data_3CFV
# 
_entry.id   3CFV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3CFV         
RCSB  RCSB046725   
WWPDB D_1000046725 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3CFS 
_pdbx_database_related.details        'The same RbAp46 protein structure complexed with longer H4 peptide' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3CFV 
_pdbx_database_status.recvd_initial_deposition_date   2008-03-04 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pei, X.-Y.'     1 
'Murzina, N.V.'  2 
'Zhang, W.'      3 
'McLaughlin, S.' 4 
'Verreault, A.'  5 
'Luisi, B.F.'    6 
'Laue, E.D.'     7 
# 
_citation.id                        primary 
_citation.title                     'Structural Basis for the Recognition of Histone H4 by the Histone-Chaperone RbAp46.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            16 
_citation.page_first                1077 
_citation.page_last                 1085 
_citation.year                      2008 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18571423 
_citation.pdbx_database_id_DOI      10.1016/j.str.2008.05.006 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Murzina, N.V.'      1  
primary 'Pei, X.Y.'          2  
primary 'Zhang, W.'          3  
primary 'Sparkes, M.'        4  
primary 'Vicente-Garcia, J.' 5  
primary 'Pratap, J.V.'       6  
primary 'McLaughlin, S.H.'   7  
primary 'Ben-Shahar, T.R.'   8  
primary 'Verreault, A.'      9  
primary 'Luisi, B.F.'        10 
primary 'Laue, E.D.'         11 
# 
_cell.entry_id           3CFV 
_cell.length_a           108.661 
_cell.length_b           44.790 
_cell.length_c           109.592 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.71 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3CFV 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone-binding protein RBBP7' 47172.113 2   ? ? ?                       ? 
2 polymer     syn 'Histone H4 peptide'            2040.399  2   ? ? 'UNP residues 25 to 42' ? 
3 non-polymer syn ARSENIC                         74.922    2   ? ? ?                       ? 
4 water       nat water                           18.015    275 ? ? ?                       ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Retinoblastoma-binding protein 7, RBBP-7, Retinoblastoma-binding protein p46, Histone acetyltransferase type B subunit 2, Nucleosome-remodeling factor subunit RBAP46
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;H(MSE)A(MSE)ASKE(MSE)FEDTVEERVINEEYKIWKKNTPFLYDLV(MSE)THALQWPSLTVQWLPEVTKPEGKDYA
LHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARY(MSE)PQNPH
IIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVD
AKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKL(MSE)IWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSA
DKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHT
AKISDFSWNPNEPWVICSVSEDNI(MSE)QIWQ(MSE)AENIYNDE
;
;HMAMASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNH
LVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHP
AKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLL
HESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKD
EIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNI
MQIWQMAENIYNDE
;
B,A ? 
2 'polypeptide(L)' no no  DNIQGITKPAIRRLARRG DNIQGITKPAIRRLARRG E,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   MSE n 
1 3   ALA n 
1 4   MSE n 
1 5   ALA n 
1 6   SER n 
1 7   LYS n 
1 8   GLU n 
1 9   MSE n 
1 10  PHE n 
1 11  GLU n 
1 12  ASP n 
1 13  THR n 
1 14  VAL n 
1 15  GLU n 
1 16  GLU n 
1 17  ARG n 
1 18  VAL n 
1 19  ILE n 
1 20  ASN n 
1 21  GLU n 
1 22  GLU n 
1 23  TYR n 
1 24  LYS n 
1 25  ILE n 
1 26  TRP n 
1 27  LYS n 
1 28  LYS n 
1 29  ASN n 
1 30  THR n 
1 31  PRO n 
1 32  PHE n 
1 33  LEU n 
1 34  TYR n 
1 35  ASP n 
1 36  LEU n 
1 37  VAL n 
1 38  MSE n 
1 39  THR n 
1 40  HIS n 
1 41  ALA n 
1 42  LEU n 
1 43  GLN n 
1 44  TRP n 
1 45  PRO n 
1 46  SER n 
1 47  LEU n 
1 48  THR n 
1 49  VAL n 
1 50  GLN n 
1 51  TRP n 
1 52  LEU n 
1 53  PRO n 
1 54  GLU n 
1 55  VAL n 
1 56  THR n 
1 57  LYS n 
1 58  PRO n 
1 59  GLU n 
1 60  GLY n 
1 61  LYS n 
1 62  ASP n 
1 63  TYR n 
1 64  ALA n 
1 65  LEU n 
1 66  HIS n 
1 67  TRP n 
1 68  LEU n 
1 69  VAL n 
1 70  LEU n 
1 71  GLY n 
1 72  THR n 
1 73  HIS n 
1 74  THR n 
1 75  SER n 
1 76  ASP n 
1 77  GLU n 
1 78  GLN n 
1 79  ASN n 
1 80  HIS n 
1 81  LEU n 
1 82  VAL n 
1 83  VAL n 
1 84  ALA n 
1 85  ARG n 
1 86  VAL n 
1 87  HIS n 
1 88  ILE n 
1 89  PRO n 
1 90  ASN n 
1 91  ASP n 
1 92  ASP n 
1 93  ALA n 
1 94  GLN n 
1 95  PHE n 
1 96  ASP n 
1 97  ALA n 
1 98  SER n 
1 99  HIS n 
1 100 CYS n 
1 101 ASP n 
1 102 SER n 
1 103 ASP n 
1 104 LYS n 
1 105 GLY n 
1 106 GLU n 
1 107 PHE n 
1 108 GLY n 
1 109 GLY n 
1 110 PHE n 
1 111 GLY n 
1 112 SER n 
1 113 VAL n 
1 114 THR n 
1 115 GLY n 
1 116 LYS n 
1 117 ILE n 
1 118 GLU n 
1 119 CYS n 
1 120 GLU n 
1 121 ILE n 
1 122 LYS n 
1 123 ILE n 
1 124 ASN n 
1 125 HIS n 
1 126 GLU n 
1 127 GLY n 
1 128 GLU n 
1 129 VAL n 
1 130 ASN n 
1 131 ARG n 
1 132 ALA n 
1 133 ARG n 
1 134 TYR n 
1 135 MSE n 
1 136 PRO n 
1 137 GLN n 
1 138 ASN n 
1 139 PRO n 
1 140 HIS n 
1 141 ILE n 
1 142 ILE n 
1 143 ALA n 
1 144 THR n 
1 145 LYS n 
1 146 THR n 
1 147 PRO n 
1 148 SER n 
1 149 SER n 
1 150 ASP n 
1 151 VAL n 
1 152 LEU n 
1 153 VAL n 
1 154 PHE n 
1 155 ASP n 
1 156 TYR n 
1 157 THR n 
1 158 LYS n 
1 159 HIS n 
1 160 PRO n 
1 161 ALA n 
1 162 LYS n 
1 163 PRO n 
1 164 ASP n 
1 165 PRO n 
1 166 SER n 
1 167 GLY n 
1 168 GLU n 
1 169 CYS n 
1 170 ASN n 
1 171 PRO n 
1 172 ASP n 
1 173 LEU n 
1 174 ARG n 
1 175 LEU n 
1 176 ARG n 
1 177 GLY n 
1 178 HIS n 
1 179 GLN n 
1 180 LYS n 
1 181 GLU n 
1 182 GLY n 
1 183 TYR n 
1 184 GLY n 
1 185 LEU n 
1 186 SER n 
1 187 TRP n 
1 188 ASN n 
1 189 SER n 
1 190 ASN n 
1 191 LEU n 
1 192 SER n 
1 193 GLY n 
1 194 HIS n 
1 195 LEU n 
1 196 LEU n 
1 197 SER n 
1 198 ALA n 
1 199 SER n 
1 200 ASP n 
1 201 ASP n 
1 202 HIS n 
1 203 THR n 
1 204 VAL n 
1 205 CYS n 
1 206 LEU n 
1 207 TRP n 
1 208 ASP n 
1 209 ILE n 
1 210 ASN n 
1 211 ALA n 
1 212 GLY n 
1 213 PRO n 
1 214 LYS n 
1 215 GLU n 
1 216 GLY n 
1 217 LYS n 
1 218 ILE n 
1 219 VAL n 
1 220 ASP n 
1 221 ALA n 
1 222 LYS n 
1 223 ALA n 
1 224 ILE n 
1 225 PHE n 
1 226 THR n 
1 227 GLY n 
1 228 HIS n 
1 229 SER n 
1 230 ALA n 
1 231 VAL n 
1 232 VAL n 
1 233 GLU n 
1 234 ASP n 
1 235 VAL n 
1 236 ALA n 
1 237 TRP n 
1 238 HIS n 
1 239 LEU n 
1 240 LEU n 
1 241 HIS n 
1 242 GLU n 
1 243 SER n 
1 244 LEU n 
1 245 PHE n 
1 246 GLY n 
1 247 SER n 
1 248 VAL n 
1 249 ALA n 
1 250 ASP n 
1 251 ASP n 
1 252 GLN n 
1 253 LYS n 
1 254 LEU n 
1 255 MSE n 
1 256 ILE n 
1 257 TRP n 
1 258 ASP n 
1 259 THR n 
1 260 ARG n 
1 261 SER n 
1 262 ASN n 
1 263 THR n 
1 264 THR n 
1 265 SER n 
1 266 LYS n 
1 267 PRO n 
1 268 SER n 
1 269 HIS n 
1 270 LEU n 
1 271 VAL n 
1 272 ASP n 
1 273 ALA n 
1 274 HIS n 
1 275 THR n 
1 276 ALA n 
1 277 GLU n 
1 278 VAL n 
1 279 ASN n 
1 280 CYS n 
1 281 LEU n 
1 282 SER n 
1 283 PHE n 
1 284 ASN n 
1 285 PRO n 
1 286 TYR n 
1 287 SER n 
1 288 GLU n 
1 289 PHE n 
1 290 ILE n 
1 291 LEU n 
1 292 ALA n 
1 293 THR n 
1 294 GLY n 
1 295 SER n 
1 296 ALA n 
1 297 ASP n 
1 298 LYS n 
1 299 THR n 
1 300 VAL n 
1 301 ALA n 
1 302 LEU n 
1 303 TRP n 
1 304 ASP n 
1 305 LEU n 
1 306 ARG n 
1 307 ASN n 
1 308 LEU n 
1 309 LYS n 
1 310 LEU n 
1 311 LYS n 
1 312 LEU n 
1 313 HIS n 
1 314 THR n 
1 315 PHE n 
1 316 GLU n 
1 317 SER n 
1 318 HIS n 
1 319 LYS n 
1 320 ASP n 
1 321 GLU n 
1 322 ILE n 
1 323 PHE n 
1 324 GLN n 
1 325 VAL n 
1 326 HIS n 
1 327 TRP n 
1 328 SER n 
1 329 PRO n 
1 330 HIS n 
1 331 ASN n 
1 332 GLU n 
1 333 THR n 
1 334 ILE n 
1 335 LEU n 
1 336 ALA n 
1 337 SER n 
1 338 SER n 
1 339 GLY n 
1 340 THR n 
1 341 ASP n 
1 342 ARG n 
1 343 ARG n 
1 344 LEU n 
1 345 ASN n 
1 346 VAL n 
1 347 TRP n 
1 348 ASP n 
1 349 LEU n 
1 350 SER n 
1 351 LYS n 
1 352 ILE n 
1 353 GLY n 
1 354 GLU n 
1 355 GLU n 
1 356 GLN n 
1 357 SER n 
1 358 ALA n 
1 359 GLU n 
1 360 ASP n 
1 361 ALA n 
1 362 GLU n 
1 363 ASP n 
1 364 GLY n 
1 365 PRO n 
1 366 PRO n 
1 367 GLU n 
1 368 LEU n 
1 369 LEU n 
1 370 PHE n 
1 371 ILE n 
1 372 HIS n 
1 373 GLY n 
1 374 GLY n 
1 375 HIS n 
1 376 THR n 
1 377 ALA n 
1 378 LYS n 
1 379 ILE n 
1 380 SER n 
1 381 ASP n 
1 382 PHE n 
1 383 SER n 
1 384 TRP n 
1 385 ASN n 
1 386 PRO n 
1 387 ASN n 
1 388 GLU n 
1 389 PRO n 
1 390 TRP n 
1 391 VAL n 
1 392 ILE n 
1 393 CYS n 
1 394 SER n 
1 395 VAL n 
1 396 SER n 
1 397 GLU n 
1 398 ASP n 
1 399 ASN n 
1 400 ILE n 
1 401 MSE n 
1 402 GLN n 
1 403 ILE n 
1 404 TRP n 
1 405 GLN n 
1 406 MSE n 
1 407 ALA n 
1 408 GLU n 
1 409 ASN n 
1 410 ILE n 
1 411 TYR n 
1 412 ASN n 
1 413 ASP n 
1 414 GLU n 
2 1   ASP n 
2 2   ASN n 
2 3   ILE n 
2 4   GLN n 
2 5   GLY n 
2 6   ILE n 
2 7   THR n 
2 8   LYS n 
2 9   PRO n 
2 10  ALA n 
2 11  ILE n 
2 12  ARG n 
2 13  ARG n 
2 14  LEU n 
2 15  ALA n 
2 16  ARG n 
2 17  ARG n 
2 18  GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'RBBP7, RBAP46' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     ? 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            sf9 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          pFBDM 
_entity_src_gen.pdbx_host_org_vector               'Bacmid vector DH10Bac' 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'The peptide is chemically synthesized.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP RBBP7_HUMAN Q16576 1 
;MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVV
ARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKP
DPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHES
LFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIF
QVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQI
WQMAENIYNDE
;
1  ? 
2 UNP H4_HUMAN    P62805 2 DNIQGITKPAIRRLARRG 25 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3CFV B 4 ? 414 ? Q16576 1  ? 411 ? 1  411 
2 2 3CFV E 1 ? 18  ? P62805 25 ? 42  ? 24 41  
3 1 3CFV A 4 ? 414 ? Q16576 1  ? 411 ? 1  411 
4 2 3CFV F 1 ? 18  ? P62805 25 ? 42  ? 24 41  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3CFV HIS B 1 ? UNP Q16576 ? ? 'CLONING ARTIFACT' -2 1 
1 3CFV MSE B 2 ? UNP Q16576 ? ? 'CLONING ARTIFACT' -1 2 
1 3CFV ALA B 3 ? UNP Q16576 ? ? 'CLONING ARTIFACT' 0  3 
3 3CFV HIS A 1 ? UNP Q16576 ? ? 'CLONING ARTIFACT' -2 4 
3 3CFV MSE A 2 ? UNP Q16576 ? ? 'CLONING ARTIFACT' -1 5 
3 3CFV ALA A 3 ? UNP Q16576 ? ? 'CLONING ARTIFACT' 0  6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ARS non-polymer         . ARSENIC          ? As               74.922  
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3CFV 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.72 
_exptl_crystal.density_percent_sol   54.72 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.3 
_exptl_crystal_grow.pdbx_details    
'13% PEG 2000, 0.2M Ca acetate, 0.1M Na Cacodylate, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2007-07-02 
_diffrn_detector.details                mirror 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    mirror 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.873 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.873 
# 
_reflns.entry_id                     3CFV 
_reflns.observed_criterion_sigma_I   3.3 
_reflns.observed_criterion_sigma_F   2.8 
_reflns.d_resolution_low             25 
_reflns.d_resolution_high            2.6 
_reflns.number_obs                   33119 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.143 
_reflns.pdbx_Rsym_value              0.143 
_reflns.pdbx_netI_over_sigmaI        18.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.6 
_reflns_shell.d_res_low              2.74 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.731 
_reflns_shell.pdbx_Rsym_value        0.731 
_reflns_shell.meanI_over_sigI_obs    3.3 
_reflns_shell.pdbx_redundancy        3.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3CFV 
_refine.ls_number_reflns_obs                     31416 
_refine.ls_number_reflns_all                     31416 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             25.00 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    99.64 
_refine.ls_R_factor_obs                          0.20178 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19895 
_refine.ls_R_factor_R_free                       0.25675 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  1577 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.939 
_refine.correlation_coeff_Fo_to_Fc_free          0.902 
_refine.B_iso_mean                               51.119 
_refine.aniso_B[1][1]                            -0.97 
_refine.aniso_B[2][2]                            -1.55 
_refine.aniso_B[3][3]                            2.55 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            1.39 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'our Rabp46/h4 SAD data phasing model' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.662 
_refine.pdbx_overall_ESU_R_Free                  0.316 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3CFV 
_refine_analyze.Luzzati_coordinate_error_obs    0.339 
_refine_analyze.Luzzati_sigma_a_obs             0.335 
_refine_analyze.Luzzati_d_res_low_obs           6 
_refine_analyze.Luzzati_coordinate_error_free   0.31 
_refine_analyze.Luzzati_sigma_a_free            0.312 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6505 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             275 
_refine_hist.number_atoms_total               6782 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        25.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.005  0.021  ? 6711 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          0.865  1.927  ? 9090 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.997  5.000  ? 809  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       31.235 24.830 ? 323  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.201 15.000 ? 1109 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       12.462 15.000 ? 28   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.058  0.200  ? 989  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.002  0.020  ? 5112 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.228  0.300  ? 2981 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.319  0.500  ? 4423 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.191  0.500  ? 483  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.203  0.300  ? 105  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.164  0.500  ? 19   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  3.462  2.000  ? 4068 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 5.422  3.000  ? 6591 'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.943  2.000  ? 2612 'X-RAY DIFFRACTION' ? 
r_scangle_it                 5.454  3.000  ? 2499 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 B 3012 0.22 5.00  'loose positional' 1 'X-RAY DIFFRACTION' 1 ? ? ? 
1 E 105  0.56 5.00  'loose positional' 2 'X-RAY DIFFRACTION' 2 ? ? ? 
1 B 3012 1.80 10.00 'loose thermal'    1 'X-RAY DIFFRACTION' 3 ? ? ? 
1 E 105  1.44 10.00 'loose thermal'    2 'X-RAY DIFFRACTION' 4 ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.600 
_refine_ls_shell.d_res_low                        2.667 
_refine_ls_shell.number_reflns_R_work             2237 
_refine_ls_shell.R_factor_R_work                  0.338 
_refine_ls_shell.percent_reflns_obs               98.75 
_refine_ls_shell.R_factor_R_free                  0.394 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             129 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 B 
1 2 A 
2 1 E 
2 2 F 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 B 11 B 408 1 6 A VAL 14 ? A TYR 411 ? 1 ? 
2 A 11 A 408 1 6 C VAL 14 ? C TYR 411 ? 1 ? 
1 E 29 E 41  1 6 B ILE 6  ? B GLY 18  ? 2 ? 
2 F 29 F 41  1 6 D ILE 6  ? D GLY 18  ? 2 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
# 
_struct.entry_id                  3CFV 
_struct.title                     'Structural basis of the interaction of RbAp46/RbAp48 with histone H4' 
_struct.pdbx_descriptor           'Histone-binding protein RBBP7, Histone H4' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3CFV 
_struct_keywords.pdbx_keywords   HISTONE/CHAPERONE 
_struct_keywords.text            
;RbAp46/RbAp48, Chromatin, Histone, WD-40 repeat protein, chaperone, flexib, Chromatin regulator, DNA replication, Phosphoprotein, Repressor, Transcription, Transcription regulation, WD repeat, Chromosomal protein, DNA-binding, Nucleosome core, HISTONE-CHAPERONE COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 12  ? LEU A 33  ? ASP B 9   LEU B 30  1 ? 22 
HELX_P HELX_P2  2  THR A 157 ? HIS A 159 ? THR B 154 HIS B 156 5 ? 3  
HELX_P HELX_P3  3  SER A 350 ? ILE A 352 ? SER B 347 ILE B 349 5 ? 3  
HELX_P HELX_P4  4  SER A 357 ? GLU A 362 ? SER B 354 GLU B 359 1 ? 6  
HELX_P HELX_P5  5  ALA A 407 ? ASN A 412 ? ALA B 404 ASN B 409 1 ? 6  
HELX_P HELX_P6  6  ASN B 2   ? ARG B 17  ? ASN E 25  ARG E 40  1 ? 16 
HELX_P HELX_P7  7  ASP C 12  ? LEU C 33  ? ASP A 9   LEU A 30  1 ? 22 
HELX_P HELX_P8  8  THR C 157 ? HIS C 159 ? THR A 154 HIS A 156 5 ? 3  
HELX_P HELX_P9  9  SER C 350 ? ILE C 352 ? SER A 347 ILE A 349 5 ? 3  
HELX_P HELX_P10 10 SER C 357 ? GLU C 362 ? SER A 354 GLU A 359 1 ? 6  
HELX_P HELX_P11 11 ALA C 407 ? ASN C 412 ? ALA A 404 ASN A 409 1 ? 6  
HELX_P HELX_P12 12 LYS D 8   ? ARG D 17  ? LYS F 31  ARG F 40  1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A HIS 1   C ? ? ? 1_555 A MSE 2   N ? ? B HIS -2  B MSE -1  1_555 ? ? ? ? ? ? ? 1.317 ? 
covale2  covale ? ? A MSE 2   C ? ? ? 1_555 A ALA 3   N ? ? B MSE -1  B ALA 0   1_555 ? ? ? ? ? ? ? 1.317 ? 
covale3  covale ? ? A ALA 3   C ? ? ? 1_555 A MSE 4   N ? ? B ALA 0   B MSE 1   1_555 ? ? ? ? ? ? ? 1.316 ? 
covale4  covale ? ? A MSE 4   C ? ? ? 1_555 A ALA 5   N ? ? B MSE 1   B ALA 2   1_555 ? ? ? ? ? ? ? 1.318 ? 
covale5  covale ? ? A GLU 8   C ? ? ? 1_555 A MSE 9   N ? ? B GLU 5   B MSE 6   1_555 ? ? ? ? ? ? ? 1.322 ? 
covale6  covale ? ? A MSE 9   C ? ? ? 1_555 A PHE 10  N ? ? B MSE 6   B PHE 7   1_555 ? ? ? ? ? ? ? 1.323 ? 
covale7  covale ? ? A VAL 37  C ? ? ? 1_555 A MSE 38  N ? ? B VAL 34  B MSE 35  1_555 ? ? ? ? ? ? ? 1.316 ? 
covale8  covale ? ? A MSE 38  C ? ? ? 1_555 A THR 39  N ? ? B MSE 35  B THR 36  1_555 ? ? ? ? ? ? ? 1.316 ? 
covale9  covale ? ? A TYR 134 C ? ? ? 1_555 A MSE 135 N ? ? B TYR 131 B MSE 132 1_555 ? ? ? ? ? ? ? 1.316 ? 
covale10 covale ? ? A MSE 135 C ? ? ? 1_555 A PRO 136 N ? ? B MSE 132 B PRO 133 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale11 covale ? ? A LEU 254 C ? ? ? 1_555 A MSE 255 N ? ? B LEU 251 B MSE 252 1_555 ? ? ? ? ? ? ? 1.316 ? 
covale12 covale ? ? A MSE 255 C ? ? ? 1_555 A ILE 256 N ? ? B MSE 252 B ILE 253 1_555 ? ? ? ? ? ? ? 1.317 ? 
covale13 covale ? ? A ILE 400 C ? ? ? 1_555 A MSE 401 N ? ? B ILE 397 B MSE 398 1_555 ? ? ? ? ? ? ? 1.317 ? 
covale14 covale ? ? A MSE 401 C ? ? ? 1_555 A GLN 402 N ? ? B MSE 398 B GLN 399 1_555 ? ? ? ? ? ? ? 1.316 ? 
covale15 covale ? ? A GLN 405 C ? ? ? 1_555 A MSE 406 N ? ? B GLN 402 B MSE 403 1_555 ? ? ? ? ? ? ? 1.313 ? 
covale16 covale ? ? A MSE 406 C ? ? ? 1_555 A ALA 407 N ? ? B MSE 403 B ALA 404 1_555 ? ? ? ? ? ? ? 1.318 ? 
covale17 covale ? ? C MSE 2   C ? ? ? 1_555 C ALA 3   N ? ? A MSE -1  A ALA 0   1_555 ? ? ? ? ? ? ? 1.318 ? 
covale18 covale ? ? C ALA 3   C ? ? ? 1_555 C MSE 4   N ? ? A ALA 0   A MSE 1   1_555 ? ? ? ? ? ? ? 1.317 ? 
covale19 covale ? ? C MSE 4   C ? ? ? 1_555 C ALA 5   N ? ? A MSE 1   A ALA 2   1_555 ? ? ? ? ? ? ? 1.315 ? 
covale20 covale ? ? C GLU 8   C ? ? ? 1_555 C MSE 9   N ? ? A GLU 5   A MSE 6   1_555 ? ? ? ? ? ? ? 1.317 ? 
covale21 covale ? ? C MSE 9   C ? ? ? 1_555 C PHE 10  N ? ? A MSE 6   A PHE 7   1_555 ? ? ? ? ? ? ? 1.317 ? 
covale22 covale ? ? C VAL 37  C ? ? ? 1_555 C MSE 38  N ? ? A VAL 34  A MSE 35  1_555 ? ? ? ? ? ? ? 1.316 ? 
covale23 covale ? ? C MSE 38  C ? ? ? 1_555 C THR 39  N ? ? A MSE 35  A THR 36  1_555 ? ? ? ? ? ? ? 1.317 ? 
covale24 covale ? ? C TYR 134 C ? ? ? 1_555 C MSE 135 N ? ? A TYR 131 A MSE 132 1_555 ? ? ? ? ? ? ? 1.318 ? 
covale25 covale ? ? C MSE 135 C ? ? ? 1_555 C PRO 136 N ? ? A MSE 132 A PRO 133 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale26 covale ? ? C LEU 254 C ? ? ? 1_555 C MSE 255 N ? ? A LEU 251 A MSE 252 1_555 ? ? ? ? ? ? ? 1.316 ? 
covale27 covale ? ? C MSE 255 C ? ? ? 1_555 C ILE 256 N ? ? A MSE 252 A ILE 253 1_555 ? ? ? ? ? ? ? 1.315 ? 
covale28 covale ? ? C ILE 400 C ? ? ? 1_555 C MSE 401 N ? ? A ILE 397 A MSE 398 1_555 ? ? ? ? ? ? ? 1.316 ? 
covale29 covale ? ? C MSE 401 C ? ? ? 1_555 C GLN 402 N ? ? A MSE 398 A GLN 399 1_555 ? ? ? ? ? ? ? 1.316 ? 
covale30 covale ? ? C GLN 405 C ? ? ? 1_555 C MSE 406 N ? ? A GLN 402 A MSE 403 1_555 ? ? ? ? ? ? ? 1.315 ? 
covale31 covale ? ? C MSE 406 C ? ? ? 1_555 C ALA 407 N ? ? A MSE 403 A ALA 404 1_555 ? ? ? ? ? ? ? 1.317 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 8   A . ? GLU 5   B MSE 9   A ? MSE 6   B 1 9.63  
2 MSE 9   A . ? MSE 6   B PHE 10  A ? PHE 7   B 1 -8.60 
3 GLU 215 A . ? GLU 212 B GLY 216 A ? GLY 213 B 1 0.98  
4 MSE 9   C . ? MSE 6   A PHE 10  C ? PHE 7   A 1 5.26  
5 GLY 5   D . ? GLY 28  F ILE 6   D ? ILE 29  F 1 1.32  
6 ILE 6   D . ? ILE 29  F THR 7   D ? THR 30  F 1 -1.51 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 5 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
G ? 4 ? 
H ? 4 ? 
I ? 4 ? 
J ? 5 ? 
K ? 4 ? 
L ? 4 ? 
M ? 4 ? 
N ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
J 4 5 ? parallel      
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 34  ? ALA A 41  ? TYR B 31  ALA B 38  
A 2 ILE A 400 ? MSE A 406 ? ILE B 397 MSE B 403 
A 3 VAL A 391 ? SER A 396 ? VAL B 388 SER B 393 
A 4 ILE A 379 ? TRP A 384 ? ILE B 376 TRP B 381 
B 1 VAL A 49  ? THR A 56  ? VAL B 46  THR B 53  
B 2 TYR A 63  ? GLY A 71  ? TYR B 60  GLY B 68  
B 3 ASN A 79  ? PRO A 89  ? ASN B 76  PRO B 86  
B 4 LYS A 116 ? HIS A 125 ? LYS B 113 HIS B 122 
C 1 ARG A 131 ? MSE A 135 ? ARG B 128 MSE B 132 
C 2 ASN A 138 ? LYS A 145 ? ASN B 135 LYS B 142 
C 3 VAL A 151 ? ASP A 155 ? VAL B 148 ASP B 152 
C 4 LEU A 173 ? ARG A 176 ? LEU B 170 ARG B 173 
C 5 ILE A 218 ? ASP A 220 ? ILE B 215 ASP B 217 
D 1 LEU A 185 ? TRP A 187 ? LEU B 182 TRP B 184 
D 2 HIS A 194 ? ALA A 198 ? HIS B 191 ALA B 195 
D 3 VAL A 204 ? ASP A 208 ? VAL B 201 ASP B 205 
D 4 ALA A 223 ? PHE A 225 ? ALA B 220 PHE B 222 
E 1 VAL A 232 ? TRP A 237 ? VAL B 229 TRP B 234 
E 2 LEU A 244 ? ALA A 249 ? LEU B 241 ALA B 246 
E 3 LYS A 253 ? ASP A 258 ? LYS B 250 ASP B 255 
E 4 HIS A 269 ? ASP A 272 ? HIS B 266 ASP B 269 
F 1 VAL A 278 ? PHE A 283 ? VAL B 275 PHE B 280 
F 2 ILE A 290 ? SER A 295 ? ILE B 287 SER B 292 
F 3 THR A 299 ? ASP A 304 ? THR B 296 ASP B 301 
F 4 HIS A 313 ? GLU A 316 ? HIS B 310 GLU B 313 
G 1 ILE A 322 ? TRP A 327 ? ILE B 319 TRP B 324 
G 2 ILE A 334 ? GLY A 339 ? ILE B 331 GLY B 336 
G 3 LEU A 344 ? ASP A 348 ? LEU B 341 ASP B 345 
G 4 LEU A 368 ? HIS A 372 ? LEU B 365 HIS B 369 
H 1 TYR C 34  ? ALA C 41  ? TYR A 31  ALA A 38  
H 2 ILE C 400 ? MSE C 406 ? ILE A 397 MSE A 403 
H 3 VAL C 391 ? SER C 396 ? VAL A 388 SER A 393 
H 4 ILE C 379 ? TRP C 384 ? ILE A 376 TRP A 381 
I 1 GLN C 50  ? THR C 56  ? GLN A 47  THR A 53  
I 2 TYR C 63  ? GLY C 71  ? TYR A 60  GLY A 68  
I 3 ASN C 79  ? PRO C 89  ? ASN A 76  PRO A 86  
I 4 LYS C 116 ? HIS C 125 ? LYS A 113 HIS A 122 
J 1 ARG C 131 ? MSE C 135 ? ARG A 128 MSE A 132 
J 2 ASN C 138 ? LYS C 145 ? ASN A 135 LYS A 142 
J 3 VAL C 151 ? ASP C 155 ? VAL A 148 ASP A 152 
J 4 LEU C 173 ? ARG C 176 ? LEU A 170 ARG A 173 
J 5 ILE C 218 ? ASP C 220 ? ILE A 215 ASP A 217 
K 1 LEU C 185 ? TRP C 187 ? LEU A 182 TRP A 184 
K 2 HIS C 194 ? ALA C 198 ? HIS A 191 ALA A 195 
K 3 VAL C 204 ? ASP C 208 ? VAL A 201 ASP A 205 
K 4 ALA C 223 ? PHE C 225 ? ALA A 220 PHE A 222 
L 1 VAL C 232 ? TRP C 237 ? VAL A 229 TRP A 234 
L 2 LEU C 244 ? ALA C 249 ? LEU A 241 ALA A 246 
L 3 LYS C 253 ? ASP C 258 ? LYS A 250 ASP A 255 
L 4 HIS C 269 ? ASP C 272 ? HIS A 266 ASP A 269 
M 1 VAL C 278 ? PHE C 283 ? VAL A 275 PHE A 280 
M 2 ILE C 290 ? SER C 295 ? ILE A 287 SER A 292 
M 3 THR C 299 ? ASP C 304 ? THR A 296 ASP A 301 
M 4 HIS C 313 ? GLU C 316 ? HIS A 310 GLU A 313 
N 1 ILE C 322 ? TRP C 327 ? ILE A 319 TRP A 324 
N 2 ILE C 334 ? GLY C 339 ? ILE A 331 GLY A 336 
N 3 LEU C 344 ? ASP C 348 ? LEU A 341 ASP A 345 
N 4 LEU C 368 ? HIS C 372 ? LEU A 365 HIS A 369 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 36  ? N LEU B 33  O GLN A 405 ? O GLN B 402 
A 2 3 O TRP A 404 ? O TRP B 401 N ILE A 392 ? N ILE B 389 
A 3 4 O VAL A 395 ? O VAL B 392 N ASP A 381 ? N ASP B 378 
B 1 2 N GLN A 50  ? N GLN B 47  O VAL A 69  ? O VAL B 66  
B 2 3 N LEU A 70  ? N LEU B 67  O VAL A 82  ? O VAL B 79  
B 3 4 N LEU A 81  ? N LEU B 78  O ILE A 123 ? O ILE B 120 
C 1 2 N MSE A 135 ? N MSE B 132 O ILE A 141 ? O ILE B 138 
C 2 3 N ILE A 142 ? N ILE B 139 O PHE A 154 ? O PHE B 151 
C 3 4 N VAL A 151 ? N VAL B 148 O LEU A 175 ? O LEU B 172 
C 4 5 N ARG A 176 ? N ARG B 173 O VAL A 219 ? O VAL B 216 
D 1 2 N SER A 186 ? N SER B 183 O LEU A 196 ? O LEU B 193 
D 2 3 N LEU A 195 ? N LEU B 192 O TRP A 207 ? O TRP B 204 
D 3 4 N VAL A 204 ? N VAL B 201 O PHE A 225 ? O PHE B 222 
E 1 2 N ALA A 236 ? N ALA B 233 O GLY A 246 ? O GLY B 243 
E 2 3 N SER A 247 ? N SER B 244 O MSE A 255 ? O MSE B 252 
E 3 4 N LEU A 254 ? N LEU B 251 O VAL A 271 ? O VAL B 268 
F 1 2 N ASN A 279 ? N ASN B 276 O GLY A 294 ? O GLY B 291 
F 2 3 N LEU A 291 ? N LEU B 288 O TRP A 303 ? O TRP B 300 
F 3 4 N VAL A 300 ? N VAL B 297 O PHE A 315 ? O PHE B 312 
G 1 2 N HIS A 326 ? N HIS B 323 O ALA A 336 ? O ALA B 333 
G 2 3 N LEU A 335 ? N LEU B 332 O TRP A 347 ? O TRP B 344 
G 3 4 N LEU A 344 ? N LEU B 341 O HIS A 372 ? O HIS B 369 
H 1 2 N MSE C 38  ? N MSE A 35  O ILE C 403 ? O ILE A 400 
H 2 3 O TRP C 404 ? O TRP A 401 N ILE C 392 ? N ILE A 389 
H 3 4 O VAL C 395 ? O VAL A 392 N ASP C 381 ? N ASP A 378 
I 1 2 N THR C 56  ? N THR A 53  O LEU C 65  ? O LEU A 62  
I 2 3 N LEU C 70  ? N LEU A 67  O VAL C 82  ? O VAL A 79  
I 3 4 N LEU C 81  ? N LEU A 78  O ILE C 123 ? O ILE A 120 
J 1 2 N MSE C 135 ? N MSE A 132 O ILE C 141 ? O ILE A 138 
J 2 3 N ILE C 142 ? N ILE A 139 O PHE C 154 ? O PHE A 151 
J 3 4 N VAL C 151 ? N VAL A 148 O LEU C 175 ? O LEU A 172 
J 4 5 N ARG C 174 ? N ARG A 171 O VAL C 219 ? O VAL A 216 
K 1 2 N SER C 186 ? N SER A 183 O LEU C 196 ? O LEU A 193 
K 2 3 N LEU C 195 ? N LEU A 192 O TRP C 207 ? O TRP A 204 
K 3 4 N VAL C 204 ? N VAL A 201 O PHE C 225 ? O PHE A 222 
L 1 2 N ALA C 236 ? N ALA A 233 O GLY C 246 ? O GLY A 243 
L 2 3 N PHE C 245 ? N PHE A 242 O TRP C 257 ? O TRP A 254 
L 3 4 N LEU C 254 ? N LEU A 251 O VAL C 271 ? O VAL A 268 
M 1 2 N CYS C 280 ? N CYS A 277 O GLY C 294 ? O GLY A 291 
M 2 3 N THR C 293 ? N THR A 290 O ALA C 301 ? O ALA A 298 
M 3 4 N VAL C 300 ? N VAL A 297 O PHE C 315 ? O PHE A 312 
N 1 2 N HIS C 326 ? N HIS A 323 O ALA C 336 ? O ALA A 333 
N 2 3 N LEU C 335 ? N LEU A 332 O TRP C 347 ? O TRP A 344 
N 3 4 N LEU C 344 ? N LEU A 341 O HIS C 372 ? O HIS A 369 
# 
_database_PDB_matrix.entry_id          3CFV 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3CFV 
_atom_sites.fract_transf_matrix[1][1]   0.009203 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000114 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.022326 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009125 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
AS 
C  
N  
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . HIS A 1 1   ? -14.398 -24.098 41.262  1.00 95.43  ? -2  HIS B N   1 
ATOM   2    C  CA  . HIS A 1 1   ? -15.867 -23.940 41.460  1.00 94.27  ? -2  HIS B CA  1 
ATOM   3    C  C   . HIS A 1 1   ? -16.187 -23.708 42.935  1.00 88.69  ? -2  HIS B C   1 
ATOM   4    O  O   . HIS A 1 1   ? -16.984 -22.834 43.279  1.00 90.74  ? -2  HIS B O   1 
ATOM   5    C  CB  . HIS A 1 1   ? -16.607 -25.174 40.935  1.00 98.84  ? -2  HIS B CB  1 
ATOM   6    C  CG  . HIS A 1 1   ? -18.082 -24.976 40.772  1.00 102.63 ? -2  HIS B CG  1 
ATOM   7    N  ND1 . HIS A 1 1   ? -19.014 -25.828 41.326  1.00 102.87 ? -2  HIS B ND1 1 
ATOM   8    C  CD2 . HIS A 1 1   ? -18.787 -24.023 40.118  1.00 103.85 ? -2  HIS B CD2 1 
ATOM   9    C  CE1 . HIS A 1 1   ? -20.228 -25.410 41.018  1.00 103.57 ? -2  HIS B CE1 1 
ATOM   10   N  NE2 . HIS A 1 1   ? -20.119 -24.315 40.287  1.00 104.46 ? -2  HIS B NE2 1 
HETATM 11   N  N   . MSE A 1 2   ? -15.559 -24.486 43.792  1.00 79.56  ? -1  MSE B N   1 
HETATM 12   C  CA  . MSE A 1 2   ? -15.751 -24.369 45.233  1.00 74.33  ? -1  MSE B CA  1 
HETATM 13   C  C   . MSE A 1 2   ? -14.540 -23.748 45.915  1.00 62.19  ? -1  MSE B C   1 
HETATM 14   O  O   . MSE A 1 2   ? -14.677 -22.852 46.745  0.50 61.21  ? -1  MSE B O   1 
HETATM 15   C  CB  . MSE A 1 2   ? -16.022 -25.739 45.842  1.00 78.26  ? -1  MSE B CB  1 
HETATM 16   C  CG  . MSE A 1 2   ? -17.485 -26.086 45.966  1.00 81.58  ? -1  MSE B CG  1 
HETATM 17   SE SE  . MSE A 1 2   ? -17.693 -27.868 46.708  1.00 87.40  ? -1  MSE B SE  1 
HETATM 18   C  CE  . MSE A 1 2   ? -16.127 -27.913 47.869  1.00 79.82  ? -1  MSE B CE  1 
ATOM   19   N  N   . ALA A 1 3   ? -13.367 -24.237 45.570  1.00 55.93  ? 0   ALA B N   1 
ATOM   20   C  CA  . ALA A 1 3   ? -12.125 -23.711 46.119  1.00 55.50  ? 0   ALA B CA  1 
ATOM   21   C  C   . ALA A 1 3   ? -11.990 -22.219 45.826  1.00 54.02  ? 0   ALA B C   1 
ATOM   22   O  O   . ALA A 1 3   ? -12.302 -21.760 44.726  1.00 49.95  ? 0   ALA B O   1 
ATOM   23   C  CB  . ALA A 1 3   ? -10.932 -24.476 45.567  1.00 49.04  ? 0   ALA B CB  1 
HETATM 24   N  N   . MSE A 1 4   ? -11.537 -21.473 46.811  1.00 52.22  ? 1   MSE B N   1 
HETATM 25   C  CA  . MSE A 1 4   ? -11.387 -20.033 46.667  1.00 58.00  ? 1   MSE B CA  1 
HETATM 26   C  C   . MSE A 1 4   ? -10.070 -19.688 45.991  1.00 54.91  ? 1   MSE B C   1 
HETATM 27   O  O   . MSE A 1 4   ? -9.110  -20.455 46.057  1.00 52.52  ? 1   MSE B O   1 
HETATM 28   C  CB  . MSE A 1 4   ? -11.445 -19.352 48.034  1.00 57.88  ? 1   MSE B CB  1 
HETATM 29   C  CG  . MSE A 1 4   ? -12.663 -19.712 48.858  1.00 68.18  ? 1   MSE B CG  1 
HETATM 30   SE SE  . MSE A 1 4   ? -12.650 -18.889 50.629  1.00 73.14  ? 1   MSE B SE  1 
HETATM 31   C  CE  . MSE A 1 4   ? -12.781 -17.014 50.130  1.00 75.25  ? 1   MSE B CE  1 
ATOM   32   N  N   . ALA A 1 5   ? -10.032 -18.541 45.343  1.00 57.25  ? 2   ALA B N   1 
ATOM   33   C  CA  . ALA A 1 5   ? -8.779  -17.996 44.846  1.00 57.37  ? 2   ALA B CA  1 
ATOM   34   C  C   . ALA A 1 5   ? -7.951  -17.556 46.047  1.00 57.59  ? 2   ALA B C   1 
ATOM   35   O  O   . ALA A 1 5   ? -8.427  -16.813 46.901  1.00 56.22  ? 2   ALA B O   1 
ATOM   36   C  CB  . ALA A 1 5   ? -9.033  -16.829 43.914  1.00 51.75  ? 2   ALA B CB  1 
ATOM   37   N  N   . SER A 1 6   ? -6.717  -18.037 46.119  1.00 63.54  ? 3   SER B N   1 
ATOM   38   C  CA  . SER A 1 6   ? -5.866  -17.769 47.267  1.00 67.91  ? 3   SER B CA  1 
ATOM   39   C  C   . SER A 1 6   ? -4.621  -16.994 46.858  1.00 73.60  ? 3   SER B C   1 
ATOM   40   O  O   . SER A 1 6   ? -3.686  -17.561 46.293  1.00 80.54  ? 3   SER B O   1 
ATOM   41   C  CB  . SER A 1 6   ? -5.470  -19.085 47.941  1.00 66.49  ? 3   SER B CB  1 
ATOM   42   O  OG  . SER A 1 6   ? -4.527  -18.867 48.974  1.00 69.16  ? 3   SER B OG  1 
ATOM   43   N  N   . LYS A 1 7   ? -4.610  -15.697 47.144  1.00 77.22  ? 4   LYS B N   1 
ATOM   44   C  CA  . LYS A 1 7   ? -3.450  -14.871 46.834  1.00 88.19  ? 4   LYS B CA  1 
ATOM   45   C  C   . LYS A 1 7   ? -2.449  -14.906 47.987  1.00 93.54  ? 4   LYS B C   1 
ATOM   46   O  O   . LYS A 1 7   ? -1.560  -14.060 48.080  1.00 97.33  ? 4   LYS B O   1 
ATOM   47   C  CB  . LYS A 1 7   ? -3.869  -13.436 46.508  1.00 89.84  ? 4   LYS B CB  1 
ATOM   48   C  CG  . LYS A 1 7   ? -2.937  -12.733 45.530  1.00 89.69  ? 4   LYS B CG  1 
ATOM   49   C  CD  . LYS A 1 7   ? -3.614  -11.541 44.877  1.00 88.88  ? 4   LYS B CD  1 
ATOM   50   C  CE  . LYS A 1 7   ? -2.751  -10.954 43.773  1.00 88.46  ? 4   LYS B CE  1 
ATOM   51   N  NZ  . LYS A 1 7   ? -3.442  -9.845  43.059  1.00 87.71  ? 4   LYS B NZ  1 
ATOM   52   N  N   . GLU A 1 8   ? -2.615  -15.902 48.854  1.00 102.02 ? 5   GLU B N   1 
ATOM   53   C  CA  . GLU A 1 8   ? -1.703  -16.192 49.964  1.00 109.08 ? 5   GLU B CA  1 
ATOM   54   C  C   . GLU A 1 8   ? -2.341  -17.246 50.868  1.00 113.26 ? 5   GLU B C   1 
ATOM   55   O  O   . GLU A 1 8   ? -3.164  -16.912 51.723  1.00 114.33 ? 5   GLU B O   1 
ATOM   56   C  CB  . GLU A 1 8   ? -1.351  -14.922 50.753  1.00 108.96 ? 5   GLU B CB  1 
ATOM   57   C  CG  . GLU A 1 8   ? -2.531  -14.001 51.060  1.00 107.79 ? 5   GLU B CG  1 
ATOM   58   C  CD  . GLU A 1 8   ? -2.107  -12.557 51.272  1.00 107.92 ? 5   GLU B CD  1 
ATOM   59   O  OE1 . GLU A 1 8   ? -2.906  -11.648 50.959  1.00 106.37 ? 5   GLU B OE1 1 
ATOM   60   O  OE2 . GLU A 1 8   ? -0.972  -12.331 51.745  1.00 109.18 ? 5   GLU B OE2 1 
HETATM 61   N  N   . MSE A 1 9   ? -1.975  -18.505 50.699  1.00 115.81 ? 6   MSE B N   1 
HETATM 62   C  CA  . MSE A 1 9   ? -0.860  -18.946 49.851  1.00 118.10 ? 6   MSE B CA  1 
HETATM 63   C  C   . MSE A 1 9   ? -1.297  -19.863 48.697  1.00 115.73 ? 6   MSE B C   1 
HETATM 64   O  O   . MSE A 1 9   ? -2.174  -20.705 48.892  1.00 118.11 ? 6   MSE B O   1 
HETATM 65   C  CB  . MSE A 1 9   ? 0.148   -19.702 50.725  1.00 120.00 ? 6   MSE B CB  1 
HETATM 66   C  CG  . MSE A 1 9   ? -0.449  -20.327 52.001  1.00 120.00 ? 6   MSE B CG  1 
HETATM 67   SE SE  . MSE A 1 9   ? -1.856  -21.684 51.759  1.00 120.00 ? 6   MSE B SE  1 
HETATM 68   C  CE  . MSE A 1 9   ? -0.760  -23.150 51.062  1.00 120.00 ? 6   MSE B CE  1 
ATOM   69   N  N   . PHE A 1 10  ? -0.724  -19.725 47.512  1.00 110.40 ? 7   PHE B N   1 
ATOM   70   C  CA  . PHE A 1 10  ? 0.197   -18.646 47.102  1.00 105.25 ? 7   PHE B CA  1 
ATOM   71   C  C   . PHE A 1 10  ? 1.668   -18.414 47.481  1.00 97.32  ? 7   PHE B C   1 
ATOM   72   O  O   . PHE A 1 10  ? 2.332   -17.554 46.897  1.00 94.92  ? 7   PHE B O   1 
ATOM   73   C  CB  . PHE A 1 10  ? -0.159  -17.312 47.762  1.00 110.81 ? 7   PHE B CB  1 
ATOM   74   C  CG  . PHE A 1 10  ? 0.450   -16.115 47.085  1.00 113.92 ? 7   PHE B CG  1 
ATOM   75   C  CD1 . PHE A 1 10  ? 0.018   -15.718 45.827  1.00 114.79 ? 7   PHE B CD1 1 
ATOM   76   C  CD2 . PHE A 1 10  ? 1.442   -15.376 47.713  1.00 113.36 ? 7   PHE B CD2 1 
ATOM   77   C  CE1 . PHE A 1 10  ? 0.572   -14.613 45.204  1.00 114.90 ? 7   PHE B CE1 1 
ATOM   78   C  CE2 . PHE A 1 10  ? 2.000   -14.270 47.094  1.00 113.57 ? 7   PHE B CE2 1 
ATOM   79   C  CZ  . PHE A 1 10  ? 1.565   -13.888 45.839  1.00 113.59 ? 7   PHE B CZ  1 
ATOM   80   N  N   . GLU A 1 11  ? 2.170   -19.168 48.455  1.00 88.63  ? 8   GLU B N   1 
ATOM   81   C  CA  . GLU A 1 11  ? 3.606   -19.237 48.728  1.00 72.40  ? 8   GLU B CA  1 
ATOM   82   C  C   . GLU A 1 11  ? 4.200   -20.641 48.671  1.00 60.30  ? 8   GLU B C   1 
ATOM   83   O  O   . GLU A 1 11  ? 3.483   -21.637 48.578  1.00 61.86  ? 8   GLU B O   1 
ATOM   84   C  CB  . GLU A 1 11  ? 3.913   -18.617 50.095  1.00 75.94  ? 8   GLU B CB  1 
ATOM   85   C  CG  . GLU A 1 11  ? 3.272   -19.341 51.267  1.00 87.00  ? 8   GLU B CG  1 
ATOM   86   C  CD  . GLU A 1 11  ? 3.498   -18.630 52.588  1.00 93.01  ? 8   GLU B CD  1 
ATOM   87   O  OE1 . GLU A 1 11  ? 4.416   -17.783 52.663  1.00 96.26  ? 8   GLU B OE1 1 
ATOM   88   O  OE2 . GLU A 1 11  ? 2.762   -18.923 53.554  1.00 93.44  ? 8   GLU B OE2 1 
ATOM   89   N  N   . ASP A 1 12  ? 5.526   -20.698 48.724  1.00 45.71  ? 9   ASP B N   1 
ATOM   90   C  CA  . ASP A 1 12  ? 6.248   -21.951 48.876  1.00 40.62  ? 9   ASP B CA  1 
ATOM   91   C  C   . ASP A 1 12  ? 6.557   -22.140 50.356  1.00 37.58  ? 9   ASP B C   1 
ATOM   92   O  O   . ASP A 1 12  ? 7.434   -21.477 50.906  1.00 37.89  ? 9   ASP B O   1 
ATOM   93   C  CB  . ASP A 1 12  ? 7.542   -21.918 48.062  1.00 38.32  ? 9   ASP B CB  1 
ATOM   94   C  CG  . ASP A 1 12  ? 8.231   -23.271 47.995  1.00 36.44  ? 9   ASP B CG  1 
ATOM   95   O  OD1 . ASP A 1 12  ? 7.938   -24.147 48.837  1.00 31.92  ? 9   ASP B OD1 1 
ATOM   96   O  OD2 . ASP A 1 12  ? 9.074   -23.456 47.092  1.00 37.89  ? 9   ASP B OD2 1 
ATOM   97   N  N   . THR A 1 13  ? 5.824   -23.040 51.000  1.00 36.92  ? 10  THR B N   1 
ATOM   98   C  CA  . THR A 1 13  ? 5.940   -23.234 52.442  1.00 37.45  ? 10  THR B CA  1 
ATOM   99   C  C   . THR A 1 13  ? 7.288   -23.831 52.842  1.00 38.02  ? 10  THR B C   1 
ATOM   100  O  O   . THR A 1 13  ? 7.715   -23.702 53.990  1.00 36.38  ? 10  THR B O   1 
ATOM   101  C  CB  . THR A 1 13  ? 4.800   -24.123 52.982  1.00 37.17  ? 10  THR B CB  1 
ATOM   102  O  OG1 . THR A 1 13  ? 4.820   -25.390 52.311  1.00 31.69  ? 10  THR B OG1 1 
ATOM   103  C  CG2 . THR A 1 13  ? 3.453   -23.456 52.752  1.00 29.86  ? 10  THR B CG2 1 
ATOM   104  N  N   . VAL A 1 14  ? 7.949   -24.488 51.893  1.00 32.63  ? 11  VAL B N   1 
ATOM   105  C  CA  . VAL A 1 14  ? 9.265   -25.061 52.138  1.00 35.45  ? 11  VAL B CA  1 
ATOM   106  C  C   . VAL A 1 14  ? 10.318  -23.961 52.127  1.00 40.74  ? 11  VAL B C   1 
ATOM   107  O  O   . VAL A 1 14  ? 11.114  -23.838 53.059  1.00 38.88  ? 11  VAL B O   1 
ATOM   108  C  CB  . VAL A 1 14  ? 9.639   -26.126 51.083  1.00 28.80  ? 11  VAL B CB  1 
ATOM   109  C  CG1 . VAL A 1 14  ? 11.064  -26.604 51.298  1.00 27.11  ? 11  VAL B CG1 1 
ATOM   110  C  CG2 . VAL A 1 14  ? 8.674   -27.300 51.137  1.00 26.95  ? 11  VAL B CG2 1 
ATOM   111  N  N   . GLU A 1 15  ? 10.310  -23.161 51.066  1.00 41.60  ? 12  GLU B N   1 
ATOM   112  C  CA  . GLU A 1 15  ? 11.264  -22.073 50.914  1.00 46.20  ? 12  GLU B CA  1 
ATOM   113  C  C   . GLU A 1 15  ? 11.068  -21.040 52.019  1.00 42.26  ? 12  GLU B C   1 
ATOM   114  O  O   . GLU A 1 15  ? 12.032  -20.455 52.516  1.00 44.71  ? 12  GLU B O   1 
ATOM   115  C  CB  . GLU A 1 15  ? 11.108  -21.425 49.539  1.00 47.19  ? 12  GLU B CB  1 
ATOM   116  C  CG  . GLU A 1 15  ? 12.267  -20.534 49.127  1.00 62.59  ? 12  GLU B CG  1 
ATOM   117  C  CD  . GLU A 1 15  ? 12.080  -19.938 47.744  1.00 69.11  ? 12  GLU B CD  1 
ATOM   118  O  OE1 . GLU A 1 15  ? 12.719  -18.905 47.447  1.00 78.68  ? 12  GLU B OE1 1 
ATOM   119  O  OE2 . GLU A 1 15  ? 11.290  -20.501 46.954  1.00 77.68  ? 12  GLU B OE2 1 
ATOM   120  N  N   . GLU A 1 16  ? 9.813   -20.833 52.407  1.00 35.01  ? 13  GLU B N   1 
ATOM   121  C  CA  . GLU A 1 16  ? 9.468   -19.884 53.459  1.00 39.18  ? 13  GLU B CA  1 
ATOM   122  C  C   . GLU A 1 16  ? 10.234  -20.177 54.748  1.00 36.17  ? 13  GLU B C   1 
ATOM   123  O  O   . GLU A 1 16  ? 10.803  -19.271 55.356  1.00 34.05  ? 13  GLU B O   1 
ATOM   124  C  CB  . GLU A 1 16  ? 7.957   -19.898 53.722  1.00 42.04  ? 13  GLU B CB  1 
ATOM   125  C  CG  . GLU A 1 16  ? 7.464   -18.784 54.640  1.00 49.53  ? 13  GLU B CG  1 
ATOM   126  C  CD  . GLU A 1 16  ? 6.018   -18.970 55.079  1.00 51.01  ? 13  GLU B CD  1 
ATOM   127  O  OE1 . GLU A 1 16  ? 5.519   -18.128 55.855  1.00 58.72  ? 13  GLU B OE1 1 
ATOM   128  O  OE2 . GLU A 1 16  ? 5.378   -19.955 54.655  1.00 54.80  ? 13  GLU B OE2 1 
ATOM   129  N  N   . ARG A 1 17  ? 10.253  -21.444 55.157  1.00 33.02  ? 14  ARG B N   1 
ATOM   130  C  CA  . ARG A 1 17  ? 10.950  -21.848 56.378  1.00 29.77  ? 14  ARG B CA  1 
ATOM   131  C  C   . ARG A 1 17  ? 12.441  -21.526 56.318  1.00 32.24  ? 14  ARG B C   1 
ATOM   132  O  O   . ARG A 1 17  ? 13.009  -20.992 57.272  1.00 28.51  ? 14  ARG B O   1 
ATOM   133  C  CB  . ARG A 1 17  ? 10.753  -23.339 56.647  1.00 27.47  ? 14  ARG B CB  1 
ATOM   134  C  CG  . ARG A 1 17  ? 9.408   -23.697 57.255  1.00 29.79  ? 14  ARG B CG  1 
ATOM   135  C  CD  . ARG A 1 17  ? 9.360   -25.173 57.602  1.00 33.61  ? 14  ARG B CD  1 
ATOM   136  N  NE  . ARG A 1 17  ? 8.026   -25.617 58.000  1.00 33.18  ? 14  ARG B NE  1 
ATOM   137  C  CZ  . ARG A 1 17  ? 7.055   -25.921 57.146  1.00 34.12  ? 14  ARG B CZ  1 
ATOM   138  N  NH1 . ARG A 1 17  ? 7.259   -25.815 55.838  1.00 30.76  ? 14  ARG B NH1 1 
ATOM   139  N  NH2 . ARG A 1 17  ? 5.874   -26.326 57.598  1.00 35.64  ? 14  ARG B NH2 1 
ATOM   140  N  N   . VAL A 1 18  ? 13.063  -21.856 55.191  1.00 28.39  ? 15  VAL B N   1 
ATOM   141  C  CA  . VAL A 1 18  ? 14.479  -21.589 54.974  1.00 28.65  ? 15  VAL B CA  1 
ATOM   142  C  C   . VAL A 1 18  ? 14.773  -20.096 55.057  1.00 32.36  ? 15  VAL B C   1 
ATOM   143  O  O   . VAL A 1 18  ? 15.680  -19.670 55.771  1.00 36.41  ? 15  VAL B O   1 
ATOM   144  C  CB  . VAL A 1 18  ? 14.934  -22.123 53.603  1.00 31.05  ? 15  VAL B CB  1 
ATOM   145  C  CG1 . VAL A 1 18  ? 16.355  -21.672 53.289  1.00 23.68  ? 15  VAL B CG1 1 
ATOM   146  C  CG2 . VAL A 1 18  ? 14.815  -23.641 53.563  1.00 31.58  ? 15  VAL B CG2 1 
ATOM   147  N  N   . ILE A 1 19  ? 13.993  -19.307 54.325  1.00 37.69  ? 16  ILE B N   1 
ATOM   148  C  CA  . ILE A 1 19  ? 14.137  -17.855 54.324  1.00 34.53  ? 16  ILE B CA  1 
ATOM   149  C  C   . ILE A 1 19  ? 14.038  -17.273 55.738  1.00 34.39  ? 16  ILE B C   1 
ATOM   150  O  O   . ILE A 1 19  ? 14.861  -16.445 56.134  1.00 32.23  ? 16  ILE B O   1 
ATOM   151  C  CB  . ILE A 1 19  ? 13.085  -17.197 53.403  1.00 34.31  ? 16  ILE B CB  1 
ATOM   152  C  CG1 . ILE A 1 19  ? 13.392  -17.518 51.938  1.00 36.59  ? 16  ILE B CG1 1 
ATOM   153  C  CG2 . ILE A 1 19  ? 13.043  -15.696 53.617  1.00 33.44  ? 16  ILE B CG2 1 
ATOM   154  C  CD1 . ILE A 1 19  ? 12.351  -17.004 50.963  1.00 33.54  ? 16  ILE B CD1 1 
ATOM   155  N  N   . ASN A 1 20  ? 13.038  -17.721 56.494  1.00 30.11  ? 17  ASN B N   1 
ATOM   156  C  CA  . ASN A 1 20  ? 12.814  -17.241 57.858  1.00 33.70  ? 17  ASN B CA  1 
ATOM   157  C  C   . ASN A 1 20  ? 13.940  -17.572 58.836  1.00 39.96  ? 17  ASN B C   1 
ATOM   158  O  O   . ASN A 1 20  ? 14.313  -16.740 59.662  1.00 40.92  ? 17  ASN B O   1 
ATOM   159  C  CB  . ASN A 1 20  ? 11.488  -17.771 58.404  1.00 31.48  ? 17  ASN B CB  1 
ATOM   160  C  CG  . ASN A 1 20  ? 10.297  -16.965 57.928  1.00 40.95  ? 17  ASN B CG  1 
ATOM   161  O  OD1 . ASN A 1 20  ? 10.439  -16.026 57.140  1.00 40.78  ? 17  ASN B OD1 1 
ATOM   162  N  ND2 . ASN A 1 20  ? 9.112   -17.326 58.405  1.00 39.53  ? 17  ASN B ND2 1 
ATOM   163  N  N   . GLU A 1 21  ? 14.471  -18.787 58.747  1.00 37.16  ? 18  GLU B N   1 
ATOM   164  C  CA  . GLU A 1 21  ? 15.548  -19.202 59.635  1.00 35.72  ? 18  GLU B CA  1 
ATOM   165  C  C   . GLU A 1 21  ? 16.841  -18.450 59.336  1.00 37.05  ? 18  GLU B C   1 
ATOM   166  O  O   . GLU A 1 21  ? 17.605  -18.133 60.250  1.00 32.51  ? 18  GLU B O   1 
ATOM   167  C  CB  . GLU A 1 21  ? 15.772  -20.715 59.568  1.00 34.84  ? 18  GLU B CB  1 
ATOM   168  C  CG  . GLU A 1 21  ? 14.653  -21.543 60.190  1.00 36.28  ? 18  GLU B CG  1 
ATOM   169  C  CD  . GLU A 1 21  ? 14.468  -21.276 61.676  1.00 42.43  ? 18  GLU B CD  1 
ATOM   170  O  OE1 . GLU A 1 21  ? 15.444  -20.868 62.342  1.00 43.41  ? 18  GLU B OE1 1 
ATOM   171  O  OE2 . GLU A 1 21  ? 13.343  -21.481 62.181  1.00 43.75  ? 18  GLU B OE2 1 
ATOM   172  N  N   . GLU A 1 22  ? 17.078  -18.160 58.059  1.00 32.13  ? 19  GLU B N   1 
ATOM   173  C  CA  . GLU A 1 22  ? 18.227  -17.347 57.667  1.00 31.66  ? 19  GLU B CA  1 
ATOM   174  C  C   . GLU A 1 22  ? 18.046  -15.901 58.111  1.00 33.26  ? 19  GLU B C   1 
ATOM   175  O  O   . GLU A 1 22  ? 19.023  -15.198 58.365  1.00 41.26  ? 19  GLU B O   1 
ATOM   176  C  CB  . GLU A 1 22  ? 18.452  -17.406 56.156  1.00 31.96  ? 19  GLU B CB  1 
ATOM   177  C  CG  . GLU A 1 22  ? 18.928  -18.759 55.659  1.00 47.47  ? 19  GLU B CG  1 
ATOM   178  C  CD  . GLU A 1 22  ? 19.402  -18.723 54.219  1.00 56.60  ? 19  GLU B CD  1 
ATOM   179  O  OE1 . GLU A 1 22  ? 19.503  -17.616 53.647  1.00 59.30  ? 19  GLU B OE1 1 
ATOM   180  O  OE2 . GLU A 1 22  ? 19.678  -19.806 53.659  1.00 64.45  ? 19  GLU B OE2 1 
ATOM   181  N  N   . TYR A 1 23  ? 16.793  -15.462 58.200  1.00 34.60  ? 20  TYR B N   1 
ATOM   182  C  CA  . TYR A 1 23  ? 16.481  -14.116 58.661  1.00 32.85  ? 20  TYR B CA  1 
ATOM   183  C  C   . TYR A 1 23  ? 16.709  -13.982 60.164  1.00 34.61  ? 20  TYR B C   1 
ATOM   184  O  O   . TYR A 1 23  ? 17.260  -12.985 60.627  1.00 36.46  ? 20  TYR B O   1 
ATOM   185  C  CB  . TYR A 1 23  ? 15.036  -13.744 58.319  1.00 32.25  ? 20  TYR B CB  1 
ATOM   186  C  CG  . TYR A 1 23  ? 14.613  -12.401 58.874  1.00 28.79  ? 20  TYR B CG  1 
ATOM   187  C  CD1 . TYR A 1 23  ? 14.838  -11.230 58.162  1.00 27.78  ? 20  TYR B CD1 1 
ATOM   188  C  CD2 . TYR A 1 23  ? 13.996  -12.304 60.114  1.00 27.44  ? 20  TYR B CD2 1 
ATOM   189  C  CE1 . TYR A 1 23  ? 14.456  -10.000 58.668  1.00 24.49  ? 20  TYR B CE1 1 
ATOM   190  C  CE2 . TYR A 1 23  ? 13.612  -11.077 60.628  1.00 25.38  ? 20  TYR B CE2 1 
ATOM   191  C  CZ  . TYR A 1 23  ? 13.844  -9.931  59.901  1.00 26.64  ? 20  TYR B CZ  1 
ATOM   192  O  OH  . TYR A 1 23  ? 13.463  -8.711  60.411  1.00 34.00  ? 20  TYR B OH  1 
ATOM   193  N  N   . LYS A 1 24  ? 16.275  -14.986 60.921  1.00 35.26  ? 21  LYS B N   1 
ATOM   194  C  CA  . LYS A 1 24  ? 16.480  -14.999 62.368  1.00 38.18  ? 21  LYS B CA  1 
ATOM   195  C  C   . LYS A 1 24  ? 17.952  -14.824 62.713  1.00 35.03  ? 21  LYS B C   1 
ATOM   196  O  O   . LYS A 1 24  ? 18.303  -14.016 63.570  1.00 33.86  ? 21  LYS B O   1 
ATOM   197  C  CB  . LYS A 1 24  ? 15.960  -16.300 62.981  1.00 32.53  ? 21  LYS B CB  1 
ATOM   198  C  CG  . LYS A 1 24  ? 14.453  -16.378 63.101  1.00 34.13  ? 21  LYS B CG  1 
ATOM   199  C  CD  . LYS A 1 24  ? 14.038  -17.693 63.728  1.00 41.42  ? 21  LYS B CD  1 
ATOM   200  C  CE  . LYS A 1 24  ? 12.545  -17.914 63.614  1.00 48.78  ? 21  LYS B CE  1 
ATOM   201  N  NZ  . LYS A 1 24  ? 12.189  -19.329 63.904  1.00 54.79  ? 21  LYS B NZ  1 
ATOM   202  N  N   . ILE A 1 25  ? 18.801  -15.588 62.030  0.50 31.44  ? 22  ILE B N   1 
ATOM   203  C  CA  . ILE A 1 25  ? 20.243  -15.541 62.234  0.50 28.98  ? 22  ILE B CA  1 
ATOM   204  C  C   . ILE A 1 25  ? 20.818  -14.186 61.835  0.50 33.91  ? 22  ILE B C   1 
ATOM   205  O  O   . ILE A 1 25  ? 21.690  -13.648 62.516  1.00 40.86  ? 22  ILE B O   1 
ATOM   206  C  CB  . ILE A 1 25  ? 20.949  -16.664 61.447  0.50 27.87  ? 22  ILE B CB  1 
ATOM   207  C  CG1 . ILE A 1 25  ? 20.633  -18.023 62.076  0.50 20.85  ? 22  ILE B CG1 1 
ATOM   208  C  CG2 . ILE A 1 25  ? 22.453  -16.430 61.400  0.50 26.49  ? 22  ILE B CG2 1 
ATOM   209  C  CD1 . ILE A 1 25  ? 21.117  -19.199 61.265  0.50 25.65  ? 22  ILE B CD1 1 
ATOM   210  N  N   . TRP A 1 26  ? 20.319  -13.638 60.732  1.00 31.06  ? 23  TRP B N   1 
ATOM   211  C  CA  . TRP A 1 26  ? 20.737  -12.315 60.274  1.00 30.64  ? 23  TRP B CA  1 
ATOM   212  C  C   . TRP A 1 26  ? 20.426  -11.233 61.307  1.00 31.63  ? 23  TRP B C   1 
ATOM   213  O  O   . TRP A 1 26  ? 21.222  -10.319 61.524  1.00 30.58  ? 23  TRP B O   1 
ATOM   214  C  CB  . TRP A 1 26  ? 20.049  -11.970 58.950  1.00 25.90  ? 23  TRP B CB  1 
ATOM   215  C  CG  . TRP A 1 26  ? 20.256  -10.552 58.520  1.00 22.39  ? 23  TRP B CG  1 
ATOM   216  C  CD1 . TRP A 1 26  ? 21.296  -10.061 57.784  1.00 26.14  ? 23  TRP B CD1 1 
ATOM   217  C  CD2 . TRP A 1 26  ? 19.401  -9.438  58.800  1.00 20.79  ? 23  TRP B CD2 1 
ATOM   218  N  NE1 . TRP A 1 26  ? 21.141  -8.708  57.587  1.00 27.32  ? 23  TRP B NE1 1 
ATOM   219  C  CE2 . TRP A 1 26  ? 19.986  -8.302  58.204  1.00 22.95  ? 23  TRP B CE2 1 
ATOM   220  C  CE3 . TRP A 1 26  ? 18.196  -9.291  59.496  1.00 26.89  ? 23  TRP B CE3 1 
ATOM   221  C  CZ2 . TRP A 1 26  ? 19.408  -7.036  58.283  1.00 26.64  ? 23  TRP B CZ2 1 
ATOM   222  C  CZ3 . TRP A 1 26  ? 17.622  -8.033  59.573  1.00 28.96  ? 23  TRP B CZ3 1 
ATOM   223  C  CH2 . TRP A 1 26  ? 18.229  -6.921  58.970  1.00 28.74  ? 23  TRP B CH2 1 
ATOM   224  N  N   . LYS A 1 27  ? 19.261  -11.351 61.936  1.00 30.06  ? 24  LYS B N   1 
ATOM   225  C  CA  . LYS A 1 27  ? 18.763  -10.343 62.863  1.00 34.60  ? 24  LYS B CA  1 
ATOM   226  C  C   . LYS A 1 27  ? 19.632  -10.216 64.114  1.00 39.05  ? 24  LYS B C   1 
ATOM   227  O  O   . LYS A 1 27  ? 19.925  -9.110  64.563  1.00 36.57  ? 24  LYS B O   1 
ATOM   228  C  CB  . LYS A 1 27  ? 17.315  -10.657 63.246  1.00 36.12  ? 24  LYS B CB  1 
ATOM   229  C  CG  . LYS A 1 27  ? 16.569  -9.514  63.918  1.00 39.93  ? 24  LYS B CG  1 
ATOM   230  C  CD  . LYS A 1 27  ? 15.177  -9.964  64.343  1.00 46.56  ? 24  LYS B CD  1 
ATOM   231  C  CE  . LYS A 1 27  ? 14.479  -8.918  65.199  1.00 48.78  ? 24  LYS B CE  1 
ATOM   232  N  NZ  . LYS A 1 27  ? 14.182  -7.679  64.429  1.00 53.68  ? 24  LYS B NZ  1 
ATOM   233  N  N   . LYS A 1 28  ? 20.044  -11.347 64.676  1.00 45.13  ? 25  LYS B N   1 
ATOM   234  C  CA  . LYS A 1 28  ? 20.889  -11.323 65.866  1.00 48.57  ? 25  LYS B CA  1 
ATOM   235  C  C   . LYS A 1 28  ? 22.318  -10.907 65.525  1.00 43.03  ? 25  LYS B C   1 
ATOM   236  O  O   . LYS A 1 28  ? 23.118  -10.619 66.413  1.00 49.21  ? 25  LYS B O   1 
ATOM   237  C  CB  . LYS A 1 28  ? 20.865  -12.670 66.597  1.00 46.16  ? 25  LYS B CB  1 
ATOM   238  C  CG  . LYS A 1 28  ? 21.179  -13.871 65.724  1.00 54.47  ? 25  LYS B CG  1 
ATOM   239  C  CD  . LYS A 1 28  ? 21.129  -15.163 66.529  1.00 58.22  ? 25  LYS B CD  1 
ATOM   240  C  CE  . LYS A 1 28  ? 19.755  -15.385 67.153  1.00 61.54  ? 25  LYS B CE  1 
ATOM   241  N  NZ  . LYS A 1 28  ? 18.718  -15.744 66.147  1.00 60.93  ? 25  LYS B NZ  1 
ATOM   242  N  N   . ASN A 1 29  ? 22.623  -10.862 64.231  1.00 35.49  ? 26  ASN B N   1 
ATOM   243  C  CA  . ASN A 1 29  ? 23.926  -10.413 63.760  1.00 30.20  ? 26  ASN B CA  1 
ATOM   244  C  C   . ASN A 1 29  ? 23.958  -8.926  63.435  1.00 35.24  ? 26  ASN B C   1 
ATOM   245  O  O   . ASN A 1 29  ? 25.030  -8.357  63.226  1.00 38.09  ? 26  ASN B O   1 
ATOM   246  C  CB  . ASN A 1 29  ? 24.351  -11.203 62.521  1.00 37.89  ? 26  ASN B CB  1 
ATOM   247  C  CG  . ASN A 1 29  ? 24.928  -12.563 62.861  1.00 44.57  ? 26  ASN B CG  1 
ATOM   248  O  OD1 . ASN A 1 29  ? 25.030  -13.436 61.999  1.00 44.98  ? 26  ASN B OD1 1 
ATOM   249  N  ND2 . ASN A 1 29  ? 25.312  -12.750 64.121  1.00 43.45  ? 26  ASN B ND2 1 
ATOM   250  N  N   . THR A 1 30  ? 22.786  -8.296  63.389  1.00 33.51  ? 27  THR B N   1 
ATOM   251  C  CA  . THR A 1 30  ? 22.698  -6.903  62.951  1.00 33.01  ? 27  THR B CA  1 
ATOM   252  C  C   . THR A 1 30  ? 23.587  -5.944  63.746  1.00 36.60  ? 27  THR B C   1 
ATOM   253  O  O   . THR A 1 30  ? 24.218  -5.064  63.156  1.00 34.32  ? 27  THR B O   1 
ATOM   254  C  CB  . THR A 1 30  ? 21.241  -6.377  62.915  1.00 35.13  ? 27  THR B CB  1 
ATOM   255  O  OG1 . THR A 1 30  ? 20.595  -6.637  64.168  1.00 33.71  ? 27  THR B OG1 1 
ATOM   256  C  CG2 . THR A 1 30  ? 20.462  -7.043  61.794  1.00 34.70  ? 27  THR B CG2 1 
ATOM   257  N  N   . PRO A 1 31  ? 23.649  -6.110  65.082  1.00 34.94  ? 28  PRO B N   1 
ATOM   258  C  CA  . PRO A 1 31  ? 24.449  -5.204  65.908  1.00 36.19  ? 28  PRO B CA  1 
ATOM   259  C  C   . PRO A 1 31  ? 25.929  -5.195  65.526  1.00 38.46  ? 28  PRO B C   1 
ATOM   260  O  O   . PRO A 1 31  ? 26.630  -4.223  65.812  1.00 41.15  ? 28  PRO B O   1 
ATOM   261  C  CB  . PRO A 1 31  ? 24.271  -5.766  67.324  1.00 36.23  ? 28  PRO B CB  1 
ATOM   262  C  CG  . PRO A 1 31  ? 23.006  -6.546  67.268  1.00 35.77  ? 28  PRO B CG  1 
ATOM   263  C  CD  . PRO A 1 31  ? 22.979  -7.139  65.898  1.00 34.89  ? 28  PRO B CD  1 
ATOM   264  N  N   . PHE A 1 32  ? 26.395  -6.267  64.888  1.00 36.07  ? 29  PHE B N   1 
ATOM   265  C  CA  . PHE A 1 32  ? 27.773  -6.337  64.408  1.00 35.69  ? 29  PHE B CA  1 
ATOM   266  C  C   . PHE A 1 32  ? 27.918  -5.696  63.039  1.00 32.99  ? 29  PHE B C   1 
ATOM   267  O  O   . PHE A 1 32  ? 28.945  -5.095  62.735  1.00 40.38  ? 29  PHE B O   1 
ATOM   268  C  CB  . PHE A 1 32  ? 28.245  -7.790  64.303  1.00 43.77  ? 29  PHE B CB  1 
ATOM   269  C  CG  . PHE A 1 32  ? 28.287  -8.517  65.612  1.00 47.26  ? 29  PHE B CG  1 
ATOM   270  C  CD1 . PHE A 1 32  ? 29.191  -8.150  66.597  1.00 48.59  ? 29  PHE B CD1 1 
ATOM   271  C  CD2 . PHE A 1 32  ? 27.438  -9.585  65.850  1.00 43.96  ? 29  PHE B CD2 1 
ATOM   272  C  CE1 . PHE A 1 32  ? 29.236  -8.825  67.801  1.00 48.64  ? 29  PHE B CE1 1 
ATOM   273  C  CE2 . PHE A 1 32  ? 27.480  -10.265 67.052  1.00 51.97  ? 29  PHE B CE2 1 
ATOM   274  C  CZ  . PHE A 1 32  ? 28.381  -9.884  68.031  1.00 48.77  ? 29  PHE B CZ  1 
ATOM   275  N  N   . LEU A 1 33  ? 26.886  -5.835  62.212  1.00 43.37  ? 30  LEU B N   1 
ATOM   276  C  CA  . LEU A 1 33  ? 26.990  -5.507  60.791  1.00 38.38  ? 30  LEU B CA  1 
ATOM   277  C  C   . LEU A 1 33  ? 26.485  -4.118  60.403  1.00 38.96  ? 30  LEU B C   1 
ATOM   278  O  O   . LEU A 1 33  ? 26.850  -3.605  59.345  1.00 44.73  ? 30  LEU B O   1 
ATOM   279  C  CB  . LEU A 1 33  ? 26.274  -6.569  59.952  1.00 37.14  ? 30  LEU B CB  1 
ATOM   280  C  CG  . LEU A 1 33  ? 26.898  -7.966  59.925  1.00 33.98  ? 30  LEU B CG  1 
ATOM   281  C  CD1 . LEU A 1 33  ? 26.090  -8.895  59.037  1.00 33.03  ? 30  LEU B CD1 1 
ATOM   282  C  CD2 . LEU A 1 33  ? 28.336  -7.894  59.446  1.00 35.73  ? 30  LEU B CD2 1 
ATOM   283  N  N   . TYR A 1 34  ? 25.655  -3.512  61.248  1.00 35.96  ? 31  TYR B N   1 
ATOM   284  C  CA  . TYR A 1 34  ? 25.024  -2.235  60.907  1.00 35.61  ? 31  TYR B CA  1 
ATOM   285  C  C   . TYR A 1 34  ? 25.166  -1.176  61.998  1.00 36.97  ? 31  TYR B C   1 
ATOM   286  O  O   . TYR A 1 34  ? 25.043  -1.476  63.184  1.00 34.01  ? 31  TYR B O   1 
ATOM   287  C  CB  . TYR A 1 34  ? 23.530  -2.429  60.623  1.00 35.60  ? 31  TYR B CB  1 
ATOM   288  C  CG  . TYR A 1 34  ? 23.187  -3.479  59.586  1.00 31.81  ? 31  TYR B CG  1 
ATOM   289  C  CD1 . TYR A 1 34  ? 23.087  -3.151  58.238  1.00 34.20  ? 31  TYR B CD1 1 
ATOM   290  C  CD2 . TYR A 1 34  ? 22.930  -4.790  59.960  1.00 28.43  ? 31  TYR B CD2 1 
ATOM   291  C  CE1 . TYR A 1 34  ? 22.761  -4.106  57.290  1.00 35.44  ? 31  TYR B CE1 1 
ATOM   292  C  CE2 . TYR A 1 34  ? 22.608  -5.751  59.022  1.00 36.65  ? 31  TYR B CE2 1 
ATOM   293  C  CZ  . TYR A 1 34  ? 22.523  -5.407  57.689  1.00 37.09  ? 31  TYR B CZ  1 
ATOM   294  O  OH  . TYR A 1 34  ? 22.195  -6.368  56.758  1.00 33.49  ? 31  TYR B OH  1 
ATOM   295  N  N   . ASP A 1 35  ? 25.402  0.068   61.586  1.00 38.40  ? 32  ASP B N   1 
ATOM   296  C  CA  . ASP A 1 35  ? 25.329  1.206   62.503  1.00 35.77  ? 32  ASP B CA  1 
ATOM   297  C  C   . ASP A 1 35  ? 23.892  1.706   62.589  1.00 36.73  ? 32  ASP B C   1 
ATOM   298  O  O   . ASP A 1 35  ? 23.522  2.413   63.527  1.00 33.08  ? 32  ASP B O   1 
ATOM   299  C  CB  . ASP A 1 35  ? 26.256  2.340   62.055  1.00 39.31  ? 32  ASP B CB  1 
ATOM   300  C  CG  . ASP A 1 35  ? 27.673  2.187   62.590  1.00 50.30  ? 32  ASP B CG  1 
ATOM   301  O  OD1 . ASP A 1 35  ? 27.831  1.870   63.791  1.00 50.25  ? 32  ASP B OD1 1 
ATOM   302  O  OD2 . ASP A 1 35  ? 28.630  2.395   61.812  1.00 51.14  ? 32  ASP B OD2 1 
ATOM   303  N  N   . LEU A 1 36  ? 23.086  1.331   61.598  1.00 36.54  ? 33  LEU B N   1 
ATOM   304  C  CA  . LEU A 1 36  ? 21.677  1.701   61.557  1.00 30.07  ? 33  LEU B CA  1 
ATOM   305  C  C   . LEU A 1 36  ? 20.869  0.651   60.807  1.00 32.67  ? 33  LEU B C   1 
ATOM   306  O  O   . LEU A 1 36  ? 21.258  0.219   59.722  1.00 32.65  ? 33  LEU B O   1 
ATOM   307  C  CB  . LEU A 1 36  ? 21.498  3.070   60.891  1.00 29.06  ? 33  LEU B CB  1 
ATOM   308  C  CG  . LEU A 1 36  ? 20.068  3.552   60.613  1.00 25.10  ? 33  LEU B CG  1 
ATOM   309  C  CD1 . LEU A 1 36  ? 19.277  3.712   61.903  1.00 28.28  ? 33  LEU B CD1 1 
ATOM   310  C  CD2 . LEU A 1 36  ? 20.085  4.861   59.840  1.00 27.36  ? 33  LEU B CD2 1 
ATOM   311  N  N   . VAL A 1 37  ? 19.754  0.235   61.402  1.00 33.87  ? 34  VAL B N   1 
ATOM   312  C  CA  . VAL A 1 37  ? 18.789  -0.643  60.737  1.00 37.13  ? 34  VAL B CA  1 
ATOM   313  C  C   . VAL A 1 37  ? 17.368  -0.309  61.159  1.00 37.18  ? 34  VAL B C   1 
ATOM   314  O  O   . VAL A 1 37  ? 17.004  -0.461  62.326  1.00 38.63  ? 34  VAL B O   1 
ATOM   315  C  CB  . VAL A 1 37  ? 19.047  -2.144  61.014  1.00 35.97  ? 34  VAL B CB  1 
ATOM   316  C  CG1 . VAL A 1 37  ? 19.562  -2.839  59.768  1.00 35.96  ? 34  VAL B CG1 1 
ATOM   317  C  CG2 . VAL A 1 37  ? 19.992  -2.330  62.194  1.00 43.42  ? 34  VAL B CG2 1 
HETATM 318  N  N   . MSE A 1 38  ? 16.578  0.144   60.209  1.00 34.88  ? 35  MSE B N   1 
HETATM 319  C  CA  . MSE A 1 38  ? 15.176  0.450   60.450  1.00 37.89  ? 35  MSE B CA  1 
HETATM 320  C  C   . MSE A 1 38  ? 14.306  -0.327  59.475  1.00 31.60  ? 35  MSE B C   1 
HETATM 321  O  O   . MSE A 1 38  ? 14.625  -0.417  58.290  1.00 28.63  ? 35  MSE B O   1 
HETATM 322  C  CB  . MSE A 1 38  ? 14.916  1.946   60.281  1.00 38.43  ? 35  MSE B CB  1 
HETATM 323  C  CG  . MSE A 1 38  ? 15.805  2.842   61.121  1.00 45.90  ? 35  MSE B CG  1 
HETATM 324  SE SE  . MSE A 1 38  ? 15.510  4.732   60.735  1.00 59.01  ? 35  MSE B SE  1 
HETATM 325  C  CE  . MSE A 1 38  ? 13.719  4.898   61.454  1.00 54.79  ? 35  MSE B CE  1 
ATOM   326  N  N   . THR A 1 39  ? 13.221  -0.887  59.967  1.00 29.98  ? 36  THR B N   1 
ATOM   327  C  CA  . THR A 1 39  ? 12.289  -1.602  59.102  1.00 33.88  ? 36  THR B CA  1 
ATOM   328  C  C   . THR A 1 39  ? 10.863  -1.104  59.276  1.00 34.23  ? 36  THR B C   1 
ATOM   329  O  O   . THR A 1 39  ? 10.464  -0.683  60.363  1.00 30.25  ? 36  THR B O   1 
ATOM   330  C  CB  . THR A 1 39  ? 12.321  -3.124  59.341  1.00 36.49  ? 36  THR B CB  1 
ATOM   331  O  OG1 . THR A 1 39  ? 11.934  -3.409  60.690  1.00 45.50  ? 36  THR B OG1 1 
ATOM   332  C  CG2 . THR A 1 39  ? 13.714  -3.675  59.084  1.00 38.96  ? 36  THR B CG2 1 
ATOM   333  N  N   . HIS A 1 40  ? 10.101  -1.156  58.190  1.00 28.66  ? 37  HIS B N   1 
ATOM   334  C  CA  . HIS A 1 40  ? 8.698   -0.778  58.217  1.00 30.36  ? 37  HIS B CA  1 
ATOM   335  C  C   . HIS A 1 40  ? 7.922   -1.591  57.187  1.00 29.22  ? 37  HIS B C   1 
ATOM   336  O  O   . HIS A 1 40  ? 8.392   -1.803  56.070  1.00 30.09  ? 37  HIS B O   1 
ATOM   337  C  CB  . HIS A 1 40  ? 8.548   0.723   57.955  1.00 30.61  ? 37  HIS B CB  1 
ATOM   338  C  CG  . HIS A 1 40  ? 7.131   1.173   57.782  1.00 32.48  ? 37  HIS B CG  1 
ATOM   339  N  ND1 . HIS A 1 40  ? 6.158   0.957   58.733  1.00 38.34  ? 37  HIS B ND1 1 
ATOM   340  C  CD2 . HIS A 1 40  ? 6.527   1.843   56.772  1.00 34.07  ? 37  HIS B CD2 1 
ATOM   341  C  CE1 . HIS A 1 40  ? 5.013   1.467   58.314  1.00 33.83  ? 37  HIS B CE1 1 
ATOM   342  N  NE2 . HIS A 1 40  ? 5.210   2.013   57.128  1.00 33.86  ? 37  HIS B NE2 1 
ATOM   343  N  N   . ALA A 1 41  ? 6.743   -2.062  57.576  1.00 32.84  ? 38  ALA B N   1 
ATOM   344  C  CA  . ALA A 1 41  ? 5.881   -2.810  56.667  1.00 30.34  ? 38  ALA B CA  1 
ATOM   345  C  C   . ALA A 1 41  ? 4.809   -1.903  56.081  1.00 25.99  ? 38  ALA B C   1 
ATOM   346  O  O   . ALA A 1 41  ? 3.911   -1.452  56.791  1.00 30.59  ? 38  ALA B O   1 
ATOM   347  C  CB  . ALA A 1 41  ? 5.243   -3.984  57.385  1.00 30.36  ? 38  ALA B CB  1 
ATOM   348  N  N   . LEU A 1 42  ? 4.916   -1.629  54.785  1.00 25.89  ? 39  LEU B N   1 
ATOM   349  C  CA  . LEU A 1 42  ? 3.909   -0.844  54.076  1.00 22.99  ? 39  LEU B CA  1 
ATOM   350  C  C   . LEU A 1 42  ? 2.625   -1.652  53.905  1.00 21.94  ? 39  LEU B C   1 
ATOM   351  O  O   . LEU A 1 42  ? 2.652   -2.882  53.933  1.00 29.79  ? 39  LEU B O   1 
ATOM   352  C  CB  . LEU A 1 42  ? 4.446   -0.425  52.709  1.00 26.03  ? 39  LEU B CB  1 
ATOM   353  C  CG  . LEU A 1 42  ? 5.725   0.417   52.716  1.00 24.51  ? 39  LEU B CG  1 
ATOM   354  C  CD1 . LEU A 1 42  ? 6.550   0.157   51.470  1.00 22.83  ? 39  LEU B CD1 1 
ATOM   355  C  CD2 . LEU A 1 42  ? 5.408   1.900   52.862  1.00 19.77  ? 39  LEU B CD2 1 
ATOM   356  N  N   . GLN A 1 43  ? 1.500   -0.964  53.738  1.00 29.04  ? 40  GLN B N   1 
ATOM   357  C  CA  . GLN A 1 43  ? 0.225   -1.640  53.500  1.00 31.12  ? 40  GLN B CA  1 
ATOM   358  C  C   . GLN A 1 43  ? 0.269   -2.429  52.192  1.00 26.88  ? 40  GLN B C   1 
ATOM   359  O  O   . GLN A 1 43  ? -0.227  -3.549  52.112  1.00 30.34  ? 40  GLN B O   1 
ATOM   360  C  CB  . GLN A 1 43  ? -0.928  -0.637  53.471  1.00 33.64  ? 40  GLN B CB  1 
ATOM   361  C  CG  . GLN A 1 43  ? -2.301  -1.287  53.373  1.00 45.16  ? 40  GLN B CG  1 
ATOM   362  C  CD  . GLN A 1 43  ? -3.414  -0.287  53.118  1.00 47.67  ? 40  GLN B CD  1 
ATOM   363  O  OE1 . GLN A 1 43  ? -3.200  0.926   53.157  1.00 53.22  ? 40  GLN B OE1 1 
ATOM   364  N  NE2 . GLN A 1 43  ? -4.612  -0.795  52.852  1.00 51.74  ? 40  GLN B NE2 1 
ATOM   365  N  N   . TRP A 1 44  ? 0.872   -1.832  51.171  1.00 28.09  ? 41  TRP B N   1 
ATOM   366  C  CA  . TRP A 1 44  ? 1.080   -2.504  49.898  1.00 33.87  ? 41  TRP B CA  1 
ATOM   367  C  C   . TRP A 1 44  ? 2.559   -2.444  49.557  1.00 34.71  ? 41  TRP B C   1 
ATOM   368  O  O   . TRP A 1 44  ? 3.234   -1.472  49.892  1.00 40.11  ? 41  TRP B O   1 
ATOM   369  C  CB  . TRP A 1 44  ? 0.263   -1.832  48.789  1.00 34.63  ? 41  TRP B CB  1 
ATOM   370  C  CG  . TRP A 1 44  ? -1.197  -1.747  49.091  1.00 31.78  ? 41  TRP B CG  1 
ATOM   371  C  CD1 . TRP A 1 44  ? -1.914  -0.619  49.361  1.00 34.54  ? 41  TRP B CD1 1 
ATOM   372  C  CD2 . TRP A 1 44  ? -2.121  -2.839  49.166  1.00 33.73  ? 41  TRP B CD2 1 
ATOM   373  N  NE1 . TRP A 1 44  ? -3.230  -0.940  49.596  1.00 33.90  ? 41  TRP B NE1 1 
ATOM   374  C  CE2 . TRP A 1 44  ? -3.382  -2.297  49.481  1.00 34.03  ? 41  TRP B CE2 1 
ATOM   375  C  CE3 . TRP A 1 44  ? -2.004  -4.223  48.994  1.00 36.57  ? 41  TRP B CE3 1 
ATOM   376  C  CZ2 . TRP A 1 44  ? -4.520  -3.089  49.629  1.00 41.13  ? 41  TRP B CZ2 1 
ATOM   377  C  CZ3 . TRP A 1 44  ? -3.133  -5.009  49.141  1.00 37.74  ? 41  TRP B CZ3 1 
ATOM   378  C  CH2 . TRP A 1 44  ? -4.375  -4.441  49.456  1.00 40.14  ? 41  TRP B CH2 1 
ATOM   379  N  N   . PRO A 1 45  ? 3.074   -3.485  48.888  1.00 34.88  ? 42  PRO B N   1 
ATOM   380  C  CA  . PRO A 1 45  ? 4.487   -3.460  48.537  1.00 30.59  ? 42  PRO B CA  1 
ATOM   381  C  C   . PRO A 1 45  ? 4.779   -2.295  47.603  1.00 30.80  ? 42  PRO B C   1 
ATOM   382  O  O   . PRO A 1 45  ? 3.886   -1.830  46.892  1.00 31.00  ? 42  PRO B O   1 
ATOM   383  C  CB  . PRO A 1 45  ? 4.702   -4.797  47.816  1.00 28.48  ? 42  PRO B CB  1 
ATOM   384  C  CG  . PRO A 1 45  ? 3.341   -5.232  47.383  1.00 36.78  ? 42  PRO B CG  1 
ATOM   385  C  CD  . PRO A 1 45  ? 2.397   -4.704  48.415  1.00 32.90  ? 42  PRO B CD  1 
ATOM   386  N  N   . SER A 1 46  ? 6.017   -1.816  47.624  1.00 30.52  ? 43  SER B N   1 
ATOM   387  C  CA  . SER A 1 46  ? 6.429   -0.744  46.734  1.00 29.51  ? 43  SER B CA  1 
ATOM   388  C  C   . SER A 1 46  ? 7.474   -1.266  45.764  1.00 30.57  ? 43  SER B C   1 
ATOM   389  O  O   . SER A 1 46  ? 8.446   -1.901  46.169  1.00 40.79  ? 43  SER B O   1 
ATOM   390  C  CB  . SER A 1 46  ? 6.978   0.441   47.528  1.00 31.85  ? 43  SER B CB  1 
ATOM   391  O  OG  . SER A 1 46  ? 7.334   1.508   46.666  1.00 31.50  ? 43  SER B OG  1 
ATOM   392  N  N   . LEU A 1 47  ? 7.265   -1.004  44.479  1.00 35.62  ? 44  LEU B N   1 
ATOM   393  C  CA  . LEU A 1 47  ? 8.189   -1.454  43.447  1.00 31.27  ? 44  LEU B CA  1 
ATOM   394  C  C   . LEU A 1 47  ? 9.291   -0.432  43.219  1.00 27.64  ? 44  LEU B C   1 
ATOM   395  O  O   . LEU A 1 47  ? 10.239  -0.689  42.480  1.00 37.24  ? 44  LEU B O   1 
ATOM   396  C  CB  . LEU A 1 47  ? 7.440   -1.703  42.137  1.00 34.98  ? 44  LEU B CB  1 
ATOM   397  C  CG  . LEU A 1 47  ? 6.381   -2.806  42.139  1.00 34.46  ? 44  LEU B CG  1 
ATOM   398  C  CD1 . LEU A 1 47  ? 5.391   -2.603  40.997  1.00 40.36  ? 44  LEU B CD1 1 
ATOM   399  C  CD2 . LEU A 1 47  ? 7.035   -4.175  42.058  1.00 29.72  ? 44  LEU B CD2 1 
ATOM   400  N  N   . THR A 1 48  ? 9.172   0.724   43.864  1.00 30.02  ? 45  THR B N   1 
ATOM   401  C  CA  . THR A 1 48  ? 10.098  1.823   43.620  1.00 29.26  ? 45  THR B CA  1 
ATOM   402  C  C   . THR A 1 48  ? 10.497  2.580   44.901  1.00 27.82  ? 45  THR B C   1 
ATOM   403  O  O   . THR A 1 48  ? 9.705   2.708   45.834  1.00 27.18  ? 45  THR B O   1 
ATOM   404  C  CB  . THR A 1 48  ? 9.502   2.799   42.569  1.00 29.77  ? 45  THR B CB  1 
ATOM   405  O  OG1 . THR A 1 48  ? 10.476  3.781   42.197  1.00 43.97  ? 45  THR B OG1 1 
ATOM   406  C  CG2 . THR A 1 48  ? 8.259   3.490   43.110  1.00 27.48  ? 45  THR B CG2 1 
ATOM   407  N  N   . VAL A 1 49  ? 11.742  3.048   44.946  1.00 19.81  ? 46  VAL B N   1 
ATOM   408  C  CA  . VAL A 1 49  ? 12.192  3.973   45.986  1.00 25.40  ? 46  VAL B CA  1 
ATOM   409  C  C   . VAL A 1 49  ? 13.213  4.946   45.438  1.00 28.09  ? 46  VAL B C   1 
ATOM   410  O  O   . VAL A 1 49  ? 14.025  4.602   44.583  1.00 29.59  ? 46  VAL B O   1 
ATOM   411  C  CB  . VAL A 1 49  ? 12.849  3.282   47.209  1.00 25.37  ? 46  VAL B CB  1 
ATOM   412  C  CG1 . VAL A 1 49  ? 11.832  3.021   48.296  1.00 39.15  ? 46  VAL B CG1 1 
ATOM   413  C  CG2 . VAL A 1 49  ? 13.592  2.020   46.803  1.00 29.69  ? 46  VAL B CG2 1 
ATOM   414  N  N   . GLN A 1 50  ? 13.167  6.164   45.955  1.00 30.03  ? 47  GLN B N   1 
ATOM   415  C  CA  . GLN A 1 50  ? 14.145  7.176   45.627  1.00 28.93  ? 47  GLN B CA  1 
ATOM   416  C  C   . GLN A 1 50  ? 14.093  8.241   46.701  1.00 29.14  ? 47  GLN B C   1 
ATOM   417  O  O   . GLN A 1 50  ? 13.017  8.726   47.053  1.00 31.99  ? 47  GLN B O   1 
ATOM   418  C  CB  . GLN A 1 50  ? 13.851  7.795   44.263  1.00 24.88  ? 47  GLN B CB  1 
ATOM   419  C  CG  . GLN A 1 50  ? 14.897  8.791   43.810  1.00 30.39  ? 47  GLN B CG  1 
ATOM   420  C  CD  . GLN A 1 50  ? 14.597  9.369   42.443  1.00 33.76  ? 47  GLN B CD  1 
ATOM   421  O  OE1 . GLN A 1 50  ? 13.443  9.621   42.103  1.00 28.10  ? 47  GLN B OE1 1 
ATOM   422  N  NE2 . GLN A 1 50  ? 15.640  9.588   41.654  1.00 29.88  ? 47  GLN B NE2 1 
ATOM   423  N  N   . TRP A 1 51  ? 15.255  8.586   47.238  1.00 21.23  ? 48  TRP B N   1 
ATOM   424  C  CA  . TRP A 1 51  ? 15.339  9.666   48.193  1.00 24.13  ? 48  TRP B CA  1 
ATOM   425  C  C   . TRP A 1 51  ? 15.128  10.989  47.473  1.00 24.44  ? 48  TRP B C   1 
ATOM   426  O  O   . TRP A 1 51  ? 15.691  11.215  46.403  1.00 29.60  ? 48  TRP B O   1 
ATOM   427  C  CB  . TRP A 1 51  ? 16.713  9.685   48.867  1.00 23.03  ? 48  TRP B CB  1 
ATOM   428  C  CG  . TRP A 1 51  ? 17.034  8.482   49.710  1.00 20.68  ? 48  TRP B CG  1 
ATOM   429  C  CD1 . TRP A 1 51  ? 17.756  7.388   49.331  1.00 22.87  ? 48  TRP B CD1 1 
ATOM   430  C  CD2 . TRP A 1 51  ? 16.670  8.267   51.079  1.00 21.20  ? 48  TRP B CD2 1 
ATOM   431  N  NE1 . TRP A 1 51  ? 17.857  6.499   50.375  1.00 27.38  ? 48  TRP B NE1 1 
ATOM   432  C  CE2 . TRP A 1 51  ? 17.199  7.014   51.460  1.00 24.35  ? 48  TRP B CE2 1 
ATOM   433  C  CE3 . TRP A 1 51  ? 15.945  9.008   52.019  1.00 21.95  ? 48  TRP B CE3 1 
ATOM   434  C  CZ2 . TRP A 1 51  ? 17.028  6.486   52.739  1.00 17.34  ? 48  TRP B CZ2 1 
ATOM   435  C  CZ3 . TRP A 1 51  ? 15.771  8.479   53.291  1.00 22.68  ? 48  TRP B CZ3 1 
ATOM   436  C  CH2 . TRP A 1 51  ? 16.311  7.231   53.638  1.00 23.01  ? 48  TRP B CH2 1 
ATOM   437  N  N   . LEU A 1 52  ? 14.303  11.852  48.051  1.00 24.44  ? 49  LEU B N   1 
ATOM   438  C  CA  . LEU A 1 52  ? 14.301  13.254  47.675  1.00 24.89  ? 49  LEU B CA  1 
ATOM   439  C  C   . LEU A 1 52  ? 15.628  13.845  48.146  1.00 30.14  ? 49  LEU B C   1 
ATOM   440  O  O   . LEU A 1 52  ? 16.224  13.336  49.098  1.00 27.39  ? 49  LEU B O   1 
ATOM   441  C  CB  . LEU A 1 52  ? 13.114  13.976  48.318  1.00 32.40  ? 49  LEU B CB  1 
ATOM   442  C  CG  . LEU A 1 52  ? 11.985  14.452  47.394  1.00 30.18  ? 49  LEU B CG  1 
ATOM   443  C  CD1 . LEU A 1 52  ? 11.964  13.704  46.070  1.00 32.82  ? 49  LEU B CD1 1 
ATOM   444  C  CD2 . LEU A 1 52  ? 10.635  14.378  48.085  1.00 20.32  ? 49  LEU B CD2 1 
ATOM   445  N  N   . PRO A 1 53  ? 16.109  14.905  47.472  1.00 29.09  ? 50  PRO B N   1 
ATOM   446  C  CA  . PRO A 1 53  ? 17.422  15.472  47.782  1.00 27.66  ? 50  PRO B CA  1 
ATOM   447  C  C   . PRO A 1 53  ? 17.467  16.353  49.030  1.00 29.94  ? 50  PRO B C   1 
ATOM   448  O  O   . PRO A 1 53  ? 18.553  16.717  49.480  1.00 36.07  ? 50  PRO B O   1 
ATOM   449  C  CB  . PRO A 1 53  ? 17.732  16.317  46.546  1.00 26.72  ? 50  PRO B CB  1 
ATOM   450  C  CG  . PRO A 1 53  ? 16.403  16.742  46.048  1.00 29.58  ? 50  PRO B CG  1 
ATOM   451  C  CD  . PRO A 1 53  ? 15.449  15.616  46.363  1.00 31.81  ? 50  PRO B CD  1 
ATOM   452  N  N   . GLU A 1 54  ? 16.311  16.698  49.586  1.00 29.03  ? 51  GLU B N   1 
ATOM   453  C  CA  . GLU A 1 54  ? 16.279  17.604  50.732  1.00 32.06  ? 51  GLU B CA  1 
ATOM   454  C  C   . GLU A 1 54  ? 16.531  16.897  52.059  1.00 35.66  ? 51  GLU B C   1 
ATOM   455  O  O   . GLU A 1 54  ? 16.048  15.789  52.286  1.00 39.71  ? 51  GLU B O   1 
ATOM   456  C  CB  . GLU A 1 54  ? 14.954  18.368  50.805  1.00 28.30  ? 51  GLU B CB  1 
ATOM   457  C  CG  . GLU A 1 54  ? 14.612  19.176  49.563  1.00 33.09  ? 51  GLU B CG  1 
ATOM   458  C  CD  . GLU A 1 54  ? 13.684  18.437  48.619  1.00 38.91  ? 51  GLU B CD  1 
ATOM   459  O  OE1 . GLU A 1 54  ? 13.721  17.188  48.591  1.00 41.49  ? 51  GLU B OE1 1 
ATOM   460  O  OE2 . GLU A 1 54  ? 12.912  19.107  47.906  1.00 44.56  ? 51  GLU B OE2 1 
ATOM   461  N  N   . VAL A 1 55  ? 17.297  17.553  52.926  1.00 30.34  ? 52  VAL B N   1 
ATOM   462  C  CA  . VAL A 1 55  ? 17.491  17.096  54.295  1.00 31.01  ? 52  VAL B CA  1 
ATOM   463  C  C   . VAL A 1 55  ? 17.466  18.299  55.232  1.00 34.79  ? 52  VAL B C   1 
ATOM   464  O  O   . VAL A 1 55  ? 17.761  19.421  54.818  1.00 39.67  ? 52  VAL B O   1 
ATOM   465  C  CB  . VAL A 1 55  ? 18.826  16.337  54.470  1.00 32.57  ? 52  VAL B CB  1 
ATOM   466  C  CG1 . VAL A 1 55  ? 20.011  17.252  54.183  1.00 23.90  ? 52  VAL B CG1 1 
ATOM   467  C  CG2 . VAL A 1 55  ? 18.928  15.755  55.874  1.00 23.83  ? 52  VAL B CG2 1 
ATOM   468  N  N   . THR A 1 56  ? 17.105  18.063  56.488  1.00 35.06  ? 53  THR B N   1 
ATOM   469  C  CA  . THR A 1 56  ? 17.134  19.112  57.498  1.00 37.38  ? 53  THR B CA  1 
ATOM   470  C  C   . THR A 1 56  ? 17.262  18.532  58.908  1.00 37.00  ? 53  THR B C   1 
ATOM   471  O  O   . THR A 1 56  ? 16.680  17.493  59.222  1.00 35.81  ? 53  THR B O   1 
ATOM   472  C  CB  . THR A 1 56  ? 15.889  20.026  57.407  1.00 39.65  ? 53  THR B CB  1 
ATOM   473  O  OG1 . THR A 1 56  ? 16.166  21.276  58.049  1.00 47.57  ? 53  THR B OG1 1 
ATOM   474  C  CG2 . THR A 1 56  ? 14.676  19.373  58.061  1.00 32.86  ? 53  THR B CG2 1 
ATOM   475  N  N   . LYS A 1 57  ? 18.045  19.199  59.749  1.00 40.06  ? 54  LYS B N   1 
ATOM   476  C  CA  . LYS A 1 57  ? 18.196  18.789  61.139  1.00 44.99  ? 54  LYS B CA  1 
ATOM   477  C  C   . LYS A 1 57  ? 17.451  19.775  62.026  1.00 47.33  ? 54  LYS B C   1 
ATOM   478  O  O   . LYS A 1 57  ? 18.019  20.778  62.462  1.00 47.50  ? 54  LYS B O   1 
ATOM   479  C  CB  . LYS A 1 57  ? 19.671  18.728  61.540  1.00 45.05  ? 54  LYS B CB  1 
ATOM   480  C  CG  . LYS A 1 57  ? 20.543  17.879  60.622  1.00 57.03  ? 54  LYS B CG  1 
ATOM   481  C  CD  . LYS A 1 57  ? 21.956  17.746  61.183  1.00 68.41  ? 54  LYS B CD  1 
ATOM   482  C  CE  . LYS A 1 57  ? 22.962  17.358  60.103  1.00 73.07  ? 54  LYS B CE  1 
ATOM   483  N  NZ  . LYS A 1 57  ? 22.748  15.975  59.588  1.00 77.42  ? 54  LYS B NZ  1 
ATOM   484  N  N   . PRO A 1 58  ? 16.170  19.491  62.299  1.00 48.25  ? 55  PRO B N   1 
ATOM   485  C  CA  . PRO A 1 58  ? 15.328  20.431  63.028  1.00 48.39  ? 55  PRO B CA  1 
ATOM   486  C  C   . PRO A 1 58  ? 15.909  20.780  64.395  1.00 51.19  ? 55  PRO B C   1 
ATOM   487  O  O   . PRO A 1 58  ? 16.360  19.899  65.127  1.00 47.89  ? 55  PRO B O   1 
ATOM   488  C  CB  . PRO A 1 58  ? 13.995  19.683  63.169  1.00 45.53  ? 55  PRO B CB  1 
ATOM   489  C  CG  . PRO A 1 58  ? 14.312  18.250  62.909  1.00 40.95  ? 55  PRO B CG  1 
ATOM   490  C  CD  . PRO A 1 58  ? 15.451  18.255  61.951  1.00 43.52  ? 55  PRO B CD  1 
ATOM   491  N  N   . GLU A 1 59  ? 15.902  22.071  64.713  1.00 60.23  ? 56  GLU B N   1 
ATOM   492  C  CA  . GLU A 1 59  ? 16.422  22.578  65.977  1.00 63.62  ? 56  GLU B CA  1 
ATOM   493  C  C   . GLU A 1 59  ? 15.734  21.932  67.174  1.00 59.97  ? 56  GLU B C   1 
ATOM   494  O  O   . GLU A 1 59  ? 14.506  21.886  67.242  1.00 59.38  ? 56  GLU B O   1 
ATOM   495  C  CB  . GLU A 1 59  ? 16.249  24.098  66.029  1.00 66.80  ? 56  GLU B CB  1 
ATOM   496  C  CG  . GLU A 1 59  ? 16.415  24.713  67.407  1.00 69.57  ? 56  GLU B CG  1 
ATOM   497  C  CD  . GLU A 1 59  ? 16.061  26.187  67.425  1.00 71.98  ? 56  GLU B CD  1 
ATOM   498  O  OE1 . GLU A 1 59  ? 15.167  26.575  68.205  1.00 76.89  ? 56  GLU B OE1 1 
ATOM   499  O  OE2 . GLU A 1 59  ? 16.670  26.956  66.650  1.00 73.63  ? 56  GLU B OE2 1 
ATOM   500  N  N   . GLY A 1 60  ? 16.531  21.428  68.110  1.00 57.99  ? 57  GLY B N   1 
ATOM   501  C  CA  . GLY A 1 60  ? 16.000  20.858  69.345  1.00 57.08  ? 57  GLY B CA  1 
ATOM   502  C  C   . GLY A 1 60  ? 15.617  19.394  69.242  1.00 57.73  ? 57  GLY B C   1 
ATOM   503  O  O   . GLY A 1 60  ? 15.184  18.785  70.222  1.00 59.53  ? 57  GLY B O   1 
ATOM   504  N  N   . LYS A 1 61  ? 15.772  18.824  68.053  1.00 55.85  ? 58  LYS B N   1 
ATOM   505  C  CA  . LYS A 1 61  ? 15.460  17.419  67.840  1.00 54.37  ? 58  LYS B CA  1 
ATOM   506  C  C   . LYS A 1 61  ? 16.749  16.610  67.733  1.00 49.13  ? 58  LYS B C   1 
ATOM   507  O  O   . LYS A 1 61  ? 17.782  17.134  67.320  1.00 48.48  ? 58  LYS B O   1 
ATOM   508  C  CB  . LYS A 1 61  ? 14.614  17.247  66.576  1.00 58.59  ? 58  LYS B CB  1 
ATOM   509  C  CG  . LYS A 1 61  ? 13.385  18.150  66.511  1.00 55.54  ? 58  LYS B CG  1 
ATOM   510  C  CD  . LYS A 1 61  ? 12.321  17.732  67.515  1.00 56.86  ? 58  LYS B CD  1 
ATOM   511  C  CE  . LYS A 1 61  ? 11.050  18.556  67.345  1.00 56.30  ? 58  LYS B CE  1 
ATOM   512  N  NZ  . LYS A 1 61  ? 9.941   18.059  68.207  1.00 55.33  ? 58  LYS B NZ  1 
ATOM   513  N  N   . ASP A 1 62  ? 16.684  15.337  68.111  1.00 48.77  ? 59  ASP B N   1 
ATOM   514  C  CA  . ASP A 1 62  ? 17.851  14.460  68.061  1.00 53.24  ? 59  ASP B CA  1 
ATOM   515  C  C   . ASP A 1 62  ? 17.806  13.525  66.855  1.00 52.56  ? 59  ASP B C   1 
ATOM   516  O  O   . ASP A 1 62  ? 18.321  12.408  66.902  1.00 54.79  ? 59  ASP B O   1 
ATOM   517  C  CB  . ASP A 1 62  ? 17.969  13.650  69.352  1.00 59.14  ? 59  ASP B CB  1 
ATOM   518  C  CG  . ASP A 1 62  ? 16.703  12.881  69.679  1.00 67.13  ? 59  ASP B CG  1 
ATOM   519  O  OD1 . ASP A 1 62  ? 16.655  12.255  70.758  1.00 72.02  ? 59  ASP B OD1 1 
ATOM   520  O  OD2 . ASP A 1 62  ? 15.756  12.902  68.863  1.00 69.90  ? 59  ASP B OD2 1 
ATOM   521  N  N   . TYR A 1 63  ? 17.186  13.992  65.776  1.00 47.69  ? 60  TYR B N   1 
ATOM   522  C  CA  . TYR A 1 63  ? 17.080  13.221  64.545  1.00 42.34  ? 60  TYR B CA  1 
ATOM   523  C  C   . TYR A 1 63  ? 17.104  14.155  63.344  1.00 42.94  ? 60  TYR B C   1 
ATOM   524  O  O   . TYR A 1 63  ? 17.087  15.377  63.498  1.00 45.46  ? 60  TYR B O   1 
ATOM   525  C  CB  . TYR A 1 63  ? 15.790  12.402  64.536  1.00 38.83  ? 60  TYR B CB  1 
ATOM   526  C  CG  . TYR A 1 63  ? 14.538  13.233  64.709  1.00 37.55  ? 60  TYR B CG  1 
ATOM   527  C  CD1 . TYR A 1 63  ? 13.964  13.898  63.629  1.00 36.10  ? 60  TYR B CD1 1 
ATOM   528  C  CD2 . TYR A 1 63  ? 13.930  13.356  65.954  1.00 36.99  ? 60  TYR B CD2 1 
ATOM   529  C  CE1 . TYR A 1 63  ? 12.818  14.662  63.785  1.00 37.07  ? 60  TYR B CE1 1 
ATOM   530  C  CE2 . TYR A 1 63  ? 12.783  14.117  66.120  1.00 36.90  ? 60  TYR B CE2 1 
ATOM   531  C  CZ  . TYR A 1 63  ? 12.232  14.767  65.031  1.00 39.88  ? 60  TYR B CZ  1 
ATOM   532  O  OH  . TYR A 1 63  ? 11.094  15.524  65.187  1.00 40.68  ? 60  TYR B OH  1 
ATOM   533  N  N   . ALA A 1 64  ? 17.138  13.578  62.149  1.00 37.88  ? 61  ALA B N   1 
ATOM   534  C  CA  . ALA A 1 64  ? 17.103  14.368  60.925  1.00 34.00  ? 61  ALA B CA  1 
ATOM   535  C  C   . ALA A 1 64  ? 15.916  13.974  60.054  1.00 32.95  ? 61  ALA B C   1 
ATOM   536  O  O   . ALA A 1 64  ? 15.520  12.808  60.014  1.00 29.67  ? 61  ALA B O   1 
ATOM   537  C  CB  . ALA A 1 64  ? 18.402  14.211  60.153  1.00 34.43  ? 61  ALA B CB  1 
ATOM   538  N  N   . LEU A 1 65  ? 15.350  14.955  59.361  1.00 30.38  ? 62  LEU B N   1 
ATOM   539  C  CA  . LEU A 1 65  ? 14.258  14.702  58.431  1.00 26.47  ? 62  LEU B CA  1 
ATOM   540  C  C   . LEU A 1 65  ? 14.789  14.325  57.055  1.00 27.20  ? 62  LEU B C   1 
ATOM   541  O  O   . LEU A 1 65  ? 15.627  15.029  56.493  1.00 26.51  ? 62  LEU B O   1 
ATOM   542  C  CB  . LEU A 1 65  ? 13.363  15.934  58.317  1.00 30.85  ? 62  LEU B CB  1 
ATOM   543  C  CG  . LEU A 1 65  ? 12.127  16.008  59.215  1.00 31.36  ? 62  LEU B CG  1 
ATOM   544  C  CD1 . LEU A 1 65  ? 12.324  15.235  60.497  1.00 32.17  ? 62  LEU B CD1 1 
ATOM   545  C  CD2 . LEU A 1 65  ? 11.761  17.454  59.505  1.00 32.86  ? 62  LEU B CD2 1 
ATOM   546  N  N   . HIS A 1 66  ? 14.305  13.204  56.526  1.00 24.75  ? 63  HIS B N   1 
ATOM   547  C  CA  . HIS A 1 66  ? 14.598  12.795  55.155  1.00 23.60  ? 63  HIS B CA  1 
ATOM   548  C  C   . HIS A 1 66  ? 13.286  12.444  54.457  1.00 23.54  ? 63  HIS B C   1 
ATOM   549  O  O   . HIS A 1 66  ? 12.279  12.185  55.119  1.00 23.56  ? 63  HIS B O   1 
ATOM   550  C  CB  . HIS A 1 66  ? 15.530  11.578  55.135  1.00 21.77  ? 63  HIS B CB  1 
ATOM   551  C  CG  . HIS A 1 66  ? 16.924  11.863  55.604  1.00 27.89  ? 63  HIS B CG  1 
ATOM   552  N  ND1 . HIS A 1 66  ? 17.256  11.964  56.939  1.00 31.32  ? 63  HIS B ND1 1 
ATOM   553  C  CD2 . HIS A 1 66  ? 18.076  12.045  54.916  1.00 29.61  ? 63  HIS B CD2 1 
ATOM   554  C  CE1 . HIS A 1 66  ? 18.549  12.206  57.052  1.00 25.33  ? 63  HIS B CE1 1 
ATOM   555  N  NE2 . HIS A 1 66  ? 19.070  12.260  55.839  1.00 29.72  ? 63  HIS B NE2 1 
ATOM   556  N  N   . TRP A 1 67  ? 13.295  12.430  53.127  1.00 23.25  ? 64  TRP B N   1 
ATOM   557  C  CA  . TRP A 1 67  ? 12.087  12.111  52.363  1.00 21.77  ? 64  TRP B CA  1 
ATOM   558  C  C   . TRP A 1 67  ? 12.303  11.032  51.303  1.00 24.88  ? 64  TRP B C   1 
ATOM   559  O  O   . TRP A 1 67  ? 13.327  11.007  50.620  1.00 25.22  ? 64  TRP B O   1 
ATOM   560  C  CB  . TRP A 1 67  ? 11.498  13.373  51.725  1.00 25.78  ? 64  TRP B CB  1 
ATOM   561  C  CG  . TRP A 1 67  ? 10.871  14.294  52.724  1.00 25.43  ? 64  TRP B CG  1 
ATOM   562  C  CD1 . TRP A 1 67  ? 9.560   14.327  53.099  1.00 27.02  ? 64  TRP B CD1 1 
ATOM   563  C  CD2 . TRP A 1 67  ? 11.532  15.307  53.492  1.00 25.71  ? 64  TRP B CD2 1 
ATOM   564  N  NE1 . TRP A 1 67  ? 9.360   15.302  54.045  1.00 26.08  ? 64  TRP B NE1 1 
ATOM   565  C  CE2 . TRP A 1 67  ? 10.555  15.918  54.306  1.00 30.27  ? 64  TRP B CE2 1 
ATOM   566  C  CE3 . TRP A 1 67  ? 12.854  15.758  53.569  1.00 29.50  ? 64  TRP B CE3 1 
ATOM   567  C  CZ2 . TRP A 1 67  ? 10.859  16.958  55.185  1.00 30.47  ? 64  TRP B CZ2 1 
ATOM   568  C  CZ3 . TRP A 1 67  ? 13.155  16.793  54.444  1.00 30.53  ? 64  TRP B CZ3 1 
ATOM   569  C  CH2 . TRP A 1 67  ? 12.161  17.381  55.239  1.00 27.98  ? 64  TRP B CH2 1 
ATOM   570  N  N   . LEU A 1 68  ? 11.324  10.141  51.181  1.00 21.80  ? 65  LEU B N   1 
ATOM   571  C  CA  . LEU A 1 68  ? 11.350  9.085   50.180  1.00 22.22  ? 65  LEU B CA  1 
ATOM   572  C  C   . LEU A 1 68  ? 10.218  9.273   49.185  1.00 23.45  ? 65  LEU B C   1 
ATOM   573  O  O   . LEU A 1 68  ? 9.126   9.698   49.559  1.00 28.36  ? 65  LEU B O   1 
ATOM   574  C  CB  . LEU A 1 68  ? 11.172  7.713   50.837  1.00 26.34  ? 65  LEU B CB  1 
ATOM   575  C  CG  . LEU A 1 68  ? 12.348  6.936   51.429  1.00 23.98  ? 65  LEU B CG  1 
ATOM   576  C  CD1 . LEU A 1 68  ? 13.625  7.292   50.709  1.00 21.46  ? 65  LEU B CD1 1 
ATOM   577  C  CD2 . LEU A 1 68  ? 12.477  7.189   52.913  1.00 34.07  ? 65  LEU B CD2 1 
ATOM   578  N  N   . VAL A 1 69  ? 10.474  8.948   47.923  1.00 23.84  ? 66  VAL B N   1 
ATOM   579  C  CA  . VAL A 1 69  ? 9.401   8.807   46.946  1.00 25.02  ? 66  VAL B CA  1 
ATOM   580  C  C   . VAL A 1 69  ? 9.069   7.325   46.789  1.00 28.39  ? 66  VAL B C   1 
ATOM   581  O  O   . VAL A 1 69  ? 9.909   6.531   46.361  1.00 33.12  ? 66  VAL B O   1 
ATOM   582  C  CB  . VAL A 1 69  ? 9.786   9.384   45.577  1.00 29.42  ? 66  VAL B CB  1 
ATOM   583  C  CG1 . VAL A 1 69  ? 8.605   9.296   44.616  1.00 26.33  ? 66  VAL B CG1 1 
ATOM   584  C  CG2 . VAL A 1 69  ? 10.252  10.815  45.721  1.00 26.09  ? 66  VAL B CG2 1 
ATOM   585  N  N   . LEU A 1 70  ? 7.846   6.957   47.149  1.00 27.42  ? 67  LEU B N   1 
ATOM   586  C  CA  . LEU A 1 70  ? 7.404   5.570   47.092  1.00 21.16  ? 67  LEU B CA  1 
ATOM   587  C  C   . LEU A 1 70  ? 6.215   5.405   46.159  1.00 27.53  ? 67  LEU B C   1 
ATOM   588  O  O   . LEU A 1 70  ? 5.695   6.376   45.610  1.00 27.97  ? 67  LEU B O   1 
ATOM   589  C  CB  . LEU A 1 70  ? 7.006   5.088   48.486  1.00 29.09  ? 67  LEU B CB  1 
ATOM   590  C  CG  . LEU A 1 70  ? 8.118   4.917   49.516  1.00 35.21  ? 67  LEU B CG  1 
ATOM   591  C  CD1 . LEU A 1 70  ? 7.568   5.088   50.927  1.00 32.11  ? 67  LEU B CD1 1 
ATOM   592  C  CD2 . LEU A 1 70  ? 8.785   3.561   49.342  1.00 29.34  ? 67  LEU B CD2 1 
ATOM   593  N  N   . GLY A 1 71  ? 5.782   4.162   45.996  1.00 32.22  ? 68  GLY B N   1 
ATOM   594  C  CA  . GLY A 1 71  ? 4.617   3.854   45.188  1.00 30.02  ? 68  GLY B CA  1 
ATOM   595  C  C   . GLY A 1 71  ? 3.816   2.728   45.804  1.00 34.18  ? 68  GLY B C   1 
ATOM   596  O  O   . GLY A 1 71  ? 4.207   2.154   46.821  1.00 33.37  ? 68  GLY B O   1 
ATOM   597  N  N   . THR A 1 72  ? 2.688   2.412   45.182  1.00 37.52  ? 69  THR B N   1 
ATOM   598  C  CA  . THR A 1 72  ? 1.811   1.359   45.668  1.00 35.50  ? 69  THR B CA  1 
ATOM   599  C  C   . THR A 1 72  ? 1.662   0.256   44.625  1.00 40.25  ? 69  THR B C   1 
ATOM   600  O  O   . THR A 1 72  ? 1.712   0.515   43.422  1.00 38.45  ? 69  THR B O   1 
ATOM   601  C  CB  . THR A 1 72  ? 0.430   1.924   46.043  1.00 30.54  ? 69  THR B CB  1 
ATOM   602  O  OG1 . THR A 1 72  ? 0.448   2.342   47.412  1.00 31.38  ? 69  THR B OG1 1 
ATOM   603  C  CG2 . THR A 1 72  ? -0.648  0.876   45.876  1.00 41.68  ? 69  THR B CG2 1 
ATOM   604  N  N   . HIS A 1 73  ? 1.494   -0.976  45.092  1.00 40.88  ? 70  HIS B N   1 
ATOM   605  C  CA  . HIS A 1 73  ? 1.277   -2.097  44.191  1.00 46.30  ? 70  HIS B CA  1 
ATOM   606  C  C   . HIS A 1 73  ? 0.054   -2.915  44.602  1.00 46.23  ? 70  HIS B C   1 
ATOM   607  O  O   . HIS A 1 73  ? 0.156   -3.855  45.393  1.00 43.66  ? 70  HIS B O   1 
ATOM   608  C  CB  . HIS A 1 73  ? 2.525   -2.979  44.119  1.00 49.64  ? 70  HIS B CB  1 
ATOM   609  C  CG  . HIS A 1 73  ? 2.429   -4.083  43.114  1.00 55.46  ? 70  HIS B CG  1 
ATOM   610  N  ND1 . HIS A 1 73  ? 2.339   -3.849  41.759  1.00 59.79  ? 70  HIS B ND1 1 
ATOM   611  C  CD2 . HIS A 1 73  ? 2.423   -5.428  43.264  1.00 55.43  ? 70  HIS B CD2 1 
ATOM   612  C  CE1 . HIS A 1 73  ? 2.273   -5.002  41.118  1.00 57.08  ? 70  HIS B CE1 1 
ATOM   613  N  NE2 . HIS A 1 73  ? 2.324   -5.976  42.008  1.00 54.87  ? 70  HIS B NE2 1 
ATOM   614  N  N   . THR A 1 74  ? -1.103  -2.534  44.068  1.00 46.65  ? 71  THR B N   1 
ATOM   615  C  CA  . THR A 1 74  ? -2.326  -3.313  44.234  1.00 51.52  ? 71  THR B CA  1 
ATOM   616  C  C   . THR A 1 74  ? -3.006  -3.469  42.885  1.00 52.28  ? 71  THR B C   1 
ATOM   617  O  O   . THR A 1 74  ? -3.092  -2.514  42.109  1.00 48.42  ? 71  THR B O   1 
ATOM   618  C  CB  . THR A 1 74  ? -3.328  -2.638  45.192  1.00 56.25  ? 71  THR B CB  1 
ATOM   619  O  OG1 . THR A 1 74  ? -2.628  -1.890  46.193  1.00 60.43  ? 71  THR B OG1 1 
ATOM   620  C  CG2 . THR A 1 74  ? -4.213  -3.685  45.857  1.00 52.85  ? 71  THR B CG2 1 
ATOM   621  N  N   . SER A 1 75  ? -3.487  -4.674  42.605  1.00 55.88  ? 72  SER B N   1 
ATOM   622  C  CA  . SER A 1 75  ? -4.227  -4.924  41.376  1.00 58.24  ? 72  SER B CA  1 
ATOM   623  C  C   . SER A 1 75  ? -5.723  -4.837  41.647  1.00 57.86  ? 72  SER B C   1 
ATOM   624  O  O   . SER A 1 75  ? -6.520  -4.662  40.728  1.00 64.20  ? 72  SER B O   1 
ATOM   625  C  CB  . SER A 1 75  ? -3.865  -6.294  40.799  1.00 60.65  ? 72  SER B CB  1 
ATOM   626  O  OG  . SER A 1 75  ? -4.143  -7.329  41.726  1.00 64.08  ? 72  SER B OG  1 
ATOM   627  N  N   . ASP A 1 76  ? -6.093  -4.952  42.919  1.00 60.46  ? 73  ASP B N   1 
ATOM   628  C  CA  . ASP A 1 76  ? -7.493  -4.918  43.330  1.00 60.88  ? 73  ASP B CA  1 
ATOM   629  C  C   . ASP A 1 76  ? -7.972  -3.512  43.679  1.00 59.56  ? 73  ASP B C   1 
ATOM   630  O  O   . ASP A 1 76  ? -9.061  -3.103  43.275  1.00 64.54  ? 73  ASP B O   1 
ATOM   631  C  CB  . ASP A 1 76  ? -7.719  -5.831  44.541  1.00 68.26  ? 73  ASP B CB  1 
ATOM   632  C  CG  . ASP A 1 76  ? -8.024  -7.267  44.150  1.00 72.06  ? 73  ASP B CG  1 
ATOM   633  O  OD1 . ASP A 1 76  ? -8.284  -8.084  45.060  1.00 71.88  ? 73  ASP B OD1 1 
ATOM   634  O  OD2 . ASP A 1 76  ? -8.007  -7.578  42.940  1.00 74.04  ? 73  ASP B OD2 1 
ATOM   635  N  N   . GLU A 1 77  ? -7.157  -2.779  44.432  1.00 52.68  ? 74  GLU B N   1 
ATOM   636  C  CA  . GLU A 1 77  ? -7.615  -1.555  45.086  1.00 44.11  ? 74  GLU B CA  1 
ATOM   637  C  C   . GLU A 1 77  ? -6.875  -0.292  44.642  1.00 40.04  ? 74  GLU B C   1 
ATOM   638  O  O   . GLU A 1 77  ? -6.106  -0.318  43.681  1.00 45.40  ? 74  GLU B O   1 
ATOM   639  C  CB  . GLU A 1 77  ? -7.542  -1.727  46.606  1.00 41.62  ? 74  GLU B CB  1 
ATOM   640  C  CG  . GLU A 1 77  ? -8.105  -3.065  47.073  1.00 46.88  ? 74  GLU B CG  1 
ATOM   641  C  CD  . GLU A 1 77  ? -8.197  -3.188  48.579  1.00 48.59  ? 74  GLU B CD  1 
ATOM   642  O  OE1 . GLU A 1 77  ? -7.952  -4.299  49.096  1.00 52.08  ? 74  GLU B OE1 1 
ATOM   643  O  OE2 . GLU A 1 77  ? -8.517  -2.182  49.247  1.00 49.06  ? 74  GLU B OE2 1 
ATOM   644  N  N   . GLN A 1 78  ? -7.116  0.809   45.349  1.00 35.09  ? 75  GLN B N   1 
ATOM   645  C  CA  . GLN A 1 78  ? -6.615  2.121   44.940  1.00 34.36  ? 75  GLN B CA  1 
ATOM   646  C  C   . GLN A 1 78  ? -5.113  2.284   45.152  1.00 36.59  ? 75  GLN B C   1 
ATOM   647  O  O   . GLN A 1 78  ? -4.595  2.038   46.243  1.00 33.67  ? 75  GLN B O   1 
