data_3CJR
# 
_entry.id   3CJR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3CJR         
RCSB  RCSB046860   
WWPDB D_1000046860 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2NXC 'Apo-form of T. thermophilus ribosomal protein L11 methyltransferase (PrmA)at 1.59 A resolution' unspecified 
PDB 2NXE 'T. thermophilus ribosomal protein L11 methyltransferase (PrmA) in complex with S-Adenosyl-L-Methionine' unspecified 
PDB 2NXJ 'T.thermophilus ribosomal protein L11 methyltransferase (PrmA) in space group P 21 21 2' unspecified 
PDB 2NXN 'T. thermophilus ribosomal protein L11 methyltransferase (PrmA) in complex with ribosomal protein L11' unspecified 
PDB 1UFK 'Apo-form of T. thermophilus ribosomal protein L11 methyltransferase (PrmA)at 1.9 A resolution' unspecified 
PDB 3CJQ 
'Ribosomal protein L11 methyltransferase (PrmA) in complex with dimethylated ribosomal protein L11 in space group P212121' 
unspecified 
PDB 3CJS . unspecified 
PDB 3CJT . unspecified 
PDB 3CJU . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3CJR 
_pdbx_database_status.recvd_initial_deposition_date   2008-03-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Demirci, H.'    1 
'Gregory, S.T.'  2 
'Dahlberg, A.E.' 3 
'Jogl, G.'       4 
# 
_citation.id                        primary 
_citation.title                     'Multiple-Site Trimethylation of Ribosomal Protein L11 by the PrmA Methyltransferase.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            16 
_citation.page_first                1059 
_citation.page_last                 1066 
_citation.year                      2008 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18611379 
_citation.pdbx_database_id_DOI      10.1016/j.str.2008.03.016 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Demirci, H.'    1 
primary 'Gregory, S.T.'  2 
primary 'Dahlberg, A.E.' 3 
primary 'Jogl, G.'       4 
# 
_cell.entry_id           3CJR 
_cell.length_a           132.742 
_cell.length_b           132.742 
_cell.length_c           46.056 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3CJR 
_symmetry.space_group_name_H-M             'P 65' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                170 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ribosomal protein L11 methyltransferase' 27661.807 1   2.1.1.- ?    ? ? 
2 polymer     man '50S ribosomal protein L11'               15468.010 1   ?       K39A ? ? 
3 non-polymer syn SINEFUNGIN                                381.387   1   ?       ?    ? ? 
4 water       nat water                                     18.015    328 ?       ?    ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'L11 Mtase' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MWVYRLKGTLEALDPILPGLFDGGARGLWEREGEVWAFFPAPVDLPYEGVWEEVGDEDWLEAWRRDLKPALAPPFVVLAP
WHTWEGAEIPLVIEPGMAFGTGHHETTRLALKALARHLRPGDKVLDLGTGSGVLAIAAEKLGGKALGVDIDPMVLPQAEA
NAKRNGVRPRFLEGSLEAALPFGPFDLLVANLYAELHAALAPRYREALVPGGRALLTGILKDRAPLVREAMAGAGFRPLE
EAAEGEWVLLAYGR
;
;MWVYRLKGTLEALDPILPGLFDGGARGLWEREGEVWAFFPAPVDLPYEGVWEEVGDEDWLEAWRRDLKPALAPPFVVLAP
WHTWEGAEIPLVIEPGMAFGTGHHETTRLALKALARHLRPGDKVLDLGTGSGVLAIAAEKLGGKALGVDIDPMVLPQAEA
NAKRNGVRPRFLEGSLEAALPFGPFDLLVANLYAELHAALAPRYREALVPGGRALLTGILKDRAPLVREAMAGAGFRPLE
EAAEGEWVLLAYGR
;
A ? 
2 'polypeptide(L)' no no 
;MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVAAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRK
AAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA
;
;MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVAAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRK
AAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   TRP n 
1 3   VAL n 
1 4   TYR n 
1 5   ARG n 
1 6   LEU n 
1 7   LYS n 
1 8   GLY n 
1 9   THR n 
1 10  LEU n 
1 11  GLU n 
1 12  ALA n 
1 13  LEU n 
1 14  ASP n 
1 15  PRO n 
1 16  ILE n 
1 17  LEU n 
1 18  PRO n 
1 19  GLY n 
1 20  LEU n 
1 21  PHE n 
1 22  ASP n 
1 23  GLY n 
1 24  GLY n 
1 25  ALA n 
1 26  ARG n 
1 27  GLY n 
1 28  LEU n 
1 29  TRP n 
1 30  GLU n 
1 31  ARG n 
1 32  GLU n 
1 33  GLY n 
1 34  GLU n 
1 35  VAL n 
1 36  TRP n 
1 37  ALA n 
1 38  PHE n 
1 39  PHE n 
1 40  PRO n 
1 41  ALA n 
1 42  PRO n 
1 43  VAL n 
1 44  ASP n 
1 45  LEU n 
1 46  PRO n 
1 47  TYR n 
1 48  GLU n 
1 49  GLY n 
1 50  VAL n 
1 51  TRP n 
1 52  GLU n 
1 53  GLU n 
1 54  VAL n 
1 55  GLY n 
1 56  ASP n 
1 57  GLU n 
1 58  ASP n 
1 59  TRP n 
1 60  LEU n 
1 61  GLU n 
1 62  ALA n 
1 63  TRP n 
1 64  ARG n 
1 65  ARG n 
1 66  ASP n 
1 67  LEU n 
1 68  LYS n 
1 69  PRO n 
1 70  ALA n 
1 71  LEU n 
1 72  ALA n 
1 73  PRO n 
1 74  PRO n 
1 75  PHE n 
1 76  VAL n 
1 77  VAL n 
1 78  LEU n 
1 79  ALA n 
1 80  PRO n 
1 81  TRP n 
1 82  HIS n 
1 83  THR n 
1 84  TRP n 
1 85  GLU n 
1 86  GLY n 
1 87  ALA n 
1 88  GLU n 
1 89  ILE n 
1 90  PRO n 
1 91  LEU n 
1 92  VAL n 
1 93  ILE n 
1 94  GLU n 
1 95  PRO n 
1 96  GLY n 
1 97  MET n 
1 98  ALA n 
1 99  PHE n 
1 100 GLY n 
1 101 THR n 
1 102 GLY n 
1 103 HIS n 
1 104 HIS n 
1 105 GLU n 
1 106 THR n 
1 107 THR n 
1 108 ARG n 
1 109 LEU n 
1 110 ALA n 
1 111 LEU n 
1 112 LYS n 
1 113 ALA n 
1 114 LEU n 
1 115 ALA n 
1 116 ARG n 
1 117 HIS n 
1 118 LEU n 
1 119 ARG n 
1 120 PRO n 
1 121 GLY n 
1 122 ASP n 
1 123 LYS n 
1 124 VAL n 
1 125 LEU n 
1 126 ASP n 
1 127 LEU n 
1 128 GLY n 
1 129 THR n 
1 130 GLY n 
1 131 SER n 
1 132 GLY n 
1 133 VAL n 
1 134 LEU n 
1 135 ALA n 
1 136 ILE n 
1 137 ALA n 
1 138 ALA n 
1 139 GLU n 
1 140 LYS n 
1 141 LEU n 
1 142 GLY n 
1 143 GLY n 
1 144 LYS n 
1 145 ALA n 
1 146 LEU n 
1 147 GLY n 
1 148 VAL n 
1 149 ASP n 
1 150 ILE n 
1 151 ASP n 
1 152 PRO n 
1 153 MET n 
1 154 VAL n 
1 155 LEU n 
1 156 PRO n 
1 157 GLN n 
1 158 ALA n 
1 159 GLU n 
1 160 ALA n 
1 161 ASN n 
1 162 ALA n 
1 163 LYS n 
1 164 ARG n 
1 165 ASN n 
1 166 GLY n 
1 167 VAL n 
1 168 ARG n 
1 169 PRO n 
1 170 ARG n 
1 171 PHE n 
1 172 LEU n 
1 173 GLU n 
1 174 GLY n 
1 175 SER n 
1 176 LEU n 
1 177 GLU n 
1 178 ALA n 
1 179 ALA n 
1 180 LEU n 
1 181 PRO n 
1 182 PHE n 
1 183 GLY n 
1 184 PRO n 
1 185 PHE n 
1 186 ASP n 
1 187 LEU n 
1 188 LEU n 
1 189 VAL n 
1 190 ALA n 
1 191 ASN n 
1 192 LEU n 
1 193 TYR n 
1 194 ALA n 
1 195 GLU n 
1 196 LEU n 
1 197 HIS n 
1 198 ALA n 
1 199 ALA n 
1 200 LEU n 
1 201 ALA n 
1 202 PRO n 
1 203 ARG n 
1 204 TYR n 
1 205 ARG n 
1 206 GLU n 
1 207 ALA n 
1 208 LEU n 
1 209 VAL n 
1 210 PRO n 
1 211 GLY n 
1 212 GLY n 
1 213 ARG n 
1 214 ALA n 
1 215 LEU n 
1 216 LEU n 
1 217 THR n 
1 218 GLY n 
1 219 ILE n 
1 220 LEU n 
1 221 LYS n 
1 222 ASP n 
1 223 ARG n 
1 224 ALA n 
1 225 PRO n 
1 226 LEU n 
1 227 VAL n 
1 228 ARG n 
1 229 GLU n 
1 230 ALA n 
1 231 MET n 
1 232 ALA n 
1 233 GLY n 
1 234 ALA n 
1 235 GLY n 
1 236 PHE n 
1 237 ARG n 
1 238 PRO n 
1 239 LEU n 
1 240 GLU n 
1 241 GLU n 
1 242 ALA n 
1 243 ALA n 
1 244 GLU n 
1 245 GLY n 
1 246 GLU n 
1 247 TRP n 
1 248 VAL n 
1 249 LEU n 
1 250 LEU n 
1 251 ALA n 
1 252 TYR n 
1 253 GLY n 
1 254 ARG n 
2 1   MET n 
2 2   LYS n 
2 3   LYS n 
2 4   VAL n 
2 5   VAL n 
2 6   ALA n 
2 7   VAL n 
2 8   VAL n 
2 9   LYS n 
2 10  LEU n 
2 11  GLN n 
2 12  LEU n 
2 13  PRO n 
2 14  ALA n 
2 15  GLY n 
2 16  LYS n 
2 17  ALA n 
2 18  THR n 
2 19  PRO n 
2 20  ALA n 
2 21  PRO n 
2 22  PRO n 
2 23  VAL n 
2 24  GLY n 
2 25  PRO n 
2 26  ALA n 
2 27  LEU n 
2 28  GLY n 
2 29  GLN n 
2 30  HIS n 
2 31  GLY n 
2 32  ALA n 
2 33  ASN n 
2 34  ILE n 
2 35  MET n 
2 36  GLU n 
2 37  PHE n 
2 38  VAL n 
2 39  ALA n 
2 40  ALA n 
2 41  PHE n 
2 42  ASN n 
2 43  ALA n 
2 44  ALA n 
2 45  THR n 
2 46  ALA n 
2 47  ASN n 
2 48  MET n 
2 49  GLY n 
2 50  ASP n 
2 51  ALA n 
2 52  ILE n 
2 53  VAL n 
2 54  PRO n 
2 55  VAL n 
2 56  GLU n 
2 57  ILE n 
2 58  THR n 
2 59  ILE n 
2 60  TYR n 
2 61  ALA n 
2 62  ASP n 
2 63  ARG n 
2 64  SER n 
2 65  PHE n 
2 66  THR n 
2 67  PHE n 
2 68  VAL n 
2 69  THR n 
2 70  LYS n 
2 71  THR n 
2 72  PRO n 
2 73  PRO n 
2 74  ALA n 
2 75  SER n 
2 76  TYR n 
2 77  LEU n 
2 78  ILE n 
2 79  ARG n 
2 80  LYS n 
2 81  ALA n 
2 82  ALA n 
2 83  GLY n 
2 84  LEU n 
2 85  GLU n 
2 86  LYS n 
2 87  GLY n 
2 88  ALA n 
2 89  HIS n 
2 90  LYS n 
2 91  PRO n 
2 92  GLY n 
2 93  ARG n 
2 94  GLU n 
2 95  LYS n 
2 96  VAL n 
2 97  GLY n 
2 98  ARG n 
2 99  ILE n 
2 100 THR n 
2 101 TRP n 
2 102 GLU n 
2 103 GLN n 
2 104 VAL n 
2 105 LEU n 
2 106 GLU n 
2 107 ILE n 
2 108 ALA n 
2 109 LYS n 
2 110 GLN n 
2 111 LYS n 
2 112 MET n 
2 113 PRO n 
2 114 ASP n 
2 115 LEU n 
2 116 ASN n 
2 117 THR n 
2 118 THR n 
2 119 ASP n 
2 120 LEU n 
2 121 GLU n 
2 122 ALA n 
2 123 ALA n 
2 124 ALA n 
2 125 ARG n 
2 126 MET n 
2 127 ILE n 
2 128 ALA n 
2 129 GLY n 
2 130 SER n 
2 131 ALA n 
2 132 ARG n 
2 133 SER n 
2 134 MET n 
2 135 GLY n 
2 136 VAL n 
2 137 GLU n 
2 138 VAL n 
2 139 VAL n 
2 140 GLY n 
2 141 ALA n 
2 142 PRO n 
2 143 GLU n 
2 144 VAL n 
2 145 LYS n 
2 146 ASP n 
2 147 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? ? prmA          ? HB8 ? ? ? ? 'Thermus thermophilus' ? ? ? ? ? ? ? ? ? 'Escherichia coli' ? ? ? ? ? ? ? 
'BL21 (DE3) Star'     ? ? ? ? ? ? ? plasmid ? ? ? pET30b ? ? 
2 1 sample ? ? ? ? ? 'rplK, rpl11' ? HB8 ? ? ? ? 'Thermus thermophilus' ? ? ? ? ? ? ? ? ? 'Escherichia coli' ? ? ? ? ? ? ? 
'BL21 (DE3) prmA::TC' ? ? ? ? ? ? ? plasmid ? ? ? pET11a ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP PRMA_THET8 Q84BQ9 1 
;MWVYRLKGTLEALDPILPGLFDGGARGLWEREGEVWAFFPAPVDLPYEGVWEEVGDEDWLEAWRRDLKPALAPPFVVLAP
WHTWEGAEIPLVIEPGMAFGTGHHETTRLALKALARHLRPGDKVLDLGTGSGVLAIAAEKLGGKALGVDIDPMVLPQAEA
NAKRNGVRPRFLEGSLEAALPFGPFDLLVANLYAELHAALAPRYREALVPGGRALLTGILKDRAPLVREAMAGAGFRPLE
EAAEGEWVLLAYGR
;
1 ? 
2 UNP RL11_THETH P36238 2 
;MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRK
AAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA
;
1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3CJR A 1 ? 254 ? Q84BQ9 1 ? 254 ? 1 254 
2 2 3CJR B 1 ? 147 ? P36238 1 ? 147 ? 1 147 
# 
_struct_ref_seq_dif.align_id                     2 
_struct_ref_seq_dif.pdbx_pdb_id_code             3CJR 
_struct_ref_seq_dif.mon_id                       ALA 
_struct_ref_seq_dif.pdbx_pdb_strand_id           B 
_struct_ref_seq_dif.seq_num                      39 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P36238 
_struct_ref_seq_dif.db_mon_id                    LYS 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          39 
_struct_ref_seq_dif.details                      ENGINEERED 
_struct_ref_seq_dif.pdbx_auth_seq_num            39 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                  'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                  'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                  'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                  'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ?                  'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                  'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                  'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?                  'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                  'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                  'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                  'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                  'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                  'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                  'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                  'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                  'C3 H7 N O3'     105.093 
SFG non-polymer         . SINEFUNGIN      ADENOSYL-ORNITHINE 'C15 H23 N7 O5'  381.387 
THR 'L-peptide linking' y THREONINE       ?                  'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                  'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                  'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                  'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3CJR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.72 
_exptl_crystal.density_percent_sol   54.71 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'microbatch under oil' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
;170 mM sodium acetate trihydrate, 85 mM TRIS-HCl, 25.5 (w/v) PEG 4000, 15% (v/v) glycerol, 1 mM Sinefungin, pH 8.5, microbatch under oil, temperature 277K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2007-04-15 
_diffrn_detector.details                
;Variable vertical and fixed horizontal slits. KOHZU double crystal monochromator with a water-cooled flat first crystal and a sagittally focused second crystal positioned for a fixed exit beam condition. Located ~18 m from source and ~6 m from sample position. Mirror system consisting of two vertically stacked, fused silica, spherical mirrors, to provide vertical focusing and harmonic rejection. One of the mirrors is rhodium coated and the other is uncoated. Located ~19.7 m from source.
;
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    
;KOHZU double crystal monochromator with a water-cooled flat first crystal and a sagittally focused second crystal positioned for a fixed exit beam condition. Located ~18 m from source and ~6 m from sample position.
;
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9797 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X4A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X4A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9797 
# 
_reflns.entry_id                     3CJR 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3 
_reflns.d_resolution_high            2.05 
_reflns.d_resolution_low             50 
_reflns.number_all                   ? 
_reflns.number_obs                   27841 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.067 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        18.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.05 
_reflns_shell.d_res_low              2.12 
_reflns_shell.percent_possible_all   99.0 
_reflns_shell.Rmerge_I_obs           0.528 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.3 
_reflns_shell.pdbx_redundancy        3.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      5621 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3CJR 
_refine.ls_number_reflns_obs                     27841 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.05 
_refine.ls_percent_reflns_obs                    99.96 
_refine.ls_R_factor_obs                          0.21636 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.21322 
_refine.ls_R_factor_R_free                       0.27695 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1491 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.946 
_refine.correlation_coeff_Fo_to_Fc_free          0.908 
_refine.B_iso_mean                               51.919 
_refine.aniso_B[1][1]                            -0.33 
_refine.aniso_B[2][2]                            -0.33 
_refine.aniso_B[3][3]                            0.50 
_refine.aniso_B[1][2]                            -0.17 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'pdb entries 2NXC, 2NXN' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.202 
_refine.pdbx_overall_ESU_R_Free                  0.194 
_refine.overall_SU_ML                            0.139 
_refine.overall_SU_B                             9.554 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2791 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         27 
_refine_hist.number_atoms_solvent             328 
_refine_hist.number_atoms_total               3146 
_refine_hist.d_res_high                       2.05 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.006  0.022  ? 2881 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.125  1.993  ? 3927 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.176  5.000  ? 363  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       30.566 22.936 ? 109  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.590 15.000 ? 444  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       13.497 15.000 ? 22   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.067  0.200  ? 441  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.002  0.020  ? 2185 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.177  0.200  ? 1284 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.297  0.200  ? 1924 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.093  0.200  ? 266  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.103  0.200  ? 47   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.111  0.200  ? 28   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.314  1.500  ? 1881 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.557  2.000  ? 2919 'X-RAY DIFFRACTION' ? 
r_scbond_it                  0.580  3.000  ? 1157 'X-RAY DIFFRACTION' ? 
r_scangle_it                 0.971  4.500  ? 1008 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.05 
_refine_ls_shell.d_res_low                        2.104 
_refine_ls_shell.number_reflns_R_work             2035 
_refine_ls_shell.R_factor_R_work                  0.267 
_refine_ls_shell.percent_reflns_obs               99.91 
_refine_ls_shell.R_factor_R_free                  0.31 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             104 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                2035 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3CJR 
_struct.title                     
'Ribosomal protein L11 methyltransferase (PrmA) in complex with ribosomal protein L11 (K39A) and inhibitor Sinefungin.' 
_struct.pdbx_descriptor           'Ribosomal protein L11 methyltransferase (E.C.2.1.1.-), 50S ribosomal protein L11' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3CJR 
_struct_keywords.pdbx_keywords   'TRANSFERASE/RIBOSOMAL PROTEIN' 
_struct_keywords.text            
;S-Adenosyl-L-Methionine dependent methyltransferase, post-translational modification, multi-specific trimethylation, Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding, TRANSFERASE-RIBOSOMAL PROTEIN COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 13  ? PRO A 15  ? LEU A 13  PRO A 15  5 ? 3  
HELX_P HELX_P2  2  ILE A 16  ? GLY A 24  ? ILE A 16  GLY A 24  1 ? 9  
HELX_P HELX_P3  3  LEU A 60  ? ASP A 66  ? LEU A 60  ASP A 66  1 ? 7  
HELX_P HELX_P4  4  HIS A 104 ? LEU A 118 ? HIS A 104 LEU A 118 1 ? 15 
HELX_P HELX_P5  5  GLY A 132 ? LEU A 141 ? GLY A 132 LEU A 141 1 ? 10 
HELX_P HELX_P6  6  ASP A 151 ? MET A 153 ? ASP A 151 MET A 153 5 ? 3  
HELX_P HELX_P7  7  VAL A 154 ? ASN A 165 ? VAL A 154 ASN A 165 1 ? 12 
HELX_P HELX_P8  8  SER A 175 ? LEU A 180 ? SER A 175 LEU A 180 1 ? 6  
HELX_P HELX_P9  9  PRO A 181 ? GLY A 183 ? PRO A 181 GLY A 183 5 ? 3  
HELX_P HELX_P10 10 TYR A 193 ? ALA A 207 ? TYR A 193 ALA A 207 1 ? 15 
HELX_P HELX_P11 11 ARG A 223 ? ALA A 234 ? ARG A 223 ALA A 234 1 ? 12 
HELX_P HELX_P12 12 PRO B 22  ? GLN B 29  ? PRO B 22  GLN B 29  1 ? 8  
HELX_P HELX_P13 13 ASN B 33  ? THR B 45  ? ASN B 33  THR B 45  1 ? 13 
HELX_P HELX_P14 14 ALA B 46  ? GLY B 49  ? ALA B 46  GLY B 49  5 ? 4  
HELX_P HELX_P15 15 PRO B 73  ? ARG B 79  ? PRO B 73  ARG B 79  1 ? 7  
HELX_P HELX_P16 16 GLU B 102 ? LEU B 105 ? GLU B 102 LEU B 105 5 ? 4  
HELX_P HELX_P17 17 GLU B 106 ? LYS B 111 ? GLU B 106 LYS B 111 1 ? 6  
HELX_P HELX_P18 18 ALA B 123 ? SER B 133 ? ALA B 123 SER B 133 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 73  A . ? PRO 73  A PRO 74  A ? PRO 74  A 1 8.02  
2 GLY 183 A . ? GLY 183 A PRO 184 A ? PRO 184 A 1 -0.39 
3 MET 1   B . ? MET 1   B LYS 2   B ? LYS 2   B 1 2.98  
4 PRO 21  B . ? PRO 21  B PRO 22  B ? PRO 22  B 1 6.76  
5 THR 71  B . ? THR 71  B PRO 72  B ? PRO 72  B 1 -0.61 
6 MET 134 B . ? MET 134 B GLY 135 B ? GLY 135 B 1 0.26  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 3 ? 
C ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? anti-parallel 
C 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 50  ? GLU A 52  ? VAL A 50  GLU A 52  
A 2 TRP A 2   ? LYS A 7   ? TRP A 2   LYS A 7   
A 3 GLU A 34  ? PHE A 39  ? GLU A 34  PHE A 39  
A 4 GLY A 27  ? GLU A 30  ? GLY A 27  GLU A 30  
A 5 VAL B 4   ? PRO B 13  ? VAL B 4   PRO B 13  
A 6 ILE B 52  ? TYR B 60  ? ILE B 52  TYR B 60  
A 7 PHE B 65  ? THR B 69  ? PHE B 65  THR B 69  
B 1 ALA A 70  ? ALA A 72  ? ALA A 70  ALA A 72  
B 2 PHE A 75  ? LEU A 78  ? PHE A 75  LEU A 78  
B 3 ILE A 89  ? VAL A 92  ? ILE A 89  VAL A 92  
C 1 ARG A 170 ? GLU A 173 ? ARG A 170 GLU A 173 
C 2 LYS A 144 ? ASP A 149 ? LYS A 144 ASP A 149 
C 3 LYS A 123 ? LEU A 127 ? LYS A 123 LEU A 127 
C 4 PHE A 185 ? ASN A 191 ? PHE A 185 ASN A 191 
C 5 LEU A 208 ? LEU A 220 ? LEU A 208 LEU A 220 
C 6 TRP A 247 ? GLY A 253 ? TRP A 247 GLY A 253 
C 7 ARG A 237 ? GLU A 244 ? ARG A 237 GLU A 244 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 50  ? O VAL A 50  N ARG A 5   ? N ARG A 5   
A 2 3 N TYR A 4   ? N TYR A 4   O ALA A 37  ? O ALA A 37  
A 3 4 O TRP A 36  ? O TRP A 36  N TRP A 29  ? N TRP A 29  
A 4 5 N LEU A 28  ? N LEU A 28  O GLN B 11  ? O GLN B 11  
A 5 6 N LEU B 12  ? N LEU B 12  O VAL B 53  ? O VAL B 53  
A 6 7 N THR B 58  ? N THR B 58  O THR B 66  ? O THR B 66  
B 1 2 N ALA A 70  ? N ALA A 70  O VAL A 77  ? O VAL A 77  
B 2 3 N LEU A 78  ? N LEU A 78  O LEU A 91  ? O LEU A 91  
C 1 2 O ARG A 170 ? O ARG A 170 N GLY A 147 ? N GLY A 147 
C 2 3 O LEU A 146 ? O LEU A 146 N ASP A 126 ? N ASP A 126 
C 3 4 N LEU A 125 ? N LEU A 125 O VAL A 189 ? O VAL A 189 
C 4 5 N LEU A 188 ? N LEU A 188 O LEU A 215 ? O LEU A 215 
C 5 6 N LEU A 216 ? N LEU A 216 O LEU A 250 ? O LEU A 250 
C 6 7 O GLY A 253 ? O GLY A 253 N ARG A 237 ? N ARG A 237 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    19 
_struct_site.details              'BINDING SITE FOR RESIDUE SFG A 255' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 19 PHE A 99  ? PHE A 99  . ? 1_555 ? 
2  AC1 19 GLY A 100 ? GLY A 100 . ? 1_555 ? 
3  AC1 19 THR A 107 ? THR A 107 . ? 1_555 ? 
4  AC1 19 GLY A 128 ? GLY A 128 . ? 1_555 ? 
5  AC1 19 THR A 129 ? THR A 129 . ? 1_555 ? 
6  AC1 19 LEU A 134 ? LEU A 134 . ? 1_555 ? 
7  AC1 19 ASP A 149 ? ASP A 149 . ? 1_555 ? 
8  AC1 19 ILE A 150 ? ILE A 150 . ? 1_555 ? 
9  AC1 19 GLY A 174 ? GLY A 174 . ? 1_555 ? 
10 AC1 19 SER A 175 ? SER A 175 . ? 1_555 ? 
11 AC1 19 ASN A 191 ? ASN A 191 . ? 1_555 ? 
12 AC1 19 LEU A 192 ? LEU A 192 . ? 1_555 ? 
13 AC1 19 HOH D .   ? HOH A 285 . ? 1_555 ? 
14 AC1 19 HOH D .   ? HOH A 286 . ? 1_555 ? 
15 AC1 19 HOH D .   ? HOH A 314 . ? 1_555 ? 
16 AC1 19 HOH D .   ? HOH A 375 . ? 1_555 ? 
17 AC1 19 HOH D .   ? HOH A 469 . ? 1_555 ? 
18 AC1 19 HOH D .   ? HOH A 473 . ? 1_555 ? 
19 AC1 19 HOH D .   ? HOH A 497 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3CJR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3CJR 
_atom_sites.fract_transf_matrix[1][1]   0.007533 
_atom_sites.fract_transf_matrix[1][2]   0.004349 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008699 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.021713 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . MET A 1 1   ? 24.725 -40.547 21.457  1.00 95.94  ? 1   MET A N     1 
ATOM   2    C CA    . MET A 1 1   ? 24.045 -39.890 20.304  1.00 95.94  ? 1   MET A CA    1 
ATOM   3    C C     . MET A 1 1   ? 22.544 -39.757 20.559  1.00 95.87  ? 1   MET A C     1 
ATOM   4    O O     . MET A 1 1   ? 21.884 -40.720 20.959  1.00 95.87  ? 1   MET A O     1 
ATOM   5    C CB    . MET A 1 1   ? 24.306 -40.673 19.012  1.00 95.97  ? 1   MET A CB    1 
ATOM   6    C CG    . MET A 1 1   ? 23.933 -39.931 17.727  1.00 96.14  ? 1   MET A CG    1 
ATOM   7    S SD    . MET A 1 1   ? 25.031 -38.553 17.321  1.00 96.48  ? 1   MET A SD    1 
ATOM   8    C CE    . MET A 1 1   ? 26.494 -39.422 16.755  1.00 96.38  ? 1   MET A CE    1 
ATOM   9    N N     . TRP A 1 2   ? 22.018 -38.557 20.323  1.00 95.78  ? 2   TRP A N     1 
ATOM   10   C CA    . TRP A 1 2   ? 20.600 -38.264 20.529  1.00 95.70  ? 2   TRP A CA    1 
ATOM   11   C C     . TRP A 1 2   ? 19.864 -38.086 19.204  1.00 95.58  ? 2   TRP A C     1 
ATOM   12   O O     . TRP A 1 2   ? 20.474 -37.750 18.186  1.00 95.59  ? 2   TRP A O     1 
ATOM   13   C CB    . TRP A 1 2   ? 20.433 -37.008 21.389  1.00 95.75  ? 2   TRP A CB    1 
ATOM   14   C CG    . TRP A 1 2   ? 20.893 -37.175 22.805  1.00 95.79  ? 2   TRP A CG    1 
ATOM   15   C CD1   . TRP A 1 2   ? 22.179 -37.118 23.263  1.00 95.82  ? 2   TRP A CD1   1 
ATOM   16   C CD2   . TRP A 1 2   ? 20.069 -37.419 23.953  1.00 95.83  ? 2   TRP A CD2   1 
ATOM   17   N NE1   . TRP A 1 2   ? 22.208 -37.316 24.622  1.00 95.83  ? 2   TRP A NE1   1 
ATOM   18   C CE2   . TRP A 1 2   ? 20.928 -37.504 25.072  1.00 95.83  ? 2   TRP A CE2   1 
ATOM   19   C CE3   . TRP A 1 2   ? 18.689 -37.578 24.144  1.00 95.82  ? 2   TRP A CE3   1 
ATOM   20   C CZ2   . TRP A 1 2   ? 20.452 -37.738 26.367  1.00 95.82  ? 2   TRP A CZ2   1 
ATOM   21   C CZ3   . TRP A 1 2   ? 18.216 -37.812 25.433  1.00 95.81  ? 2   TRP A CZ3   1 
ATOM   22   C CH2   . TRP A 1 2   ? 19.098 -37.889 26.526  1.00 95.82  ? 2   TRP A CH2   1 
ATOM   23   N N     . VAL A 1 3   ? 18.552 -38.312 19.228  1.00 95.44  ? 3   VAL A N     1 
ATOM   24   C CA    . VAL A 1 3   ? 17.712 -38.143 18.042  1.00 95.28  ? 3   VAL A CA    1 
ATOM   25   C C     . VAL A 1 3   ? 16.388 -37.428 18.359  1.00 95.14  ? 3   VAL A C     1 
ATOM   26   O O     . VAL A 1 3   ? 15.684 -37.787 19.307  1.00 95.16  ? 3   VAL A O     1 
ATOM   27   C CB    . VAL A 1 3   ? 17.488 -39.492 17.279  1.00 95.29  ? 3   VAL A CB    1 
ATOM   28   C CG1   . VAL A 1 3   ? 16.878 -40.563 18.184  1.00 95.29  ? 3   VAL A CG1   1 
ATOM   29   C CG2   . VAL A 1 3   ? 16.644 -39.283 16.024  1.00 95.29  ? 3   VAL A CG2   1 
ATOM   30   N N     . TYR A 1 4   ? 16.078 -36.406 17.563  1.00 94.95  ? 4   TYR A N     1 
ATOM   31   C CA    . TYR A 1 4   ? 14.835 -35.651 17.686  1.00 94.74  ? 4   TYR A CA    1 
ATOM   32   C C     . TYR A 1 4   ? 13.933 -35.942 16.487  1.00 94.58  ? 4   TYR A C     1 
ATOM   33   O O     . TYR A 1 4   ? 14.284 -35.640 15.343  1.00 94.56  ? 4   TYR A O     1 
ATOM   34   C CB    . TYR A 1 4   ? 15.137 -34.151 17.804  1.00 94.77  ? 4   TYR A CB    1 
ATOM   35   C CG    . TYR A 1 4   ? 13.923 -33.260 17.978  1.00 94.81  ? 4   TYR A CG    1 
ATOM   36   C CD1   . TYR A 1 4   ? 13.066 -33.413 19.070  1.00 94.81  ? 4   TYR A CD1   1 
ATOM   37   C CD2   . TYR A 1 4   ? 13.645 -32.246 17.062  1.00 94.85  ? 4   TYR A CD2   1 
ATOM   38   C CE1   . TYR A 1 4   ? 11.956 -32.588 19.236  1.00 94.84  ? 4   TYR A CE1   1 
ATOM   39   C CE2   . TYR A 1 4   ? 12.538 -31.415 17.219  1.00 94.88  ? 4   TYR A CE2   1 
ATOM   40   C CZ    . TYR A 1 4   ? 11.699 -31.593 18.307  1.00 94.83  ? 4   TYR A CZ    1 
ATOM   41   O OH    . TYR A 1 4   ? 10.603 -30.775 18.466  1.00 94.80  ? 4   TYR A OH    1 
ATOM   42   N N     . ARG A 1 5   ? 12.773 -36.536 16.761  1.00 94.34  ? 5   ARG A N     1 
ATOM   43   C CA    . ARG A 1 5   ? 11.866 -37.009 15.713  1.00 94.11  ? 5   ARG A CA    1 
ATOM   44   C C     . ARG A 1 5   ? 10.728 -36.026 15.440  1.00 93.96  ? 5   ARG A C     1 
ATOM   45   O O     . ARG A 1 5   ? 10.114 -35.498 16.369  1.00 93.93  ? 5   ARG A O     1 
ATOM   46   C CB    . ARG A 1 5   ? 11.302 -38.387 16.075  1.00 94.10  ? 5   ARG A CB    1 
ATOM   47   C CG    . ARG A 1 5   ? 12.364 -39.461 16.293  1.00 94.04  ? 5   ARG A CG    1 
ATOM   48   C CD    . ARG A 1 5   ? 11.811 -40.674 17.029  1.00 93.90  ? 5   ARG A CD    1 
ATOM   49   N NE    . ARG A 1 5   ? 10.938 -41.489 16.186  1.00 93.80  ? 5   ARG A NE    1 
ATOM   50   C CZ    . ARG A 1 5   ? 10.510 -42.710 16.498  1.00 93.76  ? 5   ARG A CZ    1 
ATOM   51   N NH1   . ARG A 1 5   ? 10.873 -43.281 17.641  1.00 93.72  ? 5   ARG A NH1   1 
ATOM   52   N NH2   . ARG A 1 5   ? 9.720  -43.367 15.661  1.00 93.79  ? 5   ARG A NH2   1 
ATOM   53   N N     . LEU A 1 6   ? 10.459 -35.791 14.157  1.00 93.76  ? 6   LEU A N     1 
ATOM   54   C CA    . LEU A 1 6   ? 9.392  -34.888 13.722  1.00 93.56  ? 6   LEU A CA    1 
ATOM   55   C C     . LEU A 1 6   ? 8.561  -35.523 12.611  1.00 93.41  ? 6   LEU A C     1 
ATOM   56   O O     . LEU A 1 6   ? 9.110  -36.061 11.651  1.00 93.36  ? 6   LEU A O     1 
ATOM   57   C CB    . LEU A 1 6   ? 9.974  -33.555 13.237  1.00 93.56  ? 6   LEU A CB    1 
ATOM   58   C CG    . LEU A 1 6   ? 10.583 -32.592 14.262  1.00 93.59  ? 6   LEU A CG    1 
ATOM   59   C CD1   . LEU A 1 6   ? 11.489 -31.584 13.572  1.00 93.63  ? 6   LEU A CD1   1 
ATOM   60   C CD2   . LEU A 1 6   ? 9.505  -31.882 15.075  1.00 93.59  ? 6   LEU A CD2   1 
ATOM   61   N N     . LYS A 1 7   ? 7.238  -35.449 12.747  1.00 93.20  ? 7   LYS A N     1 
ATOM   62   C CA    . LYS A 1 7   ? 6.318  -36.034 11.769  1.00 92.99  ? 7   LYS A CA    1 
ATOM   63   C C     . LYS A 1 7   ? 6.292  -35.229 10.468  1.00 92.83  ? 7   LYS A C     1 
ATOM   64   O O     . LYS A 1 7   ? 6.291  -33.996 10.491  1.00 92.82  ? 7   LYS A O     1 
ATOM   65   C CB    . LYS A 1 7   ? 4.908  -36.146 12.362  1.00 93.00  ? 7   LYS A CB    1 
ATOM   66   C CG    . LYS A 1 7   ? 3.969  -37.107 11.624  1.00 93.02  ? 7   LYS A CG    1 
ATOM   67   C CD    . LYS A 1 7   ? 4.285  -38.580 11.911  1.00 92.98  ? 7   LYS A CD    1 
ATOM   68   C CE    . LYS A 1 7   ? 3.762  -39.031 13.274  1.00 93.05  ? 7   LYS A CE    1 
ATOM   69   N NZ    . LYS A 1 7   ? 2.273  -39.072 13.332  1.00 92.97  ? 7   LYS A NZ    1 
ATOM   70   N N     . GLY A 1 8   ? 6.277  -35.939 9.341   1.00 92.61  ? 8   GLY A N     1 
ATOM   71   C CA    . GLY A 1 8   ? 6.249  -35.312 8.020   1.00 92.33  ? 8   GLY A CA    1 
ATOM   72   C C     . GLY A 1 8   ? 7.508  -35.563 7.208   1.00 92.13  ? 8   GLY A C     1 
ATOM   73   O O     . GLY A 1 8   ? 8.474  -36.144 7.706   1.00 92.12  ? 8   GLY A O     1 
ATOM   74   N N     . THR A 1 9   ? 7.489  -35.123 5.952   1.00 91.90  ? 9   THR A N     1 
ATOM   75   C CA    . THR A 1 9   ? 8.635  -35.267 5.051   1.00 91.67  ? 9   THR A CA    1 
ATOM   76   C C     . THR A 1 9   ? 9.593  -34.080 5.187   1.00 91.51  ? 9   THR A C     1 
ATOM   77   O O     . THR A 1 9   ? 9.271  -33.090 5.849   1.00 91.53  ? 9   THR A O     1 
ATOM   78   C CB    . THR A 1 9   ? 8.191  -35.417 3.575   1.00 91.69  ? 9   THR A CB    1 
ATOM   79   O OG1   . THR A 1 9   ? 7.395  -34.290 3.189   1.00 91.65  ? 9   THR A OG1   1 
ATOM   80   C CG2   . THR A 1 9   ? 7.385  -36.698 3.376   1.00 91.67  ? 9   THR A CG2   1 
ATOM   81   N N     . LEU A 1 10  ? 10.768 -34.190 4.567   1.00 91.25  ? 10  LEU A N     1 
ATOM   82   C CA    . LEU A 1 10  ? 11.775 -33.124 4.595   1.00 90.99  ? 10  LEU A CA    1 
ATOM   83   C C     . LEU A 1 10  ? 11.295 -31.845 3.909   1.00 90.85  ? 10  LEU A C     1 
ATOM   84   O O     . LEU A 1 10  ? 11.555 -30.742 4.393   1.00 90.82  ? 10  LEU A O     1 
ATOM   85   C CB    . LEU A 1 10  ? 13.089 -33.595 3.958   1.00 90.94  ? 10  LEU A CB    1 
ATOM   86   C CG    . LEU A 1 10  ? 14.021 -34.505 4.763   1.00 90.74  ? 10  LEU A CG    1 
ATOM   87   C CD1   . LEU A 1 10  ? 15.086 -35.098 3.851   1.00 90.56  ? 10  LEU A CD1   1 
ATOM   88   C CD2   . LEU A 1 10  ? 14.668 -33.761 5.928   1.00 90.46  ? 10  LEU A CD2   1 
ATOM   89   N N     . GLU A 1 11  ? 10.598 -31.999 2.788   1.00 90.68  ? 11  GLU A N     1 
ATOM   90   C CA    . GLU A 1 11  ? 10.072 -30.857 2.050   1.00 90.51  ? 11  GLU A CA    1 
ATOM   91   C C     . GLU A 1 11  ? 8.949  -30.171 2.821   1.00 90.37  ? 11  GLU A C     1 
ATOM   92   O O     . GLU A 1 11  ? 8.822  -28.947 2.796   1.00 90.36  ? 11  GLU A O     1 
ATOM   93   C CB    . GLU A 1 11  ? 9.573  -31.293 0.671   1.00 90.52  ? 11  GLU A CB    1 
ATOM   94   C CG    . GLU A 1 11  ? 8.583  -32.446 0.705   1.00 90.53  ? 11  GLU A CG    1 
ATOM   95   C CD    . GLU A 1 11  ? 7.728  -32.516 -0.545  0.00 20.00  ? 11  GLU A CD    1 
ATOM   96   O OE1   . GLU A 1 11  ? 6.922  -33.462 -0.663  1.00 100.00 ? 11  GLU A OE1   1 
ATOM   97   O OE2   . GLU A 1 11  ? 7.862  -31.624 -1.409  1.00 100.00 ? 11  GLU A OE2   1 
ATOM   98   N N     . ALA A 1 12  ? 8.136  -30.969 3.506   1.00 90.18  ? 12  ALA A N     1 
ATOM   99   C CA    . ALA A 1 12  ? 6.995  -30.447 4.258   1.00 90.01  ? 12  ALA A CA    1 
ATOM   100  C C     . ALA A 1 12  ? 7.443  -29.616 5.460   1.00 89.87  ? 12  ALA A C     1 
ATOM   101  O O     . ALA A 1 12  ? 6.764  -28.663 5.851   1.00 89.83  ? 12  ALA A O     1 
ATOM   102  C CB    . ALA A 1 12  ? 6.085  -31.584 4.705   1.00 90.01  ? 12  ALA A CB    1 
ATOM   103  N N     . LEU A 1 13  ? 8.587  -29.984 6.034   1.00 89.63  ? 13  LEU A N     1 
ATOM   104  C CA    . LEU A 1 13  ? 9.146  -29.281 7.189   1.00 89.42  ? 13  LEU A CA    1 
ATOM   105  C C     . LEU A 1 13  ? 10.263 -28.317 6.783   1.00 89.30  ? 13  LEU A C     1 
ATOM   106  O O     . LEU A 1 13  ? 11.074 -27.912 7.616   1.00 89.26  ? 13  LEU A O     1 
ATOM   107  C CB    . LEU A 1 13  ? 9.654  -30.285 8.235   1.00 89.40  ? 13  LEU A CB    1 
