LYS B NZ  1 
ATOM   2477 N  N   . GLY B 1 93  ? 22.200 22.957 71.215 1.00 39.33 ? 93  GLY B N   1 
ATOM   2478 C  CA  . GLY B 1 93  ? 22.687 22.749 72.563 1.00 38.39 ? 93  GLY B CA  1 
ATOM   2479 C  C   . GLY B 1 93  ? 23.562 23.901 73.016 1.00 36.71 ? 93  GLY B C   1 
ATOM   2480 O  O   . GLY B 1 93  ? 23.386 24.443 74.106 1.00 36.44 ? 93  GLY B O   1 
ATOM   2481 N  N   . ALA B 1 94  ? 24.499 24.287 72.163 1.00 35.06 ? 94  ALA B N   1 
ATOM   2482 C  CA  . ALA B 1 94  ? 25.409 25.374 72.479 1.00 35.50 ? 94  ALA B CA  1 
ATOM   2483 C  C   . ALA B 1 94  ? 24.676 26.689 72.786 1.00 36.47 ? 94  ALA B C   1 
ATOM   2484 O  O   . ALA B 1 94  ? 25.048 27.432 73.705 1.00 36.76 ? 94  ALA B O   1 
ATOM   2485 C  CB  . ALA B 1 94  ? 26.376 25.569 71.333 1.00 32.01 ? 94  ALA B CB  1 
ATOM   2486 N  N   . LEU B 1 95  ? 23.633 26.974 72.015 1.00 35.67 ? 95  LEU B N   1 
ATOM   2487 C  CA  . LEU B 1 95  ? 22.881 28.205 72.206 1.00 36.54 ? 95  LEU B CA  1 
ATOM   2488 C  C   . LEU B 1 95  ? 22.081 28.189 73.509 1.00 36.93 ? 95  LEU B C   1 
ATOM   2489 O  O   . LEU B 1 95  ? 22.009 29.194 74.222 1.00 34.41 ? 95  LEU B O   1 
ATOM   2490 C  CB  . LEU B 1 95  ? 21.967 28.453 70.997 1.00 34.40 ? 95  LEU B CB  1 
ATOM   2491 C  CG  . LEU B 1 95  ? 22.707 28.863 69.707 1.00 35.12 ? 95  LEU B CG  1 
ATOM   2492 C  CD1 . LEU B 1 95  ? 21.712 28.981 68.569 1.00 31.63 ? 95  LEU B CD1 1 
ATOM   2493 C  CD2 . LEU B 1 95  ? 23.457 30.177 69.907 1.00 30.58 ? 95  LEU B CD2 1 
ATOM   2494 N  N   . GLU B 1 96  ? 21.480 27.048 73.819 1.00 37.53 ? 96  GLU B N   1 
ATOM   2495 C  CA  . GLU B 1 96  ? 20.721 26.934 75.050 1.00 40.66 ? 96  GLU B CA  1 
ATOM   2496 C  C   . GLU B 1 96  ? 21.657 27.021 76.252 1.00 41.22 ? 96  GLU B C   1 
ATOM   2497 O  O   . GLU B 1 96  ? 21.294 27.577 77.287 1.00 40.33 ? 96  GLU B O   1 
ATOM   2498 C  CB  . GLU B 1 96  ? 19.951 25.624 75.058 1.00 42.51 ? 96  GLU B CB  1 
ATOM   2499 C  CG  . GLU B 1 96  ? 19.080 25.492 73.835 1.00 46.30 ? 96  GLU B CG  1 
ATOM   2500 C  CD  . GLU B 1 96  ? 18.286 24.217 73.812 1.00 47.73 ? 96  GLU B CD  1 
ATOM   2501 O  OE1 . GLU B 1 96  ? 18.880 23.138 74.026 1.00 50.97 ? 96  GLU B OE1 1 
ATOM   2502 O  OE2 . GLU B 1 96  ? 17.066 24.293 73.569 1.00 49.83 ? 96  GLU B OE2 1 
ATOM   2503 N  N   . LYS B 1 97  ? 22.873 26.507 76.105 1.00 42.10 ? 97  LYS B N   1 
ATOM   2504 C  CA  . LYS B 1 97  ? 23.838 26.558 77.195 1.00 43.92 ? 97  LYS B CA  1 
ATOM   2505 C  C   . LYS B 1 97  ? 24.335 27.971 77.404 1.00 42.84 ? 97  LYS B C   1 
ATOM   2506 O  O   . LYS B 1 97  ? 24.346 28.481 78.523 1.00 42.08 ? 97  LYS B O   1 
ATOM   2507 C  CB  . LYS B 1 97  ? 25.046 25.654 76.903 1.00 48.22 ? 97  LYS B CB  1 
ATOM   2508 C  CG  . LYS B 1 97  ? 26.177 25.750 77.948 1.00 52.81 ? 97  LYS B CG  1 
ATOM   2509 C  CD  . LYS B 1 97  ? 27.338 24.772 77.648 1.00 56.97 ? 97  LYS B CD  1 
ATOM   2510 C  CE  . LYS B 1 97  ? 28.110 25.118 76.356 1.00 59.70 ? 97  LYS B CE  1 
ATOM   2511 N  NZ  . LYS B 1 97  ? 28.963 26.353 76.450 1.00 59.99 ? 97  LYS B NZ  1 
ATOM   2512 N  N   . ASP B 1 98  ? 24.752 28.602 76.316 1.00 42.13 ? 98  ASP B N   1 
ATOM   2513 C  CA  . ASP B 1 98  ? 25.293 29.944 76.405 1.00 41.73 ? 98  ASP B CA  1 
ATOM   2514 C  C   . ASP B 1 98  ? 24.258 31.043 76.564 1.00 40.60 ? 98  ASP B C   1 
ATOM   2515 O  O   . ASP B 1 98  ? 24.606 32.155 76.958 1.00 42.07 ? 98  ASP B O   1 
ATOM   2516 C  CB  . ASP B 1 98  ? 26.174 30.240 75.186 1.00 44.34 ? 98  ASP B CB  1 
ATOM   2517 C  CG  . ASP B 1 98  ? 27.376 29.300 75.084 1.00 45.32 ? 98  ASP B CG  1 
ATOM   2518 O  OD1 . ASP B 1 98  ? 27.765 28.735 76.127 1.00 47.60 ? 98  ASP B OD1 1 
ATOM   2519 O  OD2 . ASP B 1 98  ? 27.937 29.139 73.972 1.00 43.35 ? 98  ASP B OD2 1 
ATOM   2520 N  N   . PHE B 1 99  ? 22.990 30.741 76.291 1.00 38.67 ? 99  PHE B N   1 
ATOM   2521 C  CA  . PHE B 1 99  ? 21.958 31.768 76.401 1.00 37.06 ? 99  PHE B CA  1 
ATOM   2522 C  C   . PHE B 1 99  ? 20.709 31.385 77.181 1.00 37.12 ? 99  PHE B C   1 
ATOM   2523 O  O   . PHE B 1 99  ? 19.838 32.221 77.391 1.00 38.71 ? 99  PHE B O   1 
ATOM   2524 C  CB  . PHE B 1 99  ? 21.574 32.255 74.997 1.00 32.67 ? 99  PHE B CB  1 
ATOM   2525 C  CG  . PHE B 1 99  ? 22.677 32.999 74.296 1.00 30.40 ? 99  PHE B CG  1 
ATOM   2526 C  CD1 . PHE B 1 99  ? 22.930 34.329 74.595 1.00 30.94 ? 99  PHE B CD1 1 
ATOM   2527 C  CD2 . PHE B 1 99  ? 23.504 32.351 73.390 1.00 29.27 ? 99  PHE B CD2 1 
ATOM   2528 C  CE1 . PHE B 1 99  ? 23.995 35.009 73.998 1.00 32.13 ? 99  PHE B CE1 1 
ATOM   2529 C  CE2 . PHE B 1 99  ? 24.567 33.015 72.791 1.00 31.90 ? 99  PHE B CE2 1 
ATOM   2530 C  CZ  . PHE B 1 99  ? 24.817 34.353 73.102 1.00 31.53 ? 99  PHE B CZ  1 
ATOM   2531 N  N   . GLY B 1 100 ? 20.613 30.135 77.617 1.00 36.80 ? 100 GLY B N   1 
ATOM   2532 C  CA  . GLY B 1 100 ? 19.432 29.727 78.371 1.00 36.88 ? 100 GLY B CA  1 
ATOM   2533 C  C   . GLY B 1 100 ? 18.406 28.999 77.520 1.00 37.97 ? 100 GLY B C   1 
ATOM   2534 O  O   . GLY B 1 100 ? 17.910 27.922 77.887 1.00 39.99 ? 100 GLY B O   1 
ATOM   2535 N  N   . SER B 1 101 ? 18.093 29.587 76.370 1.00 36.95 ? 101 SER B N   1 
ATOM   2536 C  CA  . SER B 1 101 ? 17.130 29.017 75.430 1.00 35.00 ? 101 SER B CA  1 
ATOM   2537 C  C   . SER B 1 101 ? 17.262 29.720 74.075 1.00 33.87 ? 101 SER B C   1 
ATOM   2538 O  O   . SER B 1 101 ? 17.850 30.796 73.970 1.00 31.88 ? 101 SER B O   1 
ATOM   2539 C  CB  . SER B 1 101 ? 15.713 29.219 75.955 1.00 32.94 ? 101 SER B CB  1 
ATOM   2540 O  OG  . SER B 1 101 ? 15.414 30.602 76.022 1.00 32.53 ? 101 SER B OG  1 
ATOM   2541 N  N   . LEU B 1 102 ? 16.726 29.093 73.037 1.00 33.73 ? 102 LEU B N   1 
ATOM   2542 C  CA  . LEU B 1 102 ? 16.751 29.686 71.710 1.00 33.81 ? 102 LEU B CA  1 
ATOM   2543 C  C   . LEU B 1 102 ? 15.995 31.014 71.733 1.00 33.44 ? 102 LEU B C   1 
ATOM   2544 O  O   . LEU B 1 102 ? 16.423 31.995 71.131 1.00 34.63 ? 102 LEU B O   1 
ATOM   2545 C  CB  . LEU B 1 102 ? 16.097 28.743 70.713 1.00 31.04 ? 102 LEU B CB  1 
ATOM   2546 C  CG  . LEU B 1 102 ? 16.783 27.387 70.636 1.00 31.84 ? 102 LEU B CG  1 
ATOM   2547 C  CD1 . LEU B 1 102 ? 16.124 26.563 69.527 1.00 30.62 ? 102 LEU B CD1 1 
ATOM   2548 C  CD2 . LEU B 1 102 ? 18.247 27.579 70.338 1.00 27.87 ? 102 LEU B CD2 1 
ATOM   2549 N  N   . GLU B 1 103 ? 14.880 31.046 72.447 1.00 33.99 ? 103 GLU B N   1 
ATOM   2550 C  CA  . GLU B 1 103 ? 14.067 32.252 72.534 1.00 37.30 ? 103 GLU B CA  1 
ATOM   2551 C  C   . GLU B 1 103 ? 14.832 33.399 73.183 1.00 37.04 ? 103 GLU B C   1 
ATOM   2552 O  O   . GLU B 1 103 ? 14.689 34.555 72.779 1.00 37.95 ? 103 GLU B O   1 
ATOM   2553 C  CB  . GLU B 1 103 ? 12.772 31.974 73.315 1.00 39.22 ? 103 GLU B CB  1 
ATOM   2554 C  CG  . GLU B 1 103 ? 11.945 30.803 72.762 1.00 47.43 ? 103 GLU B CG  1 
ATOM   2555 C  CD  . GLU B 1 103 ? 12.597 29.427 73.009 1.00 53.28 ? 103 GLU B CD  1 
ATOM   2556 O  OE1 . GLU B 1 103 ? 12.178 28.434 72.366 1.00 56.67 ? 103 GLU B OE1 1 
ATOM   2557 O  OE2 . GLU B 1 103 ? 13.521 29.330 73.851 1.00 54.55 ? 103 GLU B OE2 1 
ATOM   2558 N  N   . LYS B 1 104 ? 15.648 33.081 74.186 1.00 36.58 ? 104 LYS B N   1 
ATOM   2559 C  CA  . LYS B 1 104 ? 16.422 34.103 74.870 1.00 33.87 ? 104 LYS B CA  1 
ATOM   2560 C  C   . LYS B 1 104 ? 17.555 34.579 73.963 1.00 33.33 ? 104 LYS B C   1 
ATOM   2561 O  O   . LYS B 1 104 ? 17.901 35.767 73.939 1.00 32.10 ? 104 LYS B O   1 
ATOM   2562 C  CB  . LYS B 1 104 ? 16.994 33.561 76.183 1.00 35.24 ? 104 LYS B CB  1 
ATOM   2563 C  CG  . LYS B 1 104 ? 17.623 34.638 77.027 1.00 35.39 ? 104 LYS B CG  1 
ATOM   2564 C  CD  . LYS B 1 104 ? 16.570 35.639 77.451 1.00 38.47 ? 104 LYS B CD  1 
ATOM   2565 C  CE  . LYS B 1 104 ? 17.150 37.020 77.661 1.00 39.82 ? 104 LYS B CE  1 
ATOM   2566 N  NZ  . LYS B 1 104 ? 18.249 37.046 78.640 1.00 41.25 ? 104 LYS B NZ  1 
ATOM   2567 N  N   . PHE B 1 105 ? 18.146 33.650 73.218 1.00 30.67 ? 105 PHE B N   1 
ATOM   2568 C  CA  . PHE B 1 105 ? 19.209 34.039 72.305 1.00 31.46 ? 105 PHE B CA  1 
ATOM   2569 C  C   . PHE B 1 105 ? 18.629 35.047 71.294 1.00 31.55 ? 105 PHE B C   1 
ATOM   2570 O  O   . PHE B 1 105 ? 19.213 36.103 71.056 1.00 31.47 ? 105 PHE B O   1 
ATOM   2571 C  CB  . PHE B 1 105 ? 19.771 32.825 71.556 1.00 29.76 ? 105 PHE B CB  1 
ATOM   2572 C  CG  . PHE B 1 105 ? 20.718 33.197 70.451 1.00 30.71 ? 105 PHE B CG  1 
ATOM   2573 C  CD1 . PHE B 1 105 ? 21.953 33.766 70.737 1.00 31.22 ? 105 PHE B CD1 1 
ATOM   2574 C  CD2 . PHE B 1 105 ? 20.347 33.043 69.117 1.00 31.56 ? 105 PHE B CD2 1 
ATOM   2575 C  CE1 . PHE B 1 105 ? 22.812 34.189 69.711 1.00 30.15 ? 105 PHE B CE1 1 
ATOM   2576 C  CE2 . PHE B 1 105 ? 21.188 33.458 68.085 1.00 31.02 ? 105 PHE B CE2 1 
ATOM   2577 C  CZ  . PHE B 1 105 ? 22.423 34.035 68.382 1.00 32.04 ? 105 PHE B CZ  1 
ATOM   2578 N  N   . LYS B 1 106 ? 17.475 34.714 70.714 1.00 31.25 ? 106 LYS B N   1 
ATOM   2579 C  CA  . LYS B 1 106 ? 16.821 35.589 69.746 1.00 31.87 ? 106 LYS B CA  1 
ATOM   2580 C  C   . LYS B 1 106 ? 16.626 36.967 70.360 1.00 31.07 ? 106 LYS B C   1 
ATOM   2581 O  O   . LYS B 1 106 ? 17.063 37.975 69.809 1.00 29.79 ? 106 LYS B O   1 
ATOM   2582 C  CB  . LYS B 1 106 ? 15.462 35.017 69.320 1.00 32.23 ? 106 LYS B CB  1 
ATOM   2583 C  CG  . LYS B 1 106 ? 14.643 36.023 68.523 1.00 34.77 ? 106 LYS B CG  1 
ATOM   2584 C  CD  . LYS B 1 106 ? 13.323 35.483 68.018 1.00 34.32 ? 106 LYS B CD  1 
ATOM   2585 C  CE  . LYS B 1 106 ? 12.589 36.568 67.212 1.00 35.55 ? 106 LYS B CE  1 
ATOM   2586 N  NZ  . LYS B 1 106 ? 11.286 36.075 66.690 1.00 33.26 ? 106 LYS B NZ  1 
ATOM   2587 N  N   . GLU B 1 107 ? 15.977 36.991 71.513 1.00 31.73 ? 107 GLU B N   1 
ATOM   2588 C  CA  . GLU B 1 107 ? 15.730 38.224 72.231 1.00 33.86 ? 107 GLU B CA  1 
ATOM   2589 C  C   . GLU B 1 107 ? 17.040 39.011 72.401 1.00 34.15 ? 107 GLU B C   1 
ATOM   2590 O  O   . GLU B 1 107 ? 17.105 40.203 72.083 1.00 34.58 ? 107 GLU B O   1 
ATOM   2591 C  CB  . GLU B 1 107 ? 15.105 37.879 73.587 1.00 38.36 ? 107 GLU B CB  1 
ATOM   2592 C  CG  . GLU B 1 107 ? 14.595 39.051 74.434 1.00 45.91 ? 107 GLU B CG  1 
ATOM   2593 C  CD  . GLU B 1 107 ? 13.811 38.581 75.667 1.00 51.02 ? 107 GLU B CD  1 
ATOM   2594 O  OE1 . GLU B 1 107 ? 14.397 37.889 76.532 1.00 55.04 ? 107 GLU B OE1 1 
ATOM   2595 O  OE2 . GLU B 1 107 ? 12.604 38.897 75.769 1.00 53.95 ? 107 GLU B OE2 1 
ATOM   2596 N  N   . ASP B 1 108 ? 18.095 38.352 72.876 1.00 33.34 ? 108 ASP B N   1 
ATOM   2597 C  CA  . ASP B 1 108 ? 19.364 39.044 73.080 1.00 33.12 ? 108 ASP B CA  1 
ATOM   2598 C  C   . ASP B 1 108 ? 20.002 39.516 71.790 1.00 32.41 ? 108 ASP B C   1 
ATOM   2599 O  O   . ASP B 1 108 ? 20.558 40.613 71.732 1.00 32.68 ? 108 ASP B O   1 
ATOM   2600 C  CB  . ASP B 1 108 ? 20.361 38.149 73.811 1.00 34.88 ? 108 ASP B CB  1 
ATOM   2601 C  CG  . ASP B 1 108 ? 19.937 37.847 75.229 1.00 36.28 ? 108 ASP B CG  1 
ATOM   2602 O  OD1 . ASP B 1 108 ? 18.999 38.513 75.725 1.00 34.61 ? 108 ASP B OD1 1 
ATOM   2603 O  OD2 . ASP B 1 108 ? 20.550 36.948 75.840 1.00 38.82 ? 108 ASP B OD2 1 
ATOM   2604 N  N   . PHE B 1 109 ? 19.937 38.674 70.762 1.00 30.76 ? 109 PHE B N   1 
ATOM   2605 C  CA  . PHE B 1 109 ? 20.526 38.998 69.470 1.00 31.56 ? 109 PHE B CA  1 
ATOM   2606 C  C   . PHE B 1 109 ? 19.832 40.212 68.842 1.00 30.79 ? 109 PHE B C   1 
ATOM   2607 O  O   . PHE B 1 109 ? 20.481 41.182 68.428 1.00 28.66 ? 109 PHE B O   1 
ATOM   2608 C  CB  . PHE B 1 109 ? 20.447 37.785 68.534 1.00 30.32 ? 109 PHE B CB  1 
ATOM   2609 C  CG  . PHE B 1 109 ? 21.090 38.017 67.204 1.00 29.70 ? 109 PHE B CG  1 
ATOM   2610 C  CD1 . PHE B 1 109 ? 20.382 38.615 66.171 1.00 30.65 ? 109 PHE B CD1 1 
ATOM   2611 C  CD2 . PHE B 1 109 ? 22.427 37.694 67.003 1.00 30.12 ? 109 PHE B CD2 1 
ATOM   2612 C  CE1 . PHE B 1 109 ? 20.994 38.896 64.955 1.00 27.45 ? 109 PHE B CE1 1 
ATOM   2613 C  CE2 . PHE B 1 109 ? 23.054 37.967 65.796 1.00 29.26 ? 109 PHE B CE2 1 
ATOM   2614 C  CZ  . PHE B 1 109 ? 22.332 38.574 64.763 1.00 31.03 ? 109 PHE B CZ  1 
ATOM   2615 N  N   . ILE B 1 110 ? 18.507 40.157 68.795 1.00 30.85 ? 110 ILE B N   1 
ATOM   2616 C  CA  . ILE B 1 110 ? 17.731 41.250 68.249 1.00 30.41 ? 110 ILE B CA  1 
ATOM   2617 C  C   . ILE B 1 110 ? 17.906 42.549 69.041 1.00 30.44 ? 110 ILE B C   1 
ATOM   2618 O  O   . ILE B 1 110 ? 18.108 43.606 68.456 1.00 29.17 ? 110 ILE B O   1 
ATOM   2619 C  CB  . ILE B 1 110 ? 16.258 40.844 68.159 1.00 30.38 ? 110 ILE B CB  1 
ATOM   2620 C  CG1 . ILE B 1 110 ? 16.109 39.827 67.016 1.00 32.62 ? 110 ILE B CG1 1 
ATOM   2621 C  CG2 . ILE B 1 110 ? 15.384 42.063 67.935 1.00 29.28 ? 110 ILE B CG2 1 
ATOM   2622 C  CD1 . ILE B 1 110 ? 14.701 39.353 66.747 1.00 33.35 ? 110 ILE B CD1 1 
ATOM   2623 N  N   . LYS B 1 111 ? 17.852 42.483 70.367 1.00 31.89 ? 111 LYS B N   1 
ATOM   2624 C  CA  . LYS B 1 111 ? 18.028 43.701 71.163 1.00 32.44 ? 111 LYS B CA  1 
ATOM   2625 C  C   . LYS B 1 111 ? 19.377 44.362 70.886 1.00 31.58 ? 111 LYS B C   1 
ATOM   2626 O  O   . LYS B 1 111 ? 19.470 45.586 70.762 1.00 34.38 ? 111 LYS B O   1 
ATOM   2627 C  CB  . LYS B 1 111 ? 17.926 43.409 72.658 1.00 34.77 ? 111 LYS B CB  1 
ATOM   2628 C  CG  . LYS B 1 111 ? 18.334 44.597 73.505 1.00 40.94 ? 111 LYS B CG  1 
ATOM   2629 C  CD  . LYS B 1 111 ? 18.442 44.251 74.983 1.00 47.59 ? 111 LYS B CD  1 
ATOM   2630 C  CE  . LYS B 1 111 ? 18.953 45.449 75.791 1.00 51.06 ? 111 LYS B CE  1 
ATOM   2631 N  NZ  . LYS B 1 111 ? 19.219 45.096 77.221 1.00 52.65 ? 111 LYS B NZ  1 
ATOM   2632 N  N   . SER B 1 112 ? 20.425 43.549 70.801 1.00 28.65 ? 112 SER B N   1 
ATOM   2633 C  CA  . SER B 1 112 ? 21.766 44.048 70.536 1.00 26.61 ? 112 SER B CA  1 
ATOM   2634 C  C   . SER B 1 112 ? 21.851 44.692 69.140 1.00 25.59 ? 112 SER B C   1 
ATOM   2635 O  O   . SER B 1 112 ? 22.545 45.696 68.951 1.00 23.76 ? 112 SER B O   1 
ATOM   2636 C  CB  . SER B 1 112 ? 22.774 42.891 70.636 1.00 24.71 ? 112 SER B CB  1 
ATOM   2637 O  OG  . SER B 1 112 ? 24.068 43.324 70.239 1.00 23.27 ? 112 SER B OG  1 
ATOM   2638 N  N   . ALA B 1 113 ? 21.164 44.101 68.164 1.00 23.60 ? 113 ALA B N   1 
ATOM   2639 C  CA  . ALA B 1 113 ? 21.188 44.645 66.812 1.00 24.90 ? 113 ALA B CA  1 
ATOM   2640 C  C   . ALA B 1 113 ? 20.329 45.910 66.761 1.00 23.92 ? 113 ALA B C   1 
ATOM   2641 O  O   . ALA B 1 113 ? 20.549 46.787 65.932 1.00 22.20 ? 113 ALA B O   1 
ATOM   2642 C  CB  . ALA B 1 113 ? 20.679 43.598 65.800 1.00 23.34 ? 113 ALA B CB  1 
ATOM   2643 N  N   . THR B 1 114 ? 19.368 46.003 67.677 1.00 24.82 ? 114 THR B N   1 
ATOM   2644 C  CA  . THR B 1 114 ? 18.487 47.158 67.739 1.00 26.43 ? 114 THR B CA  1 
ATOM   2645 C  C   . THR B 1 114 ? 19.160 48.413 68.295 1.00 28.82 ? 114 THR B C   1 
ATOM   2646 O  O   . THR B 1 114 ? 18.928 49.520 67.804 1.00 29.13 ? 114 THR B O   1 
ATOM   2647 C  CB  . THR B 1 114 ? 17.249 46.863 68.594 1.00 25.76 ? 114 THR B CB  1 
ATOM   2648 O  OG1 . THR B 1 114 ? 16.504 45.807 67.984 1.00 27.64 ? 114 THR B OG1 1 
ATOM   2649 C  CG2 . THR B 1 114 ? 16.346 48.126 68.711 1.00 23.25 ? 114 THR B CG2 1 
ATOM   2650 N  N   . THR B 1 115 ? 19.996 48.239 69.313 1.00 28.70 ? 115 THR B N   1 
ATOM   2651 C  CA  . THR B 1 115 ? 20.671 49.370 69.944 1.00 28.37 ? 115 THR B CA  1 
ATOM   2652 C  C   . THR B 1 115 ? 22.011 49.796 69.332 1.00 28.61 ? 115 THR B C   1 
ATOM   2653 O  O   . THR B 1 115 ? 22.539 50.857 69.661 1.00 28.42 ? 115 THR B O   1 
ATOM   2654 C  CB  . THR B 1 115 ? 20.892 49.072 71.422 1.00 31.17 ? 115 THR B CB  1 
ATOM   2655 O  OG1 . THR B 1 115 ? 21.735 47.920 71.551 1.00 30.59 ? 115 THR B OG1 1 
ATOM   2656 C  CG2 . THR B 1 115 ? 19.533 48.775 72.118 1.00 29.55 ? 115 THR B CG2 1 
ATOM   2657 N  N   . LEU B 1 116 ? 22.577 48.978 68.452 1.00 28.04 ? 116 LEU B N   1 
ATOM   2658 C  CA  . LEU B 1 116 ? 23.846 49.340 67.851 1.00 26.39 ? 116 LEU B CA  1 
ATOM   2659 C  C   . LEU B 1 116 ? 23.620 50.695 67.188 1.00 25.83 ? 116 LEU B C   1 
ATOM   2660 O  O   . LEU B 1 116 ? 22.772 50.834 66.319 1.00 26.85 ? 116 LEU B O   1 
ATOM   2661 C  CB  . LEU B 1 116 ? 24.269 48.270 66.850 1.00 24.63 ? 116 LEU B CB  1 
ATOM   2662 C  CG  . LEU B 1 116 ? 25.756 48.227 66.459 1.00 25.65 ? 116 LEU B CG  1 
ATOM   2663 C  CD1 . LEU B 1 116 ? 26.038 46.911 65.729 1.00 20.12 ? 116 LEU B CD1 1 