ATOM   648  C  CB  . GLN A 1 78  ? -7.371  3.238   45.667  1.00 35.08  ? 75  GLN B CB  1 
ATOM   649  C  CG  . GLN A 1 78  ? -6.981  4.645   45.228  1.00 33.65  ? 75  GLN B CG  1 
ATOM   650  C  CD  . GLN A 1 78  ? -7.346  4.928   43.782  1.00 40.99  ? 75  GLN B CD  1 
ATOM   651  O  OE1 . GLN A 1 78  ? -6.561  5.510   43.033  1.00 43.44  ? 75  GLN B OE1 1 
ATOM   652  N  NE2 . GLN A 1 78  ? -8.541  4.512   43.380  1.00 46.27  ? 75  GLN B NE2 1 
ATOM   653  N  N   . ASN A 1 79  ? -4.427  2.714   44.097  1.00 38.97  ? 76  ASN B N   1 
ATOM   654  C  CA  . ASN A 1 79  ? -2.988  2.945   44.142  1.00 38.14  ? 76  ASN B CA  1 
ATOM   655  C  C   . ASN A 1 79  ? -2.642  4.405   44.406  1.00 36.62  ? 76  ASN B C   1 
ATOM   656  O  O   . ASN A 1 79  ? -3.407  5.306   44.061  1.00 35.42  ? 76  ASN B O   1 
ATOM   657  C  CB  . ASN A 1 79  ? -2.338  2.485   42.836  1.00 39.04  ? 76  ASN B CB  1 
ATOM   658  C  CG  . ASN A 1 79  ? -2.343  0.977   42.682  1.00 42.16  ? 76  ASN B CG  1 
ATOM   659  O  OD1 . ASN A 1 79  ? -1.460  0.287   43.190  1.00 44.68  ? 76  ASN B OD1 1 
ATOM   660  N  ND2 . ASN A 1 79  ? -3.334  0.459   41.969  1.00 41.91  ? 76  ASN B ND2 1 
ATOM   661  N  N   . HIS A 1 80  ? -1.483  4.631   45.020  1.00 36.55  ? 77  HIS B N   1 
ATOM   662  C  CA  . HIS A 1 80  ? -1.024  5.982   45.326  1.00 32.80  ? 77  HIS B CA  1 
ATOM   663  C  C   . HIS A 1 80  ? 0.453   6.171   45.012  1.00 33.42  ? 77  HIS B C   1 
ATOM   664  O  O   . HIS A 1 80  ? 1.256   5.246   45.155  1.00 33.10  ? 77  HIS B O   1 
ATOM   665  C  CB  . HIS A 1 80  ? -1.244  6.311   46.804  1.00 30.71  ? 77  HIS B CB  1 
ATOM   666  C  CG  . HIS A 1 80  ? -2.676  6.275   47.230  1.00 32.80  ? 77  HIS B CG  1 
ATOM   667  N  ND1 . HIS A 1 80  ? -3.226  5.202   47.898  1.00 37.09  ? 77  HIS B ND1 1 
ATOM   668  C  CD2 . HIS A 1 80  ? -3.672  7.182   47.091  1.00 38.80  ? 77  HIS B CD2 1 
ATOM   669  C  CE1 . HIS A 1 80  ? -4.499  5.447   48.148  1.00 37.14  ? 77  HIS B CE1 1 
ATOM   670  N  NE2 . HIS A 1 80  ? -4.795  6.642   47.668  1.00 43.51  ? 77  HIS B NE2 1 
ATOM   671  N  N   . LEU A 1 81  ? 0.797   7.378   44.578  1.00 29.33  ? 78  LEU B N   1 
ATOM   672  C  CA  . LEU A 1 81  ? 2.179   7.820   44.548  1.00 26.01  ? 78  LEU B CA  1 
ATOM   673  C  C   . LEU A 1 81  ? 2.407   8.528   45.875  1.00 30.10  ? 78  LEU B C   1 
ATOM   674  O  O   . LEU A 1 81  ? 1.661   9.440   46.229  1.00 34.43  ? 78  LEU B O   1 
ATOM   675  C  CB  . LEU A 1 81  ? 2.416   8.785   43.388  1.00 22.46  ? 78  LEU B CB  1 
ATOM   676  C  CG  . LEU A 1 81  ? 3.751   9.538   43.394  1.00 26.45  ? 78  LEU B CG  1 
ATOM   677  C  CD1 . LEU A 1 81  ? 4.897   8.604   43.035  1.00 25.18  ? 78  LEU B CD1 1 
ATOM   678  C  CD2 . LEU A 1 81  ? 3.716   10.727  42.446  1.00 20.72  ? 78  LEU B CD2 1 
ATOM   679  N  N   . VAL A 1 82  ? 3.420   8.106   46.620  1.00 26.61  ? 79  VAL B N   1 
ATOM   680  C  CA  . VAL A 1 82  ? 3.608   8.634   47.967  1.00 30.67  ? 79  VAL B CA  1 
ATOM   681  C  C   . VAL A 1 82  ? 4.997   9.203   48.238  1.00 28.83  ? 79  VAL B C   1 
ATOM   682  O  O   . VAL A 1 82  ? 6.011   8.659   47.808  1.00 33.28  ? 79  VAL B O   1 
ATOM   683  C  CB  . VAL A 1 82  ? 3.227   7.589   49.051  1.00 29.47  ? 79  VAL B CB  1 
ATOM   684  C  CG1 . VAL A 1 82  ? 3.069   6.204   48.440  1.00 29.65  ? 79  VAL B CG1 1 
ATOM   685  C  CG2 . VAL A 1 82  ? 4.241   7.581   50.188  1.00 27.67  ? 79  VAL B CG2 1 
ATOM   686  N  N   . VAL A 1 83  ? 5.016   10.332  48.931  1.00 26.10  ? 80  VAL B N   1 
ATOM   687  C  CA  . VAL A 1 83  ? 6.241   10.877  49.474  1.00 27.52  ? 80  VAL B CA  1 
ATOM   688  C  C   . VAL A 1 83  ? 6.191   10.681  50.982  1.00 31.20  ? 80  VAL B C   1 
ATOM   689  O  O   . VAL A 1 83  ? 5.310   11.218  51.656  1.00 28.28  ? 80  VAL B O   1 
ATOM   690  C  CB  . VAL A 1 83  ? 6.386   12.372  49.165  1.00 30.93  ? 80  VAL B CB  1 
ATOM   691  C  CG1 . VAL A 1 83  ? 7.650   12.921  49.808  1.00 26.42  ? 80  VAL B CG1 1 
ATOM   692  C  CG2 . VAL A 1 83  ? 6.392   12.607  47.660  1.00 30.18  ? 80  VAL B CG2 1 
ATOM   693  N  N   . ALA A 1 84  ? 7.121   9.895   51.507  1.00 23.49  ? 81  ALA B N   1 
ATOM   694  C  CA  . ALA A 1 84  ? 7.164   9.647   52.936  1.00 25.58  ? 81  ALA B CA  1 
ATOM   695  C  C   . ALA A 1 84  ? 8.203   10.531  53.622  1.00 29.57  ? 81  ALA B C   1 
ATOM   696  O  O   . ALA A 1 84  ? 9.260   10.819  53.062  1.00 30.11  ? 81  ALA B O   1 
ATOM   697  C  CB  . ALA A 1 84  ? 7.440   8.181   53.213  1.00 26.13  ? 81  ALA B CB  1 
ATOM   698  N  N   . ARG A 1 85  ? 7.881   10.971  54.833  1.00 28.62  ? 82  ARG B N   1 
ATOM   699  C  CA  . ARG A 1 85  ? 8.819   11.715  55.657  1.00 31.33  ? 82  ARG B CA  1 
ATOM   700  C  C   . ARG A 1 85  ? 9.362   10.777  56.730  1.00 32.00  ? 82  ARG B C   1 
ATOM   701  O  O   . ARG A 1 85  ? 8.595   10.077  57.392  1.00 31.78  ? 82  ARG B O   1 
ATOM   702  C  CB  . ARG A 1 85  ? 8.123   12.917  56.298  1.00 32.24  ? 82  ARG B CB  1 
ATOM   703  C  CG  . ARG A 1 85  ? 9.034   13.797  57.145  1.00 31.00  ? 82  ARG B CG  1 
ATOM   704  C  CD  . ARG A 1 85  ? 8.292   15.022  57.671  1.00 31.31  ? 82  ARG B CD  1 
ATOM   705  N  NE  . ARG A 1 85  ? 7.223   14.664  58.602  1.00 33.73  ? 82  ARG B NE  1 
ATOM   706  C  CZ  . ARG A 1 85  ? 5.927   14.693  58.306  1.00 34.95  ? 82  ARG B CZ  1 
ATOM   707  N  NH1 . ARG A 1 85  ? 5.522   15.070  57.101  1.00 35.44  ? 82  ARG B NH1 1 
ATOM   708  N  NH2 . ARG A 1 85  ? 5.032   14.348  59.220  1.00 36.91  ? 82  ARG B NH2 1 
ATOM   709  N  N   . VAL A 1 86  ? 10.679  10.747  56.897  1.00 28.35  ? 83  VAL B N   1 
ATOM   710  C  CA  . VAL A 1 86  ? 11.276  9.861   57.890  1.00 30.30  ? 83  VAL B CA  1 
ATOM   711  C  C   . VAL A 1 86  ? 12.224  10.575  58.850  1.00 32.49  ? 83  VAL B C   1 
ATOM   712  O  O   . VAL A 1 86  ? 13.000  11.446  58.443  1.00 32.18  ? 83  VAL B O   1 
ATOM   713  C  CB  . VAL A 1 86  ? 12.012  8.667   57.235  1.00 29.27  ? 83  VAL B CB  1 
ATOM   714  C  CG1 . VAL A 1 86  ? 11.101  7.952   56.252  1.00 37.06  ? 83  VAL B CG1 1 
ATOM   715  C  CG2 . VAL A 1 86  ? 13.280  9.125   56.545  1.00 33.05  ? 83  VAL B CG2 1 
ATOM   716  N  N   . HIS A 1 87  ? 12.145  10.209  60.127  1.00 31.13  ? 84  HIS B N   1 
ATOM   717  C  CA  . HIS A 1 87  ? 13.127  10.654  61.107  1.00 31.43  ? 84  HIS B CA  1 
ATOM   718  C  C   . HIS A 1 87  ? 14.256  9.640   61.155  1.00 31.71  ? 84  HIS B C   1 
ATOM   719  O  O   . HIS A 1 87  ? 14.042  8.484   61.513  1.00 40.32  ? 84  HIS B O   1 
ATOM   720  C  CB  . HIS A 1 87  ? 12.521  10.777  62.509  1.00 35.26  ? 84  HIS B CB  1 
ATOM   721  C  CG  . HIS A 1 87  ? 11.362  11.721  62.600  1.00 39.05  ? 84  HIS B CG  1 
ATOM   722  N  ND1 . HIS A 1 87  ? 10.590  11.835  63.736  1.00 41.09  ? 84  HIS B ND1 1 
ATOM   723  C  CD2 . HIS A 1 87  ? 10.832  12.579  61.698  1.00 42.53  ? 84  HIS B CD2 1 
ATOM   724  C  CE1 . HIS A 1 87  ? 9.642   12.732  63.534  1.00 43.54  ? 84  HIS B CE1 1 
ATOM   725  N  NE2 . HIS A 1 87  ? 9.765   13.197  62.304  1.00 43.83  ? 84  HIS B NE2 1 
ATOM   726  N  N   . ILE A 1 88  ? 15.453  10.067  60.779  1.00 37.46  ? 85  ILE B N   1 
ATOM   727  C  CA  . ILE A 1 88  ? 16.636  9.240   60.959  1.00 39.08  ? 85  ILE B CA  1 
ATOM   728  C  C   . ILE A 1 88  ? 17.402  9.777   62.158  1.00 41.91  ? 85  ILE B C   1 
ATOM   729  O  O   . ILE A 1 88  ? 17.837  10.929  62.152  1.00 43.39  ? 85  ILE B O   1 
ATOM   730  C  CB  . ILE A 1 88  ? 17.536  9.235   59.712  1.00 41.06  ? 85  ILE B CB  1 
ATOM   731  C  CG1 . ILE A 1 88  ? 16.804  8.595   58.532  1.00 39.41  ? 85  ILE B CG1 1 
ATOM   732  C  CG2 . ILE A 1 88  ? 18.836  8.491   59.992  1.00 41.90  ? 85  ILE B CG2 1 
ATOM   733  C  CD1 . ILE A 1 88  ? 17.636  8.515   57.270  1.00 46.25  ? 85  ILE B CD1 1 
ATOM   734  N  N   . PRO A 1 89  ? 17.549  8.946   63.200  1.00 48.59  ? 86  PRO B N   1 
ATOM   735  C  CA  . PRO A 1 89  ? 18.184  9.347   64.452  1.00 49.29  ? 86  PRO B CA  1 
ATOM   736  C  C   . PRO A 1 89  ? 19.609  9.842   64.244  1.00 52.00  ? 86  PRO B C   1 
ATOM   737  O  O   . PRO A 1 89  ? 20.345  9.278   63.437  1.00 51.89  ? 86  PRO B O   1 
ATOM   738  C  CB  . PRO A 1 89  ? 18.195  8.051   65.269  1.00 50.41  ? 86  PRO B CB  1 
ATOM   739  C  CG  . PRO A 1 89  ? 17.086  7.234   64.702  1.00 50.71  ? 86  PRO B CG  1 
ATOM   740  C  CD  . PRO A 1 89  ? 17.094  7.545   63.237  1.00 52.08  ? 86  PRO B CD  1 
ATOM   741  N  N   . ASN A 1 90  ? 19.982  10.898  64.962  1.00 58.93  ? 87  ASN B N   1 
ATOM   742  C  CA  . ASN A 1 90  ? 21.357  11.379  64.954  1.00 62.85  ? 87  ASN B CA  1 
ATOM   743  C  C   . ASN A 1 90  ? 22.278  10.321  65.538  1.00 69.85  ? 87  ASN B C   1 
ATOM   744  O  O   . ASN A 1 90  ? 21.925  9.652   66.511  1.00 71.70  ? 87  ASN B O   1 
ATOM   745  C  CB  . ASN A 1 90  ? 21.484  12.682  65.745  1.00 64.18  ? 87  ASN B CB  1 
ATOM   746  C  CG  . ASN A 1 90  ? 20.849  13.863  65.035  1.00 66.72  ? 87  ASN B CG  1 
ATOM   747  O  OD1 . ASN A 1 90  ? 20.338  14.783  65.674  1.00 65.19  ? 87  ASN B OD1 1 
ATOM   748  N  ND2 . ASN A 1 90  ? 20.877  13.842  63.706  1.00 67.26  ? 87  ASN B ND2 1 
ATOM   749  N  N   . ASP A 1 91  ? 23.454  10.168  64.940  1.00 79.21  ? 88  ASP B N   1 
ATOM   750  C  CA  . ASP A 1 91  ? 24.395  9.132   65.352  1.00 88.77  ? 88  ASP B CA  1 
ATOM   751  C  C   . ASP A 1 91  ? 24.771  9.259   66.828  1.00 90.51  ? 88  ASP B C   1 
ATOM   752  O  O   . ASP A 1 91  ? 24.948  8.255   67.518  1.00 90.55  ? 88  ASP B O   1 
ATOM   753  C  CB  . ASP A 1 91  ? 25.651  9.170   64.478  1.00 94.01  ? 88  ASP B CB  1 
ATOM   754  C  CG  . ASP A 1 91  ? 26.449  7.881   64.545  1.00 99.22  ? 88  ASP B CG  1 
ATOM   755  O  OD1 . ASP A 1 91  ? 25.882  6.847   64.961  1.00 99.85  ? 88  ASP B OD1 1 
ATOM   756  O  OD2 . ASP A 1 91  ? 27.643  7.900   64.177  1.00 102.48 ? 88  ASP B OD2 1 
ATOM   757  N  N   . ASP A 1 92  ? 24.883  10.496  67.303  1.00 94.39  ? 89  ASP B N   1 
ATOM   758  C  CA  . ASP A 1 92  ? 25.226  10.763  68.695  1.00 96.00  ? 89  ASP B CA  1 
ATOM   759  C  C   . ASP A 1 92  ? 24.051  10.481  69.628  1.00 95.28  ? 89  ASP B C   1 
ATOM   760  O  O   . ASP A 1 92  ? 23.781  9.331   69.973  1.00 94.90  ? 89  ASP B O   1 
ATOM   761  C  CB  . ASP A 1 92  ? 25.698  12.211  68.861  1.00 97.20  ? 89  ASP B CB  1 
ATOM   762  C  CG  . ASP A 1 92  ? 24.676  13.221  68.366  1.00 97.29  ? 89  ASP B CG  1 
ATOM   763  O  OD1 . ASP A 1 92  ? 23.530  13.208  68.865  1.00 95.71  ? 89  ASP B OD1 1 
ATOM   764  O  OD2 . ASP A 1 92  ? 25.023  14.034  67.485  1.00 97.91  ? 89  ASP B OD2 1 
ATOM   765  N  N   . VAL A 1 113 ? 10.093  1.434   67.425  1.00 81.22  ? 110 VAL B N   1 
ATOM   766  C  CA  . VAL A 1 113 ? 10.908  2.136   68.409  1.00 83.64  ? 110 VAL B CA  1 
ATOM   767  C  C   . VAL A 1 113 ? 11.777  3.213   67.762  1.00 82.98  ? 110 VAL B C   1 
ATOM   768  O  O   . VAL A 1 113 ? 11.370  4.373   67.668  1.00 81.92  ? 110 VAL B O   1 
ATOM   769  C  CB  . VAL A 1 113 ? 11.803  1.163   69.203  1.00 80.24  ? 110 VAL B CB  1 
ATOM   770  N  N   . THR A 1 114 ? 12.969  2.824   67.317  1.00 79.16  ? 111 THR B N   1 
ATOM   771  C  CA  . THR A 1 114 ? 13.920  3.764   66.724  1.00 75.46  ? 111 THR B CA  1 
ATOM   772  C  C   . THR A 1 114 ? 13.469  4.255   65.350  1.00 70.12  ? 111 THR B C   1 
ATOM   773  O  O   . THR A 1 114 ? 13.175  3.455   64.459  1.00 65.91  ? 111 THR B O   1 
ATOM   774  C  CB  . THR A 1 114 ? 15.329  3.147   66.591  1.00 78.28  ? 111 THR B CB  1 
ATOM   775  O  OG1 . THR A 1 114 ? 15.306  2.093   65.619  1.00 73.27  ? 111 THR B OG1 1 
ATOM   776  C  CG2 . THR A 1 114 ? 15.806  2.599   67.932  1.00 80.08  ? 111 THR B CG2 1 
ATOM   777  N  N   . GLY A 1 115 ? 13.421  5.575   65.192  1.00 62.66  ? 112 GLY B N   1 
ATOM   778  C  CA  . GLY A 1 115 ? 13.034  6.192   63.929  1.00 52.31  ? 112 GLY B CA  1 
ATOM   779  C  C   . GLY A 1 115 ? 11.535  6.327   63.753  1.00 50.46  ? 112 GLY B C   1 
ATOM   780  O  O   . GLY A 1 115 ? 10.757  5.862   64.587  1.00 52.50  ? 112 GLY B O   1 
ATOM   781  N  N   . LYS A 1 116 ? 11.128  6.956   62.654  1.00 46.94  ? 113 LYS B N   1 
ATOM   782  C  CA  . LYS A 1 116 ? 9.719   7.244   62.408  1.00 39.47  ? 113 LYS B CA  1 
ATOM   783  C  C   . LYS A 1 116 ? 9.449   7.501   60.925  1.00 33.63  ? 113 LYS B C   1 
ATOM   784  O  O   . LYS A 1 116 ? 10.223  8.182   60.256  1.00 32.35  ? 113 LYS B O   1 
ATOM   785  C  CB  . LYS A 1 116 ? 9.290   8.456   63.239  1.00 38.18  ? 113 LYS B CB  1 
ATOM   786  C  CG  . LYS A 1 116 ? 7.798   8.723   63.263  1.00 46.86  ? 113 LYS B CG  1 
ATOM   787  C  CD  . LYS A 1 116 ? 7.479   9.904   64.166  1.00 49.10  ? 113 LYS B CD  1 
ATOM   788  C  CE  . LYS A 1 116 ? 5.984   10.151  64.250  1.00 55.57  ? 113 LYS B CE  1 
ATOM   789  N  NZ  . LYS A 1 116 ? 5.674   11.460  64.892  1.00 58.96  ? 113 LYS B NZ  1 
ATOM   790  N  N   . ILE A 1 117 ? 8.357   6.941   60.412  1.00 32.37  ? 114 ILE B N   1 
ATOM   791  C  CA  . ILE A 1 117 ? 7.927   7.215   59.041  1.00 36.08  ? 114 ILE B CA  1 
ATOM   792  C  C   . ILE A 1 117 ? 6.509   7.786   59.012  1.00 37.04  ? 114 ILE B C   1 
ATOM   793  O  O   . ILE A 1 117 ? 5.634   7.344   59.757  1.00 39.20  ? 114 ILE B O   1 
ATOM   794  C  CB  . ILE A 1 117 ? 8.015   5.969   58.128  1.00 38.09  ? 114 ILE B CB  1 
ATOM   795  C  CG1 . ILE A 1 117 ? 7.646   6.343   56.690  1.00 43.57  ? 114 ILE B CG1 1 
ATOM   796  C  CG2 . ILE A 1 117 ? 7.115   4.850   58.639  1.00 38.24  ? 114 ILE B CG2 1 
ATOM   797  C  CD1 . ILE A 1 117 ? 7.741   5.201   55.710  1.00 45.47  ? 114 ILE B CD1 1 
ATOM   798  N  N   . GLU A 1 118 ? 6.298   8.779   58.156  1.00 37.09  ? 115 GLU B N   1 
ATOM   799  C  CA  . GLU A 1 118 ? 5.000   9.427   58.014  1.00 36.36  ? 115 GLU B CA  1 
ATOM   800  C  C   . GLU A 1 118 ? 4.748   9.762   56.549  1.00 35.32  ? 115 GLU B C   1 
ATOM   801  O  O   . GLU A 1 118 ? 5.637   9.617   55.710  1.00 35.51  ? 115 GLU B O   1 
ATOM   802  C  CB  . GLU A 1 118 ? 4.948   10.706  58.853  1.00 42.04  ? 115 GLU B CB  1 
ATOM   803  C  CG  . GLU A 1 118 ? 4.874   10.475  60.351  1.00 53.75  ? 115 GLU B CG  1 
ATOM   804  C  CD  . GLU A 1 118 ? 5.151   11.734  61.148  1.00 64.77  ? 115 GLU B CD  1 
ATOM   805  O  OE1 . GLU A 1 118 ? 6.176   12.398  60.881  1.00 66.78  ? 115 GLU B OE1 1 
ATOM   806  O  OE2 . GLU A 1 118 ? 4.345   12.056  62.048  1.00 70.34  ? 115 GLU B OE2 1 
ATOM   807  N  N   . CYS A 1 119 ? 3.538   10.215  56.242  1.00 31.38  ? 116 CYS B N   1 
ATOM   808  C  CA  . CYS A 1 119 ? 3.205   10.613  54.882  1.00 35.04  ? 116 CYS B CA  1 
ATOM   809  C  C   . CYS A 1 119 ? 3.232   12.123  54.707  1.00 32.29  ? 116 CYS B C   1 
ATOM   810  O  O   . CYS A 1 119 ? 2.453   12.847  55.327  1.00 32.45  ? 116 CYS B O   1 
ATOM   811  C  CB  . CYS A 1 119 ? 1.834   10.073  54.485  1.00 40.36  ? 116 CYS B CB  1 
ATOM   812  S  SG  . CYS A 1 119 ? 1.766   8.285   54.440  1.00 58.61  ? 116 CYS B SG  1 
ATOM   813  N  N   . GLU A 1 120 ? 4.139   12.597  53.864  1.00 29.09  ? 117 GLU B N   1 
ATOM   814  C  CA  . GLU A 1 120 ? 4.140   13.994  53.485  1.00 32.99  ? 117 GLU B CA  1 
ATOM   815  C  C   . GLU A 1 120 ? 2.963   14.214  52.546  1.00 35.52  ? 117 GLU B C   1 
ATOM   816  O  O   . GLU A 1 120 ? 2.121   15.077  52.788  1.00 41.20  ? 117 GLU B O   1 
ATOM   817  C  CB  . GLU A 1 120 ? 5.451   14.373  52.799  1.00 32.67  ? 117 GLU B CB  1 
ATOM   818  C  CG  . GLU A 1 120 ? 5.637   15.869  52.619  1.00 34.16  ? 117 GLU B CG  1 
ATOM   819  C  CD  . GLU A 1 120 ? 6.036   16.564  53.905  1.00 33.80  ? 117 GLU B CD  1 
ATOM   820  O  OE1 . GLU A 1 120 ? 5.469   17.634  54.203  1.00 35.27  ? 117 GLU B OE1 1 
ATOM   821  O  OE2 . GLU A 1 120 ? 6.915   16.038  54.619  1.00 33.64  ? 117 GLU B OE2 1 
ATOM   822  N  N   . ILE A 1 121 ? 2.900   13.417  51.482  1.00 33.09  ? 118 ILE B N   1 
ATOM   823  C  CA  . ILE A 1 121 ? 1.774   13.479  50.555  1.00 39.81  ? 118 ILE B CA  1 
ATOM   824  C  C   . ILE A 1 121 ? 1.455   12.124  49.917  1.00 35.00  ? 118 ILE B C   1 
ATOM   825  O  O   . ILE A 1 121 ? 2.309   11.245  49.818  1.00 36.15  ? 118 ILE B O   1 
ATOM   826  C  CB  . ILE A 1 121 ? 1.979   14.552  49.461  1.00 43.90  ? 118 ILE B CB  1 
ATOM   827  C  CG1 . ILE A 1 121 ? 0.636   14.931  48.826  1.00 45.14  ? 118 ILE B CG1 1 
ATOM   828  C  CG2 . ILE A 1 121 ? 2.979   14.077  48.416  1.00 46.65  ? 118 ILE B CG2 1 
ATOM   829  C  CD1 . ILE A 1 121 ? 0.725   16.063  47.818  1.00 45.42  ? 118 ILE B CD1 1 
ATOM   830  N  N   . LYS A 1 122 ? 0.207   11.979  49.491  1.00 34.63  ? 119 LYS B N   1 
ATOM   831  C  CA  . LYS A 1 122 ? -0.295  10.747  48.914  1.00 30.97  ? 119 LYS B CA  1 
ATOM   832  C  C   . LYS A 1 122 ? -1.170  11.145  47.735  1.00 33.09  ? 119 LYS B C   1 
ATOM   833  O  O   . LYS A 1 122 ? -2.151  11.871  47.905  1.00 35.44  ? 119 LYS B O   1 
ATOM   834  C  CB  . LYS A 1 122 ? -1.126  10.008  49.960  1.00 30.84  ? 119 LYS B CB  1 
ATOM   835  C  CG  . LYS A 1 122 ? -1.152  8.503   49.827  1.00 38.09  ? 119 LYS B CG  1 
ATOM   836  C  CD  . LYS A 1 122 ? -1.622  7.877   51.132  1.00 45.06  ? 119 LYS B CD  1 
ATOM   837  C  CE  . LYS A 1 122 ? -1.501  6.365   51.106  1.00 53.26  ? 119 LYS B CE  1 
ATOM   838  N  NZ  . LYS A 1 122 ? -1.832  5.763   52.429  1.00 59.61  ? 119 LYS B NZ  1 
ATOM   839  N  N   . ILE A 1 123 ? -0.811  10.687  46.540  1.00 27.38  ? 120 ILE B N   1 
ATOM   840  C  CA  . ILE A 1 123 ? -1.507  11.109  45.326  1.00 32.32  ? 120 ILE B CA  1 
ATOM   841  C  C   . ILE A 1 123 ? -2.216  9.960   44.605  1.00 33.99  ? 120 ILE B C   1 
ATOM   842  O  O   . ILE A 1 123 ? -1.608  8.932   44.307  1.00 33.87  ? 120 ILE B O   1 
ATOM   843  C  CB  . ILE A 1 123 ? -0.538  11.816  44.349  1.00 33.21  ? 120 ILE B CB  1 
ATOM   844  C  CG1 . ILE A 1 123 ? 0.073   13.053  45.015  1.00 34.21  ? 120 ILE B CG1 1 
ATOM   845  C  CG2 . ILE A 1 123 ? -1.249  12.190  43.050  1.00 24.10  ? 120 ILE B CG2 1 
ATOM   846  C  CD1 . ILE A 1 123 ? 1.103   13.766  44.171  1.00 26.80  ? 120 ILE B CD1 1 
ATOM   847  N  N   . ASN A 1 124 ? -3.505  10.144  44.327  1.00 36.65  ? 121 ASN B N   1 
ATOM   848  C  CA  . ASN A 1 124 ? -4.269  9.174   43.543  1.00 35.74  ? 121 ASN B CA  1 
ATOM   849  C  C   . ASN A 1 124 ? -3.543  8.787   42.259  1.00 37.98  ? 121 ASN B C   1 
ATOM   850  O  O   . ASN A 1 124 ? -3.136  9.646   41.474  1.00 34.11  ? 121 ASN B O   1 
ATOM   851  C  CB  . ASN A 1 124 ? -5.664  9.711   43.211  1.00 28.90  ? 121 ASN B CB  1 
ATOM   852  C  CG  . ASN A 1 124 ? -6.615  9.639   44.389  1.00 32.51  ? 121 ASN B CG  1 
ATOM   853  O  OD1 . ASN A 1 124 ? -6.581  8.692   45.177  1.00 35.85  ? 121 ASN B OD1 1 
ATOM   854  N  ND2 . ASN A 1 124 ? -7.476  10.642  44.513  1.00 35.73  ? 121 ASN B ND2 1 
ATOM   855  N  N   . HIS A 1 125 ? -3.387  7.485   42.056  1.00 36.34  ? 122 HIS B N   1 
ATOM   856  C  CA  . HIS A 1 125 ? -2.635  6.964   40.931  1.00 36.50  ? 122 HIS B CA  1 
ATOM   857  C  C   . HIS A 1 125 ? -3.417  5.808   40.308  1.00 40.86  ? 122 HIS B C   1 
ATOM   858  O  O   . HIS A 1 125 ? -3.913  4.934   41.018  1.00 38.11  ? 122 HIS B O   1 
ATOM   859  C  CB  . HIS A 1 125 ? -1.259  6.492   41.415  1.00 35.07  ? 122 HIS B CB  1 
ATOM   860  C  CG  . HIS A 1 125 ? -0.341  6.049   40.318  1.00 28.99  ? 122 HIS B CG  1 
ATOM   861  N  ND1 . HIS A 1 125 ? 0.597   6.883   39.749  1.00 29.36  ? 122 HIS B ND1 1 
ATOM   862  C  CD2 . HIS A 1 125 ? -0.206  4.853   39.697  1.00 20.81  ? 122 HIS B CD2 1 
ATOM   863  C  CE1 . HIS A 1 125 ? 1.264   6.223   38.818  1.00 23.08  ? 122 HIS B CE1 1 
ATOM   864  N  NE2 . HIS A 1 125 ? 0.797   4.989   38.768  1.00 28.82  ? 122 HIS B NE2 1 
ATOM   865  N  N   . GLU A 1 126 ? -3.545  5.824   38.984  1.00 44.22  ? 123 GLU B N   1 
ATOM   866  C  CA  . GLU A 1 126 ? -4.226  4.751   38.268  1.00 46.22  ? 123 GLU B CA  1 
ATOM   867  C  C   . GLU A 1 126 ? -3.279  3.588   38.032  1.00 42.49  ? 123 GLU B C   1 
ATOM   868  O  O   . GLU A 1 126 ? -2.272  3.732   37.342  1.00 41.31  ? 123 GLU B O   1 
ATOM   869  C  CB  . GLU A 1 126 ? -4.787  5.250   36.933  1.00 55.14  ? 123 GLU B CB  1 
ATOM   870  C  CG  . GLU A 1 126 ? -6.265  5.610   36.976  1.00 64.62  ? 123 GLU B CG  1 
ATOM   871  C  CD  . GLU A 1 126 ? -7.152  4.401   37.224  1.00 66.82  ? 123 GLU B CD  1 
ATOM   872  O  OE1 . GLU A 1 126 ? -8.126  4.523   37.998  1.00 68.65  ? 123 GLU B OE1 1 
ATOM   873  O  OE2 . GLU A 1 126 ? -6.872  3.328   36.650  1.00 68.63  ? 123 GLU B OE2 1 
ATOM   874  N  N   . GLY A 1 127 ? -3.608  2.436   38.608  1.00 38.45  ? 124 GLY B N   1 
ATOM   875  C  CA  . GLY A 1 127 ? -2.750  1.262   38.507  1.00 36.76  ? 124 GLY B CA  1 
ATOM   876  C  C   . GLY A 1 127 ? -1.529  1.408   39.391  1.00 40.56  ? 124 GLY B C   1 
ATOM   877  O  O   . GLY A 1 127 ? -1.302  2.467   39.976  1.00 45.74  ? 124 GLY B O   1 
ATOM   878  N  N   . GLU A 1 128 ? -0.737  0.346   39.492  1.00 38.99  ? 125 GLU B N   1 
ATOM   879  C  CA  . GLU A 1 128 ? 0.445   0.361   40.349  1.00 33.11  ? 125 GLU B CA  1 
ATOM   880  C  C   . GLU A 1 128 ? 1.525   1.300   39.820  1.00 34.06  ? 125 GLU B C   1 
ATOM   881  O  O   . GLU A 1 128 ? 1.529   1.657   38.645  1.00 41.50  ? 125 GLU B O   1 
ATOM   882  C  CB  . GLU A 1 128 ? 1.006   -1.051  40.534  1.00 29.34  ? 125 GLU B CB  1 
ATOM   883  C  CG  . GLU A 1 128 ? 1.271   -1.812  39.243  1.00 48.36  ? 125 GLU B CG  1 
ATOM   884  C  CD  . GLU A 1 128 ? 0.084   -2.651  38.789  1.00 55.66  ? 125 GLU B CD  1 
ATOM   885  O  OE1 . GLU A 1 128 ? 0.314   -3.699  38.149  1.00 59.20  ? 125 GLU B OE1 1 
ATOM   886  O  OE2 . GLU A 1 128 ? -1.074  -2.271  39.075  1.00 53.54  ? 125 GLU B OE2 1 
ATOM   887  N  N   . VAL A 1 129 ? 2.431   1.711   40.700  1.00 33.84  ? 126 VAL B N   1 
ATOM   888  C  CA  . VAL A 1 129 ? 3.543   2.562   40.303  1.00 33.28  ? 126 VAL B CA  1 
ATOM   889  C  C   . VAL A 1 129 ? 4.759   1.697   39.986  1.00 37.99  ? 126 VAL B C   1 
ATOM   890  O  O   . VAL A 1 129 ? 5.452   1.233   40.893  1.00 46.17  ? 126 VAL B O   1 
ATOM   891  C  CB  . VAL A 1 129 ? 3.905   3.577   41.409  1.00 33.83  ? 126 VAL B CB  1 
ATOM   892  C  CG1 . VAL A 1 129 ? 4.939   4.570   40.906  1.00 31.82  ? 126 VAL B CG1 1 
ATOM   893  C  CG2 . VAL A 1 129 ? 2.662   4.307   41.890  1.00 31.83  ? 126 VAL B CG2 1 
ATOM   894  N  N   . ASN A 1 130 ? 5.004   1.473   38.697  1.00 39.19  ? 127 ASN B N   1 
ATOM   895  C  CA  . ASN A 1 130 ? 6.142   0.668   38.255  1.00 38.69  ? 127 ASN B CA  1 
ATOM   896  C  C   . ASN A 1 130 ? 7.469   1.310   38.640  1.00 37.24  ? 127 ASN B C   1 
ATOM   897  O  O   . ASN A 1 130 ? 8.399   0.628   39.067  1.00 41.73  ? 127 ASN B O   1 
ATOM   898  C  CB  . ASN A 1 130 ? 6.090   0.433   36.743  1.00 40.88  ? 127 ASN B CB  1 
ATOM   899  C  CG  . ASN A 1 130 ? 5.066   -0.619  36.344  1.00 44.08  ? 127 ASN B CG  1 
ATOM   900  O  OD1 . ASN A 1 130 ? 4.425   -1.239  37.193  1.00 42.49  ? 127 ASN B OD1 1 
ATOM   901  N  ND2 . ASN A 1 130 ? 4.913   -0.825  35.040  1.00 39.08  ? 127 ASN B ND2 1 
ATOM   902  N  N   . ARG A 1 131 ? 7.544   2.627   38.483  1.00 37.51  ? 128 ARG B N   1 
ATOM   903  C  CA  . ARG A 1 131 ? 8.721   3.391   38.877  1.00 32.49  ? 128 ARG B CA  1 
ATOM   904  C  C   . ARG A 1 131 ? 8.377   4.865   39.016  1.00 30.23  ? 128 ARG B C   1 
ATOM   905  O  O   . ARG A 1 131 ? 7.588   5.401   38.242  1.00 32.54  ? 128 ARG B O   1 
ATOM   906  C  CB  . ARG A 1 131 ? 9.851   3.212   37.864  1.00 32.94  ? 128 ARG B CB  1 
ATOM   907  C  CG  . ARG A 1 131 ? 11.122  3.977   38.213  1.00 33.82  ? 128 ARG B CG  1 
ATOM   908  C  CD  . ARG A 1 131 ? 12.340  3.266   37.666  1.00 29.31  ? 128 ARG B CD  1 
ATOM   909  N  NE  . ARG A 1 131 ? 12.351  1.865   38.073  1.00 34.50  ? 128 ARG B NE  1 
ATOM   910  C  CZ  . ARG A 1 131 ? 13.120  0.930   37.527  1.00 36.38  ? 128 ARG B CZ  1 
ATOM   911  N  NH1 . ARG A 1 131 ? 13.950  1.241   36.540  1.00 39.79  ? 128 ARG B NH1 1 
ATOM   912  N  NH2 . ARG A 1 131 ? 13.054  -0.318  37.966  1.00 34.00  ? 128 ARG B NH2 1 
ATOM   913  N  N   . ALA A 1 132 ? 8.967   5.515   40.013  1.00 31.94  ? 129 ALA B N   1 
ATOM   914  C  CA  . ALA A 1 132 ? 8.758   6.943   40.217  1.00 30.74  ? 129 ALA B CA  1 
ATOM   915  C  C   . ALA A 1 132 ? 10.098  7.629   40.418  1.00 27.71  ? 129 ALA B C   1 
ATOM   916  O  O   . ALA A 1 132 ? 10.933  7.167   41.193  1.00 37.68  ? 129 ALA B O   1 
ATOM   917  C  CB  . ALA A 1 132 ? 7.839   7.190   41.402  1.00 25.07  ? 129 ALA B CB  1 
ATOM   918  N  N   . ARG A 1 133 ? 10.301  8.731   39.709  1.00 29.96  ? 130 ARG B N   1 
ATOM   919  C  CA  . ARG A 1 133 ? 11.583  9.408   39.720  1.00 30.62  ? 130 ARG B CA  1 
ATOM   920  C  C   . ARG A 1 133 ? 11.364  10.917  39.721  1.00 32.54  ? 130 ARG B C   1 
ATOM   921  O  O   . ARG A 1 133 ? 10.501  11.425  39.005  1.00 35.21  ? 130 ARG B O   1 
ATOM   922  C  CB  . ARG A 1 133 ? 12.403  8.987   38.498  1.00 31.41  ? 130 ARG B CB  1 
ATOM   923  C  CG  . ARG A 1 133 ? 13.865  8.688   38.787  1.00 40.39  ? 130 ARG B CG  1 
ATOM   924  C  CD  . ARG A 1 133 ? 14.151  7.189   38.855  1.00 33.44  ? 130 ARG B CD  1 
ATOM   925  N  NE  . ARG A 1 133 ? 13.493  6.531   39.980  1.00 36.73  ? 130 ARG B NE  1 
ATOM   926  C  CZ  . ARG A 1 133 ? 13.739  5.282   40.366  1.00 37.26  ? 130 ARG B CZ  1 
ATOM   927  N  NH1 . ARG A 1 133 ? 14.639  4.547   39.726  1.00 40.17  ? 130 ARG B NH1 1 
ATOM   928  N  NH2 . ARG A 1 133 ? 13.087  4.765   41.398  1.00 35.95  ? 130 ARG B NH2 1 
ATOM   929  N  N   . TYR A 1 134 ? 12.136  11.633  40.533  1.00 33.21  ? 131 TYR B N   1 
ATOM   930  C  CA  . TYR A 1 134 ? 11.994  13.083  40.624  1.00 35.06  ? 131 TYR B CA  1 
ATOM   931  C  C   . TYR A 1 134 ? 12.938  13.807  39.667  1.00 39.61  ? 131 TYR B C   1 
ATOM   932  O  O   . TYR A 1 134 ? 14.032  13.328  39.372  1.00 43.13  ? 131 TYR B O   1 
ATOM   933  C  CB  . TYR A 1 134 ? 12.204  13.571  42.063  1.00 31.19  ? 131 TYR B CB  1 
ATOM   934  C  CG  . TYR A 1 134 ? 13.648  13.595  42.516  1.00 32.03  ? 131 TYR B CG  1 
ATOM   935  C  CD1 . TYR A 1 134 ? 14.210  12.502  43.162  1.00 33.03  ? 131 TYR B CD1 1 
ATOM   936  C  CD2 . TYR A 1 134 ? 14.446  14.714  42.305  1.00 27.26  ? 131 TYR B CD2 1 
ATOM   937  C  CE1 . TYR A 1 134 ? 15.529  12.516  43.579  1.00 33.86  ? 131 TYR B CE1 1 
ATOM   938  C  CE2 . TYR A 1 134 ? 15.766  14.739  42.718  1.00 31.39  ? 131 TYR B CE2 1 
ATOM   939  C  CZ  . TYR A 1 134 ? 16.302  13.636  43.355  1.00 36.90  ? 131 TYR B CZ  1 
ATOM   940  O  OH  . TYR A 1 134 ? 17.613  13.649  43.772  1.00 38.50  ? 131 TYR B OH  1 
HETATM 941  N  N   . MSE A 1 135 ? 12.503  14.953  39.188  1.00 45.32  ? 132 MSE B N   1 
HETATM 942  C  CA  . MSE A 1 135 ? 13.311  15.785  38.308  1.00 48.46  ? 132 MSE B CA  1 
HETATM 943  C  C   . MSE A 1 135 ? 14.351  16.537  39.133  1.00 40.70  ? 132 MSE B C   1 
HETATM 944  O  O   . MSE A 1 135 ? 13.994  17.316  40.016  1.00 43.19  ? 132 MSE B O   1 
HETATM 945  C  CB  . MSE A 1 135 ? 12.413  16.776  37.565  1.00 49.41  ? 132 MSE B CB  1 
HETATM 946  C  CG  . MSE A 1 135 ? 13.040  17.409  36.337  1.00 54.60  ? 132 MSE B CG  1 
HETATM 947  SE SE  . MSE A 1 135 ? 11.812  18.627  35.423  1.00 63.77  ? 132 MSE B SE  1 
HETATM 948  C  CE  . MSE A 1 135 ? 12.180  20.256  36.426  1.00 51.93  ? 132 MSE B CE  1 
ATOM   949  N  N   . PRO A 1 136 ? 15.625  16.303  38.858  1.00 39.98  ? 133 PRO B N   1 
ATOM   950  C  CA  . PRO A 1 136 ? 16.719  16.914  39.615  1.00 36.30  ? 133 PRO B CA  1 
ATOM   951  C  C   . PRO A 1 136 ? 16.596  18.430  39.714  1.00 35.73  ? 133 PRO B C   1 
ATOM   952  O  O   . PRO A 1 136 ? 16.896  19.005  40.759  1.00 40.35  ? 133 PRO B O   1 
ATOM   953  C  CB  . PRO A 1 136 ? 17.958  16.540  38.798  1.00 33.15  ? 133 PRO B CB  1 
ATOM   954  C  CG  . PRO A 1 136 ? 17.580  15.280  38.109  1.00 28.02  ? 133 PRO B CG  1 
ATOM   955  C  CD  . PRO A 1 136 ? 16.123  15.420  37.788  1.00 37.50  ? 133 PRO B CD  1 
ATOM   956  N  N   . GLN A 1 137 ? 16.147  19.065  38.636  1.00 41.97  ? 134 GLN B N   1 
ATOM   957  C  CA  . GLN A 1 137 ? 16.054  20.523  38.579  1.00 41.53  ? 134 GLN B CA  1 
ATOM   958  C  C   . GLN A 1 137 ? 14.883  21.065  39.397  1.00 41.41  ? 134 GLN B C   1 
ATOM   959  O  O   . GLN A 1 137 ? 14.892  22.222  39.815  1.00 48.53  ? 134 GLN B O   1 
ATOM   960  C  CB  . GLN A 1 137 ? 15.949  20.997  37.127  1.00 42.54  ? 134 GLN B CB  1 
ATOM   961  C  CG  . GLN A 1 137 ? 17.162  20.665  36.260  1.00 37.20  ? 134 GLN B CG  1 
ATOM   962  C  CD  . GLN A 1 137 ? 17.121  19.257  35.689  1.00 36.08  ? 134 GLN B CD  1 
ATOM   963  O  OE1 . GLN A 1 137 ? 16.267  18.450  36.053  1.00 39.16  ? 134 GLN B OE1 1 
ATOM   964  N  NE2 . GLN A 1 137 ? 18.049  18.959  34.787  1.00 36.67  ? 134 GLN B NE2 1 
ATOM   965  N  N   . ASN A 1 138 ? 13.879  20.222  39.618  1.00 40.33  ? 135 ASN B N   1 
ATOM   966  C  CA  . ASN A 1 138 ? 12.700  20.590  40.396  1.00 38.92  ? 135 ASN B CA  1 
ATOM   967  C  C   . ASN A 1 138 ? 12.117  19.348  41.066  1.00 40.86  ? 135 ASN B C   1 
ATOM   968  O  O   . ASN A 1 138 ? 11.262  18.670  40.493  1.00 38.46  ? 135 ASN B O   1 
ATOM   969  C  CB  . ASN A 1 138 ? 11.654  21.255  39.499  1.00 44.64  ? 135 ASN B CB  1 
ATOM   970  C  CG  . ASN A 1 138 ? 10.565  21.960  40.284  1.00 46.76  ? 135 ASN B CG  1 
ATOM   971  O  OD1 . ASN A 1 138 ? 9.575   22.416  39.714  1.00 45.57  ? 135 ASN B OD1 1 
ATOM   972  N  ND2 . ASN A 1 138 ? 10.747  22.060  41.597  1.00 46.72  ? 135 ASN B ND2 1 
ATOM   973  N  N   . PRO A 1 139 ? 12.587  19.048  42.288  1.00 44.08  ? 136 PRO B N   1 
ATOM   974  C  CA  . PRO A 1 139 ? 12.299  17.794  42.987  1.00 36.39  ? 136 PRO B CA  1 
ATOM   975  C  C   . PRO A 1 139 ? 10.820  17.540  43.275  1.00 32.01  ? 136 PRO B C   1 
ATOM   976  O  O   . PRO A 1 139 ? 10.454  16.412  43.594  1.00 34.33  ? 136 PRO B O   1 
ATOM   977  C  CB  . PRO A 1 139 ? 13.080  17.933  44.300  1.00 38.69  ? 136 PRO B CB  1 
ATOM   978  C  CG  . PRO A 1 139 ? 14.108  18.981  44.030  1.00 42.23  ? 136 PRO B CG  1 
ATOM   979  C  CD  . PRO A 1 139 ? 13.453  19.931  43.086  1.00 38.20  ? 136 PRO B CD  1 
ATOM   980  N  N   . HIS A 1 140 ? 9.971   18.560  43.177  1.00 34.57  ? 137 HIS B N   1 
ATOM   981  C  CA  . HIS A 1 140 ? 8.540   18.317  43.378  1.00 34.90  ? 137 HIS B CA  1 
ATOM   982  C  C   . HIS A 1 140 ? 7.803   17.982  42.078  1.00 33.39  ? 137 HIS B C   1 
ATOM   983  O  O   . HIS A 1 140 ? 6.577   17.896  42.046  1.00 28.17  ? 137 HIS B O   1 
ATOM   984  C  CB  . HIS A 1 140 ? 7.846   19.420  44.201  1.00 32.91  ? 137 HIS B CB  1 
ATOM   985  C  CG  . HIS A 1 140 ? 7.975   20.799  43.634  1.00 40.59  ? 137 HIS B CG  1 
ATOM   986  N  ND1 . HIS A 1 140 ? 7.303   21.207  42.502  1.00 45.00  ? 137 HIS B ND1 1 
ATOM   987  C  CD2 . HIS A 1 140 ? 8.659   21.881  44.075  1.00 39.33  ? 137 HIS B CD2 1 
ATOM   988  C  CE1 . HIS A 1 140 ? 7.588   22.473  42.255  1.00 40.85  ? 137 HIS B CE1 1 
ATOM   989  N  NE2 . HIS A 1 140 ? 8.409   22.905  43.194  1.00 43.14  ? 137 HIS B NE2 1 
ATOM   990  N  N   . ILE A 1 141 ? 8.574   17.770  41.016  1.00 33.82  ? 138 ILE B N   1 
ATOM   991  C  CA  . ILE A 1 141 ? 8.047   17.233  39.771  1.00 30.41  ? 138 ILE B CA  1 
ATOM   992  C  C   . ILE A 1 141 ? 8.470   15.772  39.662  1.00 33.97  ? 138 ILE B C   1 
ATOM   993  O  O   . ILE A 1 141 ? 9.660   15.460  39.702  1.00 37.73  ? 138 ILE B O   1 
ATOM   994  C  CB  . ILE A 1 141 ? 8.548   18.032  38.554  1.00 33.95  ? 138 ILE B CB  1 
ATOM   995  C  CG1 . ILE A 1 141 ? 7.940   19.437  38.569  1.00 35.44  ? 138 ILE B CG1 1 
ATOM   996  C  CG2 . ILE A 1 141 ? 8.210   17.307  37.254  1.00 32.97  ? 138 ILE B CG2 1 
ATOM   997  C  CD1 . ILE A 1 141 ? 8.283   20.273  37.362  1.00 47.02  ? 138 ILE B CD1 1 
ATOM   998  N  N   . ILE A 1 142 ? 7.493   14.878  39.538  1.00 32.13  ? 139 ILE B N   1 
ATOM   999  C  CA  . ILE A 1 142 ? 7.765   13.445  39.572  1.00 29.72  ? 139 ILE B CA  1 
ATOM   1000 C  C   . ILE A 1 142 ? 7.108   12.701  38.412  1.00 30.85  ? 139 ILE B C   1 
ATOM   1001 O  O   . ILE A 1 142 ? 5.911   12.845  38.168  1.00 34.73  ? 139 ILE B O   1 
ATOM   1002 C  CB  . ILE A 1 142 ? 7.291   12.817  40.907  1.00 31.67  ? 139 ILE B CB  1 
ATOM   1003 C  CG1 . ILE A 1 142 ? 7.985   13.487  42.096  1.00 29.27  ? 139 ILE B CG1 1 
ATOM   1004 C  CG2 . ILE A 1 142 ? 7.543   11.313  40.916  1.00 23.76  ? 139 ILE B CG2 1 
ATOM   1005 C  CD1 . ILE A 1 142 ? 7.384   13.130  43.435  1.00 26.35  ? 139 ILE B CD1 1 
ATOM   1006 N  N   . ALA A 1 143 ? 7.901   11.900  37.708  1.00 28.31  ? 140 ALA B N   1 
ATOM   1007 C  CA  . ALA A 1 143 ? 7.391   11.071  36.623  1.00 30.38  ? 140 ALA B CA  1 
ATOM   1008 C  C   . ALA A 1 143 ? 7.149   9.653   37.112  1.00 33.45  ? 140 ALA B C   1 
ATOM   1009 O  O   . ALA A 1 143 ? 7.901   9.141   37.943  1.00 35.88  ? 140 ALA B O   1 
ATOM   1010 C  CB  . ALA A 1 143 ? 8.364   11.064  35.463  1.00 31.91  ? 140 ALA B CB  1 
ATOM   1011 N  N   . THR A 1 144 ? 6.100   9.018   36.599  1.00 33.74  ? 141 THR B N   1 
ATOM   1012 C  CA  . THR A 1 144 ? 5.783   7.649   36.992  1.00 36.64  ? 141 THR B CA  1 
ATOM   1013 C  C   . THR A 1 144 ? 5.509   6.759   35.790  1.00 39.10  ? 141 THR B C   1 
ATOM   1014 O  O   . THR A 1 144 ? 5.062   7.230   34.743  1.00 41.95  ? 141 THR B O   1 
ATOM   1015 C  CB  . THR A 1 144 ? 4.557   7.580   37.921  1.00 34.78  ? 141 THR B CB  1 
ATOM   1016 O  OG1 . THR A 1 144 ? 3.397   8.037   37.219  1.00 44.60  ? 141 THR B OG1 1 
ATOM   1017 C  CG2 . THR A 1 144 ? 4.766   8.423   39.168  1.00 37.00  ? 141 THR B CG2 1 
ATOM   1018 N  N   . LYS A 1 145 ? 5.778   5.467   35.955  1.00 41.66  ? 142 LYS B N   1 
ATOM   1019 C  CA  . LYS A 1 145 ? 5.455   4.470   34.944  1.00 41.34  ? 142 LYS B CA  1 
ATOM   1020 C  C   . LYS A 1 145 ? 4.250   3.649   35.390  1.00 44.07  ? 142 LYS B C   1 
ATOM   1021 O  O   . LYS A 1 145 ? 4.239   3.084   36.483  1.00 45.72  ? 142 LYS B O   1 
ATOM   1022 C  CB  . LYS A 1 145 ? 6.655   3.561   34.683  1.00 39.29  ? 142 LYS B CB  1 
ATOM   1023 C  CG  . LYS A 1 145 ? 7.821   4.259   34.008  1.00 43.83  ? 142 LYS B CG  1 
ATOM   1024 C  CD  . LYS A 1 145 ? 7.559   4.482   32.528  1.00 41.25  ? 142 LYS B CD  1 
ATOM   1025 C  CE  . LYS A 1 145 ? 7.574   3.164   31.772  1.00 43.40  ? 142 LYS B CE  1 
ATOM   1026 N  NZ  . LYS A 1 145 ? 7.413   3.351   30.306  1.00 41.94  ? 142 LYS B NZ  1 
ATOM   1027 N  N   . THR A 1 146 ? 3.241   3.592   34.528  1.00 48.60  ? 143 THR B N   1 
ATOM   1028 C  CA  . THR A 1 146 ? 1.962   2.966   34.842  1.00 48.80  ? 143 THR B CA  1 
ATOM   1029 C  C   . THR A 1 146 ? 1.877   1.594   34.175  1.00 45.04  ? 143 THR B C   1 
ATOM   1030 O  O   . THR A 1 146 ? 2.627   1.317   33.239  1.00 42.65  ? 143 THR B O   1 
ATOM   1031 C  CB  . THR A 1 146 ? 0.803   3.849   34.329  1.00 52.93  ? 143 THR B CB  1 
ATOM   1032 O  OG1 . THR A 1 146 ? 1.177   5.232   34.419  1.00 55.83  ? 143 THR B OG1 1 
ATOM   1033 C  CG2 . THR A 1 146 ? -0.457  3.625   35.141  1.00 60.13  ? 143 THR B CG2 1 
ATOM   1034 N  N   . PRO A 1 147 ? 0.978   0.719   34.662  1.00 47.52  ? 144 PRO B N   1 
ATOM   1035 C  CA  . PRO A 1 147 ? 0.741   -0.535  33.947  1.00 48.86  ? 144 PRO B CA  1 
ATOM   1036 C  C   . PRO A 1 147 ? 0.093   -0.310  32.576  1.00 51.51  ? 144 PRO B C   1 
ATOM   1037 O  O   . PRO A 1 147 ? -0.020  -1.245  31.784  1.00 48.97  ? 144 PRO B O   1 
ATOM   1038 C  CB  . PRO A 1 147 ? -0.204  -1.305  34.878  1.00 41.60  ? 144 PRO B CB  1 
ATOM   1039 C  CG  . PRO A 1 147 ? -0.846  -0.269  35.718  1.00 45.78  ? 144 PRO B CG  1 
ATOM   1040 C  CD  . PRO A 1 147 ? 0.170   0.816   35.891  1.00 46.57  ? 144 PRO B CD  1 
ATOM   1041 N  N   . SER A 1 148 ? -0.325  0.923   32.304  1.00 57.13  ? 145 SER B N   1 
ATOM   1042 C  CA  . SER A 1 148 ? -0.831  1.287   30.985  1.00 60.86  ? 145 SER B CA  1 
ATOM   1043 C  C   . SER A 1 148 ? 0.309   1.806   30.109  1.00 61.35  ? 145 SER B C   1 
ATOM   1044 O  O   . SER A 1 148 ? 1.481   1.592   30.415  1.00 62.88  ? 145 SER B O   1 
ATOM   1045 C  CB  . SER A 1 148 ? -1.944  2.332   31.093  1.00 61.16  ? 145 SER B CB  1 
ATOM   1046 O  OG  . SER A 1 148 ? -1.444  3.568   31.573  1.00 71.15  ? 145 SER B OG  1 
ATOM   1047 N  N   . SER A 1 149 ? -0.035  2.495   29.026  1.00 62.54  ? 146 SER B N   1 
ATOM   1048 C  CA  . SER A 1 149 ? 0.970   2.929   28.058  1.00 62.81  ? 146 SER B CA  1 
ATOM   1049 C  C   . SER A 1 149 ? 1.574   4.295   28.381  1.00 58.62  ? 146 SER B C   1 
ATOM   1050 O  O   . SER A 1 149 ? 2.772   4.510   28.187  1.00 57.97  ? 146 SER B O   1 
ATOM   1051 C  CB  . SER A 1 149 ? 0.392   2.923   26.638  1.00 64.78  ? 146 SER B CB  1 
ATOM   1052 O  OG  . SER A 1 149 ? -0.599  3.923   26.481  1.00 67.65  ? 146 SER B OG  1 
ATOM   1053 N  N   . ASP A 1 150 ? 0.746   5.215   28.867  1.00 52.71  ? 147 ASP B N   1 
ATOM   1054 C  CA  . ASP A 1 150 ? 1.206   6.561   29.192  1.00 54.46  ? 147 ASP B CA  1 
ATOM   1055 C  C   . ASP A 1 150 ? 2.142   6.555   30.393  1.00 56.90  ? 147 ASP B C   1 
ATOM   1056 O  O   . ASP A 1 150 ? 1.954   5.785   31.336  1.00 59.96  ? 147 ASP B O   1 
ATOM   1057 C  CB  . ASP A 1 150 ? 0.018   7.479   29.499  1.00 63.64  ? 147 ASP B CB  1 
ATOM   1058 C  CG  . ASP A 1 150 ? -0.856  7.740   28.288  1.00 69.16  ? 147 ASP B CG  1 
ATOM   1059 O  OD1 . ASP A 1 150 ? -0.374  7.570   27.148  1.00 72.04  ? 147 ASP B OD1 1 
ATOM   1060 O  OD2 . ASP A 1 150 ? -2.029  8.127   28.479  1.00 70.56  ? 147 ASP B OD2 1 
ATOM   1061 N  N   . VAL A 1 151 ? 3.158   7.411   30.354  1.00 50.21  ? 148 VAL B N   1 
ATOM   1062 C  CA  . VAL A 1 151 ? 3.908   7.715   31.561  1.00 52.95  ? 148 VAL B CA  1 
ATOM   1063 C  C   . VAL A 1 151 ? 3.357   9.037   32.084  1.00 53.18  ? 148 VAL B C   1 
ATOM   1064 O  O   . VAL A 1 151 ? 2.996   9.920   31.304  1.00 53.15  ? 148 VAL B O   1 
ATOM   1065 C  CB  . VAL A 1 151 ? 5.433   7.794   31.320  1.00 50.11  ? 148 VAL B CB  1 
ATOM   1066 C  CG1 . VAL A 1 151 ? 5.830   6.917   30.145  1.00 45.52  ? 148 VAL B CG1 1 
ATOM   1067 C  CG2 . VAL A 1 151 ? 5.874   9.223   31.093  1.00 51.38  ? 148 VAL B CG2 1 
ATOM   1068 N  N   . LEU A 1 152 ? 3.263   9.161   33.402  1.00 49.17  ? 149 LEU B N   1 
ATOM   1069 C  CA  . LEU A 1 152 ? 2.582   10.302  33.995  1.00 42.55  ? 149 LEU B CA  1 
ATOM   1070 C  C   . LEU A 1 152 ? 3.550   11.270  34.662  1.00 47.11  ? 149 LEU B C   1 
ATOM   1071 O  O   . LEU A 1 152 ? 4.660   10.896  35.040  1.00 51.49  ? 149 LEU B O   1 
ATOM   1072 C  CB  . LEU A 1 152 ? 1.524   9.823   34.991  1.00 38.67  ? 149 LEU B CB  1 
ATOM   1073 C  CG  . LEU A 1 152 ? 0.520   8.815   34.423  1.00 38.81  ? 149 LEU B CG  1 
ATOM   1074 C  CD1 . LEU A 1 152 ? -0.312  8.191   35.528  1.00 34.83  ? 149 LEU B CD1 1 
ATOM   1075 C  CD2 . LEU A 1 152 ? -0.373  9.465   33.374  1.00 42.33  ? 149 LEU B CD2 1 
ATOM   1076 N  N   . VAL A 1 153 ? 3.123   12.521  34.789  1.00 42.32  ? 150 VAL B N   1 
ATOM   1077 C  CA  . VAL A 1 153 ? 3.926   13.540  35.446  1.00 40.46  ? 150 VAL B CA  1 
ATOM   1078 C  C   . VAL A 1 153 ? 3.085   14.284  36.475  1.00 41.99  ? 150 VAL B C   1 
ATOM   1079 O  O   . VAL A 1 153 ? 2.020   14.820  36.159  1.00 41.93  ? 150 VAL B O   1 
ATOM   1080 C  CB  . VAL A 1 153 ? 4.523   14.537  34.433  1.00 44.09  ? 150 VAL B CB  1 
ATOM   1081 C  CG1 . VAL A 1 153 ? 5.082   15.762  35.147  1.00 40.89  ? 150 VAL B CG1 1 
ATOM   1082 C  CG2 . VAL A 1 153 ? 5.601   13.862  33.594  1.00 43.72  ? 150 VAL B CG2 1 
ATOM   1083 N  N   . PHE A 1 154 ? 3.569   14.304  37.712  1.00 40.04  ? 151 PHE B N   1 
ATOM   1084 C  CA  . PHE A 1 154 ? 2.863   14.963  38.795  1.00 31.58  ? 151 PHE B CA  1 
ATOM   1085 C  C   . PHE A 1 154 ? 3.698   16.085  39.390  1.00 34.90  ? 151 PHE B C   1 
ATOM   1086 O  O   . PHE A 1 154 ? 4.887   15.913  39.659  1.00 34.88  ? 151 PHE B O   1 
ATOM   1087 C  CB  . PHE A 1 154 ? 2.524   13.959  39.898  1.00 37.21  ? 151 PHE B CB  1 
ATOM   1088 C  CG  . PHE A 1 154 ? 1.593   12.862  39.466  1.00 34.82  ? 151 PHE B CG  1 
ATOM   1089 C  CD1 . PHE A 1 154 ? 2.090   11.656  39.000  1.00 34.98  ? 151 PHE B CD1 1 
ATOM   1090 C  CD2 . PHE A 1 154 ? 0.220   13.031  39.543  1.00 32.46  ? 151 PHE B CD2 1 
ATOM   1091 C  CE1 . PHE A 1 154 ? 1.235   10.639  38.608  1.00 30.86  ? 151 PHE B CE1 1 
ATOM   1092 C  CE2 . PHE A 1 154 ? -0.639  12.016  39.156  1.00 33.77  ? 151 PHE B CE2 1 
ATOM   1093 C  CZ  . PHE A 1 154 ? -0.130  10.820  38.689  1.00 29.45  ? 151 PHE B CZ  1 
ATOM   1094 N  N   . ASP A 1 155 ? 3.071   17.240  39.577  1.00 36.96  ? 152 ASP B N   1 
ATOM   1095 C  CA  . ASP A 1 155 ? 3.630   18.287  40.414  1.00 36.78  ? 152 ASP B CA  1 
ATOM   1096 C  C   . ASP A 1 155 ? 2.891   18.208  41.744  1.00 39.70  ? 152 ASP B C   1 
ATOM   1097 O  O   . ASP A 1 155 ? 1.707   18.541  41.822  1.00 37.35  ? 152 ASP B O   1 
ATOM   1098 C  CB  . ASP A 1 155 ? 3.437   19.659  39.770  1.00 34.72  ? 152 ASP B CB  1 
ATOM   1099 C  CG  . ASP A 1 155 ? 3.956   20.792  40.639  1.00 42.93  ? 152 ASP B CG  1 
ATOM   1100 O  OD1 . ASP A 1 155 ? 4.101   21.918  40.121  1.00 48.05  ? 152 ASP B OD1 1 
ATOM   1101 O  OD2 . ASP A 1 155 ? 4.219   20.563  41.840  1.00 46.97  ? 152 ASP B OD2 1 
ATOM   1102 N  N   . TYR A 1 156 ? 3.580   17.765  42.791  1.00 36.94  ? 153 TYR B N   1 
ATOM   1103 C  CA  . TYR A 1 156 ? 2.892   17.469  44.045  1.00 37.87  ? 153 TYR B CA  1 
ATOM   1104 C  C   . TYR A 1 156 ? 2.487   18.694  44.861  1.00 35.38  ? 153 TYR B C   1 
ATOM   1105 O  O   . TYR A 1 156 ? 1.754   18.577  45.841  1.00 43.42  ? 153 TYR B O   1 
ATOM   1106 C  CB  . TYR A 1 156 ? 3.654   16.430  44.887  1.00 32.70  ? 153 TYR B CB  1 
ATOM   1107 C  CG  . TYR A 1 156 ? 4.883   16.924  45.619  1.00 31.62  ? 153 TYR B CG  1 
ATOM   1108 C  CD1 . TYR A 1 156 ? 6.114   16.311  45.432  1.00 25.70  ? 153 TYR B CD1 1 
ATOM   1109 C  CD2 . TYR A 1 156 ? 4.807   17.979  46.521  1.00 37.74  ? 153 TYR B CD2 1 
ATOM   1110 C  CE1 . TYR A 1 156 ? 7.239   16.744  46.115  1.00 29.36  ? 153 TYR B CE1 1 
ATOM   1111 C  CE2 . TYR A 1 156 ? 5.926   18.424  47.202  1.00 37.94  ? 153 TYR B CE2 1 
ATOM   1112 C  CZ  . TYR A 1 156 ? 7.138   17.804  46.997  1.00 33.16  ? 153 TYR B CZ  1 
ATOM   1113 O  OH  . TYR A 1 156 ? 8.250   18.248  47.677  1.00 33.53  ? 153 TYR B OH  1 
ATOM   1114 N  N   . THR A 1 157 ? 2.944   19.870  44.445  1.00 36.34  ? 154 THR B N   1 
ATOM   1115 C  CA  . THR A 1 157 ? 2.506   21.113  45.077  1.00 40.17  ? 154 THR B CA  1 
ATOM   1116 C  C   . THR A 1 157 ? 1.150   21.547  44.530  1.00 39.57  ? 154 THR B C   1 
ATOM   1117 O  O   . THR A 1 157 ? 0.527   22.469  45.055  1.00 42.09  ? 154 THR B O   1 
ATOM   1118 C  CB  . THR A 1 157 ? 3.513   22.260  44.866  1.00 39.12  ? 154 THR B CB  1 
ATOM   1119 O  OG1 . THR A 1 157 ? 3.633   22.539  43.466  1.00 44.32  ? 154 THR B OG1 1 
ATOM   1120 C  CG2 . THR A 1 157 ? 4.879   21.893  45.435  1.00 39.18  ? 154 THR B CG2 1 
ATOM   1121 N  N   . LYS A 1 158 ? 0.698   20.879  43.474  1.00 40.46  ? 155 LYS B N   1 
ATOM   1122 C  CA  . LYS A 1 158 ? -0.589  21.189  42.858  1.00 42.56  ? 155 LYS B CA  1 
ATOM   1123 C  C   . LYS A 1 158 ? -1.624  20.110  43.153  1.00 44.45  ? 155 LYS B C   1 
ATOM   1124 O  O   . LYS A 1 158 ? -2.664  20.040  42.498  1.00 50.46  ? 155 LYS B O   1 
ATOM   1125 C  CB  . LYS A 1 158 ? -0.433  21.372  41.346  1.00 45.70  ? 155 LYS B CB  1 
ATOM   1126 C  CG  . LYS A 1 158 ? 0.332   22.626  40.958  1.00 51.95  ? 155 LYS B CG  1 
ATOM   1127 C  CD  . LYS A 1 158 ? 0.696   22.626  39.484  1.00 54.92  ? 155 LYS B CD  1 
ATOM   1128 C  CE  . LYS A 1 158 ? 1.554   23.833  39.140  1.00 58.60  ? 155 LYS B CE  1 
ATOM   1129 N  NZ  . LYS A 1 158 ? 2.140   23.727  37.775  1.00 64.66  ? 155 LYS B NZ  1 
ATOM   1130 N  N   . HIS A 1 159 ? -1.334  19.269  44.140  1.00 36.65  ? 156 HIS B N   1 
ATOM   1131 C  CA  . HIS A 1 159 ? -2.258  18.216  44.536  1.00 31.64  ? 156 HIS B CA  1 
ATOM   1132 C  C   . HIS A 1 159 ? -2.621  18.347  46.007  1.00 35.48  ? 156 HIS B C   1 
ATOM   1133 O  O   . HIS A 1 159 ? -1.793  18.763  46.818  1.00 39.29  ? 156 HIS B O   1 
ATOM   1134 C  CB  . HIS A 1 159 ? -1.662  16.838  44.243  1.00 30.10  ? 156 HIS B CB  1 
ATOM   1135 C  CG  . HIS A 1 159 ? -1.559  16.528  42.782  1.00 33.53  ? 156 HIS B CG  1 
ATOM   1136 N  ND1 . HIS A 1 159 ? -2.592  15.962  42.066  1.00 33.21  ? 156 HIS B ND1 1 
ATOM   1137 C  CD2 . HIS A 1 159 ? -0.549  16.715  41.899  1.00 36.87  ? 156 HIS B CD2 1 
ATOM   1138 C  CE1 . HIS A 1 159 ? -2.222  15.812  40.807  1.00 36.87  ? 156 HIS B CE1 1 
ATOM   1139 N  NE2 . HIS A 1 159 ? -0.987  16.262  40.679  1.00 32.83  ? 156 HIS B NE2 1 
ATOM   1140 N  N   . PRO A 1 160 ? -3.869  17.999  46.355  1.00 32.56  ? 157 PRO B N   1 
ATOM   1141 C  CA  . PRO A 1 160 ? -4.379  18.137  47.718  1.00 36.09  ? 157 PRO B CA  1 
ATOM   1142 C  C   . PRO A 1 160 ? -3.514  17.405  48.744  1.00 40.90  ? 157 PRO B C   1 
ATOM   1143 O  O   . PRO A 1 160 ? -2.934  16.361  48.438  1.00 39.19  ? 157 PRO B O   1 
ATOM   1144 C  CB  . PRO A 1 160 ? -5.772  17.497  47.638  1.00 34.98  ? 157 PRO B CB  1 
ATOM   1145 C  CG  . PRO A 1 160 ? -5.770  16.696  46.366  1.00 24.04  ? 157 PRO B CG  1 
ATOM   1146 C  CD  . PRO A 1 160 ? -4.879  17.439  45.443  0.50 23.85  ? 157 PRO B CD  1 
ATOM   1147 N  N   . ALA A 1 161 ? -3.432  17.959  49.952  1.00 45.08  ? 158 ALA B N   1 
ATOM   1148 C  CA  . ALA A 1 161 ? -2.636  17.371  51.030  1.00 46.61  ? 158 ALA B CA  1 
ATOM   1149 C  C   . ALA A 1 161 ? -3.065  15.937  51.331  1.00 48.05  ? 158 ALA B C   1 
ATOM   1150 O  O   . ALA A 1 161 ? -2.230  15.078  51.616  1.00 54.29  ? 158 ALA B O   1 
ATOM   1151 C  CB  . ALA A 1 161 ? -2.725  18.228  52.283  1.00 46.32  ? 158 ALA B CB  1 
ATOM   1152 N  N   . LYS A 1 162 ? -4.371  15.691  51.270  1.00 43.36  ? 159 LYS B N   1 
ATOM   1153 C  CA  . LYS A 1 162 ? -4.923  14.347  51.407  1.00 42.35  ? 159 LYS B CA  1 
ATOM   1154 C  C   . LYS A 1 162 ? -5.694  13.969  50.144  1.00 35.48  ? 159 LYS B C   1 
ATOM   1155 O  O   . LYS A 1 162 ? -6.479  14.767  49.634  1.00 40.07  ? 159 LYS B O   1 
ATOM   1156 C  CB  . LYS A 1 162 ? -5.836  14.255  52.633  1.00 43.11  ? 159 LYS B CB  1 
ATOM   1157 C  CG  . LYS A 1 162 ? -6.893  13.165  52.523  1.00 47.70  ? 159 LYS B CG  1 
ATOM   1158 C  CD  . LYS A 1 162 ? -7.720  13.024  53.788  1.00 46.87  ? 159 LYS B CD  1 
ATOM   1159 C  CE  . LYS A 1 162 ? -8.944  12.154  53.535  1.00 51.08  ? 159 LYS B CE  1 
ATOM   1160 N  NZ  . LYS A 1 162 ? -8.632  10.976  52.669  1.00 46.36  ? 159 LYS B NZ  1 
ATOM   1161 N  N   . PRO A 1 163 ? -5.472  12.746  49.637  1.00 36.90  ? 160 PRO B N   1 
ATOM   1162 C  CA  . PRO A 1 163 ? -6.117  12.287  48.409  1.00 32.20  ? 160 PRO B CA  1 
ATOM   1163 C  C   . PRO A 1 163 ? -7.623  12.101  48.573  1.00 38.35  ? 160 PRO B C   1 
ATOM   1164 O  O   . PRO A 1 163 ? -8.091  11.736  49.653  1.00 39.25  ? 160 PRO B O   1 
ATOM   1165 C  CB  . PRO A 1 163 ? -5.450  10.934  48.148  1.00 34.58  ? 160 PRO B CB  1 
ATOM   1166 C  CG  . PRO A 1 163 ? -4.991  10.472  49.487  1.00 35.89  ? 160 PRO B CG  1 
ATOM   1167 C  CD  . PRO A 1 163 ? -4.586  11.718  50.214  1.00 38.69  ? 160 PRO B CD  1 
ATOM   1168 N  N   . ASP A 1 164 ? -8.369  12.357  47.502  1.00 39.46  ? 161 ASP B N   1 
ATOM   1169 C  CA  . ASP A 1 164 ? -9.807  12.140  47.489  1.00 37.29  ? 161 ASP B CA  1 
ATOM   1170 C  C   . ASP A 1 164 ? -10.084 10.644  47.390  1.00 37.09  ? 161 ASP B C   1 
ATOM   1171 O  O   . ASP A 1 164 ? -9.647  9.993   46.437  1.00 31.69  ? 161 ASP B O   1 
ATOM   1172 C  CB  . ASP A 1 164 ? -10.438 12.877  46.305  1.00 48.04  ? 161 ASP B CB  1 
ATOM   1173 C  CG  . ASP A 1 164 ? -11.956 12.833  46.321  1.00 53.18  ? 161 ASP B CG  1 
ATOM   1174 O  OD1 . ASP A 1 164 ? -12.548 12.767  47.417  1.00 58.63  ? 161 ASP B OD1 1 
ATOM   1175 O  OD2 . ASP A 1 164 ? -12.559 12.876  45.230  1.00 56.25  ? 161 ASP B OD2 1 
ATOM   1176 N  N   . PRO A 1 165 ? -10.800 10.090  48.385  1.00 35.23  ? 162 PRO B N   1 
ATOM   1177 C  CA  . PRO A 1 165 ? -11.115 8.660   48.441  1.00 35.40  ? 162 PRO B CA  1 
ATOM   1178 C  C   . PRO A 1 165 ? -11.817 8.144   47.184  1.00 39.97  ? 162 PRO B C   1 
ATOM   1179 O  O   . PRO A 1 165 ? -11.857 6.935   46.956  1.00 47.15  ? 162 PRO B O   1 
ATOM   1180 C  CB  . PRO A 1 165 ? -12.052 8.553   49.645  1.00 28.25  ? 162 PRO B CB  1 
ATOM   1181 C  CG  . PRO A 1 165 ? -11.728 9.733   50.486  1.00 30.39  ? 162 PRO B CG  1 
ATOM   1182 C  CD  . PRO A 1 165 ? -11.351 10.823  49.537  1.00 28.23  ? 162 PRO B CD  1 
ATOM   1183 N  N   . SER A 1 166 ? -12.367 9.049   46.380  1.00 39.08  ? 163 SER B N   1 
ATOM   1184 C  CA  . SER A 1 166 ? -13.015 8.662   45.131  1.00 45.31  ? 163 SER B CA  1 
ATOM   1185 C  C   . SER A 1 166 ? -12.021 7.992   44.190  1.00 46.21  ? 163 SER B C   1 
ATOM   1186 O  O   . SER A 1 166 ? -12.400 7.180   43.347  1.00 49.46  ? 163 SER B O   1 
ATOM   1187 C  CB  . SER A 1 166 ? -13.643 9.877   44.449  1.00 49.56  ? 163 SER B CB  1 
ATOM   1188 O  OG  . SER A 1 166 ? -12.654 10.834  44.113  1.00 55.08  ? 163 SER B OG  1 
ATOM   1189 N  N   . GLY A 1 167 ? -10.747 8.346   44.335  1.00 49.63  ? 164 GLY B N   1 
ATOM   1190 C  CA  . GLY A 1 167 ? -9.673  7.688   43.602  1.00 43.74  ? 164 GLY B CA  1 
ATOM   1191 C  C   . GLY A 1 167 ? -9.369  8.264   42.234  1.00 48.89  ? 164 GLY B C   1 
ATOM   1192 O  O   . GLY A 1 167 ? -8.636  7.657   41.451  1.00 54.84  ? 164 GLY B O   1 
ATOM   1193 N  N   . GLU A 1 168 ? -9.923  9.435   41.939  1.00 48.12  ? 165 GLU B N   1 
ATOM   1194 C  CA  . GLU A 1 168 ? -9.694  10.076  40.647  1.00 53.84  ? 165 GLU B CA  1 
ATOM   1195 C  C   . GLU A 1 168 ? -8.223  10.443  40.477  1.00 51.43  ? 165 GLU B C   1 
ATOM   1196 O  O   . GLU A 1 168 ? -7.646  11.126  41.323  1.00 52.26  ? 165 GLU B O   1 
ATOM   1197 C  CB  . GLU A 1 168 ? -10.557 11.334  40.502  1.00 64.83  ? 165 GLU B CB  1 
ATOM   1198 C  CG  . GLU A 1 168 ? -11.991 11.196  41.000  1.00 73.10  ? 165 GLU B CG  1 
ATOM   1199 C  CD  . GLU A 1 168 ? -12.845 10.287  40.132  1.00 80.13  ? 165 GLU B CD  1 
ATOM   1200 O  OE1 . GLU A 1 168 ? -12.286 9.402   39.447  1.00 79.98  ? 165 GLU B OE1 1 
ATOM   1201 O  OE2 . GLU A 1 168 ? -14.083 10.456  40.141  1.00 83.03  ? 165 GLU B OE2 1 
ATOM   1202 N  N   . CYS A 1 169 ? -7.625  9.985   39.382  1.00 49.70  ? 166 CYS B N   1 
ATOM   1203 C  CA  . CYS A 1 169 ? -6.232  10.294  39.073  1.00 46.80  ? 166 CYS B CA  1 
ATOM   1204 C  C   . CYS A 1 169 ? -6.141  11.431  38.058  1.00 48.40  ? 166 CYS B C   1 
ATOM   1205 O  O   . CYS A 1 169 ? -6.561  11.280  36.911  1.00 50.62  ? 166 CYS B O   1 
ATOM   1206 C  CB  . CYS A 1 169 ? -5.518  9.049   38.538  1.00 47.19  ? 166 CYS B CB  1 
ATOM   1207 S  SG  . CYS A 1 169 ? -3.798  9.309   38.024  1.00 51.74  ? 166 CYS B SG  1 
ATOM   1208 N  N   . ASN A 1 170 ? -5.597  12.567  38.487  1.00 48.46  ? 167 ASN B N   1 
ATOM   1209 C  CA  . ASN A 1 170 ? -5.428  13.725  37.609  1.00 45.16  ? 167 ASN B CA  1 
ATOM   1210 C  C   . ASN A 1 170 ? -3.969  14.141  37.465  1.00 44.36  ? 167 ASN B C   1 
ATOM   1211 O  O   . ASN A 1 170 ? -3.515  15.066  38.143  1.00 41.59  ? 167 ASN B O   1 
ATOM   1212 C  CB  . ASN A 1 170 ? -6.244  14.917  38.115  1.00 48.62  ? 167 ASN B CB  1 
ATOM   1213 C  CG  . ASN A 1 170 ? -7.731  14.642  38.135  1.00 55.78  ? 167 ASN B CG  1 
ATOM   1214 O  OD1 . ASN A 1 170 ? -8.395  14.847  39.152  1.00 59.71  ? 167 ASN B OD1 1 
ATOM   1215 N  ND2 . ASN A 1 170 ? -8.266  14.173  37.010  1.00 54.55  ? 167 ASN B ND2 1 
ATOM   1216 N  N   . PRO A 1 171 ? -3.230  13.466  36.572  1.00 43.32  ? 168 PRO B N   1 
ATOM   1217 C  CA  . PRO A 1 171 ? -1.833  13.811  36.347  1.00 42.27  ? 168 PRO B CA  1 
ATOM   1218 C  C   . PRO A 1 171 ? -1.719  15.195  35.729  1.00 43.23  ? 168 PRO B C   1 
ATOM   1219 O  O   . PRO A 1 171 ? -2.605  15.609  34.983  1.00 48.93  ? 168 PRO B O   1 
ATOM   1220 C  CB  . PRO A 1 171 ? -1.372  12.748  35.346  1.00 45.39  ? 168 PRO B CB  1 
ATOM   1221 C  CG  . PRO A 1 171 ? -2.617  12.316  34.654  1.00 41.17  ? 168 PRO B CG  1 
ATOM   1222 C  CD  . PRO A 1 171 ? -3.671  12.355  35.711  1.00 41.65  ? 168 PRO B CD  1 
ATOM   1223 N  N   . ASP A 1 172 ? -0.641  15.908  36.041  1.00 42.89  ? 169 ASP B N   1 
ATOM   1224 C  CA  . ASP A 1 172 ? -0.420  17.231  35.468  1.00 45.29  ? 169 ASP B CA  1 
ATOM   1225 C  C   . ASP A 1 172 ? -0.033  17.130  33.998  1.00 45.63  ? 169 ASP B C   1 
ATOM   1226 O  O   . ASP A 1 172 ? -0.189  18.083  33.240  1.00 49.48  ? 169 ASP B O   1 
ATOM   1227 C  CB  . ASP A 1 172 ? 0.658   17.989  36.243  1.00 41.76  ? 169 ASP B CB  1 
ATOM   1228 C  CG  . ASP A 1 172 ? 0.249   18.280  37.668  1.00 45.12  ? 169 ASP B CG  1 
ATOM   1229 O  OD1 . ASP A 1 172 ? 0.418   17.393  38.530  1.00 45.20  ? 169 ASP B OD1 1 
ATOM   1230 O  OD2 . ASP A 1 172 ? -0.234  19.402  37.928  1.00 51.57  ? 169 ASP B OD2 1 
ATOM   1231 N  N   . LEU A 1 173 ? 0.470   15.963  33.609  1.00 48.43  ? 170 LEU B N   1 
ATOM   1232 C  CA  . LEU A 1 173 ? 0.898   15.704  32.241  1.00 45.81  ? 170 LEU B CA  1 
ATOM   1233 C  C   . LEU A 1 173 ? 0.800   14.215  31.922  1.00 46.17  ? 170 LEU B C   1 
ATOM   1234 O  O   . LEU A 1 173 ? 1.215   13.373  32.718  1.00 43.89  ? 170 LEU B O   1 
ATOM   1235 C  CB  . LEU A 1 173 ? 2.342   16.171  32.040  1.00 46.50  ? 170 LEU B CB  1 
ATOM   1236 C  CG  . LEU A 1 173 ? 2.707   17.348  31.127  1.00 45.46  ? 170 LEU B CG  1 
ATOM   1237 C  CD1 . LEU A 1 173 ? 1.706   18.493  31.178  1.00 39.12  ? 170 LEU B CD1 1 
ATOM   1238 C  CD2 . LEU A 1 173 ? 4.107   17.835  31.473  1.00 42.50  ? 170 LEU B CD2 1 
ATOM   1239 N  N   . ARG A 1 174 ? 0.238   13.898  30.760  1.00 46.20  ? 171 ARG B N   1 
ATOM   1240 C  CA  . ARG A 1 174 ? 0.279   12.541  30.234  1.00 48.85  ? 171 ARG B CA  1 
ATOM   1241 C  C   . ARG A 1 174 ? 1.187   12.542  29.016  1.00 53.38  ? 171 ARG B C   1 
ATOM   1242 O  O   . ARG A 1 174 ? 0.980   13.318  28.082  1.00 56.14  ? 171 ARG B O   1 
ATOM   1243 C  CB  . ARG A 1 174 ? -1.114  12.058  29.828  1.00 52.76  ? 171 ARG B CB  1 
ATOM   1244 C  CG  . ARG A 1 174 ? -2.204  12.304  30.851  1.00 56.64  ? 171 ARG B CG  1 
ATOM   1245 C  CD  . ARG A 1 174 ? -3.482  11.581  30.457  1.00 57.63  ? 171 ARG B CD  1 
ATOM   1246 N  NE  . ARG A 1 174 ? -3.437  10.169  30.823  1.00 63.72  ? 171 ARG B NE  1 
ATOM   1247 C  CZ  . ARG A 1 174 ? -4.037  9.656   31.893  1.00 64.22  ? 171 ARG B CZ  1 
ATOM   1248 N  NH1 . ARG A 1 174 ? -3.937  8.359   32.151  1.00 65.99  ? 171 ARG B NH1 1 
ATOM   1249 N  NH2 . ARG A 1 174 ? -4.741  10.436  32.704  1.00 59.36  ? 171 ARG B NH2 1 
ATOM   1250 N  N   . LEU A 1 175 ? 2.196   11.679  29.025  1.00 53.74  ? 172 LEU B N   1 
ATOM   1251 C  CA  . LEU A 1 175 ? 3.129   11.604  27.911  1.00 49.96  ? 172 LEU B CA  1 
ATOM   1252 C  C   . LEU A 1 175 ? 2.799   10.396  27.037  1.00 55.80  ? 172 LEU B C   1 
ATOM   1253 O  O   . LEU A 1 175 ? 2.728   9.269   27.528  1.00 55.85  ? 172 LEU B O   1 
ATOM   1254 C  CB  . LEU A 1 175 ? 4.568   11.525  28.422  1.00 47.44  ? 172 LEU B CB  1 
ATOM   1255 C  CG  . LEU A 1 175 ? 4.967   12.417  29.603  1.00 49.51  ? 172 LEU B CG  1 
ATOM   1256 C  CD1 . LEU A 1 175 ? 6.468   12.338  29.845  1.00 50.12  ? 172 LEU B CD1 1 
ATOM   1257 C  CD2 . LEU A 1 175 ? 4.542   13.864  29.401  1.00 50.20  ? 172 LEU B CD2 1 
ATOM   1258 N  N   . ARG A 1 176 ? 2.583   10.635  25.746  1.00 57.98  ? 173 ARG B N   1 
ATOM   1259 C  CA  . ARG A 1 176 ? 2.229   9.558   24.826  1.00 60.87  ? 173 ARG B CA  1 
ATOM   1260 C  C   . ARG A 1 176 ? 3.418   9.151   23.962  1.00 56.94  ? 173 ARG B C   1 
ATOM   1261 O  O   . ARG A 1 176 ? 4.295   9.968   23.672  1.00 53.67  ? 173 ARG B O   1 
ATOM   1262 C  CB  . ARG A 1 176 ? 1.049   9.960   23.936  1.00 68.10  ? 173 ARG B CB  1 
ATOM   1263 C  CG  . ARG A 1 176 ? -0.042  10.741  24.650  1.00 75.29  ? 173 ARG B CG  1 
ATOM   1264 C  CD  . ARG A 1 176 ? -1.376  10.607  23.933  1.00 79.35  ? 173 ARG B CD  1 
ATOM   1265 N  NE  . ARG A 1 176 ? -2.229  9.592   24.546  1.00 84.14  ? 173 ARG B NE  1 
ATOM   1266 C  CZ  . ARG A 1 176 ? -3.299  9.865   25.286  1.00 85.42  ? 173 ARG B CZ  1 
ATOM   1267 N  NH1 . ARG A 1 176 ? -4.016  8.880   25.809  1.00 86.04  ? 173 ARG B NH1 1 
ATOM   1268 N  NH2 . ARG A 1 176 ? -3.659  11.124  25.500  1.00 87.12  ? 173 ARG B NH2 1 
ATOM   1269 N  N   . GLY A 1 177 ? 3.441   7.884   23.557  1.00 53.59  ? 174 GLY B N   1 
ATOM   1270 C  CA  . GLY A 1 177 ? 4.519   7.364   22.725  1.00 56.95  ? 174 GLY B CA  1 
ATOM   1271 C  C   . GLY A 1 177 ? 4.631   5.851   22.744  1.00 61.46  ? 174 GLY B C   1 
ATOM   1272 O  O   . GLY A 1 177 ? 4.991   5.238   21.737  1.00 66.82  ? 174 GLY B O   1 
ATOM   1273 N  N   . HIS A 1 178 ? 4.326   5.246   23.889  1.00 60.08  ? 175 HIS B N   1 
ATOM   1274 C  CA  . HIS A 1 178 ? 4.448   3.798   24.051  1.00 58.19  ? 175 HIS B CA  1 
ATOM   1275 C  C   . HIS A 1 178 ? 3.157   3.053   23.731  1.00 58.59  ? 175 HIS B C   1 
ATOM   1276 O  O   . HIS A 1 178 ? 2.067   3.622   23.783  1.00 57.60  ? 175 HIS B O   1 
ATOM   1277 C  CB  . HIS A 1 178 ? 4.886   3.447   25.475  1.00 61.39  ? 175 HIS B CB  1 
ATOM   1278 C  CG  . HIS A 1 178 ? 6.318   3.767   25.769  1.00 62.98  ? 175 HIS B CG  1 
ATOM   1279 N  ND1 . HIS A 1 178 ? 6.693   4.743   26.668  1.00 64.42  ? 175 HIS B ND1 1 
ATOM   1280 C  CD2 . HIS A 1 178 ? 7.467   3.238   25.287  1.00 62.65  ? 175 HIS B CD2 1 
ATOM   1281 C  CE1 . HIS A 1 178 ? 8.012   4.801   26.726  1.00 62.51  ? 175 HIS B CE1 1 
ATOM   1282 N  NE2 . HIS A 1 178 ? 8.505   3.898   25.898  1.00 64.10  ? 175 HIS B NE2 1 
ATOM   1283 N  N   . GLN A 1 179 ? 3.297   1.769   23.413  1.00 61.08  ? 176 GLN B N   1 
ATOM   1284 C  CA  . GLN A 1 179 ? 2.155   0.894   23.179  1.00 63.44  ? 176 GLN B CA  1 
ATOM   1285 C  C   . GLN A 1 179 ? 1.889   0.014   24.399  1.00 64.14  ? 176 GLN B C   1 
ATOM   1286 O  O   . GLN A 1 179 ? 0.757   -0.408  24.636  1.00 66.24  ? 176 GLN B O   1 
ATOM   1287 C  CB  . GLN A 1 179 ? 2.400   0.013   21.953  1.00 68.89  ? 176 GLN B CB  1 
ATOM   1288 C  CG  . GLN A 1 179 ? 2.713   0.774   20.673  1.00 75.56  ? 176 GLN B CG  1 
ATOM   1289 C  CD  . GLN A 1 179 ? 1.470   1.307   19.985  1.00 79.11  ? 176 GLN B CD  1 
ATOM   1290 O  OE1 . GLN A 1 179 ? 1.138   0.892   18.875  1.00 81.70  ? 176 GLN B OE1 1 
ATOM   1291 N  NE2 . GLN A 1 179 ? 0.772   2.226   20.644  1.00 78.98  ? 176 GLN B NE2 1 
ATOM   1292 N  N   . LYS A 1 180 ? 2.940   -0.266  25.165  1.00 64.03  ? 177 LYS B N   1 
ATOM   1293 C  CA  . LYS A 1 180 ? 2.824   -1.100  26.359  1.00 64.21  ? 177 LYS B CA  1 
ATOM   1294 C  C   . LYS A 1 180 ? 3.462   -0.441  27.582  1.00 63.10  ? 177 LYS B C   1 
ATOM   1295 O  O   . LYS A 1 180 ? 4.000   0.663   27.497  1.00 57.86  ? 177 LYS B O   1 
ATOM   1296 C  CB  . LYS A 1 180 ? 3.463   -2.472  26.126  1.00 66.09  ? 177 LYS B CB  1 
ATOM   1297 C  CG  . LYS A 1 180 ? 2.704   -3.379  25.172  1.00 69.37  ? 177 LYS B CG  1 
ATOM   1298 C  CD  . LYS A 1 180 ? 3.173   -4.823  25.314  1.00 69.77  ? 177 LYS B CD  1 
ATOM   1299 C  CE  . LYS A 1 180 ? 2.634   -5.704  24.199  1.00 68.97  ? 177 LYS B CE  1 
ATOM   1300 N  NZ  . LYS A 1 180 ? 3.271   -5.392  22.888  1.00 66.61  ? 177 LYS B NZ  1 
ATOM   1301 N  N   . GLU A 1 181 ? 3.399   -1.136  28.715  1.00 66.10  ? 178 GLU B N   1 
ATOM   1302 C  CA  . GLU A 1 181 ? 3.996   -0.655  29.957  1.00 64.88  ? 178 GLU B CA  1 
ATOM   1303 C  C   . GLU A 1 181 ? 5.512   -0.840  29.952  1.00 61.65  ? 178 GLU B C   1 
ATOM   1304 O  O   . GLU A 1 181 ? 6.076   -1.420  29.025  1.00 58.80  ? 178 GLU B O   1 
ATOM   1305 C  CB  . GLU A 1 181 ? 3.393   -1.384  31.162  1.00 63.62  ? 178 GLU B CB  1 
ATOM   1306 C  CG  . GLU A 1 181 ? 3.750   -2.866  31.234  1.00 69.44  ? 178 GLU B CG  1 
ATOM   1307 C  CD  . GLU A 1 181 ? 3.598   -3.448  32.632  1.00 72.38  ? 178 GLU B CD  1 
ATOM   1308 O  OE1 . GLU A 1 181 ? 2.849   -2.871  33.449  1.00 71.26  ? 178 GLU B OE1 1 
ATOM   1309 O  OE2 . GLU A 1 181 ? 4.231   -4.488  32.914  1.00 74.11  ? 178 GLU B OE2 1 
ATOM   1310 N  N   . GLY A 1 182 ? 6.162   -0.350  31.003  1.00 60.75  ? 179 GLY B N   1 
ATOM   1311 C  CA  . GLY A 1 182 ? 7.607   -0.473  31.146  1.00 55.78  ? 179 GLY B CA  1 
ATOM   1312 C  C   . GLY A 1 182 ? 8.064   -0.142  32.554  1.00 53.80  ? 179 GLY B C   1 
ATOM   1313 O  O   . GLY A 1 182 ? 7.247   -0.007  33.466  1.00 47.56  ? 179 GLY B O   1 
ATOM   1314 N  N   . TYR A 1 183 ? 9.374   -0.006  32.729  1.00 53.17  ? 180 TYR B N   1 
ATOM   1315 C  CA  . TYR A 1 183 ? 9.949   0.300   34.035  1.00 46.17  ? 180 TYR B CA  1 
ATOM   1316 C  C   . TYR A 1 183 ? 11.029  1.374   33.946  1.00 44.93  ? 180 TYR B C   1 
ATOM   1317 O  O   . TYR A 1 183 ? 11.125  2.233   34.820  1.00 45.76  ? 180 TYR B O   1 
ATOM   1318 C  CB  . TYR A 1 183 ? 10.516  -0.966  34.684  1.00 50.24  ? 180 TYR B CB  1 
ATOM   1319 C  CG  . TYR A 1 183 ? 9.495   -1.775  35.454  1.00 52.79  ? 180 TYR B CG  1 
ATOM   1320 C  CD1 . TYR A 1 183 ? 8.651   -2.673  34.805  1.00 49.09  ? 180 TYR B CD1 1 
ATOM   1321 C  CD2 . TYR A 1 183 ? 9.376   -1.643  36.833  1.00 51.90  ? 180 TYR B CD2 1 
ATOM   1322 C  CE1 . TYR A 1 183 ? 7.715   -3.412  35.511  1.00 46.83  ? 180 TYR B CE1 1 
ATOM   1323 C  CE2 . TYR A 1 183 ? 8.446   -2.377  37.546  1.00 50.62  ? 180 TYR B CE2 1 
ATOM   1324 C  CZ  . TYR A 1 183 ? 7.619   -3.259  36.882  1.00 51.54  ? 180 TYR B CZ  1 
ATOM   1325 O  OH  . TYR A 1 183 ? 6.695   -3.986  37.597  1.00 55.01  ? 180 TYR B OH  1 
ATOM   1326 N  N   . GLY A 1 184 ? 11.835  1.321   32.887  1.00 40.41  ? 181 GLY B N   1 
ATOM   1327 C  CA  . GLY A 1 184 ? 12.925  2.274   32.692  1.00 32.41  ? 181 GLY B CA  1 
ATOM   1328 C  C   . GLY A 1 184 ? 12.449  3.714   32.673  1.00 37.09  ? 181 GLY B C   1 
ATOM   1329 O  O   . GLY A 1 184 ? 11.519  4.059   31.943  1.00 41.03  ? 181 GLY B O   1 
ATOM   1330 N  N   . LEU A 1 185 ? 13.095  4.555   33.477  1.00 33.94  ? 182 LEU B N   1 
ATOM   1331 C  CA  . LEU A 1 185 ? 12.695  5.948   33.634  1.00 31.64  ? 182 LEU B CA  1 
ATOM   1332 C  C   . LEU A 1 185 ? 13.917  6.771   34.024  1.00 37.04  ? 182 LEU B C   1 
ATOM   1333 O  O   . LEU A 1 185 ? 14.662  6.383   34.921  1.00 37.95  ? 182 LEU B O   1 
ATOM   1334 C  CB  . LEU A 1 185 ? 11.645  6.055   34.737  1.00 39.94  ? 182 LEU B CB  1 
ATOM   1335 C  CG  . LEU A 1 185 ? 10.379  6.876   34.498  1.00 42.50  ? 182 LEU B CG  1 
ATOM   1336 C  CD1 . LEU A 1 185 ? 9.979   7.564   35.792  1.00 42.71  ? 182 LEU B CD1 1 
ATOM   1337 C  CD2 . LEU A 1 185 ? 10.574  7.893   33.394  1.00 46.38  ? 182 LEU B CD2 1 
ATOM   1338 N  N   . SER A 1 186 ? 14.125  7.907   33.363  1.00 42.23  ? 183 SER B N   1 
ATOM   1339 C  CA  . SER A 1 186 ? 15.323  8.710   33.613  1.00 43.00  ? 183 SER B CA  1 
ATOM   1340 C  C   . SER A 1 186 ? 15.183  10.183  33.226  1.00 45.19  ? 183 SER B C   1 
ATOM   1341 O  O   . SER A 1 186 ? 14.923  10.510  32.069  1.00 50.36  ? 183 SER B O   1 
ATOM   1342 C  CB  . SER A 1 186 ? 16.528  8.098   32.890  1.00 44.58  ? 183 SER B CB  1 
ATOM   1343 O  OG  . SER A 1 186 ? 17.664  8.941   32.982  1.00 45.22  ? 183 SER B OG  1 
ATOM   1344 N  N   . TRP A 1 187 ? 15.361  11.065  34.206  1.00 43.83  ? 184 TRP B N   1 
ATOM   1345 C  CA  . TRP A 1 187 ? 15.398  12.503  33.959  1.00 42.79  ? 184 TRP B CA  1 
ATOM   1346 C  C   . TRP A 1 187 ? 16.811  12.912  33.559  1.00 47.19  ? 184 TRP B C   1 
ATOM   1347 O  O   . TRP A 1 187 ? 17.783  12.273  33.963  1.00 45.60  ? 184 TRP B O   1 
ATOM   1348 C  CB  . TRP A 1 187 ? 14.996  13.279  35.216  1.00 43.50  ? 184 TRP B CB  1 
ATOM   1349 C  CG  . TRP A 1 187 ? 13.534  13.225  35.566  1.00 45.54  ? 184 TRP B CG  1 
ATOM   1350 C  CD1 . TRP A 1 187 ? 12.952  12.461  36.535  1.00 45.37  ? 184 TRP B CD1 1 
ATOM   1351 C  CD2 . TRP A 1 187 ? 12.476  13.983  34.964  1.00 44.09  ? 184 TRP B CD2 1 
ATOM   1352 N  NE1 . TRP A 1 187 ? 11.597  12.690  36.570  1.00 41.54  ? 184 TRP B NE1 1 
ATOM   1353 C  CE2 . TRP A 1 187 ? 11.280  13.619  35.614  1.00 42.85  ? 184 TRP B CE2 1 
ATOM   1354 C  CE3 . TRP A 1 187 ? 12.424  14.928  33.933  1.00 43.73  ? 184 TRP B CE3 1 
ATOM   1355 C  CZ2 . TRP A 1 187 ? 10.047  14.168  35.268  1.00 43.81  ? 184 TRP B CZ2 1 
ATOM   1356 C  CZ3 . TRP A 1 187 ? 11.199  15.472  33.594  1.00 42.22  ? 184 TRP B CZ3 1 
ATOM   1357 C  CH2 . TRP A 1 187 ? 10.028  15.090  34.259  1.00 44.64  ? 184 TRP B CH2 1 
ATOM   1358 N  N   . ASN A 1 188 ? 16.927  13.977  32.773  1.00 48.04  ? 185 ASN B N   1 
ATOM   1359 C  CA  . ASN A 1 188 ? 18.238  14.496  32.400  1.00 48.66  ? 185 ASN B CA  1 
ATOM   1360 C  C   . ASN A 1 188 ? 18.724  15.546  33.395  1.00 47.94  ? 185 ASN B C   1 
ATOM   1361 O  O   . ASN A 1 188 ? 18.113  16.603  33.545  1.00 55.13  ? 185 ASN B O   1 
ATOM   1362 C  CB  . ASN A 1 188 ? 18.218  15.067  30.980  1.00 50.20  ? 185 ASN B CB  1 
ATOM   1363 C  CG  . ASN A 1 188 ? 19.613  15.304  30.426  1.00 48.26  ? 185 ASN B CG  1 
ATOM   1364 O  OD1 . ASN A 1 188 ? 20.518  15.722  31.146  1.00 46.84  ? 185 ASN B OD1 1 
ATOM   1365 N  ND2 . ASN A 1 188 ? 19.790  15.039  29.138  1.00 45.66  ? 185 ASN B ND2 1 
ATOM   1366 N  N   . SER A 1 189 ? 19.829  15.247  34.070  1.00 47.04  ? 186 SER B N   1 
ATOM   1367 C  CA  . SER A 1 189 ? 20.364  16.123  35.109  1.00 50.44  ? 186 SER B CA  1 
ATOM   1368 C  C   . SER A 1 189 ? 21.003  17.386  34.539  1.00 52.11  ? 186 SER B C   1 
ATOM   1369 O  O   . SER A 1 189 ? 21.341  18.311  35.280  1.00 52.77  ? 186 SER B O   1 
ATOM   1370 C  CB  . SER A 1 189 ? 21.384  15.366  35.958  1.00 49.11  ? 186 SER B CB  1 
ATOM   1371 O  OG  . SER A 1 189 ? 22.356  14.746  35.136  1.00 54.71  ? 186 SER B OG  1 
ATOM   1372 N  N   . ASN A 1 190 ? 21.164  17.419  33.221  1.00 53.07  ? 187 ASN B N   1 
ATOM   1373 C  CA  . ASN A 1 190 ? 21.817  18.537  32.555  1.00 52.00  ? 187 ASN B CA  1 
ATOM   1374 C  C   . ASN A 1 190 ? 20.894  19.239  31.565  1.00 55.05  ? 187 ASN B C   1 
ATOM   1375 O  O   . ASN A 1 190 ? 21.200  20.329  31.083  1.00 57.95  ? 187 ASN B O   1 
ATOM   1376 C  CB  . ASN A 1 190 ? 23.090  18.061  31.852  1.00 48.12  ? 187 ASN B CB  1 
ATOM   1377 C  CG  . ASN A 1 190 ? 24.169  17.632  32.829  1.00 47.71  ? 187 ASN B CG  1 
ATOM   1378 O  OD1 . ASN A 1 190 ? 24.662  18.439  33.617  1.00 46.60  ? 187 ASN B OD1 1 
ATOM   1379 N  ND2 . ASN A 1 190 ? 24.546  16.358  32.777  1.00 44.99  ? 187 ASN B ND2 1 
ATOM   1380 N  N   . LEU A 1 191 ? 19.764  18.609  31.265  1.00 54.30  ? 188 LEU B N   1 
ATOM   1381 C  CA  . LEU A 1 191 ? 18.795  19.188  30.343  1.00 60.33  ? 188 LEU B CA  1 
ATOM   1382 C  C   . LEU A 1 191 ? 17.395  19.138  30.948  1.00 57.92  ? 188 LEU B C   1 
ATOM   1383 O  O   . LEU A 1 191 ? 16.660  18.164  30.775  1.00 59.74  ? 188 LEU B O   1 
ATOM   1384 C  CB  . LEU A 1 191 ? 18.842  18.468  28.995  1.00 62.61  ? 188 LEU B CB  1 
ATOM   1385 C  CG  . LEU A 1 191 ? 18.554  19.318  27.756  1.00 63.02  ? 188 LEU B CG  1 
ATOM   1386 C  CD1 . LEU A 1 191 ? 19.284  20.657  27.821  1.00 61.00  ? 188 LEU B CD1 1 
ATOM   1387 C  CD2 . LEU A 1 191 ? 18.927  18.553  26.493  1.00 62.26  ? 188 LEU B CD2 1 
ATOM   1388 N  N   . SER A 1 192 ? 17.042  20.204  31.659  1.00 57.21  ? 189 SER B N   1 
ATOM   1389 C  CA  . SER A 1 192 ? 15.806  20.272  32.431  1.00 53.99  ? 189 SER B CA  1 
ATOM   1390 C  C   . SER A 1 192 ? 14.554  19.984  31.607  1.00 50.91  ? 189 SER B C   1 
ATOM   1391 O  O   . SER A 1 192 ? 14.255  20.693  30.647  1.00 54.63  ? 189 SER B O   1 
ATOM   1392 C  CB  . SER A 1 192 ? 15.685  21.644  33.097  1.00 50.44  ? 189 SER B CB  1 
ATOM   1393 O  OG  . SER A 1 192 ? 14.506  21.728  33.875  1.00 63.57  ? 189 SER B OG  1 
ATOM   1394 N  N   . GLY A 1 193 ? 13.829  18.939  31.992  1.00 45.56  ? 190 GLY B N   1 
ATOM   1395 C  CA  . GLY A 1 193 ? 12.561  18.602  31.353  1.00 42.81  ? 190 GLY B CA  1 
ATOM   1396 C  C   . GLY A 1 193 ? 12.638  17.424  30.401  1.00 46.72  ? 190 GLY B C   1 
ATOM   1397 O  O   . GLY A 1 193 ? 11.613  16.927  29.930  1.00 44.85  ? 190 GLY B O   1 
ATOM   1398 N  N   . HIS A 1 194 ? 13.854  16.971  30.117  1.00 46.35  ? 191 HIS B N   1 
ATOM   1399 C  CA  . HIS A 1 194 ? 14.054  15.886  29.165  1.00 48.95  ? 191 HIS B CA  1 
ATOM   1400 C  C   . HIS A 1 194 ? 14.031  14.520  29.838  1.00 46.18  ? 191 HIS B C   1 
ATOM   1401 O  O   . HIS A 1 194 ? 14.934  14.168  30.596  1.00 50.47  ? 191 HIS B O   1 
ATOM   1402 C  CB  . HIS A 1 194 ? 15.346  16.099  28.374  1.00 56.25  ? 191 HIS B CB  1 
ATOM   1403 C  CG  . HIS A 1 194 ? 15.276  17.250  27.420  1.00 62.72  ? 191 HIS B CG  1 
ATOM   1404 N  ND1 . HIS A 1 194 ? 15.319  18.565  27.835  1.00 62.90  ? 191 HIS B ND1 1 
ATOM   1405 C  CD2 . HIS A 1 194 ? 15.149  17.285  26.071  1.00 63.40  ? 191 HIS B CD2 1 
ATOM   1406 C  CE1 . HIS A 1 194 ? 15.229  19.359  26.784  1.00 62.14  ? 191 HIS B CE1 1 
ATOM   1407 N  NE2 . HIS A 1 194 ? 15.126  18.608  25.701  1.00 65.02  ? 191 HIS B NE2 1 
ATOM   1408 N  N   . LEU A 1 195 ? 12.986  13.756  29.541  1.00 45.25  ? 192 LEU B N   1 
ATOM   1409 C  CA  . LEU A 1 195 ? 12.730  12.493  30.215  1.00 42.98  ? 192 LEU B CA  1 
ATOM   1410 C  C   . LEU A 1 195 ? 12.792  11.320  29.245  1.00 45.32  ? 192 LEU B C   1 
ATOM   1411 O  O   . LEU A 1 195 ? 12.310  11.409  28.118  1.00 46.88  ? 192 LEU B O   1 
ATOM   1412 C  CB  . LEU A 1 195 ? 11.357  12.542  30.888  1.00 46.08  ? 192 LEU B CB  1 
ATOM   1413 C  CG  . LEU A 1 195 ? 10.905  11.338  31.716  1.00 49.05  ? 192 LEU B CG  1 
ATOM   1414 C  CD1 . LEU A 1 195 ? 11.733  11.212  32.984  1.00 48.53  ? 192 LEU B CD1 1 
ATOM   1415 C  CD2 . LEU A 1 195 ? 9.430   11.461  32.050  1.00 45.77  ? 192 LEU B CD2 1 
ATOM   1416 N  N   . LEU A 1 196 ? 13.389  10.221  29.696  1.00 45.75  ? 193 LEU B N   1 
ATOM   1417 C  CA  . LEU A 1 196 ? 13.476  9.004   28.902  1.00 43.81  ? 193 LEU B CA  1 
ATOM   1418 C  C   . LEU A 1 196 ? 12.648  7.896   29.529  1.00 47.07  ? 193 LEU B C   1 
ATOM   1419 O  O   . LEU A 1 196 ? 12.534  7.817   30.753  1.00 50.50  ? 193 LEU B O   1 
ATOM   1420 C  CB  . LEU A 1 196 ? 14.926  8.541   28.793  1.00 46.15  ? 193 LEU B CB  1 
ATOM   1421 C  CG  . LEU A 1 196 ? 15.842  9.262   27.809  1.00 45.56  ? 193 LEU B CG  1 
ATOM   1422 C  CD1 . LEU A 1 196 ? 17.279  8.895   28.112  1.00 47.45  ? 193 LEU B CD1 1 
ATOM   1423 C  CD2 . LEU A 1 196 ? 15.483  8.902   26.376  1.00 40.77  ? 193 LEU B CD2 1 
ATOM   1424 N  N   . SER A 1 197 ? 12.082  7.032   28.693  1.00 44.73  ? 194 SER B N   1 
ATOM   1425 C  CA  . SER A 1 197 ? 11.272  5.925   29.185  1.00 43.30  ? 194 SER B CA  1 
ATOM   1426 C  C   . SER A 1 197 ? 11.453  4.663   28.351  1.00 44.19  ? 194 SER B C   1 
ATOM   1427 O  O   . SER A 1 197 ? 11.497  4.719   27.125  1.00 49.60  ? 194 SER B O   1 
ATOM   1428 C  CB  . SER A 1 197 ? 9.798   6.322   29.225  1.00 43.18  ? 194 SER B CB  1 
ATOM   1429 O  OG  . SER A 1 197 ? 8.978   5.210   29.533  1.00 49.39  ? 194 SER B OG  1 
ATOM   1430 N  N   . ALA A 1 198 ? 11.561  3.526   29.031  1.00 44.09  ? 195 ALA B N   1 
ATOM   1431 C  CA  . ALA A 1 198 ? 11.686  2.235   28.370  1.00 44.08  ? 195 ALA B CA  1 
ATOM   1432 C  C   . ALA A 1 198 ? 10.377  1.469   28.505  1.00 49.51  ? 195 ALA B C   1 
ATOM   1433 O  O   . ALA A 1 198 ? 9.580   1.748   29.401  1.00 52.48  ? 195 ALA B O   1 
ATOM   1434 C  CB  . ALA A 1 198 ? 12.833  1.443   28.970  1.00 46.46  ? 195 ALA B CB  1 
ATOM   1435 N  N   . SER A 1 199 ? 10.155  0.501   27.621  1.00 52.66  ? 196 SER B N   1 
ATOM   1436 C  CA  . SER A 1 199 ? 8.873   -0.199  27.583  1.00 57.35  ? 196 SER B CA  1 
ATOM   1437 C  C   . SER A 1 199 ? 8.956   -1.605  26.998  1.00 58.10  ? 196 SER B C   1 
ATOM   1438 O  O   . SER A 1 199 ? 9.962   -1.988  26.402  1.00 61.55  ? 196 SER B O   1 
ATOM   1439 C  CB  . SER A 1 199 ? 7.848   0.627   26.801  1.00 57.64  ? 196 SER B CB  1 
ATOM   1440 O  OG  . SER A 1 199 ? 6.762   -0.173  26.366  1.00 61.22  ? 196 SER B OG  1 
ATOM   1441 N  N   . ASP A 1 200 ? 7.879   -2.364  27.175  1.00 57.10  ? 197 ASP B N   1 
ATOM   1442 C  CA  . ASP A 1 200 ? 7.774   -3.705  26.614  1.00 62.22  ? 197 ASP B CA  1 
ATOM   1443 C  C   . ASP A 1 200 ? 7.508   -3.658  25.113  1.00 60.92  ? 197 ASP B C   1 
ATOM   1444 O  O   . ASP A 1 200 ? 7.535   -4.686  24.438  1.00 62.21  ? 197 ASP B O   1 
ATOM   1445 C  CB  . ASP A 1 200 ? 6.661   -4.493  27.311  1.00 65.90  ? 197 ASP B CB  1 
ATOM   1446 C  CG  . ASP A 1 200 ? 6.960   -4.761  28.773  1.00 61.71  ? 197 ASP B CG  1 
ATOM   1447 O  OD1 . ASP A 1 200 ? 7.990   -4.264  29.270  1.00 62.60  ? 197 ASP B OD1 1 
ATOM   1448 O  OD2 . ASP A 1 200 ? 6.162   -5.468  29.422  1.00 58.50  ? 197 ASP B OD2 1 
ATOM   1449 N  N   . ASP A 1 201 ? 7.250   -2.460  24.596  1.00 60.05  ? 198 ASP B N   1 
ATOM   1450 C  CA  . ASP A 1 201 ? 6.968   -2.288  23.175  1.00 58.02  ? 198 ASP B CA  1 
ATOM   1451 C  C   . ASP A 1 201 ? 8.249   -2.236  22.346  1.00 57.97  ? 198 ASP B C   1 
ATOM   1452 O  O   . ASP A 1 201 ? 8.215   -1.910  21.159  1.00 57.37  ? 198 ASP B O   1 
ATOM   1453 C  CB  . ASP A 1 201 ? 6.111   -1.040  22.935  1.00 58.19  ? 198 ASP B CB  1 
ATOM   1454 C  CG  . ASP A 1 201 ? 6.871   0.253   23.176  1.00 61.48  ? 198 ASP B CG  1 
ATOM   1455 O  OD1 . ASP A 1 201 ? 8.009   0.200   23.688  1.00 63.66  ? 198 ASP B OD1 1 
ATOM   1456 O  OD2 . ASP A 1 201 ? 6.327   1.328   22.849  1.00 62.41  ? 198 ASP B OD2 1 
ATOM   1457 N  N   . HIS A 1 202 ? 9.375   -2.546  22.986  1.00 57.14  ? 199 HIS B N   1 
ATOM   1458 C  CA  . HIS A 1 202 ? 10.667  -2.640  22.307  1.00 58.64  ? 199 HIS B CA  1 
ATOM   1459 C  C   . HIS A 1 202 ? 11.334  -1.280  22.109  1.00 61.10  ? 199 HIS B C   1 
ATOM   1460 O  O   . HIS A 1 202 ? 12.456  -1.203  21.609  1.00 65.70  ? 199 HIS B O   1 
ATOM   1461 C  CB  . HIS A 1 202 ? 10.510  -3.339  20.951  1.00 61.51  ? 199 HIS B CB  1 
ATOM   1462 C  CG  . HIS A 1 202 ? 10.110  -4.779  21.049  1.00 62.25  ? 199 HIS B CG  1 
ATOM   1463 N  ND1 . HIS A 1 202 ? 9.292   -5.261  22.049  1.00 62.80  ? 199 HIS B ND1 1 
ATOM   1464 C  CD2 . HIS A 1 202 ? 10.396  -5.837  20.254  1.00 62.02  ? 199 HIS B CD2 1 
ATOM   1465 C  CE1 . HIS A 1 202 ? 9.106   -6.558  21.876  1.00 60.68  ? 199 HIS B CE1 1 
ATOM   1466 N  NE2 . HIS A 1 202 ? 9.764   -6.932  20.794  1.00 65.46  ? 199 HIS B NE2 1 
ATOM   1467 N  N   . THR A 1 203 ? 10.650  -0.211  22.511  1.00 57.71  ? 200 THR B N   1 
ATOM   1468 C  CA  . THR A 1 203 ? 11.112  1.143   22.212  1.00 58.49  ? 200 THR B CA  1 
ATOM   1469 C  C   . THR A 1 203 ? 11.562  1.943   23.435  1.00 57.79  ? 200 THR B C   1 
ATOM   1470 O  O   . THR A 1 203 ? 11.359  1.532   24.577  1.00 56.31  ? 200 THR B O   1 
ATOM   1471 C  CB  . THR A 1 203 ? 10.025  1.956   21.474  1.00 60.65  ? 200 THR B CB  1 
ATOM   1472 O  OG1 . THR A 1 203 ? 8.921   2.193   22.356  1.00 57.23  ? 200 THR B OG1 1 
ATOM   1473 C  CG2 . THR A 1 203 ? 9.538   1.209   20.239  1.00 58.00  ? 200 THR B CG2 1 
ATOM   1474 N  N   . VAL A 1 204 ? 12.174  3.095   23.169  1.00 54.35  ? 201 VAL B N   1 
ATOM   1475 C  CA  . VAL A 1 204 ? 12.565  4.046   24.204  1.00 50.45  ? 201 VAL B CA  1 
ATOM   1476 C  C   . VAL A 1 204 ? 12.137  5.455   23.793  1.00 56.73  ? 201 VAL B C   1 
ATOM   1477 O  O   . VAL A 1 204 ? 12.697  6.033   22.861  1.00 59.07  ? 201 VAL B O   1 
ATOM   1478 C  CB  . VAL A 1 204 ? 14.088  4.022   24.452  1.00 46.47  ? 201 VAL B CB  1 
ATOM   1479 C  CG1 . VAL A 1 204 ? 14.547  5.311   25.119  1.00 38.40  ? 201 VAL B CG1 1 
ATOM   1480 C  CG2 . VAL A 1 204 ? 14.473  2.810   25.289  1.00 44.54  ? 201 VAL B CG2 1 
ATOM   1481 N  N   . CYS A 1 205 ? 11.138  6.000   24.483  1.00 55.98  ? 202 CYS B N   1 
ATOM   1482 C  CA  . CYS A 1 205 ? 10.593  7.309   24.128  1.00 53.72  ? 202 CYS B CA  1 
ATOM   1483 C  C   . CYS A 1 205 ? 11.336  8.466   24.794  1.00 55.46  ? 202 CYS B C   1 
ATOM   1484 O  O   . CYS A 1 205 ? 11.928  8.307   25.862  1.00 60.41  ? 202 CYS B O   1 
ATOM   1485 C  CB  . CYS A 1 205 ? 9.104   7.383   24.467  1.00 56.09  ? 202 CYS B CB  1 
ATOM   1486 S  SG  . CYS A 1 205 ? 8.041   6.282   23.502  1.00 67.36  ? 202 CYS B SG  1 
ATOM   1487 N  N   . LEU A 1 206 ? 11.293  9.629   24.151  1.00 54.69  ? 203 LEU B N   1 
ATOM   1488 C  CA  . LEU A 1 206 ? 11.925  10.837  24.670  1.00 54.34  ? 203 LEU B CA  1 
ATOM   1489 C  C   . LEU A 1 206 ? 10.908  11.977  24.664  1.00 56.15  ? 203 LEU B C   1 
ATOM   1490 O  O   . LEU A 1 206 ? 10.176  12.151  23.692  1.00 62.82  ? 203 LEU B O   1 
ATOM   1491 C  CB  . LEU A 1 206 ? 13.128  11.217  23.804  1.00 51.42  ? 203 LEU B CB  1 
ATOM   1492 C  CG  . LEU A 1 206 ? 14.311  11.995  24.395  1.00 53.39  ? 203 LEU B CG  1 
ATOM   1493 C  CD1 . LEU A 1 206 ? 15.103  12.655  23.275  1.00 51.88  ? 203 LEU B CD1 1 
ATOM   1494 C  CD2 . LEU A 1 206 ? 13.886  13.040  25.414  1.00 58.48  ? 203 LEU B CD2 1 
ATOM   1495 N  N   . TRP A 1 207 ? 10.864  12.747  25.747  1.00 51.19  ? 204 TRP B N   1 
ATOM   1496 C  CA  . TRP A 1 207 ? 9.950   13.881  25.845  1.00 49.72  ? 204 TRP B CA  1 
ATOM   1497 C  C   . TRP A 1 207 ? 10.653  15.151  26.304  1.00 54.52  ? 204 TRP B C   1 
ATOM   1498 O  O   . TRP A 1 207 ? 11.693  15.101  26.961  1.00 55.58  ? 204 TRP B O   1 
ATOM   1499 C  CB  . TRP A 1 207 ? 8.819   13.588  26.830  1.00 47.71  ? 204 TRP B CB  1 
ATOM   1500 C  CG  . TRP A 1 207 ? 7.884   12.499  26.424  1.00 45.52  ? 204 TRP B CG  1 
ATOM   1501 C  CD1 . TRP A 1 207 ? 6.768   12.624  25.652  1.00 44.75  ? 204 TRP B CD1 1 
ATOM   1502 C  CD2 . TRP A 1 207 ? 7.963   11.120  26.797  1.00 43.80  ? 204 TRP B CD2 1 
ATOM   1503 N  NE1 . TRP A 1 207 ? 6.152   11.404  25.510  1.00 48.69  ? 204 TRP B NE1 1 
ATOM   1504 C  CE2 . TRP A 1 207 ? 6.867   10.464  26.203  1.00 46.73  ? 204 TRP B CE2 1 
ATOM   1505 C  CE3 . TRP A 1 207 ? 8.857   10.375  27.570  1.00 45.68  ? 204 TRP B CE3 1 
ATOM   1506 C  CZ2 . TRP A 1 207 ? 6.640   9.098   26.360  1.00 48.28  ? 204 TRP B CZ2 1 
ATOM   1507 C  CZ3 . TRP A 1 207 ? 8.631   9.020   27.724  1.00 47.41  ? 204 TRP B CZ3 1 
ATOM   1508 C  CH2 . TRP A 1 207 ? 7.531   8.395   27.124  1.00 46.19  ? 204 TRP B CH2 1 
ATOM   1509 N  N   . ASP A 1 208 ? 10.063  16.288  25.956  1.00 57.47  ? 205 ASP B N   1 
ATOM   1510 C  CA  . ASP A 1 208 ? 10.457  17.573  26.511  1.00 63.22  ? 205 ASP B CA  1 
ATOM   1511 C  C   . ASP A 1 208 ? 9.208   18.215  27.102  1.00 64.79  ? 205 ASP B C   1 
ATOM   1512 O  O   . ASP A 1 208 ? 8.394   18.789  26.378  1.00 71.03  ? 205 ASP B O   1 
ATOM   1513 C  CB  . ASP A 1 208 ? 11.067  18.468  25.431  1.00 66.43  ? 205 ASP B CB  1 
ATOM   1514 C  CG  . ASP A 1 208 ? 11.470  19.834  25.960  1.00 69.82  ? 205 ASP B CG  1 
ATOM   1515 O  OD1 . ASP A 1 208 ? 12.391  20.449  25.382  1.00 76.03  ? 205 ASP B OD1 1 
ATOM   1516 O  OD2 . ASP A 1 208 ? 10.868  20.298  26.951  1.00 67.95  ? 205 ASP B OD2 1 
ATOM   1517 N  N   . ILE A 1 209 ? 9.059   18.113  28.420  1.00 64.24  ? 206 ILE B N   1 
ATOM   1518 C  CA  . ILE A 1 209 ? 7.832   18.545  29.091  1.00 66.28  ? 206 ILE B CA  1 
ATOM   1519 C  C   . ILE A 1 209 ? 7.704   20.064  29.217  1.00 69.41  ? 206 ILE B C   1 
ATOM   1520 O  O   . ILE A 1 209 ? 6.727   20.564  29.775  1.00 69.27  ? 206 ILE B O   1 
ATOM   1521 C  CB  . ILE A 1 209 ? 7.689   17.903  30.489  1.00 63.29  ? 206 ILE B CB  1 
ATOM   1522 C  CG1 . ILE A 1 209 ? 8.798   18.394  31.422  1.00 57.76  ? 206 ILE B CG1 1 
ATOM   1523 C  CG2 . ILE A 1 209 ? 7.694   16.381  30.384  1.00 60.71  ? 206 ILE B CG2 1 
ATOM   1524 C  CD1 . ILE A 1 209 ? 8.599   17.998  32.861  1.00 50.16  ? 206 ILE B CD1 1 
ATOM   1525 N  N   . ASN A 1 210 ? 8.689   20.792  28.702  1.00 74.72  ? 207 ASN B N   1 
ATOM   1526 C  CA  . ASN A 1 210 ? 8.643   22.250  28.704  1.00 82.67  ? 207 ASN B CA  1 
ATOM   1527 C  C   . ASN A 1 210 ? 7.981   22.798  27.445  1.00 89.20  ? 207 ASN B C   1 
ATOM   1528 O  O   . ASN A 1 210 ? 7.371   23.868  27.469  1.00 92.53  ? 207 ASN B O   1 
ATOM   1529 C  CB  . ASN A 1 210 ? 10.049  22.831  28.850  1.00 83.31  ? 207 ASN B CB  1 
ATOM   1530 C  CG  . ASN A 1 210 ? 10.732  22.387  30.125  1.00 84.54  ? 207 ASN B CG  1 
ATOM   1531 O  OD1 . ASN A 1 210 ? 10.175  22.507  31.218  1.00 83.87  ? 207 ASN B OD1 1 
ATOM   1532 N  ND2 . ASN A 1 210 ? 11.949  21.872  29.994  1.00 84.55  ? 207 ASN B ND2 1 
ATOM   1533 N  N   . ALA A 1 211 ? 8.105   22.056  26.348  1.00 94.51  ? 208 ALA B N   1 
ATOM   1534 C  CA  . ALA A 1 211 ? 7.526   22.463  25.072  1.00 99.19  ? 208 ALA B CA  1 
ATOM   1535 C  C   . ALA A 1 211 ? 6.064   22.037  24.963  1.00 102.92 ? 208 ALA B C   1 
ATOM   1536 O  O   . ALA A 1 211 ? 5.275   22.251  25.884  1.00 101.83 ? 208 ALA B O   1 
ATOM   1537 C  CB  . ALA A 1 211 ? 8.338   21.893  23.916  1.00 97.62  ? 208 ALA B CB  1 
ATOM   1538 N  N   . GLY A 1 212 ? 5.712   21.433  23.832  1.00 108.43 ? 209 GLY B N   1 
ATOM   1539 C  CA  . GLY A 1 212 ? 4.341   20.998  23.584  1.00 113.25 ? 209 GLY B CA  1 
ATOM   1540 C  C   . GLY A 1 212 ? 3.419   22.162  23.276  1.00 118.16 ? 209 GLY B C   1 
ATOM   1541 O  O   . GLY A 1 212 ? 3.876   23.227  22.858  1.00 119.68 ? 209 GLY B O   1 
ATOM   1542 N  N   . PRO A 1 213 ? 2.107   21.965  23.476  1.00 120.00 ? 210 PRO B N   1 
ATOM   1543 C  CA  . PRO A 1 213 ? 1.121   23.018  23.273  1.00 120.00 ? 210 PRO B CA  1 
ATOM   1544 C  C   . PRO A 1 213 ? 0.885   23.815  24.555  1.00 120.00 ? 210 PRO B C   1 
ATOM   1545 O  O   . PRO A 1 213 ? 1.525   23.550  25.574  1.00 120.00 ? 210 PRO B O   1 
ATOM   1546 C  CB  . PRO A 1 213 ? -0.140  22.240  22.890  1.00 120.00 ? 210 PRO B CB  1 
ATOM   1547 C  CG  . PRO A 1 213 ? 0.035   20.870  23.513  1.00 120.00 ? 210 PRO B CG  1 
ATOM   1548 C  CD  . PRO A 1 213 ? 1.483   20.704  23.915  1.00 120.00 ? 210 PRO B CD  1 
ATOM   1549 N  N   . LYS A 1 214 ? -0.022  24.785  24.500  1.00 120.00 ? 211 LYS B N   1 
ATOM   1550 C  CA  . LYS A 1 214 ? -0.358  25.580  25.679  1.00 120.00 ? 211 LYS B CA  1 
ATOM   1551 C  C   . LYS A 1 214 ? -1.302  24.821  26.605  1.00 120.00 ? 211 LYS B C   1 
ATOM   1552 O  O   . LYS A 1 214 ? -1.323  25.055  27.814  1.00 120.00 ? 211 LYS B O   1 
ATOM   1553 C  CB  . LYS A 1 214 ? -0.975  26.922  25.272  1.00 120.00 ? 211 LYS B CB  1 
ATOM   1554 C  CG  . LYS A 1 214 ? 0.041   28.004  24.914  1.00 120.00 ? 211 LYS B CG  1 
ATOM   1555 C  CD  . LYS A 1 214 ? 0.422   28.859  26.123  1.00 120.00 ? 211 LYS B CD  1 
ATOM   1556 C  CE  . LYS A 1 214 ? 1.339   28.122  27.093  1.00 120.00 ? 211 LYS B CE  1 
ATOM   1557 N  NZ  . LYS A 1 214 ? 2.675   27.830  26.501  1.00 120.00 ? 211 LYS B NZ  1 
ATOM   1558 N  N   . GLU A 1 215 ? -2.078  23.908  26.024  1.00 120.00 ? 212 GLU B N   1 
ATOM   1559 C  CA  . GLU A 1 215 ? -3.003  23.070  26.781  1.00 120.00 ? 212 GLU B CA  1 
ATOM   1560 C  C   . GLU A 1 215 ? -3.229  21.734  26.073  1.00 117.29 ? 212 GLU B C   1 
ATOM   1561 O  O   . GLU A 1 215 ? -3.226  21.667  24.844  1.00 117.66 ? 212 GLU B O   1 
ATOM   1562 C  CB  . GLU A 1 215 ? -4.336  23.795  27.002  1.00 120.00 ? 212 GLU B CB  1 
ATOM   1563 C  CG  . GLU A 1 215 ? -4.383  24.632  28.277  1.00 120.00 ? 212 GLU B CG  1 
ATOM   1564 C  CD  . GLU A 1 215 ? -5.584  25.558  28.331  1.00 120.00 ? 212 GLU B CD  1 
ATOM   1565 O  OE1 . GLU A 1 215 ? -5.985  26.083  27.267  1.00 120.00 ? 212 GLU B OE1 1 
ATOM   1566 O  OE2 . GLU A 1 215 ? -6.122  25.768  29.440  1.00 120.00 ? 212 GLU B OE2 1 
ATOM   1567 N  N   . GLY A 1 216 ? -3.421  20.673  26.852  1.00 112.70 ? 213 GLY B N   1 
ATOM   1568 C  CA  . GLY A 1 216 ? -3.438  20.777  28.305  1.00 105.20 ? 213 GLY B CA  1 
ATOM   1569 C  C   . GLY A 1 216 ? -2.408  19.897  28.983  1.00 99.85  ? 213 GLY B C   1 
ATOM   1570 O  O   . GLY A 1 216 ? -1.299  20.342  29.283  1.00 101.52 ? 213 GLY B O   1 
ATOM   1571 N  N   . LYS A 1 217 ? -2.774  18.641  29.215  1.00 90.81  ? 214 LYS B N   1 
ATOM   1572 C  CA  . LYS A 1 217 ? -1.938  17.733  29.989  1.00 83.28  ? 214 LYS B CA  1 
ATOM   1573 C  C   . LYS A 1 217 ? -1.387  16.592  29.138  1.00 78.08  ? 214 LYS B C   1 
ATOM   1574 O  O   . LYS A 1 217 ? -1.109  15.511  29.651  1.00 78.06  ? 214 LYS B O   1 
ATOM   1575 C  CB  . LYS A 1 217 ? -2.738  17.158  31.164  1.00 84.25  ? 214 LYS B CB  1 
ATOM   1576 C  CG  . LYS A 1 217 ? -3.719  18.136  31.809  1.00 83.45  ? 214 LYS B CG  1 
ATOM   1577 C  CD  . LYS A 1 217 ? -3.005  19.316  32.455  1.00 86.73  ? 214 LYS B CD  1 
ATOM   1578 C  CE  . LYS A 1 217 ? -3.986  20.255  33.143  1.00 88.03  ? 214 LYS B CE  1 
ATOM   1579 N  NZ  . LYS A 1 217 ? -4.663  19.609  34.302  1.00 88.06  ? 214 LYS B NZ  1 
ATOM   1580 N  N   . ILE A 1 218 ? -1.232  16.832  27.839  1.00 73.69  ? 215 ILE B N   1 
ATOM   1581 C  CA  . ILE A 1 218 ? -0.793  15.783  26.917  1.00 70.94  ? 215 ILE B CA  1 
ATOM   1582 C  C   . ILE A 1 218 ? 0.346   16.235  26.003  1.00 67.18  ? 215 ILE B C   1 
ATOM   1583 O  O   . ILE A 1 218 ? 0.215   17.222  25.279  1.00 70.51  ? 215 ILE B O   1 
ATOM   1584 C  CB  . ILE A 1 218 ? -1.963  15.272  26.044  1.00 68.43  ? 215 ILE B CB  1 
ATOM   1585 C  CG1 . ILE A 1 218 ? -3.127  14.806  26.922  1.00 71.79  ? 215 ILE B CG1 1 
ATOM   1586 C  CG2 . ILE A 1 218 ? -1.502  14.142  25.137  1.00 66.14  ? 215 ILE B CG2 1 
ATOM   1587 C  CD1 . ILE A 1 218 ? -4.386  14.472  26.148  1.00 74.41  ? 215 ILE B CD1 1 
ATOM   1588 N  N   . VAL A 1 219 ? 1.463   15.512  26.042  1.00 62.14  ? 216 VAL B N   1 
ATOM   1589 C  CA  . VAL A 1 219 ? 2.583   15.799  25.149  1.00 62.95  ? 216 VAL B CA  1 
ATOM   1590 C  C   . VAL A 1 219 ? 3.002   14.551  24.373  1.00 64.94  ? 216 VAL B C   1 
ATOM   1591 O  O   . VAL A 1 219 ? 2.829   13.426  24.845  1.00 66.61  ? 216 VAL B O   1 
ATOM   1592 C  CB  . VAL A 1 219 ? 3.804   16.385  25.902  1.00 63.11  ? 216 VAL B CB  1 
ATOM   1593 C  CG1 . VAL A 1 219 ? 3.355   17.234  27.086  1.00 61.13  ? 216 VAL B CG1 1 
ATOM   1594 C  CG2 . VAL A 1 219 ? 4.732   15.280  26.364  1.00 62.19  ? 216 VAL B CG2 1 
ATOM   1595 N  N   . ASP A 1 220 ? 3.546   14.760  23.178  1.00 65.64  ? 217 ASP B N   1 
ATOM   1596 C  CA  . ASP A 1 220 ? 3.974   13.660  22.322  1.00 64.79  ? 217 ASP B CA  1 
ATOM   1597 C  C   . ASP A 1 220 ? 5.472   13.421  22.448  1.00 60.94  ? 217 ASP B C   1 
ATOM   1598 O  O   . ASP A 1 220 ? 6.229   14.333  22.777  1.00 60.55  ? 217 ASP B O   1 
ATOM   1599 C  CB  . ASP A 1 220 ? 3.614   13.948  20.863  1.00 67.70  ? 217 ASP B CB  1 