ATOM   108  C CG    . LEU A 1 13  ? 8.656  -31.253 8.883   1.00 89.32  ? 13  LEU A CG    1 
ATOM   109  C CD1   . LEU A 1 13  ? 9.390  -32.359 9.624   1.00 89.21  ? 13  LEU A CD1   1 
ATOM   110  C CD2   . LEU A 1 13  ? 7.691  -30.533 9.821   1.00 89.38  ? 13  LEU A CD2   1 
ATOM   111  N N     . ASP A 1 14  ? 10.274 -27.938 5.505   1.00 89.16  ? 14  ASP A N     1 
ATOM   112  C CA    . ASP A 1 14  ? 11.329 -27.098 4.919   1.00 89.06  ? 14  ASP A CA    1 
ATOM   113  C C     . ASP A 1 14  ? 11.630 -25.772 5.649   1.00 88.96  ? 14  ASP A C     1 
ATOM   114  O O     . ASP A 1 14  ? 12.801 -25.479 5.904   1.00 88.95  ? 14  ASP A O     1 
ATOM   115  C CB    . ASP A 1 14  ? 11.057 -26.847 3.427   1.00 89.07  ? 14  ASP A CB    1 
ATOM   116  C CG    . ASP A 1 14  ? 12.213 -26.151 2.724   1.00 89.11  ? 14  ASP A CG    1 
ATOM   117  O OD1   . ASP A 1 14  ? 13.363 -26.633 2.832   1.00 89.19  ? 14  ASP A OD1   1 
ATOM   118  O OD2   . ASP A 1 14  ? 11.969 -25.126 2.053   1.00 89.05  ? 14  ASP A OD2   1 
ATOM   119  N N     . PRO A 1 15  ? 10.591 -24.968 5.980   1.00 88.85  ? 15  PRO A N     1 
ATOM   120  C CA    . PRO A 1 15  ? 10.861 -23.665 6.606   1.00 88.74  ? 15  PRO A CA    1 
ATOM   121  C C     . PRO A 1 15  ? 11.497 -23.739 7.999   1.00 88.62  ? 15  PRO A C     1 
ATOM   122  O O     . PRO A 1 15  ? 12.221 -22.820 8.388   1.00 88.59  ? 15  PRO A O     1 
ATOM   123  C CB    . PRO A 1 15  ? 9.469  -23.021 6.701   1.00 88.76  ? 15  PRO A CB    1 
ATOM   124  C CG    . PRO A 1 15  ? 8.615  -23.785 5.749   1.00 88.81  ? 15  PRO A CG    1 
ATOM   125  C CD    . PRO A 1 15  ? 9.143  -25.177 5.797   1.00 88.84  ? 15  PRO A CD    1 
ATOM   126  N N     . ILE A 1 16  ? 11.230 -24.818 8.733   1.00 88.49  ? 16  ILE A N     1 
ATOM   127  C CA    . ILE A 1 16  ? 11.737 -24.971 10.102  1.00 88.36  ? 16  ILE A CA    1 
ATOM   128  C C     . ILE A 1 16  ? 13.065 -25.739 10.193  1.00 88.28  ? 16  ILE A C     1 
ATOM   129  O O     . ILE A 1 16  ? 13.599 -25.933 11.289  1.00 88.27  ? 16  ILE A O     1 
ATOM   130  C CB    . ILE A 1 16  ? 10.681 -25.612 11.054  1.00 88.37  ? 16  ILE A CB    1 
ATOM   131  C CG1   . ILE A 1 16  ? 10.312 -27.031 10.602  1.00 88.39  ? 16  ILE A CG1   1 
ATOM   132  C CG2   . ILE A 1 16  ? 9.446  -24.714 11.173  1.00 88.37  ? 16  ILE A CG2   1 
ATOM   133  C CD1   . ILE A 1 16  ? 9.807  -27.934 11.716  1.00 88.37  ? 16  ILE A CD1   1 
ATOM   134  N N     . LEU A 1 17  ? 13.591 -26.160 9.043   1.00 88.12  ? 17  LEU A N     1 
ATOM   135  C CA    . LEU A 1 17  ? 14.833 -26.945 8.984   1.00 87.96  ? 17  LEU A CA    1 
ATOM   136  C C     . LEU A 1 17  ? 16.113 -26.190 9.384   1.00 87.84  ? 17  LEU A C     1 
ATOM   137  O O     . LEU A 1 17  ? 16.943 -26.754 10.101  1.00 87.84  ? 17  LEU A O     1 
ATOM   138  C CB    . LEU A 1 17  ? 15.014 -27.611 7.610   1.00 87.97  ? 17  LEU A CB    1 
ATOM   139  C CG    . LEU A 1 17  ? 14.022 -28.686 7.148   1.00 87.94  ? 17  LEU A CG    1 
ATOM   140  C CD1   . LEU A 1 17  ? 14.416 -29.211 5.777   1.00 87.99  ? 17  LEU A CD1   1 
ATOM   141  C CD2   . LEU A 1 17  ? 13.892 -29.836 8.146   1.00 87.86  ? 17  LEU A CD2   1 
ATOM   142  N N     . PRO A 1 18  ? 16.289 -24.929 8.920   1.00 87.70  ? 18  PRO A N     1 
ATOM   143  C CA    . PRO A 1 18  ? 17.484 -24.174 9.329   1.00 87.59  ? 18  PRO A CA    1 
ATOM   144  C C     . PRO A 1 18  ? 17.591 -23.968 10.842  1.00 87.46  ? 18  PRO A C     1 
ATOM   145  O O     . PRO A 1 18  ? 18.698 -23.816 11.364  1.00 87.45  ? 18  PRO A O     1 
ATOM   146  C CB    . PRO A 1 18  ? 17.306 -22.822 8.627   1.00 87.59  ? 18  PRO A CB    1 
ATOM   147  C CG    . PRO A 1 18  ? 16.401 -23.101 7.490   1.00 87.63  ? 18  PRO A CG    1 
ATOM   148  C CD    . PRO A 1 18  ? 15.452 -24.138 7.998   1.00 87.69  ? 18  PRO A CD    1 
ATOM   149  N N     . GLY A 1 19  ? 16.449 -23.966 11.527  1.00 87.33  ? 19  GLY A N     1 
ATOM   150  C CA    . GLY A 1 19  ? 16.404 -23.846 12.983  1.00 87.13  ? 19  GLY A CA    1 
ATOM   151  C C     . GLY A 1 19  ? 16.896 -25.088 13.707  1.00 87.00  ? 19  GLY A C     1 
ATOM   152  O O     . GLY A 1 19  ? 17.387 -25.001 14.834  1.00 86.97  ? 19  GLY A O     1 
ATOM   153  N N     . LEU A 1 20  ? 16.754 -26.244 13.059  1.00 86.88  ? 20  LEU A N     1 
ATOM   154  C CA    . LEU A 1 20  ? 17.268 -27.508 13.588  1.00 86.74  ? 20  LEU A CA    1 
ATOM   155  C C     . LEU A 1 20  ? 18.795 -27.547 13.540  1.00 86.61  ? 20  LEU A C     1 
ATOM   156  O O     . LEU A 1 20  ? 19.436 -28.074 14.452  1.00 86.59  ? 20  LEU A O     1 
ATOM   157  C CB    . LEU A 1 20  ? 16.683 -28.703 12.824  1.00 86.75  ? 20  LEU A CB    1 
ATOM   158  C CG    . LEU A 1 20  ? 15.199 -29.040 13.011  1.00 86.82  ? 20  LEU A CG    1 
ATOM   159  C CD1   . LEU A 1 20  ? 14.722 -29.973 11.906  1.00 86.78  ? 20  LEU A CD1   1 
ATOM   160  C CD2   . LEU A 1 20  ? 14.925 -29.647 14.386  1.00 86.78  ? 20  LEU A CD2   1 
ATOM   161  N N     . PHE A 1 21  ? 19.366 -26.986 12.475  1.00 86.42  ? 21  PHE A N     1 
ATOM   162  C CA    . PHE A 1 21  ? 20.818 -26.858 12.342  1.00 86.23  ? 21  PHE A CA    1 
ATOM   163  C C     . PHE A 1 21  ? 21.372 -25.691 13.163  1.00 86.06  ? 21  PHE A C     1 
ATOM   164  O O     . PHE A 1 21  ? 22.572 -25.639 13.445  1.00 86.07  ? 21  PHE A O     1 
ATOM   165  C CB    . PHE A 1 21  ? 21.227 -26.732 10.872  1.00 86.24  ? 21  PHE A CB    1 
ATOM   166  C CG    . PHE A 1 21  ? 21.260 -28.044 10.138  1.00 86.30  ? 21  PHE A CG    1 
ATOM   167  C CD1   . PHE A 1 21  ? 20.199 -28.429 9.325   1.00 86.33  ? 21  PHE A CD1   1 
ATOM   168  C CD2   . PHE A 1 21  ? 22.353 -28.899 10.263  1.00 86.31  ? 21  PHE A CD2   1 
ATOM   169  C CE1   . PHE A 1 21  ? 20.226 -29.644 8.644   1.00 86.23  ? 21  PHE A CE1   1 
ATOM   170  C CE2   . PHE A 1 21  ? 22.389 -30.116 9.587   1.00 86.29  ? 21  PHE A CE2   1 
ATOM   171  C CZ    . PHE A 1 21  ? 21.323 -30.489 8.776   1.00 86.25  ? 21  PHE A CZ    1 
ATOM   172  N N     . ASP A 1 22  ? 20.495 -24.759 13.537  1.00 85.81  ? 22  ASP A N     1 
ATOM   173  C CA    . ASP A 1 22  ? 20.842 -23.692 14.476  1.00 85.56  ? 22  ASP A CA    1 
ATOM   174  C C     . ASP A 1 22  ? 21.011 -24.254 15.886  1.00 85.37  ? 22  ASP A C     1 
ATOM   175  O O     . ASP A 1 22  ? 21.830 -23.761 16.664  1.00 85.36  ? 22  ASP A O     1 
ATOM   176  C CB    . ASP A 1 22  ? 19.778 -22.589 14.471  1.00 85.57  ? 22  ASP A CB    1 
ATOM   177  C CG    . ASP A 1 22  ? 19.982 -21.572 13.355  1.00 85.52  ? 22  ASP A CG    1 
ATOM   178  O OD1   . ASP A 1 22  ? 20.884 -21.761 12.510  1.00 85.39  ? 22  ASP A OD1   1 
ATOM   179  O OD2   . ASP A 1 22  ? 19.233 -20.572 13.327  1.00 85.54  ? 22  ASP A OD2   1 
ATOM   180  N N     . GLY A 1 23  ? 20.228 -25.286 16.201  1.00 85.15  ? 23  GLY A N     1 
ATOM   181  C CA    . GLY A 1 23  ? 20.319 -25.984 17.482  1.00 84.88  ? 23  GLY A CA    1 
ATOM   182  C C     . GLY A 1 23  ? 21.606 -26.776 17.630  1.00 84.67  ? 23  GLY A C     1 
ATOM   183  O O     . GLY A 1 23  ? 22.139 -26.904 18.735  1.00 84.67  ? 23  GLY A O     1 
ATOM   184  N N     . GLY A 1 24  ? 22.101 -27.308 16.514  1.00 84.46  ? 24  GLY A N     1 
ATOM   185  C CA    . GLY A 1 24  ? 23.365 -28.040 16.490  1.00 84.16  ? 24  GLY A CA    1 
ATOM   186  C C     . GLY A 1 24  ? 23.254 -29.459 15.964  1.00 83.96  ? 24  GLY A C     1 
ATOM   187  O O     . GLY A 1 24  ? 24.026 -30.334 16.365  1.00 83.96  ? 24  GLY A O     1 
ATOM   188  N N     . ALA A 1 25  ? 22.296 -29.686 15.066  1.00 83.72  ? 25  ALA A N     1 
ATOM   189  C CA    . ALA A 1 25  ? 22.091 -31.000 14.455  1.00 83.48  ? 25  ALA A CA    1 
ATOM   190  C C     . ALA A 1 25  ? 23.225 -31.341 13.494  1.00 83.31  ? 25  ALA A C     1 
ATOM   191  O O     . ALA A 1 25  ? 23.800 -30.453 12.860  1.00 83.30  ? 25  ALA A O     1 
ATOM   192  C CB    . ALA A 1 25  ? 20.753 -31.054 13.736  1.00 83.46  ? 25  ALA A CB    1 
ATOM   193  N N     . ARG A 1 26  ? 23.541 -32.630 13.393  1.00 83.09  ? 26  ARG A N     1 
ATOM   194  C CA    . ARG A 1 26  ? 24.628 -33.089 12.527  1.00 82.88  ? 26  ARG A CA    1 
ATOM   195  C C     . ARG A 1 26  ? 24.143 -33.714 11.218  1.00 82.69  ? 26  ARG A C     1 
ATOM   196  O O     . ARG A 1 26  ? 24.927 -33.892 10.285  1.00 82.70  ? 26  ARG A O     1 
ATOM   197  C CB    . ARG A 1 26  ? 25.567 -34.045 13.279  1.00 82.90  ? 26  ARG A CB    1 
ATOM   198  C CG    . ARG A 1 26  ? 26.411 -33.392 14.381  1.00 82.95  ? 26  ARG A CG    1 
ATOM   199  C CD    . ARG A 1 26  ? 26.800 -31.957 14.031  1.00 83.11  ? 26  ARG A CD    1 
ATOM   200  N NE    . ARG A 1 26  ? 28.050 -31.535 14.657  1.00 83.21  ? 26  ARG A NE    1 
ATOM   201  C CZ    . ARG A 1 26  ? 29.197 -31.363 14.004  1.00 83.26  ? 26  ARG A CZ    1 
ATOM   202  N NH1   . ARG A 1 26  ? 29.266 -31.573 12.694  1.00 83.25  ? 26  ARG A NH1   1 
ATOM   203  N NH2   . ARG A 1 26  ? 30.281 -30.973 14.663  1.00 83.17  ? 26  ARG A NH2   1 
ATOM   204  N N     . GLY A 1 27  ? 22.853 -34.039 11.154  1.00 82.47  ? 27  GLY A N     1 
ATOM   205  C CA    . GLY A 1 27  ? 22.268 -34.618 9.948   1.00 82.14  ? 27  GLY A CA    1 
ATOM   206  C C     . GLY A 1 27  ? 20.786 -34.917 10.055  1.00 81.88  ? 27  GLY A C     1 
ATOM   207  O O     . GLY A 1 27  ? 20.291 -35.294 11.120  1.00 81.89  ? 27  GLY A O     1 
ATOM   208  N N     . LEU A 1 28  ? 20.081 -34.743 8.939   1.00 81.61  ? 28  LEU A N     1 
ATOM   209  C CA    . LEU A 1 28  ? 18.658 -35.064 8.852   1.00 81.31  ? 28  LEU A CA    1 
ATOM   210  C C     . LEU A 1 28  ? 18.449 -36.341 8.046   1.00 81.12  ? 28  LEU A C     1 
ATOM   211  O O     . LEU A 1 28  ? 19.258 -36.675 7.177   1.00 81.09  ? 28  LEU A O     1 
ATOM   212  C CB    . LEU A 1 28  ? 17.874 -33.909 8.221   1.00 81.30  ? 28  LEU A CB    1 
ATOM   213  C CG    . LEU A 1 28  ? 17.848 -32.547 8.923   1.00 81.21  ? 28  LEU A CG    1 
ATOM   214  C CD1   . LEU A 1 28  ? 17.188 -31.522 8.023   1.00 81.11  ? 28  LEU A CD1   1 
ATOM   215  C CD2   . LEU A 1 28  ? 17.135 -32.613 10.268  1.00 81.25  ? 28  LEU A CD2   1 
ATOM   216  N N     . TRP A 1 29  ? 17.358 -37.045 8.340   1.00 80.82  ? 29  TRP A N     1 
ATOM   217  C CA    . TRP A 1 29  ? 17.063 -38.332 7.718   1.00 80.56  ? 29  TRP A CA    1 
ATOM   218  C C     . TRP A 1 29  ? 15.553 -38.548 7.605   1.00 80.70  ? 29  TRP A C     1 
ATOM   219  O O     . TRP A 1 29  ? 14.856 -38.677 8.614   1.00 80.62  ? 29  TRP A O     1 
ATOM   220  C CB    . TRP A 1 29  ? 17.735 -39.463 8.514   1.00 80.21  ? 29  TRP A CB    1 
ATOM   221  C CG    . TRP A 1 29  ? 17.509 -40.871 8.004   1.00 79.77  ? 29  TRP A CG    1 
ATOM   222  C CD1   . TRP A 1 29  ? 17.093 -41.247 6.755   1.00 79.36  ? 29  TRP A CD1   1 
ATOM   223  C CD2   . TRP A 1 29  ? 17.728 -42.086 8.733   1.00 79.34  ? 29  TRP A CD2   1 
ATOM   224  N NE1   . TRP A 1 29  ? 17.018 -42.616 6.672   1.00 79.11  ? 29  TRP A NE1   1 
ATOM   225  C CE2   . TRP A 1 29  ? 17.405 -43.157 7.870   1.00 79.20  ? 29  TRP A CE2   1 
ATOM   226  C CE3   . TRP A 1 29  ? 18.159 -42.374 10.036  1.00 79.41  ? 29  TRP A CE3   1 
ATOM   227  C CZ2   . TRP A 1 29  ? 17.498 -44.495 8.267   1.00 79.51  ? 29  TRP A CZ2   1 
ATOM   228  C CZ3   . TRP A 1 29  ? 18.252 -43.706 10.431  1.00 79.42  ? 29  TRP A CZ3   1 
ATOM   229  C CH2   . TRP A 1 29  ? 17.924 -44.748 9.547   1.00 79.54  ? 29  TRP A CH2   1 
ATOM   230  N N     . GLU A 1 30  ? 15.062 -38.569 6.368   1.00 80.86  ? 30  GLU A N     1 
ATOM   231  C CA    . GLU A 1 30  ? 13.654 -38.836 6.085   1.00 81.02  ? 30  GLU A CA    1 
ATOM   232  C C     . GLU A 1 30  ? 13.394 -40.338 6.135   1.00 81.20  ? 30  GLU A C     1 
ATOM   233  O O     . GLU A 1 30  ? 14.088 -41.119 5.480   1.00 81.18  ? 30  GLU A O     1 
ATOM   234  C CB    . GLU A 1 30  ? 13.261 -38.267 4.717   1.00 81.01  ? 30  GLU A CB    1 
ATOM   235  C CG    . GLU A 1 30  ? 11.778 -38.386 4.378   1.00 80.93  ? 30  GLU A CG    1 
ATOM   236  C CD    . GLU A 1 30  ? 11.425 -37.743 3.048   1.00 80.92  ? 30  GLU A CD    1 
ATOM   237  O OE1   . GLU A 1 30  ? 11.522 -36.502 2.938   1.00 80.77  ? 30  GLU A OE1   1 
ATOM   238  O OE2   . GLU A 1 30  ? 11.041 -38.480 2.115   1.00 80.80  ? 30  GLU A OE2   1 
ATOM   239  N N     . ARG A 1 31  ? 12.394 -40.733 6.920   1.00 81.41  ? 31  ARG A N     1 
ATOM   240  C CA    . ARG A 1 31  ? 12.077 -42.148 7.115   1.00 81.68  ? 31  ARG A CA    1 
ATOM   241  C C     . ARG A 1 31  ? 10.633 -42.470 6.706   1.00 81.94  ? 31  ARG A C     1 
ATOM   242  O O     . ARG A 1 31  ? 10.067 -41.788 5.848   1.00 82.00  ? 31  ARG A O     1 
ATOM   243  C CB    . ARG A 1 31  ? 12.370 -42.573 8.561   1.00 81.62  ? 31  ARG A CB    1 
ATOM   244  C CG    . ARG A 1 31  ? 13.812 -42.313 9.005   1.00 81.44  ? 31  ARG A CG    1 
ATOM   245  C CD    . ARG A 1 31  ? 14.235 -43.222 10.147  1.00 81.10  ? 31  ARG A CD    1 
ATOM   246  N NE    . ARG A 1 31  ? 14.388 -44.611 9.716   1.00 80.85  ? 31  ARG A NE    1 
ATOM   247  C CZ    . ARG A 1 31  ? 14.764 -45.612 10.507  1.00 80.62  ? 31  ARG A CZ    1 
ATOM   248  N NH1   . ARG A 1 31  ? 15.036 -45.396 11.788  1.00 80.50  ? 31  ARG A NH1   1 
ATOM   249  N NH2   . ARG A 1 31  ? 14.872 -46.837 10.011  1.00 80.53  ? 31  ARG A NH2   1 
ATOM   250  N N     . GLU A 1 32  ? 10.053 -43.506 7.318   1.00 82.25  ? 32  GLU A N     1 
ATOM   251  C CA    . GLU A 1 32  ? 8.706  -43.999 6.984   1.00 82.54  ? 32  GLU A CA    1 
ATOM   252  C C     . GLU A 1 32  ? 7.670  -42.891 6.769   1.00 82.76  ? 32  GLU A C     1 
ATOM   253  O O     . GLU A 1 32  ? 6.905  -42.925 5.801   1.00 82.79  ? 32  GLU A O     1 
ATOM   254  C CB    . GLU A 1 32  ? 8.215  -44.978 8.056   1.00 82.53  ? 32  GLU A CB    1 
ATOM   255  C CG    . GLU A 1 32  ? 8.871  -46.225 8.257   0.00 20.00  ? 32  GLU A CG    1 
ATOM   256  C CD    . GLU A 1 32  ? 8.749  -47.079 7.010   0.00 20.00  ? 32  GLU A CD    1 
ATOM   257  O OE1   . GLU A 1 32  ? 8.121  -46.620 6.033   0.00 20.00  ? 32  GLU A OE1   1 
ATOM   258  O OE2   . GLU A 1 32  ? 9.282  -48.209 7.007   0.00 20.00  ? 32  GLU A OE2   1 
ATOM   259  N N     . GLY A 1 33  ? 7.653  -41.920 7.679   1.00 82.99  ? 33  GLY A N     1 
ATOM   260  C CA    . GLY A 1 33  ? 6.793  -40.744 7.566   1.00 83.32  ? 33  GLY A CA    1 
ATOM   261  C C     . GLY A 1 33  ? 7.246  -39.654 8.517   1.00 83.53  ? 33  GLY A C     1 
ATOM   262  O O     . GLY A 1 33  ? 6.443  -38.828 8.961   1.00 83.56  ? 33  GLY A O     1 
ATOM   263  N N     . GLU A 1 34  ? 8.541  -39.660 8.826   1.00 83.73  ? 34  GLU A N     1 
ATOM   264  C CA    . GLU A 1 34  ? 9.128  -38.759 9.814   1.00 83.98  ? 34  GLU A CA    1 
ATOM   265  C C     . GLU A 1 34  ? 10.453 -38.164 9.333   1.00 84.16  ? 34  GLU A C     1 
ATOM   266  O O     . GLU A 1 34  ? 11.005 -38.591 8.316   1.00 84.16  ? 34  GLU A O     1 
ATOM   267  C CB    . GLU A 1 34  ? 9.351  -39.499 11.138  1.00 83.93  ? 34  GLU A CB    1 
ATOM   268  C CG    . GLU A 1 34  ? 8.080  -39.888 11.882  1.00 84.03  ? 34  GLU A CG    1 
ATOM   269  C CD    . GLU A 1 34  ? 8.342  -40.823 13.052  1.00 84.05  ? 34  GLU A CD    1 
ATOM   270  O OE1   . GLU A 1 34  ? 7.513  -41.729 13.281  1.00 84.21  ? 34  GLU A OE1   1 
ATOM   271  O OE2   . GLU A 1 34  ? 9.373  -40.659 13.740  1.00 84.15  ? 34  GLU A OE2   1 
ATOM   272  N N     . VAL A 1 35  ? 10.946 -37.173 10.074  1.00 84.42  ? 35  VAL A N     1 
ATOM   273  C CA    . VAL A 1 35  ? 12.275 -36.599 9.862   1.00 84.71  ? 35  VAL A CA    1 
ATOM   274  C C     . VAL A 1 35  ? 13.089 -36.764 11.147  1.00 84.94  ? 35  VAL A C     1 
ATOM   275  O O     . VAL A 1 35  ? 12.676 -36.311 12.219  1.00 84.93  ? 35  VAL A O     1 
ATOM   276  C CB    . VAL A 1 35  ? 12.203 -35.106 9.431   1.00 84.68  ? 35  VAL A CB    1 
ATOM   277  C CG1   . VAL A 1 35  ? 13.570 -34.432 9.535   1.00 84.66  ? 35  VAL A CG1   1 
ATOM   278  C CG2   . VAL A 1 35  ? 11.661 -34.984 8.013   1.00 84.60  ? 35  VAL A CG2   1 
ATOM   279  N N     . TRP A 1 36  ? 14.238 -37.424 11.028  1.00 85.26  ? 36  TRP A N     1 
ATOM   280  C CA    . TRP A 1 36  ? 15.079 -37.741 12.179  1.00 85.57  ? 36  TRP A CA    1 
ATOM   281  C C     . TRP A 1 36  ? 16.303 -36.829 12.251  1.00 85.85  ? 36  TRP A C     1 
ATOM   282  O O     . TRP A 1 36  ? 17.255 -36.979 11.477  1.00 85.85  ? 36  TRP A O     1 
ATOM   283  C CB    . TRP A 1 36  ? 15.500 -39.216 12.143  1.00 85.54  ? 36  TRP A CB    1 
ATOM   284  C CG    . TRP A 1 36  ? 14.387 -40.191 12.449  1.00 85.52  ? 36  TRP A CG    1 
ATOM   285  C CD1   . TRP A 1 36  ? 13.102 -40.148 11.982  1.00 85.51  ? 36  TRP A CD1   1 
ATOM   286  C CD2   . TRP A 1 36  ? 14.473 -41.366 13.269  1.00 85.47  ? 36  TRP A CD2   1 
ATOM   287  N NE1   . TRP A 1 36  ? 12.382 -41.211 12.470  1.00 85.53  ? 36  TRP A NE1   1 
ATOM   288  C CE2   . TRP A 1 36  ? 13.198 -41.975 13.262  1.00 85.55  ? 36  TRP A CE2   1 
ATOM   289  C CE3   . TRP A 1 36  ? 15.502 -41.960 14.012  1.00 85.42  ? 36  TRP A CE3   1 
ATOM   290  C CZ2   . TRP A 1 36  ? 12.923 -43.152 13.969  1.00 85.47  ? 36  TRP A CZ2   1 
ATOM   291  C CZ3   . TRP A 1 36  ? 15.228 -43.129 14.718  1.00 85.50  ? 36  TRP A CZ3   1 
ATOM   292  C CH2   . TRP A 1 36  ? 13.948 -43.711 14.690  1.00 85.49  ? 36  TRP A CH2   1 
ATOM   293  N N     . ALA A 1 37  ? 16.256 -35.876 13.178  1.00 86.18  ? 37  ALA A N     1 
ATOM   294  C CA    . ALA A 1 37  ? 17.374 -34.972 13.437  1.00 86.53  ? 37  ALA A CA    1 
ATOM   295  C C     . ALA A 1 37  ? 18.285 -35.574 14.501  1.00 86.79  ? 37  ALA A C     1 
ATOM   296  O O     . ALA A 1 37  ? 17.805 -36.126 15.492  1.00 86.80  ? 37  ALA A O     1 
ATOM   297  C CB    . ALA A 1 37  ? 16.863 -33.611 13.880  1.00 86.53  ? 37  ALA A CB    1 
ATOM   298  N N     . PHE A 1 38  ? 19.595 -35.462 14.295  1.00 87.10  ? 38  PHE A N     1 
ATOM   299  C CA    . PHE A 1 38  ? 20.571 -36.071 15.199  1.00 87.42  ? 38  PHE A CA    1 
ATOM   300  C C     . PHE A 1 38  ? 21.461 -35.042 15.893  1.00 87.73  ? 38  PHE A C     1 
ATOM   301  O O     . PHE A 1 38  ? 22.165 -34.268 15.239  1.00 87.74  ? 38  PHE A O     1 
ATOM   302  C CB    . PHE A 1 38  ? 21.410 -37.118 14.459  1.00 87.37  ? 38  PHE A CB    1 
ATOM   303  C CG    . PHE A 1 38  ? 20.636 -38.350 14.072  1.00 87.26  ? 38  PHE A CG    1 
ATOM   304  C CD1   . PHE A 1 38  ? 19.918 -38.395 12.880  1.00 87.03  ? 38  PHE A CD1   1 
ATOM   305  C CD2   . PHE A 1 38  ? 20.623 -39.466 14.903  1.00 87.10  ? 38  PHE A CD2   1 
ATOM   306  C CE1   . PHE A 1 38  ? 19.199 -39.532 12.523  1.00 86.96  ? 38  PHE A CE1   1 
ATOM   307  C CE2   . PHE A 1 38  ? 19.908 -40.609 14.553  1.00 86.99  ? 38  PHE A CE2   1 
ATOM   308  C CZ    . PHE A 1 38  ? 19.195 -40.641 13.360  1.00 87.03  ? 38  PHE A CZ    1 
ATOM   309  N N     . PHE A 1 39  ? 21.415 -35.050 17.223  1.00 88.13  ? 39  PHE A N     1 
ATOM   310  C CA    . PHE A 1 39  ? 22.130 -34.083 18.054  1.00 88.52  ? 39  PHE A CA    1 
ATOM   311  C C     . PHE A 1 39  ? 23.147 -34.775 18.965  1.00 88.85  ? 39  PHE A C     1 
ATOM   312  O O     . PHE A 1 39  ? 22.900 -35.892 19.427  1.00 88.85  ? 39  PHE A O     1 
ATOM   313  C CB    . PHE A 1 39  ? 21.139 -33.292 18.914  1.00 88.49  ? 39  PHE A CB    1 
ATOM   314  C CG    . PHE A 1 39  ? 20.300 -32.309 18.142  1.00 88.46  ? 39  PHE A CG    1 
ATOM   315  C CD1   . PHE A 1 39  ? 19.157 -32.725 17.464  1.00 88.40  ? 39  PHE A CD1   1 
ATOM   316  C CD2   . PHE A 1 39  ? 20.641 -30.961 18.111  1.00 88.46  ? 39  PHE A CD2   1 
ATOM   317  C CE1   . PHE A 1 39  ? 18.374 -31.816 16.756  1.00 88.39  ? 39  PHE A CE1   1 
ATOM   318  C CE2   . PHE A 1 39  ? 19.865 -30.043 17.406  1.00 88.49  ? 39  PHE A CE2   1 
ATOM   319  C CZ    . PHE A 1 39  ? 18.729 -30.472 16.728  1.00 88.46  ? 39  PHE A CZ    1 
ATOM   320  N N     . PRO A 1 40  ? 24.298 -34.119 19.219  1.00 89.20  ? 40  PRO A N     1 
ATOM   321  C CA    . PRO A 1 40  ? 25.251 -34.612 20.219  1.00 89.51  ? 40  PRO A CA    1 
ATOM   322  C C     . PRO A 1 40  ? 24.698 -34.480 21.640  1.00 89.85  ? 40  PRO A C     1 
ATOM   323  O O     . PRO A 1 40  ? 24.946 -35.345 22.483  1.00 89.87  ? 40  PRO A O     1 
ATOM   324  C CB    . PRO A 1 40  ? 26.469 -33.695 20.035  1.00 89.49  ? 40  PRO A CB    1 
ATOM   325  C CG    . PRO A 1 40  ? 26.262 -33.005 18.722  1.00 89.35  ? 40  PRO A CG    1 
ATOM   326  C CD    . PRO A 1 40  ? 24.786 -32.892 18.565  1.00 89.22  ? 40  PRO A CD    1 
ATOM   327  N N     . ALA A 1 41  ? 23.956 -33.401 21.886  1.00 90.25  ? 41  ALA A N     1 
ATOM   328  C CA    . ALA A 1 41  ? 23.316 -33.147 23.174  1.00 90.65  ? 41  ALA A CA    1 
ATOM   329  C C     . ALA A 1 41  ? 21.894 -32.621 22.962  1.00 90.97  ? 41  ALA A C     1 
ATOM   330  O O     . ALA A 1 41  ? 21.659 -31.840 22.035  1.00 90.98  ? 41  ALA A O     1 
ATOM   331  C CB    . ALA A 1 41  ? 24.140 -32.157 23.990  1.00 90.62  ? 41  ALA A CB    1 
ATOM   332  N N     . PRO A 1 42  ? 20.939 -33.046 23.815  1.00 91.32  ? 42  PRO A N     1 
ATOM   333  C CA    . PRO A 1 42  ? 19.555 -32.603 23.645  1.00 91.60  ? 42  PRO A CA    1 
ATOM   334  C C     . PRO A 1 42  ? 19.311 -31.184 24.167  1.00 91.90  ? 42  PRO A C     1 
ATOM   335  O O     . PRO A 1 42  ? 19.608 -30.883 25.326  1.00 91.93  ? 42  PRO A O     1 
ATOM   336  C CB    . PRO A 1 42  ? 18.754 -33.631 24.450  1.00 91.58  ? 42  PRO A CB    1 
ATOM   337  C CG    . PRO A 1 42  ? 19.693 -34.116 25.496  1.00 91.47  ? 42  PRO A CG    1 
ATOM   338  C CD    . PRO A 1 42  ? 21.095 -33.954 24.969  1.00 91.34  ? 42  PRO A CD    1 
ATOM   339  N N     . VAL A 1 43  ? 18.784 -30.326 23.296  1.00 92.25  ? 43  VAL A N     1 
ATOM   340  C CA    . VAL A 1 43  ? 18.418 -28.954 23.659  1.00 92.62  ? 43  VAL A CA    1 
ATOM   341  C C     . VAL A 1 43  ? 16.967 -28.664 23.274  1.00 92.89  ? 43  VAL A C     1 
ATOM   342  O O     . VAL A 1 43  ? 16.509 -29.072 22.204  1.00 92.94  ? 43  VAL A O     1 
ATOM   343  C CB    . VAL A 1 43  ? 19.370 -27.895 23.031  1.00 92.59  ? 43  VAL A CB    1 
ATOM   344  C CG1   . VAL A 1 43  ? 20.687 -27.835 23.795  1.00 92.62  ? 43  VAL A CG1   1 
ATOM   345  C CG2   . VAL A 1 43  ? 19.611 -28.167 21.544  1.00 92.58  ? 43  VAL A CG2   1 
ATOM   346  N N     . ASP A 1 44  ? 16.255 -27.959 24.152  1.00 93.25  ? 44  ASP A N     1 
ATOM   347  C CA    . ASP A 1 44  ? 14.827 -27.687 23.971  1.00 93.59  ? 44  ASP A CA    1 
ATOM   348  C C     . ASP A 1 44  ? 14.530 -26.964 22.658  1.00 93.84  ? 44  ASP A C     1 
ATOM   349  O O     . ASP A 1 44  ? 15.149 -25.946 22.340  1.00 93.85  ? 44  ASP A O     1 
ATOM   350  C CB    . ASP A 1 44  ? 14.273 -26.891 25.160  1.00 93.58  ? 44  ASP A CB    1 
ATOM   351  C CG    . ASP A 1 44  ? 12.751 -26.863 25.193  1.00 93.62  ? 44  ASP A CG    1 
ATOM   352  O OD1   . ASP A 1 44  ? 12.140 -26.169 24.351  1.00 93.66  ? 44  ASP A OD1   1 
ATOM   353  O OD2   . ASP A 1 44  ? 12.166 -27.525 26.075  1.00 93.63  ? 44  ASP A OD2   1 
ATOM   354  N N     . LEU A 1 45  ? 13.582 -27.514 21.904  1.00 94.16  ? 45  LEU A N     1 
ATOM   355  C CA    . LEU A 1 45  ? 13.149 -26.940 20.635  1.00 94.48  ? 45  LEU A CA    1 
ATOM   356  C C     . LEU A 1 45  ? 11.626 -26.797 20.619  1.00 94.72  ? 45  LEU A C     1 
ATOM   357  O O     . LEU A 1 45  ? 10.914 -27.736 20.988  1.00 94.74  ? 45  LEU A O     1 
ATOM   358  C CB    . LEU A 1 45  ? 13.621 -27.807 19.461  1.00 94.46  ? 45  LEU A CB    1 
ATOM   359  C CG    . LEU A 1 45  ? 15.126 -27.929 19.186  1.00 94.46  ? 45  LEU A CG    1 
ATOM   360  C CD1   . LEU A 1 45  ? 15.413 -29.139 18.310  1.00 94.42  ? 45  LEU A CD1   1 
ATOM   361  C CD2   . LEU A 1 45  ? 15.694 -26.659 18.555  1.00 94.45  ? 45  LEU A CD2   1 
ATOM   362  N N     . PRO A 1 46  ? 11.119 -25.623 20.192  1.00 94.98  ? 46  PRO A N     1 
ATOM   363  C CA    . PRO A 1 46  ? 9.679  -25.355 20.220  1.00 95.20  ? 46  PRO A CA    1 
ATOM   364  C C     . PRO A 1 46  ? 8.917  -25.917 19.012  1.00 95.43  ? 46  PRO A C     1 
ATOM   365  O O     . PRO A 1 46  ? 7.779  -25.513 18.758  1.00 95.45  ? 46  PRO A O     1 
ATOM   366  C CB    . PRO A 1 46  ? 9.617  -23.825 20.235  1.00 95.18  ? 46  PRO A CB    1 
ATOM   367  C CG    . PRO A 1 46  ? 10.842 -23.392 19.501  1.00 95.11  ? 46  PRO A CG    1 
ATOM   368  C CD    . PRO A 1 46  ? 11.881 -24.477 19.657  1.00 94.99  ? 46  PRO A CD    1 
ATOM   369  N N     . TYR A 1 47  ? 9.538  -26.850 18.292  1.00 95.70  ? 47  TYR A N     1 
ATOM   370  C CA    . TYR A 1 47  ? 8.939  -27.448 17.097  1.00 95.96  ? 47  TYR A CA    1 
ATOM   371  C C     . TYR A 1 47  ? 7.985  -28.599 17.420  1.00 96.15  ? 47  TYR A C     1 
ATOM   372  O O     . TYR A 1 47  ? 7.226  -29.040 16.552  1.00 96.19  ? 47  TYR A O     1 
ATOM   373  C CB    . TYR A 1 47  ? 10.029 -27.906 16.120  1.00 95.95  ? 47  TYR A CB    1 
ATOM   374  C CG    . TYR A 1 47  ? 10.999 -26.810 15.736  1.00 95.98  ? 47  TYR A CG    1 
ATOM   375  C CD1   . TYR A 1 47  ? 12.286 -26.775 16.268  1.00 96.01  ? 47  TYR A CD1   1 
ATOM   376  C CD2   . TYR A 1 47  ? 10.625 -25.800 14.849  1.00 96.01  ? 47  TYR A CD2   1 
ATOM   377  C CE1   . TYR A 1 47  ? 13.181 -25.766 15.923  1.00 96.05  ? 47  TYR A CE1   1 
ATOM   378  C CE2   . TYR A 1 47  ? 11.510 -24.786 14.500  1.00 96.06  ? 47  TYR A CE2   1 
ATOM   379  C CZ    . TYR A 1 47  ? 12.785 -24.777 15.039  1.00 96.05  ? 47  TYR A CZ    1 
ATOM   380  O OH    . TYR A 1 47  ? 13.661 -23.775 14.694  1.00 96.05  ? 47  TYR A OH    1 
ATOM   381  N N     . GLU A 1 48  ? 8.032  -29.067 18.669  1.00 96.38  ? 48  GLU A N     1 
ATOM   382  C CA    . GLU A 1 48  ? 7.174  -30.149 19.179  1.00 96.60  ? 48  GLU A CA    1 
ATOM   383  C C     . GLU A 1 48  ? 7.425  -31.498 18.501  1.00 96.75  ? 48  GLU A C     1 
ATOM   384  O O     . GLU A 1 48  ? 6.937  -31.761 17.398  1.00 96.80  ? 48  GLU A O     1 
ATOM   385  C CB    . GLU A 1 48  ? 5.684  -29.768 19.121  1.00 96.62  ? 48  GLU A CB    1 
ATOM   386  C CG    . GLU A 1 48  ? 5.271  -28.661 20.090  1.00 96.65  ? 48  GLU A CG    1 
ATOM   387  C CD    . GLU A 1 48  ? 5.119  -29.148 21.523  1.00 96.74  ? 48  GLU A CD    1 
ATOM   388  O OE1   . GLU A 1 48  ? 4.337  -30.095 21.757  1.00 96.79  ? 48  GLU A OE1   1 
ATOM   389  O OE2   . GLU A 1 48  ? 5.775  -28.574 22.417  1.00 96.77  ? 48  GLU A OE2   1 
ATOM   390  N N     . GLY A 1 49  ? 8.197  -32.345 19.179  1.00 96.91  ? 49  GLY A N     1 
ATOM   391  C CA    . GLY A 1 49  ? 8.500  -33.693 18.704  1.00 97.06  ? 49  GLY A CA    1 
ATOM   392  C C     . GLY A 1 49  ? 8.810  -34.627 19.858  1.00 97.18  ? 49  GLY A C     1 
ATOM   393  O O     . GLY A 1 49  ? 8.258  -34.478 20.951  1.00 97.18  ? 49  GLY A O     1 
ATOM   394  N N     . VAL A 1 50  ? 9.695  -35.592 19.613  1.00 97.30  ? 50  VAL A N     1 
ATOM   395  C CA    . VAL A 1 50  ? 10.115 -36.545 20.647  1.00 97.43  ? 50  VAL A CA    1 
ATOM   396  C C     . VAL A 1 50  ? 11.629 -36.779 20.659  1.00 97.54  ? 50  VAL A C     1 
ATOM   397  O O     . VAL A 1 50  ? 12.236 -37.063 19.622  1.00 97.52  ? 50  VAL A O     1 
ATOM   398  C CB    . VAL A 1 50  ? 9.359  -37.906 20.554  1.00 97.40  ? 50  VAL A CB    1 
ATOM   399  C CG1   . VAL A 1 50  ? 8.016  -37.828 21.265  1.00 97.43  ? 50  VAL A CG1   1 
ATOM   400  C CG2   . VAL A 1 50  ? 9.182  -38.351 19.105  1.00 97.40  ? 50  VAL A CG2   1 
ATOM   401  N N     . TRP A 1 51  ? 12.224 -36.645 21.843  1.00 97.68  ? 51  TRP A N     1 
ATOM   402  C CA    . TRP A 1 51  ? 13.652 -36.888 22.044  1.00 97.82  ? 51  TRP A CA    1 
ATOM   403  C C     . TRP A 1 51  ? 13.903 -38.325 22.485  1.00 97.89  ? 51  TRP A C     1 
ATOM   404  O O     . TRP A 1 51  ? 13.117 -38.895 23.247  1.00 97.88  ? 51  TRP A O     1 
ATOM   405  C CB    . TRP A 1 51  ? 14.227 -35.916 23.078  1.00 97.83  ? 51  TRP A CB    1 
ATOM   406  C CG    . TRP A 1 51  ? 14.407 -34.519 22.563  1.00 97.87  ? 51  TRP A CG    1 
ATOM   407  C CD1   . TRP A 1 51  ? 13.543 -33.472 22.711  1.00 97.88  ? 51  TRP A CD1   1 
ATOM   408  C CD2   . TRP A 1 51  ? 15.525 -34.014 21.820  1.00 97.87  ? 51  TRP A CD2   1 
ATOM   409  N NE1   . TRP A 1 51  ? 14.051 -32.347 22.106  1.00 97.88  ? 51  TRP A NE1   1 
ATOM   410  C CE2   . TRP A 1 51  ? 15.267 -32.652 21.552  1.00 97.88  ? 51  TRP A CE2   1 
ATOM   411  C CE3   . TRP A 1 51  ? 16.720 -34.582 21.355  1.00 97.85  ? 51  TRP A CE3   1 
ATOM   412  C CZ2   . TRP A 1 51  ? 16.158 -31.847 20.836  1.00 97.87  ? 51  TRP A CZ2   1 
ATOM   413  C CZ3   . TRP A 1 51  ? 17.607 -33.779 20.645  1.00 97.86  ? 51  TRP A CZ3   1 
ATOM   414  C CH2   . TRP A 1 51  ? 17.320 -32.426 20.395  1.00 97.87  ? 51  TRP A CH2   1 
ATOM   415  N N     . GLU A 1 52  ? 15.004 -38.901 22.008  1.00 97.99  ? 52  GLU A N     1 
ATOM   416  C CA    . GLU A 1 52  ? 15.337 -40.295 22.294  1.00 98.08  ? 52  GLU A CA    1 
ATOM   417  C C     . GLU A 1 52  ? 16.845 -40.492 22.447  1.00 98.14  ? 52  GLU A C     1 
ATOM   418  O O     . GLU A 1 52  ? 17.631 -39.993 21.638  1.00 98.13  ? 52  GLU A O     1 
ATOM   419  C CB    . GLU A 1 52  ? 14.784 -41.201 21.189  1.00 98.07  ? 52  GLU A CB    1 
ATOM   420  C CG    . GLU A 1 52  ? 14.629 -42.666 21.578  1.00 98.10  ? 52  GLU A CG    1 
ATOM   421  C CD    . GLU A 1 52  ? 13.880 -43.475 20.531  1.00 98.10  ? 52  GLU A CD    1 
ATOM   422  O OE1   . GLU A 1 52  ? 14.308 -44.613 20.243  1.00 98.11  ? 52  GLU A OE1   1 
ATOM   423  O OE2   . GLU A 1 52  ? 12.866 -42.978 19.993  1.00 98.07  ? 52  GLU A OE2   1 
ATOM   424  N N     . GLU A 1 53  ? 17.234 -41.220 23.492  1.00 98.21  ? 53  GLU A N     1 
ATOM   425  C CA    . GLU A 1 53  ? 18.642 -41.503 23.767  1.00 98.29  ? 53  GLU A CA    1 
ATOM   426  C C     . GLU A 1 53  ? 19.049 -42.855 23.175  1.00 98.32  ? 53  GLU A C     1 
ATOM   427  O O     . GLU A 1 53  ? 19.153 -43.858 23.888  1.00 98.33  ? 53  GLU A O     1 
ATOM   428  C CB    . GLU A 1 53  ? 18.916 -41.457 25.276  1.00 98.29  ? 53  GLU A CB    1 
ATOM   429  C CG    . GLU A 1 53  ? 20.395 -41.351 25.649  1.00 98.32  ? 53  GLU A CG    1 
ATOM   430  C CD    . GLU A 1 53  ? 20.654 -41.530 27.138  1.00 98.35  ? 53  GLU A CD    1 
ATOM   431  O OE1   . GLU A 1 53  ? 19.789 -41.150 27.958  1.00 98.42  ? 53  GLU A OE1   1 
ATOM   432  O OE2   . GLU A 1 53  ? 21.735 -42.048 27.490  1.00 98.44  ? 53  GLU A OE2   1 
ATOM   433  N N     . VAL A 1 54  ? 19.262 -42.871 21.860  1.00 98.37  ? 54  VAL A N     1 
ATOM   434  C CA    . VAL A 1 54  ? 19.706 -44.070 21.146  1.00 98.38  ? 54  VAL A CA    1 
ATOM   435  C C     . VAL A 1 54  ? 20.881 -43.731 20.231  1.00 98.39  ? 54  VAL A C     1 
ATOM   436  O O     . VAL A 1 54  ? 22.040 -43.799 20.642  1.00 98.40  ? 54  VAL A O     1 
ATOM   437  C CB    . VAL A 1 54  ? 18.560 -44.720 20.321  1.00 98.39  ? 54  VAL A CB    1 
ATOM   438  C CG1   . VAL A 1 54  ? 19.099 -45.815 19.403  1.00 98.34  ? 54  VAL A CG1   1 
ATOM   439  C CG2   . VAL A 1 54  ? 17.483 -45.289 21.241  1.00 98.38  ? 54  VAL A CG2   1 
ATOM   440  N N     . LEU A 1 60  ? 29.959 -49.567 11.615  1.00 63.75  ? 60  LEU A N     1 
ATOM   441  C CA    . LEU A 1 60  ? 31.374 -49.218 11.734  1.00 63.71  ? 60  LEU A CA    1 
ATOM   442  C C     . LEU A 1 60  ? 32.233 -50.372 12.259  1.00 63.63  ? 60  LEU A C     1 
ATOM   443  O O     . LEU A 1 60  ? 33.376 -50.544 11.825  1.00 63.68  ? 60  LEU A O     1 
ATOM   444  C CB    . LEU A 1 60  ? 31.564 -47.952 12.588  1.00 63.78  ? 60  LEU A CB    1 
ATOM   445  C CG    . LEU A 1 60  ? 30.786 -47.758 13.897  1.00 63.90  ? 60  LEU A CG    1 
ATOM   446  C CD1   . LEU A 1 60  ? 31.539 -48.319 15.095  1.00 63.94  ? 60  LEU A CD1   1 
ATOM   447  C CD2   . LEU A 1 60  ? 30.492 -46.280 14.112  1.00 64.01  ? 60  LEU A CD2   1 
ATOM   448  N N     . GLU A 1 61  ? 31.678 -51.157 13.182  1.00 63.42  ? 61  GLU A N     1 
ATOM   449  C CA    . GLU A 1 61  ? 32.387 -52.307 13.752  1.00 63.20  ? 61  GLU A CA    1 
ATOM   450  C C     . GLU A 1 61  ? 32.316 -53.550 12.864  1.00 62.85  ? 61  GLU A C     1 
ATOM   451  O O     . GLU A 1 61  ? 33.144 -54.455 12.990  1.00 62.86  ? 61  GLU A O     1 
ATOM   452  C CB    . GLU A 1 61  ? 31.888 -52.621 15.168  1.00 63.35  ? 61  GLU A CB    1 
ATOM   453  C CG    . GLU A 1 61  ? 32.484 -51.725 16.255  1.00 63.76  ? 61  GLU A CG    1 
ATOM   454  C CD    . GLU A 1 61  ? 34.005 -51.794 16.321  1.00 64.56  ? 61  GLU A CD    1 
ATOM   455  O OE1   . GLU A 1 61  ? 34.652 -50.729 16.218  1.00 64.96  ? 61  GLU A OE1   1 
ATOM   456  O OE2   . GLU A 1 61  ? 34.555 -52.908 16.467  1.00 64.71  ? 61  GLU A OE2   1 
ATOM   457  N N     . ALA A 1 62  ? 31.323 -53.589 11.976  1.00 62.37  ? 62  ALA A N     1 
ATOM   458  C CA    . ALA A 1 62  ? 31.248 -54.621 10.942  1.00 61.85  ? 62  ALA A CA    1 
ATOM   459  C C     . ALA A 1 62  ? 32.344 -54.390 9.902   1.00 61.44  ? 62  ALA A C     1 
ATOM   460  O O     . ALA A 1 62  ? 32.938 -55.342 9.394   1.00 61.38  ? 62  ALA A O     1 
ATOM   461  C CB    . ALA A 1 62  ? 29.874 -54.626 10.287  1.00 61.90  ? 62  ALA A CB    1 
ATOM   462  N N     . TRP A 1 63  ? 32.601 -53.116 9.603   1.00 60.91  ? 63  TRP A N     1 
ATOM   463  C CA    . TRP A 1 63  ? 33.685 -52.695 8.714   1.00 60.35  ? 63  TRP A CA    1 
ATOM   464  C C     . TRP A 1 63  ? 35.051 -52.979 9.344   1.00 59.72  ? 63  TRP A C     1 