ATOM   2664 C  CD2 . LEU B 1 116 ? 26.118 49.427 65.581 1.00 25.43 ? 116 LEU B CD2 1 
ATOM   2665 N  N   . PHE B 1 117 ? 24.386 51.691 67.621 1.00 26.31 ? 117 PHE B N   1 
ATOM   2666 C  CA  . PHE B 1 117 ? 24.265 53.070 67.142 1.00 26.45 ? 117 PHE B CA  1 
ATOM   2667 C  C   . PHE B 1 117 ? 25.110 53.316 65.886 1.00 26.67 ? 117 PHE B C   1 
ATOM   2668 O  O   . PHE B 1 117 ? 26.240 52.863 65.800 1.00 27.10 ? 117 PHE B O   1 
ATOM   2669 C  CB  . PHE B 1 117 ? 24.682 54.026 68.282 1.00 23.47 ? 117 PHE B CB  1 
ATOM   2670 C  CG  . PHE B 1 117 ? 24.321 55.483 68.042 1.00 28.27 ? 117 PHE B CG  1 
ATOM   2671 C  CD1 . PHE B 1 117 ? 22.990 55.899 68.039 1.00 27.90 ? 117 PHE B CD1 1 
ATOM   2672 C  CD2 . PHE B 1 117 ? 25.313 56.432 67.781 1.00 27.87 ? 117 PHE B CD2 1 
ATOM   2673 C  CE1 . PHE B 1 117 ? 22.652 57.229 67.775 1.00 27.28 ? 117 PHE B CE1 1 
ATOM   2674 C  CE2 . PHE B 1 117 ? 24.985 57.770 67.513 1.00 26.42 ? 117 PHE B CE2 1 
ATOM   2675 C  CZ  . PHE B 1 117 ? 23.653 58.163 67.508 1.00 26.32 ? 117 PHE B CZ  1 
ATOM   2676 N  N   . GLY B 1 118 ? 24.557 54.023 64.905 1.00 26.80 ? 118 GLY B N   1 
ATOM   2677 C  CA  . GLY B 1 118 ? 25.303 54.294 63.681 1.00 25.34 ? 118 GLY B CA  1 
ATOM   2678 C  C   . GLY B 1 118 ? 25.409 53.056 62.814 1.00 25.02 ? 118 GLY B C   1 
ATOM   2679 O  O   . GLY B 1 118 ? 24.656 52.104 63.036 1.00 23.78 ? 118 GLY B O   1 
ATOM   2680 N  N   . SER B 1 119 ? 26.336 53.055 61.849 1.00 23.81 ? 119 SER B N   1 
ATOM   2681 C  CA  . SER B 1 119 ? 26.508 51.903 60.944 1.00 24.81 ? 119 SER B CA  1 
ATOM   2682 C  C   . SER B 1 119 ? 27.279 50.784 61.612 1.00 24.39 ? 119 SER B C   1 
ATOM   2683 O  O   . SER B 1 119 ? 28.178 51.045 62.406 1.00 23.59 ? 119 SER B O   1 
ATOM   2684 C  CB  . SER B 1 119 ? 27.269 52.300 59.687 1.00 22.74 ? 119 SER B CB  1 
ATOM   2685 O  OG  . SER B 1 119 ? 26.643 53.382 59.032 1.00 24.87 ? 119 SER B OG  1 
ATOM   2686 N  N   . GLY B 1 120 ? 26.936 49.541 61.279 1.00 23.68 ? 120 GLY B N   1 
ATOM   2687 C  CA  . GLY B 1 120 ? 27.629 48.413 61.875 1.00 23.03 ? 120 GLY B CA  1 
ATOM   2688 C  C   . GLY B 1 120 ? 27.036 47.046 61.581 1.00 24.23 ? 120 GLY B C   1 
ATOM   2689 O  O   . GLY B 1 120 ? 26.177 46.905 60.713 1.00 24.28 ? 120 GLY B O   1 
ATOM   2690 N  N   . TRP B 1 121 ? 27.505 46.040 62.316 1.00 23.61 ? 121 TRP B N   1 
ATOM   2691 C  CA  . TRP B 1 121 ? 27.055 44.671 62.147 1.00 23.81 ? 121 TRP B CA  1 
ATOM   2692 C  C   . TRP B 1 121 ? 26.799 44.028 63.498 1.00 24.31 ? 121 TRP B C   1 
ATOM   2693 O  O   . TRP B 1 121 ? 27.513 44.303 64.460 1.00 26.15 ? 121 TRP B O   1 
ATOM   2694 C  CB  . TRP B 1 121 ? 28.123 43.847 61.411 1.00 21.98 ? 121 TRP B CB  1 
ATOM   2695 C  CG  . TRP B 1 121 ? 28.542 44.426 60.099 1.00 22.18 ? 121 TRP B CG  1 
ATOM   2696 C  CD1 . TRP B 1 121 ? 29.355 45.511 59.897 1.00 18.69 ? 121 TRP B CD1 1 
ATOM   2697 C  CD2 . TRP B 1 121 ? 28.111 43.994 58.789 1.00 17.93 ? 121 TRP B CD2 1 
ATOM   2698 N  NE1 . TRP B 1 121 ? 29.450 45.784 58.543 1.00 20.26 ? 121 TRP B NE1 1 
ATOM   2699 C  CE2 . TRP B 1 121 ? 28.695 44.870 57.847 1.00 17.56 ? 121 TRP B CE2 1 
ATOM   2700 C  CE3 . TRP B 1 121 ? 27.285 42.958 58.332 1.00 17.49 ? 121 TRP B CE3 1 
ATOM   2701 C  CZ2 . TRP B 1 121 ? 28.479 44.741 56.471 1.00 20.14 ? 121 TRP B CZ2 1 
ATOM   2702 C  CZ3 . TRP B 1 121 ? 27.068 42.823 56.970 1.00 20.56 ? 121 TRP B CZ3 1 
ATOM   2703 C  CH2 . TRP B 1 121 ? 27.663 43.714 56.048 1.00 20.34 ? 121 TRP B CH2 1 
ATOM   2704 N  N   . ASN B 1 122 ? 25.785 43.168 63.576 1.00 24.95 ? 122 ASN B N   1 
ATOM   2705 C  CA  . ASN B 1 122 ? 25.493 42.475 64.827 1.00 24.87 ? 122 ASN B CA  1 
ATOM   2706 C  C   . ASN B 1 122 ? 25.749 40.988 64.648 1.00 25.07 ? 122 ASN B C   1 
ATOM   2707 O  O   . ASN B 1 122 ? 25.003 40.312 63.941 1.00 26.70 ? 122 ASN B O   1 
ATOM   2708 C  CB  . ASN B 1 122 ? 24.055 42.681 65.261 1.00 20.99 ? 122 ASN B CB  1 
ATOM   2709 C  CG  . ASN B 1 122 ? 23.857 42.334 66.710 1.00 22.18 ? 122 ASN B CG  1 
ATOM   2710 O  OD1 . ASN B 1 122 ? 24.382 43.007 67.591 1.00 20.91 ? 122 ASN B OD1 1 
ATOM   2711 N  ND2 . ASN B 1 122 ? 23.117 41.269 66.970 1.00 22.93 ? 122 ASN B ND2 1 
ATOM   2712 N  N   . TRP B 1 123 ? 26.783 40.481 65.314 1.00 24.83 ? 123 TRP B N   1 
ATOM   2713 C  CA  . TRP B 1 123 ? 27.185 39.077 65.187 1.00 25.57 ? 123 TRP B CA  1 
ATOM   2714 C  C   . TRP B 1 123 ? 26.918 38.146 66.354 1.00 27.34 ? 123 TRP B C   1 
ATOM   2715 O  O   . TRP B 1 123 ? 26.630 38.570 67.469 1.00 28.64 ? 123 TRP B O   1 
ATOM   2716 C  CB  . TRP B 1 123 ? 28.695 38.973 64.945 1.00 22.22 ? 123 TRP B CB  1 
ATOM   2717 C  CG  . TRP B 1 123 ? 29.302 39.978 64.044 1.00 17.94 ? 123 TRP B CG  1 
ATOM   2718 C  CD1 . TRP B 1 123 ? 29.503 41.306 64.297 1.00 19.25 ? 123 TRP B CD1 1 
ATOM   2719 C  CD2 . TRP B 1 123 ? 29.868 39.721 62.761 1.00 17.27 ? 123 TRP B CD2 1 
ATOM   2720 N  NE1 . TRP B 1 123 ? 30.174 41.896 63.241 1.00 17.13 ? 123 TRP B NE1 1 
ATOM   2721 C  CE2 . TRP B 1 123 ? 30.411 40.944 62.284 1.00 15.74 ? 123 TRP B CE2 1 
ATOM   2722 C  CE3 . TRP B 1 123 ? 29.981 38.569 61.967 1.00 18.85 ? 123 TRP B CE3 1 
ATOM   2723 C  CZ2 . TRP B 1 123 ? 31.066 41.051 61.038 1.00 17.54 ? 123 TRP B CZ2 1 
ATOM   2724 C  CZ3 . TRP B 1 123 ? 30.637 38.670 60.721 1.00 19.71 ? 123 TRP B CZ3 1 
ATOM   2725 C  CH2 . TRP B 1 123 ? 31.171 39.908 60.273 1.00 19.40 ? 123 TRP B CH2 1 
ATOM   2726 N  N   . ALA B 1 124 ? 27.039 36.861 66.048 1.00 28.53 ? 124 ALA B N   1 
ATOM   2727 C  CA  . ALA B 1 124 ? 26.980 35.772 67.006 1.00 30.02 ? 124 ALA B CA  1 
ATOM   2728 C  C   . ALA B 1 124 ? 28.321 35.155 66.602 1.00 32.65 ? 124 ALA B C   1 
ATOM   2729 O  O   . ALA B 1 124 ? 28.464 34.688 65.470 1.00 32.15 ? 124 ALA B O   1 
ATOM   2730 C  CB  . ALA B 1 124 ? 25.842 34.822 66.704 1.00 30.15 ? 124 ALA B CB  1 
ATOM   2731 N  N   . ALA B 1 125 ? 29.316 35.201 67.490 1.00 34.80 ? 125 ALA B N   1 
ATOM   2732 C  CA  . ALA B 1 125 ? 30.647 34.666 67.163 1.00 36.58 ? 125 ALA B CA  1 
ATOM   2733 C  C   . ALA B 1 125 ? 31.165 33.673 68.187 1.00 37.80 ? 125 ALA B C   1 
ATOM   2734 O  O   . ALA B 1 125 ? 30.907 33.818 69.376 1.00 38.21 ? 125 ALA B O   1 
ATOM   2735 C  CB  . ALA B 1 125 ? 31.647 35.808 67.019 1.00 36.28 ? 125 ALA B CB  1 
ATOM   2736 N  N   . TYR B 1 126 ? 31.910 32.675 67.718 1.00 39.14 ? 126 TYR B N   1 
ATOM   2737 C  CA  . TYR B 1 126 ? 32.470 31.658 68.601 1.00 41.04 ? 126 TYR B CA  1 
ATOM   2738 C  C   . TYR B 1 126 ? 33.821 32.079 69.183 1.00 41.94 ? 126 TYR B C   1 
ATOM   2739 O  O   . TYR B 1 126 ? 34.782 32.344 68.446 1.00 41.33 ? 126 TYR B O   1 
ATOM   2740 C  CB  . TYR B 1 126 ? 32.637 30.334 67.853 1.00 40.95 ? 126 TYR B CB  1 
ATOM   2741 C  CG  . TYR B 1 126 ? 33.094 29.198 68.743 1.00 41.13 ? 126 TYR B CG  1 
ATOM   2742 C  CD1 . TYR B 1 126 ? 32.241 28.646 69.696 1.00 40.41 ? 126 TYR B CD1 1 
ATOM   2743 C  CD2 . TYR B 1 126 ? 34.388 28.698 68.650 1.00 41.67 ? 126 TYR B CD2 1 
ATOM   2744 C  CE1 . TYR B 1 126 ? 32.669 27.623 70.538 1.00 42.37 ? 126 TYR B CE1 1 
ATOM   2745 C  CE2 . TYR B 1 126 ? 34.825 27.678 69.484 1.00 43.20 ? 126 TYR B CE2 1 
ATOM   2746 C  CZ  . TYR B 1 126 ? 33.964 27.147 70.423 1.00 43.85 ? 126 TYR B CZ  1 
ATOM   2747 O  OH  . TYR B 1 126 ? 34.412 26.141 71.242 1.00 47.49 ? 126 TYR B OH  1 
ATOM   2748 N  N   . ASN B 1 127 ? 33.890 32.154 70.506 1.00 42.97 ? 127 ASN B N   1 
ATOM   2749 C  CA  . ASN B 1 127 ? 35.134 32.523 71.168 1.00 46.35 ? 127 ASN B CA  1 
ATOM   2750 C  C   . ASN B 1 127 ? 35.977 31.245 71.314 1.00 47.46 ? 127 ASN B C   1 
ATOM   2751 O  O   . ASN B 1 127 ? 35.515 30.269 71.904 1.00 46.86 ? 127 ASN B O   1 
ATOM   2752 C  CB  . ASN B 1 127 ? 34.842 33.116 72.545 1.00 45.91 ? 127 ASN B CB  1 
ATOM   2753 C  CG  . ASN B 1 127 ? 36.089 33.627 73.227 1.00 45.73 ? 127 ASN B CG  1 
ATOM   2754 O  OD1 . ASN B 1 127 ? 37.084 32.919 73.331 1.00 46.26 ? 127 ASN B OD1 1 
ATOM   2755 N  ND2 . ASN B 1 127 ? 36.041 34.858 73.696 1.00 43.82 ? 127 ASN B ND2 1 
ATOM   2756 N  N   . LEU B 1 128 ? 37.197 31.249 70.770 1.00 49.05 ? 128 LEU B N   1 
ATOM   2757 C  CA  . LEU B 1 128 ? 38.070 30.069 70.835 1.00 50.41 ? 128 LEU B CA  1 
ATOM   2758 C  C   . LEU B 1 128 ? 38.643 29.786 72.228 1.00 51.51 ? 128 LEU B C   1 
ATOM   2759 O  O   . LEU B 1 128 ? 38.821 28.626 72.603 1.00 51.58 ? 128 LEU B O   1 
ATOM   2760 C  CB  . LEU B 1 128 ? 39.223 30.184 69.828 1.00 49.08 ? 128 LEU B CB  1 
ATOM   2761 C  CG  . LEU B 1 128 ? 38.968 29.872 68.349 1.00 48.55 ? 128 LEU B CG  1 
ATOM   2762 C  CD1 . LEU B 1 128 ? 38.254 28.543 68.222 1.00 47.58 ? 128 LEU B CD1 1 
ATOM   2763 C  CD2 . LEU B 1 128 ? 38.150 30.960 67.725 1.00 49.69 ? 128 LEU B CD2 1 
ATOM   2764 N  N   . ASP B 1 129 ? 38.923 30.842 72.988 1.00 52.08 ? 129 ASP B N   1 
ATOM   2765 C  CA  . ASP B 1 129 ? 39.468 30.712 74.335 1.00 52.91 ? 129 ASP B CA  1 
ATOM   2766 C  C   . ASP B 1 129 ? 38.394 30.305 75.327 1.00 53.05 ? 129 ASP B C   1 
ATOM   2767 O  O   . ASP B 1 129 ? 38.600 29.446 76.178 1.00 54.04 ? 129 ASP B O   1 
ATOM   2768 C  CB  . ASP B 1 129 ? 40.067 32.039 74.782 1.00 54.89 ? 129 ASP B CB  1 
ATOM   2769 C  CG  . ASP B 1 129 ? 41.175 32.509 73.872 1.00 58.70 ? 129 ASP B CG  1 
ATOM   2770 O  OD1 . ASP B 1 129 ? 41.696 33.619 74.108 1.00 61.48 ? 129 ASP B OD1 1 
ATOM   2771 O  OD2 . ASP B 1 129 ? 41.531 31.772 72.923 1.00 60.09 ? 129 ASP B OD2 1 
ATOM   2772 N  N   . THR B 1 130 ? 37.238 30.937 75.206 1.00 53.11 ? 130 THR B N   1 
ATOM   2773 C  CA  . THR B 1 130 ? 36.115 30.672 76.083 1.00 51.99 ? 130 THR B CA  1 
ATOM   2774 C  C   . THR B 1 130 ? 35.268 29.509 75.623 1.00 50.91 ? 130 THR B C   1 
ATOM   2775 O  O   . THR B 1 130 ? 34.549 28.908 76.422 1.00 50.54 ? 130 THR B O   1 
ATOM   2776 C  CB  . THR B 1 130 ? 35.217 31.885 76.155 1.00 53.30 ? 130 THR B CB  1 
ATOM   2777 O  OG1 . THR B 1 130 ? 35.997 33.006 76.573 1.00 55.34 ? 130 THR B OG1 1 
ATOM   2778 C  CG2 . THR B 1 130 ? 34.087 31.657 77.142 1.00 56.76 ? 130 THR B CG2 1 
ATOM   2779 N  N   . GLN B 1 131 ? 35.346 29.201 74.334 1.00 49.37 ? 131 GLN B N   1 
ATOM   2780 C  CA  . GLN B 1 131 ? 34.558 28.121 73.755 1.00 49.06 ? 131 GLN B CA  1 
ATOM   2781 C  C   . GLN B 1 131 ? 33.072 28.398 73.978 1.00 47.81 ? 131 GLN B C   1 
ATOM   2782 O  O   . GLN B 1 131 ? 32.244 27.490 74.121 1.00 46.23 ? 131 GLN B O   1 
ATOM   2783 C  CB  . GLN B 1 131 ? 34.952 26.784 74.364 1.00 48.34 ? 131 GLN B CB  1 
ATOM   2784 C  CG  . GLN B 1 131 ? 36.335 26.315 73.966 1.00 50.34 ? 131 GLN B CG  1 
ATOM   2785 C  CD  . GLN B 1 131 ? 36.708 25.043 74.681 1.00 49.96 ? 131 GLN B CD  1 
ATOM   2786 O  OE1 . GLN B 1 131 ? 36.622 24.965 75.904 1.00 52.72 ? 131 GLN B OE1 1 
ATOM   2787 N  NE2 . GLN B 1 131 ? 37.118 24.038 73.932 1.00 49.42 ? 131 GLN B NE2 1 
ATOM   2788 N  N   . LYS B 1 132 ? 32.753 29.683 74.012 1.00 47.69 ? 132 LYS B N   1 
ATOM   2789 C  CA  . LYS B 1 132 ? 31.384 30.127 74.183 1.00 47.55 ? 132 LYS B CA  1 
ATOM   2790 C  C   . LYS B 1 132 ? 30.988 30.994 72.992 1.00 45.70 ? 132 LYS B C   1 
ATOM   2791 O  O   . LYS B 1 132 ? 31.847 31.583 72.315 1.00 44.85 ? 132 LYS B O   1 
ATOM   2792 C  CB  . LYS B 1 132 ? 31.235 30.925 75.478 1.00 50.27 ? 132 LYS B CB  1 
ATOM   2793 C  CG  . LYS B 1 132 ? 30.601 30.132 76.599 1.00 54.38 ? 132 LYS B CG  1 
ATOM   2794 C  CD  . LYS B 1 132 ? 30.366 30.981 77.834 1.00 57.94 ? 132 LYS B CD  1 
ATOM   2795 C  CE  . LYS B 1 132 ? 29.035 30.606 78.523 1.00 61.44 ? 132 LYS B CE  1 
ATOM   2796 N  NZ  . LYS B 1 132 ? 28.878 29.152 78.848 1.00 62.02 ? 132 LYS B NZ  1 
ATOM   2797 N  N   . ILE B 1 133 ? 29.686 31.048 72.731 1.00 43.51 ? 133 ILE B N   1 
ATOM   2798 C  CA  . ILE B 1 133 ? 29.151 31.862 71.647 1.00 40.24 ? 133 ILE B CA  1 
ATOM   2799 C  C   . ILE B 1 133 ? 28.795 33.224 72.227 1.00 38.65 ? 133 ILE B C   1 
ATOM   2800 O  O   . ILE B 1 133 ? 28.026 33.314 73.180 1.00 37.49 ? 133 ILE B O   1 
ATOM   2801 C  CB  . ILE B 1 133 ? 27.888 31.221 71.036 1.00 39.76 ? 133 ILE B CB  1 
ATOM   2802 C  CG1 . ILE B 1 133 ? 28.246 29.871 70.406 1.00 36.80 ? 133 ILE B CG1 1 
ATOM   2803 C  CG2 . ILE B 1 133 ? 27.275 32.165 69.998 1.00 38.92 ? 133 ILE B CG2 1 
ATOM   2804 C  CD1 . ILE B 1 133 ? 27.049 29.094 69.901 1.00 36.95 ? 133 ILE B CD1 1 
ATOM   2805 N  N   . GLU B 1 134 ? 29.374 34.274 71.653 1.00 38.31 ? 134 GLU B N   1 
ATOM   2806 C  CA  . GLU B 1 134 ? 29.133 35.642 72.098 1.00 38.75 ? 134 GLU B CA  1 
ATOM   2807 C  C   . GLU B 1 134 ? 28.344 36.436 71.049 1.00 38.71 ? 134 GLU B C   1 
ATOM   2808 O  O   . GLU B 1 134 ? 28.458 36.189 69.840 1.00 37.29 ? 134 GLU B O   1 
ATOM   2809 C  CB  . GLU B 1 134 ? 30.454 36.381 72.331 1.00 38.84 ? 134 GLU B CB  1 
ATOM   2810 C  CG  . GLU B 1 134 ? 31.466 35.666 73.193 1.00 43.29 ? 134 GLU B CG  1 
ATOM   2811 C  CD  . GLU B 1 134 ? 32.809 36.385 73.220 1.00 46.03 ? 134 GLU B CD  1 
ATOM   2812 O  OE1 . GLU B 1 134 ? 33.295 36.812 72.143 1.00 45.86 ? 134 GLU B OE1 1 
ATOM   2813 O  OE2 . GLU B 1 134 ? 33.386 36.515 74.319 1.00 48.50 ? 134 GLU B OE2 1 
ATOM   2814 N  N   . ILE B 1 135 ? 27.549 37.390 71.529 1.00 37.23 ? 135 ILE B N   1 
ATOM   2815 C  CA  . ILE B 1 135 ? 26.787 38.272 70.658 1.00 35.07 ? 135 ILE B CA  1 
ATOM   2816 C  C   . ILE B 1 135 ? 27.638 39.525 70.679 1.00 33.62 ? 135 ILE B C   1 
ATOM   2817 O  O   . ILE B 1 135 ? 27.826 40.147 71.723 1.00 35.29 ? 135 ILE B O   1 
ATOM   2818 C  CB  . ILE B 1 135 ? 25.369 38.558 71.209 1.00 34.54 ? 135 ILE B CB  1 
ATOM   2819 C  CG1 . ILE B 1 135 ? 24.486 37.321 71.038 1.00 32.79 ? 135 ILE B CG1 1 
ATOM   2820 C  CG2 . ILE B 1 135 ? 24.763 39.742 70.485 1.00 35.73 ? 135 ILE B CG2 1 
ATOM   2821 C  CD1 . ILE B 1 135 ? 23.119 37.469 71.656 1.00 35.23 ? 135 ILE B CD1 1 
ATOM   2822 N  N   . ILE B 1 136 ? 28.162 39.887 69.520 1.00 32.47 ? 136 ILE B N   1 
ATOM   2823 C  CA  . ILE B 1 136 ? 29.048 41.028 69.410 1.00 31.44 ? 136 ILE B CA  1 
ATOM   2824 C  C   . ILE B 1 136 ? 28.572 42.052 68.406 1.00 32.56 ? 136 ILE B C   1 
ATOM   2825 O  O   . ILE B 1 136 ? 28.149 41.705 67.315 1.00 33.49 ? 136 ILE B O   1 
ATOM   2826 C  CB  . ILE B 1 136 ? 30.441 40.564 68.936 1.00 32.04 ? 136 ILE B CB  1 
ATOM   2827 C  CG1 . ILE B 1 136 ? 30.961 39.452 69.852 1.00 31.16 ? 136 ILE B CG1 1 
ATOM   2828 C  CG2 . ILE B 1 136 ? 31.403 41.744 68.870 1.00 30.84 ? 136 ILE B CG2 1 
ATOM   2829 C  CD1 . ILE B 1 136 ? 32.278 38.876 69.409 1.00 27.66 ? 136 ILE B CD1 1 
ATOM   2830 N  N   . GLN B 1 137 ? 28.655 43.326 68.758 1.00 33.29 ? 137 GLN B N   1 
ATOM   2831 C  CA  . GLN B 1 137 ? 28.265 44.341 67.805 1.00 33.64 ? 137 GLN B CA  1 
ATOM   2832 C  C   . GLN B 1 137 ? 29.522 45.079 67.398 1.00 33.41 ? 137 GLN B C   1 
ATOM   2833 O  O   . GLN B 1 137 ? 30.347 45.410 68.242 1.00 34.04 ? 137 GLN B O   1 
ATOM   2834 C  CB  . GLN B 1 137 ? 27.214 45.291 68.394 1.00 33.84 ? 137 GLN B CB  1 
ATOM   2835 C  CG  . GLN B 1 137 ? 27.613 46.018 69.619 1.00 36.11 ? 137 GLN B CG  1 
ATOM   2836 C  CD  . GLN B 1 137 ? 26.463 46.780 70.264 1.00 33.48 ? 137 GLN B CD  1 
ATOM   2837 O  OE1 . GLN B 1 137 ? 26.697 47.639 71.085 1.00 38.36 ? 137 GLN B OE1 1 
ATOM   2838 N  NE2 . GLN B 1 137 ? 25.230 46.460 69.904 1.00 35.85 ? 137 GLN B NE2 1 
ATOM   2839 N  N   . THR B 1 138 ? 29.695 45.280 66.094 1.00 31.36 ? 138 THR B N   1 
ATOM   2840 C  CA  . THR B 1 138 ? 30.860 45.990 65.594 1.00 30.14 ? 138 THR B CA  1 
ATOM   2841 C  C   . THR B 1 138 ? 30.404 47.195 64.781 1.00 30.14 ? 138 THR B C   1 
ATOM   2842 O  O   . THR B 1 138 ? 29.340 47.198 64.179 1.00 28.25 ? 138 THR B O   1 
ATOM   2843 C  CB  . THR B 1 138 ? 31.779 45.076 64.717 1.00 31.18 ? 138 THR B CB  1 
ATOM   2844 O  OG1 . THR B 1 138 ? 31.118 44.739 63.481 1.00 27.81 ? 138 THR B OG1 1 
ATOM   2845 C  CG2 . THR B 1 138 ? 32.121 43.790 65.483 1.00 26.64 ? 138 THR B CG2 1 
ATOM   2846 N  N   . SER B 1 139 ? 31.233 48.220 64.773 1.00 30.66 ? 139 SER B N   1 
ATOM   2847 C  CA  . SER B 1 139 ? 30.914 49.438 64.068 1.00 32.31 ? 139 SER B CA  1 
ATOM   2848 C  C   . SER B 1 139 ? 31.489 49.465 62.650 1.00 31.71 ? 139 SER B C   1 
ATOM   2849 O  O   . SER B 1 139 ? 32.543 48.879 62.371 1.00 31.03 ? 139 SER B O   1 
ATOM   2850 C  CB  . SER B 1 139 ? 31.423 50.623 64.896 1.00 34.73 ? 139 SER B CB  1 
ATOM   2851 O  OG  . SER B 1 139 ? 31.412 51.820 64.147 1.00 42.04 ? 139 SER B OG  1 