ATOM   1600 C  CG  . ASP A 1 220 ? 2.118   14.066  20.643  1.00 72.40  ? 217 ASP B CG  1 
ATOM   1601 O  OD1 . ASP A 1 220 ? 1.679   15.095  20.086  1.00 72.19  ? 217 ASP B OD1 1 
ATOM   1602 O  OD2 . ASP A 1 220 ? 1.382   13.134  21.032  1.00 73.20  ? 217 ASP B OD2 1 
ATOM   1603 N  N   . ALA A 1 221 ? 5.894   12.189  22.184  1.00 59.21  ? 218 ALA B N   1 
ATOM   1604 C  CA  . ALA A 1 221 ? 7.309   11.846  22.216  1.00 61.63  ? 218 ALA B CA  1 
ATOM   1605 C  C   . ALA A 1 221 ? 8.076   12.650  21.173  1.00 62.85  ? 218 ALA B C   1 
ATOM   1606 O  O   . ALA A 1 221 ? 7.629   12.786  20.034  1.00 64.64  ? 218 ALA B O   1 
ATOM   1607 C  CB  . ALA A 1 221 ? 7.497   10.357  21.984  1.00 60.51  ? 218 ALA B CB  1 
ATOM   1608 N  N   . LYS A 1 222 ? 9.226   13.189  21.565  1.00 62.22  ? 219 LYS B N   1 
ATOM   1609 C  CA  . LYS A 1 222 ? 10.075  13.914  20.629  1.00 62.23  ? 219 LYS B CA  1 
ATOM   1610 C  C   . LYS A 1 222 ? 10.872  12.930  19.776  1.00 64.77  ? 219 LYS B C   1 
ATOM   1611 O  O   . LYS A 1 222 ? 11.241  13.235  18.642  1.00 70.84  ? 219 LYS B O   1 
ATOM   1612 C  CB  . LYS A 1 222 ? 11.011  14.877  21.366  1.00 61.23  ? 219 LYS B CB  1 
ATOM   1613 C  CG  . LYS A 1 222 ? 11.634  15.942  20.465  1.00 65.14  ? 219 LYS B CG  1 
ATOM   1614 C  CD  . LYS A 1 222 ? 12.155  17.135  21.259  1.00 66.38  ? 219 LYS B CD  1 
ATOM   1615 C  CE  . LYS A 1 222 ? 13.501  16.844  21.907  1.00 67.92  ? 219 LYS B CE  1 
ATOM   1616 N  NZ  . LYS A 1 222 ? 14.606  16.777  20.910  1.00 68.84  ? 219 LYS B NZ  1 
ATOM   1617 N  N   . ALA A 1 223 ? 11.123  11.745  20.326  1.00 62.96  ? 220 ALA B N   1 
ATOM   1618 C  CA  . ALA A 1 223 ? 11.858  10.704  19.614  1.00 61.47  ? 220 ALA B CA  1 
ATOM   1619 C  C   . ALA A 1 223 ? 11.476  9.312   20.113  1.00 63.19  ? 220 ALA B C   1 
ATOM   1620 O  O   . ALA A 1 223 ? 11.213  9.119   21.300  1.00 69.82  ? 220 ALA B O   1 
ATOM   1621 C  CB  . ALA A 1 223 ? 13.359  10.926  19.753  1.00 54.21  ? 220 ALA B CB  1 
ATOM   1622 N  N   . ILE A 1 224 ? 11.443  8.346   19.199  1.00 60.88  ? 221 ILE B N   1 
ATOM   1623 C  CA  . ILE A 1 224 ? 11.165  6.956   19.552  1.00 59.90  ? 221 ILE B CA  1 
ATOM   1624 C  C   . ILE A 1 224 ? 12.254  6.042   18.996  1.00 63.61  ? 221 ILE B C   1 
ATOM   1625 O  O   . ILE A 1 224 ? 12.276  5.742   17.802  1.00 69.67  ? 221 ILE B O   1 
ATOM   1626 C  CB  . ILE A 1 224 ? 9.785   6.496   19.032  1.00 57.66  ? 221 ILE B CB  1 
ATOM   1627 C  CG1 . ILE A 1 224 ? 8.679   7.409   19.565  1.00 60.15  ? 221 ILE B CG1 1 
ATOM   1628 C  CG2 . ILE A 1 224 ? 9.517   5.051   19.425  1.00 54.31  ? 221 ILE B CG2 1 
ATOM   1629 C  CD1 . ILE A 1 224 ? 7.290   7.039   19.086  1.00 61.13  ? 221 ILE B CD1 1 
ATOM   1630 N  N   . PHE A 1 225 ? 13.157  5.607   19.870  1.00 66.53  ? 222 PHE B N   1 
ATOM   1631 C  CA  . PHE A 1 225 ? 14.293  4.778   19.472  1.00 64.29  ? 222 PHE B CA  1 
ATOM   1632 C  C   . PHE A 1 225 ? 13.893  3.307   19.392  1.00 65.53  ? 222 PHE B C   1 
ATOM   1633 O  O   . PHE A 1 225 ? 13.335  2.755   20.341  1.00 65.80  ? 222 PHE B O   1 
ATOM   1634 C  CB  . PHE A 1 225 ? 15.455  4.963   20.452  1.00 60.52  ? 222 PHE B CB  1 
ATOM   1635 C  CG  . PHE A 1 225 ? 15.865  6.399   20.645  1.00 61.42  ? 222 PHE B CG  1 
ATOM   1636 C  CD1 . PHE A 1 225 ? 16.962  6.916   19.976  1.00 64.04  ? 222 PHE B CD1 1 
ATOM   1637 C  CD2 . PHE A 1 225 ? 15.156  7.230   21.499  1.00 62.75  ? 222 PHE B CD2 1 
ATOM   1638 C  CE1 . PHE A 1 225 ? 17.345  8.237   20.153  1.00 62.13  ? 222 PHE B CE1 1 
ATOM   1639 C  CE2 . PHE A 1 225 ? 15.532  8.551   21.679  1.00 62.80  ? 222 PHE B CE2 1 
ATOM   1640 C  CZ  . PHE A 1 225 ? 16.628  9.055   21.005  1.00 62.68  ? 222 PHE B CZ  1 
ATOM   1641 N  N   . THR A 1 226 ? 14.183  2.675   18.258  1.00 64.88  ? 223 THR B N   1 
ATOM   1642 C  CA  . THR A 1 226 ? 13.731  1.307   18.009  1.00 67.69  ? 223 THR B CA  1 
ATOM   1643 C  C   . THR A 1 226 ? 14.883  0.322   17.825  1.00 66.89  ? 223 THR B C   1 
ATOM   1644 O  O   . THR A 1 226 ? 14.692  -0.777  17.301  1.00 68.35  ? 223 THR B O   1 
ATOM   1645 C  CB  . THR A 1 226 ? 12.819  1.240   16.767  1.00 68.61  ? 223 THR B CB  1 
ATOM   1646 O  OG1 . THR A 1 226 ? 13.483  1.850   15.653  1.00 72.43  ? 223 THR B OG1 1 
ATOM   1647 C  CG2 . THR A 1 226 ? 11.507  1.965   17.026  1.00 66.27  ? 223 THR B CG2 1 
ATOM   1648 N  N   . GLY A 1 227 ? 16.073  0.713   18.268  1.00 66.41  ? 224 GLY B N   1 
ATOM   1649 C  CA  . GLY A 1 227 ? 17.272  -0.106  18.097  1.00 68.05  ? 224 GLY B CA  1 
ATOM   1650 C  C   . GLY A 1 227 ? 17.188  -1.516  18.653  1.00 68.51  ? 224 GLY B C   1 
ATOM   1651 O  O   . GLY A 1 227 ? 17.909  -2.406  18.205  1.00 71.60  ? 224 GLY B O   1 
ATOM   1652 N  N   . HIS A 1 228 ? 16.309  -1.726  19.629  1.00 65.10  ? 225 HIS B N   1 
ATOM   1653 C  CA  . HIS A 1 228 ? 16.165  -3.038  20.250  1.00 63.14  ? 225 HIS B CA  1 
ATOM   1654 C  C   . HIS A 1 228 ? 15.126  -3.907  19.549  1.00 67.15  ? 225 HIS B C   1 
ATOM   1655 O  O   . HIS A 1 228 ? 14.218  -3.401  18.887  1.00 70.31  ? 225 HIS B O   1 
ATOM   1656 C  CB  . HIS A 1 228 ? 15.831  -2.902  21.737  1.00 60.08  ? 225 HIS B CB  1 
ATOM   1657 C  CG  . HIS A 1 228 ? 17.003  -2.514  22.584  1.00 53.24  ? 225 HIS B CG  1 
ATOM   1658 N  ND1 . HIS A 1 228 ? 17.149  -1.255  23.123  1.00 52.46  ? 225 HIS B ND1 1 
ATOM   1659 C  CD2 . HIS A 1 228 ? 18.089  -3.220  22.977  1.00 50.90  ? 225 HIS B CD2 1 
ATOM   1660 C  CE1 . HIS A 1 228 ? 18.272  -1.203  23.817  1.00 50.99  ? 225 HIS B CE1 1 
ATOM   1661 N  NE2 . HIS A 1 228 ? 18.861  -2.383  23.744  1.00 53.78  ? 225 HIS B NE2 1 
ATOM   1662 N  N   . SER A 1 229 ? 15.271  -5.220  19.704  1.00 68.87  ? 226 SER B N   1 
ATOM   1663 C  CA  . SER A 1 229 ? 14.384  -6.181  19.058  1.00 71.44  ? 226 SER B CA  1 
ATOM   1664 C  C   . SER A 1 229 ? 13.534  -6.927  20.081  1.00 72.21  ? 226 SER B C   1 
ATOM   1665 O  O   . SER A 1 229 ? 12.755  -7.813  19.726  1.00 71.69  ? 226 SER B O   1 
ATOM   1666 C  CB  . SER A 1 229 ? 15.197  -7.180  18.232  1.00 73.92  ? 226 SER B CB  1 
ATOM   1667 O  OG  . SER A 1 229 ? 16.131  -7.870  19.046  1.00 75.86  ? 226 SER B OG  1 
ATOM   1668 N  N   . ALA A 1 230 ? 13.693  -6.568  21.351  1.00 70.85  ? 227 ALA B N   1 
ATOM   1669 C  CA  . ALA A 1 230 ? 12.927  -7.185  22.429  1.00 68.32  ? 227 ALA B CA  1 
ATOM   1670 C  C   . ALA A 1 230 ? 12.586  -6.168  23.514  1.00 66.70  ? 227 ALA B C   1 
ATOM   1671 O  O   . ALA A 1 230 ? 12.904  -4.985  23.391  1.00 66.64  ? 227 ALA B O   1 
ATOM   1672 C  CB  . ALA A 1 230 ? 13.690  -8.363  23.019  1.00 66.71  ? 227 ALA B CB  1 
ATOM   1673 N  N   . VAL A 1 231 ? 11.936  -6.639  24.574  1.00 64.37  ? 228 VAL B N   1 
ATOM   1674 C  CA  . VAL A 1 231 ? 11.538  -5.782  25.688  1.00 61.89  ? 228 VAL B CA  1 
ATOM   1675 C  C   . VAL A 1 231 ? 12.733  -5.052  26.302  1.00 61.32  ? 228 VAL B C   1 
ATOM   1676 O  O   . VAL A 1 231 ? 13.615  -5.674  26.896  1.00 62.64  ? 228 VAL B O   1 
ATOM   1677 C  CB  . VAL A 1 231 ? 10.812  -6.593  26.781  1.00 60.67  ? 228 VAL B CB  1 
ATOM   1678 C  CG1 . VAL A 1 231 ? 10.644  -5.762  28.044  1.00 63.42  ? 228 VAL B CG1 1 
ATOM   1679 C  CG2 . VAL A 1 231 ? 9.463   -7.082  26.271  1.00 58.16  ? 228 VAL B CG2 1 
ATOM   1680 N  N   . VAL A 1 232 ? 12.758  -3.731  26.149  1.00 55.17  ? 229 VAL B N   1 
ATOM   1681 C  CA  . VAL A 1 232 ? 13.831  -2.917  26.714  1.00 52.59  ? 229 VAL B CA  1 
ATOM   1682 C  C   . VAL A 1 232 ? 13.558  -2.602  28.186  1.00 51.48  ? 229 VAL B C   1 
ATOM   1683 O  O   . VAL A 1 232 ? 12.544  -1.991  28.530  1.00 42.16  ? 229 VAL B O   1 
ATOM   1684 C  CB  . VAL A 1 232 ? 14.080  -1.631  25.884  1.00 55.33  ? 229 VAL B CB  1 
ATOM   1685 C  CG1 . VAL A 1 232 ? 12.767  -1.036  25.405  1.00 56.68  ? 229 VAL B CG1 1 
ATOM   1686 C  CG2 . VAL A 1 232 ? 14.897  -0.620  26.678  1.00 53.46  ? 229 VAL B CG2 1 
ATOM   1687 N  N   . GLU A 1 233 ? 14.481  -3.030  29.045  1.00 51.23  ? 230 GLU B N   1 
ATOM   1688 C  CA  . GLU A 1 233 ? 14.253  -3.077  30.487  1.00 51.97  ? 230 GLU B CA  1 
ATOM   1689 C  C   . GLU A 1 233 ? 14.556  -1.785  31.241  1.00 50.05  ? 230 GLU B C   1 
ATOM   1690 O  O   . GLU A 1 233 ? 13.845  -1.432  32.182  1.00 50.74  ? 230 GLU B O   1 
ATOM   1691 C  CB  . GLU A 1 233 ? 15.059  -4.222  31.101  1.00 52.91  ? 230 GLU B CB  1 
ATOM   1692 C  CG  . GLU A 1 233 ? 14.664  -5.603  30.603  1.00 57.41  ? 230 GLU B CG  1 
ATOM   1693 C  CD  . GLU A 1 233 ? 13.511  -6.209  31.383  1.00 61.25  ? 230 GLU B CD  1 
ATOM   1694 O  OE1 . GLU A 1 233 ? 12.732  -5.450  32.001  1.00 59.54  ? 230 GLU B OE1 1 
ATOM   1695 O  OE2 . GLU A 1 233 ? 13.386  -7.451  31.377  1.00 60.24  ? 230 GLU B OE2 1 
ATOM   1696 N  N   . ASP A 1 234 ? 15.611  -1.084  30.841  1.00 46.02  ? 231 ASP B N   1 
ATOM   1697 C  CA  . ASP A 1 234 ? 16.018  0.118   31.558  1.00 45.24  ? 231 ASP B CA  1 
ATOM   1698 C  C   . ASP A 1 234 ? 16.637  1.160   30.635  1.00 43.34  ? 231 ASP B C   1 
ATOM   1699 O  O   . ASP A 1 234 ? 17.148  0.835   29.563  1.00 43.62  ? 231 ASP B O   1 
ATOM   1700 C  CB  . ASP A 1 234 ? 16.997  -0.240  32.680  1.00 47.52  ? 231 ASP B CB  1 
ATOM   1701 C  CG  . ASP A 1 234 ? 17.149  0.869   33.698  1.00 52.41  ? 231 ASP B CG  1 
ATOM   1702 O  OD1 . ASP A 1 234 ? 18.157  0.868   34.434  1.00 56.16  ? 231 ASP B OD1 1 
ATOM   1703 O  OD2 . ASP A 1 234 ? 16.260  1.744   33.766  1.00 62.32  ? 231 ASP B OD2 1 
ATOM   1704 N  N   . VAL A 1 235 ? 16.582  2.417   31.063  1.00 40.87  ? 232 VAL B N   1 
ATOM   1705 C  CA  . VAL A 1 235 ? 17.175  3.514   30.314  1.00 43.55  ? 232 VAL B CA  1 
ATOM   1706 C  C   . VAL A 1 235 ? 17.790  4.518   31.284  1.00 41.66  ? 232 VAL B C   1 
ATOM   1707 O  O   . VAL A 1 235 ? 17.286  4.708   32.388  1.00 47.37  ? 232 VAL B O   1 
ATOM   1708 C  CB  . VAL A 1 235 ? 16.130  4.209   29.412  1.00 45.86  ? 232 VAL B CB  1 
ATOM   1709 C  CG1 . VAL A 1 235 ? 15.121  4.983   30.252  1.00 42.62  ? 232 VAL B CG1 1 
ATOM   1710 C  CG2 . VAL A 1 235 ? 16.813  5.120   28.401  1.00 44.20  ? 232 VAL B CG2 1 
ATOM   1711 N  N   . ALA A 1 236 ? 18.887  5.149   30.878  1.00 41.54  ? 233 ALA B N   1 
ATOM   1712 C  CA  . ALA A 1 236 ? 19.567  6.112   31.738  1.00 43.63  ? 233 ALA B CA  1 
ATOM   1713 C  C   . ALA A 1 236 ? 20.315  7.169   30.936  1.00 44.88  ? 233 ALA B C   1 
ATOM   1714 O  O   . ALA A 1 236 ? 20.991  6.854   29.961  1.00 52.18  ? 233 ALA B O   1 
ATOM   1715 C  CB  . ALA A 1 236 ? 20.523  5.394   32.686  1.00 34.67  ? 233 ALA B CB  1 
ATOM   1716 N  N   . TRP A 1 237 ? 20.185  8.424   31.355  1.00 47.10  ? 234 TRP B N   1 
ATOM   1717 C  CA  . TRP A 1 237 ? 20.979  9.512   30.797  1.00 46.15  ? 234 TRP B CA  1 
ATOM   1718 C  C   . TRP A 1 237 ? 22.406  9.424   31.319  1.00 48.76  ? 234 TRP B C   1 
ATOM   1719 O  O   . TRP A 1 237 ? 22.646  8.884   32.398  1.00 50.17  ? 234 TRP B O   1 
ATOM   1720 C  CB  . TRP A 1 237 ? 20.400  10.869  31.204  1.00 48.50  ? 234 TRP B CB  1 
ATOM   1721 C  CG  . TRP A 1 237 ? 19.194  11.295  30.439  1.00 50.53  ? 234 TRP B CG  1 
ATOM   1722 C  CD1 . TRP A 1 237 ? 17.907  11.318  30.887  1.00 54.74  ? 234 TRP B CD1 1 
ATOM   1723 C  CD2 . TRP A 1 237 ? 19.158  11.777  29.091  1.00 54.42  ? 234 TRP B CD2 1 
ATOM   1724 N  NE1 . TRP A 1 237 ? 17.070  11.782  29.901  1.00 56.19  ? 234 TRP B NE1 1 
ATOM   1725 C  CE2 . TRP A 1 237 ? 17.814  12.070  28.788  1.00 55.63  ? 234 TRP B CE2 1 
ATOM   1726 C  CE3 . TRP A 1 237 ? 20.132  11.986  28.110  1.00 55.62  ? 234 TRP B CE3 1 
ATOM   1727 C  CZ2 . TRP A 1 237 ? 17.418  12.558  27.544  1.00 54.24  ? 234 TRP B CZ2 1 
ATOM   1728 C  CZ3 . TRP A 1 237 ? 19.737  12.472  26.876  1.00 54.41  ? 234 TRP B CZ3 1 
ATOM   1729 C  CH2 . TRP A 1 237 ? 18.392  12.753  26.604  1.00 53.55  ? 234 TRP B CH2 1 
ATOM   1730 N  N   . HIS A 1 238 ? 23.353  9.956   30.553  1.00 49.84  ? 235 HIS B N   1 
ATOM   1731 C  CA  . HIS A 1 238 ? 24.713  10.113  31.042  1.00 46.70  ? 235 HIS B CA  1 
ATOM   1732 C  C   . HIS A 1 238 ? 24.708  11.287  32.011  1.00 46.77  ? 235 HIS B C   1 
ATOM   1733 O  O   . HIS A 1 238 ? 24.027  12.287  31.779  1.00 43.77  ? 235 HIS B O   1 
ATOM   1734 C  CB  . HIS A 1 238 ? 25.677  10.375  29.884  1.00 50.48  ? 235 HIS B CB  1 
ATOM   1735 C  CG  . HIS A 1 238 ? 27.121  10.217  30.250  1.00 52.12  ? 235 HIS B CG  1 
ATOM   1736 N  ND1 . HIS A 1 238 ? 27.887  11.258  30.729  1.00 50.10  ? 235 HIS B ND1 1 
ATOM   1737 C  CD2 . HIS A 1 238 ? 27.941  9.140   30.199  1.00 51.65  ? 235 HIS B CD2 1 
ATOM   1738 C  CE1 . HIS A 1 238 ? 29.115  10.830  30.960  1.00 50.22  ? 235 HIS B CE1 1 
ATOM   1739 N  NE2 . HIS A 1 238 ? 29.175  9.548   30.646  1.00 47.76  ? 235 HIS B NE2 1 
ATOM   1740 N  N   . LEU A 1 239 ? 25.460  11.166  33.099  1.00 46.90  ? 236 LEU B N   1 
ATOM   1741 C  CA  . LEU A 1 239 ? 25.410  12.163  34.164  1.00 51.19  ? 236 LEU B CA  1 
ATOM   1742 C  C   . LEU A 1 239 ? 26.211  13.425  33.856  1.00 56.50  ? 236 LEU B C   1 
ATOM   1743 O  O   . LEU A 1 239 ? 26.128  14.409  34.592  1.00 57.69  ? 236 LEU B O   1 
ATOM   1744 C  CB  . LEU A 1 239 ? 25.864  11.549  35.492  1.00 51.72  ? 236 LEU B CB  1 
ATOM   1745 C  CG  . LEU A 1 239 ? 25.017  10.377  35.998  1.00 50.99  ? 236 LEU B CG  1 
ATOM   1746 C  CD1 . LEU A 1 239 ? 25.616  9.782   37.257  1.00 51.94  ? 236 LEU B CD1 1 
ATOM   1747 C  CD2 . LEU A 1 239 ? 23.576  10.805  36.240  1.00 49.21  ? 236 LEU B CD2 1 
ATOM   1748 N  N   . LEU A 1 240 ? 26.969  13.402  32.762  1.00 64.99  ? 237 LEU B N   1 
ATOM   1749 C  CA  . LEU A 1 240 ? 27.854  14.518  32.425  1.00 66.99  ? 237 LEU B CA  1 
ATOM   1750 C  C   . LEU A 1 240 ? 27.656  15.070  31.011  1.00 66.76  ? 237 LEU B C   1 
ATOM   1751 O  O   . LEU A 1 240 ? 27.631  16.284  30.817  1.00 68.18  ? 237 LEU B O   1 
ATOM   1752 C  CB  . LEU A 1 240 ? 29.315  14.127  32.658  1.00 70.30  ? 237 LEU B CB  1 
ATOM   1753 C  CG  . LEU A 1 240 ? 29.753  14.204  34.125  1.00 73.42  ? 237 LEU B CG  1 
ATOM   1754 C  CD1 . LEU A 1 240 ? 30.579  12.987  34.520  1.00 71.90  ? 237 LEU B CD1 1 
ATOM   1755 C  CD2 . LEU A 1 240 ? 30.518  15.492  34.392  1.00 78.57  ? 237 LEU B CD2 1 
ATOM   1756 N  N   . HIS A 1 241 ? 27.520  14.183  30.029  1.00 70.36  ? 238 HIS B N   1 
ATOM   1757 C  CA  . HIS A 1 241 ? 27.282  14.613  28.653  1.00 73.23  ? 238 HIS B CA  1 
ATOM   1758 C  C   . HIS A 1 241 ? 25.790  14.582  28.323  1.00 70.83  ? 238 HIS B C   1 
ATOM   1759 O  O   . HIS A 1 241 ? 25.180  13.516  28.234  1.00 72.68  ? 238 HIS B O   1 
ATOM   1760 C  CB  . HIS A 1 241 ? 28.094  13.772  27.660  1.00 78.78  ? 238 HIS B CB  1 
ATOM   1761 C  CG  . HIS A 1 241 ? 29.564  13.747  27.951  1.00 82.33  ? 238 HIS B CG  1 
ATOM   1762 N  ND1 . HIS A 1 241 ? 30.288  14.887  28.227  1.00 84.20  ? 238 HIS B ND1 1 
ATOM   1763 C  CD2 . HIS A 1 241 ? 30.445  12.720  28.004  1.00 83.10  ? 238 HIS B CD2 1 
ATOM   1764 C  CE1 . HIS A 1 241 ? 31.550  14.564  28.444  1.00 83.92  ? 238 HIS B CE1 1 
ATOM   1765 N  NE2 . HIS A 1 241 ? 31.673  13.255  28.314  1.00 83.81  ? 238 HIS B NE2 1 
ATOM   1766 N  N   . GLU A 1 242 ? 25.221  15.767  28.131  1.00 67.68  ? 239 GLU B N   1 
ATOM   1767 C  CA  . GLU A 1 242 ? 23.772  15.954  28.045  1.00 68.81  ? 239 GLU B CA  1 
ATOM   1768 C  C   . GLU A 1 242 ? 23.078  15.321  26.834  1.00 65.75  ? 239 GLU B C   1 
ATOM   1769 O  O   . GLU A 1 242 ? 21.860  15.425  26.696  1.00 65.29  ? 239 GLU B O   1 
ATOM   1770 C  CB  . GLU A 1 242 ? 23.441  17.449  28.105  1.00 74.14  ? 239 GLU B CB  1 
ATOM   1771 C  CG  . GLU A 1 242 ? 24.252  18.298  27.133  1.00 82.84  ? 239 GLU B CG  1 
ATOM   1772 C  CD  . GLU A 1 242 ? 24.133  19.786  27.405  1.00 86.59  ? 239 GLU B CD  1 
ATOM   1773 O  OE1 . GLU A 1 242 ? 25.172  20.479  27.385  1.00 90.78  ? 239 GLU B OE1 1 
ATOM   1774 O  OE2 . GLU A 1 242 ? 23.004  20.265  27.643  1.00 89.11  ? 239 GLU B OE2 1 
ATOM   1775 N  N   . SER A 1 243 ? 23.838  14.665  25.964  1.00 64.87  ? 240 SER B N   1 
ATOM   1776 C  CA  . SER A 1 243 ? 23.260  14.110  24.741  1.00 65.22  ? 240 SER B CA  1 
ATOM   1777 C  C   . SER A 1 243 ? 23.358  12.590  24.661  1.00 64.57  ? 240 SER B C   1 
ATOM   1778 O  O   . SER A 1 243 ? 22.780  11.970  23.767  1.00 60.62  ? 240 SER B O   1 
ATOM   1779 C  CB  . SER A 1 243 ? 23.904  14.746  23.507  1.00 66.88  ? 240 SER B CB  1 
ATOM   1780 O  OG  . SER A 1 243 ? 23.596  16.127  23.428  1.00 70.59  ? 240 SER B OG  1 
ATOM   1781 N  N   . LEU A 1 244 ? 24.087  11.997  25.600  1.00 63.30  ? 241 LEU B N   1 
ATOM   1782 C  CA  . LEU A 1 244 ? 24.292  10.553  25.611  1.00 63.78  ? 241 LEU B CA  1 
ATOM   1783 C  C   . LEU A 1 244 ? 23.394  9.858   26.626  1.00 60.50  ? 241 LEU B C   1 
ATOM   1784 O  O   . LEU A 1 244 ? 23.159  10.373  27.719  1.00 61.79  ? 241 LEU B O   1 
ATOM   1785 C  CB  . LEU A 1 244 ? 25.757  10.225  25.907  1.00 69.24  ? 241 LEU B CB  1 
ATOM   1786 C  CG  . LEU A 1 244 ? 26.775  10.578  24.821  1.00 71.77  ? 241 LEU B CG  1 
ATOM   1787 C  CD1 . LEU A 1 244 ? 28.178  10.673  25.403  1.00 73.10  ? 241 LEU B CD1 1 
ATOM   1788 C  CD2 . LEU A 1 244 ? 26.723  9.570   23.680  1.00 70.82  ? 241 LEU B CD2 1 
ATOM   1789 N  N   . PHE A 1 245 ? 22.895  8.684   26.254  1.00 52.99  ? 242 PHE B N   1 
ATOM   1790 C  CA  . PHE A 1 245 ? 22.127  7.860   27.176  1.00 52.20  ? 242 PHE B CA  1 
ATOM   1791 C  C   . PHE A 1 245 ? 22.227  6.381   26.821  1.00 54.74  ? 242 PHE B C   1 
ATOM   1792 O  O   . PHE A 1 245 ? 22.418  6.022   25.660  1.00 59.77  ? 242 PHE B O   1 
ATOM   1793 C  CB  . PHE A 1 245 ? 20.665  8.321   27.252  1.00 48.55  ? 242 PHE B CB  1 
ATOM   1794 C  CG  . PHE A 1 245 ? 19.836  7.964   26.048  1.00 44.53  ? 242 PHE B CG  1 
ATOM   1795 C  CD1 . PHE A 1 245 ? 19.614  8.893   25.045  1.00 43.95  ? 242 PHE B CD1 1 
ATOM   1796 C  CD2 . PHE A 1 245 ? 19.252  6.710   25.936  1.00 44.07  ? 242 PHE B CD2 1 
ATOM   1797 C  CE1 . PHE A 1 245 ? 18.840  8.573   23.942  1.00 47.47  ? 242 PHE B CE1 1 
ATOM   1798 C  CE2 . PHE A 1 245 ? 18.477  6.383   24.837  1.00 44.83  ? 242 PHE B CE2 1 
ATOM   1799 C  CZ  . PHE A 1 245 ? 18.269  7.316   23.838  1.00 46.30  ? 242 PHE B CZ  1 
ATOM   1800 N  N   . GLY A 1 246 ? 22.107  5.528   27.833  1.00 53.35  ? 243 GLY B N   1 
ATOM   1801 C  CA  . GLY A 1 246 ? 22.241  4.092   27.641  1.00 49.51  ? 243 GLY B CA  1 
ATOM   1802 C  C   . GLY A 1 246 ? 20.917  3.367   27.749  1.00 49.98  ? 243 GLY B C   1 
ATOM   1803 O  O   . GLY A 1 246 ? 20.030  3.782   28.493  1.00 53.98  ? 243 GLY B O   1 
ATOM   1804 N  N   . SER A 1 247 ? 20.784  2.280   26.998  1.00 46.14  ? 244 SER B N   1 
ATOM   1805 C  CA  . SER A 1 247 ? 19.574  1.473   27.033  1.00 47.64  ? 244 SER B CA  1 
ATOM   1806 C  C   . SER A 1 247 ? 19.928  -0.001  27.163  1.00 44.28  ? 244 SER B C   1 
ATOM   1807 O  O   . SER A 1 247 ? 21.029  -0.420  26.813  1.00 48.31  ? 244 SER B O   1 
ATOM   1808 C  CB  . SER A 1 247 ? 18.719  1.717   25.788  1.00 51.56  ? 244 SER B CB  1 
ATOM   1809 O  OG  . SER A 1 247 ? 19.422  1.369   24.609  1.00 60.14  ? 244 SER B OG  1 
ATOM   1810 N  N   . VAL A 1 248 ? 18.980  -0.783  27.662  1.00 44.84  ? 245 VAL B N   1 
ATOM   1811 C  CA  . VAL A 1 248 ? 19.237  -2.168  28.024  1.00 48.33  ? 245 VAL B CA  1 
ATOM   1812 C  C   . VAL A 1 248 ? 17.972  -3.000  27.827  1.00 51.23  ? 245 VAL B C   1 
ATOM   1813 O  O   . VAL A 1 248 ? 16.889  -2.602  28.261  1.00 52.02  ? 245 VAL B O   1 
ATOM   1814 C  CB  . VAL A 1 248 ? 19.730  -2.253  29.487  1.00 49.06  ? 245 VAL B CB  1 
ATOM   1815 C  CG1 . VAL A 1 248 ? 19.140  -3.448  30.194  1.00 55.77  ? 245 VAL B CG1 1 
ATOM   1816 C  CG2 . VAL A 1 248 ? 21.253  -2.269  29.543  1.00 52.33  ? 245 VAL B CG2 1 
ATOM   1817 N  N   . ALA A 1 249 ? 18.106  -4.148  27.168  1.00 53.24  ? 246 ALA B N   1 
ATOM   1818 C  CA  . ALA A 1 249 ? 16.935  -4.943  26.799  1.00 55.16  ? 246 ALA B CA  1 
ATOM   1819 C  C   . ALA A 1 249 ? 17.112  -6.454  26.944  1.00 55.59  ? 246 ALA B C   1 
ATOM   1820 O  O   . ALA A 1 249 ? 18.153  -6.937  27.392  1.00 50.08  ? 246 ALA B O   1 
ATOM   1821 C  CB  . ALA A 1 249 ? 16.495  -4.602  25.385  1.00 57.32  ? 246 ALA B CB  1 
ATOM   1822 N  N   . ASP A 1 250 ? 16.073  -7.186  26.547  1.00 57.16  ? 247 ASP B N   1 
ATOM   1823 C  CA  . ASP A 1 250 ? 16.041  -8.639  26.663  1.00 60.31  ? 247 ASP B CA  1 
ATOM   1824 C  C   . ASP A 1 250 ? 16.753  -9.336  25.507  1.00 64.42  ? 247 ASP B C   1 
ATOM   1825 O  O   . ASP A 1 250 ? 16.867  -10.563 25.489  1.00 65.58  ? 247 ASP B O   1 
ATOM   1826 C  CB  . ASP A 1 250 ? 14.596  -9.133  26.758  1.00 63.30  ? 247 ASP B CB  1 
ATOM   1827 C  CG  . ASP A 1 250 ? 13.948  -8.787  28.084  1.00 66.78  ? 247 ASP B CG  1 
ATOM   1828 O  OD1 . ASP A 1 250 ? 14.656  -8.285  28.981  1.00 67.30  ? 247 ASP B OD1 1 
ATOM   1829 O  OD2 . ASP A 1 250 ? 12.730  -9.022  28.230  1.00 68.48  ? 247 ASP B OD2 1 
ATOM   1830 N  N   . ASP A 1 251 ? 17.228  -8.552  24.543  1.00 65.61  ? 248 ASP B N   1 
ATOM   1831 C  CA  . ASP A 1 251 ? 18.004  -9.097  23.434  1.00 64.83  ? 248 ASP B CA  1 
ATOM   1832 C  C   . ASP A 1 251 ? 19.457  -9.314  23.848  1.00 67.93  ? 248 ASP B C   1 
ATOM   1833 O  O   . ASP A 1 251 ? 20.298  -9.683  23.028  1.00 71.95  ? 248 ASP B O   1 
ATOM   1834 C  CB  . ASP A 1 251 ? 17.922  -8.180  22.210  1.00 64.70  ? 248 ASP B CB  1 
ATOM   1835 C  CG  . ASP A 1 251 ? 18.318  -6.748  22.520  1.00 66.10  ? 248 ASP B CG  1 
ATOM   1836 O  OD1 . ASP A 1 251 ? 18.866  -6.497  23.614  1.00 66.29  ? 248 ASP B OD1 1 
ATOM   1837 O  OD2 . ASP A 1 251 ? 18.082  -5.870  21.663  1.00 66.20  ? 248 ASP B OD2 1 
ATOM   1838 N  N   . GLN A 1 252 ? 19.737  -9.079  25.129  1.00 67.57  ? 249 GLN B N   1 
ATOM   1839 C  CA  . GLN A 1 252 ? 21.071  -9.259  25.701  1.00 63.55  ? 249 GLN B CA  1 
ATOM   1840 C  C   . GLN A 1 252 ? 22.041  -8.146  25.304  1.00 58.49  ? 249 GLN B C   1 
ATOM   1841 O  O   . GLN A 1 252 ? 23.251  -8.281  25.479  1.00 57.33  ? 249 GLN B O   1 
ATOM   1842 C  CB  . GLN A 1 252 ? 21.646  -10.629 25.322  1.00 62.49  ? 249 GLN B CB  1 
ATOM   1843 C  CG  . GLN A 1 252 ? 20.727  -11.798 25.648  1.00 66.68  ? 249 GLN B CG  1 
ATOM   1844 C  CD  . GLN A 1 252 ? 21.394  -13.145 25.449  1.00 68.14  ? 249 GLN B CD  1 
ATOM   1845 O  OE1 . GLN A 1 252 ? 20.729  -14.179 25.414  1.00 73.38  ? 249 GLN B OE1 1 
ATOM   1846 N  NE2 . GLN A 1 252 ? 22.716  -13.140 25.320  1.00 69.79  ? 249 GLN B NE2 1 
ATOM   1847 N  N   . LYS A 1 253 ? 21.503  -7.043  24.789  1.00 59.53  ? 250 LYS B N   1 
ATOM   1848 C  CA  . LYS A 1 253 ? 22.331  -5.961  24.256  1.00 64.76  ? 250 LYS B CA  1 
ATOM   1849 C  C   . LYS A 1 253 ? 22.287  -4.653  25.051  1.00 65.19  ? 250 LYS B C   1 
ATOM   1850 O  O   . LYS A 1 253 ? 21.218  -4.176  25.438  1.00 62.52  ? 250 LYS B O   1 
ATOM   1851 C  CB  . LYS A 1 253 ? 21.978  -5.683  22.790  1.00 66.54  ? 250 LYS B CB  1 
ATOM   1852 C  CG  . LYS A 1 253 ? 22.792  -6.484  21.784  1.00 75.21  ? 250 LYS B CG  1 
ATOM   1853 C  CD  . LYS A 1 253 ? 22.265  -7.902  21.622  1.00 79.69  ? 250 LYS B CD  1 
ATOM   1854 C  CE  . LYS A 1 253 ? 23.231  -8.767  20.824  1.00 80.62  ? 250 LYS B CE  1 
ATOM   1855 N  NZ  . LYS A 1 253 ? 23.596  -8.143  19.521  1.00 82.24  ? 250 LYS B NZ  1 
ATOM   1856 N  N   . LEU A 1 254 ? 23.466  -4.081  25.279  1.00 63.54  ? 251 LEU B N   1 
ATOM   1857 C  CA  . LEU A 1 254 ? 23.600  -2.748  25.854  1.00 59.66  ? 251 LEU B CA  1 
ATOM   1858 C  C   . LEU A 1 254 ? 23.877  -1.743  24.743  1.00 60.54  ? 251 LEU B C   1 
ATOM   1859 O  O   . LEU A 1 254 ? 24.894  -1.831  24.056  1.00 63.91  ? 251 LEU B O   1 
ATOM   1860 C  CB  . LEU A 1 254 ? 24.740  -2.717  26.874  1.00 59.69  ? 251 LEU B CB  1 
ATOM   1861 C  CG  . LEU A 1 254 ? 25.371  -1.352  27.173  1.00 54.41  ? 251 LEU B CG  1 
ATOM   1862 C  CD1 . LEU A 1 254 ? 24.405  -0.443  27.925  1.00 51.35  ? 251 LEU B CD1 1 
ATOM   1863 C  CD2 . LEU A 1 254 ? 26.664  -1.526  27.952  1.00 57.04  ? 251 LEU B CD2 1 
HETATM 1864 N  N   . MSE A 1 255 ? 22.981  -0.795  24.570  1.00 63.24  ? 252 MSE B N   1 
HETATM 1865 C  CA  . MSE A 1 255 ? 23.129  0.195   23.510  1.00 66.19  ? 252 MSE B CA  1 
HETATM 1866 C  C   . MSE A 1 255 ? 23.308  1.599   24.070  1.00 66.93  ? 252 MSE B C   1 
HETATM 1867 O  O   . MSE A 1 255 ? 22.717  1.953   25.090  1.00 71.33  ? 252 MSE B O   1 
HETATM 1868 C  CB  . MSE A 1 255 ? 21.929  0.148   22.561  1.00 66.37  ? 252 MSE B CB  1 
HETATM 1869 C  CG  . MSE A 1 255 ? 21.692  -1.219  21.945  1.00 68.84  ? 252 MSE B CG  1 
HETATM 1870 SE SE  . MSE A 1 255 ? 20.263  -1.229  20.622  1.00 75.04  ? 252 MSE B SE  1 
HETATM 1871 C  CE  . MSE A 1 255 ? 20.295  -3.130  20.179  1.00 71.03  ? 252 MSE B CE  1 
ATOM   1872 N  N   . ILE A 1 256 ? 24.122  2.386   23.398  1.00 64.28  ? 253 ILE B N   1 
ATOM   1873 C  CA  . ILE A 1 256 ? 24.381  3.763   23.798  1.00 59.37  ? 253 ILE B CA  1 
ATOM   1874 C  C   . ILE A 1 256 ? 23.998  4.712   22.671  1.00 61.37  ? 253 ILE B C   1 
ATOM   1875 O  O   . ILE A 1 256 ? 24.484  4.584   21.548  1.00 67.30  ? 253 ILE B O   1 
ATOM   1876 C  CB  . ILE A 1 256 ? 25.858  3.965   24.180  1.00 54.34  ? 253 ILE B CB  1 
ATOM   1877 C  CG1 . ILE A 1 256 ? 26.169  3.208   25.473  1.00 53.19  ? 253 ILE B CG1 1 
ATOM   1878 C  CG2 . ILE A 1 256 ? 26.178  5.447   24.331  1.00 51.31  ? 253 ILE B CG2 1 
ATOM   1879 C  CD1 . ILE A 1 256 ? 27.619  3.249   25.873  1.00 56.79  ? 253 ILE B CD1 1 
ATOM   1880 N  N   . TRP A 1 257 ? 23.123  5.664   22.975  1.00 61.50  ? 254 TRP B N   1 
ATOM   1881 C  CA  . TRP A 1 257 ? 22.562  6.535   21.952  1.00 63.16  ? 254 TRP B CA  1 
ATOM   1882 C  C   . TRP A 1 257 ? 23.070  7.966   22.060  1.00 66.43  ? 254 TRP B C   1 
ATOM   1883 O  O   . TRP A 1 257 ? 23.614  8.371   23.086  1.00 68.99  ? 254 TRP B O   1 
ATOM   1884 C  CB  . TRP A 1 257 ? 21.034  6.526   22.029  1.00 60.21  ? 254 TRP B CB  1 
ATOM   1885 C  CG  . TRP A 1 257 ? 20.432  5.156   22.015  1.00 61.18  ? 254 TRP B CG  1 
ATOM   1886 C  CD1 . TRP A 1 257 ? 20.353  4.282   23.062  1.00 62.08  ? 254 TRP B CD1 1 
ATOM   1887 C  CD2 . TRP A 1 257 ? 19.816  4.501   20.901  1.00 62.89  ? 254 TRP B CD2 1 
ATOM   1888 N  NE1 . TRP A 1 257 ? 19.730  3.124   22.667  1.00 60.80  ? 254 TRP B NE1 1 
ATOM   1889 C  CE2 . TRP A 1 257 ? 19.391  3.232   21.345  1.00 62.11  ? 254 TRP B CE2 1 
ATOM   1890 C  CE3 . TRP A 1 257 ? 19.587  4.862   19.570  1.00 63.24  ? 254 TRP B CE3 1 
ATOM   1891 C  CZ2 . TRP A 1 257 ? 18.748  2.325   20.505  1.00 63.05  ? 254 TRP B CZ2 1 
ATOM   1892 C  CZ3 . TRP A 1 257 ? 18.948  3.962   18.739  1.00 61.92  ? 254 TRP B CZ3 1 
ATOM   1893 C  CH2 . TRP A 1 257 ? 18.536  2.709   19.209  1.00 62.34  ? 254 TRP B CH2 1 
ATOM   1894 N  N   . ASP A 1 258 ? 22.887  8.723   20.982  1.00 71.33  ? 255 ASP B N   1 
ATOM   1895 C  CA  . ASP A 1 258 ? 23.203  10.143  20.963  1.00 71.96  ? 255 ASP B CA  1 
ATOM   1896 C  C   . ASP A 1 258 ? 22.009  10.893  20.385  1.00 70.36  ? 255 ASP B C   1 
ATOM   1897 O  O   . ASP A 1 258 ? 21.496  10.534  19.326  1.00 70.07  ? 255 ASP B O   1 
ATOM   1898 C  CB  . ASP A 1 258 ? 24.461  10.403  20.133  1.00 74.37  ? 255 ASP B CB  1 
ATOM   1899 C  CG  . ASP A 1 258 ? 25.099  11.742  20.445  1.00 78.65  ? 255 ASP B CG  1 
ATOM   1900 O  OD1 . ASP A 1 258 ? 24.377  12.665  20.876  1.00 80.59  ? 255 ASP B OD1 1 
ATOM   1901 O  OD2 . ASP A 1 258 ? 26.328  11.873  20.260  1.00 80.14  ? 255 ASP B OD2 1 
ATOM   1902 N  N   . THR A 1 259 ? 21.563  11.929  21.088  1.00 72.15  ? 256 THR B N   1 
ATOM   1903 C  CA  . THR A 1 259 ? 20.334  12.631  20.725  1.00 75.18  ? 256 THR B CA  1 
ATOM   1904 C  C   . THR A 1 259 ? 20.487  13.547  19.513  1.00 79.52  ? 256 THR B C   1 
ATOM   1905 O  O   . THR A 1 259 ? 19.541  13.730  18.747  1.00 79.56  ? 256 THR B O   1 
ATOM   1906 C  CB  . THR A 1 259 ? 19.769  13.443  21.909  1.00 71.80  ? 256 THR B CB  1 
ATOM   1907 O  OG1 . THR A 1 259 ? 20.831  14.155  22.553  1.00 73.31  ? 256 THR B OG1 1 
ATOM   1908 C  CG2 . THR A 1 259 ? 19.107  12.519  22.917  1.00 72.32  ? 256 THR B CG2 1 
ATOM   1909 N  N   . ARG A 1 260 ? 21.675  14.120  19.343  1.00 83.27  ? 257 ARG B N   1 
ATOM   1910 C  CA  . ARG A 1 260 ? 21.922  15.029  18.225  1.00 86.95  ? 257 ARG B CA  1 
ATOM   1911 C  C   . ARG A 1 260 ? 22.176  14.280  16.914  1.00 88.17  ? 257 ARG B C   1 
ATOM   1912 O  O   . ARG A 1 260 ? 22.243  14.885  15.842  1.00 88.94  ? 257 ARG B O   1 
ATOM   1913 C  CB  . ARG A 1 260 ? 23.057  16.009  18.552  1.00 85.52  ? 257 ARG B CB  1 
ATOM   1914 C  CG  . ARG A 1 260 ? 24.325  15.376  19.107  1.00 80.80  ? 257 ARG B CG  1 
ATOM   1915 C  CD  . ARG A 1 260 ? 24.953  16.282  20.161  1.00 77.47  ? 257 ARG B CD  1 
ATOM   1916 N  NE  . ARG A 1 260 ? 26.413  16.224  20.166  1.00 78.05  ? 257 ARG B NE  1 
ATOM   1917 C  CZ  . ARG A 1 260 ? 27.131  15.317  20.822  1.00 79.44  ? 257 ARG B CZ  1 
ATOM   1918 N  NH1 . ARG A 1 260 ? 26.531  14.373  21.532  1.00 82.56  ? 257 ARG B NH1 1 
ATOM   1919 N  NH2 . ARG A 1 260 ? 28.455  15.354  20.765  1.00 78.57  ? 257 ARG B NH2 1 
ATOM   1920 N  N   . SER A 1 261 ? 22.303  12.960  17.011  1.00 88.41  ? 258 SER B N   1 
ATOM   1921 C  CA  . SER A 1 261 ? 22.408  12.100  15.838  1.00 88.83  ? 258 SER B CA  1 
ATOM   1922 C  C   . SER A 1 261 ? 21.023  11.841  15.251  1.00 92.49  ? 258 SER B C   1 
ATOM   1923 O  O   . SER A 1 261 ? 20.106  11.436  15.965  1.00 93.60  ? 258 SER B O   1 
ATOM   1924 C  CB  . SER A 1 261 ? 23.072  10.775  16.216  1.00 86.27  ? 258 SER B CB  1 
ATOM   1925 O  OG  . SER A 1 261 ? 22.901  9.808   15.195  1.00 87.15  ? 258 SER B OG  1 
ATOM   1926 N  N   . ASN A 1 262 ? 20.877  12.070  13.949  1.00 96.81  ? 259 ASN B N   1 
ATOM   1927 C  CA  . ASN A 1 262 ? 19.578  11.945  13.285  1.00 98.42  ? 259 ASN B CA  1 
ATOM   1928 C  C   . ASN A 1 262 ? 19.240  10.536  12.797  1.00 97.01  ? 259 ASN B C   1 
ATOM   1929 O  O   . ASN A 1 262 ? 18.916  10.337  11.624  1.00 94.83  ? 259 ASN B O   1 
ATOM   1930 C  CB  . ASN A 1 262 ? 19.464  12.946  12.131  1.00 100.81 ? 259 ASN B CB  1 
ATOM   1931 C  CG  . ASN A 1 262 ? 19.026  14.320  12.597  1.00 104.23 ? 259 ASN B CG  1 
ATOM   1932 O  OD1 . ASN A 1 262 ? 17.987  14.468  13.243  1.00 106.28 ? 259 ASN B OD1 1 
ATOM   1933 N  ND2 . ASN A 1 262 ? 19.814  15.337  12.266  1.00 104.70 ? 259 ASN B ND2 1 
ATOM   1934 N  N   . THR A 1 263 ? 19.308  9.568   13.704  1.00 95.55  ? 260 THR B N   1 
ATOM   1935 C  CA  . THR A 1 263 ? 18.895  8.199   13.407  1.00 94.04  ? 260 THR B CA  1 
ATOM   1936 C  C   . THR A 1 263 ? 18.416  7.494   14.677  1.00 91.49  ? 260 THR B C   1 
ATOM   1937 O  O   . THR A 1 263 ? 19.188  7.277   15.612  1.00 90.98  ? 260 THR B O   1 
ATOM   1938 C  CB  . THR A 1 263 ? 20.020  7.387   12.721  1.00 95.38  ? 260 THR B CB  1 
ATOM   1939 O  OG1 . THR A 1 263 ? 19.556  6.057   12.449  1.00 95.98  ? 260 THR B OG1 1 
ATOM   1940 C  CG2 . THR A 1 263 ? 21.265  7.322   13.600  1.00 96.02  ? 260 THR B CG2 1 
ATOM   1941 N  N   . THR A 1 264 ? 17.134  7.143   14.704  1.00 88.38  ? 261 THR B N   1 
ATOM   1942 C  CA  . THR A 1 264 ? 16.521  6.568   15.898  1.00 85.17  ? 261 THR B CA  1 
ATOM   1943 C  C   . THR A 1 264 ? 16.264  5.068   15.766  1.00 86.39  ? 261 THR B C   1 
ATOM   1944 O  O   . THR A 1 264 ? 15.241  4.561   16.228  1.00 89.91  ? 261 THR B O   1 
ATOM   1945 C  CB  . THR A 1 264 ? 15.200  7.282   16.251  1.00 81.34  ? 261 THR B CB  1 
ATOM   1946 O  OG1 . THR A 1 264 ? 14.257  7.104   15.187  1.00 79.48  ? 261 THR B OG1 1 
ATOM   1947 C  CG2 . THR A 1 264 ? 15.438  8.769   16.470  1.00 80.47  ? 261 THR B CG2 1 
ATOM   1948 N  N   . SER A 1 265 ? 17.198  4.361   15.138  1.00 84.01  ? 262 SER B N   1 
ATOM   1949 C  CA  . SER A 1 265 ? 17.092  2.913   14.991  1.00 82.01  ? 262 SER B CA  1 
ATOM   1950 C  C   . SER A 1 265 ? 18.472  2.261   15.001  1.00 79.76  ? 262 SER B C   1 
ATOM   1951 O  O   . SER A 1 265 ? 18.596  1.041   14.886  1.00 74.86  ? 262 SER B O   1 
ATOM   1952 C  CB  . SER A 1 265 ? 16.339  2.553   13.708  1.00 81.64  ? 262 SER B CB  1 
ATOM   1953 O  OG  . SER A 1 265 ? 16.973  3.113   12.572  1.00 83.08  ? 262 SER B OG  1 
ATOM   1954 N  N   . LYS A 1 266 ? 19.505  3.084   15.144  1.00 79.36  ? 263 LYS B N   1 
ATOM   1955 C  CA  . LYS A 1 266 ? 20.875  2.595   15.176  1.00 83.34  ? 263 LYS B CA  1 
ATOM   1956 C  C   . LYS A 1 266 ? 21.704  3.451   16.128  1.00 81.90  ? 263 LYS B C   1 
ATOM   1957 O  O   . LYS A 1 266 ? 21.937  4.631   15.864  1.00 81.55  ? 263 LYS B O   1 
ATOM   1958 C  CB  . LYS A 1 266 ? 21.479  2.613   13.770  1.00 88.65  ? 263 LYS B CB  1 
ATOM   1959 C  CG  . LYS A 1 266 ? 22.422  1.455   13.481  1.00 92.47  ? 263 LYS B CG  1 
ATOM   1960 C  CD  . LYS A 1 266 ? 22.807  1.414   12.008  1.00 94.93  ? 263 LYS B CD  1 
ATOM   1961 C  CE  . LYS A 1 266 ? 23.338  0.045   11.607  1.00 94.22  ? 263 LYS B CE  1 
ATOM   1962 N  NZ  . LYS A 1 266 ? 22.282  -1.005  11.688  1.00 94.16  ? 263 LYS B NZ  1 
ATOM   1963 N  N   . PRO A 1 267 ? 22.151  2.854   17.243  1.00 81.52  ? 264 PRO B N   1 
ATOM   1964 C  CA  . PRO A 1 267 ? 22.868  3.566   18.297  1.00 82.34  ? 264 PRO B CA  1 
ATOM   1965 C  C   . PRO A 1 267 ? 24.337  3.787   17.953  1.00 82.62  ? 264 PRO B C   1 
ATOM   1966 O  O   . PRO A 1 267 ? 24.877  3.108   17.080  1.00 83.57  ? 264 PRO B O   1 
ATOM   1967 C  CB  . PRO A 1 267 ? 22.747  2.618   19.490  1.00 81.87  ? 264 PRO B CB  1 
ATOM   1968 C  CG  . PRO A 1 267 ? 22.695  1.265   18.874  1.00 80.97  ? 264 PRO B CG  1 
ATOM   1969 C  CD  . PRO A 1 267 ? 21.988  1.422   17.554  1.00 80.30  ? 264 PRO B CD  1 
ATOM   1970 N  N   . SER A 1 268 ? 24.972  4.734   18.639  1.00 81.98  ? 265 SER B N   1 
ATOM   1971 C  CA  . SER A 1 268 ? 26.389  5.014   18.430  1.00 81.23  ? 265 SER B CA  1 
ATOM   1972 C  C   . SER A 1 268 ? 27.237  3.779   18.705  1.00 80.35  ? 265 SER B C   1 
ATOM   1973 O  O   . SER A 1 268 ? 28.202  3.511   17.993  1.00 84.32  ? 265 SER B O   1 
ATOM   1974 C  CB  . SER A 1 268 ? 26.849  6.178   19.310  1.00 81.49  ? 265 SER B CB  1 
ATOM   1975 O  OG  . SER A 1 268 ? 26.256  7.395   18.894  1.00 81.99  ? 265 SER B OG  1 
ATOM   1976 N  N   . HIS A 1 269 ? 26.874  3.031   19.743  1.00 80.38  ? 266 HIS B N   1 
ATOM   1977 C  CA  . HIS A 1 269 ? 27.560  1.783   20.060  1.00 82.08  ? 266 HIS B CA  1 
ATOM   1978 C  C   . HIS A 1 269 ? 26.560  0.671   20.370  1.00 81.16  ? 266 HIS B C   1 
ATOM   1979 O  O   . HIS A 1 269 ? 25.450  0.932   20.831  1.00 82.22  ? 266 HIS B O   1 
ATOM   1980 C  CB  . HIS A 1 269 ? 28.527  1.966   21.235  1.00 85.25  ? 266 HIS B CB  1 
ATOM   1981 C  CG  . HIS A 1 269 ? 29.450  3.137   21.088  1.00 88.46  ? 266 HIS B CG  1 
ATOM   1982 N  ND1 . HIS A 1 269 ? 30.023  3.490   19.884  1.00 89.70  ? 266 HIS B ND1 1 
ATOM   1983 C  CD2 . HIS A 1 269 ? 29.915  4.025   22.000  1.00 89.56  ? 266 HIS B CD2 1 
ATOM   1984 C  CE1 . HIS A 1 269 ? 30.788  4.553   20.057  1.00 90.75  ? 266 HIS B CE1 1 
ATOM   1985 N  NE2 . HIS A 1 269 ? 30.743  4.895   21.333  1.00 91.65  ? 266 HIS B NE2 1 
ATOM   1986 N  N   . LEU A 1 270 ? 26.966  -0.568  20.108  1.00 80.46  ? 267 LEU B N   1 
ATOM   1987 C  CA  . LEU A 1 270 ? 26.136  -1.737  20.378  1.00 77.92  ? 267 LEU B CA  1 
ATOM   1988 C  C   . LEU A 1 270 ? 26.996  -2.827  21.006  1.00 77.73  ? 267 LEU B C   1 
ATOM   1989 O  O   . LEU A 1 270 ? 28.017  -3.220  20.443  1.00 81.40  ? 267 LEU B O   1 
ATOM   1990 C  CB  . LEU A 1 270 ? 25.488  -2.239  19.084  1.00 78.99  ? 267 LEU B CB  1 
ATOM   1991 C  CG  . LEU A 1 270 ? 24.541  -3.441  19.144  1.00 81.51  ? 267 LEU B CG  1 
ATOM   1992 C  CD1 . LEU A 1 270 ? 23.514  -3.364  18.021  1.00 80.65  ? 267 LEU B CD1 1 
ATOM   1993 C  CD2 . LEU A 1 270 ? 25.302  -4.763  19.092  1.00 81.07  ? 267 LEU B CD2 1 
ATOM   1994 N  N   . VAL A 1 271 ? 26.586  -3.313  22.174  1.00 75.08  ? 268 VAL B N   1 
ATOM   1995 C  CA  . VAL A 1 271 ? 27.392  -4.277  22.916  1.00 72.30  ? 268 VAL B CA  1 
ATOM   1996 C  C   . VAL A 1 271 ? 26.614  -5.537  23.269  1.00 72.46  ? 268 VAL B C   1 
ATOM   1997 O  O   . VAL A 1 271 ? 25.473  -5.466  23.724  1.00 73.32  ? 268 VAL B O   1 
ATOM   1998 C  CB  . VAL A 1 271 ? 27.934  -3.668  24.224  1.00 72.36  ? 268 VAL B CB  1 
ATOM   1999 C  CG1 . VAL A 1 271 ? 29.130  -4.465  24.722  1.00 72.99  ? 268 VAL B CG1 1 
ATOM   2000 C  CG2 . VAL A 1 271 ? 28.310  -2.213  24.020  1.00 71.66  ? 268 VAL B CG2 1 
ATOM   2001 N  N   . ASP A 1 272 ? 27.239  -6.691  23.060  1.00 74.91  ? 269 ASP B N   1 
ATOM   2002 C  CA  . ASP A 1 272 ? 26.666  -7.956  23.499  1.00 76.96  ? 269 ASP B CA  1 
ATOM   2003 C  C   . ASP A 1 272 ? 27.070  -8.162  24.954  1.00 74.61  ? 269 ASP B C   1 
ATOM   2004 O  O   . ASP A 1 272 ? 28.051  -8.847  25.250  1.00 72.21  ? 269 ASP B O   1 
ATOM   2005 C  CB  . ASP A 1 272 ? 27.165  -9.105  22.623  1.00 82.03  ? 269 ASP B CB  1 
ATOM   2006 C  CG  . ASP A 1 272 ? 26.167  -10.242 22.531  1.00 89.84  ? 269 ASP B CG  1 
ATOM   2007 O  OD1 . ASP A 1 272 ? 25.124  -10.179 23.217  1.00 91.16  ? 269 ASP B OD1 1 
ATOM   2008 O  OD2 . ASP A 1 272 ? 26.423  -11.197 21.768  1.00 94.66  ? 269 ASP B OD2 1 
ATOM   2009 N  N   . ALA A 1 273 ? 26.298  -7.561  25.855  1.00 70.99  ? 270 ALA B N   1 
ATOM   2010 C  CA  . ALA A 1 273 ? 26.696  -7.405  27.254  1.00 64.87  ? 270 ALA B CA  1 
ATOM   2011 C  C   . ALA A 1 273 ? 26.647  -8.674  28.098  1.00 61.57  ? 270 ALA B C   1 
ATOM   2012 O  O   . ALA A 1 273 ? 27.547  -8.923  28.900  1.00 60.30  ? 270 ALA B O   1 
ATOM   2013 C  CB  . ALA A 1 273 ? 25.874  -6.302  27.911  1.00 65.63  ? 270 ALA B CB  1 
ATOM   2014 N  N   . HIS A 1 274 ? 25.600  -9.473  27.929  1.00 57.16  ? 271 HIS B N   1 
ATOM   2015 C  CA  . HIS A 1 274 ? 25.424  -10.653 28.769  1.00 56.50  ? 271 HIS B CA  1 
ATOM   2016 C  C   . HIS A 1 274 ? 24.897  -11.863 28.009  1.00 56.19  ? 271 HIS B C   1 
ATOM   2017 O  O   . HIS A 1 274 ? 24.392  -11.741 26.894  1.00 54.61  ? 271 HIS B O   1 
ATOM   2018 C  CB  . HIS A 1 274 ? 24.494  -10.335 29.939  1.00 56.32  ? 271 HIS B CB  1 
ATOM   2019 C  CG  . HIS A 1 274 ? 25.117  -9.471  30.991  1.00 57.11  ? 271 HIS B CG  1 
ATOM   2020 N  ND1 . HIS A 1 274 ? 24.817  -8.133  31.130  1.00 54.92  ? 271 HIS B ND1 1 
ATOM   2021 C  CD2 . HIS A 1 274 ? 26.021  -9.756  31.958  1.00 55.72  ? 271 HIS B CD2 1 
ATOM   2022 C  CE1 . HIS A 1 274 ? 25.509  -7.631  32.137  1.00 52.40  ? 271 HIS B CE1 1 
ATOM   2023 N  NE2 . HIS A 1 274 ? 26.247  -8.595  32.657  1.00 52.76  ? 271 HIS B NE2 1 
ATOM   2024 N  N   . THR A 1 275 ? 25.017  -13.031 28.631  1.00 58.25  ? 272 THR B N   1 
ATOM   2025 C  CA  . THR A 1 275 ? 24.530  -14.274 28.047  1.00 60.64  ? 272 THR B CA  1 
ATOM   2026 C  C   . THR A 1 275 ? 23.021  -14.406 28.234  1.00 63.83  ? 272 THR B C   1 
ATOM   2027 O  O   . THR A 1 275 ? 22.387  -15.288 27.652  1.00 62.79  ? 272 THR B O   1 
ATOM   2028 C  CB  . THR A 1 275 ? 25.231  -15.498 28.667  1.00 59.59  ? 272 THR B CB  1 
ATOM   2029 O  OG1 . THR A 1 275 ? 24.894  -15.593 30.056  1.00 58.97  ? 272 THR B OG1 1 
ATOM   2030 C  CG2 . THR A 1 275 ? 26.742  -15.375 28.522  1.00 59.52  ? 272 THR B CG2 1 
ATOM   2031 N  N   . ALA A 1 276 ? 22.454  -13.521 29.049  1.00 67.32  ? 273 ALA B N   1 
ATOM   2032 C  CA  . ALA A 1 276 ? 21.016  -13.500 29.297  1.00 65.90  ? 273 ALA B CA  1 
ATOM   2033 C  C   . ALA A 1 276 ? 20.477  -12.073 29.198  1.00 62.56  ? 273 ALA B C   1 
ATOM   2034 O  O   . ALA A 1 276 ? 21.220  -11.145 28.879  1.00 56.08  ? 273 ALA B O   1 
ATOM   2035 C  CB  . ALA A 1 276 ? 20.705  -14.100 30.661  1.00 65.58  ? 273 ALA B CB  1 
ATOM   2036 N  N   . GLU A 1 277 ? 19.186  -11.902 29.475  1.00 59.68  ? 274 GLU B N   1 
ATOM   2037 C  CA  . GLU A 1 277 ? 18.552  -10.589 29.371  1.00 58.53  ? 274 GLU B CA  1 
ATOM   2038 C  C   . GLU A 1 277 ? 19.158  -9.572  30.337  1.00 56.00  ? 274 GLU B C   1 
ATOM   2039 O  O   . GLU A 1 277 ? 19.501  -9.901  31.474  1.00 54.26  ? 274 GLU B O   1 
ATOM   2040 C  CB  . GLU A 1 277 ? 17.034  -10.684 29.567  1.00 59.27  ? 274 GLU B CB  1 
ATOM   2041 C  CG  . GLU A 1 277 ? 16.585  -11.696 30.609  1.00 65.74  ? 274 GLU B CG  1 
ATOM   2042 C  CD  . GLU A 1 277 ? 16.333  -13.074 30.021  1.00 65.77  ? 274 GLU B CD  1 
ATOM   2043 O  OE1 . GLU A 1 277 ? 15.503  -13.188 29.094  1.00 66.00  ? 274 GLU B OE1 1 
ATOM   2044 O  OE2 . GLU A 1 277 ? 16.959  -14.046 30.496  1.00 62.55  ? 274 GLU B OE2 1 
ATOM   2045 N  N   . VAL A 1 278 ? 19.293  -8.337  29.866  1.00 50.14  ? 275 VAL B N   1 
ATOM   2046 C  CA  . VAL A 1 278 ? 19.872  -7.267  30.664  1.00 52.01  ? 275 VAL B CA  1 
ATOM   2047 C  C   . VAL A 1 278 ? 18.760  -6.424  31.282  1.00 53.16  ? 275 VAL B C   1 
ATOM   2048 O  O   . VAL A 1 278 ? 17.863  -5.958  30.580  1.00 54.36  ? 275 VAL B O   1 
ATOM   2049 C  CB  . VAL A 1 278 ? 20.790  -6.376  29.813  1.00 50.96  ? 275 VAL B CB  1 
ATOM   2050 C  CG1 . VAL A 1 278 ? 21.735  -5.596  30.704  1.00 48.38  ? 275 VAL B CG1 1 
ATOM   2051 C  CG2 . VAL A 1 278 ? 21.574  -7.221  28.825  1.00 49.76  ? 275 VAL B CG2 1 
ATOM   2052 N  N   . ASN A 1 279 ? 18.827  -6.221  32.594  1.00 48.55  ? 276 ASN B N   1 
ATOM   2053 C  CA  . ASN A 1 279 ? 17.709  -5.633  33.325  1.00 44.74  ? 276 ASN B CA  1 
ATOM   2054 C  C   . ASN A 1 279 ? 17.899  -4.185  33.773  1.00 45.89  ? 276 ASN B C   1 
ATOM   2055 O  O   . ASN A 1 279 ? 16.926  -3.445  33.913  1.00 47.73  ? 276 ASN B O   1 
ATOM   2056 C  CB  . ASN A 1 279 ? 17.351  -6.512  34.524  1.00 43.94  ? 276 ASN B CB  1 
ATOM   2057 C  CG  . ASN A 1 279 ? 16.819  -7.869  34.110  1.00 41.47  ? 276 ASN B CG  1 
ATOM   2058 O  OD1 . ASN A 1 279 ? 16.132  -7.993  33.097  1.00 43.73  ? 276 ASN B OD1 1 
ATOM   2059 N  ND2 . ASN A 1 279 ? 17.133  -8.894  34.892  1.00 37.81  ? 276 ASN B ND2 1 
ATOM   2060 N  N   . CYS A 1 280 ? 19.145  -3.783  33.998  1.00 49.04  ? 277 CYS B N   1 
ATOM   2061 C  CA  . CYS A 1 280 ? 19.423  -2.450  34.520  1.00 45.69  ? 277 CYS B CA  1 
ATOM   2062 C  C   . CYS A 1 280 ? 20.811  -1.951  34.137  1.00 45.98  ? 277 CYS B C   1 
ATOM   2063 O  O   . CYS A 1 280 ? 21.692  -2.739  33.791  1.00 47.20  ? 277 CYS B O   1 
ATOM   2064 C  CB  . CYS A 1 280 ? 19.280  -2.441  36.041  1.00 45.26  ? 277 CYS B CB  1 
ATOM   2065 S  SG  . CYS A 1 280 ? 20.270  -3.705  36.873  1.00 50.13  ? 277 CYS B SG  1 
ATOM   2066 N  N   . LEU A 1 281 ? 20.990  -0.635  34.205  1.00 44.14  ? 278 LEU B N   1 
ATOM   2067 C  CA  . LEU A 1 281 ? 22.281  -0.003  33.963  1.00 43.77  ? 278 LEU B CA  1 
ATOM   2068 C  C   . LEU A 1 281 ? 22.414  1.238   34.834  1.00 42.49  ? 278 LEU B C   1 
ATOM   2069 O  O   . LEU A 1 281 ? 21.416  1.870   35.177  1.00 50.40  ? 278 LEU B O   1 
ATOM   2070 C  CB  . LEU A 1 281 ? 22.444  0.368   32.485  1.00 46.54  ? 278 LEU B CB  1 
ATOM   2071 C  CG  . LEU A 1 281 ? 21.777  1.648   31.969  1.00 40.84  ? 278 LEU B CG  1 
ATOM   2072 C  CD1 . LEU A 1 281 ? 22.409  2.077   30.660  1.00 38.45  ? 278 LEU B CD1 1 
ATOM   2073 C  CD2 . LEU A 1 281 ? 20.274  1.477   31.812  1.00 41.49  ? 278 LEU B CD2 1 
ATOM   2074 N  N   . SER A 1 282 ? 23.645  1.585   35.192  1.00 43.88  ? 279 SER B N   1 
ATOM   2075 C  CA  . SER A 1 282 ? 23.892  2.746   36.040  1.00 42.30  ? 279 SER B CA  1 
ATOM   2076 C  C   . SER A 1 282 ? 25.229  3.401   35.716  1.00 42.56  ? 279 SER B C   1 
ATOM   2077 O  O   . SER A 1 282 ? 26.274  2.751   35.767  1.00 40.85  ? 279 SER B O   1 
ATOM   2078 C  CB  . SER A 1 282 ? 23.854  2.343   37.515  1.00 40.13  ? 279 SER B CB  1 
ATOM   2079 O  OG  . SER A 1 282 ? 23.988  3.472   38.362  1.00 41.12  ? 279 SER B OG  1 
ATOM   2080 N  N   . PHE A 1 283 ? 25.189  4.689   35.387  1.00 39.24  ? 280 PHE B N   1 
ATOM   2081 C  CA  . PHE A 1 283 ? 26.405  5.452   35.110  1.00 44.22  ? 280 PHE B CA  1 
ATOM   2082 C  C   . PHE A 1 283 ? 27.061  5.928   36.402  1.00 47.00  ? 280 PHE B C   1 
ATOM   2083 O  O   . PHE A 1 283 ? 26.374  6.322   37.345  1.00 55.71  ? 280 PHE B O   1 
ATOM   2084 C  CB  . PHE A 1 283 ? 26.097  6.655   34.214  1.00 38.24  ? 280 PHE B CB  1 
ATOM   2085 C  CG  . PHE A 1 283 ? 25.758  6.289   32.798  1.00 42.52  ? 280 PHE B CG  1 
ATOM   2086 C  CD1 . PHE A 1 283 ? 24.441  6.070   32.418  1.00 41.36  ? 280 PHE B CD1 1 
ATOM   2087 C  CD2 . PHE A 1 283 ? 26.757  6.166   31.842  1.00 42.82  ? 280 PHE B CD2 1 
ATOM   2088 C  CE1 . PHE A 1 283 ? 24.125  5.732   31.111  1.00 39.96  ? 280 PHE B CE1 1 
ATOM   2089 C  CE2 . PHE A 1 283 ? 26.448  5.831   30.534  1.00 43.70  ? 280 PHE B CE2 1 
ATOM   2090 C  CZ  . PHE A 1 283 ? 25.128  5.613   30.169  1.00 40.85  ? 280 PHE B CZ  1 
ATOM   2091 N  N   . ASN A 1 284 ? 28.389  5.889   36.442  1.00 46.33  ? 281 ASN B N   1 
ATOM   2092 C  CA  . ASN A 1 284 ? 29.132  6.351   37.613  1.00 48.34  ? 281 ASN B CA  1 
ATOM   2093 C  C   . ASN A 1 284 ? 29.124  7.873   37.709  1.00 45.88  ? 281 ASN B C   1 
ATOM   2094 O  O   . ASN A 1 284 ? 29.500  8.557   36.760  1.00 49.69  ? 281 ASN B O   1 
ATOM   2095 C  CB  . ASN A 1 284 ? 30.568  5.822   37.585  1.00 44.49  ? 281 ASN B CB  1 
ATOM   2096 C  CG  . ASN A 1 284 ? 31.340  6.146   38.855  1.00 45.34  ? 281 ASN B CG  1 
ATOM   2097 O  OD1 . ASN A 1 284 ? 31.467  7.308   39.243  1.00 42.89  ? 281 ASN B OD1 1 
ATOM   2098 N  ND2 . ASN A 1 284 ? 31.870  5.115   39.502  1.00 41.70  ? 281 ASN B ND2 1 
ATOM   2099 N  N   . PRO A 1 285 ? 28.691  8.404   38.862  1.00 45.79  ? 282 PRO B N   1 
ATOM   2100 C  CA  . PRO A 1 285 ? 28.541  9.844   39.087  1.00 45.65  ? 282 PRO B CA  1 
ATOM   2101 C  C   . PRO A 1 285 ? 29.851  10.631  39.074  1.00 45.29  ? 282 PRO B C   1 
ATOM   2102 O  O   . PRO A 1 285 ? 29.827  11.858  38.989  1.00 42.88  ? 282 PRO B O   1 
ATOM   2103 C  CB  . PRO A 1 285 ? 27.894  9.918   40.475  1.00 41.11  ? 282 PRO B CB  1 
ATOM   2104 C  CG  . PRO A 1 285 ? 28.254  8.639   41.135  1.00 42.03  ? 282 PRO B CG  1 
ATOM   2105 C  CD  . PRO A 1 285 ? 28.301  7.616   40.044  1.00 43.00  ? 282 PRO B CD  1 
ATOM   2106 N  N   . TYR A 1 286 ? 30.981  9.937   39.152  1.00 49.54  ? 283 TYR B N   1 
ATOM   2107 C  CA  . TYR A 1 286 ? 32.277  10.609  39.211  1.00 54.47  ? 283 TYR B CA  1 
ATOM   2108 C  C   . TYR A 1 286 ? 33.109  10.410  37.946  1.00 59.17  ? 283 TYR B C   1 
ATOM   2109 O  O   . TYR A 1 286 ? 33.706  11.356  37.433  1.00 63.71  ? 283 TYR B O   1 
ATOM   2110 C  CB  . TYR A 1 286 ? 33.051  10.163  40.452  1.00 52.81  ? 283 TYR B CB  1 
ATOM   2111 C  CG  . TYR A 1 286 ? 32.384  10.582  41.741  1.00 53.27  ? 283 TYR B CG  1 
ATOM   2112 C  CD1 . TYR A 1 286 ? 31.468  9.751   42.376  1.00 51.73  ? 283 TYR B CD1 1 
ATOM   2113 C  CD2 . TYR A 1 286 ? 32.657  11.817  42.315  1.00 54.51  ? 283 TYR B CD2 1 
ATOM   2114 C  CE1 . TYR A 1 286 ? 30.850  10.135  43.553  1.00 51.87  ? 283 TYR B CE1 1 
ATOM   2115 C  CE2 . TYR A 1 286 ? 32.045  12.210  43.492  1.00 57.29  ? 283 TYR B CE2 1 
ATOM   2116 C  CZ  . TYR A 1 286 ? 31.143  11.366  44.106  1.00 54.77  ? 283 TYR B CZ  1 
ATOM   2117 O  OH  . TYR A 1 286 ? 30.535  11.758  45.276  1.00 53.33  ? 283 TYR B OH  1 
ATOM   2118 N  N   . SER A 1 287 ? 33.145  9.181   37.445  1.00 61.70  ? 284 SER B N   1 
ATOM   2119 C  CA  . SER A 1 287 ? 33.835  8.896   36.195  1.00 61.45  ? 284 SER B CA  1 
ATOM   2120 C  C   . SER A 1 287 ? 32.890  9.096   35.015  1.00 63.65  ? 284 SER B C   1 
ATOM   2121 O  O   . SER A 1 287 ? 31.785  8.554   34.994  1.00 65.73  ? 284 SER B O   1 
ATOM   2122 C  CB  . SER A 1 287 ? 34.384  7.469   36.196  1.00 58.71  ? 284 SER B CB  1 
ATOM   2123 O  OG  . SER A 1 287 ? 35.135  7.210   35.022  1.00 58.51  ? 284 SER B OG  1 
ATOM   2124 N  N   . GLU A 1 288 ? 33.329  9.878   34.034  1.00 64.08  ? 285 GLU B N   1 
ATOM   2125 C  CA  . GLU A 1 288 ? 32.515  10.153  32.856  1.00 61.57  ? 285 GLU B CA  1 
ATOM   2126 C  C   . GLU A 1 288 ? 32.563  9.003   31.858  1.00 58.28  ? 285 GLU B C   1 
ATOM   2127 O  O   . GLU A 1 288 ? 31.936  9.065   30.801  1.00 58.29  ? 285 GLU B O   1 
ATOM   2128 C  CB  . GLU A 1 288 ? 32.973  11.449  32.183  1.00 63.96  ? 285 GLU B CB  1 
ATOM   2129 C  CG  . GLU A 1 288 ? 34.426  11.439  31.734  1.00 68.90  ? 285 GLU B CG  1 
ATOM   2130 C  CD  . GLU A 1 288 ? 34.862  12.759  31.122  1.00 70.97  ? 285 GLU B CD  1 
ATOM   2131 O  OE1 . GLU A 1 288 ? 35.904  12.782  30.436  1.00 76.74  ? 285 GLU B OE1 1 
ATOM   2132 O  OE2 . GLU A 1 288 ? 34.164  13.775  31.326  1.00 76.82  ? 285 GLU B OE2 1 
ATOM   2133 N  N   . PHE A 1 289 ? 33.299  7.949   32.199  1.00 55.12  ? 286 PHE B N   1 
ATOM   2134 C  CA  . PHE A 1 289 ? 33.511  6.844   31.271  1.00 54.91  ? 286 PHE B CA  1 
ATOM   2135 C  C   . PHE A 1 289 ? 32.879  5.524   31.712  1.00 56.02  ? 286 PHE B C   1 
ATOM   2136 O  O   . PHE A 1 289 ? 32.297  4.813   30.891  1.00 55.27  ? 286 PHE B O   1 
ATOM   2137 C  CB  . PHE A 1 289 ? 35.007  6.643   31.005  1.00 53.25  ? 286 PHE B CB  1 
ATOM   2138 C  CG  . PHE A 1 289 ? 35.685  7.844   30.409  1.00 52.99  ? 286 PHE B CG  1 
ATOM   2139 C  CD1 . PHE A 1 289 ? 36.670  8.521   31.113  1.00 50.55  ? 286 PHE B CD1 1 
ATOM   2140 C  CD2 . PHE A 1 289 ? 35.336  8.299   29.145  1.00 54.11  ? 286 PHE B CD2 1 
ATOM   2141 C  CE1 . PHE A 1 289 ? 37.298  9.629   30.565  1.00 49.07  ? 286 PHE B CE1 1 
ATOM   2142 C  CE2 . PHE A 1 289 ? 35.957  9.406   28.594  1.00 49.36  ? 286 PHE B CE2 1 
ATOM   2143 C  CZ  . PHE A 1 289 ? 36.939  10.072  29.304  1.00 50.39  ? 286 PHE B CZ  1 
ATOM   2144 N  N   . ILE A 1 290 ? 32.990  5.186   32.994  1.00 52.19  ? 287 ILE B N   1 
ATOM   2145 C  CA  . ILE A 1 290 ? 32.564  3.857   33.439  1.00 55.58  ? 287 ILE B CA  1 
ATOM   2146 C  C   . ILE A 1 290 ? 31.056  3.700   33.662  1.00 53.60  ? 287 ILE B C   1 
ATOM   2147 O  O   . ILE A 1 290 ? 30.347  4.663   33.949  1.00 51.99  ? 287 ILE B O   1 
ATOM   2148 C  CB  . ILE A 1 290 ? 33.365  3.338   34.661  1.00 58.43  ? 287 ILE B CB  1 
ATOM   2149 C  CG1 . ILE A 1 290 ? 32.983  4.093   35.930  1.00 59.11  ? 287 ILE B CG1 1 
ATOM   2150 C  CG2 . ILE A 1 290 ? 34.869  3.410   34.392  1.00 54.46  ? 287 ILE B CG2 1 
ATOM   2151 C  CD1 . ILE A 1 290 ? 33.542  3.463   37.184  1.00 65.93  ? 287 ILE B CD1 1 
ATOM   2152 N  N   . LEU A 1 291 ? 30.591  2.461   33.526  1.00 56.91  ? 288 LEU B N   1 
ATOM   2153 C  CA  . LEU A 1 291 ? 29.173  2.137   33.489  1.00 52.86  ? 288 LEU B CA  1 
ATOM   2154 C  C   . LEU A 1 291 ? 29.006  0.736   34.060  1.00 52.36  ? 288 LEU B C   1 
ATOM   2155 O  O   . LEU A 1 291 ? 29.869  -0.117  33.861  1.00 56.14  ? 288 LEU B O   1 
ATOM   2156 C  CB  . LEU A 1 291 ? 28.698  2.142   32.035  1.00 54.19  ? 288 LEU B CB  1 
ATOM   2157 C  CG  . LEU A 1 291 ? 27.251  2.464   31.655  1.00 59.85  ? 288 LEU B CG  1 
ATOM   2158 C  CD1 . LEU A 1 291 ? 27.042  2.175   30.176  1.00 61.52  ? 288 LEU B CD1 1 
ATOM   2159 C  CD2 . LEU A 1 291 ? 26.246  1.691   32.486  1.00 63.03  ? 288 LEU B CD2 1 
ATOM   2160 N  N   . ALA A 1 292 ? 27.906  0.491   34.766  1.00 46.81  ? 289 ALA B N   1 
ATOM   2161 C  CA  . ALA A 1 292 ? 27.629  -0.848  35.282  1.00 41.01  ? 289 ALA B CA  1 
ATOM   2162 C  C   . ALA A 1 292 ? 26.333  -1.409  34.710  1.00 35.70  ? 289 ALA B C   1 
ATOM   2163 O  O   . ALA A 1 292 ? 25.437  -0.661  34.328  1.00 36.65  ? 289 ALA B O   1 
ATOM   2164 C  CB  . ALA A 1 292 ? 27.592  -0.844  36.803  1.00 39.95  ? 289 ALA B CB  1 
ATOM   2165 N  N   . THR A 1 293 ? 26.235  -2.731  34.663  1.00 39.12  ? 290 THR B N   1 
ATOM   2166 C  CA  . THR A 1 293 ? 25.090  -3.383  34.041  1.00 43.73  ? 290 THR B CA  1 
ATOM   2167 C  C   . THR A 1 293 ? 24.695  -4.659  34.781  1.00 44.51  ? 290 THR B C   1 
ATOM   2168 O  O   . THR A 1 293 ? 25.549  -5.475  35.120  1.00 54.31  ? 290 THR B O   1 
ATOM   2169 C  CB  . THR A 1 293 ? 25.382  -3.699  32.562  1.00 46.08  ? 290 THR B CB  1 
ATOM   2170 O  OG1 . THR A 1 293 ? 25.234  -2.506  31.778  1.00 48.16  ? 290 THR B OG1 1 
ATOM   2171 C  CG2 . THR A 1 293 ? 24.436  -4.751  32.041  1.00 51.25  ? 290 THR B CG2 1 
ATOM   2172 N  N   . GLY A 1 294 ? 23.399  -4.822  35.035  1.00 42.06  ? 291 GLY B N   1 
ATOM   2173 C  CA  . GLY A 1 294 ? 22.892  -6.003  35.732  1.00 40.44  ? 291 GLY B CA  1 
ATOM   2174 C  C   . GLY A 1 294 ? 22.086  -6.902  34.815  1.00 42.12  ? 291 GLY B C   1 
ATOM   2175 O  O   . GLY A 1 294 ? 21.303  -6.422  33.995  1.00 44.27  ? 291 GLY B O   1 
ATOM   2176 N  N   . SER A 1 295 ? 22.269  -8.211  34.955  1.00 46.55  ? 292 SER B N   1 
ATOM   2177 C  CA  . SER A 1 295 ? 21.652  -9.159  34.031  1.00 50.65  ? 292 SER B CA  1 
ATOM   2178 C  C   . SER A 1 295 ? 20.963  -10.334 34.708  1.00 48.73  ? 292 SER B C   1 
ATOM   2179 O  O   . SER A 1 295 ? 21.049  -10.511 35.923  1.00 49.19  ? 292 SER B O   1 
ATOM   2180 C  CB  . SER A 1 295 ? 22.692  -9.691  33.047  1.00 51.99  ? 292 SER B CB  1 
ATOM   2181 O  OG  . SER A 1 295 ? 22.120  -10.647 32.169  1.00 55.16  ? 292 SER B OG  1 
ATOM   2182 N  N   . ALA A 1 296 ? 20.286  -11.140 33.895  1.00 46.96  ? 293 ALA B N   1 
ATOM   2183 C  CA  . ALA A 1 296 ? 19.627  -12.349 34.367  1.00 44.75  ? 293 ALA B CA  1 
ATOM   2184 C  C   . ALA A 1 296 ? 20.621  -13.494 34.521  1.00 45.56  ? 293 ALA B C   1 
ATOM   2185 O  O   . ALA A 1 296 ? 20.274  -14.560 35.029  1.00 50.62  ? 293 ALA B O   1 
ATOM   2186 C  CB  . ALA A 1 296 ? 18.507  -12.744 33.422  1.00 39.19  ? 293 ALA B CB  1 
ATOM   2187 N  N   . ASP A 1 297 ? 21.857  -13.275 34.081  1.00 46.65  ? 294 ASP B N   1 
ATOM   2188 C  CA  . ASP A 1 297 ? 22.898  -14.287 34.228  1.00 50.63  ? 294 ASP B CA  1 
ATOM   2189 C  C   . ASP A 1 297 ? 23.586  -14.193 35.588  1.00 49.53  ? 294 ASP B C   1 
ATOM   2190 O  O   . ASP A 1 297 ? 24.653  -14.771 35.793  1.00 50.80  ? 294 ASP B O   1 
ATOM   2191 C  CB  . ASP A 1 297 ? 23.917  -14.216 33.083  1.00 55.49  ? 294 ASP B CB  1 
ATOM   2192 C  CG  . ASP A 1 297 ? 24.633  -12.879 33.007  1.00 59.18  ? 294 ASP B CG  1 
ATOM   2193 O  OD1 . ASP A 1 297 ? 24.586  -12.107 33.988  1.00 62.57  ? 294 ASP B OD1 1 
ATOM   2194 O  OD2 . ASP A 1 297 ? 25.254  -12.605 31.958  1.00 57.25  ? 294 ASP B OD2 1 
ATOM   2195 N  N   . LYS A 1 298 ? 22.963  -13.456 36.506  1.00 46.61  ? 295 LYS B N   1 
ATOM   2196 C  CA  . LYS A 1 298 ? 23.414  -13.371 37.895  1.00 48.43  ? 295 LYS B CA  1 
ATOM   2197 C  C   . LYS A 1 298 ? 24.738  -12.628 38.064  1.00 49.22  ? 295 LYS B C   1 
ATOM   2198 O  O   . LYS A 1 298 ? 25.457  -12.849 39.042  1.00 51.83  ? 295 LYS B O   1 
ATOM   2199 C  CB  . LYS A 1 298 ? 23.524  -14.772 38.513  1.00 49.68  ? 295 LYS B CB  1 
ATOM   2200 C  CG  . LYS A 1 298 ? 22.252  -15.601 38.424  1.00 51.81  ? 295 LYS B CG  1 
ATOM   2201 C  CD  . LYS A 1 298 ? 22.412  -16.938 39.128  1.00 53.13  ? 295 LYS B CD  1 
ATOM   2202 C  CE  . LYS A 1 298 ? 23.015  -17.985 38.214  1.00 59.85  ? 295 LYS B CE  1 
ATOM   2203 N  NZ  . LYS A 1 298 ? 22.036  -18.433 37.188  1.00 65.60  ? 295 LYS B NZ  1 
ATOM   2204 N  N   . THR A 1 299 ? 25.056  -11.745 37.120  1.00 44.38  ? 296 THR B N   1 
ATOM   2205 C  CA  . THR A 1 299 ? 26.311  -10.999 37.169  1.00 47.16  ? 296 THR B CA  1 
ATOM   2206 C  C   . THR A 1 299 ? 26.131  -9.513  36.873  1.00 47.86  ? 296 THR B C   1 
ATOM   2207 O  O   . THR A 1 299 ? 25.185  -9.109  36.197  1.00 47.45  ? 296 THR B O   1 
ATOM   2208 C  CB  . THR A 1 299 ? 27.353  -11.559 36.172  1.00 51.29  ? 296 THR B CB  1 
ATOM   2209 O  OG1 . THR A 1 299 ? 26.818  -11.519 34.843  1.00 50.91  ? 296 THR B OG1 1 
ATOM   2210 C  CG2 . THR A 1 299 ? 27.735  -12.991 36.526  1.00 50.12  ? 296 THR B CG2 1 
ATOM   2211 N  N   . VAL A 1 300 ? 27.054  -8.708  37.390  1.00 49.00  ? 297 VAL B N   1 
ATOM   2212 C  CA  . VAL A 1 300 ? 27.136  -7.299  37.034  1.00 45.61  ? 297 VAL B CA  1 
ATOM   2213 C  C   . VAL A 1 300 ? 28.390  -7.097  36.191  1.00 48.19  ? 297 VAL B C   1 
ATOM   2214 O  O   . VAL A 1 300 ? 29.451  -7.629  36.516  1.00 51.27  ? 297 VAL B O   1 
ATOM   2215 C  CB  . VAL A 1 300 ? 27.207  -6.391  38.281  1.00 41.52  ? 297 VAL B CB  1 
ATOM   2216 C  CG1 . VAL A 1 300 ? 27.181  -4.927  37.876  1.00 37.27  ? 297 VAL B CG1 1 
ATOM   2217 C  CG2 . VAL A 1 300 ? 26.066  -6.700  39.236  1.00 39.25  ? 297 VAL B CG2 1 
ATOM   2218 N  N   . ALA A 1 301 ? 28.266  -6.339  35.107  1.00 48.68  ? 298 ALA B N   1 
ATOM   2219 C  CA  . ALA A 1 301 ? 29.392  -6.099  34.212  1.00 50.75  ? 298 ALA B CA  1 
ATOM   2220 C  C   . ALA A 1 301 ? 29.849  -4.644  34.244  1.00 53.67  ? 298 ALA B C   1 
ATOM   2221 O  O   . ALA A 1 301 ? 29.035  -3.724  34.193  1.00 56.65  ? 298 ALA B O   1 
ATOM   2222 C  CB  . ALA A 1 301 ? 29.036  -6.510  32.791  1.00 47.94  ? 298 ALA B CB  1 
ATOM   2223 N  N   . LEU A 1 302 ? 31.159  -4.447  34.329  1.00 56.36  ? 299 LEU B N   1 
ATOM   2224 C  CA  . LEU A 1 302 ? 31.738  -3.113  34.301  1.00 53.71  ? 299 LEU B CA  1 
ATOM   2225 C  C   . LEU A 1 302 ? 32.047  -2.746  32.853  1.00 53.19  ? 299 LEU B C   1 
ATOM   2226 O  O   . LEU A 1 302 ? 32.510  -3.583  32.083  1.00 58.81  ? 299 LEU B O   1 
ATOM   2227 C  CB  . LEU A 1 302 ? 33.017  -3.079  35.138  1.00 53.45  ? 299 LEU B CB  1 
ATOM   2228 C  CG  . LEU A 1 302 ? 33.204  -1.923  36.124  1.00 54.50  ? 299 LEU B CG  1 
ATOM   2229 C  CD1 . LEU A 1 302 ? 34.658  -1.845  36.563  1.00 53.14  ? 299 LEU B CD1 1 
ATOM   2230 C  CD2 . LEU A 1 302 ? 32.755  -0.600  35.531  1.00 55.61  ? 299 LEU B CD2 1 
ATOM   2231 N  N   . TRP A 1 303 ? 31.781  -1.498  32.482  1.00 55.41  ? 300 TRP B N   1 
ATOM   2232 C  CA  . TRP A 1 303 ? 32.015  -1.042  31.116  1.00 52.63  ? 300 TRP B CA  1 
ATOM   2233 C  C   . TRP A 1 303 ? 32.698  0.317   31.092  1.00 55.44  ? 300 TRP B C   1 
ATOM   2234 O  O   . TRP A 1 303 ? 32.449  1.161   31.950  1.00 52.85  ? 300 TRP B O   1 
ATOM   2235 C  CB  . TRP A 1 303 ? 30.699  -0.957  30.343  1.00 57.07  ? 300 TRP B CB  1 
ATOM   2236 C  CG  . TRP A 1 303 ? 29.920  -2.230  30.334  1.00 59.26  ? 300 TRP B CG  1 
ATOM   2237 C  CD1 . TRP A 1 303 ? 28.879  -2.558  31.151  1.00 60.33  ? 300 TRP B CD1 1 
ATOM   2238 C  CD2 . TRP A 1 303 ? 30.117  -3.350  29.464  1.00 60.12  ? 300 TRP B CD2 1 
ATOM   2239 N  NE1 . TRP A 1 303 ? 28.414  -3.813  30.844  1.00 63.34  ? 300 TRP B NE1 1 
ATOM   2240 C  CE2 . TRP A 1 303 ? 29.157  -4.322  29.812  1.00 60.96  ? 300 TRP B CE2 1 
ATOM   2241 C  CE3 . TRP A 1 303 ? 31.011  -3.627  28.426  1.00 57.11  ? 300 TRP B CE3 1 
ATOM   2242 C  CZ2 . TRP A 1 303 ? 29.067  -5.549  29.160  1.00 58.34  ? 300 TRP B CZ2 1 
ATOM   2243 C  CZ3 . TRP A 1 303 ? 30.920  -4.846  27.780  1.00 60.18  ? 300 TRP B CZ3 1 
ATOM   2244 C  CH2 . TRP A 1 303 ? 29.954  -5.792  28.149  1.00 60.41  ? 300 TRP B CH2 1 
ATOM   2245 N  N   . ASP A 1 304 ? 33.559  0.521   30.101  1.00 60.32  ? 301 ASP B N   1 
ATOM   2246 C  CA  . ASP A 1 304 ? 34.197  1.812   29.888  1.00 56.52  ? 301 ASP B CA  1 
ATOM   2247 C  C   . ASP A 1 304 ? 33.804  2.340   28.516  1.00 57.78  ? 301 ASP B C   1 
ATOM   2248 O  O   . ASP A 1 304 ? 33.815  1.596   27.535  1.00 59.86  ? 301 ASP B O   1 
ATOM   2249 C  CB  . ASP A 1 304 ? 35.715  1.685   29.993  1.00 54.65  ? 301 ASP B CB  1 
ATOM   2250 C  CG  . ASP A 1 304 ? 36.408  3.028   30.044  1.00 54.35  ? 301 ASP B CG  1 
ATOM   2251 O  OD1 . ASP A 1 304 ? 37.117  3.286   31.038  1.00 56.34  ? 301 ASP B OD1 1 
ATOM   2252 N  N   . LEU A 1 305 ? 33.456  3.621   28.451  1.00 58.91  ? 302 LEU B N   1 
ATOM   2253 C  CA  . LEU A 1 305 ? 32.963  4.223   27.213  1.00 61.65  ? 302 LEU B CA  1 
ATOM   2254 C  C   . LEU A 1 305 ? 33.998  4.258   26.092  1.00 63.60  ? 302 LEU B C   1 
ATOM   2255 O  O   . LEU A 1 305 ? 33.642  4.238   24.915  1.00 64.74  ? 302 LEU B O   1 
ATOM   2256 C  CB  . LEU A 1 305 ? 32.414  5.630   27.468  1.00 60.21  ? 302 LEU B CB  1 
ATOM   2257 C  CG  . LEU A 1 305 ? 31.061  5.695   28.176  1.00 58.94  ? 302 LEU B CG  1 
ATOM   2258 C  CD1 . LEU A 1 305 ? 30.475  7.094   28.074  1.00 61.11  ? 302 LEU B CD1 1 
ATOM   2259 C  CD2 . LEU A 1 305 ? 30.110  4.669   27.589  1.00 48.81  ? 302 LEU B CD2 1 
ATOM   2260 N  N   . ARG A 1 306 ? 35.275  4.322   26.458  1.00 67.70  ? 303 ARG B N   1 
ATOM   2261 C  CA  . ARG A 1 306 ? 36.345  4.358   25.466  1.00 68.18  ? 303 ARG B CA  1 
ATOM   2262 C  C   . ARG A 1 306 ? 36.334  3.107   24.592  1.00 70.91  ? 303 ARG B C   1 
ATOM   2263 O  O   . ARG A 1 306 ? 36.402  3.196   23.365  1.00 70.64  ? 303 ARG B O   1 
ATOM   2264 C  CB  . ARG A 1 306 ? 37.712  4.507   26.137  1.00 67.43  ? 303 ARG B CB  1 
ATOM   2265 C  CG  . ARG A 1 306 ? 37.948  5.841   26.830  1.00 64.00  ? 303 ARG B CG  1 
ATOM   2266 C  CD  . ARG A 1 306 ? 37.859  5.699   28.336  1.00 58.22  ? 303 ARG B CD  1 
ATOM   2267 N  NE  . ARG A 1 306 ? 38.831  6.552   29.012  1.00 51.87  ? 303 ARG B NE  1 
ATOM   2268 C  CZ  . ARG A 1 306 ? 39.273  6.348   30.247  1.00 52.55  ? 303 ARG B CZ  1 
ATOM   2269 N  NH1 . ARG A 1 306 ? 38.831  5.314   30.950  1.00 51.58  ? 303 ARG B NH1 1 
ATOM   2270 N  NH2 . ARG A 1 306 ? 40.161  7.174   30.782  1.00 52.84  ? 303 ARG B NH2 1 
ATOM   2271 N  N   . ASN A 1 307 ? 36.246  1.945   25.232  1.00 70.55  ? 304 ASN B N   1 
ATOM   2272 C  CA  . ASN A 1 307 ? 36.223  0.671   24.524  1.00 72.07  ? 304 ASN B CA  1 
ATOM   2273 C  C   . ASN A 1 307 ? 35.139  -0.259  25.062  1.00 74.86  ? 304 ASN B C   1 
ATOM   2274 O  O   . ASN A 1 307 ? 35.293  -0.861  26.125  1.00 75.29  ? 304 ASN B O   1 
ATOM   2275 C  CB  . ASN A 1 307 ? 37.592  -0.008  24.601  1.00 72.24  ? 304 ASN B CB  1 
ATOM   2276 C  CG  . ASN A 1 307 ? 37.632  -1.333  23.861  1.00 70.06  ? 304 ASN B CG  1 
ATOM   2277 O  OD1 . ASN A 1 307 ? 38.399  -2.228  24.215  1.00 65.45  ? 304 ASN B OD1 1 
ATOM   2278 N  ND2 . ASN A 1 307 ? 36.805  -1.464  22.829  1.00 69.31  ? 304 ASN B ND2 1 
ATOM   2279 N  N   . LEU A 1 308 ? 34.045  -0.372  24.315  1.00 77.33  ? 305 LEU B N   1 
ATOM   2280 C  CA  . LEU A 1 308 ? 32.910  -1.192  24.727  1.00 79.64  ? 305 LEU B CA  1 
ATOM   2281 C  C   . LEU A 1 308 ? 33.163  -2.684  24.528  1.00 84.10  ? 305 LEU B C   1 
ATOM   2282 O  O   . LEU A 1 308 ? 32.663  -3.510  25.294  1.00 90.35  ? 305 LEU B O   1 
ATOM   2283 C  CB  . LEU A 1 308 ? 31.642  -0.773  23.978  1.00 78.58  ? 305 LEU B CB  1 
ATOM   2284 C  CG  . LEU A 1 308 ? 30.920  0.503   24.423  1.00 77.95  ? 305 LEU B CG  1 
ATOM   2285 C  CD1 . LEU A 1 308 ? 30.626  0.465   25.916  1.00 76.74  ? 305 LEU B CD1 1 
ATOM   2286 C  CD2 . LEU A 1 308 ? 31.717  1.746   24.062  1.00 80.64  ? 305 LEU B CD2 1 
ATOM   2287 N  N   . LYS A 1 309 ? 33.933  -3.026  23.499  1.00 83.96  ? 306 LYS B N   1 
ATOM   2288 C  CA  . LYS A 1 309 ? 34.231  -4.422  23.193  1.00 87.27  ? 306 LYS B CA  1 
ATOM   2289 C  C   . LYS A 1 309 ? 34.726  -5.170  24.430  1.00 87.82  ? 306 LYS B C   1 
ATOM   2290 O  O   . LYS A 1 309 ? 34.303  -6.296  24.698  1.00 88.08  ? 306 LYS B O   1 
ATOM   2291 C  CB  . LYS A 1 309 ? 35.267  -4.514  22.069  1.00 88.47  ? 306 LYS B CB  1 
ATOM   2292 C  CG  . LYS A 1 309 ? 35.596  -5.935  21.632  1.00 91.68  ? 306 LYS B CG  1 
ATOM   2293 C  CD  . LYS A 1 309 ? 36.620  -5.943  20.505  1.00 92.88  ? 306 LYS B CD  1 
ATOM   2294 C  CE  . LYS A 1 309 ? 36.901  -7.358  20.018  1.00 94.05  ? 306 LYS B CE  1 
ATOM   2295 N  NZ  . LYS A 1 309 ? 37.850  -7.375  18.869  1.00 93.12  ? 306 LYS B NZ  1 
ATOM   2296 N  N   . LEU A 1 310 ? 35.614  -4.531  25.184  1.00 86.38  ? 307 LEU B N   1 
ATOM   2297 C  CA  . LEU A 1 310 ? 36.198  -5.142  26.371  1.00 82.98  ? 307 LEU B CA  1 
ATOM   2298 C  C   . LEU A 1 310 ? 35.315  -4.974  27.605  1.00 78.92  ? 307 LEU B C   1 
ATOM   2299 O  O   . LEU A 1 310 ? 35.086  -3.857  28.071  1.00 80.33  ? 307 LEU B O   1 
ATOM   2300 C  CB  . LEU A 1 310 ? 37.587  -4.557  26.643  1.00 83.75  ? 307 LEU B CB  1 
ATOM   2301 C  CG  . LEU A 1 310 ? 38.313  -5.051  27.899  1.00 86.98  ? 307 LEU B CG  1 
ATOM   2302 C  CD1 . LEU A 1 310 ? 38.623  -6.541  27.799  1.00 87.19  ? 307 LEU B CD1 1 
ATOM   2303 C  CD2 . LEU A 1 310 ? 39.586  -4.249  28.140  1.00 85.19  ? 307 LEU B CD2 1 
ATOM   2304 N  N   . LYS A 1 311 ? 34.820  -6.092  28.127  1.00 72.28  ? 308 LYS B N   1 
ATOM   2305 C  CA  . LYS A 1 311 ? 34.111  -6.092  29.399  1.00 62.51  ? 308 LYS B CA  1 
ATOM   2306 C  C   . LYS A 1 311 ? 35.134  -6.021  30.527  1.00 61.60  ? 308 LYS B C   1 
ATOM   2307 O  O   . LYS A 1 311 ? 35.803  -7.010  30.830  1.00 59.36  ? 308 LYS B O   1 
ATOM   2308 C  CB  . LYS A 1 311 ? 33.251  -7.349  29.539  1.00 58.90  ? 308 LYS B CB  1 
ATOM   2309 C  CG  . LYS A 1 311 ? 32.600  -7.504  30.907  1.00 58.65  ? 308 LYS B CG  1 
ATOM   2310 C  CD  . LYS A 1 311 ? 31.793  -8.789  31.009  1.00 57.64  ? 308 LYS B CD  1 
ATOM   2311 C  CE  . LYS A 1 311 ? 30.572  -8.749  30.107  1.00 54.25  ? 308 LYS B CE  1 
ATOM   2312 N  NZ  . LYS A 1 311 ? 29.622  -9.856  30.397  1.00 54.77  ? 308 LYS B NZ  1 
ATOM   2313 N  N   . LEU A 1 312 ? 35.253  -4.846  31.139  1.00 57.89  ? 309 LEU B N   1 
ATOM   2314 C  CA  . LEU A 1 312 ? 36.270  -4.601  32.161  1.00 56.43  ? 309 LEU B CA  1 
ATOM   2315 C  C   . LEU A 1 312 ? 36.287  -5.645  33.273  1.00 57.29  ? 309 LEU B C   1 
ATOM   2316 O  O   . LEU A 1 312 ? 37.335  -6.211  33.580  1.00 59.22  ? 309 LEU B O   1 
ATOM   2317 C  CB  . LEU A 1 312 ? 36.115  -3.200  32.760  1.00 57.64  ? 309 LEU B CB  1 
ATOM   2318 C  CG  . LEU A 1 312 ? 36.778  -2.036  32.017  1.00 63.29  ? 309 LEU B CG  1 
ATOM   2319 C  CD1 . LEU A 1 312 ? 36.268  -1.924  30.584  1.00 66.41  ? 309 LEU B CD1 1 
ATOM   2320 C  CD2 . LEU A 1 312 ? 36.565  -0.729  32.767  1.00 59.89  ? 309 LEU B CD2 1 
ATOM   2321 N  N   . HIS A 1 313 ? 35.129  -5.900  33.875  1.00 56.65  ? 310 HIS B N   1 
ATOM   2322 C  CA  . HIS A 1 313 ? 35.058  -6.820  35.007  1.00 53.96  ? 310 HIS B CA  1 
ATOM   2323 C  C   . HIS A 1 313 ? 33.688  -7.479  35.134  1.00 55.07  ? 310 HIS B C   1 
ATOM   2324 O  O   . HIS A 1 313 ? 32.704  -7.010  34.563  1.00 54.51  ? 310 HIS B O   1 
ATOM   2325 C  CB  . HIS A 1 313 ? 35.423  -6.090  36.304  1.00 52.99  ? 310 HIS B CB  1 
ATOM   2326 C  CG  . HIS A 1 313 ? 35.510  -6.985  37.500  1.00 58.00  ? 310 HIS B CG  1 
ATOM   2327 N  ND1 . HIS A 1 313 ? 36.445  -7.991  37.611  1.00 62.69  ? 310 HIS B ND1 1 
ATOM   2328 C  CD2 . HIS A 1 313 ? 34.782  -7.020  38.642  1.00 60.09  ? 310 HIS B CD2 1 
ATOM   2329 C  CE1 . HIS A 1 313 ? 36.286  -8.611  38.767  1.00 63.19  ? 310 HIS B CE1 1 
ATOM   2330 N  NE2 . HIS A 1 313 ? 35.285  -8.041  39.413  1.00 62.11  ? 310 HIS B NE2 1 
ATOM   2331 N  N   . THR A 1 314 ? 33.640  -8.577  35.882  1.00 55.56  ? 311 THR B N   1 
ATOM   2332 C  CA  . THR A 1 314 ? 32.394  -9.292  36.135  1.00 52.07  ? 311 THR B CA  1 
ATOM   2333 C  C   . THR A 1 314 ? 32.236  -9.591  37.624  1.00 54.35  ? 311 THR B C   1 
ATOM   2334 O  O   . THR A 1 314 ? 33.058  -10.292 38.222  1.00 46.00  ? 311 THR B O   1 
ATOM   2335 C  CB  . THR A 1 314 ? 32.317  -10.600 35.323  1.00 52.53  ? 311 THR B CB  1 
ATOM   2336 O  OG1 . THR A 1 314 ? 32.078  -10.289 33.945  1.00 56.00  ? 311 THR B OG1 1 
ATOM   2337 C  CG2 . THR A 1 314 ? 31.193  -11.489 35.833  1.00 51.14  ? 311 THR B CG2 1 
ATOM   2338 N  N   . PHE A 1 315 ? 31.180  -9.042  38.217  1.00 54.26  ? 312 PHE B N   1 
ATOM   2339 C  CA  . PHE A 1 315 ? 30.902  -9.246  39.632  1.00 52.32  ? 312 PHE B CA  1 
ATOM   2340 C  C   . PHE A 1 315 ? 30.043  -10.486 39.832  1.00 54.11  ? 312 PHE B C   1 
ATOM   2341 O  O   . PHE A 1 315 ? 28.889  -10.528 39.404  1.00 58.52  ? 312 PHE B O   1 
ATOM   2342 C  CB  . PHE A 1 315 ? 30.199  -8.024  40.222  1.00 49.91  ? 312 PHE B CB  1 
ATOM   2343 C  CG  . PHE A 1 315 ? 30.973  -6.746  40.071  1.00 46.76  ? 312 PHE B CG  1 
ATOM   2344 C  CD1 . PHE A 1 315 ? 30.825  -5.962  38.938  1.00 41.72  ? 312 PHE B CD1 1 
ATOM   2345 C  CD2 . PHE A 1 315 ? 31.844  -6.326  41.064  1.00 43.49  ? 312 PHE B CD2 1 
ATOM   2346 C  CE1 . PHE A 1 315 ? 31.532  -4.784  38.798  1.00 44.22  ? 312 PHE B CE1 1 
ATOM   2347 C  CE2 . PHE A 1 315 ? 32.553  -5.148  40.929  1.00 39.27  ? 312 PHE B CE2 1 
ATOM   2348 C  CZ  . PHE A 1 315 ? 32.397  -4.377  39.794  1.00 42.26  ? 312 PHE B CZ  1 
ATOM   2349 N  N   . GLU A 1 316 ? 30.614  -11.494 40.482  1.00 57.07  ? 313 GLU B N   1 
ATOM   2350 C  CA  . GLU A 1 316 ? 29.903  -12.736 40.749  1.00 61.42  ? 313 GLU B CA  1 
ATOM   2351 C  C   . GLU A 1 316 ? 29.616  -12.883 42.238  1.00 57.30  ? 313 GLU B C   1 
ATOM   2352 O  O   . GLU A 1 316 ? 30.456  -12.549 43.072  1.00 59.59  ? 313 GLU B O   1 
ATOM   2353 C  CB  . GLU A 1 316 ? 30.713  -13.934 40.250  1.00 63.98  ? 313 GLU B CB  1 
ATOM   2354 C  CG  . GLU A 1 316 ? 30.943  -13.949 38.746  1.00 72.41  ? 313 GLU B CG  1 
ATOM   2355 C  CD  . GLU A 1 316 ? 31.865  -15.073 38.302  1.00 74.21  ? 313 GLU B CD  1 
ATOM   2356 O  OE1 . GLU A 1 316 ? 32.829  -15.383 39.035  1.00 79.22  ? 313 GLU B OE1 1 
ATOM   2357 O  OE2 . GLU A 1 316 ? 31.630  -15.642 37.215  1.00 80.99  ? 313 GLU B OE2 1 
ATOM   2358 N  N   . SER A 1 317 ? 28.421  -13.375 42.555  1.00 51.79  ? 314 SER B N   1 
ATOM   2359 C  CA  . SER A 1 317 ? 28.011  -13.662 43.931  1.00 46.88  ? 314 SER B CA  1 
ATOM   2360 C  C   . SER A 1 317 ? 26.499  -13.788 44.054  1.00 45.81  ? 314 SER B C   1 
ATOM   2361 O  O   . SER A 1 317 ? 26.005  -14.590 44.845  1.00 47.90  ? 314 SER B O   1 
ATOM   2362 C  CB  . SER A 1 317 ? 28.532  -12.610 44.910  1.00 50.04  ? 314 SER B CB  1 
ATOM   2363 O  OG  . SER A 1 317 ? 29.827  -12.955 45.373  1.00 57.13  ? 314 SER B OG  1 
ATOM   2364 N  N   . HIS A 1 318 ? 25.769  -12.994 43.274  1.00 47.26  ? 315 HIS B N   1 
ATOM   2365 C  CA  . HIS A 1 318 ? 24.312  -13.086 43.248  1.00 46.90  ? 315 HIS B CA  1 
ATOM   2366 C  C   . HIS A 1 318 ? 23.870  -14.468 42.780  1.00 49.15  ? 315 HIS B C   1 
ATOM   2367 O  O   . HIS A 1 318 ? 24.429  -15.020 41.832  1.00 50.69  ? 315 HIS B O   1 
ATOM   2368 C  CB  . HIS A 1 318 ? 23.705  -11.998 42.359  1.00 45.58  ? 315 HIS B CB  1 
ATOM   2369 C  CG  . HIS A 1 318 ? 23.436  -10.710 43.076  1.00 42.09  ? 315 HIS B CG  1 
ATOM   2370 N  ND1 . HIS A 1 318 ? 24.110  -9.542  42.790  1.00 36.24  ? 315 HIS B ND1 1 
ATOM   2371 C  CD2 . HIS A 1 318 ? 22.564  -10.408 44.067  1.00 38.39  ? 315 HIS B CD2 1 
ATOM   2372 C  CE1 . HIS A 1 318 ? 23.663  -8.576  43.573  1.00 36.37  ? 315 HIS B CE1 1 
ATOM   2373 N  NE2 . HIS A 1 318 ? 22.725  -9.075  44.357  1.00 36.08  ? 315 HIS B NE2 1 
ATOM   2374 N  N   . LYS A 1 319 ? 22.866  -15.019 43.454  1.00 49.23  ? 316 LYS B N   1 
ATOM   2375 C  CA  . LYS A 1 319 ? 22.423  -16.386 43.201  1.00 47.90  ? 316 LYS B CA  1 
ATOM   2376 C  C   . LYS A 1 319 ? 21.228  -16.442 42.255  1.00 47.90  ? 316 LYS B C   1 
ATOM   2377 O  O   . LYS A 1 319 ? 20.711  -17.521 41.966  1.00 52.40  ? 316 LYS B O   1 
ATOM   2378 C  CB  . LYS A 1 319 ? 22.068  -17.081 44.520  1.00 48.78  ? 316 LYS B CB  1 
ATOM   2379 C  CG  . LYS A 1 319 ? 23.216  -17.176 45.516  1.00 49.68  ? 316 LYS B CG  1 
ATOM   2380 C  CD  . LYS A 1 319 ? 22.731  -17.721 46.850  1.00 56.42  ? 316 LYS B CD  1 
ATOM   2381 C  CE  . LYS A 1 319 ? 23.841  -17.738 47.892  1.00 61.66  ? 316 LYS B CE  1 
ATOM   2382 N  NZ  . LYS A 1 319 ? 24.881  -18.762 47.595  1.00 64.70  ? 316 LYS B NZ  1 
ATOM   2383 N  N   . ASP A 1 320 ? 20.796  -15.281 41.773  1.00 44.99  ? 317 ASP B N   1 
ATOM   2384 C  CA  . ASP A 1 320 ? 19.614  -15.197 40.923  1.00 39.30  ? 317 ASP B CA  1 
ATOM   2385 C  C   . ASP A 1 320 ? 19.664  -13.921 40.087  1.00 38.87  ? 317 ASP B C   1 
ATOM   2386 O  O   . ASP A 1 320 ? 20.657  -13.197 40.117  1.00 37.40  ? 317 ASP B O   1 
ATOM   2387 C  CB  . ASP A 1 320 ? 18.350  -15.225 41.783  1.00 47.11  ? 317 ASP B CB  1 
ATOM   2388 C  CG  . ASP A 1 320 ? 17.175  -15.877 41.081  1.00 56.05  ? 317 ASP B CG  1 
ATOM   2389 O  OD1 . ASP A 1 320 ? 17.034  -15.703 39.851  1.00 54.27  ? 317 ASP B OD1 1 
ATOM   2390 O  OD2 . ASP A 1 320 ? 16.385  -16.560 41.768  1.00 59.68  ? 317 ASP B OD2 1 
ATOM   2391 N  N   . GLU A 1 321 ? 18.593  -13.651 39.343  1.00 41.39  ? 318 GLU B N   1 
ATOM   2392 C  CA  . GLU A 1 321 ? 18.513  -12.459 38.498  1.00 47.09  ? 318 GLU B CA  1 
ATOM   2393 C  C   . GLU A 1 321 ? 18.799  -11.167 39.262  1.00 42.60  ? 318 GLU B C   1 
ATOM   2394 O  O   . GLU A 1 321 ? 18.460  -11.033 40.436  1.00 48.55  ? 318 GLU B O   1 
ATOM   2395 C  CB  . GLU A 1 321 ? 17.137  -12.358 37.833  1.00 51.53  ? 318 GLU B CB  1 
ATOM   2396 C  CG  . GLU A 1 321 ? 16.903  -13.338 36.698  1.00 60.21  ? 318 GLU B CG  1 
ATOM   2397 C  CD  . GLU A 1 321 ? 15.533  -13.173 36.062  1.00 63.30  ? 318 GLU B CD  1 
ATOM   2398 O  OE1 . GLU A 1 321 ? 15.459  -13.079 34.818  1.00 69.37  ? 318 GLU B OE1 1 
ATOM   2399 O  OE2 . GLU A 1 321 ? 14.530  -13.129 36.808  1.00 68.07  ? 318 GLU B OE2 1 
ATOM   2400 N  N   . ILE A 1 322 ? 19.421  -10.220 38.572  1.00 40.15  ? 319 ILE B N   1 
ATOM   2401 C  CA  . ILE A 1 322 ? 19.715  -8.906  39.120  1.00 38.84  ? 319 ILE B CA  1 
ATOM   2402 C  C   . ILE A 1 322 ? 18.840  -7.875  38.418  1.00 41.45  ? 319 ILE B C   1 
ATOM   2403 O  O   . ILE A 1 322 ? 18.812  -7.820  37.188  1.00 37.99  ? 319 ILE B O   1 
ATOM   2404 C  CB  . ILE A 1 322 ? 21.200  -8.552  38.911  1.00 40.64  ? 319 ILE B CB  1 
ATOM   2405 C  CG1 . ILE A 1 322 ? 22.082  -9.495  39.736  1.00 40.79  ? 319 ILE B CG1 1 
ATOM   2406 C  CG2 . ILE A 1 322 ? 21.465  -7.089  39.256  1.00 35.30  ? 319 ILE B CG2 1 
ATOM   2407 C  CD1 . ILE A 1 322 ? 23.548  -9.434  39.389  1.00 39.73  ? 319 ILE B CD1 1 
ATOM   2408 N  N   . PHE A 1 323 ? 18.121  -7.065  39.190  1.00 44.69  ? 320 PHE B N   1 
ATOM   2409 C  CA  . PHE A 1 323 ? 17.177  -6.113  38.597  1.00 43.41  ? 320 PHE B CA  1 
ATOM   2410 C  C   . PHE A 1 323 ? 17.514  -4.646  38.835  1.00 38.41  ? 320 PHE B C   1 
ATOM   2411 O  O   . PHE A 1 323 ? 17.004  -3.772  38.139  1.00 43.46  ? 320 PHE B O   1 
ATOM   2412 C  CB  . PHE A 1 323 ? 15.746  -6.408  39.048  1.00 37.90  ? 320 PHE B CB  1 
ATOM   2413 C  CG  . PHE A 1 323 ? 15.071  -7.479  38.244  1.00 40.46  ? 320 PHE B CG  1 
ATOM   2414 C  CD1 . PHE A 1 323 ? 15.028  -8.786  38.701  1.00 39.44  ? 320 PHE B CD1 1 
ATOM   2415 C  CD2 . PHE A 1 323 ? 14.482  -7.179  37.023  1.00 45.68  ? 320 PHE B CD2 1 
ATOM   2416 C  CE1 . PHE A 1 323 ? 14.407  -9.773  37.960  1.00 36.79  ? 320 PHE B CE1 1 
ATOM   2417 C  CE2 . PHE A 1 323 ? 13.859  -8.162  36.275  1.00 37.23  ? 320 PHE B CE2 1 
ATOM   2418 C  CZ  . PHE A 1 323 ? 13.822  -9.460  36.744  1.00 40.11  ? 320 PHE B CZ  1 
ATOM   2419 N  N   . GLN A 1 324 ? 18.374  -4.372  39.808  1.00 38.28  ? 321 GLN B N   1 
ATOM   2420 C  CA  . GLN A 1 324 ? 18.732  -2.991  40.106  1.00 41.32  ? 321 GLN B CA  1 
ATOM   2421 C  C   . GLN A 1 324 ? 20.212  -2.834  40.437  1.00 39.49  ? 321 GLN B C   1 
ATOM   2422 O  O   . GLN A 1 324 ? 20.793  -3.658  41.143  1.00 33.71  ? 321 GLN B O   1 
ATOM   2423 C  CB  . GLN A 1 324 ? 17.866  -2.442  41.245  1.00 44.39  ? 321 GLN B CB  1 
ATOM   2424 C  CG  . GLN A 1 324 ? 17.946  -0.931  41.430  1.00 45.65  ? 321 GLN B CG  1 
ATOM   2425 C  CD  . GLN A 1 324 ? 17.493  -0.157  40.202  1.00 48.16  ? 321 GLN B CD  1 
ATOM   2426 O  OE1 . GLN A 1 324 ? 16.372  0.347   40.151  1.00 51.37  ? 321 GLN B OE1 1 
ATOM   2427 N  NE2 . GLN A 1 324 ? 18.364  -0.062  39.205  1.00 50.74  ? 321 GLN B NE2 1 
ATOM   2428 N  N   . VAL A 1 325 ? 20.811  -1.768  39.916  1.00 38.67  ? 322 VAL B N   1 
ATOM   2429 C  CA  . VAL A 1 325 ? 22.214  -1.465  40.159  1.00 43.09  ? 322 VAL B CA  1 
ATOM   2430 C  C   . VAL A 1 325 ? 22.393  0.050   40.314  1.00 39.61  ? 322 VAL B C   1 
ATOM   2431 O  O   . VAL A 1 325 ? 21.887  0.826   39.506  1.00 44.07  ? 322 VAL B O   1 
ATOM   2432 C  CB  . VAL A 1 325 ? 23.114  -2.033  39.027  1.00 48.58  ? 322 VAL B CB  1 
ATOM   2433 C  CG1 . VAL A 1 325 ? 22.874  -1.294  37.712  1.00 46.28  ? 322 VAL B CG1 1 
ATOM   2434 C  CG2 . VAL A 1 325 ? 24.581  -1.981  39.422  1.00 48.49  ? 322 VAL B CG2 1 
ATOM   2435 N  N   . HIS A 1 326 ? 23.090  0.465   41.369  1.00 39.57  ? 323 HIS B N   1 
ATOM   2436 C  CA  . HIS A 1 326 ? 23.255  1.888   41.675  1.00 37.67  ? 323 HIS B CA  1 
ATOM   2437 C  C   . HIS A 1 326 ? 24.623  2.190   42.276  1.00 37.45  ? 323 HIS B C   1 
ATOM   2438 O  O   . HIS A 1 326 ? 25.074  1.504   43.194  1.00 35.87  ? 323 HIS B O   1 
ATOM   2439 C  CB  . HIS A 1 326 ? 22.181  2.361   42.659  1.00 39.23  ? 323 HIS B CB  1 
ATOM   2440 C  CG  . HIS A 1 326 ? 20.840  2.598   42.039  1.00 39.75  ? 323 HIS B CG  1 
ATOM   2441 N  ND1 . HIS A 1 326 ? 20.588  3.653   41.189  1.00 38.78  ? 323 HIS B ND1 1 
ATOM   2442 C  CD2 . HIS A 1 326 ? 19.667  1.933   42.170  1.00 37.98  ? 323 HIS B CD2 1 
ATOM   2443 C  CE1 . HIS A 1 326 ? 19.322  3.619   40.811  1.00 35.87  ? 323 HIS B CE1 1 
ATOM   2444 N  NE2 . HIS A 1 326 ? 18.742  2.584   41.391  1.00 34.60  ? 323 HIS B NE2 1 
ATOM   2445 N  N   . TRP A 1 327 ? 25.268  3.233   41.766  1.00 35.86  ? 324 TRP B N   1 
ATOM   2446 C  CA  . TRP A 1 327 ? 26.547  3.683   42.296  1.00 31.89  ? 324 TRP B CA  1 
ATOM   2447 C  C   . TRP A 1 327 ? 26.350  4.508   43.558  1.00 32.54  ? 324 TRP B C   1 
ATOM   2448 O  O   . TRP A 1 327 ? 25.316  5.149   43.735  1.00 37.47  ? 324 TRP B O   1 
ATOM   2449 C  CB  . TRP A 1 327 ? 27.288  4.529   41.261  1.00 34.47  ? 324 TRP B CB  1 
ATOM   2450 C  CG  . TRP A 1 327 ? 27.720  3.767   40.058  1.00 36.76  ? 324 TRP B CG  1 
ATOM   2451 C  CD1 . TRP A 1 327 ? 27.045  3.642   38.879  1.00 35.21  ? 324 TRP B CD1 1 
ATOM   2452 C  CD2 . TRP A 1 327 ? 28.932  3.019   39.909  1.00 36.60  ? 324 TRP B CD2 1 
ATOM   2453 N  NE1 . TRP A 1 327 ? 27.761  2.862   38.004  1.00 34.65  ? 324 TRP B NE1 1 
ATOM   2454 C  CE2 . TRP A 1 327 ? 28.923  2.467   38.612  1.00 35.18  ? 324 TRP B CE2 1 
ATOM   2455 C  CE3 . TRP A 1 327 ? 30.024  2.764   40.747  1.00 34.26  ? 324 TRP B CE3 1 
ATOM   2456 C  CZ2 . TRP A 1 327 ? 29.963  1.673   38.133  1.00 35.44  ? 324 TRP B CZ2 1 
ATOM   2457 C  CZ3 . TRP A 1 327 ? 31.056  1.975   40.269  1.00 35.14  ? 324 TRP B CZ3 1 
ATOM   2458 C  CH2 . TRP A 1 327 ? 31.018  1.438   38.975  1.00 36.78  ? 324 TRP B CH2 1 
ATOM   2459 N  N   . SER A 1 328 ? 27.350  4.488   44.431  1.00 36.63  ? 325 SER B N   1 
ATOM   2460 C  CA  . SER A 1 328 ? 27.361  5.353   45.600  1.00 36.24  ? 325 SER B CA  1 
ATOM   2461 C  C   . SER A 1 328 ? 27.546  6.799   45.147  1.00 37.79  ? 325 SER B C   1 
ATOM   2462 O  O   . SER A 1 328 ? 28.384  7.079   44.293  1.00 40.70  ? 325 SER B O   1 
ATOM   2463 C  CB  . SER A 1 328 ? 28.487  4.949   46.554  1.00 33.79  ? 325 SER B CB  1 
ATOM   2464 O  OG  . SER A 1 328 ? 28.633  5.883   47.612  1.00 36.86  ? 325 SER B OG  1 
ATOM   2465 N  N   . PRO A 1 329 ? 26.745  7.720   45.704  1.00 40.13  ? 326 PRO B N   1 
ATOM   2466 C  CA  . PRO A 1 329 ? 26.871  9.139   45.395  1.00 36.46  ? 326 PRO B CA  1 
ATOM   2467 C  C   . PRO A 1 329 ? 27.926  9.836   46.253  1.00 36.46  ? 326 PRO B C   1 
ATOM   2468 O  O   . PRO A 1 329 ? 28.050  11.060  46.205  1.00 39.26  ? 326 PRO B O   1 
ATOM   2469 C  CB  . PRO A 1 329 ? 25.481  9.686   45.726  1.00 32.66  ? 326 PRO B CB  1 
ATOM   2470 C  CG  . PRO A 1 329 ? 24.983  8.799   46.818  1.00 38.07  ? 326 PRO B CG  1 
ATOM   2471 C  CD  . PRO A 1 329 ? 25.648  7.452   46.653  1.00 38.08  ? 326 PRO B CD  1 
ATOM   2472 N  N   . HIS A 1 330 ? 28.677  9.063   47.032  1.00 37.84  ? 327 HIS B N   1 
ATOM   2473 C  CA  . HIS A 1 330 ? 29.716  9.631   47.890  1.00 43.80  ? 327 HIS B CA  1 
ATOM   2474 C  C   . HIS A 1 330 ? 31.086  9.032   47.597  1.00 47.47  ? 327 HIS B C   1 
ATOM   2475 O  O   . HIS A 1 330 ? 32.097  9.731   47.632  1.00 49.95  ? 327 HIS B O   1 
ATOM   2476 C  CB  . HIS A 1 330 ? 29.364  9.443   49.366  1.00 41.24  ? 327 HIS B CB  1 
ATOM   2477 C  CG  . HIS A 1 330 ? 28.135  10.184  49.791  1.00 45.61  ? 327 HIS B CG  1 
ATOM   2478 N  ND1 . HIS A 1 330 ? 26.944  9.550   50.074  1.00 46.60  ? 327 HIS B ND1 1 
ATOM   2479 C  CD2 . HIS A 1 330 ? 27.909  11.507  49.968  1.00 46.12  ? 327 HIS B CD2 1 
ATOM   2480 C  CE1 . HIS A 1 330 ? 26.039  10.451  50.414  1.00 47.58  ? 327 HIS B CE1 1 
ATOM   2481 N  NE2 . HIS A 1 330 ? 26.599  11.646  50.358  1.00 48.23  ? 327 HIS B NE2 1 
ATOM   2482 N  N   . ASN A 1 331 ? 31.112  7.735   47.307  1.00 50.38  ? 328 ASN B N   1 
ATOM   2483 C  CA  . ASN A 1 331 ? 32.357  7.036   47.022  1.00 45.26  ? 328 ASN B CA  1 
ATOM   2484 C  C   . ASN A 1 331 ? 32.360  6.457   45.612  1.00 48.47  ? 328 ASN B C   1 
ATOM   2485 O  O   . ASN A 1 331 ? 31.562  5.576   45.293  1.00 51.95  ? 328 ASN B O   1 
ATOM   2486 C  CB  . ASN A 1 331 ? 32.593  5.938   48.057  1.00 45.11  ? 328 ASN B CB  1 
ATOM   2487 C  CG  . ASN A 1 331 ? 32.504  6.453   49.482  1.00 52.85  ? 328 ASN B CG  1 
ATOM   2488 O  OD1 . ASN A 1 331 ? 31.691  5.979   50.276  1.00 54.62  ? 328 ASN B OD1 1 
ATOM   2489 N  ND2 . ASN A 1 331 ? 33.335  7.436   49.810  1.00 57.81  ? 328 ASN B ND2 1 
ATOM   2490 N  N   . GLU A 1 332 ? 33.266  6.955   44.776  1.00 50.34  ? 329 GLU B N   1 
ATOM   2491 C  CA  . GLU A 1 332 ? 33.309  6.603   43.356  1.00 55.14  ? 329 GLU B CA  1 
ATOM   2492 C  C   . GLU A 1 332 ? 33.595  5.128   43.074  1.00 52.56  ? 329 GLU B C   1 
ATOM   2493 O  O   . GLU A 1 332 ? 33.286  4.631   41.989  1.00 43.99  ? 329 GLU B O   1 
ATOM   2494 C  CB  . GLU A 1 332 ? 34.327  7.477   42.613  1.00 66.99  ? 329 GLU B CB  1 
ATOM   2495 C  CG  . GLU A 1 332 ? 35.543  7.875   43.441  1.00 78.92  ? 329 GLU B CG  1 
ATOM   2496 C  CD  . GLU A 1 332 ? 35.390  9.242   44.087  1.00 82.48  ? 329 GLU B CD  1 
ATOM   2497 O  OE1 . GLU A 1 332 ? 35.133  9.304   45.309  1.00 82.09  ? 329 GLU B OE1 1 
ATOM   2498 O  OE2 . GLU A 1 332 ? 35.519  10.256  43.367  1.00 84.14  ? 329 GLU B OE2 1 
ATOM   2499 N  N   . THR A 1 333 ? 34.183  4.432   44.042  1.00 49.58  ? 330 THR B N   1 
ATOM   2500 C  CA  . THR A 1 333 ? 34.556  3.034   43.840  1.00 48.02  ? 330 THR B CA  1 
ATOM   2501 C  C   . THR A 1 333 ? 33.546  2.067   44.452  1.00 48.04  ? 330 THR B C   1 
ATOM   2502 O  O   . THR A 1 333 ? 33.796  0.863   44.516  1.00 50.19  ? 330 THR B O   1 
ATOM   2503 C  CB  . THR A 1 333 ? 35.963  2.729   44.410  1.00 49.79  ? 330 THR B CB  1 
ATOM   2504 O  OG1 . THR A 1 333 ? 35.912  2.705   45.843  1.00 49.31  ? 330 THR B OG1 1 
ATOM   2505 C  CG2 . THR A 1 333 ? 36.970  3.777   43.952  1.00 43.04  ? 330 THR B CG2 1 
ATOM   2506 N  N   . ILE A 1 334 ? 32.408  2.592   44.896  1.00 42.71  ? 331 ILE B N   1 
ATOM   2507 C  CA  . ILE A 1 334 ? 31.400  1.765   45.559  1.00 40.90  ? 331 ILE B CA  1 
ATOM   2508 C  C   . ILE A 1 334 ? 30.158  1.530   44.690  1.00 41.62  ? 331 ILE B C   1 
ATOM   2509 O  O   . ILE A 1 334 ? 29.574  2.468   44.145  1.00 34.38  ? 331 ILE B O   1 
ATOM   2510 C  CB  . ILE A 1 334 ? 30.992  2.358   46.922  1.00 35.76  ? 331 ILE B CB  1 
ATOM   2511 C  CG1 . ILE A 1 334 ? 32.223  2.567   47.812  1.00 34.71  ? 331 ILE B CG1 1 
ATOM   2512 C  CG2 . ILE A 1 334 ? 29.985  1.460   47.614  1.00 38.77  ? 331 ILE B CG2 1 
ATOM   2513 C  CD1 . ILE A 1 334 ? 32.985  1.299   48.137  1.00 29.49  ? 331 ILE B CD1 1 
ATOM   2514 N  N   . LEU A 1 335 ? 29.764  0.265   44.574  1.00 40.72  ? 332 LEU B N   1 
ATOM   2515 C  CA  . LEU A 1 335 ? 28.652  -0.133  43.719  1.00 37.82  ? 332 LEU B CA  1 
ATOM   2516 C  C   . LEU A 1 335 ? 27.726  -1.063  44.492  1.00 34.01  ? 332 LEU B C   1 
ATOM   2517 O  O   . LEU A 1 335 ? 28.188  -1.884  45.282  1.00 35.47  ? 332 LEU B O   1 
ATOM   2518 C  CB  . LEU A 1 335 ? 29.187  -0.875  42.492  1.00 39.51  ? 332 LEU B CB  1 
ATOM   2519 C  CG  . LEU A 1 335 ? 28.542  -0.696  41.114  1.00 44.57  ? 332 LEU B CG  1 
ATOM   2520 C  CD1 . LEU A 1 335 ? 28.652  -1.999  40.332  1.00 46.75  ? 332 LEU B CD1 1 
ATOM   2521 C  CD2 . LEU A 1 335 ? 27.091  -0.254  41.198  1.00 43.73  ? 332 LEU B CD2 1 
ATOM   2522 N  N   . ALA A 1 336 ? 26.423  -0.937  44.259  1.00 33.12  ? 333 ALA B N   1 
ATOM   2523 C  CA  . ALA A 1 336 ? 25.444  -1.830  44.875  1.00 29.01  ? 333 ALA B CA  1 
ATOM   2524 C  C   . ALA A 1 336 ? 24.499  -2.433  43.840  1.00 29.56  ? 333 ALA B C   1 
ATOM   2525 O  O   . ALA A 1 336 ? 24.165  -1.794  42.841  1.00 27.38  ? 333 ALA B O   1 
ATOM   2526 C  CB  . ALA A 1 336 ? 24.657  -1.102  45.951  1.00 26.98  ? 333 ALA B CB  1 
ATOM   2527 N  N   . SER A 1 337 ? 24.069  -3.667  44.092  1.00 30.83  ? 334 SER B N   1 
ATOM   2528 C  CA  . SER A 1 337 ? 23.163  -4.369  43.192  1.00 29.18  ? 334 SER B CA  1 
ATOM   2529 C  C   . SER A 1 337 ? 22.213  -5.268  43.969  1.00 31.84  ? 334 SER B C   1 
ATOM   2530 O  O   . SER A 1 337 ? 22.603  -5.887  44.959  1.00 34.17  ? 334 SER B O   1 
ATOM   2531 C  CB  . SER A 1 337 ? 23.949  -5.200  42.175  1.00 35.76  ? 334 SER B CB  1 
ATOM   2532 O  OG  . SER A 1 337 ? 24.753  -6.173  42.823  1.00 36.24  ? 334 SER B OG  1 
ATOM   2533 N  N   . SER A 1 338 ? 20.967  -5.339  43.509  1.00 31.50  ? 335 SER B N   1 
ATOM   2534 C  CA  . SER A 1 338 ? 19.945  -6.149  44.160  1.00 34.89  ? 335 SER B CA  1 
ATOM   2535 C  C   . SER A 1 338 ? 19.205  -6.996  43.132  1.00 40.15  ? 335 SER B C   1 
ATOM   2536 O  O   . SER A 1 338 ? 19.242  -6.701  41.935  1.00 43.17  ? 335 SER B O   1 
ATOM   2537 C  CB  . SER A 1 338 ? 18.952  -5.249  44.891  1.00 39.15  ? 335 SER B CB  1 
ATOM   2538 O  OG  . SER A 1 338 ? 18.257  -4.420  43.974  1.00 42.42  ? 335 SER B OG  1 
ATOM   2539 N  N   . GLY A 1 339 ? 18.524  -8.040  43.597  1.00 32.52  ? 336 GLY B N   1 
ATOM   2540 C  CA  . GLY A 1 339 ? 17.771  -8.895  42.689  1.00 35.90  ? 336 GLY B CA  1 
ATOM   2541 C  C   . GLY A 1 339 ? 16.790  -9.863  43.320  1.00 36.83  ? 336 GLY B C   1 
ATOM   2542 O  O   . GLY A 1 339 ? 16.263  -9.622  44.406  1.00 30.42  ? 336 GLY B O   1 
ATOM   2543 N  N   . THR A 1 340 ? 16.553  -10.970 42.624  1.00 41.54  ? 337 THR B N   1 
ATOM   2544 C  CA  . THR A 1 340 ? 15.555  -11.947 43.038  1.00 43.79  ? 337 THR B CA  1 
ATOM   2545 C  C   . THR A 1 340 ? 16.055  -12.849 44.163  1.00 39.79  ? 337 THR B C   1 
ATOM   2546 O  O   . THR A 1 340 ? 15.257  -13.447 44.885  1.00 48.14  ? 337 THR B O   1 
ATOM   2547 C  CB  . THR A 1 340 ? 15.098  -12.811 41.846  1.00 48.81  ? 337 THR B CB  1 
ATOM   2548 O  OG1 . THR A 1 340 ? 14.812  -11.965 40.724  1.00 51.22  ? 337 THR B OG1 1 
ATOM   2549 C  CG2 . THR A 1 340 ? 13.852  -13.610 42.205  1.00 45.53  ? 337 THR B CG2 1 
ATOM   2550 N  N   . ASP A 1 341 ? 17.372  -12.943 44.320  1.00 39.67  ? 338 ASP B N   1 
ATOM   2551 C  CA  . ASP A 1 341 ? 17.946  -13.757 45.389  1.00 40.57  ? 338 ASP B CA  1 
ATOM   2552 C  C   . ASP A 1 341 ? 17.759  -13.103 46.758  1.00 43.11  ? 338 ASP B C   1 