ATOM   465  O O     . TRP A 1 63  ? 35.966 -53.467 8.673   1.00 59.63  ? 63  TRP A O     1 
ATOM   466  C CB    . TRP A 1 63  ? 33.536 -51.199 8.391   1.00 60.66  ? 63  TRP A CB    1 
ATOM   467  C CG    . TRP A 1 63  ? 34.716 -50.565 7.688   1.00 61.03  ? 63  TRP A CG    1 
ATOM   468  C CD1   . TRP A 1 63  ? 34.964 -50.558 6.343   1.00 61.35  ? 63  TRP A CD1   1 
ATOM   469  C CD2   . TRP A 1 63  ? 35.790 -49.830 8.296   1.00 61.20  ? 63  TRP A CD2   1 
ATOM   470  N NE1   . TRP A 1 63  ? 36.129 -49.875 6.078   1.00 61.43  ? 63  TRP A NE1   1 
ATOM   471  C CE2   . TRP A 1 63  ? 36.655 -49.417 7.257   1.00 61.35  ? 63  TRP A CE2   1 
ATOM   472  C CE3   . TRP A 1 63  ? 36.107 -49.486 9.618   1.00 61.32  ? 63  TRP A CE3   1 
ATOM   473  C CZ2   . TRP A 1 63  ? 37.819 -48.678 7.499   1.00 61.28  ? 63  TRP A CZ2   1 
ATOM   474  C CZ3   . TRP A 1 63  ? 37.263 -48.749 9.858   1.00 61.23  ? 63  TRP A CZ3   1 
ATOM   475  C CH2   . TRP A 1 63  ? 38.105 -48.355 8.801   1.00 61.31  ? 63  TRP A CH2   1 
ATOM   476  N N     . ARG A 1 64  ? 35.169 -52.686 10.637  1.00 58.83  ? 64  ARG A N     1 
ATOM   477  C CA    . ARG A 1 64  ? 36.431 -52.803 11.363  1.00 57.98  ? 64  ARG A CA    1 
ATOM   478  C C     . ARG A 1 64  ? 36.864 -54.252 11.617  1.00 57.20  ? 64  ARG A C     1 
ATOM   479  O O     . ARG A 1 64  ? 38.056 -54.560 11.576  1.00 57.20  ? 64  ARG A O     1 
ATOM   480  C CB    . ARG A 1 64  ? 36.361 -52.011 12.675  1.00 58.11  ? 64  ARG A CB    1 
ATOM   481  C CG    . ARG A 1 64  ? 37.633 -52.046 13.507  1.00 58.69  ? 64  ARG A CG    1 
ATOM   482  C CD    . ARG A 1 64  ? 37.779 -50.809 14.373  1.00 59.67  ? 64  ARG A CD    1 
ATOM   483  N NE    . ARG A 1 64  ? 38.857 -50.970 15.346  1.00 60.75  ? 64  ARG A NE    1 
ATOM   484  C CZ    . ARG A 1 64  ? 39.573 -49.973 15.859  1.00 61.29  ? 64  ARG A CZ    1 
ATOM   485  N NH1   . ARG A 1 64  ? 39.344 -48.717 15.490  1.00 61.64  ? 64  ARG A NH1   1 
ATOM   486  N NH2   . ARG A 1 64  ? 40.531 -50.234 16.739  1.00 61.37  ? 64  ARG A NH2   1 
ATOM   487  N N     . ARG A 1 65  ? 35.904 -55.137 11.878  1.00 56.14  ? 65  ARG A N     1 
ATOM   488  C CA    . ARG A 1 65  ? 36.233 -56.536 12.170  1.00 55.08  ? 65  ARG A CA    1 
ATOM   489  C C     . ARG A 1 65  ? 36.310 -57.421 10.923  1.00 54.03  ? 65  ARG A C     1 
ATOM   490  O O     . ARG A 1 65  ? 36.917 -58.495 10.957  1.00 53.99  ? 65  ARG A O     1 
ATOM   491  C CB    . ARG A 1 65  ? 35.298 -57.123 13.240  1.00 55.33  ? 65  ARG A CB    1 
ATOM   492  C CG    . ARG A 1 65  ? 35.549 -56.568 14.650  1.00 56.03  ? 65  ARG A CG    1 
ATOM   493  C CD    . ARG A 1 65  ? 37.006 -56.766 15.088  1.00 57.25  ? 65  ARG A CD    1 
ATOM   494  N NE    . ARG A 1 65  ? 37.475 -55.701 15.978  1.00 58.15  ? 65  ARG A NE    1 
ATOM   495  C CZ    . ARG A 1 65  ? 38.757 -55.421 16.216  1.00 58.29  ? 65  ARG A CZ    1 
ATOM   496  N NH1   . ARG A 1 65  ? 39.721 -56.119 15.628  1.00 58.38  ? 65  ARG A NH1   1 
ATOM   497  N NH2   . ARG A 1 65  ? 39.077 -54.432 17.041  1.00 58.32  ? 65  ARG A NH2   1 
ATOM   498  N N     . ASP A 1 66  ? 35.706 -56.961 9.829   1.00 52.60  ? 66  ASP A N     1 
ATOM   499  C CA    . ASP A 1 66  ? 35.886 -57.594 8.522   1.00 51.27  ? 66  ASP A CA    1 
ATOM   500  C C     . ASP A 1 66  ? 37.077 -56.984 7.773   1.00 50.02  ? 66  ASP A C     1 
ATOM   501  O O     . ASP A 1 66  ? 37.378 -57.385 6.643   1.00 49.99  ? 66  ASP A O     1 
ATOM   502  C CB    . ASP A 1 66  ? 34.612 -57.474 7.673   1.00 51.49  ? 66  ASP A CB    1 
ATOM   503  C CG    . ASP A 1 66  ? 33.537 -58.480 8.067   1.00 52.05  ? 66  ASP A CG    1 
ATOM   504  O OD1   . ASP A 1 66  ? 33.746 -59.258 9.026   1.00 52.79  ? 66  ASP A OD1   1 
ATOM   505  O OD2   . ASP A 1 66  ? 32.474 -58.494 7.407   1.00 52.76  ? 66  ASP A OD2   1 
ATOM   506  N N     . LEU A 1 67  ? 37.747 -56.024 8.411   1.00 48.33  ? 67  LEU A N     1 
ATOM   507  C CA    . LEU A 1 67  ? 38.849 -55.282 7.797   1.00 46.71  ? 67  LEU A CA    1 
ATOM   508  C C     . LEU A 1 67  ? 40.022 -56.202 7.468   1.00 45.47  ? 67  LEU A C     1 
ATOM   509  O O     . LEU A 1 67  ? 40.582 -56.850 8.355   1.00 45.24  ? 67  LEU A O     1 
ATOM   510  C CB    . LEU A 1 67  ? 39.320 -54.157 8.726   1.00 46.79  ? 67  LEU A CB    1 
ATOM   511  C CG    . LEU A 1 67  ? 39.353 -52.690 8.275   1.00 46.72  ? 67  LEU A CG    1 
ATOM   512  C CD1   . LEU A 1 67  ? 40.547 -51.988 8.905   1.00 46.36  ? 67  LEU A CD1   1 
ATOM   513  C CD2   . LEU A 1 67  ? 39.383 -52.522 6.764   1.00 46.73  ? 67  LEU A CD2   1 
ATOM   514  N N     . LYS A 1 68  ? 40.374 -56.260 6.186   1.00 43.98  ? 68  LYS A N     1 
ATOM   515  C CA    . LYS A 1 68  ? 41.497 -57.066 5.707   1.00 42.60  ? 68  LYS A CA    1 
ATOM   516  C C     . LYS A 1 68  ? 42.675 -56.167 5.311   1.00 41.47  ? 68  LYS A C     1 
ATOM   517  O O     . LYS A 1 68  ? 42.490 -54.964 5.128   1.00 41.27  ? 68  LYS A O     1 
ATOM   518  C CB    . LYS A 1 68  ? 41.063 -57.922 4.512   1.00 42.75  ? 68  LYS A CB    1 
ATOM   519  C CG    . LYS A 1 68  ? 40.259 -59.167 4.878   1.00 43.01  ? 68  LYS A CG    1 
ATOM   520  C CD    . LYS A 1 68  ? 40.317 -60.211 3.765   1.00 43.88  ? 68  LYS A CD    1 
ATOM   521  C CE    . LYS A 1 68  ? 39.315 -59.931 2.650   1.00 44.26  ? 68  LYS A CE    1 
ATOM   522  N NZ    . LYS A 1 68  ? 37.928 -60.343 3.021   1.00 44.41  ? 68  LYS A NZ    1 
ATOM   523  N N     . PRO A 1 69  ? 43.893 -56.741 5.192   1.00 40.29  ? 69  PRO A N     1 
ATOM   524  C CA    . PRO A 1 69  ? 45.019 -55.961 4.666   1.00 39.33  ? 69  PRO A CA    1 
ATOM   525  C C     . PRO A 1 69  ? 44.721 -55.395 3.278   1.00 38.33  ? 69  PRO A C     1 
ATOM   526  O O     . PRO A 1 69  ? 44.121 -56.081 2.448   1.00 38.32  ? 69  PRO A O     1 
ATOM   527  C CB    . PRO A 1 69  ? 46.147 -56.992 4.577   1.00 39.38  ? 69  PRO A CB    1 
ATOM   528  C CG    . PRO A 1 69  ? 45.798 -58.021 5.593   1.00 39.81  ? 69  PRO A CG    1 
ATOM   529  C CD    . PRO A 1 69  ? 44.304 -58.111 5.561   1.00 40.16  ? 69  PRO A CD    1 
ATOM   530  N N     . ALA A 1 70  ? 45.129 -54.151 3.041   1.00 37.03  ? 70  ALA A N     1 
ATOM   531  C CA    . ALA A 1 70  ? 44.911 -53.495 1.753   1.00 35.86  ? 70  ALA A CA    1 
ATOM   532  C C     . ALA A 1 70  ? 46.217 -53.378 0.973   1.00 34.96  ? 70  ALA A C     1 
ATOM   533  O O     . ALA A 1 70  ? 47.180 -52.776 1.452   1.00 34.66  ? 70  ALA A O     1 
ATOM   534  C CB    . ALA A 1 70  ? 44.283 -52.119 1.953   1.00 35.80  ? 70  ALA A CB    1 
ATOM   535  N N     . LEU A 1 71  ? 46.241 -53.960 -0.225  1.00 33.93  ? 71  LEU A N     1 
ATOM   536  C CA    . LEU A 1 71  ? 47.421 -53.904 -1.084  1.00 32.89  ? 71  LEU A CA    1 
ATOM   537  C C     . LEU A 1 71  ? 47.492 -52.604 -1.870  1.00 32.11  ? 71  LEU A C     1 
ATOM   538  O O     . LEU A 1 71  ? 46.514 -52.179 -2.488  1.00 31.95  ? 71  LEU A O     1 
ATOM   539  C CB    . LEU A 1 71  ? 47.476 -55.100 -2.043  1.00 33.13  ? 71  LEU A CB    1 
ATOM   540  C CG    . LEU A 1 71  ? 48.029 -56.433 -1.530  1.00 33.13  ? 71  LEU A CG    1 
ATOM   541  C CD1   . LEU A 1 71  ? 47.703 -57.548 -2.516  1.00 33.62  ? 71  LEU A CD1   1 
ATOM   542  C CD2   . LEU A 1 71  ? 49.529 -56.360 -1.290  1.00 33.26  ? 71  LEU A CD2   1 
ATOM   543  N N     . ALA A 1 72  ? 48.662 -51.972 -1.810  1.00 30.98  ? 72  ALA A N     1 
ATOM   544  C CA    . ALA A 1 72  ? 48.981 -50.814 -2.628  1.00 29.86  ? 72  ALA A CA    1 
ATOM   545  C C     . ALA A 1 72  ? 50.462 -50.910 -2.986  1.00 29.17  ? 72  ALA A C     1 
ATOM   546  O O     . ALA A 1 72  ? 51.278 -50.153 -2.451  1.00 28.78  ? 72  ALA A O     1 
ATOM   547  C CB    . ALA A 1 72  ? 48.678 -49.519 -1.874  1.00 29.78  ? 72  ALA A CB    1 
ATOM   548  N N     . PRO A 1 73  ? 50.815 -51.855 -3.887  1.00 28.59  ? 73  PRO A N     1 
ATOM   549  C CA    . PRO A 1 73  ? 52.213 -52.174 -4.196  1.00 28.09  ? 73  PRO A CA    1 
ATOM   550  C C     . PRO A 1 73  ? 53.057 -50.912 -4.382  1.00 27.60  ? 73  PRO A C     1 
ATOM   551  O O     . PRO A 1 73  ? 52.620 -49.993 -5.074  1.00 27.24  ? 73  PRO A O     1 
ATOM   552  C CB    . PRO A 1 73  ? 52.110 -52.958 -5.506  1.00 27.93  ? 73  PRO A CB    1 
ATOM   553  C CG    . PRO A 1 73  ? 50.787 -53.635 -5.412  1.00 28.43  ? 73  PRO A CG    1 
ATOM   554  C CD    . PRO A 1 73  ? 49.883 -52.667 -4.697  1.00 28.47  ? 73  PRO A CD    1 
ATOM   555  N N     . PRO A 1 74  ? 54.261 -50.867 -3.774  1.00 27.35  ? 74  PRO A N     1 
ATOM   556  C CA    . PRO A 1 74  ? 54.963 -51.946 -3.068  1.00 27.12  ? 74  PRO A CA    1 
ATOM   557  C C     . PRO A 1 74  ? 54.555 -52.129 -1.598  1.00 26.97  ? 74  PRO A C     1 
ATOM   558  O O     . PRO A 1 74  ? 55.218 -52.874 -0.871  1.00 26.74  ? 74  PRO A O     1 
ATOM   559  C CB    . PRO A 1 74  ? 56.422 -51.491 -3.143  1.00 27.04  ? 74  PRO A CB    1 
ATOM   560  C CG    . PRO A 1 74  ? 56.321 -49.996 -3.044  1.00 27.29  ? 74  PRO A CG    1 
ATOM   561  C CD    . PRO A 1 74  ? 55.046 -49.617 -3.761  1.00 27.26  ? 74  PRO A CD    1 
ATOM   562  N N     . PHE A 1 75  ? 53.483 -51.457 -1.174  1.00 26.85  ? 75  PHE A N     1 
ATOM   563  C CA    . PHE A 1 75  ? 53.028 -51.497 0.220   1.00 26.97  ? 75  PHE A CA    1 
ATOM   564  C C     . PHE A 1 75  ? 51.872 -52.465 0.468   1.00 27.19  ? 75  PHE A C     1 
ATOM   565  O O     . PHE A 1 75  ? 51.129 -52.829 -0.445  1.00 26.97  ? 75  PHE A O     1 
ATOM   566  C CB    . PHE A 1 75  ? 52.568 -50.110 0.693   1.00 26.90  ? 75  PHE A CB    1 
ATOM   567  C CG    . PHE A 1 75  ? 53.601 -49.029 0.542   1.00 26.91  ? 75  PHE A CG    1 
ATOM   568  C CD1   . PHE A 1 75  ? 53.527 -48.127 -0.512  1.00 26.37  ? 75  PHE A CD1   1 
ATOM   569  C CD2   . PHE A 1 75  ? 54.636 -48.902 1.464   1.00 26.39  ? 75  PHE A CD2   1 
ATOM   570  C CE1   . PHE A 1 75  ? 54.479 -47.114 -0.656  1.00 26.22  ? 75  PHE A CE1   1 
ATOM   571  C CE2   . PHE A 1 75  ? 55.589 -47.894 1.333   1.00 26.32  ? 75  PHE A CE2   1 
ATOM   572  C CZ    . PHE A 1 75  ? 55.510 -47.000 0.270   1.00 26.33  ? 75  PHE A CZ    1 
ATOM   573  N N     . VAL A 1 76  ? 51.739 -52.867 1.727   1.00 27.51  ? 76  VAL A N     1 
ATOM   574  C CA    . VAL A 1 76  ? 50.510 -53.459 2.240   1.00 27.91  ? 76  VAL A CA    1 
ATOM   575  C C     . VAL A 1 76  ? 50.106 -52.670 3.489   1.00 28.16  ? 76  VAL A C     1 
ATOM   576  O O     . VAL A 1 76  ? 50.923 -52.455 4.390   1.00 28.18  ? 76  VAL A O     1 
ATOM   577  C CB    . VAL A 1 76  ? 50.646 -54.993 2.508   1.00 27.91  ? 76  VAL A CB    1 
ATOM   578  C CG1   . VAL A 1 76  ? 51.712 -55.301 3.571   1.00 27.50  ? 76  VAL A CG1   1 
ATOM   579  C CG2   . VAL A 1 76  ? 49.295 -55.603 2.886   1.00 27.87  ? 76  VAL A CG2   1 
ATOM   580  N N     . VAL A 1 77  ? 48.864 -52.196 3.513   1.00 28.38  ? 77  VAL A N     1 
ATOM   581  C CA    . VAL A 1 77  ? 48.360 -51.436 4.653   1.00 28.75  ? 77  VAL A CA    1 
ATOM   582  C C     . VAL A 1 77  ? 47.719 -52.390 5.648   1.00 28.98  ? 77  VAL A C     1 
ATOM   583  O O     . VAL A 1 77  ? 46.775 -53.111 5.314   1.00 28.97  ? 77  VAL A O     1 
ATOM   584  C CB    . VAL A 1 77  ? 47.358 -50.336 4.238   1.00 28.97  ? 77  VAL A CB    1 
ATOM   585  C CG1   . VAL A 1 77  ? 47.014 -49.462 5.432   1.00 29.17  ? 77  VAL A CG1   1 
ATOM   586  C CG2   . VAL A 1 77  ? 47.934 -49.475 3.111   1.00 28.95  ? 77  VAL A CG2   1 
ATOM   587  N N     . LEU A 1 78  ? 48.249 -52.390 6.866   1.00 29.07  ? 78  LEU A N     1 
ATOM   588  C CA    . LEU A 1 78  ? 47.840 -53.336 7.891   1.00 29.14  ? 78  LEU A CA    1 
ATOM   589  C C     . LEU A 1 78  ? 47.305 -52.612 9.112   1.00 29.45  ? 78  LEU A C     1 
ATOM   590  O O     . LEU A 1 78  ? 47.823 -51.562 9.502   1.00 29.35  ? 78  LEU A O     1 
ATOM   591  C CB    . LEU A 1 78  ? 49.027 -54.208 8.322   1.00 29.15  ? 78  LEU A CB    1 
ATOM   592  C CG    . LEU A 1 78  ? 49.858 -54.978 7.290   1.00 29.01  ? 78  LEU A CG    1 
ATOM   593  C CD1   . LEU A 1 78  ? 51.165 -55.447 7.919   1.00 29.01  ? 78  LEU A CD1   1 
ATOM   594  C CD2   . LEU A 1 78  ? 49.086 -56.157 6.703   1.00 28.95  ? 78  LEU A CD2   1 
ATOM   595  N N     . ALA A 1 79  ? 46.264 -53.181 9.711   1.00 29.43  ? 79  ALA A N     1 
ATOM   596  C CA    . ALA A 1 79  ? 45.839 -52.782 11.044  1.00 29.77  ? 79  ALA A CA    1 
ATOM   597  C C     . ALA A 1 79  ? 46.818 -53.398 12.049  1.00 29.95  ? 79  ALA A C     1 
ATOM   598  O O     . ALA A 1 79  ? 47.468 -54.399 11.737  1.00 29.98  ? 79  ALA A O     1 
ATOM   599  C CB    . ALA A 1 79  ? 44.419 -53.257 11.307  1.00 29.82  ? 79  ALA A CB    1 
ATOM   600  N N     . PRO A 1 80  ? 46.948 -52.796 13.250  1.00 30.25  ? 80  PRO A N     1 
ATOM   601  C CA    . PRO A 1 80  ? 47.852 -53.336 14.271  1.00 30.55  ? 80  PRO A CA    1 
ATOM   602  C C     . PRO A 1 80  ? 47.619 -54.812 14.616  1.00 30.84  ? 80  PRO A C     1 
ATOM   603  O O     . PRO A 1 80  ? 48.532 -55.471 15.113  1.00 31.01  ? 80  PRO A O     1 
ATOM   604  C CB    . PRO A 1 80  ? 47.561 -52.452 15.489  1.00 30.60  ? 80  PRO A CB    1 
ATOM   605  C CG    . PRO A 1 80  ? 47.131 -51.162 14.895  1.00 30.36  ? 80  PRO A CG    1 
ATOM   606  C CD    . PRO A 1 80  ? 46.292 -51.560 13.717  1.00 30.25  ? 80  PRO A CD    1 
ATOM   607  N N     . TRP A 1 81  ? 46.418 -55.322 14.346  1.00 31.12  ? 81  TRP A N     1 
ATOM   608  C CA    . TRP A 1 81  ? 46.089 -56.719 14.638  1.00 31.46  ? 81  TRP A CA    1 
ATOM   609  C C     . TRP A 1 81  ? 46.314 -57.674 13.457  1.00 31.75  ? 81  TRP A C     1 
ATOM   610  O O     . TRP A 1 81  ? 46.033 -58.872 13.565  1.00 31.87  ? 81  TRP A O     1 
ATOM   611  C CB    . TRP A 1 81  ? 44.662 -56.845 15.189  1.00 31.30  ? 81  TRP A CB    1 
ATOM   612  C CG    . TRP A 1 81  ? 43.584 -56.353 14.274  1.00 31.18  ? 81  TRP A CG    1 
ATOM   613  C CD1   . TRP A 1 81  ? 42.925 -57.075 13.324  1.00 31.08  ? 81  TRP A CD1   1 
ATOM   614  C CD2   . TRP A 1 81  ? 43.024 -55.035 14.237  1.00 30.94  ? 81  TRP A CD2   1 
ATOM   615  N NE1   . TRP A 1 81  ? 41.993 -56.288 12.690  1.00 31.00  ? 81  TRP A NE1   1 
ATOM   616  C CE2   . TRP A 1 81  ? 42.032 -55.031 13.232  1.00 30.91  ? 81  TRP A CE2   1 
ATOM   617  C CE3   . TRP A 1 81  ? 43.266 -53.855 14.954  1.00 31.07  ? 81  TRP A CE3   1 
ATOM   618  C CZ2   . TRP A 1 81  ? 41.280 -53.892 12.923  1.00 31.12  ? 81  TRP A CZ2   1 
ATOM   619  C CZ3   . TRP A 1 81  ? 42.518 -52.721 14.646  1.00 30.98  ? 81  TRP A CZ3   1 
ATOM   620  C CH2   . TRP A 1 81  ? 41.537 -52.750 13.640  1.00 31.16  ? 81  TRP A CH2   1 
ATOM   621  N N     . HIS A 1 82  ? 46.824 -57.142 12.345  1.00 32.08  ? 82  HIS A N     1 
ATOM   622  C CA    . HIS A 1 82  ? 47.189 -57.952 11.180  1.00 32.42  ? 82  HIS A CA    1 
ATOM   623  C C     . HIS A 1 82  ? 48.665 -58.347 11.177  1.00 32.88  ? 82  HIS A C     1 
ATOM   624  O O     . HIS A 1 82  ? 49.496 -57.719 11.842  1.00 32.88  ? 82  HIS A O     1 
ATOM   625  C CB    . HIS A 1 82  ? 46.898 -57.203 9.873   1.00 32.29  ? 82  HIS A CB    1 
ATOM   626  C CG    . HIS A 1 82  ? 45.443 -56.993 9.588   1.00 32.20  ? 82  HIS A CG    1 
ATOM   627  N ND1   . HIS A 1 82  ? 44.960 -55.833 9.022   1.00 32.13  ? 82  HIS A ND1   1 
ATOM   628  C CD2   . HIS A 1 82  ? 44.367 -57.794 9.779   1.00 32.12  ? 82  HIS A CD2   1 
ATOM   629  C CE1   . HIS A 1 82  ? 43.650 -55.926 8.879   1.00 32.24  ? 82  HIS A CE1   1 
ATOM   630  N NE2   . HIS A 1 82  ? 43.265 -57.106 9.331   1.00 32.39  ? 82  HIS A NE2   1 
ATOM   631  N N     . THR A 1 83  ? 48.972 -59.404 10.427  1.00 33.38  ? 83  THR A N     1 
ATOM   632  C CA    . THR A 1 83  ? 50.335 -59.695 9.987   1.00 34.05  ? 83  THR A CA    1 
ATOM   633  C C     . THR A 1 83  ? 50.347 -59.904 8.476   1.00 34.16  ? 83  THR A C     1 
ATOM   634  O O     . THR A 1 83  ? 49.293 -59.921 7.834   1.00 34.03  ? 83  THR A O     1 
ATOM   635  C CB    . THR A 1 83  ? 50.953 -60.931 10.681  1.00 34.08  ? 83  THR A CB    1 
ATOM   636  O OG1   . THR A 1 83  ? 49.934 -61.898 10.966  1.00 34.92  ? 83  THR A OG1   1 
ATOM   637  C CG2   . THR A 1 83  ? 51.651 -60.528 11.963  1.00 34.62  ? 83  THR A CG2   1 
ATOM   638  N N     . TRP A 1 84  ? 51.545 -60.055 7.919   1.00 34.50  ? 84  TRP A N     1 
ATOM   639  C CA    . TRP A 1 84  ? 51.729 -60.253 6.487   1.00 34.74  ? 84  TRP A CA    1 
ATOM   640  C C     . TRP A 1 84  ? 52.974 -61.100 6.260   1.00 34.91  ? 84  TRP A C     1 
ATOM   641  O O     . TRP A 1 84  ? 53.984 -60.925 6.945   1.00 34.97  ? 84  TRP A O     1 
ATOM   642  C CB    . TRP A 1 84  ? 51.858 -58.898 5.785   1.00 34.77  ? 84  TRP A CB    1 
ATOM   643  C CG    . TRP A 1 84  ? 51.677 -58.944 4.291   1.00 34.76  ? 84  TRP A CG    1 
ATOM   644  C CD1   . TRP A 1 84  ? 52.647 -58.784 3.345   1.00 34.64  ? 84  TRP A CD1   1 
ATOM   645  C CD2   . TRP A 1 84  ? 50.450 -59.150 3.575   1.00 34.80  ? 84  TRP A CD2   1 
ATOM   646  N NE1   . TRP A 1 84  ? 52.105 -58.879 2.086   1.00 34.48  ? 84  TRP A NE1   1 
ATOM   647  C CE2   . TRP A 1 84  ? 50.759 -59.105 2.197   1.00 34.67  ? 84  TRP A CE2   1 
ATOM   648  C CE3   . TRP A 1 84  ? 49.121 -59.370 3.964   1.00 34.99  ? 84  TRP A CE3   1 
ATOM   649  C CZ2   . TRP A 1 84  ? 49.788 -59.272 1.204   1.00 34.72  ? 84  TRP A CZ2   1 
ATOM   650  C CZ3   . TRP A 1 84  ? 48.155 -59.539 2.974   1.00 34.87  ? 84  TRP A CZ3   1 
ATOM   651  C CH2   . TRP A 1 84  ? 48.496 -59.488 1.610   1.00 34.95  ? 84  TRP A CH2   1 
ATOM   652  N N     . GLU A 1 85  ? 52.888 -62.030 5.312   1.00 35.14  ? 85  GLU A N     1 
ATOM   653  C CA    . GLU A 1 85  ? 54.006 -62.924 4.999   1.00 35.36  ? 85  GLU A CA    1 
ATOM   654  C C     . GLU A 1 85  ? 54.687 -62.578 3.674   1.00 35.20  ? 85  GLU A C     1 
ATOM   655  O O     . GLU A 1 85  ? 55.796 -63.045 3.399   1.00 35.47  ? 85  GLU A O     1 
ATOM   656  C CB    . GLU A 1 85  ? 53.550 -64.389 5.005   1.00 35.42  ? 85  GLU A CB    1 
ATOM   657  C CG    . GLU A 1 85  ? 53.190 -64.910 6.390   1.00 35.69  ? 85  GLU A CG    1 
ATOM   658  C CD    . GLU A 1 85  ? 52.842 -66.393 6.419   1.00 35.86  ? 85  GLU A CD    1 
ATOM   659  O OE1   . GLU A 1 85  ? 52.455 -66.960 5.371   1.00 36.62  ? 85  GLU A OE1   1 
ATOM   660  O OE2   . GLU A 1 85  ? 52.950 -66.992 7.509   1.00 36.39  ? 85  GLU A OE2   1 
ATOM   661  N N     . GLY A 1 86  ? 54.025 -61.750 2.868   1.00 34.89  ? 86  GLY A N     1 
ATOM   662  C CA    . GLY A 1 86  ? 54.544 -61.343 1.561   1.00 34.34  ? 86  GLY A CA    1 
ATOM   663  C C     . GLY A 1 86  ? 55.764 -60.438 1.618   1.00 33.85  ? 86  GLY A C     1 
ATOM   664  O O     . GLY A 1 86  ? 56.277 -60.130 2.697   1.00 33.84  ? 86  GLY A O     1 
ATOM   665  N N     . ALA A 1 87  ? 56.224 -60.012 0.444   1.00 33.34  ? 87  ALA A N     1 
ATOM   666  C CA    . ALA A 1 87  ? 57.427 -59.188 0.321   1.00 32.75  ? 87  ALA A CA    1 
ATOM   667  C C     . ALA A 1 87  ? 57.136 -57.688 0.393   1.00 32.34  ? 87  ALA A C     1 
ATOM   668  O O     . ALA A 1 87  ? 58.060 -56.876 0.447   1.00 32.24  ? 87  ALA A O     1 
ATOM   669  C CB    . ALA A 1 87  ? 58.165 -59.526 -0.972  1.00 32.81  ? 87  ALA A CB    1 
ATOM   670  N N     . GLU A 1 88  ? 55.852 -57.329 0.399   1.00 31.82  ? 88  GLU A N     1 
ATOM   671  C CA    . GLU A 1 88  ? 55.420 -55.930 0.452   1.00 31.36  ? 88  GLU A CA    1 
ATOM   672  C C     . GLU A 1 88  ? 55.924 -55.203 1.696   1.00 31.06  ? 88  GLU A C     1 
ATOM   673  O O     . GLU A 1 88  ? 56.106 -55.816 2.749   1.00 30.74  ? 88  GLU A O     1 
ATOM   674  C CB    . GLU A 1 88  ? 53.891 -55.836 0.392   1.00 31.38  ? 88  GLU A CB    1 
ATOM   675  C CG    . GLU A 1 88  ? 53.288 -56.141 -0.978  1.00 31.23  ? 88  GLU A CG    1 
ATOM   676  C CD    . GLU A 1 88  ? 53.178 -57.632 -1.279  1.00 31.31  ? 88  GLU A CD    1 
ATOM   677  O OE1   . GLU A 1 88  ? 53.352 -58.460 -0.361  1.00 31.01  ? 88  GLU A OE1   1 
ATOM   678  O OE2   . GLU A 1 88  ? 52.911 -57.978 -2.446  1.00 32.14  ? 88  GLU A OE2   1 
ATOM   679  N N     . ILE A 1 89  ? 56.150 -53.896 1.560   1.00 30.67  ? 89  ILE A N     1 
ATOM   680  C CA    . ILE A 1 89  ? 56.523 -53.044 2.689   1.00 30.43  ? 89  ILE A CA    1 
ATOM   681  C C     . ILE A 1 89  ? 55.300 -52.822 3.578   1.00 30.29  ? 89  ILE A C     1 
ATOM   682  O O     . ILE A 1 89  ? 54.311 -52.245 3.130   1.00 30.24  ? 89  ILE A O     1 
ATOM   683  C CB    . ILE A 1 89  ? 57.072 -51.668 2.229   1.00 30.19  ? 89  ILE A CB    1 
ATOM   684  C CG1   . ILE A 1 89  ? 58.275 -51.845 1.295   1.00 30.33  ? 89  ILE A CG1   1 
ATOM   685  C CG2   . ILE A 1 89  ? 57.437 -50.802 3.441   1.00 30.19  ? 89  ILE A CG2   1 
ATOM   686  C CD1   . ILE A 1 89  ? 58.584 -50.615 0.457   1.00 29.24  ? 89  ILE A CD1   1 
ATOM   687  N N     . PRO A 1 90  ? 55.361 -53.287 4.840   1.00 30.49  ? 90  PRO A N     1 
ATOM   688  C CA    . PRO A 1 90  ? 54.215 -53.110 5.730   1.00 30.64  ? 90  PRO A CA    1 
ATOM   689  C C     . PRO A 1 90  ? 54.019 -51.663 6.188   1.00 30.85  ? 90  PRO A C     1 
ATOM   690  O O     . PRO A 1 90  ? 54.979 -50.981 6.566   1.00 30.75  ? 90  PRO A O     1 
ATOM   691  C CB    . PRO A 1 90  ? 54.544 -54.022 6.918   1.00 30.63  ? 90  PRO A CB    1 
ATOM   692  C CG    . PRO A 1 90  ? 56.023 -54.121 6.927   1.00 30.76  ? 90  PRO A CG    1 
ATOM   693  C CD    . PRO A 1 90  ? 56.465 -54.017 5.494   1.00 30.44  ? 90  PRO A CD    1 
ATOM   694  N N     . LEU A 1 91  ? 52.772 -51.211 6.122   1.00 31.09  ? 91  LEU A N     1 
ATOM   695  C CA    . LEU A 1 91  ? 52.361 -49.917 6.648   1.00 31.74  ? 91  LEU A CA    1 
ATOM   696  C C     . LEU A 1 91  ? 51.299 -50.157 7.712   1.00 31.88  ? 91  LEU A C     1 
ATOM   697  O O     . LEU A 1 91  ? 50.142 -50.444 7.395   1.00 31.79  ? 91  LEU A O     1 
ATOM   698  C CB    . LEU A 1 91  ? 51.795 -49.038 5.528   1.00 31.71  ? 91  LEU A CB    1 
ATOM   699  C CG    . LEU A 1 91  ? 52.555 -47.833 4.964   1.00 32.78  ? 91  LEU A CG    1 
ATOM   700  C CD1   . LEU A 1 91  ? 54.070 -48.039 4.851   1.00 33.17  ? 91  LEU A CD1   1 
ATOM   701  C CD2   . LEU A 1 91  ? 51.952 -47.455 3.618   1.00 31.77  ? 91  LEU A CD2   1 
ATOM   702  N N     . VAL A 1 92  ? 51.702 -50.059 8.973   1.00 32.25  ? 92  VAL A N     1 
ATOM   703  C CA    . VAL A 1 92  ? 50.794 -50.310 10.087  1.00 32.68  ? 92  VAL A CA    1 
ATOM   704  C C     . VAL A 1 92  ? 50.056 -49.023 10.448  1.00 33.08  ? 92  VAL A C     1 
ATOM   705  O O     . VAL A 1 92  ? 50.668 -48.048 10.888  1.00 32.90  ? 92  VAL A O     1 
ATOM   706  C CB    . VAL A 1 92  ? 51.530 -50.889 11.322  1.00 32.56  ? 92  VAL A CB    1 
ATOM   707  C CG1   . VAL A 1 92  ? 50.539 -51.187 12.453  1.00 32.82  ? 92  VAL A CG1   1 
ATOM   708  C CG2   . VAL A 1 92  ? 52.302 -52.149 10.945  1.00 32.49  ? 92  VAL A CG2   1 
ATOM   709  N N     . ILE A 1 93  ? 48.743 -49.028 10.233  1.00 33.70  ? 93  ILE A N     1 
ATOM   710  C CA    . ILE A 1 93  ? 47.900 -47.873 10.531  1.00 34.44  ? 93  ILE A CA    1 
ATOM   711  C C     . ILE A 1 93  ? 46.756 -48.295 11.448  1.00 35.25  ? 93  ILE A C     1 
ATOM   712  O O     . ILE A 1 93  ? 45.973 -49.183 11.103  1.00 35.14  ? 93  ILE A O     1 
ATOM   713  C CB    . ILE A 1 93  ? 47.326 -47.215 9.234   1.00 34.29  ? 93  ILE A CB    1 
ATOM   714  C CG1   . ILE A 1 93  ? 48.448 -46.741 8.293   1.00 33.99  ? 93  ILE A CG1   1 
ATOM   715  C CG2   . ILE A 1 93  ? 46.347 -46.072 9.570   1.00 34.07  ? 93  ILE A CG2   1 
ATOM   716  C CD1   . ILE A 1 93  ? 49.329 -45.610 8.835   1.00 34.17  ? 93  ILE A CD1   1 
ATOM   717  N N     . GLU A 1 94  ? 46.678 -47.663 12.617  1.00 36.36  ? 94  GLU A N     1 
ATOM   718  C CA    . GLU A 1 94  ? 45.555 -47.855 13.527  1.00 37.64  ? 94  GLU A CA    1 
ATOM   719  C C     . GLU A 1 94  ? 44.321 -47.174 12.942  1.00 38.45  ? 94  GLU A C     1 
ATOM   720  O O     . GLU A 1 94  ? 44.304 -45.951 12.798  1.00 38.34  ? 94  GLU A O     1 
ATOM   721  C CB    . GLU A 1 94  ? 45.885 -47.298 14.919  1.00 37.60  ? 94  GLU A CB    1 
ATOM   722  C CG    . GLU A 1 94  ? 44.700 -47.185 15.888  1.00 38.30  ? 94  GLU A CG    1 
ATOM   723  C CD    . GLU A 1 94  ? 44.039 -48.520 16.198  1.00 39.18  ? 94  GLU A CD    1 
ATOM   724  O OE1   . GLU A 1 94  ? 44.753 -49.487 16.542  1.00 39.57  ? 94  GLU A OE1   1 
ATOM   725  O OE2   . GLU A 1 94  ? 42.797 -48.599 16.101  1.00 39.72  ? 94  GLU A OE2   1 
ATOM   726  N N     . PRO A 1 95  ? 43.291 -47.965 12.585  1.00 39.47  ? 95  PRO A N     1 
ATOM   727  C CA    . PRO A 1 95  ? 42.089 -47.376 12.006  1.00 40.42  ? 95  PRO A CA    1 
ATOM   728  C C     . PRO A 1 95  ? 41.379 -46.497 13.026  1.00 41.46  ? 95  PRO A C     1 
ATOM   729  O O     . PRO A 1 95  ? 41.177 -46.908 14.171  1.00 41.59  ? 95  PRO A O     1 
ATOM   730  C CB    . PRO A 1 95  ? 41.225 -48.597 11.658  1.00 40.42  ? 95  PRO A CB    1 
ATOM   731  C CG    . PRO A 1 95  ? 42.159 -49.757 11.664  1.00 39.98  ? 95  PRO A CG    1 
ATOM   732  C CD    . PRO A 1 95  ? 43.175 -49.428 12.701  1.00 39.53  ? 95  PRO A CD    1 
ATOM   733  N N     . GLY A 1 96  ? 41.032 -45.285 12.612  1.00 42.59  ? 96  GLY A N     1 
ATOM   734  C CA    . GLY A 1 96  ? 40.330 -44.354 13.478  1.00 44.11  ? 96  GLY A CA    1 
ATOM   735  C C     . GLY A 1 96  ? 39.351 -43.494 12.711  1.00 45.15  ? 96  GLY A C     1 
ATOM   736  O O     . GLY A 1 96  ? 38.866 -43.879 11.640  1.00 45.30  ? 96  GLY A O     1 
ATOM   737  N N     . MET A 1 97  ? 39.060 -42.324 13.272  1.00 46.01  ? 97  MET A N     1 
ATOM   738  C CA    . MET A 1 97  ? 38.160 -41.360 12.651  1.00 46.81  ? 97  MET A CA    1 
ATOM   739  C C     . MET A 1 97  ? 38.935 -40.469 11.678  1.00 47.00  ? 97  MET A C     1 
ATOM   740  O O     . MET A 1 97  ? 38.345 -39.821 10.807  1.00 47.20  ? 97  MET A O     1 
ATOM   741  C CB    . MET A 1 97  ? 37.461 -40.513 13.719  1.00 47.01  ? 97  MET A CB    1 
ATOM   742  C CG    . MET A 1 97  ? 37.120 -41.260 15.022  1.00 48.17  ? 97  MET A CG    1 
ATOM   743  S SD    . MET A 1 97  ? 36.346 -42.887 14.820  1.00 50.51  ? 97  MET A SD    1 
ATOM   744  C CE    . MET A 1 97  ? 34.735 -42.436 14.169  1.00 49.86  ? 97  MET A CE    1 
ATOM   745  N N     . ALA A 1 98  ? 40.258 -40.449 11.835  1.00 47.21  ? 98  ALA A N     1 
ATOM   746  C CA    . ALA A 1 98  ? 41.147 -39.681 10.968  1.00 47.18  ? 98  ALA A CA    1 
ATOM   747  C C     . ALA A 1 98  ? 41.362 -40.400 9.641   1.00 47.13  ? 98  ALA A C     1 
ATOM   748  O O     . ALA A 1 98  ? 41.708 -41.586 9.617   1.00 47.36  ? 98  ALA A O     1 
ATOM   749  C CB    . ALA A 1 98  ? 42.479 -39.437 11.663  1.00 47.26  ? 98  ALA A CB    1 
ATOM   750  N N     . PHE A 1 99  ? 41.155 -39.675 8.542   1.00 46.96  ? 99  PHE A N     1 
ATOM   751  C CA    . PHE A 1 99  ? 41.325 -40.227 7.199   1.00 46.69  ? 99  PHE A CA    1 
ATOM   752  C C     . PHE A 1 99  ? 42.767 -40.673 6.978   1.00 46.34  ? 99  PHE A C     1 
ATOM   753  O O     . PHE A 1 99  ? 43.713 -40.020 7.436   1.00 46.42  ? 99  PHE A O     1 
ATOM   754  C CB    . PHE A 1 99  ? 40.917 -39.205 6.134   1.00 46.77  ? 99  PHE A CB    1 
ATOM   755  C CG    . PHE A 1 99  ? 40.611 -39.812 4.781   1.00 47.10  ? 99  PHE A CG    1 
ATOM   756  C CD1   . PHE A 1 99  ? 41.629 -40.059 3.857   1.00 46.77  ? 99  PHE A CD1   1 
ATOM   757  C CD2   . PHE A 1 99  ? 39.301 -40.122 4.426   1.00 46.96  ? 99  PHE A CD2   1 
ATOM   758  C CE1   . PHE A 1 99  ? 41.347 -40.610 2.609   1.00 46.51  ? 99  PHE A CE1   1 
ATOM   759  C CE2   . PHE A 1 99  ? 39.012 -40.678 3.178   1.00 46.86  ? 99  PHE A CE2   1 
ATOM   760  C CZ    . PHE A 1 99  ? 40.036 -40.918 2.270   1.00 46.60  ? 99  PHE A CZ    1 
ATOM   761  N N     . GLY A 1 100 ? 42.918 -41.797 6.282   1.00 45.74  ? 100 GLY A N     1 
ATOM   762  C CA    . GLY A 1 100 ? 44.224 -42.369 6.000   1.00 44.68  ? 100 GLY A CA    1 
ATOM   763  C C     . GLY A 1 100 ? 44.332 -43.804 6.468   1.00 44.04  ? 100 GLY A C     1 
ATOM   764  O O     . GLY A 1 100 ? 45.425 -44.273 6.796   1.00 43.97  ? 100 GLY A O     1 
ATOM   765  N N     . THR A 1 101 ? 43.196 -44.501 6.491   1.00 43.36  ? 101 THR A N     1 
ATOM   766  C CA    . THR A 1 101 ? 43.145 -45.914 6.880   1.00 42.51  ? 101 THR A CA    1 
ATOM   767  C C     . THR A 1 101 ? 43.961 -46.758 5.906   1.00 41.78  ? 101 THR A C     1 
ATOM   768  O O     . THR A 1 101 ? 44.375 -47.873 6.232   1.00 41.82  ? 101 THR A O     1 
ATOM   769  C CB    . THR A 1 101 ? 41.690 -46.434 6.943   1.00 42.64  ? 101 THR A CB    1 
ATOM   770  O OG1   . THR A 1 101 ? 40.876 -45.497 7.662   1.00 42.57  ? 101 THR A OG1   1 
ATOM   771  C CG2   . THR A 1 101 ? 41.622 -47.785 7.642   1.00 42.81  ? 101 THR A CG2   1 
ATOM   772  N N     . GLY A 1 102 ? 44.188 -46.207 4.715   1.00 40.76  ? 102 GLY A N     1 
ATOM   773  C CA    . GLY A 1 102 ? 44.994 -46.851 3.688   1.00 39.62  ? 102 GLY A CA    1 
ATOM   774  C C     . GLY A 1 102 ? 44.170 -47.650 2.703   1.00 38.83  ? 102 GLY A C     1 
ATOM   775  O O     . GLY A 1 102 ? 44.712 -48.219 1.755   1.00 39.12  ? 102 GLY A O     1 
ATOM   776  N N     . HIS A 1 103 ? 42.859 -47.693 2.923   1.00 37.71  ? 103 HIS A N     1 
ATOM   777  C CA    . HIS A 1 103 ? 41.970 -48.482 2.078   1.00 36.52  ? 103 HIS A CA    1 
ATOM   778  C C     . HIS A 1 103 ? 41.358 -47.696 0.922   1.00 35.42  ? 103 HIS A C     1 
ATOM   779  O O     . HIS A 1 103 ? 41.049 -48.274 -0.126  1.00 35.51  ? 103 HIS A O     1 
ATOM   780  C CB    . HIS A 1 103 ? 40.881 -49.142 2.923   1.00 36.72  ? 103 HIS A CB    1 
ATOM   781  C CG    . HIS A 1 103 ? 41.395 -50.235 3.804   1.00 37.41  ? 103 HIS A CG    1 
ATOM   782  N ND1   . HIS A 1 103 ? 41.161 -51.569 3.548   1.00 38.12  ? 103 HIS A ND1   1 
ATOM   783  C CD2   . HIS A 1 103 ? 42.151 -50.194 4.927   1.00 37.95  ? 103 HIS A CD2   1 
ATOM   784  C CE1   . HIS A 1 103 ? 41.743 -52.302 4.480   1.00 38.35  ? 103 HIS A CE1   1 
ATOM   785  N NE2   . HIS A 1 103 ? 42.350 -51.492 5.329   1.00 38.57  ? 103 HIS A NE2   1 
ATOM   786  N N     . HIS A 1 104 ? 41.195 -46.387 1.101   1.00 33.75  ? 104 HIS A N     1 
ATOM   787  C CA    . HIS A 1 104 ? 40.559 -45.562 0.077   1.00 32.13  ? 104 HIS A CA    1 
ATOM   788  C C     . HIS A 1 104 ? 41.402 -45.480 -1.193  1.00 31.23  ? 104 HIS A C     1 
ATOM   789  O O     . HIS A 1 104 ? 42.633 -45.545 -1.140  1.00 31.05  ? 104 HIS A O     1 
ATOM   790  C CB    . HIS A 1 104 ? 40.237 -44.163 0.603   1.00 31.96  ? 104 HIS A CB    1 
ATOM   791  C CG    . HIS A 1 104 ? 39.230 -43.431 -0.227  1.00 31.15  ? 104 HIS A CG    1 
ATOM   792  N ND1   . HIS A 1 104 ? 39.579 -42.443 -1.122  1.00 30.16  ? 104 HIS A ND1   1 
ATOM   793  C CD2   . HIS A 1 104 ? 37.885 -43.564 -0.318  1.00 30.52  ? 104 HIS A CD2   1 
ATOM   794  C CE1   . HIS A 1 104 ? 38.491 -41.986 -1.716  1.00 30.19  ? 104 HIS A CE1   1 
ATOM   795  N NE2   . HIS A 1 104 ? 37.450 -42.652 -1.248  1.00 29.82  ? 104 HIS A NE2   1 
ATOM   796  N N     . GLU A 1 105 ? 40.718 -45.344 -2.326  1.00 30.14  ? 105 GLU A N     1 
ATOM   797  C CA    . GLU A 1 105 ? 41.356 -45.264 -3.638  1.00 29.23  ? 105 GLU A CA    1 
ATOM   798  C C     . GLU A 1 105 ? 42.408 -44.166 -3.708  1.00 28.46  ? 105 GLU A C     1 
ATOM   799  O O     . GLU A 1 105 ? 43.477 -44.369 -4.273  1.00 28.33  ? 105 GLU A O     1 
ATOM   800  C CB    . GLU A 1 105 ? 40.311 -45.028 -4.735  1.00 29.22  ? 105 GLU A CB    1 
ATOM   801  C CG    . GLU A 1 105 ? 39.397 -46.215 -5.020  1.00 30.08  ? 105 GLU A CG    1 
ATOM   802  C CD    . GLU A 1 105 ? 38.124 -46.216 -4.192  1.00 31.35  ? 105 GLU A CD    1 
ATOM   803  O OE1   . GLU A 1 105 ? 38.149 -45.781 -3.018  1.00 31.53  ? 105 GLU A OE1   1 
ATOM   804  O OE2   . GLU A 1 105 ? 37.086 -46.661 -4.726  1.00 32.98  ? 105 GLU A OE2   1 
ATOM   805  N N     . THR A 1 106 ? 42.090 -43.006 -3.135  1.00 27.58  ? 106 THR A N     1 
ATOM   806  C CA    . THR A 1 106 ? 42.955 -41.829 -3.200  1.00 27.00  ? 106 THR A CA    1 
ATOM   807  C C     . THR A 1 106 ? 44.267 -42.069 -2.464  1.00 26.57  ? 106 THR A C     1 
ATOM   808  O O     . THR A 1 106 ? 45.339 -41.777 -2.988  1.00 26.44  ? 106 THR A O     1 
ATOM   809  C CB    . THR A 1 106 ? 42.256 -40.584 -2.631  1.00 27.01  ? 106 THR A CB    1 
ATOM   810  O OG1   . THR A 1 106 ? 41.812 -40.850 -1.294  1.00 27.02  ? 106 THR A OG1   1 
ATOM   811  C CG2   . THR A 1 106 ? 41.055 -40.218 -3.487  1.00 27.03  ? 106 THR A CG2   1 
ATOM   812  N N     . THR A 1 107 ? 44.165 -42.620 -1.257  1.00 26.23  ? 107 THR A N     1 
ATOM   813  C CA    . THR A 1 107 ? 45.325 -42.967 -0.446  1.00 26.00  ? 107 THR A CA    1 
ATOM   814  C C     . THR A 1 107 ? 46.214 -43.973 -1.173  1.00 26.02  ? 107 THR A C     1 
ATOM   815  O O     . THR A 1 107 ? 47.435 -43.824 -1.202  1.00 26.18  ? 107 THR A O     1 
ATOM   816  C CB    . THR A 1 107 ? 44.891 -43.548 0.912   1.00 25.90  ? 107 THR A CB    1 
ATOM   817  O OG1   . THR A 1 107 ? 43.953 -42.657 1.532   1.00 25.76  ? 107 THR A OG1   1 
ATOM   818  C CG2   . THR A 1 107 ? 46.096 -43.740 1.834   1.00 25.92  ? 107 THR A CG2   1 
ATOM   819  N N     . ARG A 1 108 ? 45.591 -44.984 -1.770  1.00 25.89  ? 108 ARG A N     1 
ATOM   820  C CA    . ARG A 1 108 ? 46.330 -46.020 -2.476  1.00 26.14  ? 108 ARG A CA    1 
ATOM   821  C C     . ARG A 1 108 ? 46.999 -45.496 -3.748  1.00 25.67  ? 108 ARG A C     1 