ATOM   2852 N  N   . ASN B 1 140 ? 30.769 50.130 61.754 1.00 30.94 ? 140 ASN B N   1 
ATOM   2853 C  CA  . ASN B 1 140 ? 31.179 50.265 60.358 1.00 30.56 ? 140 ASN B CA  1 
ATOM   2854 C  C   . ASN B 1 140 ? 31.629 48.973 59.674 1.00 29.53 ? 140 ASN B C   1 
ATOM   2855 O  O   . ASN B 1 140 ? 30.815 48.099 59.405 1.00 30.13 ? 140 ASN B O   1 
ATOM   2856 C  CB  . ASN B 1 140 ? 32.273 51.337 60.247 1.00 27.95 ? 140 ASN B CB  1 
ATOM   2857 C  CG  . ASN B 1 140 ? 31.774 52.716 60.668 1.00 29.52 ? 140 ASN B CG  1 
ATOM   2858 O  OD1 . ASN B 1 140 ? 32.555 53.676 60.792 1.00 25.99 ? 140 ASN B OD1 1 
ATOM   2859 N  ND2 . ASN B 1 140 ? 30.461 52.821 60.894 1.00 25.50 ? 140 ASN B ND2 1 
ATOM   2860 N  N   . ALA B 1 141 ? 32.923 48.849 59.399 1.00 29.87 ? 141 ALA B N   1 
ATOM   2861 C  CA  . ALA B 1 141 ? 33.439 47.670 58.707 1.00 29.95 ? 141 ALA B CA  1 
ATOM   2862 C  C   . ALA B 1 141 ? 34.053 46.581 59.596 1.00 30.57 ? 141 ALA B C   1 
ATOM   2863 O  O   . ALA B 1 141 ? 34.323 45.474 59.127 1.00 30.68 ? 141 ALA B O   1 
ATOM   2864 C  CB  . ALA B 1 141 ? 34.456 48.109 57.639 1.00 26.56 ? 141 ALA B CB  1 
ATOM   2865 N  N   . GLN B 1 142 ? 34.265 46.875 60.875 1.00 30.88 ? 142 GLN B N   1 
ATOM   2866 C  CA  . GLN B 1 142 ? 34.868 45.889 61.763 1.00 30.66 ? 142 GLN B CA  1 
ATOM   2867 C  C   . GLN B 1 142 ? 34.149 44.555 61.776 1.00 32.51 ? 142 GLN B C   1 
ATOM   2868 O  O   . GLN B 1 142 ? 32.958 44.463 61.474 1.00 33.25 ? 142 GLN B O   1 
ATOM   2869 C  CB  . GLN B 1 142 ? 34.953 46.420 63.193 1.00 30.99 ? 142 GLN B CB  1 
ATOM   2870 C  CG  . GLN B 1 142 ? 35.809 47.662 63.334 1.00 35.33 ? 142 GLN B CG  1 
ATOM   2871 C  CD  . GLN B 1 142 ? 37.154 47.529 62.620 1.00 40.43 ? 142 GLN B CD  1 
ATOM   2872 O  OE1 . GLN B 1 142 ? 37.942 46.615 62.891 1.00 40.16 ? 142 GLN B OE1 1 
ATOM   2873 N  NE2 . GLN B 1 142 ? 37.416 48.447 61.695 1.00 44.21 ? 142 GLN B NE2 1 
ATOM   2874 N  N   . THR B 1 143 ? 34.896 43.515 62.128 1.00 33.02 ? 143 THR B N   1 
ATOM   2875 C  CA  . THR B 1 143 ? 34.359 42.171 62.213 1.00 33.36 ? 143 THR B CA  1 
ATOM   2876 C  C   . THR B 1 143 ? 35.133 41.395 63.283 1.00 34.52 ? 143 THR B C   1 
ATOM   2877 O  O   . THR B 1 143 ? 36.336 41.560 63.428 1.00 34.12 ? 143 THR B O   1 
ATOM   2878 C  CB  . THR B 1 143 ? 34.445 41.448 60.843 1.00 30.82 ? 143 THR B CB  1 
ATOM   2879 O  OG1 . THR B 1 143 ? 34.208 40.053 61.035 1.00 28.44 ? 143 THR B OG1 1 
ATOM   2880 C  CG2 . THR B 1 143 ? 35.790 41.665 60.177 1.00 31.06 ? 143 THR B CG2 1 
ATOM   2881 N  N   . PRO B 1 144 ? 34.441 40.540 64.047 1.00 36.09 ? 144 PRO B N   1 
ATOM   2882 C  CA  . PRO B 1 144 ? 35.064 39.745 65.111 1.00 36.96 ? 144 PRO B CA  1 
ATOM   2883 C  C   . PRO B 1 144 ? 36.292 38.942 64.642 1.00 39.32 ? 144 PRO B C   1 
ATOM   2884 O  O   . PRO B 1 144 ? 37.150 38.573 65.440 1.00 39.17 ? 144 PRO B O   1 
ATOM   2885 C  CB  . PRO B 1 144 ? 33.924 38.841 65.570 1.00 37.94 ? 144 PRO B CB  1 
ATOM   2886 C  CG  . PRO B 1 144 ? 32.674 39.647 65.221 1.00 35.32 ? 144 PRO B CG  1 
ATOM   2887 C  CD  . PRO B 1 144 ? 33.027 40.166 63.873 1.00 33.98 ? 144 PRO B CD  1 
ATOM   2888 N  N   . VAL B 1 145 ? 36.374 38.664 63.350 1.00 38.83 ? 145 VAL B N   1 
ATOM   2889 C  CA  . VAL B 1 145 ? 37.504 37.908 62.834 1.00 39.43 ? 145 VAL B CA  1 
ATOM   2890 C  C   . VAL B 1 145 ? 38.857 38.505 63.254 1.00 40.00 ? 145 VAL B C   1 
ATOM   2891 O  O   . VAL B 1 145 ? 39.797 37.764 63.539 1.00 38.39 ? 145 VAL B O   1 
ATOM   2892 C  CB  . VAL B 1 145 ? 37.449 37.816 61.287 1.00 38.13 ? 145 VAL B CB  1 
ATOM   2893 C  CG1 . VAL B 1 145 ? 38.744 37.221 60.758 1.00 41.13 ? 145 VAL B CG1 1 
ATOM   2894 C  CG2 . VAL B 1 145 ? 36.278 36.944 60.859 1.00 37.01 ? 145 VAL B CG2 1 
ATOM   2895 N  N   . THR B 1 146 ? 38.966 39.832 63.298 1.00 40.16 ? 146 THR B N   1 
ATOM   2896 C  CA  . THR B 1 146 ? 40.235 40.434 63.676 1.00 41.05 ? 146 THR B CA  1 
ATOM   2897 C  C   . THR B 1 146 ? 40.492 40.315 65.170 1.00 43.07 ? 146 THR B C   1 
ATOM   2898 O  O   . THR B 1 146 ? 41.520 40.760 65.653 1.00 43.51 ? 146 THR B O   1 
ATOM   2899 C  CB  . THR B 1 146 ? 40.341 41.924 63.262 1.00 41.44 ? 146 THR B CB  1 
ATOM   2900 O  OG1 . THR B 1 146 ? 39.532 42.740 64.120 1.00 37.29 ? 146 THR B OG1 1 
ATOM   2901 C  CG2 . THR B 1 146 ? 39.915 42.100 61.803 1.00 41.74 ? 146 THR B CG2 1 
ATOM   2902 N  N   . ASP B 1 147 ? 39.550 39.738 65.903 1.00 43.92 ? 147 ASP B N   1 
ATOM   2903 C  CA  . ASP B 1 147 ? 39.731 39.529 67.335 1.00 45.41 ? 147 ASP B CA  1 
ATOM   2904 C  C   . ASP B 1 147 ? 39.850 38.036 67.551 1.00 45.37 ? 147 ASP B C   1 
ATOM   2905 O  O   . ASP B 1 147 ? 39.587 37.539 68.642 1.00 45.17 ? 147 ASP B O   1 
ATOM   2906 C  CB  . ASP B 1 147 ? 38.545 40.037 68.157 1.00 48.02 ? 147 ASP B CB  1 
ATOM   2907 C  CG  . ASP B 1 147 ? 38.415 41.533 68.127 1.00 51.41 ? 147 ASP B CG  1 
ATOM   2908 O  OD1 . ASP B 1 147 ? 39.447 42.227 68.247 1.00 54.85 ? 147 ASP B OD1 1 
ATOM   2909 O  OD2 . ASP B 1 147 ? 37.273 42.014 67.997 1.00 54.11 ? 147 ASP B OD2 1 
ATOM   2910 N  N   . LYS B 1 148 ? 40.221 37.322 66.493 1.00 45.61 ? 148 LYS B N   1 
ATOM   2911 C  CA  . LYS B 1 148 ? 40.390 35.880 66.569 1.00 46.10 ? 148 LYS B CA  1 
ATOM   2912 C  C   . LYS B 1 148 ? 39.101 35.138 66.907 1.00 46.13 ? 148 LYS B C   1 
ATOM   2913 O  O   . LYS B 1 148 ? 39.141 34.060 67.501 1.00 46.16 ? 148 LYS B O   1 
ATOM   2914 C  CB  . LYS B 1 148 ? 41.451 35.531 67.618 1.00 49.59 ? 148 LYS B CB  1 
ATOM   2915 C  CG  . LYS B 1 148 ? 42.836 36.126 67.366 1.00 53.64 ? 148 LYS B CG  1 
ATOM   2916 C  CD  . LYS B 1 148 ? 43.459 35.542 66.107 1.00 57.84 ? 148 LYS B CD  1 
ATOM   2917 C  CE  . LYS B 1 148 ? 44.927 35.922 65.968 1.00 59.69 ? 148 LYS B CE  1 
ATOM   2918 N  NZ  . LYS B 1 148 ? 45.496 35.414 64.682 1.00 61.57 ? 148 LYS B NZ  1 
ATOM   2919 N  N   . LYS B 1 149 ? 37.951 35.701 66.550 1.00 44.60 ? 149 LYS B N   1 
ATOM   2920 C  CA  . LYS B 1 149 ? 36.694 35.009 66.819 1.00 42.49 ? 149 LYS B CA  1 
ATOM   2921 C  C   . LYS B 1 149 ? 36.075 34.552 65.503 1.00 41.02 ? 149 LYS B C   1 
ATOM   2922 O  O   . LYS B 1 149 ? 36.335 35.137 64.446 1.00 40.28 ? 149 LYS B O   1 
ATOM   2923 C  CB  . LYS B 1 149 ? 35.744 35.904 67.612 1.00 42.21 ? 149 LYS B CB  1 
ATOM   2924 C  CG  . LYS B 1 149 ? 36.310 36.243 68.988 1.00 43.37 ? 149 LYS B CG  1 
ATOM   2925 C  CD  . LYS B 1 149 ? 35.449 37.194 69.792 1.00 41.90 ? 149 LYS B CD  1 
ATOM   2926 C  CE  . LYS B 1 149 ? 36.152 37.554 71.093 1.00 41.86 ? 149 LYS B CE  1 
ATOM   2927 N  NZ  . LYS B 1 149 ? 35.351 38.436 71.991 1.00 40.70 ? 149 LYS B NZ  1 
ATOM   2928 N  N   . VAL B 1 150 ? 35.278 33.489 65.565 1.00 39.34 ? 150 VAL B N   1 
ATOM   2929 C  CA  . VAL B 1 150 ? 34.668 32.945 64.363 1.00 37.59 ? 150 VAL B CA  1 
ATOM   2930 C  C   . VAL B 1 150 ? 33.193 33.285 64.221 1.00 36.92 ? 150 VAL B C   1 
ATOM   2931 O  O   . VAL B 1 150 ? 32.366 32.863 65.033 1.00 36.56 ? 150 VAL B O   1 
ATOM   2932 C  CB  . VAL B 1 150 ? 34.818 31.424 64.314 1.00 37.97 ? 150 VAL B CB  1 
ATOM   2933 C  CG1 . VAL B 1 150 ? 34.443 30.915 62.928 1.00 36.59 ? 150 VAL B CG1 1 
ATOM   2934 C  CG2 . VAL B 1 150 ? 36.248 31.031 64.686 1.00 38.19 ? 150 VAL B CG2 1 
ATOM   2935 N  N   . PRO B 1 151 ? 32.850 34.058 63.175 1.00 35.05 ? 151 PRO B N   1 
ATOM   2936 C  CA  . PRO B 1 151 ? 31.473 34.470 62.901 1.00 33.02 ? 151 PRO B CA  1 
ATOM   2937 C  C   . PRO B 1 151 ? 30.581 33.269 62.687 1.00 31.45 ? 151 PRO B C   1 
ATOM   2938 O  O   . PRO B 1 151 ? 30.947 32.335 61.973 1.00 32.10 ? 151 PRO B O   1 
ATOM   2939 C  CB  . PRO B 1 151 ? 31.613 35.300 61.635 1.00 32.05 ? 151 PRO B CB  1 
ATOM   2940 C  CG  . PRO B 1 151 ? 32.978 35.900 61.785 1.00 33.92 ? 151 PRO B CG  1 
ATOM   2941 C  CD  . PRO B 1 151 ? 33.781 34.716 62.241 1.00 34.14 ? 151 PRO B CD  1 
ATOM   2942 N  N   . LEU B 1 152 ? 29.423 33.274 63.325 1.00 29.88 ? 152 LEU B N   1 
ATOM   2943 C  CA  . LEU B 1 152 ? 28.479 32.183 63.153 1.00 29.73 ? 152 LEU B CA  1 
ATOM   2944 C  C   . LEU B 1 152 ? 27.207 32.718 62.481 1.00 30.65 ? 152 LEU B C   1 
ATOM   2945 O  O   . LEU B 1 152 ? 26.558 32.025 61.696 1.00 30.35 ? 152 LEU B O   1 
ATOM   2946 C  CB  . LEU B 1 152 ? 28.141 31.569 64.508 1.00 28.59 ? 152 LEU B CB  1 
ATOM   2947 C  CG  . LEU B 1 152 ? 29.312 31.019 65.333 1.00 29.53 ? 152 LEU B CG  1 
ATOM   2948 C  CD1 . LEU B 1 152 ? 28.784 30.459 66.655 1.00 27.57 ? 152 LEU B CD1 1 
ATOM   2949 C  CD2 . LEU B 1 152 ? 30.049 29.941 64.542 1.00 24.77 ? 152 LEU B CD2 1 
ATOM   2950 N  N   . LEU B 1 153 ? 26.880 33.976 62.783 1.00 31.25 ? 153 LEU B N   1 
ATOM   2951 C  CA  . LEU B 1 153 ? 25.690 34.631 62.254 1.00 29.83 ? 153 LEU B CA  1 
ATOM   2952 C  C   . LEU B 1 153 ? 25.891 36.136 62.294 1.00 29.75 ? 153 LEU B C   1 
ATOM   2953 O  O   . LEU B 1 153 ? 26.504 36.665 63.231 1.00 30.48 ? 153 LEU B O   1 
ATOM   2954 C  CB  . LEU B 1 153 ? 24.473 34.262 63.111 1.00 26.38 ? 153 LEU B CB  1 
ATOM   2955 C  CG  . LEU B 1 153 ? 23.142 34.965 62.816 1.00 27.11 ? 153 LEU B CG  1 
ATOM   2956 C  CD1 . LEU B 1 153 ? 22.627 34.538 61.450 1.00 25.06 ? 153 LEU B CD1 1 
ATOM   2957 C  CD2 . LEU B 1 153 ? 22.127 34.611 63.886 1.00 23.48 ? 153 LEU B CD2 1 
ATOM   2958 N  N   . VAL B 1 154 ? 25.385 36.832 61.281 1.00 28.35 ? 154 VAL B N   1 
ATOM   2959 C  CA  . VAL B 1 154 ? 25.498 38.287 61.258 1.00 28.96 ? 154 VAL B CA  1 
ATOM   2960 C  C   . VAL B 1 154 ? 24.324 38.936 60.547 1.00 29.31 ? 154 VAL B C   1 
ATOM   2961 O  O   . VAL B 1 154 ? 23.730 38.356 59.642 1.00 30.06 ? 154 VAL B O   1 
ATOM   2962 C  CB  . VAL B 1 154 ? 26.786 38.786 60.542 1.00 28.18 ? 154 VAL B CB  1 
ATOM   2963 C  CG1 . VAL B 1 154 ? 26.611 38.722 59.034 1.00 26.95 ? 154 VAL B CG1 1 
ATOM   2964 C  CG2 . VAL B 1 154 ? 27.092 40.208 60.962 1.00 25.69 ? 154 VAL B CG2 1 
ATOM   2965 N  N   . VAL B 1 155 ? 23.981 40.138 60.992 1.00 28.16 ? 155 VAL B N   1 
ATOM   2966 C  CA  . VAL B 1 155 ? 22.934 40.913 60.363 1.00 25.37 ? 155 VAL B CA  1 
ATOM   2967 C  C   . VAL B 1 155 ? 23.544 42.300 60.160 1.00 25.30 ? 155 VAL B C   1 
ATOM   2968 O  O   . VAL B 1 155 ? 24.156 42.863 61.074 1.00 25.55 ? 155 VAL B O   1 
ATOM   2969 C  CB  . VAL B 1 155 ? 21.650 41.011 61.232 1.00 24.37 ? 155 VAL B CB  1 
ATOM   2970 C  CG1 . VAL B 1 155 ? 21.916 41.807 62.518 1.00 21.63 ? 155 VAL B CG1 1 
ATOM   2971 C  CG2 . VAL B 1 155 ? 20.562 41.679 60.431 1.00 16.06 ? 155 VAL B CG2 1 
ATOM   2972 N  N   . ASP B 1 156 ? 23.417 42.807 58.939 1.00 23.66 ? 156 ASP B N   1 
ATOM   2973 C  CA  . ASP B 1 156 ? 23.913 44.128 58.539 1.00 23.65 ? 156 ASP B CA  1 
ATOM   2974 C  C   . ASP B 1 156 ? 22.925 45.168 59.087 1.00 24.02 ? 156 ASP B C   1 
ATOM   2975 O  O   . ASP B 1 156 ? 21.714 45.047 58.848 1.00 23.23 ? 156 ASP B O   1 
ATOM   2976 C  CB  . ASP B 1 156 ? 23.939 44.184 56.992 1.00 22.51 ? 156 ASP B CB  1 
ATOM   2977 C  CG  . ASP B 1 156 ? 24.661 45.401 56.432 1.00 23.02 ? 156 ASP B CG  1 
ATOM   2978 O  OD1 . ASP B 1 156 ? 25.132 46.247 57.237 1.00 20.07 ? 156 ASP B OD1 1 
ATOM   2979 O  OD2 . ASP B 1 156 ? 24.754 45.504 55.169 1.00 18.23 ? 156 ASP B OD2 1 
ATOM   2980 N  N   . VAL B 1 157 ? 23.410 46.145 59.857 1.00 22.37 ? 157 VAL B N   1 
ATOM   2981 C  CA  . VAL B 1 157 ? 22.508 47.181 60.347 1.00 22.00 ? 157 VAL B CA  1 
ATOM   2982 C  C   . VAL B 1 157 ? 22.844 48.566 59.816 1.00 21.37 ? 157 VAL B C   1 
ATOM   2983 O  O   . VAL B 1 157 ? 22.372 49.577 60.331 1.00 21.28 ? 157 VAL B O   1 
ATOM   2984 C  CB  . VAL B 1 157 ? 22.350 47.226 61.896 1.00 22.19 ? 157 VAL B CB  1 
ATOM   2985 C  CG1 . VAL B 1 157 ? 21.629 45.974 62.357 1.00 21.36 ? 157 VAL B CG1 1 
ATOM   2986 C  CG2 . VAL B 1 157 ? 23.688 47.413 62.589 1.00 23.08 ? 157 VAL B CG2 1 
ATOM   2987 N  N   . TRP B 1 158 ? 23.677 48.614 58.785 1.00 21.23 ? 158 TRP B N   1 
ATOM   2988 C  CA  . TRP B 1 158 ? 23.918 49.889 58.117 1.00 21.73 ? 158 TRP B CA  1 
ATOM   2989 C  C   . TRP B 1 158 ? 22.511 50.222 57.580 1.00 22.09 ? 158 TRP B C   1 
ATOM   2990 O  O   . TRP B 1 158 ? 21.812 49.335 57.089 1.00 19.38 ? 158 TRP B O   1 
ATOM   2991 C  CB  . TRP B 1 158 ? 24.837 49.726 56.907 1.00 21.72 ? 158 TRP B CB  1 
ATOM   2992 C  CG  . TRP B 1 158 ? 26.298 49.685 57.203 1.00 23.62 ? 158 TRP B CG  1 
ATOM   2993 C  CD1 . TRP B 1 158 ? 26.959 48.786 58.000 1.00 23.48 ? 158 TRP B CD1 1 
ATOM   2994 C  CD2 . TRP B 1 158 ? 27.292 50.555 56.662 1.00 21.92 ? 158 TRP B CD2 1 
ATOM   2995 N  NE1 . TRP B 1 158 ? 28.313 49.046 57.981 1.00 23.59 ? 158 TRP B NE1 1 
ATOM   2996 C  CE2 . TRP B 1 158 ? 28.544 50.127 57.168 1.00 25.00 ? 158 TRP B CE2 1 
ATOM   2997 C  CE3 . TRP B 1 158 ? 27.250 51.657 55.798 1.00 21.00 ? 158 TRP B CE3 1 
ATOM   2998 C  CZ2 . TRP B 1 158 ? 29.746 50.770 56.834 1.00 24.13 ? 158 TRP B CZ2 1 
ATOM   2999 C  CZ3 . TRP B 1 158 ? 28.439 52.298 55.465 1.00 22.50 ? 158 TRP B CZ3 1 
ATOM   3000 C  CH2 . TRP B 1 158 ? 29.673 51.853 55.982 1.00 23.23 ? 158 TRP B CH2 1 
ATOM   3001 N  N   . GLU B 1 159 ? 22.107 51.485 57.625 1.00 22.10 ? 159 GLU B N   1 
ATOM   3002 C  CA  . GLU B 1 159 ? 20.781 51.840 57.162 1.00 20.50 ? 159 GLU B CA  1 
ATOM   3003 C  C   . GLU B 1 159 ? 20.490 51.417 55.725 1.00 20.30 ? 159 GLU B C   1 
ATOM   3004 O  O   . GLU B 1 159 ? 19.349 51.089 55.397 1.00 19.73 ? 159 GLU B O   1 
ATOM   3005 C  CB  . GLU B 1 159 ? 20.556 53.339 57.364 1.00 19.56 ? 159 GLU B CB  1 
ATOM   3006 C  CG  . GLU B 1 159 ? 20.614 53.760 58.847 1.00 19.65 ? 159 GLU B CG  1 
ATOM   3007 C  CD  . GLU B 1 159 ? 20.440 55.259 59.075 1.00 22.09 ? 159 GLU B CD  1 
ATOM   3008 O  OE1 . GLU B 1 159 ? 21.118 56.075 58.395 1.00 18.28 ? 159 GLU B OE1 1 
ATOM   3009 O  OE2 . GLU B 1 159 ? 19.622 55.618 59.956 1.00 26.03 ? 159 GLU B OE2 1 
ATOM   3010 N  N   . HIS B 1 160 ? 21.506 51.381 54.869 1.00 20.36 ? 160 HIS B N   1 
ATOM   3011 C  CA  . HIS B 1 160 ? 21.253 50.984 53.492 1.00 22.12 ? 160 HIS B CA  1 
ATOM   3012 C  C   . HIS B 1 160 ? 20.780 49.549 53.387 1.00 22.21 ? 160 HIS B C   1 
ATOM   3013 O  O   . HIS B 1 160 ? 20.267 49.143 52.351 1.00 25.00 ? 160 HIS B O   1 
ATOM   3014 C  CB  . HIS B 1 160 ? 22.489 51.197 52.603 1.00 24.07 ? 160 HIS B CB  1 
ATOM   3015 C  CG  . HIS B 1 160 ? 23.605 50.240 52.870 1.00 26.78 ? 160 HIS B CG  1 
ATOM   3016 N  ND1 . HIS B 1 160 ? 24.906 50.628 53.092 1.00 25.76 ? 160 HIS B ND1 1 
ATOM   3017 C  CD2 . HIS B 1 160 ? 23.620 48.882 52.874 1.00 26.67 ? 160 HIS B CD2 1 
ATOM   3018 C  CE1 . HIS B 1 160 ? 25.663 49.518 53.208 1.00 29.24 ? 160 HIS B CE1 1 
ATOM   3019 N  NE2 . HIS B 1 160 ? 24.936 48.425 53.086 1.00 28.02 ? 160 HIS B NE2 1 
ATOM   3020 N  N   . ALA B 1 161 ? 20.932 48.764 54.446 1.00 22.66 ? 161 ALA B N   1 
ATOM   3021 C  CA  . ALA B 1 161 ? 20.482 47.368 54.368 1.00 21.80 ? 161 ALA B CA  1 
ATOM   3022 C  C   . ALA B 1 161 ? 18.980 47.233 54.518 1.00 21.22 ? 161 ALA B C   1 
ATOM   3023 O  O   . ALA B 1 161 ? 18.413 46.210 54.140 1.00 19.79 ? 161 ALA B O   1 
ATOM   3024 C  CB  . ALA B 1 161 ? 21.191 46.497 55.426 1.00 19.90 ? 161 ALA B CB  1 
ATOM   3025 N  N   . TYR B 1 162 ? 18.326 48.262 55.047 1.00 21.60 ? 162 TYR B N   1 
ATOM   3026 C  CA  . TYR B 1 162 ? 16.885 48.159 55.244 1.00 22.32 ? 162 TYR B CA  1 
ATOM   3027 C  C   . TYR B 1 162 ? 16.030 49.382 54.926 1.00 21.82 ? 162 TYR B C   1 
ATOM   3028 O  O   . TYR B 1 162 ? 14.807 49.310 54.998 1.00 22.91 ? 162 TYR B O   1 
ATOM   3029 C  CB  . TYR B 1 162 ? 16.617 47.736 56.689 1.00 21.67 ? 162 TYR B CB  1 
ATOM   3030 C  CG  . TYR B 1 162 ? 17.177 48.692 57.708 1.00 22.29 ? 162 TYR B CG  1 
ATOM   3031 C  CD1 . TYR B 1 162 ? 16.450 49.818 58.119 1.00 22.81 ? 162 TYR B CD1 1 
ATOM   3032 C  CD2 . TYR B 1 162 ? 18.422 48.457 58.303 1.00 25.04 ? 162 TYR B CD2 1 
ATOM   3033 C  CE1 . TYR B 1 162 ? 16.945 50.681 59.112 1.00 24.15 ? 162 TYR B CE1 1 
ATOM   3034 C  CE2 . TYR B 1 162 ? 18.934 49.320 59.300 1.00 25.23 ? 162 TYR B CE2 1 
ATOM   3035 C  CZ  . TYR B 1 162 ? 18.190 50.421 59.698 1.00 25.27 ? 162 TYR B CZ  1 
ATOM   3036 O  OH  . TYR B 1 162 ? 18.673 51.250 60.682 1.00 25.60 ? 162 TYR B OH  1 
ATOM   3037 N  N   . TYR B 1 163 ? 16.652 50.496 54.569 1.00 22.42 ? 163 TYR B N   1 
ATOM   3038 C  CA  . TYR B 1 163 ? 15.875 51.693 54.298 1.00 22.61 ? 163 TYR B CA  1 
ATOM   3039 C  C   . TYR B 1 163 ? 14.862 51.616 53.165 1.00 23.16 ? 163 TYR B C   1 