ATOM   2553 O  O   . ASP A 1 341 ? 18.298  -13.575 47.762  1.00 47.79  ? 338 ASP B O   1 
ATOM   2554 C  CB  . ASP A 1 341 ? 19.426  -14.059 45.127  1.00 47.40  ? 338 ASP B CB  1 
ATOM   2555 C  CG  . ASP A 1 341 ? 20.297  -12.813 45.145  1.00 54.46  ? 338 ASP B CG  1 
ATOM   2556 O  OD1 . ASP A 1 341 ? 19.761  -11.693 45.003  1.00 58.79  ? 338 ASP B OD1 1 
ATOM   2557 O  OD2 . ASP A 1 341 ? 21.528  -12.961 45.295  1.00 54.98  ? 338 ASP B OD2 1 
ATOM   2558 N  N   . ARG A 1 342 ? 16.997  -12.011 46.780  1.00 37.95  ? 339 ARG B N   1 
ATOM   2559 C  CA  . ARG A 1 342 ? 16.620  -11.328 48.017  1.00 32.57  ? 339 ARG B CA  1 
ATOM   2560 C  C   . ARG A 1 342 ? 17.810  -10.681 48.712  1.00 37.53  ? 339 ARG B C   1 
ATOM   2561 O  O   . ARG A 1 342 ? 17.737  -10.344 49.892  1.00 43.42  ? 339 ARG B O   1 
ATOM   2562 C  CB  . ARG A 1 342 ? 15.927  -12.299 48.972  1.00 28.07  ? 339 ARG B CB  1 
ATOM   2563 C  CG  . ARG A 1 342 ? 14.787  -13.078 48.345  1.00 29.57  ? 339 ARG B CG  1 
ATOM   2564 C  CD  . ARG A 1 342 ? 14.195  -14.074 49.322  1.00 30.67  ? 339 ARG B CD  1 
ATOM   2565 N  NE  . ARG A 1 342 ? 15.207  -14.980 49.856  1.00 36.75  ? 339 ARG B NE  1 
ATOM   2566 C  CZ  . ARG A 1 342 ? 15.553  -16.132 49.290  1.00 41.21  ? 339 ARG B CZ  1 
ATOM   2567 N  NH1 . ARG A 1 342 ? 14.966  -16.524 48.167  1.00 42.64  ? 339 ARG B NH1 1 
ATOM   2568 N  NH2 . ARG A 1 342 ? 16.485  -16.892 49.849  1.00 38.85  ? 339 ARG B NH2 1 
ATOM   2569 N  N   . ARG A 1 343 ? 18.903  -10.506 47.978  1.00 38.62  ? 340 ARG B N   1 
ATOM   2570 C  CA  . ARG A 1 343 ? 20.124  -9.960  48.552  1.00 36.22  ? 340 ARG B CA  1 
ATOM   2571 C  C   . ARG A 1 343 ? 20.502  -8.638  47.905  1.00 34.53  ? 340 ARG B C   1 
ATOM   2572 O  O   . ARG A 1 343 ? 20.261  -8.420  46.718  1.00 38.26  ? 340 ARG B O   1 
ATOM   2573 C  CB  . ARG A 1 343 ? 21.280  -10.952 48.398  1.00 38.69  ? 340 ARG B CB  1 
ATOM   2574 C  CG  . ARG A 1 343 ? 21.039  -12.304 49.045  1.00 43.20  ? 340 ARG B CG  1 
ATOM   2575 C  CD  . ARG A 1 343 ? 21.020  -12.206 50.559  1.00 50.80  ? 340 ARG B CD  1 
ATOM   2576 N  NE  . ARG A 1 343 ? 20.896  -13.524 51.177  1.00 64.03  ? 340 ARG B NE  1 
ATOM   2577 C  CZ  . ARG A 1 343 ? 19.804  -13.967 51.793  1.00 65.26  ? 340 ARG B CZ  1 
ATOM   2578 N  NH1 . ARG A 1 343 ? 19.788  -15.184 52.318  1.00 66.95  ? 340 ARG B NH1 1 
ATOM   2579 N  NH2 . ARG A 1 343 ? 18.731  -13.194 51.891  1.00 66.09  ? 340 ARG B NH2 1 
ATOM   2580 N  N   . LEU A 1 344 ? 21.093  -7.752  48.693  1.00 34.32  ? 341 LEU B N   1 
ATOM   2581 C  CA  . LEU A 1 344 ? 21.666  -6.535  48.151  1.00 33.13  ? 341 LEU B CA  1 
ATOM   2582 C  C   . LEU A 1 344 ? 23.167  -6.563  48.400  1.00 34.63  ? 341 LEU B C   1 
ATOM   2583 O  O   . LEU A 1 344 ? 23.621  -6.528  49.546  1.00 27.94  ? 341 LEU B O   1 
ATOM   2584 C  CB  . LEU A 1 344 ? 21.018  -5.297  48.775  1.00 30.88  ? 341 LEU B CB  1 
ATOM   2585 C  CG  . LEU A 1 344 ? 21.360  -3.952  48.129  1.00 29.94  ? 341 LEU B CG  1 
ATOM   2586 C  CD1 . LEU A 1 344 ? 20.225  -2.962  48.326  1.00 28.59  ? 341 LEU B CD1 1 
ATOM   2587 C  CD2 . LEU A 1 344 ? 22.673  -3.393  48.670  1.00 21.31  ? 341 LEU B CD2 1 
ATOM   2588 N  N   . ASN A 1 345 ? 23.930  -6.651  47.315  1.00 34.11  ? 342 ASN B N   1 
ATOM   2589 C  CA  . ASN A 1 345 ? 25.381  -6.740  47.391  1.00 27.33  ? 342 ASN B CA  1 
ATOM   2590 C  C   . ASN A 1 345 ? 26.036  -5.387  47.184  1.00 33.06  ? 342 ASN B C   1 
ATOM   2591 O  O   . ASN A 1 345 ? 25.647  -4.628  46.294  1.00 29.76  ? 342 ASN B O   1 
ATOM   2592 C  CB  . ASN A 1 345 ? 25.911  -7.720  46.344  1.00 31.87  ? 342 ASN B CB  1 
ATOM   2593 C  CG  . ASN A 1 345 ? 25.447  -9.143  46.585  1.00 33.62  ? 342 ASN B CG  1 
ATOM   2594 O  OD1 . ASN A 1 345 ? 25.550  -9.995  45.705  1.00 38.10  ? 342 ASN B OD1 1 
ATOM   2595 N  ND2 . ASN A 1 345 ? 24.933  -9.408  47.779  1.00 38.51  ? 342 ASN B ND2 1 
ATOM   2596 N  N   . VAL A 1 346 ? 27.032  -5.089  48.014  1.00 33.03  ? 343 VAL B N   1 
ATOM   2597 C  CA  . VAL A 1 346 ? 27.812  -3.869  47.865  1.00 31.74  ? 343 VAL B CA  1 
ATOM   2598 C  C   . VAL A 1 346 ? 29.235  -4.218  47.433  1.00 38.53  ? 343 VAL B C   1 
ATOM   2599 O  O   . VAL A 1 346 ? 29.894  -5.055  48.054  1.00 35.55  ? 343 VAL B O   1 
ATOM   2600 C  CB  . VAL A 1 346 ? 27.841  -3.050  49.165  1.00 33.16  ? 343 VAL B CB  1 
ATOM   2601 C  CG1 . VAL A 1 346 ? 28.588  -1.737  48.953  1.00 25.10  ? 343 VAL B CG1 1 
ATOM   2602 C  CG2 . VAL A 1 346 ? 26.423  -2.790  49.659  1.00 29.24  ? 343 VAL B CG2 1 
ATOM   2603 N  N   . TRP A 1 347 ? 29.694  -3.579  46.360  1.00 37.67  ? 344 TRP B N   1 
ATOM   2604 C  CA  . TRP A 1 347 ? 30.999  -3.883  45.785  1.00 40.26  ? 344 TRP B CA  1 
ATOM   2605 C  C   . TRP A 1 347 ? 31.976  -2.718  45.928  1.00 43.50  ? 344 TRP B C   1 
ATOM   2606 O  O   . TRP A 1 347 ? 31.583  -1.551  45.857  1.00 42.31  ? 344 TRP B O   1 
ATOM   2607 C  CB  . TRP A 1 347 ? 30.865  -4.240  44.305  1.00 39.43  ? 344 TRP B CB  1 
ATOM   2608 C  CG  . TRP A 1 347 ? 29.719  -5.145  43.975  1.00 38.50  ? 344 TRP B CG  1 
ATOM   2609 C  CD1 . TRP A 1 347 ? 28.444  -4.770  43.670  1.00 39.84  ? 344 TRP B CD1 1 
ATOM   2610 C  CD2 . TRP A 1 347 ? 29.748  -6.575  43.893  1.00 42.47  ? 344 TRP B CD2 1 
ATOM   2611 N  NE1 . TRP A 1 347 ? 27.674  -5.876  43.409  1.00 40.59  ? 344 TRP B NE1 1 
ATOM   2612 C  CE2 . TRP A 1 347 ? 28.450  -6.998  43.538  1.00 41.98  ? 344 TRP B CE2 1 
ATOM   2613 C  CE3 . TRP A 1 347 ? 30.742  -7.540  44.089  1.00 43.70  ? 344 TRP B CE3 1 
ATOM   2614 C  CZ2 . TRP A 1 347 ? 28.121  -8.343  43.374  1.00 39.02  ? 344 TRP B CZ2 1 
ATOM   2615 C  CZ3 . TRP A 1 347 ? 30.414  -8.876  43.924  1.00 41.03  ? 344 TRP B CZ3 1 
ATOM   2616 C  CH2 . TRP A 1 347 ? 29.114  -9.264  43.572  1.00 41.07  ? 344 TRP B CH2 1 
ATOM   2617 N  N   . ASP A 1 348 ? 33.250  -3.051  46.119  1.00 42.53  ? 345 ASP B N   1 
ATOM   2618 C  CA  . ASP A 1 348 ? 34.317  -2.059  46.189  1.00 42.51  ? 345 ASP B CA  1 
ATOM   2619 C  C   . ASP A 1 348 ? 35.336  -2.323  45.083  1.00 47.68  ? 345 ASP B C   1 
ATOM   2620 O  O   . ASP A 1 348 ? 36.175  -3.219  45.204  1.00 51.21  ? 345 ASP B O   1 
ATOM   2621 C  CB  . ASP A 1 348 ? 34.995  -2.103  47.559  1.00 42.67  ? 345 ASP B CB  1 
ATOM   2622 C  CG  . ASP A 1 348 ? 35.999  -0.979  47.754  1.00 43.51  ? 345 ASP B CG  1 
ATOM   2623 O  OD1 . ASP A 1 348 ? 36.082  -0.086  46.882  1.00 45.37  ? 345 ASP B OD1 1 
ATOM   2624 O  OD2 . ASP A 1 348 ? 36.704  -0.987  48.785  1.00 40.79  ? 345 ASP B OD2 1 
ATOM   2625 N  N   . LEU A 1 349 ? 35.255  -1.541  44.009  1.00 46.16  ? 346 LEU B N   1 
ATOM   2626 C  CA  . LEU A 1 349 ? 36.105  -1.739  42.833  1.00 46.36  ? 346 LEU B CA  1 
ATOM   2627 C  C   . LEU A 1 349 ? 37.594  -1.705  43.157  1.00 48.81  ? 346 LEU B C   1 
ATOM   2628 O  O   . LEU A 1 349 ? 38.398  -2.339  42.472  1.00 48.37  ? 346 LEU B O   1 
ATOM   2629 C  CB  . LEU A 1 349 ? 35.802  -0.689  41.762  1.00 46.44  ? 346 LEU B CB  1 
ATOM   2630 C  CG  . LEU A 1 349 ? 34.443  -0.728  41.063  1.00 43.48  ? 346 LEU B CG  1 
ATOM   2631 C  CD1 . LEU A 1 349 ? 34.366  0.373   40.020  1.00 49.59  ? 346 LEU B CD1 1 
ATOM   2632 C  CD2 . LEU A 1 349 ? 34.218  -2.070  40.420  1.00 44.43  ? 346 LEU B CD2 1 
ATOM   2633 N  N   . SER A 1 350 ? 37.959  -0.964  44.200  1.00 46.89  ? 347 SER B N   1 
ATOM   2634 C  CA  . SER A 1 350 ? 39.364  -0.780  44.546  1.00 48.11  ? 347 SER B CA  1 
ATOM   2635 C  C   . SER A 1 350 ? 40.018  -2.065  45.054  1.00 49.01  ? 347 SER B C   1 
ATOM   2636 O  O   . SER A 1 350 ? 41.232  -2.114  45.249  1.00 54.41  ? 347 SER B O   1 
ATOM   2637 C  CB  . SER A 1 350 ? 39.524  0.339   45.577  1.00 47.83  ? 347 SER B CB  1 
ATOM   2638 O  OG  . SER A 1 350 ? 39.173  -0.107  46.875  1.00 57.15  ? 347 SER B OG  1 
ATOM   2639 N  N   . LYS A 1 351 ? 39.214  -3.103  45.262  1.00 46.38  ? 348 LYS B N   1 
ATOM   2640 C  CA  . LYS A 1 351 ? 39.729  -4.372  45.767  1.00 46.23  ? 348 LYS B CA  1 
ATOM   2641 C  C   . LYS A 1 351 ? 39.694  -5.482  44.714  1.00 48.36  ? 348 LYS B C   1 
ATOM   2642 O  O   . LYS A 1 351 ? 39.882  -6.655  45.035  1.00 46.46  ? 348 LYS B O   1 
ATOM   2643 C  CB  . LYS A 1 351 ? 38.965  -4.795  47.025  1.00 50.86  ? 348 LYS B CB  1 
ATOM   2644 C  CG  . LYS A 1 351 ? 39.032  -3.772  48.151  1.00 58.09  ? 348 LYS B CG  1 
ATOM   2645 C  CD  . LYS A 1 351 ? 38.449  -4.313  49.448  1.00 63.23  ? 348 LYS B CD  1 
ATOM   2646 C  CE  . LYS A 1 351 ? 38.640  -3.317  50.584  1.00 70.57  ? 348 LYS B CE  1 
ATOM   2647 N  NZ  . LYS A 1 351 ? 38.121  -3.822  51.887  1.00 71.04  ? 348 LYS B NZ  1 
ATOM   2648 N  N   . ILE A 1 352 ? 39.459  -5.106  43.460  1.00 50.26  ? 349 ILE B N   1 
ATOM   2649 C  CA  . ILE A 1 352 ? 39.450  -6.065  42.356  1.00 57.11  ? 349 ILE B CA  1 
ATOM   2650 C  C   . ILE A 1 352 ? 40.846  -6.627  42.093  1.00 65.88  ? 349 ILE B C   1 
ATOM   2651 O  O   . ILE A 1 352 ? 41.835  -5.894  42.122  1.00 68.35  ? 349 ILE B O   1 
ATOM   2652 C  CB  . ILE A 1 352 ? 38.918  -5.428  41.051  1.00 56.64  ? 349 ILE B CB  1 
ATOM   2653 C  CG1 . ILE A 1 352 ? 37.428  -5.108  41.170  1.00 57.70  ? 349 ILE B CG1 1 
ATOM   2654 C  CG2 . ILE A 1 352 ? 39.153  -6.351  39.863  1.00 50.98  ? 349 ILE B CG2 1 
ATOM   2655 C  CD1 . ILE A 1 352 ? 36.841  -4.487  39.919  1.00 55.28  ? 349 ILE B CD1 1 
ATOM   2656 N  N   . GLY A 1 353 ? 40.918  -7.933  41.843  1.00 71.46  ? 350 GLY B N   1 
ATOM   2657 C  CA  . GLY A 1 353 ? 42.175  -8.589  41.486  1.00 72.52  ? 350 GLY B CA  1 
ATOM   2658 C  C   . GLY A 1 353 ? 43.107  -8.806  42.662  1.00 73.35  ? 350 GLY B C   1 
ATOM   2659 O  O   . GLY A 1 353 ? 44.174  -9.403  42.520  1.00 76.65  ? 350 GLY B O   1 
ATOM   2660 N  N   . GLU A 1 354 ? 42.696  -8.316  43.826  1.00 73.08  ? 351 GLU B N   1 
ATOM   2661 C  CA  . GLU A 1 354 ? 43.478  -8.437  45.050  1.00 74.11  ? 351 GLU B CA  1 
ATOM   2662 C  C   . GLU A 1 354 ? 43.512  -9.882  45.553  1.00 75.21  ? 351 GLU B C   1 
ATOM   2663 O  O   . GLU A 1 354 ? 42.530  -10.614 45.431  1.00 74.28  ? 351 GLU B O   1 
ATOM   2664 C  CB  . GLU A 1 354 ? 42.912  -7.481  46.105  1.00 73.24  ? 351 GLU B CB  1 
ATOM   2665 C  CG  . GLU A 1 354 ? 43.082  -7.906  47.549  1.00 73.95  ? 351 GLU B CG  1 
ATOM   2666 C  CD  . GLU A 1 354 ? 42.308  -7.009  48.495  1.00 73.93  ? 351 GLU B CD  1 
ATOM   2667 O  OE1 . GLU A 1 354 ? 41.690  -7.532  49.445  1.00 73.16  ? 351 GLU B OE1 1 
ATOM   2668 O  OE2 . GLU A 1 354 ? 42.307  -5.778  48.276  1.00 75.02  ? 351 GLU B OE2 1 
ATOM   2669 N  N   . GLU A 1 355 ? 44.651  -10.289 46.105  1.00 81.63  ? 352 GLU B N   1 
ATOM   2670 C  CA  . GLU A 1 355 ? 44.839  -11.661 46.572  1.00 84.80  ? 352 GLU B CA  1 
ATOM   2671 C  C   . GLU A 1 355 ? 44.111  -11.922 47.889  1.00 79.75  ? 352 GLU B C   1 
ATOM   2672 O  O   . GLU A 1 355 ? 43.935  -11.015 48.701  1.00 79.68  ? 352 GLU B O   1 
ATOM   2673 C  CB  . GLU A 1 355 ? 46.330  -11.977 46.722  1.00 87.84  ? 352 GLU B CB  1 
ATOM   2674 C  CG  . GLU A 1 355 ? 47.045  -11.129 47.766  1.00 93.81  ? 352 GLU B CG  1 
ATOM   2675 C  CD  . GLU A 1 355 ? 48.537  -11.396 47.817  1.00 94.47  ? 352 GLU B CD  1 
ATOM   2676 O  OE1 . GLU A 1 355 ? 49.144  -11.603 46.745  1.00 98.20  ? 352 GLU B OE1 1 
ATOM   2677 O  OE2 . GLU A 1 355 ? 49.105  -11.393 48.930  1.00 96.44  ? 352 GLU B OE2 1 
ATOM   2678 N  N   . GLN A 1 356 ? 43.693  -13.168 48.091  0.50 76.85  ? 353 GLN B N   1 
ATOM   2679 C  CA  . GLN A 1 356 ? 42.970  -13.551 49.298  0.50 73.94  ? 353 GLN B CA  1 
ATOM   2680 C  C   . GLN A 1 356 ? 43.214  -15.014 49.658  0.50 73.03  ? 353 GLN B C   1 
ATOM   2681 O  O   . GLN A 1 356 ? 43.569  -15.823 48.801  1.00 67.43  ? 353 GLN B O   1 
ATOM   2682 C  CB  . GLN A 1 356 ? 41.470  -13.289 49.132  0.50 73.77  ? 353 GLN B CB  1 
ATOM   2683 C  CG  . GLN A 1 356 ? 40.860  -13.910 47.884  0.50 72.75  ? 353 GLN B CG  1 
ATOM   2684 C  CD  . GLN A 1 356 ? 39.388  -13.578 47.720  0.50 72.65  ? 353 GLN B CD  1 
ATOM   2685 O  OE1 . GLN A 1 356 ? 38.768  -13.936 46.718  0.50 69.71  ? 353 GLN B OE1 1 
ATOM   2686 N  NE2 . GLN A 1 356 ? 38.821  -12.890 48.704  0.50 71.19  ? 353 GLN B NE2 1 
ATOM   2687 N  N   . SER A 1 357 ? 43.020  -15.346 50.931  1.00 74.49  ? 354 SER B N   1 
ATOM   2688 C  CA  . SER A 1 357 ? 43.183  -16.717 51.404  1.00 79.50  ? 354 SER B CA  1 
ATOM   2689 C  C   . SER A 1 357 ? 42.078  -17.623 50.866  1.00 83.41  ? 354 SER B C   1 
ATOM   2690 O  O   . SER A 1 357 ? 41.121  -17.149 50.253  1.00 87.27  ? 354 SER B O   1 
ATOM   2691 C  CB  . SER A 1 357 ? 43.201  -16.758 52.934  1.00 80.84  ? 354 SER B CB  1 
ATOM   2692 O  OG  . SER A 1 357 ? 41.980  -16.279 53.473  1.00 80.66  ? 354 SER B OG  1 
ATOM   2693 N  N   . ALA A 1 358 ? 42.215  -18.925 51.100  1.00 86.00  ? 355 ALA B N   1 
ATOM   2694 C  CA  . ALA A 1 358 ? 41.244  -19.901 50.613  1.00 85.41  ? 355 ALA B CA  1 
ATOM   2695 C  C   . ALA A 1 358 ? 39.929  -19.833 51.385  1.00 85.28  ? 355 ALA B C   1 
ATOM   2696 O  O   . ALA A 1 358 ? 38.857  -20.035 50.817  1.00 85.46  ? 355 ALA B O   1 
ATOM   2697 C  CB  . ALA A 1 358 ? 41.828  -21.306 50.671  1.00 83.51  ? 355 ALA B CB  1 
ATOM   2698 N  N   . GLU A 1 359 ? 40.018  -19.546 52.680  0.50 86.83  ? 356 GLU B N   1 
ATOM   2699 C  CA  . GLU A 1 359 ? 38.833  -19.448 53.526  0.50 88.99  ? 356 GLU B CA  1 
ATOM   2700 C  C   . GLU A 1 359 ? 38.011  -18.200 53.208  0.50 88.88  ? 356 GLU B C   1 
ATOM   2701 O  O   . GLU A 1 359 ? 36.797  -18.178 53.413  1.00 91.39  ? 356 GLU B O   1 
ATOM   2702 C  CB  . GLU A 1 359 ? 39.221  -19.475 55.008  0.50 89.78  ? 356 GLU B CB  1 
ATOM   2703 C  CG  . GLU A 1 359 ? 40.290  -18.465 55.397  0.50 91.89  ? 356 GLU B CG  1 
ATOM   2704 C  CD  . GLU A 1 359 ? 40.732  -18.608 56.840  0.50 92.46  ? 356 GLU B CD  1 
ATOM   2705 O  OE1 . GLU A 1 359 ? 41.537  -17.772 57.302  0.50 93.19  ? 356 GLU B OE1 1 
ATOM   2706 O  OE2 . GLU A 1 359 ? 40.277  -19.556 57.514  0.50 95.03  ? 356 GLU B OE2 1 
ATOM   2707 N  N   . ASP A 1 360 ? 38.678  -17.166 52.704  1.00 86.90  ? 357 ASP B N   1 
ATOM   2708 C  CA  . ASP A 1 360 ? 38.000  -15.934 52.313  1.00 83.15  ? 357 ASP B CA  1 
ATOM   2709 C  C   . ASP A 1 360 ? 37.477  -16.013 50.884  1.00 80.52  ? 357 ASP B C   1 
ATOM   2710 O  O   . ASP A 1 360 ? 36.460  -15.403 50.553  1.00 83.06  ? 357 ASP B O   1 
ATOM   2711 C  CB  . ASP A 1 360 ? 38.928  -14.728 52.471  1.00 83.03  ? 357 ASP B CB  1 
ATOM   2712 C  CG  . ASP A 1 360 ? 39.039  -14.263 53.910  1.00 87.23  ? 357 ASP B CG  1 
ATOM   2713 O  OD1 . ASP A 1 360 ? 38.322  -14.816 54.769  1.00 86.43  ? 357 ASP B OD1 1 
ATOM   2714 O  OD2 . ASP A 1 360 ? 39.840  -13.344 54.183  1.00 90.17  ? 357 ASP B OD2 1 
ATOM   2715 N  N   . ALA A 1 361 ? 38.174  -16.770 50.042  1.00 77.27  ? 358 ALA B N   1 
ATOM   2716 C  CA  . ALA A 1 361 ? 37.784  -16.917 48.644  1.00 74.53  ? 358 ALA B CA  1 
ATOM   2717 C  C   . ALA A 1 361 ? 36.527  -17.768 48.504  1.00 70.26  ? 358 ALA B C   1 
ATOM   2718 O  O   . ALA A 1 361 ? 35.872  -17.752 47.462  1.00 67.36  ? 358 ALA B O   1 
ATOM   2719 C  CB  . ALA A 1 361 ? 38.925  -17.508 47.829  1.00 71.95  ? 358 ALA B CB  1 
ATOM   2720 N  N   . GLU A 1 362 ? 36.195  -18.507 49.557  0.50 69.11  ? 359 GLU B N   1 
ATOM   2721 C  CA  . GLU A 1 362 ? 35.000  -19.341 49.562  0.50 70.72  ? 359 GLU B CA  1 
ATOM   2722 C  C   . GLU A 1 362 ? 33.741  -18.502 49.743  0.50 68.28  ? 359 GLU B C   1 
ATOM   2723 O  O   . GLU A 1 362 ? 32.645  -18.930 49.387  1.00 69.35  ? 359 GLU B O   1 
ATOM   2724 C  CB  . GLU A 1 362 ? 35.087  -20.404 50.660  0.50 72.11  ? 359 GLU B CB  1 
ATOM   2725 C  CG  . GLU A 1 362 ? 36.064  -21.531 50.359  0.50 75.14  ? 359 GLU B CG  1 
ATOM   2726 C  CD  . GLU A 1 362 ? 36.168  -22.536 51.492  0.50 75.43  ? 359 GLU B CD  1 
ATOM   2727 O  OE1 . GLU A 1 362 ? 35.253  -22.576 52.343  0.50 76.77  ? 359 GLU B OE1 1 
ATOM   2728 O  OE2 . GLU A 1 362 ? 37.165  -23.288 51.530  0.50 76.43  ? 359 GLU B OE2 1 
ATOM   2729 N  N   . ASP A 1 363 ? 33.906  -17.305 50.296  0.50 67.28  ? 360 ASP B N   1 
ATOM   2730 C  CA  . ASP A 1 363 ? 32.779  -16.414 50.547  0.50 64.03  ? 360 ASP B CA  1 
ATOM   2731 C  C   . ASP A 1 363 ? 32.477  -15.524 49.346  0.50 63.62  ? 360 ASP B C   1 
ATOM   2732 O  O   . ASP A 1 363 ? 31.375  -14.994 49.218  1.00 68.42  ? 360 ASP B O   1 
ATOM   2733 C  CB  . ASP A 1 363 ? 33.037  -15.560 51.789  0.50 62.39  ? 360 ASP B CB  1 
ATOM   2734 C  CG  . ASP A 1 363 ? 33.072  -16.381 53.063  0.50 62.20  ? 360 ASP B CG  1 
ATOM   2735 O  OD1 . ASP A 1 363 ? 32.472  -17.477 53.082  0.50 59.56  ? 360 ASP B OD1 1 
ATOM   2736 O  OD2 . ASP A 1 363 ? 33.695  -15.930 54.046  0.50 62.15  ? 360 ASP B OD2 1 
ATOM   2737 N  N   . GLY A 1 364 ? 33.459  -15.366 48.466  1.00 62.31  ? 361 GLY B N   1 
ATOM   2738 C  CA  . GLY A 1 364 ? 33.277  -14.565 47.262  1.00 57.36  ? 361 GLY B CA  1 
ATOM   2739 C  C   . GLY A 1 364 ? 34.524  -13.807 46.851  1.00 54.70  ? 361 GLY B C   1 
ATOM   2740 O  O   . GLY A 1 364 ? 35.547  -13.870 47.535  1.00 57.42  ? 361 GLY B O   1 
ATOM   2741 N  N   . PRO A 1 365 ? 34.444  -13.077 45.728  1.00 53.01  ? 362 PRO B N   1 
ATOM   2742 C  CA  . PRO A 1 365 ? 35.566  -12.310 45.202  1.00 49.30  ? 362 PRO B CA  1 
ATOM   2743 C  C   . PRO A 1 365 ? 35.959  -11.191 46.162  1.00 53.08  ? 362 PRO B C   1 
ATOM   2744 O  O   . PRO A 1 365 ? 35.148  -10.788 46.995  1.00 53.95  ? 362 PRO B O   1 
ATOM   2745 C  CB  . PRO A 1 365 ? 35.010  -11.732 43.895  1.00 49.45  ? 362 PRO B CB  1 
ATOM   2746 C  CG  . PRO A 1 365 ? 33.536  -11.724 44.076  1.00 49.43  ? 362 PRO B CG  1 
ATOM   2747 C  CD  . PRO A 1 365 ? 33.238  -12.938 44.891  1.00 51.86  ? 362 PRO B CD  1 
ATOM   2748 N  N   . PRO A 1 366 ? 37.202  -10.695 46.050  1.00 53.00  ? 363 PRO B N   1 
ATOM   2749 C  CA  . PRO A 1 366 ? 37.725  -9.678  46.962  1.00 48.61  ? 363 PRO B CA  1 
ATOM   2750 C  C   . PRO A 1 366 ? 36.955  -8.358  46.917  1.00 48.64  ? 363 PRO B C   1 
ATOM   2751 O  O   . PRO A 1 366 ? 36.941  -7.623  47.905  1.00 48.78  ? 363 PRO B O   1 
ATOM   2752 C  CB  . PRO A 1 366 ? 39.162  -9.470  46.468  1.00 47.00  ? 363 PRO B CB  1 
ATOM   2753 C  CG  . PRO A 1 366 ? 39.156  -9.938  45.055  1.00 49.32  ? 363 PRO B CG  1 
ATOM   2754 C  CD  . PRO A 1 366 ? 38.195  -11.082 45.033  1.00 51.83  ? 363 PRO B CD  1 
ATOM   2755 N  N   . GLU A 1 367 ? 36.321  -8.058  45.787  1.00 43.84  ? 364 GLU B N   1 
ATOM   2756 C  CA  . GLU A 1 367 ? 35.599  -6.795  45.640  1.00 47.04  ? 364 GLU B CA  1 
ATOM   2757 C  C   . GLU A 1 367 ? 34.231  -6.823  46.321  1.00 45.50  ? 364 GLU B C   1 
ATOM   2758 O  O   . GLU A 1 367 ? 33.547  -5.804  46.395  1.00 44.13  ? 364 GLU B O   1 
ATOM   2759 C  CB  . GLU A 1 367 ? 35.459  -6.401  44.165  1.00 46.38  ? 364 GLU B CB  1 
ATOM   2760 C  CG  . GLU A 1 367 ? 34.548  -7.301  43.344  1.00 48.16  ? 364 GLU B CG  1 
ATOM   2761 C  CD  . GLU A 1 367 ? 35.276  -8.492  42.759  1.00 51.31  ? 364 GLU B CD  1 
ATOM   2762 O  OE1 . GLU A 1 367 ? 36.353  -8.852  43.280  1.00 50.57  ? 364 GLU B OE1 1 
ATOM   2763 O  OE2 . GLU A 1 367 ? 34.771  -9.069  41.774  1.00 52.95  ? 364 GLU B OE2 1 
ATOM   2764 N  N   . LEU A 1 368 ? 33.837  -7.992  46.816  1.00 42.82  ? 365 LEU B N   1 
ATOM   2765 C  CA  . LEU A 1 368 ? 32.579  -8.122  47.537  1.00 40.84  ? 365 LEU B CA  1 
ATOM   2766 C  C   . LEU A 1 368 ? 32.726  -7.570  48.948  1.00 38.11  ? 365 LEU B C   1 
ATOM   2767 O  O   . LEU A 1 368 ? 33.339  -8.198  49.811  1.00 41.35  ? 365 LEU B O   1 
ATOM   2768 C  CB  . LEU A 1 368 ? 32.120  -9.582  47.580  1.00 36.81  ? 365 LEU B CB  1 
ATOM   2769 C  CG  . LEU A 1 368 ? 30.818  -9.851  48.339  1.00 37.21  ? 365 LEU B CG  1 
ATOM   2770 C  CD1 . LEU A 1 368 ? 29.637  -9.180  47.653  1.00 34.03  ? 365 LEU B CD1 1 
ATOM   2771 C  CD2 . LEU A 1 368 ? 30.581  -11.345 48.479  1.00 43.03  ? 365 LEU B CD2 1 
ATOM   2772 N  N   . LEU A 1 369 ? 32.150  -6.394  49.173  1.00 37.38  ? 366 LEU B N   1 
ATOM   2773 C  CA  . LEU A 1 369 ? 32.295  -5.687  50.437  1.00 33.90  ? 366 LEU B CA  1 
ATOM   2774 C  C   . LEU A 1 369 ? 31.281  -6.156  51.479  1.00 36.84  ? 366 LEU B C   1 
ATOM   2775 O  O   . LEU A 1 369 ? 31.630  -6.387  52.638  1.00 41.85  ? 366 LEU B O   1 
ATOM   2776 C  CB  . LEU A 1 369 ? 32.122  -4.184  50.207  1.00 38.07  ? 366 LEU B CB  1 
ATOM   2777 C  CG  . LEU A 1 369 ? 32.973  -3.185  50.999  1.00 45.04  ? 366 LEU B CG  1 
ATOM   2778 C  CD1 . LEU A 1 369 ? 32.199  -1.880  51.177  1.00 37.11  ? 366 LEU B CD1 1 
ATOM   2779 C  CD2 . LEU A 1 369 ? 33.424  -3.738  52.349  1.00 36.64  ? 366 LEU B CD2 1 
ATOM   2780 N  N   . PHE A 1 370 ? 30.026  -6.292  51.063  1.00 33.35  ? 367 PHE B N   1 
ATOM   2781 C  CA  . PHE A 1 370 ? 28.928  -6.479  52.004  1.00 32.26  ? 367 PHE B CA  1 
ATOM   2782 C  C   . PHE A 1 370 ? 27.728  -7.136  51.329  1.00 33.76  ? 367 PHE B C   1 
ATOM   2783 O  O   . PHE A 1 370 ? 27.373  -6.790  50.201  1.00 42.46  ? 367 PHE B O   1 
ATOM   2784 C  CB  . PHE A 1 370 ? 28.517  -5.114  52.567  1.00 28.43  ? 367 PHE B CB  1 
ATOM   2785 C  CG  . PHE A 1 370 ? 27.544  -5.181  53.712  1.00 26.83  ? 367 PHE B CG  1 
ATOM   2786 C  CD1 . PHE A 1 370 ? 27.995  -5.332  55.017  1.00 25.46  ? 367 PHE B CD1 1 
ATOM   2787 C  CD2 . PHE A 1 370 ? 26.180  -5.059  53.488  1.00 19.09  ? 367 PHE B CD2 1 
ATOM   2788 C  CE1 . PHE A 1 370 ? 27.103  -5.377  56.079  1.00 23.03  ? 367 PHE B CE1 1 
ATOM   2789 C  CE2 . PHE A 1 370 ? 25.281  -5.106  54.542  1.00 23.98  ? 367 PHE B CE2 1 
ATOM   2790 C  CZ  . PHE A 1 370 ? 25.744  -5.265  55.840  1.00 25.99  ? 367 PHE B CZ  1 
ATOM   2791 N  N   . ILE A 1 371 ? 27.108  -8.084  52.021  0.50 25.00  ? 368 ILE B N   1 
ATOM   2792 C  CA  . ILE A 1 371 ? 25.862  -8.666  51.549  0.50 22.90  ? 368 ILE B CA  1 
ATOM   2793 C  C   . ILE A 1 371 ? 24.751  -8.348  52.535  0.50 25.86  ? 368 ILE B C   1 
ATOM   2794 O  O   . ILE A 1 371 ? 24.771  -8.803  53.678  1.00 33.25  ? 368 ILE B O   1 
ATOM   2795 C  CB  . ILE A 1 371 ? 25.963  -10.191 51.350  0.50 23.85  ? 368 ILE B CB  1 
ATOM   2796 C  CG1 . ILE A 1 371 ? 27.013  -10.522 50.287  0.50 24.83  ? 368 ILE B CG1 1 
ATOM   2797 C  CG2 . ILE A 1 371 ? 24.608  -10.765 50.955  0.50 10.06  ? 368 ILE B CG2 1 
ATOM   2798 C  CD1 . ILE A 1 371 ? 27.048  -11.983 49.890  0.50 28.04  ? 368 ILE B CD1 1 
ATOM   2799 N  N   . HIS A 1 372 ? 23.788  -7.550  52.089  1.00 33.07  ? 369 HIS B N   1 
ATOM   2800 C  CA  . HIS A 1 372 ? 22.646  -7.193  52.918  1.00 29.73  ? 369 HIS B CA  1 
ATOM   2801 C  C   . HIS A 1 372 ? 21.589  -8.287  52.832  1.00 28.41  ? 369 HIS B C   1 
ATOM   2802 O  O   . HIS A 1 372 ? 21.024  -8.532  51.764  1.00 36.28  ? 369 HIS B O   1 
ATOM   2803 C  CB  . HIS A 1 372 ? 22.072  -5.847  52.474  1.00 28.29  ? 369 HIS B CB  1 
ATOM   2804 C  CG  . HIS A 1 372 ? 20.820  -5.453  53.194  1.00 29.65  ? 369 HIS B CG  1 
ATOM   2805 N  ND1 . HIS A 1 372 ? 20.795  -5.163  54.541  1.00 28.30  ? 369 HIS B ND1 1 
ATOM   2806 C  CD2 . HIS A 1 372 ? 19.552  -5.288  52.750  1.00 23.18  ? 369 HIS B CD2 1 
ATOM   2807 C  CE1 . HIS A 1 372 ? 19.564  -4.847  54.899  1.00 21.81  ? 369 HIS B CE1 1 
ATOM   2808 N  NE2 . HIS A 1 372 ? 18.790  -4.914  53.830  1.00 24.02  ? 369 HIS B NE2 1 
ATOM   2809 N  N   . GLY A 1 373 ? 21.330  -8.948  53.956  1.00 26.74  ? 370 GLY B N   1 
ATOM   2810 C  CA  . GLY A 1 373 ? 20.362  -10.040 53.995  1.00 27.39  ? 370 GLY B CA  1 
ATOM   2811 C  C   . GLY A 1 373 ? 19.186  -9.789  54.918  1.00 26.48  ? 370 GLY B C   1 
ATOM   2812 O  O   . GLY A 1 373 ? 18.758  -10.681 55.647  1.00 28.39  ? 370 GLY B O   1 
ATOM   2813 N  N   . GLY A 1 374 ? 18.652  -8.573  54.880  1.00 31.09  ? 371 GLY B N   1 
ATOM   2814 C  CA  . GLY A 1 374 ? 17.531  -8.211  55.740  1.00 34.65  ? 371 GLY B CA  1 
ATOM   2815 C  C   . GLY A 1 374 ? 16.172  -8.460  55.118  1.00 33.31  ? 371 GLY B C   1 
ATOM   2816 O  O   . GLY A 1 374 ? 15.157  -8.483  55.813  1.00 37.86  ? 371 GLY B O   1 
ATOM   2817 N  N   . HIS A 1 375 ? 16.147  -8.645  53.803  1.00 29.53  ? 372 HIS B N   1 
ATOM   2818 C  CA  . HIS A 1 375 ? 14.888  -8.848  53.102  1.00 27.99  ? 372 HIS B CA  1 
ATOM   2819 C  C   . HIS A 1 375 ? 14.547  -10.324 52.963  1.00 30.07  ? 372 HIS B C   1 
ATOM   2820 O  O   . HIS A 1 375 ? 15.430  -11.168 52.807  1.00 37.14  ? 372 HIS B O   1 
ATOM   2821 C  CB  . HIS A 1 375 ? 14.906  -8.164  51.737  1.00 23.25  ? 372 HIS B CB  1 
ATOM   2822 C  CG  . HIS A 1 375 ? 14.829  -6.672  51.815  1.00 26.56  ? 372 HIS B CG  1 
ATOM   2823 N  ND1 . HIS A 1 375 ? 13.639  -5.997  51.976  1.00 29.63  ? 372 HIS B ND1 1 
ATOM   2824 C  CD2 . HIS A 1 375 ? 15.795  -5.725  51.762  1.00 28.95  ? 372 HIS B CD2 1 
ATOM   2825 C  CE1 . HIS A 1 375 ? 13.874  -4.697  52.014  1.00 30.07  ? 372 HIS B CE1 1 
ATOM   2826 N  NE2 . HIS A 1 375 ? 15.175  -4.505  51.887  1.00 32.82  ? 372 HIS B NE2 1 
ATOM   2827 N  N   . THR A 1 376 ? 13.255  -10.622 53.026  1.00 27.46  ? 373 THR B N   1 
ATOM   2828 C  CA  . THR A 1 376 ? 12.779  -11.995 52.990  1.00 27.37  ? 373 THR B CA  1 
ATOM   2829 C  C   . THR A 1 376 ? 12.031  -12.289 51.692  1.00 28.00  ? 373 THR B C   1 
ATOM   2830 O  O   . THR A 1 376 ? 11.412  -13.343 51.545  1.00 28.46  ? 373 THR B O   1 
ATOM   2831 C  CB  . THR A 1 376 ? 11.881  -12.290 54.199  1.00 26.68  ? 373 THR B CB  1 
ATOM   2832 O  OG1 . THR A 1 376 ? 10.950  -11.215 54.369  1.00 34.23  ? 373 THR B OG1 1 
ATOM   2833 C  CG2 . THR A 1 376 ? 12.724  -12.412 55.462  1.00 23.10  ? 373 THR B CG2 1 
ATOM   2834 N  N   . ALA A 1 377 ? 12.097  -11.346 50.756  1.00 21.82  ? 374 ALA B N   1 
ATOM   2835 C  CA  . ALA A 1 377 ? 11.549  -11.530 49.417  1.00 25.86  ? 374 ALA B CA  1 
ATOM   2836 C  C   . ALA A 1 377 ? 12.346  -10.699 48.417  1.00 30.63  ? 374 ALA B C   1 
ATOM   2837 O  O   . ALA A 1 377 ? 13.216  -9.917  48.804  1.00 31.13  ? 374 ALA B O   1 
ATOM   2838 C  CB  . ALA A 1 377 ? 10.081  -11.150 49.378  1.00 21.43  ? 374 ALA B CB  1 
ATOM   2839 N  N   . LYS A 1 378 ? 12.053  -10.875 47.132  1.00 32.31  ? 375 LYS B N   1 
ATOM   2840 C  CA  . LYS A 1 378 ? 12.763  -10.157 46.082  1.00 34.42  ? 375 LYS B CA  1 
ATOM   2841 C  C   . LYS A 1 378 ? 12.814  -8.661  46.363  1.00 33.08  ? 375 LYS B C   1 
ATOM   2842 O  O   . LYS A 1 378 ? 11.815  -8.064  46.756  1.00 35.79  ? 375 LYS B O   1 
ATOM   2843 C  CB  . LYS A 1 378 ? 12.107  -10.398 44.721  1.00 38.00  ? 375 LYS B CB  1 
ATOM   2844 C  CG  . LYS A 1 378 ? 12.657  -9.504  43.615  1.00 43.37  ? 375 LYS B CG  1 
ATOM   2845 C  CD  . LYS A 1 378 ? 11.946  -9.720  42.293  1.00 44.05  ? 375 LYS B CD  1 
ATOM   2846 C  CE  . LYS A 1 378 ? 12.418  -8.715  41.253  1.00 46.13  ? 375 LYS B CE  1 
ATOM   2847 N  NZ  . LYS A 1 378 ? 11.746  -8.909  39.937  1.00 46.94  ? 375 LYS B NZ  1 
ATOM   2848 N  N   . ILE A 1 379 ? 13.984  -8.062  46.163  1.00 31.85  ? 376 ILE B N   1 
ATOM   2849 C  CA  . ILE A 1 379 ? 14.136  -6.618  46.274  1.00 29.76  ? 376 ILE B CA  1 
ATOM   2850 C  C   . ILE A 1 379 ? 13.778  -5.963  44.943  1.00 33.35  ? 376 ILE B C   1 
ATOM   2851 O  O   . ILE A 1 379 ? 14.385  -6.258  43.915  1.00 42.73  ? 376 ILE B O   1 
ATOM   2852 C  CB  . ILE A 1 379 ? 15.572  -6.237  46.698  1.00 30.83  ? 376 ILE B CB  1 
ATOM   2853 C  CG1 . ILE A 1 379 ? 15.861  -6.768  48.106  1.00 25.73  ? 376 ILE B CG1 1 
ATOM   2854 C  CG2 . ILE A 1 379 ? 15.770  -4.727  46.645  1.00 23.75  ? 376 ILE B CG2 1 
ATOM   2855 C  CD1 . ILE A 1 379 ? 17.316  -6.728  48.499  1.00 22.39  ? 376 ILE B CD1 1 
ATOM   2856 N  N   . SER A 1 380 ? 12.782  -5.081  44.968  1.00 38.43  ? 377 SER B N   1 
ATOM   2857 C  CA  . SER A 1 380 ? 12.271  -4.449  43.750  1.00 34.49  ? 377 SER B CA  1 
ATOM   2858 C  C   . SER A 1 380 ? 13.070  -3.217  43.347  1.00 32.73  ? 377 SER B C   1 
ATOM   2859 O  O   . SER A 1 380 ? 13.128  -2.862  42.170  1.00 37.63  ? 377 SER B O   1 
ATOM   2860 C  CB  . SER A 1 380 ? 10.803  -4.062  43.928  1.00 39.55  ? 377 SER B CB  1 
ATOM   2861 O  OG  . SER A 1 380 ? 10.014  -5.189  44.266  1.00 56.03  ? 377 SER B OG  1 
ATOM   2862 N  N   . ASP A 1 381 ? 13.677  -2.563  44.330  1.00 33.50  ? 378 ASP B N   1 
ATOM   2863 C  CA  . ASP A 1 381 ? 14.421  -1.337  44.090  1.00 33.28  ? 378 ASP B CA  1 
ATOM   2864 C  C   . ASP A 1 381 ? 15.130  -0.940  45.370  1.00 32.31  ? 378 ASP B C   1 
ATOM   2865 O  O   . ASP A 1 381 ? 14.793  -1.425  46.450  1.00 33.22  ? 378 ASP B O   1 
ATOM   2866 C  CB  . ASP A 1 381 ? 13.472  -0.212  43.656  1.00 36.30  ? 378 ASP B CB  1 
ATOM   2867 C  CG  . ASP A 1 381 ? 14.181  0.901   42.890  1.00 38.37  ? 378 ASP B CG  1 
ATOM   2868 O  OD1 . ASP A 1 381 ? 15.418  0.839   42.738  1.00 33.58  ? 378 ASP B OD1 1 
ATOM   2869 O  OD2 . ASP A 1 381 ? 13.494  1.841   42.433  1.00 37.48  ? 378 ASP B OD2 1 
ATOM   2870 N  N   . PHE A 1 382 ? 16.120  -0.065  45.244  1.00 29.62  ? 379 PHE B N   1 
ATOM   2871 C  CA  . PHE A 1 382 ? 16.778  0.519   46.401  1.00 31.51  ? 379 PHE B CA  1 
ATOM   2872 C  C   . PHE A 1 382 ? 17.326  1.883   46.022  1.00 29.86  ? 379 PHE B C   1 
ATOM   2873 O  O   . PHE A 1 382 ? 17.326  2.246   44.846  1.00 23.40  ? 379 PHE B O   1 
ATOM   2874 C  CB  . PHE A 1 382 ? 17.883  -0.393  46.942  1.00 31.50  ? 379 PHE B CB  1 
ATOM   2875 C  CG  . PHE A 1 382 ? 19.085  -0.489  46.054  1.00 29.37  ? 379 PHE B CG  1 
ATOM   2876 C  CD1 . PHE A 1 382 ? 19.137  -1.429  45.034  1.00 29.06  ? 379 PHE B CD1 1 
ATOM   2877 C  CD2 . PHE A 1 382 ? 20.174  0.346   46.249  1.00 29.15  ? 379 PHE B CD2 1 
ATOM   2878 C  CE1 . PHE A 1 382 ? 20.248  -1.526  44.213  1.00 28.18  ? 379 PHE B CE1 1 
ATOM   2879 C  CE2 . PHE A 1 382 ? 21.292  0.254   45.431  1.00 32.79  ? 379 PHE B CE2 1 
ATOM   2880 C  CZ  . PHE A 1 382 ? 21.327  -0.683  44.412  1.00 30.72  ? 379 PHE B CZ  1 
ATOM   2881 N  N   . SER A 1 383 ? 17.789  2.635   47.016  1.00 25.35  ? 380 SER B N   1 
ATOM   2882 C  CA  . SER A 1 383 ? 18.240  3.999   46.784  1.00 26.87  ? 380 SER B CA  1 
ATOM   2883 C  C   . SER A 1 383 ? 19.300  4.437   47.790  1.00 31.11  ? 380 SER B C   1 
ATOM   2884 O  O   . SER A 1 383 ? 19.109  4.331   49.004  1.00 29.82  ? 380 SER B O   1 
ATOM   2885 C  CB  . SER A 1 383 ? 17.047  4.962   46.824  1.00 31.19  ? 380 SER B CB  1 
ATOM   2886 O  OG  . SER A 1 383 ? 17.447  6.294   46.553  1.00 32.43  ? 380 SER B OG  1 
ATOM   2887 N  N   . TRP A 1 384 ? 20.421  4.929   47.272  1.00 29.80  ? 381 TRP B N   1 
ATOM   2888 C  CA  . TRP A 1 384 ? 21.470  5.487   48.108  1.00 28.47  ? 381 TRP B CA  1 
ATOM   2889 C  C   . TRP A 1 384 ? 21.036  6.853   48.629  1.00 33.28  ? 381 TRP B C   1 
ATOM   2890 O  O   . TRP A 1 384 ? 20.587  7.703   47.858  1.00 31.98  ? 381 TRP B O   1 
ATOM   2891 C  CB  . TRP A 1 384 ? 22.756  5.662   47.307  1.00 23.54  ? 381 TRP B CB  1 
ATOM   2892 C  CG  . TRP A 1 384 ? 23.510  4.406   46.988  1.00 23.94  ? 381 TRP B CG  1 
ATOM   2893 C  CD1 . TRP A 1 384 ? 23.440  3.677   45.835  1.00 23.74  ? 381 TRP B CD1 1 
ATOM   2894 C  CD2 . TRP A 1 384 ? 24.487  3.756   47.815  1.00 24.36  ? 381 TRP B CD2 1 
ATOM   2895 N  NE1 . TRP A 1 384 ? 24.303  2.607   45.897  1.00 29.57  ? 381 TRP B NE1 1 
ATOM   2896 C  CE2 . TRP A 1 384 ? 24.955  2.631   47.103  1.00 26.64  ? 381 TRP B CE2 1 
ATOM   2897 C  CE3 . TRP A 1 384 ? 25.008  4.013   49.087  1.00 16.98  ? 381 TRP B CE3 1 
ATOM   2898 C  CZ2 . TRP A 1 384 ? 25.918  1.766   47.622  1.00 27.32  ? 381 TRP B CZ2 1 
ATOM   2899 C  CZ3 . TRP A 1 384 ? 25.962  3.152   49.603  1.00 20.89  ? 381 TRP B CZ3 1 
ATOM   2900 C  CH2 . TRP A 1 384 ? 26.409  2.043   48.871  1.00 26.17  ? 381 TRP B CH2 1 
ATOM   2901 N  N   . ASN A 1 385 ? 21.175  7.061   49.933  1.00 30.66  ? 382 ASN B N   1 
ATOM   2902 C  CA  . ASN A 1 385 ? 20.888  8.356   50.530  1.00 31.20  ? 382 ASN B CA  1 
ATOM   2903 C  C   . ASN A 1 385 ? 21.921  9.388   50.097  1.00 30.69  ? 382 ASN B C   1 
ATOM   2904 O  O   . ASN A 1 385 ? 23.117  9.181   50.281  1.00 33.63  ? 382 ASN B O   1 
ATOM   2905 C  CB  . ASN A 1 385 ? 20.851  8.248   52.053  1.00 30.20  ? 382 ASN B CB  1 
ATOM   2906 C  CG  . ASN A 1 385 ? 20.353  9.514   52.711  1.00 34.13  ? 382 ASN B CG  1 
ATOM   2907 O  OD1 . ASN A 1 385 ? 21.011  10.553  52.662  1.00 33.89  ? 382 ASN B OD1 1 
ATOM   2908 N  ND2 . ASN A 1 385 ? 19.183  9.433   53.338  1.00 34.75  ? 382 ASN B ND2 1 
ATOM   2909 N  N   . PRO A 1 386 ? 21.457  10.508  49.522  1.00 34.59  ? 383 PRO B N   1 
ATOM   2910 C  CA  . PRO A 1 386 ? 22.350  11.508  48.950  1.00 33.47  ? 383 PRO B CA  1 
ATOM   2911 C  C   . PRO A 1 386 ? 22.955  12.441  49.995  1.00 31.55  ? 383 PRO B C   1 
ATOM   2912 O  O   . PRO A 1 386 ? 23.872  13.197  49.681  1.00 29.47  ? 383 PRO B O   1 
ATOM   2913 C  CB  . PRO A 1 386 ? 21.426  12.292  48.019  1.00 28.26  ? 383 PRO B CB  1 
ATOM   2914 C  CG  . PRO A 1 386 ? 20.103  12.228  48.687  1.00 29.49  ? 383 PRO B CG  1 
ATOM   2915 C  CD  . PRO A 1 386 ? 20.041  10.893  49.385  1.00 34.80  ? 383 PRO B CD  1 
ATOM   2916 N  N   . ASN A 1 387 ? 22.452  12.378  51.224  1.00 30.45  ? 384 ASN B N   1 
ATOM   2917 C  CA  . ASN A 1 387 ? 22.878  13.299  52.275  1.00 35.04  ? 384 ASN B CA  1 
ATOM   2918 C  C   . ASN A 1 387 ? 23.616  12.624  53.424  1.00 38.64  ? 384 ASN B C   1 
ATOM   2919 O  O   . ASN A 1 387 ? 24.403  13.261  54.121  1.00 43.28  ? 384 ASN B O   1 
ATOM   2920 C  CB  . ASN A 1 387 ? 21.679  14.080  52.813  1.00 37.03  ? 384 ASN B CB  1 
ATOM   2921 C  CG  . ASN A 1 387 ? 21.120  15.056  51.799  1.00 43.04  ? 384 ASN B CG  1 
ATOM   2922 O  OD1 . ASN A 1 387 ? 19.991  14.905  51.334  1.00 49.31  ? 384 ASN B OD1 1 
ATOM   2923 N  ND2 . ASN A 1 387 ? 21.914  16.062  51.443  1.00 37.27  ? 384 ASN B ND2 1 
ATOM   2924 N  N   . GLU A 1 388 ? 23.346  11.338  53.624  1.00 41.89  ? 385 GLU B N   1 
ATOM   2925 C  CA  . GLU A 1 388 ? 24.032  10.554  54.643  1.00 36.89  ? 385 GLU B CA  1 
ATOM   2926 C  C   . GLU A 1 388 ? 24.782  9.392   54.009  1.00 36.54  ? 385 GLU B C   1 
ATOM   2927 O  O   . GLU A 1 388 ? 24.169  8.424   53.561  1.00 40.70  ? 385 GLU B O   1 
ATOM   2928 C  CB  . GLU A 1 388 ? 23.044  10.032  55.685  1.00 37.54  ? 385 GLU B CB  1 
ATOM   2929 C  CG  . GLU A 1 388 ? 22.772  11.003  56.818  1.00 54.21  ? 385 GLU B CG  1 
ATOM   2930 C  CD  . GLU A 1 388 ? 23.942  11.132  57.779  1.00 58.01  ? 385 GLU B CD  1 
ATOM   2931 O  OE1 . GLU A 1 388 ? 24.790  10.216  57.815  1.00 60.17  ? 385 GLU B OE1 1 
ATOM   2932 O  OE2 . GLU A 1 388 ? 24.008  12.147  58.505  1.00 61.41  ? 385 GLU B OE2 1 
ATOM   2933 N  N   . PRO A 1 389 ? 26.118  9.488   53.967  1.00 39.27  ? 386 PRO B N   1 
ATOM   2934 C  CA  . PRO A 1 389 ? 26.955  8.454   53.370  1.00 37.90  ? 386 PRO B CA  1 
ATOM   2935 C  C   . PRO A 1 389 ? 26.646  7.064   53.918  1.00 35.40  ? 386 PRO B C   1 
ATOM   2936 O  O   . PRO A 1 389 ? 26.468  6.898   55.126  1.00 31.21  ? 386 PRO B O   1 
ATOM   2937 C  CB  . PRO A 1 389 ? 28.368  8.883   53.773  1.00 35.74  ? 386 PRO B CB  1 
ATOM   2938 C  CG  . PRO A 1 389 ? 28.273  10.365  53.901  1.00 29.92  ? 386 PRO B CG  1 
ATOM   2939 C  CD  . PRO A 1 389 ? 26.917  10.613  54.487  1.00 32.71  ? 386 PRO B CD  1 
ATOM   2940 N  N   . TRP A 1 390 ? 26.565  6.087   53.016  1.00 35.72  ? 387 TRP B N   1 
ATOM   2941 C  CA  . TRP A 1 390 ? 26.395  4.676   53.376  1.00 35.56  ? 387 TRP B CA  1 
ATOM   2942 C  C   . TRP A 1 390 ? 24.998  4.304   53.878  1.00 36.30  ? 387 TRP B C   1 
ATOM   2943 O  O   . TRP A 1 390 ? 24.756  3.161   54.265  1.00 45.59  ? 387 TRP B O   1 
ATOM   2944 C  CB  . TRP A 1 390 ? 27.469  4.237   54.376  1.00 35.06  ? 387 TRP B CB  1 
ATOM   2945 C  CG  . TRP A 1 390 ? 28.839  4.292   53.792  1.00 36.06  ? 387 TRP B CG  1 
ATOM   2946 C  CD1 . TRP A 1 390 ? 29.738  5.315   53.899  1.00 32.54  ? 387 TRP B CD1 1 
ATOM   2947 C  CD2 . TRP A 1 390 ? 29.463  3.291   52.982  1.00 36.46  ? 387 TRP B CD2 1 
ATOM   2948 N  NE1 . TRP A 1 390 ? 30.887  5.007   53.212  1.00 31.96  ? 387 TRP B NE1 1 
ATOM   2949 C  CE2 . TRP A 1 390 ? 30.745  3.769   52.641  1.00 32.84  ? 387 TRP B CE2 1 
ATOM   2950 C  CE3 . TRP A 1 390 ? 29.066  2.032   52.518  1.00 33.81  ? 387 TRP B CE3 1 
ATOM   2951 C  CZ2 . TRP A 1 390 ? 31.631  3.034   51.857  1.00 32.90  ? 387 TRP B CZ2 1 
ATOM   2952 C  CZ3 . TRP A 1 390 ? 29.947  1.305   51.739  1.00 35.35  ? 387 TRP B CZ3 1 
ATOM   2953 C  CH2 . TRP A 1 390 ? 31.215  1.807   51.416  1.00 35.09  ? 387 TRP B CH2 1 
ATOM   2954 N  N   . VAL A 1 391 ? 24.081  5.263   53.868  1.00 32.30  ? 388 VAL B N   1 
ATOM   2955 C  CA  . VAL A 1 391 ? 22.696  4.974   54.212  1.00 34.56  ? 388 VAL B CA  1 
ATOM   2956 C  C   . VAL A 1 391 ? 21.918  4.594   52.956  1.00 34.81  ? 388 VAL B C   1 
ATOM   2957 O  O   . VAL A 1 391 ? 21.938  5.316   51.958  1.00 28.08  ? 388 VAL B O   1 
ATOM   2958 C  CB  . VAL A 1 391 ? 22.020  6.159   54.923  1.00 34.34  ? 388 VAL B CB  1 
ATOM   2959 C  CG1 . VAL A 1 391 ? 20.508  5.991   54.921  1.00 30.78  ? 388 VAL B CG1 1 
ATOM   2960 C  CG2 . VAL A 1 391 ? 22.547  6.285   56.347  1.00 31.43  ? 388 VAL B CG2 1 
ATOM   2961 N  N   . ILE A 1 392 ? 21.253  3.445   53.006  1.00 28.97  ? 389 ILE B N   1 
ATOM   2962 C  CA  . ILE A 1 392 ? 20.486  2.957   51.872  1.00 29.22  ? 389 ILE B CA  1 
ATOM   2963 C  C   . ILE A 1 392 ? 19.049  2.660   52.277  1.00 32.14  ? 389 ILE B C   1 
ATOM   2964 O  O   . ILE A 1 392 ? 18.769  2.364   53.439  1.00 26.76  ? 389 ILE B O   1 
ATOM   2965 C  CB  . ILE A 1 392 ? 21.112  1.680   51.270  1.00 29.27  ? 389 ILE B CB  1 
ATOM   2966 C  CG1 . ILE A 1 392 ? 22.447  2.002   50.597  1.00 32.61  ? 389 ILE B CG1 1 
ATOM   2967 C  CG2 . ILE A 1 392 ? 20.165  1.038   50.264  1.00 27.07  ? 389 ILE B CG2 1 
ATOM   2968 C  CD1 . ILE A 1 392 ? 23.016  0.854   49.774  1.00 31.01  ? 389 ILE B CD1 1 
ATOM   2969 N  N   . CYS A 1 393 ? 18.139  2.765   51.313  1.00 29.92  ? 390 CYS B N   1 
ATOM   2970 C  CA  . CYS A 1 393 ? 16.778  2.293   51.502  1.00 25.36  ? 390 CYS B CA  1 
ATOM   2971 C  C   . CYS A 1 393 ? 16.435  1.301   50.408  1.00 23.56  ? 390 CYS B C   1 
ATOM   2972 O  O   . CYS A 1 393 ? 16.558  1.609   49.225  1.00 26.36  ? 390 CYS B O   1 
ATOM   2973 C  CB  . CYS A 1 393 ? 15.777  3.443   51.478  1.00 21.97  ? 390 CYS B CB  1 
ATOM   2974 S  SG  . CYS A 1 393 ? 14.075  2.873   51.689  1.00 28.09  ? 390 CYS B SG  1 
ATOM   2975 N  N   . SER A 1 394 ? 16.014  0.108   50.810  1.00 26.26  ? 391 SER B N   1 
ATOM   2976 C  CA  . SER A 1 394 ? 15.599  -0.923  49.864  1.00 25.71  ? 391 SER B CA  1 
ATOM   2977 C  C   . SER A 1 394 ? 14.173  -1.367  50.161  1.00 28.44  ? 391 SER B C   1 
ATOM   2978 O  O   . SER A 1 394 ? 13.712  -1.284  51.303  1.00 26.75  ? 391 SER B O   1 
ATOM   2979 C  CB  . SER A 1 394 ? 16.552  -2.120  49.911  1.00 24.73  ? 391 SER B CB  1 
ATOM   2980 O  OG  . SER A 1 394 ? 16.871  -2.484  51.246  1.00 17.09  ? 391 SER B OG  1 
ATOM   2981 N  N   . VAL A 1 395 ? 13.477  -1.827  49.125  1.00 27.25  ? 392 VAL B N   1 
ATOM   2982 C  CA  . VAL A 1 395 ? 12.099  -2.287  49.263  1.00 20.34  ? 392 VAL B CA  1 
ATOM   2983 C  C   . VAL A 1 395 ? 11.908  -3.653  48.615  1.00 25.26  ? 392 VAL B C   1 
ATOM   2984 O  O   . VAL A 1 395 ? 12.386  -3.897  47.506  1.00 28.60  ? 392 VAL B O   1 
ATOM   2985 C  CB  . VAL A 1 395 ? 11.101  -1.281  48.655  1.00 21.99  ? 392 VAL B CB  1 
ATOM   2986 C  CG1 . VAL A 1 395 ? 10.971  -0.057  49.545  1.00 22.84  ? 392 VAL B CG1 1 
ATOM   2987 C  CG2 . VAL A 1 395 ? 11.527  -0.883  47.244  1.00 20.98  ? 392 VAL B CG2 1 
ATOM   2988 N  N   . SER A 1 396 ? 11.206  -4.542  49.311  1.00 26.98  ? 393 SER B N   1 
ATOM   2989 C  CA  . SER A 1 396 ? 10.989  -5.899  48.820  1.00 27.51  ? 393 SER B CA  1 
ATOM   2990 C  C   . SER A 1 396 ? 9.520   -6.162  48.496  1.00 31.39  ? 393 SER B C   1 
ATOM   2991 O  O   . SER A 1 396 ? 8.636   -5.419  48.925  1.00 32.24  ? 393 SER B O   1 
ATOM   2992 C  CB  . SER A 1 396 ? 11.519  -6.930  49.821  1.00 27.03  ? 393 SER B CB  1 
ATOM   2993 O  OG  . SER A 1 396 ? 10.961  -6.736  51.109  1.00 30.02  ? 393 SER B OG  1 
ATOM   2994 N  N   . GLU A 1 397 ? 9.270   -7.229  47.741  1.00 32.88  ? 394 GLU B N   1 
ATOM   2995 C  CA  . GLU A 1 397 ? 7.928   -7.543  47.249  1.00 33.91  ? 394 GLU B CA  1 
ATOM   2996 C  C   . GLU A 1 397 ? 6.968   -7.958  48.355  1.00 33.90  ? 394 GLU B C   1 
ATOM   2997 O  O   . GLU A 1 397 ? 5.768   -8.104  48.116  1.00 38.60  ? 394 GLU B O   1 
ATOM   2998 C  CB  . GLU A 1 397 ? 7.980   -8.649  46.193  1.00 27.20  ? 394 GLU B CB  1 
ATOM   2999 C  CG  . GLU A 1 397 ? 8.725   -8.279  44.932  1.00 33.99  ? 394 GLU B CG  1 
ATOM   3000 C  CD  . GLU A 1 397 ? 8.487   -9.268  43.811  1.00 39.92  ? 394 GLU B CD  1 
ATOM   3001 O  OE1 . GLU A 1 397 ? 7.984   -10.379 44.090  1.00 36.38  ? 394 GLU B OE1 1 
ATOM   3002 O  OE2 . GLU A 1 397 ? 8.799   -8.933  42.648  1.00 44.03  ? 394 GLU B OE2 1 
ATOM   3003 N  N   . ASP A 1 398 ? 7.494   -8.158  49.558  1.00 28.22  ? 395 ASP B N   1 
ATOM   3004 C  CA  . ASP A 1 398 ? 6.669   -8.595  50.681  1.00 30.20  ? 395 ASP B CA  1 
ATOM   3005 C  C   . ASP A 1 398 ? 6.275   -7.445  51.603  1.00 30.28  ? 395 ASP B C   1 
ATOM   3006 O  O   . ASP A 1 398 ? 6.052   -7.649  52.798  1.00 31.00  ? 395 ASP B O   1 
ATOM   3007 C  CB  . ASP A 1 398 ? 7.368   -9.706  51.471  1.00 31.27  ? 395 ASP B CB  1 
ATOM   3008 C  CG  . ASP A 1 398 ? 8.721   -9.280  52.012  1.00 36.59  ? 395 ASP B CG  1 
ATOM   3009 O  OD1 . ASP A 1 398 ? 9.082   -8.091  51.880  1.00 33.83  ? 395 ASP B OD1 1 
ATOM   3010 O  OD2 . ASP A 1 398 ? 9.427   -10.144 52.572  1.00 42.56  ? 395 ASP B OD2 1 
ATOM   3011 N  N   . ASN A 1 399 ? 6.205   -6.240  51.035  1.00 31.23  ? 396 ASN B N   1 
ATOM   3012 C  CA  . ASN A 1 399 ? 5.723   -5.039  51.735  1.00 31.84  ? 396 ASN B CA  1 
ATOM   3013 C  C   . ASN A 1 399 ? 6.748   -4.335  52.626  1.00 34.41  ? 396 ASN B C   1 
ATOM   3014 O  O   . ASN A 1 399 ? 6.479   -3.256  53.159  1.00 36.32  ? 396 ASN B O   1 
ATOM   3015 C  CB  . ASN A 1 399 ? 4.451   -5.343  52.535  1.00 28.39  ? 396 ASN B CB  1 
ATOM   3016 C  CG  . ASN A 1 399 ? 3.303   -5.789  51.655  1.00 36.79  ? 396 ASN B CG  1 
ATOM   3017 O  OD1 . ASN A 1 399 ? 3.481   -6.600  50.745  1.00 37.11  ? 396 ASN B OD1 1 
ATOM   3018 N  ND2 . ASN A 1 399 ? 2.114   -5.260  51.920  1.00 38.98  ? 396 ASN B ND2 1 
ATOM   3019 N  N   . ILE A 1 400 ? 7.920   -4.941  52.780  1.00 31.32  ? 397 ILE B N   1 
ATOM   3020 C  CA  . ILE A 1 400 ? 8.939   -4.412  53.676  1.00 33.50  ? 397 ILE B CA  1 
ATOM   3021 C  C   . ILE A 1 400 ? 9.770   -3.306  53.032  1.00 32.63  ? 397 ILE B C   1 
ATOM   3022 O  O   . ILE A 1 400 ? 10.138  -3.390  51.862  1.00 34.02  ? 397 ILE B O   1 
ATOM   3023 C  CB  . ILE A 1 400 ? 9.882   -5.535  54.174  1.00 34.50  ? 397 ILE B CB  1 
ATOM   3024 C  CG1 . ILE A 1 400 ? 9.099   -6.569  54.983  1.00 30.11  ? 397 ILE B CG1 1 
ATOM   3025 C  CG2 . ILE A 1 400 ? 11.024  -4.960  55.010  1.00 26.67  ? 397 ILE B CG2 1 
ATOM   3026 C  CD1 . ILE A 1 400 ? 8.558   -6.034  56.291  1.00 31.06  ? 397 ILE B CD1 1 
HETATM 3027 N  N   . MSE A 1 401 ? 10.049  -2.272  53.798  1.00 30.86  ? 398 MSE B N   1 
HETATM 3028 C  CA  . MSE A 1 401 ? 11.034  -1.277  53.399  1.00 39.66  ? 398 MSE B CA  1 
HETATM 3029 C  C   . MSE A 1 401 ? 12.078  -1.167  54.511  1.00 31.33  ? 398 MSE B C   1 
HETATM 3030 O  O   . MSE A 1 401 ? 11.742  -1.189  55.694  1.00 28.22  ? 398 MSE B O   1 
HETATM 3031 C  CB  . MSE A 1 401 ? 10.377  0.078   53.092  1.00 38.87  ? 398 MSE B CB  1 
HETATM 3032 C  CG  . MSE A 1 401 ? 10.312  1.058   54.257  1.00 52.95  ? 398 MSE B CG  1 
HETATM 3033 SE SE  . MSE A 1 401 ? 9.587   2.816   53.766  1.00 63.24  ? 398 MSE B SE  1 
HETATM 3034 C  CE  . MSE A 1 401 ? 10.846  3.310   52.367  1.00 59.73  ? 398 MSE B CE  1 
ATOM   3035 N  N   . GLN A 1 402 ? 13.337  -1.090  54.137  1.00 30.16  ? 399 GLN B N   1 
ATOM   3036 C  CA  . GLN A 1 402 ? 14.400  -0.994  55.127  1.00 34.12  ? 399 GLN B CA  1 
ATOM   3037 C  C   . GLN A 1 402 ? 15.327  0.180   54.856  1.00 24.94  ? 399 GLN B C   1 
ATOM   3038 O  O   . GLN A 1 402 ? 15.862  0.320   53.759  1.00 31.69  ? 399 GLN B O   1 
ATOM   3039 C  CB  . GLN A 1 402 ? 15.209  -2.292  55.187  1.00 37.42  ? 399 GLN B CB  1 
ATOM   3040 C  CG  . GLN A 1 402 ? 14.429  -3.493  55.685  1.00 39.34  ? 399 GLN B CG  1 
ATOM   3041 C  CD  . GLN A 1 402 ? 15.315  -4.698  55.940  1.00 38.38  ? 399 GLN B CD  1 
ATOM   3042 O  OE1 . GLN A 1 402 ? 15.002  -5.548  56.773  1.00 39.82  ? 399 GLN B OE1 1 
ATOM   3043 N  NE2 . GLN A 1 402 ? 16.428  -4.776  55.224  1.00 32.91  ? 399 GLN B NE2 1 
ATOM   3044 N  N   . ILE A 1 403 ? 15.498  1.030   55.858  0.50 17.08  ? 400 ILE B N   1 
ATOM   3045 C  CA  . ILE A 1 403 ? 16.508  2.070   55.805  0.50 14.38  ? 400 ILE B CA  1 
ATOM   3046 C  C   . ILE A 1 403 ? 17.657  1.589   56.670  0.50 19.72  ? 400 ILE B C   1 
ATOM   3047 O  O   . ILE A 1 403 ? 17.481  1.346   57.862  1.00 24.24  ? 400 ILE B O   1 
ATOM   3048 C  CB  . ILE A 1 403 ? 15.974  3.409   56.329  0.50 8.54   ? 400 ILE B CB  1 
ATOM   3049 C  CG1 . ILE A 1 403 ? 14.835  3.903   55.437  0.50 2.00   ? 400 ILE B CG1 1 
ATOM   3050 C  CG2 . ILE A 1 403 ? 17.095  4.442   56.396  0.50 9.59   ? 400 ILE B CG2 1 
ATOM   3051 C  CD1 . ILE A 1 403 ? 14.010  5.003   56.054  0.50 3.98   ? 400 ILE B CD1 1 
ATOM   3052 N  N   . TRP A 1 404 ? 18.829  1.423   56.069  1.00 20.36  ? 401 TRP B N   1 
ATOM   3053 C  CA  . TRP A 1 404 ? 19.933  0.808   56.786  1.00 24.86  ? 401 TRP B CA  1 
ATOM   3054 C  C   . TRP A 1 404 ? 21.300  1.382   56.435  1.00 33.02  ? 401 TRP B C   1 
ATOM   3055 O  O   . TRP A 1 404 ? 21.470  2.049   55.412  1.00 28.88  ? 401 TRP B O   1 
ATOM   3056 C  CB  . TRP A 1 404 ? 19.924  -0.706  56.576  1.00 23.54  ? 401 TRP B CB  1 
ATOM   3057 C  CG  . TRP A 1 404 ? 19.946  -1.119  55.141  1.00 25.34  ? 401 TRP B CG  1 
ATOM   3058 C  CD1 . TRP A 1 404 ? 18.873  -1.240  54.304  1.00 25.31  ? 401 TRP B CD1 1 
ATOM   3059 C  CD2 . TRP A 1 404 ? 21.100  -1.479  54.372  1.00 27.81  ? 401 TRP B CD2 1 
ATOM   3060 N  NE1 . TRP A 1 404 ? 19.290  -1.646  53.058  1.00 29.61  ? 401 TRP B NE1 1 
ATOM   3061 C  CE2 . TRP A 1 404 ? 20.652  -1.802  53.075  1.00 27.41  ? 401 TRP B CE2 1 
ATOM   3062 C  CE3 . TRP A 1 404 ? 22.469  -1.557  54.654  1.00 23.25  ? 401 TRP B CE3 1 
ATOM   3063 C  CZ2 . TRP A 1 404 ? 21.523  -2.199  52.062  1.00 21.99  ? 401 TRP B CZ2 1 
ATOM   3064 C  CZ3 . TRP A 1 404 ? 23.331  -1.950  53.649  1.00 25.71  ? 401 TRP B CZ3 1 
ATOM   3065 C  CH2 . TRP A 1 404 ? 22.855  -2.267  52.368  1.00 25.41  ? 401 TRP B CH2 1 
ATOM   3066 N  N   . GLN A 1 405 ? 22.268  1.120   57.309  1.00 35.06  ? 402 GLN B N   1 
ATOM   3067 C  CA  . GLN A 1 405 ? 23.623  1.615   57.130  1.00 30.89  ? 402 GLN B CA  1 
ATOM   3068 C  C   . GLN A 1 405 ? 24.654  0.627   57.647  1.00 35.39  ? 402 GLN B C   1 
ATOM   3069 O  O   . GLN A 1 405 ? 24.658  0.262   58.825  1.00 42.39  ? 402 GLN B O   1 
ATOM   3070 C  CB  . GLN A 1 405 ? 23.810  2.960   57.829  1.00 32.17  ? 402 GLN B CB  1 
ATOM   3071 C  CG  . GLN A 1 405 ? 25.202  3.543   57.655  1.00 29.97  ? 402 GLN B CG  1 
ATOM   3072 C  CD  . GLN A 1 405 ? 25.349  4.894   58.312  1.00 28.27  ? 402 GLN B CD  1 
ATOM   3073 O  OE1 . GLN A 1 405 ? 24.858  5.116   59.415  1.00 34.20  ? 402 GLN B OE1 1 
ATOM   3074 N  NE2 . GLN A 1 405 ? 26.030  5.808   57.634  1.00 32.11  ? 402 GLN B NE2 1 
HETATM 3075 N  N   . MSE A 1 406 ? 25.516  0.210   56.748  1.00 32.60  ? 403 MSE B N   1 
HETATM 3076 C  CA  . MSE A 1 406 ? 26.653  -0.648  57.043  1.00 36.59  ? 403 MSE B CA  1 
HETATM 3077 C  C   . MSE A 1 406 ? 27.489  -0.108  58.207  1.00 37.47  ? 403 MSE B C   1 
HETATM 3078 O  O   . MSE A 1 406 ? 27.585  1.104   58.406  1.00 36.95  ? 403 MSE B O   1 
HETATM 3079 C  CB  . MSE A 1 406 ? 27.506  -0.699  55.787  1.00 37.67  ? 403 MSE B CB  1 
HETATM 3080 C  CG  . MSE A 1 406 ? 28.591  -1.719  55.749  1.00 40.02  ? 403 MSE B CG  1 
HETATM 3081 SE SE  . MSE A 1 406 ? 29.432  -1.498  54.019  1.00 53.10  ? 403 MSE B SE  1 
HETATM 3082 C  CE  . MSE A 1 406 ? 30.577  -3.066  54.041  1.00 55.60  ? 403 MSE B CE  1 
ATOM   3083 N  N   . ALA A 1 407 ? 28.092  -1.002  58.964  1.00 38.04  ? 404 ALA B N   1 
ATOM   3084 C  CA  . ALA A 1 407 ? 28.966  -0.603  60.068  1.00 33.66  ? 404 ALA B CA  1 
ATOM   3085 C  C   . ALA A 1 407 ? 30.231  0.054   59.532  1.00 33.95  ? 404 ALA B C   1 
ATOM   3086 O  O   . ALA A 1 407 ? 30.865  -0.466  58.613  1.00 35.96  ? 404 ALA B O   1 
ATOM   3087 C  CB  . ALA A 1 407 ? 29.315  -1.804  60.934  1.00 26.19  ? 404 ALA B CB  1 
ATOM   3088 N  N   . GLU A 1 408 ? 30.590  1.201   60.102  1.00 37.91  ? 405 GLU B N   1 
ATOM   3089 C  CA  . GLU A 1 408 ? 31.782  1.933   59.679  1.00 48.34  ? 405 GLU B CA  1 
ATOM   3090 C  C   . GLU A 1 408 ? 32.995  1.017   59.703  1.00 48.64  ? 405 GLU B C   1 
ATOM   3091 O  O   . GLU A 1 408 ? 33.803  1.003   58.774  1.00 46.53  ? 405 GLU B O   1 
ATOM   3092 C  CB  . GLU A 1 408 ? 32.015  3.141   60.588  1.00 53.05  ? 405 GLU B CB  1 
ATOM   3093 C  CG  . GLU A 1 408 ? 33.189  4.014   60.178  1.00 57.16  ? 405 GLU B CG  1 
ATOM   3094 C  CD  . GLU A 1 408 ? 33.265  5.294   60.986  1.00 59.70  ? 405 GLU B CD  1 
ATOM   3095 O  OE1 . GLU A 1 408 ? 34.039  6.196   60.603  1.00 61.64  ? 405 GLU B OE1 1 
ATOM   3096 O  OE2 . GLU A 1 408 ? 32.547  5.399   62.003  1.00 63.00  ? 405 GLU B OE2 1 
ATOM   3097 N  N   . ASN A 1 409 ? 33.097  0.250   60.782  1.00 50.15  ? 406 ASN B N   1 
ATOM   3098 C  CA  . ASN A 1 409 ? 34.118  -0.769  60.960  1.00 52.19  ? 406 ASN B CA  1 
ATOM   3099 C  C   . ASN A 1 409 ? 34.438  -1.561  59.689  1.00 54.74  ? 406 ASN B C   1 
ATOM   3100 O  O   . ASN A 1 409 ? 35.539  -2.093  59.540  1.00 58.44  ? 406 ASN B O   1 
ATOM   3101 C  CB  . ASN A 1 409 ? 33.661  -1.727  62.063  1.00 61.41  ? 406 ASN B CB  1 
ATOM   3102 C  CG  . ASN A 1 409 ? 34.748  -2.677  62.503  1.00 67.10  ? 406 ASN B CG  1 
ATOM   3103 O  OD1 . ASN A 1 409 ? 35.929  -2.331  62.504  1.00 74.54  ? 406 ASN B OD1 1 
ATOM   3104 N  ND2 . ASN A 1 409 ? 34.354  -3.885  62.892  1.00 67.60  ? 406 ASN B ND2 1 
ATOM   3105 N  N   . ILE A 1 410 ? 33.480  -1.629  58.769  1.00 53.83  ? 407 ILE B N   1 
ATOM   3106 C  CA  . ILE A 1 410 ? 33.615  -2.486  57.592  1.00 51.65  ? 407 ILE B CA  1 
ATOM   3107 C  C   . ILE A 1 410 ? 34.180  -1.795  56.346  1.00 51.40  ? 407 ILE B C   1 
ATOM   3108 O  O   . ILE A 1 410 ? 34.928  -2.407  55.584  1.00 50.42  ? 407 ILE B O   1 
ATOM   3109 C  CB  . ILE A 1 410 ? 32.282  -3.178  57.242  1.00 49.06  ? 407 ILE B CB  1 
ATOM   3110 C  CG1 . ILE A 1 410 ? 31.681  -3.826  58.489  1.00 47.64  ? 407 ILE B CG1 1 
ATOM   3111 C  CG2 . ILE A 1 410 ? 32.495  -4.221  56.160  1.00 47.98  ? 407 ILE B CG2 1 
ATOM   3112 C  CD1 . ILE A 1 410 ? 30.431  -4.619  58.219  1.00 46.84  ? 407 ILE B CD1 1 
ATOM   3113 N  N   . TYR A 1 411 ? 33.829  -0.530  56.132  1.00 54.09  ? 408 TYR B N   1 
ATOM   3114 C  CA  . TYR A 1 411 ? 34.330  0.190   54.959  1.00 54.38  ? 408 TYR B CA  1 
ATOM   3115 C  C   . TYR A 1 411 ? 35.540  1.072   55.259  1.00 58.73  ? 408 TYR B C   1 
ATOM   3116 O  O   . TYR A 1 411 ? 36.391  1.288   54.394  1.00 53.55  ? 408 TYR B O   1 
ATOM   3117 C  CB  . TYR A 1 411 ? 33.219  0.995   54.272  1.00 54.52  ? 408 TYR B CB  1 
ATOM   3118 C  CG  . TYR A 1 411 ? 32.421  1.911   55.176  1.00 51.98  ? 408 TYR B CG  1 
ATOM   3119 C  CD1 . TYR A 1 411 ? 32.874  3.190   55.482  1.00 47.67  ? 408 TYR B CD1 1 
ATOM   3120 C  CD2 . TYR A 1 411 ? 31.200  1.505   55.701  1.00 51.26  ? 408 TYR B CD2 1 
ATOM   3121 C  CE1 . TYR A 1 411 ? 32.139  4.033   56.300  1.00 51.01  ? 408 TYR B CE1 1 
ATOM   3122 C  CE2 . TYR A 1 411 ? 30.457  2.340   56.517  1.00 54.82  ? 408 TYR B CE2 1 
ATOM   3123 C  CZ  . TYR A 1 411 ? 30.932  3.603   56.814  1.00 54.87  ? 408 TYR B CZ  1 
ATOM   3124 O  OH  . TYR A 1 411 ? 30.194  4.432   57.629  1.00 54.63  ? 408 TYR B OH  1 
ATOM   3125 N  N   . ASN A 1 412 ? 35.611  1.579   56.485  1.00 65.80  ? 409 ASN B N   1 
ATOM   3126 C  CA  . ASN A 1 412 ? 36.697  2.463   56.892  1.00 73.78  ? 409 ASN B CA  1 
ATOM   3127 C  C   . ASN A 1 412 ? 37.627  1.815   57.914  1.00 77.14  ? 409 ASN B C   1 
ATOM   3128 O  O   . ASN A 1 412 ? 37.175  1.288   58.931  1.00 76.61  ? 409 ASN B O   1 
ATOM   3129 C  CB  . ASN A 1 412 ? 36.131  3.788   57.421  1.00 80.19  ? 409 ASN B CB  1 
ATOM   3130 C  CG  . ASN A 1 412 ? 36.969  4.384   58.539  1.00 86.84  ? 409 ASN B CG  1 
ATOM   3131 O  OD1 . ASN A 1 412 ? 37.823  5.239   58.302  1.00 90.06  ? 409 ASN B OD1 1 
ATOM   3132 N  ND2 . ASN A 1 412 ? 36.727  3.933   59.766  1.00 88.49  ? 409 ASN B ND2 1 
ATOM   3133 N  N   . ASP A 1 413 ? 38.927  1.854   57.638  1.00 85.94  ? 410 ASP B N   1 
ATOM   3134 C  CA  . ASP A 1 413 ? 39.917  1.279   58.543  1.00 92.84  ? 410 ASP B CA  1 
ATOM   3135 C  C   . ASP A 1 413 ? 40.045  2.104   59.823  1.00 92.63  ? 410 ASP B C   1 
ATOM   3136 O  O   . ASP A 1 413 ? 40.965  1.903   60.617  1.00 89.69  ? 410 ASP B O   1 
ATOM   3137 C  CB  . ASP A 1 413 ? 41.278  1.147   57.850  1.00 95.18  ? 410 ASP B CB  1 
ATOM   3138 C  CG  . ASP A 1 413 ? 41.864  2.490   57.445  1.00 99.64  ? 410 ASP B CG  1 
ATOM   3139 O  OD1 . ASP A 1 413 ? 42.512  2.555   56.379  1.00 103.20 ? 410 ASP B OD1 1 
ATOM   3140 O  OD2 . ASP A 1 413 ? 41.680  3.479   58.187  1.00 100.02 ? 410 ASP B OD2 1 
ATOM   3141 N  N   . ASP B 2 1   ? 48.869  -4.656  69.567  1.00 94.48  ? 24  ASP E N   1 
ATOM   3142 C  CA  . ASP B 2 1   ? 47.600  -4.676  68.783  1.00 96.15  ? 24  ASP E CA  1 
ATOM   3143 C  C   . ASP B 2 1   ? 46.389  -4.312  69.635  1.00 95.07  ? 24  ASP E C   1 
ATOM   3144 O  O   . ASP B 2 1   ? 46.413  -4.446  70.860  1.00 95.28  ? 24  ASP E O   1 
ATOM   3145 C  CB  . ASP B 2 1   ? 47.387  -6.045  68.131  1.00 96.44  ? 24  ASP E CB  1 
ATOM   3146 C  CG  . ASP B 2 1   ? 48.109  -6.177  66.806  1.00 98.31  ? 24  ASP E CG  1 
ATOM   3147 O  OD1 . ASP B 2 1   ? 47.834  -7.150  66.073  1.00 98.61  ? 24  ASP E OD1 1 
ATOM   3148 O  OD2 . ASP B 2 1   ? 48.947  -5.304  66.493  1.00 97.36  ? 24  ASP E OD2 1 
ATOM   3149 N  N   . ASN B 2 2   ? 45.331  -3.854  68.973  1.00 91.97  ? 25  ASN E N   1 
ATOM   3150 C  CA  . ASN B 2 2   ? 44.086  -3.508  69.649  1.00 88.59  ? 25  ASN E CA  1 
ATOM   3151 C  C   . ASN B 2 2   ? 42.964  -4.489  69.320  1.00 88.09  ? 25  ASN E C   1 
ATOM   3152 O  O   . ASN B 2 2   ? 43.061  -5.260  68.367  1.00 84.98  ? 25  ASN E O   1 
ATOM   3153 C  CB  . ASN B 2 2   ? 43.663  -2.074  69.314  1.00 85.16  ? 25  ASN E CB  1 
ATOM   3154 C  CG  . ASN B 2 2   ? 43.242  -1.910  67.868  1.00 83.63  ? 25  ASN E CG  1 
ATOM   3155 O  OD1 . ASN B 2 2   ? 42.161  -1.396  67.582  1.00 81.99  ? 25  ASN E OD1 1 
ATOM   3156 N  ND2 . ASN B 2 2   ? 44.093  -2.345  66.946  1.00 84.36  ? 25  ASN E ND2 1 
ATOM   3157 N  N   . ILE B 2 3   ? 41.899  -4.447  70.115  1.00 89.75  ? 26  ILE E N   1 
ATOM   3158 C  CA  . ILE B 2 3   ? 40.789  -5.389  69.979  1.00 92.77  ? 26  ILE E CA  1 
ATOM   3159 C  C   . ILE B 2 3   ? 39.953  -5.192  68.717  1.00 95.02  ? 26  ILE E C   1 
ATOM   3160 O  O   . ILE B 2 3   ? 39.379  -6.149  68.198  1.00 96.64  ? 26  ILE E O   1 
ATOM   3161 C  CB  . ILE B 2 3   ? 39.869  -5.348  71.208  1.00 91.83  ? 26  ILE E CB  1 
ATOM   3162 C  CG1 . ILE B 2 3   ? 39.933  -3.965  71.858  1.00 91.11  ? 26  ILE E CG1 1 
ATOM   3163 C  CG2 . ILE B 2 3   ? 40.268  -6.425  72.203  1.00 91.80  ? 26  ILE E CG2 1 
ATOM   3164 C  CD1 . ILE B 2 3   ? 39.614  -3.969  73.325  1.00 90.11  ? 26  ILE E CD1 1 
ATOM   3165 N  N   . GLN B 2 4   ? 39.876  -3.958  68.226  1.00 96.50  ? 27  GLN E N   1 
ATOM   3166 C  CA  . GLN B 2 4   ? 39.154  -3.699  66.987  1.00 97.50  ? 27  GLN E CA  1 
ATOM   3167 C  C   . GLN B 2 4   ? 39.854  -4.398  65.827  1.00 97.70  ? 27  GLN E C   1 
ATOM   3168 O  O   . GLN B 2 4   ? 39.204  -4.983  64.961  1.00 100.44 ? 27  GLN E O   1 
ATOM   3169 C  CB  . GLN B 2 4   ? 39.022  -2.198  66.714  1.00 99.91  ? 27  GLN E CB  1 
ATOM   3170 C  CG  . GLN B 2 4   ? 38.229  -1.875  65.449  1.00 100.93 ? 27  GLN E CG  1 
ATOM   3171 C  CD  . GLN B 2 4   ? 37.735  -0.440  65.405  1.00 99.90  ? 27  GLN E CD  1 
ATOM   3172 O  OE1 . GLN B 2 4   ? 38.271  0.438   66.083  1.00 99.10  ? 27  GLN E OE1 1 
ATOM   3173 N  NE2 . GLN B 2 4   ? 36.707  -0.193  64.600  1.00 99.23  ? 27  GLN E NE2 1 
ATOM   3174 N  N   . GLY B 2 5   ? 41.182  -4.347  65.829  1.00 96.21  ? 28  GLY E N   1 
ATOM   3175 C  CA  . GLY B 2 5   ? 41.983  -5.022  64.813  1.00 94.38  ? 28  GLY E CA  1 
ATOM   3176 C  C   . GLY B 2 5   ? 41.806  -6.529  64.848  1.00 94.10  ? 28  GLY E C   1 
ATOM   3177 O  O   . GLY B 2 5   ? 42.064  -7.214  63.859  1.00 95.03  ? 28  GLY E O   1 
ATOM   3178 N  N   . ILE B 2 6   ? 41.364  -7.043  65.992  1.00 93.53  ? 29  ILE E N   1 
ATOM   3179 C  CA  . ILE B 2 6   ? 41.104  -8.472  66.144  1.00 95.37  ? 29  ILE E CA  1 
ATOM   3180 C  C   . ILE B 2 6   ? 39.756  -8.860  65.540  1.00 97.23  ? 29  ILE E C   1 
ATOM   3181 O  O   . ILE B 2 6   ? 39.634  -9.901  64.892  1.00 98.25  ? 29  ILE E O   1 
ATOM   3182 C  CB  . ILE B 2 6   ? 41.171  -8.913  67.630  1.00 96.11  ? 29  ILE E CB  1 
ATOM   3183 C  CG1 . ILE B 2 6   ? 42.589  -9.359  67.995  1.00 96.02  ? 29  ILE E CG1 1 
ATOM   3184 C  CG2 . ILE B 2 6   ? 40.215  -10.070 67.900  1.00 94.76  ? 29  ILE E CG2 1 
ATOM   3185 C  CD1 . ILE B 2 6   ? 43.649  -8.292  67.827  1.00 96.19  ? 29  ILE E CD1 1 
ATOM   3186 N  N   . THR B 2 7   ? 38.750  -8.014  65.743  1.00 96.32  ? 30  THR E N   1 
ATOM   3187 C  CA  . THR B 2 7   ? 37.398  -8.318  65.282  1.00 93.45  ? 30  THR E CA  1 
ATOM   3188 C  C   . THR B 2 7   ? 37.068  -7.712  63.919  1.00 91.46  ? 30  THR E C   1 
ATOM   3189 O  O   . THR B 2 7   ? 35.964  -7.895  63.411  1.00 93.60  ? 30  THR E O   1 
ATOM   3190 C  CB  . THR B 2 7   ? 36.331  -7.882  66.309  1.00 92.39  ? 30  THR E CB  1 
ATOM   3191 O  OG1 . THR B 2 7   ? 36.577  -6.530  66.712  1.00 91.41  ? 30  THR E OG1 1 
ATOM   3192 C  CG2 . THR B 2 7   ? 36.367  -8.788  67.533  1.00 93.30  ? 30  THR E CG2 1 
ATOM   3193 N  N   . LYS B 2 8   ? 38.021  -6.998  63.327  1.00 86.97  ? 31  LYS E N   1 
ATOM   3194 C  CA  . LYS B 2 8   ? 37.817  -6.431  61.993  1.00 84.09  ? 31  LYS E CA  1 
ATOM   3195 C  C   . LYS B 2 8   ? 37.710  -7.500  60.906  1.00 81.66  ? 31  LYS E C   1 
ATOM   3196 O  O   . LYS B 2 8   ? 36.807  -7.444  60.074  1.00 80.14  ? 31  LYS E O   1 
ATOM   3197 C  CB  . LYS B 2 8   ? 38.911  -5.419  61.640  1.00 86.35  ? 31  LYS E CB  1 
ATOM   3198 C  CG  . LYS B 2 8   ? 38.558  -3.984  61.981  1.00 87.43  ? 31  LYS E CG  1 
ATOM   3199 C  CD  . LYS B 2 8   ? 39.585  -3.019  61.419  1.00 89.46  ? 31  LYS E CD  1 
ATOM   3200 C  CE  . LYS B 2 8   ? 39.195  -1.580  61.698  1.00 91.04  ? 31  LYS E CE  1 
ATOM   3201 N  NZ  . LYS B 2 8   ? 40.267  -0.640  61.277  1.00 92.51  ? 31  LYS E NZ  1 
ATOM   3202 N  N   . PRO B 2 9   ? 38.634  -8.477  60.904  1.00 80.43  ? 32  PRO E N   1 
ATOM   3203 C  CA  . PRO B 2 9   ? 38.567  -9.545  59.908  1.00 77.31  ? 32  PRO E CA  1 
ATOM   3204 C  C   . PRO B 2 9   ? 37.373  -10.469 60.140  1.00 71.54  ? 32  PRO E C   1 
ATOM   3205 O  O   . PRO B 2 9   ? 36.861  -11.068 59.194  1.00 70.28  ? 32  PRO E O   1 
ATOM   3206 C  CB  . PRO B 2 9   ? 39.880  -10.314 60.121  1.00 79.39  ? 32  PRO E CB  1 
ATOM   3207 C  CG  . PRO B 2 9   ? 40.744  -9.414  60.960  1.00 78.49  ? 32  PRO E CG  1 
ATOM   3208 C  CD  . PRO B 2 9   ? 39.791  -8.640  61.800  1.00 78.14  ? 32  PRO E CD  1 
ATOM   3209 N  N   . ALA B 2 10  ? 36.942  -10.579 61.393  1.00 66.30  ? 33  ALA E N   1 
ATOM   3210 C  CA  . ALA B 2 10  ? 35.815  -11.435 61.749  1.00 64.35  ? 33  ALA E CA  1 
ATOM   3211 C  C   . ALA B 2 10  ? 34.494  -10.824 61.292  1.00 61.28  ? 33  ALA E C   1 
ATOM   3212 O  O   . ALA B 2 10  ? 33.640  -11.516 60.738  1.00 59.43  ? 33  ALA E O   1 
ATOM   3213 C  CB  . ALA B 2 10  ? 35.796  -11.691 63.250  1.00 60.96  ? 33  ALA E CB  1 
ATOM   3214 N  N   . ILE B 2 11  ? 34.336  -9.525  61.531  1.00 58.72  ? 34  ILE E N   1 
ATOM   3215 C  CA  . ILE B 2 11  ? 33.140  -8.800  61.116  1.00 56.05  ? 34  ILE E CA  1 
ATOM   3216 C  C   . ILE B 2 11  ? 33.067  -8.693  59.592  1.00 56.32  ? 34  ILE E C   1 
ATOM   3217 O  O   . ILE B 2 11  ? 32.002  -8.876  59.001  1.00 53.93  ? 34  ILE E O   1 
ATOM   3218 C  CB  . ILE B 2 11  ? 33.084  -7.384  61.740  1.00 54.65  ? 34  ILE E CB  1 
ATOM   3219 C  CG1 . ILE B 2 11  ? 33.165  -7.459  63.268  1.00 56.82  ? 34  ILE E CG1 1 
ATOM   3220 C  CG2 . ILE B 2 11  ? 31.818  -6.651  61.313  1.00 56.10  ? 34  ILE E CG2 1 
ATOM   3221 C  CD1 . ILE B 2 11  ? 32.068  -8.279  63.913  1.00 58.40  ? 34  ILE E CD1 1 
ATOM   3222 N  N   . ARG B 2 12  ? 34.203  -8.403  58.963  1.00 56.82  ? 35  ARG E N   1 
ATOM   3223 C  CA  . ARG B 2 12  ? 34.265  -8.282  57.508  1.00 58.81  ? 35  ARG E CA  1 
ATOM   3224 C  C   . ARG B 2 12  ? 33.963  -9.607  56.816  1.00 59.25  ? 35  ARG E C   1 
ATOM   3225 O  O   . ARG B 2 12  ? 33.451  -9.625  55.698  1.00 60.44  ? 35  ARG E O   1 
ATOM   3226 C  CB  . ARG B 2 12  ? 35.620  -7.727  57.052  1.00 59.54  ? 35  ARG E CB  1 
ATOM   3227 C  CG  . ARG B 2 12  ? 35.796  -6.238  57.326  1.00 62.59  ? 35  ARG E CG  1 
ATOM   3228 C  CD  . ARG B 2 12  ? 37.140  -5.714  56.836  1.00 62.40  ? 35  ARG E CD  1 
ATOM   3229 N  NE  . ARG B 2 12  ? 37.362  -4.331  57.255  1.00 69.11  ? 35  ARG E NE  1 
ATOM   3230 C  CZ  . ARG B 2 12  ? 38.349  -3.557  56.811  1.00 72.42  ? 35  ARG E CZ  1 
ATOM   3231 N  NH1 . ARG B 2 12  ? 39.217  -4.023  55.922  1.00 73.06  ? 35  ARG E NH1 1 
ATOM   3232 N  NH2 . ARG B 2 12  ? 38.465  -2.311  57.254  1.00 72.42  ? 35  ARG E NH2 1 
ATOM   3233 N  N   . ARG B 2 13  ? 34.279  -10.714 57.480  1.00 59.51  ? 36  ARG E N   1 
ATOM   3234 C  CA  . ARG B 2 13  ? 33.909  -12.027 56.963  1.00 62.33  ? 36  ARG E CA  1 
ATOM   3235 C  C   . ARG B 2 13  ? 32.416  -12.267 57.145  1.00 56.71  ? 36  ARG E C   1 
ATOM   3236 O  O   . ARG B 2 13  ? 31.751  -12.797 56.255  1.00 55.67  ? 36  ARG E O   1 
ATOM   3237 C  CB  . ARG B 2 13  ? 34.718  -13.141 57.633  1.00 71.13  ? 36  ARG E CB  1 
ATOM   3238 C  CG  . ARG B 2 13  ? 36.017  -13.470 56.913  1.00 79.56  ? 36  ARG E CG  1 
ATOM   3239 C  CD  . ARG B 2 13  ? 36.483  -14.891 57.207  1.00 86.92  ? 36  ARG E CD  1 
ATOM   3240 N  NE  . ARG B 2 13  ? 37.366  -14.967 58.367  1.00 90.46  ? 36  ARG E NE  1 
ATOM   3241 C  CZ  . ARG B 2 13  ? 36.983  -15.356 59.580  1.00 92.03  ? 36  ARG E CZ  1 
ATOM   3242 N  NH1 . ARG B 2 13  ? 35.723  -15.707 59.803  1.00 93.78  ? 36  ARG E NH1 1 
ATOM   3243 N  NH2 . ARG B 2 13  ? 37.862  -15.393 60.572  1.00 92.03  ? 36  ARG E NH2 1 
ATOM   3244 N  N   . LEU B 2 14  ? 31.896  -11.865 58.302  1.00 50.52  ? 37  LEU E N   1 
ATOM   3245 C  CA  . LEU B 2 14  ? 30.473  -11.983 58.595  1.00 46.48  ? 37  LEU E CA  1 
ATOM   3246 C  C   . LEU B 2 14  ? 29.648  -11.148 57.618  1.00 47.93  ? 37  LEU E C   1 
ATOM   3247 O  O   . LEU B 2 14  ? 28.525  -11.510 57.265  1.00 52.83  ? 37  LEU E O   1 
ATOM   3248 C  CB  . LEU B 2 14  ? 30.192  -11.540 60.033  1.00 44.49  ? 37  LEU E CB  1 
ATOM   3249 C  CG  . LEU B 2 14  ? 28.769  -11.722 60.566  1.00 43.83  ? 37  LEU E CG  1 
ATOM   3250 C  CD1 . LEU B 2 14  ? 28.420  -13.200 60.690  1.00 42.23  ? 37  LEU E CD1 1 
ATOM   3251 C  CD2 . LEU B 2 14  ? 28.604  -11.016 61.904  1.00 40.41  ? 37  LEU E CD2 1 
ATOM   3252 N  N   . ALA B 2 15  ? 30.221  -10.031 57.180  1.00 42.31  ? 38  ALA E N   1 
ATOM   3253 C  CA  . ALA B 2 15  ? 29.551  -9.124  56.257  1.00 45.46  ? 38  ALA E CA  1 
ATOM   3254 C  C   . ALA B 2 15  ? 29.404  -9.731  54.865  1.00 49.71  ? 38  ALA E C   1 
ATOM   3255 O  O   . ALA B 2 15  ? 28.432  -9.463  54.159  1.00 49.19  ? 38  ALA E O   1 
ATOM   3256 C  CB  . ALA B 2 15  ? 30.306  -7.806  56.182  1.00 41.83  ? 38  ALA E CB  1 
ATOM   3257 N  N   . ARG B 2 16  ? 30.376  -10.550 54.478  1.00 53.24  ? 39  ARG E N   1 
ATOM   3258 C  CA  . ARG B 2 16  ? 30.404  -11.130 53.140  1.00 55.04  ? 39  ARG E CA  1 
ATOM   3259 C  C   . ARG B 2 16  ? 29.670  -12.467 53.087  1.00 60.06  ? 39  ARG E C   1 
ATOM   3260 O  O   . ARG B 2 16  ? 29.462  -13.031 52.011  1.00 64.49  ? 39  ARG E O   1 
ATOM   3261 C  CB  . ARG B 2 16  ? 31.849  -11.269 52.655  1.00 52.94  ? 39  ARG E CB  1 
ATOM   3262 C  CG  . ARG B 2 16  ? 32.611  -9.951  52.676  1.00 54.42  ? 39  ARG E CG  1 
ATOM   3263 C  CD  . ARG B 2 16  ? 34.103  -10.139 52.471  1.00 55.17  ? 39  ARG E CD  1 
ATOM   3264 N  NE  . ARG B 2 16  ? 34.423  -10.448 51.082  1.00 58.91  ? 39  ARG E NE  1 
ATOM   3265 C  CZ  . ARG B 2 16  ? 34.819  -11.641 50.655  1.00 57.57  ? 39  ARG E CZ  1 
ATOM   3266 N  NH1 . ARG B 2 16  ? 34.956  -12.642 51.514  1.00 54.24  ? 39  ARG E NH1 1 
ATOM   3267 N  NH2 . ARG B 2 16  ? 35.084  -11.830 49.370  1.00 59.99  ? 39  ARG E NH2 1 
ATOM   3268 N  N   . ARG B 2 17  ? 29.280  -12.967 54.255  1.00 60.68  ? 40  ARG E N   1 
ATOM   3269 C  CA  . ARG B 2 17  ? 28.446  -14.158 54.337  1.00 64.25  ? 40  ARG E CA  1 
ATOM   3270 C  C   . ARG B 2 17  ? 27.003  -13.750 54.603  1.00 67.04  ? 40  ARG E C   1 
ATOM   3271 O  O   . ARG B 2 17  ? 26.108  -14.594 54.659  1.00 67.57  ? 40  ARG E O   1 
ATOM   3272 C  CB  . ARG B 2 17  ? 28.930  -15.086 55.449  1.00 69.64  ? 40  ARG E CB  1 
ATOM   3273 C  CG  . ARG B 2 17  ? 30.348  -15.595 55.277  1.00 73.51  ? 40  ARG E CG  1 
ATOM   3274 C  CD  . ARG B 2 17  ? 30.712  -16.529 56.416  1.00 80.20  ? 40  ARG E CD  1 
ATOM   3275 N  NE  . ARG B 2 17  ? 32.156  -16.694 56.556  1.00 86.82  ? 40  ARG E NE  1 
ATOM   3276 C  CZ  . ARG B 2 17  ? 32.743  -17.255 57.609  1.00 90.05  ? 40  ARG E CZ  1 
ATOM   3277 N  NH1 . ARG B 2 17  ? 32.010  -17.704 58.619  1.00 91.97  ? 40  ARG E NH1 1 
ATOM   3278 N  NH2 . ARG B 2 17  ? 34.064  -17.364 57.653  1.00 89.99  ? 40  ARG E NH2 1 
ATOM   3279 N  N   . GLY B 2 18  ? 26.787  -12.448 54.774  1.00 68.60  ? 41  GLY E N   1 
ATOM   3280 C  CA  . GLY B 2 18  ? 25.456  -11.908 55.024  1.00 62.46  ? 41  GLY E CA  1 
ATOM   3281 C  C   . GLY B 2 18  ? 25.112  -11.863 56.500  1.00 58.68  ? 41  GLY E C   1 
ATOM   3282 O  O   . GLY B 2 18  ? 23.941  -11.927 56.875  1.00 59.11  ? 41  GLY E O   1 
HETATM 3283 N  N   . MSE C 1 2   ? 66.490  -12.937 -14.288 1.00 56.66  ? -1  MSE A N   1 
HETATM 3284 C  CA  . MSE C 1 2   ? 65.011  -13.032 -14.469 1.00 66.90  ? -1  MSE A CA  1 
HETATM 3285 C  C   . MSE C 1 2   ? 64.223  -12.432 -13.307 1.00 61.50  ? -1  MSE A C   1 
HETATM 3286 O  O   . MSE C 1 2   ? 63.320  -11.622 -13.516 1.00 56.18  ? -1  MSE A O   1 
HETATM 3287 C  CB  . MSE C 1 2   ? 64.583  -14.483 -14.697 1.00 71.76  ? -1  MSE A CB  1 
HETATM 3288 C  CG  . MSE C 1 2   ? 64.233  -14.799 -16.138 1.00 77.69  ? -1  MSE A CG  1 
HETATM 3289 SE SE  . MSE C 1 2   ? 63.318  -16.509 -16.317 1.00 81.76  ? -1  MSE A SE  1 
HETATM 3290 C  CE  . MSE C 1 2   ? 62.342  -16.525 -14.629 1.00 77.70  ? -1  MSE A CE  1 
ATOM   3291 N  N   . ALA C 1 3   ? 64.558  -12.836 -12.098 1.00 58.16  ? 0   ALA A N   1 
ATOM   3292 C  CA  . ALA C 1 3   ? 63.895  -12.314 -10.909 1.00 54.74  ? 0   ALA A CA  1 
ATOM   3293 C  C   . ALA C 1 3   ? 64.102  -10.809 -10.795 1.00 53.38  ? 0   ALA A C   1 
ATOM   3294 O  O   . ALA C 1 3   ? 65.192  -10.302 -11.058 1.00 56.91  ? 0   ALA A O   1 
ATOM   3295 C  CB  . ALA C 1 3   ? 64.405  -13.017 -9.662  1.00 52.08  ? 0   ALA A CB  1 
HETATM 3296 N  N   . MSE C 1 4   ? 63.057  -10.104 -10.415 1.00 54.94  ? 1   MSE A N   1 
HETATM 3297 C  CA  . MSE C 1 4   ? 63.136  -8.662  -10.229 1.00 54.88  ? 1   MSE A CA  1 
HETATM 3298 C  C   . MSE C 1 4   ? 63.731  -8.332  -8.868  1.00 51.72  ? 1   MSE A C   1 
HETATM 3299 O  O   . MSE C 1 4   ? 63.653  -9.130  -7.934  1.00 50.93  ? 1   MSE A O   1 
HETATM 3300 C  CB  . MSE C 1 4   ? 61.750  -8.029  -10.332 1.00 54.57  ? 1   MSE A CB  1 
HETATM 3301 C  CG  . MSE C 1 4   ? 60.905  -8.531  -11.484 1.00 59.25  ? 1   MSE A CG  1 
HETATM 3302 SE SE  . MSE C 1 4   ? 59.220  -7.555  -11.601 1.00 67.10  ? 1   MSE A SE  1 
HETATM 3303 C  CE  . MSE C 1 4   ? 58.181  -8.862  -12.615 1.00 60.92  ? 1   MSE A CE  1 
ATOM   3304 N  N   . ALA C 1 5   ? 64.320  -7.161  -8.761  1.00 51.71  ? 2   ALA A N   1 
ATOM   3305 C  CA  . ALA C 1 5   ? 64.768  -6.655  -7.474  1.00 51.51  ? 2   ALA A CA  1 
ATOM   3306 C  C   . ALA C 1 5   ? 63.548  -6.216  -6.670  1.00 54.87  ? 2   ALA A C   1 
ATOM   3307 O  O   . ALA C 1 5   ? 62.620  -5.616  -7.212  1.00 47.21  ? 2   ALA A O   1 
ATOM   3308 C  CB  . ALA C 1 5   ? 65.732  -5.496  -7.665  1.00 47.96  ? 2   ALA A CB  1 
ATOM   3309 N  N   . SER C 1 6   ? 63.542  -6.525  -5.378  1.00 65.66  ? 3   SER A N   1 
ATOM   3310 C  CA  . SER C 1 6   ? 62.415  -6.169  -4.526  1.00 73.36  ? 3   SER A CA  1 
ATOM   3311 C  C   . SER C 1 6   ? 62.830  -5.150  -3.471  1.00 80.04  ? 3   SER A C   1 
ATOM   3312 O  O   . SER C 1 6   ? 63.978  -5.135  -3.028  1.00 80.12  ? 3   SER A O   1 
ATOM   3313 C  CB  . SER C 1 6   ? 61.820  -7.415  -3.868  1.00 70.61  ? 3   SER A CB  1 
ATOM   3314 O  OG  . SER C 1 6   ? 60.554  -7.133  -3.297  1.00 68.53  ? 3   SER A OG  1 
ATOM   3315 N  N   . LYS C 1 7   ? 61.887  -4.301  -3.076  1.00 89.89  ? 4   LYS A N   1 
ATOM   3316 C  CA  . LYS C 1 7   ? 62.151  -3.243  -2.107  1.00 99.46  ? 4   LYS A CA  1 
ATOM   3317 C  C   . LYS C 1 7   ? 60.878  -2.917  -1.336  1.00 105.02 ? 4   LYS A C   1 
ATOM   3318 O  O   . LYS C 1 7   ? 60.227  -1.903  -1.593  1.00 110.42 ? 4   LYS A O   1 
ATOM   3319 C  CB  . LYS C 1 7   ? 62.667  -1.991  -2.825  1.00 101.72 ? 4   LYS A CB  1 
ATOM   3320 C  CG  . LYS C 1 7   ? 63.035  -0.825  -1.914  1.00 103.86 ? 4   LYS A CG  1 
ATOM   3321 C  CD  . LYS C 1 7   ? 64.495  -0.873  -1.498  1.00 106.02 ? 4   LYS A CD  1 
ATOM   3322 C  CE  . LYS C 1 7   ? 64.948  0.472   -0.949  1.00 106.15 ? 4   LYS A CE  1 
ATOM   3323 N  NZ  . LYS C 1 7   ? 66.411  0.504   -0.674  1.00 106.36 ? 4   LYS A NZ  1 
ATOM   3324 N  N   . GLU C 1 8   ? 60.517  -3.784  -0.395  1.00 108.65 ? 5   GLU A N   1 
ATOM   3325 C  CA  . GLU C 1 8   ? 59.304  -3.579  0.390   1.00 112.91 ? 5   GLU A CA  1 
ATOM   3326 C  C   . GLU C 1 8   ? 59.419  -4.124  1.810   1.00 114.13 ? 5   GLU A C   1 
ATOM   3327 O  O   . GLU C 1 8   ? 59.683  -5.308  2.014   1.00 116.69 ? 5   GLU A O   1 
ATOM   3328 C  CB  . GLU C 1 8   ? 58.088  -4.195  -0.314  1.00 113.71 ? 5   GLU A CB  1 
ATOM   3329 C  CG  . GLU C 1 8   ? 58.236  -5.671  -0.658  1.00 112.86 ? 5   GLU A CG  1 
ATOM   3330 C  CD  . GLU C 1 8   ? 56.933  -6.298  -1.111  1.00 111.84 ? 5   GLU A CD  1 
ATOM   3331 O  OE1 . GLU C 1 8   ? 56.977  -7.211  -1.963  1.00 111.76 ? 5   GLU A OE1 1 
ATOM   3332 O  OE2 . GLU C 1 8   ? 55.864  -5.878  -0.619  1.00 110.34 ? 5   GLU A OE2 1 
HETATM 3333 N  N   . MSE C 1 9   ? 59.229  -3.252  2.778   1.00 114.86 ? 6   MSE A N   1 
HETATM 3334 C  CA  . MSE C 1 9   ? 59.143  -3.663  4.172   1.00 118.30 ? 6   MSE A CA  1 
HETATM 3335 C  C   . MSE C 1 9   ? 57.677  -3.781  4.576   1.00 110.88 ? 6   MSE A C   1 
HETATM 3336 O  O   . MSE C 1 9   ? 56.828  -3.065  4.046   1.00 110.69 ? 6   MSE A O   1 
HETATM 3337 C  CB  . MSE C 1 9   ? 59.879  -2.675  5.080   1.00 120.00 ? 6   MSE A CB  1 
HETATM 3338 C  CG  . MSE C 1 9   ? 61.364  -2.972  5.237   1.00 120.00 ? 6   MSE A CG  1 
HETATM 3339 SE SE  . MSE C 1 9   ? 62.228  -1.838  6.571   1.00 120.00 ? 6   MSE A SE  1 
HETATM 3340 C  CE  . MSE C 1 9   ? 61.026  -2.163  8.080   1.00 120.00 ? 6   MSE A CE  1 
ATOM   3341 N  N   . PHE C 1 10  ? 57.381  -4.665  5.506   1.00 103.84 ? 7   PHE A N   1 
ATOM   3342 C  CA  . PHE C 1 10  ? 58.394  -5.433  6.224   1.00 97.59  ? 7   PHE A CA  1 
ATOM   3343 C  C   . PHE C 1 10  ? 58.855  -6.662  5.440   1.00 90.36  ? 7   PHE A C   1 
ATOM   3344 O  O   . PHE C 1 10  ? 58.056  -7.327  4.780   1.00 92.15  ? 7   PHE A O   1 
ATOM   3345 C  CB  . PHE C 1 10  ? 57.856  -5.834  7.601   1.00 99.76  ? 7   PHE A CB  1 
ATOM   3346 C  CG  . PHE C 1 10  ? 56.956  -4.796  8.218   1.00 101.40 ? 7   PHE A CG  1 
ATOM   3347 C  CD1 . PHE C 1 10  ? 55.578  -4.940  8.176   1.00 98.97  ? 7   PHE A CD1 1 
ATOM   3348 C  CD2 . PHE C 1 10  ? 57.487  -3.665  8.819   1.00 101.61 ? 7   PHE A CD2 1 
ATOM   3349 C  CE1 . PHE C 1 10  ? 54.745  -3.985  8.734   1.00 97.66  ? 7   PHE A CE1 1 
ATOM   3350 C  CE2 . PHE C 1 10  ? 56.659  -2.705  9.377   1.00 100.46 ? 7   PHE A CE2 1 
ATOM   3351 C  CZ  . PHE C 1 10  ? 55.287  -2.866  9.334   1.00 98.76  ? 7   PHE A CZ  1 
ATOM   3352 N  N   . GLU C 1 11  ? 60.151  -6.950  5.514   1.00 81.63  ? 8   GLU A N   1 
ATOM   3353 C  CA  . GLU C 1 11  ? 60.744  -8.062  4.775   1.00 68.64  ? 8   GLU A CA  1 
ATOM   3354 C  C   . GLU C 1 11  ? 60.424  -9.414  5.403   1.00 58.81  ? 8   GLU A C   1 
ATOM   3355 O  O   . GLU C 1 11  ? 60.360  -10.429 4.708   1.00 57.72  ? 8   GLU A O   1 
ATOM   3356 C  CB  . GLU C 1 11  ? 62.260  -7.884  4.668   1.00 72.96  ? 8   GLU A CB  1 
ATOM   3357 C  CG  . GLU C 1 11  ? 62.699  -6.777  3.722   1.00 76.47  ? 8   GLU A CG  1 
ATOM   3358 C  CD  . GLU C 1 11  ? 62.539  -7.156  2.259   1.00 78.61  ? 8   GLU A CD  1 
ATOM   3359 O  OE1 . GLU C 1 11  ? 61.412  -7.501  1.846   1.00 80.38  ? 8   GLU A OE1 1 
ATOM   3360 O  OE2 . GLU C 1 11  ? 63.544  -7.102  1.519   1.00 79.51  ? 8   GLU A OE2 1 
ATOM   3361 N  N   . ASP C 1 12  ? 60.237  -9.425  6.718   1.00 49.28  ? 9   ASP A N   1 
ATOM   3362 C  CA  . ASP C 1 12  ? 59.890  -10.648 7.430   1.00 38.77  ? 9   ASP A CA  1 
ATOM   3363 C  C   . ASP C 1 12  ? 58.376  -10.740 7.549   1.00 30.46  ? 9   ASP A C   1 
ATOM   3364 O  O   . ASP C 1 12  ? 57.748  -9.929  8.224   1.00 32.67  ? 9   ASP A O   1 
ATOM   3365 C  CB  . ASP C 1 12  ? 60.543  -10.665 8.813   1.00 41.89  ? 9   ASP A CB  1 
ATOM   3366 C  CG  . ASP C 1 12  ? 60.498  -12.034 9.466   1.00 46.95  ? 9   ASP A CG  1 
ATOM   3367 O  OD1 . ASP C 1 12  ? 59.584  -12.825 9.147   1.00 42.91  ? 9   ASP A OD1 1 
ATOM   3368 O  OD2 . ASP C 1 12  ? 61.383  -12.318 10.301  1.00 49.49  ? 9   ASP A OD2 1 
ATOM   3369 N  N   . THR C 1 13  ? 57.791  -11.726 6.881   1.00 28.67  ? 10  THR A N   1 
ATOM   3370 C  CA  . THR C 1 13  ? 56.339  -11.858 6.840   1.00 29.66  ? 10  THR A CA  1 
ATOM   3371 C  C   . THR C 1 13  ? 55.788  -12.485 8.119   1.00 31.49  ? 10  THR A C   1 
ATOM   3372 O  O   . THR C 1 13  ? 54.618  -12.303 8.457   1.00 33.16  ? 10  THR A O   1 
ATOM   3373 C  CB  . THR C 1 13  ? 55.882  -12.663 5.612   1.00 29.32  ? 10  THR A CB  1 
ATOM   3374 O  OG1 . THR C 1 13  ? 56.636  -13.878 5.529   1.00 25.90  ? 10  THR A OG1 1 
ATOM   3375 C  CG2 . THR C 1 13  ? 56.104  -11.852 4.342   1.00 26.78  ? 10  THR A CG2 1 
ATOM   3376 N  N   . VAL C 1 14  ? 56.640  -13.222 8.822   1.00 31.94  ? 11  VAL A N   1 
ATOM   3377 C  CA  . VAL C 1 14  ? 56.284  -13.781 10.116  1.00 33.66  ? 11  VAL A CA  1 
ATOM   3378 C  C   . VAL C 1 14  ? 56.246  -12.665 11.157  1.00 33.49  ? 11  VAL A C   1 
ATOM   3379 O  O   . VAL C 1 14  ? 55.304  -12.564 11.944  1.00 32.03  ? 11  VAL A O   1 
ATOM   3380 C  CB  . VAL C 1 14  ? 57.291  -14.867 10.551  1.00 35.05  ? 11  VAL A CB  1 
ATOM   3381 C  CG1 . VAL C 1 14  ? 57.045  -15.283 11.989  1.00 22.93  ? 11  VAL A CG1 1 
ATOM   3382 C  CG2 . VAL C 1 14  ? 57.209  -16.069 9.621   1.00 33.58  ? 11  VAL A CG2 1 
ATOM   3383 N  N   . GLU C 1 15  ? 57.273  -11.821 11.145  1.00 36.29  ? 12  GLU A N   1 
ATOM   3384 C  CA  . GLU C 1 15  ? 57.375  -10.726 12.098  1.00 46.21  ? 12  GLU A CA  1 
ATOM   3385 C  C   . GLU C 1 15  ? 56.331  -9.651  11.809  1.00 44.05  ? 12  GLU A C   1 
ATOM   3386 O  O   . GLU C 1 15  ? 55.833  -8.997  12.727  1.00 43.65  ? 12  GLU A O   1 
ATOM   3387 C  CB  . GLU C 1 15  ? 58.782  -10.127 12.078  1.00 46.14  ? 12  GLU A CB  1 
ATOM   3388 C  CG  . GLU C 1 15  ? 59.191  -9.473  13.387  1.00 61.18  ? 12  GLU A CG  1 
ATOM   3389 C  CD  . GLU C 1 15  ? 60.638  -9.018  13.386  1.00 65.26  ? 12  GLU A CD  1 
ATOM   3390 O  OE1 . GLU C 1 15  ? 60.999  -8.172  12.537  1.00 74.05  ? 12  GLU A OE1 1 
ATOM   3391 O  OE2 . GLU C 1 15  ? 61.414  -9.501  14.241  1.00 73.91  ? 12  GLU A OE2 1 
ATOM   3392 N  N   . GLU C 1 16  ? 55.999  -9.482  10.531  1.00 40.99  ? 13  GLU A N   1 
ATOM   3393 C  CA  . GLU C 1 16  ? 54.979  -8.522  10.120  1.00 40.02  ? 13  GLU A CA  1 
ATOM   3394 C  C   . GLU C 1 16  ? 53.646  -8.798  10.813  1.00 36.05  ? 13  GLU A C   1 
ATOM   3395 O  O   . GLU C 1 16  ? 53.001  -7.878  11.324  1.00 31.06  ? 13  GLU A O   1 
ATOM   3396 C  CB  . GLU C 1 16  ? 54.803  -8.539  8.600   1.00 38.82  ? 13  GLU A CB  1 
ATOM   3397 C  CG  . GLU C 1 16  ? 53.610  -7.733  8.098   1.00 48.93  ? 13  GLU A CG  1 
ATOM   3398 C  CD  . GLU C 1 16  ? 53.576  -7.613  6.585   1.00 55.26  ? 13  GLU A CD  1 
ATOM   3399 O  OE1 . GLU C 1 16  ? 52.595  -8.079  5.968   1.00 63.92  ? 13  GLU A OE1 1 
ATOM   3400 O  OE2 . GLU C 1 16  ? 54.535  -7.057  6.009   1.00 65.14  ? 13  GLU A OE2 1 
ATOM   3401 N  N   . ARG C 1 17  ? 53.243  -10.066 10.829  1.00 30.80  ? 14  ARG A N   1 
ATOM   3402 C  CA  . ARG C 1 17  ? 52.004  -10.474 11.488  1.00 31.84  ? 14  ARG A CA  1 
ATOM   3403 C  C   . ARG C 1 17  ? 52.028  -10.152 12.982  1.00 31.66  ? 14  ARG A C   1 
ATOM   3404 O  O   . ARG C 1 17  ? 51.077  -9.579  13.515  1.00 31.87  ? 14  ARG A O   1 
ATOM   3405 C  CB  . ARG C 1 17  ? 51.743  -11.968 11.278  1.00 29.33  ? 14  ARG A CB  1 
ATOM   3406 C  CG  . ARG C 1 17  ? 51.314  -12.349 9.868   1.00 34.34  ? 14  ARG A CG  1 
ATOM   3407 C  CD  . ARG C 1 17  ? 51.098  -13.853 9.751   1.00 37.50  ? 14  ARG A CD  1 
ATOM   3408 N  NE  . ARG C 1 17  ? 50.596  -14.251 8.437   1.00 36.54  ? 14  ARG A NE  1 
ATOM   3409 C  CZ  . ARG C 1 17  ? 51.369  -14.567 7.402   1.00 36.63  ? 14  ARG A CZ  1 
ATOM   3410 N  NH1 . ARG C 1 17  ? 52.690  -14.528 7.517   1.00 24.94  ? 14  ARG A NH1 1 
ATOM   3411 N  NH2 . ARG C 1 17  ? 50.822  -14.920 6.246   1.00 36.83  ? 14  ARG A NH2 1 
ATOM   3412 N  N   . VAL C 1 18  ? 53.119  -10.524 13.648  1.00 30.36  ? 15  VAL A N   1 
ATOM   3413 C  CA  . VAL C 1 18  ? 53.279  -10.277 15.079  1.00 30.55  ? 15  VAL A CA  1 
ATOM   3414 C  C   . VAL C 1 18  ? 53.144  -8.790  15.389  1.00 28.41  ? 15  VAL A C   1 
ATOM   3415 O  O   . VAL C 1 18  ? 52.373  -8.390  16.259  1.00 32.36  ? 15  VAL A O   1 
ATOM   3416 C  CB  . VAL C 1 18  ? 54.654  -10.764 15.587  1.00 32.25  ? 15  VAL A CB  1 
ATOM   3417 C  CG1 . VAL C 1 18  ? 54.835  -10.413 17.060  1.00 30.91  ? 15  VAL A CG1 1 
ATOM   3418 C  CG2 . VAL C 1 18  ? 54.808  -12.259 15.364  1.00 31.37  ? 15  VAL A CG2 1 
ATOM   3419 N  N   . ILE C 1 19  ? 53.909  -7.980  14.668  1.00 30.50  ? 16  ILE A N   1 
ATOM   3420 C  CA  . ILE C 1 19  ? 53.859  -6.533  14.816  1.00 32.64  ? 16  ILE A CA  1 
ATOM   3421 C  C   . ILE C 1 19  ? 52.453  -5.973  14.586  1.00 31.67  ? 16  ILE A C   1 
ATOM   3422 O  O   . ILE C 1 19  ? 51.990  -5.119  15.342  1.00 31.47  ? 16  ILE A O   1 
ATOM   3423 C  CB  . ILE C 1 19  ? 54.844  -5.849  13.854  1.00 33.59  ? 16  ILE A CB  1 
ATOM   3424 C  CG1 . ILE C 1 19  ? 56.285  -6.143  14.277  1.00 36.83  ? 16  ILE A CG1 1 
ATOM   3425 C  CG2 . ILE C 1 19  ? 54.596  -4.361  13.820  1.00 38.47  ? 16  ILE A CG2 1 
ATOM   3426 C  CD1 . ILE C 1 19  ? 57.328  -5.627  13.307  1.00 34.52  ? 16  ILE A CD1 1 
ATOM   3427 N  N   . ASN C 1 20  ? 51.778  -6.463  13.550  1.00 29.41  ? 17  ASN A N   1 
ATOM   3428 C  CA  . ASN C 1 20  ? 50.447  -5.968  13.200  1.00 35.41  ? 17  ASN A CA  1 
ATOM   3429 C  C   . ASN C 1 20  ? 49.375  -6.277  14.238  1.00 37.43  ? 17  ASN A C   1 
ATOM   3430 O  O   . ASN C 1 20  ? 48.503  -5.448  14.503  1.00 40.42  ? 17  ASN A O   1 
ATOM   3431 C  CB  . ASN C 1 20  ? 50.017  -6.482  11.825  1.00 32.26  ? 17  ASN A CB  1 
ATOM   3432 C  CG  . ASN C 1 20  ? 50.652  -5.705  10.689  1.00 36.13  ? 17  ASN A CG  1 
ATOM   3433 O  OD1 . ASN C 1 20  ? 51.311  -4.687  10.909  1.00 39.86  ? 17  ASN A OD1 1 
ATOM   3434 N  ND2 . ASN C 1 20  ? 50.455  -6.178  9.468   1.00 35.07  ? 17  ASN A ND2 1 
ATOM   3435 N  N   . GLU C 1 21  ? 49.438  -7.468  14.821  1.00 38.31  ? 18  GLU A N   1 
ATOM   3436 C  CA  . GLU C 1 21  ? 48.462  -7.860  15.831  1.00 36.08  ? 18  GLU A CA  1 
ATOM   3437 C  C   . GLU C 1 21  ? 48.646  -7.062  17.116  1.00 39.21  ? 18  GLU A C   1 
ATOM   3438 O  O   . GLU C 1 21  ? 47.669  -6.629  17.731  1.00 39.49  ? 18  GLU A O   1 
ATOM   3439 C  CB  . GLU C 1 21  ? 48.533  -9.362  16.107  1.00 32.51  ? 18  GLU A CB  1 
ATOM   3440 C  CG  . GLU C 1 21  ? 47.974  -10.216 14.981  1.00 38.91  ? 18  GLU A CG  1 
ATOM   3441 C  CD  . GLU C 1 21  ? 46.511  -9.925  14.689  1.00 43.94  ? 18  GLU A CD  1 
ATOM   3442 O  OE1 . GLU C 1 21  ? 45.813  -9.383  15.575  1.00 47.01  ? 18  GLU A OE1 1 
ATOM   3443 O  OE2 . GLU C 1 21  ? 46.057  -10.247 13.571  1.00 41.16  ? 18  GLU A OE2 1 
ATOM   3444 N  N   . GLU C 1 22  ? 49.901  -6.862  17.511  1.00 33.48  ? 19  GLU A N   1 
ATOM   3445 C  CA  . GLU C 1 22  ? 50.213  -6.007  18.646  1.00 39.07  ? 19  GLU A CA  1 
ATOM   3446 C  C   . GLU C 1 22  ? 49.667  -4.603  18.412  1.00 35.26  ? 19  GLU A C   1 
ATOM   3447 O  O   . GLU C 1 22  ? 49.109  -3.982  19.317  1.00 38.28  ? 19  GLU A O   1 
ATOM   3448 C  CB  . GLU C 1 22  ? 51.722  -5.956  18.888  1.00 39.19  ? 19  GLU A CB  1 
ATOM   3449 C  CG  . GLU C 1 22  ? 52.284  -7.204  19.553  1.00 48.40  ? 19  GLU A CG  1 
ATOM   3450 C  CD  . GLU C 1 22  ? 53.794  -7.155  19.716  1.00 54.48  ? 19  GLU A CD  1 
ATOM   3451 O  OE1 . GLU C 1 22  ? 54.391  -6.082  19.479  1.00 61.84  ? 19  GLU A OE1 1 
ATOM   3452 O  OE2 . GLU C 1 22  ? 54.385  -8.193  20.081  1.00 60.63  ? 19  GLU A OE2 1 
ATOM   3453 N  N   . TYR C 1 23  ? 49.820  -4.113  17.186  1.00 34.28  ? 20  TYR A N   1 
ATOM   3454 C  CA  . TYR C 1 23  ? 49.330  -2.791  16.827  1.00 31.19  ? 20  TYR A CA  1 
ATOM   3455 C  C   . TYR C 1 23  ? 47.817  -2.685  16.989  1.00 37.24  ? 20  TYR A C   1 
ATOM   3456 O  O   . TYR C 1 23  ? 47.314  -1.688  17.510  1.00 41.60  ? 20  TYR A O   1 
ATOM   3457 C  CB  . TYR C 1 23  ? 49.731  -2.428  15.395  1.00 31.27  ? 20  TYR A CB  1 
ATOM   3458 C  CG  . TYR C 1 23  ? 49.224  -1.072  14.969  1.00 31.30  ? 20  TYR A CG  1 
ATOM   3459 C  CD1 . TYR C 1 23  ? 49.932  0.085   15.279  1.00 24.89  ? 20  TYR A CD1 1 
ATOM   3460 C  CD2 . TYR C 1 23  ? 48.027  -0.945  14.271  1.00 23.81  ? 20  TYR A CD2 1 
ATOM   3461 C  CE1 . TYR C 1 23  ? 49.466  1.330   14.899  1.00 22.59  ? 20  TYR A CE1 1 
ATOM   3462 C  CE2 . TYR C 1 23  ? 47.553  0.293   13.889  1.00 25.90  ? 20  TYR A CE2 1 
ATOM   3463 C  CZ  . TYR C 1 23  ? 48.275  1.427   14.206  1.00 29.36  ? 20  TYR A CZ  1 
ATOM   3464 O  OH  . TYR C 1 23  ? 47.802  2.662   13.822  1.00 37.53  ? 20  TYR A OH  1 
ATOM   3465 N  N   . LYS C 1 24  ? 47.095  -3.710  16.541  1.00 38.90  ? 21  LYS A N   1 
ATOM   3466 C  CA  . LYS C 1 24  ? 45.637  -3.722  16.650  1.00 37.94  ? 21  LYS A CA  1 
ATOM   3467 C  C   . LYS C 1 24  ? 45.202  -3.598  18.105  1.00 40.57  ? 21  LYS A C   1 
ATOM   3468 O  O   . LYS C 1 24  ? 44.182  -2.981  18.409  1.00 43.60  ? 21  LYS A O   1 
ATOM   3469 C  CB  . LYS C 1 24  ? 45.053  -5.001  16.051  1.00 39.62  ? 21  LYS A CB  1 
ATOM   3470 C  CG  . LYS C 1 24  ? 45.103  -5.084  14.535  1.00 39.08  ? 21  LYS A CG  1 
ATOM   3471 C  CD  . LYS C 1 24  ? 44.550  -6.420  14.067  1.00 39.57  ? 21  LYS A CD  1 
ATOM   3472 C  CE  . LYS C 1 24  ? 44.765  -6.621  12.581  1.00 51.36  ? 21  LYS A CE  1 
ATOM   3473 N  NZ  . LYS C 1 24  ? 44.444  -8.015  12.166  1.00 54.87  ? 21  LYS A NZ  1 
ATOM   3474 N  N   . ILE C 1 25  ? 45.978  -4.199  19.000  1.00 37.42  ? 22  ILE A N   1 
ATOM   3475 C  CA  . ILE C 1 25  ? 45.703  -4.121  20.427  1.00 34.83  ? 22  ILE A CA  1 
ATOM   3476 C  C   . ILE C 1 25  ? 46.031  -2.724  20.947  1.00 35.07  ? 22  ILE A C   1 
ATOM   3477 O  O   . ILE C 1 25  ? 45.262  -2.144  21.715  1.00 42.67  ? 22  ILE A O   1 
ATOM   3478 C  CB  . ILE C 1 25  ? 46.482  -5.205  21.210  1.00 36.69  ? 22  ILE A CB  1 
ATOM   3479 C  CG1 . ILE C 1 25  ? 45.880  -6.584  20.929  1.00 32.07  ? 22  ILE A CG1 1 
ATOM   3480 C  CG2 . ILE C 1 25  ? 46.474  -4.916  22.707  1.00 31.10  ? 22  ILE A CG2 1 
ATOM   3481 C  CD1 . ILE C 1 25  ? 46.722  -7.738  21.427  1.00 34.40  ? 22  ILE A CD1 1 
ATOM   3482 N  N   . TRP C 1 26  ? 47.165  -2.184  20.508  1.00 28.44  ? 23  TRP A N   1 
ATOM   3483 C  CA  . TRP C 1 26  ? 47.566  -0.826  20.873  1.00 30.24  ? 23  TRP A CA  1 
ATOM   3484 C  C   . TRP C 1 26  ? 46.529  0.210   20.445  1.00 29.43  ? 23  TRP A C   1 
ATOM   3485 O  O   . TRP C 1 26  ? 46.235  1.149   21.184  1.00 31.00  ? 23  TRP A O   1 
ATOM   3486 C  CB  . TRP C 1 26  ? 48.929  -0.480  20.267  1.00 26.76  ? 23  TRP A CB  1 
ATOM   3487 C  CG  . TRP C 1 26  ? 49.310  0.960   20.444  1.00 31.41  ? 23  TRP A CG  1 
ATOM   3488 C  CD1 . TRP C 1 26  ? 49.986  1.504   21.496  1.00 29.59  ? 23  TRP A CD1 1 
ATOM   3489 C  CD2 . TRP C 1 26  ? 49.033  2.042   19.541  1.00 31.43  ? 23  TRP A CD2 1 
ATOM   3490 N  NE1 . TRP C 1 26  ? 50.149  2.857   21.306  1.00 31.08  ? 23  TRP A NE1 1 
ATOM   3491 C  CE2 . TRP C 1 26  ? 49.573  3.212   20.115  1.00 30.36  ? 23  TRP A CE2 1 
ATOM   3492 C  CE3 . TRP C 1 26  ? 48.384  2.134   18.305  1.00 27.82  ? 23  TRP A CE3 1 
ATOM   3493 C  CZ2 . TRP C 1 26  ? 49.483  4.460   19.494  1.00 30.75  ? 23  TRP A CZ2 1 
ATOM   3494 C  CZ3 . TRP C 1 26  ? 48.293  3.373   17.691  1.00 27.47  ? 23  TRP A CZ3 1 
ATOM   3495 C  CH2 . TRP C 1 26  ? 48.841  4.519   18.285  1.00 31.68  ? 23  TRP A CH2 1 
ATOM   3496 N  N   . LYS C 1 27  ? 45.979  0.033   19.247  1.00 32.52  ? 24  LYS A N   1 
ATOM   3497 C  CA  . LYS C 1 27  ? 45.003  0.967   18.703  1.00 31.96  ? 24  LYS A CA  1 
ATOM   3498 C  C   . LYS C 1 27  ? 43.724  0.993   19.542  1.00 37.39  ? 24  LYS A C   1 
ATOM   3499 O  O   . LYS C 1 27  ? 43.127  2.051   19.742  1.00 40.25  ? 24  LYS A O   1 
ATOM   3500 C  CB  . LYS C 1 27  ? 44.687  0.617   17.247  1.00 32.11  ? 24  LYS A CB  1 
ATOM   3501 C  CG  . LYS C 1 27  ? 44.046  1.748   16.456  1.00 40.58  ? 24  LYS A CG  1 
ATOM   3502 C  CD  . LYS C 1 27  ? 43.684  1.297   15.047  1.00 45.22  ? 24  LYS A CD  1 
ATOM   3503 C  CE  . LYS C 1 27  ? 42.817  2.325   14.334  1.00 47.15  ? 24  LYS A CE  1 
ATOM   3504 N  NZ  . LYS C 1 27  ? 43.532  3.615   14.139  1.00 49.81  ? 24  LYS A NZ  1 