ATOM   822  O O     . ARG A 1 108 ? 48.123 -45.891 -4.056  1.00 25.83  ? 108 ARG A O     1 
ATOM   823  C CB    . ARG A 1 108 ? 45.441 -47.236 -2.747  1.00 25.96  ? 108 ARG A CB    1 
ATOM   824  C CG    . ARG A 1 108 ? 45.075 -47.990 -1.462  1.00 26.98  ? 108 ARG A CG    1 
ATOM   825  C CD    . ARG A 1 108 ? 44.419 -49.342 -1.724  1.00 27.32  ? 108 ARG A CD    1 
ATOM   826  N NE    . ARG A 1 108 ? 43.001 -49.210 -2.052  1.00 30.16  ? 108 ARG A NE    1 
ATOM   827  C CZ    . ARG A 1 108 ? 42.516 -49.190 -3.288  1.00 30.78  ? 108 ARG A CZ    1 
ATOM   828  N NH1   . ARG A 1 108 ? 43.331 -49.301 -4.326  1.00 31.66  ? 108 ARG A NH1   1 
ATOM   829  N NH2   . ARG A 1 108 ? 41.210 -49.060 -3.484  1.00 31.76  ? 108 ARG A NH2   1 
ATOM   830  N N     . LEU A 1 109 ? 46.324 -44.595 -4.461  1.00 25.24  ? 109 LEU A N     1 
ATOM   831  C CA    . LEU A 1 109 ? 46.916 -43.930 -5.630  1.00 24.90  ? 109 LEU A CA    1 
ATOM   832  C C     . LEU A 1 109 ? 48.173 -43.137 -5.257  1.00 24.73  ? 109 LEU A C     1 
ATOM   833  O O     . LEU A 1 109 ? 49.172 -43.176 -5.977  1.00 24.45  ? 109 LEU A O     1 
ATOM   834  C CB    . LEU A 1 109 ? 45.902 -43.005 -6.307  1.00 24.82  ? 109 LEU A CB    1 
ATOM   835  C CG    . LEU A 1 109 ? 44.771 -43.619 -7.139  1.00 24.57  ? 109 LEU A CG    1 
ATOM   836  C CD1   . LEU A 1 109 ? 43.659 -42.600 -7.342  1.00 23.58  ? 109 LEU A CD1   1 
ATOM   837  C CD2   . LEU A 1 109 ? 45.283 -44.148 -8.483  1.00 24.14  ? 109 LEU A CD2   1 
ATOM   838  N N     . ALA A 1 110 ? 48.111 -42.428 -4.131  1.00 24.54  ? 110 ALA A N     1 
ATOM   839  C CA    . ALA A 1 110 ? 49.232 -41.628 -3.638  1.00 24.57  ? 110 ALA A CA    1 
ATOM   840  C C     . ALA A 1 110 ? 50.401 -42.489 -3.165  1.00 24.47  ? 110 ALA A C     1 
ATOM   841  O O     . ALA A 1 110 ? 51.554 -42.140 -3.397  1.00 24.53  ? 110 ALA A O     1 
ATOM   842  C CB    . ALA A 1 110 ? 48.772 -40.679 -2.523  1.00 24.54  ? 110 ALA A CB    1 
ATOM   843  N N     . LEU A 1 111 ? 50.094 -43.608 -2.510  1.00 24.56  ? 111 LEU A N     1 
ATOM   844  C CA    . LEU A 1 111 ? 51.111 -44.566 -2.059  1.00 24.77  ? 111 LEU A CA    1 
ATOM   845  C C     . LEU A 1 111 ? 51.920 -45.130 -3.220  1.00 24.82  ? 111 LEU A C     1 
ATOM   846  O O     . LEU A 1 111 ? 53.147 -45.221 -3.148  1.00 24.78  ? 111 LEU A O     1 
ATOM   847  C CB    . LEU A 1 111 ? 50.467 -45.717 -1.280  1.00 24.62  ? 111 LEU A CB    1 
ATOM   848  C CG    . LEU A 1 111 ? 49.993 -45.408 0.141   1.00 24.83  ? 111 LEU A CG    1 
ATOM   849  C CD1   . LEU A 1 111 ? 49.196 -46.578 0.697   1.00 24.45  ? 111 LEU A CD1   1 
ATOM   850  C CD2   . LEU A 1 111 ? 51.171 -45.075 1.033   1.00 24.20  ? 111 LEU A CD2   1 
ATOM   851  N N     . LYS A 1 112 ? 51.215 -45.508 -4.283  1.00 25.08  ? 112 LYS A N     1 
ATOM   852  C CA    . LYS A 1 112 ? 51.834 -46.041 -5.494  1.00 25.14  ? 112 LYS A CA    1 
ATOM   853  C C     . LYS A 1 112 ? 52.622 -44.965 -6.235  1.00 24.82  ? 112 LYS A C     1 
ATOM   854  O O     . LYS A 1 112 ? 53.708 -45.232 -6.749  1.00 24.82  ? 112 LYS A O     1 
ATOM   855  C CB    . LYS A 1 112 ? 50.770 -46.639 -6.418  1.00 25.16  ? 112 LYS A CB    1 
ATOM   856  C CG    . LYS A 1 112 ? 50.066 -47.866 -5.865  1.00 26.57  ? 112 LYS A CG    1 
ATOM   857  C CD    . LYS A 1 112 ? 48.877 -48.233 -6.738  1.00 28.84  ? 112 LYS A CD    1 
ATOM   858  C CE    . LYS A 1 112 ? 48.221 -49.518 -6.276  1.00 30.36  ? 112 LYS A CE    1 
ATOM   859  N NZ    . LYS A 1 112 ? 47.154 -49.961 -7.237  1.00 32.04  ? 112 LYS A NZ    1 
ATOM   860  N N     . ALA A 1 113 ? 52.067 -43.754 -6.287  1.00 24.39  ? 113 ALA A N     1 
ATOM   861  C CA    . ALA A 1 113 ? 52.740 -42.617 -6.916  1.00 24.08  ? 113 ALA A CA    1 
ATOM   862  C C     . ALA A 1 113 ? 54.034 -42.241 -6.192  1.00 23.81  ? 113 ALA A C     1 
ATOM   863  O O     . ALA A 1 113 ? 55.020 -41.881 -6.833  1.00 23.89  ? 113 ALA A O     1 
ATOM   864  C CB    . ALA A 1 113 ? 51.806 -41.418 -7.002  1.00 23.99  ? 113 ALA A CB    1 
ATOM   865  N N     . LEU A 1 114 ? 54.027 -42.322 -4.861  1.00 23.40  ? 114 LEU A N     1 
ATOM   866  C CA    . LEU A 1 114 ? 55.242 -42.110 -4.068  1.00 23.33  ? 114 LEU A CA    1 
ATOM   867  C C     . LEU A 1 114 ? 56.354 -43.089 -4.456  1.00 23.35  ? 114 LEU A C     1 
ATOM   868  O O     . LEU A 1 114 ? 57.515 -42.700 -4.586  1.00 23.55  ? 114 LEU A O     1 
ATOM   869  C CB    . LEU A 1 114 ? 54.942 -42.213 -2.562  1.00 23.33  ? 114 LEU A CB    1 
ATOM   870  C CG    . LEU A 1 114 ? 54.259 -41.025 -1.873  1.00 23.27  ? 114 LEU A CG    1 
ATOM   871  C CD1   . LEU A 1 114 ? 53.893 -41.364 -0.424  1.00 23.16  ? 114 LEU A CD1   1 
ATOM   872  C CD2   . LEU A 1 114 ? 55.132 -39.768 -1.932  1.00 23.30  ? 114 LEU A CD2   1 
ATOM   873  N N     . ALA A 1 115 ? 55.993 -44.355 -4.651  1.00 23.13  ? 115 ALA A N     1 
ATOM   874  C CA    . ALA A 1 115 ? 56.948 -45.388 -5.050  1.00 23.27  ? 115 ALA A CA    1 
ATOM   875  C C     . ALA A 1 115 ? 57.587 -45.102 -6.410  1.00 23.48  ? 115 ALA A C     1 
ATOM   876  O O     . ALA A 1 115 ? 58.761 -45.407 -6.621  1.00 23.45  ? 115 ALA A O     1 
ATOM   877  C CB    . ALA A 1 115 ? 56.271 -46.748 -5.064  1.00 23.05  ? 115 ALA A CB    1 
ATOM   878  N N     . ARG A 1 116 ? 56.806 -44.519 -7.318  1.00 23.65  ? 116 ARG A N     1 
ATOM   879  C CA    . ARG A 1 116 ? 57.268 -44.190 -8.669  1.00 24.28  ? 116 ARG A CA    1 
ATOM   880  C C     . ARG A 1 116 ? 58.104 -42.913 -8.727  1.00 24.52  ? 116 ARG A C     1 
ATOM   881  O O     . ARG A 1 116 ? 58.934 -42.756 -9.622  1.00 24.27  ? 116 ARG A O     1 
ATOM   882  C CB    . ARG A 1 116 ? 56.078 -44.039 -9.628  1.00 24.32  ? 116 ARG A CB    1 
ATOM   883  C CG    . ARG A 1 116 ? 55.250 -45.296 -9.849  1.00 24.39  ? 116 ARG A CG    1 
ATOM   884  C CD    . ARG A 1 116 ? 54.326 -45.155 -11.066 1.00 24.37  ? 116 ARG A CD    1 
ATOM   885  N NE    . ARG A 1 116 ? 53.407 -44.015 -10.967 1.00 24.77  ? 116 ARG A NE    1 
ATOM   886  C CZ    . ARG A 1 116 ? 52.232 -44.032 -10.336 1.00 25.00  ? 116 ARG A CZ    1 
ATOM   887  N NH1   . ARG A 1 116 ? 51.801 -45.131 -9.727  1.00 26.21  ? 116 ARG A NH1   1 
ATOM   888  N NH2   . ARG A 1 116 ? 51.481 -42.943 -10.314 1.00 25.20  ? 116 ARG A NH2   1 
ATOM   889  N N     . HIS A 1 117 ? 57.882 -42.002 -7.779  1.00 24.91  ? 117 HIS A N     1 
ATOM   890  C CA    . HIS A 1 117 ? 58.469 -40.661 -7.861  1.00 25.30  ? 117 HIS A CA    1 
ATOM   891  C C     . HIS A 1 117 ? 59.525 -40.332 -6.811  1.00 25.58  ? 117 HIS A C     1 
ATOM   892  O O     . HIS A 1 117 ? 60.469 -39.596 -7.096  1.00 25.79  ? 117 HIS A O     1 
ATOM   893  C CB    . HIS A 1 117 ? 57.369 -39.601 -7.812  1.00 25.37  ? 117 HIS A CB    1 
ATOM   894  C CG    . HIS A 1 117 ? 56.491 -39.588 -9.023  1.00 26.11  ? 117 HIS A CG    1 
ATOM   895  N ND1   . HIS A 1 117 ? 56.804 -38.871 -10.156 1.00 27.14  ? 117 HIS A ND1   1 
ATOM   896  C CD2   . HIS A 1 117 ? 55.310 -40.199 -9.278  1.00 25.67  ? 117 HIS A CD2   1 
ATOM   897  C CE1   . HIS A 1 117 ? 55.856 -39.044 -11.061 1.00 27.04  ? 117 HIS A CE1   1 
ATOM   898  N NE2   . HIS A 1 117 ? 54.937 -39.844 -10.551 1.00 26.96  ? 117 HIS A NE2   1 
ATOM   899  N N     . LEU A 1 118 ? 59.359 -40.857 -5.600  1.00 25.39  ? 118 LEU A N     1 
ATOM   900  C CA    . LEU A 1 118 ? 60.226 -40.476 -4.487  1.00 25.24  ? 118 LEU A CA    1 
ATOM   901  C C     . LEU A 1 118 ? 61.627 -41.085 -4.572  1.00 25.13  ? 118 LEU A C     1 
ATOM   902  O O     . LEU A 1 118 ? 61.783 -42.298 -4.738  1.00 25.18  ? 118 LEU A O     1 
ATOM   903  C CB    . LEU A 1 118 ? 59.561 -40.814 -3.144  1.00 25.38  ? 118 LEU A CB    1 
ATOM   904  C CG    . LEU A 1 118 ? 60.188 -40.245 -1.869  1.00 25.85  ? 118 LEU A CG    1 
ATOM   905  C CD1   . LEU A 1 118 ? 60.265 -38.732 -1.968  1.00 27.17  ? 118 LEU A CD1   1 
ATOM   906  C CD2   . LEU A 1 118 ? 59.365 -40.648 -0.666  1.00 25.34  ? 118 LEU A CD2   1 
ATOM   907  N N     . ARG A 1 119 ? 62.635 -40.222 -4.464  1.00 24.70  ? 119 ARG A N     1 
ATOM   908  C CA    . ARG A 1 119 ? 64.035 -40.638 -4.395  1.00 24.67  ? 119 ARG A CA    1 
ATOM   909  C C     . ARG A 1 119 ? 64.482 -40.691 -2.937  1.00 24.35  ? 119 ARG A C     1 
ATOM   910  O O     . ARG A 1 119 ? 64.096 -39.831 -2.152  1.00 24.29  ? 119 ARG A O     1 
ATOM   911  C CB    . ARG A 1 119 ? 64.931 -39.656 -5.159  1.00 24.49  ? 119 ARG A CB    1 
ATOM   912  C CG    . ARG A 1 119 ? 64.570 -39.454 -6.644  1.00 25.12  ? 119 ARG A CG    1 
ATOM   913  C CD    . ARG A 1 119 ? 64.431 -40.789 -7.380  1.00 24.99  ? 119 ARG A CD    1 
ATOM   914  N NE    . ARG A 1 119 ? 65.594 -41.655 -7.171  1.00 24.96  ? 119 ARG A NE    1 
ATOM   915  C CZ    . ARG A 1 119 ? 65.559 -42.986 -7.188  1.00 24.78  ? 119 ARG A CZ    1 
ATOM   916  N NH1   . ARG A 1 119 ? 64.415 -43.628 -7.408  1.00 24.69  ? 119 ARG A NH1   1 
ATOM   917  N NH2   . ARG A 1 119 ? 66.671 -43.678 -6.975  1.00 23.53  ? 119 ARG A NH2   1 
ATOM   918  N N     . PRO A 1 120 ? 65.300 -41.693 -2.567  1.00 24.24  ? 120 PRO A N     1 
ATOM   919  C CA    . PRO A 1 120 ? 65.855 -41.666 -1.214  1.00 24.26  ? 120 PRO A CA    1 
ATOM   920  C C     . PRO A 1 120 ? 66.587 -40.345 -0.964  1.00 24.26  ? 120 PRO A C     1 
ATOM   921  O O     . PRO A 1 120 ? 67.370 -39.899 -1.811  1.00 23.94  ? 120 PRO A O     1 
ATOM   922  C CB    . PRO A 1 120 ? 66.838 -42.844 -1.212  1.00 24.11  ? 120 PRO A CB    1 
ATOM   923  C CG    . PRO A 1 120 ? 66.325 -43.762 -2.262  1.00 24.19  ? 120 PRO A CG    1 
ATOM   924  C CD    . PRO A 1 120 ? 65.748 -42.876 -3.326  1.00 24.27  ? 120 PRO A CD    1 
ATOM   925  N N     . GLY A 1 121 ? 66.301 -39.721 0.177   1.00 24.40  ? 121 GLY A N     1 
ATOM   926  C CA    . GLY A 1 121 ? 66.887 -38.429 0.533   1.00 24.48  ? 121 GLY A CA    1 
ATOM   927  C C     . GLY A 1 121 ? 66.029 -37.225 0.171   1.00 24.76  ? 121 GLY A C     1 
ATOM   928  O O     . GLY A 1 121 ? 66.335 -36.101 0.575   1.00 24.90  ? 121 GLY A O     1 
ATOM   929  N N     . ASP A 1 122 ? 64.962 -37.450 -0.599  1.00 24.61  ? 122 ASP A N     1 
ATOM   930  C CA    . ASP A 1 122 ? 64.047 -36.376 -0.992  1.00 24.55  ? 122 ASP A CA    1 
ATOM   931  C C     . ASP A 1 122 ? 63.353 -35.790 0.231   1.00 24.45  ? 122 ASP A C     1 
ATOM   932  O O     . ASP A 1 122 ? 62.919 -36.526 1.114   1.00 24.48  ? 122 ASP A O     1 
ATOM   933  C CB    . ASP A 1 122 ? 62.965 -36.894 -1.948  1.00 24.37  ? 122 ASP A CB    1 
ATOM   934  C CG    . ASP A 1 122 ? 63.359 -36.815 -3.421  1.00 24.82  ? 122 ASP A CG    1 
ATOM   935  O OD1   . ASP A 1 122 ? 64.429 -36.269 -3.762  1.00 24.92  ? 122 ASP A OD1   1 
ATOM   936  O OD2   . ASP A 1 122 ? 62.567 -37.306 -4.251  1.00 25.73  ? 122 ASP A OD2   1 
ATOM   937  N N     . LYS A 1 123 ? 63.258 -34.465 0.274   1.00 24.57  ? 123 LYS A N     1 
ATOM   938  C CA    . LYS A 1 123 ? 62.417 -33.775 1.244   1.00 24.61  ? 123 LYS A CA    1 
ATOM   939  C C     . LYS A 1 123 ? 60.977 -33.805 0.733   1.00 24.71  ? 123 LYS A C     1 
ATOM   940  O O     . LYS A 1 123 ? 60.696 -33.348 -0.378  1.00 24.68  ? 123 LYS A O     1 
ATOM   941  C CB    . LYS A 1 123 ? 62.905 -32.340 1.449   1.00 24.55  ? 123 LYS A CB    1 
ATOM   942  C CG    . LYS A 1 123 ? 64.255 -32.254 2.160   1.00 24.54  ? 123 LYS A CG    1 
ATOM   943  C CD    . LYS A 1 123 ? 64.692 -30.814 2.388   1.00 25.04  ? 123 LYS A CD    1 
ATOM   944  C CE    . LYS A 1 123 ? 63.800 -30.118 3.416   1.00 25.76  ? 123 LYS A CE    1 
ATOM   945  N NZ    . LYS A 1 123 ? 64.330 -28.778 3.754   1.00 27.28  ? 123 LYS A NZ    1 
ATOM   946  N N     . VAL A 1 124 ? 60.083 -34.371 1.542   1.00 24.54  ? 124 VAL A N     1 
ATOM   947  C CA    . VAL A 1 124 ? 58.695 -34.612 1.153   1.00 24.66  ? 124 VAL A CA    1 
ATOM   948  C C     . VAL A 1 124 ? 57.723 -33.887 2.069   1.00 24.40  ? 124 VAL A C     1 
ATOM   949  O O     . VAL A 1 124 ? 57.781 -34.042 3.293   1.00 24.22  ? 124 VAL A O     1 
ATOM   950  C CB    . VAL A 1 124 ? 58.332 -36.118 1.225   1.00 24.80  ? 124 VAL A CB    1 
ATOM   951  C CG1   . VAL A 1 124 ? 56.966 -36.380 0.584   1.00 25.19  ? 124 VAL A CG1   1 
ATOM   952  C CG2   . VAL A 1 124 ? 59.405 -36.975 0.586   1.00 25.28  ? 124 VAL A CG2   1 
ATOM   953  N N     . LEU A 1 125 ? 56.823 -33.111 1.475   1.00 24.39  ? 125 LEU A N     1 
ATOM   954  C CA    . LEU A 1 125 ? 55.723 -32.524 2.222   1.00 24.54  ? 125 LEU A CA    1 
ATOM   955  C C     . LEU A 1 125 ? 54.443 -33.304 1.942   1.00 24.73  ? 125 LEU A C     1 
ATOM   956  O O     . LEU A 1 125 ? 54.041 -33.457 0.785   1.00 24.32  ? 125 LEU A O     1 
ATOM   957  C CB    . LEU A 1 125 ? 55.537 -31.038 1.879   1.00 24.55  ? 125 LEU A CB    1 
ATOM   958  C CG    . LEU A 1 125 ? 54.325 -30.321 2.493   1.00 24.73  ? 125 LEU A CG    1 
ATOM   959  C CD1   . LEU A 1 125 ? 54.392 -30.294 4.022   1.00 24.32  ? 125 LEU A CD1   1 
ATOM   960  C CD2   . LEU A 1 125 ? 54.188 -28.903 1.936   1.00 24.69  ? 125 LEU A CD2   1 
ATOM   961  N N     . ASP A 1 126 ? 53.828 -33.800 3.012   1.00 24.58  ? 126 ASP A N     1 
ATOM   962  C CA    . ASP A 1 126 ? 52.535 -34.471 2.948   1.00 25.02  ? 126 ASP A CA    1 
ATOM   963  C C     . ASP A 1 126 ? 51.493 -33.498 3.503   1.00 25.13  ? 126 ASP A C     1 
ATOM   964  O O     . ASP A 1 126 ? 51.338 -33.346 4.717   1.00 24.84  ? 126 ASP A O     1 
ATOM   965  C CB    . ASP A 1 126 ? 52.587 -35.799 3.727   1.00 25.12  ? 126 ASP A CB    1 
ATOM   966  C CG    . ASP A 1 126 ? 51.227 -36.480 3.869   1.00 25.51  ? 126 ASP A CG    1 
ATOM   967  O OD1   . ASP A 1 126 ? 50.298 -36.215 3.069   1.00 24.82  ? 126 ASP A OD1   1 
ATOM   968  O OD2   . ASP A 1 126 ? 51.098 -37.311 4.799   1.00 25.31  ? 126 ASP A OD2   1 
ATOM   969  N N     . LEU A 1 127 ? 50.809 -32.813 2.593   1.00 25.37  ? 127 LEU A N     1 
ATOM   970  C CA    . LEU A 1 127 ? 49.852 -31.778 2.964   1.00 25.81  ? 127 LEU A CA    1 
ATOM   971  C C     . LEU A 1 127 ? 48.500 -32.397 3.292   1.00 25.91  ? 127 LEU A C     1 
ATOM   972  O O     . LEU A 1 127 ? 47.839 -32.972 2.422   1.00 25.96  ? 127 LEU A O     1 
ATOM   973  C CB    . LEU A 1 127 ? 49.732 -30.734 1.846   1.00 25.78  ? 127 LEU A CB    1 
ATOM   974  C CG    . LEU A 1 127 ? 48.793 -29.537 2.012   1.00 25.82  ? 127 LEU A CG    1 
ATOM   975  C CD1   . LEU A 1 127 ? 49.217 -28.627 3.159   1.00 26.24  ? 127 LEU A CD1   1 
ATOM   976  C CD2   . LEU A 1 127 ? 48.746 -28.762 0.708   1.00 26.23  ? 127 LEU A CD2   1 
ATOM   977  N N     . GLY A 1 128 ? 48.096 -32.265 4.553   1.00 26.02  ? 128 GLY A N     1 
ATOM   978  C CA    . GLY A 1 128 ? 46.875 -32.894 5.048   1.00 26.23  ? 128 GLY A CA    1 
ATOM   979  C C     . GLY A 1 128 ? 47.166 -34.333 5.420   1.00 26.36  ? 128 GLY A C     1 
ATOM   980  O O     . GLY A 1 128 ? 46.595 -35.261 4.839   1.00 26.62  ? 128 GLY A O     1 
ATOM   981  N N     . THR A 1 129 ? 48.055 -34.508 6.397   1.00 26.26  ? 129 THR A N     1 
ATOM   982  C CA    . THR A 1 129 ? 48.624 -35.818 6.709   1.00 26.13  ? 129 THR A CA    1 
ATOM   983  C C     . THR A 1 129 ? 47.654 -36.803 7.370   1.00 26.30  ? 129 THR A C     1 
ATOM   984  O O     . THR A 1 129 ? 47.800 -38.019 7.209   1.00 26.26  ? 129 THR A O     1 
ATOM   985  C CB    . THR A 1 129 ? 49.945 -35.695 7.523   1.00 25.96  ? 129 THR A CB    1 
ATOM   986  O OG1   . THR A 1 129 ? 50.686 -36.920 7.423   1.00 25.69  ? 129 THR A OG1   1 
ATOM   987  C CG2   . THR A 1 129 ? 49.685 -35.350 9.003   1.00 25.59  ? 129 THR A CG2   1 
ATOM   988  N N     . GLY A 1 130 ? 46.669 -36.277 8.097   1.00 26.46  ? 130 GLY A N     1 
ATOM   989  C CA    . GLY A 1 130 ? 45.696 -37.104 8.813   1.00 26.42  ? 130 GLY A CA    1 
ATOM   990  C C     . GLY A 1 130 ? 46.364 -38.134 9.704   1.00 26.37  ? 130 GLY A C     1 
ATOM   991  O O     . GLY A 1 130 ? 47.142 -37.780 10.590  1.00 26.44  ? 130 GLY A O     1 
ATOM   992  N N     . SER A 1 131 ? 46.062 -39.406 9.439   1.00 26.43  ? 131 SER A N     1 
ATOM   993  C CA    . SER A 1 131 ? 46.639 -40.564 10.133  1.00 26.47  ? 131 SER A CA    1 
ATOM   994  C C     . SER A 1 131 ? 48.164 -40.636 10.040  1.00 26.11  ? 131 SER A C     1 
ATOM   995  O O     . SER A 1 131 ? 48.811 -41.330 10.831  1.00 25.98  ? 131 SER A O     1 
ATOM   996  C CB    . SER A 1 131 ? 46.058 -41.858 9.543   1.00 26.67  ? 131 SER A CB    1 
ATOM   997  O OG    . SER A 1 131 ? 46.549 -42.084 8.215   1.00 26.78  ? 131 SER A OG    1 
ATOM   998  N N     . GLY A 1 132 ? 48.720 -39.949 9.049   1.00 25.83  ? 132 GLY A N     1 
ATOM   999  C CA    . GLY A 1 132 ? 50.158 -39.932 8.817   1.00 25.75  ? 132 GLY A CA    1 
ATOM   1000 C C     . GLY A 1 132 ? 50.643 -40.942 7.792   1.00 25.61  ? 132 GLY A C     1 
ATOM   1001 O O     . GLY A 1 132 ? 51.841 -41.028 7.536   1.00 25.71  ? 132 GLY A O     1 
ATOM   1002 N N     . VAL A 1 133 ? 49.713 -41.689 7.193   1.00 25.38  ? 133 VAL A N     1 
ATOM   1003 C CA    . VAL A 1 133 ? 50.042 -42.811 6.294   1.00 25.10  ? 133 VAL A CA    1 
ATOM   1004 C C     . VAL A 1 133 ? 51.048 -42.480 5.173   1.00 24.85  ? 133 VAL A C     1 
ATOM   1005 O O     . VAL A 1 133 ? 52.009 -43.224 4.959   1.00 24.90  ? 133 VAL A O     1 
ATOM   1006 C CB    . VAL A 1 133 ? 48.753 -43.515 5.734   1.00 25.24  ? 133 VAL A CB    1 
ATOM   1007 C CG1   . VAL A 1 133 ? 47.950 -42.585 4.822   1.00 25.04  ? 133 VAL A CG1   1 
ATOM   1008 C CG2   . VAL A 1 133 ? 49.103 -44.832 5.021   1.00 25.22  ? 133 VAL A CG2   1 
ATOM   1009 N N     . LEU A 1 134 ? 50.846 -41.361 4.483   1.00 24.61  ? 134 LEU A N     1 
ATOM   1010 C CA    . LEU A 1 134 ? 51.704 -41.002 3.350   1.00 24.66  ? 134 LEU A CA    1 
ATOM   1011 C C     . LEU A 1 134 ? 53.091 -40.521 3.777   1.00 24.43  ? 134 LEU A C     1 
ATOM   1012 O O     . LEU A 1 134 ? 54.077 -40.787 3.092   1.00 24.91  ? 134 LEU A O     1 
ATOM   1013 C CB    . LEU A 1 134 ? 51.024 -39.969 2.440   1.00 24.34  ? 134 LEU A CB    1 
ATOM   1014 C CG    . LEU A 1 134 ? 49.657 -40.316 1.833   1.00 24.69  ? 134 LEU A CG    1 
ATOM   1015 C CD1   . LEU A 1 134 ? 49.177 -39.184 0.922   1.00 23.52  ? 134 LEU A CD1   1 
ATOM   1016 C CD2   . LEU A 1 134 ? 49.685 -41.640 1.077   1.00 23.62  ? 134 LEU A CD2   1 
ATOM   1017 N N     . ALA A 1 135 ? 53.159 -39.809 4.900   1.00 24.46  ? 135 ALA A N     1 
ATOM   1018 C CA    . ALA A 1 135 ? 54.437 -39.361 5.458   1.00 24.27  ? 135 ALA A CA    1 
ATOM   1019 C C     . ALA A 1 135 ? 55.244 -40.560 5.955   1.00 24.05  ? 135 ALA A C     1 
ATOM   1020 O O     . ALA A 1 135 ? 56.460 -40.617 5.778   1.00 23.77  ? 135 ALA A O     1 
ATOM   1021 C CB    . ALA A 1 135 ? 54.215 -38.359 6.586   1.00 24.58  ? 135 ALA A CB    1 
ATOM   1022 N N     . ILE A 1 136 ? 54.549 -41.515 6.566   1.00 23.79  ? 136 ILE A N     1 
ATOM   1023 C CA    . ILE A 1 136 ? 55.160 -42.760 7.032   1.00 23.61  ? 136 ILE A CA    1 
ATOM   1024 C C     . ILE A 1 136 ? 55.704 -43.584 5.857   1.00 23.59  ? 136 ILE A C     1 
ATOM   1025 O O     . ILE A 1 136 ? 56.862 -44.010 5.874   1.00 23.55  ? 136 ILE A O     1 
ATOM   1026 C CB    . ILE A 1 136 ? 54.162 -43.570 7.901   1.00 23.59  ? 136 ILE A CB    1 
ATOM   1027 C CG1   . ILE A 1 136 ? 53.943 -42.849 9.236   1.00 23.35  ? 136 ILE A CG1   1 
ATOM   1028 C CG2   . ILE A 1 136 ? 54.656 -45.004 8.123   1.00 23.58  ? 136 ILE A CG2   1 
ATOM   1029 C CD1   . ILE A 1 136 ? 52.709 -43.286 9.997   1.00 23.75  ? 136 ILE A CD1   1 
ATOM   1030 N N     . ALA A 1 137 ? 54.871 -43.783 4.838   1.00 23.50  ? 137 ALA A N     1 
ATOM   1031 C CA    . ALA A 1 137 ? 55.289 -44.424 3.588   1.00 23.56  ? 137 ALA A CA    1 
ATOM   1032 C C     . ALA A 1 137 ? 56.495 -43.732 2.953   1.00 23.60  ? 137 ALA A C     1 
ATOM   1033 O O     . ALA A 1 137 ? 57.430 -44.395 2.511   1.00 23.68  ? 137 ALA A O     1 
ATOM   1034 C CB    . ALA A 1 137 ? 54.131 -44.459 2.606   1.00 23.28  ? 137 ALA A CB    1 
ATOM   1035 N N     . ALA A 1 138 ? 56.467 -42.399 2.909   1.00 23.59  ? 138 ALA A N     1 
ATOM   1036 C CA    . ALA A 1 138 ? 57.598 -41.618 2.405   1.00 23.74  ? 138 ALA A CA    1 
ATOM   1037 C C     . ALA A 1 138 ? 58.895 -41.932 3.157   1.00 23.73  ? 138 ALA A C     1 
ATOM   1038 O O     . ALA A 1 138 ? 59.937 -42.147 2.536   1.00 23.74  ? 138 ALA A O     1 
ATOM   1039 C CB    . ALA A 1 138 ? 57.290 -40.114 2.450   1.00 23.54  ? 138 ALA A CB    1 
ATOM   1040 N N     . GLU A 1 139 ? 58.823 -41.963 4.488   1.00 23.94  ? 139 GLU A N     1 
ATOM   1041 C CA    . GLU A 1 139 ? 59.970 -42.337 5.323   1.00 24.25  ? 139 GLU A CA    1 
ATOM   1042 C C     . GLU A 1 139 ? 60.445 -43.769 5.050   1.00 24.23  ? 139 GLU A C     1 
ATOM   1043 O O     . GLU A 1 139 ? 61.649 -44.025 5.002   1.00 23.95  ? 139 GLU A O     1 
ATOM   1044 C CB    . GLU A 1 139 ? 59.650 -42.160 6.816   1.00 24.41  ? 139 GLU A CB    1 
ATOM   1045 C CG    . GLU A 1 139 ? 59.512 -40.702 7.294   1.00 25.32  ? 139 GLU A CG    1 
ATOM   1046 C CD    . GLU A 1 139 ? 60.841 -39.956 7.401   1.00 26.84  ? 139 GLU A CD    1 
ATOM   1047 O OE1   . GLU A 1 139 ? 60.838 -38.715 7.249   1.00 27.92  ? 139 GLU A OE1   1 
ATOM   1048 O OE2   . GLU A 1 139 ? 61.889 -40.597 7.640   1.00 27.22  ? 139 GLU A OE2   1 
ATOM   1049 N N     . LYS A 1 140 ? 59.496 -44.691 4.875   1.00 24.62  ? 140 LYS A N     1 
ATOM   1050 C CA    . LYS A 1 140 ? 59.797 -46.088 4.524   1.00 25.26  ? 140 LYS A CA    1 
ATOM   1051 C C     . LYS A 1 140 ? 60.564 -46.196 3.202   1.00 25.14  ? 140 LYS A C     1 
ATOM   1052 O O     . LYS A 1 140 ? 61.331 -47.137 2.991   1.00 25.36  ? 140 LYS A O     1 
ATOM   1053 C CB    . LYS A 1 140 ? 58.508 -46.917 4.432   1.00 25.42  ? 140 LYS A CB    1 
ATOM   1054 C CG    . LYS A 1 140 ? 57.890 -47.296 5.773   1.00 26.84  ? 140 LYS A CG    1 
ATOM   1055 C CD    . LYS A 1 140 ? 58.655 -48.432 6.445   1.00 28.59  ? 140 LYS A CD    1 
ATOM   1056 C CE    . LYS A 1 140 ? 58.003 -48.825 7.753   1.00 30.12  ? 140 LYS A CE    1 
ATOM   1057 N NZ    . LYS A 1 140 ? 58.796 -49.848 8.503   1.00 30.25  ? 140 LYS A NZ    1 
ATOM   1058 N N     . LEU A 1 141 ? 60.358 -45.220 2.325   1.00 24.85  ? 141 LEU A N     1 
ATOM   1059 C CA    . LEU A 1 141 ? 61.017 -45.191 1.023   1.00 24.70  ? 141 LEU A CA    1 
ATOM   1060 C C     . LEU A 1 141 ? 62.320 -44.377 1.038   1.00 24.59  ? 141 LEU A C     1 
ATOM   1061 O O     . LEU A 1 141 ? 62.919 -44.132 -0.012  1.00 24.54  ? 141 LEU A O     1 
ATOM   1062 C CB    . LEU A 1 141 ? 60.051 -44.659 -0.044  1.00 24.79  ? 141 LEU A CB    1 
ATOM   1063 C CG    . LEU A 1 141 ? 58.847 -45.548 -0.394  1.00 25.04  ? 141 LEU A CG    1 
ATOM   1064 C CD1   . LEU A 1 141 ? 57.904 -44.839 -1.360  1.00 25.10  ? 141 LEU A CD1   1 
ATOM   1065 C CD2   . LEU A 1 141 ? 59.290 -46.901 -0.967  1.00 25.01  ? 141 LEU A CD2   1 
ATOM   1066 N N     . GLY A 1 142 ? 62.755 -43.970 2.230   1.00 24.34  ? 142 GLY A N     1 
ATOM   1067 C CA    . GLY A 1 142 ? 63.996 -43.207 2.386   1.00 24.45  ? 142 GLY A CA    1 
ATOM   1068 C C     . GLY A 1 142 ? 63.821 -41.704 2.249   1.00 24.31  ? 142 GLY A C     1 
ATOM   1069 O O     . GLY A 1 142 ? 64.804 -40.959 2.184   1.00 24.24  ? 142 GLY A O     1 
ATOM   1070 N N     . GLY A 1 143 ? 62.568 -41.261 2.206   1.00 24.34  ? 143 GLY A N     1 
ATOM   1071 C CA    . GLY A 1 143 ? 62.251 -39.837 2.138   1.00 24.41  ? 143 GLY A CA    1 
ATOM   1072 C C     . GLY A 1 143 ? 62.381 -39.169 3.492   1.00 24.73  ? 143 GLY A C     1 
ATOM   1073 O O     . GLY A 1 143 ? 62.377 -39.835 4.531   1.00 24.73  ? 143 GLY A O     1 
ATOM   1074 N N     . LYS A 1 144 ? 62.517 -37.849 3.470   1.00 24.69  ? 144 LYS A N     1 
ATOM   1075 C CA    . LYS A 1 144 ? 62.593 -37.049 4.680   1.00 24.72  ? 144 LYS A CA    1 
ATOM   1076 C C     . LYS A 1 144 ? 61.302 -36.236 4.755   1.00 24.50  ? 144 LYS A C     1 
ATOM   1077 O O     . LYS A 1 144 ? 61.170 -35.195 4.113   1.00 24.66  ? 144 LYS A O     1 
ATOM   1078 C CB    . LYS A 1 144 ? 63.833 -36.149 4.641   1.00 24.78  ? 144 LYS A CB    1 
ATOM   1079 C CG    . LYS A 1 144 ? 65.155 -36.922 4.588   1.00 25.22  ? 144 LYS A CG    1 
ATOM   1080 C CD    . LYS A 1 144 ? 66.328 -36.000 4.296   1.00 26.99  ? 144 LYS A CD    1 
ATOM   1081 C CE    . LYS A 1 144 ? 67.651 -36.742 4.428   1.00 28.12  ? 144 LYS A CE    1 
ATOM   1082 N NZ    . LYS A 1 144 ? 68.814 -35.841 4.208   1.00 29.73  ? 144 LYS A NZ    1 
ATOM   1083 N N     . ALA A 1 145 ? 60.347 -36.737 5.532   1.00 24.32  ? 145 ALA A N     1 
ATOM   1084 C CA    . ALA A 1 145 ? 58.961 -36.282 5.436   1.00 24.25  ? 145 ALA A CA    1 
ATOM   1085 C C     . ALA A 1 145 ? 58.527 -35.273 6.493   1.00 24.07  ? 145 ALA A C     1 
ATOM   1086 O O     . ALA A 1 145 ? 58.894 -35.376 7.672   1.00 24.31  ? 145 ALA A O     1 
ATOM   1087 C CB    . ALA A 1 145 ? 58.013 -37.485 5.436   1.00 24.11  ? 145 ALA A CB    1 
ATOM   1088 N N     . LEU A 1 146 ? 57.742 -34.298 6.048   1.00 24.19  ? 146 LEU A N     1 
ATOM   1089 C CA    . LEU A 1 146 ? 56.962 -33.446 6.938   1.00 24.06  ? 146 LEU A CA    1 
ATOM   1090 C C     . LEU A 1 146 ? 55.484 -33.667 6.632   1.00 24.29  ? 146 LEU A C     1 
ATOM   1091 O O     . LEU A 1 146 ? 55.050 -33.492 5.494   1.00 24.19  ? 146 LEU A O     1 
ATOM   1092 C CB    . LEU A 1 146 ? 57.332 -31.968 6.752   1.00 23.88  ? 146 LEU A CB    1 
ATOM   1093 C CG    . LEU A 1 146 ? 56.480 -30.908 7.469   1.00 24.10  ? 146 LEU A CG    1 
ATOM   1094 C CD1   . LEU A 1 146 ? 56.580 -31.041 8.987   1.00 24.04  ? 146 LEU A CD1   1 
ATOM   1095 C CD2   . LEU A 1 146 ? 56.892 -29.502 7.049   1.00 23.99  ? 146 LEU A CD2   1 
ATOM   1096 N N     . GLY A 1 147 ? 54.723 -34.075 7.643   1.00 24.44  ? 147 GLY A N     1 
ATOM   1097 C CA    . GLY A 1 147 ? 53.274 -34.171 7.519   1.00 24.69  ? 147 GLY A CA    1 
ATOM   1098 C C     . GLY A 1 147 ? 52.628 -33.033 8.281   1.00 25.19  ? 147 GLY A C     1 
ATOM   1099 O O     . GLY A 1 147 ? 52.848 -32.893 9.483   1.00 24.83  ? 147 GLY A O     1 
ATOM   1100 N N     . VAL A 1 148 ? 51.850 -32.206 7.581   1.00 25.66  ? 148 VAL A N     1 
ATOM   1101 C CA    . VAL A 1 148 ? 51.113 -31.114 8.231   1.00 26.46  ? 148 VAL A CA    1 
ATOM   1102 C C     . VAL A 1 148 ? 49.606 -31.314 8.138   1.00 26.96  ? 148 VAL A C     1 
ATOM   1103 O O     . VAL A 1 148 ? 49.103 -31.878 7.164   1.00 26.94  ? 148 VAL A O     1 
ATOM   1104 C CB    . VAL A 1 148 ? 51.499 -29.691 7.701   1.00 26.51  ? 148 VAL A CB    1 
ATOM   1105 C CG1   . VAL A 1 148 ? 52.989 -29.419 7.893   1.00 26.65  ? 148 VAL A CG1   1 
ATOM   1106 C CG2   . VAL A 1 148 ? 51.096 -29.505 6.238   1.00 26.71  ? 148 VAL A CG2   1 
ATOM   1107 N N     . ASP A 1 149 ? 48.894 -30.851 9.162   1.00 27.70  ? 149 ASP A N     1 
ATOM   1108 C CA    . ASP A 1 149 ? 47.439 -30.913 9.176   1.00 28.73  ? 149 ASP A CA    1 
ATOM   1109 C C     . ASP A 1 149 ? 46.853 -29.733 9.946   1.00 29.38  ? 149 ASP A C     1 
ATOM   1110 O O     . ASP A 1 149 ? 47.342 -29.384 11.023  1.00 29.26  ? 149 ASP A O     1 
ATOM   1111 C CB    . ASP A 1 149 ? 46.970 -32.233 9.791   1.00 28.52  ? 149 ASP A CB    1 
ATOM   1112 C CG    . ASP A 1 149 ? 45.619 -32.669 9.268   1.00 28.92  ? 149 ASP A CG    1 
ATOM   1113 O OD1   . ASP A 1 149 ? 45.559 -33.723 8.603   1.00 28.93  ? 149 ASP A OD1   1 
ATOM   1114 O OD2   . ASP A 1 149 ? 44.619 -31.958 9.511   1.00 29.87  ? 149 ASP A OD2   1 
ATOM   1115 N N     . ILE A 1 150 ? 45.810 -29.120 9.386   1.00 30.53  ? 150 ILE A N     1 
ATOM   1116 C CA    . ILE A 1 150 ? 45.120 -28.002 10.049  1.00 31.65  ? 150 ILE A CA    1 
ATOM   1117 C C     . ILE A 1 150 ? 44.317 -28.454 11.270  1.00 32.24  ? 150 ILE A C     1 
ATOM   1118 O O     . ILE A 1 150 ? 43.949 -27.636 12.116  1.00 32.43  ? 150 ILE A O     1 
ATOM   1119 C CB    . ILE A 1 150 ? 44.206 -27.199 9.079   1.00 31.66  ? 150 ILE A CB    1 
ATOM   1120 C CG1   . ILE A 1 150 ? 43.238 -28.131 8.334   1.00 31.72  ? 150 ILE A CG1   1 
ATOM   1121 C CG2   . ILE A 1 150 ? 45.056 -26.363 8.110   1.00 32.02  ? 150 ILE A CG2   1 
ATOM   1122 C CD1   . ILE A 1 150 ? 42.052 -27.420 7.691   1.00 32.03  ? 150 ILE A CD1   1 
ATOM   1123 N N     . ASP A 1 151 ? 44.049 -29.756 11.348  1.00 32.98  ? 151 ASP A N     1 
ATOM   1124 C CA    . ASP A 1 151 ? 43.378 -30.358 12.494  1.00 33.67  ? 151 ASP A CA    1 
ATOM   1125 C C     . ASP A 1 151 ? 44.424 -30.932 13.454  1.00 34.11  ? 151 ASP A C     1 
ATOM   1126 O O     . ASP A 1 151 ? 45.038 -31.959 13.161  1.00 34.18  ? 151 ASP A O     1 
ATOM   1127 C CB    . ASP A 1 151 ? 42.408 -31.449 12.023  1.00 33.73  ? 151 ASP A CB    1 
ATOM   1128 C CG    . ASP A 1 151 ? 41.617 -32.081 13.162  1.00 34.43  ? 151 ASP A CG    1 
ATOM   1129 O OD1   . ASP A 1 151 ? 41.767 -31.662 14.332  1.00 35.05  ? 151 ASP A OD1   1 
ATOM   1130 O OD2   . ASP A 1 151 ? 40.833 -33.012 12.878  1.00 35.34  ? 151 ASP A OD2   1 
ATOM   1131 N N     . PRO A 1 152 ? 44.628 -30.270 14.609  1.00 34.57  ? 152 PRO A N     1 
ATOM   1132 C CA    . PRO A 1 152 ? 45.647 -30.697 15.573  1.00 34.79  ? 152 PRO A CA    1 
ATOM   1133 C C     . PRO A 1 152 ? 45.344 -32.043 16.239  1.00 34.97  ? 152 PRO A C     1 
ATOM   1134 O O     . PRO A 1 152 ? 46.246 -32.660 16.809  1.00 35.07  ? 152 PRO A O     1 
ATOM   1135 C CB    . PRO A 1 152 ? 45.630 -29.577 16.616  1.00 34.88  ? 152 PRO A CB    1 
ATOM   1136 C CG    . PRO A 1 152 ? 44.256 -29.004 16.528  1.00 34.87  ? 152 PRO A CG    1 
ATOM   1137 C CD    . PRO A 1 152 ? 43.904 -29.072 15.075  1.00 34.60  ? 152 PRO A CD    1 
ATOM   1138 N N     . MET A 1 153 ? 44.092 -32.490 16.148  1.00 35.14  ? 153 MET A N     1 
ATOM   1139 C CA    . MET A 1 153 ? 43.640 -33.730 16.788  1.00 35.32  ? 153 MET A CA    1 
ATOM   1140 C C     . MET A 1 153 ? 44.171 -35.013 16.143  1.00 35.04  ? 153 MET A C     1 
ATOM   1141 O O     . MET A 1 153 ? 44.261 -36.050 16.806  1.00 35.17  ? 153 MET A O     1 
ATOM   1142 C CB    . MET A 1 153 ? 42.110 -33.771 16.858  1.00 35.63  ? 153 MET A CB    1 
ATOM   1143 C CG    . MET A 1 153 ? 41.476 -32.688 17.728  1.00 36.69  ? 153 MET A CG    1 
ATOM   1144 S SD    . MET A 1 153 ? 41.799 -32.883 19.495  1.00 39.81  ? 153 MET A SD    1 
ATOM   1145 C CE    . MET A 1 153 ? 43.227 -31.819 19.725  1.00 38.91  ? 153 MET A CE    1 
ATOM   1146 N N     . VAL A 1 154 ? 44.516 -34.947 14.858  1.00 34.65  ? 154 VAL A N     1 
ATOM   1147 C CA    . VAL A 1 154 ? 45.059 -36.112 14.155  1.00 34.25  ? 154 VAL A CA    1 
ATOM   1148 C C     . VAL A 1 154 ? 46.544 -36.326 14.458  1.00 33.92  ? 154 VAL A C     1 
ATOM   1149 O O     . VAL A 1 154 ? 47.076 -37.413 14.231  1.00 33.91  ? 154 VAL A O     1 
ATOM   1150 C CB    . VAL A 1 154 ? 44.851 -36.035 12.612  1.00 34.30  ? 154 VAL A CB    1 
ATOM   1151 C CG1   . VAL A 1 154 ? 43.389 -35.796 12.271  1.00 34.39  ? 154 VAL A CG1   1 
ATOM   1152 C CG2   . VAL A 1 154 ? 45.731 -34.959 11.989  1.00 34.17  ? 154 VAL A CG2   1 
ATOM   1153 N N     . LEU A 1 155 ? 47.204 -35.289 14.970  1.00 33.52  ? 155 LEU A N     1 
ATOM   1154 C CA    . LEU A 1 155 ? 48.657 -35.313 15.163  1.00 33.19  ? 155 LEU A CA    1 
ATOM   1155 C C     . LEU A 1 155 ? 49.163 -36.352 16.177  1.00 32.83  ? 155 LEU A C     1 
ATOM   1156 O O     . LEU A 1 155 ? 50.143 -37.038 15.890  1.00 32.75  ? 155 LEU A O     1 
ATOM   1157 C CB    . LEU A 1 155 ? 49.209 -33.911 15.457  1.00 33.27  ? 155 LEU A CB    1 
ATOM   1158 C CG    . LEU A 1 155 ? 48.970 -32.835 14.389  1.00 33.52  ? 155 LEU A CG    1 
ATOM   1159 C CD1   . LEU A 1 155 ? 49.433 -31.485 14.900  1.00 34.11  ? 155 LEU A CD1   1 
ATOM   1160 C CD2   . LEU A 1 155 ? 49.651 -33.174 13.064  1.00 33.54  ? 155 LEU A CD2   1 
ATOM   1161 N N     . PRO A 1 156 ? 48.511 -36.475 17.357  1.00 32.63  ? 156 PRO A N     1 
ATOM   1162 C CA    . PRO A 1 156 ? 48.874 -37.582 18.252  1.00 32.34  ? 156 PRO A CA    1 
ATOM   1163 C C     . PRO A 1 156 ? 48.707 -38.963 17.603  1.00 32.03  ? 156 PRO A C     1 
ATOM   1164 O O     . PRO A 1 156 ? 49.510 -39.862 17.859  1.00 31.87  ? 156 PRO A O     1 
ATOM   1165 C CB    . PRO A 1 156 ? 47.895 -37.427 19.423  1.00 32.40  ? 156 PRO A CB    1 
ATOM   1166 C CG    . PRO A 1 156 ? 47.515 -35.994 19.409  1.00 32.61  ? 156 PRO A CG    1 
ATOM   1167 C CD    . PRO A 1 156 ? 47.462 -35.625 17.955  1.00 32.62  ? 156 PRO A CD    1 
ATOM   1168 N N     . GLN A 1 157 ? 47.676 -39.115 16.774  1.00 31.77  ? 157 GLN A N     1 
ATOM   1169 C CA    . GLN A 1 157 ? 47.433 -40.357 16.033  1.00 31.72  ? 157 GLN A CA    1 
ATOM   1170 C C     . GLN A 1 157 ? 48.526 -40.625 14.999  1.00 30.95  ? 157 GLN A C     1 
ATOM   1171 O O     . GLN A 1 157 ? 48.942 -41.771 14.809  1.00 30.64  ? 157 GLN A O     1 
ATOM   1172 C CB    . GLN A 1 157 ? 46.075 -40.313 15.332  1.00 31.76  ? 157 GLN A CB    1 
ATOM   1173 C CG    . GLN A 1 157 ? 44.877 -40.200 16.267  1.00 32.68  ? 157 GLN A CG    1 
ATOM   1174 C CD    . GLN A 1 157 ? 43.562 -40.139 15.514  1.00 32.91  ? 157 GLN A CD    1 
ATOM   1175 O OE1   . GLN A 1 157 ? 42.802 -39.177 15.646  1.00 34.96  ? 157 GLN A OE1   1 
ATOM   1176 N NE2   . GLN A 1 157 ? 43.288 -41.166 14.710  1.00 34.76  ? 157 GLN A NE2   1 
ATOM   1177 N N     . ALA A 1 158 ? 48.974 -39.563 14.330  1.00 30.38  ? 158 ALA A N     1 
ATOM   1178 C CA    . ALA A 1 158 ? 50.046 -39.656 13.339  1.00 29.74  ? 158 ALA A CA    1 