ATOM   3040 O  O   . TYR B 1 163 ? 13.787 52.194 53.281 1.00 24.10 ? 163 TYR B O   1 
ATOM   3041 C  CB  . TYR B 1 163 ? 16.788 52.885 54.067 1.00 20.67 ? 163 TYR B CB  1 
ATOM   3042 C  CG  . TYR B 1 163 ? 16.351 54.042 54.899 1.00 22.20 ? 163 TYR B CG  1 
ATOM   3043 C  CD1 . TYR B 1 163 ? 16.464 53.999 56.282 1.00 21.81 ? 163 TYR B CD1 1 
ATOM   3044 C  CD2 . TYR B 1 163 ? 15.718 55.143 54.320 1.00 22.09 ? 163 TYR B CD2 1 
ATOM   3045 C  CE1 . TYR B 1 163 ? 15.946 55.026 57.079 1.00 21.85 ? 163 TYR B CE1 1 
ATOM   3046 C  CE2 . TYR B 1 163 ? 15.201 56.158 55.101 1.00 21.26 ? 163 TYR B CE2 1 
ATOM   3047 C  CZ  . TYR B 1 163 ? 15.314 56.092 56.479 1.00 21.93 ? 163 TYR B CZ  1 
ATOM   3048 O  OH  . TYR B 1 163 ? 14.758 57.066 57.261 1.00 22.83 ? 163 TYR B OH  1 
ATOM   3049 N  N   . ILE B 1 164 ? 15.192 50.910 52.082 1.00 23.79 ? 164 ILE B N   1 
ATOM   3050 C  CA  . ILE B 1 164 ? 14.282 50.794 50.952 1.00 23.07 ? 164 ILE B CA  1 
ATOM   3051 C  C   . ILE B 1 164 ? 12.950 50.150 51.313 1.00 24.35 ? 164 ILE B C   1 
ATOM   3052 O  O   . ILE B 1 164 ? 11.907 50.701 51.000 1.00 24.11 ? 164 ILE B O   1 
ATOM   3053 C  CB  . ILE B 1 164 ? 14.920 50.015 49.801 1.00 23.32 ? 164 ILE B CB  1 
ATOM   3054 C  CG1 . ILE B 1 164 ? 16.048 50.849 49.214 1.00 19.44 ? 164 ILE B CG1 1 
ATOM   3055 C  CG2 . ILE B 1 164 ? 13.869 49.722 48.693 1.00 18.84 ? 164 ILE B CG2 1 
ATOM   3056 C  CD1 . ILE B 1 164 ? 16.883 50.113 48.186 1.00 21.30 ? 164 ILE B CD1 1 
ATOM   3057 N  N   . ASP B 1 165 ? 12.972 49.005 51.985 1.00 24.43 ? 165 ASP B N   1 
ATOM   3058 C  CA  . ASP B 1 165 ? 11.718 48.329 52.357 1.00 24.86 ? 165 ASP B CA  1 
ATOM   3059 C  C   . ASP B 1 165 ? 11.175 48.680 53.728 1.00 25.20 ? 165 ASP B C   1 
ATOM   3060 O  O   . ASP B 1 165 ? 9.987  48.475 53.988 1.00 24.77 ? 165 ASP B O   1 
ATOM   3061 C  CB  . ASP B 1 165 ? 11.880 46.807 52.331 1.00 23.87 ? 165 ASP B CB  1 
ATOM   3062 C  CG  . ASP B 1 165 ? 12.343 46.302 51.004 1.00 24.18 ? 165 ASP B CG  1 
ATOM   3063 O  OD1 . ASP B 1 165 ? 11.647 46.603 50.019 1.00 25.58 ? 165 ASP B OD1 1 
ATOM   3064 O  OD2 . ASP B 1 165 ? 13.392 45.618 50.945 1.00 25.04 ? 165 ASP B OD2 1 
ATOM   3065 N  N   . HIS B 1 166 ? 12.032 49.207 54.603 1.00 25.11 ? 166 HIS B N   1 
ATOM   3066 C  CA  . HIS B 1 166 ? 11.618 49.489 55.971 1.00 23.77 ? 166 HIS B CA  1 
ATOM   3067 C  C   . HIS B 1 166 ? 11.898 50.894 56.505 1.00 23.98 ? 166 HIS B C   1 
ATOM   3068 O  O   . HIS B 1 166 ? 11.532 51.219 57.639 1.00 24.61 ? 166 HIS B O   1 
ATOM   3069 C  CB  . HIS B 1 166 ? 12.277 48.456 56.879 1.00 22.09 ? 166 HIS B CB  1 
ATOM   3070 C  CG  . HIS B 1 166 ? 12.055 47.046 56.432 1.00 24.66 ? 166 HIS B CG  1 
ATOM   3071 N  ND1 . HIS B 1 166 ? 10.862 46.381 56.623 1.00 26.77 ? 166 HIS B ND1 1 
ATOM   3072 C  CD2 . HIS B 1 166 ? 12.857 46.188 55.757 1.00 27.22 ? 166 HIS B CD2 1 
ATOM   3073 C  CE1 . HIS B 1 166 ? 10.939 45.174 56.088 1.00 25.44 ? 166 HIS B CE1 1 
ATOM   3074 N  NE2 . HIS B 1 166 ? 12.138 45.032 55.555 1.00 25.22 ? 166 HIS B NE2 1 
ATOM   3075 N  N   . LYS B 1 167 ? 12.524 51.731 55.693 1.00 24.59 ? 167 LYS B N   1 
ATOM   3076 C  CA  . LYS B 1 167 ? 12.875 53.087 56.119 1.00 26.41 ? 167 LYS B CA  1 
ATOM   3077 C  C   . LYS B 1 167 ? 13.548 52.991 57.481 1.00 25.27 ? 167 LYS B C   1 
ATOM   3078 O  O   . LYS B 1 167 ? 14.430 52.167 57.671 1.00 24.08 ? 167 LYS B O   1 
ATOM   3079 C  CB  . LYS B 1 167 ? 11.639 53.981 56.218 1.00 28.02 ? 167 LYS B CB  1 
ATOM   3080 C  CG  . LYS B 1 167 ? 10.883 54.138 54.921 1.00 33.56 ? 167 LYS B CG  1 
ATOM   3081 C  CD  . LYS B 1 167 ? 11.643 54.982 53.939 1.00 36.12 ? 167 LYS B CD  1 
ATOM   3082 C  CE  . LYS B 1 167 ? 10.819 55.194 52.679 1.00 40.53 ? 167 LYS B CE  1 
ATOM   3083 N  NZ  . LYS B 1 167 ? 10.941 54.014 51.765 1.00 46.51 ? 167 LYS B NZ  1 
ATOM   3084 N  N   . ASN B 1 168 ? 13.099 53.800 58.436 1.00 24.72 ? 168 ASN B N   1 
ATOM   3085 C  CA  . ASN B 1 168 ? 13.695 53.833 59.774 1.00 24.03 ? 168 ASN B CA  1 
ATOM   3086 C  C   . ASN B 1 168 ? 13.320 52.683 60.699 1.00 23.21 ? 168 ASN B C   1 
ATOM   3087 O  O   . ASN B 1 168 ? 13.859 52.566 61.788 1.00 21.00 ? 168 ASN B O   1 
ATOM   3088 C  CB  . ASN B 1 168 ? 13.331 55.151 60.481 1.00 24.65 ? 168 ASN B CB  1 
ATOM   3089 C  CG  . ASN B 1 168 ? 11.824 55.298 60.706 1.00 28.29 ? 168 ASN B CG  1 
ATOM   3090 O  OD1 . ASN B 1 168 ? 11.374 55.554 61.816 1.00 32.67 ? 168 ASN B OD1 1 
ATOM   3091 N  ND2 . ASN B 1 168 ? 11.048 55.134 59.650 1.00 27.13 ? 168 ASN B ND2 1 
ATOM   3092 N  N   . ALA B 1 169 ? 12.396 51.838 60.275 1.00 23.73 ? 169 ALA B N   1 
ATOM   3093 C  CA  . ALA B 1 169 ? 11.945 50.732 61.129 1.00 22.26 ? 169 ALA B CA  1 
ATOM   3094 C  C   . ALA B 1 169 ? 12.897 49.532 61.248 1.00 21.22 ? 169 ALA B C   1 
ATOM   3095 O  O   . ALA B 1 169 ? 12.510 48.404 60.912 1.00 21.47 ? 169 ALA B O   1 
ATOM   3096 C  CB  . ALA B 1 169 ? 10.588 50.262 60.645 1.00 18.56 ? 169 ALA B CB  1 
ATOM   3097 N  N   . ARG B 1 170 ? 14.113 49.758 61.747 1.00 20.85 ? 170 ARG B N   1 
ATOM   3098 C  CA  . ARG B 1 170 ? 15.094 48.669 61.884 1.00 20.92 ? 170 ARG B CA  1 
ATOM   3099 C  C   . ARG B 1 170 ? 14.508 47.471 62.638 1.00 20.17 ? 170 ARG B C   1 
ATOM   3100 O  O   . ARG B 1 170 ? 14.753 46.318 62.280 1.00 21.33 ? 170 ARG B O   1 
ATOM   3101 C  CB  . ARG B 1 170 ? 16.371 49.156 62.609 1.00 22.27 ? 170 ARG B CB  1 
ATOM   3102 C  CG  . ARG B 1 170 ? 17.524 48.166 62.521 1.00 22.86 ? 170 ARG B CG  1 
ATOM   3103 C  CD  . ARG B 1 170 ? 18.658 48.475 63.496 1.00 24.06 ? 170 ARG B CD  1 
ATOM   3104 N  NE  . ARG B 1 170 ? 19.428 49.669 63.167 1.00 24.02 ? 170 ARG B NE  1 
ATOM   3105 C  CZ  . ARG B 1 170 ? 20.506 50.071 63.850 1.00 27.21 ? 170 ARG B CZ  1 
ATOM   3106 N  NH1 . ARG B 1 170 ? 20.936 49.373 64.898 1.00 24.28 ? 170 ARG B NH1 1 
ATOM   3107 N  NH2 . ARG B 1 170 ? 21.170 51.164 63.480 1.00 25.15 ? 170 ARG B NH2 1 
ATOM   3108 N  N   . PRO B 1 171 ? 13.704 47.727 63.680 1.00 19.78 ? 171 PRO B N   1 
ATOM   3109 C  CA  . PRO B 1 171 ? 13.140 46.586 64.414 1.00 20.75 ? 171 PRO B CA  1 
ATOM   3110 C  C   . PRO B 1 171 ? 12.360 45.625 63.520 1.00 22.71 ? 171 PRO B C   1 
ATOM   3111 O  O   . PRO B 1 171 ? 12.507 44.408 63.608 1.00 23.67 ? 171 PRO B O   1 
ATOM   3112 C  CB  . PRO B 1 171 ? 12.262 47.250 65.485 1.00 17.33 ? 171 PRO B CB  1 
ATOM   3113 C  CG  . PRO B 1 171 ? 12.974 48.564 65.742 1.00 20.46 ? 171 PRO B CG  1 
ATOM   3114 C  CD  . PRO B 1 171 ? 13.383 49.013 64.334 1.00 16.64 ? 171 PRO B CD  1 
ATOM   3115 N  N   . VAL B 1 172 ? 11.514 46.168 62.661 1.00 25.42 ? 172 VAL B N   1 
ATOM   3116 C  CA  . VAL B 1 172 ? 10.736 45.332 61.750 1.00 25.07 ? 172 VAL B CA  1 
ATOM   3117 C  C   . VAL B 1 172 ? 11.689 44.557 60.862 1.00 24.72 ? 172 VAL B C   1 
ATOM   3118 O  O   . VAL B 1 172 ? 11.508 43.369 60.630 1.00 25.44 ? 172 VAL B O   1 
ATOM   3119 C  CB  . VAL B 1 172 ? 9.810  46.196 60.855 1.00 26.10 ? 172 VAL B CB  1 
ATOM   3120 C  CG1 . VAL B 1 172 ? 9.111  45.320 59.808 1.00 20.32 ? 172 VAL B CG1 1 
ATOM   3121 C  CG2 . VAL B 1 172 ? 8.792  46.927 61.741 1.00 25.42 ? 172 VAL B CG2 1 
ATOM   3122 N  N   . TYR B 1 173 ? 12.704 45.244 60.350 1.00 24.76 ? 173 TYR B N   1 
ATOM   3123 C  CA  . TYR B 1 173 ? 13.704 44.606 59.491 1.00 25.03 ? 173 TYR B CA  1 
ATOM   3124 C  C   . TYR B 1 173 ? 14.396 43.455 60.239 1.00 26.10 ? 173 TYR B C   1 
ATOM   3125 O  O   . TYR B 1 173 ? 14.601 42.377 59.682 1.00 24.68 ? 173 TYR B O   1 
ATOM   3126 C  CB  . TYR B 1 173 ? 14.739 45.651 59.049 1.00 23.56 ? 173 TYR B CB  1 
ATOM   3127 C  CG  . TYR B 1 173 ? 16.091 45.094 58.629 1.00 23.17 ? 173 TYR B CG  1 
ATOM   3128 C  CD1 . TYR B 1 173 ? 16.242 44.406 57.429 1.00 22.24 ? 173 TYR B CD1 1 
ATOM   3129 C  CD2 . TYR B 1 173 ? 17.228 45.288 59.423 1.00 21.99 ? 173 TYR B CD2 1 
ATOM   3130 C  CE1 . TYR B 1 173 ? 17.469 43.935 57.017 1.00 16.78 ? 173 TYR B CE1 1 
ATOM   3131 C  CE2 . TYR B 1 173 ? 18.472 44.813 59.026 1.00 20.88 ? 173 TYR B CE2 1 
ATOM   3132 C  CZ  . TYR B 1 173 ? 18.584 44.135 57.809 1.00 23.68 ? 173 TYR B CZ  1 
ATOM   3133 O  OH  . TYR B 1 173 ? 19.808 43.661 57.371 1.00 20.33 ? 173 TYR B OH  1 
ATOM   3134 N  N   . LEU B 1 174 ? 14.738 43.683 61.506 1.00 25.95 ? 174 LEU B N   1 
ATOM   3135 C  CA  . LEU B 1 174 ? 15.413 42.658 62.284 1.00 27.67 ? 174 LEU B CA  1 
ATOM   3136 C  C   . LEU B 1 174 ? 14.528 41.430 62.488 1.00 28.27 ? 174 LEU B C   1 
ATOM   3137 O  O   . LEU B 1 174 ? 14.980 40.288 62.324 1.00 26.91 ? 174 LEU B O   1 
ATOM   3138 C  CB  . LEU B 1 174 ? 15.868 43.238 63.635 1.00 26.50 ? 174 LEU B CB  1 
ATOM   3139 C  CG  . LEU B 1 174 ? 17.009 44.257 63.507 1.00 27.20 ? 174 LEU B CG  1 
ATOM   3140 C  CD1 . LEU B 1 174 ? 17.309 44.851 64.883 1.00 26.79 ? 174 LEU B CD1 1 
ATOM   3141 C  CD2 . LEU B 1 174 ? 18.270 43.587 62.909 1.00 21.68 ? 174 LEU B CD2 1 
ATOM   3142 N  N   . GLU B 1 175 ? 13.266 41.670 62.831 1.00 28.24 ? 175 GLU B N   1 
ATOM   3143 C  CA  . GLU B 1 175 ? 12.316 40.585 63.052 1.00 29.21 ? 175 GLU B CA  1 
ATOM   3144 C  C   . GLU B 1 175 ? 12.171 39.754 61.773 1.00 28.81 ? 175 GLU B C   1 
ATOM   3145 O  O   . GLU B 1 175 ? 12.148 38.528 61.813 1.00 27.78 ? 175 GLU B O   1 
ATOM   3146 C  CB  . GLU B 1 175 ? 10.959 41.156 63.474 1.00 30.52 ? 175 GLU B CB  1 
ATOM   3147 C  CG  . GLU B 1 175 ? 9.933  40.098 63.814 1.00 38.32 ? 175 GLU B CG  1 
ATOM   3148 C  CD  . GLU B 1 175 ? 10.420 39.133 64.889 1.00 42.45 ? 175 GLU B CD  1 
ATOM   3149 O  OE1 . GLU B 1 175 ? 10.227 37.911 64.712 1.00 43.90 ? 175 GLU B OE1 1 
ATOM   3150 O  OE2 . GLU B 1 175 ? 10.986 39.593 65.903 1.00 42.58 ? 175 GLU B OE2 1 
ATOM   3151 N  N   . LYS B 1 176 ? 12.088 40.425 60.631 1.00 28.64 ? 176 LYS B N   1 
ATOM   3152 C  CA  . LYS B 1 176 ? 11.952 39.719 59.359 1.00 28.91 ? 176 LYS B CA  1 
ATOM   3153 C  C   . LYS B 1 176 ? 13.226 38.948 59.037 1.00 28.36 ? 176 LYS B C   1 
ATOM   3154 O  O   . LYS B 1 176 ? 13.169 37.848 58.493 1.00 25.67 ? 176 LYS B O   1 
ATOM   3155 C  CB  . LYS B 1 176 ? 11.646 40.702 58.228 1.00 31.85 ? 176 LYS B CB  1 
ATOM   3156 C  CG  . LYS B 1 176 ? 10.274 41.355 58.328 1.00 31.46 ? 176 LYS B CG  1 
ATOM   3157 C  CD  . LYS B 1 176 ? 9.190  40.297 58.481 1.00 32.17 ? 176 LYS B CD  1 
ATOM   3158 C  CE  . LYS B 1 176 ? 7.826  40.872 58.133 1.00 33.01 ? 176 LYS B CE  1 
ATOM   3159 N  NZ  . LYS B 1 176 ? 6.696  39.982 58.504 1.00 29.64 ? 176 LYS B NZ  1 
ATOM   3160 N  N   . PHE B 1 177 ? 14.378 39.536 59.367 1.00 28.23 ? 177 PHE B N   1 
ATOM   3161 C  CA  . PHE B 1 177 ? 15.664 38.876 59.149 1.00 27.03 ? 177 PHE B CA  1 
ATOM   3162 C  C   . PHE B 1 177 ? 15.712 37.564 59.944 1.00 27.57 ? 177 PHE B C   1 
ATOM   3163 O  O   . PHE B 1 177 ? 15.971 36.494 59.377 1.00 28.17 ? 177 PHE B O   1 
ATOM   3164 C  CB  . PHE B 1 177 ? 16.812 39.775 59.600 1.00 28.62 ? 177 PHE B CB  1 
ATOM   3165 C  CG  . PHE B 1 177 ? 18.109 39.038 59.843 1.00 29.78 ? 177 PHE B CG  1 
ATOM   3166 C  CD1 . PHE B 1 177 ? 19.005 38.820 58.799 1.00 28.50 ? 177 PHE B CD1 1 
ATOM   3167 C  CD2 . PHE B 1 177 ? 18.425 38.550 61.118 1.00 27.74 ? 177 PHE B CD2 1 
ATOM   3168 C  CE1 . PHE B 1 177 ? 20.194 38.132 59.016 1.00 28.94 ? 177 PHE B CE1 1 
ATOM   3169 C  CE2 . PHE B 1 177 ? 19.612 37.858 61.345 1.00 29.11 ? 177 PHE B CE2 1 
ATOM   3170 C  CZ  . PHE B 1 177 ? 20.499 37.648 60.300 1.00 28.59 ? 177 PHE B CZ  1 
ATOM   3171 N  N   . TYR B 1 178 ? 15.465 37.649 61.250 1.00 26.11 ? 178 TYR B N   1 
ATOM   3172 C  CA  . TYR B 1 178 ? 15.490 36.470 62.102 1.00 26.54 ? 178 TYR B CA  1 
ATOM   3173 C  C   . TYR B 1 178 ? 14.681 35.314 61.511 1.00 28.55 ? 178 TYR B C   1 
ATOM   3174 O  O   . TYR B 1 178 ? 15.126 34.171 61.534 1.00 29.97 ? 178 TYR B O   1 
ATOM   3175 C  CB  . TYR B 1 178 ? 14.973 36.796 63.514 1.00 25.42 ? 178 TYR B CB  1 
ATOM   3176 C  CG  . TYR B 1 178 ? 15.665 35.947 64.571 1.00 29.34 ? 178 TYR B CG  1 
ATOM   3177 C  CD1 . TYR B 1 178 ? 16.905 36.331 65.086 1.00 29.84 ? 178 TYR B CD1 1 
ATOM   3178 C  CD2 . TYR B 1 178 ? 15.142 34.715 64.966 1.00 27.73 ? 178 TYR B CD2 1 
ATOM   3179 C  CE1 . TYR B 1 178 ? 17.610 35.515 65.959 1.00 32.73 ? 178 TYR B CE1 1 
ATOM   3180 C  CE2 . TYR B 1 178 ? 15.839 33.882 65.830 1.00 31.35 ? 178 TYR B CE2 1 
ATOM   3181 C  CZ  . TYR B 1 178 ? 17.077 34.289 66.321 1.00 33.22 ? 178 TYR B CZ  1 
ATOM   3182 O  OH  . TYR B 1 178 ? 17.807 33.471 67.143 1.00 34.38 ? 178 TYR B OH  1 
ATOM   3183 N  N   . GLY B 1 179 ? 13.500 35.610 60.968 1.00 28.89 ? 179 GLY B N   1 
ATOM   3184 C  CA  . GLY B 1 179 ? 12.670 34.570 60.384 1.00 26.96 ? 179 GLY B CA  1 
ATOM   3185 C  C   . GLY B 1 179 ? 13.308 33.879 59.186 1.00 27.27 ? 179 GLY B C   1 
ATOM   3186 O  O   . GLY B 1 179 ? 12.932 32.768 58.832 1.00 27.61 ? 179 GLY B O   1 
ATOM   3187 N  N   . HIS B 1 180 ? 14.284 34.523 58.564 1.00 25.14 ? 180 HIS B N   1 
ATOM   3188 C  CA  . HIS B 1 180 ? 14.946 33.950 57.398 1.00 25.82 ? 180 HIS B CA  1 
ATOM   3189 C  C   . HIS B 1 180 ? 16.372 33.478 57.652 1.00 27.10 ? 180 HIS B C   1 
ATOM   3190 O  O   . HIS B 1 180 ? 17.141 33.254 56.709 1.00 25.69 ? 180 HIS B O   1 
ATOM   3191 C  CB  . HIS B 1 180 ? 14.965 34.968 56.258 1.00 26.62 ? 180 HIS B CB  1 
ATOM   3192 C  CG  . HIS B 1 180 ? 13.646 35.124 55.577 1.00 29.99 ? 180 HIS B CG  1 
ATOM   3193 N  ND1 . HIS B 1 180 ? 13.099 34.134 54.788 1.00 27.92 ? 180 HIS B ND1 1 
ATOM   3194 C  CD2 . HIS B 1 180 ? 12.750 36.140 55.586 1.00 28.58 ? 180 HIS B CD2 1 
ATOM   3195 C  CE1 . HIS B 1 180 ? 11.925 34.538 54.338 1.00 29.19 ? 180 HIS B CE1 1 
ATOM   3196 N  NE2 . HIS B 1 180 ? 11.691 35.750 54.807 1.00 28.06 ? 180 HIS B NE2 1 
ATOM   3197 N  N   . ILE B 1 181 ? 16.746 33.335 58.919 1.00 28.67 ? 181 ILE B N   1 
ATOM   3198 C  CA  . ILE B 1 181 ? 18.098 32.881 59.214 1.00 28.43 ? 181 ILE B CA  1 
ATOM   3199 C  C   . ILE B 1 181 ? 18.314 31.469 58.679 1.00 28.02 ? 181 ILE B C   1 
ATOM   3200 O  O   . ILE B 1 181 ? 17.487 30.575 58.865 1.00 28.98 ? 181 ILE B O   1 
ATOM   3201 C  CB  . ILE B 1 181 ? 18.405 32.908 60.730 1.00 28.77 ? 181 ILE B CB  1 
ATOM   3202 C  CG1 . ILE B 1 181 ? 18.556 34.358 61.188 1.00 27.31 ? 181 ILE B CG1 1 
ATOM   3203 C  CG2 . ILE B 1 181 ? 19.680 32.119 61.024 1.00 24.87 ? 181 ILE B CG2 1 
ATOM   3204 C  CD1 . ILE B 1 181 ? 18.520 34.519 62.690 1.00 29.85 ? 181 ILE B CD1 1 
ATOM   3205 N  N   . ASN B 1 182 ? 19.431 31.306 57.988 1.00 27.62 ? 182 ASN B N   1 
ATOM   3206 C  CA  . ASN B 1 182 ? 19.841 30.035 57.409 1.00 28.30 ? 182 ASN B CA  1 
ATOM   3207 C  C   . ASN B 1 182 ? 20.550 29.231 58.510 1.00 28.37 ? 182 ASN B C   1 
ATOM   3208 O  O   . ASN B 1 182 ? 21.778 29.132 58.521 1.00 27.06 ? 182 ASN B O   1 
ATOM   3209 C  CB  . ASN B 1 182 ? 20.822 30.306 56.267 1.00 29.26 ? 182 ASN B CB  1 
ATOM   3210 C  CG  . ASN B 1 182 ? 21.214 29.053 55.530 1.00 31.92 ? 182 ASN B CG  1 
ATOM   3211 O  OD1 . ASN B 1 182 ? 20.974 27.938 56.006 1.00 33.76 ? 182 ASN B OD1 1 
ATOM   3212 N  ND2 . ASN B 1 182 ? 21.832 29.223 54.364 1.00 31.98 ? 182 ASN B ND2 1 
ATOM   3213 N  N   . TRP B 1 183 ? 19.777 28.681 59.439 1.00 28.79 ? 183 TRP B N   1 
ATOM   3214 C  CA  . TRP B 1 183 ? 20.342 27.922 60.544 1.00 32.02 ? 183 TRP B CA  1 
ATOM   3215 C  C   . TRP B 1 183 ? 21.260 26.807 60.092 1.00 34.86 ? 183 TRP B C   1 
ATOM   3216 O  O   . TRP B 1 183 ? 22.224 26.458 60.782 1.00 37.48 ? 183 TRP B O   1 
ATOM   3217 C  CB  . TRP B 1 183 ? 19.225 27.376 61.424 1.00 31.10 ? 183 TRP B CB  1 
ATOM   3218 C  CG  . TRP B 1 183 ? 18.500 28.487 62.118 1.00 32.04 ? 183 TRP B CG  1 
ATOM   3219 C  CD1 . TRP B 1 183 ? 17.216 28.904 61.890 1.00 33.33 ? 183 TRP B CD1 1 
ATOM   3220 C  CD2 . TRP B 1 183 ? 19.031 29.355 63.131 1.00 31.30 ? 183 TRP B CD2 1 
ATOM   3221 N  NE1 . TRP B 1 183 ? 16.916 29.975 62.701 1.00 34.70 ? 183 TRP B NE1 1 
ATOM   3222 C  CE2 . TRP B 1 183 ? 18.010 30.272 63.472 1.00 32.55 ? 183 TRP B CE2 1 
ATOM   3223 C  CE3 . TRP B 1 183 ? 20.269 29.450 63.779 1.00 31.74 ? 183 TRP B CE3 1 
ATOM   3224 C  CZ2 . TRP B 1 183 ? 18.189 31.270 64.434 1.00 33.92 ? 183 TRP B CZ2 1 
ATOM   3225 C  CZ3 . TRP B 1 183 ? 20.448 30.448 64.736 1.00 34.36 ? 183 TRP B CZ3 1 
ATOM   3226 C  CH2 . TRP B 1 183 ? 19.411 31.343 65.055 1.00 33.71 ? 183 TRP B CH2 1 