ATOM   3505 N  N   . LYS C 1 28  ? 43.311  -0.172  20.035  1.00 40.30  ? 25  LYS A N   1 
ATOM   3506 C  CA  . LYS C 1 28  ? 42.119  -0.272  20.875  1.00 42.48  ? 25  LYS A CA  1 
ATOM   3507 C  C   . LYS C 1 28  ? 42.334  0.371   22.244  1.00 44.33  ? 25  LYS A C   1 
ATOM   3508 O  O   . LYS C 1 28  ? 41.383  0.821   22.882  1.00 46.02  ? 25  LYS A O   1 
ATOM   3509 C  CB  . LYS C 1 28  ? 41.701  -1.731  21.060  1.00 47.39  ? 25  LYS A CB  1 
ATOM   3510 C  CG  . LYS C 1 28  ? 41.147  -2.406  19.816  1.00 53.76  ? 25  LYS A CG  1 
ATOM   3511 C  CD  . LYS C 1 28  ? 40.424  -3.695  20.194  1.00 60.57  ? 25  LYS A CD  1 
ATOM   3512 C  CE  . LYS C 1 28  ? 40.114  -4.554  18.978  1.00 64.85  ? 25  LYS A CE  1 
ATOM   3513 N  NZ  . LYS C 1 28  ? 41.308  -5.316  18.515  1.00 67.77  ? 25  LYS A NZ  1 
ATOM   3514 N  N   . ASN C 1 29  ? 43.587  0.404   22.689  1.00 42.06  ? 26  ASN A N   1 
ATOM   3515 C  CA  . ASN C 1 29  ? 43.930  0.952   23.997  1.00 35.07  ? 26  ASN A CA  1 
ATOM   3516 C  C   . ASN C 1 29  ? 44.162  2.459   24.000  1.00 35.34  ? 26  ASN A C   1 
ATOM   3517 O  O   . ASN C 1 29  ? 44.143  3.089   25.056  1.00 32.56  ? 26  ASN A O   1 
ATOM   3518 C  CB  . ASN C 1 29  ? 45.161  0.243   24.566  1.00 39.28  ? 26  ASN A CB  1 
ATOM   3519 C  CG  . ASN C 1 29  ? 44.825  -1.093  25.204  1.00 45.34  ? 26  ASN A CG  1 
ATOM   3520 O  OD1 . ASN C 1 29  ? 45.696  -1.947  25.377  1.00 49.94  ? 26  ASN A OD1 1 
ATOM   3521 N  ND2 . ASN C 1 29  ? 43.558  -1.279  25.563  1.00 39.46  ? 26  ASN A ND2 1 
ATOM   3522 N  N   . THR C 1 30  ? 44.376  3.037   22.821  1.00 35.58  ? 27  THR A N   1 
ATOM   3523 C  CA  . THR C 1 30  ? 44.709  4.460   22.716  1.00 36.49  ? 27  THR A CA  1 
ATOM   3524 C  C   . THR C 1 30  ? 43.809  5.396   23.533  1.00 35.07  ? 27  THR A C   1 
ATOM   3525 O  O   . THR C 1 30  ? 44.309  6.322   24.173  1.00 40.07  ? 27  THR A O   1 
ATOM   3526 C  CB  . THR C 1 30  ? 44.783  4.947   21.246  1.00 34.90  ? 27  THR A CB  1 
ATOM   3527 O  OG1 . THR C 1 30  ? 43.676  4.423   20.501  1.00 34.83  ? 27  THR A OG1 1 
ATOM   3528 C  CG2 . THR C 1 30  ? 46.080  4.496   20.602  1.00 33.70  ? 27  THR A CG2 1 
ATOM   3529 N  N   . PRO C 1 31  ? 42.484  5.164   23.516  1.00 33.28  ? 28  PRO A N   1 
ATOM   3530 C  CA  . PRO C 1 31  ? 41.589  6.040   24.276  1.00 36.21  ? 28  PRO A CA  1 
ATOM   3531 C  C   . PRO C 1 31  ? 41.870  6.047   25.782  1.00 36.91  ? 28  PRO A C   1 
ATOM   3532 O  O   . PRO C 1 31  ? 41.483  6.989   26.474  1.00 38.26  ? 28  PRO A O   1 
ATOM   3533 C  CB  . PRO C 1 31  ? 40.199  5.457   23.992  1.00 34.75  ? 28  PRO A CB  1 
ATOM   3534 C  CG  . PRO C 1 31  ? 40.356  4.667   22.737  1.00 31.98  ? 28  PRO A CG  1 
ATOM   3535 C  CD  . PRO C 1 31  ? 41.740  4.114   22.798  1.00 31.39  ? 28  PRO A CD  1 
ATOM   3536 N  N   . PHE C 1 32  ? 42.535  5.007   26.280  1.00 35.40  ? 29  PHE A N   1 
ATOM   3537 C  CA  . PHE C 1 32  ? 42.921  4.941   27.687  1.00 32.88  ? 29  PHE A CA  1 
ATOM   3538 C  C   . PHE C 1 32  ? 44.301  5.553   27.920  1.00 35.05  ? 29  PHE A C   1 
ATOM   3539 O  O   . PHE C 1 32  ? 44.588  6.060   29.003  1.00 40.40  ? 29  PHE A O   1 
ATOM   3540 C  CB  . PHE C 1 32  ? 42.949  3.489   28.180  1.00 39.67  ? 29  PHE A CB  1 
ATOM   3541 C  CG  . PHE C 1 32  ? 41.633  2.769   28.061  1.00 45.71  ? 29  PHE A CG  1 
ATOM   3542 C  CD1 . PHE C 1 32  ? 40.606  3.015   28.960  1.00 44.34  ? 29  PHE A CD1 1 
ATOM   3543 C  CD2 . PHE C 1 32  ? 41.434  1.824   27.064  1.00 48.00  ? 29  PHE A CD2 1 
ATOM   3544 C  CE1 . PHE C 1 32  ? 39.400  2.345   28.857  1.00 44.41  ? 29  PHE A CE1 1 
ATOM   3545 C  CE2 . PHE C 1 32  ? 40.227  1.151   26.954  1.00 48.81  ? 29  PHE A CE2 1 
ATOM   3546 C  CZ  . PHE C 1 32  ? 39.209  1.413   27.853  1.00 46.00  ? 29  PHE A CZ  1 
ATOM   3547 N  N   . LEU C 1 33  ? 45.157  5.494   26.904  1.00 38.07  ? 30  LEU A N   1 
ATOM   3548 C  CA  . LEU C 1 33  ? 46.576  5.800   27.085  1.00 36.46  ? 30  LEU A CA  1 
ATOM   3549 C  C   . LEU C 1 33  ? 47.009  7.186   26.609  1.00 39.00  ? 30  LEU A C   1 
ATOM   3550 O  O   . LEU C 1 33  ? 48.086  7.661   26.976  1.00 36.25  ? 30  LEU A O   1 
ATOM   3551 C  CB  . LEU C 1 33  ? 47.437  4.726   26.412  1.00 37.77  ? 30  LEU A CB  1 
ATOM   3552 C  CG  . LEU C 1 33  ? 47.447  3.350   27.081  1.00 34.30  ? 30  LEU A CG  1 
ATOM   3553 C  CD1 . LEU C 1 33  ? 48.432  2.417   26.396  1.00 27.86  ? 30  LEU A CD1 1 
ATOM   3554 C  CD2 . LEU C 1 33  ? 47.787  3.497   28.551  1.00 36.98  ? 30  LEU A CD2 1 
ATOM   3555 N  N   . TYR C 1 34  ? 46.179  7.833   25.797  1.00 37.65  ? 31  TYR A N   1 
ATOM   3556 C  CA  . TYR C 1 34  ? 46.555  9.110   25.200  1.00 33.42  ? 31  TYR A CA  1 
ATOM   3557 C  C   . TYR C 1 34  ? 45.469  10.168  25.327  1.00 33.18  ? 31  TYR A C   1 
ATOM   3558 O  O   . TYR C 1 34  ? 44.280  9.860   25.293  1.00 30.07  ? 31  TYR A O   1 
ATOM   3559 C  CB  . TYR C 1 34  ? 46.899  8.926   23.718  1.00 36.10  ? 31  TYR A CB  1 
ATOM   3560 C  CG  . TYR C 1 34  ? 48.006  7.931   23.449  1.00 32.64  ? 31  TYR A CG  1 
ATOM   3561 C  CD1 . TYR C 1 34  ? 49.336  8.332   23.417  1.00 26.72  ? 31  TYR A CD1 1 
ATOM   3562 C  CD2 . TYR C 1 34  ? 47.719  6.591   23.221  1.00 31.20  ? 31  TYR A CD2 1 
ATOM   3563 C  CE1 . TYR C 1 34  ? 50.349  7.423   23.167  1.00 31.88  ? 31  TYR A CE1 1 
ATOM   3564 C  CE2 . TYR C 1 34  ? 48.725  5.676   22.973  1.00 31.63  ? 31  TYR A CE2 1 
ATOM   3565 C  CZ  . TYR C 1 34  ? 50.036  6.097   22.947  1.00 31.43  ? 31  TYR A CZ  1 
ATOM   3566 O  OH  . TYR C 1 34  ? 51.035  5.187   22.697  1.00 33.59  ? 31  TYR A OH  1 
ATOM   3567 N  N   . ASP C 1 35  ? 45.891  11.419  25.476  1.00 38.84  ? 32  ASP A N   1 
ATOM   3568 C  CA  . ASP C 1 35  ? 44.980  12.549  25.377  1.00 36.28  ? 32  ASP A CA  1 
ATOM   3569 C  C   . ASP C 1 35  ? 44.946  12.992  23.928  1.00 33.99  ? 32  ASP A C   1 
ATOM   3570 O  O   . ASP C 1 35  ? 43.999  13.638  23.486  1.00 36.15  ? 32  ASP A O   1 
ATOM   3571 C  CB  . ASP C 1 35  ? 45.446  13.704  26.262  1.00 41.56  ? 32  ASP A CB  1 
ATOM   3572 C  CG  . ASP C 1 35  ? 45.025  13.538  27.708  1.00 49.07  ? 32  ASP A CG  1 
ATOM   3573 O  OD1 . ASP C 1 35  ? 44.013  12.848  27.961  1.00 45.49  ? 32  ASP A OD1 1 
ATOM   3574 O  OD2 . ASP C 1 35  ? 45.703  14.105  28.593  1.00 54.08  ? 32  ASP A OD2 1 
ATOM   3575 N  N   . LEU C 1 36  ? 45.992  12.625  23.194  1.00 36.06  ? 33  LEU A N   1 
ATOM   3576 C  CA  . LEU C 1 36  ? 46.136  12.998  21.796  1.00 32.20  ? 33  LEU A CA  1 
ATOM   3577 C  C   . LEU C 1 36  ? 46.949  11.961  21.030  1.00 34.77  ? 33  LEU A C   1 
ATOM   3578 O  O   . LEU C 1 36  ? 48.044  11.592  21.449  1.00 35.12  ? 33  LEU A O   1 
ATOM   3579 C  CB  . LEU C 1 36  ? 46.823  14.362  21.684  1.00 30.60  ? 33  LEU A CB  1 
ATOM   3580 C  CG  . LEU C 1 36  ? 47.253  14.802  20.283  1.00 24.28  ? 33  LEU A CG  1 
ATOM   3581 C  CD1 . LEU C 1 36  ? 46.032  15.113  19.423  1.00 27.77  ? 33  LEU A CD1 1 
ATOM   3582 C  CD2 . LEU C 1 36  ? 48.175  16.006  20.368  1.00 26.09  ? 33  LEU A CD2 1 
ATOM   3583 N  N   . VAL C 1 37  ? 46.403  11.495  19.911  1.00 32.97  ? 34  VAL A N   1 
ATOM   3584 C  CA  . VAL C 1 37  ? 47.143  10.640  18.986  1.00 34.86  ? 34  VAL A CA  1 
ATOM   3585 C  C   . VAL C 1 37  ? 46.839  11.005  17.538  1.00 36.78  ? 34  VAL A C   1 
ATOM   3586 O  O   . VAL C 1 37  ? 45.694  10.927  17.090  1.00 33.80  ? 34  VAL A O   1 
ATOM   3587 C  CB  . VAL C 1 37  ? 46.853  9.138   19.198  1.00 37.32  ? 34  VAL A CB  1 
ATOM   3588 C  CG1 . VAL C 1 37  ? 47.912  8.511   20.083  1.00 40.54  ? 34  VAL A CG1 1 
ATOM   3589 C  CG2 . VAL C 1 37  ? 45.457  8.929   19.769  1.00 45.27  ? 34  VAL A CG2 1 
HETATM 3590 N  N   . MSE C 1 38  ? 47.869  11.403  16.822  1.00 34.42  ? 35  MSE A N   1 
HETATM 3591 C  CA  . MSE C 1 38  ? 47.746  11.747  15.416  1.00 37.05  ? 35  MSE A CA  1 
HETATM 3592 C  C   . MSE C 1 38  ? 48.784  10.980  14.610  1.00 36.52  ? 35  MSE A C   1 
HETATM 3593 O  O   . MSE C 1 38  ? 49.968  10.990  14.946  1.00 36.55  ? 35  MSE A O   1 
HETATM 3594 C  CB  . MSE C 1 38  ? 47.953  13.250  15.218  1.00 38.25  ? 35  MSE A CB  1 
HETATM 3595 C  CG  . MSE C 1 38  ? 46.905  14.128  15.880  1.00 44.65  ? 35  MSE A CG  1 
HETATM 3596 SE SE  . MSE C 1 38  ? 47.232  16.028  15.572  1.00 54.38  ? 35  MSE A SE  1 
HETATM 3597 C  CE  . MSE C 1 38  ? 48.564  16.376  16.936  1.00 54.43  ? 35  MSE A CE  1 
ATOM   3598 N  N   . THR C 1 39  ? 48.345  10.315  13.562  1.00 35.85  ? 36  THR A N   1 
ATOM   3599 C  CA  . THR C 1 39  ? 49.262  9.611   12.669  1.00 36.91  ? 36  THR A CA  1 
ATOM   3600 C  C   . THR C 1 39  ? 49.146  10.126  11.242  1.00 31.91  ? 36  THR A C   1 
ATOM   3601 O  O   . THR C 1 39  ? 48.064  10.492  10.790  1.00 31.28  ? 36  THR A O   1 
ATOM   3602 C  CB  . THR C 1 39  ? 49.013  8.086   12.656  1.00 37.52  ? 36  THR A CB  1 
ATOM   3603 O  OG1 . THR C 1 39  ? 47.745  7.807   12.048  1.00 44.23  ? 36  THR A OG1 1 
ATOM   3604 C  CG2 . THR C 1 39  ? 49.035  7.526   14.062  1.00 38.36  ? 36  THR A CG2 1 
ATOM   3605 N  N   . HIS C 1 40  ? 50.273  10.150  10.539  1.00 29.54  ? 37  HIS A N   1 
ATOM   3606 C  CA  . HIS C 1 40  ? 50.297  10.509  9.129   1.00 30.50  ? 37  HIS A CA  1 
ATOM   3607 C  C   . HIS C 1 40  ? 51.365  9.690   8.427   1.00 30.09  ? 37  HIS A C   1 
ATOM   3608 O  O   . HIS C 1 40  ? 52.464  9.498   8.954   1.00 28.59  ? 37  HIS A O   1 
ATOM   3609 C  CB  . HIS C 1 40  ? 50.565  12.006  8.958   1.00 29.31  ? 37  HIS A CB  1 
ATOM   3610 C  CG  . HIS C 1 40  ? 50.826  12.426  7.543   1.00 31.71  ? 37  HIS A CG  1 
ATOM   3611 N  ND1 . HIS C 1 40  ? 49.834  12.494  6.588   1.00 36.80  ? 37  HIS A ND1 1 
ATOM   3612 C  CD2 . HIS C 1 40  ? 51.964  12.831  6.930   1.00 27.56  ? 37  HIS A CD2 1 
ATOM   3613 C  CE1 . HIS C 1 40  ? 50.352  12.909  5.445   1.00 32.94  ? 37  HIS A CE1 1 
ATOM   3614 N  NE2 . HIS C 1 40  ? 51.643  13.121  5.626   1.00 33.82  ? 37  HIS A NE2 1 
ATOM   3615 N  N   . ALA C 1 41  ? 51.029  9.182   7.247   1.00 26.29  ? 38  ALA A N   1 
ATOM   3616 C  CA  . ALA C 1 41  ? 51.994  8.454   6.443   1.00 24.13  ? 38  ALA A CA  1 
ATOM   3617 C  C   . ALA C 1 41  ? 52.628  9.418   5.454   1.00 21.81  ? 38  ALA A C   1 
ATOM   3618 O  O   . ALA C 1 41  ? 51.934  10.116  4.713   1.00 28.83  ? 38  ALA A O   1 
ATOM   3619 C  CB  . ALA C 1 41  ? 51.331  7.292   5.721   1.00 24.74  ? 38  ALA A CB  1 
ATOM   3620 N  N   . LEU C 1 42  ? 53.952  9.476   5.474   1.00 21.14  ? 39  LEU A N   1 
ATOM   3621 C  CA  . LEU C 1 42  ? 54.691  10.324  4.562   1.00 20.21  ? 39  LEU A CA  1 
ATOM   3622 C  C   . LEU C 1 42  ? 54.921  9.540   3.282   1.00 29.99  ? 39  LEU A C   1 
ATOM   3623 O  O   . LEU C 1 42  ? 54.906  8.307   3.298   1.00 35.77  ? 39  LEU A O   1 
ATOM   3624 C  CB  . LEU C 1 42  ? 56.035  10.699  5.178   1.00 23.71  ? 39  LEU A CB  1 
ATOM   3625 C  CG  . LEU C 1 42  ? 56.031  11.570  6.434   1.00 27.45  ? 39  LEU A CG  1 
ATOM   3626 C  CD1 . LEU C 1 42  ? 57.355  11.441  7.177   1.00 18.11  ? 39  LEU A CD1 1 
ATOM   3627 C  CD2 . LEU C 1 42  ? 55.739  13.029  6.082   1.00 23.74  ? 39  LEU A CD2 1 
ATOM   3628 N  N   . GLN C 1 43  ? 55.127  10.244  2.174   1.00 30.11  ? 40  GLN A N   1 
ATOM   3629 C  CA  . GLN C 1 43  ? 55.484  9.574   0.931   1.00 30.38  ? 40  GLN A CA  1 
ATOM   3630 C  C   . GLN C 1 43  ? 56.800  8.828   1.118   1.00 29.48  ? 40  GLN A C   1 
ATOM   3631 O  O   . GLN C 1 43  ? 56.940  7.678   0.703   1.00 27.20  ? 40  GLN A O   1 
ATOM   3632 C  CB  . GLN C 1 43  ? 55.605  10.574  -0.218  1.00 31.90  ? 40  GLN A CB  1 
ATOM   3633 C  CG  . GLN C 1 43  ? 56.000  9.927   -1.535  1.00 37.90  ? 40  GLN A CG  1 
ATOM   3634 C  CD  . GLN C 1 43  ? 55.910  10.878  -2.708  1.00 43.31  ? 40  GLN A CD  1 
ATOM   3635 O  OE1 . GLN C 1 43  ? 55.764  12.090  -2.536  1.00 44.58  ? 40  GLN A OE1 1 
ATOM   3636 N  NE2 . GLN C 1 43  ? 56.000  10.330  -3.916  1.00 44.53  ? 40  GLN A NE2 1 
ATOM   3637 N  N   . TRP C 1 44  ? 57.760  9.494   1.752   1.00 26.04  ? 41  TRP A N   1 
ATOM   3638 C  CA  . TRP C 1 44  ? 59.048  8.891   2.051   1.00 30.05  ? 41  TRP A CA  1 
ATOM   3639 C  C   . TRP C 1 44  ? 59.287  8.906   3.551   1.00 28.68  ? 41  TRP A C   1 
ATOM   3640 O  O   . TRP C 1 44  ? 58.839  9.817   4.240   1.00 38.37  ? 41  TRP A O   1 
ATOM   3641 C  CB  . TRP C 1 44  ? 60.175  9.639   1.332   1.00 33.79  ? 41  TRP A CB  1 
ATOM   3642 C  CG  . TRP C 1 44  ? 60.020  9.657   -0.159  1.00 37.12  ? 41  TRP A CG  1 
ATOM   3643 C  CD1 . TRP C 1 44  ? 59.813  10.751  -0.949  1.00 36.17  ? 41  TRP A CD1 1 
ATOM   3644 C  CD2 . TRP C 1 44  ? 60.043  8.525   -1.040  1.00 37.60  ? 41  TRP A CD2 1 
ATOM   3645 N  NE1 . TRP C 1 44  ? 59.714  10.372  -2.265  1.00 34.99  ? 41  TRP A NE1 1 
ATOM   3646 C  CE2 . TRP C 1 44  ? 59.850  9.011   -2.348  1.00 35.50  ? 41  TRP A CE2 1 
ATOM   3647 C  CE3 . TRP C 1 44  ? 60.211  7.149   -0.848  1.00 39.77  ? 41  TRP A CE3 1 
ATOM   3648 C  CZ2 . TRP C 1 44  ? 59.821  8.172   -3.461  1.00 37.59  ? 41  TRP A CZ2 1 
ATOM   3649 C  CZ3 . TRP C 1 44  ? 60.182  6.315   -1.954  1.00 38.87  ? 41  TRP A CZ3 1 
ATOM   3650 C  CH2 . TRP C 1 44  ? 59.987  6.830   -3.244  1.00 38.86  ? 41  TRP A CH2 1 
ATOM   3651 N  N   . PRO C 1 45  ? 59.991  7.891   4.065   1.00 34.12  ? 42  PRO A N   1 
ATOM   3652 C  CA  . PRO C 1 45  ? 60.309  7.891   5.485   1.00 33.55  ? 42  PRO A CA  1 
ATOM   3653 C  C   . PRO C 1 45  ? 61.225  9.057   5.837   1.00 31.35  ? 42  PRO A C   1 
ATOM   3654 O  O   . PRO C 1 45  ? 62.118  9.397   5.065   1.00 28.75  ? 42  PRO A O   1 
ATOM   3655 C  CB  . PRO C 1 45  ? 61.047  6.561   5.682   1.00 29.63  ? 42  PRO A CB  1 
ATOM   3656 C  CG  . PRO C 1 45  ? 61.555  6.196   4.333   1.00 29.38  ? 42  PRO A CG  1 
ATOM   3657 C  CD  . PRO C 1 45  ? 60.526  6.705   3.374   1.00 33.44  ? 42  PRO A CD  1 
ATOM   3658 N  N   . SER C 1 46  ? 60.987  9.676   6.987   1.00 31.30  ? 43  SER A N   1 
ATOM   3659 C  CA  . SER C 1 46  ? 61.895  10.691  7.494   1.00 32.90  ? 43  SER A CA  1 
ATOM   3660 C  C   . SER C 1 46  ? 62.809  10.055  8.528   1.00 34.16  ? 43  SER A C   1 
ATOM   3661 O  O   . SER C 1 46  ? 62.356  9.291   9.381   1.00 43.24  ? 43  SER A O   1 
ATOM   3662 C  CB  . SER C 1 46  ? 61.125  11.855  8.118   1.00 29.72  ? 43  SER A CB  1 
ATOM   3663 O  OG  . SER C 1 46  ? 62.006  12.911  8.458   1.00 29.94  ? 43  SER A OG  1 
ATOM   3664 N  N   . LEU C 1 47  ? 64.097  10.358  8.443   1.00 33.16  ? 44  LEU A N   1 
ATOM   3665 C  CA  . LEU C 1 47  ? 65.057  9.841   9.407   1.00 36.12  ? 44  LEU A CA  1 
ATOM   3666 C  C   . LEU C 1 47  ? 65.236  10.815  10.569  1.00 34.85  ? 44  LEU A C   1 
ATOM   3667 O  O   . LEU C 1 47  ? 65.980  10.539  11.509  1.00 39.09  ? 44  LEU A O   1 
ATOM   3668 C  CB  . LEU C 1 47  ? 66.404  9.578   8.726   1.00 35.69  ? 44  LEU A CB  1 
ATOM   3669 C  CG  . LEU C 1 47  ? 66.527  8.301   7.888   1.00 39.71  ? 44  LEU A CG  1 
ATOM   3670 C  CD1 . LEU C 1 47  ? 67.562  8.457   6.776   1.00 39.99  ? 44  LEU A CD1 1 
ATOM   3671 C  CD2 . LEU C 1 47  ? 66.862  7.113   8.777   1.00 35.56  ? 44  LEU A CD2 1 
ATOM   3672 N  N   . THR C 1 48  ? 64.539  11.947  10.508  1.00 33.60  ? 45  THR A N   1 
ATOM   3673 C  CA  . THR C 1 48  ? 64.783  13.037  11.447  1.00 30.61  ? 45  THR A CA  1 
ATOM   3674 C  C   . THR C 1 48  ? 63.520  13.841  11.773  1.00 28.49  ? 45  THR A C   1 
ATOM   3675 O  O   . THR C 1 48  ? 62.612  13.947  10.948  1.00 29.27  ? 45  THR A O   1 
ATOM   3676 C  CB  . THR C 1 48  ? 65.885  13.981  10.902  1.00 29.94  ? 45  THR A CB  1 
ATOM   3677 O  OG1 . THR C 1 48  ? 66.375  14.820  11.953  1.00 41.66  ? 45  THR A OG1 1 
ATOM   3678 C  CG2 . THR C 1 48  ? 65.354  14.845  9.760   1.00 32.43  ? 45  THR A CG2 1 
ATOM   3679 N  N   . VAL C 1 49  ? 63.464  14.387  12.987  1.00 22.70  ? 46  VAL A N   1 
ATOM   3680 C  CA  . VAL C 1 49  ? 62.403  15.326  13.374  1.00 27.09  ? 46  VAL A CA  1 
ATOM   3681 C  C   . VAL C 1 49  ? 62.864  16.320  14.419  1.00 28.58  ? 46  VAL A C   1 
ATOM   3682 O  O   . VAL C 1 49  ? 63.657  15.992  15.301  1.00 30.88  ? 46  VAL A O   1 
ATOM   3683 C  CB  . VAL C 1 49  ? 61.128  14.642  13.940  1.00 25.84  ? 46  VAL A CB  1 
ATOM   3684 C  CG1 . VAL C 1 49  ? 60.060  14.534  12.879  1.00 36.58  ? 46  VAL A CG1 1 
ATOM   3685 C  CG2 . VAL C 1 49  ? 61.444  13.294  14.569  1.00 26.18  ? 46  VAL A CG2 1 
ATOM   3686 N  N   . GLN C 1 50  ? 62.343  17.535  14.315  1.00 29.17  ? 47  GLN A N   1 
ATOM   3687 C  CA  . GLN C 1 50  ? 62.559  18.555  15.323  1.00 28.42  ? 47  GLN A CA  1 
ATOM   3688 C  C   . GLN C 1 50  ? 61.482  19.622  15.209  1.00 30.21  ? 47  GLN A C   1 
ATOM   3689 O  O   . GLN C 1 50  ? 61.261  20.177  14.133  1.00 32.76  ? 47  GLN A O   1 
ATOM   3690 C  CB  . GLN C 1 50  ? 63.939  19.188  15.169  1.00 23.08  ? 47  GLN A CB  1 
ATOM   3691 C  CG  . GLN C 1 50  ? 64.293  20.136  16.297  1.00 28.38  ? 47  GLN A CG  1 
ATOM   3692 C  CD  . GLN C 1 50  ? 65.669  20.740  16.135  1.00 34.71  ? 47  GLN A CD  1 
ATOM   3693 O  OE1 . GLN C 1 50  ? 66.108  21.021  15.019  1.00 35.53  ? 47  GLN A OE1 1 
ATOM   3694 N  NE2 . GLN C 1 50  ? 66.359  20.949  17.252  1.00 31.42  ? 47  GLN A NE2 1 
ATOM   3695 N  N   . TRP C 1 51  ? 60.800  19.894  16.317  1.00 27.90  ? 48  TRP A N   1 
ATOM   3696 C  CA  . TRP C 1 51  ? 59.828  20.971  16.356  1.00 23.02  ? 48  TRP A CA  1 
ATOM   3697 C  C   . TRP C 1 51  ? 60.560  22.295  16.225  1.00 21.80  ? 48  TRP A C   1 
ATOM   3698 O  O   . TRP C 1 51  ? 61.618  22.489  16.821  1.00 27.55  ? 48  TRP A O   1 
ATOM   3699 C  CB  . TRP C 1 51  ? 59.047  20.966  17.677  1.00 20.49  ? 48  TRP A CB  1 
ATOM   3700 C  CG  . TRP C 1 51  ? 58.195  19.750  17.924  1.00 19.89  ? 48  TRP A CG  1 
ATOM   3701 C  CD1 . TRP C 1 51  ? 58.559  18.623  18.598  1.00 18.63  ? 48  TRP A CD1 1 
ATOM   3702 C  CD2 . TRP C 1 51  ? 56.829  19.554  17.524  1.00 20.29  ? 48  TRP A CD2 1 
ATOM   3703 N  NE1 . TRP C 1 51  ? 57.512  17.733  18.638  1.00 22.94  ? 48  TRP A NE1 1 
ATOM   3704 C  CE2 . TRP C 1 51  ? 56.440  18.277  17.981  1.00 21.95  ? 48  TRP A CE2 1 
ATOM   3705 C  CE3 . TRP C 1 51  ? 55.904  20.325  16.809  1.00 21.18  ? 48  TRP A CE3 1 
ATOM   3706 C  CZ2 . TRP C 1 51  ? 55.164  17.754  17.753  1.00 21.06  ? 48  TRP A CZ2 1 
ATOM   3707 C  CZ3 . TRP C 1 51  ? 54.634  19.805  16.583  1.00 21.93  ? 48  TRP A CZ3 1 
ATOM   3708 C  CH2 . TRP C 1 51  ? 54.278  18.532  17.055  1.00 21.59  ? 48  TRP A CH2 1 
ATOM   3709 N  N   . LEU C 1 52  ? 60.003  23.200  15.432  1.00 25.96  ? 49  LEU A N   1 
ATOM   3710 C  CA  . LEU C 1 52  ? 60.441  24.583  15.439  1.00 23.08  ? 49  LEU A CA  1 
ATOM   3711 C  C   . LEU C 1 52  ? 59.888  25.221  16.707  1.00 24.62  ? 49  LEU A C   1 
ATOM   3712 O  O   . LEU C 1 52  ? 58.868  24.774  17.227  1.00 31.50  ? 49  LEU A O   1 
ATOM   3713 C  CB  . LEU C 1 52  ? 59.919  25.311  14.201  1.00 32.55  ? 49  LEU A CB  1 
ATOM   3714 C  CG  . LEU C 1 52  ? 60.917  25.636  13.089  1.00 31.45  ? 49  LEU A CG  1 
ATOM   3715 C  CD1 . LEU C 1 52  ? 62.017  24.594  12.998  1.00 33.80  ? 49  LEU A CD1 1 
ATOM   3716 C  CD2 . LEU C 1 52  ? 60.195  25.799  11.758  1.00 27.70  ? 49  LEU A CD2 1 
ATOM   3717 N  N   . PRO C 1 53  ? 60.565  26.257  17.219  1.00 25.12  ? 50  PRO A N   1 
ATOM   3718 C  CA  . PRO C 1 53  ? 60.148  26.894  18.470  1.00 25.06  ? 50  PRO A CA  1 
ATOM   3719 C  C   . PRO C 1 53  ? 58.862  27.712  18.365  1.00 27.38  ? 50  PRO A C   1 
ATOM   3720 O  O   . PRO C 1 53  ? 58.246  28.018  19.386  1.00 28.59  ? 50  PRO A O   1 
ATOM   3721 C  CB  . PRO C 1 53  ? 61.328  27.811  18.805  1.00 28.33  ? 50  PRO A CB  1 
ATOM   3722 C  CG  . PRO C 1 53  ? 61.957  28.109  17.490  1.00 30.18  ? 50  PRO A CG  1 
ATOM   3723 C  CD  . PRO C 1 53  ? 61.781  26.873  16.657  1.00 26.77  ? 50  PRO A CD  1 
ATOM   3724 N  N   . GLU C 1 54  ? 58.453  28.059  17.149  1.00 29.34  ? 51  GLU A N   1 
ATOM   3725 C  CA  . GLU C 1 54  ? 57.283  28.918  16.974  1.00 28.41  ? 51  GLU A CA  1 
ATOM   3726 C  C   . GLU C 1 54  ? 55.964  28.189  17.200  1.00 27.29  ? 51  GLU A C   1 
ATOM   3727 O  O   . GLU C 1 54  ? 55.791  27.041  16.788  1.00 29.90  ? 51  GLU A O   1 
ATOM   3728 C  CB  . GLU C 1 54  ? 57.274  29.576  15.592  1.00 27.60  ? 51  GLU A CB  1 
ATOM   3729 C  CG  . GLU C 1 54  ? 58.465  30.473  15.306  1.00 31.12  ? 51  GLU A CG  1 
ATOM   3730 C  CD  . GLU C 1 54  ? 59.590  29.739  14.606  1.00 37.24  ? 51  GLU A CD  1 
ATOM   3731 O  OE1 . GLU C 1 54  ? 59.602  28.491  14.641  1.00 37.57  ? 51  GLU A OE1 1 
ATOM   3732 O  OE2 . GLU C 1 54  ? 60.460  30.412  14.014  1.00 42.80  ? 51  GLU A OE2 1 
ATOM   3733 N  N   . VAL C 1 55  ? 55.040  28.873  17.863  1.00 25.20  ? 52  VAL A N   1 
ATOM   3734 C  CA  . VAL C 1 55  ? 53.684  28.378  18.037  1.00 23.19  ? 52  VAL A CA  1 
ATOM   3735 C  C   . VAL C 1 55  ? 52.722  29.556  17.932  1.00 26.81  ? 52  VAL A C   1 
ATOM   3736 O  O   . VAL C 1 55  ? 53.080  30.688  18.251  1.00 29.02  ? 52  VAL A O   1 
ATOM   3737 C  CB  . VAL C 1 55  ? 53.499  27.676  19.396  1.00 24.28  ? 52  VAL A CB  1 
ATOM   3738 C  CG1 . VAL C 1 55  ? 53.696  28.666  20.545  1.00 25.68  ? 52  VAL A CG1 1 
ATOM   3739 C  CG2 . VAL C 1 55  ? 52.123  27.022  19.481  1.00 23.19  ? 52  VAL A CG2 1 
ATOM   3740 N  N   . THR C 1 56  ? 51.508  29.295  17.467  1.00 29.09  ? 53  THR A N   1 
ATOM   3741 C  CA  . THR C 1 56  ? 50.498  30.340  17.411  1.00 33.71  ? 53  THR A CA  1 
ATOM   3742 C  C   . THR C 1 56  ? 49.092  29.751  17.451  1.00 33.48  ? 53  THR A C   1 
ATOM   3743 O  O   . THR C 1 56  ? 48.838  28.684  16.891  1.00 36.50  ? 53  THR A O   1 
ATOM   3744 C  CB  . THR C 1 56  ? 50.686  31.259  16.176  1.00 34.89  ? 53  THR A CB  1 
ATOM   3745 O  OG1 . THR C 1 56  ? 49.986  32.491  16.384  1.00 44.02  ? 53  THR A OG1 1 
ATOM   3746 C  CG2 . THR C 1 56  ? 50.180  30.596  14.904  1.00 24.71  ? 53  THR A CG2 1 
ATOM   3747 N  N   . LYS C 1 57  ? 48.194  30.441  18.146  1.00 38.31  ? 54  LYS A N   1 
ATOM   3748 C  CA  . LYS C 1 57  ? 46.798  30.032  18.235  1.00 39.35  ? 54  LYS A CA  1 
ATOM   3749 C  C   . LYS C 1 57  ? 45.948  31.057  17.503  1.00 41.50  ? 54  LYS A C   1 
ATOM   3750 O  O   . LYS C 1 57  ? 45.557  32.072  18.080  1.00 38.68  ? 54  LYS A O   1 
ATOM   3751 C  CB  . LYS C 1 57  ? 46.353  29.924  19.695  1.00 41.44  ? 54  LYS A CB  1 
ATOM   3752 C  CG  . LYS C 1 57  ? 47.321  29.162  20.585  1.00 54.00  ? 54  LYS A CG  1 
ATOM   3753 C  CD  . LYS C 1 57  ? 46.717  28.880  21.952  1.00 66.24  ? 54  LYS A CD  1 
ATOM   3754 C  CE  . LYS C 1 57  ? 47.797  28.572  22.986  1.00 71.19  ? 54  LYS A CE  1 
ATOM   3755 N  NZ  . LYS C 1 57  ? 48.661  27.424  22.589  1.00 73.19  ? 54  LYS A NZ  1 
ATOM   3756 N  N   . PRO C 1 58  ? 45.662  30.795  16.221  1.00 43.56  ? 55  PRO A N   1 
ATOM   3757 C  CA  . PRO C 1 58  ? 44.953  31.738  15.366  1.00 43.36  ? 55  PRO A CA  1 
ATOM   3758 C  C   . PRO C 1 58  ? 43.623  32.193  15.959  1.00 45.15  ? 55  PRO A C   1 
ATOM   3759 O  O   . PRO C 1 58  ? 42.962  31.435  16.669  1.00 40.70  ? 55  PRO A O   1 
ATOM   3760 C  CB  . PRO C 1 58  ? 44.713  30.935  14.088  1.00 44.12  ? 55  PRO A CB  1 
ATOM   3761 C  CG  . PRO C 1 58  ? 45.800  29.923  14.075  1.00 43.97  ? 55  PRO A CG  1 
ATOM   3762 C  CD  . PRO C 1 58  ? 46.004  29.553  15.507  1.00 38.32  ? 55  PRO A CD  1 
ATOM   3763 N  N   . GLU C 1 59  ? 43.249  33.433  15.667  1.00 52.91  ? 56  GLU A N   1 
ATOM   3764 C  CA  . GLU C 1 59  ? 41.970  33.979  16.096  1.00 57.94  ? 56  GLU A CA  1 
ATOM   3765 C  C   . GLU C 1 59  ? 40.817  33.240  15.418  1.00 55.24  ? 56  GLU A C   1 
ATOM   3766 O  O   . GLU C 1 59  ? 40.822  33.044  14.201  1.00 47.73  ? 56  GLU A O   1 
ATOM   3767 C  CB  . GLU C 1 59  ? 41.908  35.468  15.757  1.00 64.70  ? 56  GLU A CB  1 
ATOM   3768 C  CG  . GLU C 1 59  ? 40.638  36.171  16.198  1.00 69.43  ? 56  GLU A CG  1 
ATOM   3769 C  CD  . GLU C 1 59  ? 40.435  37.488  15.477  1.00 73.33  ? 56  GLU A CD  1 
ATOM   3770 O  OE1 . GLU C 1 59  ? 40.322  37.473  14.232  1.00 73.58  ? 56  GLU A OE1 1 
ATOM   3771 O  OE2 . GLU C 1 59  ? 40.386  38.538  16.153  1.00 74.35  ? 56  GLU A OE2 1 
ATOM   3772 N  N   . GLY C 1 60  ? 39.838  32.819  16.214  1.00 51.39  ? 57  GLY A N   1 
ATOM   3773 C  CA  . GLY C 1 60  ? 38.643  32.166  15.687  1.00 53.49  ? 57  GLY A CA  1 
ATOM   3774 C  C   . GLY C 1 60  ? 38.777  30.670  15.466  1.00 56.19  ? 57  GLY A C   1 
ATOM   3775 O  O   . GLY C 1 60  ? 37.776  29.968  15.306  1.00 56.68  ? 57  GLY A O   1 
ATOM   3776 N  N   . LYS C 1 61  ? 40.011  30.177  15.460  1.00 52.44  ? 58  LYS A N   1 
ATOM   3777 C  CA  . LYS C 1 61  ? 40.269  28.767  15.193  1.00 49.91  ? 58  LYS A CA  1 
ATOM   3778 C  C   . LYS C 1 61  ? 40.212  27.925  16.465  1.00 50.47  ? 58  LYS A C   1 
ATOM   3779 O  O   . LYS C 1 61  ? 40.336  28.446  17.573  1.00 55.72  ? 58  LYS A O   1 
ATOM   3780 C  CB  . LYS C 1 61  ? 41.621  28.593  14.499  1.00 52.99  ? 58  LYS A CB  1 
ATOM   3781 C  CG  . LYS C 1 61  ? 41.769  29.403  13.220  1.00 53.64  ? 58  LYS A CG  1 
ATOM   3782 C  CD  . LYS C 1 61  ? 40.700  29.044  12.204  1.00 53.77  ? 58  LYS A CD  1 
ATOM   3783 C  CE  . LYS C 1 61  ? 40.864  29.848  10.929  1.00 53.50  ? 58  LYS A CE  1 
ATOM   3784 N  NZ  . LYS C 1 61  ? 39.875  29.436  9.899   1.00 58.33  ? 58  LYS A NZ  1 
ATOM   3785 N  N   . ASP C 1 62  ? 40.018  26.622  16.292  1.00 48.15  ? 59  ASP A N   1 
ATOM   3786 C  CA  . ASP C 1 62  ? 39.920  25.694  17.414  1.00 54.52  ? 59  ASP A CA  1 
ATOM   3787 C  C   . ASP C 1 62  ? 41.136  24.772  17.472  1.00 52.19  ? 59  ASP A C   1 
ATOM   3788 O  O   . ASP C 1 62  ? 41.083  23.688  18.052  1.00 49.64  ? 59  ASP A O   1 
ATOM   3789 C  CB  . ASP C 1 62  ? 38.633  24.870  17.313  1.00 59.51  ? 59  ASP A CB  1 
ATOM   3790 C  CG  . ASP C 1 62  ? 38.487  24.176  15.967  1.00 68.15  ? 59  ASP A CG  1 
ATOM   3791 O  OD1 . ASP C 1 62  ? 37.671  23.236  15.869  1.00 71.98  ? 59  ASP A OD1 1 
ATOM   3792 O  OD2 . ASP C 1 62  ? 39.184  24.570  15.007  1.00 67.90  ? 59  ASP A OD2 1 
ATOM   3793 N  N   . TYR C 1 63  ? 42.229  25.212  16.861  1.00 48.27  ? 60  TYR A N   1 
ATOM   3794 C  CA  . TYR C 1 63  ? 43.467  24.450  16.854  1.00 41.91  ? 60  TYR A CA  1 
ATOM   3795 C  C   . TYR C 1 63  ? 44.653  25.385  17.030  1.00 42.69  ? 60  TYR A C   1 
ATOM   3796 O  O   . TYR C 1 63  ? 44.485  26.601  17.116  1.00 50.11  ? 60  TYR A O   1 
ATOM   3797 C  CB  . TYR C 1 63  ? 43.606  23.675  15.544  1.00 38.98  ? 60  TYR A CB  1 
ATOM   3798 C  CG  . TYR C 1 63  ? 43.514  24.544  14.309  1.00 37.92  ? 60  TYR A CG  1 
ATOM   3799 C  CD1 . TYR C 1 63  ? 44.607  25.283  13.873  1.00 35.70  ? 60  TYR A CD1 1 
ATOM   3800 C  CD2 . TYR C 1 63  ? 42.332  24.625  13.578  1.00 29.94  ? 60  TYR A CD2 1 
ATOM   3801 C  CE1 . TYR C 1 63  ? 44.528  26.080  12.749  1.00 37.08  ? 60  TYR A CE1 1 
ATOM   3802 C  CE2 . TYR C 1 63  ? 42.244  25.422  12.449  1.00 30.91  ? 60  TYR A CE2 1 
ATOM   3803 C  CZ  . TYR C 1 63  ? 43.347  26.146  12.040  1.00 37.64  ? 60  TYR A CZ  1 
ATOM   3804 O  OH  . TYR C 1 63  ? 43.279  26.938  10.918  1.00 39.99  ? 60  TYR A OH  1 
ATOM   3805 N  N   . ALA C 1 64  ? 45.851  24.813  17.079  1.00 40.01  ? 61  ALA A N   1 
ATOM   3806 C  CA  . ALA C 1 64  ? 47.070  25.605  17.166  1.00 35.36  ? 61  ALA A CA  1 
ATOM   3807 C  C   . ALA C 1 64  ? 48.018  25.250  16.028  1.00 35.73  ? 61  ALA A C   1 
ATOM   3808 O  O   . ALA C 1 64  ? 47.979  24.141  15.495  1.00 35.23  ? 61  ALA A O   1 
ATOM   3809 C  CB  . ALA C 1 64  ? 47.746  25.398  18.510  1.00 32.78  ? 61  ALA A CB  1 
ATOM   3810 N  N   . LEU C 1 65  ? 48.865  26.201  15.655  1.00 36.03  ? 62  LEU A N   1 
ATOM   3811 C  CA  . LEU C 1 65  ? 49.843  25.983  14.601  1.00 31.24  ? 62  LEU A CA  1 
ATOM   3812 C  C   . LEU C 1 65  ? 51.215  25.672  15.192  1.00 35.59  ? 62  LEU A C   1 
ATOM   3813 O  O   . LEU C 1 65  ? 51.741  26.444  15.996  1.00 33.16  ? 62  LEU A O   1 
ATOM   3814 C  CB  . LEU C 1 65  ? 49.923  27.210  13.687  1.00 31.99  ? 62  LEU A CB  1 
ATOM   3815 C  CG  . LEU C 1 65  ? 49.123  27.205  12.378  1.00 31.89  ? 62  LEU A CG  1 
ATOM   3816 C  CD1 . LEU C 1 65  ? 47.814  26.451  12.505  1.00 28.45  ? 62  LEU A CD1 1 
ATOM   3817 C  CD2 . LEU C 1 65  ? 48.885  28.624  11.882  1.00 31.12  ? 62  LEU A CD2 1 
ATOM   3818 N  N   . HIS C 1 66  ? 51.773  24.528  14.802  1.00 28.60  ? 63  HIS A N   1 
ATOM   3819 C  CA  . HIS C 1 66  ? 53.136  24.151  15.162  1.00 27.52  ? 63  HIS A CA  1 
ATOM   3820 C  C   . HIS C 1 66  ? 53.891  23.803  13.884  1.00 27.57  ? 63  HIS A C   1 
ATOM   3821 O  O   . HIS C 1 66  ? 53.273  23.562  12.846  1.00 29.48  ? 63  HIS A O   1 
ATOM   3822 C  CB  . HIS C 1 66  ? 53.139  22.945  16.104  1.00 29.38  ? 63  HIS A CB  1 
ATOM   3823 C  CG  . HIS C 1 66  ? 52.417  23.176  17.396  1.00 32.44  ? 63  HIS A CG  1 
ATOM   3824 N  ND1 . HIS C 1 66  ? 53.066  23.227  18.612  1.00 26.80  ? 63  HIS A ND1 1 
ATOM   3825 C  CD2 . HIS C 1 66  ? 51.102  23.360  17.664  1.00 28.27  ? 63  HIS A CD2 1 
ATOM   3826 C  CE1 . HIS C 1 66  ? 52.182  23.435  19.572  1.00 20.80  ? 63  HIS A CE1 1 
ATOM   3827 N  NE2 . HIS C 1 66  ? 50.984  23.520  19.023  1.00 27.83  ? 63  HIS A NE2 1 
ATOM   3828 N  N   . TRP C 1 67  ? 55.219  23.770  13.955  1.00 21.40  ? 64  TRP A N   1 
ATOM   3829 C  CA  . TRP C 1 67  ? 56.030  23.452  12.779  1.00 27.46  ? 64  TRP A CA  1 
ATOM   3830 C  C   . TRP C 1 67  ? 57.089  22.379  13.038  1.00 30.89  ? 64  TRP A C   1 
ATOM   3831 O  O   . TRP C 1 67  ? 57.775  22.397  14.063  1.00 33.20  ? 64  TRP A O   1 
ATOM   3832 C  CB  . TRP C 1 67  ? 56.677  24.716  12.209  1.00 28.94  ? 64  TRP A CB  1 
ATOM   3833 C  CG  . TRP C 1 67  ? 55.699  25.631  11.548  1.00 29.01  ? 64  TRP A CG  1 
ATOM   3834 C  CD1 . TRP C 1 67  ? 55.382  25.672  10.220  1.00 30.98  ? 64  TRP A CD1 1 
ATOM   3835 C  CD2 . TRP C 1 67  ? 54.898  26.633  12.184  1.00 29.42  ? 64  TRP A CD2 1 
ATOM   3836 N  NE1 . TRP C 1 67  ? 54.436  26.642  9.989   1.00 30.07  ? 64  TRP A NE1 1 
ATOM   3837 C  CE2 . TRP C 1 67  ? 54.120  27.246  11.178  1.00 31.15  ? 64  TRP A CE2 1 
ATOM   3838 C  CE3 . TRP C 1 67  ? 54.765  27.076  13.504  1.00 29.51  ? 64  TRP A CE3 1 
ATOM   3839 C  CZ2 . TRP C 1 67  ? 53.222  28.279  11.452  1.00 29.15  ? 64  TRP A CZ2 1 
ATOM   3840 C  CZ3 . TRP C 1 67  ? 53.871  28.101  13.775  1.00 31.14  ? 64  TRP A CZ3 1 
ATOM   3841 C  CH2 . TRP C 1 67  ? 53.111  28.690  12.753  1.00 30.49  ? 64  TRP A CH2 1 
ATOM   3842 N  N   . LEU C 1 68  ? 57.214  21.449  12.095  1.00 26.29  ? 65  LEU A N   1 
ATOM   3843 C  CA  . LEU C 1 68  ? 58.195  20.372  12.187  1.00 26.93  ? 65  LEU A CA  1 
ATOM   3844 C  C   . LEU C 1 68  ? 59.263  20.511  11.111  1.00 27.06  ? 65  LEU A C   1 
ATOM   3845 O  O   . LEU C 1 68  ? 58.963  20.871  9.974   1.00 33.27  ? 65  LEU A O   1 
ATOM   3846 C  CB  . LEU C 1 68  ? 57.520  19.006  12.015  1.00 30.15  ? 65  LEU A CB  1 
ATOM   3847 C  CG  . LEU C 1 68  ? 56.774  18.311  13.159  1.00 27.81  ? 65  LEU A CG  1 
ATOM   3848 C  CD1 . LEU C 1 68  ? 57.536  18.440  14.464  1.00 27.10  ? 65  LEU A CD1 1 
ATOM   3849 C  CD2 . LEU C 1 68  ? 55.366  18.847  13.307  1.00 37.69  ? 65  LEU A CD2 1 
ATOM   3850 N  N   . VAL C 1 69  ? 60.508  20.214  11.466  1.00 29.12  ? 66  VAL A N   1 
ATOM   3851 C  CA  . VAL C 1 69  ? 61.559  20.071  10.468  1.00 26.19  ? 66  VAL A CA  1 
ATOM   3852 C  C   . VAL C 1 69  ? 61.745  18.589  10.165  1.00 29.42  ? 66  VAL A C   1 
ATOM   3853 O  O   . VAL C 1 69  ? 62.082  17.802  11.049  1.00 33.40  ? 66  VAL A O   1 
ATOM   3854 C  CB  . VAL C 1 69  ? 62.893  20.682  10.928  1.00 28.19  ? 66  VAL A CB  1 
ATOM   3855 C  CG1 . VAL C 1 69  ? 63.978  20.401  9.904   1.00 25.88  ? 66  VAL A CG1 1 
ATOM   3856 C  CG2 . VAL C 1 69  ? 62.743  22.175  11.138  1.00 24.92  ? 66  VAL A CG2 1 
ATOM   3857 N  N   . LEU C 1 70  ? 61.505  18.214  8.915   1.00 30.08  ? 67  LEU A N   1 
ATOM   3858 C  CA  . LEU C 1 70  ? 61.591  16.822  8.498   1.00 27.31  ? 67  LEU A CA  1 
ATOM   3859 C  C   . LEU C 1 70  ? 62.541  16.672  7.320   1.00 30.76  ? 67  LEU A C   1 
ATOM   3860 O  O   . LEU C 1 70  ? 63.064  17.655  6.796   1.00 29.63  ? 67  LEU A O   1 
ATOM   3861 C  CB  . LEU C 1 70  ? 60.213  16.303  8.088   1.00 26.50  ? 67  LEU A CB  1 
ATOM   3862 C  CG  . LEU C 1 70  ? 59.094  16.252  9.126   1.00 28.27  ? 67  LEU A CG  1 
ATOM   3863 C  CD1 . LEU C 1 70  ? 57.738  16.302  8.436   1.00 29.01  ? 67  LEU A CD1 1 
ATOM   3864 C  CD2 . LEU C 1 70  ? 59.217  15.003  9.977   1.00 27.59  ? 67  LEU A CD2 1 
ATOM   3865 N  N   . GLY C 1 71  ? 62.750  15.429  6.905   1.00 33.89  ? 68  GLY A N   1 
ATOM   3866 C  CA  . GLY C 1 71  ? 63.556  15.130  5.733   1.00 30.63  ? 68  GLY A CA  1 
ATOM   3867 C  C   . GLY C 1 71  ? 62.944  13.959  4.994   1.00 34.76  ? 68  GLY A C   1 
ATOM   3868 O  O   . GLY C 1 71  ? 61.933  13.405  5.427   1.00 37.00  ? 68  GLY A O   1 
ATOM   3869 N  N   . THR C 1 72  ? 63.547  13.584  3.873   1.00 34.22  ? 69  THR A N   1 
ATOM   3870 C  CA  . THR C 1 72  ? 63.086  12.428  3.122   1.00 31.55  ? 69  THR A CA  1 
ATOM   3871 C  C   . THR C 1 72  ? 64.185  11.385  3.046   1.00 37.35  ? 69  THR A C   1 
ATOM   3872 O  O   . THR C 1 72  ? 65.360  11.688  3.256   1.00 42.74  ? 69  THR A O   1 
ATOM   3873 C  CB  . THR C 1 72  ? 62.678  12.806  1.695   1.00 30.89  ? 69  THR A CB  1 
ATOM   3874 O  OG1 . THR C 1 72  ? 63.797  13.397  1.027   1.00 29.53  ? 69  THR A OG1 1 
ATOM   3875 C  CG2 . THR C 1 72  ? 61.513  13.786  1.706   1.00 27.75  ? 69  THR A CG2 1 
ATOM   3876 N  N   . HIS C 1 73  ? 63.796  10.154  2.741   1.00 39.64  ? 70  HIS A N   1 
ATOM   3877 C  CA  . HIS C 1 73  ? 64.747  9.067   2.605   1.00 40.78  ? 70  HIS A CA  1 
ATOM   3878 C  C   . HIS C 1 73  ? 64.378  8.195   1.414   1.00 43.09  ? 70  HIS A C   1 
ATOM   3879 O  O   . HIS C 1 73  ? 63.534  7.303   1.511   1.00 45.74  ? 70  HIS A O   1 
ATOM   3880 C  CB  . HIS C 1 73  ? 64.812  8.243   3.894   1.00 44.85  ? 70  HIS A CB  1 
ATOM   3881 C  CG  . HIS C 1 73  ? 65.839  7.153   3.870   1.00 51.74  ? 70  HIS A CG  1 
ATOM   3882 N  ND1 . HIS C 1 73  ? 67.156  7.377   3.534   1.00 54.24  ? 70  HIS A ND1 1 
ATOM   3883 C  CD2 . HIS C 1 73  ? 65.745  5.835   4.165   1.00 51.87  ? 70  HIS A CD2 1 
ATOM   3884 C  CE1 . HIS C 1 73  ? 67.827  6.241   3.609   1.00 50.03  ? 70  HIS A CE1 1 
ATOM   3885 N  NE2 . HIS C 1 73  ? 66.994  5.290   3.991   1.00 49.88  ? 70  HIS A NE2 1 
ATOM   3886 N  N   . THR C 1 74  ? 65.006  8.484   0.282   1.00 45.46  ? 71  THR A N   1 
ATOM   3887 C  CA  . THR C 1 74  ? 64.874  7.660   -0.909  1.00 48.27  ? 71  THR A CA  1 
ATOM   3888 C  C   . THR C 1 74  ? 66.197  7.664   -1.665  1.00 51.37  ? 71  THR A C   1 
ATOM   3889 O  O   . THR C 1 74  ? 66.735  8.723   -1.993  1.00 50.15  ? 71  THR A O   1 
ATOM   3890 C  CB  . THR C 1 74  ? 63.721  8.134   -1.826  1.00 49.68  ? 71  THR A CB  1 
ATOM   3891 O  OG1 . THR C 1 74  ? 63.782  7.433   -3.075  1.00 52.47  ? 71  THR A OG1 1 
ATOM   3892 C  CG2 . THR C 1 74  ? 63.803  9.635   -2.086  1.00 46.70  ? 71  THR A CG2 1 
ATOM   3893 N  N   . SER C 1 75  ? 66.732  6.474   -1.917  1.00 56.59  ? 72  SER A N   1 
ATOM   3894 C  CA  . SER C 1 75  ? 67.998  6.346   -2.625  1.00 59.33  ? 72  SER A CA  1 
ATOM   3895 C  C   . SER C 1 75  ? 67.779  6.439   -4.127  1.00 57.47  ? 72  SER A C   1 
ATOM   3896 O  O   . SER C 1 75  ? 68.719  6.662   -4.886  1.00 63.41  ? 72  SER A O   1 
ATOM   3897 C  CB  . SER C 1 75  ? 68.675  5.020   -2.280  1.00 63.53  ? 72  SER A CB  1 
ATOM   3898 O  OG  . SER C 1 75  ? 67.915  3.925   -2.761  1.00 71.93  ? 72  SER A OG  1 
ATOM   3899 N  N   . ASP C 1 76  ? 66.528  6.270   -4.546  1.00 58.53  ? 73  ASP A N   1 
ATOM   3900 C  CA  . ASP C 1 76  ? 66.179  6.267   -5.963  1.00 59.34  ? 73  ASP A CA  1 
ATOM   3901 C  C   . ASP C 1 76  ? 65.852  7.651   -6.511  1.00 55.24  ? 73  ASP A C   1 
ATOM   3902 O  O   . ASP C 1 76  ? 66.288  8.009   -7.605  1.00 59.64  ? 73  ASP A O   1 
ATOM   3903 C  CB  . ASP C 1 76  ? 64.990  5.335   -6.217  1.00 66.60  ? 73  ASP A CB  1 
ATOM   3904 C  CG  . ASP C 1 76  ? 65.413  3.905   -6.474  1.00 72.70  ? 73  ASP A CG  1 
ATOM   3905 O  OD1 . ASP C 1 76  ? 64.523  3.043   -6.641  1.00 75.65  ? 73  ASP A OD1 1 
ATOM   3906 O  OD2 . ASP C 1 76  ? 66.634  3.644   -6.514  1.00 76.68  ? 73  ASP A OD2 1 
ATOM   3907 N  N   . GLU C 1 77  ? 65.083  8.424   -5.752  1.00 47.46  ? 74  GLU A N   1 
ATOM   3908 C  CA  . GLU C 1 77  ? 64.487  9.645   -6.283  1.00 41.77  ? 74  GLU A CA  1 
ATOM   3909 C  C   . GLU C 1 77  ? 64.875  10.912  -5.526  1.00 39.17  ? 74  GLU A C   1 
ATOM   3910 O  O   . GLU C 1 77  ? 65.726  10.881  -4.635  1.00 38.16  ? 74  GLU A O   1 
ATOM   3911 C  CB  . GLU C 1 77  ? 62.966  9.487   -6.348  1.00 41.30  ? 74  GLU A CB  1 
ATOM   3912 C  CG  . GLU C 1 77  ? 62.539  8.265   -7.151  1.00 47.75  ? 74  GLU A CG  1 
ATOM   3913 C  CD  . GLU C 1 77  ? 61.058  7.979   -7.065  1.00 50.56  ? 74  GLU A CD  1 
ATOM   3914 O  OE1 . GLU C 1 77  ? 60.699  6.840   -6.701  1.00 51.52  ? 74  GLU A OE1 1 
ATOM   3915 O  OE2 . GLU C 1 77  ? 60.254  8.889   -7.361  1.00 52.40  ? 74  GLU A OE2 1 
ATOM   3916 N  N   . GLN C 1 78  ? 64.249  12.026  -5.897  1.00 35.03  ? 75  GLN A N   1 
ATOM   3917 C  CA  . GLN C 1 78  ? 64.590  13.330  -5.336  1.00 35.11  ? 75  GLN A CA  1 
ATOM   3918 C  C   . GLN C 1 78  ? 64.265  13.433  -3.850  1.00 33.26  ? 75  GLN A C   1 
ATOM   3919 O  O   . GLN C 1 78  ? 63.176  13.061  -3.417  1.00 30.05  ? 75  GLN A O   1 
ATOM   3920 C  CB  . GLN C 1 78  ? 63.874  14.447  -6.099  1.00 35.62  ? 75  GLN A CB  1 
ATOM   3921 C  CG  . GLN C 1 78  ? 64.283  15.851  -5.675  1.00 34.76  ? 75  GLN A CG  1 
ATOM   3922 C  CD  . GLN C 1 78  ? 65.760  16.118  -5.897  1.00 40.51  ? 75  GLN A CD  1 
ATOM   3923 O  OE1 . GLN C 1 78  ? 66.448  16.647  -5.021  1.00 39.88  ? 75  GLN A OE1 1 
ATOM   3924 N  NE2 . GLN C 1 78  ? 66.258  15.745  -7.071  1.00 44.63  ? 75  GLN A NE2 1 
ATOM   3925 N  N   . ASN C 1 79  ? 65.222  13.941  -3.079  1.00 32.35  ? 76  ASN A N   1 
ATOM   3926 C  CA  . ASN C 1 79  ? 65.029  14.180  -1.655  1.00 31.87  ? 76  ASN A CA  1 
ATOM   3927 C  C   . ASN C 1 79  ? 64.760  15.649  -1.351  1.00 34.51  ? 76  ASN A C   1 
ATOM   3928 O  O   . ASN C 1 79  ? 65.175  16.533  -2.104  1.00 36.65  ? 76  ASN A O   1 
ATOM   3929 C  CB  . ASN C 1 79  ? 66.253  13.712  -0.869  1.00 35.81  ? 76  ASN A CB  1 
ATOM   3930 C  CG  . ASN C 1 79  ? 66.397  12.207  -0.857  1.00 31.66  ? 76  ASN A CG  1 
ATOM   3931 O  OD1 . ASN C 1 79  ? 65.635  11.505  -0.196  1.00 34.72  ? 76  ASN A OD1 1 
ATOM   3932 N  ND2 . ASN C 1 79  ? 67.385  11.702  -1.583  1.00 36.33  ? 76  ASN A ND2 1 
ATOM   3933 N  N   . HIS C 1 80  ? 64.073  15.903  -0.239  1.00 36.94  ? 77  HIS A N   1 
ATOM   3934 C  CA  . HIS C 1 80  ? 63.774  17.264  0.195   1.00 31.84  ? 77  HIS A CA  1 
ATOM   3935 C  C   . HIS C 1 80  ? 64.015  17.471  1.686   1.00 33.77  ? 77  HIS A C   1 
ATOM   3936 O  O   . HIS C 1 80  ? 63.767  16.578  2.496   1.00 36.60  ? 77  HIS A O   1 
ATOM   3937 C  CB  . HIS C 1 80  ? 62.316  17.616  -0.101  1.00 29.82  ? 77  HIS A CB  1 
ATOM   3938 C  CG  . HIS C 1 80  ? 61.966  17.604  -1.554  1.00 34.27  ? 77  HIS A CG  1 
ATOM   3939 N  ND1 . HIS C 1 80  ? 61.290  16.561  -2.148  1.00 39.66  ? 77  HIS A ND1 1 
ATOM   3940 C  CD2 . HIS C 1 80  ? 62.183  18.516  -2.530  1.00 37.96  ? 77  HIS A CD2 1 
ATOM   3941 C  CE1 . HIS C 1 80  ? 61.112  16.826  -3.429  1.00 40.12  ? 77  HIS A CE1 1 
ATOM   3942 N  NE2 . HIS C 1 80  ? 61.644  18.007  -3.687  1.00 44.78  ? 77  HIS A NE2 1 
ATOM   3943 N  N   . LEU C 1 81  ? 64.499  18.657  2.042   1.00 32.97  ? 78  LEU A N   1 
ATOM   3944 C  CA  . LEU C 1 81  ? 64.430  19.123  3.419   1.00 26.26  ? 78  LEU A CA  1 
ATOM   3945 C  C   . LEU C 1 81  ? 63.059  19.768  3.567   1.00 29.36  ? 78  LEU A C   1 
ATOM   3946 O  O   . LEU C 1 81  ? 62.639  20.543  2.710   1.00 28.76  ? 78  LEU A O   1 
ATOM   3947 C  CB  . LEU C 1 81  ? 65.537  20.133  3.721   1.00 26.60  ? 78  LEU A CB  1 
ATOM   3948 C  CG  . LEU C 1 81  ? 65.421  20.876  5.057   1.00 25.24  ? 78  LEU A CG  1 
ATOM   3949 C  CD1 . LEU C 1 81  ? 65.493  19.908  6.229   1.00 19.65  ? 78  LEU A CD1 1 
ATOM   3950 C  CD2 . LEU C 1 81  ? 66.490  21.945  5.174   1.00 20.64  ? 78  LEU A CD2 1 
ATOM   3951 N  N   . VAL C 1 82  ? 62.355  19.437  4.642   1.00 29.64  ? 79  VAL A N   1 
ATOM   3952 C  CA  . VAL C 1 82  ? 60.945  19.787  4.743   1.00 27.48  ? 79  VAL A CA  1 
ATOM   3953 C  C   . VAL C 1 82  ? 60.593  20.482  6.049   1.00 31.46  ? 79  VAL A C   1 
ATOM   3954 O  O   . VAL C 1 82  ? 60.998  20.047  7.126   1.00 35.36  ? 79  VAL A O   1 
ATOM   3955 C  CB  . VAL C 1 82  ? 60.049  18.532  4.575   1.00 26.66  ? 79  VAL A CB  1 
ATOM   3956 C  CG1 . VAL C 1 82  ? 58.608  18.840  4.944   1.00 25.09  ? 79  VAL A CG1 1 
ATOM   3957 C  CG2 . VAL C 1 82  ? 60.134  18.004  3.150   1.00 23.76  ? 79  VAL A CG2 1 
ATOM   3958 N  N   . VAL C 1 83  ? 59.841  21.572  5.940   1.00 30.90  ? 80  VAL A N   1 
ATOM   3959 C  CA  . VAL C 1 83  ? 59.243  22.206  7.103   1.00 30.89  ? 80  VAL A CA  1 
ATOM   3960 C  C   . VAL C 1 83  ? 57.729  22.041  7.026   1.00 34.88  ? 80  VAL A C   1 
ATOM   3961 O  O   . VAL C 1 83  ? 57.082  22.559  6.114   1.00 35.22  ? 80  VAL A O   1 
ATOM   3962 C  CB  . VAL C 1 83  ? 59.606  23.696  7.203   1.00 29.75  ? 80  VAL A CB  1 
ATOM   3963 C  CG1 . VAL C 1 83  ? 58.979  24.303  8.448   1.00 25.85  ? 80  VAL A CG1 1 
ATOM   3964 C  CG2 . VAL C 1 83  ? 61.118  23.872  7.227   1.00 23.49  ? 80  VAL A CG2 1 
ATOM   3965 N  N   . ALA C 1 84  ? 57.170  21.304  7.979   1.00 30.60  ? 81  ALA A N   1 
ATOM   3966 C  CA  . ALA C 1 84  ? 55.743  21.025  7.977   1.00 26.82  ? 81  ALA A CA  1 
ATOM   3967 C  C   . ALA C 1 84  ? 54.995  21.901  8.975   1.00 30.23  ? 81  ALA A C   1 
ATOM   3968 O  O   . ALA C 1 84  ? 55.455  22.115  10.096  1.00 32.83  ? 81  ALA A O   1 
ATOM   3969 C  CB  . ALA C 1 84  ? 55.491  19.554  8.262   1.00 23.84  ? 81  ALA A CB  1 
ATOM   3970 N  N   . ARG C 1 85  ? 53.848  22.416  8.543   1.00 28.57  ? 82  ARG A N   1 
ATOM   3971 C  CA  . ARG C 1 85  ? 52.940  23.157  9.405   1.00 25.31  ? 82  ARG A CA  1 
ATOM   3972 C  C   . ARG C 1 85  ? 51.849  22.196  9.858   1.00 30.66  ? 82  ARG A C   1 
ATOM   3973 O  O   . ARG C 1 85  ? 51.275  21.481  9.036   1.00 30.12  ? 82  ARG A O   1 
ATOM   3974 C  CB  . ARG C 1 85  ? 52.321  24.323  8.632   1.00 29.08  ? 82  ARG A CB  1 
ATOM   3975 C  CG  . ARG C 1 85  ? 51.250  25.093  9.392   1.00 25.23  ? 82  ARG A CG  1 
ATOM   3976 C  CD  . ARG C 1 85  ? 50.810  26.337  8.631   1.00 26.44  ? 82  ARG A CD  1 
ATOM   3977 N  NE  . ARG C 1 85  ? 49.985  26.024  7.465   1.00 29.19  ? 82  ARG A NE  1 
ATOM   3978 C  CZ  . ARG C 1 85  ? 50.408  26.084  6.205   1.00 34.78  ? 82  ARG A CZ  1 
ATOM   3979 N  NH1 . ARG C 1 85  ? 51.655  26.446  5.934   1.00 31.99  ? 82  ARG A NH1 1 
ATOM   3980 N  NH2 . ARG C 1 85  ? 49.582  25.784  5.211   1.00 32.57  ? 82  ARG A NH2 1 
ATOM   3981 N  N   . VAL C 1 86  ? 51.564  22.167  11.158  1.00 27.94  ? 83  VAL A N   1 
ATOM   3982 C  CA  . VAL C 1 86  ? 50.550  21.244  11.672  1.00 34.25  ? 83  VAL A CA  1 
ATOM   3983 C  C   . VAL C 1 86  ? 49.468  21.901  12.530  1.00 34.35  ? 83  VAL A C   1 
ATOM   3984 O  O   . VAL C 1 86  ? 49.719  22.868  13.251  1.00 30.88  ? 83  VAL A O   1 
ATOM   3985 C  CB  . VAL C 1 86  ? 51.176  20.046  12.445  1.00 35.00  ? 83  VAL A CB  1 
ATOM   3986 C  CG1 . VAL C 1 86  ? 52.202  19.330  11.584  1.00 35.40  ? 83  VAL A CG1 1 
ATOM   3987 C  CG2 . VAL C 1 86  ? 51.800  20.502  13.753  1.00 35.16  ? 83  VAL A CG2 1 
ATOM   3988 N  N   . HIS C 1 87  ? 48.256  21.364  12.431  1.00 39.72  ? 84  HIS A N   1 
ATOM   3989 C  CA  . HIS C 1 87  ? 47.144  21.786  13.266  1.00 34.84  ? 84  HIS A CA  1 
ATOM   3990 C  C   . HIS C 1 87  ? 47.042  20.845  14.459  1.00 32.03  ? 84  HIS A C   1 
ATOM   3991 O  O   . HIS C 1 87  ? 46.679  19.682  14.301  1.00 36.09  ? 84  HIS A O   1 
ATOM   3992 C  CB  . HIS C 1 87  ? 45.832  21.718  12.479  1.00 35.03  ? 84  HIS A CB  1 
ATOM   3993 C  CG  . HIS C 1 87  ? 45.680  22.785  11.440  1.00 37.85  ? 84  HIS A CG  1 
ATOM   3994 N  ND1 . HIS C 1 87  ? 46.753  23.388  10.822  1.00 44.80  ? 84  HIS A ND1 1 
ATOM   3995 C  CD2 . HIS C 1 87  ? 44.571  23.332  10.887  1.00 38.22  ? 84  HIS A CD2 1 
ATOM   3996 C  CE1 . HIS C 1 87  ? 46.313  24.275  9.947   1.00 42.03  ? 84  HIS A CE1 1 
ATOM   3997 N  NE2 . HIS C 1 87  ? 44.993  24.261  9.967   1.00 36.15  ? 84  HIS A NE2 1 
ATOM   3998 N  N   . ILE C 1 88  ? 47.373  21.338  15.647  1.00 36.01  ? 85  ILE A N   1 
ATOM   3999 C  CA  . ILE C 1 88  ? 47.120  20.581  16.870  1.00 40.54  ? 85  ILE A CA  1 
ATOM   4000 C  C   . ILE C 1 88  ? 45.865  21.131  17.536  1.00 44.69  ? 85  ILE A C   1 
ATOM   4001 O  O   . ILE C 1 88  ? 45.845  22.284  17.973  1.00 43.82  ? 85  ILE A O   1 
ATOM   4002 C  CB  . ILE C 1 88  ? 48.302  20.642  17.859  1.00 42.08  ? 85  ILE A CB  1 
ATOM   4003 C  CG1 . ILE C 1 88  ? 49.562  20.047  17.231  1.00 44.14  ? 85  ILE A CG1 1 
ATOM   4004 C  CG2 . ILE C 1 88  ? 47.966  19.892  19.141  1.00 40.36  ? 85  ILE A CG2 1 
ATOM   4005 C  CD1 . ILE C 1 88  ? 50.712  19.898  18.206  1.00 46.19  ? 85  ILE A CD1 1 
ATOM   4006 N  N   . PRO C 1 89  ? 44.809  20.305  17.605  1.00 48.60  ? 86  PRO A N   1 
ATOM   4007 C  CA  . PRO C 1 89  ? 43.505  20.691  18.142  1.00 51.10  ? 86  PRO A CA  1 
ATOM   4008 C  C   . PRO C 1 89  ? 43.585  21.189  19.581  1.00 54.50  ? 86  PRO A C   1 
ATOM   4009 O  O   . PRO C 1 89  ? 44.320  20.623  20.390  1.00 55.82  ? 86  PRO A O   1 
ATOM   4010 C  CB  . PRO C 1 89  ? 42.705  19.386  18.089  1.00 49.35  ? 86  PRO A CB  1 
ATOM   4011 C  CG  . PRO C 1 89  ? 43.373  18.572  17.036  1.00 48.75  ? 86  PRO A CG  1 
ATOM   4012 C  CD  . PRO C 1 89  ? 44.825  18.906  17.149  1.00 49.97  ? 86  PRO A CD  1 
ATOM   4013 N  N   . ASN C 1 90  ? 42.835  22.245  19.886  1.00 60.18  ? 87  ASN A N   1 
ATOM   4014 C  CA  . ASN C 1 90  ? 42.763  22.776  21.244  1.00 66.29  ? 87  ASN A CA  1 
ATOM   4015 C  C   . ASN C 1 90  ? 41.986  21.845  22.164  1.00 73.27  ? 87  ASN A C   1 
ATOM   4016 O  O   . ASN C 1 90  ? 41.032  21.193  21.740  1.00 76.14  ? 87  ASN A O   1 
ATOM   4017 C  CB  . ASN C 1 90  ? 42.117  24.164  21.250  1.00 68.24  ? 87  ASN A CB  1 
ATOM   4018 C  CG  . ASN C 1 90  ? 43.033  25.242  20.700  1.00 68.76  ? 87  ASN A CG  1 
ATOM   4019 O  OD1 . ASN C 1 90  ? 42.580  26.176  20.038  1.00 68.80  ? 87  ASN A OD1 1 
ATOM   4020 N  ND2 . ASN C 1 90  ? 44.327  25.119  20.973  1.00 68.87  ? 87  ASN A ND2 1 
ATOM   4021 N  N   . ASP C 1 91  ? 42.398  21.789  23.426  1.00 82.06  ? 88  ASP A N   1 
ATOM   4022 C  CA  . ASP C 1 91  ? 41.716  20.967  24.420  1.00 88.33  ? 88  ASP A CA  1 
ATOM   4023 C  C   . ASP C 1 91  ? 41.738  21.638  25.791  1.00 88.33  ? 88  ASP A C   1 
ATOM   4024 O  O   . ASP C 1 91  ? 42.737  21.577  26.508  1.00 85.00  ? 88  ASP A O   1 
ATOM   4025 C  CB  . ASP C 1 91  ? 42.354  19.578  24.499  1.00 94.45  ? 88  ASP A CB  1 
ATOM   4026 C  CG  . ASP C 1 91  ? 41.593  18.636  25.415  1.00 100.93 ? 88  ASP A CG  1 
ATOM   4027 O  OD1 . ASP C 1 91  ? 40.372  18.833  25.599  1.00 101.43 ? 88  ASP A OD1 1 
ATOM   4028 O  OD2 . ASP C 1 91  ? 42.217  17.691  25.947  1.00 103.51 ? 88  ASP A OD2 1 
ATOM   4029 N  N   . VAL C 1 113 ? 40.513  14.108  9.699   1.00 80.43  ? 110 VAL A N   1 
ATOM   4030 C  CA  . VAL C 1 113 ? 40.194  13.421  10.945  1.00 83.38  ? 110 VAL A CA  1 
ATOM   4031 C  C   . VAL C 1 113 ? 40.432  14.330  12.145  1.00 82.40  ? 110 VAL A C   1 
ATOM   4032 O  O   . VAL C 1 113 ? 39.632  15.222  12.428  1.00 83.93  ? 110 VAL A O   1 
ATOM   4033 N  N   . THR C 1 114 ? 41.531  14.093  12.854  1.00 78.23  ? 111 THR A N   1 
ATOM   4034 C  CA  . THR C 1 114 ? 41.915  14.939  13.979  1.00 74.83  ? 111 THR A CA  1 
ATOM   4035 C  C   . THR C 1 114 ? 43.272  15.580  13.712  1.00 70.57  ? 111 THR A C   1 
ATOM   4036 O  O   . THR C 1 114 ? 44.302  14.903  13.711  1.00 67.56  ? 111 THR A O   1 
ATOM   4037 C  CB  . THR C 1 114 ? 41.962  14.153  15.310  1.00 76.23  ? 111 THR A CB  1 
ATOM   4038 O  OG1 . THR C 1 114 ? 42.838  13.026  15.178  1.00 73.31  ? 111 THR A OG1 1 
ATOM   4039 C  CG2 . THR C 1 114 ? 40.570  13.668  15.698  1.00 79.32  ? 111 THR A CG2 1 
ATOM   4040 N  N   . GLY C 1 115 ? 43.266  16.889  13.478  1.00 62.25  ? 112 GLY A N   1 
ATOM   4041 C  CA  . GLY C 1 115 ? 44.491  17.610  13.160  1.00 51.38  ? 112 GLY A CA  1 
ATOM   4042 C  C   . GLY C 1 115 ? 44.761  17.639  11.669  1.00 49.62  ? 112 GLY A C   1 
ATOM   4043 O  O   . GLY C 1 115 ? 44.106  16.942  10.893  1.00 47.41  ? 112 GLY A O   1 
ATOM   4044 N  N   . LYS C 1 116 ? 45.737  18.442  11.265  1.00 45.39  ? 113 LYS A N   1 
ATOM   4045 C  CA  . LYS C 1 116 ? 46.025  18.637  9.853   1.00 40.61  ? 113 LYS A CA  1 
ATOM   4046 C  C   . LYS C 1 116 ? 47.514  18.869  9.640   1.00 36.79  ? 113 LYS A C   1 
ATOM   4047 O  O   . LYS C 1 116 ? 48.172  19.524  10.446  1.00 41.63  ? 113 LYS A O   1 
ATOM   4048 C  CB  . LYS C 1 116 ? 45.227  19.833  9.327   1.00 43.43  ? 113 LYS A CB  1 
ATOM   4049 C  CG  . LYS C 1 116 ? 45.216  19.994  7.818   1.00 46.02  ? 113 LYS A CG  1 
ATOM   4050 C  CD  . LYS C 1 116 ? 44.350  21.179  7.419   1.00 50.29  ? 113 LYS A CD  1 
ATOM   4051 C  CE  . LYS C 1 116 ? 44.161  21.256  5.913   1.00 57.33  ? 113 LYS A CE  1 
ATOM   4052 N  NZ  . LYS C 1 116 ? 43.301  22.409  5.519   1.00 59.12  ? 113 LYS A NZ  1 
ATOM   4053 N  N   . ILE C 1 117 ? 48.046  18.320  8.557   1.00 34.20  ? 114 ILE A N   1 
ATOM   4054 C  CA  . ILE C 1 117 ? 49.437  18.555  8.201   1.00 38.28  ? 114 ILE A CA  1 
ATOM   4055 C  C   . ILE C 1 117 ? 49.546  19.121  6.789   1.00 38.22  ? 114 ILE A C   1 
ATOM   4056 O  O   . ILE C 1 117 ? 48.882  18.651  5.863   1.00 37.11  ? 114 ILE A O   1 
ATOM   4057 C  CB  . ILE C 1 117 ? 50.299  17.279  8.337   1.00 42.82  ? 114 ILE A CB  1 
ATOM   4058 C  CG1 . ILE C 1 117 ? 51.777  17.619  8.126   1.00 43.01  ? 114 ILE A CG1 1 
ATOM   4059 C  CG2 . ILE C 1 117 ? 49.833  16.198  7.366   1.00 40.46  ? 114 ILE A CG2 1 
ATOM   4060 C  CD1 . ILE C 1 117 ? 52.714  16.480  8.419   1.00 45.22  ? 114 ILE A CD1 1 
ATOM   4061 N  N   . GLU C 1 118 ? 50.378  20.147  6.643   1.00 39.41  ? 115 GLU A N   1 
ATOM   4062 C  CA  . GLU C 1 118 ? 50.599  20.800  5.362   1.00 37.53  ? 115 GLU A CA  1 
ATOM   4063 C  C   . GLU C 1 118 ? 52.078  21.108  5.208   1.00 36.22  ? 115 GLU A C   1 
ATOM   4064 O  O   . GLU C 1 118 ? 52.845  20.990  6.163   1.00 37.99  ? 115 GLU A O   1 
ATOM   4065 C  CB  . GLU C 1 118 ? 49.796  22.099  5.284   1.00 44.52  ? 115 GLU A CB  1 
ATOM   4066 C  CG  . GLU C 1 118 ? 48.292  21.904  5.225   1.00 54.62  ? 115 GLU A CG  1 
ATOM   4067 C  CD  . GLU C 1 118 ? 47.523  23.163  5.573   1.00 61.93  ? 115 GLU A CD  1 
ATOM   4068 O  OE1 . GLU C 1 118 ? 47.880  23.828  6.568   1.00 65.59  ? 115 GLU A OE1 1 
ATOM   4069 O  OE2 . GLU C 1 118 ? 46.553  23.481  4.854   1.00 69.25  ? 115 GLU A OE2 1 
ATOM   4070 N  N   . CYS C 1 119 ? 52.478  21.499  4.005   1.00 37.75  ? 116 CYS A N   1 
ATOM   4071 C  CA  . CYS C 1 119 ? 53.862  21.873  3.758   1.00 41.64  ? 116 CYS A CA  1 
ATOM   4072 C  C   . CYS C 1 119 ? 54.050  23.374  3.874   1.00 38.09  ? 116 CYS A C   1 
ATOM   4073 O  O   . CYS C 1 119 ? 53.430  24.143  3.141   1.00 41.48  ? 116 CYS A O   1 
ATOM   4074 C  CB  . CYS C 1 119 ? 54.310  21.408  2.375   1.00 45.62  ? 116 CYS A CB  1 
ATOM   4075 S  SG  . CYS C 1 119 ? 54.465  19.626  2.222   1.00 67.83  ? 116 CYS A SG  1 
ATOM   4076 N  N   . GLU C 1 120 ? 54.899  23.791  4.806   1.00 31.86  ? 117 GLU A N   1 
ATOM   4077 C  CA  . GLU C 1 120 ? 55.285  25.185  4.878   1.00 31.72  ? 117 GLU A CA  1 
ATOM   4078 C  C   . GLU C 1 120 ? 56.275  25.444  3.755   1.00 32.79  ? 117 GLU A C   1 
ATOM   4079 O  O   . GLU C 1 120 ? 56.133  26.404  2.999   1.00 41.87  ? 117 GLU A O   1 
ATOM   4080 C  CB  . GLU C 1 120 ? 55.911  25.515  6.232   1.00 35.67  ? 117 GLU A CB  1 
ATOM   4081 C  CG  . GLU C 1 120 ? 56.209  26.993  6.428   1.00 34.68  ? 117 GLU A CG  1 
ATOM   4082 C  CD  . GLU C 1 120 ? 54.952  27.832  6.568   1.00 36.18  ? 117 GLU A CD  1 
ATOM   4083 O  OE1 . GLU C 1 120 ? 54.960  28.989  6.100   1.00 34.85  ? 117 GLU A OE1 1 
ATOM   4084 O  OE2 . GLU C 1 120 ? 53.958  27.336  7.146   1.00 33.29  ? 117 GLU A OE2 1 
ATOM   4085 N  N   . ILE C 1 121 ? 57.269  24.568  3.643   1.00 30.24  ? 118 ILE A N   1 
ATOM   4086 C  CA  . ILE C 1 121 ? 58.266  24.670  2.582   1.00 37.65  ? 118 ILE A CA  1 
ATOM   4087 C  C   . ILE C 1 121 ? 58.997  23.346  2.355   1.00 33.81  ? 118 ILE A C   1 
ATOM   4088 O  O   . ILE C 1 121 ? 59.164  22.547  3.279   1.00 33.88  ? 118 ILE A O   1 
ATOM   4089 C  CB  . ILE C 1 121 ? 59.293  25.797  2.867   1.00 41.86  ? 118 ILE A CB  1 
ATOM   4090 C  CG1 . ILE C 1 121 ? 60.001  26.223  1.575   1.00 40.08  ? 118 ILE A CG1 1 
ATOM   4091 C  CG2 . ILE C 1 121 ? 60.292  25.365  3.933   1.00 43.47  ? 118 ILE A CG2 1 
ATOM   4092 C  CD1 . ILE C 1 121 ? 60.966  27.379  1.756   1.00 40.36  ? 118 ILE A CD1 1 
ATOM   4093 N  N   . LYS C 1 122 ? 59.409  23.120  1.111   1.00 35.16  ? 119 LYS A N   1 
ATOM   4094 C  CA  . LYS C 1 122 ? 60.233  21.972  0.749   1.00 35.03  ? 119 LYS A CA  1 
ATOM   4095 C  C   . LYS C 1 122 ? 61.443  22.457  -0.038  1.00 34.57  ? 119 LYS A C   1 
ATOM   4096 O  O   . LYS C 1 122 ? 61.303  23.203  -1.007  1.00 40.49  ? 119 LYS A O   1 
ATOM   4097 C  CB  . LYS C 1 122 ? 59.436  20.971  -0.090  1.00 32.51  ? 119 LYS A CB  1 
ATOM   4098 C  CG  . LYS C 1 122 ? 58.325  20.265  0.668   1.00 43.22  ? 119 LYS A CG  1 
ATOM   4099 C  CD  . LYS C 1 122 ? 57.502  19.370  -0.249  1.00 46.43  ? 119 LYS A CD  1 
ATOM   4100 C  CE  . LYS C 1 122 ? 58.310  18.186  -0.752  1.00 53.48  ? 119 LYS A CE  1 
ATOM   4101 N  NZ  . LYS C 1 122 ? 57.480  17.281  -1.594  1.00 60.21  ? 119 LYS A NZ  1 
ATOM   4102 N  N   . ILE C 1 123 ? 62.631  22.036  0.380   1.00 32.48  ? 120 ILE A N   1 
ATOM   4103 C  CA  . ILE C 1 123 ? 63.860  22.470  -0.274  1.00 32.27  ? 120 ILE A CA  1 
ATOM   4104 C  C   . ILE C 1 123 ? 64.636  21.300  -0.879  1.00 35.09  ? 120 ILE A C   1 
ATOM   4105 O  O   . ILE C 1 123 ? 64.935  20.320  -0.194  1.00 36.46  ? 120 ILE A O   1 
ATOM   4106 C  CB  . ILE C 1 123 ? 64.767  23.246  0.700   1.00 29.98  ? 120 ILE A CB  1 
ATOM   4107 C  CG1 . ILE C 1 123 ? 64.015  24.450  1.278   1.00 30.10  ? 120 ILE A CG1 1 
ATOM   4108 C  CG2 . ILE C 1 123 ? 66.038  23.694  -0.002  1.00 23.63  ? 120 ILE A CG2 1 
ATOM   4109 C  CD1 . ILE C 1 123 ? 64.760  25.178  2.375   1.00 27.05  ? 120 ILE A CD1 1 
ATOM   4110 N  N   . ASN C 1 124 ? 64.956  21.413  -2.166  1.00 31.54  ? 121 ASN A N   1 
ATOM   4111 C  CA  . ASN C 1 124 ? 65.731  20.395  -2.868  1.00 33.78  ? 121 ASN A CA  1 
ATOM   4112 C  C   . ASN C 1 124 ? 67.002  20.013  -2.115  1.00 35.24  ? 121 ASN A C   1 
ATOM   4113 O  O   . ASN C 1 124 ? 67.824  20.873  -1.796  1.00 33.58  ? 121 ASN A O   1 
ATOM   4114 C  CB  . ASN C 1 124 ? 66.079  20.872  -4.278  1.00 32.21  ? 121 ASN A CB  1 
ATOM   4115 C  CG  . ASN C 1 124 ? 64.890  20.841  -5.212  1.00 35.39  ? 121 ASN A CG  1 
ATOM   4116 O  OD1 . ASN C 1 124 ? 63.965  20.051  -5.030  1.00 37.29  ? 121 ASN A OD1 1 
ATOM   4117 N  ND2 . ASN C 1 124 ? 64.909  21.700  -6.225  1.00 40.41  ? 121 ASN A ND2 1 
ATOM   4118 N  N   . HIS C 1 125 ? 67.159  18.720  -1.842  1.00 35.68  ? 122 HIS A N   1 
ATOM   4119 C  CA  . HIS C 1 125 ? 68.276  18.228  -1.034  1.00 38.48  ? 122 HIS A CA  1 
ATOM   4120 C  C   . HIS C 1 125 ? 68.993  17.056  -1.712  1.00 37.31  ? 122 HIS A C   1 
ATOM   4121 O  O   . HIS C 1 125 ? 68.367  16.064  -2.080  1.00 38.62  ? 122 HIS A O   1 
ATOM   4122 C  CB  . HIS C 1 125 ? 67.766  17.815  0.352   1.00 30.04  ? 122 HIS A CB  1 
ATOM   4123 C  CG  . HIS C 1 125 ? 68.844  17.382  1.297   1.00 29.50  ? 122 HIS A CG  1 
ATOM   4124 N  ND1 . HIS C 1 125 ? 69.414  18.234  2.218   1.00 36.54  ? 122 HIS A ND1 1 
ATOM   4125 C  CD2 . HIS C 1 125 ? 69.448  16.183  1.471   1.00 27.14  ? 122 HIS A CD2 1 
ATOM   4126 C  CE1 . HIS C 1 125 ? 70.328  17.581  2.913   1.00 30.77  ? 122 HIS A CE1 1 
ATOM   4127 N  NE2 . HIS C 1 125 ? 70.368  16.334  2.480   1.00 32.06  ? 122 HIS A NE2 1 
ATOM   4128 N  N   . GLU C 1 126 ? 70.307  17.175  -1.875  1.00 41.30  ? 123 GLU A N   1 
ATOM   4129 C  CA  . GLU C 1 126 ? 71.102  16.104  -2.477  1.00 43.67  ? 123 GLU A CA  1 
ATOM   4130 C  C   . GLU C 1 126 ? 71.313  14.941  -1.519  1.00 40.17  ? 123 GLU A C   1 
ATOM   4131 O  O   . GLU C 1 126 ? 72.012  15.069  -0.513  1.00 42.44  ? 123 GLU A O   1 
ATOM   4132 C  CB  . GLU C 1 126 ? 72.453  16.627  -2.972  1.00 54.15  ? 123 GLU A CB  1 
ATOM   4133 C  CG  . GLU C 1 126 ? 72.484  16.951  -4.462  1.00 64.10  ? 123 GLU A CG  1 
ATOM   4134 C  CD  . GLU C 1 126 ? 72.186  15.740  -5.333  1.00 66.99  ? 123 GLU A CD  1 
ATOM   4135 O  OE1 . GLU C 1 126 ? 71.432  15.886  -6.319  1.00 66.11  ? 123 GLU A OE1 1 
ATOM   4136 O  OE2 . GLU C 1 126 ? 72.698  14.641  -5.029  1.00 69.16  ? 123 GLU A OE2 1 
ATOM   4137 N  N   . GLY C 1 127 ? 70.710  13.804  -1.849  1.00 33.81  ? 124 GLY A N   1 
ATOM   4138 C  CA  . GLY C 1 127 ? 70.776  12.624  -0.999  1.00 31.11  ? 124 GLY A CA  1 
ATOM   4139 C  C   . GLY C 1 127 ? 69.734  12.704  0.097   1.00 38.59  ? 124 GLY A C   1 
ATOM   4140 O  O   . GLY C 1 127 ? 69.066  13.725  0.253   1.00 41.45  ? 124 GLY A O   1 
ATOM   4141 N  N   . GLU C 1 128 ? 69.586  11.625  0.858   1.00 35.68  ? 125 GLU A N   1 
ATOM   4142 C  CA  . GLU C 1 128 ? 68.628  11.609  1.955   1.00 33.23  ? 125 GLU A CA  1 
ATOM   4143 C  C   . GLU C 1 128 ? 69.092  12.518  3.088   1.00 36.50  ? 125 GLU A C   1 
ATOM   4144 O  O   . GLU C 1 128 ? 70.281  12.808  3.216   1.00 33.93  ? 125 GLU A O   1 
ATOM   4145 C  CB  . GLU C 1 128 ? 68.404  10.185  2.471   1.00 36.96  ? 125 GLU A CB  1 
ATOM   4146 C  CG  . GLU C 1 128 ? 69.676  9.417   2.817   1.00 45.54  ? 125 GLU A CG  1 
ATOM   4147 C  CD  . GLU C 1 128 ? 70.173  8.548   1.673   1.00 54.31  ? 125 GLU A CD  1 
ATOM   4148 O  OE1 . GLU C 1 128 ? 71.013  7.658   1.929   1.00 58.63  ? 125 GLU A OE1 1 
ATOM   4149 O  OE2 . GLU C 1 128 ? 69.722  8.745   0.523   1.00 54.72  ? 125 GLU A OE2 1 
ATOM   4150 N  N   . VAL C 1 129 ? 68.148  12.978  3.900   1.00 37.46  ? 126 VAL A N   1 
ATOM   4151 C  CA  . VAL C 1 129 ? 68.491  13.798  5.051   1.00 35.15  ? 126 VAL A CA  1 
ATOM   4152 C  C   . VAL C 1 129 ? 68.705  12.906  6.264   1.00 33.20  ? 126 VAL A C   1 
ATOM   4153 O  O   . VAL C 1 129 ? 67.745  12.435  6.871   1.00 40.65  ? 126 VAL A O   1 
ATOM   4154 C  CB  . VAL C 1 129 ? 67.403  14.847  5.359   1.00 35.09  ? 126 VAL A CB  1 
ATOM   4155 C  CG1 . VAL C 1 129 ? 67.843  15.751  6.508   1.00 31.85  ? 126 VAL A CG1 1 
ATOM   4156 C  CG2 . VAL C 1 129 ? 67.093  15.673  4.120   1.00 26.17  ? 126 VAL A CG2 1 
ATOM   4157 N  N   . ASN C 1 130 ? 69.968  12.665  6.603   1.00 37.44  ? 127 ASN A N   1 
ATOM   4158 C  CA  . ASN C 1 130 ? 70.309  11.876  7.783   1.00 36.76  ? 127 ASN A CA  1 
ATOM   4159 C  C   . ASN C 1 130 ? 69.816  12.532  9.067   1.00 32.28  ? 127 ASN A C   1 
ATOM   4160 O  O   . ASN C 1 130 ? 69.295  11.865  9.956   1.00 33.89  ? 127 ASN A O   1 
ATOM   4161 C  CB  . ASN C 1 130 ? 71.820  11.643  7.862   1.00 36.17  ? 127 ASN A CB  1 
ATOM   4162 C  CG  . ASN C 1 130 ? 72.287  10.530  6.943   1.00 43.55  ? 127 ASN A CG  1 
ATOM   4163 O  OD1 . ASN C 1 130 ? 71.477  9.817   6.349   1.00 48.28  ? 127 ASN A OD1 1 
ATOM   4164 N  ND2 . ASN C 1 130 ? 73.601  10.374  6.825   1.00 41.92  ? 127 ASN A ND2 1 
ATOM   4165 N  N   . ARG C 1 131 ? 69.979  13.846  9.150   1.00 32.42  ? 128 ARG A N   1 
ATOM   4166 C  CA  . ARG C 1 131 ? 69.573  14.591  10.330  1.00 33.78  ? 128 ARG A CA  1 
ATOM   4167 C  C   . ARG C 1 131 ? 69.507  16.079  10.014  1.00 31.98  ? 128 ARG A C   1 
ATOM   4168 O  O   . ARG C 1 131 ? 70.372  16.613  9.324   1.00 35.48  ? 128 ARG A O   1 
ATOM   4169 C  CB  . ARG C 1 131 ? 70.543  14.325  11.485  1.00 34.02  ? 128 ARG A CB  1 
ATOM   4170 C  CG  . ARG C 1 131 ? 70.240  15.092  12.758  1.00 34.21  ? 128 ARG A CG  1 
ATOM   4171 C  CD  . ARG C 1 131 ? 70.757  14.344  13.970  1.00 32.20  ? 128 ARG A CD  1 
ATOM   4172 N  NE  . ARG C 1 131 ? 70.126  13.032  14.090  1.00 40.06  ? 128 ARG A NE  1 
ATOM   4173 C  CZ  . ARG C 1 131 ? 70.474  12.107  14.979  1.00 36.86  ? 128 ARG A CZ  1 
ATOM   4174 N  NH1 . ARG C 1 131 ? 71.460  12.339  15.834  1.00 39.39  ? 128 ARG A NH1 1 
ATOM   4175 N  NH2 . ARG C 1 131 ? 69.836  10.944  15.008  1.00 30.55  ? 128 ARG A NH2 1 
ATOM   4176 N  N   . ALA C 1 132 ? 68.465  16.737  10.510  1.00 32.65  ? 129 ALA A N   1 
ATOM   4177 C  CA  . ALA C 1 132 ? 68.297  18.170  10.313  1.00 34.22  ? 129 ALA A CA  1 
ATOM   4178 C  C   . ALA C 1 132 ? 67.978  18.843  11.641  1.00 38.90  ? 129 ALA A C   1 
ATOM   4179 O  O   . ALA C 1 132 ? 67.123  18.376  12.401  1.00 37.11  ? 129 ALA A O   1 
ATOM   4180 C  CB  . ALA C 1 132 ? 67.201  18.446  9.295   1.00 31.69  ? 129 ALA A CB  1 
ATOM   4181 N  N   . ARG C 1 133 ? 68.670  19.943  11.915  1.00 34.54  ? 130 ARG A N   1 
ATOM   4182 C  CA  . ARG C 1 133 ? 68.523  20.637  13.180  1.00 34.18  ? 130 ARG A CA  1 
ATOM   4183 C  C   . ARG C 1 133 ? 68.589  22.147  12.948  1.00 33.04  ? 130 ARG A C   1 
ATOM   4184 O  O   . ARG C 1 133 ? 69.454  22.626  12.217  1.00 36.01  ? 130 ARG A O   1 
ATOM   4185 C  CB  . ARG C 1 133 ? 69.626  20.190  14.143  1.00 38.22  ? 130 ARG A CB  1 
ATOM   4186 C  CG  . ARG C 1 133 ? 69.174  20.003  15.585  1.00 44.61  ? 130 ARG A CG  1 
ATOM   4187 C  CD  . ARG C 1 133 ? 69.129  18.531  15.994  1.00 37.10  ? 130 ARG A CD  1 
ATOM   4188 N  NE  . ARG C 1 133 ? 68.086  17.768  15.320  1.00 38.48  ? 130 ARG A NE  1 
ATOM   4189 C  CZ  . ARG C 1 133 ? 67.838  16.482  15.550  1.00 41.03  ? 130 ARG A CZ  1 
ATOM   4190 N  NH1 . ARG C 1 133 ? 68.558  15.812  16.440  1.00 42.57  ? 130 ARG A NH1 1 
ATOM   4191 N  NH2 . ARG C 1 133 ? 66.871  15.861  14.889  1.00 39.48  ? 130 ARG A NH2 1 
ATOM   4192 N  N   . TYR C 1 134 ? 67.671  22.894  13.561  1.00 31.01  ? 131 TYR A N   1 
ATOM   4193 C  CA  . TYR C 1 134 ? 67.616  24.347  13.375  1.00 35.16  ? 131 TYR A CA  1 
ATOM   4194 C  C   . TYR C 1 134 ? 68.552  25.080  14.337  1.00 36.44  ? 131 TYR A C   1 
ATOM   4195 O  O   . TYR C 1 134 ? 68.842  24.583  15.423  1.00 39.29  ? 131 TYR A O   1 
ATOM   4196 C  CB  . TYR C 1 134 ? 66.180  24.865  13.540  1.00 35.24  ? 131 TYR A CB  1 
ATOM   4197 C  CG  . TYR C 1 134 ? 65.707  24.932  14.978  1.00 37.80  ? 131 TYR A CG  1 
ATOM   4198 C  CD1 . TYR C 1 134 ? 64.945  23.908  15.531  1.00 36.08  ? 131 TYR A CD1 1 
ATOM   4199 C  CD2 . TYR C 1 134 ? 66.027  26.018  15.785  1.00 34.87  ? 131 TYR A CD2 1 
ATOM   4200 C  CE1 . TYR C 1 134 ? 64.517  23.964  16.848  1.00 34.41  ? 131 TYR A CE1 1 
ATOM   4201 C  CE2 . TYR C 1 134 ? 65.609  26.081  17.102  1.00 36.18  ? 131 TYR A CE2 1 
ATOM   4202 C  CZ  . TYR C 1 134 ? 64.854  25.054  17.627  1.00 37.81  ? 131 TYR A CZ  1 
ATOM   4203 O  OH  . TYR C 1 134 ? 64.432  25.125  18.934  1.00 41.12  ? 131 TYR A OH  1 
HETATM 4204 N  N   . MSE C 1 135 ? 69.010  26.251  13.943  1.00 36.79  ? 132 MSE A N   1 
HETATM 4205 C  CA  . MSE C 1 135 ? 69.861  27.067  14.805  1.00 45.54  ? 132 MSE A CA  1 
HETATM 4206 C  C   . MSE C 1 135 ? 69.017  27.809  15.835  1.00 42.52  ? 132 MSE A C   1 
HETATM 4207 O  O   . MSE C 1 135 ? 68.120  28.565  15.473  1.00 48.14  ? 132 MSE A O   1 
HETATM 4208 C  CB  . MSE C 1 135 ? 70.682  28.066  13.985  1.00 48.15  ? 132 MSE A CB  1 
HETATM 4209 C  CG  . MSE C 1 135 ? 71.852  28.675  14.755  1.00 53.39  ? 132 MSE A CG  1 
HETATM 4210 SE SE  . MSE C 1 135 ? 72.898  29.967  13.726  1.00 63.91  ? 132 MSE A SE  1 
HETATM 4211 C  CE  . MSE C 1 135 ? 71.956  31.598  14.223  1.00 56.92  ? 132 MSE A CE  1 
ATOM   4212 N  N   . PRO C 1 136 ? 69.307  27.601  17.109  1.00 38.65  ? 133 PRO A N   1 
ATOM   4213 C  CA  . PRO C 1 136 ? 68.505  28.143  18.203  1.00 34.80  ? 133 PRO A CA  1 
ATOM   4214 C  C   . PRO C 1 136 ? 68.402  29.664  18.171  1.00 37.69  ? 133 PRO A C   1 
ATOM   4215 O  O   . PRO C 1 136 ? 67.357  30.219  18.507  1.00 40.27  ? 133 PRO A O   1 
ATOM   4216 C  CB  . PRO C 1 136 ? 69.270  27.692  19.453  1.00 36.08  ? 133 PRO A CB  1 
ATOM   4217 C  CG  . PRO C 1 136 ? 70.066  26.509  19.007  1.00 28.19  ? 133 PRO A CG  1 
ATOM   4218 C  CD  . PRO C 1 136 ? 70.451  26.814  17.601  1.00 31.80  ? 133 PRO A CD  1 
ATOM   4219 N  N   . GLN C 1 137 ? 69.477  30.330  17.768  1.00 42.68  ? 134 GLN A N   1 
ATOM   4220 C  CA  . GLN C 1 137 ? 69.497  31.788  17.739  1.00 44.29  ? 134 GLN A CA  1 
ATOM   4221 C  C   . GLN C 1 137 ? 68.775  32.325  16.509  1.00 41.89  ? 134 GLN A C   1 
ATOM   4222 O  O   . GLN C 1 137 ? 68.344  33.477  16.486  1.00 45.21  ? 134 GLN A O   1 
ATOM   4223 C  CB  . GLN C 1 137 ? 70.934  32.312  17.794  1.00 43.96  ? 134 GLN A CB  1 
ATOM   4224 C  CG  . GLN C 1 137 ? 71.673  31.979  19.086  1.00 41.81  ? 134 GLN A CG  1 
ATOM   4225 C  CD  . GLN C 1 137 ? 72.336  30.612  19.058  1.00 43.98  ? 134 GLN A CD  1 
ATOM   4226 O  OE1 . GLN C 1 137 ? 72.208  29.865  18.089  1.00 48.60  ? 134 GLN A OE1 1 
ATOM   4227 N  NE2 . GLN C 1 137 ? 73.056  30.283  20.124  1.00 47.10  ? 134 GLN A NE2 1 
ATOM   4228 N  N   . ASN C 1 138 ? 68.652  31.483  15.489  1.00 43.25  ? 135 ASN A N   1 
ATOM   4229 C  CA  . ASN C 1 138 ? 67.911  31.832  14.282  1.00 43.23  ? 135 ASN A CA  1 
ATOM   4230 C  C   . ASN C 1 138 ? 67.263  30.593  13.674  1.00 41.99  ? 135 ASN A C   1 
ATOM   4231 O  O   . ASN C 1 138 ? 67.863  29.919  12.836  1.00 44.83  ? 135 ASN A O   1 
ATOM   4232 C  CB  . ASN C 1 138 ? 68.817  32.520  13.260  1.00 42.02  ? 135 ASN A CB  1 
ATOM   4233 C  CG  . ASN C 1 138 ? 68.036  33.161  12.130  1.00 48.05  ? 135 ASN A CG  1 
ATOM   4234 O  OD1 . ASN C 1 138 ? 68.576  33.417  11.054  1.00 47.54  ? 135 ASN A OD1 1 
ATOM   4235 N  ND2 . ASN C 1 138 ? 66.756  33.423  12.369  1.00 45.57  ? 135 ASN A ND2 1 
ATOM   4236 N  N   . PRO C 1 139 ? 66.031  30.291  14.106  1.00 40.70  ? 136 PRO A N   1 
ATOM   4237 C  CA  . PRO C 1 139 ? 65.295  29.077  13.753  1.00 37.17  ? 136 PRO A CA  1 
ATOM   4238 C  C   . PRO C 1 139 ? 65.052  28.864  12.257  1.00 36.11  ? 136 PRO A C   1 
ATOM   4239 O  O   . PRO C 1 139 ? 64.643  27.772  11.864  1.00 44.21  ? 136 PRO A O   1 
ATOM   4240 C  CB  . PRO C 1 139 ? 63.960  29.247  14.489  1.00 41.42  ? 136 PRO A CB  1 
ATOM   4241 C  CG  . PRO C 1 139 ? 64.255  30.208  15.594  1.00 42.54  ? 136 PRO A CG  1 
ATOM   4242 C  CD  . PRO C 1 139 ? 65.263  31.151  15.022  1.00 40.27  ? 136 PRO A CD  1 
ATOM   4243 N  N   . HIS C 1 140 ? 65.288  29.872  11.421  1.00 38.15  ? 137 HIS A N   1 
ATOM   4244 C  CA  . HIS C 1 140 ? 65.160  29.634  9.982   1.00 36.68  ? 137 HIS A CA  1 
ATOM   4245 C  C   . HIS C 1 140 ? 66.473  29.228  9.310   1.00 35.79  ? 137 HIS A C   1 
ATOM   4246 O  O   . HIS C 1 140 ? 66.552  29.117  8.085   1.00 33.63  ? 137 HIS A O   1 
ATOM   4247 C  CB  . HIS C 1 140 ? 64.413  30.752  9.234   1.00 36.40  ? 137 HIS A CB  1 
ATOM   4248 C  CG  . HIS C 1 140 ? 65.017  32.114  9.372   1.00 40.35  ? 137 HIS A CG  1 
ATOM   4249 N  ND1 . HIS C 1 140 ? 66.224  32.457  8.801   1.00 42.25  ? 137 HIS A ND1 1 
ATOM   4250 C  CD2 . HIS C 1 140 ? 64.548  33.238  9.963   1.00 34.72  ? 137 HIS A CD2 1 
ATOM   4251 C  CE1 . HIS C 1 140 ? 66.486  33.725  9.061   1.00 38.34  ? 137 HIS A CE1 1 
ATOM   4252 N  NE2 . HIS C 1 140 ? 65.485  34.222  9.764   1.00 36.94  ? 137 HIS A NE2 1 
ATOM   4253 N  N   . ILE C 1 141 ? 67.498  29.008  10.126  1.00 33.86  ? 138 ILE A N   1 
ATOM   4254 C  CA  . ILE C 1 141 ? 68.758  28.457  9.649   1.00 30.99  ? 138 ILE A CA  1 
ATOM   4255 C  C   . ILE C 1 141 ? 68.850  26.997  10.077  1.00 31.35  ? 138 ILE A C   1 
ATOM   4256 O  O   . ILE C 1 141 ? 68.768  26.681  11.263  1.00 36.60  ? 138 ILE A O   1 
ATOM   4257 C  CB  . ILE C 1 141 ? 69.968  29.253  10.169  1.00 33.43  ? 138 ILE A CB  1 
ATOM   4258 C  CG1 . ILE C 1 141 ? 69.964  30.663  9.576   1.00 36.41  ? 138 ILE A CG1 1 
ATOM   4259 C  CG2 . ILE C 1 141 ? 71.267  28.547  9.816   1.00 33.83  ? 138 ILE A CG2 1 
ATOM   4260 C  CD1 . ILE C 1 141 ? 71.168  31.487  9.959   1.00 47.31  ? 138 ILE A CD1 1 
ATOM   4261 N  N   . ILE C 1 142 ? 69.004  26.110  9.103   1.00 32.05  ? 139 ILE A N   1 
ATOM   4262 C  CA  . ILE C 1 142 ? 68.948  24.679  9.359   1.00 31.75  ? 139 ILE A CA  1 
ATOM   4263 C  C   . ILE C 1 142 ? 70.170  23.969  8.799   1.00 33.39  ? 139 ILE A C   1 
ATOM   4264 O  O   . ILE C 1 142 ? 70.451  24.052  7.603   1.00 31.42  ? 139 ILE A O   1 
ATOM   4265 C  CB  . ILE C 1 142 ? 67.684  24.052  8.730   1.00 31.18  ? 139 ILE A CB  1 
ATOM   4266 C  CG1 . ILE C 1 142 ? 66.427  24.759  9.241   1.00 29.16  ? 139 ILE A CG1 1 
ATOM   4267 C  CG2 . ILE C 1 142 ? 67.626  22.554  9.015   1.00 26.08  ? 139 ILE A CG2 1 
ATOM   4268 C  CD1 . ILE C 1 142 ? 65.181  24.436  8.454   1.00 28.60  ? 139 ILE A CD1 1 
ATOM   4269 N  N   . ALA C 1 143 ? 70.896  23.276  9.672   1.00 29.93  ? 140 ALA A N   1 
ATOM   4270 C  CA  . ALA C 1 143 ? 71.993  22.423  9.242   1.00 29.02  ? 140 ALA A CA  1 
ATOM   4271 C  C   . ALA C 1 143 ? 71.440  21.043  8.927   1.00 31.62  ? 140 ALA A C   1 
ATOM   4272 O  O   . ALA C 1 143 ? 70.388  20.659  9.437   1.00 35.53  ? 140 ALA A O   1 
ATOM   4273 C  CB  . ALA C 1 143 ? 73.061  22.337  10.315  1.00 31.51  ? 140 ALA A CB  1 
ATOM   4274 N  N   . THR C 1 144 ? 72.145  20.297  8.086   1.00 35.46  ? 141 THR A N   1 
ATOM   4275 C  CA  . THR C 1 144 ? 71.670  18.987  7.667   1.00 36.85  ? 141 THR A CA  1 
ATOM   4276 C  C   . THR C 1 144 ? 72.822  18.056  7.306   1.00 39.01  ? 141 THR A C   1 
ATOM   4277 O  O   . THR C 1 144 ? 73.799  18.471  6.683   1.00 43.35  ? 141 THR A O   1 
ATOM   4278 C  CB  . THR C 1 144 ? 70.706  19.102  6.470   1.00 36.41  ? 141 THR A CB  1 
ATOM   4279 O  OG1 . THR C 1 144 ? 70.405  17.797  5.968   1.00 53.16  ? 141 THR A OG1 1 
ATOM   4280 C  CG2 . THR C 1 144 ? 71.333  19.916  5.366   1.00 42.71  ? 141 THR A CG2 1 
ATOM   4281 N  N   . LYS C 1 145 ? 72.703  16.796  7.710   1.00 39.23  ? 142 LYS A N   1 
ATOM   4282 C  CA  . LYS C 1 145 ? 73.704  15.789  7.379   1.00 40.29  ? 142 LYS A CA  1 
ATOM   4283 C  C   . LYS C 1 145 ? 73.265  14.990  6.162   1.00 41.26  ? 142 LYS A C   1 
ATOM   4284 O  O   . LYS C 1 145 ? 72.142  14.491  6.111   1.00 45.27  ? 142 LYS A O   1 
ATOM   4285 C  CB  . LYS C 1 145 ? 73.942  14.856  8.567   1.00 40.86  ? 142 LYS A CB  1 
ATOM   4286 C  CG  . LYS C 1 145 ? 74.530  15.546  9.784   1.00 39.73  ? 142 LYS A CG  1 
ATOM   4287 C  CD  . LYS C 1 145 ? 76.033  15.722  9.658   1.00 36.47  ? 142 LYS A CD  1 
ATOM   4288 C  CE  . LYS C 1 145 ? 76.751  14.398  9.853   1.00 42.39  ? 142 LYS A CE  1 
ATOM   4289 N  NZ  . LYS C 1 145 ? 78.228  14.555  9.965   1.00 47.24  ? 142 LYS A NZ  1 
ATOM   4290 N  N   . THR C 1 146 ? 74.159  14.879  5.185   1.00 45.63  ? 143 THR A N   1 
ATOM   4291 C  CA  . THR C 1 146 ? 73.877  14.171  3.941   1.00 45.81  ? 143 THR A CA  1 
ATOM   4292 C  C   . THR C 1 146 ? 74.575  12.817  3.928   1.00 46.44  ? 143 THR A C   1 
ATOM   4293 O  O   . THR C 1 146 ? 75.423  12.547  4.780   1.00 48.54  ? 143 THR A O   1 
ATOM   4294 C  CB  . THR C 1 146 ? 74.370  14.977  2.728   1.00 49.50  ? 143 THR A CB  1 
ATOM   4295 O  OG1 . THR C 1 146 ? 75.802  14.995  2.718   1.00 53.87  ? 143 THR A OG1 1 
ATOM   4296 C  CG2 . THR C 1 146 ? 73.856  16.402  2.789   1.00 54.87  ? 143 THR A CG2 1 
ATOM   4297 N  N   . PRO C 1 147 ? 74.220  11.952  2.961   1.00 52.64  ? 144 PRO A N   1 
ATOM   4298 C  CA  . PRO C 1 147 ? 74.955  10.701  2.799   1.00 50.54  ? 144 PRO A CA  1 
ATOM   4299 C  C   . PRO C 1 147 ? 76.336  10.932  2.185   1.00 56.34  ? 144 PRO A C   1 
ATOM   4300 O  O   . PRO C 1 147 ? 77.124  9.992   2.058   1.00 56.53  ? 144 PRO A O   1 
ATOM   4301 C  CB  . PRO C 1 147 ? 74.071  9.896   1.846   1.00 42.94  ? 144 PRO A CB  1 
ATOM   4302 C  CG  . PRO C 1 147 ? 73.336  10.915  1.067   1.00 48.31  ? 144 PRO A CG  1 
ATOM   4303 C  CD  . PRO C 1 147 ? 73.120  12.080  1.988   1.00 49.38  ? 144 PRO A CD  1 
ATOM   4304 N  N   . SER C 1 148 ? 76.623  12.178  1.812   1.00 59.23  ? 145 SER A N   1 
ATOM   4305 C  CA  . SER C 1 148 ? 77.935  12.537  1.285   1.00 62.69  ? 145 SER A CA  1 
ATOM   4306 C  C   . SER C 1 148 ? 78.866  13.030  2.394   1.00 64.33  ? 145 SER A C   1 
ATOM   4307 O  O   . SER C 1 148 ? 78.763  12.594  3.540   1.00 68.94  ? 145 SER A O   1 
ATOM   4308 C  CB  . SER C 1 148 ? 77.814  13.579  0.170   1.00 63.32  ? 145 SER A CB  1 
ATOM   4309 O  OG  . SER C 1 148 ? 77.227  14.776  0.648   1.00 75.37  ? 145 SER A OG  1 
ATOM   4310 N  N   . SER C 1 149 ? 79.767  13.944  2.052   1.00 66.73  ? 146 SER A N   1 
ATOM   4311 C  CA  . SER C 1 149 ? 80.843  14.332  2.960   1.00 66.43  ? 146 SER A CA  1 
ATOM   4312 C  C   . SER C 1 149 ? 80.573  15.646  3.695   1.00 64.40  ? 146 SER A C   1 
ATOM   4313 O  O   . SER C 1 149 ? 80.658  15.708  4.925   1.00 55.41  ? 146 SER A O   1 
ATOM   4314 C  CB  . SER C 1 149 ? 82.169  14.409  2.196   1.00 68.27  ? 146 SER A CB  1 
ATOM   4315 O  OG  . SER C 1 149 ? 83.269  14.182  3.058   1.00 73.63  ? 146 SER A OG  1 
ATOM   4316 N  N   . ASP C 1 150 ? 80.256  16.695  2.941   1.00 63.27  ? 147 ASP A N   1 
ATOM   4317 C  CA  . ASP C 1 150 ? 79.982  18.003  3.529   1.00 60.45  ? 147 ASP A CA  1 
ATOM   4318 C  C   . ASP C 1 150 ? 78.670  17.975  4.298   1.00 56.14  ? 147 ASP A C   1 
ATOM   4319 O  O   . ASP C 1 150 ? 77.747  17.246  3.938   1.00 59.97  ? 147 ASP A O   1 
ATOM   4320 C  CB  . ASP C 1 150 ? 79.886  19.079  2.444   1.00 67.06  ? 147 ASP A CB  1 
ATOM   4321 C  CG  . ASP C 1 150 ? 80.861  18.859  1.306   1.00 71.57  ? 147 ASP A CG  1 
ATOM   4322 O  OD1 . ASP C 1 150 ? 80.420  18.902  0.137   1.00 71.88  ? 147 ASP A OD1 1 
ATOM   4323 O  OD2 . ASP C 1 150 ? 82.062  18.642  1.578   1.00 73.07  ? 147 ASP A OD2 1 
ATOM   4324 N  N   . VAL C 1 151 ? 78.589  18.770  5.359   1.00 51.15  ? 148 VAL A N   1 
ATOM   4325 C  CA  . VAL C 1 151 ? 77.309  19.013  6.004   1.00 49.21  ? 148 VAL A CA  1 
ATOM   4326 C  C   . VAL C 1 151 ? 76.802  20.359  5.497   1.00 50.69  ? 148 VAL A C   1 
ATOM   4327 O  O   . VAL C 1 151 ? 77.578  21.301  5.324   1.00 51.78  ? 148 VAL A O   1 
ATOM   4328 C  CB  . VAL C 1 151 ? 77.401  18.974  7.548   1.00 46.26  ? 148 VAL A CB  1 
ATOM   4329 C  CG1 . VAL C 1 151 ? 78.483  17.996  7.992   1.00 39.91  ? 148 VAL A CG1 1 
ATOM   4330 C  CG2 . VAL C 1 151 ? 77.660  20.350  8.114   1.00 42.97  ? 148 VAL A CG2 1 
ATOM   4331 N  N   . LEU C 1 152 ? 75.506  20.438  5.229   1.00 46.52  ? 149 LEU A N   1 
ATOM   4332 C  CA  . LEU C 1 152 ? 74.951  21.605  4.563   1.00 38.83  ? 149 LEU A CA  1 
ATOM   4333 C  C   . LEU C 1 152 ? 74.217  22.523  5.527   1.00 43.08  ? 149 LEU A C   1 
ATOM   4334 O  O   . LEU C 1 152 ? 73.723  22.089  6.567   1.00 48.89  ? 149 LEU A O   1 
ATOM   4335 C  CB  . LEU C 1 152 ? 74.017  21.172  3.434   1.00 35.09  ? 149 LEU A CB  1 
ATOM   4336 C  CG  . LEU C 1 152 ? 74.573  20.141  2.450   1.00 39.46  ? 149 LEU A CG  1 
ATOM   4337 C  CD1 . LEU C 1 152 ? 73.507  19.733  1.440   1.00 37.64  ? 149 LEU A CD1 1 
ATOM   4338 C  CD2 . LEU C 1 152 ? 75.813  20.677  1.743   1.00 40.31  ? 149 LEU A CD2 1 
ATOM   4339 N  N   . VAL C 1 153 ? 74.157  23.801  5.171   1.00 40.41  ? 150 VAL A N   1 
ATOM   4340 C  CA  . VAL C 1 153 ? 73.416  24.786  5.944   1.00 38.24  ? 150 VAL A CA  1 
ATOM   4341 C  C   . VAL C 1 153 ? 72.425  25.498  5.032   1.00 39.05  ? 150 VAL A C   1 
ATOM   4342 O  O   . VAL C 1 153 ? 72.800  26.033  3.989   1.00 37.48  ? 150 VAL A O   1 
ATOM   4343 C  CB  . VAL C 1 153 ? 74.356  25.817  6.599   1.00 39.86  ? 150 VAL A CB  1 
ATOM   4344 C  CG1 . VAL C 1 153 ? 73.559  26.950  7.227   1.00 38.87  ? 150 VAL A CG1 1 
ATOM   4345 C  CG2 . VAL C 1 153 ? 75.250  25.145  7.632   1.00 42.13  ? 150 VAL A CG2 1 
ATOM   4346 N  N   . PHE C 1 154 ? 71.157  25.490  5.427   1.00 41.22  ? 151 PHE A N   1 
ATOM   4347 C  CA  . PHE C 1 154 ? 70.103  26.124  4.651   1.00 36.17  ? 151 PHE A CA  1 
ATOM   4348 C  C   . PHE C 1 154 ? 69.453  27.256  5.437   1.00 38.46  ? 151 PHE A C   1 
ATOM   4349 O  O   . PHE C 1 154 ? 69.175  27.117  6.626   1.00 41.28  ? 151 PHE A O   1 
ATOM   4350 C  CB  . PHE C 1 154 ? 69.028  25.101  4.278   1.00 35.22  ? 151 PHE A CB  1 
ATOM   4351 C  CG  . PHE C 1 154 ? 69.477  24.076  3.280   1.00 34.31  ? 151 PHE A CG  1 
ATOM   4352 C  CD1 . PHE C 1 154 ? 69.993  22.859  3.698   1.00 32.80  ? 151 PHE A CD1 1 
ATOM   4353 C  CD2 . PHE C 1 154 ? 69.370  24.322  1.919   1.00 35.59  ? 151 PHE A CD2 1 
ATOM   4354 C  CE1 . PHE C 1 154 ? 70.400  21.907  2.778   1.00 32.86  ? 151 PHE A CE1 1 
ATOM   4355 C  CE2 . PHE C 1 154 ? 69.779  23.377  0.994   1.00 35.78  ? 151 PHE A CE2 1 
ATOM   4356 C  CZ  . PHE C 1 154 ? 70.295  22.166  1.425   1.00 36.04  ? 151 PHE A CZ  1 
ATOM   4357 N  N   . ASP C 1 155 ? 69.220  28.378  4.767   1.00 39.79  ? 152 ASP A N   1 
ATOM   4358 C  CA  . ASP C 1 155 ? 68.376  29.432  5.309   1.00 38.26  ? 152 ASP A CA  1 
ATOM   4359 C  C   . ASP C 1 155 ? 67.088  29.407  4.501   1.00 39.00  ? 152 ASP A C   1 
ATOM   4360 O  O   . ASP C 1 155 ? 67.050  29.891  3.370   1.00 41.45  ? 152 ASP A O   1 
ATOM   4361 C  CB  . ASP C 1 155 ? 69.063  30.794  5.191   1.00 38.31  ? 152 ASP A CB  1 
ATOM   4362 C  CG  . ASP C 1 155 ? 68.139  31.950  5.537   1.00 44.67  ? 152 ASP A CG  1 
ATOM   4363 O  OD1 . ASP C 1 155 ? 68.589  33.112  5.463   1.00 50.53  ? 152 ASP A OD1 1 
ATOM   4364 O  OD2 . ASP C 1 155 ? 66.963  31.703  5.881   1.00 45.73  ? 152 ASP A OD2 1 
ATOM   4365 N  N   . TYR C 1 156 ? 66.034  28.840  5.081   1.00 35.93  ? 153 TYR A N   1 
ATOM   4366 C  CA  . TYR C 1 156 ? 64.821  28.557  4.316   1.00 35.07  ? 153 TYR A CA  1 
ATOM   4367 C  C   . TYR C 1 156 ? 64.062  29.798  3.845   1.00 35.70  ? 153 TYR A C   1 
ATOM   4368 O  O   . TYR C 1 156 ? 63.164  29.700  3.007   1.00 41.81  ? 153 TYR A O   1 
ATOM   4369 C  CB  . TYR C 1 156 ? 63.906  27.559  5.046   1.00 30.34  ? 153 TYR A CB  1 
ATOM   4370 C  CG  . TYR C 1 156 ? 63.116  28.093  6.223   1.00 29.30  ? 153 TYR A CG  1 
ATOM   4371 C  CD1 . TYR C 1 156 ? 63.229  27.504  7.478   1.00 28.90  ? 153 TYR A CD1 1 
ATOM   4372 C  CD2 . TYR C 1 156 ? 62.234  29.158  6.077   1.00 30.59  ? 153 TYR A CD2 1 
ATOM   4373 C  CE1 . TYR C 1 156 ? 62.496  27.968  8.555   1.00 29.42  ? 153 TYR A CE1 1 
ATOM   4374 C  CE2 . TYR C 1 156 ? 61.500  29.635  7.150   1.00 27.08  ? 153 TYR A CE2 1 
ATOM   4375 C  CZ  . TYR C 1 156 ? 61.635  29.035  8.385   1.00 31.43  ? 153 TYR A CZ  1 
ATOM   4376 O  OH  . TYR C 1 156 ? 60.911  29.504  9.456   1.00 34.38  ? 153 TYR A OH  1 
ATOM   4377 N  N   . THR C 1 157 ? 64.437  30.962  4.367   1.00 31.18  ? 154 THR A N   1 
ATOM   4378 C  CA  . THR C 1 157 ? 63.861  32.222  3.911   1.00 36.67  ? 154 THR A CA  1 
ATOM   4379 C  C   . THR C 1 157 ? 64.471  32.642  2.575   1.00 38.38  ? 154 THR A C   1 
ATOM   4380 O  O   . THR C 1 157 ? 64.008  33.590  1.939   1.00 39.90  ? 154 THR A O   1 
ATOM   4381 C  CB  . THR C 1 157 ? 64.092  33.353  4.930   1.00 35.78  ? 154 THR A CB  1 
ATOM   4382 O  OG1 . THR C 1 157 ? 65.494  33.627  5.029   1.00 31.47  ? 154 THR A OG1 1 
ATOM   4383 C  CG2 . THR C 1 157 ? 63.560  32.960  6.297   1.00 32.59  ? 154 THR A CG2 1 
ATOM   4384 N  N   . LYS C 1 158 ? 65.514  31.931  2.155   1.00 38.92  ? 155 LYS A N   1 
ATOM   4385 C  CA  . LYS C 1 158 ? 66.229  32.264  0.928   1.00 37.69  ? 155 LYS A CA  1 
ATOM   4386 C  C   . LYS C 1 158 ? 66.024  31.218  -0.162  1.00 38.45  ? 155 LYS A C   1 
ATOM   4387 O  O   . LYS C 1 158 ? 66.844  31.087  -1.069  1.00 47.80  ? 155 LYS A O   1 
ATOM   4388 C  CB  . LYS C 1 158 ? 67.720  32.447  1.213   1.00 42.46  ? 155 LYS A CB  1 
ATOM   4389 C  CG  . LYS C 1 158 ? 68.023  33.611  2.142   1.00 50.31  ? 155 LYS A CG  1 
ATOM   4390 C  CD  . LYS C 1 158 ? 69.506  33.916  2.193   1.00 51.14  ? 155 LYS A CD  1 
ATOM   4391 C  CE  . LYS C 1 158 ? 69.759  35.243  2.884   1.00 56.29  ? 155 LYS A CE  1 
ATOM   4392 N  NZ  . LYS C 1 158 ? 71.184  35.657  2.771   1.00 64.52  ? 155 LYS A NZ  1 
ATOM   4393 N  N   . HIS C 1 159 ? 64.926  30.477  -0.067  1.00 36.61  ? 156 HIS A N   1 
ATOM   4394 C  CA  . HIS C 1 159 ? 64.590  29.464  -1.058  1.00 28.80  ? 156 HIS A CA  1 
ATOM   4395 C  C   . HIS C 1 159 ? 63.128  29.603  -1.463  1.00 32.59  ? 156 HIS A C   1 
ATOM   4396 O  O   . HIS C 1 159 ? 62.297  30.010  -0.655  1.00 36.53  ? 156 HIS A O   1 
ATOM   4397 C  CB  . HIS C 1 159 ? 64.866  28.065  -0.507  1.00 28.16  ? 156 HIS A CB  1 
ATOM   4398 C  CG  . HIS C 1 159 ? 66.307  27.814  -0.189  1.00 32.18  ? 156 HIS A CG  1 
ATOM   4399 N  ND1 . HIS C 1 159 ? 67.145  27.114  -1.030  1.00 36.46  ? 156 HIS A ND1 1 
ATOM   4400 C  CD2 . HIS C 1 159 ? 67.062  28.176  0.876   1.00 33.66  ? 156 HIS A CD2 1 
ATOM   4401 C  CE1 . HIS C 1 159 ? 68.352  27.051  -0.495  1.00 35.07  ? 156 HIS A CE1 1 
ATOM   4402 N  NE2 . HIS C 1 159 ? 68.328  27.689  0.661   1.00 30.11  ? 156 HIS A NE2 1 
ATOM   4403 N  N   . PRO C 1 160 ? 62.807  29.265  -2.722  1.00 39.92  ? 157 PRO A N   1 
ATOM   4404 C  CA  . PRO C 1 160 ? 61.455  29.458  -3.240  1.00 37.49  ? 157 PRO A CA  1 
ATOM   4405 C  C   . PRO C 1 160 ? 60.418  28.648  -2.471  1.00 43.64  ? 157 PRO A C   1 
ATOM   4406 O  O   . PRO C 1 160 ? 60.716  27.553  -1.994  1.00 43.86  ? 157 PRO A O   1 
ATOM   4407 C  CB  . PRO C 1 160 ? 61.557  28.950  -4.684  1.00 32.87  ? 157 PRO A CB  1 
ATOM   4408 C  CG  . PRO C 1 160 ? 62.740  28.053  -4.692  1.00 32.64  ? 157 PRO A CG  1 
ATOM   4409 C  CD  . PRO C 1 160 ? 63.699  28.664  -3.728  1.00 31.20  ? 157 PRO A CD  1 
ATOM   4410 N  N   . ALA C 1 161 ? 59.210  29.194  -2.356  1.00 48.04  ? 158 ALA A N   1 
ATOM   4411 C  CA  . ALA C 1 161 ? 58.113  28.513  -1.679  1.00 48.33  ? 158 ALA A CA  1 
ATOM   4412 C  C   . ALA C 1 161 ? 57.987  27.074  -2.169  1.00 48.29  ? 158 ALA A C   1 
ATOM   4413 O  O   . ALA C 1 161 ? 57.907  26.139  -1.373  1.00 55.43  ? 158 ALA A O   1 
ATOM   4414 C  CB  . ALA C 1 161 ? 56.810  29.267  -1.900  1.00 47.77  ? 158 ALA A CB  1 
ATOM   4415 N  N   . LYS C 1 162 ? 57.973  26.910  -3.488  1.00 45.92  ? 159 LYS A N   1 
ATOM   4416 C  CA  . LYS C 1 162 ? 57.912  25.594  -4.108  1.00 43.17  ? 159 LYS A CA  1 
ATOM   4417 C  C   . LYS C 1 162 ? 59.258  25.286  -4.754  1.00 39.33  ? 159 LYS A C   1 
ATOM   4418 O  O   . LYS C 1 162 ? 59.804  26.119  -5.476  1.00 47.42  ? 159 LYS A O   1 
ATOM   4419 C  CB  . LYS C 1 162 ? 56.792  25.558  -5.153  1.00 43.58  ? 159 LYS A CB  1 
ATOM   4420 C  CG  . LYS C 1 162 ? 56.673  24.246  -5.912  1.00 48.45  ? 159 LYS A CG  1 
ATOM   4421 C  CD  . LYS C 1 162 ? 55.606  24.326  -6.995  1.00 47.75  ? 159 LYS A CD  1 
ATOM   4422 C  CE  . LYS C 1 162 ? 55.498  23.018  -7.768  1.00 47.34  ? 159 LYS A CE  1 
ATOM   4423 N  NZ  . LYS C 1 162 ? 56.769  22.671  -8.464  1.00 43.91  ? 159 LYS A NZ  1 
ATOM   4424 N  N   . PRO C 1 163 ? 59.803  24.087  -4.492  1.00 38.81  ? 160 PRO A N   1 
ATOM   4425 C  CA  . PRO C 1 163 ? 61.113  23.726  -5.031  1.00 38.98  ? 160 PRO A CA  1 
ATOM   4426 C  C   . PRO C 1 163 ? 61.057  23.452  -6.530  1.00 41.21  ? 160 PRO A C   1 
ATOM   4427 O  O   . PRO C 1 163 ? 60.032  22.997  -7.037  1.00 41.94  ? 160 PRO A O   1 
ATOM   4428 C  CB  . PRO C 1 163 ? 61.460  22.441  -4.273  1.00 33.98  ? 160 PRO A CB  1 
ATOM   4429 C  CG  . PRO C 1 163 ? 60.145  21.851  -3.917  1.00 34.73  ? 160 PRO A CG  1 
ATOM   4430 C  CD  . PRO C 1 163 ? 59.218  23.008  -3.676  1.00 35.01  ? 160 PRO A CD  1 
ATOM   4431 N  N   . ASP C 1 164 ? 62.152  23.733  -7.230  1.00 43.57  ? 161 ASP A N   1 
ATOM   4432 C  CA  . ASP C 1 164 ? 62.223  23.468  -8.661  1.00 41.22  ? 161 ASP A CA  1 
ATOM   4433 C  C   . ASP C 1 164 ? 62.301  21.967  -8.920  1.00 39.57  ? 161 ASP A C   1 
ATOM   4434 O  O   . ASP C 1 164 ? 63.176  21.285  -8.385  1.00 37.77  ? 161 ASP A O   1 
ATOM   4435 C  CB  . ASP C 1 164 ? 63.424  24.173  -9.288  1.00 44.91  ? 161 ASP A CB  1 
ATOM   4436 C  CG  . ASP C 1 164 ? 63.395  24.130  -10.802 1.00 53.40  ? 161 ASP A CG  1 
ATOM   4437 O  OD1 . ASP C 1 164 ? 64.240  23.429  -11.393 1.00 60.44  ? 161 ASP A OD1 1 
ATOM   4438 O  OD2 . ASP C 1 164 ? 62.518  24.783  -11.404 1.00 54.49  ? 161 ASP A OD2 1 
ATOM   4439 N  N   . PRO C 1 165 ? 61.373  21.450  -9.739  1.00 34.98  ? 162 PRO A N   1 
ATOM   4440 C  CA  . PRO C 1 165 ? 61.250  20.027  -10.058 1.00 34.94  ? 162 PRO A CA  1 
ATOM   4441 C  C   . PRO C 1 165 ? 62.525  19.402  -10.626 1.00 41.62  ? 162 PRO A C   1 
ATOM   4442 O  O   . PRO C 1 165 ? 62.623  18.179  -10.702 1.00 50.20  ? 162 PRO A O   1 
ATOM   4443 C  CB  . PRO C 1 165 ? 60.135  20.000  -11.107 1.00 33.42  ? 162 PRO A CB  1 
ATOM   4444 C  CG  . PRO C 1 165 ? 59.334  21.228  -10.838 1.00 32.25  ? 162 PRO A CG  1 
ATOM   4445 C  CD  . PRO C 1 165 ? 60.336  22.257  -10.406 1.00 31.50  ? 162 PRO A CD  1 
ATOM   4446 N  N   . SER C 1 166 ? 63.492  20.229  -11.016 1.00 45.92  ? 163 SER A N   1 
ATOM   4447 C  CA  . SER C 1 166 ? 64.755  19.723  -11.551 1.00 46.87  ? 163 SER A CA  1 
ATOM   4448 C  C   . SER C 1 166 ? 65.718  19.299  -10.439 1.00 48.51  ? 163 SER A C   1 
ATOM   4449 O  O   . SER C 1 166 ? 66.814  18.806  -10.708 1.00 50.69  ? 163 SER A O   1 
ATOM   4450 C  CB  . SER C 1 166 ? 65.413  20.761  -12.459 1.00 46.47  ? 163 SER A CB  1 
ATOM   4451 O  OG  . SER C 1 166 ? 65.794  21.907  -11.722 1.00 54.59  ? 163 SER A OG  1 
ATOM   4452 N  N   . GLY C 1 167 ? 65.304  19.511  -9.194  1.00 48.34  ? 164 GLY A N   1 
ATOM   4453 C  CA  . GLY C 1 167 ? 66.010  18.981  -8.029  1.00 44.19  ? 164 GLY A CA  1 
ATOM   4454 C  C   . GLY C 1 167 ? 67.406  19.509  -7.764  1.00 45.38  ? 164 GLY A C   1 
ATOM   4455 O  O   . GLY C 1 167 ? 68.227  18.818  -7.162  1.00 46.74  ? 164 GLY A O   1 
ATOM   4456 N  N   . GLU C 1 168 ? 67.678  20.734  -8.202  1.00 48.88  ? 165 GLU A N   1 