ATOM   1179 C C     . ALA A 1 158 ? 51.367 -40.082 13.979  1.00 29.40  ? 158 ALA A C     1 
ATOM   1180 O O     . ALA A 1 158 ? 52.075 -40.932 13.438  1.00 29.28  ? 158 ALA A O     1 
ATOM   1181 C CB    . ALA A 1 158 ? 50.203 -38.334 12.596  1.00 29.79  ? 158 ALA A CB    1 
ATOM   1182 N N     . GLU A 1 159 ? 51.683 -39.499 15.136  1.00 29.11  ? 159 GLU A N     1 
ATOM   1183 C CA    . GLU A 1 159 ? 52.899 -39.840 15.879  1.00 28.99  ? 159 GLU A CA    1 
ATOM   1184 C C     . GLU A 1 159 ? 52.873 -41.287 16.379  1.00 28.62  ? 159 GLU A C     1 
ATOM   1185 O O     . GLU A 1 159 ? 53.888 -41.981 16.339  1.00 28.41  ? 159 GLU A O     1 
ATOM   1186 C CB    . GLU A 1 159 ? 53.112 -38.888 17.063  1.00 29.13  ? 159 GLU A CB    1 
ATOM   1187 C CG    . GLU A 1 159 ? 53.317 -37.420 16.687  1.00 29.90  ? 159 GLU A CG    1 
ATOM   1188 C CD    . GLU A 1 159 ? 54.726 -37.093 16.219  1.00 31.38  ? 159 GLU A CD    1 
ATOM   1189 O OE1   . GLU A 1 159 ? 55.556 -38.015 16.048  1.00 32.45  ? 159 GLU A OE1   1 
ATOM   1190 O OE2   . GLU A 1 159 ? 55.004 -35.893 16.019  1.00 31.89  ? 159 GLU A OE2   1 
ATOM   1191 N N     . ALA A 1 160 ? 51.709 -41.727 16.855  1.00 28.32  ? 160 ALA A N     1 
ATOM   1192 C CA    . ALA A 1 160 ? 51.523 -43.102 17.314  1.00 28.01  ? 160 ALA A CA    1 
ATOM   1193 C C     . ALA A 1 160 ? 51.698 -44.088 16.160  1.00 27.71  ? 160 ALA A C     1 
ATOM   1194 O O     . ALA A 1 160 ? 52.369 -45.109 16.307  1.00 27.64  ? 160 ALA A O     1 
ATOM   1195 C CB    . ALA A 1 160 ? 50.155 -43.268 17.966  1.00 28.08  ? 160 ALA A CB    1 
ATOM   1196 N N     . ASN A 1 161 ? 51.105 -43.769 15.011  1.00 27.45  ? 161 ASN A N     1 
ATOM   1197 C CA    . ASN A 1 161 ? 51.272 -44.583 13.806  1.00 27.37  ? 161 ASN A CA    1 
ATOM   1198 C C     . ASN A 1 161 ? 52.732 -44.684 13.369  1.00 27.32  ? 161 ASN A C     1 
ATOM   1199 O O     . ASN A 1 161 ? 53.196 -45.762 12.999  1.00 27.24  ? 161 ASN A O     1 
ATOM   1200 C CB    . ASN A 1 161 ? 50.390 -44.069 12.662  1.00 27.21  ? 161 ASN A CB    1 
ATOM   1201 C CG    . ASN A 1 161 ? 48.947 -44.551 12.768  1.00 27.27  ? 161 ASN A CG    1 
ATOM   1202 O OD1   . ASN A 1 161 ? 48.677 -45.648 13.261  1.00 26.91  ? 161 ASN A OD1   1 
ATOM   1203 N ND2   . ASN A 1 161 ? 48.014 -43.732 12.292  1.00 27.26  ? 161 ASN A ND2   1 
ATOM   1204 N N     . ALA A 1 162 ? 53.451 -43.563 13.435  1.00 27.40  ? 162 ALA A N     1 
ATOM   1205 C CA    . ALA A 1 162 ? 54.876 -43.526 13.102  1.00 27.65  ? 162 ALA A CA    1 
ATOM   1206 C C     . ALA A 1 162 ? 55.690 -44.523 13.933  1.00 27.86  ? 162 ALA A C     1 
ATOM   1207 O O     . ALA A 1 162 ? 56.482 -45.288 13.383  1.00 27.90  ? 162 ALA A O     1 
ATOM   1208 C CB    . ALA A 1 162 ? 55.431 -42.109 13.252  1.00 27.50  ? 162 ALA A CB    1 
ATOM   1209 N N     . LYS A 1 163 ? 55.474 -44.522 15.248  1.00 28.19  ? 163 LYS A N     1 
ATOM   1210 C CA    . LYS A 1 163 ? 56.174 -45.440 16.156  1.00 28.55  ? 163 LYS A CA    1 
ATOM   1211 C C     . LYS A 1 163 ? 55.847 -46.912 15.888  1.00 28.64  ? 163 LYS A C     1 
ATOM   1212 O O     . LYS A 1 163 ? 56.691 -47.786 16.110  1.00 28.88  ? 163 LYS A O     1 
ATOM   1213 C CB    . LYS A 1 163 ? 55.903 -45.078 17.621  1.00 28.59  ? 163 LYS A CB    1 
ATOM   1214 C CG    . LYS A 1 163 ? 56.642 -43.832 18.090  1.00 28.52  ? 163 LYS A CG    1 
ATOM   1215 C CD    . LYS A 1 163 ? 56.378 -43.539 19.560  1.00 28.89  ? 163 LYS A CD    1 
ATOM   1216 C CE    . LYS A 1 163 ? 57.070 -42.257 19.999  1.00 29.38  ? 163 LYS A CE    1 
ATOM   1217 N NZ    . LYS A 1 163 ? 56.389 -41.049 19.462  1.00 30.08  ? 163 LYS A NZ    1 
ATOM   1218 N N     . ARG A 1 164 ? 54.632 -47.175 15.401  1.00 28.58  ? 164 ARG A N     1 
ATOM   1219 C CA    . ARG A 1 164 ? 54.225 -48.520 14.973  1.00 28.59  ? 164 ARG A CA    1 
ATOM   1220 C C     . ARG A 1 164 ? 55.019 -48.996 13.757  1.00 28.39  ? 164 ARG A C     1 
ATOM   1221 O O     . ARG A 1 164 ? 55.066 -50.190 13.464  1.00 28.28  ? 164 ARG A O     1 
ATOM   1222 C CB    . ARG A 1 164 ? 52.731 -48.555 14.634  1.00 28.63  ? 164 ARG A CB    1 
ATOM   1223 C CG    . ARG A 1 164 ? 51.803 -48.439 15.823  1.00 29.21  ? 164 ARG A CG    1 
ATOM   1224 C CD    . ARG A 1 164 ? 50.344 -48.613 15.419  1.00 29.21  ? 164 ARG A CD    1 
ATOM   1225 N NE    . ARG A 1 164 ? 49.468 -48.447 16.579  1.00 31.75  ? 164 ARG A NE    1 
ATOM   1226 C CZ    . ARG A 1 164 ? 48.829 -47.322 16.888  1.00 32.49  ? 164 ARG A CZ    1 
ATOM   1227 N NH1   . ARG A 1 164 ? 48.938 -46.250 16.114  1.00 33.39  ? 164 ARG A NH1   1 
ATOM   1228 N NH2   . ARG A 1 164 ? 48.064 -47.269 17.969  1.00 33.47  ? 164 ARG A NH2   1 
ATOM   1229 N N     . ASN A 1 165 ? 55.639 -48.054 13.051  1.00 28.19  ? 165 ASN A N     1 
ATOM   1230 C CA    . ASN A 1 165 ? 56.338 -48.355 11.808  1.00 27.91  ? 165 ASN A CA    1 
ATOM   1231 C C     . ASN A 1 165 ? 57.861 -48.191 11.877  1.00 28.03  ? 165 ASN A C     1 
ATOM   1232 O O     . ASN A 1 165 ? 58.558 -48.451 10.897  1.00 28.22  ? 165 ASN A O     1 
ATOM   1233 C CB    . ASN A 1 165 ? 55.743 -47.528 10.660  1.00 27.74  ? 165 ASN A CB    1 
ATOM   1234 C CG    . ASN A 1 165 ? 54.352 -47.999 10.263  1.00 27.37  ? 165 ASN A CG    1 
ATOM   1235 O OD1   . ASN A 1 165 ? 54.197 -49.042 9.627   1.00 26.91  ? 165 ASN A OD1   1 
ATOM   1236 N ND2   . ASN A 1 165 ? 53.333 -47.232 10.639  1.00 26.64  ? 165 ASN A ND2   1 
ATOM   1237 N N     . GLY A 1 166 ? 58.370 -47.768 13.032  1.00 27.90  ? 166 GLY A N     1 
ATOM   1238 C CA    . GLY A 1 166 ? 59.809 -47.568 13.225  1.00 27.90  ? 166 GLY A CA    1 
ATOM   1239 C C     . GLY A 1 166 ? 60.411 -46.451 12.386  1.00 27.83  ? 166 GLY A C     1 
ATOM   1240 O O     . GLY A 1 166 ? 61.592 -46.495 12.036  1.00 27.79  ? 166 GLY A O     1 
ATOM   1241 N N     . VAL A 1 167 ? 59.593 -45.451 12.063  1.00 27.61  ? 167 VAL A N     1 
ATOM   1242 C CA    . VAL A 1 167 ? 60.034 -44.290 11.292  1.00 27.39  ? 167 VAL A CA    1 
ATOM   1243 C C     . VAL A 1 167 ? 59.676 -43.010 12.034  1.00 27.35  ? 167 VAL A C     1 
ATOM   1244 O O     . VAL A 1 167 ? 58.784 -43.009 12.881  1.00 27.53  ? 167 VAL A O     1 
ATOM   1245 C CB    . VAL A 1 167 ? 59.414 -44.259 9.868   1.00 27.26  ? 167 VAL A CB    1 
ATOM   1246 C CG1   . VAL A 1 167 ? 59.968 -45.392 9.011   1.00 27.63  ? 167 VAL A CG1   1 
ATOM   1247 C CG2   . VAL A 1 167 ? 57.893 -44.316 9.933   1.00 27.33  ? 167 VAL A CG2   1 
ATOM   1248 N N     . ARG A 1 168 ? 60.370 -41.921 11.716  1.00 27.28  ? 168 ARG A N     1 
ATOM   1249 C CA    . ARG A 1 168 ? 60.148 -40.659 12.412  1.00 27.28  ? 168 ARG A CA    1 
ATOM   1250 C C     . ARG A 1 168 ? 60.026 -39.470 11.464  1.00 27.00  ? 168 ARG A C     1 
ATOM   1251 O O     . ARG A 1 168 ? 60.970 -38.679 11.324  1.00 26.89  ? 168 ARG A O     1 
ATOM   1252 C CB    . ARG A 1 168 ? 61.237 -40.417 13.461  1.00 27.47  ? 168 ARG A CB    1 
ATOM   1253 C CG    . ARG A 1 168 ? 61.033 -41.216 14.739  1.00 28.22  ? 168 ARG A CG    1 
ATOM   1254 C CD    . ARG A 1 168 ? 62.006 -40.810 15.813  1.00 29.43  ? 168 ARG A CD    1 
ATOM   1255 N NE    . ARG A 1 168 ? 61.681 -39.508 16.391  1.00 29.96  ? 168 ARG A NE    1 
ATOM   1256 C CZ    . ARG A 1 168 ? 62.333 -38.963 17.412  1.00 30.29  ? 168 ARG A CZ    1 
ATOM   1257 N NH1   . ARG A 1 168 ? 61.966 -37.774 17.872  1.00 30.68  ? 168 ARG A NH1   1 
ATOM   1258 N NH2   . ARG A 1 168 ? 63.349 -39.607 17.979  1.00 29.75  ? 168 ARG A NH2   1 
ATOM   1259 N N     . PRO A 1 169 ? 58.858 -39.336 10.810  1.00 26.72  ? 169 PRO A N     1 
ATOM   1260 C CA    . PRO A 1 169 ? 58.628 -38.102 10.069  1.00 26.58  ? 169 PRO A CA    1 
ATOM   1261 C C     . PRO A 1 169 ? 58.393 -36.951 11.040  1.00 26.43  ? 169 PRO A C     1 
ATOM   1262 O O     . PRO A 1 169 ? 58.166 -37.182 12.231  1.00 26.25  ? 169 PRO A O     1 
ATOM   1263 C CB    . PRO A 1 169 ? 57.361 -38.392 9.255   1.00 26.59  ? 169 PRO A CB    1 
ATOM   1264 C CG    . PRO A 1 169 ? 56.723 -39.574 9.879   1.00 26.74  ? 169 PRO A CG    1 
ATOM   1265 C CD    . PRO A 1 169 ? 57.723 -40.278 10.728  1.00 26.54  ? 169 PRO A CD    1 
ATOM   1266 N N     . ARG A 1 170 ? 58.484 -35.722 10.546  1.00 26.44  ? 170 ARG A N     1 
ATOM   1267 C CA    . ARG A 1 170 ? 58.080 -34.580 11.346  1.00 26.68  ? 170 ARG A CA    1 
ATOM   1268 C C     . ARG A 1 170 ? 56.596 -34.332 11.125  1.00 26.75  ? 170 ARG A C     1 
ATOM   1269 O O     . ARG A 1 170 ? 56.123 -34.338 9.988   1.00 26.73  ? 170 ARG A O     1 
ATOM   1270 C CB    . ARG A 1 170 ? 58.883 -33.328 10.992  1.00 26.65  ? 170 ARG A CB    1 
ATOM   1271 C CG    . ARG A 1 170 ? 58.506 -32.127 11.861  1.00 26.77  ? 170 ARG A CG    1 
ATOM   1272 C CD    . ARG A 1 170 ? 59.407 -30.928 11.635  1.00 27.54  ? 170 ARG A CD    1 
ATOM   1273 N NE    . ARG A 1 170 ? 60.819 -31.281 11.716  1.00 28.43  ? 170 ARG A NE    1 
ATOM   1274 C CZ    . ARG A 1 170 ? 61.485 -31.513 12.839  1.00 29.79  ? 170 ARG A CZ    1 
ATOM   1275 N NH1   . ARG A 1 170 ? 60.872 -31.438 14.021  1.00 30.63  ? 170 ARG A NH1   1 
ATOM   1276 N NH2   . ARG A 1 170 ? 62.773 -31.833 12.773  1.00 30.60  ? 170 ARG A NH2   1 
ATOM   1277 N N     . PHE A 1 171 ? 55.866 -34.132 12.217  1.00 26.99  ? 171 PHE A N     1 
ATOM   1278 C CA    . PHE A 1 171 ? 54.451 -33.786 12.144  1.00 27.19  ? 171 PHE A CA    1 
ATOM   1279 C C     . PHE A 1 171 ? 54.221 -32.415 12.757  1.00 27.57  ? 171 PHE A C     1 
ATOM   1280 O O     . PHE A 1 171 ? 54.822 -32.073 13.778  1.00 27.96  ? 171 PHE A O     1 
ATOM   1281 C CB    . PHE A 1 171 ? 53.581 -34.838 12.831  1.00 27.17  ? 171 PHE A CB    1 
ATOM   1282 C CG    . PHE A 1 171 ? 53.560 -36.163 12.125  1.00 27.06  ? 171 PHE A CG    1 
ATOM   1283 C CD1   . PHE A 1 171 ? 54.106 -37.290 12.727  1.00 27.02  ? 171 PHE A CD1   1 
ATOM   1284 C CD2   . PHE A 1 171 ? 52.998 -36.284 10.855  1.00 27.14  ? 171 PHE A CD2   1 
ATOM   1285 C CE1   . PHE A 1 171 ? 54.088 -38.524 12.077  1.00 27.45  ? 171 PHE A CE1   1 
ATOM   1286 C CE2   . PHE A 1 171 ? 52.977 -37.512 10.198  1.00 27.23  ? 171 PHE A CE2   1 
ATOM   1287 C CZ    . PHE A 1 171 ? 53.522 -38.633 10.813  1.00 26.94  ? 171 PHE A CZ    1 
ATOM   1288 N N     . LEU A 1 172 ? 53.340 -31.642 12.131  1.00 27.70  ? 172 LEU A N     1 
ATOM   1289 C CA    . LEU A 1 172 ? 53.181 -30.235 12.458  1.00 28.17  ? 172 LEU A CA    1 
ATOM   1290 C C     . LEU A 1 172 ? 51.748 -29.787 12.206  1.00 27.94  ? 172 LEU A C     1 
ATOM   1291 O O     . LEU A 1 172 ? 51.132 -30.198 11.228  1.00 27.85  ? 172 LEU A O     1 
ATOM   1292 C CB    . LEU A 1 172 ? 54.141 -29.420 11.587  1.00 28.17  ? 172 LEU A CB    1 
ATOM   1293 C CG    . LEU A 1 172 ? 54.532 -27.998 11.956  1.00 29.11  ? 172 LEU A CG    1 
ATOM   1294 C CD1   . LEU A 1 172 ? 55.409 -27.985 13.201  1.00 30.01  ? 172 LEU A CD1   1 
ATOM   1295 C CD2   . LEU A 1 172 ? 55.258 -27.364 10.781  1.00 28.95  ? 172 LEU A CD2   1 
ATOM   1296 N N     . GLU A 1 173 ? 51.221 -28.949 13.095  1.00 28.13  ? 173 GLU A N     1 
ATOM   1297 C CA    . GLU A 1 173 ? 49.919 -28.326 12.881  1.00 28.42  ? 173 GLU A CA    1 
ATOM   1298 C C     . GLU A 1 173 ? 50.041 -27.181 11.883  1.00 28.53  ? 173 GLU A C     1 
ATOM   1299 O O     . GLU A 1 173 ? 50.978 -26.381 11.955  1.00 28.60  ? 173 GLU A O     1 
ATOM   1300 C CB    . GLU A 1 173 ? 49.332 -27.805 14.196  1.00 28.49  ? 173 GLU A CB    1 
ATOM   1301 C CG    . GLU A 1 173 ? 47.899 -27.287 14.061  1.00 28.40  ? 173 GLU A CG    1 
ATOM   1302 C CD    . GLU A 1 173 ? 47.371 -26.637 15.330  1.00 28.94  ? 173 GLU A CD    1 
ATOM   1303 O OE1   . GLU A 1 173 ? 48.003 -26.786 16.399  1.00 29.59  ? 173 GLU A OE1   1 
ATOM   1304 O OE2   . GLU A 1 173 ? 46.313 -25.977 15.251  1.00 29.66  ? 173 GLU A OE2   1 
ATOM   1305 N N     . GLY A 1 174 ? 49.090 -27.108 10.958  1.00 28.58  ? 174 GLY A N     1 
ATOM   1306 C CA    . GLY A 1 174 ? 49.057 -26.029 9.980   1.00 28.90  ? 174 GLY A CA    1 
ATOM   1307 C C     . GLY A 1 174 ? 48.947 -26.520 8.553   1.00 29.06  ? 174 GLY A C     1 
ATOM   1308 O O     . GLY A 1 174 ? 48.515 -27.649 8.300   1.00 29.19  ? 174 GLY A O     1 
ATOM   1309 N N     . SER A 1 175 ? 49.347 -25.661 7.621   1.00 29.35  ? 175 SER A N     1 
ATOM   1310 C CA    . SER A 1 175 ? 49.220 -25.935 6.196   1.00 29.50  ? 175 SER A CA    1 
ATOM   1311 C C     . SER A 1 175 ? 50.517 -25.549 5.479   1.00 29.73  ? 175 SER A C     1 
ATOM   1312 O O     . SER A 1 175 ? 51.598 -25.662 6.058   1.00 29.63  ? 175 SER A O     1 
ATOM   1313 C CB    . SER A 1 175 ? 48.017 -25.172 5.627   1.00 29.54  ? 175 SER A CB    1 
ATOM   1314 O OG    . SER A 1 175 ? 47.646 -25.670 4.350   1.00 29.99  ? 175 SER A OG    1 
ATOM   1315 N N     . LEU A 1 176 ? 50.407 -25.104 4.226   1.00 29.82  ? 176 LEU A N     1 
ATOM   1316 C CA    . LEU A 1 176 ? 51.565 -24.698 3.422   1.00 30.17  ? 176 LEU A CA    1 
ATOM   1317 C C     . LEU A 1 176 ? 52.446 -23.652 4.095   1.00 30.17  ? 176 LEU A C     1 
ATOM   1318 O O     . LEU A 1 176 ? 53.677 -23.733 4.027   1.00 30.03  ? 176 LEU A O     1 
ATOM   1319 C CB    . LEU A 1 176 ? 51.107 -24.184 2.051   1.00 30.35  ? 176 LEU A CB    1 
ATOM   1320 C CG    . LEU A 1 176 ? 51.352 -24.991 0.772   1.00 30.94  ? 176 LEU A CG    1 
ATOM   1321 C CD1   . LEU A 1 176 ? 51.617 -26.467 1.008   1.00 31.52  ? 176 LEU A CD1   1 
ATOM   1322 C CD2   . LEU A 1 176 ? 50.193 -24.776 -0.197  1.00 30.76  ? 176 LEU A CD2   1 
ATOM   1323 N N     . GLU A 1 177 ? 51.805 -22.672 4.731   1.00 30.05  ? 177 GLU A N     1 
ATOM   1324 C CA    . GLU A 1 177 ? 52.494 -21.612 5.463   1.00 30.25  ? 177 GLU A CA    1 
ATOM   1325 C C     . GLU A 1 177 ? 53.421 -22.142 6.552   1.00 29.71  ? 177 GLU A C     1 
ATOM   1326 O O     . GLU A 1 177 ? 54.573 -21.715 6.654   1.00 29.65  ? 177 GLU A O     1 
ATOM   1327 C CB    . GLU A 1 177 ? 51.490 -20.611 6.062   1.00 30.71  ? 177 GLU A CB    1 
ATOM   1328 C CG    . GLU A 1 177 ? 49.999 -20.976 5.889   1.00 33.00  ? 177 GLU A CG    1 
ATOM   1329 C CD    . GLU A 1 177 ? 49.409 -21.864 6.994   1.00 35.81  ? 177 GLU A CD    1 
ATOM   1330 O OE1   . GLU A 1 177 ? 48.192 -21.716 7.261   1.00 36.89  ? 177 GLU A OE1   1 
ATOM   1331 O OE2   . GLU A 1 177 ? 50.131 -22.702 7.586   1.00 35.42  ? 177 GLU A OE2   1 
ATOM   1332 N N     . ALA A 1 178 ? 52.910 -23.073 7.356   1.00 28.95  ? 178 ALA A N     1 
ATOM   1333 C CA    . ALA A 1 178 ? 53.667 -23.646 8.466   1.00 28.51  ? 178 ALA A CA    1 
ATOM   1334 C C     . ALA A 1 178 ? 54.845 -24.482 7.973   1.00 28.09  ? 178 ALA A C     1 
ATOM   1335 O O     . ALA A 1 178 ? 55.871 -24.570 8.648   1.00 28.05  ? 178 ALA A O     1 
ATOM   1336 C CB    . ALA A 1 178 ? 52.756 -24.476 9.360   1.00 28.43  ? 178 ALA A CB    1 
ATOM   1337 N N     . ALA A 1 179 ? 54.690 -25.073 6.789   1.00 27.62  ? 179 ALA A N     1 
ATOM   1338 C CA    . ALA A 1 179 ? 55.697 -25.955 6.196   1.00 27.35  ? 179 ALA A CA    1 
ATOM   1339 C C     . ALA A 1 179 ? 56.868 -25.189 5.588   1.00 27.24  ? 179 ALA A C     1 
ATOM   1340 O O     . ALA A 1 179 ? 57.964 -25.734 5.442   1.00 27.09  ? 179 ALA A O     1 
ATOM   1341 C CB    . ALA A 1 179 ? 55.051 -26.844 5.142   1.00 27.19  ? 179 ALA A CB    1 
ATOM   1342 N N     . LEU A 1 180 ? 56.622 -23.926 5.246   1.00 27.10  ? 180 LEU A N     1 
ATOM   1343 C CA    . LEU A 1 180 ? 57.571 -23.071 4.520   1.00 27.26  ? 180 LEU A CA    1 
ATOM   1344 C C     . LEU A 1 180 ? 58.993 -23.038 5.120   1.00 26.62  ? 180 LEU A C     1 
ATOM   1345 O O     . LEU A 1 180 ? 59.964 -23.268 4.392   1.00 26.60  ? 180 LEU A O     1 
ATOM   1346 C CB    . LEU A 1 180 ? 56.985 -21.655 4.363   1.00 27.37  ? 180 LEU A CB    1 
ATOM   1347 C CG    . LEU A 1 180 ? 57.317 -20.732 3.184   1.00 28.69  ? 180 LEU A CG    1 
ATOM   1348 C CD1   . LEU A 1 180 ? 56.996 -21.364 1.834   1.00 28.92  ? 180 LEU A CD1   1 
ATOM   1349 C CD2   . LEU A 1 180 ? 56.557 -19.420 3.334   1.00 28.14  ? 180 LEU A CD2   1 
ATOM   1350 N N     . PRO A 1 181 ? 59.125 -22.776 6.440   1.00 26.13  ? 181 PRO A N     1 
ATOM   1351 C CA    . PRO A 1 181 ? 60.457 -22.726 7.060   1.00 25.74  ? 181 PRO A CA    1 
ATOM   1352 C C     . PRO A 1 181 ? 61.223 -24.056 7.063   1.00 25.24  ? 181 PRO A C     1 
ATOM   1353 O O     . PRO A 1 181 ? 62.426 -24.063 7.313   1.00 25.02  ? 181 PRO A O     1 
ATOM   1354 C CB    . PRO A 1 181 ? 60.157 -22.304 8.505   1.00 25.78  ? 181 PRO A CB    1 
ATOM   1355 C CG    . PRO A 1 181 ? 58.808 -21.690 8.460   1.00 26.12  ? 181 PRO A CG    1 
ATOM   1356 C CD    . PRO A 1 181 ? 58.073 -22.478 7.430   1.00 26.21  ? 181 PRO A CD    1 
ATOM   1357 N N     . PHE A 1 182 ? 60.529 -25.162 6.800   1.00 24.82  ? 182 PHE A N     1 
ATOM   1358 C CA    . PHE A 1 182 ? 61.161 -26.486 6.745   1.00 24.59  ? 182 PHE A CA    1 
ATOM   1359 C C     . PHE A 1 182 ? 61.494 -26.905 5.314   1.00 24.54  ? 182 PHE A C     1 
ATOM   1360 O O     . PHE A 1 182 ? 62.188 -27.902 5.096   1.00 24.62  ? 182 PHE A O     1 
ATOM   1361 C CB    . PHE A 1 182 ? 60.266 -27.537 7.407   1.00 24.38  ? 182 PHE A CB    1 
ATOM   1362 C CG    . PHE A 1 182 ? 60.031 -27.293 8.872   1.00 24.39  ? 182 PHE A CG    1 
ATOM   1363 C CD1   . PHE A 1 182 ? 58.918 -26.571 9.299   1.00 24.31  ? 182 PHE A CD1   1 
ATOM   1364 C CD2   . PHE A 1 182 ? 60.925 -27.772 9.822   1.00 23.15  ? 182 PHE A CD2   1 
ATOM   1365 C CE1   . PHE A 1 182 ? 58.701 -26.334 10.654  1.00 24.52  ? 182 PHE A CE1   1 
ATOM   1366 C CE2   . PHE A 1 182 ? 60.713 -27.542 11.179  1.00 23.48  ? 182 PHE A CE2   1 
ATOM   1367 C CZ    . PHE A 1 182 ? 59.597 -26.825 11.594  1.00 23.62  ? 182 PHE A CZ    1 
ATOM   1368 N N     . GLY A 1 183 ? 60.991 -26.143 4.347   1.00 24.47  ? 183 GLY A N     1 
ATOM   1369 C CA    . GLY A 1 183 ? 61.260 -26.395 2.929   1.00 24.44  ? 183 GLY A CA    1 
ATOM   1370 C C     . GLY A 1 183 ? 62.449 -25.599 2.418   1.00 24.45  ? 183 GLY A C     1 
ATOM   1371 O O     . GLY A 1 183 ? 63.262 -25.128 3.215   1.00 24.34  ? 183 GLY A O     1 
ATOM   1372 N N     . PRO A 1 184 ? 62.564 -25.439 1.083   1.00 24.53  ? 184 PRO A N     1 
ATOM   1373 C CA    . PRO A 1 184 ? 61.649 -25.970 0.066   1.00 24.37  ? 184 PRO A CA    1 
ATOM   1374 C C     . PRO A 1 184 ? 61.759 -27.488 -0.080  1.00 24.23  ? 184 PRO A C     1 
ATOM   1375 O O     . PRO A 1 184 ? 62.738 -28.089 0.369   1.00 24.24  ? 184 PRO A O     1 
ATOM   1376 C CB    . PRO A 1 184 ? 62.099 -25.265 -1.216  1.00 24.40  ? 184 PRO A CB    1 
ATOM   1377 C CG    . PRO A 1 184 ? 63.531 -24.949 -0.989  1.00 24.71  ? 184 PRO A CG    1 
ATOM   1378 C CD    . PRO A 1 184 ? 63.662 -24.659 0.480   1.00 24.62  ? 184 PRO A CD    1 
ATOM   1379 N N     . PHE A 1 185 ? 60.756 -28.095 -0.706  1.00 23.94  ? 185 PHE A N     1 
ATOM   1380 C CA    . PHE A 1 185 ? 60.669 -29.548 -0.792  1.00 23.93  ? 185 PHE A CA    1 
ATOM   1381 C C     . PHE A 1 185 ? 60.938 -30.075 -2.199  1.00 23.96  ? 185 PHE A C     1 
ATOM   1382 O O     . PHE A 1 185 ? 60.726 -29.371 -3.187  1.00 23.83  ? 185 PHE A O     1 
ATOM   1383 C CB    . PHE A 1 185 ? 59.303 -30.022 -0.281  1.00 23.65  ? 185 PHE A CB    1 
ATOM   1384 C CG    . PHE A 1 185 ? 59.050 -29.672 1.164   1.00 24.18  ? 185 PHE A CG    1 
ATOM   1385 C CD1   . PHE A 1 185 ? 58.435 -28.467 1.507   1.00 23.49  ? 185 PHE A CD1   1 
ATOM   1386 C CD2   . PHE A 1 185 ? 59.448 -30.533 2.181   1.00 24.10  ? 185 PHE A CD2   1 
ATOM   1387 C CE1   . PHE A 1 185 ? 58.212 -28.133 2.838   1.00 24.04  ? 185 PHE A CE1   1 
ATOM   1388 C CE2   . PHE A 1 185 ? 59.234 -30.202 3.522   1.00 23.85  ? 185 PHE A CE2   1 
ATOM   1389 C CZ    . PHE A 1 185 ? 58.615 -29.003 3.847   1.00 23.49  ? 185 PHE A CZ    1 
ATOM   1390 N N     . ASP A 1 186 ? 61.418 -31.315 -2.269  1.00 24.06  ? 186 ASP A N     1 
ATOM   1391 C CA    . ASP A 1 186 ? 61.607 -32.021 -3.536  1.00 24.11  ? 186 ASP A CA    1 
ATOM   1392 C C     . ASP A 1 186 ? 60.296 -32.572 -4.073  1.00 24.36  ? 186 ASP A C     1 
ATOM   1393 O O     . ASP A 1 186 ? 60.087 -32.637 -5.290  1.00 23.77  ? 186 ASP A O     1 
ATOM   1394 C CB    . ASP A 1 186 ? 62.592 -33.174 -3.349  1.00 24.20  ? 186 ASP A CB    1 
ATOM   1395 C CG    . ASP A 1 186 ? 63.975 -32.693 -2.996  1.00 24.31  ? 186 ASP A CG    1 
ATOM   1396 O OD1   . ASP A 1 186 ? 64.410 -32.905 -1.846  1.00 24.57  ? 186 ASP A OD1   1 
ATOM   1397 O OD2   . ASP A 1 186 ? 64.609 -32.077 -3.865  1.00 24.91  ? 186 ASP A OD2   1 
ATOM   1398 N N     . LEU A 1 187 ? 59.420 -32.972 -3.154  1.00 24.56  ? 187 LEU A N     1 
ATOM   1399 C CA    . LEU A 1 187 ? 58.161 -33.605 -3.513  1.00 24.98  ? 187 LEU A CA    1 
ATOM   1400 C C     . LEU A 1 187 ? 57.028 -33.182 -2.590  1.00 24.96  ? 187 LEU A C     1 
ATOM   1401 O O     . LEU A 1 187 ? 57.171 -33.170 -1.362  1.00 24.78  ? 187 LEU A O     1 
ATOM   1402 C CB    . LEU A 1 187 ? 58.307 -35.132 -3.519  1.00 25.31  ? 187 LEU A CB    1 
ATOM   1403 C CG    . LEU A 1 187 ? 57.245 -35.950 -4.269  1.00 26.68  ? 187 LEU A CG    1 
ATOM   1404 C CD1   . LEU A 1 187 ? 57.865 -37.178 -4.905  1.00 28.19  ? 187 LEU A CD1   1 
ATOM   1405 C CD2   . LEU A 1 187 ? 56.112 -36.353 -3.343  1.00 28.44  ? 187 LEU A CD2   1 
ATOM   1406 N N     . LEU A 1 188 ? 55.902 -32.829 -3.199  1.00 24.84  ? 188 LEU A N     1 
ATOM   1407 C CA    . LEU A 1 188 ? 54.676 -32.578 -2.465  1.00 24.85  ? 188 LEU A CA    1 
ATOM   1408 C C     . LEU A 1 188 ? 53.672 -33.674 -2.776  1.00 24.82  ? 188 LEU A C     1 
ATOM   1409 O O     . LEU A 1 188 ? 53.429 -33.993 -3.941  1.00 24.79  ? 188 LEU A O     1 
ATOM   1410 C CB    . LEU A 1 188 ? 54.094 -31.202 -2.823  1.00 24.99  ? 188 LEU A CB    1 
ATOM   1411 C CG    . LEU A 1 188 ? 52.623 -30.974 -2.452  1.00 25.51  ? 188 LEU A CG    1 
ATOM   1412 C CD1   . LEU A 1 188 ? 52.473 -30.642 -0.976  1.00 25.74  ? 188 LEU A CD1   1 
ATOM   1413 C CD2   . LEU A 1 188 ? 52.016 -29.886 -3.317  1.00 26.61  ? 188 LEU A CD2   1 
ATOM   1414 N N     . VAL A 1 189 ? 53.108 -34.267 -1.730  1.00 24.90  ? 189 VAL A N     1 
ATOM   1415 C CA    . VAL A 1 189 ? 51.993 -35.194 -1.892  1.00 24.88  ? 189 VAL A CA    1 
ATOM   1416 C C     . VAL A 1 189 ? 50.790 -34.627 -1.129  1.00 25.19  ? 189 VAL A C     1 
ATOM   1417 O O     . VAL A 1 189 ? 50.901 -34.268 0.050   1.00 25.23  ? 189 VAL A O     1 
ATOM   1418 C CB    . VAL A 1 189 ? 52.370 -36.664 -1.491  1.00 24.96  ? 189 VAL A CB    1 
ATOM   1419 C CG1   . VAL A 1 189 ? 52.726 -36.791 0.001   1.00 25.00  ? 189 VAL A CG1   1 
ATOM   1420 C CG2   . VAL A 1 189 ? 51.260 -37.649 -1.880  1.00 24.55  ? 189 VAL A CG2   1 
ATOM   1421 N N     . ALA A 1 190 ? 49.658 -34.511 -1.818  1.00 25.33  ? 190 ALA A N     1 
ATOM   1422 C CA    . ALA A 1 190 ? 48.473 -33.879 -1.243  1.00 25.59  ? 190 ALA A CA    1 
ATOM   1423 C C     . ALA A 1 190 ? 47.189 -34.605 -1.632  1.00 25.88  ? 190 ALA A C     1 
ATOM   1424 O O     . ALA A 1 190 ? 46.728 -34.518 -2.773  1.00 25.75  ? 190 ALA A O     1 
ATOM   1425 C CB    . ALA A 1 190 ? 48.405 -32.401 -1.642  1.00 25.25  ? 190 ALA A CB    1 
ATOM   1426 N N     . ASN A 1 191 ? 46.637 -35.341 -0.673  1.00 26.32  ? 191 ASN A N     1 
ATOM   1427 C CA    . ASN A 1 191 ? 45.344 -35.982 -0.838  1.00 26.77  ? 191 ASN A CA    1 
ATOM   1428 C C     . ASN A 1 191 ? 44.274 -35.082 -0.241  1.00 27.09  ? 191 ASN A C     1 
ATOM   1429 O O     . ASN A 1 191 ? 43.921 -35.199 0.937   1.00 27.20  ? 191 ASN A O     1 
ATOM   1430 C CB    . ASN A 1 191 ? 45.341 -37.364 -0.181  1.00 26.93  ? 191 ASN A CB    1 
ATOM   1431 C CG    . ASN A 1 191 ? 44.064 -38.148 -0.449  1.00 27.06  ? 191 ASN A CG    1 
ATOM   1432 O OD1   . ASN A 1 191 ? 43.185 -37.704 -1.187  1.00 27.13  ? 191 ASN A OD1   1 
ATOM   1433 N ND2   . ASN A 1 191 ? 43.964 -39.327 0.150   1.00 27.03  ? 191 ASN A ND2   1 
ATOM   1434 N N     . LEU A 1 192 ? 43.776 -34.163 -1.061  1.00 27.31  ? 192 LEU A N     1 
ATOM   1435 C CA    . LEU A 1 192 ? 42.799 -33.187 -0.607  1.00 27.84  ? 192 LEU A CA    1 
ATOM   1436 C C     . LEU A 1 192 ? 41.549 -33.271 -1.479  1.00 28.29  ? 192 LEU A C     1 
ATOM   1437 O O     . LEU A 1 192 ? 40.883 -34.307 -1.498  1.00 28.60  ? 192 LEU A O     1 
ATOM   1438 C CB    . LEU A 1 192 ? 43.411 -31.775 -0.591  1.00 27.68  ? 192 LEU A CB    1 
ATOM   1439 C CG    . LEU A 1 192 ? 44.654 -31.566 0.290   1.00 27.71  ? 192 LEU A CG    1 
ATOM   1440 C CD1   . LEU A 1 192 ? 45.274 -30.190 0.062   1.00 27.78  ? 192 LEU A CD1   1 
ATOM   1441 C CD2   . LEU A 1 192 ? 44.346 -31.783 1.771   1.00 27.22  ? 192 LEU A CD2   1 
ATOM   1442 N N     . TYR A 1 193 ? 41.228 -32.185 -2.176  1.00 28.78  ? 193 TYR A N     1 
ATOM   1443 C CA    . TYR A 1 193 ? 40.113 -32.153 -3.130  1.00 29.17  ? 193 TYR A CA    1 
ATOM   1444 C C     . TYR A 1 193 ? 40.382 -31.116 -4.213  1.00 28.87  ? 193 TYR A C     1 
ATOM   1445 O O     . TYR A 1 193 ? 41.146 -30.169 -4.000  1.00 28.75  ? 193 TYR A O     1 
ATOM   1446 C CB    . TYR A 1 193 ? 38.756 -31.925 -2.440  1.00 29.66  ? 193 TYR A CB    1 
ATOM   1447 C CG    . TYR A 1 193 ? 38.634 -30.646 -1.637  1.00 30.49  ? 193 TYR A CG    1 
ATOM   1448 C CD1   . TYR A 1 193 ? 38.187 -29.465 -2.231  1.00 30.36  ? 193 TYR A CD1   1 
ATOM   1449 C CD2   . TYR A 1 193 ? 38.952 -30.620 -0.277  1.00 31.19  ? 193 TYR A CD2   1 
ATOM   1450 C CE1   . TYR A 1 193 ? 38.070 -28.291 -1.497  1.00 30.99  ? 193 TYR A CE1   1 
ATOM   1451 C CE2   . TYR A 1 193 ? 38.838 -29.447 0.466   1.00 31.10  ? 193 TYR A CE2   1 
ATOM   1452 C CZ    . TYR A 1 193 ? 38.396 -28.290 -0.149  1.00 31.06  ? 193 TYR A CZ    1 
ATOM   1453 O OH    . TYR A 1 193 ? 38.281 -27.126 0.579   1.00 31.45  ? 193 TYR A OH    1 
ATOM   1454 N N     . ALA A 1 194 ? 39.751 -31.312 -5.368  1.00 28.50  ? 194 ALA A N     1 
ATOM   1455 C CA    . ALA A 1 194 ? 40.025 -30.536 -6.578  1.00 28.35  ? 194 ALA A CA    1 
ATOM   1456 C C     . ALA A 1 194 ? 40.081 -29.022 -6.386  1.00 28.28  ? 194 ALA A C     1 
ATOM   1457 O O     . ALA A 1 194 ? 41.030 -28.374 -6.828  1.00 28.41  ? 194 ALA A O     1 
ATOM   1458 C CB    . ALA A 1 194 ? 39.018 -30.886 -7.660  1.00 28.22  ? 194 ALA A CB    1 
ATOM   1459 N N     . GLU A 1 195 ? 39.063 -28.470 -5.730  1.00 28.22  ? 195 GLU A N     1 
ATOM   1460 C CA    . GLU A 1 195 ? 38.915 -27.021 -5.598  1.00 28.08  ? 195 GLU A CA    1 
ATOM   1461 C C     . GLU A 1 195 ? 39.999 -26.406 -4.717  1.00 27.97  ? 195 GLU A C     1 
ATOM   1462 O O     . GLU A 1 195 ? 40.401 -25.261 -4.928  1.00 27.85  ? 195 GLU A O     1 
ATOM   1463 C CB    . GLU A 1 195 ? 37.523 -26.666 -5.066  1.00 28.07  ? 195 GLU A CB    1 
ATOM   1464 C CG    . GLU A 1 195 ? 36.376 -26.996 -6.033  1.00 28.60  ? 195 GLU A CG    1 
ATOM   1465 C CD    . GLU A 1 195 ? 35.876 -28.438 -5.929  1.00 29.22  ? 195 GLU A CD    1 
ATOM   1466 O OE1   . GLU A 1 195 ? 36.414 -29.229 -5.122  1.00 29.54  ? 195 GLU A OE1   1 
ATOM   1467 O OE2   . GLU A 1 195 ? 34.931 -28.780 -6.667  1.00 30.22  ? 195 GLU A OE2   1 
ATOM   1468 N N     . LEU A 1 196 ? 40.467 -27.172 -3.735  1.00 27.79  ? 196 LEU A N     1 
ATOM   1469 C CA    . LEU A 1 196 ? 41.567 -26.731 -2.884  1.00 27.76  ? 196 LEU A CA    1 
ATOM   1470 C C     . LEU A 1 196 ? 42.900 -26.758 -3.640  1.00 27.62  ? 196 LEU A C     1 
ATOM   1471 O O     . LEU A 1 196 ? 43.672 -25.806 -3.561  1.00 27.58  ? 196 LEU A O     1 
ATOM   1472 C CB    . LEU A 1 196 ? 41.628 -27.560 -1.595  1.00 27.65  ? 196 LEU A CB    1 
ATOM   1473 C CG    . LEU A 1 196 ? 42.523 -27.085 -0.443  1.00 27.87  ? 196 LEU A CG    1 
ATOM   1474 C CD1   . LEU A 1 196 ? 42.303 -25.608 -0.083  1.00 27.93  ? 196 LEU A CD1   1 
ATOM   1475 C CD2   . LEU A 1 196 ? 42.300 -27.976 0.771   1.00 27.60  ? 196 LEU A CD2   1 
ATOM   1476 N N     . HIS A 1 197 ? 43.155 -27.833 -4.386  1.00 27.62  ? 197 HIS A N     1 
ATOM   1477 C CA    . HIS A 1 197 ? 44.340 -27.908 -5.248  1.00 27.63  ? 197 HIS A CA    1 
ATOM   1478 C C     . HIS A 1 197 ? 44.417 -26.707 -6.195  1.00 27.69  ? 197 HIS A C     1 
ATOM   1479 O O     . HIS A 1 197 ? 45.487 -26.122 -6.379  1.00 27.85  ? 197 HIS A O     1 
ATOM   1480 C CB    . HIS A 1 197 ? 44.358 -29.205 -6.069  1.00 27.47  ? 197 HIS A CB    1 
ATOM   1481 C CG    . HIS A 1 197 ? 44.577 -30.444 -5.256  1.00 27.13  ? 197 HIS A CG    1 
ATOM   1482 N ND1   . HIS A 1 197 ? 45.596 -30.564 -4.335  1.00 26.90  ? 197 HIS A ND1   1 
ATOM   1483 C CD2   . HIS A 1 197 ? 43.924 -31.631 -5.251  1.00 26.91  ? 197 HIS A CD2   1 
ATOM   1484 C CE1   . HIS A 1 197 ? 45.549 -31.764 -3.784  1.00 26.88  ? 197 HIS A CE1   1 
ATOM   1485 N NE2   . HIS A 1 197 ? 44.544 -32.431 -4.322  1.00 26.33  ? 197 HIS A NE2   1 
ATOM   1486 N N     . ALA A 1 198 ? 43.276 -26.350 -6.783  1.00 27.69  ? 198 ALA A N     1 
ATOM   1487 C CA    . ALA A 1 198 ? 43.193 -25.241 -7.734  1.00 27.64  ? 198 ALA A CA    1 
ATOM   1488 C C     . ALA A 1 198 ? 43.535 -23.895 -7.091  1.00 27.59  ? 198 ALA A C     1 
ATOM   1489 O O     . ALA A 1 198 ? 44.245 -23.083 -7.684  1.00 27.69  ? 198 ALA A O     1 
ATOM   1490 C CB    . ALA A 1 198 ? 41.811 -25.197 -8.387  1.00 27.62  ? 198 ALA A CB    1 
ATOM   1491 N N     . ALA A 1 199 ? 43.036 -23.677 -5.876  1.00 27.53  ? 199 ALA A N     1 
ATOM   1492 C CA    . ALA A 1 199 ? 43.295 -22.449 -5.125  1.00 27.57  ? 199 ALA A CA    1 
ATOM   1493 C C     . ALA A 1 199 ? 44.738 -22.361 -4.621  1.00 27.57  ? 199 ALA A C     1 
ATOM   1494 O O     . ALA A 1 199 ? 45.276 -21.267 -4.448  1.00 27.52  ? 199 ALA A O     1 
ATOM   1495 C CB    . ALA A 1 199 ? 42.323 -22.332 -3.959  1.00 27.54  ? 199 ALA A CB    1 
ATOM   1496 N N     . LEU A 1 200 ? 45.354 -23.519 -4.393  1.00 27.54  ? 200 LEU A N     1 
ATOM   1497 C CA    . LEU A 1 200 ? 46.685 -23.603 -3.792  1.00 27.46  ? 200 LEU A CA    1 
ATOM   1498 C C     . LEU A 1 200 ? 47.819 -23.757 -4.805  1.00 27.34  ? 200 LEU A C     1 
ATOM   1499 O O     . LEU A 1 200 ? 48.994 -23.671 -4.439  1.00 27.33  ? 200 LEU A O     1 
ATOM   1500 C CB    . LEU A 1 200 ? 46.724 -24.771 -2.803  1.00 27.55  ? 200 LEU A CB    1 
ATOM   1501 C CG    . LEU A 1 200 ? 46.610 -24.550 -1.290  1.00 27.96  ? 200 LEU A CG    1 
ATOM   1502 C CD1   . LEU A 1 200 ? 45.748 -23.350 -0.897  1.00 28.04  ? 200 LEU A CD1   1 
ATOM   1503 C CD2   . LEU A 1 200 ? 46.126 -25.822 -0.616  1.00 27.42  ? 200 LEU A CD2   1 
ATOM   1504 N N     . ALA A 1 201 ? 47.467 -23.978 -6.069  1.00 27.20  ? 201 ALA A N     1 
ATOM   1505 C CA    . ALA A 1 201 ? 48.449 -24.229 -7.129  1.00 27.25  ? 201 ALA A CA    1 
ATOM   1506 C C     . ALA A 1 201 ? 49.671 -23.286 -7.140  1.00 27.31  ? 201 ALA A C     1 
ATOM   1507 O O     . ALA A 1 201 ? 50.802 -23.770 -7.213  1.00 27.29  ? 201 ALA A O     1 
ATOM   1508 C CB    . ALA A 1 201 ? 47.768 -24.274 -8.504  1.00 27.29  ? 201 ALA A CB    1 
ATOM   1509 N N     . PRO A 1 202 ? 49.456 -21.949 -7.063  1.00 27.36  ? 202 PRO A N     1 
ATOM   1510 C CA    . PRO A 1 202 ? 50.612 -21.041 -7.012  1.00 27.51  ? 202 PRO A CA    1 
ATOM   1511 C C     . PRO A 1 202 ? 51.516 -21.257 -5.794  1.00 27.70  ? 202 PRO A C     1 
ATOM   1512 O O     . PRO A 1 202 ? 52.737 -21.135 -5.903  1.00 27.73  ? 202 PRO A O     1 
ATOM   1513 C CB    . PRO A 1 202 ? 49.965 -19.650 -6.947  1.00 27.49  ? 202 PRO A CB    1 
ATOM   1514 C CG    . PRO A 1 202 ? 48.607 -19.837 -7.520  1.00 27.43  ? 202 PRO A CG    1 
ATOM   1515 C CD    . PRO A 1 202 ? 48.188 -21.193 -7.052  1.00 27.27  ? 202 PRO A CD    1 
ATOM   1516 N N     . ARG A 1 203 ? 50.915 -21.578 -4.653  1.00 27.87  ? 203 ARG A N     1 
ATOM   1517 C CA    . ARG A 1 203 ? 51.670 -21.833 -3.429  1.00 28.19  ? 203 ARG A CA    1 
ATOM   1518 C C     . ARG A 1 203 ? 52.352 -23.201 -3.445  1.00 27.85  ? 203 ARG A C     1 
ATOM   1519 O O     . ARG A 1 203 ? 53.385 -23.387 -2.798  1.00 27.62  ? 203 ARG A O     1 
ATOM   1520 C CB    . ARG A 1 203 ? 50.770 -21.683 -2.203  1.00 28.51  ? 203 ARG A CB    1 
ATOM   1521 C CG    . ARG A 1 203 ? 50.268 -20.261 -1.993  1.00 30.47  ? 203 ARG A CG    1 
ATOM   1522 C CD    . ARG A 1 203 ? 49.250 -20.195 -0.875  1.00 34.76  ? 203 ARG A CD    1 
ATOM   1523 N NE    . ARG A 1 203 ? 49.885 -20.170 0.441   1.00 38.25  ? 203 ARG A NE    1 
ATOM   1524 C CZ    . ARG A 1 203 ? 49.227 -20.159 1.599   1.00 39.89  ? 203 ARG A CZ    1 
ATOM   1525 N NH1   . ARG A 1 203 ? 47.897 -20.174 1.626   1.00 40.80  ? 203 ARG A NH1   1 
ATOM   1526 N NH2   . ARG A 1 203 ? 49.906 -20.135 2.738   1.00 40.34  ? 203 ARG A NH2   1 
ATOM   1527 N N     . TYR A 1 204 ? 51.774 -24.152 -4.181  1.00 27.64  ? 204 TYR A N     1 
ATOM   1528 C CA    . TYR A 1 204 ? 52.438 -25.432 -4.439  1.00 27.51  ? 204 TYR A CA    1 
ATOM   1529 C C     . TYR A 1 204 ? 53.793 -25.209 -5.111  1.00 27.70  ? 204 TYR A C     1 
ATOM   1530 O O     . TYR A 1 204 ? 54.792 -25.819 -4.723  1.00 27.67  ? 204 TYR A O     1 
ATOM   1531 C CB    . TYR A 1 204 ? 51.575 -26.349 -5.318  1.00 27.49  ? 204 TYR A CB    1 
ATOM   1532 C CG    . TYR A 1 204 ? 50.383 -26.995 -4.631  1.00 27.29  ? 204 TYR A CG    1 
ATOM   1533 C CD1   . TYR A 1 204 ? 49.396 -27.636 -5.380  1.00 27.06  ? 204 TYR A CD1   1 
ATOM   1534 C CD2   . TYR A 1 204 ? 50.236 -26.960 -3.243  1.00 27.04  ? 204 TYR A CD2   1 
ATOM   1535 C CE1   . TYR A 1 204 ? 48.303 -28.237 -4.769  1.00 27.10  ? 204 TYR A CE1   1 