ATOM   3227 N  N   . HIS B 1 184 ? 20.977 26.258 58.922 1.00 35.38 ? 184 HIS B N   1 
ATOM   3228 C  CA  . HIS B 1 184 ? 21.803 25.202 58.390 1.00 36.44 ? 184 HIS B CA  1 
ATOM   3229 C  C   . HIS B 1 184 ? 23.237 25.717 58.222 1.00 35.79 ? 184 HIS B C   1 
ATOM   3230 O  O   . HIS B 1 184 ? 24.211 25.047 58.601 1.00 38.27 ? 184 HIS B O   1 
ATOM   3231 C  CB  . HIS B 1 184 ? 21.255 24.753 57.046 1.00 41.80 ? 184 HIS B CB  1 
ATOM   3232 C  CG  . HIS B 1 184 ? 22.046 23.650 56.428 1.00 44.00 ? 184 HIS B CG  1 
ATOM   3233 N  ND1 . HIS B 1 184 ? 21.983 22.351 56.883 1.00 45.94 ? 184 HIS B ND1 1 
ATOM   3234 C  CD2 . HIS B 1 184 ? 22.955 23.659 55.424 1.00 46.00 ? 184 HIS B CD2 1 
ATOM   3235 C  CE1 . HIS B 1 184 ? 22.820 21.605 56.184 1.00 46.72 ? 184 HIS B CE1 1 
ATOM   3236 N  NE2 . HIS B 1 184 ? 23.423 22.375 55.292 1.00 46.36 ? 184 HIS B NE2 1 
ATOM   3237 N  N   . PHE B 1 185 ? 23.361 26.908 57.648 1.00 32.65 ? 185 PHE B N   1 
ATOM   3238 C  CA  . PHE B 1 185 ? 24.666 27.524 57.448 1.00 30.17 ? 185 PHE B CA  1 
ATOM   3239 C  C   . PHE B 1 185 ? 25.275 27.946 58.786 1.00 30.47 ? 185 PHE B C   1 
ATOM   3240 O  O   . PHE B 1 185 ? 26.482 27.813 58.975 1.00 30.23 ? 185 PHE B O   1 
ATOM   3241 C  CB  . PHE B 1 185 ? 24.549 28.742 56.538 1.00 24.95 ? 185 PHE B CB  1 
ATOM   3242 C  CG  . PHE B 1 185 ? 25.821 29.572 56.448 1.00 22.86 ? 185 PHE B CG  1 
ATOM   3243 C  CD1 . PHE B 1 185 ? 26.896 29.134 55.688 1.00 19.84 ? 185 PHE B CD1 1 
ATOM   3244 C  CD2 . PHE B 1 185 ? 25.925 30.800 57.113 1.00 20.37 ? 185 PHE B CD2 1 
ATOM   3245 C  CE1 . PHE B 1 185 ? 28.063 29.904 55.579 1.00 22.07 ? 185 PHE B CE1 1 
ATOM   3246 C  CE2 . PHE B 1 185 ? 27.089 31.585 57.014 1.00 22.60 ? 185 PHE B CE2 1 
ATOM   3247 C  CZ  . PHE B 1 185 ? 28.164 31.134 56.241 1.00 21.81 ? 185 PHE B CZ  1 
ATOM   3248 N  N   . VAL B 1 186 ? 24.454 28.462 59.705 1.00 30.41 ? 186 VAL B N   1 
ATOM   3249 C  CA  . VAL B 1 186 ? 24.965 28.869 61.015 1.00 31.02 ? 186 VAL B CA  1 
ATOM   3250 C  C   . VAL B 1 186 ? 25.540 27.617 61.685 1.00 33.12 ? 186 VAL B C   1 
ATOM   3251 O  O   . VAL B 1 186 ? 26.553 27.675 62.379 1.00 33.63 ? 186 VAL B O   1 
ATOM   3252 C  CB  . VAL B 1 186 ? 23.843 29.470 61.939 1.00 31.10 ? 186 VAL B CB  1 
ATOM   3253 C  CG1 . VAL B 1 186 ? 24.409 29.754 63.336 1.00 30.12 ? 186 VAL B CG1 1 
ATOM   3254 C  CG2 . VAL B 1 186 ? 23.306 30.768 61.355 1.00 27.75 ? 186 VAL B CG2 1 
ATOM   3255 N  N   . SER B 1 187 ? 24.897 26.477 61.459 1.00 34.85 ? 187 SER B N   1 
ATOM   3256 C  CA  . SER B 1 187 ? 25.357 25.234 62.047 1.00 36.39 ? 187 SER B CA  1 
ATOM   3257 C  C   . SER B 1 187 ? 26.711 24.842 61.465 1.00 37.69 ? 187 SER B C   1 
ATOM   3258 O  O   . SER B 1 187 ? 27.604 24.415 62.203 1.00 37.20 ? 187 SER B O   1 
ATOM   3259 C  CB  . SER B 1 187 ? 24.309 24.135 61.840 1.00 36.73 ? 187 SER B CB  1 
ATOM   3260 O  OG  . SER B 1 187 ? 23.158 24.389 62.643 1.00 33.76 ? 187 SER B OG  1 
ATOM   3261 N  N   . GLN B 1 188 ? 26.872 25.004 60.153 1.00 37.87 ? 188 GLN B N   1 
ATOM   3262 C  CA  . GLN B 1 188 ? 28.146 24.689 59.512 1.00 38.87 ? 188 GLN B CA  1 
ATOM   3263 C  C   . GLN B 1 188 ? 29.263 25.496 60.135 1.00 38.66 ? 188 GLN B C   1 
ATOM   3264 O  O   . GLN B 1 188 ? 30.306 24.958 60.505 1.00 38.92 ? 188 GLN B O   1 
ATOM   3265 C  CB  . GLN B 1 188 ? 28.140 25.047 58.036 1.00 41.75 ? 188 GLN B CB  1 
ATOM   3266 C  CG  . GLN B 1 188 ? 27.541 24.041 57.119 1.00 49.49 ? 188 GLN B CG  1 
ATOM   3267 C  CD  . GLN B 1 188 ? 27.982 24.282 55.685 1.00 53.87 ? 188 GLN B CD  1 
ATOM   3268 O  OE1 . GLN B 1 188 ? 27.378 23.758 54.750 1.00 58.09 ? 188 GLN B OE1 1 
ATOM   3269 N  NE2 . GLN B 1 188 ? 29.051 25.076 55.506 1.00 53.32 ? 188 GLN B NE2 1 
ATOM   3270 N  N   . CYS B 1 189 ? 29.048 26.803 60.205 1.00 37.06 ? 189 CYS B N   1 
ATOM   3271 C  CA  . CYS B 1 189 ? 30.030 27.722 60.760 1.00 37.44 ? 189 CYS B CA  1 
ATOM   3272 C  C   . CYS B 1 189 ? 30.473 27.334 62.168 1.00 38.33 ? 189 CYS B C   1 
ATOM   3273 O  O   . CYS B 1 189 ? 31.635 27.485 62.522 1.00 36.86 ? 189 CYS B O   1 
ATOM   3274 C  CB  . CYS B 1 189 ? 29.461 29.146 60.790 1.00 37.43 ? 189 CYS B CB  1 
ATOM   3275 S  SG  . CYS B 1 189 ? 29.325 29.952 59.189 1.00 32.11 ? 189 CYS B SG  1 
ATOM   3276 N  N   . TYR B 1 190 ? 29.528 26.857 62.970 1.00 39.44 ? 190 TYR B N   1 
ATOM   3277 C  CA  . TYR B 1 190 ? 29.811 26.463 64.339 1.00 42.03 ? 190 TYR B CA  1 
ATOM   3278 C  C   . TYR B 1 190 ? 30.692 25.218 64.325 1.00 43.53 ? 190 TYR B C   1 
ATOM   3279 O  O   . TYR B 1 190 ? 31.796 25.221 64.873 1.00 42.09 ? 190 TYR B O   1 
ATOM   3280 C  CB  . TYR B 1 190 ? 28.499 26.182 65.076 1.00 42.16 ? 190 TYR B CB  1 
ATOM   3281 C  CG  . TYR B 1 190 ? 28.688 25.780 66.509 1.00 44.49 ? 190 TYR B CG  1 
ATOM   3282 C  CD1 . TYR B 1 190 ? 29.369 26.612 67.403 1.00 43.60 ? 190 TYR B CD1 1 
ATOM   3283 C  CD2 . TYR B 1 190 ? 28.203 24.558 66.979 1.00 45.89 ? 190 TYR B CD2 1 
ATOM   3284 C  CE1 . TYR B 1 190 ? 29.567 26.238 68.729 1.00 44.46 ? 190 TYR B CE1 1 
ATOM   3285 C  CE2 . TYR B 1 190 ? 28.395 24.171 68.312 1.00 47.28 ? 190 TYR B CE2 1 
ATOM   3286 C  CZ  . TYR B 1 190 ? 29.082 25.017 69.180 1.00 46.67 ? 190 TYR B CZ  1 
ATOM   3287 O  OH  . TYR B 1 190 ? 29.306 24.637 70.491 1.00 48.03 ? 190 TYR B OH  1 
ATOM   3288 N  N   . GLU B 1 191 ? 30.184 24.159 63.699 1.00 44.20 ? 191 GLU B N   1 
ATOM   3289 C  CA  . GLU B 1 191 ? 30.908 22.909 63.583 1.00 46.63 ? 191 GLU B CA  1 
ATOM   3290 C  C   . GLU B 1 191 ? 32.368 23.149 63.177 1.00 47.05 ? 191 GLU B C   1 
ATOM   3291 O  O   . GLU B 1 191 ? 33.292 22.687 63.846 1.00 47.55 ? 191 GLU B O   1 
ATOM   3292 C  CB  . GLU B 1 191 ? 30.216 22.004 62.559 1.00 47.58 ? 191 GLU B CB  1 
ATOM   3293 C  CG  . GLU B 1 191 ? 31.114 20.929 61.996 1.00 51.08 ? 191 GLU B CG  1 
ATOM   3294 C  CD  . GLU B 1 191 ? 30.375 19.941 61.114 1.00 55.25 ? 191 GLU B CD  1 
ATOM   3295 O  OE1 . GLU B 1 191 ? 31.057 19.103 60.478 1.00 57.94 ? 191 GLU B OE1 1 
ATOM   3296 O  OE2 . GLU B 1 191 ? 29.122 19.993 61.060 1.00 55.71 ? 191 GLU B OE2 1 
ATOM   3297 N  N   . TRP B 1 192 ? 32.580 23.893 62.102 1.00 47.10 ? 192 TRP B N   1 
ATOM   3298 C  CA  . TRP B 1 192 ? 33.936 24.144 61.650 1.00 47.66 ? 192 TRP B CA  1 
ATOM   3299 C  C   . TRP B 1 192 ? 34.732 25.105 62.522 1.00 46.58 ? 192 TRP B C   1 
ATOM   3300 O  O   . TRP B 1 192 ? 35.956 25.078 62.497 1.00 47.11 ? 192 TRP B O   1 
ATOM   3301 C  CB  . TRP B 1 192 ? 33.929 24.634 60.205 1.00 50.97 ? 192 TRP B CB  1 
ATOM   3302 C  CG  . TRP B 1 192 ? 33.341 23.645 59.269 1.00 54.75 ? 192 TRP B CG  1 
ATOM   3303 C  CD1 . TRP B 1 192 ? 33.056 22.341 59.536 1.00 55.57 ? 192 TRP B CD1 1 
ATOM   3304 C  CD2 . TRP B 1 192 ? 32.980 23.866 57.898 1.00 60.29 ? 192 TRP B CD2 1 
ATOM   3305 N  NE1 . TRP B 1 192 ? 32.541 21.730 58.422 1.00 58.42 ? 192 TRP B NE1 1 
ATOM   3306 C  CE2 . TRP B 1 192 ? 32.482 22.641 57.398 1.00 61.72 ? 192 TRP B CE2 1 
ATOM   3307 C  CE3 . TRP B 1 192 ? 33.029 24.982 57.039 1.00 62.22 ? 192 TRP B CE3 1 
ATOM   3308 C  CZ2 . TRP B 1 192 ? 32.030 22.496 56.065 1.00 63.11 ? 192 TRP B CZ2 1 
ATOM   3309 C  CZ3 . TRP B 1 192 ? 32.577 24.836 55.712 1.00 62.56 ? 192 TRP B CZ3 1 
ATOM   3310 C  CH2 . TRP B 1 192 ? 32.086 23.601 55.245 1.00 62.17 ? 192 TRP B CH2 1 
ATOM   3311 N  N   . ALA B 1 193 ? 34.057 25.962 63.279 1.00 44.81 ? 193 ALA B N   1 
ATOM   3312 C  CA  . ALA B 1 193 ? 34.765 26.891 64.154 1.00 44.58 ? 193 ALA B CA  1 
ATOM   3313 C  C   . ALA B 1 193 ? 35.409 26.053 65.264 1.00 45.30 ? 193 ALA B C   1 
ATOM   3314 O  O   . ALA B 1 193 ? 36.520 26.338 65.719 1.00 43.10 ? 193 ALA B O   1 
ATOM   3315 C  CB  . ALA B 1 193 ? 33.797 27.903 64.762 1.00 43.40 ? 193 ALA B CB  1 
ATOM   3316 N  N   . LYS B 1 194 ? 34.688 25.014 65.679 1.00 45.64 ? 194 LYS B N   1 
ATOM   3317 C  CA  . LYS B 1 194 ? 35.142 24.109 66.721 1.00 46.90 ? 194 LYS B CA  1 
ATOM   3318 C  C   . LYS B 1 194 ? 36.259 23.215 66.220 1.00 48.14 ? 194 LYS B C   1 
ATOM   3319 O  O   . LYS B 1 194 ? 37.189 22.936 66.963 1.00 48.33 ? 194 LYS B O   1 
ATOM   3320 C  CB  . LYS B 1 194 ? 33.977 23.246 67.221 1.00 45.98 ? 194 LYS B CB  1 
ATOM   3321 C  CG  . LYS B 1 194 ? 33.213 23.854 68.392 1.00 47.01 ? 194 LYS B CG  1 
ATOM   3322 C  CD  . LYS B 1 194 ? 31.772 23.345 68.468 1.00 49.79 ? 194 LYS B CD  1 
ATOM   3323 C  CE  . LYS B 1 194 ? 31.662 21.832 68.668 1.00 52.19 ? 194 LYS B CE  1 
ATOM   3324 N  NZ  . LYS B 1 194 ? 30.265 21.300 68.461 1.00 52.62 ? 194 LYS B NZ  1 
ATOM   3325 N  N   . LYS B 1 195 ? 36.177 22.788 64.959 1.00 49.05 ? 195 LYS B N   1 
ATOM   3326 C  CA  . LYS B 1 195 ? 37.181 21.901 64.381 1.00 49.98 ? 195 LYS B CA  1 
ATOM   3327 C  C   . LYS B 1 195 ? 38.417 22.579 63.803 1.00 51.22 ? 195 LYS B C   1 
ATOM   3328 O  O   . LYS B 1 195 ? 39.533 22.118 64.029 1.00 53.16 ? 195 LYS B O   1 
ATOM   3329 C  CB  . LYS B 1 195 ? 36.546 21.019 63.302 1.00 51.04 ? 195 LYS B CB  1 
ATOM   3330 C  CG  . LYS B 1 195 ? 35.446 20.108 63.826 1.00 54.34 ? 195 LYS B CG  1 
ATOM   3331 C  CD  . LYS B 1 195 ? 34.899 19.188 62.736 1.00 55.97 ? 195 LYS B CD  1 
ATOM   3332 C  CE  . LYS B 1 195 ? 33.766 18.317 63.268 1.00 56.65 ? 195 LYS B CE  1 
ATOM   3333 N  NZ  . LYS B 1 195 ? 33.197 17.430 62.212 1.00 57.73 ? 195 LYS B NZ  1 
ATOM   3334 N  N   . GLU B 1 196 ? 38.238 23.664 63.061 1.00 51.07 ? 196 GLU B N   1 
ATOM   3335 C  CA  . GLU B 1 196 ? 39.375 24.340 62.458 1.00 50.63 ? 196 GLU B CA  1 
ATOM   3336 C  C   . GLU B 1 196 ? 39.635 25.713 63.035 1.00 49.59 ? 196 GLU B C   1 
ATOM   3337 O  O   . GLU B 1 196 ? 40.565 26.405 62.613 1.00 48.16 ? 196 GLU B O   1 
ATOM   3338 C  CB  . GLU B 1 196 ? 39.167 24.471 60.949 1.00 54.45 ? 196 GLU B CB  1 
ATOM   3339 C  CG  . GLU B 1 196 ? 39.208 23.146 60.213 1.00 61.27 ? 196 GLU B CG  1 
ATOM   3340 C  CD  . GLU B 1 196 ? 40.421 22.312 60.608 1.00 64.09 ? 196 GLU B CD  1 
ATOM   3341 O  OE1 . GLU B 1 196 ? 41.547 22.870 60.660 1.00 63.43 ? 196 GLU B OE1 1 
ATOM   3342 O  OE2 . GLU B 1 196 ? 40.243 21.100 60.863 1.00 65.49 ? 196 GLU B OE2 1 
ATOM   3343 N  N   . GLY B 1 197 ? 38.818 26.118 63.997 1.00 48.41 ? 197 GLY B N   1 
ATOM   3344 C  CA  . GLY B 1 197 ? 38.997 27.440 64.571 1.00 48.08 ? 197 GLY B CA  1 
ATOM   3345 C  C   . GLY B 1 197 ? 38.946 28.547 63.519 1.00 47.92 ? 197 GLY B C   1 
ATOM   3346 O  O   . GLY B 1 197 ? 38.159 28.498 62.565 1.00 47.38 ? 197 GLY B O   1 
ATOM   3347 N  N   . LEU B 1 198 ? 39.796 29.551 63.684 1.00 46.58 ? 198 LEU B N   1 
ATOM   3348 C  CA  . LEU B 1 198 ? 39.835 30.666 62.759 1.00 47.65 ? 198 LEU B CA  1 
ATOM   3349 C  C   . LEU B 1 198 ? 40.187 30.215 61.341 1.00 48.32 ? 198 LEU B C   1 
ATOM   3350 O  O   . LEU B 1 198 ? 40.032 30.966 60.374 1.00 48.32 ? 198 LEU B O   1 
ATOM   3351 C  CB  . LEU B 1 198 ? 40.855 31.689 63.231 1.00 48.39 ? 198 LEU B CB  1 
ATOM   3352 C  CG  . LEU B 1 198 ? 40.536 33.118 62.814 1.00 50.92 ? 198 LEU B CG  1 
ATOM   3353 C  CD1 . LEU B 1 198 ? 39.836 33.824 63.966 1.00 51.92 ? 198 LEU B CD1 1 
ATOM   3354 C  CD2 . LEU B 1 198 ? 41.822 33.846 62.441 1.00 53.28 ? 198 LEU B CD2 1 
ATOM   3355 N  N   . GLY B 1 199 ? 40.670 28.985 61.222 1.00 48.06 ? 199 GLY B N   1 
ATOM   3356 C  CA  . GLY B 1 199 ? 41.034 28.464 59.919 1.00 45.22 ? 199 GLY B CA  1 
ATOM   3357 C  C   . GLY B 1 199 ? 39.810 28.181 59.077 1.00 44.14 ? 199 GLY B C   1 
ATOM   3358 O  O   . GLY B 1 199 ? 39.892 28.157 57.849 1.00 44.31 ? 199 GLY B O   1 
ATOM   3359 N  N   . SER B 1 200 ? 38.672 27.954 59.729 1.00 42.06 ? 200 SER B N   1 
ATOM   3360 C  CA  . SER B 1 200 ? 37.439 27.683 59.002 1.00 42.10 ? 200 SER B CA  1 
ATOM   3361 C  C   . SER B 1 200 ? 37.012 28.926 58.201 1.00 42.58 ? 200 SER B C   1 
ATOM   3362 O  O   . SER B 1 200 ? 36.396 28.812 57.143 1.00 42.46 ? 200 SER B O   1 
ATOM   3363 C  CB  . SER B 1 200 ? 36.333 27.278 59.975 1.00 40.65 ? 200 SER B CB  1 
ATOM   3364 O  OG  . SER B 1 200 ? 36.065 28.321 60.888 1.00 39.42 ? 200 SER B OG  1 
ATOM   3365 N  N   . VAL B 1 201 ? 37.347 30.105 58.722 1.00 42.69 ? 201 VAL B N   1 
ATOM   3366 C  CA  . VAL B 1 201 ? 37.035 31.366 58.066 1.00 43.37 ? 201 VAL B CA  1 
ATOM   3367 C  C   . VAL B 1 201 ? 37.858 31.445 56.780 1.00 45.42 ? 201 VAL B C   1 
ATOM   3368 O  O   . VAL B 1 201 ? 37.332 31.766 55.705 1.00 45.27 ? 201 VAL B O   1 
ATOM   3369 C  CB  . VAL B 1 201 ? 37.386 32.559 58.984 1.00 43.01 ? 201 VAL B CB  1 
ATOM   3370 C  CG1 . VAL B 1 201 ? 37.255 33.878 58.223 1.00 42.86 ? 201 VAL B CG1 1 
ATOM   3371 C  CG2 . VAL B 1 201 ? 36.480 32.544 60.197 1.00 39.57 ? 201 VAL B CG2 1 
ATOM   3372 N  N   . ASP B 1 202 ? 39.149 31.143 56.906 1.00 45.35 ? 202 ASP B N   1 
ATOM   3373 C  CA  . ASP B 1 202 ? 40.087 31.140 55.782 1.00 44.91 ? 202 ASP B CA  1 
ATOM   3374 C  C   . ASP B 1 202 ? 39.495 30.263 54.676 1.00 44.00 ? 202 ASP B C   1 
ATOM   3375 O  O   . ASP B 1 202 ? 39.383 30.670 53.516 1.00 42.25 ? 202 ASP B O   1 
ATOM   3376 C  CB  . ASP B 1 202 ? 41.428 30.548 56.257 1.00 47.33 ? 202 ASP B CB  1 
ATOM   3377 C  CG  . ASP B 1 202 ? 42.554 30.678 55.227 1.00 47.38 ? 202 ASP B CG  1 
ATOM   3378 O  OD1 . ASP B 1 202 ? 42.341 30.407 54.030 1.00 47.84 ? 202 ASP B OD1 1 
ATOM   3379 O  OD2 . ASP B 1 202 ? 43.679 31.030 55.631 1.00 49.66 ? 202 ASP B OD2 1 
ATOM   3380 N  N   . TYR B 1 203 ? 39.116 29.050 55.060 1.00 44.02 ? 203 TYR B N   1 
ATOM   3381 C  CA  . TYR B 1 203 ? 38.542 28.086 54.133 1.00 45.62 ? 203 TYR B CA  1 
ATOM   3382 C  C   . TYR B 1 203 ? 37.278 28.671 53.487 1.00 45.80 ? 203 TYR B C   1 
ATOM   3383 O  O   . TYR B 1 203 ? 37.116 28.632 52.263 1.00 46.40 ? 203 TYR B O   1 
ATOM   3384 C  CB  . TYR B 1 203 ? 38.208 26.789 54.883 1.00 45.43 ? 203 TYR B CB  1 
ATOM   3385 C  CG  . TYR B 1 203 ? 37.584 25.714 54.019 1.00 50.40 ? 203 TYR B CG  1 
ATOM   3386 C  CD1 . TYR B 1 203 ? 38.320 25.084 53.004 1.00 51.98 ? 203 TYR B CD1 1 
ATOM   3387 C  CD2 . TYR B 1 203 ? 36.256 25.326 54.209 1.00 50.94 ? 203 TYR B CD2 1 
ATOM   3388 C  CE1 . TYR B 1 203 ? 37.744 24.088 52.196 1.00 52.12 ? 203 TYR B CE1 1 
ATOM   3389 C  CE2 . TYR B 1 203 ? 35.670 24.338 53.410 1.00 53.14 ? 203 TYR B CE2 1 
ATOM   3390 C  CZ  . TYR B 1 203 ? 36.419 23.725 52.405 1.00 54.15 ? 203 TYR B CZ  1 
ATOM   3391 O  OH  . TYR B 1 203 ? 35.833 22.762 51.608 1.00 55.75 ? 203 TYR B OH  1 
ATOM   3392 N  N   . TYR B 1 204 ? 36.387 29.208 54.321 1.00 44.95 ? 204 TYR B N   1 
ATOM   3393 C  CA  . TYR B 1 204 ? 35.145 29.813 53.851 1.00 43.66 ? 204 TYR B CA  1 
ATOM   3394 C  C   . TYR B 1 204 ? 35.404 30.837 52.752 1.00 42.62 ? 204 TYR B C   1 
ATOM   3395 O  O   . TYR B 1 204 ? 34.822 30.760 51.679 1.00 41.02 ? 204 TYR B O   1 
ATOM   3396 C  CB  . TYR B 1 204 ? 34.417 30.501 55.004 1.00 43.05 ? 204 TYR B CB  1 
ATOM   3397 C  CG  . TYR B 1 204 ? 33.211 31.298 54.552 1.00 41.77 ? 204 TYR B CG  1 
ATOM   3398 C  CD1 . TYR B 1 204 ? 32.024 30.661 54.195 1.00 41.07 ? 204 TYR B CD1 1 
ATOM   3399 C  CD2 . TYR B 1 204 ? 33.266 32.687 54.457 1.00 39.22 ? 204 TYR B CD2 1 
ATOM   3400 C  CE1 . TYR B 1 204 ? 30.919 31.390 53.755 1.00 38.80 ? 204 TYR B CE1 1 
ATOM   3401 C  CE2 . TYR B 1 204 ? 32.169 33.424 54.017 1.00 39.08 ? 204 TYR B CE2 1 
ATOM   3402 C  CZ  . TYR B 1 204 ? 30.999 32.772 53.667 1.00 38.50 ? 204 TYR B CZ  1 
ATOM   3403 O  OH  . TYR B 1 204 ? 29.919 33.504 53.221 1.00 34.06 ? 204 TYR B OH  1 
ATOM   3404 N  N   . ILE B 1 205 ? 36.278 31.795 53.028 1.00 43.80 ? 205 ILE B N   1 
ATOM   3405 C  CA  . ILE B 1 205 ? 36.601 32.824 52.051 1.00 45.66 ? 205 ILE B CA  1 
ATOM   3406 C  C   . ILE B 1 205 ? 37.240 32.252 50.789 1.00 48.99 ? 205 ILE B C   1 
ATOM   3407 O  O   . ILE B 1 205 ? 36.815 32.558 49.674 1.00 48.29 ? 205 ILE B O   1 
ATOM   3408 C  CB  . ILE B 1 205 ? 37.546 33.872 52.648 1.00 43.19 ? 205 ILE B CB  1 
ATOM   3409 C  CG1 . ILE B 1 205 ? 36.848 34.575 53.813 1.00 40.97 ? 205 ILE B CG1 1 
ATOM   3410 C  CG2 . ILE B 1 205 ? 37.971 34.862 51.568 1.00 41.02 ? 205 ILE B CG2 1 
ATOM   3411 C  CD1 . ILE B 1 205 ? 37.717 35.544 54.576 1.00 42.20 ? 205 ILE B CD1 1 
ATOM   3412 N  N   . ASN B 1 206 ? 38.238 31.392 50.961 1.00 52.62 ? 206 ASN B N   1 
ATOM   3413 C  CA  . ASN B 1 206 ? 38.923 30.826 49.807 1.00 56.17 ? 206 ASN B CA  1 
ATOM   3414 C  C   . ASN B 1 206 ? 38.301 29.605 49.140 1.00 58.23 ? 206 ASN B C   1 