ATOM   4457 C  CA  . GLU C 1 168 ? 68.984  21.353  -7.992  1.00 50.20  ? 165 GLU A CA  1 
ATOM   4458 C  C   . GLU C 1 168 ? 69.159  21.752  -6.529  1.00 49.65  ? 165 GLU A C   1 
ATOM   4459 O  O   . GLU C 1 168 ? 68.388  22.551  -6.000  1.00 51.08  ? 165 GLU A O   1 
ATOM   4460 C  CB  . GLU C 1 168 ? 69.142  22.585  -8.886  1.00 61.75  ? 165 GLU A CB  1 
ATOM   4461 C  CG  . GLU C 1 168 ? 68.738  22.374  -10.341 1.00 70.49  ? 165 GLU A CG  1 
ATOM   4462 C  CD  . GLU C 1 168 ? 69.787  21.627  -11.148 1.00 76.72  ? 165 GLU A CD  1 
ATOM   4463 O  OE1 . GLU C 1 168 ? 70.945  21.533  -10.689 1.00 79.25  ? 165 GLU A OE1 1 
ATOM   4464 O  OE2 . GLU C 1 168 ? 69.452  21.138  -12.249 1.00 78.23  ? 165 GLU A OE2 1 
ATOM   4465 N  N   . CYS C 1 169 ? 70.174  21.194  -5.877  1.00 48.05  ? 166 CYS A N   1 
ATOM   4466 C  CA  . CYS C 1 169 ? 70.442  21.501  -4.477  1.00 45.29  ? 166 CYS A CA  1 
ATOM   4467 C  C   . CYS C 1 169 ? 71.415  22.668  -4.353  1.00 50.01  ? 166 CYS A C   1 
ATOM   4468 O  O   . CYS C 1 169 ? 72.561  22.578  -4.793  1.00 55.70  ? 166 CYS A O   1 
ATOM   4469 C  CB  . CYS C 1 169 ? 70.998  20.272  -3.755  1.00 47.90  ? 166 CYS A CB  1 
ATOM   4470 S  SG  . CYS C 1 169 ? 71.315  20.516  -1.986  1.00 47.33  ? 166 CYS A SG  1 
ATOM   4471 N  N   . ASN C 1 170 ? 70.952  23.760  -3.752  1.00 47.89  ? 167 ASN A N   1 
ATOM   4472 C  CA  . ASN C 1 170 ? 71.765  24.962  -3.601  1.00 45.14  ? 167 ASN A CA  1 
ATOM   4473 C  C   . ASN C 1 170 ? 71.917  25.380  -2.147  1.00 44.95  ? 167 ASN A C   1 
ATOM   4474 O  O   . ASN C 1 170 ? 71.242  26.307  -1.695  1.00 45.39  ? 167 ASN A O   1 
ATOM   4475 C  CB  . ASN C 1 170 ? 71.159  26.119  -4.395  1.00 49.86  ? 167 ASN A CB  1 
ATOM   4476 C  CG  . ASN C 1 170 ? 71.198  25.885  -5.887  1.00 55.54  ? 167 ASN A CG  1 
ATOM   4477 O  OD1 . ASN C 1 170 ? 70.197  26.070  -6.580  1.00 59.86  ? 167 ASN A OD1 1 
ATOM   4478 N  ND2 . ASN C 1 170 ? 72.356  25.473  -6.393  1.00 56.11  ? 167 ASN A ND2 1 
ATOM   4479 N  N   . PRO C 1 171 ? 72.812  24.705  -1.410  1.00 43.21  ? 168 PRO A N   1 
ATOM   4480 C  CA  . PRO C 1 171 ? 73.029  25.018  0.000   1.00 42.58  ? 168 PRO A CA  1 
ATOM   4481 C  C   . PRO C 1 171 ? 73.615  26.413  0.162   1.00 43.42  ? 168 PRO A C   1 
ATOM   4482 O  O   . PRO C 1 171 ? 74.451  26.827  -0.640  1.00 48.97  ? 168 PRO A O   1 
ATOM   4483 C  CB  . PRO C 1 171 ? 74.057  23.968  0.443   1.00 46.25  ? 168 PRO A CB  1 
ATOM   4484 C  CG  . PRO C 1 171 ? 74.026  22.907  -0.612  1.00 47.11  ? 168 PRO A CG  1 
ATOM   4485 C  CD  . PRO C 1 171 ? 73.678  23.611  -1.876  1.00 40.48  ? 168 PRO A CD  1 
ATOM   4486 N  N   . ASP C 1 172 ? 73.178  27.130  1.190   1.00 46.07  ? 169 ASP A N   1 
ATOM   4487 C  CA  . ASP C 1 172 ? 73.712  28.458  1.471   1.00 46.31  ? 169 ASP A CA  1 
ATOM   4488 C  C   . ASP C 1 172 ? 75.123  28.369  2.044   1.00 45.53  ? 169 ASP A C   1 
ATOM   4489 O  O   . ASP C 1 172 ? 75.871  29.343  2.029   1.00 49.01  ? 169 ASP A O   1 
ATOM   4490 C  CB  . ASP C 1 172 ? 72.790  29.220  2.423   1.00 44.92  ? 169 ASP A CB  1 
ATOM   4491 C  CG  . ASP C 1 172 ? 71.375  29.326  1.895   1.00 51.02  ? 169 ASP A CG  1 
ATOM   4492 O  OD1 . ASP C 1 172 ? 70.602  28.358  2.069   1.00 52.34  ? 169 ASP A OD1 1 
ATOM   4493 O  OD2 . ASP C 1 172 ? 71.036  30.375  1.303   1.00 52.50  ? 169 ASP A OD2 1 
ATOM   4494 N  N   . LEU C 1 173 ? 75.476  27.189  2.542   1.00 46.17  ? 170 LEU A N   1 
ATOM   4495 C  CA  . LEU C 1 173 ? 76.804  26.929  3.082   1.00 45.31  ? 170 LEU A CA  1 
ATOM   4496 C  C   . LEU C 1 173 ? 77.145  25.447  2.974   1.00 45.19  ? 170 LEU A C   1 
ATOM   4497 O  O   . LEU C 1 173 ? 76.296  24.590  3.210   1.00 46.84  ? 170 LEU A O   1 
ATOM   4498 C  CB  . LEU C 1 173 ? 76.888  27.373  4.545   1.00 43.55  ? 170 LEU A CB  1 
ATOM   4499 C  CG  . LEU C 1 173 ? 77.763  28.568  4.940   1.00 42.40  ? 170 LEU A CG  1 
ATOM   4500 C  CD1 . LEU C 1 173 ? 77.802  29.652  3.876   1.00 38.93  ? 170 LEU A CD1 1 
ATOM   4501 C  CD2 . LEU C 1 173 ? 77.301  29.140  6.274   1.00 43.27  ? 170 LEU A CD2 1 
ATOM   4502 N  N   . ARG C 1 174 ? 78.386  25.154  2.601   1.00 49.11  ? 171 ARG A N   1 
ATOM   4503 C  CA  . ARG C 1 174 ? 78.896  23.789  2.636   1.00 51.41  ? 171 ARG A CA  1 
ATOM   4504 C  C   . ARG C 1 174 ? 80.048  23.744  3.629   1.00 52.70  ? 171 ARG A C   1 
ATOM   4505 O  O   . ARG C 1 174 ? 81.020  24.486  3.495   1.00 54.10  ? 171 ARG A O   1 
ATOM   4506 C  CB  . ARG C 1 174 ? 79.376  23.339  1.254   1.00 51.22  ? 171 ARG A CB  1 
ATOM   4507 C  CG  . ARG C 1 174 ? 78.410  23.646  0.120   1.00 57.39  ? 171 ARG A CG  1 
ATOM   4508 C  CD  . ARG C 1 174 ? 78.870  23.011  -1.183  1.00 58.81  ? 171 ARG A CD  1 
ATOM   4509 N  NE  . ARG C 1 174 ? 78.482  21.606  -1.276  1.00 59.99  ? 171 ARG A NE  1 
ATOM   4510 C  CZ  . ARG C 1 174 ? 77.429  21.169  -1.958  1.00 62.84  ? 171 ARG A CZ  1 
ATOM   4511 N  NH1 . ARG C 1 174 ? 77.146  19.874  -1.989  1.00 63.96  ? 171 ARG A NH1 1 
ATOM   4512 N  NH2 . ARG C 1 174 ? 76.660  22.028  -2.615  1.00 64.06  ? 171 ARG A NH2 1 
ATOM   4513 N  N   . LEU C 1 175 ? 79.932  22.881  4.631   1.00 53.97  ? 172 LEU A N   1 
ATOM   4514 C  CA  . LEU C 1 175 ? 80.953  22.779  5.665   1.00 51.75  ? 172 LEU A CA  1 
ATOM   4515 C  C   . LEU C 1 175 ? 81.886  21.598  5.413   1.00 59.33  ? 172 LEU A C   1 
ATOM   4516 O  O   . LEU C 1 175 ? 81.550  20.453  5.723   1.00 58.37  ? 172 LEU A O   1 
ATOM   4517 C  CB  . LEU C 1 175 ? 80.305  22.659  7.047   1.00 50.22  ? 172 LEU A CB  1 
ATOM   4518 C  CG  . LEU C 1 175 ? 79.266  23.715  7.439   1.00 50.56  ? 172 LEU A CG  1 
ATOM   4519 C  CD1 . LEU C 1 175 ? 78.713  23.426  8.820   1.00 49.67  ? 172 LEU A CD1 1 
ATOM   4520 C  CD2 . LEU C 1 175 ? 79.852  25.113  7.396   1.00 46.67  ? 172 LEU A CD2 1 
ATOM   4521 N  N   . ARG C 1 176 ? 83.054  21.884  4.842   1.00 63.95  ? 173 ARG A N   1 
ATOM   4522 C  CA  . ARG C 1 176 ? 84.067  20.860  4.593   1.00 65.54  ? 173 ARG A CA  1 
ATOM   4523 C  C   . ARG C 1 176 ? 84.803  20.489  5.877   1.00 56.92  ? 173 ARG A C   1 
ATOM   4524 O  O   . ARG C 1 176 ? 85.047  21.341  6.731   1.00 53.96  ? 173 ARG A O   1 
ATOM   4525 C  CB  . ARG C 1 176 ? 85.076  21.341  3.545   1.00 68.43  ? 173 ARG A CB  1 
ATOM   4526 C  CG  . ARG C 1 176 ? 84.585  21.277  2.107   1.00 73.84  ? 173 ARG A CG  1 
ATOM   4527 C  CD  . ARG C 1 176 ? 85.701  21.648  1.137   1.00 77.22  ? 173 ARG A CD  1 
ATOM   4528 N  NE  . ARG C 1 176 ? 85.320  21.568  -0.275  1.00 83.09  ? 173 ARG A NE  1 
ATOM   4529 C  CZ  . ARG C 1 176 ? 84.108  21.250  -0.730  1.00 85.61  ? 173 ARG A CZ  1 
ATOM   4530 N  NH1 . ARG C 1 176 ? 83.117  20.971  0.108   1.00 84.88  ? 173 ARG A NH1 1 
ATOM   4531 N  NH2 . ARG C 1 176 ? 83.887  21.212  -2.037  1.00 86.54  ? 173 ARG A NH2 1 
ATOM   4532 N  N   . GLY C 1 177 ? 85.159  19.215  6.008   1.00 55.51  ? 174 GLY A N   1 
ATOM   4533 C  CA  . GLY C 1 177 ? 85.893  18.751  7.180   1.00 55.81  ? 174 GLY A CA  1 
ATOM   4534 C  C   . GLY C 1 177 ? 85.901  17.244  7.356   1.00 57.49  ? 174 GLY A C   1 
ATOM   4535 O  O   . GLY C 1 177 ? 86.822  16.690  7.956   1.00 63.80  ? 174 GLY A O   1 
ATOM   4536 N  N   . HIS C 1 178 ? 84.877  16.578  6.834   1.00 54.63  ? 175 HIS A N   1 
ATOM   4537 C  CA  . HIS C 1 178 ? 84.731  15.136  7.017   1.00 58.55  ? 175 HIS A CA  1 
ATOM   4538 C  C   . HIS C 1 178 ? 85.150  14.327  5.791   1.00 59.13  ? 175 HIS A C   1 
ATOM   4539 O  O   . HIS C 1 178 ? 85.261  14.860  4.688   1.00 62.15  ? 175 HIS A O   1 
ATOM   4540 C  CB  . HIS C 1 178 ? 83.289  14.785  7.392   1.00 59.43  ? 175 HIS A CB  1 
ATOM   4541 C  CG  . HIS C 1 178 ? 82.960  15.029  8.831   1.00 57.55  ? 175 HIS A CG  1 
ATOM   4542 N  ND1 . HIS C 1 178 ? 82.117  16.039  9.242   1.00 61.49  ? 175 HIS A ND1 1 
ATOM   4543 C  CD2 . HIS C 1 178 ? 83.360  14.392  9.956   1.00 57.25  ? 175 HIS A CD2 1 
ATOM   4544 C  CE1 . HIS C 1 178 ? 82.009  16.011  10.558  1.00 62.44  ? 175 HIS A CE1 1 
ATOM   4545 N  NE2 . HIS C 1 178 ? 82.755  15.022  11.016  1.00 60.48  ? 175 HIS A NE2 1 
ATOM   4546 N  N   . GLN C 1 179 ? 85.379  13.035  6.001   1.00 60.59  ? 176 GLN A N   1 
ATOM   4547 C  CA  . GLN C 1 179 ? 85.681  12.111  4.913   1.00 66.70  ? 176 GLN A CA  1 
ATOM   4548 C  C   . GLN C 1 179 ? 84.474  11.241  4.570   1.00 67.18  ? 176 GLN A C   1 
ATOM   4549 O  O   . GLN C 1 179 ? 84.262  10.894  3.408   1.00 67.52  ? 176 GLN A O   1 
ATOM   4550 C  CB  . GLN C 1 179 ? 86.882  11.227  5.264   1.00 70.80  ? 176 GLN A CB  1 
ATOM   4551 C  CG  . GLN C 1 179 ? 88.160  11.546  4.491   1.00 75.16  ? 176 GLN A CG  1 
ATOM   4552 C  CD  . GLN C 1 179 ? 88.971  12.675  5.102   1.00 80.83  ? 176 GLN A CD  1 
ATOM   4553 O  OE1 . GLN C 1 179 ? 90.191  12.573  5.230   1.00 84.54  ? 176 GLN A OE1 1 
ATOM   4554 N  NE2 . GLN C 1 179 ? 88.299  13.756  5.481   1.00 81.78  ? 176 GLN A NE2 1 
ATOM   4555 N  N   . LYS C 1 180 ? 83.689  10.887  5.584   1.00 69.52  ? 177 LYS A N   1 
ATOM   4556 C  CA  . LYS C 1 180 ? 82.508  10.049  5.384   1.00 67.38  ? 177 LYS A CA  1 
ATOM   4557 C  C   . LYS C 1 180 ? 81.229  10.719  5.890   1.00 66.07  ? 177 LYS A C   1 
ATOM   4558 O  O   . LYS C 1 180 ? 81.252  11.864  6.343   1.00 63.23  ? 177 LYS A O   1 
ATOM   4559 C  CB  . LYS C 1 180 ? 82.692  8.683   6.056   1.00 67.14  ? 177 LYS A CB  1 
ATOM   4560 C  CG  . LYS C 1 180 ? 83.818  7.840   5.471   1.00 69.55  ? 177 LYS A CG  1 
ATOM   4561 C  CD  . LYS C 1 180 ? 83.575  6.356   5.713   1.00 71.36  ? 177 LYS A CD  1 
ATOM   4562 C  CE  . LYS C 1 180 ? 84.662  5.495   5.085   1.00 69.17  ? 177 LYS A CE  1 
ATOM   4563 N  NZ  . LYS C 1 180 ? 85.894  5.453   5.920   1.00 66.34  ? 177 LYS A NZ  1 
ATOM   4564 N  N   . GLU C 1 181 ? 80.114  9.997   5.804   1.00 67.41  ? 178 GLU A N   1 
ATOM   4565 C  CA  . GLU C 1 181 ? 78.828  10.500  6.279   1.00 64.85  ? 178 GLU A CA  1 
ATOM   4566 C  C   . GLU C 1 181 ? 78.700  10.312  7.788   1.00 60.61  ? 178 GLU A C   1 
ATOM   4567 O  O   . GLU C 1 181 ? 79.513  9.630   8.409   1.00 56.83  ? 178 GLU A O   1 
ATOM   4568 C  CB  . GLU C 1 181 ? 77.670  9.793   5.566   1.00 62.58  ? 178 GLU A CB  1 
ATOM   4569 C  CG  . GLU C 1 181 ? 77.441  8.354   6.020   1.00 69.35  ? 178 GLU A CG  1 
ATOM   4570 C  CD  . GLU C 1 181 ? 76.128  7.772   5.518   1.00 72.07  ? 178 GLU A CD  1 
ATOM   4571 O  OE1 . GLU C 1 181 ? 75.608  8.258   4.493   1.00 74.53  ? 178 GLU A OE1 1 
ATOM   4572 O  OE2 . GLU C 1 181 ? 75.613  6.823   6.149   1.00 76.04  ? 178 GLU A OE2 1 
ATOM   4573 N  N   . GLY C 1 182 ? 77.673  10.921  8.369   1.00 63.47  ? 179 GLY A N   1 
ATOM   4574 C  CA  . GLY C 1 182 ? 77.413  10.792  9.798   1.00 59.02  ? 179 GLY A CA  1 
ATOM   4575 C  C   . GLY C 1 182 ? 75.996  11.191  10.160  1.00 55.79  ? 179 GLY A C   1 
ATOM   4576 O  O   . GLY C 1 182 ? 75.199  11.542  9.289   1.00 50.15  ? 179 GLY A O   1 
ATOM   4577 N  N   . TYR C 1 183 ? 75.685  11.144  11.452  1.00 54.43  ? 180 TYR A N   1 
ATOM   4578 C  CA  . TYR C 1 183 ? 74.353  11.492  11.936  1.00 45.10  ? 180 TYR A CA  1 
ATOM   4579 C  C   . TYR C 1 183 ? 74.370  12.608  12.984  1.00 42.57  ? 180 TYR A C   1 
ATOM   4580 O  O   . TYR C 1 183 ? 73.507  13.480  12.974  1.00 46.74  ? 180 TYR A O   1 
ATOM   4581 C  CB  . TYR C 1 183 ? 73.645  10.252  12.485  1.00 48.35  ? 180 TYR A CB  1 
ATOM   4582 C  CG  . TYR C 1 183 ? 73.027  9.375   11.417  1.00 50.76  ? 180 TYR A CG  1 
ATOM   4583 C  CD1 . TYR C 1 183 ? 73.785  8.426   10.741  1.00 48.08  ? 180 TYR A CD1 1 
ATOM   4584 C  CD2 . TYR C 1 183 ? 71.681  9.496   11.086  1.00 51.48  ? 180 TYR A CD2 1 
ATOM   4585 C  CE1 . TYR C 1 183 ? 73.220  7.624   9.764   1.00 48.94  ? 180 TYR A CE1 1 
ATOM   4586 C  CE2 . TYR C 1 183 ? 71.108  8.699   10.113  1.00 47.79  ? 180 TYR A CE2 1 
ATOM   4587 C  CZ  . TYR C 1 183 ? 71.881  7.767   9.456   1.00 51.27  ? 180 TYR A CZ  1 
ATOM   4588 O  OH  . TYR C 1 183 ? 71.309  6.974   8.489   1.00 52.93  ? 180 TYR A OH  1 
ATOM   4589 N  N   . GLY C 1 184 ? 75.352  12.579  13.880  1.00 39.97  ? 181 GLY A N   1 
ATOM   4590 C  CA  . GLY C 1 184 ? 75.450  13.570  14.952  1.00 30.59  ? 181 GLY A CA  1 
ATOM   4591 C  C   . GLY C 1 184 ? 75.486  15.001  14.451  1.00 33.68  ? 181 GLY A C   1 
ATOM   4592 O  O   . GLY C 1 184 ? 76.182  15.310  13.483  1.00 41.13  ? 181 GLY A O   1 
ATOM   4593 N  N   . LEU C 1 185 ? 74.737  15.877  15.117  1.00 29.41  ? 182 LEU A N   1 
ATOM   4594 C  CA  . LEU C 1 185 ? 74.620  17.272  14.702  1.00 28.85  ? 182 LEU A CA  1 
ATOM   4595 C  C   . LEU C 1 185 ? 74.146  18.100  15.889  1.00 34.52  ? 182 LEU A C   1 
ATOM   4596 O  O   . LEU C 1 185 ? 73.140  17.763  16.513  1.00 38.18  ? 182 LEU A O   1 
ATOM   4597 C  CB  . LEU C 1 185 ? 73.605  17.395  13.562  1.00 39.18  ? 182 LEU A CB  1 
ATOM   4598 C  CG  . LEU C 1 185 ? 73.995  18.129  12.274  1.00 44.64  ? 182 LEU A CG  1 
ATOM   4599 C  CD1 . LEU C 1 185 ? 72.749  18.599  11.526  1.00 38.01  ? 182 LEU A CD1 1 
ATOM   4600 C  CD2 . LEU C 1 185 ? 74.918  19.298  12.548  1.00 44.54  ? 182 LEU A CD2 1 
ATOM   4601 N  N   . SER C 1 186 ? 74.857  19.181  16.202  1.00 39.79  ? 183 SER A N   1 
ATOM   4602 C  CA  . SER C 1 186 ? 74.505  20.001  17.365  1.00 41.68  ? 183 SER A CA  1 
ATOM   4603 C  C   . SER C 1 186 ? 74.939  21.465  17.253  1.00 42.45  ? 183 SER A C   1 
ATOM   4604 O  O   . SER C 1 186 ? 76.120  21.756  17.061  1.00 47.57  ? 183 SER A O   1 
ATOM   4605 C  CB  . SER C 1 186 ? 75.086  19.382  18.639  1.00 39.64  ? 183 SER A CB  1 
ATOM   4606 O  OG  . SER C 1 186 ? 74.638  20.069  19.793  1.00 44.64  ? 183 SER A OG  1 
ATOM   4607 N  N   . TRP C 1 187 ? 73.976  22.378  17.379  1.00 39.55  ? 184 TRP A N   1 
ATOM   4608 C  CA  . TRP C 1 187 ? 74.259  23.813  17.434  1.00 40.70  ? 184 TRP A CA  1 
ATOM   4609 C  C   . TRP C 1 187 ? 74.529  24.233  18.873  1.00 42.51  ? 184 TRP A C   1 
ATOM   4610 O  O   . TRP C 1 187 ? 73.948  23.679  19.807  1.00 43.81  ? 184 TRP A O   1 
ATOM   4611 C  CB  . TRP C 1 187 ? 73.070  24.629  16.922  1.00 41.49  ? 184 TRP A CB  1 
ATOM   4612 C  CG  . TRP C 1 187 ? 72.795  24.543  15.451  1.00 43.00  ? 184 TRP A CG  1 
ATOM   4613 C  CD1 . TRP C 1 187 ? 71.862  23.757  14.836  1.00 43.58  ? 184 TRP A CD1 1 
ATOM   4614 C  CD2 . TRP C 1 187 ? 73.432  25.296  14.412  1.00 41.88  ? 184 TRP A CD2 1 
ATOM   4615 N  NE1 . TRP C 1 187 ? 71.889  23.963  13.480  1.00 40.50  ? 184 TRP A NE1 1 
ATOM   4616 C  CE2 . TRP C 1 187 ? 72.844  24.903  13.192  1.00 42.10  ? 184 TRP A CE2 1 
ATOM   4617 C  CE3 . TRP C 1 187 ? 74.450  26.255  14.393  1.00 43.59  ? 184 TRP A CE3 1 
ATOM   4618 C  CZ2 . TRP C 1 187 ? 73.238  25.437  11.967  1.00 42.72  ? 184 TRP A CZ2 1 
ATOM   4619 C  CZ3 . TRP C 1 187 ? 74.841  26.784  13.174  1.00 42.51  ? 184 TRP A CZ3 1 
ATOM   4620 C  CH2 . TRP C 1 187 ? 74.236  26.374  11.979  1.00 44.49  ? 184 TRP A CH2 1 
ATOM   4621 N  N   . ASN C 1 188 ? 75.396  25.225  19.052  1.00 43.44  ? 185 ASN A N   1 
ATOM   4622 C  CA  . ASN C 1 188 ? 75.654  25.782  20.376  1.00 45.09  ? 185 ASN A CA  1 
ATOM   4623 C  C   . ASN C 1 188 ? 74.604  26.827  20.733  1.00 45.55  ? 185 ASN A C   1 
ATOM   4624 O  O   . ASN C 1 188 ? 74.506  27.866  20.080  1.00 49.20  ? 185 ASN A O   1 
ATOM   4625 C  CB  . ASN C 1 188 ? 77.055  26.394  20.437  1.00 49.25  ? 185 ASN A CB  1 
ATOM   4626 C  CG  . ASN C 1 188 ? 77.535  26.620  21.861  1.00 49.70  ? 185 ASN A CG  1 
ATOM   4627 O  OD1 . ASN C 1 188 ? 76.797  27.122  22.710  1.00 52.27  ? 185 ASN A OD1 1 
ATOM   4628 N  ND2 . ASN C 1 188 ? 78.783  26.255  22.126  1.00 46.29  ? 185 ASN A ND2 1 
ATOM   4629 N  N   . SER C 1 189 ? 73.822  26.548  21.772  1.00 44.05  ? 186 SER A N   1 
ATOM   4630 C  CA  . SER C 1 189 ? 72.716  27.421  22.161  1.00 47.84  ? 186 SER A CA  1 
ATOM   4631 C  C   . SER C 1 189 ? 73.188  28.667  22.905  1.00 51.94  ? 186 SER A C   1 
ATOM   4632 O  O   . SER C 1 189 ? 72.381  29.518  23.282  1.00 56.79  ? 186 SER A O   1 
ATOM   4633 C  CB  . SER C 1 189 ? 71.701  26.655  23.013  1.00 47.76  ? 186 SER A CB  1 
ATOM   4634 O  OG  . SER C 1 189 ? 72.288  26.207  24.224  1.00 50.37  ? 186 SER A OG  1 
ATOM   4635 N  N   . ASN C 1 190 ? 74.495  28.770  23.113  1.00 52.03  ? 187 ASN A N   1 
ATOM   4636 C  CA  . ASN C 1 190 ? 75.074  29.912  23.806  1.00 51.61  ? 187 ASN A CA  1 
ATOM   4637 C  C   . ASN C 1 190 ? 76.060  30.670  22.923  1.00 54.95  ? 187 ASN A C   1 
ATOM   4638 O  O   . ASN C 1 190 ? 76.277  31.869  23.100  1.00 59.05  ? 187 ASN A O   1 
ATOM   4639 C  CB  . ASN C 1 190 ? 75.752  29.454  25.099  1.00 49.94  ? 187 ASN A CB  1 
ATOM   4640 C  CG  . ASN C 1 190 ? 74.772  28.848  26.086  1.00 51.07  ? 187 ASN A CG  1 
ATOM   4641 O  OD1 . ASN C 1 190 ? 73.763  29.463  26.433  1.00 52.02  ? 187 ASN A OD1 1 
ATOM   4642 N  ND2 . ASN C 1 190 ? 75.066  27.636  26.544  1.00 48.09  ? 187 ASN A ND2 1 
ATOM   4643 N  N   . LEU C 1 191 ? 76.650  29.962  21.968  1.00 54.60  ? 188 LEU A N   1 
ATOM   4644 C  CA  . LEU C 1 191 ? 77.594  30.566  21.042  1.00 56.88  ? 188 LEU A CA  1 
ATOM   4645 C  C   . LEU C 1 191 ? 77.029  30.474  19.629  1.00 56.04  ? 188 LEU A C   1 
ATOM   4646 O  O   . LEU C 1 191 ? 77.116  29.432  18.979  1.00 60.24  ? 188 LEU A O   1 
ATOM   4647 C  CB  . LEU C 1 191 ? 78.946  29.858  21.137  1.00 60.56  ? 188 LEU A CB  1 
ATOM   4648 C  CG  . LEU C 1 191 ? 80.210  30.712  21.017  1.00 62.13  ? 188 LEU A CG  1 
ATOM   4649 C  CD1 . LEU C 1 191 ? 80.069  32.009  21.799  1.00 62.59  ? 188 LEU A CD1 1 
ATOM   4650 C  CD2 . LEU C 1 191 ? 81.419  29.924  21.500  1.00 61.23  ? 188 LEU A CD2 1 
ATOM   4651 N  N   . SER C 1 192 ? 76.445  31.574  19.165  1.00 53.94  ? 189 SER A N   1 
ATOM   4652 C  CA  . SER C 1 192 ? 75.730  31.604  17.892  1.00 54.79  ? 189 SER A CA  1 
ATOM   4653 C  C   . SER C 1 192 ? 76.599  31.237  16.685  1.00 54.75  ? 189 SER A C   1 
ATOM   4654 O  O   . SER C 1 192 ? 77.664  31.821  16.472  1.00 54.27  ? 189 SER A O   1 
ATOM   4655 C  CB  . SER C 1 192 ? 75.087  32.976  17.680  1.00 53.23  ? 189 SER A CB  1 
ATOM   4656 O  OG  . SER C 1 192 ? 74.351  33.009  16.471  1.00 60.63  ? 189 SER A OG  1 
ATOM   4657 N  N   . GLY C 1 193 ? 76.133  30.267  15.903  1.00 45.57  ? 190 GLY A N   1 
ATOM   4658 C  CA  . GLY C 1 193 ? 76.794  29.892  14.656  1.00 44.52  ? 190 GLY A CA  1 
ATOM   4659 C  C   . GLY C 1 193 ? 77.830  28.792  14.792  1.00 46.68  ? 190 GLY A C   1 
ATOM   4660 O  O   . GLY C 1 193 ? 78.502  28.439  13.821  1.00 39.33  ? 190 GLY A O   1 
ATOM   4661 N  N   . HIS C 1 194 ? 77.961  28.244  15.995  1.00 49.87  ? 191 HIS A N   1 
ATOM   4662 C  CA  . HIS C 1 194 ? 78.946  27.198  16.254  1.00 49.78  ? 191 HIS A CA  1 
ATOM   4663 C  C   . HIS C 1 194 ? 78.294  25.819  16.212  1.00 48.26  ? 191 HIS A C   1 
ATOM   4664 O  O   . HIS C 1 194 ? 77.334  25.552  16.936  1.00 46.71  ? 191 HIS A O   1 
ATOM   4665 C  CB  . HIS C 1 194 ? 79.640  27.443  17.595  1.00 58.19  ? 191 HIS A CB  1 
ATOM   4666 C  CG  . HIS C 1 194 ? 80.575  28.614  17.583  1.00 63.58  ? 191 HIS A CG  1 
ATOM   4667 N  ND1 . HIS C 1 194 ? 81.693  28.683  18.388  1.00 65.12  ? 191 HIS A ND1 1 
ATOM   4668 C  CD2 . HIS C 1 194 ? 80.569  29.753  16.849  1.00 65.54  ? 191 HIS A CD2 1 
ATOM   4669 C  CE1 . HIS C 1 194 ? 82.327  29.820  18.160  1.00 65.77  ? 191 HIS A CE1 1 
ATOM   4670 N  NE2 . HIS C 1 194 ? 81.666  30.487  17.230  1.00 67.24  ? 191 HIS A NE2 1 
ATOM   4671 N  N   . LEU C 1 195 ? 78.826  24.947  15.361  1.00 45.27  ? 192 LEU A N   1 
ATOM   4672 C  CA  . LEU C 1 195 ? 78.178  23.677  15.057  1.00 42.95  ? 192 LEU A CA  1 
ATOM   4673 C  C   . LEU C 1 195 ? 79.133  22.493  15.171  1.00 47.26  ? 192 LEU A C   1 
ATOM   4674 O  O   . LEU C 1 195 ? 80.283  22.573  14.746  1.00 51.60  ? 192 LEU A O   1 
ATOM   4675 C  CB  . LEU C 1 195 ? 77.593  23.728  13.642  1.00 42.56  ? 192 LEU A CB  1 
ATOM   4676 C  CG  . LEU C 1 195 ? 76.815  22.511  13.139  1.00 42.74  ? 192 LEU A CG  1 
ATOM   4677 C  CD1 . LEU C 1 195 ? 75.427  22.475  13.756  1.00 43.22  ? 192 LEU A CD1 1 
ATOM   4678 C  CD2 . LEU C 1 195 ? 76.724  22.532  11.627  1.00 41.91  ? 192 LEU A CD2 1 
ATOM   4679 N  N   . LEU C 1 196 ? 78.642  21.395  15.738  1.00 48.08  ? 193 LEU A N   1 
ATOM   4680 C  CA  . LEU C 1 196 ? 79.405  20.152  15.827  1.00 46.14  ? 193 LEU A CA  1 
ATOM   4681 C  C   . LEU C 1 196 ? 78.783  19.076  14.945  1.00 50.91  ? 193 LEU A C   1 
ATOM   4682 O  O   . LEU C 1 196 ? 77.596  19.138  14.624  1.00 48.52  ? 193 LEU A O   1 
ATOM   4683 C  CB  . LEU C 1 196 ? 79.450  19.653  17.269  1.00 46.07  ? 193 LEU A CB  1 
ATOM   4684 C  CG  . LEU C 1 196 ? 80.290  20.435  18.273  1.00 47.69  ? 193 LEU A CG  1 
ATOM   4685 C  CD1 . LEU C 1 196 ? 79.872  20.065  19.679  1.00 48.13  ? 193 LEU A CD1 1 
ATOM   4686 C  CD2 . LEU C 1 196 ? 81.775  20.175  18.063  1.00 48.53  ? 193 LEU A CD2 1 
ATOM   4687 N  N   . SER C 1 197 ? 79.585  18.083  14.570  1.00 51.42  ? 194 SER A N   1 
ATOM   4688 C  CA  . SER C 1 197 ? 79.110  16.994  13.720  1.00 45.97  ? 194 SER A CA  1 
ATOM   4689 C  C   . SER C 1 197 ? 79.943  15.723  13.873  1.00 44.49  ? 194 SER A C   1 
ATOM   4690 O  O   . SER C 1 197 ? 81.171  15.763  13.824  1.00 46.34  ? 194 SER A O   1 
ATOM   4691 C  CB  . SER C 1 197 ? 79.098  17.426  12.254  1.00 48.89  ? 194 SER A CB  1 
ATOM   4692 O  OG  . SER C 1 197 ? 78.899  16.311  11.402  1.00 54.74  ? 194 SER A OG  1 
ATOM   4693 N  N   . ALA C 1 198 ? 79.261  14.597  14.051  1.00 45.28  ? 195 ALA A N   1 
ATOM   4694 C  CA  . ALA C 1 198 ? 79.918  13.299  14.127  1.00 44.37  ? 195 ALA A CA  1 
ATOM   4695 C  C   . ALA C 1 198 ? 79.879  12.609  12.768  1.00 52.06  ? 195 ALA A C   1 
ATOM   4696 O  O   . ALA C 1 198 ? 78.991  12.873  11.956  1.00 55.09  ? 195 ALA A O   1 
ATOM   4697 C  CB  . ALA C 1 198 ? 79.254  12.436  15.175  1.00 46.45  ? 195 ALA A CB  1 
ATOM   4698 N  N   . SER C 1 199 ? 80.839  11.721  12.525  1.00 56.73  ? 196 SER A N   1 
ATOM   4699 C  CA  . SER C 1 199 ? 80.932  11.036  11.240  1.00 56.17  ? 196 SER A CA  1 
ATOM   4700 C  C   . SER C 1 199 ? 81.463  9.614   11.374  1.00 57.33  ? 196 SER A C   1 
ATOM   4701 O  O   . SER C 1 199 ? 81.894  9.196   12.448  1.00 56.80  ? 196 SER A O   1 
ATOM   4702 C  CB  . SER C 1 199 ? 81.817  11.830  10.279  1.00 58.30  ? 196 SER A CB  1 
ATOM   4703 O  OG  . SER C 1 199 ? 82.079  11.099  9.094   1.00 61.62  ? 196 SER A OG  1 
ATOM   4704 N  N   . ASP C 1 200 ? 81.430  8.879   10.266  1.00 58.92  ? 197 ASP A N   1 
ATOM   4705 C  CA  . ASP C 1 200 ? 81.939  7.515   10.227  1.00 60.26  ? 197 ASP A CA  1 
ATOM   4706 C  C   . ASP C 1 200 ? 83.463  7.491   10.127  1.00 61.47  ? 197 ASP A C   1 
ATOM   4707 O  O   . ASP C 1 200 ? 84.082  6.430   10.220  1.00 61.56  ? 197 ASP A O   1 
ATOM   4708 C  CB  . ASP C 1 200 ? 81.324  6.746   9.055   1.00 62.14  ? 197 ASP A CB  1 
ATOM   4709 C  CG  . ASP C 1 200 ? 79.847  6.455   9.254   1.00 62.48  ? 197 ASP A CG  1 
ATOM   4710 O  OD1 . ASP C 1 200 ? 79.327  6.722   10.356  1.00 61.21  ? 197 ASP A OD1 1 
ATOM   4711 O  OD2 . ASP C 1 200 ? 79.206  5.954   8.304   1.00 61.84  ? 197 ASP A OD2 1 
ATOM   4712 N  N   . ASP C 1 201 ? 84.064  8.662   9.942   1.00 57.29  ? 198 ASP A N   1 
ATOM   4713 C  CA  . ASP C 1 201 ? 85.514  8.755   9.811   1.00 56.69  ? 198 ASP A CA  1 
ATOM   4714 C  C   . ASP C 1 201 ? 86.215  8.868   11.164  1.00 58.17  ? 198 ASP A C   1 
ATOM   4715 O  O   . ASP C 1 201 ? 87.397  9.208   11.232  1.00 60.01  ? 198 ASP A O   1 
ATOM   4716 C  CB  . ASP C 1 201 ? 85.906  9.922   8.899   1.00 56.93  ? 198 ASP A CB  1 
ATOM   4717 C  CG  . ASP C 1 201 ? 85.370  11.254  9.386   1.00 59.65  ? 198 ASP A CG  1 
ATOM   4718 O  OD1 . ASP C 1 201 ? 85.085  11.388  10.593  1.00 58.71  ? 198 ASP A OD1 1 
ATOM   4719 O  OD2 . ASP C 1 201 ? 85.238  12.176  8.554   1.00 61.87  ? 198 ASP A OD2 1 
ATOM   4720 N  N   . HIS C 1 202 ? 85.478  8.589   12.237  1.00 55.95  ? 199 HIS A N   1 
ATOM   4721 C  CA  . HIS C 1 202 ? 86.049  8.547   13.580  1.00 57.95  ? 199 HIS A CA  1 
ATOM   4722 C  C   . HIS C 1 202 ? 86.228  9.936   14.181  1.00 59.98  ? 199 HIS A C   1 
ATOM   4723 O  O   . HIS C 1 202 ? 86.660  10.071  15.326  1.00 65.41  ? 199 HIS A O   1 
ATOM   4724 C  CB  . HIS C 1 202 ? 87.404  7.832   13.557  1.00 61.32  ? 199 HIS A CB  1 
ATOM   4725 C  CG  . HIS C 1 202 ? 87.332  6.401   13.124  1.00 62.40  ? 199 HIS A CG  1 
ATOM   4726 N  ND1 . HIS C 1 202 ? 86.231  5.866   12.490  1.00 65.18  ? 199 HIS A ND1 1 
ATOM   4727 C  CD2 . HIS C 1 202 ? 88.239  5.401   13.209  1.00 61.42  ? 199 HIS A CD2 1 
ATOM   4728 C  CE1 . HIS C 1 202 ? 86.456  4.593   12.221  1.00 63.86  ? 199 HIS A CE1 1 
ATOM   4729 N  NE2 . HIS C 1 202 ? 87.668  4.286   12.646  1.00 63.96  ? 199 HIS A NE2 1 
ATOM   4730 N  N   . THR C 1 203 ? 85.895  10.967  13.410  1.00 60.23  ? 200 THR A N   1 
ATOM   4731 C  CA  . THR C 1 203 ? 86.187  12.340  13.811  1.00 59.96  ? 200 THR A CA  1 
ATOM   4732 C  C   . THR C 1 203 ? 84.948  13.155  14.169  1.00 61.81  ? 200 THR A C   1 
ATOM   4733 O  O   . THR C 1 203 ? 83.823  12.805  13.810  1.00 60.91  ? 200 THR A O   1 
ATOM   4734 C  CB  . THR C 1 203 ? 86.944  13.095  12.704  1.00 61.24  ? 200 THR A CB  1 
ATOM   4735 O  OG1 . THR C 1 203 ? 86.070  13.306  11.588  1.00 56.12  ? 200 THR A OG1 1 
ATOM   4736 C  CG2 . THR C 1 203 ? 88.167  12.308  12.253  1.00 60.95  ? 200 THR A CG2 1 
ATOM   4737 N  N   . VAL C 1 204 ? 85.178  14.252  14.882  1.00 56.47  ? 201 VAL A N   1 
ATOM   4738 C  CA  . VAL C 1 204 ? 84.134  15.206  15.206  1.00 49.11  ? 201 VAL A CA  1 
ATOM   4739 C  C   . VAL C 1 204 ? 84.600  16.580  14.751  1.00 55.07  ? 201 VAL A C   1 
ATOM   4740 O  O   . VAL C 1 204 ? 85.606  17.091  15.241  1.00 59.21  ? 201 VAL A O   1 
ATOM   4741 C  CB  . VAL C 1 204 ? 83.851  15.239  16.721  1.00 45.79  ? 201 VAL A CB  1 
ATOM   4742 C  CG1 . VAL C 1 204 ? 82.813  16.302  17.048  1.00 43.78  ? 201 VAL A CG1 1 
ATOM   4743 C  CG2 . VAL C 1 204 ? 83.393  13.873  17.209  1.00 40.60  ? 201 VAL A CG2 1 
ATOM   4744 N  N   . CYS C 1 205 ? 83.883  17.172  13.802  1.00 57.63  ? 202 CYS A N   1 
ATOM   4745 C  CA  . CYS C 1 205 ? 84.267  18.476  13.269  1.00 54.64  ? 202 CYS A CA  1 
ATOM   4746 C  C   . CYS C 1 205 ? 83.530  19.622  13.950  1.00 55.86  ? 202 CYS A C   1 
ATOM   4747 O  O   . CYS C 1 205 ? 82.441  19.438  14.493  1.00 55.55  ? 202 CYS A O   1 
ATOM   4748 C  CB  . CYS C 1 205 ? 84.032  18.536  11.762  1.00 54.72  ? 202 CYS A CB  1 
ATOM   4749 S  SG  . CYS C 1 205 ? 85.167  17.537  10.791  1.00 59.61  ? 202 CYS A SG  1 
ATOM   4750 N  N   . LEU C 1 206 ? 84.139  20.803  13.909  1.00 56.13  ? 203 LEU A N   1 
ATOM   4751 C  CA  . LEU C 1 206 ? 83.561  22.005  14.496  1.00 53.85  ? 203 LEU A CA  1 
ATOM   4752 C  C   . LEU C 1 206 ? 83.677  23.167  13.518  1.00 56.61  ? 203 LEU A C   1 
ATOM   4753 O  O   . LEU C 1 206 ? 84.738  23.391  12.939  1.00 64.30  ? 203 LEU A O   1 
ATOM   4754 C  CB  . LEU C 1 206 ? 84.268  22.350  15.809  1.00 51.48  ? 203 LEU A CB  1 
ATOM   4755 C  CG  . LEU C 1 206 ? 84.033  23.737  16.416  1.00 53.71  ? 203 LEU A CG  1 
ATOM   4756 C  CD1 . LEU C 1 206 ? 82.576  23.936  16.801  1.00 52.99  ? 203 LEU A CD1 1 
ATOM   4757 C  CD2 . LEU C 1 206 ? 84.935  23.950  17.623  1.00 53.83  ? 203 LEU A CD2 1 
ATOM   4758 N  N   . TRP C 1 207 ? 82.583  23.901  13.334  1.00 53.97  ? 204 TRP A N   1 
ATOM   4759 C  CA  . TRP C 1 207 ? 82.573  25.045  12.430  1.00 50.11  ? 204 TRP A CA  1 
ATOM   4760 C  C   . TRP C 1 207 ? 82.066  26.307  13.116  1.00 54.82  ? 204 TRP A C   1 
ATOM   4761 O  O   . TRP C 1 207 ? 81.263  26.243  14.045  1.00 59.57  ? 204 TRP A O   1 
ATOM   4762 C  CB  . TRP C 1 207 ? 81.694  24.764  11.212  1.00 45.65  ? 204 TRP A CB  1 
ATOM   4763 C  CG  . TRP C 1 207 ? 82.186  23.671  10.322  1.00 43.39  ? 204 TRP A CG  1 
ATOM   4764 C  CD1 . TRP C 1 207 ? 83.072  23.789  9.295   1.00 40.68  ? 204 TRP A CD1 1 
ATOM   4765 C  CD2 . TRP C 1 207 ? 81.799  22.292  10.362  1.00 43.66  ? 204 TRP A CD2 1 
ATOM   4766 N  NE1 . TRP C 1 207 ? 83.272  22.569  8.699   1.00 41.86  ? 204 TRP A NE1 1 
ATOM   4767 C  CE2 . TRP C 1 207 ? 82.502  21.632  9.337   1.00 43.71  ? 204 TRP A CE2 1 
ATOM   4768 C  CE3 . TRP C 1 207 ? 80.933  21.551  11.171  1.00 46.10  ? 204 TRP A CE3 1 
ATOM   4769 C  CZ2 . TRP C 1 207 ? 82.362  20.266  9.094   1.00 44.21  ? 204 TRP A CZ2 1 
ATOM   4770 C  CZ3 . TRP C 1 207 ? 80.797  20.194  10.930  1.00 43.99  ? 204 TRP A CZ3 1 
ATOM   4771 C  CH2 . TRP C 1 207 ? 81.505  19.567  9.898   1.00 42.92  ? 204 TRP A CH2 1 
ATOM   4772 N  N   . ASP C 1 208 ? 82.546  27.453  12.648  1.00 56.81  ? 205 ASP A N   1 
ATOM   4773 C  CA  . ASP C 1 208 ? 81.991  28.740  13.037  1.00 62.08  ? 205 ASP A CA  1 
ATOM   4774 C  C   . ASP C 1 208 ? 81.523  29.442  11.770  1.00 63.83  ? 205 ASP A C   1 
ATOM   4775 O  O   . ASP C 1 208 ? 82.296  30.142  11.116  1.00 66.26  ? 205 ASP A O   1 
ATOM   4776 C  CB  . ASP C 1 208 ? 83.033  29.585  13.773  1.00 66.68  ? 205 ASP A CB  1 
ATOM   4777 C  CG  . ASP C 1 208 ? 82.499  30.949  14.181  1.00 69.86  ? 205 ASP A CG  1 
ATOM   4778 O  OD1 . ASP C 1 208 ? 83.275  31.745  14.752  1.00 73.39  ? 205 ASP A OD1 1 
ATOM   4779 O  OD2 . ASP C 1 208 ? 81.306  31.228  13.934  1.00 69.38  ? 205 ASP A OD2 1 
ATOM   4780 N  N   . ILE C 1 209 ? 80.253  29.246  11.428  1.00 63.46  ? 206 ILE A N   1 
ATOM   4781 C  CA  . ILE C 1 209 ? 79.708  29.739  10.165  1.00 64.22  ? 206 ILE A CA  1 
ATOM   4782 C  C   . ILE C 1 209 ? 79.695  31.266  10.074  1.00 69.37  ? 206 ILE A C   1 
ATOM   4783 O  O   . ILE C 1 209 ? 79.114  31.837  9.152   1.00 69.00  ? 206 ILE A O   1 
ATOM   4784 C  CB  . ILE C 1 209 ? 78.294  29.172  9.893   1.00 63.01  ? 206 ILE A CB  1 
ATOM   4785 C  CG1 . ILE C 1 209 ? 77.283  29.720  10.902  1.00 62.65  ? 206 ILE A CG1 1 
ATOM   4786 C  CG2 . ILE C 1 209 ? 78.312  27.650  9.933   1.00 60.41  ? 206 ILE A CG2 1 
ATOM   4787 C  CD1 . ILE C 1 209 ? 75.851  29.372  10.575  1.00 57.80  ? 206 ILE A CD1 1 
ATOM   4788 N  N   . ASN C 1 210 ? 80.341  31.919  11.035  1.00 76.43  ? 207 ASN A N   1 
ATOM   4789 C  CA  . ASN C 1 210 ? 80.528  33.364  10.993  1.00 82.99  ? 207 ASN A CA  1 
ATOM   4790 C  C   . ASN C 1 210 ? 81.932  33.720  10.516  1.00 89.10  ? 207 ASN A C   1 
ATOM   4791 O  O   . ASN C 1 210 ? 82.569  34.627  11.051  1.00 94.00  ? 207 ASN A O   1 
ATOM   4792 C  CB  . ASN C 1 210 ? 80.272  33.982  12.370  1.00 82.53  ? 207 ASN A CB  1 
ATOM   4793 C  CG  . ASN C 1 210 ? 78.831  33.842  12.814  1.00 82.86  ? 207 ASN A CG  1 
ATOM   4794 O  OD1 . ASN C 1 210 ? 77.926  33.690  11.993  1.00 85.39  ? 207 ASN A OD1 1 
ATOM   4795 N  ND2 . ASN C 1 210 ? 78.608  33.897  14.122  1.00 79.93  ? 207 ASN A ND2 1 
ATOM   4796 N  N   . ALA C 1 211 ? 82.413  32.997  9.510   1.00 94.21  ? 208 ALA A N   1 
ATOM   4797 C  CA  . ALA C 1 211 ? 83.758  33.211  8.985   1.00 98.80  ? 208 ALA A CA  1 
ATOM   4798 C  C   . ALA C 1 211 ? 83.828  32.934  7.486   1.00 102.81 ? 208 ALA A C   1 
ATOM   4799 O  O   . ALA C 1 211 ? 83.040  33.473  6.708   1.00 101.68 ? 208 ALA A O   1 
ATOM   4800 C  CB  . ALA C 1 211 ? 84.764  32.348  9.735   1.00 96.15  ? 208 ALA A CB  1 
ATOM   4801 N  N   . GLY C 1 212 ? 84.776  32.090  7.089   1.00 107.97 ? 209 GLY A N   1 
ATOM   4802 C  CA  . GLY C 1 212 ? 84.976  31.760  5.682   1.00 112.98 ? 209 GLY A CA  1 
ATOM   4803 C  C   . GLY C 1 212 ? 85.492  32.943  4.886   1.00 117.27 ? 209 GLY A C   1 
ATOM   4804 O  O   . GLY C 1 212 ? 86.096  33.858  5.448   1.00 118.36 ? 209 GLY A O   1 
ATOM   4805 N  N   . PRO C 1 213 ? 85.263  32.930  3.564   1.00 119.64 ? 210 PRO A N   1 
ATOM   4806 C  CA  . PRO C 1 213 ? 85.639  34.036  2.689   1.00 120.00 ? 210 PRO A CA  1 
ATOM   4807 C  C   . PRO C 1 213 ? 84.664  35.204  2.816   1.00 120.00 ? 210 PRO A C   1 
ATOM   4808 O  O   . PRO C 1 213 ? 84.035  35.377  3.862   1.00 120.00 ? 210 PRO A O   1 
ATOM   4809 C  CB  . PRO C 1 213 ? 85.551  33.424  1.281   1.00 120.00 ? 210 PRO A CB  1 
ATOM   4810 C  CG  . PRO C 1 213 ? 85.281  31.949  1.480   1.00 120.00 ? 210 PRO A CG  1 
ATOM   4811 C  CD  . PRO C 1 213 ? 84.634  31.832  2.814   1.00 120.00 ? 210 PRO A CD  1 
ATOM   4812 N  N   . LYS C 1 214 ? 84.543  35.998  1.757   1.00 120.00 ? 211 LYS A N   1 
ATOM   4813 C  CA  . LYS C 1 214 ? 83.609  37.119  1.745   1.00 120.00 ? 211 LYS A CA  1 
ATOM   4814 C  C   . LYS C 1 214 ? 82.482  36.909  0.738   1.00 120.00 ? 211 LYS A C   1 
ATOM   4815 O  O   . LYS C 1 214 ? 81.579  37.739  0.623   1.00 120.00 ? 211 LYS A O   1 
ATOM   4816 C  CB  . LYS C 1 214 ? 84.342  38.434  1.462   1.00 120.00 ? 211 LYS A CB  1 
ATOM   4817 C  CG  . LYS C 1 214 ? 84.872  39.141  2.706   1.00 120.00 ? 211 LYS A CG  1 
ATOM   4818 C  CD  . LYS C 1 214 ? 83.867  40.148  3.266   1.00 120.00 ? 211 LYS A CD  1 
ATOM   4819 C  CE  . LYS C 1 214 ? 82.614  39.477  3.817   1.00 120.00 ? 211 LYS A CE  1 
ATOM   4820 N  NZ  . LYS C 1 214 ? 82.920  38.542  4.935   1.00 120.00 ? 211 LYS A NZ  1 
ATOM   4821 N  N   . GLU C 1 215 ? 82.539  35.793  0.015   1.00 120.00 ? 212 GLU A N   1 
ATOM   4822 C  CA  . GLU C 1 215 ? 81.515  35.460  -0.971  1.00 120.00 ? 212 GLU A CA  1 
ATOM   4823 C  C   . GLU C 1 215 ? 81.561  33.974  -1.328  1.00 117.73 ? 212 GLU A C   1 
ATOM   4824 O  O   . GLU C 1 215 ? 80.987  33.545  -2.330  1.00 116.89 ? 212 GLU A O   1 
ATOM   4825 C  CB  . GLU C 1 215 ? 81.679  36.324  -2.226  1.00 120.00 ? 212 GLU A CB  1 
ATOM   4826 C  CG  . GLU C 1 215 ? 80.404  36.496  -3.040  1.00 120.00 ? 212 GLU A CG  1 
ATOM   4827 C  CD  . GLU C 1 215 ? 80.493  37.641  -4.030  1.00 120.00 ? 212 GLU A CD  1 
ATOM   4828 O  OE1 . GLU C 1 215 ? 81.346  38.533  -3.837  1.00 120.00 ? 212 GLU A OE1 1 
ATOM   4829 O  OE2 . GLU C 1 215 ? 79.705  37.653  -5.000  1.00 120.00 ? 212 GLU A OE2 1 
ATOM   4830 N  N   . GLY C 1 216 ? 82.244  33.193  -0.496  1.00 113.24 ? 213 GLY A N   1 
ATOM   4831 C  CA  . GLY C 1 216 ? 82.364  31.756  -0.714  1.00 105.46 ? 213 GLY A CA  1 
ATOM   4832 C  C   . GLY C 1 216 ? 81.333  30.960  0.062   1.00 98.58  ? 213 GLY A C   1 
ATOM   4833 O  O   . GLY C 1 216 ? 81.106  31.206  1.248   1.00 97.83  ? 213 GLY A O   1 
ATOM   4834 N  N   . LYS C 1 217 ? 80.711  29.997  -0.611  1.00 90.72  ? 214 LYS A N   1 
ATOM   4835 C  CA  . LYS C 1 217 ? 79.694  29.156  0.009   1.00 84.35  ? 214 LYS A CA  1 
ATOM   4836 C  C   . LYS C 1 217 ? 80.322  28.026  0.821   1.00 78.76  ? 214 LYS A C   1 
ATOM   4837 O  O   . LYS C 1 217 ? 79.617  27.231  1.440   1.00 78.07  ? 214 LYS A O   1 
ATOM   4838 C  CB  . LYS C 1 217 ? 78.758  28.575  -1.055  1.00 84.36  ? 214 LYS A CB  1 
ATOM   4839 C  CG  . LYS C 1 217 ? 77.943  29.609  -1.819  1.00 84.47  ? 214 LYS A CG  1 
ATOM   4840 C  CD  . LYS C 1 217 ? 76.940  30.309  -0.916  1.00 86.31  ? 214 LYS A CD  1 
ATOM   4841 C  CE  . LYS C 1 217 ? 75.949  31.139  -1.719  1.00 87.27  ? 214 LYS A CE  1 
ATOM   4842 N  NZ  . LYS C 1 217 ? 75.052  30.291  -2.555  1.00 83.66  ? 214 LYS A NZ  1 
ATOM   4843 N  N   . ILE C 1 218 ? 81.649  27.960  0.815   1.00 73.48  ? 215 ILE A N   1 
ATOM   4844 C  CA  . ILE C 1 218 ? 82.367  26.886  1.494   1.00 68.52  ? 215 ILE A CA  1 
ATOM   4845 C  C   . ILE C 1 218 ? 83.105  27.397  2.728   1.00 67.05  ? 215 ILE A C   1 
ATOM   4846 O  O   . ILE C 1 218 ? 83.653  28.500  2.722   1.00 67.25  ? 215 ILE A O   1 
ATOM   4847 C  CB  . ILE C 1 218 ? 83.373  26.200  0.544   1.00 66.79  ? 215 ILE A CB  1 
ATOM   4848 C  CG1 . ILE C 1 218 ? 82.672  25.750  -0.742  1.00 68.96  ? 215 ILE A CG1 1 
ATOM   4849 C  CG2 . ILE C 1 218 ? 84.047  25.021  1.232   1.00 63.60  ? 215 ILE A CG2 1 
ATOM   4850 C  CD1 . ILE C 1 218 ? 83.619  25.286  -1.835  1.00 70.64  ? 215 ILE A CD1 1 
ATOM   4851 N  N   . VAL C 1 219 ? 83.105  26.592  3.786   1.00 64.33  ? 216 VAL A N   1 
ATOM   4852 C  CA  . VAL C 1 219 ? 83.840  26.918  5.006   1.00 65.71  ? 216 VAL A CA  1 
ATOM   4853 C  C   . VAL C 1 219 ? 84.430  25.667  5.658   1.00 69.43  ? 216 VAL A C   1 
ATOM   4854 O  O   . VAL C 1 219 ? 83.745  24.656  5.825   1.00 69.49  ? 216 VAL A O   1 
ATOM   4855 C  CB  . VAL C 1 219 ? 82.971  27.715  6.011   1.00 64.03  ? 216 VAL A CB  1 
ATOM   4856 C  CG1 . VAL C 1 219 ? 81.506  27.349  5.868   1.00 61.30  ? 216 VAL A CG1 1 
ATOM   4857 C  CG2 . VAL C 1 219 ? 83.461  27.512  7.442   1.00 62.45  ? 216 VAL A CG2 1 
ATOM   4858 N  N   . ASP C 1 220 ? 85.711  25.746  6.010   1.00 71.56  ? 217 ASP A N   1 
ATOM   4859 C  CA  . ASP C 1 220 ? 86.445  24.615  6.569   1.00 64.56  ? 217 ASP A CA  1 
ATOM   4860 C  C   . ASP C 1 220 ? 86.288  24.533  8.083   1.00 61.19  ? 217 ASP A C   1 
ATOM   4861 O  O   . ASP C 1 220 ? 86.026  25.539  8.744   1.00 56.56  ? 217 ASP A O   1 
ATOM   4862 C  CB  . ASP C 1 220 ? 87.928  24.722  6.208   1.00 68.10  ? 217 ASP A CB  1 
ATOM   4863 C  CG  . ASP C 1 220 ? 88.160  24.795  4.711   1.00 72.62  ? 217 ASP A CG  1 
ATOM   4864 O  OD1 . ASP C 1 220 ? 88.801  25.767  4.256   1.00 74.03  ? 217 ASP A OD1 1 
ATOM   4865 O  OD2 . ASP C 1 220 ? 87.695  23.887  3.989   1.00 75.73  ? 217 ASP A OD2 1 
ATOM   4866 N  N   . ALA C 1 221 ? 86.458  23.329  8.622   1.00 57.85  ? 218 ALA A N   1 
ATOM   4867 C  CA  . ALA C 1 221 ? 86.329  23.100  10.056  1.00 57.88  ? 218 ALA A CA  1 
ATOM   4868 C  C   . ALA C 1 221 ? 87.326  23.928  10.858  1.00 58.92  ? 218 ALA A C   1 
ATOM   4869 O  O   . ALA C 1 221 ? 88.482  24.079  10.464  1.00 61.26  ? 218 ALA A O   1 
ATOM   4870 C  CB  . ALA C 1 221 ? 86.491  21.622  10.372  1.00 58.05  ? 218 ALA A CB  1 
ATOM   4871 N  N   . LYS C 1 222 ? 86.870  24.465  11.984  1.00 60.00  ? 219 LYS A N   1 
ATOM   4872 C  CA  . LYS C 1 222 ? 87.732  25.244  12.861  1.00 62.05  ? 219 LYS A CA  1 
ATOM   4873 C  C   . LYS C 1 222 ? 88.566  24.315  13.735  1.00 63.00  ? 219 LYS A C   1 
ATOM   4874 O  O   . LYS C 1 222 ? 89.620  24.702  14.240  1.00 65.90  ? 219 LYS A O   1 
ATOM   4875 C  CB  . LYS C 1 222 ? 86.902  26.189  13.734  1.00 61.86  ? 219 LYS A CB  1 
ATOM   4876 C  CG  . LYS C 1 222 ? 87.693  27.352  14.319  1.00 63.52  ? 219 LYS A CG  1 
ATOM   4877 C  CD  . LYS C 1 222 ? 86.793  28.325  15.065  1.00 65.31  ? 219 LYS A CD  1 
ATOM   4878 C  CE  . LYS C 1 222 ? 86.380  27.780  16.424  1.00 66.50  ? 219 LYS A CE  1 
ATOM   4879 N  NZ  . LYS C 1 222 ? 87.530  27.713  17.368  1.00 66.28  ? 219 LYS A NZ  1 
ATOM   4880 N  N   . ALA C 1 223 ? 88.086  23.086  13.902  1.00 62.53  ? 220 ALA A N   1 
ATOM   4881 C  CA  . ALA C 1 223 ? 88.764  22.092  14.727  1.00 61.50  ? 220 ALA A CA  1 
ATOM   4882 C  C   . ALA C 1 223 ? 88.183  20.697  14.510  1.00 65.06  ? 220 ALA A C   1 
ATOM   4883 O  O   . ALA C 1 223 ? 86.968  20.505  14.556  1.00 72.42  ? 220 ALA A O   1 
ATOM   4884 C  CB  . ALA C 1 223 ? 88.680  22.476  16.198  1.00 55.14  ? 220 ALA A CB  1 
ATOM   4885 N  N   . ILE C 1 224 ? 89.060  19.727  14.271  1.00 63.22  ? 221 ILE A N   1 
ATOM   4886 C  CA  . ILE C 1 224 ? 88.647  18.338  14.125  1.00 60.08  ? 221 ILE A CA  1 
ATOM   4887 C  C   . ILE C 1 224 ? 89.154  17.527  15.315  1.00 63.44  ? 221 ILE A C   1 
ATOM   4888 O  O   . ILE C 1 224 ? 90.342  17.550  15.629  1.00 69.66  ? 221 ILE A O   1 
ATOM   4889 C  CB  . ILE C 1 224 ? 89.172  17.724  12.810  1.00 57.99  ? 221 ILE A CB  1 
ATOM   4890 C  CG1 . ILE C 1 224 ? 88.757  18.583  11.613  1.00 57.56  ? 221 ILE A CG1 1 
ATOM   4891 C  CG2 . ILE C 1 224 ? 88.668  16.299  12.643  1.00 57.26  ? 221 ILE A CG2 1 
ATOM   4892 C  CD1 . ILE C 1 224 ? 89.135  17.991  10.269  1.00 58.96  ? 221 ILE A CD1 1 
ATOM   4893 N  N   . PHE C 1 225 ? 88.246  16.817  15.975  1.00 65.35  ? 222 PHE A N   1 
ATOM   4894 C  CA  . PHE C 1 225 ? 88.587  16.049  17.169  1.00 64.56  ? 222 PHE A CA  1 
ATOM   4895 C  C   . PHE C 1 225 ? 88.701  14.560  16.848  1.00 67.46  ? 222 PHE A C   1 
ATOM   4896 O  O   . PHE C 1 225 ? 87.791  13.968  16.267  1.00 70.04  ? 222 PHE A O   1 
ATOM   4897 C  CB  . PHE C 1 225 ? 87.553  16.298  18.266  1.00 61.41  ? 222 PHE A CB  1 
ATOM   4898 C  CG  . PHE C 1 225 ? 87.394  17.749  18.626  1.00 61.65  ? 222 PHE A CG  1 
ATOM   4899 C  CD1 . PHE C 1 225 ? 88.021  18.272  19.745  1.00 62.13  ? 222 PHE A CD1 1 
ATOM   4900 C  CD2 . PHE C 1 225 ? 86.627  18.594  17.839  1.00 60.60  ? 222 PHE A CD2 1 
ATOM   4901 C  CE1 . PHE C 1 225 ? 87.879  19.608  20.077  1.00 61.58  ? 222 PHE A CE1 1 
ATOM   4902 C  CE2 . PHE C 1 225 ? 86.484  19.931  18.164  1.00 59.98  ? 222 PHE A CE2 1 
ATOM   4903 C  CZ  . PHE C 1 225 ? 87.110  20.439  19.284  1.00 61.29  ? 222 PHE A CZ  1 
ATOM   4904 N  N   . THR C 1 226 ? 89.825  13.961  17.231  1.00 67.51  ? 223 THR A N   1 
ATOM   4905 C  CA  . THR C 1 226 ? 90.150  12.602  16.801  1.00 67.03  ? 223 THR A CA  1 
ATOM   4906 C  C   . THR C 1 226 ? 90.363  11.626  17.958  1.00 67.10  ? 223 THR A C   1 
ATOM   4907 O  O   . THR C 1 226 ? 90.986  10.577  17.788  1.00 66.08  ? 223 THR A O   1 
ATOM   4908 C  CB  . THR C 1 226 ? 91.400  12.596  15.902  1.00 66.65  ? 223 THR A CB  1 
ATOM   4909 O  OG1 . THR C 1 226 ? 92.445  13.346  16.534  1.00 70.26  ? 223 THR A OG1 1 
ATOM   4910 C  CG2 . THR C 1 226 ? 91.087  13.221  14.548  1.00 63.95  ? 223 THR A CG2 1 
ATOM   4911 N  N   . GLY C 1 227 ? 89.830  11.968  19.127  1.00 68.06  ? 224 GLY A N   1 
ATOM   4912 C  CA  . GLY C 1 227 ? 89.972  11.130  20.315  1.00 68.53  ? 224 GLY A CA  1 
ATOM   4913 C  C   . GLY C 1 227 ? 89.348  9.751   20.198  1.00 68.62  ? 224 GLY A C   1 
ATOM   4914 O  O   . GLY C 1 227 ? 89.678  8.849   20.968  1.00 68.18  ? 224 GLY A O   1 
ATOM   4915 N  N   . HIS C 1 228 ? 88.447  9.583   19.234  1.00 69.53  ? 225 HIS A N   1 
ATOM   4916 C  CA  . HIS C 1 228 ? 87.763  8.305   19.042  1.00 67.89  ? 225 HIS A CA  1 
ATOM   4917 C  C   . HIS C 1 228 ? 88.505  7.385   18.078  1.00 68.13  ? 225 HIS A C   1 
ATOM   4918 O  O   . HIS C 1 228 ? 89.173  7.846   17.151  1.00 68.32  ? 225 HIS A O   1 
ATOM   4919 C  CB  . HIS C 1 228 ? 86.324  8.523   18.567  1.00 62.70  ? 225 HIS A CB  1 
ATOM   4920 C  CG  . HIS C 1 228 ? 85.378  8.895   19.665  1.00 58.64  ? 225 HIS A CG  1 
ATOM   4921 N  ND1 . HIS C 1 228 ? 84.757  10.123  19.731  1.00 55.62  ? 225 HIS A ND1 1 
ATOM   4922 C  CD2 . HIS C 1 228 ? 84.956  8.201   20.749  1.00 58.41  ? 225 HIS A CD2 1 
ATOM   4923 C  CE1 . HIS C 1 228 ? 83.987  10.167  20.804  1.00 53.57  ? 225 HIS A CE1 1 
ATOM   4924 N  NE2 . HIS C 1 228 ? 84.090  9.014   21.439  1.00 55.21  ? 225 HIS A NE2 1 
ATOM   4925 N  N   . SER C 1 229 ? 88.377  6.081   18.306  1.00 66.84  ? 226 SER A N   1 
ATOM   4926 C  CA  . SER C 1 229 ? 89.051  5.085   17.483  1.00 70.44  ? 226 SER A CA  1 
ATOM   4927 C  C   . SER C 1 229 ? 88.088  4.430   16.502  1.00 69.25  ? 226 SER A C   1 
ATOM   4928 O  O   . SER C 1 229 ? 88.511  3.796   15.536  1.00 70.52  ? 226 SER A O   1 
ATOM   4929 C  CB  . SER C 1 229 ? 89.698  4.012   18.363  1.00 73.83  ? 226 SER A CB  1 
ATOM   4930 O  OG  . SER C 1 229 ? 88.715  3.217   19.005  1.00 74.29  ? 226 SER A OG  1 
ATOM   4931 N  N   . ALA C 1 230 ? 86.792  4.577   16.761  1.00 68.97  ? 227 ALA A N   1 
ATOM   4932 C  CA  . ALA C 1 230 ? 85.767  3.983   15.909  1.00 67.13  ? 227 ALA A CA  1 
ATOM   4933 C  C   . ALA C 1 230 ? 84.799  5.041   15.391  1.00 65.47  ? 227 ALA A C   1 
ATOM   4934 O  O   . ALA C 1 230 ? 85.019  6.239   15.579  1.00 65.13  ? 227 ALA A O   1 
ATOM   4935 C  CB  . ALA C 1 230 ? 85.017  2.900   16.664  1.00 62.96  ? 227 ALA A CB  1 
ATOM   4936 N  N   . VAL C 1 231 ? 83.732  4.591   14.736  1.00 62.51  ? 228 VAL A N   1 
ATOM   4937 C  CA  . VAL C 1 231 ? 82.709  5.490   14.212  1.00 58.90  ? 228 VAL A CA  1 
ATOM   4938 C  C   . VAL C 1 231 ? 81.998  6.225   15.343  1.00 57.69  ? 228 VAL A C   1 
ATOM   4939 O  O   . VAL C 1 231 ? 81.344  5.605   16.182  1.00 60.47  ? 228 VAL A O   1 
ATOM   4940 C  CB  . VAL C 1 231 ? 81.662  4.730   13.369  1.00 58.59  ? 228 VAL A CB  1 
ATOM   4941 C  CG1 . VAL C 1 231 ? 80.461  5.616   13.082  1.00 62.77  ? 228 VAL A CG1 1 
ATOM   4942 C  CG2 . VAL C 1 231 ? 82.279  4.224   12.075  1.00 56.45  ? 228 VAL A CG2 1 
ATOM   4943 N  N   . VAL C 1 232 ? 82.137  7.546   15.367  1.00 50.93  ? 229 VAL A N   1 
ATOM   4944 C  CA  . VAL C 1 232 ? 81.467  8.365   16.371  1.00 50.50  ? 229 VAL A CA  1 
ATOM   4945 C  C   . VAL C 1 232 ? 80.004  8.615   15.979  1.00 50.62  ? 229 VAL A C   1 
ATOM   4946 O  O   . VAL C 1 232 ? 79.715  9.229   14.951  1.00 37.98  ? 229 VAL A O   1 
ATOM   4947 C  CB  . VAL C 1 232 ? 82.235  9.686   16.641  1.00 50.54  ? 229 VAL A CB  1 
ATOM   4948 C  CG1 . VAL C 1 232 ? 82.710  10.309  15.340  1.00 53.48  ? 229 VAL A CG1 1 
ATOM   4949 C  CG2 . VAL C 1 232 ? 81.386  10.663  17.449  1.00 46.39  ? 229 VAL A CG2 1 
ATOM   4950 N  N   . GLU C 1 233 ? 79.089  8.119   16.808  1.00 50.09  ? 230 GLU A N   1 
ATOM   4951 C  CA  . GLU C 1 233 ? 77.664  8.122   16.486  1.00 51.54  ? 230 GLU A CA  1 
ATOM   4952 C  C   . GLU C 1 233 ? 76.974  9.471   16.692  1.00 51.99  ? 230 GLU A C   1 
ATOM   4953 O  O   . GLU C 1 233 ? 76.290  9.961   15.793  1.00 56.22  ? 230 GLU A O   1 
ATOM   4954 C  CB  . GLU C 1 233 ? 76.936  7.037   17.283  1.00 51.06  ? 230 GLU A CB  1 
ATOM   4955 C  CG  . GLU C 1 233 ? 77.386  5.618   16.969  1.00 55.93  ? 230 GLU A CG  1 
ATOM   4956 C  CD  . GLU C 1 233 ? 76.776  5.066   15.692  1.00 59.74  ? 230 GLU A CD  1 
ATOM   4957 O  OE1 . GLU C 1 233 ? 76.315  5.863   14.845  1.00 61.57  ? 230 GLU A OE1 1 
ATOM   4958 O  OE2 . GLU C 1 233 ? 76.758  3.827   15.536  1.00 58.07  ? 230 GLU A OE2 1 
ATOM   4959 N  N   . ASP C 1 234 ? 77.147  10.068  17.867  1.00 47.51  ? 231 ASP A N   1 
ATOM   4960 C  CA  . ASP C 1 234 ? 76.448  11.310  18.185  1.00 50.31  ? 231 ASP A CA  1 
ATOM   4961 C  C   . ASP C 1 234 ? 77.325  12.332  18.912  1.00 52.42  ? 231 ASP A C   1 
ATOM   4962 O  O   . ASP C 1 234 ? 78.315  11.978  19.554  1.00 52.80  ? 231 ASP A O   1 
ATOM   4963 C  CB  . ASP C 1 234 ? 75.193  11.010  19.010  1.00 55.06  ? 231 ASP A CB  1 
ATOM   4964 C  CG  . ASP C 1 234 ? 74.195  12.153  18.996  1.00 59.94  ? 231 ASP A CG  1 
ATOM   4965 O  OD1 . ASP C 1 234 ? 73.370  12.232  19.932  1.00 61.62  ? 231 ASP A OD1 1 
ATOM   4966 O  OD2 . ASP C 1 234 ? 74.235  12.972  18.052  1.00 60.98  ? 231 ASP A OD2 1 
ATOM   4967 N  N   . VAL C 1 235 ? 76.943  13.601  18.806  1.00 48.46  ? 232 VAL A N   1 
ATOM   4968 C  CA  . VAL C 1 235 ? 77.661  14.695  19.449  1.00 45.93  ? 232 VAL A CA  1 
ATOM   4969 C  C   . VAL C 1 235 ? 76.663  15.729  19.969  1.00 48.22  ? 232 VAL A C   1 
ATOM   4970 O  O   . VAL C 1 235 ? 75.612  15.942  19.366  1.00 52.45  ? 232 VAL A O   1 
ATOM   4971 C  CB  . VAL C 1 235 ? 78.650  15.364  18.471  1.00 45.37  ? 232 VAL A CB  1 
ATOM   4972 C  CG1 . VAL C 1 235 ? 77.899  16.117  17.372  1.00 33.36  ? 232 VAL A CG1 1 
ATOM   4973 C  CG2 . VAL C 1 235 ? 79.600  16.292  19.216  1.00 39.29  ? 232 VAL A CG2 1 
ATOM   4974 N  N   . ALA C 1 236 ? 76.989  16.369  21.088  1.00 46.42  ? 233 ALA A N   1 
ATOM   4975 C  CA  . ALA C 1 236 ? 76.065  17.305  21.720  1.00 44.90  ? 233 ALA A CA  1 
ATOM   4976 C  C   . ALA C 1 236 ? 76.783  18.350  22.564  1.00 50.87  ? 233 ALA A C   1 
ATOM   4977 O  O   . ALA C 1 236 ? 77.590  18.011  23.431  1.00 58.12  ? 233 ALA A O   1 
ATOM   4978 C  CB  . ALA C 1 236 ? 75.056  16.548  22.574  1.00 36.17  ? 233 ALA A CB  1 
ATOM   4979 N  N   . TRP C 1 237 ? 76.483  19.621  22.309  1.00 47.00  ? 234 TRP A N   1 
ATOM   4980 C  CA  . TRP C 1 237 ? 76.983  20.707  23.141  1.00 50.00  ? 234 TRP A CA  1 
ATOM   4981 C  C   . TRP C 1 237 ? 76.371  20.621  24.534  1.00 55.13  ? 234 TRP A C   1 
ATOM   4982 O  O   . TRP C 1 237 ? 75.268  20.100  24.705  1.00 59.05  ? 234 TRP A O   1 
ATOM   4983 C  CB  . TRP C 1 237 ? 76.616  22.062  22.535  1.00 51.89  ? 234 TRP A CB  1 
ATOM   4984 C  CG  . TRP C 1 237 ? 77.440  22.480  21.358  1.00 53.35  ? 234 TRP A CG  1 
ATOM   4985 C  CD1 . TRP C 1 237 ? 77.055  22.481  20.049  1.00 53.49  ? 234 TRP A CD1 1 
ATOM   4986 C  CD2 . TRP C 1 237 ? 78.781  22.983  21.383  1.00 55.66  ? 234 TRP A CD2 1 
ATOM   4987 N  NE1 . TRP C 1 237 ? 78.075  22.946  19.256  1.00 53.90  ? 234 TRP A NE1 1 
ATOM   4988 C  CE2 . TRP C 1 237 ? 79.146  23.263  20.050  1.00 56.71  ? 234 TRP A CE2 1 
ATOM   4989 C  CE3 . TRP C 1 237 ? 79.711  23.221  22.401  1.00 56.77  ? 234 TRP A CE3 1 
ATOM   4990 C  CZ2 . TRP C 1 237 ? 80.401  23.767  19.708  1.00 54.83  ? 234 TRP A CZ2 1 
ATOM   4991 C  CZ3 . TRP C 1 237 ? 80.956  23.722  22.061  1.00 55.68  ? 234 TRP A CZ3 1 
ATOM   4992 C  CH2 . TRP C 1 237 ? 81.290  23.989  20.725  1.00 55.31  ? 234 TRP A CH2 1 
ATOM   4993 N  N   . HIS C 1 238 ? 77.091  21.134  25.528  1.00 54.55  ? 235 HIS A N   1 
ATOM   4994 C  CA  . HIS C 1 238 ? 76.521  21.348  26.850  1.00 50.19  ? 235 HIS A CA  1 
ATOM   4995 C  C   . HIS C 1 238 ? 75.493  22.462  26.704  1.00 51.38  ? 235 HIS A C   1 
ATOM   4996 O  O   . HIS C 1 238 ? 75.646  23.345  25.859  1.00 52.61  ? 235 HIS A O   1 
ATOM   4997 C  CB  . HIS C 1 238 ? 77.614  21.764  27.837  1.00 53.08  ? 235 HIS A CB  1 
ATOM   4998 C  CG  . HIS C 1 238 ? 77.225  21.621  29.275  1.00 54.86  ? 235 HIS A CG  1 
ATOM   4999 N  ND1 . HIS C 1 238 ? 76.558  22.607  29.969  1.00 53.94  ? 235 HIS A ND1 1 
ATOM   5000 C  CD2 . HIS C 1 238 ? 77.422  20.611  30.155  1.00 53.13  ? 235 HIS A CD2 1 
ATOM   5001 C  CE1 . HIS C 1 238 ? 76.354  22.209  31.212  1.00 53.21  ? 235 HIS A CE1 1 
ATOM   5002 N  NE2 . HIS C 1 238 ? 76.870  21.000  31.351  1.00 51.37  ? 235 HIS A NE2 1 
ATOM   5003 N  N   . LEU C 1 239 ? 74.443  22.427  27.515  1.00 52.33  ? 236 LEU A N   1 
ATOM   5004 C  CA  . LEU C 1 239 ? 73.369  23.407  27.376  1.00 55.26  ? 236 LEU A CA  1 
ATOM   5005 C  C   . LEU C 1 239 ? 73.573  24.663  28.223  1.00 56.19  ? 236 LEU A C   1 
ATOM   5006 O  O   . LEU C 1 239 ? 72.813  25.624  28.101  1.00 55.30  ? 236 LEU A O   1 
ATOM   5007 C  CB  . LEU C 1 239 ? 72.010  22.762  27.666  1.00 52.00  ? 236 LEU A CB  1 
ATOM   5008 C  CG  . LEU C 1 239 ? 71.522  21.812  26.568  1.00 51.84  ? 236 LEU A CG  1 
ATOM   5009 C  CD1 . LEU C 1 239 ? 70.363  20.957  27.046  1.00 54.17  ? 236 LEU A CD1 1 
ATOM   5010 C  CD2 . LEU C 1 239 ? 71.138  22.591  25.319  1.00 51.50  ? 236 LEU A CD2 1 
ATOM   5011 N  N   . LEU C 1 240 ? 74.602  24.660  29.067  1.00 60.93  ? 237 LEU A N   1 
ATOM   5012 C  CA  . LEU C 1 240 ? 74.857  25.791  29.960  1.00 64.15  ? 237 LEU A CA  1 
ATOM   5013 C  C   . LEU C 1 240 ? 76.268  26.371  29.837  1.00 63.77  ? 237 LEU A C   1 
ATOM   5014 O  O   . LEU C 1 240 ? 76.436  27.587  29.769  1.00 63.67  ? 237 LEU A O   1 
ATOM   5015 C  CB  . LEU C 1 240 ? 74.545  25.413  31.411  1.00 67.99  ? 237 LEU A CB  1 
ATOM   5016 C  CG  . LEU C 1 240 ? 73.051  25.359  31.751  1.00 71.55  ? 237 LEU A CG  1 
ATOM   5017 C  CD1 . LEU C 1 240 ? 72.794  24.578  33.033  1.00 71.74  ? 237 LEU A CD1 1 
ATOM   5018 C  CD2 . LEU C 1 240 ? 72.468  26.768  31.844  1.00 78.93  ? 237 LEU A CD2 1 
ATOM   5019 N  N   . HIS C 1 241 ? 77.278  25.506  29.814  1.00 68.38  ? 238 HIS A N   1 
ATOM   5020 C  CA  . HIS C 1 241 ? 78.653  25.952  29.602  1.00 71.73  ? 238 HIS A CA  1 
ATOM   5021 C  C   . HIS C 1 241 ? 78.990  25.891  28.118  1.00 70.83  ? 238 HIS A C   1 
ATOM   5022 O  O   . HIS C 1 241 ? 78.985  24.817  27.518  1.00 77.04  ? 238 HIS A O   1 
ATOM   5023 C  CB  . HIS C 1 241 ? 79.639  25.110  30.417  1.00 77.76  ? 238 HIS A CB  1 
ATOM   5024 C  CG  . HIS C 1 241 ? 79.408  25.168  31.896  1.00 82.78  ? 238 HIS A CG  1 
ATOM   5025 N  ND1 . HIS C 1 241 ? 79.555  26.328  32.628  1.00 83.65  ? 238 HIS A ND1 1 
ATOM   5026 C  CD2 . HIS C 1 241 ? 79.048  24.208  32.781  1.00 84.43  ? 238 HIS A CD2 1 
ATOM   5027 C  CE1 . HIS C 1 241 ? 79.289  26.081  33.898  1.00 84.11  ? 238 HIS A CE1 1 
ATOM   5028 N  NE2 . HIS C 1 241 ? 78.980  24.802  34.018  1.00 84.69  ? 238 HIS A NE2 1 
ATOM   5029 N  N   . GLU C 1 242 ? 79.286  27.048  27.534  1.00 67.90  ? 239 GLU A N   1 
ATOM   5030 C  CA  . GLU C 1 242 ? 79.443  27.173  26.084  1.00 68.15  ? 239 GLU A CA  1 
ATOM   5031 C  C   . GLU C 1 242 ? 80.651  26.440  25.489  1.00 65.46  ? 239 GLU A C   1 
ATOM   5032 O  O   . GLU C 1 242 ? 80.712  26.223  24.279  1.00 63.39  ? 239 GLU A O   1 
ATOM   5033 C  CB  . GLU C 1 242 ? 79.459  28.649  25.673  1.00 75.56  ? 239 GLU A CB  1 
ATOM   5034 C  CG  . GLU C 1 242 ? 80.436  29.516  26.453  1.00 80.82  ? 239 GLU A CG  1 
ATOM   5035 C  CD  . GLU C 1 242 ? 80.139  30.999  26.308  1.00 84.92  ? 239 GLU A CD  1 
ATOM   5036 O  OE1 . GLU C 1 242 ? 81.095  31.786  26.141  1.00 86.52  ? 239 GLU A OE1 1 
ATOM   5037 O  OE2 . GLU C 1 242 ? 78.948  31.377  26.357  1.00 84.90  ? 239 GLU A OE2 1 
ATOM   5038 N  N   . SER C 1 243 ? 81.603  26.058  26.334  1.00 65.61  ? 240 SER A N   1 
ATOM   5039 C  CA  . SER C 1 243 ? 82.830  25.429  25.853  1.00 65.25  ? 240 SER A CA  1 
ATOM   5040 C  C   . SER C 1 243 ? 82.761  23.904  25.874  1.00 65.40  ? 240 SER A C   1 
ATOM   5041 O  O   . SER C 1 243 ? 83.505  23.232  25.160  1.00 66.53  ? 240 SER A O   1 
ATOM   5042 C  CB  . SER C 1 243 ? 84.030  25.905  26.672  1.00 67.67  ? 240 SER A CB  1 
ATOM   5043 O  OG  . SER C 1 243 ? 84.153  27.316  26.629  1.00 71.28  ? 240 SER A OG  1 
ATOM   5044 N  N   . LEU C 1 244 ? 81.866  23.364  26.693  1.00 64.82  ? 241 LEU A N   1 
ATOM   5045 C  CA  . LEU C 1 244 ? 81.779  21.920  26.882  1.00 63.67  ? 241 LEU A CA  1 
ATOM   5046 C  C   . LEU C 1 244 ? 80.918  21.226  25.832  1.00 60.14  ? 241 LEU A C   1 
ATOM   5047 O  O   . LEU C 1 244 ? 79.902  21.763  25.390  1.00 59.11  ? 241 LEU A O   1 
ATOM   5048 C  CB  . LEU C 1 244 ? 81.240  21.597  28.279  1.00 66.82  ? 241 LEU A CB  1 
ATOM   5049 C  CG  . LEU C 1 244 ? 82.181  21.816  29.463  1.00 69.88  ? 241 LEU A CG  1 
ATOM   5050 C  CD1 . LEU C 1 244 ? 81.416  21.706  30.771  1.00 73.05  ? 241 LEU A CD1 1 
ATOM   5051 C  CD2 . LEU C 1 244 ? 83.337  20.828  29.426  1.00 69.99  ? 241 LEU A CD2 1 
ATOM   5052 N  N   . PHE C 1 245 ? 81.340  20.027  25.440  1.00 54.33  ? 242 PHE A N   1 
ATOM   5053 C  CA  . PHE C 1 245 ? 80.525  19.165  24.592  1.00 51.32  ? 242 PHE A CA  1 
ATOM   5054 C  C   . PHE C 1 245 ? 80.924  17.698  24.726  1.00 53.49  ? 242 PHE A C   1 
ATOM   5055 O  O   . PHE C 1 245 ? 82.088  17.380  24.967  1.00 60.53  ? 242 PHE A O   1 
ATOM   5056 C  CB  . PHE C 1 245 ? 80.551  19.624  23.127  1.00 50.55  ? 242 PHE A CB  1 
ATOM   5057 C  CG  . PHE C 1 245 ? 81.793  19.231  22.371  1.00 45.91  ? 242 PHE A CG  1 
ATOM   5058 C  CD1 . PHE C 1 245 ? 82.828  20.136  22.196  1.00 46.38  ? 242 PHE A CD1 1 
ATOM   5059 C  CD2 . PHE C 1 245 ? 81.905  17.972  21.795  1.00 46.49  ? 242 PHE A CD2 1 
ATOM   5060 C  CE1 . PHE C 1 245 ? 83.963  19.788  21.482  1.00 46.15  ? 242 PHE A CE1 1 
ATOM   5061 C  CE2 . PHE C 1 245 ? 83.036  17.615  21.081  1.00 44.74  ? 242 PHE A CE2 1 
ATOM   5062 C  CZ  . PHE C 1 245 ? 84.067  18.525  20.923  1.00 47.36  ? 242 PHE A CZ  1 
ATOM   5063 N  N   . GLY C 1 246 ? 79.946  16.812  24.577  1.00 50.81  ? 243 GLY A N   1 
ATOM   5064 C  CA  . GLY C 1 246 ? 80.190  15.382  24.688  1.00 49.75  ? 243 GLY A CA  1 
ATOM   5065 C  C   . GLY C 1 246 ? 80.058  14.669  23.358  1.00 54.11  ? 243 GLY A C   1 
ATOM   5066 O  O   . GLY C 1 246 ? 79.260  15.064  22.508  1.00 57.37  ? 243 GLY A O   1 
ATOM   5067 N  N   . SER C 1 247 ? 80.848  13.615  23.179  1.00 53.81  ? 244 SER A N   1 
ATOM   5068 C  CA  . SER C 1 247 ? 80.787  12.800  21.974  1.00 50.05  ? 244 SER A CA  1 
ATOM   5069 C  C   . SER C 1 247 ? 80.625  11.333  22.342  1.00 49.40  ? 244 SER A C   1 
ATOM   5070 O  O   . SER C 1 247 ? 80.947  10.921  23.454  1.00 52.27  ? 244 SER A O   1 
ATOM   5071 C  CB  . SER C 1 247 ? 82.041  12.998  21.125  1.00 52.98  ? 244 SER A CB  1 
ATOM   5072 O  OG  . SER C 1 247 ? 83.204  12.671  21.863  1.00 60.43  ? 244 SER A OG  1 
ATOM   5073 N  N   . VAL C 1 248 ? 80.131  10.546  21.394  1.00 50.71  ? 245 VAL A N   1 
ATOM   5074 C  CA  . VAL C 1 248 ? 79.779  9.158   21.647  1.00 48.01  ? 245 VAL A CA  1 
ATOM   5075 C  C   . VAL C 1 248 ? 80.054  8.316   20.403  1.00 51.53  ? 245 VAL A C   1 
ATOM   5076 O  O   . VAL C 1 248 ? 79.703  8.716   19.292  1.00 48.59  ? 245 VAL A O   1 
ATOM   5077 C  CB  . VAL C 1 248 ? 78.299  9.056   22.065  1.00 51.16  ? 245 VAL A CB  1 
ATOM   5078 C  CG1 . VAL C 1 248 ? 77.622  7.879   21.398  1.00 58.37  ? 245 VAL A CG1 1 
ATOM   5079 C  CG2 . VAL C 1 248 ? 78.176  8.991   23.580  1.00 54.79  ? 245 VAL A CG2 1 
ATOM   5080 N  N   . ALA C 1 249 ? 80.688  7.157   20.587  1.00 54.51  ? 246 ALA A N   1 
ATOM   5081 C  CA  . ALA C 1 249 ? 81.162  6.363   19.448  1.00 57.89  ? 246 ALA A CA  1 
ATOM   5082 C  C   . ALA C 1 249 ? 81.005  4.851   19.599  1.00 59.76  ? 246 ALA A C   1 
ATOM   5083 O  O   . ALA C 1 249 ? 80.546  4.355   20.630  1.00 62.87  ? 246 ALA A O   1 
ATOM   5084 C  CB  . ALA C 1 249 ? 82.610  6.707   19.139  1.00 58.14  ? 246 ALA A CB  1 
ATOM   5085 N  N   . ASP C 1 250 ? 81.405  4.128   18.555  1.00 58.76  ? 247 ASP A N   1 
ATOM   5086 C  CA  . ASP C 1 250 ? 81.302  2.671   18.518  1.00 60.64  ? 247 ASP A CA  1 
ATOM   5087 C  C   . ASP C 1 250 ? 82.354  1.977   19.377  1.00 62.63  ? 247 ASP A C   1 
ATOM   5088 O  O   . ASP C 1 250 ? 82.288  0.765   19.588  1.00 62.70  ? 247 ASP A O   1 
ATOM   5089 C  CB  . ASP C 1 250 ? 81.394  2.159   17.078  1.00 59.70  ? 247 ASP A CB  1 
ATOM   5090 C  CG  . ASP C 1 250 ? 80.077  2.257   16.338  1.00 62.04  ? 247 ASP A CG  1 
ATOM   5091 O  OD1 . ASP C 1 250 ? 79.128  2.850   16.890  1.00 65.97  ? 247 ASP A OD1 1 
ATOM   5092 O  OD2 . ASP C 1 250 ? 79.988  1.739   15.206  1.00 61.46  ? 247 ASP A OD2 1 
ATOM   5093 N  N   . ASP C 1 251 ? 83.323  2.744   19.868  1.00 61.68  ? 248 ASP A N   1 
ATOM   5094 C  CA  . ASP C 1 251 ? 84.364  2.193   20.728  1.00 62.72  ? 248 ASP A CA  1 
ATOM   5095 C  C   . ASP C 1 251 ? 83.856  1.993   22.155  1.00 65.23  ? 248 ASP A C   1 
ATOM   5096 O  O   . ASP C 1 251 ? 84.604  1.564   23.034  1.00 69.23  ? 248 ASP A O   1 
ATOM   5097 C  CB  . ASP C 1 251 ? 85.614  3.079   20.711  1.00 61.82  ? 248 ASP A CB  1 
ATOM   5098 C  CG  . ASP C 1 251 ? 85.304  4.538   20.989  1.00 60.90  ? 248 ASP A CG  1 
ATOM   5099 O  OD1 . ASP C 1 251 ? 84.240  4.827   21.575  1.00 61.08  ? 248 ASP A OD1 1 
ATOM   5100 O  OD2 . ASP C 1 251 ? 86.133  5.398   20.623  1.00 59.86  ? 248 ASP A OD2 1 
ATOM   5101 N  N   . GLN C 1 252 ? 82.580  2.307   22.368  1.00 66.95  ? 249 GLN A N   1 
ATOM   5102 C  CA  . GLN C 1 252 ? 81.900  2.087   23.648  1.00 64.25  ? 249 GLN A CA  1 
ATOM   5103 C  C   . GLN C 1 252 ? 82.202  3.173   24.677  1.00 60.83  ? 249 GLN A C   1 
ATOM   5104 O  O   . GLN C 1 252 ? 81.863  3.034   25.852  1.00 62.92  ? 249 GLN A O   1 
ATOM   5105 C  CB  . GLN C 1 252 ? 82.238  0.705   24.221  1.00 63.15  ? 249 GLN A CB  1 
ATOM   5106 C  CG  . GLN C 1 252 ? 81.954  -0.451  23.270  1.00 68.25  ? 249 GLN A CG  1 
ATOM   5107 C  CD  . GLN C 1 252 ? 82.173  -1.809  23.908  1.00 67.52  ? 249 GLN A CD  1 
ATOM   5108 O  OE1 . GLN C 1 252 ? 82.240  -2.826  23.218  1.00 72.22  ? 249 GLN A OE1 1 
ATOM   5109 N  NE2 . GLN C 1 252 ? 82.281  -1.834  25.231  1.00 66.96  ? 249 GLN A NE2 1 
ATOM   5110 N  N   . LYS C 1 253 ? 82.825  4.258   24.228  1.00 61.92  ? 250 LYS A N   1 
ATOM   5111 C  CA  . LYS C 1 253 ? 83.255  5.319   25.134  1.00 65.92  ? 250 LYS A CA  1 
ATOM   5112 C  C   . LYS C 1 253 ? 82.453  6.608   24.989  1.00 65.60  ? 250 LYS A C   1 
ATOM   5113 O  O   . LYS C 1 253 ? 82.121  7.028   23.880  1.00 66.51  ? 250 LYS A O   1 
ATOM   5114 C  CB  . LYS C 1 253 ? 84.748  5.622   24.948  1.00 69.25  ? 250 LYS A CB  1 
ATOM   5115 C  CG  . LYS C 1 253 ? 85.687  4.678   25.691  1.00 76.78  ? 250 LYS A CG  1 
ATOM   5116 C  CD  . LYS C 1 253 ? 85.859  3.356   24.957  1.00 78.99  ? 250 LYS A CD  1 
ATOM   5117 C  CE  . LYS C 1 253 ? 86.545  2.315   25.830  1.00 81.37  ? 250 LYS A CE  1 
ATOM   5118 N  NZ  . LYS C 1 253 ? 87.916  2.733   26.233  1.00 82.46  ? 250 LYS A NZ  1 
ATOM   5119 N  N   . LEU C 1 254 ? 82.144  7.226   26.124  1.00 64.05  ? 251 LEU A N   1 
ATOM   5120 C  CA  . LEU C 1 254 ? 81.596  8.575   26.149  1.00 62.00  ? 251 LEU A CA  1 
ATOM   5121 C  C   . LEU C 1 254 ? 82.722  9.539   26.487  1.00 62.02  ? 251 LEU A C   1 
ATOM   5122 O  O   . LEU C 1 254 ? 83.407  9.373   27.495  1.00 63.93  ? 251 LEU A O   1 
ATOM   5123 C  CB  . LEU C 1 254 ? 80.474  8.694   27.185  1.00 62.46  ? 251 LEU A CB  1 
ATOM   5124 C  CG  . LEU C 1 254 ? 80.063  10.108  27.621  1.00 59.57  ? 251 LEU A CG  1 
ATOM   5125 C  CD1 . LEU C 1 254 ? 79.500  10.915  26.461  1.00 57.52  ? 251 LEU A CD1 1 
ATOM   5126 C  CD2 . LEU C 1 254 ? 79.061  10.054  28.764  1.00 61.56  ? 251 LEU A CD2 1 
HETATM 5127 N  N   . MSE C 1 255 ? 82.916  10.533  25.646  1.00 63.30  ? 252 MSE A N   1 
HETATM 5128 C  CA  . MSE C 1 255 ? 83.972  11.512  25.864  1.00 65.29  ? 252 MSE A CA  1 
HETATM 5129 C  C   . MSE C 1 255 ? 83.413  12.915  26.046  1.00 62.74  ? 252 MSE A C   1 
HETATM 5130 O  O   . MSE C 1 255 ? 82.389  13.268  25.467  1.00 68.49  ? 252 MSE A O   1 
HETATM 5131 C  CB  . MSE C 1 255 ? 84.977  11.485  24.713  1.00 66.76  ? 252 MSE A CB  1 
HETATM 5132 C  CG  . MSE C 1 255 ? 85.688  10.154  24.566  1.00 70.21  ? 252 MSE A CG  1 
HETATM 5133 SE SE  . MSE C 1 255 ? 87.038  10.152  23.166  1.00 76.92  ? 252 MSE A SE  1 
HETATM 5134 C  CE  . MSE C 1 255 ? 87.529  8.267   23.254  1.00 69.72  ? 252 MSE A CE  1 
ATOM   5135 N  N   . ILE C 1 256 ? 84.091  13.700  26.855  1.00 60.24  ? 253 ILE A N   1 
ATOM   5136 C  CA  . ILE C 1 256 ? 83.688  15.072  27.131  1.00 55.91  ? 253 ILE A CA  1 
ATOM   5137 C  C   . ILE C 1 256 ? 84.826  16.010  26.754  1.00 56.35  ? 253 ILE A C   1 
ATOM   5138 O  O   . ILE C 1 256 ? 85.970  15.795  27.147  1.00 61.63  ? 253 ILE A O   1 
ATOM   5139 C  CB  . ILE C 1 256 ? 83.326  15.251  28.612  1.00 50.49  ? 253 ILE A CB  1 
ATOM   5140 C  CG1 . ILE C 1 256 ? 82.058  14.458  28.937  1.00 50.89  ? 253 ILE A CG1 1 
ATOM   5141 C  CG2 . ILE C 1 256 ? 83.146  16.723  28.950  1.00 45.61  ? 253 ILE A CG2 1 
ATOM   5142 C  CD1 . ILE C 1 256 ? 81.973  14.010  30.374  1.00 57.62  ? 253 ILE A CD1 1 
ATOM   5143 N  N   . TRP C 1 257 ? 84.511  17.049  25.990  1.00 56.69  ? 254 TRP A N   1 
ATOM   5144 C  CA  . TRP C 1 257 ? 85.546  17.893  25.413  1.00 61.56  ? 254 TRP A CA  1 
ATOM   5145 C  C   . TRP C 1 257 ? 85.465  19.344  25.867  1.00 66.14  ? 254 TRP A C   1 
ATOM   5146 O  O   . TRP C 1 257 ? 84.452  19.789  26.405  1.00 68.03  ? 254 TRP A O   1 
ATOM   5147 C  CB  . TRP C 1 257 ? 85.495  17.822  23.887  1.00 61.44  ? 254 TRP A CB  1 
ATOM   5148 C  CG  . TRP C 1 257 ? 85.610  16.432  23.341  1.00 62.09  ? 254 TRP A CG  1 
ATOM   5149 C  CD1 . TRP C 1 257 ? 84.624  15.489  23.282  1.00 61.87  ? 254 TRP A CD1 1 
ATOM   5150 C  CD2 . TRP C 1 257 ? 86.775  15.828  22.769  1.00 64.25  ? 254 TRP A CD2 1 
ATOM   5151 N  NE1 . TRP C 1 257 ? 85.104  14.336  22.713  1.00 62.24  ? 254 TRP A NE1 1 
ATOM   5152 C  CE2 . TRP C 1 257 ? 86.423  14.518  22.388  1.00 65.06  ? 254 TRP A CE2 1 
ATOM   5153 C  CE3 . TRP C 1 257 ? 88.084  16.267  22.544  1.00 63.97  ? 254 TRP A CE3 1 
ATOM   5154 C  CZ2 . TRP C 1 257 ? 87.330  13.643  21.794  1.00 64.26  ? 254 TRP A CZ2 1 
ATOM   5155 C  CZ3 . TRP C 1 257 ? 88.983  15.398  21.953  1.00 62.66  ? 254 TRP A CZ3 1 
ATOM   5156 C  CH2 . TRP C 1 257 ? 88.603  14.101  21.586  1.00 62.81  ? 254 TRP A CH2 1 
ATOM   5157 N  N   . ASP C 1 258 ? 86.553  20.072  25.639  1.00 71.04  ? 255 ASP A N   1 
ATOM   5158 C  CA  . ASP C 1 258 ? 86.641  21.481  25.981  1.00 72.42  ? 255 ASP A CA  1 
ATOM   5159 C  C   . ASP C 1 258 ? 87.293  22.216  24.815  1.00 73.04  ? 255 ASP A C   1 
ATOM   5160 O  O   . ASP C 1 258 ? 88.388  21.854  24.379  1.00 73.64  ? 255 ASP A O   1 
ATOM   5161 C  CB  . ASP C 1 258 ? 87.461  21.662  27.260  1.00 74.01  ? 255 ASP A CB  1 
ATOM   5162 C  CG  . ASP C 1 258 ? 87.152  22.960  27.975  1.00 78.76  ? 255 ASP A CG  1 
ATOM   5163 O  OD1 . ASP C 1 258 ? 86.829  23.957  27.296  1.00 82.98  ? 255 ASP A OD1 1 
ATOM   5164 O  OD2 . ASP C 1 258 ? 87.232  22.982  29.221  1.00 78.71  ? 255 ASP A OD2 1 
ATOM   5165 N  N   . THR C 1 259 ? 86.615  23.238  24.304  1.00 71.94  ? 256 THR A N   1 
ATOM   5166 C  CA  . THR C 1 259 ? 87.070  23.932  23.100  1.00 73.62  ? 256 THR A CA  1 
ATOM   5167 C  C   . THR C 1 259 ? 88.257  24.860  23.346  1.00 78.46  ? 256 THR A C   1 
ATOM   5168 O  O   . THR C 1 259 ? 89.047  25.117  22.436  1.00 75.73  ? 256 THR A O   1 
ATOM   5169 C  CB  . THR C 1 259 ? 85.924  24.714  22.422  1.00 67.85  ? 256 THR A CB  1 
ATOM   5170 O  OG1 . THR C 1 259 ? 85.134  25.368  23.421  1.00 67.58  ? 256 THR A OG1 1 
ATOM   5171 C  CG2 . THR C 1 259 ? 85.036  23.771  21.628  1.00 66.42  ? 256 THR A CG2 1 
ATOM   5172 N  N   . ARG C 1 260 ? 88.382  25.360  24.572  1.00 83.12  ? 257 ARG A N   1 
ATOM   5173 C  CA  . ARG C 1 260 ? 89.475  26.272  24.907  1.00 86.28  ? 257 ARG A CA  1 
ATOM   5174 C  C   . ARG C 1 260 ? 90.754  25.531  25.297  1.00 87.11  ? 257 ARG A C   1 
ATOM   5175 O  O   . ARG C 1 260 ? 91.823  26.133  25.406  1.00 89.18  ? 257 ARG A O   1 
ATOM   5176 C  CB  . ARG C 1 260 ? 89.049  27.276  25.985  1.00 84.91  ? 257 ARG A CB  1 
ATOM   5177 C  CG  . ARG C 1 260 ? 88.547  26.667  27.285  1.00 81.68  ? 257 ARG A CG  1 
ATOM   5178 C  CD  . ARG C 1 260 ? 87.513  27.582  27.928  1.00 78.37  ? 257 ARG A CD  1 
ATOM   5179 N  NE  . ARG C 1 260 ? 87.419  27.411  29.374  1.00 77.17  ? 257 ARG A NE  1 
ATOM   5180 C  CZ  . ARG C 1 260 ? 86.658  26.504  29.980  1.00 77.85  ? 257 ARG A CZ  1 
ATOM   5181 N  NH1 . ARG C 1 260 ? 85.920  25.665  29.268  1.00 78.86  ? 257 ARG A NH1 1 
ATOM   5182 N  NH2 . ARG C 1 260 ? 86.640  26.433  31.305  1.00 79.18  ? 257 ARG A NH2 1 
ATOM   5183 N  N   . SER C 1 261 ? 90.636  24.222  25.502  1.00 87.18  ? 258 SER A N   1 
ATOM   5184 C  CA  . SER C 1 261 ? 91.800  23.365  25.682  1.00 88.69  ? 258 SER A CA  1 
ATOM   5185 C  C   . SER C 1 261 ? 92.479  23.169  24.331  1.00 91.78  ? 258 SER A C   1 
ATOM   5186 O  O   . SER C 1 261 ? 91.817  22.864  23.338  1.00 93.52  ? 258 SER A O   1 
ATOM   5187 C  CB  . SER C 1 261 ? 91.386  22.014  26.269  1.00 87.33  ? 258 SER A CB  1 
ATOM   5188 O  OG  . SER C 1 261 ? 92.443  21.073  26.195  1.00 86.16  ? 258 SER A OG  1 
ATOM   5189 N  N   . ASN C 1 262 ? 93.796  23.345  24.292  1.00 94.07  ? 259 ASN A N   1 
ATOM   5190 C  CA  . ASN C 1 262 ? 94.535  23.291  23.030  1.00 98.54  ? 259 ASN A CA  1 
ATOM   5191 C  C   . ASN C 1 262 ? 94.972  21.895  22.584  1.00 98.09  ? 259 ASN A C   1 
ATOM   5192 O  O   . ASN C 1 262 ? 96.068  21.723  22.049  1.00 98.46  ? 259 ASN A O   1 
ATOM   5193 C  CB  . ASN C 1 262 ? 95.737  24.240  23.063  1.00 101.63 ? 259 ASN A CB  1 
ATOM   5194 C  CG  . ASN C 1 262 ? 95.442  25.578  22.409  1.00 104.12 ? 259 ASN A CG  1 
ATOM   5195 O  OD1 . ASN C 1 262 ? 94.803  25.641  21.358  1.00 105.39 ? 259 ASN A OD1 1 
ATOM   5196 N  ND2 . ASN C 1 262 ? 95.916  26.656  23.025  1.00 105.41 ? 259 ASN A ND2 1 
ATOM   5197 N  N   . THR C 1 263 ? 94.111  20.904  22.797  1.00 95.38  ? 260 THR A N   1 
ATOM   5198 C  CA  . THR C 1 263 ? 94.365  19.560  22.288  1.00 94.07  ? 260 THR A CA  1 
ATOM   5199 C  C   . THR C 1 263 ? 93.115  18.975  21.635  1.00 91.25  ? 260 THR A C   1 
ATOM   5200 O  O   . THR C 1 263 ? 92.022  19.025  22.202  1.00 92.24  ? 260 THR A O   1 
ATOM   5201 C  CB  . THR C 1 263 ? 94.904  18.612  23.381  1.00 95.02  ? 260 THR A CB  1 
ATOM   5202 O  OG1 . THR C 1 263 ? 95.309  17.371  22.787  1.00 96.09  ? 260 THR A OG1 1 
ATOM   5203 C  CG2 . THR C 1 263 ? 93.860  18.348  24.456  1.00 94.96  ? 260 THR A CG2 1 
ATOM   5204 N  N   . THR C 1 264 ? 93.282  18.431  20.435  1.00 87.73  ? 261 THR A N   1 
ATOM   5205 C  CA  . THR C 1 264 ? 92.157  17.900  19.672  1.00 84.82  ? 261 THR A CA  1 
ATOM   5206 C  C   . THR C 1 264 ? 92.267  16.389  19.484  1.00 85.64  ? 261 THR A C   1 
ATOM   5207 O  O   . THR C 1 264 ? 91.753  15.835  18.511  1.00 87.69  ? 261 THR A O   1 
ATOM   5208 C  CB  . THR C 1 264 ? 92.042  18.582  18.293  1.00 81.97  ? 261 THR A CB  1 
ATOM   5209 O  OG1 . THR C 1 264 ? 93.232  18.335  17.534  1.00 77.73  ? 261 THR A OG1 1 
ATOM   5210 C  CG2 . THR C 1 264 ? 91.850  20.085  18.452  1.00 81.00  ? 261 THR A CG2 1 
ATOM   5211 N  N   . SER C 1 265 ? 92.937  15.726  20.422  1.00 84.64  ? 262 SER A N   1 
ATOM   5212 C  CA  . SER C 1 265 ? 93.129  14.282  20.348  1.00 84.33  ? 262 SER A CA  1 
ATOM   5213 C  C   . SER C 1 265 ? 92.916  13.607  21.701  1.00 81.06  ? 262 SER A C   1 
ATOM   5214 O  O   . SER C 1 265 ? 92.879  12.380  21.792  1.00 78.79  ? 262 SER A O   1 
ATOM   5215 C  CB  . SER C 1 265 ? 94.522  13.953  19.806  1.00 85.75  ? 262 SER A CB  1 
ATOM   5216 O  OG  . SER C 1 265 ? 95.533  14.533  20.612  1.00 87.03  ? 262 SER A OG  1 
ATOM   5217 N  N   . LYS C 1 266 ? 92.779  14.413  22.749  1.00 80.88  ? 263 LYS A N   1 
ATOM   5218 C  CA  . LYS C 1 266 ? 92.510  13.892  24.087  1.00 85.37  ? 263 LYS A CA  1 
ATOM   5219 C  C   . LYS C 1 266 ? 91.471  14.729  24.826  1.00 82.46  ? 263 LYS A C   1 
ATOM   5220 O  O   . LYS C 1 266 ? 91.690  15.911  25.091  1.00 80.00  ? 263 LYS A O   1 
ATOM   5221 C  CB  . LYS C 1 266 ? 93.798  13.789  24.910  1.00 90.29  ? 263 LYS A CB  1 
ATOM   5222 C  CG  . LYS C 1 266 ? 94.558  12.486  24.708  1.00 93.51  ? 263 LYS A CG  1 
ATOM   5223 C  CD  . LYS C 1 266 ? 95.730  12.368  25.671  1.00 96.50  ? 263 LYS A CD  1 
ATOM   5224 C  CE  . LYS C 1 266 ? 96.291  10.953  25.689  1.00 95.27  ? 263 LYS A CE  1 
ATOM   5225 N  NZ  . LYS C 1 266 ? 96.717  10.504  24.334  1.00 95.70  ? 263 LYS A NZ  1 
ATOM   5226 N  N   . PRO C 1 267 ? 90.331  14.108  25.162  1.00 81.50  ? 264 PRO A N   1 
ATOM   5227 C  CA  . PRO C 1 267 ? 89.236  14.786  25.843  1.00 82.81  ? 264 PRO A CA  1 
ATOM   5228 C  C   . PRO C 1 267 ? 89.554  15.034  27.313  1.00 82.74  ? 264 PRO A C   1 
ATOM   5229 O  O   . PRO C 1 267 ? 90.450  14.398  27.868  1.00 80.92  ? 264 PRO A O   1 
ATOM   5230 C  CB  . PRO C 1 267 ? 88.086  13.786  25.717  1.00 84.35  ? 264 PRO A CB  1 
ATOM   5231 C  CG  . PRO C 1 267 ? 88.757  12.459  25.660  1.00 81.64  ? 264 PRO A CG  1 
ATOM   5232 C  CD  . PRO C 1 267 ? 90.032  12.688  24.904  1.00 80.78  ? 264 PRO A CD  1 
ATOM   5233 N  N   . SER C 1 268 ? 88.823  15.956  27.932  1.00 82.70  ? 265 SER A N   1 
ATOM   5234 C  CA  . SER C 1 268 ? 88.987  16.232  29.352  1.00 82.25  ? 265 SER A CA  1 
ATOM   5235 C  C   . SER C 1 268 ? 88.604  15.013  30.183  1.00 83.68  ? 265 SER A C   1 
ATOM   5236 O  O   . SER C 1 268 ? 89.198  14.753  31.229  1.00 88.27  ? 265 SER A O   1 
ATOM   5237 C  CB  . SER C 1 268 ? 88.141  17.437  29.769  1.00 81.59  ? 265 SER A CB  1 
ATOM   5238 O  OG  . SER C 1 268 ? 88.607  18.626  29.156  1.00 84.87  ? 265 SER A OG  1 
ATOM   5239 N  N   . HIS C 1 269 ? 87.608  14.270  29.711  1.00 82.25  ? 266 HIS A N   1 
ATOM   5240 C  CA  . HIS C 1 269 ? 87.122  13.093  30.420  1.00 82.90  ? 266 HIS A CA  1 
ATOM   5241 C  C   . HIS C 1 269 ? 86.883  11.941  29.447  1.00 81.69  ? 266 HIS A C   1 
ATOM   5242 O  O   . HIS C 1 269 ? 86.575  12.161  28.277  1.00 82.54  ? 266 HIS A O   1 
ATOM   5243 C  CB  . HIS C 1 269 ? 85.832  13.425  31.176  1.00 86.64  ? 266 HIS A CB  1 
ATOM   5244 C  CG  . HIS C 1 269 ? 86.017  14.400  32.299  1.00 90.09  ? 266 HIS A CG  1 
ATOM   5245 N  ND1 . HIS C 1 269 ? 86.957  15.408  32.266  1.00 92.28  ? 266 HIS A ND1 1 
ATOM   5246 C  CD2 . HIS C 1 269 ? 85.365  14.534  33.479  1.00 91.98  ? 266 HIS A CD2 1 
ATOM   5247 C  CE1 . HIS C 1 269 ? 86.887  16.111  33.382  1.00 92.64  ? 266 HIS A CE1 1 
ATOM   5248 N  NE2 . HIS C 1 269 ? 85.928  15.603  34.134  1.00 93.63  ? 266 HIS A NE2 1 
ATOM   5249 N  N   . LEU C 1 270 ? 87.031  10.715  29.937  1.00 79.73  ? 267 LEU A N   1 
ATOM   5250 C  CA  . LEU C 1 270 ? 86.823  9.523   29.121  1.00 78.26  ? 267 LEU A CA  1 
ATOM   5251 C  C   . LEU C 1 270 ? 86.081  8.470   29.936  1.00 78.24  ? 267 LEU A C   1 
ATOM   5252 O  O   . LEU C 1 270 ? 86.420  8.220   31.091  1.00 83.24  ? 267 LEU A O   1 
ATOM   5253 C  CB  . LEU C 1 270 ? 88.165  8.977   28.621  1.00 78.18  ? 267 LEU A CB  1 
ATOM   5254 C  CG  . LEU C 1 270 ? 88.168  7.806   27.630  1.00 81.88  ? 267 LEU A CG  1 
ATOM   5255 C  CD1 . LEU C 1 270 ? 89.440  7.821   26.793  1.00 80.34  ? 267 LEU A CD1 1 
ATOM   5256 C  CD2 . LEU C 1 270 ? 88.007  6.466   28.341  1.00 81.93  ? 267 LEU A CD2 1 
ATOM   5257 N  N   . VAL C 1 271 ? 85.062  7.859   29.338  1.00 75.73  ? 268 VAL A N   1 
ATOM   5258 C  CA  . VAL C 1 271 ? 84.227  6.906   30.062  1.00 73.29  ? 268 VAL A CA  1 
ATOM   5259 C  C   . VAL C 1 271 ? 83.934  5.652   29.249  1.00 72.43  ? 268 VAL A C   1 
ATOM   5260 O  O   . VAL C 1 271 ? 83.406  5.731   28.143  1.00 74.28  ? 268 VAL A O   1 
ATOM   5261 C  CB  . VAL C 1 271 ? 82.872  7.530   30.459  1.00 74.84  ? 268 VAL A CB  1 
ATOM   5262 C  CG1 . VAL C 1 271 ? 82.204  6.700   31.545  1.00 74.08  ? 268 VAL A CG1 1 
ATOM   5263 C  CG2 . VAL C 1 271 ? 83.053  8.966   30.916  1.00 75.18  ? 268 VAL A CG2 1 
ATOM   5264 N  N   . ASP C 1 272 ? 84.274  4.493   29.803  1.00 74.29  ? 269 ASP A N   1 
ATOM   5265 C  CA  . ASP C 1 272 ? 83.832  3.232   29.230  1.00 76.43  ? 269 ASP A CA  1 
ATOM   5266 C  C   . ASP C 1 272 ? 82.361  3.071   29.598  1.00 74.26  ? 269 ASP A C   1 
ATOM   5267 O  O   . ASP C 1 272 ? 82.021  2.429   30.593  1.00 70.67  ? 269 ASP A O   1 
ATOM   5268 C  CB  . ASP C 1 272 ? 84.663  2.068   29.772  1.00 83.80  ? 269 ASP A CB  1 
ATOM   5269 C  CG  . ASP C 1 272 ? 84.541  0.815   28.922  1.00 91.26  ? 269 ASP A CG  1 
ATOM   5270 O  OD1 . ASP C 1 272 ? 83.653  0.767   28.043  1.00 93.16  ? 269 ASP A OD1 1 
ATOM   5271 O  OD2 . ASP C 1 272 ? 85.337  -0.125  29.132  1.00 94.41  ? 269 ASP A OD2 1 
ATOM   5272 N  N   . ALA C 1 273 ? 81.497  3.671   28.785  1.00 71.58  ? 270 ALA A N   1 
ATOM   5273 C  CA  . ALA C 1 273 ? 80.088  3.847   29.129  1.00 65.05  ? 270 ALA A CA  1 
ATOM   5274 C  C   . ALA C 1 273 ? 79.247  2.583   29.004  1.00 61.88  ? 270 ALA A C   1 
ATOM   5275 O  O   . ALA C 1 273 ? 78.371  2.334   29.832  1.00 58.16  ? 270 ALA A O   1 
ATOM   5276 C  CB  . ALA C 1 273 ? 79.480  4.968   28.293  1.00 67.60  ? 270 ALA A CB  1 
ATOM   5277 N  N   . HIS C 1 274 ? 79.503  1.791   27.968  1.00 57.88  ? 271 HIS A N   1 
ATOM   5278 C  CA  . HIS C 1 274 ? 78.662  0.631   27.694  1.00 57.73  ? 271 HIS A CA  1 
ATOM   5279 C  C   . HIS C 1 274 ? 79.444  -0.599  27.248  1.00 58.52  ? 271 HIS A C   1 
ATOM   5280 O  O   . HIS C 1 274 ? 80.622  -0.510  26.901  1.00 59.88  ? 271 HIS A O   1 
ATOM   5281 C  CB  . HIS C 1 274 ? 77.596  0.983   26.653  1.00 51.64  ? 271 HIS A CB  1 
ATOM   5282 C  CG  . HIS C 1 274 ? 76.491  1.839   27.189  1.00 48.29  ? 271 HIS A CG  1 
ATOM   5283 N  ND1 . HIS C 1 274 ? 76.440  3.201   26.990  1.00 49.78  ? 271 HIS A ND1 1 
ATOM   5284 C  CD2 . HIS C 1 274 ? 75.398  1.525   27.923  1.00 48.43  ? 271 HIS A CD2 1 
ATOM   5285 C  CE1 . HIS C 1 274 ? 75.361  3.689   27.575  1.00 46.65  ? 271 HIS A CE1 1 
ATOM   5286 N  NE2 . HIS C 1 274 ? 74.711  2.693   28.148  1.00 46.18  ? 271 HIS A NE2 1 
ATOM   5287 N  N   . THR C 1 275 ? 78.771  -1.746  27.262  1.00 59.21  ? 272 THR A N   1 
ATOM   5288 C  CA  . THR C 1 275 ? 79.370  -3.011  26.851  1.00 59.67  ? 272 THR A CA  1 
ATOM   5289 C  C   . THR C 1 275 ? 79.264  -3.201  25.339  1.00 64.15  ? 272 THR A C   1 
ATOM   5290 O  O   . THR C 1 275 ? 79.869  -4.110  24.771  1.00 68.67  ? 272 THR A O   1 
ATOM   5291 C  CB  . THR C 1 275 ? 78.712  -4.203  27.572  1.00 60.03  ? 272 THR A CB  1 
ATOM   5292 O  OG1 . THR C 1 275 ? 77.295  -4.171  27.362  1.00 57.11  ? 272 THR A OG1 1 
ATOM   5293 C  CG2 . THR C 1 275 ? 78.996  -4.142  29.066  1.00 61.08  ? 272 THR A CG2 1 
ATOM   5294 N  N   . ALA C 1 276 ? 78.483  -2.337  24.698  1.00 66.26  ? 273 ALA A N   1 
ATOM   5295 C  CA  . ALA C 1 276 ? 78.380  -2.309  23.243  1.00 62.61  ? 273 ALA A CA  1 
ATOM   5296 C  C   . ALA C 1 276 ? 78.510  -0.865  22.768  1.00 62.03  ? 273 ALA A C   1 
ATOM   5297 O  O   . ALA C 1 276 ? 78.685  0.043   23.582  1.00 59.47  ? 273 ALA A O   1 
ATOM   5298 C  CB  . ALA C 1 276 ? 77.061  -2.909  22.791  1.00 60.79  ? 273 ALA A CB  1 
ATOM   5299 N  N   . GLU C 1 277 ? 78.427  -0.652  21.457  1.00 59.26  ? 274 GLU A N   1 
ATOM   5300 C  CA  . GLU C 1 277 ? 78.551  0.698   20.907  1.00 59.34  ? 274 GLU A CA  1 
ATOM   5301 C  C   . GLU C 1 277 ? 77.508  1.654   21.479  1.00 55.98  ? 274 GLU A C   1 
ATOM   5302 O  O   . GLU C 1 277 ? 76.385  1.257   21.795  1.00 54.62  ? 274 GLU A O   1 
ATOM   5303 C  CB  . GLU C 1 277 ? 78.489  0.694   19.374  1.00 59.86  ? 274 GLU A CB  1 
ATOM   5304 C  CG  . GLU C 1 277 ? 77.496  -0.280  18.769  1.00 62.62  ? 274 GLU A CG  1 
ATOM   5305 C  CD  . GLU C 1 277 ? 78.128  -1.614  18.423  1.00 61.46  ? 274 GLU A CD  1 
ATOM   5306 O  OE1 . GLU C 1 277 ? 79.299  -1.622  17.988  1.00 60.72  ? 274 GLU A OE1 1 
ATOM   5307 O  OE2 . GLU C 1 277 ? 77.453  -2.652  18.578  1.00 63.11  ? 274 GLU A OE2 1 
ATOM   5308 N  N   . VAL C 1 278 ? 77.898  2.915   21.621  1.00 54.68  ? 275 VAL A N   1 
ATOM   5309 C  CA  . VAL C 1 278 ? 77.007  3.944   22.136  1.00 51.65  ? 275 VAL A CA  1 
ATOM   5310 C  C   . VAL C 1 278 ? 76.474  4.774   20.972  1.00 52.30  ? 275 VAL A C   1 
ATOM   5311 O  O   . VAL C 1 278 ? 77.245  5.250   20.139  1.00 55.54  ? 275 VAL A O   1 
ATOM   5312 C  CB  . VAL C 1 278 ? 77.732  4.846   23.146  1.00 47.70  ? 275 VAL A CB  1 
ATOM   5313 C  CG1 . VAL C 1 278 ? 76.734  5.693   23.903  1.00 45.87  ? 275 VAL A CG1 1 
ATOM   5314 C  CG2 . VAL C 1 278 ? 78.547  4.001   24.112  1.00 48.93  ? 275 VAL A CG2 1 
ATOM   5315 N  N   . ASN C 1 279 ? 75.157  4.946   20.915  1.00 49.87  ? 276 ASN A N   1 
ATOM   5316 C  CA  . ASN C 1 279 ? 74.516  5.542   19.744  1.00 46.30  ? 276 ASN A CA  1 
ATOM   5317 C  C   . ASN C 1 279 ? 74.057  6.992   19.898  1.00 46.60  ? 276 ASN A C   1 
ATOM   5318 O  O   . ASN C 1 279 ? 73.920  7.708   18.906  1.00 50.23  ? 276 ASN A O   1 
ATOM   5319 C  CB  . ASN C 1 279 ? 73.340  4.676   19.292  1.00 43.28  ? 276 ASN A CB  1 
ATOM   5320 C  CG  . ASN C 1 279 ? 73.783  3.342   18.727  1.00 46.74  ? 276 ASN A CG  1 
ATOM   5321 O  OD1 . ASN C 1 279 ? 74.878  3.218   18.177  1.00 47.81  ? 276 ASN A OD1 1 
ATOM   5322 N  ND2 . ASN C 1 279 ? 72.928  2.334   18.854  1.00 47.38  ? 276 ASN A ND2 1 
ATOM   5323 N  N   . CYS C 1 280 ? 73.817  7.426   21.130  1.00 46.77  ? 277 CYS A N   1 
ATOM   5324 C  CA  . CYS C 1 280 ? 73.262  8.757   21.356  1.00 44.18  ? 277 CYS A CA  1 
ATOM   5325 C  C   . CYS C 1 280 ? 73.545  9.290   22.754  1.00 42.35  ? 277 CYS A C   1 
ATOM   5326 O  O   . CYS C 1 280 ? 73.810  8.527   23.682  1.00 45.77  ? 277 CYS A O   1 
ATOM   5327 C  CB  . CYS C 1 280 ? 71.754  8.735   21.116  1.00 40.38  ? 277 CYS A CB  1 
ATOM   5328 S  SG  . CYS C 1 280 ? 70.912  7.409   22.003  1.00 44.65  ? 277 CYS A SG  1 
ATOM   5329 N  N   . LEU C 1 281 ? 73.480  10.609  22.895  1.00 41.19  ? 278 LEU A N   1 
ATOM   5330 C  CA  . LEU C 1 281 ? 73.653  11.253  24.189  1.00 43.73  ? 278 LEU A CA  1 
ATOM   5331 C  C   . LEU C 1 281 ? 72.848  12.543  24.238  1.00 43.95  ? 278 LEU A C   1 
ATOM   5332 O  O   . LEU C 1 281 ? 72.606  13.169  23.207  1.00 47.54  ? 278 LEU A O   1 
ATOM   5333 C  CB  . LEU C 1 281 ? 75.130  11.541  24.471  1.00 46.46  ? 278 LEU A CB  1 
ATOM   5334 C  CG  . LEU C 1 281 ? 75.765  12.777  23.829  1.00 45.03  ? 278 LEU A CG  1 
ATOM   5335 C  CD1 . LEU C 1 281 ? 76.982  13.222  24.625  1.00 46.71  ? 278 LEU A CD1 1 
ATOM   5336 C  CD2 . LEU C 1 281 ? 76.131  12.528  22.372  1.00 48.17  ? 278 LEU A CD2 1 
ATOM   5337 N  N   . SER C 1 282 ? 72.431  12.934  25.438  1.00 44.19  ? 279 SER A N   1 
ATOM   5338 C  CA  . SER C 1 282 ? 71.628  14.138  25.604  1.00 43.30  ? 279 SER A CA  1 
ATOM   5339 C  C   . SER C 1 282 ? 71.802  14.746  26.989  1.00 45.47  ? 279 SER A C   1 
ATOM   5340 O  O   . SER C 1 282 ? 71.574  14.085  28.005  1.00 44.30  ? 279 SER A O   1 
ATOM   5341 C  CB  . SER C 1 282 ? 70.150  13.836  25.350  1.00 40.50  ? 279 SER A CB  1 
ATOM   5342 O  OG  . SER C 1 282 ? 69.362  15.001  25.512  1.00 39.96  ? 279 SER A OG  1 
ATOM   5343 N  N   . PHE C 1 283 ? 72.205  16.012  27.018  1.00 46.16  ? 280 PHE A N   1 
ATOM   5344 C  CA  . PHE C 1 283 ? 72.378  16.737  28.269  1.00 45.32  ? 280 PHE A CA  1 
ATOM   5345 C  C   . PHE C 1 283 ? 71.044  17.231  28.802  1.00 45.96  ? 280 PHE A C   1 
ATOM   5346 O  O   . PHE C 1 283 ? 70.202  17.714  28.043  1.00 50.81  ? 280 PHE A O   1 
ATOM   5347 C  CB  . PHE C 1 283 ? 73.315  17.927  28.072  1.00 41.52  ? 280 PHE A CB  1 
ATOM   5348 C  CG  . PHE C 1 283 ? 74.743  17.540  27.832  1.00 45.79  ? 280 PHE A CG  1 
ATOM   5349 C  CD1 . PHE C 1 283 ? 75.196  17.273  26.550  1.00 44.48  ? 280 PHE A CD1 1 
ATOM   5350 C  CD2 . PHE C 1 283 ? 75.635  17.448  28.890  1.00 43.45  ? 280 PHE A CD2 1 
ATOM   5351 C  CE1 . PHE C 1 283 ? 76.515  16.919  26.329  1.00 46.12  ? 280 PHE A CE1 1 
ATOM   5352 C  CE2 . PHE C 1 283 ? 76.953  17.094  28.676  1.00 41.76  ? 280 PHE A CE2 1 
ATOM   5353 C  CZ  . PHE C 1 283 ? 77.394  16.830  27.394  1.00 42.81  ? 280 PHE A CZ  1 
ATOM   5354 N  N   . ASN C 1 284 ? 70.856  17.107  30.109  1.00 43.60  ? 281 ASN A N   1 
ATOM   5355 C  CA  . ASN C 1 284 ? 69.672  17.639  30.762  1.00 43.97  ? 281 ASN A CA  1 
ATOM   5356 C  C   . ASN C 1 284 ? 69.671  19.167  30.706  1.00 44.50  ? 281 ASN A C   1 
ATOM   5357 O  O   . ASN C 1 284 ? 70.677  19.800  31.022  1.00 45.38  ? 281 ASN A O   1 
ATOM   5358 C  CB  . ASN C 1 284 ? 69.597  17.142  32.206  1.00 41.02  ? 281 ASN A CB  1 
ATOM   5359 C  CG  . ASN C 1 284 ? 68.335  17.588  32.912  1.00 43.47  ? 281 ASN A CG  1 
ATOM   5360 O  OD1 . ASN C 1 284 ? 68.131  18.779  33.151  1.00 40.13  ? 281 ASN A OD1 1 
ATOM   5361 N  ND2 . ASN C 1 284 ? 67.480  16.632  33.259  1.00 38.89  ? 281 ASN A ND2 1 
ATOM   5362 N  N   . PRO C 1 285 ? 68.543  19.762  30.286  1.00 43.61  ? 282 PRO A N   1 
ATOM   5363 C  CA  . PRO C 1 285 ? 68.435  21.212  30.121  1.00 45.19  ? 282 PRO A CA  1 
ATOM   5364 C  C   . PRO C 1 285 ? 68.301  21.985  31.435  1.00 51.32  ? 282 PRO A C   1 
ATOM   5365 O  O   . PRO C 1 285 ? 68.346  23.217  31.427  1.00 51.59  ? 282 PRO A O   1 
ATOM   5366 C  CB  . PRO C 1 285 ? 67.158  21.371  29.295  1.00 35.76  ? 282 PRO A CB  1 
ATOM   5367 C  CG  . PRO C 1 285 ? 66.332  20.204  29.675  1.00 41.53  ? 282 PRO A CG  1 
ATOM   5368 C  CD  . PRO C 1 285 ? 67.290  19.073  29.927  1.00 36.94  ? 282 PRO A CD  1 
ATOM   5369 N  N   . TYR C 1 286 ? 68.141  21.277  32.549  1.00 53.01  ? 283 TYR A N   1 
ATOM   5370 C  CA  . TYR C 1 286 ? 67.938  21.937  33.838  1.00 56.64  ? 283 TYR A CA  1 
ATOM   5371 C  C   . TYR C 1 286 ? 69.102  21.747  34.812  1.00 61.17  ? 283 TYR A C   1 
ATOM   5372 O  O   . TYR C 1 286 ? 69.331  22.587  35.681  1.00 63.84  ? 283 TYR A O   1 
ATOM   5373 C  CB  . TYR C 1 286 ? 66.623  21.483  34.477  1.00 54.09  ? 283 TYR A CB  1 
ATOM   5374 C  CG  . TYR C 1 286 ? 65.388  21.983  33.757  1.00 55.30  ? 283 TYR A CG  1 
ATOM   5375 C  CD1 . TYR C 1 286 ? 64.713  21.174  32.847  1.00 54.44  ? 283 TYR A CD1 1 
ATOM   5376 C  CD2 . TYR C 1 286 ? 64.897  23.263  33.985  1.00 54.97  ? 283 TYR A CD2 1 
ATOM   5377 C  CE1 . TYR C 1 286 ? 63.582  21.628  32.186  1.00 55.47  ? 283 TYR A CE1 1 
ATOM   5378 C  CE2 . TYR C 1 286 ? 63.769  23.726  33.330  1.00 59.22  ? 283 TYR A CE2 1 
ATOM   5379 C  CZ  . TYR C 1 286 ? 63.114  22.904  32.431  1.00 57.51  ? 283 TYR A CZ  1 
ATOM   5380 O  OH  . TYR C 1 286 ? 61.992  23.363  31.781  1.00 52.15  ? 283 TYR A OH  1 
ATOM   5381 N  N   . SER C 1 287 ? 69.832  20.644  34.666  1.00 63.65  ? 284 SER A N   1 
ATOM   5382 C  CA  . SER C 1 287 ? 70.984  20.373  35.522  1.00 58.83  ? 284 SER A CA  1 
ATOM   5383 C  C   . SER C 1 287 ? 72.279  20.451  34.727  1.00 57.40  ? 284 SER A C   1 
ATOM   5384 O  O   . SER C 1 287 ? 72.428  19.788  33.702  1.00 56.11  ? 284 SER A O   1 
ATOM   5385 C  CB  . SER C 1 287 ? 70.861  18.999  36.186  1.00 62.91  ? 284 SER A CB  1 
ATOM   5386 O  OG  . SER C 1 287 ? 71.939  18.758  37.077  1.00 62.64  ? 284 SER A OG  1 
ATOM   5387 N  N   . GLU C 1 288 ? 73.216  21.257  35.212  1.00 60.95  ? 285 GLU A N   1 
ATOM   5388 C  CA  . GLU C 1 288 ? 74.498  21.444  34.539  1.00 62.93  ? 285 GLU A CA  1 
ATOM   5389 C  C   . GLU C 1 288 ? 75.419  20.232  34.666  1.00 56.15  ? 285 GLU A C   1 
ATOM   5390 O  O   . GLU C 1 288 ? 76.494  20.203  34.069  1.00 54.62  ? 285 GLU A O   1 
ATOM   5391 C  CB  . GLU C 1 288 ? 75.204  22.698  35.068  1.00 67.07  ? 285 GLU A CB  1 
ATOM   5392 C  CG  . GLU C 1 288 ? 75.309  22.767  36.586  1.00 71.92  ? 285 GLU A CG  1 
ATOM   5393 C  CD  . GLU C 1 288 ? 76.011  24.027  37.073  1.00 72.71  ? 285 GLU A CD  1 
ATOM   5394 O  OE1 . GLU C 1 288 ? 75.696  24.492  38.191  1.00 72.59  ? 285 GLU A OE1 1 
ATOM   5395 O  OE2 . GLU C 1 288 ? 76.876  24.553  36.340  1.00 74.61  ? 285 GLU A OE2 1 
ATOM   5396 N  N   . PHE C 1 289 ? 74.994  19.231  35.432  1.00 53.74  ? 286 PHE A N   1 
ATOM   5397 C  CA  . PHE C 1 289 ? 75.837  18.068  35.701  1.00 54.29  ? 286 PHE A CA  1 
ATOM   5398 C  C   . PHE C 1 289 ? 75.310  16.762  35.100  1.00 52.53  ? 286 PHE A C   1 
ATOM   5399 O  O   . PHE C 1 289 ? 76.088  15.878  34.746  1.00 53.94  ? 286 PHE A O   1 
ATOM   5400 C  CB  . PHE C 1 289 ? 76.042  17.896  37.211  1.00 57.87  ? 286 PHE A CB  1 
ATOM   5401 C  CG  . PHE C 1 289 ? 76.545  19.133  37.902  1.00 56.99  ? 286 PHE A CG  1 
ATOM   5402 C  CD1 . PHE C 1 289 ? 75.777  19.765  38.868  1.00 56.73  ? 286 PHE A CD1 1 
ATOM   5403 C  CD2 . PHE C 1 289 ? 77.784  19.669  37.579  1.00 55.42  ? 286 PHE A CD2 1 
ATOM   5404 C  CE1 . PHE C 1 289 ? 76.236  20.906  39.505  1.00 57.76  ? 286 PHE A CE1 1 
ATOM   5405 C  CE2 . PHE C 1 289 ? 78.248  20.810  38.209  1.00 55.77  ? 286 PHE A CE2 1 
ATOM   5406 C  CZ  . PHE C 1 289 ? 77.473  21.430  39.174  1.00 57.91  ? 286 PHE A CZ  1 
ATOM   5407 N  N   . ILE C 1 290 ? 73.991  16.643  34.986  1.00 54.37  ? 287 ILE A N   1 
ATOM   5408 C  CA  . ILE C 1 290 ? 73.372  15.383  34.568  1.00 55.49  ? 287 ILE A CA  1 
ATOM   5409 C  C   . ILE C 1 290 ? 73.368  15.157  33.049  1.00 56.87  ? 287 ILE A C   1 