ATOM   1536 C CE2   . TYR A 1 204 ? 49.146 -27.560 -2.623  1.00 27.38  ? 204 TYR A CE2   1 
ATOM   1537 C CZ    . TYR A 1 204 ? 48.187 -28.198 -3.392  1.00 27.17  ? 204 TYR A CZ    1 
ATOM   1538 O OH    . TYR A 1 204 ? 47.107 -28.788 -2.786  1.00 27.56  ? 204 TYR A OH    1 
ATOM   1539 N N     . ARG A 1 205 ? 53.820 -24.331 -6.115  1.00 27.86  ? 205 ARG A N     1 
ATOM   1540 C CA    . ARG A 1 205 ? 55.057 -24.010 -6.827  1.00 28.16  ? 205 ARG A CA    1 
ATOM   1541 C C     . ARG A 1 205 ? 56.090 -23.370 -5.903  1.00 28.02  ? 205 ARG A C     1 
ATOM   1542 O O     . ARG A 1 205 ? 57.273 -23.707 -5.966  1.00 27.99  ? 205 ARG A O     1 
ATOM   1543 C CB    . ARG A 1 205 ? 54.793 -23.102 -8.031  1.00 28.27  ? 205 ARG A CB    1 
ATOM   1544 C CG    . ARG A 1 205 ? 55.959 -23.074 -9.012  1.00 29.52  ? 205 ARG A CG    1 
ATOM   1545 C CD    . ARG A 1 205 ? 55.800 -22.021 -10.087 1.00 31.57  ? 205 ARG A CD    1 
ATOM   1546 N NE    . ARG A 1 205 ? 56.878 -22.097 -11.074 1.00 32.51  ? 205 ARG A NE    1 
ATOM   1547 C CZ    . ARG A 1 205 ? 58.026 -21.428 -10.993 1.00 32.99  ? 205 ARG A CZ    1 
ATOM   1548 N NH1   . ARG A 1 205 ? 58.264 -20.617 -9.968  1.00 33.23  ? 205 ARG A NH1   1 
ATOM   1549 N NH2   . ARG A 1 205 ? 58.941 -21.569 -11.944 1.00 33.14  ? 205 ARG A NH2   1 
ATOM   1550 N N     . GLU A 1 206 ? 55.628 -22.463 -5.045  1.00 28.02  ? 206 GLU A N     1 
ATOM   1551 C CA    . GLU A 1 206 ? 56.487 -21.785 -4.072  1.00 28.43  ? 206 GLU A CA    1 
ATOM   1552 C C     . GLU A 1 206 ? 57.045 -22.755 -3.022  1.00 27.87  ? 206 GLU A C     1 
ATOM   1553 O O     . GLU A 1 206 ? 58.111 -22.516 -2.453  1.00 27.57  ? 206 GLU A O     1 
ATOM   1554 C CB    . GLU A 1 206 ? 55.725 -20.634 -3.392  1.00 28.39  ? 206 GLU A CB    1 
ATOM   1555 C CG    . GLU A 1 206 ? 55.299 -19.514 -4.350  1.00 29.62  ? 206 GLU A CG    1 
ATOM   1556 C CD    . GLU A 1 206 ? 54.378 -18.465 -3.722  1.00 30.29  ? 206 GLU A CD    1 
ATOM   1557 O OE1   . GLU A 1 206 ? 54.029 -17.494 -4.431  1.00 32.41  ? 206 GLU A OE1   1 
ATOM   1558 O OE2   . GLU A 1 206 ? 54.000 -18.596 -2.533  1.00 33.20  ? 206 GLU A OE2   1 
ATOM   1559 N N     . ALA A 1 207 ? 56.329 -23.854 -2.790  1.00 27.55  ? 207 ALA A N     1 
ATOM   1560 C CA    . ALA A 1 207 ? 56.708 -24.838 -1.770  1.00 27.43  ? 207 ALA A CA    1 
ATOM   1561 C C     . ALA A 1 207 ? 57.830 -25.771 -2.224  1.00 27.21  ? 207 ALA A C     1 
ATOM   1562 O O     . ALA A 1 207 ? 58.499 -26.396 -1.398  1.00 27.23  ? 207 ALA A O     1 
ATOM   1563 C CB    . ALA A 1 207 ? 55.493 -25.652 -1.339  1.00 27.40  ? 207 ALA A CB    1 
ATOM   1564 N N     . LEU A 1 208 ? 58.031 -25.851 -3.536  1.00 26.84  ? 208 LEU A N     1 
ATOM   1565 C CA    . LEU A 1 208 ? 58.949 -26.817 -4.125  1.00 26.66  ? 208 LEU A CA    1 
ATOM   1566 C C     . LEU A 1 208 ? 60.237 -26.188 -4.652  1.00 26.52  ? 208 LEU A C     1 
ATOM   1567 O O     . LEU A 1 208 ? 60.238 -25.039 -5.099  1.00 26.38  ? 208 LEU A O     1 
ATOM   1568 C CB    . LEU A 1 208 ? 58.250 -27.574 -5.257  1.00 26.80  ? 208 LEU A CB    1 
ATOM   1569 C CG    . LEU A 1 208 ? 57.011 -28.416 -4.932  1.00 26.78  ? 208 LEU A CG    1 
ATOM   1570 C CD1   . LEU A 1 208 ? 56.266 -28.784 -6.213  1.00 27.01  ? 208 LEU A CD1   1 
ATOM   1571 C CD2   . LEU A 1 208 ? 57.394 -29.663 -4.144  1.00 26.35  ? 208 LEU A CD2   1 
ATOM   1572 N N     . VAL A 1 209 ? 61.325 -26.956 -4.599  1.00 26.36  ? 209 VAL A N     1 
ATOM   1573 C CA    . VAL A 1 209 ? 62.586 -26.580 -5.247  1.00 26.46  ? 209 VAL A CA    1 
ATOM   1574 C C     . VAL A 1 209 ? 62.370 -26.514 -6.762  1.00 26.75  ? 209 VAL A C     1 
ATOM   1575 O O     . VAL A 1 209 ? 61.440 -27.146 -7.274  1.00 26.61  ? 209 VAL A O     1 
ATOM   1576 C CB    . VAL A 1 209 ? 63.738 -27.590 -4.943  1.00 26.28  ? 209 VAL A CB    1 
ATOM   1577 C CG1   . VAL A 1 209 ? 64.110 -27.569 -3.469  1.00 26.39  ? 209 VAL A CG1   1 
ATOM   1578 C CG2   . VAL A 1 209 ? 63.381 -29.010 -5.399  1.00 26.04  ? 209 VAL A CG2   1 
ATOM   1579 N N     . PRO A 1 210 ? 63.199 -25.728 -7.479  1.00 27.01  ? 210 PRO A N     1 
ATOM   1580 C CA    . PRO A 1 210 ? 63.181 -25.818 -8.941  1.00 27.33  ? 210 PRO A CA    1 
ATOM   1581 C C     . PRO A 1 210 ? 63.384 -27.266 -9.397  1.00 27.49  ? 210 PRO A C     1 
ATOM   1582 O O     . PRO A 1 210 ? 64.272 -27.958 -8.891  1.00 27.75  ? 210 PRO A O     1 
ATOM   1583 C CB    . PRO A 1 210 ? 64.367 -24.947 -9.356  1.00 27.26  ? 210 PRO A CB    1 
ATOM   1584 C CG    . PRO A 1 210 ? 64.488 -23.944 -8.253  1.00 27.53  ? 210 PRO A CG    1 
ATOM   1585 C CD    . PRO A 1 210 ? 64.156 -24.712 -7.003  1.00 27.07  ? 210 PRO A CD    1 
ATOM   1586 N N     . GLY A 1 211 ? 62.541 -27.724 -10.317 1.00 27.60  ? 211 GLY A N     1 
ATOM   1587 C CA    . GLY A 1 211 ? 62.569 -29.114 -10.770 1.00 27.54  ? 211 GLY A CA    1 
ATOM   1588 C C     . GLY A 1 211 ? 61.786 -30.073 -9.889  1.00 27.83  ? 211 GLY A C     1 
ATOM   1589 O O     . GLY A 1 211 ? 61.674 -31.261 -10.211 1.00 28.07  ? 211 GLY A O     1 
ATOM   1590 N N     . GLY A 1 212 ? 61.241 -29.562 -8.783  1.00 27.56  ? 212 GLY A N     1 
ATOM   1591 C CA    . GLY A 1 212 ? 60.470 -30.369 -7.835  1.00 27.44  ? 212 GLY A CA    1 
ATOM   1592 C C     . GLY A 1 212 ? 59.142 -30.820 -8.411  1.00 27.43  ? 212 GLY A C     1 
ATOM   1593 O O     . GLY A 1 212 ? 58.731 -30.355 -9.480  1.00 27.50  ? 212 GLY A O     1 
ATOM   1594 N N     . ARG A 1 213 ? 58.470 -31.735 -7.717  1.00 27.29  ? 213 ARG A N     1 
ATOM   1595 C CA    . ARG A 1 213 ? 57.207 -32.274 -8.227  1.00 27.29  ? 213 ARG A CA    1 
ATOM   1596 C C     . ARG A 1 213 ? 56.067 -32.374 -7.213  1.00 26.77  ? 213 ARG A C     1 
ATOM   1597 O O     . ARG A 1 213 ? 56.287 -32.413 -5.996  1.00 26.77  ? 213 ARG A O     1 
ATOM   1598 C CB    . ARG A 1 213 ? 57.418 -33.598 -8.982  1.00 27.52  ? 213 ARG A CB    1 
ATOM   1599 C CG    . ARG A 1 213 ? 57.997 -34.750 -8.181  1.00 28.01  ? 213 ARG A CG    1 
ATOM   1600 C CD    . ARG A 1 213 ? 58.395 -35.887 -9.123  1.00 27.96  ? 213 ARG A CD    1 
ATOM   1601 N NE    . ARG A 1 213 ? 59.271 -35.422 -10.202 1.00 29.02  ? 213 ARG A NE    1 
ATOM   1602 C CZ    . ARG A 1 213 ? 59.555 -36.111 -11.306 1.00 29.45  ? 213 ARG A CZ    1 
ATOM   1603 N NH1   . ARG A 1 213 ? 59.037 -37.318 -11.510 1.00 29.84  ? 213 ARG A NH1   1 
ATOM   1604 N NH2   . ARG A 1 213 ? 60.363 -35.589 -12.215 1.00 29.24  ? 213 ARG A NH2   1 
ATOM   1605 N N     . ALA A 1 214 ? 54.847 -32.409 -7.743  1.00 26.03  ? 214 ALA A N     1 
ATOM   1606 C CA    . ALA A 1 214 ? 53.640 -32.446 -6.933  1.00 25.57  ? 214 ALA A CA    1 
ATOM   1607 C C     . ALA A 1 214 ? 52.779 -33.640 -7.311  1.00 25.41  ? 214 ALA A C     1 
ATOM   1608 O O     . ALA A 1 214 ? 52.535 -33.891 -8.496  1.00 25.41  ? 214 ALA A O     1 
ATOM   1609 C CB    . ALA A 1 214 ? 52.859 -31.151 -7.097  1.00 25.42  ? 214 ALA A CB    1 
ATOM   1610 N N     . LEU A 1 215 ? 52.331 -34.375 -6.298  1.00 25.12  ? 215 LEU A N     1 
ATOM   1611 C CA    . LEU A 1 215 ? 51.449 -35.521 -6.487  1.00 25.14  ? 215 LEU A CA    1 
ATOM   1612 C C     . LEU A 1 215 ? 50.111 -35.229 -5.821  1.00 25.06  ? 215 LEU A C     1 
ATOM   1613 O O     . LEU A 1 215 ? 49.993 -35.254 -4.589  1.00 24.89  ? 215 LEU A O     1 
ATOM   1614 C CB    . LEU A 1 215 ? 52.075 -36.800 -5.911  1.00 25.01  ? 215 LEU A CB    1 
ATOM   1615 C CG    . LEU A 1 215 ? 53.479 -37.224 -6.353  1.00 25.19  ? 215 LEU A CG    1 
ATOM   1616 C CD1   . LEU A 1 215 ? 53.907 -38.463 -5.581  1.00 25.19  ? 215 LEU A CD1   1 
ATOM   1617 C CD2   . LEU A 1 215 ? 53.554 -37.478 -7.854  1.00 24.70  ? 215 LEU A CD2   1 
ATOM   1618 N N     . LEU A 1 216 ? 49.111 -34.954 -6.651  1.00 25.12  ? 216 LEU A N     1 
ATOM   1619 C CA    . LEU A 1 216 ? 47.822 -34.443 -6.197  1.00 25.44  ? 216 LEU A CA    1 
ATOM   1620 C C     . LEU A 1 216 ? 46.712 -35.467 -6.385  1.00 25.36  ? 216 LEU A C     1 
ATOM   1621 O O     . LEU A 1 216 ? 46.470 -35.940 -7.498  1.00 25.07  ? 216 LEU A O     1 
ATOM   1622 C CB    . LEU A 1 216 ? 47.471 -33.171 -6.970  1.00 25.44  ? 216 LEU A CB    1 
ATOM   1623 C CG    . LEU A 1 216 ? 47.954 -31.776 -6.553  1.00 26.24  ? 216 LEU A CG    1 
ATOM   1624 C CD1   . LEU A 1 216 ? 49.245 -31.741 -5.744  1.00 26.56  ? 216 LEU A CD1   1 
ATOM   1625 C CD2   . LEU A 1 216 ? 48.042 -30.884 -7.779  1.00 25.89  ? 216 LEU A CD2   1 
ATOM   1626 N N     . THR A 1 217 ? 46.033 -35.803 -5.294  1.00 25.38  ? 217 THR A N     1 
ATOM   1627 C CA    . THR A 1 217 ? 44.891 -36.711 -5.369  1.00 25.51  ? 217 THR A CA    1 
ATOM   1628 C C     . THR A 1 217 ? 43.745 -36.254 -4.456  1.00 25.83  ? 217 THR A C     1 
ATOM   1629 O O     . THR A 1 217 ? 43.793 -35.155 -3.893  1.00 25.74  ? 217 THR A O     1 
ATOM   1630 C CB    . THR A 1 217 ? 45.309 -38.202 -5.156  1.00 25.54  ? 217 THR A CB    1 
ATOM   1631 O OG1   . THR A 1 217 ? 44.229 -39.071 -5.532  1.00 25.77  ? 217 THR A OG1   1 
ATOM   1632 C CG2   . THR A 1 217 ? 45.732 -38.476 -3.712  1.00 25.02  ? 217 THR A CG2   1 
ATOM   1633 N N     . GLY A 1 218 ? 42.714 -37.087 -4.332  1.00 26.01  ? 218 GLY A N     1 
ATOM   1634 C CA    . GLY A 1 218 ? 41.466 -36.682 -3.691  1.00 26.39  ? 218 GLY A CA    1 
ATOM   1635 C C     . GLY A 1 218 ? 40.577 -35.996 -4.707  1.00 26.69  ? 218 GLY A C     1 
ATOM   1636 O O     . GLY A 1 218 ? 39.625 -35.299 -4.350  1.00 26.64  ? 218 GLY A O     1 
ATOM   1637 N N     . ILE A 1 219 ? 40.893 -36.214 -5.982  1.00 26.88  ? 219 ILE A N     1 
ATOM   1638 C CA    . ILE A 1 219 ? 40.242 -35.529 -7.087  1.00 27.05  ? 219 ILE A CA    1 
ATOM   1639 C C     . ILE A 1 219 ? 39.230 -36.438 -7.784  1.00 27.72  ? 219 ILE A C     1 
ATOM   1640 O O     . ILE A 1 219 ? 39.593 -37.463 -8.371  1.00 27.49  ? 219 ILE A O     1 
ATOM   1641 C CB    . ILE A 1 219 ? 41.281 -34.987 -8.111  1.00 26.98  ? 219 ILE A CB    1 
ATOM   1642 C CG1   . ILE A 1 219 ? 42.283 -34.049 -7.425  1.00 26.80  ? 219 ILE A CG1   1 
ATOM   1643 C CG2   . ILE A 1 219 ? 40.585 -34.269 -9.263  1.00 26.96  ? 219 ILE A CG2   1 
ATOM   1644 C CD1   . ILE A 1 219 ? 43.610 -33.875 -8.183  1.00 26.87  ? 219 ILE A CD1   1 
ATOM   1645 N N     . LEU A 1 220 ? 37.957 -36.053 -7.691  1.00 28.36  ? 220 LEU A N     1 
ATOM   1646 C CA    . LEU A 1 220 ? 36.882 -36.674 -8.456  1.00 29.17  ? 220 LEU A CA    1 
ATOM   1647 C C     . LEU A 1 220 ? 37.166 -36.493 -9.944  1.00 29.66  ? 220 LEU A C     1 
ATOM   1648 O O     . LEU A 1 220 ? 37.544 -35.402 -10.374 1.00 29.61  ? 220 LEU A O     1 
ATOM   1649 C CB    . LEU A 1 220 ? 35.546 -36.019 -8.087  1.00 29.10  ? 220 LEU A CB    1 
ATOM   1650 C CG    . LEU A 1 220 ? 34.491 -36.691 -7.196  1.00 29.51  ? 220 LEU A CG    1 
ATOM   1651 C CD1   . LEU A 1 220 ? 34.953 -37.970 -6.509  1.00 29.23  ? 220 LEU A CD1   1 
ATOM   1652 C CD2   . LEU A 1 220 ? 33.916 -35.702 -6.184  1.00 29.73  ? 220 LEU A CD2   1 
ATOM   1653 N N     . LYS A 1 221 ? 36.997 -37.566 -10.716 1.00 30.39  ? 221 LYS A N     1 
ATOM   1654 C CA    . LYS A 1 221 ? 37.289 -37.570 -12.160 1.00 31.32  ? 221 LYS A CA    1 
ATOM   1655 C C     . LYS A 1 221 ? 36.826 -36.319 -12.910 1.00 31.58  ? 221 LYS A C     1 
ATOM   1656 O O     . LYS A 1 221 ? 37.590 -35.739 -13.685 1.00 31.65  ? 221 LYS A O     1 
ATOM   1657 C CB    . LYS A 1 221 ? 36.689 -38.809 -12.835 1.00 31.56  ? 221 LYS A CB    1 
ATOM   1658 C CG    . LYS A 1 221 ? 37.706 -39.875 -13.181 1.00 32.78  ? 221 LYS A CG    1 
ATOM   1659 C CD    . LYS A 1 221 ? 37.297 -40.647 -14.438 1.00 34.41  ? 221 LYS A CD    1 
ATOM   1660 C CE    . LYS A 1 221 ? 38.295 -41.757 -14.779 1.00 35.20  ? 221 LYS A CE    1 
ATOM   1661 N NZ    . LYS A 1 221 ? 39.698 -41.272 -14.967 1.00 35.14  ? 221 LYS A NZ    1 
ATOM   1662 N N     . ASP A 1 222 ? 35.577 -35.919 -12.671 1.00 31.89  ? 222 ASP A N     1 
ATOM   1663 C CA    . ASP A 1 222 ? 34.954 -34.786 -13.362 1.00 32.25  ? 222 ASP A CA    1 
ATOM   1664 C C     . ASP A 1 222 ? 35.467 -33.419 -12.895 1.00 32.09  ? 222 ASP A C     1 
ATOM   1665 O O     . ASP A 1 222 ? 35.219 -32.400 -13.551 1.00 31.91  ? 222 ASP A O     1 
ATOM   1666 C CB    . ASP A 1 222 ? 33.429 -34.852 -13.211 1.00 32.46  ? 222 ASP A CB    1 
ATOM   1667 C CG    . ASP A 1 222 ? 32.819 -36.078 -13.880 1.00 33.62  ? 222 ASP A CG    1 
ATOM   1668 O OD1   . ASP A 1 222 ? 33.563 -36.872 -14.499 1.00 35.05  ? 222 ASP A OD1   1 
ATOM   1669 O OD2   . ASP A 1 222 ? 31.584 -36.247 -13.788 1.00 34.92  ? 222 ASP A OD2   1 
ATOM   1670 N N     . ARG A 1 223 ? 36.173 -33.404 -11.766 1.00 32.04  ? 223 ARG A N     1 
ATOM   1671 C CA    . ARG A 1 223 ? 36.722 -32.173 -11.193 1.00 32.00  ? 223 ARG A CA    1 
ATOM   1672 C C     . ARG A 1 223 ? 38.186 -31.954 -11.600 1.00 31.92  ? 223 ARG A C     1 
ATOM   1673 O O     . ARG A 1 223 ? 38.764 -30.900 -11.319 1.00 31.83  ? 223 ARG A O     1 
ATOM   1674 C CB    . ARG A 1 223 ? 36.605 -32.194 -9.662  1.00 32.14  ? 223 ARG A CB    1 
ATOM   1675 C CG    . ARG A 1 223 ? 35.220 -32.534 -9.108  1.00 32.63  ? 223 ARG A CG    1 
ATOM   1676 C CD    . ARG A 1 223 ? 34.317 -31.320 -8.987  1.00 33.05  ? 223 ARG A CD    1 
ATOM   1677 N NE    . ARG A 1 223 ? 32.970 -31.703 -8.561  1.00 33.75  ? 223 ARG A NE    1 
ATOM   1678 C CZ    . ARG A 1 223 ? 32.443 -31.445 -7.366  1.00 33.90  ? 223 ARG A CZ    1 
ATOM   1679 N NH1   . ARG A 1 223 ? 33.133 -30.783 -6.447  1.00 33.70  ? 223 ARG A NH1   1 
ATOM   1680 N NH2   . ARG A 1 223 ? 31.207 -31.845 -7.092  1.00 34.00  ? 223 ARG A NH2   1 
ATOM   1681 N N     . ALA A 1 224 ? 38.767 -32.954 -12.264 1.00 31.68  ? 224 ALA A N     1 
ATOM   1682 C CA    . ALA A 1 224 ? 40.162 -32.919 -12.725 1.00 31.48  ? 224 ALA A CA    1 
ATOM   1683 C C     . ALA A 1 224 ? 40.531 -31.745 -13.655 1.00 31.39  ? 224 ALA A C     1 
ATOM   1684 O O     . ALA A 1 224 ? 41.629 -31.196 -13.522 1.00 31.16  ? 224 ALA A O     1 
ATOM   1685 C CB    . ALA A 1 224 ? 40.554 -34.257 -13.359 1.00 31.52  ? 224 ALA A CB    1 
ATOM   1686 N N     . PRO A 1 225 ? 39.636 -31.366 -14.601 1.00 31.26  ? 225 PRO A N     1 
ATOM   1687 C CA    . PRO A 1 225 ? 39.915 -30.190 -15.440 1.00 31.23  ? 225 PRO A CA    1 
ATOM   1688 C C     . PRO A 1 225 ? 40.276 -28.916 -14.665 1.00 31.12  ? 225 PRO A C     1 
ATOM   1689 O O     . PRO A 1 225 ? 41.111 -28.143 -15.131 1.00 31.15  ? 225 PRO A O     1 
ATOM   1690 C CB    . PRO A 1 225 ? 38.605 -29.991 -16.210 1.00 31.15  ? 225 PRO A CB    1 
ATOM   1691 C CG    . PRO A 1 225 ? 38.029 -31.347 -16.301 1.00 31.24  ? 225 PRO A CG    1 
ATOM   1692 C CD    . PRO A 1 225 ? 38.357 -31.999 -14.987 1.00 31.27  ? 225 PRO A CD    1 
ATOM   1693 N N     . LEU A 1 226 ? 39.653 -28.705 -13.505 1.00 31.15  ? 226 LEU A N     1 
ATOM   1694 C CA    . LEU A 1 226 ? 39.953 -27.548 -12.653 1.00 31.18  ? 226 LEU A CA    1 
ATOM   1695 C C     . LEU A 1 226 ? 41.405 -27.560 -12.171 1.00 31.11  ? 226 LEU A C     1 
ATOM   1696 O O     . LEU A 1 226 ? 42.083 -26.527 -12.185 1.00 31.18  ? 226 LEU A O     1 
ATOM   1697 C CB    . LEU A 1 226 ? 39.020 -27.503 -11.438 1.00 31.20  ? 226 LEU A CB    1 
ATOM   1698 C CG    . LEU A 1 226 ? 37.503 -27.463 -11.618 1.00 31.57  ? 226 LEU A CG    1 
ATOM   1699 C CD1   . LEU A 1 226 ? 36.828 -27.714 -10.275 1.00 31.44  ? 226 LEU A CD1   1 
ATOM   1700 C CD2   . LEU A 1 226 ? 37.036 -26.139 -12.227 1.00 31.26  ? 226 LEU A CD2   1 
ATOM   1701 N N     . VAL A 1 227 ? 41.871 -28.732 -11.743 1.00 30.92  ? 227 VAL A N     1 
ATOM   1702 C CA    . VAL A 1 227 ? 43.244 -28.897 -11.262 1.00 30.69  ? 227 VAL A CA    1 
ATOM   1703 C C     . VAL A 1 227 ? 44.242 -28.738 -12.411 1.00 30.69  ? 227 VAL A C     1 
ATOM   1704 O O     . VAL A 1 227 ? 45.248 -28.040 -12.266 1.00 30.72  ? 227 VAL A O     1 
ATOM   1705 C CB    . VAL A 1 227 ? 43.452 -30.253 -10.529 1.00 30.66  ? 227 VAL A CB    1 
ATOM   1706 C CG1   . VAL A 1 227 ? 44.849 -30.330 -9.903  1.00 30.61  ? 227 VAL A CG1   1 
ATOM   1707 C CG2   . VAL A 1 227 ? 42.400 -30.446 -9.455  1.00 30.18  ? 227 VAL A CG2   1 
ATOM   1708 N N     . ARG A 1 228 ? 43.954 -29.369 -13.549 1.00 30.58  ? 228 ARG A N     1 
ATOM   1709 C CA    . ARG A 1 228 ? 44.813 -29.259 -14.732 1.00 30.55  ? 228 ARG A CA    1 
ATOM   1710 C C     . ARG A 1 228 ? 45.013 -27.801 -15.141 1.00 30.64  ? 228 ARG A C     1 
ATOM   1711 O O     . ARG A 1 228 ? 46.135 -27.380 -15.428 1.00 30.36  ? 228 ARG A O     1 
ATOM   1712 C CB    . ARG A 1 228 ? 44.244 -30.057 -15.909 1.00 30.59  ? 228 ARG A CB    1 
ATOM   1713 C CG    . ARG A 1 228 ? 44.208 -31.562 -15.698 1.00 30.24  ? 228 ARG A CG    1 
ATOM   1714 C CD    . ARG A 1 228 ? 43.909 -32.282 -17.000 1.00 30.22  ? 228 ARG A CD    1 
ATOM   1715 N NE    . ARG A 1 228 ? 43.630 -33.700 -16.783 1.00 30.15  ? 228 ARG A NE    1 
ATOM   1716 C CZ    . ARG A 1 228 ? 42.413 -34.233 -16.741 1.00 30.26  ? 228 ARG A CZ    1 
ATOM   1717 N NH1   . ARG A 1 228 ? 41.336 -33.474 -16.907 1.00 29.66  ? 228 ARG A NH1   1 
ATOM   1718 N NH2   . ARG A 1 228 ? 42.271 -35.536 -16.536 1.00 29.75  ? 228 ARG A NH2   1 
ATOM   1719 N N     . GLU A 1 229 ? 43.913 -27.048 -15.150 1.00 30.71  ? 229 GLU A N     1 
ATOM   1720 C CA    . GLU A 1 229 ? 43.904 -25.635 -15.528 1.00 31.08  ? 229 GLU A CA    1 
ATOM   1721 C C     . GLU A 1 229 ? 44.702 -24.774 -14.547 1.00 30.63  ? 229 GLU A C     1 
ATOM   1722 O O     . GLU A 1 229 ? 45.503 -23.936 -14.960 1.00 30.65  ? 229 GLU A O     1 
ATOM   1723 C CB    . GLU A 1 229 ? 42.456 -25.137 -15.625 1.00 30.99  ? 229 GLU A CB    1 
ATOM   1724 C CG    . GLU A 1 229 ? 42.290 -23.689 -16.074 1.00 32.04  ? 229 GLU A CG    1 
ATOM   1725 C CD    . GLU A 1 229 ? 40.836 -23.234 -16.060 1.00 32.11  ? 229 GLU A CD    1 
ATOM   1726 O OE1   . GLU A 1 229 ? 40.144 -23.453 -15.036 1.00 33.46  ? 229 GLU A OE1   1 
ATOM   1727 O OE2   . GLU A 1 229 ? 40.387 -22.653 -17.072 1.00 33.40  ? 229 GLU A OE2   1 
ATOM   1728 N N     . ALA A 1 230 ? 44.479 -24.989 -13.254 1.00 30.36  ? 230 ALA A N     1 
ATOM   1729 C CA    . ALA A 1 230 ? 45.168 -24.226 -12.213 1.00 30.16  ? 230 ALA A CA    1 
ATOM   1730 C C     . ALA A 1 230 ? 46.668 -24.514 -12.174 1.00 30.00  ? 230 ALA A C     1 
ATOM   1731 O O     . ALA A 1 230 ? 47.472 -23.599 -11.993 1.00 29.79  ? 230 ALA A O     1 
ATOM   1732 C CB    . ALA A 1 230 ? 44.543 -24.496 -10.861 1.00 30.13  ? 230 ALA A CB    1 
ATOM   1733 N N     . MET A 1 231 ? 47.036 -25.784 -12.347 1.00 29.95  ? 231 MET A N     1 
ATOM   1734 C CA    . MET A 1 231 ? 48.440 -26.198 -12.285 1.00 29.93  ? 231 MET A CA    1 
ATOM   1735 C C     . MET A 1 231 ? 49.233 -25.713 -13.493 1.00 30.10  ? 231 MET A C     1 
ATOM   1736 O O     . MET A 1 231 ? 50.381 -25.292 -13.352 1.00 30.16  ? 231 MET A O     1 
ATOM   1737 C CB    . MET A 1 231 ? 48.564 -27.717 -12.126 1.00 29.69  ? 231 MET A CB    1 
ATOM   1738 C CG    . MET A 1 231 ? 48.111 -28.237 -10.767 1.00 29.37  ? 231 MET A CG    1 
ATOM   1739 S SD    . MET A 1 231 ? 49.123 -27.631 -9.401  1.00 28.73  ? 231 MET A SD    1 
ATOM   1740 C CE    . MET A 1 231 ? 50.465 -28.815 -9.412  1.00 27.90  ? 231 MET A CE    1 
ATOM   1741 N N     . ALA A 1 232 ? 48.616 -25.769 -14.673 1.00 30.32  ? 232 ALA A N     1 
ATOM   1742 C CA    . ALA A 1 232 ? 49.217 -25.202 -15.879 1.00 30.51  ? 232 ALA A CA    1 
ATOM   1743 C C     . ALA A 1 232 ? 49.378 -23.691 -15.718 1.00 30.70  ? 232 ALA A C     1 
ATOM   1744 O O     . ALA A 1 232 ? 50.413 -23.134 -16.078 1.00 30.71  ? 232 ALA A O     1 
ATOM   1745 C CB    . ALA A 1 232 ? 48.378 -25.533 -17.105 1.00 30.49  ? 232 ALA A CB    1 
ATOM   1746 N N     . GLY A 1 233 ? 48.357 -23.048 -15.150 1.00 30.94  ? 233 GLY A N     1 
ATOM   1747 C CA    . GLY A 1 233 ? 48.383 -21.612 -14.862 1.00 31.34  ? 233 GLY A CA    1 
ATOM   1748 C C     . GLY A 1 233 ? 49.450 -21.225 -13.853 1.00 31.51  ? 233 GLY A C     1 
ATOM   1749 O O     . GLY A 1 233 ? 49.988 -20.117 -13.904 1.00 31.66  ? 233 GLY A O     1 
ATOM   1750 N N     . ALA A 1 234 ? 49.759 -22.143 -12.938 1.00 31.71  ? 234 ALA A N     1 
ATOM   1751 C CA    . ALA A 1 234 ? 50.796 -21.928 -11.930 1.00 31.81  ? 234 ALA A CA    1 
ATOM   1752 C C     . ALA A 1 234 ? 52.203 -22.193 -12.478 1.00 31.87  ? 234 ALA A C     1 
ATOM   1753 O O     . ALA A 1 234 ? 53.197 -21.917 -11.807 1.00 32.00  ? 234 ALA A O     1 
ATOM   1754 C CB    . ALA A 1 234 ? 50.529 -22.789 -10.699 1.00 31.77  ? 234 ALA A CB    1 
ATOM   1755 N N     . GLY A 1 235 ? 52.281 -22.735 -13.690 1.00 31.86  ? 235 GLY A N     1 
ATOM   1756 C CA    . GLY A 1 235 ? 53.564 -22.985 -14.346 1.00 31.90  ? 235 GLY A CA    1 
ATOM   1757 C C     . GLY A 1 235 ? 54.073 -24.412 -14.250 1.00 31.84  ? 235 GLY A C     1 
ATOM   1758 O O     . GLY A 1 235 ? 55.231 -24.682 -14.579 1.00 32.13  ? 235 GLY A O     1 
ATOM   1759 N N     . PHE A 1 236 ? 53.217 -25.327 -13.799 1.00 31.75  ? 236 PHE A N     1 
ATOM   1760 C CA    . PHE A 1 236 ? 53.573 -26.745 -13.709 1.00 31.51  ? 236 PHE A CA    1 
ATOM   1761 C C     . PHE A 1 236 ? 53.446 -27.434 -15.060 1.00 31.84  ? 236 PHE A C     1 
ATOM   1762 O O     . PHE A 1 236 ? 52.611 -27.053 -15.883 1.00 31.81  ? 236 PHE A O     1 
ATOM   1763 C CB    . PHE A 1 236 ? 52.674 -27.467 -12.707 1.00 31.28  ? 236 PHE A CB    1 
ATOM   1764 C CG    . PHE A 1 236 ? 53.036 -27.226 -11.273 1.00 30.55  ? 236 PHE A CG    1 
ATOM   1765 C CD1   . PHE A 1 236 ? 52.448 -26.182 -10.560 1.00 29.82  ? 236 PHE A CD1   1 
ATOM   1766 C CD2   . PHE A 1 236 ? 53.948 -28.056 -10.625 1.00 29.81  ? 236 PHE A CD2   1 
ATOM   1767 C CE1   . PHE A 1 236 ? 52.770 -25.965 -9.223  1.00 29.77  ? 236 PHE A CE1   1 
ATOM   1768 C CE2   . PHE A 1 236 ? 54.279 -27.849 -9.286  1.00 29.92  ? 236 PHE A CE2   1 
ATOM   1769 C CZ    . PHE A 1 236 ? 53.688 -26.802 -8.585  1.00 29.94  ? 236 PHE A CZ    1 
ATOM   1770 N N     . ARG A 1 237 ? 54.274 -28.454 -15.269 1.00 32.02  ? 237 ARG A N     1 
ATOM   1771 C CA    . ARG A 1 237 ? 54.206 -29.306 -16.452 1.00 32.45  ? 237 ARG A CA    1 
ATOM   1772 C C     . ARG A 1 237 ? 53.637 -30.667 -16.049 1.00 32.27  ? 237 ARG A C     1 
ATOM   1773 O O     . ARG A 1 237 ? 54.037 -31.215 -15.016 1.00 32.22  ? 237 ARG A O     1 
ATOM   1774 C CB    . ARG A 1 237 ? 55.599 -29.507 -17.058 1.00 32.71  ? 237 ARG A CB    1 
ATOM   1775 C CG    . ARG A 1 237 ? 56.377 -28.232 -17.354 1.00 33.89  ? 237 ARG A CG    1 
ATOM   1776 C CD    . ARG A 1 237 ? 57.875 -28.521 -17.473 1.00 36.13  ? 237 ARG A CD    1 
ATOM   1777 N NE    . ARG A 1 237 ? 58.499 -28.793 -16.172 1.00 37.78  ? 237 ARG A NE    1 
ATOM   1778 C CZ    . ARG A 1 237 ? 58.887 -29.996 -15.748 1.00 38.93  ? 237 ARG A CZ    1 
ATOM   1779 N NH1   . ARG A 1 237 ? 58.727 -31.071 -16.515 1.00 39.06  ? 237 ARG A NH1   1 
ATOM   1780 N NH2   . ARG A 1 237 ? 59.440 -30.128 -14.547 1.00 39.47  ? 237 ARG A NH2   1 
ATOM   1781 N N     . PRO A 1 238 ? 52.705 -31.216 -16.857 1.00 32.14  ? 238 PRO A N     1 
ATOM   1782 C CA    . PRO A 1 238 ? 52.115 -32.522 -16.546 1.00 32.15  ? 238 PRO A CA    1 
ATOM   1783 C C     . PRO A 1 238 ? 53.122 -33.664 -16.680 1.00 32.18  ? 238 PRO A C     1 
ATOM   1784 O O     . PRO A 1 238 ? 53.893 -33.706 -17.641 1.00 32.12  ? 238 PRO A O     1 
ATOM   1785 C CB    . PRO A 1 238 ? 50.990 -32.664 -17.579 1.00 32.08  ? 238 PRO A CB    1 
ATOM   1786 C CG    . PRO A 1 238 ? 51.392 -31.783 -18.706 1.00 32.25  ? 238 PRO A CG    1 
ATOM   1787 C CD    . PRO A 1 238 ? 52.150 -30.639 -18.096 1.00 32.09  ? 238 PRO A CD    1 
ATOM   1788 N N     . LEU A 1 239 ? 53.118 -34.572 -15.709 1.00 32.17  ? 239 LEU A N     1 
ATOM   1789 C CA    . LEU A 1 239 ? 54.032 -35.711 -15.728 1.00 32.48  ? 239 LEU A CA    1 
ATOM   1790 C C     . LEU A 1 239 ? 53.309 -37.000 -16.088 1.00 32.70  ? 239 LEU A C     1 
ATOM   1791 O O     . LEU A 1 239 ? 53.712 -37.708 -17.017 1.00 32.99  ? 239 LEU A O     1 
ATOM   1792 C CB    . LEU A 1 239 ? 54.759 -35.855 -14.386 1.00 32.30  ? 239 LEU A CB    1 
ATOM   1793 C CG    . LEU A 1 239 ? 55.697 -34.717 -13.971 1.00 32.33  ? 239 LEU A CG    1 
ATOM   1794 C CD1   . LEU A 1 239 ? 56.306 -35.008 -12.606 1.00 32.11  ? 239 LEU A CD1   1 
ATOM   1795 C CD2   . LEU A 1 239 ? 56.790 -34.474 -15.006 1.00 32.38  ? 239 LEU A CD2   1 
ATOM   1796 N N     . GLU A 1 240 ? 52.239 -37.289 -15.352 1.00 32.71  ? 240 GLU A N     1 
ATOM   1797 C CA    . GLU A 1 240 ? 51.424 -38.480 -15.562 1.00 32.91  ? 240 GLU A CA    1 
ATOM   1798 C C     . GLU A 1 240 ? 50.102 -38.352 -14.816 1.00 32.62  ? 240 GLU A C     1 
ATOM   1799 O O     . GLU A 1 240 ? 49.945 -37.481 -13.954 1.00 32.74  ? 240 GLU A O     1 
ATOM   1800 C CB    . GLU A 1 240 ? 52.160 -39.738 -15.088 1.00 33.04  ? 240 GLU A CB    1 
ATOM   1801 C CG    . GLU A 1 240 ? 52.597 -39.691 -13.623 1.00 33.46  ? 240 GLU A CG    1 
ATOM   1802 C CD    . GLU A 1 240 ? 53.016 -41.037 -13.083 1.00 33.64  ? 240 GLU A CD    1 
ATOM   1803 O OE1   . GLU A 1 240 ? 53.005 -41.203 -11.846 1.00 34.11  ? 240 GLU A OE1   1 
ATOM   1804 O OE2   . GLU A 1 240 ? 53.360 -41.930 -13.890 1.00 35.52  ? 240 GLU A OE2   1 
ATOM   1805 N N     . GLU A 1 241 ? 49.160 -39.225 -15.156 1.00 32.30  ? 241 GLU A N     1 
ATOM   1806 C CA    . GLU A 1 241 ? 47.886 -39.320 -14.451 1.00 32.02  ? 241 GLU A CA    1 
ATOM   1807 C C     . GLU A 1 241 ? 47.605 -40.781 -14.119 1.00 31.82  ? 241 GLU A C     1 
ATOM   1808 O O     . GLU A 1 241 ? 47.962 -41.676 -14.884 1.00 31.93  ? 241 GLU A O     1 
ATOM   1809 C CB    . GLU A 1 241 ? 46.741 -38.748 -15.297 1.00 32.05  ? 241 GLU A CB    1 
ATOM   1810 C CG    . GLU A 1 241 ? 46.953 -37.306 -15.766 1.00 32.04  ? 241 GLU A CG    1 
ATOM   1811 C CD    . GLU A 1 241 ? 45.676 -36.634 -16.240 1.00 32.00  ? 241 GLU A CD    1 
ATOM   1812 O OE1   . GLU A 1 241 ? 44.596 -37.256 -16.163 1.00 31.75  ? 241 GLU A OE1   1 
ATOM   1813 O OE2   . GLU A 1 241 ? 45.752 -35.468 -16.678 1.00 32.08  ? 241 GLU A OE2   1 
ATOM   1814 N N     . ALA A 1 242 ? 46.979 -41.012 -12.969 1.00 31.44  ? 242 ALA A N     1 
ATOM   1815 C CA    . ALA A 1 242 ? 46.554 -42.348 -12.562 1.00 31.21  ? 242 ALA A CA    1 
ATOM   1816 C C     . ALA A 1 242 ? 45.115 -42.285 -12.064 1.00 31.10  ? 242 ALA A C     1 
ATOM   1817 O O     . ALA A 1 242 ? 44.679 -41.257 -11.544 1.00 30.98  ? 242 ALA A O     1 
ATOM   1818 C CB    . ALA A 1 242 ? 47.476 -42.903 -11.484 1.00 30.98  ? 242 ALA A CB    1 
ATOM   1819 N N     . ALA A 1 243 ? 44.379 -43.381 -12.231 1.00 30.96  ? 243 ALA A N     1 
ATOM   1820 C CA    . ALA A 1 243 ? 42.974 -43.414 -11.842 1.00 30.93  ? 243 ALA A CA    1 
ATOM   1821 C C     . ALA A 1 243 ? 42.582 -44.711 -11.145 1.00 30.97  ? 243 ALA A C     1 
ATOM   1822 O O     . ALA A 1 243 ? 43.154 -45.769 -11.408 1.00 30.84  ? 243 ALA A O     1 
ATOM   1823 C CB    . ALA A 1 243 ? 42.082 -43.177 -13.059 1.00 30.90  ? 243 ALA A CB    1 
ATOM   1824 N N     . GLU A 1 244 ? 41.609 -44.608 -10.244 1.00 31.04  ? 244 GLU A N     1 
ATOM   1825 C CA    . GLU A 1 244 ? 40.938 -45.771 -9.674  1.00 31.54  ? 244 GLU A CA    1 
ATOM   1826 C C     . GLU A 1 244 ? 39.513 -45.391 -9.294  1.00 31.16  ? 244 GLU A C     1 
ATOM   1827 O O     . GLU A 1 244 ? 39.303 -44.530 -8.437  1.00 31.09  ? 244 GLU A O     1 
ATOM   1828 C CB    . GLU A 1 244 ? 41.690 -46.321 -8.461  1.00 31.34  ? 244 GLU A CB    1 
ATOM   1829 C CG    . GLU A 1 244 ? 41.206 -47.702 -8.037  1.00 32.64  ? 244 GLU A CG    1 
ATOM   1830 C CD    . GLU A 1 244 ? 41.930 -48.253 -6.827  1.00 32.91  ? 244 GLU A CD    1 
ATOM   1831 O OE1   . GLU A 1 244 ? 42.979 -47.697 -6.434  1.00 35.42  ? 244 GLU A OE1   1 
ATOM   1832 O OE2   . GLU A 1 244 ? 41.445 -49.258 -6.264  1.00 35.37  ? 244 GLU A OE2   1 
ATOM   1833 N N     . GLY A 1 245 ? 38.545 -46.034 -9.947  1.00 30.99  ? 245 GLY A N     1 
ATOM   1834 C CA    . GLY A 1 245 ? 37.128 -45.741 -9.735  1.00 30.68  ? 245 GLY A CA    1 
ATOM   1835 C C     . GLY A 1 245 ? 36.775 -44.310 -10.093 1.00 30.48  ? 245 GLY A C     1 
ATOM   1836 O O     . GLY A 1 245 ? 37.086 -43.843 -11.186 1.00 30.48  ? 245 GLY A O     1 
ATOM   1837 N N     . GLU A 1 246 ? 36.132 -43.621 -9.153  1.00 30.42  ? 246 GLU A N     1 
ATOM   1838 C CA    . GLU A 1 246 ? 35.745 -42.212 -9.297  1.00 30.49  ? 246 GLU A CA    1 
ATOM   1839 C C     . GLU A 1 246 ? 36.924 -41.235 -9.248  1.00 29.82  ? 246 GLU A C     1 
ATOM   1840 O O     . GLU A 1 246 ? 36.777 -40.063 -9.605  1.00 29.68  ? 246 GLU A O     1 
ATOM   1841 C CB    . GLU A 1 246 ? 34.801 -41.823 -8.158  1.00 30.46  ? 246 GLU A CB    1 
ATOM   1842 C CG    . GLU A 1 246 ? 33.326 -42.033 -8.405  1.00 31.64  ? 246 GLU A CG    1 
ATOM   1843 C CD    . GLU A 1 246 ? 32.480 -41.411 -7.305  1.00 31.59  ? 246 GLU A CD    1 
ATOM   1844 O OE1   . GLU A 1 246 ? 31.584 -40.603 -7.630  1.00 34.03  ? 246 GLU A OE1   1 
ATOM   1845 O OE2   . GLU A 1 246 ? 32.722 -41.713 -6.114  1.00 33.07  ? 246 GLU A OE2   1 
ATOM   1846 N N     . TRP A 1 247 ? 38.080 -41.719 -8.799  1.00 29.26  ? 247 TRP A N     1 
ATOM   1847 C CA    . TRP A 1 247 ? 39.160 -40.846 -8.339  1.00 28.67  ? 247 TRP A CA    1 
ATOM   1848 C C     . TRP A 1 247 ? 40.381 -40.824 -9.248  1.00 28.50  ? 247 TRP A C     1 
ATOM   1849 O O     . TRP A 1 247 ? 40.672 -41.799 -9.938  1.00 28.33  ? 247 TRP A O     1 
ATOM   1850 C CB    . TRP A 1 247 ? 39.581 -41.252 -6.925  1.00 28.49  ? 247 TRP A CB    1 
ATOM   1851 C CG    . TRP A 1 247 ? 38.428 -41.374 -5.980  1.00 28.42  ? 247 TRP A CG    1 
ATOM   1852 C CD1   . TRP A 1 247 ? 37.689 -42.493 -5.729  1.00 28.35  ? 247 TRP A CD1   1 
ATOM   1853 C CD2   . TRP A 1 247 ? 37.871 -40.334 -5.170  1.00 28.33  ? 247 TRP A CD2   1 
ATOM   1854 N NE1   . TRP A 1 247 ? 36.707 -42.217 -4.809  1.00 28.19  ? 247 TRP A NE1   1 
ATOM   1855 C CE2   . TRP A 1 247 ? 36.798 -40.899 -4.447  1.00 28.33  ? 247 TRP A CE2   1 
ATOM   1856 C CE3   . TRP A 1 247 ? 38.176 -38.979 -4.982  1.00 28.32  ? 247 TRP A CE3   1 
ATOM   1857 C CZ2   . TRP A 1 247 ? 36.031 -40.158 -3.545  1.00 28.40  ? 247 TRP A CZ2   1 
ATOM   1858 C CZ3   . TRP A 1 247 ? 37.413 -38.243 -4.082  1.00 28.35  ? 247 TRP A CZ3   1 
ATOM   1859 C CH2   . TRP A 1 247 ? 36.353 -38.836 -3.376  1.00 28.45  ? 247 TRP A CH2   1 
ATOM   1860 N N     . VAL A 1 248 ? 41.099 -39.702 -9.234  1.00 28.18  ? 248 VAL A N     1 
ATOM   1861 C CA    . VAL A 1 248 ? 42.332 -39.575 -10.006 1.00 28.07  ? 248 VAL A CA    1 
ATOM   1862 C C     . VAL A 1 248 ? 43.481 -38.999 -9.186  1.00 27.96  ? 248 VAL A C     1 
ATOM   1863 O O     . VAL A 1 248 ? 43.269 -38.301 -8.191  1.00 27.87  ? 248 VAL A O     1 
ATOM   1864 C CB    . VAL A 1 248 ? 42.153 -38.729 -11.305 1.00 28.12  ? 248 VAL A CB    1 
ATOM   1865 C CG1   . VAL A 1 248 ? 41.096 -39.335 -12.219 1.00 28.17  ? 248 VAL A CG1   1 
ATOM   1866 C CG2   . VAL A 1 248 ? 41.819 -37.282 -10.984 1.00 28.39  ? 248 VAL A CG2   1 
ATOM   1867 N N     . LEU A 1 249 ? 44.696 -39.318 -9.618  1.00 27.84  ? 249 LEU A N     1 
ATOM   1868 C CA    . LEU A 1 249 ? 45.895 -38.660 -9.130  1.00 27.62  ? 249 LEU A CA    1 
ATOM   1869 C C     . LEU A 1 249 ? 46.575 -37.972 -10.305 1.00 27.62  ? 249 LEU A C     1 
ATOM   1870 O O     . LEU A 1 249 ? 46.735 -38.565 -11.374 1.00 27.51  ? 249 LEU A O     1 
ATOM   1871 C CB    . LEU A 1 249 ? 46.842 -39.659 -8.459  1.00 27.44  ? 249 LEU A CB    1 
ATOM   1872 C CG    . LEU A 1 249 ? 48.178 -39.095 -7.950  1.00 27.01  ? 249 LEU A CG    1 
ATOM   1873 C CD1   . LEU A 1 249 ? 48.534 -39.684 -6.602  1.00 26.12  ? 249 LEU A CD1   1 
ATOM   1874 C CD2   . LEU A 1 249 ? 49.308 -39.302 -8.962  1.00 26.93  ? 249 LEU A CD2   1 
ATOM   1875 N N     . LEU A 1 250 ? 46.970 -36.720 -10.097 1.00 27.76  ? 250 LEU A N     1 
ATOM   1876 C CA    . LEU A 1 250 ? 47.657 -35.949 -11.123 1.00 27.95  ? 250 LEU A CA    1 
ATOM   1877 C C     . LEU A 1 250 ? 49.053 -35.562 -10.635 1.00 28.08  ? 250 LEU A C     1 
ATOM   1878 O O     . LEU A 1 250 ? 49.206 -34.938 -9.579  1.00 28.03  ? 250 LEU A O     1 
ATOM   1879 C CB    . LEU A 1 250 ? 46.833 -34.708 -11.510 1.00 27.96  ? 250 LEU A CB    1 
ATOM   1880 C CG    . LEU A 1 250 ? 45.328 -34.880 -11.788 1.00 28.19  ? 250 LEU A CG    1 
ATOM   1881 C CD1   . LEU A 1 250 ? 44.622 -33.539 -11.904 1.00 28.21  ? 250 LEU A CD1   1 
ATOM   1882 C CD2   . LEU A 1 250 ? 45.067 -35.711 -13.028 1.00 27.60  ? 250 LEU A CD2   1 
ATOM   1883 N N     . ALA A 1 251 ? 50.067 -35.964 -11.400 1.00 28.35  ? 251 ALA A N     1 
ATOM   1884 C CA    . ALA A 1 251 ? 51.460 -35.644 -11.089 1.00 28.44  ? 251 ALA A CA    1 
ATOM   1885 C C     . ALA A 1 251 ? 51.970 -34.508 -11.974 1.00 28.78  ? 251 ALA A C     1 
ATOM   1886 O O     . ALA A 1 251 ? 51.695 -34.468 -13.178 1.00 28.52  ? 251 ALA A O     1 
ATOM   1887 C CB    . ALA A 1 251 ? 52.339 -36.872 -11.239 1.00 28.27  ? 251 ALA A CB    1 
ATOM   1888 N N     . TYR A 1 252 ? 52.713 -33.591 -11.361 1.00 29.09  ? 252 TYR A N     1 
ATOM   1889 C CA    . TYR A 1 252 ? 53.188 -32.381 -12.023 1.00 29.46  ? 252 TYR A CA    1 
ATOM   1890 C C     . TYR A 1 252 ? 54.623 -32.070 -11.637 1.00 29.75  ? 252 TYR A C     1 
ATOM   1891 O O     . TYR A 1 252 ? 55.048 -32.364 -10.521 1.00 29.80  ? 252 TYR A O     1 
ATOM   1892 C CB    . TYR A 1 252 ? 52.312 -31.189 -11.639 1.00 29.64  ? 252 TYR A CB    1 