ATOM   3415 O  O   . ASN B 1 206 ? 38.302 29.515 47.915 1.00 57.73 ? 206 ASN B O   1 
ATOM   3416 C  CB  . ASN B 1 206 ? 40.378 30.563 50.174 1.00 56.35 ? 206 ASN B CB  1 
ATOM   3417 C  CG  . ASN B 1 206 ? 41.100 31.841 50.532 1.00 58.13 ? 206 ASN B CG  1 
ATOM   3418 O  OD1 . ASN B 1 206 ? 41.329 32.692 49.676 1.00 61.45 ? 206 ASN B OD1 1 
ATOM   3419 N  ND2 . ASN B 1 206 ? 41.438 32.001 51.802 1.00 60.53 ? 206 ASN B ND2 1 
ATOM   3420 N  N   . GLU B 1 207 ? 37.747 28.673 49.900 1.00 60.74 ? 207 GLU B N   1 
ATOM   3421 C  CA  . GLU B 1 207 ? 37.181 27.506 49.240 1.00 65.32 ? 207 GLU B CA  1 
ATOM   3422 C  C   . GLU B 1 207 ? 35.669 27.531 49.067 1.00 66.37 ? 207 GLU B C   1 
ATOM   3423 O  O   . GLU B 1 207 ? 35.117 26.787 48.261 1.00 67.66 ? 207 GLU B O   1 
ATOM   3424 C  CB  . GLU B 1 207 ? 37.617 26.222 49.963 1.00 66.88 ? 207 GLU B CB  1 
ATOM   3425 C  CG  . GLU B 1 207 ? 38.796 25.493 49.302 1.00 70.89 ? 207 GLU B CG  1 
ATOM   3426 C  CD  . GLU B 1 207 ? 40.032 26.378 49.098 1.00 74.08 ? 207 GLU B CD  1 
ATOM   3427 O  OE1 . GLU B 1 207 ? 40.915 25.980 48.306 1.00 76.01 ? 207 GLU B OE1 1 
ATOM   3428 O  OE2 . GLU B 1 207 ? 40.129 27.461 49.723 1.00 75.23 ? 207 GLU B OE2 1 
ATOM   3429 N  N   . LEU B 1 208 ? 34.988 28.398 49.797 1.00 68.18 ? 208 LEU B N   1 
ATOM   3430 C  CA  . LEU B 1 208 ? 33.536 28.444 49.684 1.00 69.58 ? 208 LEU B CA  1 
ATOM   3431 C  C   . LEU B 1 208 ? 32.991 29.656 48.939 1.00 70.21 ? 208 LEU B C   1 
ATOM   3432 O  O   . LEU B 1 208 ? 31.816 29.672 48.565 1.00 70.64 ? 208 LEU B O   1 
ATOM   3433 C  CB  . LEU B 1 208 ? 32.899 28.343 51.076 1.00 69.95 ? 208 LEU B CB  1 
ATOM   3434 C  CG  . LEU B 1 208 ? 32.328 26.961 51.421 1.00 69.64 ? 208 LEU B CG  1 
ATOM   3435 C  CD1 . LEU B 1 208 ? 33.297 25.854 50.987 1.00 69.21 ? 208 LEU B CD1 1 
ATOM   3436 C  CD2 . LEU B 1 208 ? 32.030 26.886 52.914 1.00 69.52 ? 208 LEU B CD2 1 
ATOM   3437 N  N   . VAL B 1 209 ? 33.831 30.662 48.707 1.00 70.17 ? 209 VAL B N   1 
ATOM   3438 C  CA  . VAL B 1 209 ? 33.369 31.843 47.991 1.00 70.35 ? 209 VAL B CA  1 
ATOM   3439 C  C   . VAL B 1 209 ? 34.347 32.280 46.910 1.00 70.83 ? 209 VAL B C   1 
ATOM   3440 O  O   . VAL B 1 209 ? 34.094 32.078 45.726 1.00 71.02 ? 209 VAL B O   1 
ATOM   3441 C  CB  . VAL B 1 209 ? 33.110 33.035 48.950 1.00 69.72 ? 209 VAL B CB  1 
ATOM   3442 C  CG1 . VAL B 1 209 ? 32.434 34.164 48.199 1.00 68.94 ? 209 VAL B CG1 1 
ATOM   3443 C  CG2 . VAL B 1 209 ? 32.234 32.602 50.103 1.00 68.80 ? 209 VAL B CG2 1 
ATOM   3444 N  N   . HIS B 1 210 ? 35.467 32.866 47.319 1.00 71.79 ? 210 HIS B N   1 
ATOM   3445 C  CA  . HIS B 1 210 ? 36.479 33.361 46.385 1.00 72.39 ? 210 HIS B CA  1 
ATOM   3446 C  C   . HIS B 1 210 ? 37.571 32.337 46.076 1.00 72.34 ? 210 HIS B C   1 
ATOM   3447 O  O   . HIS B 1 210 ? 37.357 31.511 45.160 1.00 73.15 ? 210 HIS B O   1 
ATOM   3448 C  CB  . HIS B 1 210 ? 37.101 34.643 46.958 1.00 73.22 ? 210 HIS B CB  1 
ATOM   3449 C  CG  . HIS B 1 210 ? 36.107 35.745 47.179 1.00 74.36 ? 210 HIS B CG  1 
ATOM   3450 N  ND1 . HIS B 1 210 ? 35.676 36.575 46.165 1.00 73.35 ? 210 HIS B ND1 1 
ATOM   3451 C  CD2 . HIS B 1 210 ? 35.407 36.105 48.281 1.00 73.73 ? 210 HIS B CD2 1 
ATOM   3452 C  CE1 . HIS B 1 210 ? 34.753 37.396 46.631 1.00 72.83 ? 210 HIS B CE1 1 
ATOM   3453 N  NE2 . HIS B 1 210 ? 34.569 37.131 47.913 1.00 72.54 ? 210 HIS B NE2 1 
HETATM 3454 FE FE  . FE  C 2 .   ? 20.256 62.542 60.251 1.00 21.74 ? 500 FE  A FE  1 
HETATM 3455 S  S   . SO4 D 3 .   ? 17.834 71.204 43.213 1.00 67.62 ? 700 SO4 A S   1 
HETATM 3456 O  O1  . SO4 D 3 .   ? 18.571 72.196 42.402 1.00 68.50 ? 700 SO4 A O1  1 
HETATM 3457 O  O2  . SO4 D 3 .   ? 18.633 70.834 44.395 1.00 67.99 ? 700 SO4 A O2  1 
HETATM 3458 O  O3  . SO4 D 3 .   ? 16.548 71.789 43.642 1.00 68.41 ? 700 SO4 A O3  1 
HETATM 3459 O  O4  . SO4 D 3 .   ? 17.583 69.984 42.420 1.00 69.80 ? 700 SO4 A O4  1 
HETATM 3460 FE FE  . FE  E 2 .   ? 25.525 46.512 53.731 1.00 22.90 ? 500 FE  B FE  1 
HETATM 3461 O  O   . HOH F 4 .   ? 21.811 61.807 61.262 1.00 24.14 ? 600 HOH A O   1 
HETATM 3462 O  O   . HOH F 4 .   ? 21.474 52.702 38.501 1.00 42.07 ? 628 HOH A O   1 
HETATM 3463 O  O   . HOH F 4 .   ? 28.509 54.558 61.644 1.00 18.70 ? 702 HOH A O   1 
HETATM 3464 O  O   . HOH F 4 .   ? 21.089 49.163 49.618 1.00 13.57 ? 703 HOH A O   1 
HETATM 3465 O  O   . HOH F 4 .   ? 24.379 53.244 57.406 1.00 19.19 ? 704 HOH A O   1 
HETATM 3466 O  O   . HOH F 4 .   ? 31.810 65.173 69.643 1.00 26.39 ? 705 HOH A O   1 
HETATM 3467 O  O   . HOH F 4 .   ? 11.009 69.595 48.762 1.00 20.19 ? 706 HOH A O   1 
HETATM 3468 O  O   . HOH F 4 .   ? 15.223 59.920 56.753 1.00 23.33 ? 707 HOH A O   1 
HETATM 3469 O  O   . HOH F 4 .   ? 7.769  72.922 57.273 1.00 27.76 ? 708 HOH A O   1 
HETATM 3470 O  O   . HOH F 4 .   ? 10.919 72.752 45.681 1.00 22.70 ? 709 HOH A O   1 
HETATM 3471 O  O   . HOH F 4 .   ? 18.459 65.096 54.734 1.00 20.39 ? 710 HOH A O   1 
HETATM 3472 O  O   . HOH F 4 .   ? 14.693 70.133 67.848 1.00 18.93 ? 711 HOH A O   1 
HETATM 3473 O  O   . HOH F 4 .   ? 30.376 54.761 54.080 1.00 26.98 ? 712 HOH A O   1 
HETATM 3474 O  O   . HOH F 4 .   ? 9.457  60.980 48.058 1.00 44.75 ? 713 HOH A O   1 
HETATM 3475 O  O   . HOH F 4 .   ? 34.129 61.388 65.481 1.00 29.37 ? 714 HOH A O   1 
HETATM 3476 O  O   . HOH F 4 .   ? 18.570 83.859 48.158 1.00 30.82 ? 715 HOH A O   1 
HETATM 3477 O  O   . HOH F 4 .   ? 7.887  63.532 48.571 1.00 25.45 ? 716 HOH A O   1 
HETATM 3478 O  O   . HOH F 4 .   ? 16.534 61.527 50.684 1.00 26.74 ? 717 HOH A O   1 
HETATM 3479 O  O   . HOH F 4 .   ? 7.973  66.553 60.046 1.00 24.78 ? 718 HOH A O   1 
HETATM 3480 O  O   . HOH F 4 .   ? 16.425 60.164 52.675 1.00 24.12 ? 719 HOH A O   1 
HETATM 3481 O  O   . HOH F 4 .   ? 7.548  64.552 64.565 1.00 42.44 ? 720 HOH A O   1 
HETATM 3482 O  O   . HOH F 4 .   ? 14.370 74.620 44.938 1.00 45.44 ? 721 HOH A O   1 
HETATM 3483 O  O   . HOH F 4 .   ? 35.878 89.568 50.695 1.00 56.97 ? 722 HOH A O   1 
HETATM 3484 O  O   . HOH F 4 .   ? 26.609 56.685 55.638 1.00 20.49 ? 723 HOH A O   1 
HETATM 3485 O  O   . HOH F 4 .   ? 20.340 56.684 65.484 1.00 34.21 ? 724 HOH A O   1 
HETATM 3486 O  O   . HOH F 4 .   ? 38.393 65.203 59.780 1.00 33.31 ? 725 HOH A O   1 
HETATM 3487 O  O   . HOH F 4 .   ? 14.444 54.408 50.118 1.00 32.55 ? 726 HOH A O   1 
HETATM 3488 O  O   . HOH F 4 .   ? 27.514 55.361 53.686 1.00 20.29 ? 727 HOH A O   1 
HETATM 3489 O  O   . HOH F 4 .   ? 24.179 86.715 58.031 1.00 27.70 ? 728 HOH A O   1 
HETATM 3490 O  O   . HOH F 4 .   ? 13.103 72.065 73.071 1.00 31.14 ? 729 HOH A O   1 
HETATM 3491 O  O   . HOH F 4 .   ? 37.014 82.731 45.965 1.00 43.88 ? 730 HOH A O   1 
HETATM 3492 O  O   . HOH F 4 .   ? 6.672  62.085 59.628 1.00 33.30 ? 731 HOH A O   1 
HETATM 3493 O  O   . HOH F 4 .   ? 22.619 54.542 42.192 1.00 30.78 ? 732 HOH A O   1 
HETATM 3494 O  O   . HOH F 4 .   ? 15.763 56.690 44.694 1.00 61.52 ? 733 HOH A O   1 
HETATM 3495 O  O   . HOH F 4 .   ? 34.858 67.726 45.771 1.00 47.61 ? 734 HOH A O   1 
HETATM 3496 O  O   . HOH F 4 .   ? 26.081 77.432 47.611 1.00 31.91 ? 735 HOH A O   1 
HETATM 3497 O  O   . HOH F 4 .   ? 25.428 55.195 51.113 1.00 22.81 ? 736 HOH A O   1 
HETATM 3498 O  O   . HOH F 4 .   ? 39.809 84.623 62.662 1.00 49.54 ? 737 HOH A O   1 
HETATM 3499 O  O   . HOH F 4 .   ? 38.978 67.473 51.939 1.00 34.42 ? 738 HOH A O   1 
HETATM 3500 O  O   . HOH F 4 .   ? 7.122  60.480 64.576 1.00 40.08 ? 739 HOH A O   1 
HETATM 3501 O  O   . HOH F 4 .   ? 5.425  72.346 55.314 1.00 34.31 ? 740 HOH A O   1 
HETATM 3502 O  O   . HOH F 4 .   ? 31.528 56.549 60.992 1.00 31.84 ? 741 HOH A O   1 
HETATM 3503 O  O   . HOH F 4 .   ? 31.807 63.560 45.899 1.00 27.08 ? 742 HOH A O   1 
HETATM 3504 O  O   . HOH F 4 .   ? 12.482 76.869 63.521 1.00 27.16 ? 743 HOH A O   1 
HETATM 3505 O  O   . HOH F 4 .   ? 16.430 58.849 65.098 1.00 36.65 ? 744 HOH A O   1 
HETATM 3506 O  O   . HOH F 4 .   ? 40.092 68.976 54.240 1.00 45.99 ? 745 HOH A O   1 
HETATM 3507 O  O   . HOH F 4 .   ? 42.627 74.789 49.771 1.00 48.29 ? 746 HOH A O   1 
HETATM 3508 O  O   . HOH F 4 .   ? 42.898 74.602 53.548 1.00 33.36 ? 747 HOH A O   1 
HETATM 3509 O  O   . HOH F 4 .   ? 31.637 56.657 52.507 1.00 29.90 ? 748 HOH A O   1 
HETATM 3510 O  O   . HOH F 4 .   ? 21.249 72.500 44.147 1.00 30.43 ? 749 HOH A O   1 
HETATM 3511 O  O   . HOH F 4 .   ? 34.308 65.513 68.232 1.00 37.16 ? 750 HOH A O   1 
HETATM 3512 O  O   . HOH F 4 .   ? 11.640 73.796 74.048 1.00 52.16 ? 751 HOH A O   1 
HETATM 3513 O  O   . HOH F 4 .   ? 12.570 55.287 47.996 1.00 38.01 ? 752 HOH A O   1 
HETATM 3514 O  O   . HOH F 4 .   ? 5.628  60.449 54.965 1.00 38.48 ? 753 HOH A O   1 
HETATM 3515 O  O   . HOH F 4 .   ? 8.668  67.164 70.416 1.00 36.29 ? 754 HOH A O   1 
HETATM 3516 O  O   . HOH F 4 .   ? 32.134 77.743 48.050 1.00 41.73 ? 755 HOH A O   1 
HETATM 3517 O  O   . HOH F 4 .   ? 6.611  66.073 62.297 1.00 37.52 ? 756 HOH A O   1 
HETATM 3518 O  O   . HOH F 4 .   ? 36.073 67.985 65.867 1.00 51.53 ? 757 HOH A O   1 
HETATM 3519 O  O   . HOH F 4 .   ? 35.387 63.702 66.509 1.00 33.46 ? 758 HOH A O   1 
HETATM 3520 O  O   . HOH F 4 .   ? 28.001 80.797 66.111 1.00 40.52 ? 759 HOH A O   1 
HETATM 3521 O  O   . HOH F 4 .   ? 39.863 82.412 59.714 1.00 51.27 ? 760 HOH A O   1 
HETATM 3522 O  O   . HOH F 4 .   ? 8.950  66.757 72.982 1.00 42.47 ? 761 HOH A O   1 
HETATM 3523 O  O   . HOH F 4 .   ? 6.789  61.684 68.926 1.00 39.68 ? 762 HOH A O   1 
HETATM 3524 O  O   . HOH F 4 .   ? 30.281 58.749 49.245 1.00 37.79 ? 763 HOH A O   1 
HETATM 3525 O  O   . HOH F 4 .   ? 27.664 77.802 65.617 1.00 42.53 ? 764 HOH A O   1 
HETATM 3526 O  O   . HOH F 4 .   ? 25.359 76.505 66.731 1.00 35.60 ? 765 HOH A O   1 
HETATM 3527 O  O   . HOH F 4 .   ? 30.053 65.146 44.527 1.00 41.89 ? 766 HOH A O   1 
HETATM 3528 O  O   . HOH F 4 .   ? 25.997 61.173 80.654 1.00 37.37 ? 767 HOH A O   1 
HETATM 3529 O  O   . HOH F 4 .   ? 4.634  64.064 52.464 1.00 41.96 ? 768 HOH A O   1 
HETATM 3530 O  O   . HOH F 4 .   ? 19.760 61.296 42.990 1.00 45.37 ? 769 HOH A O   1 
HETATM 3531 O  O   . HOH F 4 .   ? 26.067 52.229 41.972 1.00 55.43 ? 770 HOH A O   1 
HETATM 3532 O  O   . HOH F 4 .   ? 27.933 59.101 68.689 1.00 31.92 ? 771 HOH A O   1 
HETATM 3533 O  O   . HOH F 4 .   ? 10.545 69.479 46.486 1.00 33.02 ? 772 HOH A O   1 
HETATM 3534 O  O   . HOH F 4 .   ? 13.966 78.922 55.171 1.00 41.15 ? 773 HOH A O   1 
HETATM 3535 O  O   . HOH F 4 .   ? 36.565 59.896 59.123 1.00 33.39 ? 774 HOH A O   1 
HETATM 3536 O  O   . HOH F 4 .   ? 29.146 91.485 53.857 1.00 47.51 ? 775 HOH A O   1 
HETATM 3537 O  O   . HOH F 4 .   ? 36.508 65.381 64.687 1.00 42.90 ? 776 HOH A O   1 
HETATM 3538 O  O   . HOH F 4 .   ? 23.874 87.119 53.899 1.00 54.91 ? 777 HOH A O   1 
HETATM 3539 O  O   . HOH F 4 .   ? 32.387 69.243 75.836 1.00 36.20 ? 778 HOH A O   1 
HETATM 3540 O  O   . HOH F 4 .   ? 29.540 56.583 50.566 1.00 41.19 ? 779 HOH A O   1 
HETATM 3541 O  O   . HOH F 4 .   ? 31.159 57.784 46.820 1.00 47.46 ? 780 HOH A O   1 
HETATM 3542 O  O   . HOH F 4 .   ? 30.556 67.953 43.739 1.00 49.89 ? 781 HOH A O   1 
HETATM 3543 O  O   . HOH F 4 .   ? 20.647 57.685 43.054 1.00 44.04 ? 782 HOH A O   1 
HETATM 3544 O  O   . HOH F 4 .   ? 4.347  66.809 54.195 1.00 57.98 ? 783 HOH A O   1 
HETATM 3545 O  O   . HOH F 4 .   ? 31.310 77.619 45.270 1.00 41.29 ? 784 HOH A O   1 
HETATM 3546 O  O   . HOH F 4 .   ? 19.727 54.796 41.338 1.00 41.99 ? 785 HOH A O   1 
HETATM 3547 O  O   . HOH F 4 .   ? 38.570 66.015 56.235 1.00 42.90 ? 786 HOH A O   1 
HETATM 3548 O  O   . HOH F 4 .   ? 18.440 56.846 63.222 1.00 41.77 ? 787 HOH A O   1 
HETATM 3549 O  O   . HOH F 4 .   ? 17.559 57.723 43.337 1.00 47.19 ? 788 HOH A O   1 
HETATM 3550 O  O   . HOH F 4 .   ? 18.157 74.909 43.939 1.00 42.66 ? 789 HOH A O   1 
HETATM 3551 O  O   . HOH F 4 .   ? 34.913 64.787 45.911 1.00 46.48 ? 790 HOH A O   1 
HETATM 3552 O  O   . HOH F 4 .   ? 32.042 71.755 74.590 1.00 48.69 ? 791 HOH A O   1 
HETATM 3553 O  O   . HOH F 4 .   ? 12.326 61.068 45.533 1.00 49.11 ? 792 HOH A O   1 
HETATM 3554 O  O   . HOH F 4 .   ? 16.849 54.890 41.949 1.00 52.60 ? 793 HOH A O   1 
HETATM 3555 O  O   . HOH F 4 .   ? 41.574 75.659 57.262 1.00 53.35 ? 794 HOH A O   1 
HETATM 3556 O  O   . HOH F 4 .   ? 36.265 58.033 57.349 1.00 49.39 ? 795 HOH A O   1 
HETATM 3557 O  O   . HOH F 4 .   ? 33.814 55.903 50.816 1.00 42.52 ? 796 HOH A O   1 
HETATM 3558 O  O   . HOH F 4 .   ? 35.657 56.247 52.647 1.00 49.51 ? 797 HOH A O   1 
HETATM 3559 O  O   . HOH F 4 .   ? 17.696 86.847 72.008 1.00 45.69 ? 798 HOH A O   1 
HETATM 3560 O  O   . HOH G 4 .   ? 26.811 47.203 55.155 1.00 20.23 ? 600 HOH B O   1 
HETATM 3561 O  O   . HOH G 4 .   ? 17.270 48.600 51.771 1.00 12.78 ? 601 HOH B O   1 
HETATM 3562 O  O   . HOH G 4 .   ? 37.781 44.221 62.657 1.00 32.43 ? 602 HOH B O   1 
HETATM 3563 O  O   . HOH G 4 .   ? 26.838 44.746 40.148 1.00 21.06 ? 603 HOH B O   1 
HETATM 3564 O  O   . HOH G 4 .   ? 15.243 47.301 52.522 1.00 19.91 ? 604 HOH B O   1 
HETATM 3565 O  O   . HOH G 4 .   ? 22.688 52.283 60.923 1.00 20.70 ? 605 HOH B O   1 
HETATM 3566 O  O   . HOH G 4 .   ? 11.100 45.179 43.956 1.00 27.28 ? 606 HOH B O   1 
HETATM 3567 O  O   . HOH G 4 .   ? 12.567 38.781 47.951 1.00 24.92 ? 607 HOH B O   1 
HETATM 3568 O  O   . HOH G 4 .   ? 32.680 41.893 40.353 1.00 20.65 ? 608 HOH B O   1 
HETATM 3569 O  O   . HOH G 4 .   ? 17.653 53.917 60.852 1.00 23.69 ? 609 HOH B O   1 
HETATM 3570 O  O   . HOH G 4 .   ? 21.175 34.666 77.602 1.00 30.95 ? 610 HOH B O   1 
HETATM 3571 O  O   . HOH G 4 .   ? 23.693 56.015 58.297 1.00 21.01 ? 611 HOH B O   1 
HETATM 3572 O  O   . HOH G 4 .   ? 38.735 33.644 69.926 1.00 32.18 ? 612 HOH B O   1 
HETATM 3573 O  O   . HOH G 4 .   ? 10.979 36.270 58.211 1.00 38.00 ? 613 HOH B O   1 
HETATM 3574 O  O   . HOH G 4 .   ? 27.250 37.234 74.086 1.00 35.52 ? 614 HOH B O   1 
HETATM 3575 O  O   . HOH G 4 .   ? 11.515 41.397 67.181 1.00 44.25 ? 615 HOH B O   1 
HETATM 3576 O  O   . HOH G 4 .   ? 9.971  28.369 55.833 1.00 39.64 ? 616 HOH B O   1 
HETATM 3577 O  O   . HOH G 4 .   ? 9.593  51.956 52.490 1.00 35.75 ? 617 HOH B O   1 
HETATM 3578 O  O   . HOH G 4 .   ? 31.138 37.943 39.320 1.00 36.97 ? 618 HOH B O   1 
HETATM 3579 O  O   . HOH G 4 .   ? 16.393 31.424 68.377 1.00 26.08 ? 619 HOH B O   1 
HETATM 3580 O  O   . HOH G 4 .   ? 29.372 44.082 71.649 1.00 28.78 ? 620 HOH B O   1 
HETATM 3581 O  O   . HOH G 4 .   ? 4.632  40.847 57.024 1.00 31.56 ? 621 HOH B O   1 
HETATM 3582 O  O   . HOH G 4 .   ? 13.905 45.386 68.313 1.00 33.06 ? 622 HOH B O   1 
HETATM 3583 O  O   . HOH G 4 .   ? 11.847 32.968 43.938 1.00 53.87 ? 623 HOH B O   1 
HETATM 3584 O  O   . HOH G 4 .   ? 40.542 35.196 48.747 1.00 38.41 ? 624 HOH B O   1 
HETATM 3585 O  O   . HOH G 4 .   ? 35.374 50.335 59.515 1.00 31.48 ? 625 HOH B O   1 
HETATM 3586 O  O   . HOH G 4 .   ? 30.412 52.399 52.505 1.00 28.15 ? 626 HOH B O   1 
HETATM 3587 O  O   . HOH G 4 .   ? 31.560 38.708 46.791 1.00 31.90 ? 627 HOH B O   1 
HETATM 3588 O  O   . HOH G 4 .   ? 22.969 42.460 41.896 1.00 27.22 ? 629 HOH B O   1 
HETATM 3589 O  O   . HOH G 4 .   ? 26.665 31.854 45.662 1.00 34.02 ? 630 HOH B O   1 
HETATM 3590 O  O   . HOH G 4 .   ? 29.479 50.499 49.102 1.00 28.96 ? 631 HOH B O   1 
HETATM 3591 O  O   . HOH G 4 .   ? 21.517 30.722 51.823 1.00 30.61 ? 632 HOH B O   1 
HETATM 3592 O  O   . HOH G 4 .   ? 18.023 22.170 57.283 1.00 44.90 ? 633 HOH B O   1 
HETATM 3593 O  O   . HOH G 4 .   ? 27.195 48.843 40.771 1.00 29.53 ? 634 HOH B O   1 
HETATM 3594 O  O   . HOH G 4 .   ? 7.416  37.329 57.565 1.00 34.91 ? 635 HOH B O   1 
HETATM 3595 O  O   . HOH G 4 .   ? 26.250 51.078 70.193 1.00 28.25 ? 636 HOH B O   1 
HETATM 3596 O  O   . HOH G 4 .   ? 21.720 46.563 40.811 1.00 46.44 ? 637 HOH B O   1 
HETATM 3597 O  O   . HOH G 4 .   ? 20.235 35.571 42.878 1.00 38.09 ? 638 HOH B O   1 
HETATM 3598 O  O   . HOH G 4 .   ? 23.144 37.657 75.696 1.00 37.64 ? 639 HOH B O   1 
HETATM 3599 O  O   . HOH G 4 .   ? 8.458  53.765 59.926 1.00 37.00 ? 640 HOH B O   1 
HETATM 3600 O  O   . HOH G 4 .   ? 28.021 34.380 75.337 1.00 38.86 ? 641 HOH B O   1 
HETATM 3601 O  O   . HOH G 4 .   ? 33.123 35.178 44.221 1.00 37.56 ? 642 HOH B O   1 