ATOM   5410 O  O   . ILE C 1 290 ? 73.199  16.092  32.266  1.00 52.75  ? 287 ILE A O   1 
ATOM   5411 C  CB  . ILE C 1 290 ? 71.957  15.236  35.163  1.00 56.84  ? 287 ILE A CB  1 
ATOM   5412 C  CG1 . ILE C 1 290 ? 72.056  15.053  36.681  1.00 55.79  ? 287 ILE A CG1 1 
ATOM   5413 C  CG2 . ILE C 1 290 ? 71.219  14.064  34.532  1.00 56.40  ? 287 ILE A CG2 1 
ATOM   5414 C  CD1 . ILE C 1 290 ? 70.723  15.017  37.390  1.00 66.69  ? 287 ILE A CD1 1 
ATOM   5415 N  N   . LEU C 1 291 ? 73.563  13.901  32.653  1.00 56.70  ? 288 LEU A N   1 
ATOM   5416 C  CA  . LEU C 1 291 ? 73.691  13.520  31.251  1.00 50.36  ? 288 LEU A CA  1 
ATOM   5417 C  C   . LEU C 1 291 ? 73.045  12.150  31.045  1.00 48.85  ? 288 LEU A C   1 
ATOM   5418 O  O   . LEU C 1 291 ? 72.920  11.369  31.989  1.00 46.22  ? 288 LEU A O   1 
ATOM   5419 C  CB  . LEU C 1 291 ? 75.173  13.428  30.883  1.00 56.93  ? 288 LEU A CB  1 
ATOM   5420 C  CG  . LEU C 1 291 ? 75.689  13.903  29.521  1.00 58.50  ? 288 LEU A CG  1 
ATOM   5421 C  CD1 . LEU C 1 291 ? 77.008  13.214  29.202  1.00 56.14  ? 288 LEU A CD1 1 
ATOM   5422 C  CD2 . LEU C 1 291 ? 74.690  13.663  28.409  1.00 63.02  ? 288 LEU A CD2 1 
ATOM   5423 N  N   . ALA C 1 292 ? 72.640  11.858  29.812  1.00 49.08  ? 289 ALA A N   1 
ATOM   5424 C  CA  . ALA C 1 292 ? 72.094  10.545  29.475  1.00 42.49  ? 289 ALA A CA  1 
ATOM   5425 C  C   . ALA C 1 292 ? 72.764  9.965   28.234  1.00 45.16  ? 289 ALA A C   1 
ATOM   5426 O  O   . ALA C 1 292 ? 73.266  10.701  27.384  1.00 46.32  ? 289 ALA A O   1 
ATOM   5427 C  CB  . ALA C 1 292 ? 70.592  10.619  29.285  1.00 44.16  ? 289 ALA A CB  1 
ATOM   5428 N  N   . THR C 1 293 ? 72.754  8.640   28.135  1.00 47.14  ? 290 THR A N   1 
ATOM   5429 C  CA  . THR C 1 293 ? 73.450  7.937   27.068  1.00 42.45  ? 290 THR A CA  1 
ATOM   5430 C  C   . THR C 1 293 ? 72.688  6.675   26.661  1.00 42.56  ? 290 THR A C   1 
ATOM   5431 O  O   . THR C 1 293 ? 72.313  5.870   27.512  1.00 49.16  ? 290 THR A O   1 
ATOM   5432 C  CB  . THR C 1 293 ? 74.889  7.584   27.506  1.00 44.88  ? 290 THR A CB  1 
ATOM   5433 O  OG1 . THR C 1 293 ? 75.740  8.720   27.311  1.00 48.68  ? 290 THR A OG1 1 
ATOM   5434 C  CG2 . THR C 1 293 ? 75.433  6.428   26.710  1.00 48.97  ? 290 THR A CG2 1 
ATOM   5435 N  N   . GLY C 1 294 ? 72.448  6.518   25.360  1.00 39.29  ? 291 GLY A N   1 
ATOM   5436 C  CA  . GLY C 1 294 ? 71.740  5.352   24.833  1.00 35.07  ? 291 GLY A CA  1 
ATOM   5437 C  C   . GLY C 1 294 ? 72.680  4.446   24.060  1.00 43.71  ? 291 GLY A C   1 
ATOM   5438 O  O   . GLY C 1 294 ? 73.554  4.926   23.336  1.00 43.64  ? 291 GLY A O   1 
ATOM   5439 N  N   . SER C 1 295 ? 72.498  3.134   24.198  1.00 43.55  ? 292 SER A N   1 
ATOM   5440 C  CA  . SER C 1 295 ? 73.474  2.184   23.666  1.00 45.77  ? 292 SER A CA  1 
ATOM   5441 C  C   . SER C 1 295 ? 72.894  1.013   22.882  1.00 44.28  ? 292 SER A C   1 
ATOM   5442 O  O   . SER C 1 295 ? 71.684  0.794   22.854  1.00 41.56  ? 292 SER A O   1 
ATOM   5443 C  CB  . SER C 1 295 ? 74.342  1.641   24.800  1.00 40.83  ? 292 SER A CB  1 
ATOM   5444 O  OG  . SER C 1 295 ? 75.161  0.578   24.347  1.00 41.62  ? 292 SER A OG  1 
ATOM   5445 N  N   . ALA C 1 296 ? 73.789  0.252   22.260  1.00 45.08  ? 293 ALA A N   1 
ATOM   5446 C  CA  . ALA C 1 296 ? 73.421  -0.951  21.529  1.00 43.38  ? 293 ALA A CA  1 
ATOM   5447 C  C   . ALA C 1 296 ? 73.157  -2.131  22.463  1.00 45.73  ? 293 ALA A C   1 
ATOM   5448 O  O   . ALA C 1 296 ? 72.653  -3.169  22.031  1.00 48.23  ? 293 ALA A O   1 
ATOM   5449 C  CB  . ALA C 1 296 ? 74.502  -1.305  20.527  1.00 38.75  ? 293 ALA A CB  1 
ATOM   5450 N  N   . ASP C 1 297 ? 73.497  -1.975  23.740  1.00 46.11  ? 294 ASP A N   1 
ATOM   5451 C  CA  . ASP C 1 297 ? 73.254  -3.033  24.718  1.00 50.84  ? 294 ASP A CA  1 
ATOM   5452 C  C   . ASP C 1 297 ? 71.857  -2.937  25.325  1.00 51.16  ? 294 ASP A C   1 
ATOM   5453 O  O   . ASP C 1 297 ? 71.539  -3.635  26.289  1.00 54.81  ? 294 ASP A O   1 
ATOM   5454 C  CB  . ASP C 1 297 ? 74.330  -3.044  25.811  1.00 53.89  ? 294 ASP A CB  1 
ATOM   5455 C  CG  . ASP C 1 297 ? 74.364  -1.763  26.617  1.00 56.57  ? 294 ASP A CG  1 
ATOM   5456 O  OD1 . ASP C 1 297 ? 75.476  -1.250  26.854  1.00 63.86  ? 294 ASP A OD1 1 
ATOM   5457 O  OD2 . ASP C 1 297 ? 73.290  -1.270  27.019  1.00 55.51  ? 294 ASP A OD2 1 
ATOM   5458 N  N   . LYS C 1 298 ? 71.036  -2.058  24.757  1.00 48.19  ? 295 LYS A N   1 
ATOM   5459 C  CA  . LYS C 1 298 ? 69.616  -1.965  25.095  1.00 48.93  ? 295 LYS A CA  1 
ATOM   5460 C  C   . LYS C 1 298 ? 69.329  -1.175  26.371  1.00 48.24  ? 295 LYS A C   1 
ATOM   5461 O  O   . LYS C 1 298 ? 68.242  -1.286  26.938  1.00 54.39  ? 295 LYS A O   1 
ATOM   5462 C  CB  . LYS C 1 298 ? 68.992  -3.363  25.197  1.00 51.14  ? 295 LYS A CB  1 
ATOM   5463 C  CG  . LYS C 1 298 ? 69.195  -4.238  23.967  1.00 52.80  ? 295 LYS A CG  1 
ATOM   5464 C  CD  . LYS C 1 298 ? 68.430  -5.549  24.083  1.00 54.82  ? 295 LYS A CD  1 
ATOM   5465 C  CE  . LYS C 1 298 ? 69.139  -6.536  24.991  1.00 60.68  ? 295 LYS A CE  1 
ATOM   5466 N  NZ  . LYS C 1 298 ? 70.440  -6.967  24.410  1.00 67.70  ? 295 LYS A NZ  1 
ATOM   5467 N  N   . THR C 1 299 ? 70.290  -0.372  26.819  1.00 43.58  ? 296 THR A N   1 
ATOM   5468 C  CA  . THR C 1 299 ? 70.121  0.370   28.069  1.00 43.10  ? 296 THR A CA  1 
ATOM   5469 C  C   . THR C 1 299 ? 70.452  1.858   27.945  1.00 44.62  ? 296 THR A C   1 
ATOM   5470 O  O   . THR C 1 299 ? 71.287  2.259   27.132  1.00 44.73  ? 296 THR A O   1 
ATOM   5471 C  CB  . THR C 1 299 ? 70.977  -0.231  29.214  1.00 42.74  ? 296 THR A CB  1 
ATOM   5472 O  OG1 . THR C 1 299 ? 72.368  -0.011  28.949  1.00 44.04  ? 296 THR A OG1 1 
ATOM   5473 C  CG2 . THR C 1 299 ? 70.726  -1.723  29.361  1.00 38.71  ? 296 THR A CG2 1 
ATOM   5474 N  N   . VAL C 1 300 ? 69.783  2.669   28.759  1.00 40.49  ? 297 VAL A N   1 
ATOM   5475 C  CA  . VAL C 1 300 ? 70.119  4.079   28.892  1.00 41.08  ? 297 VAL A CA  1 
ATOM   5476 C  C   . VAL C 1 300 ? 70.933  4.284   30.170  1.00 49.01  ? 297 VAL A C   1 
ATOM   5477 O  O   . VAL C 1 300 ? 70.559  3.794   31.239  1.00 50.04  ? 297 VAL A O   1 
ATOM   5478 C  CB  . VAL C 1 300 ? 68.856  4.965   28.940  1.00 41.80  ? 297 VAL A CB  1 
ATOM   5479 C  CG1 . VAL C 1 300 ? 69.238  6.438   28.966  1.00 39.98  ? 297 VAL A CG1 1 
ATOM   5480 C  CG2 . VAL C 1 300 ? 67.953  4.671   27.752  1.00 43.18  ? 297 VAL A CG2 1 
ATOM   5481 N  N   . ALA C 1 301 ? 72.047  5.000   30.056  1.00 48.77  ? 298 ALA A N   1 
ATOM   5482 C  CA  . ALA C 1 301 ? 72.921  5.240   31.198  1.00 49.01  ? 298 ALA A CA  1 
ATOM   5483 C  C   . ALA C 1 301 ? 72.813  6.679   31.692  1.00 51.85  ? 298 ALA A C   1 
ATOM   5484 O  O   . ALA C 1 301 ? 72.805  7.618   30.896  1.00 54.06  ? 298 ALA A O   1 
ATOM   5485 C  CB  . ALA C 1 301 ? 74.361  4.905   30.842  1.00 47.91  ? 298 ALA A CB  1 
ATOM   5486 N  N   . LEU C 1 302 ? 72.736  6.839   33.011  1.00 49.59  ? 299 LEU A N   1 
ATOM   5487 C  CA  . LEU C 1 302 ? 72.609  8.153   33.634  1.00 51.33  ? 299 LEU A CA  1 
ATOM   5488 C  C   . LEU C 1 302 ? 73.963  8.608   34.178  1.00 53.22  ? 299 LEU A C   1 
ATOM   5489 O  O   . LEU C 1 302 ? 74.585  7.910   34.978  1.00 55.11  ? 299 LEU A O   1 
ATOM   5490 C  CB  . LEU C 1 302 ? 71.562  8.101   34.751  1.00 52.38  ? 299 LEU A CB  1 
ATOM   5491 C  CG  . LEU C 1 302 ? 70.819  9.380   35.153  1.00 55.58  ? 299 LEU A CG  1 
ATOM   5492 C  CD1 . LEU C 1 302 ? 71.585  10.172  36.199  1.00 55.58  ? 299 LEU A CD1 1 
ATOM   5493 C  CD2 . LEU C 1 302 ? 70.498  10.245  33.939  1.00 56.28  ? 299 LEU A CD2 1 
ATOM   5494 N  N   . TRP C 1 303 ? 74.417  9.779   33.739  1.00 56.28  ? 300 TRP A N   1 
ATOM   5495 C  CA  . TRP C 1 303 ? 75.759  10.249  34.076  1.00 55.40  ? 300 TRP A CA  1 
ATOM   5496 C  C   . TRP C 1 303 ? 75.776  11.579  34.817  1.00 57.54  ? 300 TRP A C   1 
ATOM   5497 O  O   . TRP C 1 303 ? 74.918  12.436  34.604  1.00 56.05  ? 300 TRP A O   1 
ATOM   5498 C  CB  . TRP C 1 303 ? 76.618  10.360  32.815  1.00 57.46  ? 300 TRP A CB  1 
ATOM   5499 C  CG  . TRP C 1 303 ? 76.749  9.074   32.071  1.00 59.39  ? 300 TRP A CG  1 
ATOM   5500 C  CD1 . TRP C 1 303 ? 76.102  8.723   30.923  1.00 59.63  ? 300 TRP A CD1 1 
ATOM   5501 C  CD2 . TRP C 1 303 ? 77.572  7.958   32.427  1.00 60.22  ? 300 TRP A CD2 1 
ATOM   5502 N  NE1 . TRP C 1 303 ? 76.475  7.459   30.538  1.00 60.73  ? 300 TRP A NE1 1 
ATOM   5503 C  CE2 . TRP C 1 303 ? 77.376  6.966   31.445  1.00 59.50  ? 300 TRP A CE2 1 
ATOM   5504 C  CE3 . TRP C 1 303 ? 78.457  7.701   33.479  1.00 57.08  ? 300 TRP A CE3 1 
ATOM   5505 C  CZ2 . TRP C 1 303 ? 78.032  5.738   31.483  1.00 58.73  ? 300 TRP A CZ2 1 
ATOM   5506 C  CZ3 . TRP C 1 303 ? 79.108  6.481   33.515  1.00 58.12  ? 300 TRP A CZ3 1 
ATOM   5507 C  CH2 . TRP C 1 303 ? 78.892  5.515   32.523  1.00 58.68  ? 300 TRP A CH2 1 
ATOM   5508 N  N   . ASP C 1 304 ? 76.770  11.738  35.685  1.00 59.94  ? 301 ASP A N   1 
ATOM   5509 C  CA  . ASP C 1 304 ? 77.008  12.994  36.383  1.00 59.03  ? 301 ASP A CA  1 
ATOM   5510 C  C   . ASP C 1 304 ? 78.400  13.491  36.024  1.00 57.82  ? 301 ASP A C   1 
ATOM   5511 O  O   . ASP C 1 304 ? 79.378  12.753  36.147  1.00 62.77  ? 301 ASP A O   1 
ATOM   5512 C  CB  . ASP C 1 304 ? 76.893  12.796  37.895  1.00 59.61  ? 301 ASP A CB  1 
ATOM   5513 C  CG  . ASP C 1 304 ? 76.692  14.100  38.643  1.00 61.03  ? 301 ASP A CG  1 
ATOM   5514 O  OD1 . ASP C 1 304 ? 75.835  14.132  39.552  1.00 60.54  ? 301 ASP A OD1 1 
ATOM   5515 O  OD2 . ASP C 1 304 ? 77.384  15.091  38.324  1.00 62.57  ? 301 ASP A OD2 1 
ATOM   5516 N  N   . LEU C 1 305 ? 78.488  14.741  35.580  1.00 58.79  ? 302 LEU A N   1 
ATOM   5517 C  CA  . LEU C 1 305 ? 79.757  15.316  35.135  1.00 61.07  ? 302 LEU A CA  1 
ATOM   5518 C  C   . LEU C 1 305 ? 80.769  15.494  36.267  1.00 64.40  ? 302 LEU A C   1 
ATOM   5519 O  O   . LEU C 1 305 ? 81.956  15.705  36.020  1.00 67.47  ? 302 LEU A O   1 
ATOM   5520 C  CB  . LEU C 1 305 ? 79.525  16.659  34.436  1.00 58.62  ? 302 LEU A CB  1 
ATOM   5521 C  CG  . LEU C 1 305 ? 78.940  16.621  33.025  1.00 59.23  ? 302 LEU A CG  1 
ATOM   5522 C  CD1 . LEU C 1 305 ? 78.768  18.032  32.479  1.00 59.58  ? 302 LEU A CD1 1 
ATOM   5523 C  CD2 . LEU C 1 305 ? 79.828  15.802  32.110  1.00 58.07  ? 302 LEU A CD2 1 
ATOM   5524 N  N   . ARG C 1 306 ? 80.297  15.412  37.506  1.00 64.43  ? 303 ARG A N   1 
ATOM   5525 C  CA  . ARG C 1 306 ? 81.164  15.606  38.660  1.00 67.82  ? 303 ARG A CA  1 
ATOM   5526 C  C   . ARG C 1 306 ? 82.049  14.389  38.926  1.00 70.28  ? 303 ARG A C   1 
ATOM   5527 O  O   . ARG C 1 306 ? 83.171  14.523  39.416  1.00 70.43  ? 303 ARG A O   1 
ATOM   5528 C  CB  . ARG C 1 306 ? 80.335  15.978  39.892  1.00 67.83  ? 303 ARG A CB  1 
ATOM   5529 C  CG  . ARG C 1 306 ? 79.797  17.404  39.842  1.00 63.57  ? 303 ARG A CG  1 
ATOM   5530 C  CD  . ARG C 1 306 ? 78.754  17.662  40.918  1.00 62.53  ? 303 ARG A CD  1 
ATOM   5531 N  NE  . ARG C 1 306 ? 77.544  16.873  40.708  1.00 58.72  ? 303 ARG A NE  1 
ATOM   5532 C  CZ  . ARG C 1 306 ? 76.420  17.031  41.398  1.00 56.41  ? 303 ARG A CZ  1 
ATOM   5533 N  NH1 . ARG C 1 306 ? 76.345  17.955  42.346  1.00 58.84  ? 303 ARG A NH1 1 
ATOM   5534 N  NH2 . ARG C 1 306 ? 75.368  16.266  41.139  1.00 54.82  ? 303 ARG A NH2 1 
ATOM   5535 N  N   . ASN C 1 307 ? 81.540  13.206  38.593  1.00 71.39  ? 304 ASN A N   1 
ATOM   5536 C  CA  . ASN C 1 307 ? 82.320  11.973  38.676  1.00 73.67  ? 304 ASN A CA  1 
ATOM   5537 C  C   . ASN C 1 307 ? 81.860  10.951  37.643  1.00 75.81  ? 304 ASN A C   1 
ATOM   5538 O  O   . ASN C 1 307 ? 80.881  10.234  37.857  1.00 75.78  ? 304 ASN A O   1 
ATOM   5539 C  CB  . ASN C 1 307 ? 82.250  11.370  40.081  1.00 74.16  ? 304 ASN A CB  1 
ATOM   5540 C  CG  . ASN C 1 307 ? 83.056  10.086  40.206  1.00 73.81  ? 304 ASN A CG  1 
ATOM   5541 O  OD1 . ASN C 1 307 ? 82.620  9.125   40.843  1.00 69.76  ? 304 ASN A OD1 1 
ATOM   5542 N  ND2 . ASN C 1 307 ? 84.235  10.064  39.592  1.00 72.69  ? 304 ASN A ND2 1 
ATOM   5543 N  N   . LEU C 1 308 ? 82.579  10.885  36.527  1.00 76.61  ? 305 LEU A N   1 
ATOM   5544 C  CA  . LEU C 1 308 ? 82.207  10.017  35.412  1.00 78.73  ? 305 LEU A CA  1 
ATOM   5545 C  C   . LEU C 1 308 ? 82.448  8.537   35.693  1.00 82.76  ? 305 LEU A C   1 
ATOM   5546 O  O   . LEU C 1 308 ? 81.802  7.675   35.097  1.00 85.82  ? 305 LEU A O   1 
ATOM   5547 C  CB  . LEU C 1 308 ? 82.951  10.431  34.141  1.00 76.61  ? 305 LEU A CB  1 
ATOM   5548 C  CG  . LEU C 1 308 ? 82.413  11.645  33.381  1.00 76.12  ? 305 LEU A CG  1 
ATOM   5549 C  CD1 . LEU C 1 308 ? 80.951  11.435  33.010  1.00 76.63  ? 305 LEU A CD1 1 
ATOM   5550 C  CD2 . LEU C 1 308 ? 82.586  12.919  34.189  1.00 77.16  ? 305 LEU A CD2 1 
ATOM   5551 N  N   . LYS C 1 309 ? 83.378  8.246   36.597  1.00 85.59  ? 306 LYS A N   1 
ATOM   5552 C  CA  . LYS C 1 309 ? 83.705  6.865   36.944  1.00 88.65  ? 306 LYS A CA  1 
ATOM   5553 C  C   . LYS C 1 309 ? 82.482  6.108   37.463  1.00 87.58  ? 306 LYS A C   1 
ATOM   5554 O  O   . LYS C 1 309 ? 82.376  4.892   37.301  1.00 87.40  ? 306 LYS A O   1 
ATOM   5555 C  CB  . LYS C 1 309 ? 84.834  6.827   37.978  1.00 89.94  ? 306 LYS A CB  1 
ATOM   5556 C  CG  . LYS C 1 309 ? 85.361  5.430   38.273  1.00 93.94  ? 306 LYS A CG  1 
ATOM   5557 C  CD  . LYS C 1 309 ? 86.456  5.455   39.325  1.00 94.44  ? 306 LYS A CD  1 
ATOM   5558 C  CE  . LYS C 1 309 ? 86.908  4.045   39.679  1.00 96.88  ? 306 LYS A CE  1 
ATOM   5559 N  NZ  . LYS C 1 309 ? 87.963  4.043   40.729  1.00 96.32  ? 306 LYS A NZ  1 
ATOM   5560 N  N   . LEU C 1 310 ? 81.558  6.836   38.081  1.00 87.06  ? 307 LEU A N   1 
ATOM   5561 C  CA  . LEU C 1 310 ? 80.356  6.230   38.640  1.00 84.37  ? 307 LEU A CA  1 
ATOM   5562 C  C   . LEU C 1 310 ? 79.153  6.384   37.711  1.00 77.48  ? 307 LEU A C   1 
ATOM   5563 O  O   . LEU C 1 310 ? 78.712  7.499   37.430  1.00 73.72  ? 307 LEU A O   1 
ATOM   5564 C  CB  . LEU C 1 310 ? 80.044  6.832   40.015  1.00 85.52  ? 307 LEU A CB  1 
ATOM   5565 C  CG  . LEU C 1 310 ? 78.824  6.285   40.762  1.00 88.06  ? 307 LEU A CG  1 
ATOM   5566 C  CD1 . LEU C 1 310 ? 78.962  4.789   41.019  1.00 88.38  ? 307 LEU A CD1 1 
ATOM   5567 C  CD2 . LEU C 1 310 ? 78.606  7.040   42.068  1.00 86.88  ? 307 LEU A CD2 1 
ATOM   5568 N  N   . LYS C 1 311 ? 78.632  5.258   37.232  1.00 70.16  ? 308 LYS A N   1 
ATOM   5569 C  CA  . LYS C 1 311 ? 77.403  5.259   36.451  1.00 63.48  ? 308 LYS A CA  1 
ATOM   5570 C  C   . LYS C 1 311 ? 76.209  5.311   37.394  1.00 61.77  ? 308 LYS A C   1 
ATOM   5571 O  O   . LYS C 1 311 ? 75.895  4.328   38.064  1.00 61.13  ? 308 LYS A O   1 
ATOM   5572 C  CB  . LYS C 1 311 ? 77.317  4.017   35.563  1.00 60.03  ? 308 LYS A CB  1 
ATOM   5573 C  CG  . LYS C 1 311 ? 76.099  4.003   34.653  1.00 56.45  ? 308 LYS A CG  1 
ATOM   5574 C  CD  . LYS C 1 311 ? 75.934  2.672   33.934  1.00 57.33  ? 308 LYS A CD  1 
ATOM   5575 C  CE  . LYS C 1 311 ? 76.991  2.476   32.858  1.00 55.89  ? 308 LYS A CE  1 
ATOM   5576 N  NZ  . LYS C 1 311 ? 76.583  1.434   31.871  1.00 55.81  ? 308 LYS A NZ  1 
ATOM   5577 N  N   . LEU C 1 312 ? 75.546  6.463   37.438  1.00 58.77  ? 309 LEU A N   1 
ATOM   5578 C  CA  . LEU C 1 312 ? 74.462  6.691   38.391  1.00 58.99  ? 309 LEU A CA  1 
ATOM   5579 C  C   . LEU C 1 312 ? 73.322  5.684   38.287  1.00 58.80  ? 309 LEU A C   1 
ATOM   5580 O  O   . LEU C 1 312 ? 72.840  5.185   39.306  1.00 60.13  ? 309 LEU A O   1 
ATOM   5581 C  CB  . LEU C 1 312 ? 73.917  8.117   38.264  1.00 57.23  ? 309 LEU A CB  1 
ATOM   5582 C  CG  . LEU C 1 312 ? 74.817  9.234   38.796  1.00 62.29  ? 309 LEU A CG  1 
ATOM   5583 C  CD1 . LEU C 1 312 ? 74.125  10.581  38.681  1.00 62.47  ? 309 LEU A CD1 1 
ATOM   5584 C  CD2 . LEU C 1 312 ? 75.218  8.961   40.241  1.00 66.54  ? 309 LEU A CD2 1 
ATOM   5585 N  N   . HIS C 1 313 ? 72.895  5.379   37.065  1.00 53.04  ? 310 HIS A N   1 
ATOM   5586 C  CA  . HIS C 1 313 ? 71.747  4.498   36.879  1.00 52.49  ? 310 HIS A CA  1 
ATOM   5587 C  C   . HIS C 1 313 ? 71.718  3.818   35.512  1.00 51.34  ? 310 HIS A C   1 
ATOM   5588 O  O   . HIS C 1 313 ? 72.349  4.278   34.561  1.00 47.62  ? 310 HIS A O   1 
ATOM   5589 C  CB  . HIS C 1 313 ? 70.449  5.277   37.107  1.00 54.70  ? 310 HIS A CB  1 
ATOM   5590 C  CG  . HIS C 1 313 ? 69.241  4.408   37.264  1.00 58.16  ? 310 HIS A CG  1 
ATOM   5591 N  ND1 . HIS C 1 313 ? 69.025  3.629   38.381  1.00 59.61  ? 310 HIS A ND1 1 
ATOM   5592 C  CD2 . HIS C 1 313 ? 68.181  4.199   36.449  1.00 59.39  ? 310 HIS A CD2 1 
ATOM   5593 C  CE1 . HIS C 1 313 ? 67.886  2.975   38.245  1.00 61.57  ? 310 HIS A CE1 1 
ATOM   5594 N  NE2 . HIS C 1 313 ? 67.353  3.303   37.082  1.00 62.47  ? 310 HIS A NE2 1 
ATOM   5595 N  N   . THR C 1 314 ? 70.979  2.715   35.429  1.00 49.65  ? 311 THR A N   1 
ATOM   5596 C  CA  . THR C 1 314 ? 70.788  2.001   34.173  1.00 49.13  ? 311 THR A CA  1 
ATOM   5597 C  C   . THR C 1 314 ? 69.306  1.716   33.950  1.00 51.29  ? 311 THR A C   1 
ATOM   5598 O  O   . THR C 1 314 ? 68.671  1.020   34.744  1.00 50.49  ? 311 THR A O   1 
ATOM   5599 C  CB  . THR C 1 314 ? 71.588  0.679   34.140  1.00 49.58  ? 311 THR A CB  1 
ATOM   5600 O  OG1 . THR C 1 314 ? 72.980  0.966   33.964  1.00 48.00  ? 311 THR A OG1 1 
ATOM   5601 C  CG2 . THR C 1 314 ? 71.121  -0.204  32.993  1.00 52.09  ? 311 THR A CG2 1 
ATOM   5602 N  N   . PHE C 1 315 ? 68.758  2.269   32.872  1.00 50.85  ? 312 PHE A N   1 
ATOM   5603 C  CA  . PHE C 1 315 ? 67.352  2.069   32.542  1.00 48.97  ? 312 PHE A CA  1 
ATOM   5604 C  C   . PHE C 1 315 ? 67.184  0.835   31.664  1.00 52.95  ? 312 PHE A C   1 
ATOM   5605 O  O   . PHE C 1 315 ? 67.709  0.782   30.551  1.00 56.99  ? 312 PHE A O   1 
ATOM   5606 C  CB  . PHE C 1 315 ? 66.785  3.299   31.830  1.00 49.59  ? 312 PHE A CB  1 
ATOM   5607 C  CG  . PHE C 1 315 ? 66.913  4.574   32.619  1.00 48.04  ? 312 PHE A CG  1 
ATOM   5608 C  CD1 . PHE C 1 315 ? 68.051  5.358   32.516  1.00 46.35  ? 312 PHE A CD1 1 
ATOM   5609 C  CD2 . PHE C 1 315 ? 65.891  4.992   33.455  1.00 45.51  ? 312 PHE A CD2 1 
ATOM   5610 C  CE1 . PHE C 1 315 ? 68.170  6.533   33.234  1.00 45.28  ? 312 PHE A CE1 1 
ATOM   5611 C  CE2 . PHE C 1 315 ? 66.004  6.167   34.177  1.00 44.82  ? 312 PHE A CE2 1 
ATOM   5612 C  CZ  . PHE C 1 315 ? 67.146  6.937   34.065  1.00 45.73  ? 312 PHE A CZ  1 
ATOM   5613 N  N   . GLU C 1 316 ? 66.454  -0.154  32.170  1.00 55.89  ? 313 GLU A N   1 
ATOM   5614 C  CA  . GLU C 1 316 ? 66.245  -1.405  31.446  1.00 59.26  ? 313 GLU A CA  1 
ATOM   5615 C  C   . GLU C 1 316 ? 64.786  -1.595  31.051  1.00 54.42  ? 313 GLU A C   1 
ATOM   5616 O  O   . GLU C 1 316 ? 63.889  -1.441  31.877  1.00 58.03  ? 313 GLU A O   1 
ATOM   5617 C  CB  . GLU C 1 316 ? 66.708  -2.597  32.284  1.00 63.25  ? 313 GLU A CB  1 
ATOM   5618 C  CG  . GLU C 1 316 ? 68.208  -2.651  32.518  1.00 73.52  ? 313 GLU A CG  1 
ATOM   5619 C  CD  . GLU C 1 316 ? 68.616  -3.790  33.434  1.00 74.04  ? 313 GLU A CD  1 
ATOM   5620 O  OE1 . GLU C 1 316 ? 67.798  -4.193  34.290  1.00 77.22  ? 313 GLU A OE1 1 
ATOM   5621 O  OE2 . GLU C 1 316 ? 69.757  -4.280  33.300  1.00 81.05  ? 313 GLU A OE2 1 
ATOM   5622 N  N   . SER C 1 317 ? 64.568  -1.928  29.781  1.00 51.22  ? 314 SER A N   1 
ATOM   5623 C  CA  . SER C 1 317 ? 63.240  -2.236  29.244  1.00 48.19  ? 314 SER A CA  1 
ATOM   5624 C  C   . SER C 1 317 ? 63.295  -2.453  27.741  1.00 47.57  ? 314 SER A C   1 
ATOM   5625 O  O   . SER C 1 317 ? 62.631  -3.344  27.213  1.00 49.99  ? 314 SER A O   1 
ATOM   5626 C  CB  . SER C 1 317 ? 62.223  -1.140  29.570  1.00 50.73  ? 314 SER A CB  1 
ATOM   5627 O  OG  . SER C 1 317 ? 61.425  -1.501  30.685  1.00 51.85  ? 314 SER A OG  1 
ATOM   5628 N  N   . HIS C 1 318 ? 64.082  -1.632  27.054  1.00 49.70  ? 315 HIS A N   1 
ATOM   5629 C  CA  . HIS C 1 318 ? 64.211  -1.745  25.605  1.00 54.11  ? 315 HIS A CA  1 
ATOM   5630 C  C   . HIS C 1 318 ? 64.734  -3.119  25.203  1.00 56.41  ? 315 HIS A C   1 
ATOM   5631 O  O   . HIS C 1 318 ? 65.727  -3.602  25.750  1.00 60.98  ? 315 HIS A O   1 
ATOM   5632 C  CB  . HIS C 1 318 ? 65.107  -0.639  25.042  1.00 51.80  ? 315 HIS A CB  1 
ATOM   5633 C  CG  . HIS C 1 318 ? 64.383  0.642   24.765  1.00 47.41  ? 315 HIS A CG  1 
ATOM   5634 N  ND1 . HIS C 1 318 ? 64.659  1.816   25.432  1.00 44.35  ? 315 HIS A ND1 1 
ATOM   5635 C  CD2 . HIS C 1 318 ? 63.388  0.931   23.892  1.00 45.94  ? 315 HIS A CD2 1 
ATOM   5636 C  CE1 . HIS C 1 318 ? 63.872  2.774   24.977  1.00 43.43  ? 315 HIS A CE1 1 
ATOM   5637 N  NE2 . HIS C 1 318 ? 63.089  2.263   24.044  1.00 46.75  ? 315 HIS A NE2 1 
ATOM   5638 N  N   . LYS C 1 319 ? 64.051  -3.740  24.246  1.00 56.28  ? 316 LYS A N   1 
ATOM   5639 C  CA  . LYS C 1 319 ? 64.373  -5.097  23.816  1.00 51.03  ? 316 LYS A CA  1 
ATOM   5640 C  C   . LYS C 1 319 ? 65.370  -5.133  22.659  1.00 47.00  ? 316 LYS A C   1 
ATOM   5641 O  O   . LYS C 1 319 ? 65.648  -6.199  22.114  1.00 50.73  ? 316 LYS A O   1 
ATOM   5642 C  CB  . LYS C 1 319 ? 63.097  -5.844  23.420  1.00 49.31  ? 316 LYS A CB  1 
ATOM   5643 C  CG  . LYS C 1 319 ? 62.072  -5.966  24.534  1.00 52.76  ? 316 LYS A CG  1 
ATOM   5644 C  CD  . LYS C 1 319 ? 60.796  -6.631  24.034  1.00 61.88  ? 316 LYS A CD  1 
ATOM   5645 C  CE  . LYS C 1 319 ? 59.832  -6.920  25.177  1.00 64.95  ? 316 LYS A CE  1 
ATOM   5646 N  NZ  . LYS C 1 319 ? 60.418  -7.862  26.175  1.00 66.54  ? 316 LYS A NZ  1 
ATOM   5647 N  N   . ASP C 1 320 ? 65.907  -3.972  22.291  1.00 47.00  ? 317 ASP A N   1 
ATOM   5648 C  CA  . ASP C 1 320 ? 66.858  -3.883  21.184  1.00 38.97  ? 317 ASP A CA  1 
ATOM   5649 C  C   . ASP C 1 320 ? 67.670  -2.590  21.258  1.00 38.63  ? 317 ASP A C   1 
ATOM   5650 O  O   . ASP C 1 320 ? 67.558  -1.836  22.223  1.00 41.94  ? 317 ASP A O   1 
ATOM   5651 C  CB  . ASP C 1 320 ? 66.124  -3.979  19.845  1.00 47.50  ? 317 ASP A CB  1 
ATOM   5652 C  CG  . ASP C 1 320 ? 66.981  -4.577  18.748  1.00 55.04  ? 317 ASP A CG  1 
ATOM   5653 O  OD1 . ASP C 1 320 ? 68.206  -4.716  18.950  1.00 55.32  ? 317 ASP A OD1 1 
ATOM   5654 O  OD2 . ASP C 1 320 ? 66.426  -4.910  17.679  1.00 61.38  ? 317 ASP A OD2 1 
ATOM   5655 N  N   . GLU C 1 321 ? 68.486  -2.343  20.236  1.00 44.40  ? 318 GLU A N   1 
ATOM   5656 C  CA  . GLU C 1 321 ? 69.334  -1.151  20.171  1.00 48.09  ? 318 GLU A CA  1 
ATOM   5657 C  C   . GLU C 1 321 ? 68.575  0.156   20.407  1.00 43.20  ? 318 GLU A C   1 
ATOM   5658 O  O   . GLU C 1 321 ? 67.474  0.349   19.894  1.00 45.41  ? 318 GLU A O   1 
ATOM   5659 C  CB  . GLU C 1 321 ? 70.046  -1.077  18.817  1.00 49.81  ? 318 GLU A CB  1 
ATOM   5660 C  CG  . GLU C 1 321 ? 71.267  -1.968  18.687  1.00 55.83  ? 318 GLU A CG  1 
ATOM   5661 C  CD  . GLU C 1 321 ? 71.997  -1.762  17.372  1.00 58.57  ? 318 GLU A CD  1 
ATOM   5662 O  OE1 . GLU C 1 321 ? 73.204  -1.443  17.401  1.00 64.04  ? 318 GLU A OE1 1 
ATOM   5663 O  OE2 . GLU C 1 321 ? 71.361  -1.910  16.306  1.00 63.14  ? 318 GLU A OE2 1 
ATOM   5664 N  N   . ILE C 1 322 ? 69.184  1.051   21.178  1.00 36.62  ? 319 ILE A N   1 
ATOM   5665 C  CA  . ILE C 1 322 ? 68.633  2.381   21.410  1.00 39.94  ? 319 ILE A CA  1 
ATOM   5666 C  C   . ILE C 1 322 ? 69.399  3.399   20.572  1.00 42.53  ? 319 ILE A C   1 
ATOM   5667 O  O   . ILE C 1 322 ? 70.629  3.444   20.621  1.00 37.41  ? 319 ILE A O   1 
ATOM   5668 C  CB  . ILE C 1 322 ? 68.714  2.770   22.901  1.00 39.39  ? 319 ILE A CB  1 
ATOM   5669 C  CG1 . ILE C 1 322 ? 67.872  1.808   23.745  1.00 44.23  ? 319 ILE A CG1 1 
ATOM   5670 C  CG2 . ILE C 1 322 ? 68.253  4.202   23.112  1.00 32.40  ? 319 ILE A CG2 1 
ATOM   5671 C  CD1 . ILE C 1 322 ? 68.048  1.987   25.236  1.00 41.31  ? 319 ILE A CD1 1 
ATOM   5672 N  N   . PHE C 1 323 ? 68.675  4.212   19.804  1.00 42.28  ? 320 PHE A N   1 
ATOM   5673 C  CA  . PHE C 1 323 ? 69.314  5.156   18.883  1.00 40.89  ? 320 PHE A CA  1 
ATOM   5674 C  C   . PHE C 1 323 ? 69.064  6.630   19.195  1.00 39.12  ? 320 PHE A C   1 
ATOM   5675 O  O   . PHE C 1 323 ? 69.749  7.504   18.658  1.00 38.89  ? 320 PHE A O   1 
ATOM   5676 C  CB  . PHE C 1 323 ? 68.914  4.855   17.436  1.00 41.16  ? 320 PHE A CB  1 
ATOM   5677 C  CG  . PHE C 1 323 ? 69.759  3.803   16.781  1.00 43.88  ? 320 PHE A CG  1 
ATOM   5678 C  CD1 . PHE C 1 323 ? 69.365  2.474   16.785  1.00 43.77  ? 320 PHE A CD1 1 
ATOM   5679 C  CD2 . PHE C 1 323 ? 70.952  4.142   16.163  1.00 46.41  ? 320 PHE A CD2 1 
ATOM   5680 C  CE1 . PHE C 1 323 ? 70.143  1.500   16.180  1.00 37.77  ? 320 PHE A CE1 1 
ATOM   5681 C  CE2 . PHE C 1 323 ? 71.735  3.174   15.559  1.00 44.36  ? 320 PHE A CE2 1 
ATOM   5682 C  CZ  . PHE C 1 323 ? 71.329  1.851   15.567  1.00 40.16  ? 320 PHE A CZ  1 
ATOM   5683 N  N   . GLN C 1 324 ? 68.092  6.912   20.056  1.00 37.91  ? 321 GLN A N   1 
ATOM   5684 C  CA  . GLN C 1 324 ? 67.765  8.300   20.368  1.00 40.44  ? 321 GLN A CA  1 
ATOM   5685 C  C   . GLN C 1 324 ? 67.461  8.527   21.847  1.00 36.82  ? 321 GLN A C   1 
ATOM   5686 O  O   . GLN C 1 324 ? 66.847  7.685   22.503  1.00 30.11  ? 321 GLN A O   1 
ATOM   5687 C  CB  . GLN C 1 324 ? 66.599  8.789   19.501  1.00 45.03  ? 321 GLN A CB  1 
ATOM   5688 C  CG  . GLN C 1 324 ? 66.434  10.303  19.462  1.00 49.30  ? 321 GLN A CG  1 
ATOM   5689 C  CD  . GLN C 1 324 ? 67.684  11.023  18.983  1.00 51.91  ? 321 GLN A CD  1 
ATOM   5690 O  OE1 . GLN C 1 324 ? 67.787  11.401  17.815  1.00 50.22  ? 321 GLN A OE1 1 
ATOM   5691 N  NE2 . GLN C 1 324 ? 68.644  11.213  19.884  1.00 53.10  ? 321 GLN A NE2 1 
ATOM   5692 N  N   . VAL C 1 325 ? 67.904  9.673   22.357  1.00 35.34  ? 322 VAL A N   1 
ATOM   5693 C  CA  . VAL C 1 325 ? 67.672  10.062  23.744  1.00 39.23  ? 322 VAL A CA  1 
ATOM   5694 C  C   . VAL C 1 325 ? 67.391  11.564  23.816  1.00 35.66  ? 322 VAL A C   1 
ATOM   5695 O  O   . VAL C 1 325 ? 68.105  12.365  23.212  1.00 37.74  ? 322 VAL A O   1 
ATOM   5696 C  CB  . VAL C 1 325 ? 68.882  9.702   24.645  1.00 39.95  ? 322 VAL A CB  1 
ATOM   5697 C  CG1 . VAL C 1 325 ? 68.870  10.522  25.921  1.00 45.38  ? 322 VAL A CG1 1 
ATOM   5698 C  CG2 . VAL C 1 325 ? 68.884  8.218   24.970  1.00 40.80  ? 322 VAL A CG2 1 
ATOM   5699 N  N   . HIS C 1 326 ? 66.339  11.936  24.537  1.00 30.32  ? 323 HIS A N   1 
ATOM   5700 C  CA  . HIS C 1 326 ? 65.959  13.338  24.679  1.00 34.35  ? 323 HIS A CA  1 
ATOM   5701 C  C   . HIS C 1 326 ? 65.299  13.596  26.023  1.00 35.49  ? 323 HIS A C   1 
ATOM   5702 O  O   . HIS C 1 326 ? 64.416  12.848  26.443  1.00 41.93  ? 323 HIS A O   1 
ATOM   5703 C  CB  . HIS C 1 326 ? 64.987  13.754  23.573  1.00 33.58  ? 323 HIS A CB  1 
ATOM   5704 C  CG  . HIS C 1 326 ? 65.614  13.868  22.220  1.00 35.49  ? 323 HIS A CG  1 
ATOM   5705 N  ND1 . HIS C 1 326 ? 66.624  14.763  21.941  1.00 40.93  ? 323 HIS A ND1 1 
ATOM   5706 C  CD2 . HIS C 1 326 ? 65.362  13.212  21.063  1.00 32.59  ? 323 HIS A CD2 1 
ATOM   5707 C  CE1 . HIS C 1 326 ? 66.974  14.648  20.673  1.00 33.83  ? 323 HIS A CE1 1 
ATOM   5708 N  NE2 . HIS C 1 326 ? 66.223  13.714  20.117  1.00 30.55  ? 323 HIS A NE2 1 
ATOM   5709 N  N   . TRP C 1 327 ? 65.717  14.666  26.689  1.00 36.42  ? 324 TRP A N   1 
ATOM   5710 C  CA  . TRP C 1 327 ? 65.068  15.091  27.922  1.00 37.07  ? 324 TRP A CA  1 
ATOM   5711 C  C   . TRP C 1 327 ? 63.810  15.895  27.615  1.00 34.88  ? 324 TRP A C   1 
ATOM   5712 O  O   . TRP C 1 327 ? 63.674  16.463  26.530  1.00 35.58  ? 324 TRP A O   1 
ATOM   5713 C  CB  . TRP C 1 327 ? 66.020  15.935  28.769  1.00 38.12  ? 324 TRP A CB  1 
ATOM   5714 C  CG  . TRP C 1 327 ? 67.230  15.192  29.239  1.00 37.68  ? 324 TRP A CG  1 
ATOM   5715 C  CD1 . TRP C 1 327 ? 68.438  15.109  28.611  1.00 36.68  ? 324 TRP A CD1 1 
ATOM   5716 C  CD2 . TRP C 1 327 ? 67.351  14.429  30.445  1.00 34.65  ? 324 TRP A CD2 1 
ATOM   5717 N  NE1 . TRP C 1 327 ? 69.305  14.341  29.350  1.00 38.97  ? 324 TRP A NE1 1 
ATOM   5718 C  CE2 . TRP C 1 327 ? 68.661  13.909  30.480  1.00 38.37  ? 324 TRP A CE2 1 
ATOM   5719 C  CE3 . TRP C 1 327 ? 66.479  14.132  31.496  1.00 38.79  ? 324 TRP A CE3 1 
ATOM   5720 C  CZ2 . TRP C 1 327 ? 69.119  13.111  31.527  1.00 36.38  ? 324 TRP A CZ2 1 
ATOM   5721 C  CZ3 . TRP C 1 327 ? 66.935  13.339  32.535  1.00 37.47  ? 324 TRP A CZ3 1 
ATOM   5722 C  CH2 . TRP C 1 327 ? 68.243  12.837  32.542  1.00 38.51  ? 324 TRP A CH2 1 
ATOM   5723 N  N   . SER C 1 328 ? 62.889  15.932  28.572  1.00 35.71  ? 325 SER A N   1 
ATOM   5724 C  CA  . SER C 1 328 ? 61.723  16.797  28.472  1.00 34.69  ? 325 SER A CA  1 
ATOM   5725 C  C   . SER C 1 328 ? 62.138  18.241  28.718  1.00 37.41  ? 325 SER A C   1 
ATOM   5726 O  O   . SER C 1 328 ? 62.861  18.526  29.670  1.00 43.10  ? 325 SER A O   1 
ATOM   5727 C  CB  . SER C 1 328 ? 60.662  16.384  29.488  1.00 37.25  ? 325 SER A CB  1 
ATOM   5728 O  OG  . SER C 1 328 ? 59.665  17.385  29.617  1.00 38.81  ? 325 SER A OG  1 
ATOM   5729 N  N   . PRO C 1 329 ? 61.689  19.160  27.852  1.00 40.01  ? 326 PRO A N   1 
ATOM   5730 C  CA  . PRO C 1 329 ? 61.993  20.578  28.025  1.00 37.30  ? 326 PRO A CA  1 
ATOM   5731 C  C   . PRO C 1 329 ? 61.099  21.240  29.072  1.00 37.99  ? 326 PRO A C   1 
ATOM   5732 O  O   . PRO C 1 329 ? 61.303  22.407  29.399  1.00 45.16  ? 326 PRO A O   1 
ATOM   5733 C  CB  . PRO C 1 329 ? 61.707  21.164  26.643  1.00 36.15  ? 326 PRO A CB  1 
ATOM   5734 C  CG  . PRO C 1 329 ? 60.649  20.286  26.080  1.00 41.63  ? 326 PRO A CG  1 
ATOM   5735 C  CD  . PRO C 1 329 ? 60.874  18.907  26.650  1.00 38.83  ? 326 PRO A CD  1 
ATOM   5736 N  N   . HIS C 1 330 ? 60.126  20.496  29.592  1.00 39.30  ? 327 HIS A N   1 
ATOM   5737 C  CA  . HIS C 1 330 ? 59.183  21.026  30.576  1.00 43.68  ? 327 HIS A CA  1 
ATOM   5738 C  C   . HIS C 1 330 ? 59.349  20.384  31.947  1.00 49.05  ? 327 HIS A C   1 
ATOM   5739 O  O   . HIS C 1 330 ? 59.022  20.987  32.968  1.00 53.48  ? 327 HIS A O   1 
ATOM   5740 C  CB  . HIS C 1 330 ? 57.743  20.824  30.102  1.00 41.31  ? 327 HIS A CB  1 
ATOM   5741 C  CG  . HIS C 1 330 ? 57.421  21.544  28.833  1.00 48.65  ? 327 HIS A CG  1 
ATOM   5742 N  ND1 . HIS C 1 330 ? 57.298  20.897  27.622  1.00 48.01  ? 327 HIS A ND1 1 
ATOM   5743 C  CD2 . HIS C 1 330 ? 57.202  22.857  28.583  1.00 47.70  ? 327 HIS A CD2 1 
ATOM   5744 C  CE1 . HIS C 1 330 ? 57.013  21.780  26.682  1.00 49.84  ? 327 HIS A CE1 1 
ATOM   5745 N  NE2 . HIS C 1 330 ? 56.950  22.977  27.239  1.00 50.91  ? 327 HIS A NE2 1 
ATOM   5746 N  N   . ASN C 1 331 ? 59.840  19.150  31.961  1.00 51.77  ? 328 ASN A N   1 
ATOM   5747 C  CA  . ASN C 1 331 ? 59.993  18.394  33.195  1.00 42.84  ? 328 ASN A CA  1 
ATOM   5748 C  C   . ASN C 1 331 ? 61.428  17.919  33.372  1.00 47.85  ? 328 ASN A C   1 
ATOM   5749 O  O   . ASN C 1 331 ? 61.956  17.175  32.546  1.00 50.59  ? 328 ASN A O   1 
ATOM   5750 C  CB  . ASN C 1 331 ? 59.027  17.214  33.209  1.00 42.43  ? 328 ASN A CB  1 
ATOM   5751 C  CG  . ASN C 1 331 ? 57.574  17.653  33.193  1.00 45.85  ? 328 ASN A CG  1 
ATOM   5752 O  OD1 . ASN C 1 331 ? 56.876  17.492  32.193  1.00 43.75  ? 328 ASN A OD1 1 
ATOM   5753 N  ND2 . ASN C 1 331 ? 57.114  18.219  34.303  1.00 51.23  ? 328 ASN A ND2 1 
ATOM   5754 N  N   . GLU C 1 332 ? 62.053  18.353  34.460  1.00 51.41  ? 329 GLU A N   1 
ATOM   5755 C  CA  . GLU C 1 332 ? 63.485  18.141  34.664  1.00 56.59  ? 329 GLU A CA  1 
ATOM   5756 C  C   . GLU C 1 332 ? 63.892  16.706  35.006  1.00 50.98  ? 329 GLU A C   1 
ATOM   5757 O  O   . GLU C 1 332 ? 65.071  16.361  34.935  1.00 49.95  ? 329 GLU A O   1 
ATOM   5758 C  CB  . GLU C 1 332 ? 64.013  19.127  35.710  1.00 63.53  ? 329 GLU A CB  1 
ATOM   5759 C  CG  . GLU C 1 332 ? 62.918  19.785  36.534  1.00 74.48  ? 329 GLU A CG  1 
ATOM   5760 C  CD  . GLU C 1 332 ? 63.296  21.176  37.006  1.00 81.73  ? 329 GLU A CD  1 
ATOM   5761 O  OE1 . GLU C 1 332 ? 62.385  22.018  37.167  1.00 85.22  ? 329 GLU A OE1 1 
ATOM   5762 O  OE2 . GLU C 1 332 ? 64.502  21.431  37.212  1.00 81.42  ? 329 GLU A OE2 1 
ATOM   5763 N  N   . THR C 1 333 ? 62.921  15.869  35.358  1.00 45.42  ? 330 THR A N   1 
ATOM   5764 C  CA  . THR C 1 333 ? 63.215  14.490  35.738  1.00 45.14  ? 330 THR A CA  1 
ATOM   5765 C  C   . THR C 1 333 ? 62.668  13.481  34.729  1.00 45.09  ? 330 THR A C   1 
ATOM   5766 O  O   . THR C 1 333 ? 62.750  12.271  34.943  1.00 43.12  ? 330 THR A O   1 
ATOM   5767 C  CB  . THR C 1 333 ? 62.650  14.158  37.136  1.00 44.33  ? 330 THR A CB  1 
ATOM   5768 O  OG1 . THR C 1 333 ? 61.231  13.973  37.053  1.00 42.09  ? 330 THR A OG1 1 
ATOM   5769 C  CG2 . THR C 1 333 ? 62.960  15.278  38.120  1.00 38.23  ? 330 THR A CG2 1 
ATOM   5770 N  N   . ILE C 1 334 ? 62.111  13.983  33.631  1.00 43.64  ? 331 ILE A N   1 
ATOM   5771 C  CA  . ILE C 1 334 ? 61.508  13.125  32.615  1.00 34.07  ? 331 ILE A CA  1 
ATOM   5772 C  C   . ILE C 1 334 ? 62.426  12.939  31.407  1.00 36.13  ? 331 ILE A C   1 
ATOM   5773 O  O   . ILE C 1 334 ? 62.916  13.910  30.828  1.00 33.97  ? 331 ILE A O   1 
ATOM   5774 C  CB  . ILE C 1 334 ? 60.137  13.663  32.170  1.00 36.64  ? 331 ILE A CB  1 
ATOM   5775 C  CG1 . ILE C 1 334 ? 59.187  13.733  33.369  1.00 32.10  ? 331 ILE A CG1 1 
ATOM   5776 C  CG2 . ILE C 1 334 ? 59.543  12.791  31.074  1.00 37.44  ? 331 ILE A CG2 1 
ATOM   5777 C  CD1 . ILE C 1 334 ? 58.928  12.394  34.034  1.00 26.27  ? 331 ILE A CD1 1 
ATOM   5778 N  N   . LEU C 1 335 ? 62.652  11.681  31.040  1.00 38.80  ? 332 LEU A N   1 
ATOM   5779 C  CA  . LEU C 1 335 ? 63.579  11.329  29.971  1.00 40.43  ? 332 LEU A CA  1 
ATOM   5780 C  C   . LEU C 1 335 ? 62.886  10.372  29.006  1.00 40.79  ? 332 LEU A C   1 
ATOM   5781 O  O   . LEU C 1 335 ? 62.050  9.568   29.419  1.00 40.88  ? 332 LEU A O   1 
ATOM   5782 C  CB  . LEU C 1 335 ? 64.806  10.636  30.570  1.00 44.86  ? 332 LEU A CB  1 
ATOM   5783 C  CG  . LEU C 1 335 ? 66.191  10.775  29.929  1.00 48.74  ? 332 LEU A CG  1 
ATOM   5784 C  CD1 . LEU C 1 335 ? 67.031  9.554   30.271  1.00 47.24  ? 332 LEU A CD1 1 
ATOM   5785 C  CD2 . LEU C 1 335 ? 66.112  10.949  28.427  1.00 48.35  ? 332 LEU A CD2 1 
ATOM   5786 N  N   . ALA C 1 336 ? 63.231  10.454  27.724  1.00 38.40  ? 333 ALA A N   1 
ATOM   5787 C  CA  . ALA C 1 336 ? 62.664  9.543   26.728  1.00 34.16  ? 333 ALA A CA  1 
ATOM   5788 C  C   . ALA C 1 336 ? 63.726  8.932   25.821  1.00 29.32  ? 333 ALA A C   1 
ATOM   5789 O  O   . ALA C 1 336 ? 64.744  9.559   25.523  1.00 26.88  ? 333 ALA A O   1 
ATOM   5790 C  CB  . ALA C 1 336 ? 61.590  10.243  25.900  1.00 34.62  ? 333 ALA A CB  1 
ATOM   5791 N  N   . SER C 1 337 ? 63.471  7.704   25.379  1.00 30.80  ? 334 SER A N   1 
ATOM   5792 C  CA  . SER C 1 337 ? 64.395  6.985   24.507  1.00 29.67  ? 334 SER A CA  1 
ATOM   5793 C  C   . SER C 1 337 ? 63.632  6.103   23.524  1.00 30.32  ? 334 SER A C   1 
ATOM   5794 O  O   . SER C 1 337 ? 62.474  5.754   23.762  1.00 29.10  ? 334 SER A O   1 
ATOM   5795 C  CB  . SER C 1 337 ? 65.347  6.123   25.339  1.00 30.75  ? 334 SER A CB  1 
ATOM   5796 O  OG  . SER C 1 337 ? 64.628  5.146   26.075  1.00 31.42  ? 334 SER A OG  1 
ATOM   5797 N  N   . SER C 1 338 ? 64.291  5.741   22.427  1.00 32.21  ? 335 SER A N   1 
ATOM   5798 C  CA  . SER C 1 338 ? 63.678  4.920   21.386  1.00 38.32  ? 335 SER A CA  1 
ATOM   5799 C  C   . SER C 1 338 ? 64.745  4.217   20.560  1.00 45.16  ? 335 SER A C   1 
ATOM   5800 O  O   . SER C 1 338 ? 65.935  4.513   20.686  1.00 47.79  ? 335 SER A O   1 
ATOM   5801 C  CB  . SER C 1 338 ? 62.824  5.788   20.464  1.00 36.62  ? 335 SER A CB  1 
ATOM   5802 O  OG  . SER C 1 338 ? 63.637  6.700   19.744  1.00 34.12  ? 335 SER A OG  1 
ATOM   5803 N  N   . GLY C 1 339 ? 64.316  3.292   19.705  1.00 45.57  ? 336 GLY A N   1 
ATOM   5804 C  CA  . GLY C 1 339 ? 65.248  2.584   18.834  1.00 43.98  ? 336 GLY A CA  1 
ATOM   5805 C  C   . GLY C 1 339 ? 64.650  1.445   18.031  1.00 40.74  ? 336 GLY A C   1 
ATOM   5806 O  O   . GLY C 1 339 ? 63.467  1.459   17.692  1.00 37.41  ? 336 GLY A O   1 
ATOM   5807 N  N   . THR C 1 340 ? 65.482  0.447   17.744  1.00 42.01  ? 337 THR A N   1 
ATOM   5808 C  CA  . THR C 1 340 ? 65.131  -0.643  16.837  1.00 43.67  ? 337 THR A CA  1 
ATOM   5809 C  C   . THR C 1 340 ? 63.961  -1.502  17.314  1.00 41.61  ? 337 THR A C   1 
ATOM   5810 O  O   . THR C 1 340 ? 63.252  -2.088  16.496  1.00 49.07  ? 337 THR A O   1 
ATOM   5811 C  CB  . THR C 1 340 ? 66.354  -1.542  16.545  1.00 45.20  ? 337 THR A CB  1 
ATOM   5812 O  OG1 . THR C 1 340 ? 67.479  -0.720  16.207  1.00 46.71  ? 337 THR A OG1 1 
ATOM   5813 C  CG2 . THR C 1 340 ? 66.063  -2.488  15.387  1.00 45.65  ? 337 THR A CG2 1 
ATOM   5814 N  N   . ASP C 1 341 ? 63.752  -1.576  18.625  1.00 39.77  ? 338 ASP A N   1 
ATOM   5815 C  CA  . ASP C 1 341 ? 62.659  -2.389  19.163  1.00 40.78  ? 338 ASP A CA  1 
ATOM   5816 C  C   . ASP C 1 341 ? 61.288  -1.771  18.884  1.00 38.24  ? 338 ASP A C   1 
ATOM   5817 O  O   . ASP C 1 341 ? 60.260  -2.308  19.299  1.00 41.37  ? 338 ASP A O   1 
ATOM   5818 C  CB  . ASP C 1 341 ? 62.846  -2.667  20.661  1.00 48.24  ? 338 ASP A CB  1 
ATOM   5819 C  CG  . ASP C 1 341 ? 62.856  -1.404  21.500  1.00 57.13  ? 338 ASP A CG  1 
ATOM   5820 O  OD1 . ASP C 1 341 ? 63.445  -0.393  21.060  1.00 65.37  ? 338 ASP A OD1 1 
ATOM   5821 O  OD2 . ASP C 1 341 ? 62.282  -1.429  22.610  1.00 55.63  ? 338 ASP A OD2 1 
ATOM   5822 N  N   . ARG C 1 342 ? 61.291  -0.642  18.176  1.00 40.98  ? 339 ARG A N   1 
ATOM   5823 C  CA  . ARG C 1 342 ? 60.068  0.018   17.703  1.00 36.73  ? 339 ARG A CA  1 
ATOM   5824 C  C   . ARG C 1 342 ? 59.267  0.695   18.814  1.00 38.85  ? 339 ARG A C   1 
ATOM   5825 O  O   . ARG C 1 342 ? 58.152  1.163   18.583  1.00 39.45  ? 339 ARG A O   1 
ATOM   5826 C  CB  . ARG C 1 342 ? 59.176  -0.969  16.944  1.00 30.76  ? 339 ARG A CB  1 
ATOM   5827 C  CG  . ARG C 1 342 ? 59.886  -1.725  15.837  1.00 32.31  ? 339 ARG A CG  1 
ATOM   5828 C  CD  . ARG C 1 342 ? 58.954  -2.719  15.164  1.00 37.08  ? 339 ARG A CD  1 
ATOM   5829 N  NE  . ARG C 1 342 ? 58.282  -3.582  16.131  1.00 39.04  ? 339 ARG A NE  1 
ATOM   5830 C  CZ  . ARG C 1 342 ? 58.783  -4.724  16.592  1.00 36.23  ? 339 ARG A CZ  1 
ATOM   5831 N  NH1 . ARG C 1 342 ? 59.968  -5.149  16.175  1.00 36.60  ? 339 ARG A NH1 1 
ATOM   5832 N  NH2 . ARG C 1 342 ? 58.099  -5.442  17.470  1.00 30.04  ? 339 ARG A NH2 1 
ATOM   5833 N  N   . ARG C 1 343 ? 59.833  0.743   20.016  1.00 38.97  ? 340 ARG A N   1 
ATOM   5834 C  CA  . ARG C 1 343 ? 59.155  1.367   21.146  1.00 35.57  ? 340 ARG A CA  1 
ATOM   5835 C  C   . ARG C 1 343 ? 59.780  2.721   21.478  1.00 32.55  ? 340 ARG A C   1 
ATOM   5836 O  O   . ARG C 1 343 ? 60.942  2.980   21.162  1.00 33.82  ? 340 ARG A O   1 
ATOM   5837 C  CB  . ARG C 1 343 ? 59.217  0.459   22.379  1.00 38.73  ? 340 ARG A CB  1 
ATOM   5838 C  CG  . ARG C 1 343 ? 58.795  -0.988  22.154  1.00 41.41  ? 340 ARG A CG  1 
ATOM   5839 C  CD  . ARG C 1 343 ? 57.285  -1.155  22.189  1.00 51.89  ? 340 ARG A CD  1 
ATOM   5840 N  NE  . ARG C 1 343 ? 56.691  -1.200  20.855  1.00 60.43  ? 340 ARG A NE  1 
ATOM   5841 C  CZ  . ARG C 1 343 ? 56.145  -2.286  20.315  1.00 60.05  ? 340 ARG A CZ  1 
ATOM   5842 N  NH1 . ARG C 1 343 ? 56.109  -3.422  20.996  1.00 62.91  ? 340 ARG A NH1 1 
ATOM   5843 N  NH2 . ARG C 1 343 ? 55.629  -2.235  19.095  1.00 60.17  ? 340 ARG A NH2 1 
ATOM   5844 N  N   . LEU C 1 344 ? 59.000  3.590   22.107  1.00 31.98  ? 341 LEU A N   1 
ATOM   5845 C  CA  . LEU C 1 344 ? 59.548  4.801   22.696  1.00 31.61  ? 341 LEU A CA  1 
ATOM   5846 C  C   . LEU C 1 344 ? 59.220  4.768   24.182  1.00 34.83  ? 341 LEU A C   1 
ATOM   5847 O  O   . LEU C 1 344 ? 58.048  4.728   24.566  1.00 29.45  ? 341 LEU A O   1 
ATOM   5848 C  CB  . LEU C 1 344 ? 58.981  6.059   22.028  1.00 30.21  ? 341 LEU A CB  1 
ATOM   5849 C  CG  . LEU C 1 344 ? 59.695  7.390   22.321  1.00 32.12  ? 341 LEU A CG  1 
ATOM   5850 C  CD1 . LEU C 1 344 ? 59.366  8.435   21.260  1.00 32.07  ? 341 LEU A CD1 1 
ATOM   5851 C  CD2 . LEU C 1 344 ? 59.369  7.927   23.712  1.00 20.93  ? 341 LEU A CD2 1 
ATOM   5852 N  N   . ASN C 1 345 ? 60.261  4.755   25.010  1.00 32.07  ? 342 ASN A N   1 
ATOM   5853 C  CA  . ASN C 1 345 ? 60.096  4.688   26.457  1.00 30.08  ? 342 ASN A CA  1 
ATOM   5854 C  C   . ASN C 1 345 ? 60.252  6.057   27.103  1.00 30.83  ? 342 ASN A C   1 
ATOM   5855 O  O   . ASN C 1 345 ? 61.172  6.809   26.770  1.00 28.29  ? 342 ASN A O   1 
ATOM   5856 C  CB  . ASN C 1 345 ? 61.120  3.732   27.075  1.00 34.77  ? 342 ASN A CB  1 
ATOM   5857 C  CG  . ASN C 1 345 ? 60.946  2.297   26.610  1.00 40.36  ? 342 ASN A CG  1 
ATOM   5858 O  OD1 . ASN C 1 345 ? 61.763  1.430   26.933  1.00 39.54  ? 342 ASN A OD1 1 
ATOM   5859 N  ND2 . ASN C 1 345 ? 59.886  2.037   25.849  1.00 37.55  ? 342 ASN A ND2 1 
ATOM   5860 N  N   . VAL C 1 346 ? 59.351  6.375   28.026  1.00 24.69  ? 343 VAL A N   1 
ATOM   5861 C  CA  . VAL C 1 346 ? 59.478  7.586   28.825  1.00 29.46  ? 343 VAL A CA  1 
ATOM   5862 C  C   . VAL C 1 346 ? 59.837  7.196   30.255  1.00 30.92  ? 343 VAL A C   1 
ATOM   5863 O  O   . VAL C 1 346 ? 59.171  6.356   30.862  1.00 29.44  ? 343 VAL A O   1 
ATOM   5864 C  CB  . VAL C 1 346 ? 58.185  8.433   28.809  1.00 25.12  ? 343 VAL A CB  1 
ATOM   5865 C  CG1 . VAL C 1 346 ? 58.378  9.713   29.605  1.00 24.30  ? 343 VAL A CG1 1 
ATOM   5866 C  CG2 . VAL C 1 346 ? 57.777  8.763   27.382  1.00 25.56  ? 343 VAL A CG2 1 
ATOM   5867 N  N   . TRP C 1 347 ? 60.898  7.797   30.784  1.00 34.70  ? 344 TRP A N   1 
ATOM   5868 C  CA  . TRP C 1 347 ? 61.375  7.467   32.127  1.00 41.11  ? 344 TRP A CA  1 
ATOM   5869 C  C   . TRP C 1 347 ? 61.179  8.621   33.108  1.00 38.44  ? 344 TRP A C   1 
ATOM   5870 O  O   . TRP C 1 347 ? 61.306  9.788   32.740  1.00 37.25  ? 344 TRP A O   1 
ATOM   5871 C  CB  . TRP C 1 347 ? 62.853  7.071   32.095  1.00 37.56  ? 344 TRP A CB  1 
ATOM   5872 C  CG  . TRP C 1 347 ? 63.222  6.143   30.978  1.00 39.41  ? 344 TRP A CG  1 
ATOM   5873 C  CD1 . TRP C 1 347 ? 63.579  6.491   29.709  1.00 41.38  ? 344 TRP A CD1 1 
ATOM   5874 C  CD2 . TRP C 1 347 ? 63.288  4.712   31.035  1.00 44.33  ? 344 TRP A CD2 1 
ATOM   5875 N  NE1 . TRP C 1 347 ? 63.856  5.368   28.969  1.00 42.61  ? 344 TRP A NE1 1 
ATOM   5876 C  CE2 . TRP C 1 347 ? 63.687  4.262   29.759  1.00 44.36  ? 344 TRP A CE2 1 
ATOM   5877 C  CE3 . TRP C 1 347 ? 63.047  3.767   32.039  1.00 42.50  ? 344 TRP A CE3 1 
ATOM   5878 C  CZ2 . TRP C 1 347 ? 63.850  2.908   29.461  1.00 40.63  ? 344 TRP A CZ2 1 
ATOM   5879 C  CZ3 . TRP C 1 347 ? 63.209  2.425   31.740  1.00 41.65  ? 344 TRP A CZ3 1 
ATOM   5880 C  CH2 . TRP C 1 347 ? 63.607  2.008   30.461  1.00 40.13  ? 344 TRP A CH2 1 
ATOM   5881 N  N   . ASP C 1 348 ? 60.870  8.282   34.356  1.00 39.26  ? 345 ASP A N   1 
ATOM   5882 C  CA  . ASP C 1 348 ? 60.740  9.272   35.420  1.00 42.00  ? 345 ASP A CA  1 
ATOM   5883 C  C   . ASP C 1 348 ? 61.783  9.021   36.509  1.00 45.11  ? 345 ASP A C   1 
ATOM   5884 O  O   . ASP C 1 348 ? 61.656  8.084   37.297  1.00 46.40  ? 345 ASP A O   1 
ATOM   5885 C  CB  . ASP C 1 348 ? 59.331  9.239   36.018  1.00 40.31  ? 345 ASP A CB  1 
ATOM   5886 C  CG  . ASP C 1 348 ? 59.102  10.340  37.043  1.00 44.86  ? 345 ASP A CG  1 
ATOM   5887 O  OD1 . ASP C 1 348 ? 60.022  11.157  37.265  1.00 45.33  ? 345 ASP A OD1 1 
ATOM   5888 O  OD2 . ASP C 1 348 ? 57.998  10.390  37.626  1.00 40.95  ? 345 ASP A OD2 1 
ATOM   5889 N  N   . LEU C 1 349 ? 62.810  9.868   36.546  1.00 45.74  ? 346 LEU A N   1 
ATOM   5890 C  CA  . LEU C 1 349 ? 63.908  9.718   37.501  1.00 45.87  ? 346 LEU A CA  1 
ATOM   5891 C  C   . LEU C 1 349 ? 63.430  9.714   38.951  1.00 47.62  ? 346 LEU A C   1 
ATOM   5892 O  O   . LEU C 1 349 ? 63.993  9.016   39.796  1.00 50.47  ? 346 LEU A O   1 
ATOM   5893 C  CB  . LEU C 1 349 ? 64.950  10.826  37.309  1.00 45.32  ? 346 LEU A CB  1 
ATOM   5894 C  CG  . LEU C 1 349 ? 65.684  10.937  35.969  1.00 44.04  ? 346 LEU A CG  1 
ATOM   5895 C  CD1 . LEU C 1 349 ? 66.811  11.954  36.063  1.00 44.12  ? 346 LEU A CD1 1 
ATOM   5896 C  CD2 . LEU C 1 349 ? 66.224  9.596   35.532  1.00 43.39  ? 346 LEU A CD2 1 
ATOM   5897 N  N   . SER C 1 350 ? 62.388  10.490  39.233  1.00 43.62  ? 347 SER A N   1 
ATOM   5898 C  CA  . SER C 1 350 ? 61.894  10.658  40.597  1.00 46.16  ? 347 SER A CA  1 
ATOM   5899 C  C   . SER C 1 350 ? 61.280  9.386   41.182  1.00 48.54  ? 347 SER A C   1 
ATOM   5900 O  O   . SER C 1 350 ? 60.744  9.400   42.291  1.00 52.86  ? 347 SER A O   1 
ATOM   5901 C  CB  . SER C 1 350 ? 60.885  11.808  40.661  1.00 41.52  ? 347 SER A CB  1 
ATOM   5902 O  OG  . SER C 1 350 ? 59.670  11.454  40.029  1.00 48.09  ? 347 SER A OG  1 
ATOM   5903 N  N   . LYS C 1 351 ? 61.364  8.288   40.438  1.00 50.84  ? 348 LYS A N   1 
ATOM   5904 C  CA  . LYS C 1 351 ? 60.832  7.007   40.894  1.00 53.21  ? 348 LYS A CA  1 
ATOM   5905 C  C   . LYS C 1 351 ? 61.879  5.902   40.788  1.00 54.08  ? 348 LYS A C   1 
ATOM   5906 O  O   . LYS C 1 351 ? 61.538  4.722   40.696  1.00 54.57  ? 348 LYS A O   1 
ATOM   5907 C  CB  . LYS C 1 351 ? 59.586  6.626   40.089  1.00 52.98  ? 348 LYS A CB  1 
ATOM   5908 C  CG  . LYS C 1 351 ? 58.420  7.587   40.253  1.00 59.59  ? 348 LYS A CG  1 
ATOM   5909 C  CD  . LYS C 1 351 ? 57.238  7.185   39.383  1.00 60.86  ? 348 LYS A CD  1 
ATOM   5910 C  CE  . LYS C 1 351 ? 56.089  8.171   39.531  1.00 64.90  ? 348 LYS A CE  1 
ATOM   5911 N  NZ  . LYS C 1 351 ? 54.953  7.843   38.626  1.00 65.21  ? 348 LYS A NZ  1 
ATOM   5912 N  N   . ILE C 1 352 ? 63.150  6.289   40.811  1.00 54.59  ? 349 ILE A N   1 
ATOM   5913 C  CA  . ILE C 1 352 ? 64.250  5.345   40.605  1.00 58.15  ? 349 ILE A CA  1 
ATOM   5914 C  C   . ILE C 1 352 ? 64.452  4.358   41.759  1.00 66.07  ? 349 ILE A C   1 
ATOM   5915 O  O   . ILE C 1 352 ? 64.664  3.166   41.529  1.00 72.65  ? 349 ILE A O   1 
ATOM   5916 C  CB  . ILE C 1 352 ? 65.574  6.079   40.283  1.00 56.84  ? 349 ILE A CB  1 
ATOM   5917 C  CG1 . ILE C 1 352 ? 65.611  6.464   38.799  1.00 56.92  ? 349 ILE A CG1 1 
ATOM   5918 C  CG2 . ILE C 1 352 ? 66.774  5.214   40.636  1.00 50.78  ? 349 ILE A CG2 1 
ATOM   5919 C  CD1 . ILE C 1 352 ? 66.832  7.260   38.394  1.00 54.66  ? 349 ILE A CD1 1 
ATOM   5920 N  N   . GLY C 1 353 ? 64.378  4.846   42.993  1.00 70.14  ? 350 GLY A N   1 
ATOM   5921 C  CA  . GLY C 1 353 ? 64.590  3.984   44.155  1.00 74.90  ? 350 GLY A CA  1 
ATOM   5922 C  C   . GLY C 1 353 ? 63.302  3.428   44.732  1.00 73.96  ? 350 GLY A C   1 
ATOM   5923 O  O   . GLY C 1 353 ? 63.275  2.952   45.865  1.00 79.25  ? 350 GLY A O   1 
ATOM   5924 N  N   . GLU C 1 354 ? 62.236  3.475   43.941  1.00 74.55  ? 351 GLU A N   1 
ATOM   5925 C  CA  . GLU C 1 354 ? 60.897  3.144   44.420  1.00 75.69  ? 351 GLU A CA  1 
ATOM   5926 C  C   . GLU C 1 354 ? 60.638  1.639   44.518  1.00 78.30  ? 351 GLU A C   1 
ATOM   5927 O  O   . GLU C 1 354 ? 61.021  0.870   43.635  1.00 75.87  ? 351 GLU A O   1 
ATOM   5928 C  CB  . GLU C 1 354 ? 59.852  3.813   43.524  1.00 73.63  ? 351 GLU A CB  1 
ATOM   5929 C  CG  . GLU C 1 354 ? 58.439  3.809   44.075  1.00 75.57  ? 351 GLU A CG  1 
ATOM   5930 C  CD  . GLU C 1 354 ? 57.521  4.742   43.310  1.00 76.67  ? 351 GLU A CD  1 
ATOM   5931 O  OE1 . GLU C 1 354 ? 56.476  4.274   42.809  1.00 74.80  ? 351 GLU A OE1 1 
ATOM   5932 O  OE2 . GLU C 1 354 ? 57.849  5.943   43.201  1.00 78.27  ? 351 GLU A OE2 1 
ATOM   5933 N  N   . GLU C 1 355 ? 59.987  1.230   45.605  1.00 83.50  ? 352 GLU A N   1 
ATOM   5934 C  CA  . GLU C 1 355 ? 59.620  -0.167  45.815  1.00 86.66  ? 352 GLU A CA  1 
ATOM   5935 C  C   . GLU C 1 355 ? 58.354  -0.503  45.034  1.00 83.25  ? 352 GLU A C   1 
ATOM   5936 O  O   . GLU C 1 355 ? 57.534  0.374   44.761  1.00 84.98  ? 352 GLU A O   1 
ATOM   5937 C  CB  . GLU C 1 355 ? 59.416  -0.451  47.307  1.00 89.31  ? 352 GLU A CB  1 
ATOM   5938 C  CG  . GLU C 1 355 ? 58.364  0.432   47.975  1.00 94.32  ? 352 GLU A CG  1 
ATOM   5939 C  CD  . GLU C 1 355 ? 58.300  0.242   49.481  1.00 94.14  ? 352 GLU A CD  1 
ATOM   5940 O  OE1 . GLU C 1 355 ? 59.238  -0.356  50.051  1.00 98.03  ? 352 GLU A OE1 1 
ATOM   5941 O  OE2 . GLU C 1 355 ? 57.312  0.697   50.098  1.00 94.50  ? 352 GLU A OE2 1 
ATOM   5942 N  N   . GLN C 1 356 ? 58.196  -1.774  44.675  1.00 79.44  ? 353 GLN A N   1 
ATOM   5943 C  CA  . GLN C 1 356 ? 57.050  -2.202  43.879  1.00 76.14  ? 353 GLN A CA  1 
ATOM   5944 C  C   . GLN C 1 356 ? 56.704  -3.671  44.107  1.00 75.43  ? 353 GLN A C   1 
ATOM   5945 O  O   . GLN C 1 356 ? 57.562  -4.470  44.483  1.00 72.59  ? 353 GLN A O   1 
ATOM   5946 C  CB  . GLN C 1 356 ? 57.305  -1.941  42.390  1.00 75.82  ? 353 GLN A CB  1 
ATOM   5947 C  CG  . GLN C 1 356 ? 58.607  -2.532  41.863  1.00 74.86  ? 353 GLN A CG  1 
ATOM   5948 C  CD  . GLN C 1 356 ? 58.869  -2.184  40.407  1.00 75.27  ? 353 GLN A CD  1 
ATOM   5949 O  OE1 . GLN C 1 356 ? 59.861  -2.621  39.823  1.00 74.69  ? 353 GLN A OE1 1 
ATOM   5950 N  NE2 . GLN C 1 356 ? 57.980  -1.394  39.813  1.00 74.81  ? 353 GLN A NE2 1 
ATOM   5951 N  N   . SER C 1 357 ? 55.441  -4.016  43.874  1.00 77.12  ? 354 SER A N   1 
ATOM   5952 C  CA  . SER C 1 357 ? 54.976  -5.391  44.011  1.00 79.73  ? 354 SER A CA  1 
ATOM   5953 C  C   . SER C 1 357 ? 55.547  -6.277  42.908  1.00 82.74  ? 354 SER A C   1 
ATOM   5954 O  O   . SER C 1 357 ? 56.180  -5.789  41.972  1.00 84.87  ? 354 SER A O   1 
ATOM   5955 C  CB  . SER C 1 357 ? 53.447  -5.443  43.986  1.00 81.75  ? 354 SER A CB  1 
ATOM   5956 O  OG  . SER C 1 357 ? 52.941  -5.027  42.729  1.00 81.42  ? 354 SER A OG  1 
ATOM   5957 N  N   . ALA C 1 358 ? 55.316  -7.582  43.022  1.00 86.58  ? 355 ALA A N   1 
ATOM   5958 C  CA  . ALA C 1 358 ? 55.835  -8.543  42.055  1.00 87.35  ? 355 ALA A CA  1 
ATOM   5959 C  C   . ALA C 1 358 ? 55.160  -8.398  40.694  1.00 88.24  ? 355 ALA A C   1 
ATOM   5960 O  O   . ALA C 1 358 ? 55.806  -8.545  39.656  1.00 87.08  ? 355 ALA A O   1 
ATOM   5961 C  CB  . ALA C 1 358 ? 55.676  -9.963  42.580  1.00 84.75  ? 355 ALA A CB  1 
ATOM   5962 N  N   . GLU C 1 359 ? 53.863  -8.104  40.707  1.00 88.92  ? 356 GLU A N   1 
ATOM   5963 C  CA  . GLU C 1 359 ? 53.090  -7.969  39.473  1.00 91.42  ? 356 GLU A CA  1 
ATOM   5964 C  C   . GLU C 1 359 ? 53.392  -6.670  38.725  1.00 89.79  ? 356 GLU A C   1 
ATOM   5965 O  O   . GLU C 1 359 ? 53.182  -6.581  37.515  1.00 90.73  ? 356 GLU A O   1 
ATOM   5966 C  CB  . GLU C 1 359 ? 51.589  -8.093  39.757  1.00 92.48  ? 356 GLU A CB  1 
ATOM   5967 C  CG  . GLU C 1 359 ? 51.086  -7.212  40.893  1.00 95.72  ? 356 GLU A CG  1 
ATOM   5968 C  CD  . GLU C 1 359 ? 49.611  -7.419  41.186  1.00 96.25  ? 356 GLU A CD  1 
ATOM   5969 O  OE1 . GLU C 1 359 ? 49.103  -6.807  42.150  1.00 98.78  ? 356 GLU A OE1 1 
ATOM   5970 O  OE2 . GLU C 1 359 ? 48.957  -8.192  40.454  1.00 98.13  ? 356 GLU A OE2 1 
ATOM   5971 N  N   . ASP C 1 360 ? 53.882  -5.668  39.449  1.00 88.04  ? 357 ASP A N   1 
ATOM   5972 C  CA  . ASP C 1 360 ? 54.273  -4.399  38.840  1.00 83.65  ? 357 ASP A CA  1 
ATOM   5973 C  C   . ASP C 1 360 ? 55.727  -4.425  38.383  1.00 81.26  ? 357 ASP A C   1 
ATOM   5974 O  O   . ASP C 1 360 ? 56.098  -3.738  37.432  1.00 82.37  ? 357 ASP A O   1 
ATOM   5975 C  CB  . ASP C 1 360 ? 54.052  -3.236  39.811  1.00 83.97  ? 357 ASP A CB  1 
ATOM   5976 C  CG  . ASP C 1 360 ? 52.641  -2.680  39.747  1.00 86.58  ? 357 ASP A CG  1 
ATOM   5977 O  OD1 . ASP C 1 360 ? 51.850  -3.142  38.896  1.00 86.78  ? 357 ASP A OD1 1 
ATOM   5978 O  OD2 . ASP C 1 360 ? 52.324  -1.774  40.546  1.00 86.39  ? 357 ASP A OD2 1 
ATOM   5979 N  N   . ALA C 1 361 ? 56.546  -5.220  39.066  1.00 79.39  ? 358 ALA A N   1 
ATOM   5980 C  CA  . ALA C 1 361 ? 57.962  -5.334  38.730  1.00 76.44  ? 358 ALA A CA  1 
ATOM   5981 C  C   . ALA C 1 361 ? 58.176  -6.191  37.485  1.00 74.96  ? 358 ALA A C   1 
ATOM   5982 O  O   . ALA C 1 361 ? 59.231  -6.129  36.851  1.00 72.49  ? 358 ALA A O   1 
ATOM   5983 C  CB  . ALA C 1 361 ? 58.745  -5.898  39.906  1.00 77.06  ? 358 ALA A CB  1 
ATOM   5984 N  N   . GLU C 1 362 ? 57.170  -6.990  37.141  1.00 74.67  ? 359 GLU A N   1 
ATOM   5985 C  CA  . GLU C 1 362 ? 57.225  -7.821  35.943  1.00 74.09  ? 359 GLU A CA  1 
ATOM   5986 C  C   . GLU C 1 362 ? 57.116  -6.974  34.679  1.00 71.16  ? 359 GLU A C   1 
ATOM   5987 O  O   . GLU C 1 362 ? 57.598  -7.364  33.616  1.00 69.88  ? 359 GLU A O   1 
ATOM   5988 C  CB  . GLU C 1 362 ? 56.118  -8.878  35.969  1.00 73.02  ? 359 GLU A CB  1 
ATOM   5989 C  CG  . GLU C 1 362 ? 56.395  -10.043 36.910  1.00 77.61  ? 359 GLU A CG  1 
ATOM   5990 C  CD  . GLU C 1 362 ? 55.239  -11.025 36.988  1.00 79.65  ? 359 GLU A CD  1 
ATOM   5991 O  OE1 . GLU C 1 362 ? 54.382  -11.019 36.076  1.00 83.68  ? 359 GLU A OE1 1 
ATOM   5992 O  OE2 . GLU C 1 362 ? 55.187  -11.805 37.962  1.00 79.90  ? 359 GLU A OE2 1 
ATOM   5993 N  N   . ASP C 1 363 ? 56.487  -5.809  34.806  1.00 70.92  ? 360 ASP A N   1 
ATOM   5994 C  CA  . ASP C 1 363 ? 56.290  -4.907  33.676  1.00 67.87  ? 360 ASP A CA  1 
ATOM   5995 C  C   . ASP C 1 363 ? 57.487  -3.983  33.466  1.00 67.61  ? 360 ASP A C   1 
ATOM   5996 O  O   . ASP C 1 363 ? 57.562  -3.272  32.464  1.00 71.88  ? 360 ASP A O   1 
ATOM   5997 C  CB  . ASP C 1 363 ? 55.015  -4.084  33.870  1.00 66.42  ? 360 ASP A CB  1 
ATOM   5998 C  CG  . ASP C 1 363 ? 53.784  -4.952  34.054  1.00 69.94  ? 360 ASP A CG  1 
ATOM   5999 O  OD1 . ASP C 1 363 ? 53.761  -6.078  33.511  1.00 67.50  ? 360 ASP A OD1 1 
ATOM   6000 O  OD2 . ASP C 1 363 ? 52.836  -4.507  34.739  1.00 69.18  ? 360 ASP A OD2 1 
ATOM   6001 N  N   . GLY C 1 364 ? 58.418  -3.994  34.415  1.00 64.37  ? 361 GLY A N   1 
ATOM   6002 C  CA  . GLY C 1 364 ? 59.625  -3.180  34.313  1.00 58.50  ? 361 GLY A CA  1 
ATOM   6003 C  C   . GLY C 1 364 ? 59.960  -2.450  35.600  1.00 57.89  ? 361 GLY A C   1 
ATOM   6004 O  O   . GLY C 1 364 ? 59.228  -2.554  36.585  1.00 58.78  ? 361 GLY A O   1 
ATOM   6005 N  N   . PRO C 1 365 ? 61.075  -1.702  35.597  1.00 55.56  ? 362 PRO A N   1 
ATOM   6006 C  CA  . PRO C 1 365 ? 61.524  -0.919  36.743  1.00 52.37  ? 362 PRO A CA  1 
ATOM   6007 C  C   . PRO C 1 365 ? 60.555  0.216   37.061  1.00 54.55  ? 362 PRO A C   1 
ATOM   6008 O  O   . PRO C 1 365 ? 59.835  0.674   36.175  1.00 54.33  ? 362 PRO A O   1 
ATOM   6009 C  CB  . PRO C 1 365 ? 62.872  -0.359  36.280  1.00 53.43  ? 362 PRO A CB  1 
ATOM   6010 C  CG  . PRO C 1 365 ? 62.795  -0.362  34.798  1.00 56.83  ? 362 PRO A CG  1 
ATOM   6011 C  CD  . PRO C 1 365 ? 61.988  -1.571  34.449  1.00 55.90  ? 362 PRO A CD  1 
ATOM   6012 N  N   . PRO C 1 366 ? 60.542  0.672   38.324  1.00 57.53  ? 363 PRO A N   1 
ATOM   6013 C  CA  . PRO C 1 366 ? 59.596  1.680   38.805  1.00 54.64  ? 363 PRO A CA  1 
ATOM   6014 C  C   . PRO C 1 366 ? 59.691  3.024   38.081  1.00 51.11  ? 363 PRO A C   1 
ATOM   6015 O  O   . PRO C 1 366 ? 58.716  3.777   38.062  1.00 51.28  ? 363 PRO A O   1 
ATOM   6016 C  CB  . PRO C 1 366 ? 59.983  1.848   40.280  1.00 52.07  ? 363 PRO A CB  1 
ATOM   6017 C  CG  . PRO C 1 366 ? 61.394  1.363   40.364  1.00 52.48  ? 363 PRO A CG  1 
ATOM   6018 C  CD  . PRO C 1 366 ? 61.460  0.236   39.390  1.00 54.53  ? 363 PRO A CD  1 
ATOM   6019 N  N   . GLU C 1 367 ? 60.846  3.324   37.495  1.00 43.09  ? 364 GLU A N   1 
ATOM   6020 C  CA  . GLU C 1 367 ? 61.028  4.607   36.818  1.00 47.94  ? 364 GLU A CA  1 
ATOM   6021 C  C   . GLU C 1 367 ? 60.519  4.601   35.374  1.00 49.37  ? 364 GLU A C   1 
ATOM   6022 O  O   . GLU C 1 367 ? 60.476  5.645   34.722  1.00 49.79  ? 364 GLU A O   1 
ATOM   6023 C  CB  . GLU C 1 367 ? 62.488  5.071   36.883  1.00 46.32  ? 364 GLU A CB  1 
ATOM   6024 C  CG  . GLU C 1 367 ? 63.463  4.244   36.066  1.00 53.25  ? 364 GLU A CG  1 
ATOM   6025 C  CD  . GLU C 1 367 ? 63.921  2.989   36.785  1.00 57.71  ? 364 GLU A CD  1 
ATOM   6026 O  OE1 . GLU C 1 367 ? 63.255  2.575   37.760  1.00 55.78  ? 364 GLU A OE1 1 
ATOM   6027 O  OE2 . GLU C 1 367 ? 64.950  2.416   36.370  1.00 56.08  ? 364 GLU A OE2 1 
ATOM   6028 N  N   . LEU C 1 368 ? 60.132  3.428   34.878  1.00 44.52  ? 365 LEU A N   1 
ATOM   6029 C  CA  . LEU C 1 368 ? 59.529  3.336   33.553  1.00 38.81  ? 365 LEU A CA  1 
ATOM   6030 C  C   . LEU C 1 368 ? 58.102  3.868   33.602  1.00 37.00  ? 365 LEU A C   1 
ATOM   6031 O  O   . LEU C 1 368 ? 57.204  3.217   34.134  1.00 38.89  ? 365 LEU A O   1 
ATOM   6032 C  CB  . LEU C 1 368 ? 59.538  1.895   33.039  1.00 35.28  ? 365 LEU A CB  1 
ATOM   6033 C  CG  . LEU C 1 368 ? 58.878  1.688   31.673  1.00 37.49  ? 365 LEU A CG  1 
ATOM   6034 C  CD1 . LEU C 1 368 ? 59.720  2.310   30.563  1.00 36.19  ? 365 LEU A CD1 1 
ATOM   6035 C  CD2 . LEU C 1 368 ? 58.630  0.211   31.403  1.00 38.26  ? 365 LEU A CD2 1 
ATOM   6036 N  N   . LEU C 1 369 ? 57.901  5.056   33.042  1.00 37.21  ? 366 LEU A N   1 
ATOM   6037 C  CA  . LEU C 1 369 ? 56.614  5.732   33.126  1.00 34.51  ? 366 LEU A CA  1 
ATOM   6038 C  C   . LEU C 1 369 ? 55.644  5.230   32.062  1.00 36.69  ? 366 LEU A C   1 
ATOM   6039 O  O   . LEU C 1 369 ? 54.467  5.001   32.343  1.00 39.96  ? 366 LEU A O   1 
ATOM   6040 C  CB  . LEU C 1 369 ? 56.802  7.244   32.971  1.00 36.20  ? 366 LEU A CB  1 
ATOM   6041 C  CG  . LEU C 1 369 ? 55.911  8.218   33.753  1.00 41.54  ? 366 LEU A CG  1 
ATOM   6042 C  CD1 . LEU C 1 369 ? 55.759  9.521   32.978  1.00 40.39  ? 366 LEU A CD1 1 
ATOM   6043 C  CD2 . LEU C 1 369 ? 54.543  7.637   34.065  1.00 44.87  ? 366 LEU A CD2 1 
ATOM   6044 N  N   . PHE C 1 370 ? 56.141  5.051   30.843  1.00 37.31  ? 367 PHE A N   1 
ATOM   6045 C  CA  . PHE C 1 370 ? 55.264  4.868   29.696  1.00 32.41  ? 367 PHE A CA  1 
ATOM   6046 C  C   . PHE C 1 370 ? 56.017  4.332   28.483  1.00 32.58  ? 367 PHE A C   1 
ATOM   6047 O  O   . PHE C 1 370 ? 57.096  4.818   28.145  1.00 40.25  ? 367 PHE A O   1 
ATOM   6048 C  CB  . PHE C 1 370 ? 54.610  6.213   29.358  1.00 26.83  ? 367 PHE A CB  1 
ATOM   6049 C  CG  . PHE C 1 370 ? 53.652  6.160   28.209  1.00 26.03  ? 367 PHE A CG  1 
ATOM   6050 C  CD1 . PHE C 1 370 ? 52.297  5.989   28.431  1.00 20.79  ? 367 PHE A CD1 1 
ATOM   6051 C  CD2 . PHE C 1 370 ? 54.103  6.302   26.904  1.00 23.69  ? 367 PHE A CD2 1 
ATOM   6052 C  CE1 . PHE C 1 370 ? 51.406  5.948   27.371  1.00 27.85  ? 367 PHE A CE1 1 
ATOM   6053 C  CE2 . PHE C 1 370 ? 53.217  6.258   25.839  1.00 28.40  ? 367 PHE A CE2 1 
ATOM   6054 C  CZ  . PHE C 1 370 ? 51.866  6.082   26.073  1.00 22.79  ? 367 PHE A CZ  1 
ATOM   6055 N  N   . ILE C 1 371 ? 55.441  3.327   27.830  1.00 28.28  ? 368 ILE A N   1 
ATOM   6056 C  CA  . ILE C 1 371 ? 55.994  2.805   26.585  1.00 29.81  ? 368 ILE A CA  1 
ATOM   6057 C  C   . ILE C 1 371 ? 55.060  3.108   25.422  1.00 32.03  ? 368 ILE A C   1 
ATOM   6058 O  O   . ILE C 1 371 ? 53.918  2.652   25.399  1.00 34.83  ? 368 ILE A O   1 
ATOM   6059 C  CB  . ILE C 1 371 ? 56.206  1.281   26.643  1.00 33.94  ? 368 ILE A CB  1 
ATOM   6060 C  CG1 . ILE C 1 371 ? 57.153  0.906   27.784  1.00 33.00  ? 368 ILE A CG1 1 
ATOM   6061 C  CG2 . ILE C 1 371 ? 56.741  0.767   25.309  1.00 29.06  ? 368 ILE A CG2 1 
ATOM   6062 C  CD1 . ILE C 1 371 ? 57.349  -0.588  27.938  1.00 32.65  ? 368 ILE A CD1 1 
ATOM   6063 N  N   . HIS C 1 372 ? 55.549  3.882   24.459  1.00 35.80  ? 369 HIS A N   1 
ATOM   6064 C  CA  . HIS C 1 372 ? 54.782  4.177   23.255  1.00 34.29  ? 369 HIS A CA  1 
ATOM   6065 C  C   . HIS C 1 372 ? 54.975  3.065   22.229  1.00 31.55  ? 369 HIS A C   1 
ATOM   6066 O  O   . HIS C 1 372 ? 56.081  2.856   21.728  1.00 33.36  ? 369 HIS A O   1 
ATOM   6067 C  CB  . HIS C 1 372 ? 55.205  5.524   22.667  1.00 31.34  ? 369 HIS A CB  1 
ATOM   6068 C  CG  . HIS C 1 372 ? 54.508  5.872   21.388  1.00 33.52  ? 369 HIS A CG  1 
ATOM   6069 N  ND1 . HIS C 1 372 ? 53.146  6.072   21.312  1.00 30.10  ? 369 HIS A ND1 1 
ATOM   6070 C  CD2 . HIS C 1 372 ? 54.987  6.064   20.136  1.00 27.80  ? 369 HIS A CD2 1 
ATOM   6071 C  CE1 . HIS C 1 372 ? 52.815  6.366   20.068  1.00 28.17  ? 369 HIS A CE1 1 
ATOM   6072 N  NE2 . HIS C 1 372 ? 53.914  6.370   19.335  1.00 28.99  ? 369 HIS A NE2 1 
ATOM   6073 N  N   . GLY C 1 373 ? 53.899  2.347   21.926  1.00 28.05  ? 370 GLY A N   1 
ATOM   6074 C  CA  . GLY C 1 373 ? 53.970  1.234   20.985  1.00 26.75  ? 370 GLY A CA  1 
ATOM   6075 C  C   . GLY C 1 373 ? 53.181  1.486   19.718  1.00 28.09  ? 370 GLY A C   1 
ATOM   6076 O  O   . GLY C 1 373 ? 52.619  0.562   19.135  1.00 37.81  ? 370 GLY A O   1 
ATOM   6077 N  N   . GLY C 1 374 ? 53.149  2.741   19.282  1.00 34.50  ? 371 GLY A N   1 
ATOM   6078 C  CA  . GLY C 1 374 ? 52.349  3.128   18.123  1.00 38.33  ? 371 GLY A CA  1 
ATOM   6079 C  C   . GLY C 1 374 ? 52.992  2.829   16.783  1.00 34.91  ? 371 GLY A C   1 
ATOM   6080 O  O   . GLY C 1 374 ? 52.308  2.745   15.763  1.00 34.39  ? 371 GLY A O   1 
ATOM   6081 N  N   . HIS C 1 375 ? 54.310  2.667   16.785  1.00 33.08  ? 372 HIS A N   1 
ATOM   6082 C  CA  . HIS C 1 375 ? 55.047  2.430   15.552  1.00 29.16  ? 372 HIS A CA  1 
ATOM   6083 C  C   . HIS C 1 375 ? 55.216  0.947   15.255  1.00 27.00  ? 372 HIS A C   1 
ATOM   6084 O  O   . HIS C 1 375 ? 55.298  0.123   16.164  1.00 32.27  ? 372 HIS A O   1 
ATOM   6085 C  CB  . HIS C 1 375 ? 56.402  3.132   15.597  1.00 30.69  ? 372 HIS A CB  1 
ATOM   6086 C  CG  . HIS C 1 375 ? 56.296  4.620   15.705  1.00 29.85  ? 372 HIS A CG  1 
ATOM   6087 N  ND1 . HIS C 1 375 ? 56.153  5.436   14.603  1.00 29.52  ? 372 HIS A ND1 1 
ATOM   6088 C  CD2 . HIS C 1 375 ? 56.291  5.438   16.784  1.00 23.13  ? 372 HIS A CD2 1 
ATOM   6089 C  CE1 . HIS C 1 375 ? 56.076  6.695   14.999  1.00 30.05  ? 372 HIS A CE1 1 
ATOM   6090 N  NE2 . HIS C 1 375 ? 56.156  6.723   16.317  1.00 23.93  ? 372 HIS A NE2 1 
ATOM   6091 N  N   . THR C 1 376 ? 55.263  0.618   13.969  0.50 21.49  ? 373 THR A N   1 
ATOM   6092 C  CA  . THR C 1 376 ? 55.342  -0.766  13.534  0.50 15.90  ? 373 THR A CA  1 
ATOM   6093 C  C   . THR C 1 376 ? 56.700  -1.061  12.910  0.50 18.72  ? 373 THR A C   1 
ATOM   6094 O  O   . THR C 1 376 ? 56.942  -2.156  12.406  0.50 16.35  ? 373 THR A O   1 
ATOM   6095 C  CB  . THR C 1 376 ? 54.219  -1.092  12.541  0.50 17.09  ? 373 THR A CB  1 
ATOM   6096 O  OG1 . THR C 1 376 ? 54.124  -0.045  11.566  0.50 18.45  ? 373 THR A OG1 1 
ATOM   6097 C  CG2 . THR C 1 376 ? 52.892  -1.206  13.274  0.50 11.36  ? 373 THR A CG2 1 
ATOM   6098 N  N   . ALA C 1 377 ? 57.584  -0.070  12.961  1.00 26.60  ? 374 ALA A N   1 
ATOM   6099 C  CA  . ALA C 1 377 ? 58.944  -0.205  12.452  1.00 26.48  ? 374 ALA A CA  1 
ATOM   6100 C  C   . ALA C 1 377 ? 59.909  0.584   13.327  1.00 25.78  ? 374 ALA A C   1 
ATOM   6101 O  O   . ALA C 1 377 ? 59.488  1.317   14.220  1.00 32.42  ? 374 ALA A O   1 
ATOM   6102 C  CB  . ALA C 1 377 ? 59.021  0.275   11.012  1.00 19.17  ? 374 ALA A CB  1 
ATOM   6103 N  N   . LYS C 1 378 ? 61.204  0.436   13.067  1.00 34.74  ? 375 LYS A N   1 
ATOM   6104 C  CA  . LYS C 1 378 ? 62.228  1.115   13.855  1.00 33.72  ? 375 LYS A CA  1 
ATOM   6105 C  C   . LYS C 1 378 ? 61.976  2.616   13.928  1.00 35.43  ? 375 LYS A C   1 
ATOM   6106 O  O   . LYS C 1 378 ? 61.700  3.255   12.915  1.00 34.19  ? 375 LYS A O   1 
ATOM   6107 C  CB  . LYS C 1 378 ? 63.616  0.858   13.267  1.00 34.64  ? 375 LYS A CB  1 
ATOM   6108 C  CG  . LYS C 1 378 ? 64.713  1.692   13.910  1.00 43.00  ? 375 LYS A CG  1 
ATOM   6109 C  CD  . LYS C 1 378 ? 66.048  1.501   13.215  1.00 45.44  ? 375 LYS A CD  1 
ATOM   6110 C  CE  . LYS C 1 378 ? 67.146  2.268   13.930  1.00 45.68  ? 375 LYS A CE  1 
ATOM   6111 N  NZ  . LYS C 1 378 ? 68.456  2.129   13.240  1.00 49.98  ? 375 LYS A NZ  1 
ATOM   6112 N  N   . ILE C 1 379 ? 62.075  3.171   15.133  1.00 33.57  ? 376 ILE A N   1 
ATOM   6113 C  CA  . ILE C 1 379 ? 61.938  4.608   15.331  1.00 30.11  ? 376 ILE A CA  1 
ATOM   6114 C  C   . ILE C 1 379 ? 63.275  5.296   15.078  1.00 34.16  ? 376 ILE A C   1 
ATOM   6115 O  O   . ILE C 1 379 ? 64.245  5.071   15.801  1.00 39.97  ? 376 ILE A O   1 
ATOM   6116 C  CB  . ILE C 1 379 ? 61.437  4.941   16.752  1.00 28.37  ? 376 ILE A CB  1 
ATOM   6117 C  CG1 . ILE C 1 379 ? 60.055  4.324   16.987  1.00 30.88  ? 376 ILE A CG1 1 
ATOM   6118 C  CG2 . ILE C 1 379 ? 61.393  6.449   16.963  1.00 26.23  ? 376 ILE A CG2 1 
ATOM   6119 C  CD1 . ILE C 1 379 ? 59.475  4.593   18.363  1.00 26.65  ? 376 ILE A CD1 1 
ATOM   6120 N  N   . SER C 1 380 ? 63.319  6.129   14.042  1.00 38.09  ? 377 SER A N   1 
ATOM   6121 C  CA  . SER C 1 380 ? 64.545  6.824   13.663  1.00 32.04  ? 377 SER A CA  1 
ATOM   6122 C  C   . SER C 1 380 ? 64.846  7.980   14.605  1.00 36.58  ? 377 SER A C   1 
ATOM   6123 O  O   . SER C 1 380 ? 65.954  8.099   15.127  1.00 43.89  ? 377 SER A O   1 
ATOM   6124 C  CB  . SER C 1 380 ? 64.441  7.347   12.229  1.00 37.14  ? 377 SER A CB  1 
ATOM   6125 O  OG  . SER C 1 380 ? 64.241  6.290   11.306  1.00 49.45  ? 377 SER A OG  1 
ATOM   6126 N  N   . ASP C 1 381 ? 63.852  8.833   14.821  1.00 38.78  ? 378 ASP A N   1 
ATOM   6127 C  CA  . ASP C 1 381 ? 64.045  10.033  15.619  1.00 36.22  ? 378 ASP A CA  1 
ATOM   6128 C  C   . ASP C 1 381 ? 62.742  10.433  16.296  1.00 30.34  ? 378 ASP A C   1 
ATOM   6129 O  O   . ASP C 1 381 ? 61.665  9.999   15.887  1.00 30.21  ? 378 ASP A O   1 
ATOM   6130 C  CB  . ASP C 1 381 ? 64.550  11.173  14.727  1.00 35.31  ? 378 ASP A CB  1 
ATOM   6131 C  CG  . ASP C 1 381 ? 65.212  12.291  15.516  1.00 42.52  ? 378 ASP A CG  1 
ATOM   6132 O  OD1 . ASP C 1 381 ? 65.172  12.252  16.766  1.00 40.20  ? 378 ASP A OD1 1 
ATOM   6133 O  OD2 . ASP C 1 381 ? 65.775  13.210  14.881  1.00 36.70  ? 378 ASP A OD2 1 
ATOM   6134 N  N   . PHE C 1 382 ? 62.850  11.244  17.344  1.00 26.89  ? 379 PHE A N   1 
ATOM   6135 C  CA  . PHE C 1 382 ? 61.683  11.864  17.964  1.00 28.50  ? 379 PHE A CA  1 
ATOM   6136 C  C   . PHE C 1 382 ? 62.040  13.223  18.556  1.00 28.79  ? 379 PHE A C   1 
ATOM   6137 O  O   . PHE C 1 382 ? 63.214  13.546  18.736  1.00 32.68  ? 379 PHE A O   1 
ATOM   6138 C  CB  . PHE C 1 382 ? 61.054  10.954  19.021  1.00 31.73  ? 379 PHE A CB  1 
ATOM   6139 C  CG  . PHE C 1 382 ? 61.857  10.832  20.286  1.00 29.68  ? 379 PHE A CG  1 
ATOM   6140 C  CD1 . PHE C 1 382 ? 62.775  9.807   20.443  1.00 28.44  ? 379 PHE A CD1 1 
ATOM   6141 C  CD2 . PHE C 1 382 ? 61.676  11.728  21.328  1.00 29.73  ? 379 PHE A CD2 1 
ATOM   6142 C  CE1 . PHE C 1 382 ? 63.506  9.683   21.611  1.00 29.35  ? 379 PHE A CE1 1 
ATOM   6143 C  CE2 . PHE C 1 382 ? 62.406  11.612  22.497  1.00 32.06  ? 379 PHE A CE2 1 
ATOM   6144 C  CZ  . PHE C 1 382 ? 63.321  10.588  22.640  1.00 27.83  ? 379 PHE A CZ  1 
ATOM   6145 N  N   . SER C 1 383 ? 61.019  14.017  18.856  1.00 25.81  ? 380 SER A N   1 
ATOM   6146 C  CA  . SER C 1 383 ? 61.228  15.377  19.321  1.00 25.55  ? 380 SER A CA  1 
ATOM   6147 C  C   . SER C 1 383 ? 60.124  15.803  20.281  1.00 32.17  ? 380 SER A C   1 
ATOM   6148 O  O   . SER C 1 383 ? 58.936  15.659  19.978  1.00 28.24  ? 380 SER A O   1 
ATOM   6149 C  CB  . SER C 1 383 ? 61.285  16.333  18.126  1.00 32.17  ? 380 SER A CB  1 
ATOM   6150 O  OG  . SER C 1 383 ? 61.351  17.686  18.540  1.00 35.75  ? 380 SER A OG  1 
ATOM   6151 N  N   . TRP C 1 384 ? 60.526  16.314  21.443  1.00 28.81  ? 381 TRP A N   1 
ATOM   6152 C  CA  . TRP C 1 384 ? 59.589  16.874  22.409  1.00 26.98  ? 381 TRP A CA  1 
ATOM   6153 C  C   . TRP C 1 384 ? 59.094  18.229  21.920  1.00 28.28  ? 381 TRP A C   1 
ATOM   6154 O  O   . TRP C 1 384 ? 59.885  19.064  21.480  1.00 35.32  ? 381 TRP A O   1 
ATOM   6155 C  CB  . TRP C 1 384 ? 60.268  17.075  23.765  1.00 25.67  ? 381 TRP A CB  1 
ATOM   6156 C  CG  . TRP C 1 384 ? 60.611  15.825  24.523  1.00 23.65  ? 381 TRP A CG  1 
ATOM   6157 C  CD1 . TRP C 1 384 ? 61.785  15.133  24.473  1.00 23.80  ? 381 TRP A CD1 1 
ATOM   6158 C  CD2 . TRP C 1 384 ? 59.784  15.142  25.477  1.00 23.64  ? 381 TRP A CD2 1 
ATOM   6159 N  NE1 . TRP C 1 384 ? 61.737  14.055  25.324  1.00 27.24  ? 381 TRP A NE1 1 
ATOM   6160 C  CE2 . TRP C 1 384 ? 60.519  14.039  25.952  1.00 26.01  ? 381 TRP A CE2 1 
ATOM   6161 C  CE3 . TRP C 1 384 ? 58.492  15.354  25.969  1.00 23.39  ? 381 TRP A CE3 1 
ATOM   6162 C  CZ2 . TRP C 1 384 ? 60.004  13.150  26.896  1.00 25.72  ? 381 TRP A CZ2 1 
ATOM   6163 C  CZ3 . TRP C 1 384 ? 57.983  14.471  26.903  1.00 23.86  ? 381 TRP A CZ3 1 
ATOM   6164 C  CH2 . TRP C 1 384 ? 58.738  13.382  27.357  1.00 21.99  ? 381 TRP A CH2 1 
ATOM   6165 N  N   . ASN C 1 385 ? 57.788  18.452  22.002  1.00 27.13  ? 382 ASN A N   1 
ATOM   6166 C  CA  . ASN C 1 385 ? 57.223  19.757  21.687  1.00 28.89  ? 382 ASN A CA  1 
ATOM   6167 C  C   . ASN C 1 385 ? 57.638  20.770  22.750  1.00 30.93  ? 382 ASN A C   1 
ATOM   6168 O  O   . ASN C 1 385 ? 57.476  20.517  23.943  1.00 29.44  ? 382 ASN A O   1 
ATOM   6169 C  CB  . ASN C 1 385 ? 55.698  19.671  21.593  1.00 28.30  ? 382 ASN A CB  1 
ATOM   6170 C  CG  . ASN C 1 385 ? 55.088  20.851  20.862  1.00 30.57  ? 382 ASN A CG  1 
ATOM   6171 O  OD1 . ASN C 1 385 ? 55.245  22.001  21.270  1.00 34.79  ? 382 ASN A OD1 1 
ATOM   6172 N  ND2 . ASN C 1 385 ? 54.379  20.569  19.777  1.00 33.52  ? 382 ASN A ND2 1 
ATOM   6173 N  N   . PRO C 1 386 ? 58.179  21.922  22.323  1.00 36.88  ? 383 PRO A N   1 
ATOM   6174 C  CA  . PRO C 1 386 ? 58.680  22.917  23.266  1.00 35.04  ? 383 PRO A CA  1 
ATOM   6175 C  C   . PRO C 1 386 ? 57.596  23.867  23.768  1.00 36.15  ? 383 PRO A C   1 
ATOM   6176 O  O   . PRO C 1 386 ? 57.863  24.703  24.629  1.00 39.39  ? 383 PRO A O   1 
ATOM   6177 C  CB  . PRO C 1 386 ? 59.698  23.690  22.429  1.00 30.38  ? 383 PRO A CB  1 
ATOM   6178 C  CG  . PRO C 1 386 ? 59.130  23.651  21.048  1.00 32.28  ? 383 PRO A CG  1 
ATOM   6179 C  CD  . PRO C 1 386 ? 58.353  22.356  20.925  1.00 36.51  ? 383 PRO A CD  1 
ATOM   6180 N  N   . ASN C 1 387 ? 56.384  23.736  23.237  1.00 34.93  ? 384 ASN A N   1 
ATOM   6181 C  CA  . ASN C 1 387 ? 55.305  24.659  23.569  1.00 38.70  ? 384 ASN A CA  1 
ATOM   6182 C  C   . ASN C 1 387 ? 54.103  23.976  24.217  1.00 41.65  ? 384 ASN A C   1 
ATOM   6183 O  O   . ASN C 1 387 ? 53.321  24.614  24.925  1.00 39.09  ? 384 ASN A O   1 
ATOM   6184 C  CB  . ASN C 1 387 ? 54.872  25.440  22.324  1.00 39.29  ? 384 ASN A CB  1 
ATOM   6185 C  CG  . ASN C 1 387 ? 55.944  26.398  21.837  1.00 43.61  ? 384 ASN A CG  1 
ATOM   6186 O  OD1 . ASN C 1 387 ? 56.452  26.267  20.723  1.00 49.62  ? 384 ASN A OD1 1 
ATOM   6187 N  ND2 . ASN C 1 387 ? 56.301  27.363  22.675  1.00 41.66  ? 384 ASN A ND2 1 
ATOM   6188 N  N   . GLU C 1 388 ? 53.959  22.680  23.967  1.00 42.15  ? 385 GLU A N   1 
ATOM   6189 C  CA  . GLU C 1 388 ? 52.892  21.897  24.576  1.00 41.73  ? 385 GLU A CA  1 
ATOM   6190 C  C   . GLU C 1 388 ? 53.470  20.724  25.352  1.00 39.95  ? 385 GLU A C   1 
ATOM   6191 O  O   . GLU C 1 388 ? 53.902  19.736  24.761  1.00 48.06  ? 385 GLU A O   1 
ATOM   6192 C  CB  . GLU C 1 388 ? 51.904  21.402  23.517  1.00 44.37  ? 385 GLU A CB  1 
ATOM   6193 C  CG  . GLU C 1 388 ? 50.803  22.396  23.174  1.00 57.90  ? 385 GLU A CG  1 
ATOM   6194 C  CD  . GLU C 1 388 ? 49.772  22.550  24.284  1.00 61.75  ? 385 GLU A CD  1 
ATOM   6195 O  OE1 . GLU C 1 388 ? 49.779  21.737  25.235  1.00 58.09  ? 385 GLU A OE1 1 
ATOM   6196 O  OE2 . GLU C 1 388 ? 48.949  23.488  24.202  1.00 65.32  ? 385 GLU A OE2 1 
ATOM   6197 N  N   . PRO C 1 389 ? 53.486  20.836  26.686  1.00 44.52  ? 386 PRO A N   1 
ATOM   6198 C  CA  . PRO C 1 389 ? 54.040  19.810  27.564  1.00 42.19  ? 386 PRO A CA  1 
ATOM   6199 C  C   . PRO C 1 389 ? 53.531  18.412  27.228  1.00 39.84  ? 386 PRO A C   1 
ATOM   6200 O  O   . PRO C 1 389 ? 52.329  18.219  27.048  1.00 40.63  ? 386 PRO A O   1 
ATOM   6201 C  CB  . PRO C 1 389 ? 53.536  20.232  28.944  1.00 42.31  ? 386 PRO A CB  1 
ATOM   6202 C  CG  . PRO C 1 389 ? 53.402  21.712  28.845  1.00 40.16  ? 386 PRO A CG  1 
ATOM   6203 C  CD  . PRO C 1 389 ? 52.956  21.986  27.440  1.00 40.87  ? 386 PRO A CD  1 
ATOM   6204 N  N   . TRP C 1 390 ? 54.456  17.459  27.128  1.00 36.90  ? 387 TRP A N   1 
ATOM   6205 C  CA  . TRP C 1 390 ? 54.132  16.036  26.963  1.00 34.47  ? 387 TRP A CA  1 
ATOM   6206 C  C   . TRP C 1 390 ? 53.734  15.627  25.549  1.00 37.80  ? 387 TRP A C   1 
ATOM   6207 O  O   . TRP C 1 390 ? 53.520  14.444  25.281  1.00 40.55  ? 387 TRP A O   1 
ATOM   6208 C  CB  . TRP C 1 390 ? 53.071  15.591  27.974  1.00 34.27  ? 387 TRP A CB  1 
ATOM   6209 C  CG  . TRP C 1 390 ? 53.558  15.689  29.380  1.00 35.28  ? 387 TRP A CG  1 
ATOM   6210 C  CD1 . TRP C 1 390 ? 53.319  16.700  30.262  1.00 34.18  ? 387 TRP A CD1 1 
ATOM   6211 C  CD2 . TRP C 1 390 ? 54.393  14.749  30.064  1.00 34.59  ? 387 TRP A CD2 1 
ATOM   6212 N  NE1 . TRP C 1 390 ? 53.946  16.444  31.456  1.00 33.37  ? 387 TRP A NE1 1 
ATOM   6213 C  CE2 . TRP C 1 390 ? 54.613  15.252  31.361  1.00 31.99  ? 387 TRP A CE2 1 
ATOM   6214 C  CE3 . TRP C 1 390 ? 54.971  13.526  29.707  1.00 34.51  ? 387 TRP A CE3 1 
ATOM   6215 C  CZ2 . TRP C 1 390 ? 55.385  14.575  32.305  1.00 34.30  ? 387 TRP A CZ2 1 
ATOM   6216 C  CZ3 . TRP C 1 390 ? 55.738  12.855  30.645  1.00 37.07  ? 387 TRP A CZ3 1 
ATOM   6217 C  CH2 . TRP C 1 390 ? 55.937  13.381  31.929  1.00 34.22  ? 387 TRP A CH2 1 
ATOM   6218 N  N   . VAL C 1 391 ? 53.635  16.600  24.648  1.00 36.11  ? 388 VAL A N   1 
ATOM   6219 C  CA  . VAL C 1 391 ? 53.388  16.303  23.243  1.00 26.48  ? 388 VAL A CA  1 
ATOM   6220 C  C   . VAL C 1 391 ? 54.692  15.896  22.568  1.00 27.44  ? 388 VAL A C   1 
ATOM   6221 O  O   . VAL C 1 391 ? 55.695  16.604  22.662  1.00 20.51  ? 388 VAL A O   1 
ATOM   6222 C  CB  . VAL C 1 391 ? 52.776  17.503  22.506  1.00 27.85  ? 388 VAL A CB  1 
ATOM   6223 C  CG1 . VAL C 1 391 ? 52.621  17.197  21.017  1.00 21.70  ? 388 VAL A CG1 1 
ATOM   6224 C  CG2 . VAL C 1 391 ? 51.437  17.866  23.124  1.00 27.30  ? 388 VAL A CG2 1 
ATOM   6225 N  N   . ILE C 1 392 ? 54.674  14.744  21.904  1.00 24.39  ? 389 ILE A N   1 
ATOM   6226 C  CA  . ILE C 1 392 ? 55.848  14.235  21.205  1.00 23.15  ? 389 ILE A CA  1 
ATOM   6227 C  C   . ILE C 1 392 ? 55.536  13.905  19.745  1.00 27.28  ? 389 ILE A C   1 
ATOM   6228 O  O   . ILE C 1 392 ? 54.411  13.525  19.411  1.00 24.92  ? 389 ILE A O   1 
ATOM   6229 C  CB  . ILE C 1 392 ? 56.398  12.967  21.893  1.00 21.87  ? 389 ILE A CB  1 
ATOM   6230 C  CG1 . ILE C 1 392 ? 56.959  13.308  23.274  1.00 27.41  ? 389 ILE A CG1 1 
ATOM   6231 C  CG2 . ILE C 1 392 ? 57.465  12.306  21.034  1.00 16.67  ? 389 ILE A CG2 1 
ATOM   6232 C  CD1 . ILE C 1 392 ? 57.636  12.144  23.961  1.00 32.49  ? 389 ILE A CD1 1 
ATOM   6233 N  N   . CYS C 1 393 ? 56.533  14.066  18.879  1.00 27.47  ? 390 CYS A N   1 
ATOM   6234 C  CA  . CYS C 1 393 ? 56.442  13.587  17.503  1.00 24.44  ? 390 CYS A CA  1 
ATOM   6235 C  C   . CYS C 1 393 ? 57.550  12.589  17.205  1.00 23.03  ? 390 CYS A C   1 
ATOM   6236 O  O   . CYS C 1 393 ? 58.729  12.909  17.322  1.00 26.38  ? 390 CYS A O   1 
ATOM   6237 C  CB  . CYS C 1 393 ? 56.526  14.739  16.501  1.00 24.44  ? 390 CYS A CB  1 
ATOM   6238 S  SG  . CYS C 1 393 ? 56.504  14.178  14.773  1.00 26.14  ? 390 CYS A SG  1 
ATOM   6239 N  N   . SER C 1 394 ? 57.171  11.379  16.815  1.00 23.25  ? 391 SER A N   1 
ATOM   6240 C  CA  . SER C 1 394 ? 58.152  10.373  16.442  1.00 24.71  ? 391 SER A CA  1 
ATOM   6241 C  C   . SER C 1 394 ? 57.962  9.929   15.000  1.00 27.08  ? 391 SER A C   1 
ATOM   6242 O  O   . SER C 1 394 ? 56.837  9.794   14.523  1.00 23.25  ? 391 SER A O   1 
ATOM   6243 C  CB  . SER C 1 394 ? 58.083  9.171   17.383  1.00 21.84  ? 391 SER A CB  1 
ATOM   6244 O  OG  . SER C 1 394 ? 56.742  8.851   17.698  1.00 18.76  ? 391 SER A OG  1 
ATOM   6245 N  N   . VAL C 1 395 ? 59.078  9.716   14.311  1.00 26.94  ? 392 VAL A N   1 
ATOM   6246 C  CA  . VAL C 1 395 ? 59.056  9.204   12.949  1.00 26.76  ? 392 VAL A CA  1 
ATOM   6247 C  C   . VAL C 1 395 ? 59.721  7.832   12.902  1.00 29.75  ? 392 VAL A C   1 
ATOM   6248 O  O   . VAL C 1 395 ? 60.704  7.583   13.604  1.00 31.92  ? 392 VAL A O   1 
ATOM   6249 C  CB  . VAL C 1 395 ? 59.756  10.167  11.969  1.00 22.88  ? 392 VAL A CB  1 
ATOM   6250 C  CG1 . VAL C 1 395 ? 58.955  11.454  11.830  1.00 18.45  ? 392 VAL A CG1 1 
ATOM   6251 C  CG2 . VAL C 1 395 ? 61.173  10.461  12.426  1.00 18.18  ? 392 VAL A CG2 1 
ATOM   6252 N  N   . SER C 1 396 ? 59.174  6.934   12.090  1.00 28.72  ? 393 SER A N   1 
ATOM   6253 C  CA  . SER C 1 396 ? 59.725  5.588   11.984  1.00 31.25  ? 393 SER A CA  1 
ATOM   6254 C  C   . SER C 1 396 ? 60.091  5.227   10.547  1.00 31.29  ? 393 SER A C   1 
ATOM   6255 O  O   . SER C 1 396 ? 59.756  5.948   9.609   1.00 31.92  ? 393 SER A O   1 
ATOM   6256 C  CB  . SER C 1 396 ? 58.765  4.553   12.576  1.00 28.65  ? 393 SER A CB  1 
ATOM   6257 O  OG  . SER C 1 396 ? 57.502  4.602   11.942  1.00 40.28  ? 393 SER A OG  1 
ATOM   6258 N  N   . GLU C 1 397 ? 60.776  4.100   10.389  1.00 32.77  ? 394 GLU A N   1 
ATOM   6259 C  CA  . GLU C 1 397 ? 61.330  3.703   9.100   1.00 30.94  ? 394 GLU A CA  1 
ATOM   6260 C  C   . GLU C 1 397 ? 60.294  3.316   8.047   1.00 29.15  ? 394 GLU A C   1 
ATOM   6261 O  O   . GLU C 1 397 ? 60.636  3.142   6.879   1.00 35.39  ? 394 GLU A O   1 
ATOM   6262 C  CB  . GLU C 1 397 ? 62.332  2.567   9.285   1.00 22.08  ? 394 GLU A CB  1 
ATOM   6263 C  CG  . GLU C 1 397 ? 63.659  3.019   9.845   1.00 30.80  ? 394 GLU A CG  1 
ATOM   6264 C  CD  . GLU C 1 397 ? 64.694  1.918   9.836   1.00 36.51  ? 394 GLU A CD  1 
ATOM   6265 O  OE1 . GLU C 1 397 ? 64.305  0.733   9.729   1.00 34.11  ? 394 GLU A OE1 1 
ATOM   6266 O  OE2 . GLU C 1 397 ? 65.896  2.239   9.936   1.00 42.95  ? 394 GLU A OE2 1 
ATOM   6267 N  N   . ASP C 1 398 ? 59.038  3.181   8.456   1.00 23.57  ? 395 ASP A N   1 
ATOM   6268 C  CA  . ASP C 1 398 ? 57.986  2.754   7.540   1.00 27.98  ? 395 ASP A CA  1 
ATOM   6269 C  C   . ASP C 1 398 ? 57.097  3.913   7.098   1.00 31.11  ? 395 ASP A C   1 
ATOM   6270 O  O   . ASP C 1 398 ? 55.916  3.721   6.801   1.00 33.98  ? 395 ASP A O   1 
ATOM   6271 C  CB  . ASP C 1 398 ? 57.142  1.638   8.166   1.00 28.04  ? 395 ASP A CB  1 
ATOM   6272 C  CG  . ASP C 1 398 ? 56.475  2.067   9.460   1.00 31.13  ? 395 ASP A CG  1 
ATOM   6273 O  OD1 . ASP C 1 398 ? 56.719  3.206   9.911   1.00 34.35  ? 395 ASP A OD1 1 
ATOM   6274 O  OD2 . ASP C 1 398 ? 55.705  1.264   10.026  1.00 34.87  ? 395 ASP A OD2 1 
ATOM   6275 N  N   . ASN C 1 399 ? 57.670  5.114   7.063   1.00 33.88  ? 396 ASN A N   1 
ATOM   6276 C  CA  . ASN C 1 399 ? 56.967  6.305   6.582   1.00 31.43  ? 396 ASN A CA  1 
ATOM   6277 C  C   . ASN C 1 399 ? 56.072  6.977   7.626   1.00 28.23  ? 396 ASN A C   1 
ATOM   6278 O  O   . ASN C 1 399 ? 55.531  8.056   7.385   1.00 27.60  ? 396 ASN A O   1 
ATOM   6279 C  CB  . ASN C 1 399 ? 56.152  5.981   5.323   1.00 33.04  ? 396 ASN A CB  1 
ATOM   6280 C  CG  . ASN C 1 399 ? 57.020  5.527   4.163   1.00 39.01  ? 396 ASN A CG  1 
ATOM   6281 O  OD1 . ASN C 1 399 ? 57.930  4.715   4.331   1.00 44.56  ? 396 ASN A OD1 1 
ATOM   6282 N  ND2 . ASN C 1 399 ? 56.737  6.048   2.975   1.00 38.74  ? 396 ASN A ND2 1 
ATOM   6283 N  N   . ILE C 1 400 ? 55.923  6.347   8.786   1.00 31.98  ? 397 ILE A N   1 
ATOM   6284 C  CA  . ILE C 1 400 ? 54.995  6.845   9.800   1.00 30.08  ? 397 ILE A CA  1 
ATOM   6285 C  C   . ILE C 1 400 ? 55.532  7.993   10.657  1.00 33.13  ? 397 ILE A C   1 
ATOM   6286 O  O   . ILE C 1 400 ? 56.679  7.982   11.114  1.00 30.02  ? 397 ILE A O   1 
ATOM   6287 C  CB  . ILE C 1 400 ? 54.497  5.716   10.719  1.00 27.64  ? 397 ILE A CB  1 
ATOM   6288 C  CG1 . ILE C 1 400 ? 53.597  4.752   9.937   1.00 29.70  ? 397 ILE A CG1 1 
ATOM   6289 C  CG2 . ILE C 1 400 ? 53.761  6.291   11.918  1.00 19.01  ? 397 ILE A CG2 1 
ATOM   6290 C  CD1 . ILE C 1 400 ? 52.419  5.413   9.259   1.00 19.34  ? 397 ILE A CD1 1 
HETATM 6291 N  N   . MSE C 1 401 ? 54.682  8.979   10.849  1.00 31.17  ? 398 MSE A N   1 
HETATM 6292 C  CA  . MSE C 1 401 ? 54.936  10.078  11.759  1.00 33.10  ? 398 MSE A CA  1 
HETATM 6293 C  C   . MSE C 1 401 ? 53.748  10.210  12.700  1.00 30.46  ? 398 MSE A C   1 
HETATM 6294 O  O   . MSE C 1 401 ? 52.607  10.336  12.255  1.00 32.54  ? 398 MSE A O   1 
HETATM 6295 C  CB  . MSE C 1 401 ? 55.124  11.372  10.981  1.00 37.22  ? 398 MSE A CB  1 
HETATM 6296 C  CG  . MSE C 1 401 ? 54.795  12.622  11.776  1.00 51.23  ? 398 MSE A CG  1 
HETATM 6297 SE SE  . MSE C 1 401 ? 54.656  14.156  10.597  1.00 58.18  ? 398 MSE A SE  1 
HETATM 6298 C  CE  . MSE C 1 401 ? 53.923  13.242  9.054   1.00 59.56  ? 398 MSE A CE  1 
ATOM   6299 N  N   . GLN C 1 402 ? 54.012  10.170  13.989  1.00 28.27  ? 399 GLN A N   1 
ATOM   6300 C  CA  . GLN C 1 402 ? 52.951  10.283  14.981  1.00 32.31  ? 399 GLN A CA  1 
ATOM   6301 C  C   . GLN C 1 402 ? 53.179  11.455  15.930  1.00 31.95  ? 399 GLN A C   1 
ATOM   6302 O  O   . GLN C 1 402 ? 54.283  11.650  16.440  1.00 32.51  ? 399 GLN A O   1 
ATOM   6303 C  CB  . GLN C 1 402 ? 52.811  8.981   15.771  1.00 30.23  ? 399 GLN A CB  1 
ATOM   6304 C  CG  . GLN C 1 402 ? 52.380  7.802   14.927  1.00 32.10  ? 399 GLN A CG  1 
ATOM   6305 C  CD  . GLN C 1 402 ? 52.115  6.557   15.744  1.00 33.58  ? 399 GLN A CD  1 
ATOM   6306 O  OE1 . GLN C 1 402 ? 51.212  5.779   15.436  1.00 34.94  ? 399 GLN A OE1 1 
ATOM   6307 N  NE2 . GLN C 1 402 ? 52.900  6.360   16.795  1.00 37.88  ? 399 GLN A NE2 1 
ATOM   6308 N  N   . ILE C 1 403 ? 52.129  12.241  16.142  1.00 27.21  ? 400 ILE A N   1 
ATOM   6309 C  CA  . ILE C 1 403 ? 52.151  13.322  17.118  1.00 24.65  ? 400 ILE A CA  1 
ATOM   6310 C  C   . ILE C 1 403 ? 51.202  12.935  18.238  1.00 25.46  ? 400 ILE A C   1 
ATOM   6311 O  O   . ILE C 1 403 ? 49.994  12.826  18.032  1.00 25.84  ? 400 ILE A O   1 
ATOM   6312 C  CB  . ILE C 1 403 ? 51.709  14.659  16.506  1.00 20.78  ? 400 ILE A CB  1 
ATOM   6313 C  CG1 . ILE C 1 403 ? 52.694  15.104  15.422  1.00 18.03  ? 400 ILE A CG1 1 
ATOM   6314 C  CG2 . ILE C 1 403 ? 51.592  15.727  17.586  1.00 14.47  ? 400 ILE A CG2 1 
ATOM   6315 C  CD1 . ILE C 1 403 ? 52.177  16.245  14.566  1.00 17.63  ? 400 ILE A CD1 1 
ATOM   6316 N  N   . TRP C 1 404 ? 51.751  12.713  19.423  1.00 29.05  ? 401 TRP A N   1 
ATOM   6317 C  CA  . TRP C 1 404 ? 50.968  12.129  20.499  1.00 26.84  ? 401 TRP A CA  1 
ATOM   6318 C  C   . TRP C 1 404 ? 51.285  12.712  21.864  1.00 27.17  ? 401 TRP A C   1 
ATOM   6319 O  O   . TRP C 1 404 ? 52.320  13.348  22.070  1.00 26.86  ? 401 TRP A O   1 
ATOM   6320 C  CB  . TRP C 1 404 ? 51.160  10.611  20.526  1.00 25.36  ? 401 TRP A CB  1 
ATOM   6321 C  CG  . TRP C 1 404 ? 52.595  10.193  20.583  1.00 24.17  ? 401 TRP A CG  1 
ATOM   6322 C  CD1 . TRP C 1 404 ? 53.451  10.063  19.530  1.00 24.58  ? 401 TRP A CD1 1 
ATOM   6323 C  CD2 . TRP C 1 404 ? 53.344  9.851   21.755  1.00 23.02  ? 401 TRP A CD2 1 
ATOM   6324 N  NE1 . TRP C 1 404 ? 54.687  9.660   19.972  1.00 25.66  ? 401 TRP A NE1 1 
ATOM   6325 C  CE2 . TRP C 1 404 ? 54.647  9.520   21.334  1.00 24.58  ? 401 TRP A CE2 1 
ATOM   6326 C  CE3 . TRP C 1 404 ? 53.039  9.790   23.119  1.00 23.67  ? 401 TRP A CE3 1 
ATOM   6327 C  CZ2 . TRP C 1 404 ? 55.646  9.133   22.228  1.00 26.23  ? 401 TRP A CZ2 1 
ATOM   6328 C  CZ3 . TRP C 1 404 ? 54.032  9.406   24.006  1.00 23.58  ? 401 TRP A CZ3 1 
ATOM   6329 C  CH2 . TRP C 1 404 ? 55.319  9.083   23.556  1.00 27.65  ? 401 TRP A CH2 1 
ATOM   6330 N  N   . GLN C 1 405 ? 50.369  12.480  22.793  1.00 34.20  ? 402 GLN A N   1 
ATOM   6331 C  CA  . GLN C 1 405 ? 50.487  12.956  24.158  1.00 34.18  ? 402 GLN A CA  1 
ATOM   6332 C  C   . GLN C 1 405 ? 49.833  11.908  25.043  1.00 31.60  ? 402 GLN A C   1 
ATOM   6333 O  O   . GLN C 1 405 ? 48.653  11.599  24.874  1.00 33.62  ? 402 GLN A O   1 
ATOM   6334 C  CB  . GLN C 1 405 ? 49.752  14.287  24.305  1.00 31.42  ? 402 GLN A CB  1 
ATOM   6335 C  CG  . GLN C 1 405 ? 50.059  15.049  25.576  1.00 34.54  ? 402 GLN A CG  1 
ATOM   6336 C  CD  . GLN C 1 405 ? 49.233  16.312  25.693  1.00 39.22  ? 402 GLN A CD  1 
ATOM   6337 O  OE1 . GLN C 1 405 ? 48.066  16.344  25.291  1.00 40.32  ? 402 GLN A OE1 1 
ATOM   6338 N  NE2 . GLN C 1 405 ? 49.832  17.364  26.242  1.00 29.75  ? 402 GLN A NE2 1 
HETATM 6339 N  N   . MSE C 1 406 ? 50.586  11.358  25.970  1.00 32.66  ? 403 MSE A N   1 
HETATM 6340 C  CA  . MSE C 1 406 ? 50.017  10.394  26.900  1.00 38.36  ? 403 MSE A CA  1 
HETATM 6341 C  C   . MSE C 1 406 ? 48.941  11.058  27.749  1.00 36.22  ? 403 MSE A C   1 
HETATM 6342 O  O   . MSE C 1 406 ? 48.964  12.273  27.952  1.00 37.56  ? 403 MSE A O   1 
HETATM 6343 C  CB  . MSE C 1 406 ? 51.098  9.790   27.789  1.00 35.31  ? 403 MSE A CB  1 
HETATM 6344 C  CG  . MSE C 1 406 ? 51.772  10.783  28.708  1.00 40.99  ? 403 MSE A CG  1 
HETATM 6345 SE SE  . MSE C 1 406 ? 53.117  9.909   29.804  1.00 49.65  ? 403 MSE A SE  1 
HETATM 6346 C  CE  . MSE C 1 406 ? 51.945  8.858   30.922  1.00 50.46  ? 403 MSE A CE  1 
ATOM   6347 N  N   . ALA C 1 407 ? 48.002  10.267  28.225  1.00 38.05  ? 404 ALA A N   1 
ATOM   6348 C  CA  . ALA C 1 407 ? 46.919  10.776  29.060  1.00 31.66  ? 404 ALA A CA  1 
ATOM   6349 C  C   . ALA C 1 407 ? 47.474  11.441  30.314  1.00 37.55  ? 404 ALA A C   1 
ATOM   6350 O  O   . ALA C 1 407 ? 48.465  10.982  30.886  1.00 34.06  ? 404 ALA A O   1 
ATOM   6351 C  CB  . ALA C 1 407 ? 45.958  9.659   29.423  1.00 26.61  ? 404 ALA A CB  1 
ATOM   6352 N  N   . GLU C 1 408 ? 46.829  12.526  30.732  1.00 39.37  ? 405 GLU A N   1 
ATOM   6353 C  CA  . GLU C 1 408 ? 47.291  13.309  31.872  1.00 50.31  ? 405 GLU A CA  1 
ATOM   6354 C  C   . GLU C 1 408 ? 47.308  12.514  33.177  1.00 48.38  ? 405 GLU A C   1 
ATOM   6355 O  O   . GLU C 1 408 ? 48.174  12.725  34.025  1.00 46.98  ? 405 GLU A O   1 
ATOM   6356 C  CB  . GLU C 1 408 ? 46.441  14.574  32.034  1.00 54.05  ? 405 GLU A CB  1 
ATOM   6357 C  CG  . GLU C 1 408 ? 46.969  15.542  33.084  1.00 60.76  ? 405 GLU A CG  1 
ATOM   6358 C  CD  . GLU C 1 408 ? 46.250  16.877  33.071  1.00 61.49  ? 405 GLU A CD  1 
ATOM   6359 O  OE1 . GLU C 1 408 ? 46.790  17.847  33.647  1.00 63.07  ? 405 GLU A OE1 1 
ATOM   6360 O  OE2 . GLU C 1 408 ? 45.150  16.958  32.484  1.00 66.54  ? 405 GLU A OE2 1 
ATOM   6361 N  N   . ASN C 1 409 ? 46.362  11.592  33.326  1.00 50.04  ? 406 ASN A N   1 