ATOM   1893 C CG    . TYR A 1 252 ? 50.917 -31.244 -12.205 1.00 30.36  ? 252 TYR A CG    1 
ATOM   1894 C CD1   . TYR A 1 252 ? 49.861 -31.751 -11.450 1.00 30.68  ? 252 TYR A CD1   1 
ATOM   1895 C CD2   . TYR A 1 252 ? 50.651 -30.795 -13.497 1.00 29.96  ? 252 TYR A CD2   1 
ATOM   1896 C CE1   . TYR A 1 252 ? 48.576 -31.807 -11.967 1.00 30.69  ? 252 TYR A CE1   1 
ATOM   1897 C CE2   . TYR A 1 252 ? 49.362 -30.851 -14.025 1.00 30.85  ? 252 TYR A CE2   1 
ATOM   1898 C CZ    . TYR A 1 252 ? 48.334 -31.361 -13.250 1.00 30.62  ? 252 TYR A CZ    1 
ATOM   1899 O OH    . TYR A 1 252 ? 47.055 -31.423 -13.754 1.00 31.58  ? 252 TYR A OH    1 
ATOM   1900 N N     . GLY A 1 253 ? 55.362 -31.473 -12.566 1.00 30.05  ? 253 GLY A N     1 
ATOM   1901 C CA    . GLY A 1 253 ? 56.714 -31.001 -12.295 1.00 30.61  ? 253 GLY A CA    1 
ATOM   1902 C C     . GLY A 1 253 ? 56.807 -29.513 -12.552 1.00 31.23  ? 253 GLY A C     1 
ATOM   1903 O O     . GLY A 1 253 ? 56.169 -28.994 -13.471 1.00 31.12  ? 253 GLY A O     1 
ATOM   1904 N N     . ARG A 1 254 ? 57.589 -28.813 -11.737 1.00 31.78  ? 254 ARG A N     1 
ATOM   1905 C CA    . ARG A 1 254 ? 57.813 -27.387 -11.971 1.00 32.50  ? 254 ARG A CA    1 
ATOM   1906 C C     . ARG A 1 254 ? 59.186 -27.140 -12.589 1.00 32.76  ? 254 ARG A C     1 
ATOM   1907 O O     . ARG A 1 254 ? 59.470 -26.034 -13.050 1.00 33.36  ? 254 ARG A O     1 
ATOM   1908 C CB    . ARG A 1 254 ? 57.625 -26.573 -10.687 1.00 32.60  ? 254 ARG A CB    1 
ATOM   1909 C CG    . ARG A 1 254 ? 58.748 -26.720 -9.678  1.00 33.46  ? 254 ARG A CG    1 
ATOM   1910 C CD    . ARG A 1 254 ? 58.291 -26.262 -8.325  1.00 34.45  ? 254 ARG A CD    1 
ATOM   1911 N NE    . ARG A 1 254 ? 58.715 -24.930 -7.873  1.00 35.54  ? 254 ARG A NE    1 
ATOM   1912 C CZ    . ARG A 1 254 ? 59.536 -24.081 -8.491  1.00 34.79  ? 254 ARG A CZ    1 
ATOM   1913 N NH1   . ARG A 1 254 ? 60.082 -24.363 -9.662  1.00 34.75  ? 254 ARG A NH1   1 
ATOM   1914 N NH2   . ARG A 1 254 ? 59.811 -22.921 -7.910  1.00 33.45  ? 254 ARG A NH2   1 
ATOM   1915 O OXT   . ARG A 1 254 ? 60.033 -28.034 -12.657 1.00 32.81  ? 254 ARG A OXT   1 
ATOM   1916 N N     . MET B 2 1   ? 21.210 -51.646 -14.745 1.00 54.51  ? 1   MET B N     1 
ATOM   1917 C CA    . MET B 2 1   ? 20.151 -52.237 -13.877 1.00 54.43  ? 1   MET B CA    1 
ATOM   1918 C C     . MET B 2 1   ? 20.537 -53.675 -13.525 1.00 54.21  ? 1   MET B C     1 
ATOM   1919 O O     . MET B 2 1   ? 20.501 -54.538 -14.400 1.00 54.30  ? 1   MET B O     1 
ATOM   1920 C CB    . MET B 2 1   ? 18.790 -52.212 -14.583 1.00 54.39  ? 1   MET B CB    1 
ATOM   1921 C CG    . MET B 2 1   ? 18.553 -51.002 -15.481 1.00 54.49  ? 1   MET B CG    1 
ATOM   1922 S SD    . MET B 2 1   ? 16.826 -50.791 -15.953 1.00 54.68  ? 1   MET B SD    1 
ATOM   1923 C CE    . MET B 2 1   ? 16.191 -49.967 -14.490 1.00 54.53  ? 1   MET B CE    1 
ATOM   1924 N N     . LYS B 2 2   ? 20.917 -53.964 -12.275 1.00 54.06  ? 2   LYS B N     1 
ATOM   1925 C CA    . LYS B 2 2   ? 20.962 -53.046 -11.112 1.00 53.64  ? 2   LYS B CA    1 
ATOM   1926 C C     . LYS B 2 2   ? 19.599 -52.687 -10.502 1.00 53.23  ? 2   LYS B C     1 
ATOM   1927 O O     . LYS B 2 2   ? 19.035 -51.621 -10.764 1.00 53.10  ? 2   LYS B O     1 
ATOM   1928 C CB    . LYS B 2 2   ? 21.841 -51.806 -11.351 1.00 53.89  ? 2   LYS B CB    1 
ATOM   1929 C CG    . LYS B 2 2   ? 23.328 -52.059 -11.163 1.00 54.38  ? 2   LYS B CG    1 
ATOM   1930 C CD    . LYS B 2 2   ? 24.072 -50.774 -10.826 1.00 55.65  ? 2   LYS B CD    1 
ATOM   1931 C CE    . LYS B 2 2   ? 25.560 -51.026 -10.620 1.00 56.53  ? 2   LYS B CE    1 
ATOM   1932 N NZ    . LYS B 2 2   ? 25.841 -51.900 -9.443  1.00 57.14  ? 2   LYS B NZ    1 
ATOM   1933 N N     . LYS B 2 3   ? 19.095 -53.605 -9.679  1.00 52.72  ? 3   LYS B N     1 
ATOM   1934 C CA    . LYS B 2 3   ? 17.851 -53.427 -8.938  1.00 52.24  ? 3   LYS B CA    1 
ATOM   1935 C C     . LYS B 2 3   ? 18.057 -52.461 -7.776  1.00 52.08  ? 3   LYS B C     1 
ATOM   1936 O O     . LYS B 2 3   ? 19.002 -52.608 -7.001  1.00 51.93  ? 3   LYS B O     1 
ATOM   1937 C CB    . LYS B 2 3   ? 17.361 -54.779 -8.409  1.00 52.21  ? 3   LYS B CB    1 
ATOM   1938 C CG    . LYS B 2 3   ? 16.059 -54.727 -7.611  1.00 51.99  ? 3   LYS B CG    1 
ATOM   1939 C CD    . LYS B 2 3   ? 15.791 -56.037 -6.878  1.00 51.98  ? 3   LYS B CD    1 
ATOM   1940 C CE    . LYS B 2 3   ? 15.319 -57.137 -7.819  1.00 51.60  ? 3   LYS B CE    1 
ATOM   1941 N NZ    . LYS B 2 3   ? 15.053 -58.408 -7.091  1.00 51.30  ? 3   LYS B NZ    1 
ATOM   1942 N N     . VAL B 2 4   ? 17.166 -51.481 -7.662  1.00 51.85  ? 4   VAL B N     1 
ATOM   1943 C CA    . VAL B 2 4   ? 17.189 -50.527 -6.554  1.00 51.67  ? 4   VAL B CA    1 
ATOM   1944 C C     . VAL B 2 4   ? 16.489 -51.144 -5.343  1.00 51.63  ? 4   VAL B C     1 
ATOM   1945 O O     . VAL B 2 4   ? 15.371 -51.651 -5.460  1.00 51.63  ? 4   VAL B O     1 
ATOM   1946 C CB    . VAL B 2 4   ? 16.508 -49.191 -6.946  1.00 51.64  ? 4   VAL B CB    1 
ATOM   1947 C CG1   . VAL B 2 4   ? 16.501 -48.214 -5.774  1.00 51.34  ? 4   VAL B CG1   1 
ATOM   1948 C CG2   . VAL B 2 4   ? 17.198 -48.572 -8.156  1.00 51.50  ? 4   VAL B CG2   1 
ATOM   1949 N N     . VAL B 2 5   ? 17.151 -51.105 -4.189  1.00 51.53  ? 5   VAL B N     1 
ATOM   1950 C CA    . VAL B 2 5   ? 16.567 -51.621 -2.944  1.00 51.52  ? 5   VAL B CA    1 
ATOM   1951 C C     . VAL B 2 5   ? 16.178 -50.522 -1.952  1.00 51.52  ? 5   VAL B C     1 
ATOM   1952 O O     . VAL B 2 5   ? 15.402 -50.765 -1.023  1.00 51.54  ? 5   VAL B O     1 
ATOM   1953 C CB    . VAL B 2 5   ? 17.476 -52.673 -2.243  1.00 51.49  ? 5   VAL B CB    1 
ATOM   1954 C CG1   . VAL B 2 5   ? 17.596 -53.930 -3.093  1.00 51.47  ? 5   VAL B CG1   1 
ATOM   1955 C CG2   . VAL B 2 5   ? 18.852 -52.095 -1.908  1.00 51.57  ? 5   VAL B CG2   1 
ATOM   1956 N N     . ALA B 2 6   ? 16.718 -49.320 -2.155  1.00 51.54  ? 6   ALA B N     1 
ATOM   1957 C CA    . ALA B 2 6   ? 16.432 -48.176 -1.288  1.00 51.58  ? 6   ALA B CA    1 
ATOM   1958 C C     . ALA B 2 6   ? 16.783 -46.838 -1.932  1.00 51.60  ? 6   ALA B C     1 
ATOM   1959 O O     . ALA B 2 6   ? 17.729 -46.739 -2.716  1.00 51.40  ? 6   ALA B O     1 
ATOM   1960 C CB    . ALA B 2 6   ? 17.165 -48.318 0.042   1.00 51.56  ? 6   ALA B CB    1 
ATOM   1961 N N     . VAL B 2 7   ? 16.001 -45.817 -1.591  1.00 51.68  ? 7   VAL B N     1 
ATOM   1962 C CA    . VAL B 2 7   ? 16.321 -44.429 -1.921  1.00 51.78  ? 7   VAL B CA    1 
ATOM   1963 C C     . VAL B 2 7   ? 16.325 -43.603 -0.626  1.00 51.70  ? 7   VAL B C     1 
ATOM   1964 O O     . VAL B 2 7   ? 15.272 -43.266 -0.079  1.00 51.68  ? 7   VAL B O     1 
ATOM   1965 C CB    . VAL B 2 7   ? 15.381 -43.840 -3.026  1.00 51.77  ? 7   VAL B CB    1 
ATOM   1966 C CG1   . VAL B 2 7   ? 13.905 -44.084 -2.706  1.00 52.15  ? 7   VAL B CG1   1 
ATOM   1967 C CG2   . VAL B 2 7   ? 15.664 -42.354 -3.260  1.00 51.80  ? 7   VAL B CG2   1 
ATOM   1968 N N     . VAL B 2 8   ? 17.526 -43.310 -0.132  1.00 51.65  ? 8   VAL B N     1 
ATOM   1969 C CA    . VAL B 2 8   ? 17.701 -42.639 1.157   1.00 51.64  ? 8   VAL B CA    1 
ATOM   1970 C C     . VAL B 2 8   ? 17.846 -41.128 0.980   1.00 51.62  ? 8   VAL B C     1 
ATOM   1971 O O     . VAL B 2 8   ? 18.746 -40.657 0.281   1.00 51.57  ? 8   VAL B O     1 
ATOM   1972 C CB    . VAL B 2 8   ? 18.920 -43.206 1.942   1.00 51.65  ? 8   VAL B CB    1 
ATOM   1973 C CG1   . VAL B 2 8   ? 19.066 -42.514 3.295   1.00 51.69  ? 8   VAL B CG1   1 
ATOM   1974 C CG2   . VAL B 2 8   ? 18.790 -44.713 2.131   1.00 51.59  ? 8   VAL B CG2   1 
ATOM   1975 N N     . LYS B 2 9   ? 16.951 -40.380 1.618   1.00 51.61  ? 9   LYS B N     1 
ATOM   1976 C CA    . LYS B 2 9   ? 17.005 -38.923 1.599   1.00 51.67  ? 9   LYS B CA    1 
ATOM   1977 C C     . LYS B 2 9   ? 17.592 -38.395 2.902   1.00 51.72  ? 9   LYS B C     1 
ATOM   1978 O O     . LYS B 2 9   ? 17.034 -38.610 3.980   1.00 51.69  ? 9   LYS B O     1 
ATOM   1979 C CB    . LYS B 2 9   ? 15.619 -38.323 1.345   1.00 51.69  ? 9   LYS B CB    1 
ATOM   1980 C CG    . LYS B 2 9   ? 15.104 -38.517 -0.075  1.00 51.67  ? 9   LYS B CG    1 
ATOM   1981 C CD    . LYS B 2 9   ? 13.807 -37.759 -0.299  1.00 51.72  ? 9   LYS B CD    1 
ATOM   1982 C CE    . LYS B 2 9   ? 13.293 -37.948 -1.719  1.00 51.72  ? 9   LYS B CE    1 
ATOM   1983 N NZ    . LYS B 2 9   ? 12.067 -37.140 -1.979  1.00 51.42  ? 9   LYS B NZ    1 
ATOM   1984 N N     . LEU B 2 10  ? 18.733 -37.720 2.789   1.00 51.81  ? 10  LEU B N     1 
ATOM   1985 C CA    . LEU B 2 10  ? 19.414 -37.125 3.935   1.00 51.91  ? 10  LEU B CA    1 
ATOM   1986 C C     . LEU B 2 10  ? 19.645 -35.635 3.708   1.00 52.04  ? 10  LEU B C     1 
ATOM   1987 O O     . LEU B 2 10  ? 19.534 -35.147 2.582   1.00 52.09  ? 10  LEU B O     1 
ATOM   1988 C CB    . LEU B 2 10  ? 20.768 -37.808 4.181   1.00 51.87  ? 10  LEU B CB    1 
ATOM   1989 C CG    . LEU B 2 10  ? 20.895 -39.303 4.498   1.00 51.65  ? 10  LEU B CG    1 
ATOM   1990 C CD1   . LEU B 2 10  ? 22.366 -39.691 4.549   1.00 51.69  ? 10  LEU B CD1   1 
ATOM   1991 C CD2   . LEU B 2 10  ? 20.215 -39.666 5.804   1.00 51.52  ? 10  LEU B CD2   1 
ATOM   1992 N N     . GLN B 2 11  ? 19.958 -34.920 4.787   1.00 52.15  ? 11  GLN B N     1 
ATOM   1993 C CA    . GLN B 2 11  ? 20.449 -33.546 4.697   1.00 52.33  ? 11  GLN B CA    1 
ATOM   1994 C C     . GLN B 2 11  ? 21.687 -33.386 5.577   1.00 52.47  ? 11  GLN B C     1 
ATOM   1995 O O     . GLN B 2 11  ? 21.613 -33.502 6.803   1.00 52.58  ? 11  GLN B O     1 
ATOM   1996 C CB    . GLN B 2 11  ? 19.362 -32.533 5.069   1.00 52.32  ? 11  GLN B CB    1 
ATOM   1997 C CG    . GLN B 2 11  ? 18.251 -32.412 4.028   1.00 52.32  ? 11  GLN B CG    1 
ATOM   1998 C CD    . GLN B 2 11  ? 17.307 -31.250 4.280   1.00 52.30  ? 11  GLN B CD    1 
ATOM   1999 O OE1   . GLN B 2 11  ? 17.665 -30.263 4.924   1.00 52.28  ? 11  GLN B OE1   1 
ATOM   2000 N NE2   . GLN B 2 11  ? 16.093 -31.360 3.755   1.00 52.26  ? 11  GLN B NE2   1 
ATOM   2001 N N     . LEU B 2 12  ? 22.823 -33.131 4.933   1.00 52.64  ? 12  LEU B N     1 
ATOM   2002 C CA    . LEU B 2 12  ? 24.123 -33.101 5.602   1.00 52.77  ? 12  LEU B CA    1 
ATOM   2003 C C     . LEU B 2 12  ? 24.853 -31.779 5.366   1.00 52.90  ? 12  LEU B C     1 
ATOM   2004 O O     . LEU B 2 12  ? 24.646 -31.136 4.335   1.00 52.81  ? 12  LEU B O     1 
ATOM   2005 C CB    . LEU B 2 12  ? 25.000 -34.262 5.110   1.00 52.74  ? 12  LEU B CB    1 
ATOM   2006 C CG    . LEU B 2 12  ? 24.526 -35.709 5.289   1.00 52.70  ? 12  LEU B CG    1 
ATOM   2007 C CD1   . LEU B 2 12  ? 25.376 -36.646 4.447   1.00 52.81  ? 12  LEU B CD1   1 
ATOM   2008 C CD2   . LEU B 2 12  ? 24.544 -36.135 6.754   1.00 52.55  ? 12  LEU B CD2   1 
ATOM   2009 N N     . PRO B 2 13  ? 25.703 -31.362 6.329   1.00 53.08  ? 13  PRO B N     1 
ATOM   2010 C CA    . PRO B 2 13  ? 26.581 -30.207 6.115   1.00 53.22  ? 13  PRO B CA    1 
ATOM   2011 C C     . PRO B 2 13  ? 27.635 -30.485 5.042   1.00 53.26  ? 13  PRO B C     1 
ATOM   2012 O O     . PRO B 2 13  ? 28.186 -31.587 4.987   1.00 53.27  ? 13  PRO B O     1 
ATOM   2013 C CB    . PRO B 2 13  ? 27.244 -30.007 7.483   1.00 53.26  ? 13  PRO B CB    1 
ATOM   2014 C CG    . PRO B 2 13  ? 27.153 -31.335 8.153   1.00 53.23  ? 13  PRO B CG    1 
ATOM   2015 C CD    . PRO B 2 13  ? 25.865 -31.931 7.681   1.00 53.08  ? 13  PRO B CD    1 
ATOM   2016 N N     . ALA B 2 14  ? 27.904 -29.485 4.204   1.00 53.39  ? 14  ALA B N     1 
ATOM   2017 C CA    . ALA B 2 14  ? 28.831 -29.619 3.078   1.00 53.50  ? 14  ALA B CA    1 
ATOM   2018 C C     . ALA B 2 14  ? 30.262 -29.936 3.509   1.00 53.59  ? 14  ALA B C     1 
ATOM   2019 O O     . ALA B 2 14  ? 30.866 -29.197 4.290   1.00 53.61  ? 14  ALA B O     1 
ATOM   2020 C CB    . ALA B 2 14  ? 28.803 -28.364 2.211   1.00 53.46  ? 14  ALA B CB    1 
ATOM   2021 N N     . GLY B 2 15  ? 30.783 -31.049 2.998   1.00 53.73  ? 15  GLY B N     1 
ATOM   2022 C CA    . GLY B 2 15  ? 32.173 -31.447 3.207   1.00 53.91  ? 15  GLY B CA    1 
ATOM   2023 C C     . GLY B 2 15  ? 32.548 -31.884 4.611   1.00 54.05  ? 15  GLY B C     1 
ATOM   2024 O O     . GLY B 2 15  ? 33.735 -31.995 4.928   1.00 54.12  ? 15  GLY B O     1 
ATOM   2025 N N     . LYS B 2 16  ? 31.546 -32.138 5.451   1.00 54.15  ? 16  LYS B N     1 
ATOM   2026 C CA    . LYS B 2 16  ? 31.786 -32.522 6.846   1.00 54.33  ? 16  LYS B CA    1 
ATOM   2027 C C     . LYS B 2 16  ? 30.931 -33.707 7.307   1.00 54.24  ? 16  LYS B C     1 
ATOM   2028 O O     . LYS B 2 16  ? 30.619 -33.832 8.494   1.00 54.31  ? 16  LYS B O     1 
ATOM   2029 C CB    . LYS B 2 16  ? 31.593 -31.319 7.782   1.00 54.30  ? 16  LYS B CB    1 
ATOM   2030 C CG    . LYS B 2 16  ? 32.722 -30.289 7.734   1.00 54.58  ? 16  LYS B CG    1 
ATOM   2031 C CD    . LYS B 2 16  ? 32.681 -29.324 8.920   1.00 54.70  ? 16  LYS B CD    1 
ATOM   2032 C CE    . LYS B 2 16  ? 31.786 -28.110 8.663   1.00 55.45  ? 16  LYS B CE    1 
ATOM   2033 N NZ    . LYS B 2 16  ? 30.328 -28.424 8.742   1.00 55.69  ? 16  LYS B NZ    1 
ATOM   2034 N N     . ALA B 2 17  ? 30.565 -34.577 6.366   1.00 54.14  ? 17  ALA B N     1 
ATOM   2035 C CA    . ALA B 2 17  ? 29.830 -35.800 6.684   1.00 54.02  ? 17  ALA B CA    1 
ATOM   2036 C C     . ALA B 2 17  ? 30.738 -36.822 7.364   1.00 53.92  ? 17  ALA B C     1 
ATOM   2037 O O     . ALA B 2 17  ? 31.935 -36.889 7.079   1.00 53.83  ? 17  ALA B O     1 
ATOM   2038 C CB    . ALA B 2 17  ? 29.206 -36.393 5.430   1.00 54.02  ? 17  ALA B CB    1 
ATOM   2039 N N     . THR B 2 18  ? 30.157 -37.611 8.265   1.00 53.88  ? 18  THR B N     1 
ATOM   2040 C CA    . THR B 2 18  ? 30.894 -38.627 9.019   1.00 53.80  ? 18  THR B CA    1 
ATOM   2041 C C     . THR B 2 18  ? 30.128 -39.957 9.046   1.00 53.71  ? 18  THR B C     1 
ATOM   2042 O O     . THR B 2 18  ? 28.935 -39.985 8.731   1.00 53.64  ? 18  THR B O     1 
ATOM   2043 C CB    . THR B 2 18  ? 31.202 -38.153 10.466  1.00 53.82  ? 18  THR B CB    1 
ATOM   2044 O OG1   . THR B 2 18  ? 30.076 -37.444 10.995  1.00 53.91  ? 18  THR B OG1   1 
ATOM   2045 C CG2   . THR B 2 18  ? 32.425 -37.244 10.487  1.00 53.86  ? 18  THR B CG2   1 
ATOM   2046 N N     . PRO B 2 19  ? 30.812 -41.068 9.402   1.00 53.68  ? 19  PRO B N     1 
ATOM   2047 C CA    . PRO B 2 19  ? 30.146 -42.372 9.537   1.00 53.65  ? 19  PRO B CA    1 
ATOM   2048 C C     . PRO B 2 19  ? 29.113 -42.433 10.671  1.00 53.68  ? 19  PRO B C     1 
ATOM   2049 O O     . PRO B 2 19  ? 28.402 -43.432 10.801  1.00 53.70  ? 19  PRO B O     1 
ATOM   2050 C CB    . PRO B 2 19  ? 31.308 -43.328 9.829   1.00 53.66  ? 19  PRO B CB    1 
ATOM   2051 C CG    . PRO B 2 19  ? 32.370 -42.466 10.412  1.00 53.72  ? 19  PRO B CG    1 
ATOM   2052 C CD    . PRO B 2 19  ? 32.259 -41.174 9.671   1.00 53.66  ? 19  PRO B CD    1 
ATOM   2053 N N     . ALA B 2 20  ? 29.045 -41.373 11.476  1.00 53.62  ? 20  ALA B N     1 
ATOM   2054 C CA    . ALA B 2 20  ? 28.061 -41.248 12.549  1.00 53.52  ? 20  ALA B CA    1 
ATOM   2055 C C     . ALA B 2 20  ? 26.649 -41.044 11.979  1.00 53.50  ? 20  ALA B C     1 
ATOM   2056 O O     . ALA B 2 20  ? 26.507 -40.576 10.845  1.00 53.59  ? 20  ALA B O     1 
ATOM   2057 C CB    . ALA B 2 20  ? 28.441 -40.093 13.471  1.00 53.52  ? 20  ALA B CB    1 
ATOM   2058 N N     . PRO B 2 21  ? 25.602 -41.408 12.756  1.00 53.35  ? 21  PRO B N     1 
ATOM   2059 C CA    . PRO B 2 21  ? 24.209 -41.180 12.354  1.00 53.19  ? 21  PRO B CA    1 
ATOM   2060 C C     . PRO B 2 21  ? 23.964 -39.757 11.839  1.00 53.00  ? 21  PRO B C     1 
ATOM   2061 O O     . PRO B 2 21  ? 24.531 -38.807 12.386  1.00 53.08  ? 21  PRO B O     1 
ATOM   2062 C CB    . PRO B 2 21  ? 23.435 -41.415 13.651  1.00 53.21  ? 21  PRO B CB    1 
ATOM   2063 C CG    . PRO B 2 21  ? 24.245 -42.415 14.378  1.00 53.31  ? 21  PRO B CG    1 
ATOM   2064 C CD    . PRO B 2 21  ? 25.680 -42.086 14.066  1.00 53.35  ? 21  PRO B CD    1 
ATOM   2065 N N     . PRO B 2 22  ? 23.108 -39.600 10.808  1.00 52.77  ? 22  PRO B N     1 
ATOM   2066 C CA    . PRO B 2 22  ? 22.256 -40.616 10.180  1.00 52.56  ? 22  PRO B CA    1 
ATOM   2067 C C     . PRO B 2 22  ? 22.934 -41.527 9.150   1.00 52.35  ? 22  PRO B C     1 
ATOM   2068 O O     . PRO B 2 22  ? 22.390 -42.584 8.833   1.00 52.33  ? 22  PRO B O     1 
ATOM   2069 C CB    . PRO B 2 22  ? 21.180 -39.777 9.492   1.00 52.54  ? 22  PRO B CB    1 
ATOM   2070 C CG    . PRO B 2 22  ? 21.868 -38.512 9.137   1.00 52.74  ? 22  PRO B CG    1 
ATOM   2071 C CD    . PRO B 2 22  ? 22.932 -38.278 10.178  1.00 52.77  ? 22  PRO B CD    1 
ATOM   2072 N N     . VAL B 2 23  ? 24.100 -41.124 8.643   1.00 52.14  ? 23  VAL B N     1 
ATOM   2073 C CA    . VAL B 2 23  ? 24.800 -41.856 7.575   1.00 51.90  ? 23  VAL B CA    1 
ATOM   2074 C C     . VAL B 2 23  ? 25.032 -43.331 7.923   1.00 51.70  ? 23  VAL B C     1 
ATOM   2075 O O     . VAL B 2 23  ? 24.753 -44.215 7.109   1.00 51.70  ? 23  VAL B O     1 
ATOM   2076 C CB    . VAL B 2 23  ? 26.142 -41.169 7.189   1.00 51.90  ? 23  VAL B CB    1 
ATOM   2077 C CG1   . VAL B 2 23  ? 26.899 -41.987 6.145   1.00 51.86  ? 23  VAL B CG1   1 
ATOM   2078 C CG2   . VAL B 2 23  ? 25.890 -39.760 6.673   1.00 51.97  ? 23  VAL B CG2   1 
ATOM   2079 N N     . GLY B 2 24  ? 25.531 -43.579 9.132   1.00 51.42  ? 24  GLY B N     1 
ATOM   2080 C CA    . GLY B 2 24  ? 25.772 -44.935 9.629   1.00 51.17  ? 24  GLY B CA    1 
ATOM   2081 C C     . GLY B 2 24  ? 24.599 -45.885 9.453   1.00 51.00  ? 24  GLY B C     1 
ATOM   2082 O O     . GLY B 2 24  ? 24.674 -46.802 8.636   1.00 51.00  ? 24  GLY B O     1 
ATOM   2083 N N     . PRO B 2 25  ? 23.507 -45.677 10.219  1.00 50.83  ? 25  PRO B N     1 
ATOM   2084 C CA    . PRO B 2 25  ? 22.310 -46.519 10.107  1.00 50.67  ? 25  PRO B CA    1 
ATOM   2085 C C     . PRO B 2 25  ? 21.590 -46.436 8.754   1.00 50.54  ? 25  PRO B C     1 
ATOM   2086 O O     . PRO B 2 25  ? 21.092 -47.456 8.271   1.00 50.54  ? 25  PRO B O     1 
ATOM   2087 C CB    . PRO B 2 25  ? 21.402 -45.997 11.229  1.00 50.72  ? 25  PRO B CB    1 
ATOM   2088 C CG    . PRO B 2 25  ? 21.876 -44.615 11.498  1.00 50.75  ? 25  PRO B CG    1 
ATOM   2089 C CD    . PRO B 2 25  ? 23.353 -44.647 11.264  1.00 50.77  ? 25  PRO B CD    1 
ATOM   2090 N N     . ALA B 2 26  ? 21.541 -45.245 8.155   1.00 50.31  ? 26  ALA B N     1 
ATOM   2091 C CA    . ALA B 2 26  ? 20.808 -45.028 6.901   1.00 50.18  ? 26  ALA B CA    1 
ATOM   2092 C C     . ALA B 2 26  ? 21.336 -45.872 5.741   1.00 50.12  ? 26  ALA B C     1 
ATOM   2093 O O     . ALA B 2 26  ? 20.558 -46.410 4.954   1.00 50.03  ? 26  ALA B O     1 
ATOM   2094 C CB    . ALA B 2 26  ? 20.799 -43.549 6.525   1.00 50.17  ? 26  ALA B CB    1 
ATOM   2095 N N     . LEU B 2 27  ? 22.659 -45.977 5.643   1.00 49.97  ? 27  LEU B N     1 
ATOM   2096 C CA    . LEU B 2 27  ? 23.293 -46.791 4.611   1.00 49.93  ? 27  LEU B CA    1 
ATOM   2097 C C     . LEU B 2 27  ? 23.632 -48.185 5.132   1.00 49.90  ? 27  LEU B C     1 
ATOM   2098 O O     . LEU B 2 27  ? 23.594 -49.160 4.379   1.00 49.99  ? 27  LEU B O     1 
ATOM   2099 C CB    . LEU B 2 27  ? 24.547 -46.094 4.070   1.00 49.90  ? 27  LEU B CB    1 
ATOM   2100 C CG    . LEU B 2 27  ? 24.384 -45.104 2.909   1.00 49.89  ? 27  LEU B CG    1 
ATOM   2101 C CD1   . LEU B 2 27  ? 23.594 -43.850 3.290   1.00 49.87  ? 27  LEU B CD1   1 
ATOM   2102 C CD2   . LEU B 2 27  ? 25.751 -44.723 2.380   1.00 49.79  ? 27  LEU B CD2   1 
ATOM   2103 N N     . GLY B 2 28  ? 23.945 -48.266 6.424   1.00 49.82  ? 28  GLY B N     1 
ATOM   2104 C CA    . GLY B 2 28  ? 24.334 -49.517 7.074   1.00 49.76  ? 28  GLY B CA    1 
ATOM   2105 C C     . GLY B 2 28  ? 23.279 -50.607 7.067   1.00 49.68  ? 28  GLY B C     1 
ATOM   2106 O O     . GLY B 2 28  ? 23.612 -51.789 6.971   1.00 49.83  ? 28  GLY B O     1 
ATOM   2107 N N     . GLN B 2 29  ? 22.009 -50.215 7.164   1.00 49.54  ? 29  GLN B N     1 
ATOM   2108 C CA    . GLN B 2 29  ? 20.906 -51.179 7.161   1.00 49.41  ? 29  GLN B CA    1 
ATOM   2109 C C     . GLN B 2 29  ? 20.733 -51.878 5.807   1.00 49.17  ? 29  GLN B C     1 
ATOM   2110 O O     . GLN B 2 29  ? 20.134 -52.954 5.734   1.00 49.03  ? 29  GLN B O     1 
ATOM   2111 C CB    . GLN B 2 29  ? 19.590 -50.536 7.627   1.00 49.50  ? 29  GLN B CB    1 
ATOM   2112 C CG    . GLN B 2 29  ? 18.991 -49.499 6.682   1.00 49.88  ? 29  GLN B CG    1 
ATOM   2113 C CD    . GLN B 2 29  ? 17.490 -49.341 6.861   1.00 50.56  ? 29  GLN B CD    1 
ATOM   2114 O OE1   . GLN B 2 29  ? 16.728 -50.301 6.712   1.00 50.92  ? 29  GLN B OE1   1 
ATOM   2115 N NE2   . GLN B 2 29  ? 17.056 -48.125 7.173   1.00 50.62  ? 29  GLN B NE2   1 
ATOM   2116 N N     . HIS B 2 30  ? 21.264 -51.266 4.750   1.00 48.89  ? 30  HIS B N     1 
ATOM   2117 C CA    . HIS B 2 30  ? 21.222 -51.848 3.407   1.00 48.73  ? 30  HIS B CA    1 
ATOM   2118 C C     . HIS B 2 30  ? 22.588 -52.384 2.954   1.00 48.58  ? 30  HIS B C     1 
ATOM   2119 O O     . HIS B 2 30  ? 22.752 -52.803 1.804   1.00 48.45  ? 30  HIS B O     1 
ATOM   2120 C CB    . HIS B 2 30  ? 20.655 -50.844 2.397   1.00 48.73  ? 30  HIS B CB    1 
ATOM   2121 C CG    . HIS B 2 30  ? 19.215 -50.507 2.632   1.00 48.86  ? 30  HIS B CG    1 
ATOM   2122 N ND1   . HIS B 2 30  ? 18.817 -49.375 3.310   1.00 49.09  ? 30  HIS B ND1   1 
ATOM   2123 C CD2   . HIS B 2 30  ? 18.079 -51.161 2.292   1.00 48.83  ? 30  HIS B CD2   1 
ATOM   2124 C CE1   . HIS B 2 30  ? 17.498 -49.343 3.372   1.00 48.83  ? 30  HIS B CE1   1 
ATOM   2125 N NE2   . HIS B 2 30  ? 17.026 -50.415 2.762   1.00 49.06  ? 30  HIS B NE2   1 
ATOM   2126 N N     . GLY B 2 31  ? 23.556 -52.366 3.869   1.00 48.41  ? 31  GLY B N     1 
ATOM   2127 C CA    . GLY B 2 31  ? 24.890 -52.919 3.623   1.00 48.22  ? 31  GLY B CA    1 
ATOM   2128 C C     . GLY B 2 31  ? 25.788 -52.110 2.703   1.00 48.06  ? 31  GLY B C     1 
ATOM   2129 O O     . GLY B 2 31  ? 26.782 -52.630 2.188   1.00 48.17  ? 31  GLY B O     1 
ATOM   2130 N N     . ALA B 2 32  ? 25.445 -50.840 2.496   1.00 47.78  ? 32  ALA B N     1 
ATOM   2131 C CA    . ALA B 2 32  ? 26.240 -49.946 1.653   1.00 47.53  ? 32  ALA B CA    1 
ATOM   2132 C C     . ALA B 2 32  ? 27.535 -49.535 2.350   1.00 47.39  ? 32  ALA B C     1 
ATOM   2133 O O     . ALA B 2 32  ? 27.592 -49.463 3.582   1.00 47.31  ? 32  ALA B O     1 
ATOM   2134 C CB    . ALA B 2 32  ? 25.427 -48.716 1.268   1.00 47.60  ? 32  ALA B CB    1 
ATOM   2135 N N     . ASN B 2 33  ? 28.572 -49.270 1.557   1.00 47.06  ? 33  ASN B N     1 
ATOM   2136 C CA    . ASN B 2 33  ? 29.871 -48.882 2.096   1.00 46.82  ? 33  ASN B CA    1 
ATOM   2137 C C     . ASN B 2 33  ? 29.835 -47.451 2.631   1.00 46.72  ? 33  ASN B C     1 
ATOM   2138 O O     . ASN B 2 33  ? 29.874 -46.483 1.865   1.00 46.54  ? 33  ASN B O     1 
ATOM   2139 C CB    . ASN B 2 33  ? 30.975 -49.064 1.046   1.00 46.78  ? 33  ASN B CB    1 
ATOM   2140 C CG    . ASN B 2 33  ? 32.375 -49.045 1.649   1.00 46.55  ? 33  ASN B CG    1 
ATOM   2141 O OD1   . ASN B 2 33  ? 32.671 -48.266 2.556   1.00 46.49  ? 33  ASN B OD1   1 
ATOM   2142 N ND2   . ASN B 2 33  ? 33.248 -49.900 1.131   1.00 45.97  ? 33  ASN B ND2   1 
ATOM   2143 N N     . ILE B 2 34  ? 29.757 -47.341 3.957   1.00 46.58  ? 34  ILE B N     1 
ATOM   2144 C CA    . ILE B 2 34  ? 29.611 -46.059 4.650   1.00 46.52  ? 34  ILE B CA    1 
ATOM   2145 C C     . ILE B 2 34  ? 30.809 -45.135 4.420   1.00 46.48  ? 34  ILE B C     1 
ATOM   2146 O O     . ILE B 2 34  ? 30.637 -43.962 4.080   1.00 46.44  ? 34  ILE B O     1 
ATOM   2147 C CB    . ILE B 2 34  ? 29.365 -46.265 6.173   1.00 46.54  ? 34  ILE B CB    1 
ATOM   2148 C CG1   . ILE B 2 34  ? 28.042 -47.006 6.406   1.00 46.64  ? 34  ILE B CG1   1 
ATOM   2149 C CG2   . ILE B 2 34  ? 29.368 -44.929 6.911   1.00 46.57  ? 34  ILE B CG2   1 
ATOM   2150 C CD1   . ILE B 2 34  ? 27.936 -47.702 7.758   1.00 47.22  ? 34  ILE B CD1   1 
ATOM   2151 N N     . MET B 2 35  ? 32.014 -45.672 4.599   1.00 46.46  ? 35  MET B N     1 
ATOM   2152 C CA    . MET B 2 35  ? 33.242 -44.895 4.430   1.00 46.38  ? 35  MET B CA    1 
ATOM   2153 C C     . MET B 2 35  ? 33.421 -44.405 2.991   1.00 46.12  ? 35  MET B C     1 
ATOM   2154 O O     . MET B 2 35  ? 33.926 -43.302 2.766   1.00 46.06  ? 35  MET B O     1 
ATOM   2155 C CB    . MET B 2 35  ? 34.461 -45.698 4.892   1.00 46.68  ? 35  MET B CB    1 
ATOM   2156 C CG    . MET B 2 35  ? 34.441 -46.071 6.375   1.00 47.45  ? 35  MET B CG    1 
ATOM   2157 S SD    . MET B 2 35  ? 34.301 -44.640 7.469   1.00 50.35  ? 35  MET B SD    1 
ATOM   2158 C CE    . MET B 2 35  ? 35.241 -43.448 6.899   0.00 25.00  ? 35  MET B CE    1 
ATOM   2159 N N     . GLU B 2 36  ? 32.994 -45.222 2.029   1.00 45.79  ? 36  GLU B N     1 
ATOM   2160 C CA    . GLU B 2 36  ? 33.019 -44.839 0.618   1.00 45.77  ? 36  GLU B CA    1 
ATOM   2161 C C     . GLU B 2 36  ? 32.090 -43.653 0.350   1.00 45.25  ? 36  GLU B C     1 
ATOM   2162 O O     . GLU B 2 36  ? 32.470 -42.716 -0.353  1.00 45.09  ? 36  GLU B O     1 
ATOM   2163 C CB    . GLU B 2 36  ? 32.652 -46.023 -0.280  1.00 45.71  ? 36  GLU B CB    1 
ATOM   2164 C CG    . GLU B 2 36  ? 32.771 -45.739 -1.777  1.00 46.22  ? 36  GLU B CG    1 
ATOM   2165 C CD    . GLU B 2 36  ? 32.424 -46.938 -2.647  1.00 46.76  ? 36  GLU B CD    1 
ATOM   2166 O OE1   . GLU B 2 36  ? 31.973 -47.974 -2.108  1.00 47.61  ? 36  GLU B OE1   1 
ATOM   2167 O OE2   . GLU B 2 36  ? 32.605 -46.842 -3.880  1.00 48.69  ? 36  GLU B OE2   1 
ATOM   2168 N N     . PHE B 2 37  ? 30.879 -43.696 0.910   1.00 44.91  ? 37  PHE B N     1 
ATOM   2169 C CA    . PHE B 2 37  ? 29.940 -42.584 0.758   1.00 44.51  ? 37  PHE B CA    1 
ATOM   2170 C C     . PHE B 2 37  ? 30.451 -41.310 1.416   1.00 44.28  ? 37  PHE B C     1 
ATOM   2171 O O     . PHE B 2 37  ? 30.399 -40.239 0.813   1.00 44.29  ? 37  PHE B O     1 
ATOM   2172 C CB    . PHE B 2 37  ? 28.549 -42.912 1.310   1.00 44.50  ? 37  PHE B CB    1 
ATOM   2173 C CG    . PHE B 2 37  ? 27.644 -41.713 1.374   1.00 44.36  ? 37  PHE B CG    1 
ATOM   2174 C CD1   . PHE B 2 37  ? 27.049 -41.213 0.218   1.00 44.27  ? 37  PHE B CD1   1 
ATOM   2175 C CD2   . PHE B 2 37  ? 27.431 -41.049 2.576   1.00 44.37  ? 37  PHE B CD2   1 
ATOM   2176 C CE1   . PHE B 2 37  ? 26.237 -40.089 0.265   1.00 44.21  ? 37  PHE B CE1   1 
ATOM   2177 C CE2   . PHE B 2 37  ? 26.619 -39.923 2.631   1.00 44.41  ? 37  PHE B CE2   1 
ATOM   2178 C CZ    . PHE B 2 37  ? 26.022 -39.443 1.473   1.00 44.10  ? 37  PHE B CZ    1 
ATOM   2179 N N     . VAL B 2 38  ? 30.921 -41.437 2.656   1.00 44.00  ? 38  VAL B N     1 
ATOM   2180 C CA    . VAL B 2 38  ? 31.461 -40.310 3.420   1.00 43.95  ? 38  VAL B CA    1 
ATOM   2181 C C     . VAL B 2 38  ? 32.552 -39.574 2.637   1.00 43.79  ? 38  VAL B C     1 
ATOM   2182 O O     . VAL B 2 38  ? 32.501 -38.351 2.491   1.00 43.91  ? 38  VAL B O     1 
ATOM   2183 C CB    . VAL B 2 38  ? 31.987 -40.771 4.808   1.00 43.94  ? 38  VAL B CB    1 
ATOM   2184 C CG1   . VAL B 2 38  ? 32.833 -39.686 5.471   1.00 44.00  ? 38  VAL B CG1   1 
ATOM   2185 C CG2   . VAL B 2 38  ? 30.824 -41.162 5.710   1.00 44.00  ? 38  VAL B CG2   1 
ATOM   2186 N N     . ALA B 2 39  ? 33.520 -40.328 2.121   1.00 43.69  ? 39  ALA B N     1 
ATOM   2187 C CA    . ALA B 2 39  ? 34.617 -39.762 1.338   1.00 43.52  ? 39  ALA B CA    1 
ATOM   2188 C C     . ALA B 2 39  ? 34.121 -39.076 0.064   1.00 43.40  ? 39  ALA B C     1 
ATOM   2189 O O     . ALA B 2 39  ? 34.544 -37.962 -0.245  1.00 43.41  ? 39  ALA B O     1 
ATOM   2190 C CB    . ALA B 2 39  ? 35.642 -40.838 1.005   1.00 43.36  ? 39  ALA B CB    1 
ATOM   2191 N N     . ALA B 2 40  ? 33.216 -39.740 -0.656  1.00 43.29  ? 40  ALA B N     1 
ATOM   2192 C CA    . ALA B 2 40  ? 32.691 -39.227 -1.926  1.00 43.18  ? 40  ALA B CA    1 
ATOM   2193 C C     . ALA B 2 40  ? 31.787 -38.005 -1.756  1.00 43.14  ? 40  ALA B C     1 
ATOM   2194 O O     . ALA B 2 40  ? 31.888 -37.048 -2.524  1.00 42.83  ? 40  ALA B O     1 
ATOM   2195 C CB    . ALA B 2 40  ? 31.968 -40.327 -2.695  1.00 43.08  ? 40  ALA B CB    1 
ATOM   2196 N N     . PHE B 2 41  ? 30.906 -38.041 -0.758  1.00 43.32  ? 41  PHE B N     1 
ATOM   2197 C CA    . PHE B 2 41  ? 30.034 -36.902 -0.469  1.00 43.55  ? 41  PHE B CA    1 
ATOM   2198 C C     . PHE B 2 41  ? 30.850 -35.662 -0.113  1.00 43.77  ? 41  PHE B C     1 
ATOM   2199 O O     . PHE B 2 41  ? 30.583 -34.571 -0.623  1.00 43.80  ? 41  PHE B O     1 
ATOM   2200 C CB    . PHE B 2 41  ? 29.048 -37.221 0.661   1.00 43.54  ? 41  PHE B CB    1 
ATOM   2201 C CG    . PHE B 2 41  ? 28.174 -36.055 1.048   1.00 43.57  ? 41  PHE B CG    1 
ATOM   2202 C CD1   . PHE B 2 41  ? 27.002 -35.784 0.348   1.00 43.69  ? 41  PHE B CD1   1 
ATOM   2203 C CD2   . PHE B 2 41  ? 28.530 -35.220 2.106   1.00 43.99  ? 41  PHE B CD2   1 
ATOM   2204 C CE1   . PHE B 2 41  ? 26.194 -34.704 0.698   1.00 43.76  ? 41  PHE B CE1   1 
ATOM   2205 C CE2   . PHE B 2 41  ? 27.730 -34.137 2.464   1.00 43.86  ? 41  PHE B CE2   1 
ATOM   2206 C CZ    . PHE B 2 41  ? 26.560 -33.879 1.757   1.00 43.85  ? 41  PHE B CZ    1 
ATOM   2207 N N     . ASN B 2 42  ? 31.837 -35.840 0.764   1.00 43.95  ? 42  ASN B N     1 
ATOM   2208 C CA    . ASN B 2 42  ? 32.669 -34.735 1.233   1.00 44.27  ? 42  ASN B CA    1 
ATOM   2209 C C     . ASN B 2 42  ? 33.444 -34.049 0.115   1.00 44.62  ? 42  ASN B C     1 
ATOM   2210 O O     . ASN B 2 42  ? 33.565 -32.827 0.110   1.00 44.83  ? 42  ASN B O     1 
ATOM   2211 C CB    . ASN B 2 42  ? 33.612 -35.199 2.344   1.00 44.12  ? 42  ASN B CB    1 
ATOM   2212 C CG    . ASN B 2 42  ? 32.899 -35.381 3.672   1.00 43.92  ? 42  ASN B CG    1 
ATOM   2213 O OD1   . ASN B 2 42  ? 31.777 -34.912 3.855   1.00 43.33  ? 42  ASN B OD1   1 
ATOM   2214 N ND2   . ASN B 2 42  ? 33.553 -36.058 4.608   1.00 44.12  ? 42  ASN B ND2   1 
ATOM   2215 N N     . ALA B 2 43  ? 33.950 -34.836 -0.832  1.00 45.01  ? 43  ALA B N     1 
ATOM   2216 C CA    . ALA B 2 43  ? 34.658 -34.292 -1.987  1.00 45.55  ? 43  ALA B CA    1 
ATOM   2217 C C     . ALA B 2 43  ? 33.710 -33.592 -2.962  1.00 45.94  ? 43  ALA B C     1 
ATOM   2218 O O     . ALA B 2 43  ? 34.059 -32.563 -3.538  1.00 46.08  ? 43  ALA B O     1 
ATOM   2219 C CB    . ALA B 2 43  ? 35.449 -35.384 -2.695  1.00 45.44  ? 43  ALA B CB    1 
ATOM   2220 N N     . ALA B 2 44  ? 32.513 -34.152 -3.132  1.00 46.38  ? 44  ALA B N     1 
ATOM   2221 C CA    . ALA B 2 44  ? 31.515 -33.608 -4.056  1.00 47.00  ? 44  ALA B CA    1 
ATOM   2222 C C     . ALA B 2 44  ? 30.921 -32.278 -3.585  1.00 47.40  ? 44  ALA B C     1 
ATOM   2223 O O     . ALA B 2 44  ? 30.468 -31.473 -4.401  1.00 47.42  ? 44  ALA B O     1 
ATOM   2224 C CB    . ALA B 2 44  ? 30.408 -34.626 -4.299  1.00 46.87  ? 44  ALA B CB    1 
ATOM   2225 N N     . THR B 2 45  ? 30.931 -32.058 -2.270  1.00 48.02  ? 45  THR B N     1 
ATOM   2226 C CA    . THR B 2 45  ? 30.318 -30.877 -1.657  1.00 48.56  ? 45  THR B CA    1 
ATOM   2227 C C     . THR B 2 45  ? 31.362 -29.969 -1.004  1.00 49.04  ? 45  THR B C     1 
ATOM   2228 O O     . THR B 2 45  ? 31.024 -29.072 -0.230  1.00 48.97  ? 45  THR B O     1 
ATOM   2229 C CB    . THR B 2 45  ? 29.273 -31.284 -0.591  1.00 48.57  ? 45  THR B CB    1 
ATOM   2230 O OG1   . THR B 2 45  ? 29.928 -31.953 0.496   1.00 48.33  ? 45  THR B OG1   1 
ATOM   2231 C CG2   . THR B 2 45  ? 28.210 -32.203 -1.191  1.00 48.56  ? 45  THR B CG2   1 
ATOM   2232 N N     . ALA B 2 46  ? 32.626 -30.204 -1.346  1.00 49.73  ? 46  ALA B N     1 
ATOM   2233 C CA    . ALA B 2 46  ? 33.773 -29.591 -0.674  1.00 50.37  ? 46  ALA B CA    1 
ATOM   2234 C C     . ALA B 2 46  ? 33.850 -28.070 -0.781  1.00 50.83  ? 46  ALA B C     1 
ATOM   2235 O O     . ALA B 2 46  ? 34.166 -27.391 0.199   1.00 50.94  ? 46  ALA B O     1 
ATOM   2236 C CB    . ALA B 2 46  ? 35.057 -30.215 -1.185  1.00 50.30  ? 46  ALA B CB    1 
ATOM   2237 N N     . ASN B 2 47  ? 33.565 -27.545 -1.970  1.00 51.40  ? 47  ASN B N     1 
ATOM   2238 C CA    . ASN B 2 47  ? 33.694 -26.115 -2.235  1.00 51.91  ? 47  ASN B CA    1 
ATOM   2239 C C     . ASN B 2 47  ? 32.521 -25.281 -1.713  1.00 52.24  ? 47  ASN B C     1 
ATOM   2240 O O     . ASN B 2 47  ? 32.613 -24.053 -1.631  1.00 52.26  ? 47  ASN B O     1 
ATOM   2241 C CB    . ASN B 2 47  ? 33.884 -25.874 -3.735  1.00 51.94  ? 47  ASN B CB    1 
ATOM   2242 C CG    . ASN B 2 47  ? 34.684 -24.617 -4.030  1.00 52.03  ? 47  ASN B CG    1 
ATOM   2243 O OD1   . ASN B 2 47  ? 35.604 -24.260 -3.291  1.00 52.26  ? 47  ASN B OD1   1 
ATOM   2244 N ND2   . ASN B 2 47  ? 34.345 -23.946 -5.125  1.00 52.28  ? 47  ASN B ND2   1 
ATOM   2245 N N     . MET B 2 48  ? 31.433 -25.958 -1.348  1.00 52.66  ? 48  MET B N     1 
ATOM   2246 C CA    . MET B 2 48  ? 30.186 -25.302 -0.939  1.00 53.16  ? 48  MET B CA    1 
ATOM   2247 C C     . MET B 2 48  ? 30.252 -24.651 0.445   1.00 53.11  ? 48  MET B C     1 
ATOM   2248 O O     . MET B 2 48  ? 29.371 -23.869 0.811   1.00 53.21  ? 48  MET B O     1 
ATOM   2249 C CB    . MET B 2 48  ? 29.020 -26.292 -1.007  1.00 53.10  ? 48  MET B CB    1 