HETATM 3602 O  O   . HOH G 4 .   ? 14.662 31.677 62.454 1.00 31.73 ? 643 HOH B O   1 
HETATM 3603 O  O   . HOH G 4 .   ? 8.621  47.856 56.572 1.00 36.52 ? 644 HOH B O   1 
HETATM 3604 O  O   . HOH G 4 .   ? 28.855 52.687 64.422 1.00 34.81 ? 645 HOH B O   1 
HETATM 3605 O  O   . HOH G 4 .   ? 34.002 51.998 42.416 1.00 46.30 ? 646 HOH B O   1 
HETATM 3606 O  O   . HOH G 4 .   ? 25.357 43.419 72.634 1.00 35.12 ? 647 HOH B O   1 
HETATM 3607 O  O   . HOH G 4 .   ? 18.807 48.011 49.391 1.00 28.39 ? 648 HOH B O   1 
HETATM 3608 O  O   . HOH G 4 .   ? 10.925 30.854 59.883 1.00 55.29 ? 649 HOH B O   1 
HETATM 3609 O  O   . HOH G 4 .   ? 13.261 31.912 41.151 1.00 43.75 ? 650 HOH B O   1 
HETATM 3610 O  O   . HOH G 4 .   ? 29.094 29.728 51.277 1.00 37.31 ? 651 HOH B O   1 
HETATM 3611 O  O   . HOH G 4 .   ? 8.356  46.954 52.840 1.00 38.52 ? 652 HOH B O   1 
HETATM 3612 O  O   . HOH G 4 .   ? 33.256 28.587 60.666 1.00 35.06 ? 653 HOH B O   1 
HETATM 3613 O  O   . HOH G 4 .   ? 24.022 30.035 51.405 1.00 37.57 ? 654 HOH B O   1 
HETATM 3614 O  O   . HOH G 4 .   ? 19.872 44.048 53.353 1.00 25.97 ? 655 HOH B O   1 
HETATM 3615 O  O   . HOH G 4 .   ? 36.992 24.967 70.816 1.00 34.07 ? 656 HOH B O   1 
HETATM 3616 O  O   . HOH G 4 .   ? 20.708 53.896 62.303 1.00 18.94 ? 657 HOH B O   1 
HETATM 3617 O  O   . HOH G 4 .   ? 15.087 30.326 59.479 1.00 33.75 ? 658 HOH B O   1 
HETATM 3618 O  O   . HOH G 4 .   ? 24.909 42.642 40.246 1.00 27.18 ? 659 HOH B O   1 
HETATM 3619 O  O   . HOH G 4 .   ? 9.820  32.806 51.697 1.00 37.68 ? 660 HOH B O   1 
HETATM 3620 O  O   . HOH G 4 .   ? 35.944 53.127 60.223 1.00 38.55 ? 661 HOH B O   1 
HETATM 3621 O  O   . HOH G 4 .   ? 16.080 31.129 45.761 1.00 42.72 ? 662 HOH B O   1 
HETATM 3622 O  O   . HOH G 4 .   ? 21.676 54.349 64.828 1.00 25.09 ? 663 HOH B O   1 
HETATM 3623 O  O   . HOH G 4 .   ? 13.549 31.141 56.305 1.00 45.39 ? 664 HOH B O   1 
HETATM 3624 O  O   . HOH G 4 .   ? 21.325 44.192 39.627 1.00 44.50 ? 665 HOH B O   1 
HETATM 3625 O  O   . HOH G 4 .   ? 24.021 17.524 64.936 1.00 42.28 ? 666 HOH B O   1 
HETATM 3626 O  O   . HOH G 4 .   ? 32.683 31.398 59.994 1.00 34.57 ? 667 HOH B O   1 
HETATM 3627 O  O   . HOH G 4 .   ? 37.609 53.834 53.994 1.00 33.21 ? 668 HOH B O   1 
HETATM 3628 O  O   . HOH G 4 .   ? 33.859 47.714 66.072 1.00 31.63 ? 669 HOH B O   1 
HETATM 3629 O  O   . HOH G 4 .   ? 8.590  44.415 53.287 1.00 31.53 ? 670 HOH B O   1 
HETATM 3630 O  O   . HOH G 4 .   ? 26.044 41.260 73.841 1.00 34.51 ? 671 HOH B O   1 
HETATM 3631 O  O   . HOH G 4 .   ? 16.817 28.895 56.872 1.00 54.32 ? 672 HOH B O   1 
HETATM 3632 O  O   . HOH G 4 .   ? 33.310 27.888 57.960 1.00 31.41 ? 673 HOH B O   1 
HETATM 3633 O  O   . HOH G 4 .   ? 31.630 52.331 49.795 1.00 41.03 ? 674 HOH B O   1 
HETATM 3634 O  O   . HOH G 4 .   ? 45.008 50.990 53.326 1.00 42.28 ? 675 HOH B O   1 
HETATM 3635 O  O   . HOH G 4 .   ? 28.267 37.264 40.092 1.00 43.14 ? 676 HOH B O   1 
HETATM 3636 O  O   . HOH G 4 .   ? 17.192 29.334 66.881 1.00 31.55 ? 677 HOH B O   1 
HETATM 3637 O  O   . HOH G 4 .   ? 30.276 27.012 56.979 1.00 51.37 ? 678 HOH B O   1 
HETATM 3638 O  O   . HOH G 4 .   ? 22.940 37.225 42.482 1.00 45.75 ? 679 HOH B O   1 
HETATM 3639 O  O   . HOH G 4 .   ? 39.758 50.817 58.791 1.00 39.15 ? 680 HOH B O   1 
HETATM 3640 O  O   . HOH G 4 .   ? 15.401 26.620 73.860 1.00 44.33 ? 681 HOH B O   1 
HETATM 3641 O  O   . HOH G 4 .   ? 21.680 41.972 73.854 1.00 38.15 ? 682 HOH B O   1 
HETATM 3642 O  O   . HOH G 4 .   ? 16.953 50.615 65.955 1.00 34.44 ? 683 HOH B O   1 
HETATM 3643 O  O   . HOH G 4 .   ? 36.669 36.681 43.631 1.00 34.98 ? 684 HOH B O   1 
HETATM 3644 O  O   . HOH G 4 .   ? 8.849  51.800 57.718 1.00 32.96 ? 685 HOH B O   1 
HETATM 3645 O  O   . HOH G 4 .   ? 30.785 34.832 76.705 1.00 54.57 ? 686 HOH B O   1 
HETATM 3646 O  O   . HOH G 4 .   ? 14.739 41.708 71.475 1.00 33.04 ? 687 HOH B O   1 
HETATM 3647 O  O   . HOH G 4 .   ? 8.408  51.969 54.956 1.00 32.26 ? 688 HOH B O   1 
HETATM 3648 O  O   . HOH G 4 .   ? 35.800 22.679 56.046 1.00 53.37 ? 689 HOH B O   1 
HETATM 3649 O  O   . HOH G 4 .   ? 36.873 24.154 57.821 1.00 40.27 ? 690 HOH B O   1 
HETATM 3650 O  O   . HOH G 4 .   ? 35.856 21.369 59.185 1.00 44.88 ? 691 HOH B O   1 
HETATM 3651 O  O   . HOH G 4 .   ? 33.653 32.756 57.901 1.00 33.48 ? 692 HOH B O   1 
HETATM 3652 O  O   . HOH G 4 .   ? 24.094 39.391 74.150 1.00 54.36 ? 693 HOH B O   1 
HETATM 3653 O  O   . HOH G 4 .   ? 10.160 43.647 51.361 1.00 46.84 ? 694 HOH B O   1 
HETATM 3654 O  O   . HOH G 4 .   ? 35.731 45.777 66.423 1.00 46.03 ? 695 HOH B O   1 
HETATM 3655 O  O   . HOH G 4 .   ? 8.896  46.803 50.100 1.00 37.14 ? 696 HOH B O   1 
HETATM 3656 O  O   . HOH G 4 .   ? 37.625 54.651 58.979 1.00 44.08 ? 697 HOH B O   1 
HETATM 3657 O  O   . HOH G 4 .   ? 17.751 53.026 64.944 1.00 35.69 ? 698 HOH B O   1 
HETATM 3658 O  O   . HOH G 4 .   ? 17.029 29.012 47.264 1.00 44.88 ? 699 HOH B O   1 
HETATM 3659 O  O   . HOH G 4 .   ? 7.314  49.739 58.574 1.00 58.24 ? 700 HOH B O   1 
HETATM 3660 O  O   . HOH G 4 .   ? 34.239 52.117 50.225 1.00 43.52 ? 701 HOH B O   1 
HETATM 3661 O  O   . HOH G 4 .   ? 20.118 28.775 50.320 1.00 49.30 ? 702 HOH B O   1 
HETATM 3662 O  O   . HOH G 4 .   ? 13.369 30.876 45.160 1.00 47.33 ? 703 HOH B O   1 
HETATM 3663 O  O   . HOH G 4 .   ? 14.722 44.817 71.417 1.00 46.85 ? 704 HOH B O   1 
HETATM 3664 O  O   . HOH G 4 .   ? 29.803 41.148 72.923 1.00 60.87 ? 705 HOH B O   1 
HETATM 3665 O  O   . HOH G 4 .   ? 20.480 52.532 66.580 1.00 40.07 ? 706 HOH B O   1 
HETATM 3666 O  O   . HOH G 4 .   ? 32.348 24.732 72.271 1.00 48.78 ? 707 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   PHE 2   2   2   PHE PHE A . n 
A 1 3   THR 3   3   3   THR THR A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   ARG 5   5   5   ARG ARG A . n 
A 1 6   GLU 6   6   6   GLU GLU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   PRO 8   8   8   PRO PRO A . n 
A 1 9   PHE 9   9   9   PHE PHE A . n 
A 1 10  ALA 10  10  10  ALA ALA A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  ASP 12  12  12  ASP ASP A . n 
A 1 13  SER 13  13  13  SER SER A . n 
A 1 14  MET 14  14  14  MET MET A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  ASP 16  16  16  ASP ASP A . n 
A 1 17  PHE 17  17  17  PHE PHE A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  SER 19  19  19  SER SER A . n 
A 1 20  PRO 20  20  20  PRO PRO A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  ALA 22  22  22  ALA ALA A . n 
A 1 23  PHE 23  23  23  PHE PHE A . n 
A 1 24  ASP 24  24  24  ASP ASP A . n 
A 1 25  PHE 25  25  25  PHE PHE A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  HIS 27  27  27  HIS HIS A . n 
A 1 28  GLY 28  28  28  GLY GLY A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  HIS 30  30  30  HIS HIS A . n 
A 1 31  HIS 31  31  31  HIS HIS A . n 
A 1 32  GLN 32  32  32  GLN GLN A . n 
A 1 33  THR 33  33  33  THR THR A . n 
A 1 34  TYR 34  34  34  TYR TYR A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  ASN 36  36  36  ASN ASN A . n 
A 1 37  ASN 37  37  37  ASN ASN A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  ASN 39  39  39  ASN ASN A . n 
A 1 40  ASN 40  40  40  ASN ASN A . n 
A 1 41  LEU 41  41  41  LEU LEU A . n 
A 1 42  ILE 42  42  42  ILE ILE A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  GLY 44  44  44  GLY GLY A . n 
A 1 45  THR 45  45  45  THR THR A . n 
A 1 46  ASP 46  46  46  ASP ASP A . n 
A 1 47  PHE 47  47  47  PHE PHE A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  SER 50  50  50  SER SER A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  PHE 53  53  53  PHE PHE A . n 
A 1 54  ALA 54  54  54  ALA ALA A . n 
A 1 55  ILE 55  55  55  ILE ILE A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  THR 57  57  57  THR THR A . n 
A 1 58  LYS 58  58  58  LYS LYS A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  SER 60  60  60  SER SER A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  GLY 62  62  62  GLY GLY A . n 
A 1 63  VAL 63  63  63  VAL VAL A . n 
A 1 64  PHE 64  64  64  PHE PHE A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  ALA 68  68  68  ALA ALA A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  ILE 70  70  70  ILE ILE A . n 
A 1 71  TYR 71  71  71  TYR TYR A . n 
A 1 72  ASN 72  72  72  ASN ASN A . n 
A 1 73  HIS 73  73  73  HIS HIS A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  TYR 76  76  76  TYR TYR A . n 
A 1 77  TRP 77  77  77  TRP TRP A . n 
A 1 78  ASP 78  78  78  ASP ASP A . n 
A 1 79  CYS 79  79  79  CYS CYS A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  PRO 82  82  82  PRO PRO A . n 
A 1 83  LYS 83  83  83  LYS LYS A . n 
A 1 84  ALA 84  84  84  ALA ALA A . n 
A 1 85  THR 85  85  85  THR THR A . n 
A 1 86  ALA 86  86  86  ALA ALA A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  SER 88  88  88  SER SER A . n 
A 1 89  ASP 89  89  89  ASP ASP A . n 
A 1 90  GLU 90  90  90  GLU GLU A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  LYS 92  92  92  LYS LYS A . n 
A 1 93  GLY 93  93  93  GLY GLY A . n 
A 1 94  ALA 94  94  94  ALA ALA A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  GLU 96  96  96  GLU GLU A . n 
A 1 97  LYS 97  97  97  LYS LYS A . n 
A 1 98  ASP 98  98  98  ASP ASP A . n 
A 1 99  PHE 99  99  99  PHE PHE A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 SER 101 101 101 SER SER A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 GLU 103 103 103 GLU GLU A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 PHE 105 105 105 PHE PHE A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 GLU 107 107 107 GLU GLU A . n 
A 1 108 ASP 108 108 108 ASP ASP A . n 
A 1 109 PHE 109 109 109 PHE PHE A . n 
A 1 110 ILE 110 110 110 ILE ILE A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 SER 112 112 112 SER SER A . n 
A 1 113 ALA 113 113 113 ALA ALA A . n 
A 1 114 THR 114 114 114 THR THR A . n 
A 1 115 THR 115 115 115 THR THR A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 PHE 117 117 117 PHE PHE A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 SER 119 119 119 SER SER A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 TRP 121 121 121 TRP TRP A . n 
A 1 122 ASN 122 122 122 ASN ASN A . n 
A 1 123 TRP 123 123 123 TRP TRP A . n 
A 1 124 ALA 124 124 124 ALA ALA A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 TYR 126 126 126 TYR TYR A . n 
A 1 127 ASN 127 127 127 ASN ASN A . n 
A 1 128 LEU 128 128 128 LEU LEU A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 THR 130 130 130 THR THR A . n 
A 1 131 GLN 131 131 131 GLN GLN A . n 
A 1 132 LYS 132 132 132 LYS LYS A . n 
A 1 133 ILE 133 133 133 ILE ILE A . n 
A 1 134 GLU 134 134 134 GLU GLU A . n 
A 1 135 ILE 135 135 135 ILE ILE A . n 
A 1 136 ILE 136 136 136 ILE ILE A . n 
A 1 137 GLN 137 137 137 GLN GLN A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 SER 139 139 139 SER SER A . n 
A 1 140 ASN 140 140 140 ASN ASN A . n 
A 1 141 ALA 141 141 141 ALA ALA A . n 
A 1 142 GLN 142 142 142 GLN GLN A . n 
A 1 143 THR 143 143 143 THR THR A . n 
A 1 144 PRO 144 144 144 PRO PRO A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 THR 146 146 146 THR THR A . n 
A 1 147 ASP 147 147 147 ASP ASP A . n 
A 1 148 LYS 148 148 148 LYS LYS A . n 
A 1 149 LYS 149 149 149 LYS LYS A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 PRO 151 151 151 PRO PRO A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 VAL 154 154 154 VAL VAL A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 ASP 156 156 156 ASP ASP A . n 
A 1 157 VAL 157 157 157 VAL VAL A . n 
A 1 158 TRP 158 158 158 TRP TRP A . n 
A 1 159 GLU 159 159 159 GLU GLU A . n 
A 1 160 HIS 160 160 160 HIS HIS A . n 
A 1 161 ALA 161 161 161 ALA ALA A . n 
A 1 162 TYR 162 162 162 TYR TYR A . n 
A 1 163 TYR 163 163 163 TYR TYR A . n 
A 1 164 ILE 164 164 164 ILE ILE A . n 
A 1 165 ASP 165 165 165 ASP ASP A . n 
A 1 166 HIS 166 166 166 HIS HIS A . n 
A 1 167 LYS 167 167 167 LYS LYS A . n 
A 1 168 ASN 168 168 168 ASN ASN A . n 
A 1 169 ALA 169 169 169 ALA ALA A . n 
A 1 170 ARG 170 170 170 ARG ARG A . n 
A 1 171 PRO 171 171 171 PRO PRO A . n 
A 1 172 VAL 172 172 172 VAL VAL A . n 
A 1 173 TYR 173 173 173 TYR TYR A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 GLU 175 175 175 GLU GLU A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 PHE 177 177 177 PHE PHE A . n 
A 1 178 TYR 178 178 178 TYR TYR A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 HIS 180 180 180 HIS HIS A . n 
A 1 181 ILE 181 181 181 ILE ILE A . n 
A 1 182 ASN 182 182 182 ASN ASN A . n 
A 1 183 TRP 183 183 183 TRP TRP A . n 
A 1 184 HIS 184 184 184 HIS HIS A . n 
A 1 185 PHE 185 185 185 PHE PHE A . n 
A 1 186 VAL 186 186 186 VAL VAL A . n 
A 1 187 SER 187 187 187 SER SER A . n 
A 1 188 GLN 188 188 188 GLN GLN A . n 
A 1 189 CYS 189 189 189 CYS CYS A . n 
A 1 190 TYR 190 190 190 TYR TYR A . n 
A 1 191 GLU 191 191 191 GLU GLU A . n 
A 1 192 TRP 192 192 192 TRP TRP A . n 
A 1 193 ALA 193 193 193 ALA ALA A . n 
A 1 194 LYS 194 194 194 LYS LYS A . n 
A 1 195 LYS 195 195 195 LYS LYS A . n 
A 1 196 GLU 196 196 196 GLU GLU A . n 
A 1 197 GLY 197 197 197 GLY GLY A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 GLY 199 199 199 GLY GLY A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 VAL 201 201 201 VAL VAL A . n 
A 1 202 ASP 202 202 202 ASP ASP A . n 
A 1 203 TYR 203 203 203 TYR TYR A . n 
A 1 204 TYR 204 204 204 TYR TYR A . n 
A 1 205 ILE 205 205 205 ILE ILE A . n 
A 1 206 ASN 206 206 206 ASN ASN A . n 
A 1 207 GLU 207 207 207 GLU GLU A . n 
A 1 208 LEU 208 208 208 LEU LEU A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 HIS 210 210 210 HIS HIS A . n 
A 1 211 LYS 211 211 211 LYS LYS A . n 
A 1 212 LYS 212 212 212 LYS LYS A . n 
A 1 213 LEU 213 213 213 LEU LEU A . n 
B 1 1   MET 1   1   1   MET MET B . n 
B 1 2   PHE 2   2   2   PHE PHE B . n 
B 1 3   THR 3   3   3   THR THR B . n 
B 1 4   LEU 4   4   4   LEU LEU B . n 
B 1 5   ARG 5   5   5   ARG ARG B . n 
B 1 6   GLU 6   6   6   GLU GLU B . n 
B 1 7   LEU 7   7   7   LEU LEU B . n 
B 1 8   PRO 8   8   8   PRO PRO B . n 
B 1 9   PHE 9   9   9   PHE PHE B . n 
B 1 10  ALA 10  10  10  ALA ALA B . n 
B 1 11  LYS 11  11  11  LYS LYS B . n 
B 1 12  ASP 12  12  12  ASP ASP B . n 
B 1 13  SER 13  13  13  SER SER B . n 
B 1 14  MET 14  14  14  MET MET B . n 
B 1 15  GLY 15  15  15  GLY GLY B . n 
B 1 16  ASP 16  16  16  ASP ASP B . n 
B 1 17  PHE 17  17  17  PHE PHE B . n 
B 1 18  LEU 18  18  18  LEU LEU B . n 
B 1 19  SER 19  19  19  SER SER B . n 
B 1 20  PRO 20  20  20  PRO PRO B . n 
B 1 21  VAL 21  21  21  VAL VAL B . n 
B 1 22  ALA 22  22  22  ALA ALA B . n 
B 1 23  PHE 23  23  23  PHE PHE B . n 
B 1 24  ASP 24  24  24  ASP ASP B . n 
B 1 25  PHE 25  25  25  PHE PHE B . n 
B 1 26  HIS 26  26  26  HIS HIS B . n 
B 1 27  HIS 27  27  27  HIS HIS B . n 
B 1 28  GLY 28  28  28  GLY GLY B . n 
B 1 29  LYS 29  29  29  LYS LYS B . n 
B 1 30  HIS 30  30  30  HIS HIS B . n 
B 1 31  HIS 31  31  31  HIS HIS B . n 
B 1 32  GLN 32  32  32  GLN GLN B . n 
B 1 33  THR 33  33  33  THR THR B . n 
B 1 34  TYR 34  34  34  TYR TYR B . n 
B 1 35  VAL 35  35  35  VAL VAL B . n 
B 1 36  ASN 36  36  36  ASN ASN B . n 
B 1 37  ASN 37  37  37  ASN ASN B . n 
B 1 38  LEU 38  38  38  LEU LEU B . n 
B 1 39  ASN 39  39  39  ASN ASN B . n 
B 1 40  ASN 40  40  40  ASN ASN B . n 
B 1 41  LEU 41  41  41  LEU LEU B . n 
B 1 42  ILE 42  42  42  ILE ILE B . n 
B 1 43  LYS 43  43  43  LYS LYS B . n 
B 1 44  GLY 44  44  44  GLY GLY B . n 
B 1 45  THR 45  45  45  THR THR B . n 
B 1 46  ASP 46  46  46  ASP ASP B . n 
B 1 47  PHE 47  47  47  PHE PHE B . n 
B 1 48  GLU 48  48  48  GLU GLU B . n 
B 1 49  LYS 49  49  49  LYS LYS B . n 
B 1 50  SER 50  50  50  SER SER B . n 
B 1 51  SER 51  51  51  SER SER B . n 
B 1 52  LEU 52  52  52  LEU LEU B . n 
B 1 53  PHE 53  53  53  PHE PHE B . n 
B 1 54  ALA 54  54  54  ALA ALA B . n 
B 1 55  ILE 55  55  55  ILE ILE B . n 
B 1 56  LEU 56  56  56  LEU LEU B . n 
B 1 57  THR 57  57  57  THR THR B . n 
B 1 58  LYS 58  58  58  LYS LYS B . n 
B 1 59  SER 59  59  59  SER SER B . n 
B 1 60  SER 60  60  60  SER SER B . n 
B 1 61  GLY 61  61  61  GLY GLY B . n 
B 1 62  GLY 62  62  62  GLY GLY B . n 
B 1 63  VAL 63  63  63  VAL VAL B . n 