ATOM   6362 C  CA  . ASN C 1 409 ? 46.223  10.823  34.562  1.00 53.85  ? 406 ASN A CA  1 
ATOM   6363 C  C   . ASN C 1 409 ? 47.320  9.779   34.784  1.00 52.51  ? 406 ASN A C   1 
ATOM   6364 O  O   . ASN C 1 409 ? 47.178  8.894   35.626  1.00 56.90  ? 406 ASN A O   1 
ATOM   6365 C  CB  . ASN C 1 409 ? 44.839  10.165  34.627  1.00 61.45  ? 406 ASN A CB  1 
ATOM   6366 C  CG  . ASN C 1 409 ? 44.676  9.035   33.624  1.00 66.73  ? 406 ASN A CG  1 
ATOM   6367 O  OD1 . ASN C 1 409 ? 45.039  7.890   33.896  1.00 72.69  ? 406 ASN A OD1 1 
ATOM   6368 N  ND2 . ASN C 1 409 ? 44.113  9.351   32.463  1.00 67.18  ? 406 ASN A ND2 1 
ATOM   6369 N  N   . ILE C 1 410 ? 48.412  9.884   34.033  1.00 52.28  ? 407 ILE A N   1 
ATOM   6370 C  CA  . ILE C 1 410 ? 49.513  8.934   34.159  1.00 49.29  ? 407 ILE A CA  1 
ATOM   6371 C  C   . ILE C 1 410 ? 50.768  9.596   34.730  1.00 51.63  ? 407 ILE A C   1 
ATOM   6372 O  O   . ILE C 1 410 ? 51.510  8.981   35.498  1.00 45.74  ? 407 ILE A O   1 
ATOM   6373 C  CB  . ILE C 1 410 ? 49.848  8.259   32.808  1.00 45.70  ? 407 ILE A CB  1 
ATOM   6374 C  CG1 . ILE C 1 410 ? 48.585  7.686   32.160  1.00 49.22  ? 407 ILE A CG1 1 
ATOM   6375 C  CG2 . ILE C 1 410 ? 50.891  7.162   32.995  1.00 43.71  ? 407 ILE A CG2 1 
ATOM   6376 C  CD1 . ILE C 1 410 ? 48.850  6.919   30.876  1.00 45.91  ? 407 ILE A CD1 1 
ATOM   6377 N  N   . TYR C 1 411 ? 51.004  10.849  34.350  1.00 52.39  ? 408 TYR A N   1 
ATOM   6378 C  CA  . TYR C 1 411 ? 52.152  11.590  34.862  1.00 56.07  ? 408 TYR A CA  1 
ATOM   6379 C  C   . TYR C 1 411 ? 51.739  12.573  35.953  1.00 59.14  ? 408 TYR A C   1 
ATOM   6380 O  O   . TYR C 1 411 ? 52.567  13.015  36.748  1.00 62.52  ? 408 TYR A O   1 
ATOM   6381 C  CB  . TYR C 1 411 ? 52.895  12.317  33.731  1.00 54.20  ? 408 TYR A CB  1 
ATOM   6382 C  CG  . TYR C 1 411 ? 52.047  13.289  32.935  1.00 52.48  ? 408 TYR A CG  1 
ATOM   6383 C  CD1 . TYR C 1 411 ? 51.760  14.558  33.425  1.00 48.73  ? 408 TYR A CD1 1 
ATOM   6384 C  CD2 . TYR C 1 411 ? 51.547  12.941  31.686  1.00 52.86  ? 408 TYR A CD2 1 
ATOM   6385 C  CE1 . TYR C 1 411 ? 50.987  15.450  32.699  1.00 48.32  ? 408 TYR A CE1 1 
ATOM   6386 C  CE2 . TYR C 1 411 ? 50.775  13.826  30.950  1.00 55.47  ? 408 TYR A CE2 1 
ATOM   6387 C  CZ  . TYR C 1 411 ? 50.498  15.080  31.462  1.00 55.07  ? 408 TYR A CZ  1 
ATOM   6388 O  OH  . TYR C 1 411 ? 49.731  15.961  30.733  1.00 52.94  ? 408 TYR A OH  1 
ATOM   6389 N  N   . ASN C 1 412 ? 50.453  12.905  35.988  1.00 62.59  ? 409 ASN A N   1 
ATOM   6390 C  CA  . ASN C 1 412 ? 49.927  13.852  36.965  1.00 68.87  ? 409 ASN A CA  1 
ATOM   6391 C  C   . ASN C 1 412 ? 49.733  13.204  38.333  1.00 69.80  ? 409 ASN A C   1 
ATOM   6392 O  O   . ASN C 1 412 ? 48.604  12.983  38.772  1.00 72.84  ? 409 ASN A O   1 
ATOM   6393 C  CB  . ASN C 1 412 ? 48.610  14.450  36.464  1.00 72.07  ? 409 ASN A CB  1 
ATOM   6394 C  CG  . ASN C 1 412 ? 48.223  15.716  37.200  1.00 73.66  ? 409 ASN A CG  1 
ATOM   6395 O  OD1 . ASN C 1 412 ? 48.643  15.945  38.334  1.00 76.71  ? 409 ASN A OD1 1 
ATOM   6396 N  ND2 . ASN C 1 412 ? 47.411  16.547  36.556  1.00 74.94  ? 409 ASN A ND2 1 
ATOM   6397 N  N   . GLY D 2 5   ? 41.115  5.607   41.971  1.00 85.95  ? 28  GLY F N   1 
ATOM   6398 C  CA  . GLY D 2 5   ? 39.805  5.916   41.327  1.00 87.99  ? 28  GLY F CA  1 
ATOM   6399 C  C   . GLY D 2 5   ? 39.973  6.482   39.930  1.00 89.59  ? 28  GLY F C   1 
ATOM   6400 O  O   . GLY D 2 5   ? 40.497  7.583   39.759  1.00 86.15  ? 28  GLY F O   1 
ATOM   6401 N  N   . ILE D 2 6   ? 39.524  5.730   38.928  1.00 93.42  ? 29  ILE F N   1 
ATOM   6402 C  CA  . ILE D 2 6   ? 38.875  4.438   39.161  1.00 94.07  ? 29  ILE F CA  1 
ATOM   6403 C  C   . ILE D 2 6   ? 39.770  3.194   38.998  1.00 94.74  ? 29  ILE F C   1 
ATOM   6404 O  O   . ILE D 2 6   ? 39.754  2.350   39.895  1.00 96.08  ? 29  ILE F O   1 
ATOM   6405 C  CB  . ILE D 2 6   ? 37.533  4.280   38.382  1.00 94.18  ? 29  ILE F CB  1 
ATOM   6406 C  CG1 . ILE D 2 6   ? 36.403  5.035   39.090  1.00 93.44  ? 29  ILE F CG1 1 
ATOM   6407 C  CG2 . ILE D 2 6   ? 37.161  2.808   38.240  1.00 93.47  ? 29  ILE F CG2 1 
ATOM   6408 C  CD1 . ILE D 2 6   ? 36.534  6.546   39.054  1.00 92.26  ? 29  ILE F CD1 1 
ATOM   6409 N  N   . THR D 2 7   ? 40.556  3.025   37.922  1.00 94.74  ? 30  THR F N   1 
ATOM   6410 C  CA  . THR D 2 7   ? 40.737  3.873   36.715  1.00 93.38  ? 30  THR F CA  1 
ATOM   6411 C  C   . THR D 2 7   ? 41.965  4.729   36.395  1.00 89.90  ? 30  THR F C   1 
ATOM   6412 O  O   . THR D 2 7   ? 42.203  5.072   35.236  1.00 90.32  ? 30  THR F O   1 
ATOM   6413 C  CB  . THR D 2 7   ? 39.851  5.137   36.629  1.00 96.71  ? 30  THR F CB  1 
ATOM   6414 O  OG1 . THR D 2 7   ? 38.617  4.806   35.977  1.00 98.79  ? 30  THR F OG1 1 
ATOM   6415 C  CG2 . THR D 2 7   ? 40.542  6.224   35.808  1.00 96.72  ? 30  THR F CG2 1 
ATOM   6416 N  N   . LYS D 2 8   ? 42.740  5.061   37.426  1.00 83.97  ? 31  LYS F N   1 
ATOM   6417 C  CA  . LYS D 2 8   ? 44.145  5.464   37.385  1.00 82.61  ? 31  LYS F CA  1 
ATOM   6418 C  C   . LYS D 2 8   ? 45.102  4.273   37.450  1.00 77.17  ? 31  LYS F C   1 
ATOM   6419 O  O   . LYS D 2 8   ? 45.931  4.097   36.558  1.00 76.96  ? 31  LYS F O   1 
ATOM   6420 C  CB  . LYS D 2 8   ? 44.465  6.447   38.518  1.00 85.35  ? 31  LYS F CB  1 
ATOM   6421 C  CG  . LYS D 2 8   ? 44.318  7.918   38.161  1.00 88.08  ? 31  LYS F CG  1 
ATOM   6422 C  CD  . LYS D 2 8   ? 44.692  8.799   39.353  1.00 89.44  ? 31  LYS F CD  1 
ATOM   6423 C  CE  . LYS D 2 8   ? 45.118  10.196  38.915  1.00 89.46  ? 31  LYS F CE  1 
ATOM   6424 N  NZ  . LYS D 2 8   ? 44.010  10.947  38.249  1.00 91.26  ? 31  LYS F NZ  1 
ATOM   6425 N  N   . PRO D 2 9   ? 44.986  3.447   38.504  1.00 75.62  ? 32  PRO F N   1 
ATOM   6426 C  CA  . PRO D 2 9   ? 45.930  2.349   38.715  1.00 73.87  ? 32  PRO F CA  1 
ATOM   6427 C  C   . PRO D 2 9   ? 46.025  1.389   37.529  1.00 68.63  ? 32  PRO F C   1 
ATOM   6428 O  O   . PRO D 2 9   ? 47.122  0.955   37.176  1.00 64.26  ? 32  PRO F O   1 
ATOM   6429 C  CB  . PRO D 2 9   ? 45.364  1.626   39.947  1.00 74.09  ? 32  PRO F CB  1 
ATOM   6430 C  CG  . PRO D 2 9   ? 43.949  2.092   40.066  1.00 72.66  ? 32  PRO F CG  1 
ATOM   6431 C  CD  . PRO D 2 9   ? 43.956  3.489   39.556  1.00 74.43  ? 32  PRO F CD  1 
ATOM   6432 N  N   . ALA D 2 10  ? 44.886  1.064   36.923  1.00 65.54  ? 33  ALA F N   1 
ATOM   6433 C  CA  . ALA D 2 10  ? 44.857  0.143   35.790  1.00 61.26  ? 33  ALA F CA  1 
ATOM   6434 C  C   . ALA D 2 10  ? 45.496  0.762   34.552  1.00 59.02  ? 33  ALA F C   1 
ATOM   6435 O  O   . ALA D 2 10  ? 46.274  0.113   33.853  1.00 53.70  ? 33  ALA F O   1 
ATOM   6436 C  CB  . ALA D 2 10  ? 43.428  -0.288  35.490  1.00 57.33  ? 33  ALA F CB  1 
ATOM   6437 N  N   . ILE D 2 11  ? 45.161  2.022   34.290  1.00 58.37  ? 34  ILE F N   1 
ATOM   6438 C  CA  . ILE D 2 11  ? 45.700  2.742   33.143  1.00 55.82  ? 34  ILE F CA  1 
ATOM   6439 C  C   . ILE D 2 11  ? 47.212  2.920   33.254  1.00 55.43  ? 34  ILE F C   1 
ATOM   6440 O  O   . ILE D 2 11  ? 47.938  2.742   32.274  1.00 58.39  ? 34  ILE F O   1 
ATOM   6441 C  CB  . ILE D 2 11  ? 44.995  4.105   32.943  1.00 56.16  ? 34  ILE F CB  1 
ATOM   6442 C  CG1 . ILE D 2 11  ? 43.608  3.889   32.326  1.00 57.85  ? 34  ILE F CG1 1 
ATOM   6443 C  CG2 . ILE D 2 11  ? 45.829  5.024   32.064  1.00 52.54  ? 34  ILE F CG2 1 
ATOM   6444 C  CD1 . ILE D 2 11  ? 42.856  5.168   32.012  1.00 58.13  ? 34  ILE F CD1 1 
ATOM   6445 N  N   . ARG D 2 12  ? 47.685  3.254   34.451  1.00 53.74  ? 35  ARG F N   1 
ATOM   6446 C  CA  . ARG D 2 12  ? 49.115  3.419   34.690  1.00 56.15  ? 35  ARG F CA  1 
ATOM   6447 C  C   . ARG D 2 12  ? 49.849  2.089   34.552  1.00 58.82  ? 35  ARG F C   1 
ATOM   6448 O  O   . ARG D 2 12  ? 51.033  2.049   34.214  1.00 57.83  ? 35  ARG F O   1 
ATOM   6449 C  CB  . ARG D 2 12  ? 49.366  4.035   36.069  1.00 59.82  ? 35  ARG F CB  1 
ATOM   6450 C  CG  . ARG D 2 12  ? 48.824  5.450   36.212  1.00 61.83  ? 35  ARG F CG  1 
ATOM   6451 C  CD  . ARG D 2 12  ? 49.255  6.100   37.514  1.00 63.35  ? 35  ARG F CD  1 
ATOM   6452 N  NE  . ARG D 2 12  ? 48.765  7.472   37.611  1.00 68.46  ? 35  ARG F NE  1 
ATOM   6453 C  CZ  . ARG D 2 12  ? 49.248  8.387   38.446  1.00 70.35  ? 35  ARG F CZ  1 
ATOM   6454 N  NH1 . ARG D 2 12  ? 50.245  8.084   39.267  1.00 70.51  ? 35  ARG F NH1 1 
ATOM   6455 N  NH2 . ARG D 2 12  ? 48.736  9.611   38.457  1.00 70.26  ? 35  ARG F NH2 1 
ATOM   6456 N  N   . ARG D 2 13  ? 49.129  1.002   34.812  1.00 60.44  ? 36  ARG F N   1 
ATOM   6457 C  CA  . ARG D 2 13  ? 49.666  -0.342  34.663  1.00 58.99  ? 36  ARG F CA  1 
ATOM   6458 C  C   . ARG D 2 13  ? 49.740  -0.705  33.182  1.00 56.16  ? 36  ARG F C   1 
ATOM   6459 O  O   . ARG D 2 13  ? 50.747  -1.235  32.712  1.00 52.73  ? 36  ARG F O   1 
ATOM   6460 C  CB  . ARG D 2 13  ? 48.779  -1.334  35.419  1.00 67.16  ? 36  ARG F CB  1 
ATOM   6461 C  CG  . ARG D 2 13  ? 49.395  -2.698  35.680  1.00 76.42  ? 36  ARG F CG  1 
ATOM   6462 C  CD  . ARG D 2 13  ? 48.526  -3.481  36.658  1.00 84.20  ? 36  ARG F CD  1 
ATOM   6463 N  NE  . ARG D 2 13  ? 48.870  -4.900  36.712  1.00 89.62  ? 36  ARG F NE  1 
ATOM   6464 C  CZ  . ARG D 2 13  ? 48.158  -5.816  37.363  1.00 91.20  ? 36  ARG F CZ  1 
ATOM   6465 N  NH1 . ARG D 2 13  ? 47.058  -5.466  38.019  1.00 91.13  ? 36  ARG F NH1 1 
ATOM   6466 N  NH2 . ARG D 2 13  ? 48.544  -7.085  37.359  1.00 91.05  ? 36  ARG F NH2 1 
ATOM   6467 N  N   . LEU D 2 14  ? 48.667  -0.401  32.452  1.00 51.72  ? 37  LEU F N   1 
ATOM   6468 C  CA  . LEU D 2 14  ? 48.591  -0.659  31.014  1.00 48.68  ? 37  LEU F CA  1 
ATOM   6469 C  C   . LEU D 2 14  ? 49.636  0.138   30.235  1.00 51.50  ? 37  LEU F C   1 
ATOM   6470 O  O   . LEU D 2 14  ? 50.185  -0.344  29.242  1.00 53.66  ? 37  LEU F O   1 
ATOM   6471 C  CB  . LEU D 2 14  ? 47.192  -0.323  30.490  1.00 48.16  ? 37  LEU F CB  1 
ATOM   6472 C  CG  . LEU D 2 14  ? 46.910  -0.564  29.006  1.00 45.38  ? 37  LEU F CG  1 
ATOM   6473 C  CD1 . LEU D 2 14  ? 46.991  -2.048  28.667  1.00 41.39  ? 37  LEU F CD1 1 
ATOM   6474 C  CD2 . LEU D 2 14  ? 45.549  -0.002  28.628  1.00 44.40  ? 37  LEU F CD2 1 
ATOM   6475 N  N   . ALA D 2 15  ? 49.904  1.356   30.697  1.00 46.82  ? 38  ALA F N   1 
ATOM   6476 C  CA  . ALA D 2 15  ? 50.874  2.239   30.059  1.00 43.66  ? 38  ALA F CA  1 
ATOM   6477 C  C   . ALA D 2 15  ? 52.284  1.654   30.064  1.00 47.88  ? 38  ALA F C   1 
ATOM   6478 O  O   . ALA D 2 15  ? 53.057  1.865   29.130  1.00 48.31  ? 38  ALA F O   1 
ATOM   6479 C  CB  . ALA D 2 15  ? 50.865  3.600   30.736  1.00 45.09  ? 38  ALA F CB  1 
ATOM   6480 N  N   . ARG D 2 16  ? 52.615  0.922   31.123  1.00 52.60  ? 39  ARG F N   1 
ATOM   6481 C  CA  . ARG D 2 16  ? 53.946  0.337   31.270  1.00 55.36  ? 39  ARG F CA  1 
ATOM   6482 C  C   . ARG D 2 16  ? 54.055  -0.980  30.508  1.00 59.05  ? 39  ARG F C   1 
ATOM   6483 O  O   . ARG D 2 16  ? 55.153  -1.471  30.244  1.00 61.56  ? 39  ARG F O   1 
ATOM   6484 C  CB  . ARG D 2 16  ? 54.278  0.141   32.750  1.00 50.81  ? 39  ARG F CB  1 
ATOM   6485 C  CG  . ARG D 2 16  ? 54.085  1.407   33.571  1.00 55.55  ? 39  ARG F CG  1 
ATOM   6486 C  CD  . ARG D 2 16  ? 54.241  1.160   35.057  1.00 51.21  ? 39  ARG F CD  1 
ATOM   6487 N  NE  . ARG D 2 16  ? 55.633  0.926   35.416  1.00 53.57  ? 39  ARG F NE  1 
ATOM   6488 C  CZ  . ARG D 2 16  ? 56.113  -0.245  35.816  1.00 52.39  ? 39  ARG F CZ  1 
ATOM   6489 N  NH1 . ARG D 2 16  ? 55.306  -1.293  35.922  1.00 46.74  ? 39  ARG F NH1 1 
ATOM   6490 N  NH2 . ARG D 2 16  ? 57.398  -0.364  36.119  1.00 56.70  ? 39  ARG F NH2 1 
ATOM   6491 N  N   . ARG D 2 17  ? 52.906  -1.541  30.152  1.00 63.64  ? 40  ARG F N   1 
ATOM   6492 C  CA  . ARG D 2 17  ? 52.860  -2.747  29.338  1.00 66.07  ? 40  ARG F CA  1 
ATOM   6493 C  C   . ARG D 2 17  ? 52.666  -2.386  27.869  1.00 66.32  ? 40  ARG F C   1 
ATOM   6494 O  O   . ARG D 2 17  ? 52.627  -3.261  27.003  1.00 65.15  ? 40  ARG F O   1 
ATOM   6495 C  CB  . ARG D 2 17  ? 51.745  -3.674  29.827  1.00 69.25  ? 40  ARG F CB  1 
ATOM   6496 C  CG  . ARG D 2 17  ? 52.061  -4.337  31.159  1.00 72.47  ? 40  ARG F CG  1 
ATOM   6497 C  CD  . ARG D 2 17  ? 50.807  -4.614  31.974  1.00 79.93  ? 40  ARG F CD  1 
ATOM   6498 N  NE  . ARG D 2 17  ? 49.990  -5.681  31.403  1.00 84.05  ? 40  ARG F NE  1 
ATOM   6499 C  CZ  . ARG D 2 17  ? 48.900  -6.174  31.982  1.00 89.02  ? 40  ARG F CZ  1 
ATOM   6500 N  NH1 . ARG D 2 17  ? 48.216  -7.145  31.391  1.00 89.38  ? 40  ARG F NH1 1 
ATOM   6501 N  NH2 . ARG D 2 17  ? 48.492  -5.698  33.152  1.00 89.97  ? 40  ARG F NH2 1 
ATOM   6502 N  N   . GLY D 2 18  ? 52.553  -1.088  27.599  1.00 65.77  ? 41  GLY F N   1 
ATOM   6503 C  CA  . GLY D 2 18  ? 52.413  -0.589  26.236  1.00 61.48  ? 41  GLY F CA  1 
ATOM   6504 C  C   . GLY D 2 18  ? 51.011  -0.761  25.685  1.00 55.38  ? 41  GLY F C   1 
ATOM   6505 O  O   . GLY D 2 18  ? 50.782  -0.579  24.491  1.00 53.50  ? 41  GLY F O   1 
HETATM 6506 AS AS  . ARS E 3 .   ? 3.740   6.463   53.935  1.00 99.76  ? 412 ARS B AS  1 
HETATM 6507 AS AS  . ARS F 3 .   ? 54.907  17.817  4.288   1.00 80.45  ? 412 ARS A AS  1 
HETATM 6508 O  O   . HOH G 4 .   ? 16.616  7.239   36.927  1.00 51.52  ? 413 HOH B O   1 
HETATM 6509 O  O   . HOH G 4 .   ? 22.552  6.446   35.666  1.00 30.98  ? 414 HOH B O   1 
HETATM 6510 O  O   . HOH G 4 .   ? 15.071  16.807  33.677  1.00 39.89  ? 415 HOH B O   1 
HETATM 6511 O  O   . HOH G 4 .   ? 11.158  -6.753  17.250  1.00 83.29  ? 416 HOH B O   1 
HETATM 6512 O  O   . HOH G 4 .   ? 33.612  -6.788  54.249  1.00 38.92  ? 417 HOH B O   1 
HETATM 6513 O  O   . HOH G 4 .   ? 7.621   14.645  61.433  1.00 41.31  ? 418 HOH B O   1 
HETATM 6514 O  O   . HOH G 4 .   ? 11.763  -8.253  53.605  1.00 26.80  ? 419 HOH B O   1 
HETATM 6515 O  O   . HOH G 4 .   ? 21.171  4.625   38.570  1.00 40.39  ? 420 HOH B O   1 
HETATM 6516 O  O   . HOH G 4 .   ? 15.670  13.214  51.843  1.00 31.74  ? 421 HOH B O   1 
HETATM 6517 O  O   . HOH G 4 .   ? 18.290  12.510  51.862  1.00 40.20  ? 422 HOH B O   1 
HETATM 6518 O  O   . HOH G 4 .   ? -3.393  14.087  46.654  1.00 34.79  ? 423 HOH B O   1 
HETATM 6519 O  O   . HOH G 4 .   ? 35.680  3.153   50.553  1.00 43.25  ? 424 HOH B O   1 
HETATM 6520 O  O   . HOH G 4 .   ? 13.131  24.359  37.040  1.00 52.85  ? 425 HOH B O   1 
HETATM 6521 O  O   . HOH G 4 .   ? -4.958  12.613  44.933  1.00 32.27  ? 426 HOH B O   1 
HETATM 6522 O  O   . HOH G 4 .   ? 18.360  -6.210  18.817  1.00 80.33  ? 427 HOH B O   1 
HETATM 6523 O  O   . HOH G 4 .   ? 11.137  0.713   40.101  1.00 30.88  ? 428 HOH B O   1 
HETATM 6524 O  O   . HOH G 4 .   ? 3.452   1.159   49.556  1.00 26.25  ? 429 HOH B O   1 
HETATM 6525 O  O   . HOH G 4 .   ? 17.303  -16.337 52.451  1.00 34.91  ? 430 HOH B O   1 
HETATM 6526 O  O   . HOH G 4 .   ? 23.371  -8.804  55.964  1.00 28.56  ? 431 HOH B O   1 
HETATM 6527 O  O   . HOH G 4 .   ? 17.627  -19.458 62.277  1.00 48.69  ? 432 HOH B O   1 
HETATM 6528 O  O   . HOH G 4 .   ? 16.175  10.188  36.973  1.00 33.65  ? 433 HOH B O   1 
HETATM 6529 O  O   . HOH G 4 .   ? 20.915  18.956  50.644  1.00 49.47  ? 434 HOH B O   1 
HETATM 6530 O  O   . HOH G 4 .   ? 12.516  -8.450  56.457  1.00 44.06  ? 435 HOH B O   1 
HETATM 6531 O  O   . HOH G 4 .   ? 23.258  6.449   38.404  1.00 50.74  ? 436 HOH B O   1 
HETATM 6532 O  O   . HOH G 4 .   ? 20.549  5.242   44.624  1.00 26.30  ? 437 HOH B O   1 
HETATM 6533 O  O   . HOH G 4 .   ? -7.847  8.886   51.027  1.00 62.06  ? 438 HOH B O   1 
HETATM 6534 O  O   . HOH G 4 .   ? 25.495  0.472   53.842  1.00 28.13  ? 439 HOH B O   1 
HETATM 6535 O  O   . HOH G 4 .   ? -6.978  5.939   40.276  1.00 46.90  ? 440 HOH B O   1 
HETATM 6536 O  O   . HOH G 4 .   ? 21.453  -14.000 54.837  1.00 31.32  ? 441 HOH B O   1 
HETATM 6537 O  O   . HOH G 4 .   ? 29.707  7.907   58.332  1.00 62.30  ? 442 HOH B O   1 
HETATM 6538 O  O   . HOH G 4 .   ? 9.265   22.362  34.952  1.00 43.19  ? 443 HOH B O   1 
HETATM 6539 O  O   . HOH G 4 .   ? 25.211  13.535  47.398  1.00 59.76  ? 444 HOH B O   1 
HETATM 6540 O  O   . HOH G 4 .   ? -7.535  13.713  45.188  1.00 30.51  ? 445 HOH B O   1 
HETATM 6541 O  O   . HOH G 4 .   ? 28.236  7.586   61.057  1.00 57.26  ? 446 HOH B O   1 
HETATM 6542 O  O   . HOH G 4 .   ? 14.654  -10.173 33.357  1.00 60.47  ? 447 HOH B O   1 
HETATM 6543 O  O   . HOH G 4 .   ? 39.351  -2.576  37.281  1.00 27.08  ? 448 HOH B O   1 
HETATM 6544 O  O   . HOH G 4 .   ? 23.935  -19.995 64.087  1.00 51.35  ? 449 HOH B O   1 
HETATM 6545 O  O   . HOH G 4 .   ? 11.545  23.672  68.542  1.00 55.70  ? 450 HOH B O   1 
HETATM 6546 O  O   . HOH G 4 .   ? 55.324  -12.981 48.472  1.00 66.84  ? 451 HOH B O   1 
HETATM 6547 O  O   . HOH G 4 .   ? 6.290   -12.726 48.851  1.00 46.53  ? 452 HOH B O   1 
HETATM 6548 O  O   . HOH G 4 .   ? 19.705  0.617   64.546  1.00 46.41  ? 453 HOH B O   1 
HETATM 6549 O  O   . HOH G 4 .   ? -1.309  12.116  53.311  1.00 61.82  ? 454 HOH B O   1 
HETATM 6550 O  O   . HOH G 4 .   ? 21.811  18.010  39.931  1.00 48.90  ? 455 HOH B O   1 
HETATM 6551 O  O   . HOH G 4 .   ? 13.796  9.899   65.828  1.00 46.39  ? 456 HOH B O   1 
HETATM 6552 O  O   . HOH G 4 .   ? 4.311   20.798  34.624  1.00 46.08  ? 457 HOH B O   1 
HETATM 6553 O  O   . HOH G 4 .   ? 19.041  2.883   36.441  1.00 42.44  ? 458 HOH B O   1 
HETATM 6554 O  O   . HOH G 4 .   ? 20.956  -2.934  66.039  1.00 37.55  ? 459 HOH B O   1 
HETATM 6555 O  O   . HOH G 4 .   ? 17.628  20.450  45.047  1.00 64.60  ? 460 HOH B O   1 
HETATM 6556 O  O   . HOH G 4 .   ? -5.282  20.746  49.813  1.00 45.83  ? 461 HOH B O   1 
HETATM 6557 O  O   . HOH G 4 .   ? 34.453  14.685  26.789  1.00 63.73  ? 462 HOH B O   1 
HETATM 6558 O  O   . HOH G 4 .   ? 31.659  -4.470  20.402  1.00 47.65  ? 463 HOH B O   1 
HETATM 6559 O  O   . HOH G 4 .   ? -7.680  7.902   48.160  1.00 25.77  ? 464 HOH B O   1 
HETATM 6560 O  O   . HOH G 4 .   ? 16.681  -14.472 54.530  1.00 34.67  ? 465 HOH B O   1 
HETATM 6561 O  O   . HOH G 4 .   ? 19.759  11.249  35.202  1.00 34.02  ? 466 HOH B O   1 
HETATM 6562 O  O   . HOH G 4 .   ? 2.809   2.872   56.170  1.00 33.48  ? 467 HOH B O   1 
HETATM 6563 O  O   . HOH G 4 .   ? 1.750   -6.068  37.786  1.00 59.26  ? 468 HOH B O   1 
HETATM 6564 O  O   . HOH G 4 .   ? 37.849  1.598   52.349  1.00 48.54  ? 469 HOH B O   1 
HETATM 6565 O  O   . HOH G 4 .   ? 36.230  -25.845 54.408  1.00 56.59  ? 470 HOH B O   1 
HETATM 6566 O  O   . HOH G 4 .   ? 16.362  -13.534 65.462  1.00 50.50  ? 471 HOH B O   1 
HETATM 6567 O  O   . HOH G 4 .   ? 22.766  -1.636  64.648  1.00 45.54  ? 472 HOH B O   1 
HETATM 6568 O  O   . HOH G 4 .   ? 15.883  11.296  39.369  1.00 28.34  ? 473 HOH B O   1 
HETATM 6569 O  O   . HOH G 4 .   ? -9.337  16.026  49.384  1.00 31.68  ? 474 HOH B O   1 
HETATM 6570 O  O   . HOH G 4 .   ? 18.066  4.338   34.748  1.00 36.28  ? 475 HOH B O   1 
HETATM 6571 O  O   . HOH G 4 .   ? -0.547  3.302   51.220  1.00 55.52  ? 476 HOH B O   1 
HETATM 6572 O  O   . HOH G 4 .   ? 18.484  9.032   43.134  1.00 45.39  ? 477 HOH B O   1 
HETATM 6573 O  O   . HOH G 4 .   ? 33.022  9.390   26.093  1.00 50.65  ? 478 HOH B O   1 
HETATM 6574 O  O   . HOH G 4 .   ? -3.837  12.283  40.754  1.00 33.88  ? 479 HOH B O   1 
HETATM 6575 O  O   . HOH G 4 .   ? 22.792  7.551   60.931  1.00 49.46  ? 480 HOH B O   1 
HETATM 6576 O  O   . HOH G 4 .   ? 16.960  3.321   38.215  1.00 31.44  ? 481 HOH B O   1 
HETATM 6577 O  O   . HOH G 4 .   ? 14.286  -21.367 45.879  1.00 58.18  ? 482 HOH B O   1 
HETATM 6578 O  O   . HOH G 4 .   ? 8.195   25.227  40.738  1.00 56.08  ? 483 HOH B O   1 
HETATM 6579 O  O   . HOH G 4 .   ? 9.600   16.891  63.160  1.00 46.00  ? 484 HOH B O   1 
HETATM 6580 O  O   . HOH G 4 .   ? 7.952   10.254  16.519  1.00 54.99  ? 485 HOH B O   1 
HETATM 6581 O  O   . HOH G 4 .   ? 20.604  9.384   45.314  1.00 40.72  ? 486 HOH B O   1 
HETATM 6582 O  O   . HOH G 4 .   ? 30.779  3.331   15.230  1.00 61.24  ? 487 HOH B O   1 
HETATM 6583 O  O   . HOH G 4 .   ? 25.144  -7.704  11.284  1.00 52.58  ? 488 HOH B O   1 
HETATM 6584 O  O   . HOH G 4 .   ? 26.546  14.568  50.453  1.00 46.67  ? 489 HOH B O   1 
HETATM 6585 O  O   . HOH G 4 .   ? 21.511  8.305   34.695  1.00 35.54  ? 490 HOH B O   1 
HETATM 6586 O  O   . HOH G 4 .   ? 14.256  -3.421  35.905  1.00 53.37  ? 491 HOH B O   1 
HETATM 6587 O  O   . HOH G 4 .   ? 7.789   -2.870  49.551  1.00 32.48  ? 492 HOH B O   1 
HETATM 6588 O  O   . HOH G 4 .   ? 34.281  16.132  28.925  1.00 69.89  ? 493 HOH B O   1 
HETATM 6589 O  O   . HOH G 4 .   ? 21.417  16.287  48.329  1.00 43.43  ? 494 HOH B O   1 
HETATM 6590 O  O   . HOH G 4 .   ? -5.221  2.337   41.279  1.00 33.58  ? 495 HOH B O   1 
HETATM 6591 O  O   . HOH G 4 .   ? 15.735  -14.109 52.058  1.00 26.39  ? 496 HOH B O   1 
HETATM 6592 O  O   . HOH G 4 .   ? 33.560  -11.108 40.699  1.00 39.02  ? 497 HOH B O   1 
HETATM 6593 O  O   . HOH G 4 .   ? -8.012  20.285  48.982  1.00 38.33  ? 498 HOH B O   1 
HETATM 6594 O  O   . HOH G 4 .   ? 9.253   -4.164  31.592  1.00 53.03  ? 499 HOH B O   1 
HETATM 6595 O  O   . HOH G 4 .   ? 27.577  14.575  47.421  1.00 51.03  ? 500 HOH B O   1 
HETATM 6596 O  O   . HOH G 4 .   ? 24.261  16.946  52.847  1.00 48.06  ? 501 HOH B O   1 
HETATM 6597 O  O   . HOH G 4 .   ? 9.728   25.758  33.500  1.00 42.58  ? 502 HOH B O   1 
HETATM 6598 O  O   . HOH G 4 .   ? 23.387  16.170  55.454  1.00 50.23  ? 503 HOH B O   1 
HETATM 6599 O  O   . HOH G 4 .   ? 26.842  6.764   50.026  1.00 58.72  ? 504 HOH B O   1 
HETATM 6600 O  O   . HOH G 4 .   ? 4.306   -11.303 48.261  1.00 54.71  ? 505 HOH B O   1 
HETATM 6601 O  O   . HOH G 4 .   ? 10.596  -3.405  39.816  1.00 54.75  ? 506 HOH B O   1 
HETATM 6602 O  O   . HOH G 4 .   ? 18.158  12.304  39.594  1.00 38.79  ? 507 HOH B O   1 
HETATM 6603 O  O   . HOH G 4 .   ? 6.105   -22.250 56.517  1.00 33.16  ? 508 HOH B O   1 
HETATM 6604 O  O   . HOH G 4 .   ? 7.391   -12.724 53.214  1.00 48.10  ? 509 HOH B O   1 
HETATM 6605 O  O   . HOH G 4 .   ? 0.223   -6.974  45.156  1.00 45.92  ? 510 HOH B O   1 
HETATM 6606 O  O   . HOH G 4 .   ? 18.623  19.848  51.790  1.00 53.21  ? 511 HOH B O   1 
HETATM 6607 O  O   . HOH G 4 .   ? 31.646  -8.073  24.822  1.00 61.06  ? 512 HOH B O   1 
HETATM 6608 O  O   . HOH G 4 .   ? 40.311  -21.866 39.662  1.00 46.64  ? 513 HOH B O   1 
HETATM 6609 O  O   . HOH G 4 .   ? 38.607  -19.168 37.787  1.00 64.60  ? 514 HOH B O   1 
HETATM 6610 O  O   . HOH G 4 .   ? 20.857  12.196  58.967  1.00 33.84  ? 515 HOH B O   1 
HETATM 6611 O  O   . HOH G 4 .   ? 18.611  7.651   38.771  1.00 55.61  ? 516 HOH B O   1 
HETATM 6612 O  O   . HOH G 4 .   ? 23.102  14.617  31.120  1.00 39.87  ? 517 HOH B O   1 
HETATM 6613 O  O   . HOH G 4 .   ? -5.504  13.219  32.204  1.00 53.11  ? 518 HOH B O   1 
HETATM 6614 O  O   . HOH G 4 .   ? -7.281  8.989   30.321  1.00 56.31  ? 519 HOH B O   1 
HETATM 6615 O  O   . HOH G 4 .   ? 12.560  26.125  66.841  1.00 43.02  ? 520 HOH B O   1 
HETATM 6616 O  O   . HOH G 4 .   ? 8.495   -14.921 53.976  1.00 39.46  ? 521 HOH B O   1 
HETATM 6617 O  O   . HOH G 4 .   ? -4.938  -23.212 45.403  1.00 47.19  ? 522 HOH B O   1 
HETATM 6618 O  O   . HOH G 4 .   ? -4.923  17.579  27.564  1.00 50.96  ? 523 HOH B O   1 
HETATM 6619 O  O   . HOH G 4 .   ? 3.209   18.223  22.281  1.00 54.55  ? 524 HOH B O   1 
HETATM 6620 O  O   . HOH G 4 .   ? 24.310  6.872   50.860  1.00 30.29  ? 525 HOH B O   1 
HETATM 6621 O  O   . HOH G 4 .   ? 18.683  11.187  45.128  1.00 34.14  ? 526 HOH B O   1 
HETATM 6622 O  O   . HOH G 4 .   ? 1.865   -8.264  39.293  1.00 49.04  ? 527 HOH B O   1 
HETATM 6623 O  O   . HOH G 4 .   ? -1.425  12.238  21.275  1.00 53.19  ? 528 HOH B O   1 
HETATM 6624 O  O   . HOH G 4 .   ? 11.213  10.025  66.055  1.00 48.79  ? 529 HOH B O   1 
HETATM 6625 O  O   . HOH G 4 .   ? 9.911   -6.775  42.239  1.00 32.43  ? 530 HOH B O   1 
HETATM 6626 O  O   . HOH G 4 .   ? -2.711  -6.878  44.563  1.00 66.70  ? 531 HOH B O   1 
HETATM 6627 O  O   . HOH G 4 .   ? 3.648   -26.296 55.893  1.00 37.55  ? 532 HOH B O   1 
HETATM 6628 O  O   . HOH G 4 .   ? 21.973  -16.341 53.684  1.00 48.85  ? 533 HOH B O   1 
HETATM 6629 O  O   . HOH G 4 .   ? 11.702  -22.264 44.922  1.00 43.00  ? 534 HOH B O   1 
HETATM 6630 O  O   . HOH G 4 .   ? -0.077  -6.719  50.298  1.00 36.82  ? 535 HOH B O   1 
HETATM 6631 O  O   . HOH G 4 .   ? 33.858  14.670  20.972  1.00 61.63  ? 536 HOH B O   1 
HETATM 6632 O  O   . HOH G 4 .   ? 18.294  6.444   44.003  1.00 26.80  ? 537 HOH B O   1 
HETATM 6633 O  O   . HOH H 4 .   ? 26.941  -15.920 50.528  1.00 46.89  ? 177 HOH E O   1 
HETATM 6634 O  O   . HOH H 4 .   ? 28.350  -23.240 65.329  1.00 47.71  ? 191 HOH E O   1 
HETATM 6635 O  O   . HOH H 4 .   ? 43.326  -6.762  58.165  1.00 59.04  ? 192 HOH E O   1 
HETATM 6636 O  O   . HOH H 4 .   ? 26.224  -16.594 58.306  1.00 56.20  ? 193 HOH E O   1 
HETATM 6637 O  O   . HOH H 4 .   ? 37.724  -13.385 68.522  1.00 35.86  ? 195 HOH E O   1 
HETATM 6638 O  O   . HOH H 4 .   ? 32.037  -11.861 66.252  1.00 56.71  ? 196 HOH E O   1 
HETATM 6639 O  O   . HOH H 4 .   ? 24.872  -19.395 61.860  1.00 44.12  ? 198 HOH E O   1 
HETATM 6640 O  O   . HOH I 4 .   ? 61.001  9.401   45.751  1.00 54.70  ? 413 HOH A O   1 
HETATM 6641 O  O   . HOH I 4 .   ? 60.546  27.255  -7.739  1.00 36.18  ? 414 HOH A O   1 
HETATM 6642 O  O   . HOH I 4 .   ? 56.343  24.613  16.574  1.00 29.64  ? 415 HOH A O   1 
HETATM 6643 O  O   . HOH I 4 .   ? 59.291  28.018  22.456  1.00 44.05  ? 416 HOH A O   1 
HETATM 6644 O  O   . HOH I 4 .   ? 69.397  15.591  22.618  1.00 34.22  ? 417 HOH A O   1 
HETATM 6645 O  O   . HOH I 4 .   ? 64.632  24.078  -3.437  1.00 40.60  ? 418 HOH A O   1 
HETATM 6646 O  O   . HOH I 4 .   ? 68.176  13.903  -3.355  1.00 30.85  ? 419 HOH A O   1 
HETATM 6647 O  O   . HOH I 4 .   ? 55.757  24.027  19.263  1.00 28.13  ? 420 HOH A O   1 
HETATM 6648 O  O   . HOH I 4 .   ? 54.672  2.762   12.284  1.00 30.38  ? 421 HOH A O   1 
HETATM 6649 O  O   . HOH I 4 .   ? 62.605  25.403  -2.246  1.00 31.42  ? 422 HOH A O   1 
HETATM 6650 O  O   . HOH I 4 .   ? 45.220  28.284  9.601   1.00 54.45  ? 423 HOH A O   1 
HETATM 6651 O  O   . HOH I 4 .   ? 65.710  -8.959  -0.240  1.00 58.22  ? 424 HOH A O   1 
HETATM 6652 O  O   . HOH I 4 .   ? 71.200  18.717  18.028  1.00 38.44  ? 425 HOH A O   1 
HETATM 6653 O  O   . HOH I 4 .   ? 63.137  16.719  22.109  1.00 35.20  ? 426 HOH A O   1 
HETATM 6654 O  O   . HOH I 4 .   ? 64.410  25.120  -6.064  1.00 26.23  ? 427 HOH A O   1 
HETATM 6655 O  O   . HOH I 4 .   ? 65.473  6.385   17.674  1.00 29.11  ? 428 HOH A O   1 
HETATM 6656 O  O   . HOH I 4 .   ? 85.809  14.569  0.141   1.00 55.15  ? 429 HOH A O   1 
HETATM 6657 O  O   . HOH I 4 .   ? 52.225  2.908   13.128  1.00 30.96  ? 430 HOH A O   1 
HETATM 6658 O  O   . HOH I 4 .   ? 53.420  11.980  26.049  1.00 39.46  ? 431 HOH A O   1 
HETATM 6659 O  O   . HOH I 4 .   ? 46.596  19.234  26.569  1.00 53.55  ? 432 HOH A O   1 
HETATM 6660 O  O   . HOH I 4 .   ? 57.375  18.050  27.707  1.00 29.88  ? 433 HOH A O   1 
HETATM 6661 O  O   . HOH I 4 .   ? 51.280  2.586   23.987  1.00 27.44  ? 434 HOH A O   1 
HETATM 6662 O  O   . HOH I 4 .   ? 71.258  21.328  17.890  1.00 33.89  ? 435 HOH A O   1 
HETATM 6663 O  O   . HOH I 4 .   ? 45.624  23.247  24.101  1.00 62.16  ? 436 HOH A O   1 
HETATM 6664 O  O   . HOH I 4 .   ? 57.801  24.439  -10.751 1.00 44.15  ? 437 HOH A O   1 
HETATM 6665 O  O   . HOH I 4 .   ? 60.516  25.098  26.781  1.00 46.78  ? 438 HOH A O   1 
HETATM 6666 O  O   . HOH I 4 .   ? 72.861  19.398  23.574  1.00 44.91  ? 439 HOH A O   1 
HETATM 6667 O  O   . HOH I 4 .   ? 59.035  11.729  -6.397  1.00 50.85  ? 440 HOH A O   1 
HETATM 6668 O  O   . HOH I 4 .   ? 60.366  24.355  33.482  1.00 53.85  ? 441 HOH A O   1 
HETATM 6669 O  O   . HOH I 4 .   ? 42.663  -2.170  16.556  1.00 46.08  ? 442 HOH A O   1 
HETATM 6670 O  O   . HOH I 4 .   ? 68.314  11.651  12.459  1.00 42.71  ? 443 HOH A O   1 
HETATM 6671 O  O   . HOH I 4 .   ? 83.182  30.872  35.635  1.00 62.88  ? 444 HOH A O   1 
HETATM 6672 O  O   . HOH I 4 .   ? 55.484  15.098  36.472  1.00 54.20  ? 445 HOH A O   1 
HETATM 6673 O  O   . HOH I 4 .   ? 68.818  1.411   40.984  1.00 56.09  ? 446 HOH A O   1 
HETATM 6674 O  O   . HOH I 4 .   ? 70.493  1.131   38.202  1.00 53.84  ? 447 HOH A O   1 
HETATM 6675 O  O   . HOH I 4 .   ? 63.815  0.946   2.087   1.00 58.55  ? 448 HOH A O   1 
HETATM 6676 O  O   . HOH I 4 .   ? 67.777  3.787   -9.564  1.00 50.84  ? 449 HOH A O   1 
HETATM 6677 O  O   . HOH I 4 .   ? 72.797  6.311   0.428   1.00 64.07  ? 450 HOH A O   1 
HETATM 6678 O  O   . HOH I 4 .   ? 82.141  17.971  6.475   1.00 36.88  ? 451 HOH A O   1 
HETATM 6679 O  O   . HOH I 4 .   ? 69.432  -15.107 -9.255  1.00 48.30  ? 452 HOH A O   1 
HETATM 6680 O  O   . HOH I 4 .   ? 67.393  26.344  -5.638  1.00 55.53  ? 453 HOH A O   1 
HETATM 6681 O  O   . HOH I 4 .   ? 89.612  9.720   15.232  1.00 55.11  ? 454 HOH A O   1 
HETATM 6682 O  O   . HOH I 4 .   ? 80.148  2.487   35.014  1.00 51.35  ? 455 HOH A O   1 
HETATM 6683 O  O   . HOH I 4 .   ? 60.190  -8.880  16.604  1.00 70.67  ? 456 HOH A O   1 
HETATM 6684 O  O   . HOH I 4 .   ? 64.409  -6.319  27.458  1.00 40.42  ? 457 HOH A O   1 
HETATM 6685 O  O   . HOH I 4 .   ? 66.060  0.250   35.021  1.00 64.71  ? 458 HOH A O   1 
HETATM 6686 O  O   . HOH I 4 .   ? 60.442  31.456  18.973  1.00 49.65  ? 459 HOH A O   1 
HETATM 6687 O  O   . HOH I 4 .   ? 68.514  31.060  21.982  1.00 56.32  ? 460 HOH A O   1 
HETATM 6688 O  O   . HOH I 4 .   ? 57.941  3.404   53.778  1.00 40.91  ? 461 HOH A O   1 
HETATM 6689 O  O   . HOH I 4 .   ? 43.304  12.185  19.587  1.00 39.93  ? 462 HOH A O   1 
HETATM 6690 O  O   . HOH I 4 .   ? 52.764  -14.998 4.232   1.00 35.37  ? 463 HOH A O   1 
HETATM 6691 O  O   . HOH I 4 .   ? 62.319  12.125  -8.290  1.00 48.51  ? 464 HOH A O   1 
HETATM 6692 O  O   . HOH I 4 .   ? 53.960  -2.972  17.181  1.00 40.48  ? 465 HOH A O   1 
HETATM 6693 O  O   . HOH I 4 .   ? 55.859  3.019   18.844  1.00 44.28  ? 466 HOH A O   1 
HETATM 6694 O  O   . HOH I 4 .   ? 43.921  -10.709 11.633  1.00 39.60  ? 467 HOH A O   1 
HETATM 6695 O  O   . HOH I 4 .   ? 39.701  6.000   16.567  1.00 40.21  ? 468 HOH A O   1 
HETATM 6696 O  O   . HOH I 4 .   ? 47.370  7.322   8.784   1.00 43.90  ? 469 HOH A O   1 
HETATM 6697 O  O   . HOH I 4 .   ? 49.616  9.730   4.027   1.00 26.77  ? 470 HOH A O   1 
HETATM 6698 O  O   . HOH I 4 .   ? 58.201  14.381  0.007   1.00 51.66  ? 471 HOH A O   1 
HETATM 6699 O  O   . HOH I 4 .   ? 64.975  15.772  17.802  1.00 41.39  ? 472 HOH A O   1 
HETATM 6700 O  O   . HOH I 4 .   ? 67.743  17.064  24.339  1.00 33.01  ? 473 HOH A O   1 
HETATM 6701 O  O   . HOH I 4 .   ? 62.252  20.482  21.964  1.00 43.19  ? 474 HOH A O   1 
HETATM 6702 O  O   . HOH I 4 .   ? 77.884  1.507   13.314  1.00 43.02  ? 475 HOH A O   1 
HETATM 6703 O  O   . HOH I 4 .   ? 71.877  33.262  5.347   1.00 55.28  ? 476 HOH A O   1 
HETATM 6704 O  O   . HOH I 4 .   ? 68.851  22.927  17.264  1.00 31.53  ? 477 HOH A O   1 
HETATM 6705 O  O   . HOH I 4 .   ? 64.135  3.423   2.940   1.00 40.78  ? 478 HOH A O   1 
HETATM 6706 O  O   . HOH I 4 .   ? 62.490  21.592  19.448  1.00 37.44  ? 479 HOH A O   1 
HETATM 6707 O  O   . HOH I 4 .   ? 71.198  17.437  24.755  1.00 55.56  ? 480 HOH A O   1 
HETATM 6708 O  O   . HOH I 4 .   ? 55.275  6.268   -1.098  1.00 44.82  ? 481 HOH A O   1 
HETATM 6709 O  O   . HOH I 4 .   ? 74.066  18.342  32.142  1.00 34.68  ? 482 HOH A O   1 
HETATM 6710 O  O   . HOH I 4 .   ? 79.974  33.994  18.035  1.00 57.68  ? 483 HOH A O   1 
HETATM 6711 O  O   . HOH I 4 .   ? 63.855  16.013  -9.163  1.00 50.54  ? 484 HOH A O   1 
HETATM 6712 O  O   . HOH I 4 .   ? 52.962  -10.748 6.647   1.00 41.62  ? 485 HOH A O   1 
HETATM 6713 O  O   . HOH I 4 .   ? 46.947  20.299  23.447  1.00 39.33  ? 486 HOH A O   1 
HETATM 6714 O  O   . HOH I 4 .   ? 42.472  8.186   21.203  1.00 59.62  ? 487 HOH A O   1 
HETATM 6715 O  O   . HOH I 4 .   ? 46.210  18.167  23.177  1.00 39.26  ? 488 HOH A O   1 
HETATM 6716 O  O   . HOH I 4 .   ? 41.285  31.023  40.836  1.00 59.80  ? 489 HOH A O   1 
HETATM 6717 O  O   . HOH I 4 .   ? 51.221  26.586  23.529  1.00 50.90  ? 490 HOH A O   1 
HETATM 6718 O  O   . HOH I 4 .   ? 68.163  9.675   -5.035  1.00 66.78  ? 491 HOH A O   1 
HETATM 6719 O  O   . HOH I 4 .   ? 35.890  8.096   13.818  1.00 45.05  ? 492 HOH A O   1 
HETATM 6720 O  O   . HOH I 4 .   ? 72.343  34.713  12.254  1.00 45.88  ? 493 HOH A O   1 
HETATM 6721 O  O   . HOH I 4 .   ? 92.617  17.749  13.499  1.00 50.98  ? 494 HOH A O   1 
HETATM 6722 O  O   . HOH I 4 .   ? 74.203  32.555  8.067   1.00 58.21  ? 495 HOH A O   1 
HETATM 6723 O  O   . HOH I 4 .   ? 73.976  33.296  10.606  1.00 53.68  ? 496 HOH A O   1 
HETATM 6724 O  O   . HOH I 4 .   ? 60.036  32.587  -0.387  1.00 54.16  ? 497 HOH A O   1 
HETATM 6725 O  O   . HOH I 4 .   ? 63.435  33.125  -3.277  1.00 54.57  ? 498 HOH A O   1 
HETATM 6726 O  O   . HOH I 4 .   ? 62.641  33.950  -0.887  1.00 54.93  ? 499 HOH A O   1 
HETATM 6727 O  O   . HOH I 4 .   ? 76.702  -0.656  13.790  1.00 56.70  ? 500 HOH A O   1 
HETATM 6728 O  O   . HOH I 4 .   ? 65.749  22.432  25.785  1.00 57.43  ? 501 HOH A O   1 
HETATM 6729 O  O   . HOH I 4 .   ? 56.979  30.047  21.358  1.00 46.35  ? 502 HOH A O   1 
HETATM 6730 O  O   . HOH I 4 .   ? 93.583  20.756  5.710   1.00 59.87  ? 503 HOH A O   1 
HETATM 6731 O  O   . HOH I 4 .   ? 75.332  0.791   15.791  1.00 61.94  ? 504 HOH A O   1 
HETATM 6732 O  O   . HOH I 4 .   ? 76.320  -7.292  11.904  1.00 58.90  ? 505 HOH A O   1 
HETATM 6733 O  O   . HOH I 4 .   ? 81.091  -0.534  31.129  1.00 54.53  ? 506 HOH A O   1 
HETATM 6734 O  O   . HOH I 4 .   ? 72.029  -5.347  41.922  1.00 62.88  ? 507 HOH A O   1 
HETATM 6735 O  O   . HOH I 4 .   ? 42.149  9.709   23.150  1.00 42.67  ? 508 HOH A O   1 
HETATM 6736 O  O   . HOH I 4 .   ? 46.965  25.961  7.719   1.00 51.21  ? 509 HOH A O   1 
HETATM 6737 O  O   . HOH I 4 .   ? 65.033  12.022  6.186   1.00 32.07  ? 510 HOH A O   1 
HETATM 6738 O  O   . HOH I 4 .   ? 92.565  8.038   5.266   1.00 49.30  ? 511 HOH A O   1 
HETATM 6739 O  O   . HOH I 4 .   ? 90.181  24.015  18.829  1.00 60.67  ? 512 HOH A O   1 
HETATM 6740 O  O   . HOH I 4 .   ? 68.765  13.848  -6.338  1.00 48.58  ? 513 HOH A O   1 
HETATM 6741 O  O   . HOH I 4 .   ? 43.128  10.322  17.646  1.00 65.69  ? 514 HOH A O   1 
HETATM 6742 O  O   . HOH I 4 .   ? 66.104  -7.484  -4.065  1.00 56.82  ? 515 HOH A O   1 
HETATM 6743 O  O   . HOH I 4 .   ? 82.271  27.048  29.466  1.00 56.65  ? 516 HOH A O   1 
HETATM 6744 O  O   . HOH I 4 .   ? 68.392  23.609  -2.248  1.00 33.11  ? 517 HOH A O   1 
HETATM 6745 O  O   . HOH I 4 .   ? 64.912  -4.442  3.322   1.00 55.77  ? 518 HOH A O   1 
HETATM 6746 O  O   . HOH I 4 .   ? 64.325  4.816   -2.773  1.00 72.05  ? 519 HOH A O   1 
HETATM 6747 O  O   . HOH I 4 .   ? 46.026  16.909  28.153  1.00 56.04  ? 520 HOH A O   1 
HETATM 6748 O  O   . HOH I 4 .   ? 61.560  29.833  11.994  1.00 42.74  ? 521 HOH A O   1 
HETATM 6749 O  O   . HOH I 4 .   ? 55.847  31.459  19.132  1.00 40.88  ? 522 HOH A O   1 
HETATM 6750 O  O   . HOH I 4 .   ? 58.950  8.292   9.061   1.00 30.91  ? 523 HOH A O   1 
HETATM 6751 O  O   . HOH I 4 .   ? 64.914  20.406  19.638  1.00 32.30  ? 524 HOH A O   1 
HETATM 6752 O  O   . HOH I 4 .   ? 56.795  18.274  24.732  1.00 21.23  ? 525 HOH A O   1 
HETATM 6753 O  O   . HOH I 4 .   ? 59.225  -4.207  21.500  1.00 69.20  ? 526 HOH A O   1 
HETATM 6754 O  O   . HOH I 4 .   ? 57.127  33.327  -1.181  1.00 50.24  ? 527 HOH A O   1 
HETATM 6755 O  O   . HOH I 4 .   ? 68.063  23.624  19.509  1.00 47.32  ? 528 HOH A O   1 
HETATM 6756 O  O   . HOH I 4 .   ? 46.401  -8.143  24.982  1.00 35.94  ? 529 HOH A O   1 
HETATM 6757 O  O   . HOH I 4 .   ? 38.227  11.037  10.140  1.00 67.98  ? 530 HOH A O   1 
HETATM 6758 O  O   . HOH I 4 .   ? 54.765  13.101  37.689  1.00 46.97  ? 531 HOH A O   1 
HETATM 6759 O  O   . HOH I 4 .   ? 40.774  3.954   17.928  1.00 50.19  ? 532 HOH A O   1 
HETATM 6760 O  O   . HOH I 4 .   ? 73.261  21.009  30.618  1.00 49.33  ? 533 HOH A O   1 
HETATM 6761 O  O   . HOH I 4 .   ? 72.607  22.230  22.231  1.00 53.27  ? 534 HOH A O   1 
HETATM 6762 O  O   . HOH I 4 .   ? 74.037  24.280  23.575  1.00 42.13  ? 535 HOH A O   1 
HETATM 6763 O  O   . HOH I 4 .   ? 52.646  4.704   34.622  1.00 26.89  ? 536 HOH A O   1 
HETATM 6764 O  O   . HOH I 4 .   ? 52.745  -0.194  46.748  1.00 57.85  ? 537 HOH A O   1 
HETATM 6765 O  O   . HOH I 4 .   ? 56.804  23.447  -0.975  1.00 58.88  ? 538 HOH A O   1 
HETATM 6766 O  O   . HOH I 4 .   ? 76.859  33.969  21.142  1.00 52.99  ? 539 HOH A O   1 
HETATM 6767 O  O   . HOH I 4 .   ? 74.444  28.367  17.193  1.00 56.29  ? 540 HOH A O   1 
HETATM 6768 O  O   . HOH I 4 .   ? 71.453  30.609  -7.714  1.00 72.94  ? 541 HOH A O   1 
HETATM 6769 O  O   . HOH I 4 .   ? 89.177  4.481   21.827  1.00 42.43  ? 542 HOH A O   1 
HETATM 6770 O  O   . HOH I 4 .   ? 59.433  -13.238 4.874   1.00 51.77  ? 543 HOH A O   1 
HETATM 6771 O  O   . HOH I 4 .   ? 85.481  12.243  40.756  1.00 46.76  ? 544 HOH A O   1 
HETATM 6772 O  O   . HOH I 4 .   ? 79.903  2.651   37.893  1.00 59.08  ? 545 HOH A O   1 
HETATM 6773 O  O   . HOH I 4 .   ? 88.382  21.574  6.351   1.00 45.42  ? 546 HOH A O   1 
HETATM 6774 O  O   . HOH I 4 .   ? 62.034  19.226  -6.472  1.00 42.46  ? 547 HOH A O   1 
HETATM 6775 O  O   . HOH I 4 .   ? 85.916  2.059   10.416  1.00 69.08  ? 548 HOH A O   1 
HETATM 6776 O  O   . HOH I 4 .   ? 74.343  6.235   2.756   1.00 45.73  ? 549 HOH A O   1 
HETATM 6777 O  O   . HOH I 4 .   ? 87.929  14.094  41.383  1.00 50.60  ? 550 HOH A O   1 
HETATM 6778 O  O   . HOH I 4 .   ? 71.881  7.588   16.353  1.00 69.53  ? 551 HOH A O   1 
HETATM 6779 O  O   . HOH I 4 .   ? 72.420  36.185  0.640   1.00 50.07  ? 552 HOH A O   1 
HETATM 6780 O  O   . HOH I 4 .   ? 55.987  -8.598  3.371   1.00 47.59  ? 553 HOH A O   1 
HETATM 6781 O  O   . HOH J 4 .   ? 41.270  -0.661  32.156  1.00 46.86  ? 4   HOH F O   1 
HETATM 6782 O  O   . HOH J 4 .   ? 48.849  -1.813  23.468  1.00 53.32  ? 364 HOH F O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   HIS 1   -2  -2  HIS HIS B . n 
A 1 2   MSE 2   -1  -1  MSE MSE B . n 
A 1 3   ALA 3   0   0   ALA ALA B . n 
A 1 4   MSE 4   1   1   MSE MSE B . n 
A 1 5   ALA 5   2   2   ALA ALA B . n 
A 1 6   SER 6   3   3   SER SER B . n 
A 1 7   LYS 7   4   4   LYS LYS B . n 
A 1 8   GLU 8   5   5   GLU GLU B . n 
A 1 9   MSE 9   6   6   MSE MSE B . n 
A 1 10  PHE 10  7   7   PHE PHE B . n 
A 1 11  GLU 11  8   8   GLU GLU B . n 
A 1 12  ASP 12  9   9   ASP ASP B . n 
A 1 13  THR 13  10  10  THR THR B . n 
A 1 14  VAL 14  11  11  VAL VAL B . n 
A 1 15  GLU 15  12  12  GLU GLU B . n 
A 1 16  GLU 16  13  13  GLU GLU B . n 
A 1 17  ARG 17  14  14  ARG ARG B . n 
A 1 18  VAL 18  15  15  VAL VAL B . n 
A 1 19  ILE 19  16  16  ILE ILE B . n 
A 1 20  ASN 20  17  17  ASN ASN B . n 
A 1 21  GLU 21  18  18  GLU GLU B . n 
A 1 22  GLU 22  19  19  GLU GLU B . n 
A 1 23  TYR 23  20  20  TYR TYR B . n 
A 1 24  LYS 24  21  21  LYS LYS B . n 
A 1 25  ILE 25  22  22  ILE ILE B . n 
A 1 26  TRP 26  23  23  TRP TRP B . n 
A 1 27  LYS 27  24  24  LYS LYS B . n 
A 1 28  LYS 28  25  25  LYS LYS B . n 
A 1 29  ASN 29  26  26  ASN ASN B . n 
A 1 30  THR 30  27  27  THR THR B . n 
A 1 31  PRO 31  28  28  PRO PRO B . n 
A 1 32  PHE 32  29  29  PHE PHE B . n 
A 1 33  LEU 33  30  30  LEU LEU B . n 
A 1 34  TYR 34  31  31  TYR TYR B . n 
A 1 35  ASP 35  32  32  ASP ASP B . n 
A 1 36  LEU 36  33  33  LEU LEU B . n 
A 1 37  VAL 37  34  34  VAL VAL B . n 
A 1 38  MSE 38  35  35  MSE MSE B . n 
A 1 39  THR 39  36  36  THR THR B . n 
A 1 40  HIS 40  37  37  HIS HIS B . n 
A 1 41  ALA 41  38  38  ALA ALA B . n 
A 1 42  LEU 42  39  39  LEU LEU B . n 
A 1 43  GLN 43  40  40  GLN GLN B . n 
A 1 44  TRP 44  41  41  TRP TRP B . n 
A 1 45  PRO 45  42  42  PRO PRO B . n 
A 1 46  SER 46  43  43  SER SER B . n 
A 1 47  LEU 47  44  44  LEU LEU B . n 
A 1 48  THR 48  45  45  THR THR B . n 
A 1 49  VAL 49  46  46  VAL VAL B . n 
A 1 50  GLN 50  47  47  GLN GLN B . n 
A 1 51  TRP 51  48  48  TRP TRP B . n 
A 1 52  LEU 52  49  49  LEU LEU B . n 
A 1 53  PRO 53  50  50  PRO PRO B . n 
A 1 54  GLU 54  51  51  GLU GLU B . n 
A 1 55  VAL 55  52  52  VAL VAL B . n 
A 1 56  THR 56  53  53  THR THR B . n 
A 1 57  LYS 57  54  54  LYS LYS B . n 
A 1 58  PRO 58  55  55  PRO PRO B . n 
A 1 59  GLU 59  56  56  GLU GLU B . n 
A 1 60  GLY 60  57  57  GLY GLY B . n 
A 1 61  LYS 61  58  58  LYS LYS B . n 
A 1 62  ASP 62  59  59  ASP ASP B . n 
A 1 63  TYR 63  60  60  TYR TYR B . n 
A 1 64  ALA 64  61  61  ALA ALA B . n 
A 1 65  LEU 65  62  62  LEU LEU B . n 
A 1 66  HIS 66  63  63  HIS HIS B . n 
A 1 67  TRP 67  64  64  TRP TRP B . n 
A 1 68  LEU 68  65  65  LEU LEU B . n 
A 1 69  VAL 69  66  66  VAL VAL B . n 
A 1 70  LEU 70  67  67  LEU LEU B . n 
A 1 71  GLY 71  68  68  GLY GLY B . n 
A 1 72  THR 72  69  69  THR THR B . n 
A 1 73  HIS 73  70  70  HIS HIS B . n 
A 1 74  THR 74  71  71  THR THR B . n 
A 1 75  SER 75  72  72  SER SER B . n 
A 1 76  ASP 76  73  73  ASP ASP B . n 
A 1 77  GLU 77  74  74  GLU GLU B . n 
A 1 78  GLN 78  75  75  GLN GLN B . n 
A 1 79  ASN 79  76  76  ASN ASN B . n 
A 1 80  HIS 80  77  77  HIS HIS B . n 
A 1 81  LEU 81  78  78  LEU LEU B . n 
A 1 82  VAL 82  79  79  VAL VAL B . n 
A 1 83  VAL 83  80  80  VAL VAL B . n 
A 1 84  ALA 84  81  81  ALA ALA B . n 
A 1 85  ARG 85  82  82  ARG ARG B . n 
A 1 86  VAL 86  83  83  VAL VAL B . n 
A 1 87  HIS 87  84  84  HIS HIS B . n 
A 1 88  ILE 88  85  85  ILE ILE B . n 
A 1 89  PRO 89  86  86  PRO PRO B . n 
A 1 90  ASN 90  87  87  ASN ASN B . n 
A 1 91  ASP 91  88  88  ASP ASP B . n 
A 1 92  ASP 92  89  89  ASP ASP B . n 
A 1 93  ALA 93  90  ?   ?   ?   B . n 
A 1 94  GLN 94  91  ?   ?   ?   B . n 
A 1 95  PHE 95  92  ?   ?   ?   B . n 
A 1 96  ASP 96  93  ?   ?   ?   B . n 
A 1 97  ALA 97  94  ?   ?   ?   B . n 
A 1 98  SER 98  95  ?   ?   ?   B . n 
A 1 99  HIS 99  96  ?   ?   ?   B . n 
A 1 100 CYS 100 97  ?   ?   ?   B . n 
A 1 101 ASP 101 98  ?   ?   ?   B . n 
A 1 102 SER 102 99  ?   ?   ?   B . n 
A 1 103 ASP 103 100 ?   ?   ?   B . n 
A 1 104 LYS 104 101 ?   ?   ?   B . n 
A 1 105 GLY 105 102 ?   ?   ?   B . n 
A 1 106 GLU 106 103 ?   ?   ?   B . n 
A 1 107 PHE 107 104 ?   ?   ?   B . n 
A 1 108 GLY 108 105 ?   ?   ?   B . n 
A 1 109 GLY 109 106 ?   ?   ?   B . n 
A 1 110 PHE 110 107 ?   ?   ?   B . n 
A 1 111 GLY 111 108 ?   ?   ?   B . n 
A 1 112 SER 112 109 ?   ?   ?   B . n 
A 1 113 VAL 113 110 110 VAL VAL B . n 
A 1 114 THR 114 111 111 THR THR B . n 
A 1 115 GLY 115 112 112 GLY GLY B . n 
A 1 116 LYS 116 113 113 LYS LYS B . n 
A 1 117 ILE 117 114 114 ILE ILE B . n 
A 1 118 GLU 118 115 115 GLU GLU B . n 
A 1 119 CYS 119 116 116 CYS CYS B . n 
A 1 120 GLU 120 117 117 GLU GLU B . n 
A 1 121 ILE 121 118 118 ILE ILE B . n 
A 1 122 LYS 122 119 119 LYS LYS B . n 
A 1 123 ILE 123 120 120 ILE ILE B . n 
A 1 124 ASN 124 121 121 ASN ASN B . n 
A 1 125 HIS 125 122 122 HIS HIS B . n 
A 1 126 GLU 126 123 123 GLU GLU B . n 
A 1 127 GLY 127 124 124 GLY GLY B . n 
A 1 128 GLU 128 125 125 GLU GLU B . n 
A 1 129 VAL 129 126 126 VAL VAL B . n 
A 1 130 ASN 130 127 127 ASN ASN B . n 
A 1 131 ARG 131 128 128 ARG ARG B . n 
A 1 132 ALA 132 129 129 ALA ALA B . n 
A 1 133 ARG 133 130 130 ARG ARG B . n 
A 1 134 TYR 134 131 131 TYR TYR B . n 
A 1 135 MSE 135 132 132 MSE MSE B . n 
A 1 136 PRO 136 133 133 PRO PRO B . n 
A 1 137 GLN 137 134 134 GLN GLN B . n 
A 1 138 ASN 138 135 135 ASN ASN B . n 
A 1 139 PRO 139 136 136 PRO PRO B . n 
A 1 140 HIS 140 137 137 HIS HIS B . n 
A 1 141 ILE 141 138 138 ILE ILE B . n 
A 1 142 ILE 142 139 139 ILE ILE B . n 
A 1 143 ALA 143 140 140 ALA ALA B . n 
A 1 144 THR 144 141 141 THR THR B . n 
A 1 145 LYS 145 142 142 LYS LYS B . n 
A 1 146 THR 146 143 143 THR THR B . n 
A 1 147 PRO 147 144 144 PRO PRO B . n 
A 1 148 SER 148 145 145 SER SER B . n 
A 1 149 SER 149 146 146 SER SER B . n 
A 1 150 ASP 150 147 147 ASP ASP B . n 
A 1 151 VAL 151 148 148 VAL VAL B . n 
A 1 152 LEU 152 149 149 LEU LEU B . n 
A 1 153 VAL 153 150 150 VAL VAL B . n 
A 1 154 PHE 154 151 151 PHE PHE B . n 
A 1 155 ASP 155 152 152 ASP ASP B . n 
A 1 156 TYR 156 153 153 TYR TYR B . n 
A 1 157 THR 157 154 154 THR THR B . n 
A 1 158 LYS 158 155 155 LYS LYS B . n 
A 1 159 HIS 159 156 156 HIS HIS B . n 
A 1 160 PRO 160 157 157 PRO PRO B . n 
A 1 161 ALA 161 158 158 ALA ALA B . n 
A 1 162 LYS 162 159 159 LYS LYS B . n 
A 1 163 PRO 163 160 160 PRO PRO B . n 
A 1 164 ASP 164 161 161 ASP ASP B . n 
A 1 165 PRO 165 162 162 PRO PRO B . n 
A 1 166 SER 166 163 163 SER SER B . n 
A 1 167 GLY 167 164 164 GLY GLY B . n 
A 1 168 GLU 168 165 165 GLU GLU B . n 
A 1 169 CYS 169 166 166 CYS CYS B . n 
A 1 170 ASN 170 167 167 ASN ASN B . n 
A 1 171 PRO 171 168 168 PRO PRO B . n 
A 1 172 ASP 172 169 169 ASP ASP B . n 
A 1 173 LEU 173 170 170 LEU LEU B . n 
A 1 174 ARG 174 171 171 ARG ARG B . n 
A 1 175 LEU 175 172 172 LEU LEU B . n 
A 1 176 ARG 176 173 173 ARG ARG B . n 
A 1 177 GLY 177 174 174 GLY GLY B . n 
A 1 178 HIS 178 175 175 HIS HIS B . n 
A 1 179 GLN 179 176 176 GLN GLN B . n 
A 1 180 LYS 180 177 177 LYS LYS B . n 
A 1 181 GLU 181 178 178 GLU GLU B . n 
A 1 182 GLY 182 179 179 GLY GLY B . n 
A 1 183 TYR 183 180 180 TYR TYR B . n 
A 1 184 GLY 184 181 181 GLY GLY B . n 
A 1 185 LEU 185 182 182 LEU LEU B . n 
A 1 186 SER 186 183 183 SER SER B . n 
A 1 187 TRP 187 184 184 TRP TRP B . n 
A 1 188 ASN 188 185 185 ASN ASN B . n 
A 1 189 SER 189 186 186 SER SER B . n 
A 1 190 ASN 190 187 187 ASN ASN B . n 
A 1 191 LEU 191 188 188 LEU LEU B . n 
A 1 192 SER 192 189 189 SER SER B . n 
A 1 193 GLY 193 190 190 GLY GLY B . n 
A 1 194 HIS 194 191 191 HIS HIS B . n 
A 1 195 LEU 195 192 192 LEU LEU B . n 
A 1 196 LEU 196 193 193 LEU LEU B . n 
A 1 197 SER 197 194 194 SER SER B . n 
A 1 198 ALA 198 195 195 ALA ALA B . n 
A 1 199 SER 199 196 196 SER SER B . n 
A 1 200 ASP 200 197 197 ASP ASP B . n 
A 1 201 ASP 201 198 198 ASP ASP B . n 
A 1 202 HIS 202 199 199 HIS HIS B . n 
A 1 203 THR 203 200 200 THR THR B . n 
A 1 204 VAL 204 201 201 VAL VAL B . n 
A 1 205 CYS 205 202 202 CYS CYS B . n 
A 1 206 LEU 206 203 203 LEU LEU B . n 
A 1 207 TRP 207 204 204 TRP TRP B . n 
A 1 208 ASP 208 205 205 ASP ASP B . n 
A 1 209 ILE 209 206 206 ILE ILE B . n 
A 1 210 ASN 210 207 207 ASN ASN B . n 
A 1 211 ALA 211 208 208 ALA ALA B . n 
A 1 212 GLY 212 209 209 GLY GLY B . n 
A 1 213 PRO 213 210 210 PRO PRO B . n 
A 1 214 LYS 214 211 211 LYS LYS B . n 
A 1 215 GLU 215 212 212 GLU GLU B . n 
A 1 216 GLY 216 213 213 GLY GLY B . n 
A 1 217 LYS 217 214 214 LYS LYS B . n 
A 1 218 ILE 218 215 215 ILE ILE B . n 
A 1 219 VAL 219 216 216 VAL VAL B . n 
A 1 220 ASP 220 217 217 ASP ASP B . n 
A 1 221 ALA 221 218 218 ALA ALA B . n 
A 1 222 LYS 222 219 219 LYS LYS B . n 
A 1 223 ALA 223 220 220 ALA ALA B . n 
A 1 224 ILE 224 221 221 ILE ILE B . n 
A 1 225 PHE 225 222 222 PHE PHE B . n 
A 1 226 THR 226 223 223 THR THR B . n 
A 1 227 GLY 227 224 224 GLY GLY B . n 
A 1 228 HIS 228 225 225 HIS HIS B . n 
A 1 229 SER 229 226 226 SER SER B . n 
A 1 230 ALA 230 227 227 ALA ALA B . n 
A 1 231 VAL 231 228 228 VAL VAL B . n 
A 1 232 VAL 232 229 229 VAL VAL B . n 
A 1 233 GLU 233 230 230 GLU GLU B . n 
A 1 234 ASP 234 231 231 ASP ASP B . n 
A 1 235 VAL 235 232 232 VAL VAL B . n 
A 1 236 ALA 236 233 233 ALA ALA B . n 
A 1 237 TRP 237 234 234 TRP TRP B . n 
A 1 238 HIS 238 235 235 HIS HIS B . n 
A 1 239 LEU 239 236 236 LEU LEU B . n 
A 1 240 LEU 240 237 237 LEU LEU B . n 
A 1 241 HIS 241 238 238 HIS HIS B . n 
A 1 242 GLU 242 239 239 GLU GLU B . n 
A 1 243 SER 243 240 240 SER SER B . n 
A 1 244 LEU 244 241 241 LEU LEU B . n 
A 1 245 PHE 245 242 242 PHE PHE B . n 
A 1 246 GLY 246 243 243 GLY GLY B . n 
A 1 247 SER 247 244 244 SER SER B . n 
A 1 248 VAL 248 245 245 VAL VAL B . n 
A 1 249 ALA 249 246 246 ALA ALA B . n 
A 1 250 ASP 250 247 247 ASP ASP B . n 
A 1 251 ASP 251 248 248 ASP ASP B . n 
A 1 252 GLN 252 249 249 GLN GLN B . n 
A 1 253 LYS 253 250 250 LYS LYS B . n 
A 1 254 LEU 254 251 251 LEU LEU B . n 
A 1 255 MSE 255 252 252 MSE MSE B . n 
A 1 256 ILE 256 253 253 ILE ILE B . n 
A 1 257 TRP 257 254 254 TRP TRP B . n 
A 1 258 ASP 258 255 255 ASP ASP B . n 
A 1 259 THR 259 256 256 THR THR B . n 
A 1 260 ARG 260 257 257 ARG ARG B . n 
A 1 261 SER 261 258 258 SER SER B . n 
A 1 262 ASN 262 259 259 ASN ASN B . n 
A 1 263 THR 263 260 260 THR THR B . n 
A 1 264 THR 264 261 261 THR THR B . n 
A 1 265 SER 265 262 262 SER SER B . n 
A 1 266 LYS 266 263 263 LYS LYS B . n 
A 1 267 PRO 267 264 264 PRO PRO B . n 
A 1 268 SER 268 265 265 SER SER B . n 
A 1 269 HIS 269 266 266 HIS HIS B . n 
A 1 270 LEU 270 267 267 LEU LEU B . n 
A 1 271 VAL 271 268 268 VAL VAL B . n 
A 1 272 ASP 272 269 269 ASP ASP B . n 
A 1 273 ALA 273 270 270 ALA ALA B . n 
A 1 274 HIS 274 271 271 HIS HIS B . n 
A 1 275 THR 275 272 272 THR THR B . n 
A 1 276 ALA 276 273 273 ALA ALA B . n 
A 1 277 GLU 277 274 274 GLU GLU B . n 
A 1 278 VAL 278 275 275 VAL VAL B . n 
A 1 279 ASN 279 276 276 ASN ASN B . n 
A 1 280 CYS 280 277 277 CYS CYS B . n 
A 1 281 LEU 281 278 278 LEU LEU B . n 
A 1 282 SER 282 279 279 SER SER B . n 
A 1 283 PHE 283 280 280 PHE PHE B . n 
A 1 284 ASN 284 281 281 ASN ASN B . n 
A 1 285 PRO 285 282 282 PRO PRO B . n 
A 1 286 TYR 286 283 283 TYR TYR B . n 
A 1 287 SER 287 284 284 SER SER B . n 
A 1 288 GLU 288 285 285 GLU GLU B . n 
A 1 289 PHE 289 286 286 PHE PHE B . n 
A 1 290 ILE 290 287 287 ILE ILE B . n 
A 1 291 LEU 291 288 288 LEU LEU B . n 
A 1 292 ALA 292 289 289 ALA ALA B . n 
A 1 293 THR 293 290 290 THR THR B . n 
A 1 294 GLY 294 291 291 GLY GLY B . n 
A 1 295 SER 295 292 292 SER SER B . n 
A 1 296 ALA 296 293 293 ALA ALA B . n 
A 1 297 ASP 297 294 294 ASP ASP B . n 
A 1 298 LYS 298 295 295 LYS LYS B . n 
A 1 299 THR 299 296 296 THR THR B . n 
A 1 300 VAL 300 297 297 VAL VAL B . n 
A 1 301 ALA 301 298 298 ALA ALA B . n 
A 1 302 LEU 302 299 299 LEU LEU B . n 
A 1 303 TRP 303 300 300 TRP TRP B . n 
A 1 304 ASP 304 301 301 ASP ASP B . n 
A 1 305 LEU 305 302 302 LEU LEU B . n 
A 1 306 ARG 306 303 303 ARG ARG B . n 
A 1 307 ASN 307 304 304 ASN ASN B . n 
A 1 308 LEU 308 305 305 LEU LEU B . n 
A 1 309 LYS 309 306 306 LYS LYS B . n 
A 1 310 LEU 310 307 307 LEU LEU B . n 
A 1 311 LYS 311 308 308 LYS LYS B . n 
A 1 312 LEU 312 309 309 LEU LEU B . n 
A 1 313 HIS 313 310 310 HIS HIS B . n 
A 1 314 THR 314 311 311 THR THR B . n 
A 1 315 PHE 315 312 312 PHE PHE B . n 
A 1 316 GLU 316 313 313 GLU GLU B . n 
A 1 317 SER 317 314 314 SER SER B . n 
A 1 318 HIS 318 315 315 HIS HIS B . n 
A 1 319 LYS 319 316 316 LYS LYS B . n 
A 1 320 ASP 320 317 317 ASP ASP B . n 
A 1 321 GLU 321 318 318 GLU GLU B . n 
A 1 322 ILE 322 319 319 ILE ILE B . n 
A 1 323 PHE 323 320 320 PHE PHE B . n 
A 1 324 GLN 324 321 321 GLN GLN B . n 
A 1 325 VAL 325 322 322 VAL VAL B . n 
A 1 326 HIS 326 323 323 HIS HIS B . n 
A 1 327 TRP 327 324 324 TRP TRP B . n 
A 1 328 SER 328 325 325 SER SER B . n 
A 1 329 PRO 329 326 326 PRO PRO B . n 
A 1 330 HIS 330 327 327 HIS HIS B . n 
A 1 331 ASN 331 328 328 ASN ASN B . n 
A 1 332 GLU 332 329 329 GLU GLU B . n 
A 1 333 THR 333 330 330 THR THR B . n 
A 1 334 ILE 334 331 331 ILE ILE B . n 
A 1 335 LEU 335 332 332 LEU LEU B . n 
A 1 336 ALA 336 333 333 ALA ALA B . n 
A 1 337 SER 337 334 334 SER SER B . n 
A 1 338 SER 338 335 335 SER SER B . n 
A 1 339 GLY 339 336 336 GLY GLY B . n 
A 1 340 THR 340 337 337 THR THR B . n 
A 1 341 ASP 341 338 338 ASP ASP B . n 
A 1 342 ARG 342 339 339 ARG ARG B . n 
A 1 343 ARG 343 340 340 ARG ARG B . n 
A 1 344 LEU 344 341 341 LEU LEU B . n 
A 1 345 ASN 345 342 342 ASN ASN B . n 
A 1 346 VAL 346 343 343 VAL VAL B . n 
A 1 347 TRP 347 344 344 TRP TRP B . n 
A 1 348 ASP 348 345 345 ASP ASP B . n 
A 1 349 LEU 349 346 346 LEU LEU B . n 
A 1 350 SER 350 347 347 SER SER B . n 
A 1 351 LYS 351 348 348 LYS LYS B . n 
A 1 352 ILE 352 349 349 ILE ILE B . n 
A 1 353 GLY 353 350 350 GLY GLY B . n 
A 1 354 GLU 354 351 351 GLU GLU B . n 
A 1 355 GLU 355 352 352 GLU GLU B . n 
A 1 356 GLN 356 353 353 GLN GLN B . n 
A 1 357 SER 357 354 354 SER SER B . n 
A 1 358 ALA 358 355 355 ALA ALA B . n 
A 1 359 GLU 359 356 356 GLU GLU B . n 
A 1 360 ASP 360 357 357 ASP ASP B . n 
A 1 361 ALA 361 358 358 ALA ALA B . n 
A 1 362 GLU 362 359 359 GLU GLU B . n 
A 1 363 ASP 363 360 360 ASP ASP B . n 
A 1 364 GLY 364 361 361 GLY GLY B . n 
A 1 365 PRO 365 362 362 PRO PRO B . n 
A 1 366 PRO 366 363 363 PRO PRO B . n 
A 1 367 GLU 367 364 364 GLU GLU B . n 
A 1 368 LEU 368 365 365 LEU LEU B . n 
A 1 369 LEU 369 366 366 LEU LEU B . n 
A 1 370 PHE 370 367 367 PHE PHE B . n 
A 1 371 ILE 371 368 368 ILE ILE B . n 
A 1 372 HIS 372 369 369 HIS HIS B . n 
A 1 373 GLY 373 370 370 GLY GLY B . n 
A 1 374 GLY 374 371 371 GLY GLY B . n 
A 1 375 HIS 375 372 372 HIS HIS B . n 
A 1 376 THR 376 373 373 THR THR B . n 
A 1 377 ALA 377 374 374 ALA ALA B . n 
A 1 378 LYS 378 375 375 LYS LYS B . n 
A 1 379 ILE 379 376 376 ILE ILE B . n 
A 1 380 SER 380 377 377 SER SER B . n 
A 1 381 ASP 381 378 378 ASP ASP B . n 
A 1 382 PHE 382 379 379 PHE PHE B . n 
A 1 383 SER 383 380 380 SER SER B . n 
A 1 384 TRP 384 381 381 TRP TRP B . n 
A 1 385 ASN 385 382 382 ASN ASN B . n 
A 1 386 PRO 386 383 383 PRO PRO B . n 
A 1 387 ASN 387 384 384 ASN ASN B . n 
A 1 388 GLU 388 385 385 GLU GLU B . n 
A 1 389 PRO 389 386 386 PRO PRO B . n 
A 1 390 TRP 390 387 387 TRP TRP B . n 
A 1 391 VAL 391 388 388 VAL VAL B . n 
A 1 392 ILE 392 389 389 ILE ILE B . n 
A 1 393 CYS 393 390 390 CYS CYS B . n 
A 1 394 SER 394 391 391 SER SER B . n 
A 1 395 VAL 395 392 392 VAL VAL B . n 
A 1 396 SER 396 393 393 SER SER B . n 
A 1 397 GLU 397 394 394 GLU GLU B . n 
A 1 398 ASP 398 395 395 ASP ASP B . n 
A 1 399 ASN 399 396 396 ASN ASN B . n 
A 1 400 ILE 400 397 397 ILE ILE B . n 
A 1 401 MSE 401 398 398 MSE MSE B . n 
A 1 402 GLN 402 399 399 GLN GLN B . n 
A 1 403 ILE 403 400 400 ILE ILE B . n 
A 1 404 TRP 404 401 401 TRP TRP B . n 
A 1 405 GLN 405 402 402 GLN GLN B . n 
A 1 406 MSE 406 403 403 MSE MSE B . n 
A 1 407 ALA 407 404 404 ALA ALA B . n 
A 1 408 GLU 408 405 405 GLU GLU B . n 
A 1 409 ASN 409 406 406 ASN ASN B . n 
A 1 410 ILE 410 407 407 ILE ILE B . n 
A 1 411 TYR 411 408 408 TYR TYR B . n 
A 1 412 ASN 412 409 409 ASN ASN B . n 
A 1 413 ASP 413 410 410 ASP ASP B . n 
A 1 414 GLU 414 411 ?   ?   ?   B . n 
B 2 1   ASP 1   24  24  ASP ASP E . n 
B 2 2   ASN 2   25  25  ASN ASN E . n 
B 2 3   ILE 3   26  26  ILE ILE E . n 
B 2 4   GLN 4   27  27  GLN GLN E . n 
B 2 5   GLY 5   28  28  GLY GLY E . n 
B 2 6   ILE 6   29  29  ILE ILE E . n 
B 2 7   THR 7   30  30  THR THR E . n 
B 2 8   LYS 8   31  31  LYS LYS E . n 
B 2 9   PRO 9   32  32  PRO PRO E . n 
B 2 10  ALA 10  33  33  ALA ALA E . n 
B 2 11  ILE 11  34  34  ILE ILE E . n 
B 2 12  ARG 12  35  35  ARG ARG E . n 
B 2 13  ARG 13  36  36  ARG ARG E . n 
B 2 14  LEU 14  37  37  LEU LEU E . n 
B 2 15  ALA 15  38  38  ALA ALA E . n 
B 2 16  ARG 16  39  39  ARG ARG E . n 
B 2 17  ARG 17  40  40  ARG ARG E . n 
B 2 18  GLY 18  41  41  GLY GLY E . n 
C 1 1   HIS 1   -2  ?   ?   ?   A . n 
C 1 2   MSE 2   -1  -1  MSE MSE A . n 
C 1 3   ALA 3   0   0   ALA ALA A . n 
C 1 4   MSE 4   1   1   MSE MSE A . n 
C 1 5   ALA 5   2   2   ALA ALA A . n 
C 1 6   SER 6   3   3   SER SER A . n 
C 1 7   LYS 7   4   4   LYS LYS A . n 
C 1 8   GLU 8   5   5   GLU GLU A . n 
C 1 9   MSE 9   6   6   MSE MSE A . n 
C 1 10  PHE 10  7   7   PHE PHE A . n 
C 1 11  GLU 11  8   8   GLU GLU A . n 
C 1 12  ASP 12  9   9   ASP ASP A . n 
C 1 13  THR 13  10  10  THR THR A . n 
C 1 14  VAL 14  11  11  VAL VAL A . n 
C 1 15  GLU 15  12  12  GLU GLU A . n 
C 1 16  GLU 16  13  13  GLU GLU A . n 
C 1 17  ARG 17  14  14  ARG ARG A . n 
C 1 18  VAL 18  15  15  VAL VAL A . n 
C 1 19  ILE 19  16  16  ILE ILE A . n 
C 1 20  ASN 20  17  17  ASN ASN A . n 
C 1 21  GLU 21  18  18  GLU GLU A . n 
C 1 22  GLU 22  19  19  GLU GLU A . n 
C 1 23  TYR 23  20  20  TYR TYR A . n 
C 1 24  LYS 24  21  21  LYS LYS A . n 
C 1 25  ILE 25  22  22  ILE ILE A . n 
C 1 26  TRP 26  23  23  TRP TRP A . n 
C 1 27  LYS 27  24  24  LYS LYS A . n 
C 1 28  LYS 28  25  25  LYS LYS A . n 
C 1 29  ASN 29  26  26  ASN ASN A . n 
C 1 30  THR 30  27  27  THR THR A . n 
C 1 31  PRO 31  28  28  PRO PRO A . n 
C 1 32  PHE 32  29  29  PHE PHE A . n 
C 1 33  LEU 33  30  30  LEU LEU A . n 
C 1 34  TYR 34  31  31  TYR TYR A . n 
C 1 35  ASP 35  32  32  ASP ASP A . n 
C 1 36  LEU 36  33  33  LEU LEU A . n 
C 1 37  VAL 37  34  34  VAL VAL A . n 
C 1 38  MSE 38  35  35  MSE MSE A . n 
C 1 39  THR 39  36  36  THR THR A . n 
C 1 40  HIS 40  37  37  HIS HIS A . n 
C 1 41  ALA 41  38  38  ALA ALA A . n 
C 1 42  LEU 42  39  39  LEU LEU A . n 
C 1 43  GLN 43  40  40  GLN GLN A . n 
C 1 44  TRP 44  41  41  TRP TRP A . n 
C 1 45  PRO 45  42  42  PRO PRO A . n 
C 1 46  SER 46  43  43  SER SER A . n 
C 1 47  LEU 47  44  44  LEU LEU A . n 
C 1 48  THR 48  45  45  THR THR A . n 
C 1 49  VAL 49  46  46  VAL VAL A . n 
C 1 50  GLN 50  47  47  GLN GLN A . n 
C 1 51  TRP 51  48  48  TRP TRP A . n 
C 1 52  LEU 52  49  49  LEU LEU A . n 
C 1 53  PRO 53  50  50  PRO PRO A . n 
C 1 54  GLU 54  51  51  GLU GLU A . n 
C 1 55  VAL 55  52  52  VAL VAL A . n 
C 1 56  THR 56  53  53  THR THR A . n 
C 1 57  LYS 57  54  54  LYS LYS A . n 
C 1 58  PRO 58  55  55  PRO PRO A . n 
C 1 59  GLU 59  56  56  GLU GLU A . n 
C 1 60  GLY 60  57  57  GLY GLY A . n 
C 1 61  LYS 61  58  58  LYS LYS A . n 
C 1 62  ASP 62  59  59  ASP ASP A . n 
C 1 63  TYR 63  60  60  TYR TYR A . n 
C 1 64  ALA 64  61  61  ALA ALA A . n 
C 1 65  LEU 65  62  62  LEU LEU A . n 
C 1 66  HIS 66  63  63  HIS HIS A . n 
C 1 67  TRP 67  64  64  TRP TRP A . n 
C 1 68  LEU 68  65  65  LEU LEU A . n 
C 1 69  VAL 69  66  66  VAL VAL A . n 
C 1 70  LEU 70  67  67  LEU LEU A . n 
C 1 71  GLY 71  68  68  GLY GLY A . n 
C 1 72  THR 72  69  69  THR THR A . n 
C 1 73  HIS 73  70  70  HIS HIS A . n 
C 1 74  THR 74  71  71  THR THR A . n 
C 1 75  SER 75  72  72  SER SER A . n 
C 1 76  ASP 76  73  73  ASP ASP A . n 
C 1 77  GLU 77  74  74  GLU GLU A . n 
C 1 78  GLN 78  75  75  GLN GLN A . n 
C 1 79  ASN 79  76  76  ASN ASN A . n 
C 1 80  HIS 80  77  77  HIS HIS A . n 
C 1 81  LEU 81  78  78  LEU LEU A . n 
C 1 82  VAL 82  79  79  VAL VAL A . n 
C 1 83  VAL 83  80  80  VAL VAL A . n 
C 1 84  ALA 84  81  81  ALA ALA A . n 
C 1 85  ARG 85  82  82  ARG ARG A . n 
C 1 86  VAL 86  83  83  VAL VAL A . n 
C 1 87  HIS 87  84  84  HIS HIS A . n 
C 1 88  ILE 88  85  85  ILE ILE A . n 
C 1 89  PRO 89  86  86  PRO PRO A . n 
C 1 90  ASN 90  87  87  ASN ASN A . n 
C 1 91  ASP 91  88  88  ASP ASP A . n 
C 1 92  ASP 92  89  ?   ?   ?   A . n 
C 1 93  ALA 93  90  ?   ?   ?   A . n 
C 1 94  GLN 94  91  ?   ?   ?   A . n 
C 1 95  PHE 95  92  ?   ?   ?   A . n 
C 1 96  ASP 96  93  ?   ?   ?   A . n 
C 1 97  ALA 97  94  ?   ?   ?   A . n 
C 1 98  SER 98  95  ?   ?   ?   A . n 
C 1 99  HIS 99  96  ?   ?   ?   A . n 
C 1 100 CYS 100 97  ?   ?   ?   A . n 
C 1 101 ASP 101 98  ?   ?   ?   A . n 
C 1 102 SER 102 99  ?   ?   ?   A . n 
C 1 103 ASP 103 100 ?   ?   ?   A . n 
C 1 104 LYS 104 101 ?   ?   ?   A . n 
C 1 105 GLY 105 102 ?   ?   ?   A . n 
C 1 106 GLU 106 103 ?   ?   ?   A . n 
C 1 107 PHE 107 104 ?   ?   ?   A . n 
C 1 108 GLY 108 105 ?   ?   ?   A . n 
C 1 109 GLY 109 106 ?   ?   ?   A . n 
C 1 110 PHE 110 107 ?   ?   ?   A . n 
C 1 111 GLY 111 108 ?   ?   ?   A . n 
C 1 112 SER 112 109 ?   ?   ?   A . n 
C 1 113 VAL 113 110 110 VAL VAL A . n 
C 1 114 THR 114 111 111 THR THR A . n 
C 1 115 GLY 115 112 112 GLY GLY A . n 
C 1 116 LYS 116 113 113 LYS LYS A . n 
C 1 117 ILE 117 114 114 ILE ILE A . n 
C 1 118 GLU 118 115 115 GLU GLU A . n 
C 1 119 CYS 119 116 116 CYS CYS A . n 
C 1 120 GLU 120 117 117 GLU GLU A . n 
C 1 121 ILE 121 118 118 ILE ILE A . n 
C 1 122 LYS 122 119 119 LYS LYS A . n 
C 1 123 ILE 123 120 120 ILE ILE A . n 
C 1 124 ASN 124 121 121 ASN ASN A . n 
C 1 125 HIS 125 122 122 HIS HIS A . n 
C 1 126 GLU 126 123 123 GLU GLU A . n 
C 1 127 GLY 127 124 124 GLY GLY A . n 
C 1 128 GLU 128 125 125 GLU GLU A . n 
C 1 129 VAL 129 126 126 VAL VAL A . n 
C 1 130 ASN 130 127 127 ASN ASN A . n 
C 1 131 ARG 131 128 128 ARG ARG A . n 
C 1 132 ALA 132 129 129 ALA ALA A . n 
C 1 133 ARG 133 130 130 ARG ARG A . n 
C 1 134 TYR 134 131 131 TYR TYR A . n 
C 1 135 MSE 135 132 132 MSE MSE A . n 
C 1 136 PRO 136 133 133 PRO PRO A . n 
C 1 137 GLN 137 134 134 GLN GLN A . n 
C 1 138 ASN 138 135 135 ASN ASN A . n 
C 1 139 PRO 139 136 136 PRO PRO A . n 
C 1 140 HIS 140 137 137 HIS HIS A . n 
C 1 141 ILE 141 138 138 ILE ILE A . n 
C 1 142 ILE 142 139 139 ILE ILE A . n 
C 1 143 ALA 143 140 140 ALA ALA A . n 
C 1 144 THR 144 141 141 THR THR A . n 
C 1 145 LYS 145 142 142 LYS LYS A . n 
C 1 146 THR 146 143 143 THR THR A . n 
C 1 147 PRO 147 144 144 PRO PRO A . n 
C 1 148 SER 148 145 145 SER SER A . n 
C 1 149 SER 149 146 146 SER SER A . n 
C 1 150 ASP 150 147 147 ASP ASP A . n 
C 1 151 VAL 151 148 148 VAL VAL A . n 
C 1 152 LEU 152 149 149 LEU LEU A . n 
C 1 153 VAL 153 150 150 VAL VAL A . n 
C 1 154 PHE 154 151 151 PHE PHE A . n 
C 1 155 ASP 155 152 152 ASP ASP A . n 
C 1 156 TYR 156 153 153 TYR TYR A . n 
C 1 157 THR 157 154 154 THR THR A . n 
C 1 158 LYS 158 155 155 LYS LYS A . n 
C 1 159 HIS 159 156 156 HIS HIS A . n 
C 1 160 PRO 160 157 157 PRO PRO A . n 
C 1 161 ALA 161 158 158 ALA ALA A . n 
C 1 162 LYS 162 159 159 LYS LYS A . n 
C 1 163 PRO 163 160 160 PRO PRO A . n 
C 1 164 ASP 164 161 161 ASP ASP A . n 
C 1 165 PRO 165 162 162 PRO PRO A . n 
C 1 166 SER 166 163 163 SER SER A . n 
C 1 167 GLY 167 164 164 GLY GLY A . n 
C 1 168 GLU 168 165 165 GLU GLU A . n 
C 1 169 CYS 169 166 166 CYS CYS A . n 
C 1 170 ASN 170 167 167 ASN ASN A . n 
C 1 171 PRO 171 168 168 PRO PRO A . n 
C 1 172 ASP 172 169 169 ASP ASP A . n 
C 1 173 LEU 173 170 170 LEU LEU A . n 
C 1 174 ARG 174 171 171 ARG ARG A . n 
C 1 175 LEU 175 172 172 LEU LEU A . n 
C 1 176 ARG 176 173 173 ARG ARG A . n 
C 1 177 GLY 177 174 174 GLY GLY A . n 
C 1 178 HIS 178 175 175 HIS HIS A . n 
C 1 179 GLN 179 176 176 GLN GLN A . n 
C 1 180 LYS 180 177 177 LYS LYS A . n 
C 1 181 GLU 181 178 178 GLU GLU A . n 
C 1 182 GLY 182 179 179 GLY GLY A . n 
C 1 183 TYR 183 180 180 TYR TYR A . n 
C 1 184 GLY 184 181 181 GLY GLY A . n 
C 1 185 LEU 185 182 182 LEU LEU A . n 
C 1 186 SER 186 183 183 SER SER A . n 
C 1 187 TRP 187 184 184 TRP TRP A . n 
C 1 188 ASN 188 185 185 ASN ASN A . n 
C 1 189 SER 189 186 186 SER SER A . n 
C 1 190 ASN 190 187 187 ASN ASN A . n 
C 1 191 LEU 191 188 188 LEU LEU A . n 
C 1 192 SER 192 189 189 SER SER A . n 
C 1 193 GLY 193 190 190 GLY GLY A . n 
C 1 194 HIS 194 191 191 HIS HIS A . n 
C 1 195 LEU 195 192 192 LEU LEU A . n 
C 1 196 LEU 196 193 193 LEU LEU A . n 
C 1 197 SER 197 194 194 SER SER A . n 
C 1 198 ALA 198 195 195 ALA ALA A . n 
C 1 199 SER 199 196 196 SER SER A . n 
C 1 200 ASP 200 197 197 ASP ASP A . n 
C 1 201 ASP 201 198 198 ASP ASP A . n 
C 1 202 HIS 202 199 199 HIS HIS A . n 
C 1 203 THR 203 200 200 THR THR A . n 
C 1 204 VAL 204 201 201 VAL VAL A . n 
C 1 205 CYS 205 202 202 CYS CYS A . n 
C 1 206 LEU 206 203 203 LEU LEU A . n 
C 1 207 TRP 207 204 204 TRP TRP A . n 
C 1 208 ASP 208 205 205 ASP ASP A . n 
C 1 209 ILE 209 206 206 ILE ILE A . n 
C 1 210 ASN 210 207 207 ASN ASN A . n 
C 1 211 ALA 211 208 208 ALA ALA A . n 
C 1 212 GLY 212 209 209 GLY GLY A . n 
C 1 213 PRO 213 210 210 PRO PRO A . n 
C 1 214 LYS 214 211 211 LYS LYS A . n 
C 1 215 GLU 215 212 212 GLU GLU A . n 
C 1 216 GLY 216 213 213 GLY GLY A . n 
C 1 217 LYS 217 214 214 LYS LYS A . n 
C 1 218 ILE 218 215 215 ILE ILE A . n 
C 1 219 VAL 219 216 216 VAL VAL A . n 
C 1 220 ASP 220 217 217 ASP ASP A . n 
C 1 221 ALA 221 218 218 ALA ALA A . n 
C 1 222 LYS 222 219 219 LYS LYS A . n 
C 1 223 ALA 223 220 220 ALA ALA A . n 
C 1 224 ILE 224 221 221 ILE ILE A . n 
C 1 225 PHE 225 222 222 PHE PHE A . n 
C 1 226 THR 226 223 223 THR THR A . n 
C 1 227 GLY 227 224 224 GLY GLY A . n 
C 1 228 HIS 228 225 225 HIS HIS A . n 
C 1 229 SER 229 226 226 SER SER A . n 
C 1 230 ALA 230 227 227 ALA ALA A . n 
C 1 231 VAL 231 228 228 VAL VAL A . n 
C 1 232 VAL 232 229 229 VAL VAL A . n 
C 1 233 GLU 233 230 230 GLU GLU A . n 
C 1 234 ASP 234 231 231 ASP ASP A . n 
C 1 235 VAL 235 232 232 VAL VAL A . n 
C 1 236 ALA 236 233 233 ALA ALA A . n 
C 1 237 TRP 237 234 234 TRP TRP A . n 
C 1 238 HIS 238 235 235 HIS HIS A . n 
C 1 239 LEU 239 236 236 LEU LEU A . n 
C 1 240 LEU 240 237 237 LEU LEU A . n 
C 1 241 HIS 241 238 238 HIS HIS A . n 
C 1 242 GLU 242 239 239 GLU GLU A . n 
C 1 243 SER 243 240 240 SER SER A . n 
C 1 244 LEU 244 241 241 LEU LEU A . n 
C 1 245 PHE 245 242 242 PHE PHE A . n 
C 1 246 GLY 246 243 243 GLY GLY A . n 
C 1 247 SER 247 244 244 SER SER A . n 
C 1 248 VAL 248 245 245 VAL VAL A . n 
C 1 249 ALA 249 246 246 ALA ALA A . n 
C 1 250 ASP 250 247 247 ASP ASP A . n 
C 1 251 ASP 251 248 248 ASP ASP A . n 
C 1 252 GLN 252 249 249 GLN GLN A . n 
C 1 253 LYS 253 250 250 LYS LYS A . n 
C 1 254 LEU 254 251 251 LEU LEU A . n 
C 1 255 MSE 255 252 252 MSE MSE A . n 
C 1 256 ILE 256 253 253 ILE ILE A . n 
C 1 257 TRP 257 254 254 TRP TRP A . n 
C 1 258 ASP 258 255 255 ASP ASP A . n 
C 1 259 THR 259 256 256 THR THR A . n 
C 1 260 ARG 260 257 257 ARG ARG A . n 
C 1 261 SER 261 258 258 SER SER A . n 
C 1 262 ASN 262 259 259 ASN ASN A . n 
C 1 263 THR 263 260 260 THR THR A . n 
C 1 264 THR 264 261 261 THR THR A . n 
C 1 265 SER 265 262 262 SER SER A . n 
C 1 266 LYS 266 263 263 LYS LYS A . n 
C 1 267 PRO 267 264 264 PRO PRO A . n 
C 1 268 SER 268 265 265 SER SER A . n 
C 1 269 HIS 269 266 266 HIS HIS A . n 
C 1 270 LEU 270 267 267 LEU LEU A . n 
C 1 271 VAL 271 268 268 VAL VAL A . n 
C 1 272 ASP 272 269 269 ASP ASP A . n 
C 1 273 ALA 273 270 270 ALA ALA A . n 
C 1 274 HIS 274 271 271 HIS HIS A . n 
C 1 275 THR 275 272 272 THR THR A . n 
C 1 276 ALA 276 273 273 ALA ALA A . n 
C 1 277 GLU 277 274 274 GLU GLU A . n 
C 1 278 VAL 278 275 275 VAL VAL A . n 
C 1 279 ASN 279 276 276 ASN ASN A . n 
C 1 280 CYS 280 277 277 CYS CYS A . n 
C 1 281 LEU 281 278 278 LEU LEU A . n 
C 1 282 SER 282 279 279 SER SER A . n 
C 1 283 PHE 283 280 280 PHE PHE A . n 
C 1 284 ASN 284 281 281 ASN ASN A . n 
C 1 285 PRO 285 282 282 PRO PRO A . n 
C 1 286 TYR 286 283 283 TYR TYR A . n 
C 1 287 SER 287 284 284 SER SER A . n 
C 1 288 GLU 288 285 285 GLU GLU A . n 
C 1 289 PHE 289 286 286 PHE PHE A . n 
C 1 290 ILE 290 287 287 ILE ILE A . n 
C 1 291 LEU 291 288 288 LEU LEU A . n 
C 1 292 ALA 292 289 289 ALA ALA A . n 
C 1 293 THR 293 290 290 THR THR A . n 
C 1 294 GLY 294 291 291 GLY GLY A . n 
C 1 295 SER 295 292 292 SER SER A . n 
C 1 296 ALA 296 293 293 ALA ALA A . n 
C 1 297 ASP 297 294 294 ASP ASP A . n 
C 1 298 LYS 298 295 295 LYS LYS A . n 
C 1 299 THR 299 296 296 THR THR A . n 
C 1 300 VAL 300 297 297 VAL VAL A . n 
C 1 301 ALA 301 298 298 ALA ALA A . n 
C 1 302 LEU 302 299 299 LEU LEU A . n 
C 1 303 TRP 303 300 300 TRP TRP A . n 
C 1 304 ASP 304 301 301 ASP ASP A . n 
C 1 305 LEU 305 302 302 LEU LEU A . n 
C 1 306 ARG 306 303 303 ARG ARG A . n 
C 1 307 ASN 307 304 304 ASN ASN A . n 
C 1 308 LEU 308 305 305 LEU LEU A . n 
C 1 309 LYS 309 306 306 LYS LYS A . n 
C 1 310 LEU 310 307 307 LEU LEU A . n 
C 1 311 LYS 311 308 308 LYS LYS A . n 
C 1 312 LEU 312 309 309 LEU LEU A . n 
C 1 313 HIS 313 310 310 HIS HIS A . n 
C 1 314 THR 314 311 311 THR THR A . n 
C 1 315 PHE 315 312 312 PHE PHE A . n 
C 1 316 GLU 316 313 313 GLU GLU A . n 
C 1 317 SER 317 314 314 SER SER A . n 
C 1 318 HIS 318 315 315 HIS HIS A . n 
C 1 319 LYS 319 316 316 LYS LYS A . n 
C 1 320 ASP 320 317 317 ASP ASP A . n 
C 1 321 GLU 321 318 318 GLU GLU A . n 
C 1 322 ILE 322 319 319 ILE ILE A . n 
C 1 323 PHE 323 320 320 PHE PHE A . n 
C 1 324 GLN 324 321 321 GLN GLN A . n 
C 1 325 VAL 325 322 322 VAL VAL A . n 
C 1 326 HIS 326 323 323 HIS HIS A . n 
C 1 327 TRP 327 324 324 TRP TRP A . n 
C 1 328 SER 328 325 325 SER SER A . n 
C 1 329 PRO 329 326 326 PRO PRO A . n 
C 1 330 HIS 330 327 327 HIS HIS A . n 
C 1 331 ASN 331 328 328 ASN ASN A . n 
C 1 332 GLU 332 329 329 GLU GLU A . n 
C 1 333 THR 333 330 330 THR THR A . n 
C 1 334 ILE 334 331 331 ILE ILE A . n 
C 1 335 LEU 335 332 332 LEU LEU A . n 
C 1 336 ALA 336 333 333 ALA ALA A . n 
C 1 337 SER 337 334 334 SER SER A . n 
C 1 338 SER 338 335 335 SER SER A . n 
C 1 339 GLY 339 336 336 GLY GLY A . n 
C 1 340 THR 340 337 337 THR THR A . n 
C 1 341 ASP 341 338 338 ASP ASP A . n 
C 1 342 ARG 342 339 339 ARG ARG A . n 
C 1 343 ARG 343 340 340 ARG ARG A . n 
C 1 344 LEU 344 341 341 LEU LEU A . n 
C 1 345 ASN 345 342 342 ASN ASN A . n 
C 1 346 VAL 346 343 343 VAL VAL A . n 
C 1 347 TRP 347 344 344 TRP TRP A . n 
C 1 348 ASP 348 345 345 ASP ASP A . n 
C 1 349 LEU 349 346 346 LEU LEU A . n 
C 1 350 SER 350 347 347 SER SER A . n 
C 1 351 LYS 351 348 348 LYS LYS A . n 
C 1 352 ILE 352 349 349 ILE ILE A . n 
C 1 353 GLY 353 350 350 GLY GLY A . n 
C 1 354 GLU 354 351 351 GLU GLU A . n 
C 1 355 GLU 355 352 352 GLU GLU A . n 
C 1 356 GLN 356 353 353 GLN GLN A . n 
C 1 357 SER 357 354 354 SER SER A . n 
C 1 358 ALA 358 355 355 ALA ALA A . n 
C 1 359 GLU 359 356 356 GLU GLU A . n 
C 1 360 ASP 360 357 357 ASP ASP A . n 
C 1 361 ALA 361 358 358 ALA ALA A . n 
C 1 362 GLU 362 359 359 GLU GLU A . n 
C 1 363 ASP 363 360 360 ASP ASP A . n 
C 1 364 GLY 364 361 361 GLY GLY A . n 
C 1 365 PRO 365 362 362 PRO PRO A . n 
C 1 366 PRO 366 363 363 PRO PRO A . n 
C 1 367 GLU 367 364 364 GLU GLU A . n 
C 1 368 LEU 368 365 365 LEU LEU A . n 
C 1 369 LEU 369 366 366 LEU LEU A . n 
C 1 370 PHE 370 367 367 PHE PHE A . n 
C 1 371 ILE 371 368 368 ILE ILE A . n 
C 1 372 HIS 372 369 369 HIS HIS A . n 
C 1 373 GLY 373 370 370 GLY GLY A . n 
C 1 374 GLY 374 371 371 GLY GLY A . n 
C 1 375 HIS 375 372 372 HIS HIS A . n 
C 1 376 THR 376 373 373 THR THR A . n 
C 1 377 ALA 377 374 374 ALA ALA A . n 
C 1 378 LYS 378 375 375 LYS LYS A . n 
C 1 379 ILE 379 376 376 ILE ILE A . n 
C 1 380 SER 380 377 377 SER SER A . n 
C 1 381 ASP 381 378 378 ASP ASP A . n 
C 1 382 PHE 382 379 379 PHE PHE A . n 
C 1 383 SER 383 380 380 SER SER A . n 
C 1 384 TRP 384 381 381 TRP TRP A . n 
C 1 385 ASN 385 382 382 ASN ASN A . n 
C 1 386 PRO 386 383 383 PRO PRO A . n 
C 1 387 ASN 387 384 384 ASN ASN A . n 
C 1 388 GLU 388 385 385 GLU GLU A . n 
C 1 389 PRO 389 386 386 PRO PRO A . n 
C 1 390 TRP 390 387 387 TRP TRP A . n 
C 1 391 VAL 391 388 388 VAL VAL A . n 
C 1 392 ILE 392 389 389 ILE ILE A . n 
C 1 393 CYS 393 390 390 CYS CYS A . n 
C 1 394 SER 394 391 391 SER SER A . n 
C 1 395 VAL 395 392 392 VAL VAL A . n 
C 1 396 SER 396 393 393 SER SER A . n 
C 1 397 GLU 397 394 394 GLU GLU A . n 
C 1 398 ASP 398 395 395 ASP ASP A . n 
C 1 399 ASN 399 396 396 ASN ASN A . n 
C 1 400 ILE 400 397 397 ILE ILE A . n 
C 1 401 MSE 401 398 398 MSE MSE A . n 
C 1 402 GLN 402 399 399 GLN GLN A . n 
C 1 403 ILE 403 400 400 ILE ILE A . n 
C 1 404 TRP 404 401 401 TRP TRP A . n 
C 1 405 GLN 405 402 402 GLN GLN A . n 
C 1 406 MSE 406 403 403 MSE MSE A . n 
C 1 407 ALA 407 404 404 ALA ALA A . n 
C 1 408 GLU 408 405 405 GLU GLU A . n 
C 1 409 ASN 409 406 406 ASN ASN A . n 
C 1 410 ILE 410 407 407 ILE ILE A . n 
C 1 411 TYR 411 408 408 TYR TYR A . n 
C 1 412 ASN 412 409 409 ASN ASN A . n 
C 1 413 ASP 413 410 ?   ?   ?   A . n 
C 1 414 GLU 414 411 ?   ?   ?   A . n 
D 2 1   ASP 1   24  ?   ?   ?   F . n 
D 2 2   ASN 2   25  ?   ?   ?   F . n 
D 2 3   ILE 3   26  ?   ?   ?   F . n 
D 2 4   GLN 4   27  ?   ?   ?   F . n 
D 2 5   GLY 5   28  28  GLY GLY F . n 
D 2 6   ILE 6   29  29  ILE ILE F . n 
D 2 7   THR 7   30  30  THR THR F . n 
D 2 8   LYS 8   31  31  LYS LYS F . n 
D 2 9   PRO 9   32  32  PRO PRO F . n 
D 2 10  ALA 10  33  33  ALA ALA F . n 
D 2 11  ILE 11  34  34  ILE ILE F . n 
D 2 12  ARG 12  35  35  ARG ARG F . n 
D 2 13  ARG 13  36  36  ARG ARG F . n 
D 2 14  LEU 14  37  37  LEU LEU F . n 
D 2 15  ALA 15  38  38  ALA ALA F . n 
D 2 16  ARG 16  39  39  ARG ARG F . n 
D 2 17  ARG 17  40  40  ARG ARG F . n 
D 2 18  GLY 18  41  41  GLY GLY F . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 ARS 1   412 411 ARS ARS B . 
F 3 ARS 1   412 411 ARS ARS A . 
G 4 HOH 1   413 412 HOH HOH B . 
G 4 HOH 2   414 413 HOH HOH B . 
G 4 HOH 3   415 414 HOH HOH B . 
G 4 HOH 4   416 415 HOH HOH B . 
G 4 HOH 5   417 416 HOH HOH B . 
G 4 HOH 6   418 417 HOH HOH B . 
G 4 HOH 7   419 418 HOH HOH B . 
G 4 HOH 8   420 419 HOH HOH B . 
G 4 HOH 9   421 420 HOH HOH B . 
G 4 HOH 10  422 421 HOH HOH B . 
G 4 HOH 11  423 422 HOH HOH B . 
G 4 HOH 12  424 423 HOH HOH B . 
G 4 HOH 13  425 424 HOH HOH B . 
G 4 HOH 14  426 425 HOH HOH B . 
G 4 HOH 15  427 426 HOH HOH B . 
G 4 HOH 16  428 427 HOH HOH B . 
G 4 HOH 17  429 428 HOH HOH B . 
G 4 HOH 18  430 429 HOH HOH B . 
G 4 HOH 19  431 430 HOH HOH B . 
G 4 HOH 20  432 431 HOH HOH B . 
G 4 HOH 21  433 432 HOH HOH B . 
G 4 HOH 22  434 433 HOH HOH B . 
G 4 HOH 23  435 434 HOH HOH B . 
G 4 HOH 24  436 435 HOH HOH B . 
G 4 HOH 25  437 436 HOH HOH B . 
G 4 HOH 26  438 437 HOH HOH B . 
G 4 HOH 27  439 438 HOH HOH B . 
G 4 HOH 28  440 439 HOH HOH B . 
G 4 HOH 29  441 440 HOH HOH B . 
G 4 HOH 30  442 441 HOH HOH B . 
G 4 HOH 31  443 442 HOH HOH B . 
G 4 HOH 32  444 443 HOH HOH B . 
G 4 HOH 33  445 444 HOH HOH B . 
G 4 HOH 34  446 445 HOH HOH B . 
G 4 HOH 35  447 446 HOH HOH B . 
G 4 HOH 36  448 447 HOH HOH B . 
G 4 HOH 37  449 448 HOH HOH B . 
G 4 HOH 38  450 450 HOH HOH B . 
G 4 HOH 39  451 451 HOH HOH B . 
G 4 HOH 40  452 452 HOH HOH B . 
G 4 HOH 41  453 453 HOH HOH B . 
G 4 HOH 42  454 454 HOH HOH B . 
G 4 HOH 43  455 455 HOH HOH B . 
G 4 HOH 44  456 456 HOH HOH B . 
G 4 HOH 45  457 457 HOH HOH B . 
G 4 HOH 46  458 458 HOH HOH B . 
G 4 HOH 47  459 459 HOH HOH B . 
G 4 HOH 48  460 460 HOH HOH B . 
G 4 HOH 49  461 461 HOH HOH B . 
G 4 HOH 50  462 462 HOH HOH B . 
G 4 HOH 51  463 463 HOH HOH B . 
G 4 HOH 52  464 464 HOH HOH B . 
G 4 HOH 53  465 465 HOH HOH B . 
G 4 HOH 54  466 466 HOH HOH B . 
G 4 HOH 55  467 467 HOH HOH B . 
G 4 HOH 56  468 468 HOH HOH B . 
G 4 HOH 57  469 469 HOH HOH B . 
G 4 HOH 58  470 470 HOH HOH B . 
G 4 HOH 59  471 471 HOH HOH B . 
G 4 HOH 60  472 472 HOH HOH B . 
G 4 HOH 61  473 473 HOH HOH B . 
G 4 HOH 62  474 474 HOH HOH B . 
G 4 HOH 63  475 475 HOH HOH B . 
G 4 HOH 64  476 476 HOH HOH B . 
G 4 HOH 65  477 477 HOH HOH B . 
G 4 HOH 66  478 478 HOH HOH B . 
G 4 HOH 67  479 479 HOH HOH B . 
G 4 HOH 68  480 480 HOH HOH B . 
G 4 HOH 69  481 481 HOH HOH B . 
G 4 HOH 70  482 482 HOH HOH B . 
G 4 HOH 71  483 483 HOH HOH B . 
G 4 HOH 72  484 484 HOH HOH B . 
G 4 HOH 73  485 485 HOH HOH B . 
G 4 HOH 74  486 486 HOH HOH B . 
G 4 HOH 75  487 487 HOH HOH B . 
G 4 HOH 76  488 488 HOH HOH B . 
G 4 HOH 77  489 489 HOH HOH B . 
G 4 HOH 78  490 490 HOH HOH B . 
G 4 HOH 79  491 491 HOH HOH B . 
G 4 HOH 80  492 492 HOH HOH B . 
G 4 HOH 81  493 493 HOH HOH B . 
G 4 HOH 82  494 494 HOH HOH B . 
G 4 HOH 83  495 495 HOH HOH B . 
G 4 HOH 84  496 496 HOH HOH B . 
G 4 HOH 85  497 497 HOH HOH B . 
G 4 HOH 86  498 498 HOH HOH B . 
G 4 HOH 87  499 499 HOH HOH B . 
G 4 HOH 88  500 500 HOH HOH B . 
G 4 HOH 89  501 502 HOH HOH B . 
G 4 HOH 90  502 503 HOH HOH B . 
G 4 HOH 91  503 504 HOH HOH B . 
G 4 HOH 92  504 505 HOH HOH B . 
G 4 HOH 93  505 506 HOH HOH B . 
G 4 HOH 94  506 507 HOH HOH B . 
G 4 HOH 95  507 508 HOH HOH B . 
G 4 HOH 96  508 509 HOH HOH B . 
G 4 HOH 97  509 510 HOH HOH B . 
G 4 HOH 98  510 511 HOH HOH B . 
G 4 HOH 99  511 512 HOH HOH B . 
G 4 HOH 100 512 513 HOH HOH B . 
G 4 HOH 101 513 514 HOH HOH B . 
G 4 HOH 102 514 515 HOH HOH B . 
G 4 HOH 103 515 516 HOH HOH B . 
G 4 HOH 104 516 517 HOH HOH B . 
G 4 HOH 105 517 518 HOH HOH B . 
G 4 HOH 106 518 519 HOH HOH B . 
G 4 HOH 107 519 520 HOH HOH B . 
G 4 HOH 108 520 521 HOH HOH B . 
G 4 HOH 109 521 522 HOH HOH B . 
G 4 HOH 110 522 523 HOH HOH B . 
G 4 HOH 111 523 524 HOH HOH B . 
G 4 HOH 112 524 525 HOH HOH B . 
G 4 HOH 113 525 526 HOH HOH B . 
G 4 HOH 114 526 527 HOH HOH B . 
G 4 HOH 115 527 528 HOH HOH B . 
G 4 HOH 116 528 529 HOH HOH B . 
G 4 HOH 117 529 530 HOH HOH B . 
G 4 HOH 118 530 531 HOH HOH B . 
G 4 HOH 119 531 532 HOH HOH B . 
G 4 HOH 120 532 533 HOH HOH B . 
G 4 HOH 121 533 534 HOH HOH B . 
G 4 HOH 122 534 535 HOH HOH B . 
G 4 HOH 123 535 536 HOH HOH B . 
G 4 HOH 124 536 537 HOH HOH B . 
G 4 HOH 125 537 538 HOH HOH B . 
H 4 HOH 1   177 177 HOH HOH E . 
H 4 HOH 2   191 191 HOH HOH E . 
H 4 HOH 3   192 192 HOH HOH E . 
H 4 HOH 4   193 193 HOH HOH E . 
H 4 HOH 5   195 195 HOH HOH E . 
H 4 HOH 6   196 196 HOH HOH E . 
H 4 HOH 7   198 198 HOH HOH E . 
I 4 HOH 1   413 412 HOH HOH A . 
I 4 HOH 2   414 413 HOH HOH A . 
I 4 HOH 3   415 414 HOH HOH A . 
I 4 HOH 4   416 415 HOH HOH A . 
I 4 HOH 5   417 416 HOH HOH A . 
I 4 HOH 6   418 417 HOH HOH A . 
I 4 HOH 7   419 418 HOH HOH A . 
I 4 HOH 8   420 419 HOH HOH A . 
I 4 HOH 9   421 420 HOH HOH A . 
I 4 HOH 10  422 421 HOH HOH A . 
I 4 HOH 11  423 422 HOH HOH A . 
I 4 HOH 12  424 424 HOH HOH A . 
I 4 HOH 13  425 425 HOH HOH A . 
I 4 HOH 14  426 426 HOH HOH A . 
I 4 HOH 15  427 427 HOH HOH A . 
I 4 HOH 16  428 428 HOH HOH A . 
I 4 HOH 17  429 429 HOH HOH A . 
I 4 HOH 18  430 430 HOH HOH A . 
I 4 HOH 19  431 432 HOH HOH A . 
I 4 HOH 20  432 433 HOH HOH A . 
I 4 HOH 21  433 434 HOH HOH A . 
I 4 HOH 22  434 435 HOH HOH A . 
I 4 HOH 23  435 436 HOH HOH A . 
I 4 HOH 24  436 437 HOH HOH A . 
I 4 HOH 25  437 438 HOH HOH A . 
I 4 HOH 26  438 439 HOH HOH A . 
I 4 HOH 27  439 440 HOH HOH A . 
I 4 HOH 28  440 441 HOH HOH A . 
I 4 HOH 29  441 442 HOH HOH A . 
I 4 HOH 30  442 443 HOH HOH A . 
I 4 HOH 31  443 444 HOH HOH A . 
I 4 HOH 32  444 445 HOH HOH A . 
I 4 HOH 33  445 446 HOH HOH A . 
I 4 HOH 34  446 447 HOH HOH A . 
I 4 HOH 35  447 448 HOH HOH A . 
I 4 HOH 36  448 450 HOH HOH A . 
I 4 HOH 37  449 451 HOH HOH A . 
I 4 HOH 38  450 452 HOH HOH A . 
I 4 HOH 39  451 453 HOH HOH A . 
I 4 HOH 40  452 454 HOH HOH A . 
I 4 HOH 41  453 455 HOH HOH A . 
I 4 HOH 42  454 456 HOH HOH A . 
I 4 HOH 43  455 457 HOH HOH A . 
I 4 HOH 44  456 458 HOH HOH A . 
I 4 HOH 45  457 459 HOH HOH A . 
I 4 HOH 46  458 460 HOH HOH A . 
I 4 HOH 47  459 461 HOH HOH A . 
I 4 HOH 48  460 462 HOH HOH A . 
I 4 HOH 49  461 463 HOH HOH A . 
I 4 HOH 50  462 464 HOH HOH A . 
I 4 HOH 51  463 465 HOH HOH A . 
I 4 HOH 52  464 466 HOH HOH A . 
I 4 HOH 53  465 467 HOH HOH A . 
I 4 HOH 54  466 468 HOH HOH A . 
I 4 HOH 55  467 469 HOH HOH A . 
I 4 HOH 56  468 470 HOH HOH A . 
I 4 HOH 57  469 471 HOH HOH A . 
I 4 HOH 58  470 472 HOH HOH A . 
I 4 HOH 59  471 473 HOH HOH A . 
I 4 HOH 60  472 475 HOH HOH A . 
I 4 HOH 61  473 476 HOH HOH A . 
I 4 HOH 62  474 477 HOH HOH A . 
I 4 HOH 63  475 478 HOH HOH A . 
I 4 HOH 64  476 479 HOH HOH A . 
I 4 HOH 65  477 480 HOH HOH A . 
I 4 HOH 66  478 481 HOH HOH A . 
I 4 HOH 67  479 482 HOH HOH A . 
I 4 HOH 68  480 483 HOH HOH A . 
I 4 HOH 69  481 484 HOH HOH A . 
I 4 HOH 70  482 485 HOH HOH A . 
I 4 HOH 71  483 486 HOH HOH A . 
I 4 HOH 72  484 488 HOH HOH A . 
I 4 HOH 73  485 489 HOH HOH A . 
I 4 HOH 74  486 490 HOH HOH A . 
I 4 HOH 75  487 491 HOH HOH A . 
I 4 HOH 76  488 492 HOH HOH A . 
I 4 HOH 77  489 493 HOH HOH A . 
I 4 HOH 78  490 494 HOH HOH A . 
I 4 HOH 79  491 495 HOH HOH A . 
I 4 HOH 80  492 496 HOH HOH A . 
I 4 HOH 81  493 497 HOH HOH A . 
I 4 HOH 82  494 498 HOH HOH A . 
I 4 HOH 83  495 499 HOH HOH A . 
I 4 HOH 84  496 500 HOH HOH A . 
I 4 HOH 85  497 501 HOH HOH A . 
I 4 HOH 86  498 503 HOH HOH A . 
I 4 HOH 87  499 504 HOH HOH A . 
I 4 HOH 88  500 505 HOH HOH A . 
I 4 HOH 89  501 506 HOH HOH A . 
I 4 HOH 90  502 507 HOH HOH A . 
I 4 HOH 91  503 508 HOH HOH A . 
I 4 HOH 92  504 509 HOH HOH A . 
I 4 HOH 93  505 510 HOH HOH A . 
I 4 HOH 94  506 511 HOH HOH A . 
I 4 HOH 95  507 512 HOH HOH A . 
I 4 HOH 96  508 513 HOH HOH A . 
I 4 HOH 97  509 514 HOH HOH A . 
I 4 HOH 98  510 515 HOH HOH A . 
I 4 HOH 99  511 516 HOH HOH A . 
I 4 HOH 100 512 517 HOH HOH A . 
I 4 HOH 101 513 518 HOH HOH A . 
I 4 HOH 102 514 519 HOH HOH A . 
I 4 HOH 103 515 520 HOH HOH A . 
I 4 HOH 104 516 521 HOH HOH A . 
I 4 HOH 105 517 522 HOH HOH A . 
I 4 HOH 106 518 523 HOH HOH A . 
I 4 HOH 107 519 524 HOH HOH A . 
I 4 HOH 108 520 525 HOH HOH A . 
I 4 HOH 109 521 526 HOH HOH A . 
I 4 HOH 110 522 527 HOH HOH A . 
I 4 HOH 111 523 528 HOH HOH A . 
I 4 HOH 112 524 529 HOH HOH A . 
I 4 HOH 113 525 530 HOH HOH A . 
I 4 HOH 114 526 531 HOH HOH A . 
I 4 HOH 115 527 532 HOH HOH A . 
I 4 HOH 116 528 533 HOH HOH A . 
I 4 HOH 117 529 534 HOH HOH A . 
I 4 HOH 118 530 535 HOH HOH A . 
I 4 HOH 119 531 536 HOH HOH A . 
I 4 HOH 120 532 537 HOH HOH A . 
I 4 HOH 121 533 538 HOH HOH A . 
I 4 HOH 122 534 539 HOH HOH A . 
I 4 HOH 123 535 540 HOH HOH A . 
I 4 HOH 124 536 541 HOH HOH A . 
I 4 HOH 125 537 542 HOH HOH A . 
I 4 HOH 126 538 543 HOH HOH A . 
I 4 HOH 127 539 544 HOH HOH A . 
I 4 HOH 128 540 545 HOH HOH A . 
I 4 HOH 129 541 546 HOH HOH A . 
I 4 HOH 130 542 547 HOH HOH A . 
I 4 HOH 131 543 548 HOH HOH A . 
I 4 HOH 132 544 549 HOH HOH A . 
I 4 HOH 133 545 550 HOH HOH A . 
I 4 HOH 134 546 551 HOH HOH A . 
I 4 HOH 135 547 552 HOH HOH A . 
I 4 HOH 136 548 553 HOH HOH A . 
I 4 HOH 137 549 554 HOH HOH A . 
I 4 HOH 138 550 555 HOH HOH A . 
I 4 HOH 139 551 556 HOH HOH A . 
I 4 HOH 140 552 557 HOH HOH A . 
I 4 HOH 141 553 558 HOH HOH A . 
J 4 HOH 1   4   4   HOH HOH F . 
J 4 HOH 2   364 364 HOH HOH F . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1  A MSE 2   B MSE -1  ? MET SELENOMETHIONINE 
2  A MSE 4   B MSE 1   ? MET SELENOMETHIONINE 
3  A MSE 9   B MSE 6   ? MET SELENOMETHIONINE 
4  A MSE 38  B MSE 35  ? MET SELENOMETHIONINE 
5  A MSE 135 B MSE 132 ? MET SELENOMETHIONINE 
6  A MSE 255 B MSE 252 ? MET SELENOMETHIONINE 
7  A MSE 401 B MSE 398 ? MET SELENOMETHIONINE 
8  A MSE 406 B MSE 403 ? MET SELENOMETHIONINE 
9  C MSE 2   A MSE -1  ? MET SELENOMETHIONINE 
10 C MSE 4   A MSE 1   ? MET SELENOMETHIONINE 
11 C MSE 9   A MSE 6   ? MET SELENOMETHIONINE 
12 C MSE 38  A MSE 35  ? MET SELENOMETHIONINE 
13 C MSE 135 A MSE 132 ? MET SELENOMETHIONINE 
14 C MSE 255 A MSE 252 ? MET SELENOMETHIONINE 
15 C MSE 401 A MSE 398 ? MET SELENOMETHIONINE 
16 C MSE 406 A MSE 403 ? MET SELENOMETHIONINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,G,H 
2 1 C,D,F,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1500  ? 
1 MORE         -6.2  ? 
1 'SSA (A^2)'  19350 ? 
2 'ABSA (A^2)' 1400  ? 
2 MORE         -8.2  ? 
2 'SSA (A^2)'  18740 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-06-10 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2018-01-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Structure summary'         
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            audit_author 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    3 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_audit_author.name' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement        5.2.0019 ? 1 
ADSC   'data collection' Quantum  ? 2 
MOSFLM 'data reduction'  .        ? 3 
SCALA  'data scaling'    .        ? 4 
AMoRE  phasing           .        ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB B PHE 7  ? ? CA B PHE 7  ? ? C B PHE 7  ? ? 89.12  110.40 -21.28 2.00 N 
2 1 N  B PHE 7  ? ? CA B PHE 7  ? ? C B PHE 7  ? ? 129.71 111.00 18.71  2.70 N 
3 1 CB F THR 30 ? ? CA F THR 30 ? ? C F THR 30 ? ? 89.48  111.60 -22.12 2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU B 5   ? ? 170.56  97.74   
2  1 PHE B 7   ? ? 73.98   -10.23  
3  1 ASN B 135 ? ? -151.26 89.67   
4  1 TYR B 180 ? ? -135.81 -38.57  
5  1 HIS B 199 ? ? 81.87   -2.89   
6  1 ALA B 208 ? ? -85.10  -132.20 
7  1 SER B 314 ? ? 161.99  -35.04  
8  1 ASN B 396 ? ? 81.85   -6.21   
9  1 ASN B 406 ? ? -39.15  -25.10  
10 1 LYS A 4   ? ? -151.40 76.01   
11 1 SER A 145 ? ? -92.75  -148.41 
12 1 HIS A 199 ? ? 79.61   -2.20   
13 1 ILE A 206 ? ? -64.95  9.43    
14 1 ASN A 207 ? ? -100.65 41.18   
15 1 ALA A 208 ? ? -147.26 -127.56 
16 1 PRO A 210 ? ? -76.92  -153.27 
17 1 GLU A 212 ? ? -161.96 15.86   
18 1 GLN A 249 ? ? 80.42   11.13   
19 1 ASN A 259 ? ? -86.07  38.68   
20 1 LYS A 295 ? ? 80.96   17.96   
21 1 SER A 314 ? ? 174.74  -40.32  
22 1 SER A 347 ? ? -67.27  5.00    
23 1 TRP A 387 ? ? 78.51   -4.37   
24 1 ASN A 396 ? ? 82.88   -6.62   
25 1 THR F 30  ? ? 107.52  -21.24  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 B VAL 110 ? CG1 ? A VAL 113 CG1 
2 1 Y 1 B VAL 110 ? CG2 ? A VAL 113 CG2 
3 1 Y 1 B ASP 301 ? OD2 ? A ASP 304 OD2 
4 1 Y 1 A VAL 110 ? CB  ? C VAL 113 CB  
5 1 Y 1 A VAL 110 ? CG1 ? C VAL 113 CG1 
6 1 Y 1 A VAL 110 ? CG2 ? C VAL 113 CG2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 B ALA 90  ? A ALA 93  
2  1 Y 1 B GLN 91  ? A GLN 94  
3  1 Y 1 B PHE 92  ? A PHE 95  
4  1 Y 1 B ASP 93  ? A ASP 96  
5  1 Y 1 B ALA 94  ? A ALA 97  
6  1 Y 1 B SER 95  ? A SER 98  
7  1 Y 1 B HIS 96  ? A HIS 99  
8  1 Y 1 B CYS 97  ? A CYS 100 
9  1 Y 1 B ASP 98  ? A ASP 101 
10 1 Y 1 B SER 99  ? A SER 102 
11 1 Y 1 B ASP 100 ? A ASP 103 
12 1 Y 1 B LYS 101 ? A LYS 104 
13 1 Y 1 B GLY 102 ? A GLY 105 
14 1 Y 1 B GLU 103 ? A GLU 106 
15 1 Y 1 B PHE 104 ? A PHE 107 
16 1 Y 1 B GLY 105 ? A GLY 108 
17 1 Y 1 B GLY 106 ? A GLY 109 
18 1 Y 1 B PHE 107 ? A PHE 110 
19 1 Y 1 B GLY 108 ? A GLY 111 
20 1 Y 1 B SER 109 ? A SER 112 
21 1 Y 1 B GLU 411 ? A GLU 414 
22 1 Y 1 A HIS -2  ? C HIS 1   
23 1 Y 1 A ASP 89  ? C ASP 92  
24 1 Y 1 A ALA 90  ? C ALA 93  
25 1 Y 1 A GLN 91  ? C GLN 94  
26 1 Y 1 A PHE 92  ? C PHE 95  
27 1 Y 1 A ASP 93  ? C ASP 96  
28 1 Y 1 A ALA 94  ? C ALA 97  
29 1 Y 1 A SER 95  ? C SER 98  
30 1 Y 1 A HIS 96  ? C HIS 99  
31 1 Y 1 A CYS 97  ? C CYS 100 
32 1 Y 1 A ASP 98  ? C ASP 101 
33 1 Y 1 A SER 99  ? C SER 102 
34 1 Y 1 A ASP 100 ? C ASP 103 
35 1 Y 1 A LYS 101 ? C LYS 104 
36 1 Y 1 A GLY 102 ? C GLY 105 
37 1 Y 1 A GLU 103 ? C GLU 106 
38 1 Y 1 A PHE 104 ? C PHE 107 
39 1 Y 1 A GLY 105 ? C GLY 108 
40 1 Y 1 A GLY 106 ? C GLY 109 
41 1 Y 1 A PHE 107 ? C PHE 110 
42 1 Y 1 A GLY 108 ? C GLY 111 
43 1 Y 1 A SER 109 ? C SER 112 
44 1 Y 1 A ASP 410 ? C ASP 413 
45 1 Y 1 A GLU 411 ? C GLU 414 
46 1 Y 1 F ASP 24  ? D ASP 1   
47 1 Y 1 F ASN 25  ? D ASN 2   
48 1 Y 1 F ILE 26  ? D ILE 3   
49 1 Y 1 F GLN 27  ? D GLN 4   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 ARSENIC ARS 
4 water   HOH 
#