B 1 64  PHE 64  64  64  PHE PHE B . n 
B 1 65  ASN 65  65  65  ASN ASN B . n 
B 1 66  ASN 66  66  66  ASN ASN B . n 
B 1 67  ALA 67  67  67  ALA ALA B . n 
B 1 68  ALA 68  68  68  ALA ALA B . n 
B 1 69  GLN 69  69  69  GLN GLN B . n 
B 1 70  ILE 70  70  70  ILE ILE B . n 
B 1 71  TYR 71  71  71  TYR TYR B . n 
B 1 72  ASN 72  72  72  ASN ASN B . n 
B 1 73  HIS 73  73  73  HIS HIS B . n 
B 1 74  ASP 74  74  74  ASP ASP B . n 
B 1 75  PHE 75  75  75  PHE PHE B . n 
B 1 76  TYR 76  76  76  TYR TYR B . n 
B 1 77  TRP 77  77  77  TRP TRP B . n 
B 1 78  ASP 78  78  78  ASP ASP B . n 
B 1 79  CYS 79  79  79  CYS CYS B . n 
B 1 80  LEU 80  80  80  LEU LEU B . n 
B 1 81  SER 81  81  81  SER SER B . n 
B 1 82  PRO 82  82  82  PRO PRO B . n 
B 1 83  LYS 83  83  83  LYS LYS B . n 
B 1 84  ALA 84  84  84  ALA ALA B . n 
B 1 85  THR 85  85  85  THR THR B . n 
B 1 86  ALA 86  86  86  ALA ALA B . n 
B 1 87  LEU 87  87  87  LEU LEU B . n 
B 1 88  SER 88  88  88  SER SER B . n 
B 1 89  ASP 89  89  89  ASP ASP B . n 
B 1 90  GLU 90  90  90  GLU GLU B . n 
B 1 91  LEU 91  91  91  LEU LEU B . n 
B 1 92  LYS 92  92  92  LYS LYS B . n 
B 1 93  GLY 93  93  93  GLY GLY B . n 
B 1 94  ALA 94  94  94  ALA ALA B . n 
B 1 95  LEU 95  95  95  LEU LEU B . n 
B 1 96  GLU 96  96  96  GLU GLU B . n 
B 1 97  LYS 97  97  97  LYS LYS B . n 
B 1 98  ASP 98  98  98  ASP ASP B . n 
B 1 99  PHE 99  99  99  PHE PHE B . n 
B 1 100 GLY 100 100 100 GLY GLY B . n 
B 1 101 SER 101 101 101 SER SER B . n 
B 1 102 LEU 102 102 102 LEU LEU B . n 
B 1 103 GLU 103 103 103 GLU GLU B . n 
B 1 104 LYS 104 104 104 LYS LYS B . n 
B 1 105 PHE 105 105 105 PHE PHE B . n 
B 1 106 LYS 106 106 106 LYS LYS B . n 
B 1 107 GLU 107 107 107 GLU GLU B . n 
B 1 108 ASP 108 108 108 ASP ASP B . n 
B 1 109 PHE 109 109 109 PHE PHE B . n 
B 1 110 ILE 110 110 110 ILE ILE B . n 
B 1 111 LYS 111 111 111 LYS LYS B . n 
B 1 112 SER 112 112 112 SER SER B . n 
B 1 113 ALA 113 113 113 ALA ALA B . n 
B 1 114 THR 114 114 114 THR THR B . n 
B 1 115 THR 115 115 115 THR THR B . n 
B 1 116 LEU 116 116 116 LEU LEU B . n 
B 1 117 PHE 117 117 117 PHE PHE B . n 
B 1 118 GLY 118 118 118 GLY GLY B . n 
B 1 119 SER 119 119 119 SER SER B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 TRP 121 121 121 TRP TRP B . n 
B 1 122 ASN 122 122 122 ASN ASN B . n 
B 1 123 TRP 123 123 123 TRP TRP B . n 
B 1 124 ALA 124 124 124 ALA ALA B . n 
B 1 125 ALA 125 125 125 ALA ALA B . n 
B 1 126 TYR 126 126 126 TYR TYR B . n 
B 1 127 ASN 127 127 127 ASN ASN B . n 
B 1 128 LEU 128 128 128 LEU LEU B . n 
B 1 129 ASP 129 129 129 ASP ASP B . n 
B 1 130 THR 130 130 130 THR THR B . n 
B 1 131 GLN 131 131 131 GLN GLN B . n 
B 1 132 LYS 132 132 132 LYS LYS B . n 
B 1 133 ILE 133 133 133 ILE ILE B . n 
B 1 134 GLU 134 134 134 GLU GLU B . n 
B 1 135 ILE 135 135 135 ILE ILE B . n 
B 1 136 ILE 136 136 136 ILE ILE B . n 
B 1 137 GLN 137 137 137 GLN GLN B . n 
B 1 138 THR 138 138 138 THR THR B . n 
B 1 139 SER 139 139 139 SER SER B . n 
B 1 140 ASN 140 140 140 ASN ASN B . n 
B 1 141 ALA 141 141 141 ALA ALA B . n 
B 1 142 GLN 142 142 142 GLN GLN B . n 
B 1 143 THR 143 143 143 THR THR B . n 
B 1 144 PRO 144 144 144 PRO PRO B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 THR 146 146 146 THR THR B . n 
B 1 147 ASP 147 147 147 ASP ASP B . n 
B 1 148 LYS 148 148 148 LYS LYS B . n 
B 1 149 LYS 149 149 149 LYS LYS B . n 
B 1 150 VAL 150 150 150 VAL VAL B . n 
B 1 151 PRO 151 151 151 PRO PRO B . n 
B 1 152 LEU 152 152 152 LEU LEU B . n 
B 1 153 LEU 153 153 153 LEU LEU B . n 
B 1 154 VAL 154 154 154 VAL VAL B . n 
B 1 155 VAL 155 155 155 VAL VAL B . n 
B 1 156 ASP 156 156 156 ASP ASP B . n 
B 1 157 VAL 157 157 157 VAL VAL B . n 
B 1 158 TRP 158 158 158 TRP TRP B . n 
B 1 159 GLU 159 159 159 GLU GLU B . n 
B 1 160 HIS 160 160 160 HIS HIS B . n 
B 1 161 ALA 161 161 161 ALA ALA B . n 
B 1 162 TYR 162 162 162 TYR TYR B . n 
B 1 163 TYR 163 163 163 TYR TYR B . n 
B 1 164 ILE 164 164 164 ILE ILE B . n 
B 1 165 ASP 165 165 165 ASP ASP B . n 
B 1 166 HIS 166 166 166 HIS HIS B . n 
B 1 167 LYS 167 167 167 LYS LYS B . n 
B 1 168 ASN 168 168 168 ASN ASN B . n 
B 1 169 ALA 169 169 169 ALA ALA B . n 
B 1 170 ARG 170 170 170 ARG ARG B . n 
B 1 171 PRO 171 171 171 PRO PRO B . n 
B 1 172 VAL 172 172 172 VAL VAL B . n 
B 1 173 TYR 173 173 173 TYR TYR B . n 
B 1 174 LEU 174 174 174 LEU LEU B . n 
B 1 175 GLU 175 175 175 GLU GLU B . n 
B 1 176 LYS 176 176 176 LYS LYS B . n 
B 1 177 PHE 177 177 177 PHE PHE B . n 
B 1 178 TYR 178 178 178 TYR TYR B . n 
B 1 179 GLY 179 179 179 GLY GLY B . n 
B 1 180 HIS 180 180 180 HIS HIS B . n 
B 1 181 ILE 181 181 181 ILE ILE B . n 
B 1 182 ASN 182 182 182 ASN ASN B . n 
B 1 183 TRP 183 183 183 TRP TRP B . n 
B 1 184 HIS 184 184 184 HIS HIS B . n 
B 1 185 PHE 185 185 185 PHE PHE B . n 
B 1 186 VAL 186 186 186 VAL VAL B . n 
B 1 187 SER 187 187 187 SER SER B . n 
B 1 188 GLN 188 188 188 GLN GLN B . n 
B 1 189 CYS 189 189 189 CYS CYS B . n 
B 1 190 TYR 190 190 190 TYR TYR B . n 
B 1 191 GLU 191 191 191 GLU GLU B . n 
B 1 192 TRP 192 192 192 TRP TRP B . n 
B 1 193 ALA 193 193 193 ALA ALA B . n 
B 1 194 LYS 194 194 194 LYS LYS B . n 
B 1 195 LYS 195 195 195 LYS LYS B . n 
B 1 196 GLU 196 196 196 GLU GLU B . n 
B 1 197 GLY 197 197 197 GLY GLY B . n 
B 1 198 LEU 198 198 198 LEU LEU B . n 
B 1 199 GLY 199 199 199 GLY GLY B . n 
B 1 200 SER 200 200 200 SER SER B . n 
B 1 201 VAL 201 201 201 VAL VAL B . n 
B 1 202 ASP 202 202 202 ASP ASP B . n 
B 1 203 TYR 203 203 203 TYR TYR B . n 
B 1 204 TYR 204 204 204 TYR TYR B . n 
B 1 205 ILE 205 205 205 ILE ILE B . n 
B 1 206 ASN 206 206 206 ASN ASN B . n 
B 1 207 GLU 207 207 207 GLU GLU B . n 
B 1 208 LEU 208 208 208 LEU LEU B . n 
B 1 209 VAL 209 209 209 VAL VAL B . n 
B 1 210 HIS 210 210 210 HIS HIS B . n 
B 1 211 LYS 211 211 ?   ?   ?   B . n 
B 1 212 LYS 212 212 ?   ?   ?   B . n 
B 1 213 LEU 213 213 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 FE  1   500 500 FE  FE  A . 
D 3 SO4 1   700 700 SO4 SO4 A . 
E 2 FE  1   500 500 FE  FE  B . 
F 4 HOH 1   600 600 HOH HOH A . 
F 4 HOH 2   628 628 HOH HOH A . 
F 4 HOH 3   702 702 HOH HOH A . 
F 4 HOH 4   703 703 HOH HOH A . 
F 4 HOH 5   704 704 HOH HOH A . 
F 4 HOH 6   705 705 HOH HOH A . 
F 4 HOH 7   706 706 HOH HOH A . 
F 4 HOH 8   707 707 HOH HOH A . 
F 4 HOH 9   708 708 HOH HOH A . 
F 4 HOH 10  709 709 HOH HOH A . 
F 4 HOH 11  710 710 HOH HOH A . 
F 4 HOH 12  711 711 HOH HOH A . 
F 4 HOH 13  712 712 HOH HOH A . 
F 4 HOH 14  713 713 HOH HOH A . 
F 4 HOH 15  714 714 HOH HOH A . 
F 4 HOH 16  715 715 HOH HOH A . 
F 4 HOH 17  716 716 HOH HOH A . 
F 4 HOH 18  717 717 HOH HOH A . 
F 4 HOH 19  718 718 HOH HOH A . 
F 4 HOH 20  719 719 HOH HOH A . 
F 4 HOH 21  720 720 HOH HOH A . 
F 4 HOH 22  721 721 HOH HOH A . 
F 4 HOH 23  722 722 HOH HOH A . 
F 4 HOH 24  723 723 HOH HOH A . 
F 4 HOH 25  724 724 HOH HOH A . 
F 4 HOH 26  725 725 HOH HOH A . 
F 4 HOH 27  726 726 HOH HOH A . 
F 4 HOH 28  727 727 HOH HOH A . 
F 4 HOH 29  728 728 HOH HOH A . 
F 4 HOH 30  729 729 HOH HOH A . 
F 4 HOH 31  730 730 HOH HOH A . 
F 4 HOH 32  731 731 HOH HOH A . 
F 4 HOH 33  732 732 HOH HOH A . 
F 4 HOH 34  733 733 HOH HOH A . 
F 4 HOH 35  734 734 HOH HOH A . 
F 4 HOH 36  735 735 HOH HOH A . 
F 4 HOH 37  736 736 HOH HOH A . 
F 4 HOH 38  737 737 HOH HOH A . 
F 4 HOH 39  738 738 HOH HOH A . 
F 4 HOH 40  739 739 HOH HOH A . 
F 4 HOH 41  740 740 HOH HOH A . 
F 4 HOH 42  741 741 HOH HOH A . 
F 4 HOH 43  742 742 HOH HOH A . 
F 4 HOH 44  743 743 HOH HOH A . 
F 4 HOH 45  744 744 HOH HOH A . 
F 4 HOH 46  745 745 HOH HOH A . 
F 4 HOH 47  746 746 HOH HOH A . 
F 4 HOH 48  747 747 HOH HOH A . 
F 4 HOH 49  748 748 HOH HOH A . 
F 4 HOH 50  749 749 HOH HOH A . 
F 4 HOH 51  750 750 HOH HOH A . 
F 4 HOH 52  751 751 HOH HOH A . 
F 4 HOH 53  752 752 HOH HOH A . 
F 4 HOH 54  753 753 HOH HOH A . 
F 4 HOH 55  754 754 HOH HOH A . 
F 4 HOH 56  755 755 HOH HOH A . 
F 4 HOH 57  756 756 HOH HOH A . 
F 4 HOH 58  757 757 HOH HOH A . 
F 4 HOH 59  758 758 HOH HOH A . 
F 4 HOH 60  759 759 HOH HOH A . 
F 4 HOH 61  760 760 HOH HOH A . 
F 4 HOH 62  761 761 HOH HOH A . 
F 4 HOH 63  762 762 HOH HOH A . 
F 4 HOH 64  763 763 HOH HOH A . 
F 4 HOH 65  764 764 HOH HOH A . 
F 4 HOH 66  765 765 HOH HOH A . 
F 4 HOH 67  766 766 HOH HOH A . 
F 4 HOH 68  767 767 HOH HOH A . 
F 4 HOH 69  768 768 HOH HOH A . 
F 4 HOH 70  769 769 HOH HOH A . 
F 4 HOH 71  770 770 HOH HOH A . 
F 4 HOH 72  771 771 HOH HOH A . 
F 4 HOH 73  772 772 HOH HOH A . 
F 4 HOH 74  773 773 HOH HOH A . 
F 4 HOH 75  774 774 HOH HOH A . 
F 4 HOH 76  775 775 HOH HOH A . 
F 4 HOH 77  776 776 HOH HOH A . 
F 4 HOH 78  777 777 HOH HOH A . 
F 4 HOH 79  778 778 HOH HOH A . 
F 4 HOH 80  779 779 HOH HOH A . 
F 4 HOH 81  780 780 HOH HOH A . 
F 4 HOH 82  781 781 HOH HOH A . 
F 4 HOH 83  782 782 HOH HOH A . 
F 4 HOH 84  783 783 HOH HOH A . 
F 4 HOH 85  784 784 HOH HOH A . 
F 4 HOH 86  785 785 HOH HOH A . 
F 4 HOH 87  786 786 HOH HOH A . 
F 4 HOH 88  787 787 HOH HOH A . 
F 4 HOH 89  788 788 HOH HOH A . 
F 4 HOH 90  789 789 HOH HOH A . 
F 4 HOH 91  790 790 HOH HOH A . 
F 4 HOH 92  791 791 HOH HOH A . 
F 4 HOH 93  792 792 HOH HOH A . 
F 4 HOH 94  793 793 HOH HOH A . 
F 4 HOH 95  794 794 HOH HOH A . 
F 4 HOH 96  795 795 HOH HOH A . 
F 4 HOH 97  796 796 HOH HOH A . 
F 4 HOH 98  797 797 HOH HOH A . 
F 4 HOH 99  798 798 HOH HOH A . 
G 4 HOH 1   600 600 HOH HOH B . 
G 4 HOH 2   601 601 HOH HOH B . 
G 4 HOH 3   602 602 HOH HOH B . 
G 4 HOH 4   603 603 HOH HOH B . 
G 4 HOH 5   604 604 HOH HOH B . 
G 4 HOH 6   605 605 HOH HOH B . 
G 4 HOH 7   606 606 HOH HOH B . 
G 4 HOH 8   607 607 HOH HOH B . 
G 4 HOH 9   608 608 HOH HOH B . 
G 4 HOH 10  609 609 HOH HOH B . 
G 4 HOH 11  610 610 HOH HOH B . 
G 4 HOH 12  611 611 HOH HOH B . 
G 4 HOH 13  612 612 HOH HOH B . 
G 4 HOH 14  613 613 HOH HOH B . 
G 4 HOH 15  614 614 HOH HOH B . 
G 4 HOH 16  615 615 HOH HOH B . 
G 4 HOH 17  616 616 HOH HOH B . 
G 4 HOH 18  617 617 HOH HOH B . 
G 4 HOH 19  618 618 HOH HOH B . 
G 4 HOH 20  619 619 HOH HOH B . 
G 4 HOH 21  620 620 HOH HOH B . 
G 4 HOH 22  621 621 HOH HOH B . 
G 4 HOH 23  622 622 HOH HOH B . 
G 4 HOH 24  623 623 HOH HOH B . 
G 4 HOH 25  624 624 HOH HOH B . 
G 4 HOH 26  625 625 HOH HOH B . 
G 4 HOH 27  626 626 HOH HOH B . 
G 4 HOH 28  627 627 HOH HOH B . 
G 4 HOH 29  629 629 HOH HOH B . 
G 4 HOH 30  630 630 HOH HOH B . 
G 4 HOH 31  631 631 HOH HOH B . 
G 4 HOH 32  632 632 HOH HOH B . 
G 4 HOH 33  633 633 HOH HOH B . 
G 4 HOH 34  634 634 HOH HOH B . 
G 4 HOH 35  635 635 HOH HOH B . 
G 4 HOH 36  636 636 HOH HOH B . 
G 4 HOH 37  637 637 HOH HOH B . 
G 4 HOH 38  638 638 HOH HOH B . 
G 4 HOH 39  639 639 HOH HOH B . 
G 4 HOH 40  640 640 HOH HOH B . 
G 4 HOH 41  641 641 HOH HOH B . 
G 4 HOH 42  642 642 HOH HOH B . 
G 4 HOH 43  643 643 HOH HOH B . 
G 4 HOH 44  644 644 HOH HOH B . 
G 4 HOH 45  645 645 HOH HOH B . 
G 4 HOH 46  646 646 HOH HOH B . 
G 4 HOH 47  647 647 HOH HOH B . 
G 4 HOH 48  648 648 HOH HOH B . 
G 4 HOH 49  649 649 HOH HOH B . 
G 4 HOH 50  650 650 HOH HOH B . 
G 4 HOH 51  651 651 HOH HOH B . 
G 4 HOH 52  652 652 HOH HOH B . 
G 4 HOH 53  653 653 HOH HOH B . 
G 4 HOH 54  654 654 HOH HOH B . 
G 4 HOH 55  655 655 HOH HOH B . 
G 4 HOH 56  656 656 HOH HOH B . 
G 4 HOH 57  657 657 HOH HOH B . 
G 4 HOH 58  658 658 HOH HOH B . 
G 4 HOH 59  659 659 HOH HOH B . 
G 4 HOH 60  660 660 HOH HOH B . 
G 4 HOH 61  661 661 HOH HOH B . 
G 4 HOH 62  662 662 HOH HOH B . 
G 4 HOH 63  663 663 HOH HOH B . 
G 4 HOH 64  664 664 HOH HOH B . 
G 4 HOH 65  665 665 HOH HOH B . 
G 4 HOH 66  666 666 HOH HOH B . 
G 4 HOH 67  667 667 HOH HOH B . 
G 4 HOH 68  668 668 HOH HOH B . 
G 4 HOH 69  669 669 HOH HOH B . 
G 4 HOH 70  670 670 HOH HOH B . 
G 4 HOH 71  671 671 HOH HOH B . 
G 4 HOH 72  672 672 HOH HOH B . 
G 4 HOH 73  673 673 HOH HOH B . 
G 4 HOH 74  674 674 HOH HOH B . 
G 4 HOH 75  675 675 HOH HOH B . 
G 4 HOH 76  676 676 HOH HOH B . 
G 4 HOH 77  677 677 HOH HOH B . 
G 4 HOH 78  678 678 HOH HOH B . 
G 4 HOH 79  679 679 HOH HOH B . 
G 4 HOH 80  680 680 HOH HOH B . 
G 4 HOH 81  681 681 HOH HOH B . 
G 4 HOH 82  682 682 HOH HOH B . 
G 4 HOH 83  683 683 HOH HOH B . 
G 4 HOH 84  684 684 HOH HOH B . 
G 4 HOH 85  685 685 HOH HOH B . 
G 4 HOH 86  686 686 HOH HOH B . 
G 4 HOH 87  687 687 HOH HOH B . 
G 4 HOH 88  688 688 HOH HOH B . 
G 4 HOH 89  689 689 HOH HOH B . 
G 4 HOH 90  690 690 HOH HOH B . 
G 4 HOH 91  691 691 HOH HOH B . 
G 4 HOH 92  692 692 HOH HOH B . 
G 4 HOH 93  693 693 HOH HOH B . 
G 4 HOH 94  694 694 HOH HOH B . 
G 4 HOH 95  695 695 HOH HOH B . 
G 4 HOH 96  696 696 HOH HOH B . 
G 4 HOH 97  697 697 HOH HOH B . 
G 4 HOH 98  698 698 HOH HOH B . 
G 4 HOH 99  699 699 HOH HOH B . 
G 4 HOH 100 700 700 HOH HOH B . 
G 4 HOH 101 701 701 HOH HOH B . 
G 4 HOH 102 702 702 HOH HOH B . 
G 4 HOH 103 703 703 HOH HOH B . 
G 4 HOH 104 704 704 HOH HOH B . 
G 4 HOH 105 705 705 HOH HOH B . 
G 4 HOH 106 706 706 HOH HOH B . 
G 4 HOH 107 707 707 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1930  ? 
1 MORE         -26.4 ? 
1 'SSA (A^2)'  17860 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 26  ? A HIS 26  ? 1_555 FE ? C FE . ? A FE 500 ? 1_555 NE2 ? A HIS 73  ? A HIS 73  ? 1_555 85.6  ? 
2  NE2 ? A HIS 26  ? A HIS 26  ? 1_555 FE ? C FE . ? A FE 500 ? 1_555 OD2 ? A ASP 156 ? A ASP 156 ? 1_555 89.5  ? 
3  NE2 ? A HIS 73  ? A HIS 73  ? 1_555 FE ? C FE . ? A FE 500 ? 1_555 OD2 ? A ASP 156 ? A ASP 156 ? 1_555 107.6 ? 
4  NE2 ? A HIS 26  ? A HIS 26  ? 1_555 FE ? C FE . ? A FE 500 ? 1_555 NE2 ? A HIS 160 ? A HIS 160 ? 1_555 90.5  ? 
5  NE2 ? A HIS 73  ? A HIS 73  ? 1_555 FE ? C FE . ? A FE 500 ? 1_555 NE2 ? A HIS 160 ? A HIS 160 ? 1_555 127.5 ? 
6  OD2 ? A ASP 156 ? A ASP 156 ? 1_555 FE ? C FE . ? A FE 500 ? 1_555 NE2 ? A HIS 160 ? A HIS 160 ? 1_555 124.7 ? 
7  NE2 ? A HIS 26  ? A HIS 26  ? 1_555 FE ? C FE . ? A FE 500 ? 1_555 O   ? F HOH .   ? A HOH 600 ? 1_555 178.3 ? 
8  NE2 ? A HIS 73  ? A HIS 73  ? 1_555 FE ? C FE . ? A FE 500 ? 1_555 O   ? F HOH .   ? A HOH 600 ? 1_555 93.6  ? 
9  OD2 ? A ASP 156 ? A ASP 156 ? 1_555 FE ? C FE . ? A FE 500 ? 1_555 O   ? F HOH .   ? A HOH 600 ? 1_555 89.3  ? 
10 NE2 ? A HIS 160 ? A HIS 160 ? 1_555 FE ? C FE . ? A FE 500 ? 1_555 O   ? F HOH .   ? A HOH 600 ? 1_555 91.2  ? 
11 NE2 ? B HIS 26  ? B HIS 26  ? 1_555 FE ? E FE . ? B FE 500 ? 1_555 NE2 ? B HIS 73  ? B HIS 73  ? 1_555 91.3  ? 
12 NE2 ? B HIS 26  ? B HIS 26  ? 1_555 FE ? E FE . ? B FE 500 ? 1_555 OD2 ? B ASP 156 ? B ASP 156 ? 1_555 88.1  ? 
13 NE2 ? B HIS 73  ? B HIS 73  ? 1_555 FE ? E FE . ? B FE 500 ? 1_555 OD2 ? B ASP 156 ? B ASP 156 ? 1_555 106.7 ? 
14 NE2 ? B HIS 26  ? B HIS 26  ? 1_555 FE ? E FE . ? B FE 500 ? 1_555 NE2 ? B HIS 160 ? B HIS 160 ? 1_555 90.1  ? 
15 NE2 ? B HIS 73  ? B HIS 73  ? 1_555 FE ? E FE . ? B FE 500 ? 1_555 NE2 ? B HIS 160 ? B HIS 160 ? 1_555 126.8 ? 
16 OD2 ? B ASP 156 ? B ASP 156 ? 1_555 FE ? E FE . ? B FE 500 ? 1_555 NE2 ? B HIS 160 ? B HIS 160 ? 1_555 126.5 ? 
17 NE2 ? B HIS 26  ? B HIS 26  ? 1_555 FE ? E FE . ? B FE 500 ? 1_555 O   ? G HOH .   ? B HOH 600 ? 1_555 172.7 ? 
18 NE2 ? B HIS 73  ? B HIS 73  ? 1_555 FE ? E FE . ? B FE 500 ? 1_555 O   ? G HOH .   ? B HOH 600 ? 1_555 90.1  ? 
19 OD2 ? B ASP 156 ? B ASP 156 ? 1_555 FE ? E FE . ? B FE 500 ? 1_555 O   ? G HOH .   ? B HOH 600 ? 1_555 84.7  ? 
20 NE2 ? B HIS 160 ? B HIS 160 ? 1_555 FE ? E FE . ? B FE 500 ? 1_555 O   ? G HOH .   ? B HOH 600 ? 1_555 94.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-06-10 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS    refinement       1.1 ? 1 
MOSFLM 'data reduction' .   ? 2 
SCALA  'data scaling'   .   ? 3 
AMoRE  phasing          .   ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 MET A 14  ? ? -98.43  32.92   
2  1 LYS A 29  ? ? -120.01 -56.07  
3  1 ASN A 140 ? ? 50.51   -107.55 
4  1 TYR A 162 ? ? -140.74 -1.83   
5  1 LYS A 167 ? ? 53.68   -130.94 
6  1 HIS A 210 ? ? -105.76 40.74   
7  1 LYS A 212 ? ? -58.29  100.85  
8  1 PHE B 17  ? ? -123.77 -60.12  
9  1 ASN B 140 ? ? 47.50   -109.27 
10 1 LYS B 167 ? ? 48.33   -130.61 
11 1 VAL B 209 ? ? -134.04 -73.76  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 B LYS 211 ? B LYS 211 
2 1 Y 1 B LYS 212 ? B LYS 212 
3 1 Y 1 B LEU 213 ? B LEU 213 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'FE (III) ION' FE  
3 'SULFATE ION'  SO4 
4 water          HOH 
#