ATOM   2250 C CG    . MET B 2 48  ? 28.779 -26.865 -2.398  1.00 53.47  ? 48  MET B CG    1 
ATOM   2251 S SD    . MET B 2 48  ? 27.466 -28.098 -2.446  1.00 54.12  ? 48  MET B SD    1 
ATOM   2252 C CE    . MET B 2 48  ? 26.014 -27.054 -2.292  1.00 54.29  ? 48  MET B CE    1 
ATOM   2253 N N     . GLY B 2 49  ? 31.293 -24.978 1.207   1.00 53.14  ? 49  GLY B N     1 
ATOM   2254 C CA    . GLY B 2 49  ? 31.520 -24.372 2.516   1.00 53.12  ? 49  GLY B CA    1 
ATOM   2255 C C     . GLY B 2 49  ? 30.604 -24.906 3.598   1.00 53.12  ? 49  GLY B C     1 
ATOM   2256 O O     . GLY B 2 49  ? 30.665 -26.087 3.947   1.00 53.12  ? 49  GLY B O     1 
ATOM   2257 N N     . ASP B 2 50  ? 29.749 -24.030 4.124   1.00 53.10  ? 50  ASP B N     1 
ATOM   2258 C CA    . ASP B 2 50  ? 28.866 -24.369 5.242   1.00 53.04  ? 50  ASP B CA    1 
ATOM   2259 C C     . ASP B 2 50  ? 27.418 -24.664 4.841   1.00 52.88  ? 50  ASP B C     1 
ATOM   2260 O O     . ASP B 2 50  ? 26.568 -24.893 5.707   1.00 52.91  ? 50  ASP B O     1 
ATOM   2261 C CB    . ASP B 2 50  ? 28.905 -23.263 6.304   1.00 53.12  ? 50  ASP B CB    1 
ATOM   2262 C CG    . ASP B 2 50  ? 30.194 -23.268 7.109   1.00 53.39  ? 50  ASP B CG    1 
ATOM   2263 O OD1   . ASP B 2 50  ? 30.887 -24.309 7.138   1.00 53.85  ? 50  ASP B OD1   1 
ATOM   2264 O OD2   . ASP B 2 50  ? 30.510 -22.226 7.722   1.00 53.63  ? 50  ASP B OD2   1 
ATOM   2265 N N     . ALA B 2 51  ? 27.146 -24.672 3.537   1.00 52.65  ? 51  ALA B N     1 
ATOM   2266 C CA    . ALA B 2 51  ? 25.794 -24.893 3.021   1.00 52.36  ? 51  ALA B CA    1 
ATOM   2267 C C     . ALA B 2 51  ? 25.231 -26.251 3.432   1.00 52.18  ? 51  ALA B C     1 
ATOM   2268 O O     . ALA B 2 51  ? 25.946 -27.254 3.433   1.00 52.23  ? 51  ALA B O     1 
ATOM   2269 C CB    . ALA B 2 51  ? 25.773 -24.743 1.506   1.00 52.35  ? 51  ALA B CB    1 
ATOM   2270 N N     . ILE B 2 52  ? 23.951 -26.268 3.797   1.00 51.91  ? 52  ILE B N     1 
ATOM   2271 C CA    . ILE B 2 52  ? 23.256 -27.511 4.130   1.00 51.58  ? 52  ILE B CA    1 
ATOM   2272 C C     . ILE B 2 52  ? 22.893 -28.223 2.833   1.00 51.31  ? 52  ILE B C     1 
ATOM   2273 O O     . ILE B 2 52  ? 22.179 -27.671 2.000   1.00 51.29  ? 52  ILE B O     1 
ATOM   2274 C CB    . ILE B 2 52  ? 21.980 -27.255 4.983   1.00 51.62  ? 52  ILE B CB    1 
ATOM   2275 C CG1   . ILE B 2 52  ? 22.319 -26.510 6.287   1.00 51.77  ? 52  ILE B CG1   1 
ATOM   2276 C CG2   . ILE B 2 52  ? 21.220 -28.563 5.252   1.00 51.57  ? 52  ILE B CG2   1 
ATOM   2277 C CD1   . ILE B 2 52  ? 23.386 -27.174 7.166   1.00 52.04  ? 52  ILE B CD1   1 
ATOM   2278 N N     . VAL B 2 53  ? 23.392 -29.444 2.667   1.00 51.02  ? 53  VAL B N     1 
ATOM   2279 C CA    . VAL B 2 53  ? 23.213 -30.180 1.418   1.00 50.65  ? 53  VAL B CA    1 
ATOM   2280 C C     . VAL B 2 53  ? 22.244 -31.350 1.584   1.00 50.41  ? 53  VAL B C     1 
ATOM   2281 O O     . VAL B 2 53  ? 22.535 -32.298 2.317   1.00 50.38  ? 53  VAL B O     1 
ATOM   2282 C CB    . VAL B 2 53  ? 24.567 -30.689 0.846   1.00 50.68  ? 53  VAL B CB    1 
ATOM   2283 C CG1   . VAL B 2 53  ? 24.355 -31.401 -0.484  1.00 50.62  ? 53  VAL B CG1   1 
ATOM   2284 C CG2   . VAL B 2 53  ? 25.552 -29.538 0.674   1.00 50.59  ? 53  VAL B CG2   1 
ATOM   2285 N N     . PRO B 2 54  ? 21.076 -31.278 0.915   1.00 50.14  ? 54  PRO B N     1 
ATOM   2286 C CA    . PRO B 2 54  ? 20.210 -32.442 0.806   1.00 49.97  ? 54  PRO B CA    1 
ATOM   2287 C C     . PRO B 2 54  ? 20.797 -33.422 -0.202  1.00 49.75  ? 54  PRO B C     1 
ATOM   2288 O O     . PRO B 2 54  ? 21.269 -33.014 -1.268  1.00 49.72  ? 54  PRO B O     1 
ATOM   2289 C CB    . PRO B 2 54  ? 18.884 -31.858 0.288   1.00 49.96  ? 54  PRO B CB    1 
ATOM   2290 C CG    . PRO B 2 54  ? 19.026 -30.364 0.392   1.00 50.08  ? 54  PRO B CG    1 
ATOM   2291 C CD    . PRO B 2 54  ? 20.485 -30.109 0.250   1.00 50.11  ? 54  PRO B CD    1 
ATOM   2292 N N     . VAL B 2 55  ? 20.783 -34.702 0.149   1.00 49.44  ? 55  VAL B N     1 
ATOM   2293 C CA    . VAL B 2 55  ? 21.370 -35.734 -0.698  1.00 49.13  ? 55  VAL B CA    1 
ATOM   2294 C C     . VAL B 2 55  ? 20.443 -36.945 -0.812  1.00 48.90  ? 55  VAL B C     1 
ATOM   2295 O O     . VAL B 2 55  ? 19.805 -37.349 0.163   1.00 48.90  ? 55  VAL B O     1 
ATOM   2296 C CB    . VAL B 2 55  ? 22.812 -36.122 -0.219  1.00 49.13  ? 55  VAL B CB    1 
ATOM   2297 C CG1   . VAL B 2 55  ? 22.819 -36.596 1.238   1.00 49.07  ? 55  VAL B CG1   1 
ATOM   2298 C CG2   . VAL B 2 55  ? 23.456 -37.153 -1.148  1.00 48.84  ? 55  VAL B CG2   1 
ATOM   2299 N N     . GLU B 2 56  ? 20.356 -37.496 -2.019  1.00 48.70  ? 56  GLU B N     1 
ATOM   2300 C CA    . GLU B 2 56  ? 19.584 -38.706 -2.270  1.00 48.43  ? 56  GLU B CA    1 
ATOM   2301 C C     . GLU B 2 56  ? 20.520 -39.849 -2.624  1.00 47.99  ? 56  GLU B C     1 
ATOM   2302 O O     . GLU B 2 56  ? 21.178 -39.819 -3.664  1.00 47.87  ? 56  GLU B O     1 
ATOM   2303 C CB    . GLU B 2 56  ? 18.575 -38.489 -3.399  1.00 48.53  ? 56  GLU B CB    1 
ATOM   2304 C CG    . GLU B 2 56  ? 17.362 -37.663 -3.009  1.00 49.35  ? 56  GLU B CG    1 
ATOM   2305 C CD    . GLU B 2 56  ? 16.235 -37.760 -4.022  1.00 50.25  ? 56  GLU B CD    1 
ATOM   2306 O OE1   . GLU B 2 56  ? 16.071 -38.834 -4.644  1.00 50.68  ? 56  GLU B OE1   1 
ATOM   2307 O OE2   . GLU B 2 56  ? 15.507 -36.758 -4.191  1.00 50.97  ? 56  GLU B OE2   1 
ATOM   2308 N N     . ILE B 2 57  ? 20.581 -40.849 -1.750  1.00 47.58  ? 57  ILE B N     1 
ATOM   2309 C CA    . ILE B 2 57  ? 21.423 -42.020 -1.978  1.00 47.11  ? 57  ILE B CA    1 
ATOM   2310 C C     . ILE B 2 57  ? 20.563 -43.175 -2.484  1.00 46.93  ? 57  ILE B C     1 
ATOM   2311 O O     . ILE B 2 57  ? 19.661 -43.650 -1.788  1.00 46.87  ? 57  ILE B O     1 
ATOM   2312 C CB    . ILE B 2 57  ? 22.215 -42.450 -0.707  1.00 47.11  ? 57  ILE B CB    1 
ATOM   2313 C CG1   . ILE B 2 57  ? 22.948 -41.261 -0.076  1.00 47.05  ? 57  ILE B CG1   1 
ATOM   2314 C CG2   . ILE B 2 57  ? 23.212 -43.555 -1.038  1.00 46.84  ? 57  ILE B CG2   1 
ATOM   2315 C CD1   . ILE B 2 57  ? 22.172 -40.557 1.020   1.00 46.82  ? 57  ILE B CD1   1 
ATOM   2316 N N     . THR B 2 58  ? 20.837 -43.604 -3.711  1.00 46.54  ? 58  THR B N     1 
ATOM   2317 C CA    . THR B 2 58  ? 20.172 -44.765 -4.283  1.00 46.28  ? 58  THR B CA    1 
ATOM   2318 C C     . THR B 2 58  ? 21.049 -45.988 -4.036  1.00 46.21  ? 58  THR B C     1 
ATOM   2319 O O     . THR B 2 58  ? 22.183 -46.046 -4.507  1.00 46.08  ? 58  THR B O     1 
ATOM   2320 C CB    . THR B 2 58  ? 19.907 -44.574 -5.793  1.00 46.24  ? 58  THR B CB    1 
ATOM   2321 O OG1   . THR B 2 58  ? 19.044 -43.448 -5.986  1.00 45.60  ? 58  THR B OG1   1 
ATOM   2322 C CG2   . THR B 2 58  ? 19.256 -45.811 -6.397  1.00 46.17  ? 58  THR B CG2   1 
ATOM   2323 N N     . ILE B 2 59  ? 20.519 -46.949 -3.281  1.00 46.14  ? 59  ILE B N     1 
ATOM   2324 C CA    . ILE B 2 59  ? 21.248 -48.174 -2.949  1.00 46.05  ? 59  ILE B CA    1 
ATOM   2325 C C     . ILE B 2 59  ? 20.698 -49.347 -3.761  1.00 46.15  ? 59  ILE B C     1 
ATOM   2326 O O     . ILE B 2 59  ? 19.482 -49.528 -3.862  1.00 46.05  ? 59  ILE B O     1 
ATOM   2327 C CB    . ILE B 2 59  ? 21.202 -48.476 -1.427  1.00 46.03  ? 59  ILE B CB    1 
ATOM   2328 C CG1   . ILE B 2 59  ? 21.765 -47.287 -0.633  1.00 45.64  ? 59  ILE B CG1   1 
ATOM   2329 C CG2   . ILE B 2 59  ? 21.974 -49.757 -1.100  1.00 45.79  ? 59  ILE B CG2   1 
ATOM   2330 C CD1   . ILE B 2 59  ? 21.388 -47.272 0.838   1.00 45.34  ? 59  ILE B CD1   1 
ATOM   2331 N N     . TYR B 2 60  ? 21.604 -50.131 -4.341  1.00 46.17  ? 60  TYR B N     1 
ATOM   2332 C CA    . TYR B 2 60  ? 21.230 -51.231 -5.226  1.00 46.22  ? 60  TYR B CA    1 
ATOM   2333 C C     . TYR B 2 60  ? 21.370 -52.589 -4.542  1.00 46.31  ? 60  TYR B C     1 
ATOM   2334 O O     . TYR B 2 60  ? 21.929 -52.686 -3.445  1.00 46.27  ? 60  TYR B O     1 
ATOM   2335 C CB    . TYR B 2 60  ? 22.047 -51.182 -6.524  1.00 46.25  ? 60  TYR B CB    1 
ATOM   2336 C CG    . TYR B 2 60  ? 22.019 -49.830 -7.204  1.00 46.33  ? 60  TYR B CG    1 
ATOM   2337 C CD1   . TYR B 2 60  ? 20.981 -49.483 -8.070  1.00 46.25  ? 60  TYR B CD1   1 
ATOM   2338 C CD2   . TYR B 2 60  ? 23.025 -48.892 -6.971  1.00 45.92  ? 60  TYR B CD2   1 
ATOM   2339 C CE1   . TYR B 2 60  ? 20.951 -48.236 -8.690  1.00 46.48  ? 60  TYR B CE1   1 
ATOM   2340 C CE2   . TYR B 2 60  ? 23.004 -47.645 -7.584  1.00 46.09  ? 60  TYR B CE2   1 
ATOM   2341 C CZ    . TYR B 2 60  ? 21.967 -47.324 -8.441  1.00 46.13  ? 60  TYR B CZ    1 
ATOM   2342 O OH    . TYR B 2 60  ? 21.949 -46.090 -9.045  1.00 46.58  ? 60  TYR B OH    1 
ATOM   2343 N N     . ALA B 2 61  ? 20.856 -53.628 -5.199  1.00 46.32  ? 61  ALA B N     1 
ATOM   2344 C CA    . ALA B 2 61  ? 20.816 -54.980 -4.640  1.00 46.43  ? 61  ALA B CA    1 
ATOM   2345 C C     . ALA B 2 61  ? 22.195 -55.610 -4.432  1.00 46.58  ? 61  ALA B C     1 
ATOM   2346 O O     . ALA B 2 61  ? 22.356 -56.486 -3.580  1.00 46.51  ? 61  ALA B O     1 
ATOM   2347 C CB    . ALA B 2 61  ? 19.938 -55.877 -5.495  1.00 46.37  ? 61  ALA B CB    1 
ATOM   2348 N N     . ASP B 2 62  ? 23.183 -55.161 -5.205  1.00 46.90  ? 62  ASP B N     1 
ATOM   2349 C CA    . ASP B 2 62  ? 24.564 -55.617 -5.036  1.00 47.37  ? 62  ASP B CA    1 
ATOM   2350 C C     . ASP B 2 62  ? 25.316 -54.813 -3.965  1.00 47.61  ? 62  ASP B C     1 
ATOM   2351 O O     . ASP B 2 62  ? 26.532 -54.958 -3.812  1.00 47.69  ? 62  ASP B O     1 
ATOM   2352 C CB    . ASP B 2 62  ? 25.316 -55.602 -6.375  1.00 47.40  ? 62  ASP B CB    1 
ATOM   2353 C CG    . ASP B 2 62  ? 25.563 -54.195 -6.911  1.00 47.91  ? 62  ASP B CG    1 
ATOM   2354 O OD1   . ASP B 2 62  ? 24.939 -53.223 -6.427  1.00 48.01  ? 62  ASP B OD1   1 
ATOM   2355 O OD2   . ASP B 2 62  ? 26.393 -54.066 -7.837  1.00 48.56  ? 62  ASP B OD2   1 
ATOM   2356 N N     . ARG B 2 63  ? 24.574 -53.969 -3.242  1.00 47.89  ? 63  ARG B N     1 
ATOM   2357 C CA    . ARG B 2 63  ? 25.090 -53.149 -2.129  1.00 48.24  ? 63  ARG B CA    1 
ATOM   2358 C C     . ARG B 2 63  ? 25.839 -51.883 -2.560  1.00 48.26  ? 63  ARG B C     1 
ATOM   2359 O O     . ARG B 2 63  ? 26.204 -51.061 -1.713  1.00 48.19  ? 63  ARG B O     1 
ATOM   2360 C CB    . ARG B 2 63  ? 25.945 -53.980 -1.162  1.00 48.34  ? 63  ARG B CB    1 
ATOM   2361 C CG    . ARG B 2 63  ? 25.162 -54.939 -0.281  1.00 48.85  ? 63  ARG B CG    1 
ATOM   2362 C CD    . ARG B 2 63  ? 26.090 -55.992 0.306   1.00 50.22  ? 63  ARG B CD    1 
ATOM   2363 N NE    . ARG B 2 63  ? 25.703 -56.373 1.664   1.00 51.38  ? 63  ARG B NE    1 
ATOM   2364 C CZ    . ARG B 2 63  ? 24.864 -57.364 1.958   1.00 51.67  ? 63  ARG B CZ    1 
ATOM   2365 N NH1   . ARG B 2 63  ? 24.577 -57.633 3.227   1.00 52.15  ? 63  ARG B NH1   1 
ATOM   2366 N NH2   . ARG B 2 63  ? 24.155 -58.033 1.276   0.00 25.00  ? 63  ARG B NH2   1 
ATOM   2367 N N     . SER B 2 64  ? 26.052 -51.719 -3.865  1.00 48.38  ? 64  SER B N     1 
ATOM   2368 C CA    . SER B 2 64  ? 26.644 -50.492 -4.405  1.00 48.52  ? 64  SER B CA    1 
ATOM   2369 C C     . SER B 2 64  ? 25.639 -49.342 -4.330  1.00 48.68  ? 64  SER B C     1 
ATOM   2370 O O     . SER B 2 64  ? 24.452 -49.561 -4.072  1.00 48.56  ? 64  SER B O     1 
ATOM   2371 C CB    . SER B 2 64  ? 27.118 -50.700 -5.847  1.00 48.52  ? 64  SER B CB    1 
ATOM   2372 O OG    . SER B 2 64  ? 26.025 -50.754 -6.749  1.00 48.57  ? 64  SER B OG    1 
ATOM   2373 N N     . PHE B 2 65  ? 26.115 -48.120 -4.557  1.00 48.82  ? 65  PHE B N     1 
ATOM   2374 C CA    . PHE B 2 65  ? 25.260 -46.939 -4.470  1.00 49.06  ? 65  PHE B CA    1 
ATOM   2375 C C     . PHE B 2 65  ? 25.673 -45.843 -5.451  1.00 49.16  ? 65  PHE B C     1 
ATOM   2376 O O     . PHE B 2 65  ? 26.802 -45.824 -5.948  1.00 49.17  ? 65  PHE B O     1 
ATOM   2377 C CB    . PHE B 2 65  ? 25.250 -46.381 -3.035  1.00 49.00  ? 65  PHE B CB    1 
ATOM   2378 C CG    . PHE B 2 65  ? 26.559 -45.759 -2.613  1.00 49.08  ? 65  PHE B CG    1 
ATOM   2379 C CD1   . PHE B 2 65  ? 26.796 -44.399 -2.807  1.00 49.19  ? 65  PHE B CD1   1 
ATOM   2380 C CD2   . PHE B 2 65  ? 27.556 -46.535 -2.029  1.00 49.22  ? 65  PHE B CD2   1 
ATOM   2381 C CE1   . PHE B 2 65  ? 28.008 -43.824 -2.431  1.00 49.37  ? 65  PHE B CE1   1 
ATOM   2382 C CE2   . PHE B 2 65  ? 28.767 -45.969 -1.646  1.00 49.50  ? 65  PHE B CE2   1 
ATOM   2383 C CZ    . PHE B 2 65  ? 28.996 -44.613 -1.852  1.00 49.28  ? 65  PHE B CZ    1 
ATOM   2384 N N     . THR B 2 66  ? 24.734 -44.944 -5.725  1.00 49.38  ? 66  THR B N     1 
ATOM   2385 C CA    . THR B 2 66  ? 25.007 -43.667 -6.378  1.00 49.71  ? 66  THR B CA    1 
ATOM   2386 C C     . THR B 2 66  ? 24.279 -42.605 -5.565  1.00 50.11  ? 66  THR B C     1 
ATOM   2387 O O     . THR B 2 66  ? 23.377 -42.933 -4.793  1.00 50.10  ? 66  THR B O     1 
ATOM   2388 C CB    . THR B 2 66  ? 24.495 -43.623 -7.839  1.00 49.63  ? 66  THR B CB    1 
ATOM   2389 O OG1   . THR B 2 66  ? 23.098 -43.943 -7.874  1.00 49.55  ? 66  THR B OG1   1 
ATOM   2390 C CG2   . THR B 2 66  ? 25.272 -44.589 -8.730  1.00 49.41  ? 66  THR B CG2   1 
ATOM   2391 N N     . PHE B 2 67  ? 24.669 -41.342 -5.717  1.00 50.67  ? 67  PHE B N     1 
ATOM   2392 C CA    . PHE B 2 67  ? 23.962 -40.259 -5.031  1.00 51.37  ? 67  PHE B CA    1 
ATOM   2393 C C     . PHE B 2 67  ? 23.872 -38.957 -5.826  1.00 52.04  ? 67  PHE B C     1 
ATOM   2394 O O     . PHE B 2 67  ? 24.683 -38.694 -6.715  1.00 51.91  ? 67  PHE B O     1 
ATOM   2395 C CB    . PHE B 2 67  ? 24.509 -40.023 -3.608  1.00 51.13  ? 67  PHE B CB    1 
ATOM   2396 C CG    . PHE B 2 67  ? 25.906 -39.464 -3.563  1.00 50.82  ? 67  PHE B CG    1 
ATOM   2397 C CD1   . PHE B 2 67  ? 27.006 -40.314 -3.504  1.00 50.38  ? 67  PHE B CD1   1 
ATOM   2398 C CD2   . PHE B 2 67  ? 26.120 -38.088 -3.547  1.00 50.33  ? 67  PHE B CD2   1 
ATOM   2399 C CE1   . PHE B 2 67  ? 28.299 -39.801 -3.451  1.00 50.22  ? 67  PHE B CE1   1 
ATOM   2400 C CE2   . PHE B 2 67  ? 27.409 -37.566 -3.494  1.00 50.31  ? 67  PHE B CE2   1 
ATOM   2401 C CZ    . PHE B 2 67  ? 28.499 -38.424 -3.447  1.00 50.21  ? 67  PHE B CZ    1 
ATOM   2402 N N     . VAL B 2 68  ? 22.853 -38.165 -5.501  1.00 53.15  ? 68  VAL B N     1 
ATOM   2403 C CA    . VAL B 2 68  ? 22.626 -36.862 -6.118  1.00 54.26  ? 68  VAL B CA    1 
ATOM   2404 C C     . VAL B 2 68  ? 22.478 -35.816 -5.013  1.00 55.15  ? 68  VAL B C     1 
ATOM   2405 O O     . VAL B 2 68  ? 21.672 -35.982 -4.093  1.00 55.24  ? 68  VAL B O     1 
ATOM   2406 C CB    . VAL B 2 68  ? 21.359 -36.856 -7.023  1.00 54.23  ? 68  VAL B CB    1 
ATOM   2407 C CG1   . VAL B 2 68  ? 21.179 -35.500 -7.705  1.00 54.30  ? 68  VAL B CG1   1 
ATOM   2408 C CG2   . VAL B 2 68  ? 21.423 -37.965 -8.068  1.00 54.20  ? 68  VAL B CG2   1 
ATOM   2409 N N     . THR B 2 69  ? 23.275 -34.754 -5.103  1.00 56.30  ? 69  THR B N     1 
ATOM   2410 C CA    . THR B 2 69  ? 23.180 -33.621 -4.184  1.00 57.46  ? 69  THR B CA    1 
ATOM   2411 C C     . THR B 2 69  ? 22.204 -32.582 -4.733  1.00 58.38  ? 69  THR B C     1 
ATOM   2412 O O     . THR B 2 69  ? 21.953 -32.537 -5.941  1.00 58.33  ? 69  THR B O     1 
ATOM   2413 C CB    . THR B 2 69  ? 24.558 -32.973 -3.933  1.00 57.38  ? 69  THR B CB    1 
ATOM   2414 O OG1   . THR B 2 69  ? 25.150 -32.595 -5.182  1.00 57.47  ? 69  THR B OG1   1 
ATOM   2415 C CG2   . THR B 2 69  ? 25.482 -33.944 -3.208  1.00 57.29  ? 69  THR B CG2   1 
ATOM   2416 N N     . LYS B 2 70  ? 21.661 -31.749 -3.847  1.00 59.70  ? 70  LYS B N     1 
ATOM   2417 C CA    . LYS B 2 70  ? 20.598 -30.813 -4.225  1.00 61.02  ? 70  LYS B CA    1 
ATOM   2418 C C     . LYS B 2 70  ? 21.025 -29.342 -4.291  1.00 61.87  ? 70  LYS B C     1 
ATOM   2419 O O     . LYS B 2 70  ? 22.199 -29.012 -4.105  1.00 62.03  ? 70  LYS B O     1 
ATOM   2420 C CB    . LYS B 2 70  ? 19.363 -30.999 -3.331  1.00 61.01  ? 70  LYS B CB    1 
ATOM   2421 C CG    . LYS B 2 70  ? 18.691 -32.368 -3.461  1.00 61.46  ? 70  LYS B CG    1 
ATOM   2422 C CD    . LYS B 2 70  ? 18.066 -32.577 -4.836  1.00 62.09  ? 70  LYS B CD    1 
ATOM   2423 C CE    . LYS B 2 70  ? 17.637 -34.022 -5.031  1.00 62.49  ? 70  LYS B CE    1 
ATOM   2424 N NZ    . LYS B 2 70  ? 16.988 -34.236 -6.355  1.00 62.94  ? 70  LYS B NZ    1 
ATOM   2425 N N     . THR B 2 71  ? 20.043 -28.476 -4.537  1.00 63.01  ? 71  THR B N     1 
ATOM   2426 C CA    . THR B 2 71  ? 20.260 -27.095 -4.999  1.00 64.06  ? 71  THR B CA    1 
ATOM   2427 C C     . THR B 2 71  ? 21.036 -26.110 -4.103  1.00 64.76  ? 71  THR B C     1 
ATOM   2428 O O     . THR B 2 71  ? 21.865 -25.359 -4.624  1.00 64.89  ? 71  THR B O     1 
ATOM   2429 C CB    . THR B 2 71  ? 18.941 -26.453 -5.491  1.00 64.05  ? 71  THR B CB    1 
ATOM   2430 O OG1   . THR B 2 71  ? 17.902 -26.697 -4.537  1.00 64.33  ? 71  THR B OG1   1 
ATOM   2431 C CG2   . THR B 2 71  ? 18.535 -27.059 -6.824  1.00 64.18  ? 71  THR B CG2   1 
ATOM   2432 N N     . PRO B 2 72  ? 20.791 -26.091 -2.773  1.00 65.47  ? 72  PRO B N     1 
ATOM   2433 C CA    . PRO B 2 72  ? 19.903 -26.806 -1.861  1.00 66.01  ? 72  PRO B CA    1 
ATOM   2434 C C     . PRO B 2 72  ? 18.622 -26.014 -1.479  1.00 66.66  ? 72  PRO B C     1 
ATOM   2435 O O     . PRO B 2 72  ? 18.070 -25.327 -2.341  1.00 66.70  ? 72  PRO B O     1 
ATOM   2436 C CB    . PRO B 2 72  ? 20.813 -27.037 -0.653  1.00 65.99  ? 72  PRO B CB    1 
ATOM   2437 C CG    . PRO B 2 72  ? 21.888 -25.933 -0.732  1.00 65.81  ? 72  PRO B CG    1 
ATOM   2438 C CD    . PRO B 2 72  ? 21.654 -25.174 -2.007  1.00 65.52  ? 72  PRO B CD    1 
ATOM   2439 N N     . PRO B 2 73  ? 18.154 -26.096 -0.204  1.00 67.22  ? 73  PRO B N     1 
ATOM   2440 C CA    . PRO B 2 73  ? 16.815 -25.581 0.116   1.00 67.74  ? 73  PRO B CA    1 
ATOM   2441 C C     . PRO B 2 73  ? 16.690 -24.056 0.140   1.00 68.29  ? 73  PRO B C     1 
ATOM   2442 O O     . PRO B 2 73  ? 17.657 -23.352 0.447   1.00 68.38  ? 73  PRO B O     1 
ATOM   2443 C CB    . PRO B 2 73  ? 16.552 -26.146 1.515   1.00 67.70  ? 73  PRO B CB    1 
ATOM   2444 C CG    . PRO B 2 73  ? 17.891 -26.266 2.120   1.00 67.46  ? 73  PRO B CG    1 
ATOM   2445 C CD    . PRO B 2 73  ? 18.814 -26.643 1.000   1.00 67.25  ? 73  PRO B CD    1 
ATOM   2446 N N     . ALA B 2 74  ? 15.489 -23.571 -0.172  1.00 68.87  ? 74  ALA B N     1 
ATOM   2447 C CA    . ALA B 2 74  ? 15.188 -22.141 -0.200  1.00 69.46  ? 74  ALA B CA    1 
ATOM   2448 C C     . ALA B 2 74  ? 15.296 -21.495 1.181   1.00 69.86  ? 74  ALA B C     1 
ATOM   2449 O O     . ALA B 2 74  ? 15.793 -20.376 1.304   1.00 69.96  ? 74  ALA B O     1 
ATOM   2450 C CB    . ALA B 2 74  ? 13.807 -21.901 -0.796  1.00 69.42  ? 74  ALA B CB    1 
ATOM   2451 N N     . SER B 2 75  ? 14.845 -22.211 2.210   1.00 70.39  ? 75  SER B N     1 
ATOM   2452 C CA    . SER B 2 75  ? 14.868 -21.720 3.593   1.00 70.89  ? 75  SER B CA    1 
ATOM   2453 C C     . SER B 2 75  ? 16.276 -21.365 4.084   1.00 71.23  ? 75  SER B C     1 
ATOM   2454 O O     . SER B 2 75  ? 16.435 -20.527 4.975   1.00 71.31  ? 75  SER B O     1 
ATOM   2455 C CB    . SER B 2 75  ? 14.215 -22.735 4.534   1.00 70.88  ? 75  SER B CB    1 
ATOM   2456 O OG    . SER B 2 75  ? 14.902 -23.975 4.509   1.00 71.04  ? 75  SER B OG    1 
ATOM   2457 N N     . TYR B 2 76  ? 17.286 -22.009 3.503   1.00 71.63  ? 76  TYR B N     1 
ATOM   2458 C CA    . TYR B 2 76  ? 18.681 -21.655 3.753   1.00 72.00  ? 76  TYR B CA    1 
ATOM   2459 C C     . TYR B 2 76  ? 19.085 -20.450 2.904   1.00 72.23  ? 76  TYR B C     1 
ATOM   2460 O O     . TYR B 2 76  ? 19.794 -19.558 3.377   1.00 72.26  ? 76  TYR B O     1 
ATOM   2461 C CB    . TYR B 2 76  ? 19.605 -22.846 3.468   1.00 72.02  ? 76  TYR B CB    1 
ATOM   2462 C CG    . TYR B 2 76  ? 21.084 -22.539 3.616   1.00 72.04  ? 76  TYR B CG    1 
ATOM   2463 C CD1   . TYR B 2 76  ? 21.698 -22.555 4.870   1.00 72.05  ? 76  TYR B CD1   1 
ATOM   2464 C CD2   . TYR B 2 76  ? 21.868 -22.235 2.502   1.00 72.03  ? 76  TYR B CD2   1 
ATOM   2465 C CE1   . TYR B 2 76  ? 23.055 -22.273 5.010   1.00 72.06  ? 76  TYR B CE1   1 
ATOM   2466 C CE2   . TYR B 2 76  ? 23.225 -21.950 2.632   1.00 72.09  ? 76  TYR B CE2   1 
ATOM   2467 C CZ    . TYR B 2 76  ? 23.811 -21.971 3.888   1.00 72.06  ? 76  TYR B CZ    1 
ATOM   2468 O OH    . TYR B 2 76  ? 25.152 -21.692 4.021   1.00 72.05  ? 76  TYR B OH    1 
ATOM   2469 N N     . LEU B 2 77  ? 18.625 -20.435 1.654   1.00 72.54  ? 77  LEU B N     1 
ATOM   2470 C CA    . LEU B 2 77  ? 18.973 -19.385 0.693   1.00 72.84  ? 77  LEU B CA    1 
ATOM   2471 C C     . LEU B 2 77  ? 18.277 -18.052 0.983   1.00 73.03  ? 77  LEU B C     1 
ATOM   2472 O O     . LEU B 2 77  ? 18.672 -17.011 0.450   1.00 73.10  ? 77  LEU B O     1 
ATOM   2473 C CB    . LEU B 2 77  ? 18.675 -19.845 -0.743  1.00 72.83  ? 77  LEU B CB    1 
ATOM   2474 C CG    . LEU B 2 77  ? 19.475 -21.028 -1.308  1.00 72.84  ? 77  LEU B CG    1 
ATOM   2475 C CD1   . LEU B 2 77  ? 18.824 -21.565 -2.576  1.00 72.76  ? 77  LEU B CD1   1 
ATOM   2476 C CD2   . LEU B 2 77  ? 20.935 -20.660 -1.568  1.00 72.84  ? 77  LEU B CD2   1 
ATOM   2477 N N     . ILE B 2 78  ? 17.245 -18.093 1.825   1.00 73.24  ? 78  ILE B N     1 
ATOM   2478 C CA    . ILE B 2 78  ? 16.544 -16.887 2.266   1.00 73.39  ? 78  ILE B CA    1 
ATOM   2479 C C     . ILE B 2 78  ? 17.342 -16.182 3.368   1.00 73.49  ? 78  ILE B C     1 
ATOM   2480 O O     . ILE B 2 78  ? 17.505 -14.959 3.337   1.00 73.54  ? 78  ILE B O     1 
ATOM   2481 C CB    . ILE B 2 78  ? 15.091 -17.198 2.726   1.00 73.40  ? 78  ILE B CB    1 
ATOM   2482 C CG1   . ILE B 2 78  ? 14.232 -17.614 1.527   1.00 73.40  ? 78  ILE B CG1   1 
ATOM   2483 C CG2   . ILE B 2 78  ? 14.460 -15.991 3.422   1.00 73.38  ? 78  ILE B CG2   1 
ATOM   2484 C CD1   . ILE B 2 78  ? 13.044 -18.497 1.880   1.00 73.48  ? 78  ILE B CD1   1 
ATOM   2485 N N     . ARG B 2 79  ? 17.844 -16.958 4.327   1.00 73.58  ? 79  ARG B N     1 
ATOM   2486 C CA    . ARG B 2 79  ? 18.666 -16.417 5.410   1.00 73.68  ? 79  ARG B CA    1 
ATOM   2487 C C     . ARG B 2 79  ? 20.105 -16.194 4.952   1.00 73.69  ? 79  ARG B C     1 
ATOM   2488 O O     . ARG B 2 79  ? 20.375 -15.346 4.100   1.00 73.68  ? 79  ARG B O     1 
ATOM   2489 C CB    . ARG B 2 79  ? 18.648 -17.340 6.632   1.00 73.70  ? 79  ARG B CB    1 
ATOM   2490 C CG    . ARG B 2 79  ? 17.267 -17.588 7.230   1.00 73.84  ? 79  ARG B CG    1 
ATOM   2491 C CD    . ARG B 2 79  ? 17.349 -17.924 8.717   1.00 74.03  ? 79  ARG B CD    1 
ATOM   2492 N NE    . ARG B 2 79  ? 18.302 -18.998 8.999   1.00 74.26  ? 79  ARG B NE    1 
ATOM   2493 C CZ    . ARG B 2 79  ? 18.662 -19.390 10.220  1.00 74.39  ? 79  ARG B CZ    1 
ATOM   2494 N NH1   . ARG B 2 79  ? 18.152 -18.805 11.297  1.00 74.47  ? 79  ARG B NH1   1 
ATOM   2495 N NH2   . ARG B 2 79  ? 19.539 -20.375 10.362  1.00 74.44  ? 79  ARG B NH2   1 
ATOM   2496 N N     . ILE B 2 99  ? 13.970 -8.602  5.278   1.00 100.00 ? 99  ILE B N     1 
ATOM   2497 C CA    . ILE B 2 99  ? 14.761 -7.950  4.235   1.00 100.00 ? 99  ILE B CA    1 
ATOM   2498 C C     . ILE B 2 99  ? 14.719 -8.709  2.902   1.00 100.00 ? 99  ILE B C     1 
ATOM   2499 O O     . ILE B 2 99  ? 15.671 -9.401  2.529   1.00 100.00 ? 99  ILE B O     1 
ATOM   2500 C CB    . ILE B 2 99  ? 16.229 -7.682  4.688   1.00 100.00 ? 99  ILE B CB    1 
ATOM   2501 C CG1   . ILE B 2 99  ? 16.814 -8.898  5.423   1.00 100.00 ? 99  ILE B CG1   1 
ATOM   2502 C CG2   . ILE B 2 99  ? 16.292 -6.432  5.563   1.00 100.00 ? 99  ILE B CG2   1 
ATOM   2503 C CD1   . ILE B 2 99  ? 18.335 -8.919  5.494   1.00 100.00 ? 99  ILE B CD1   1 
ATOM   2504 N N     . THR B 2 100 ? 13.599 -8.574  2.193   1.00 100.00 ? 100 THR B N     1 
ATOM   2505 C CA    . THR B 2 100 ? 13.416 -9.215  0.891   1.00 100.00 ? 100 THR B CA    1 
ATOM   2506 C C     . THR B 2 100 ? 13.830 -8.265  -0.234  1.00 100.00 ? 100 THR B C     1 
ATOM   2507 O O     . THR B 2 100 ? 13.115 -7.309  -0.548  1.00 100.00 ? 100 THR B O     1 
ATOM   2508 C CB    . THR B 2 100 ? 11.951 -9.688  0.684   1.00 100.00 ? 100 THR B CB    1 
ATOM   2509 O OG1   . THR B 2 100 ? 11.544 -10.504 1.789   1.00 100.00 ? 100 THR B OG1   1 
ATOM   2510 C CG2   . THR B 2 100 ? 11.810 -10.488 -0.608  1.00 100.00 ? 100 THR B CG2   1 
ATOM   2511 N N     . TRP B 2 101 ? 14.993 -8.532  -0.827  1.00 100.00 ? 101 TRP B N     1 
ATOM   2512 C CA    . TRP B 2 101 ? 15.493 -7.730  -1.945  1.00 100.00 ? 101 TRP B CA    1 
ATOM   2513 C C     . TRP B 2 101 ? 15.237 -8.412  -3.292  1.00 100.00 ? 101 TRP B C     1 
ATOM   2514 O O     . TRP B 2 101 ? 14.280 -9.178  -3.431  1.00 100.00 ? 101 TRP B O     1 
ATOM   2515 C CB    . TRP B 2 101 ? 16.979 -7.374  -1.756  1.00 100.00 ? 101 TRP B CB    1 
ATOM   2516 C CG    . TRP B 2 101 ? 17.930 -8.542  -1.615  1.00 100.00 ? 101 TRP B CG    1 
ATOM   2517 C CD1   . TRP B 2 101 ? 18.411 -9.337  -2.618  1.00 100.00 ? 101 TRP B CD1   1 
ATOM   2518 C CD2   . TRP B 2 101 ? 18.544 -9.012  -0.406  1.00 100.00 ? 101 TRP B CD2   1 
ATOM   2519 N NE1   . TRP B 2 101 ? 19.266 -10.284 -2.108  1.00 100.00 ? 101 TRP B NE1   1 
ATOM   2520 C CE2   . TRP B 2 101 ? 19.368 -10.107 -0.753  1.00 100.00 ? 101 TRP B CE2   1 
ATOM   2521 C CE3   . TRP B 2 101 ? 18.471 -8.620  0.938   1.00 100.00 ? 101 TRP B CE3   1 
ATOM   2522 C CZ2   . TRP B 2 101 ? 20.114 -10.816 0.195   1.00 100.00 ? 101 TRP B CZ2   1 
ATOM   2523 C CZ3   . TRP B 2 101 ? 19.214 -9.326  1.882   1.00 100.00 ? 101 TRP B CZ3   1 
ATOM   2524 C CH2   . TRP B 2 101 ? 20.024 -10.412 1.503   1.00 100.00 ? 101 TRP B CH2   1 
ATOM   2525 N N     . GLU B 2 102 ? 16.082 -8.121  -4.280  1.00 100.00 ? 102 GLU B N     1 
ATOM   2526 C CA    . GLU B 2 102 ? 16.036 -8.802  -5.574  1.00 100.00 ? 102 GLU B CA    1 
ATOM   2527 C C     . GLU B 2 102 ? 16.649 -10.201 -5.445  1.00 100.00 ? 102 GLU B C     1 
ATOM   2528 O O     . GLU B 2 102 ? 17.568 -10.567 -6.185  1.00 100.00 ? 102 GLU B O     1 
ATOM   2529 C CB    . GLU B 2 102 ? 16.768 -7.982  -6.645  1.00 100.00 ? 102 GLU B CB    1 
ATOM   2530 C CG    . GLU B 2 102 ? 16.268 -6.544  -6.822  1.00 100.00 ? 102 GLU B CG    1 
ATOM   2531 C CD    . GLU B 2 102 ? 14.892 -6.447  -7.468  1.00 100.00 ? 102 GLU B CD    1 
ATOM   2532 O OE1   . GLU B 2 102 ? 14.538 -7.325  -8.285  1.00 100.00 ? 102 GLU B OE1   1 
ATOM   2533 O OE2   . GLU B 2 102 ? 14.164 -5.478  -7.162  1.00 100.00 ? 102 GLU B OE2   1 
ATOM   2534 N N     . GLN B 2 103 ? 16.123 -10.971 -4.494  1.00 100.00 ? 103 GLN B N     1 
ATOM   2535 C CA    . GLN B 2 103 ? 16.637 -12.296 -4.156  1.00 100.00 ? 103 GLN B CA    1 
ATOM   2536 C C     . GLN B 2 103 ? 16.343 -13.315 -5.251  1.00 100.00 ? 103 GLN B C     1 
ATOM   2537 O O     . GLN B 2 103 ? 17.227 -14.070 -5.661  1.00 100.00 ? 103 GLN B O     1 
ATOM   2538 C CB    . GLN B 2 103 ? 16.028 -12.783 -2.833  1.00 100.00 ? 103 GLN B CB    1 
ATOM   2539 C CG    . GLN B 2 103 ? 16.271 -11.869 -1.633  1.00 100.00 ? 103 GLN B CG    1 
ATOM   2540 C CD    . GLN B 2 103 ? 15.385 -12.195 -0.437  1.00 100.00 ? 103 GLN B CD    1 
ATOM   2541 O OE1   . GLN B 2 103 ? 14.310 -12.780 -0.580  1.00 100.00 ? 103 GLN B OE1   1 
ATOM   2542 N NE2   . GLN B 2 103 ? 15.834 -11.804 0.751   1.00 100.00 ? 103 GLN B NE2   1 
ATOM   2543 N N     . VAL B 2 104 ? 15.101 -13.312 -5.730  1.00 100.00 ? 104 VAL B N     1 
ATOM   2544 C CA    . VAL B 2 104 ? 14.597 -14.368 -6.609  1.00 100.00 ? 104 VAL B CA    1 
ATOM   2545 C C     . VAL B 2 104 ? 14.845 -14.102 -8.104  1.00 100.00 ? 104 VAL B C     1 
ATOM   2546 O O     . VAL B 2 104 ? 14.188 -14.692 -8.967  1.00 100.00 ? 104 VAL B O     1 
ATOM   2547 C CB    . VAL B 2 104 ? 13.091 -14.661 -6.349  1.00 100.00 ? 104 VAL B CB    1 
ATOM   2548 C CG1   . VAL B 2 104 ? 12.832 -16.155 -6.417  1.00 100.00 ? 104 VAL B CG1   1 
ATOM   2549 C CG2   . VAL B 2 104 ? 12.653 -14.125 -4.989  1.00 100.00 ? 104 VAL B CG2   1 
ATOM   2550 N N     . LEU B 2 105 ? 15.793 -13.216 -8.404  1.00 100.00 ? 105 LEU B N     1 
ATOM   2551 C CA    . LEU B 2 105 ? 16.249 -13.009 -9.780  1.00 100.00 ? 105 LEU B CA    1 
ATOM   2552 C C     . LEU B 2 105 ? 17.276 -14.069 -10.179 1.00 100.00 ? 105 LEU B C     1 
ATOM   2553 O O     . LEU B 2 105 ? 17.571 -14.249 -11.364 1.00 100.00 ? 105 LEU B O     1 
ATOM   2554 C CB    . LEU B 2 105 ? 16.833 -11.604 -9.967  1.00 100.00 ? 105 LEU B CB    1 
ATOM   2555 C CG    . LEU B 2 105 ? 15.882 -10.422 -10.189 1.00 100.00 ? 105 LEU B CG    1 
ATOM   2556 C CD1   . LEU B 2 105 ? 16.669 -9.123  -10.230 1.00 100.00 ? 105 LEU B CD1   1 
ATOM   2557 C CD2   . LEU B 2 105 ? 15.057 -10.582 -11.465 1.00 100.00 ? 105 LEU B CD2   1 
ATOM   2558 N N     . GLU B 2 106 ? 17.813 -14.763 -9.176  1.00 100.00 ? 106 GLU B N     1 
ATOM   2559 C CA    . GLU B 2 106 ? 18.780 -15.838 -9.384  1.00 100.00 ? 106 GLU B CA    1 
ATOM   2560 C C     . GLU B 2 106 ? 18.369 -17.094 -8.611  1.00 100.00 ? 106 GLU B C     1 
ATOM   2561 O O     . GLU B 2 106 ? 18.725 -18.209 -8.999  1.00 100.00 ? 106 GLU B O     1 
ATOM   2562 C CB    . GLU B 2 106 ? 20.181 -15.377 -8.971  1.00 100.00 ? 106 GLU B CB    1 
ATOM   2563 C CG    . GLU B 2 106 ? 21.326 -16.034 -9.745  1.00 100.00 ? 106 GLU B CG    1 
ATOM   2564 C CD    . GLU B 2 106 ? 21.768 -17.368 -9.162  1.00 100.00 ? 106 GLU B CD    1 
ATOM   2565 O OE1   . GLU B 2 106 ? 21.611 -17.578 -7.939  1.00 100.00 ? 106 GLU B OE1   1 
ATOM   2566 O OE2   . GLU B 2 106 ? 22.284 -18.207 -9.931  1.00 100.00 ? 106 GLU B OE2   1 
ATOM   2567 N N     . ILE B 2 107 ? 17.618 -16.902 -7.526  1.00 100.00 ? 107 ILE B N     1 
ATOM   2568 C CA    . ILE B 2 107 ? 17.103 -18.007 -6.705  1.00 100.00 ? 107 ILE B CA    1 
ATOM   2569 C C     . ILE B 2 107 ? 16.042 -18.825 -7.454  1.00 100.00 ? 107 ILE B C     1 
ATOM   2570 O O     . ILE B 2 107 ? 15.967 -20.046 -7.294  1.00 100.00 ? 107 ILE B O     1 
ATOM   2571 C CB    . ILE B 2 107 ? 16.572 -17.504 -5.328  1.00 100.00 ? 107 ILE B CB    1 
ATOM   2572 C CG1   . ILE B 2 107 ? 17.746 -17.110 -4.421  1.00 100.00 ? 107 ILE B CG1   1 
ATOM   2573 C CG2   . ILE B 2 107 ? 15.707 -18.567 -4.638  1.00 100.00 ? 107 ILE B CG2   1 
ATOM   2574 C CD1   . ILE B 2 107 ? 17.350 -16.367 -3.152  1.00 100.00 ? 107 ILE B CD1   1 
ATOM   2575 N N     . ALA B 2 108 ? 15.238 -18.150 -8.277  1.00 100.00 ? 108 ALA B N     1 
ATOM   2576 C CA    . ALA B 2 108 ? 14.256 -18.820 -9.135  1.00 100.00 ? 108 ALA B CA    1 
ATOM   2577 C C     . ALA B 2 108 ? 14.935 -19.711 -10.177 1.00 100.00 ? 108 ALA B C     1 
ATOM   2578 O O     . ALA B 2 108 ? 14.377 -20.729 -10.596 1.00 100.00 ? 108 ALA B O     1 
ATOM   2579 C CB    . ALA B 2 108 ? 13.355 -17.801 -9.814  1.00 100.00 ? 108 ALA B CB    1 
ATOM   2580 N N     . LYS B 2 109 ? 16.139 -19.315 -10.587 1.00 100.00 ? 109 LYS B N     1 
ATOM   2581 C CA    . LYS B 2 109 ? 16.959 -20.104 -11.505 1.00 100.00 ? 109 LYS B CA    1 
ATOM   2582 C C     . LYS B 2 109 ? 17.755 -21.176 -10.755 1.00 100.00 ? 109 LYS B C     1 
ATOM   2583 O O     . LYS B 2 109 ? 18.249 -22.130 -11.360 1.00 100.00 ? 109 LYS B O     1 
ATOM   2584 C CB    . LYS B 2 109 ? 17.897 -19.196 -12.309 1.00 100.00 ? 109 LYS B CB    1 
ATOM   2585 C CG    . LYS B 2 109 ? 17.175 -18.217 -13.237 1.00 100.00 ? 109 LYS B CG    1 
ATOM   2586 C CD    . LYS B 2 109 ? 18.147 -17.325 -14.001 1.00 100.00 ? 109 LYS B CD    1 
ATOM   2587 C CE    . LYS B 2 109 ? 18.725 -18.031 -15.221 1.00 100.00 ? 109 LYS B CE    1 
ATOM   2588 N NZ    . LYS B 2 109 ? 19.653 -17.150 -15.982 1.00 100.00 ? 109 LYS B NZ    1 
ATOM   2589 N N     . GLN B 2 110 ? 17.875 -21.007 -9.438  1.00 100.00 ? 110 GLN B N     1 
ATOM   2590 C CA    . GLN B 2 110 ? 18.504 -22.004 -8.572  1.00 100.00 ? 110 GLN B CA    1 
ATOM   2591 C C     . GLN B 2 110 ? 17.535 -23.127 -8.215  1.00 100.00 ? 110 GLN B C     1 
ATOM   2592 O O     . GLN B 2 110 ? 17.952 -24.264 -8.006  1.00 100.00 ? 110 GLN B O     1 
ATOM   2593 C CB    . GLN B 2 110 ? 19.029 -21.360 -7.287  1.00 100.00 ? 110 GLN B CB    1 
ATOM   2594 C CG    . GLN B 2 110 ? 20.396 -20.709 -7.412  1.00 100.00 ? 110 GLN B CG    1 
ATOM   2595 C CD    . GLN B 2 110 ? 20.907 -20.162 -6.089  1.00 100.00 ? 110 GLN B CD    1 
ATOM   2596 O OE1   . GLN B 2 110 ? 20.179 -19.494 -5.353  1.00 100.00 ? 110 GLN B OE1   1 
ATOM   2597 N NE2   . GLN B 2 110 ? 22.170 -20.439 -5.785  1.00 100.00 ? 110 GLN B NE2   1 
ATOM   2598 N N     . LYS B 2 111 ? 16.246 -22.797 -8.148  1.00 100.00 ? 111 LYS B N     1 
ATOM   2599 C CA    . LYS B 2 111 ? 15.211 -23.750 -7.741  1.00 100.00 ? 111 LYS B CA    1 
ATOM   2600 C C     . LYS B 2 111 ? 14.617 -24.545 -8.910  1.00 100.00 ? 111 LYS B C     1 
ATOM   2601 O O     . LYS B 2 111 ? 13.605 -25.233 -8.746  1.00 100.00 ? 111 LYS B O     1 
ATOM   2602 C CB    . LYS B 2 111 ? 14.099 -23.031 -6.964  1.00 100.00 ? 111 LYS B CB    1 
ATOM   2603 C CG    . LYS B 2 111 ? 14.501 -22.516 -5.579  1.00 100.00 ? 111 LYS B CG    1 
ATOM   2604 C CD    . LYS B 2 111 ? 14.259 -23.542 -4.473  1.00 100.00 ? 111 LYS B CD    1 
ATOM   2605 C CE    . LYS B 2 111 ? 15.490 -24.394 -4.208  1.00 100.00 ? 111 LYS B CE    1 
ATOM   2606 N NZ    . LYS B 2 111 ? 15.290 -25.320 -3.059  1.00 100.00 ? 111 LYS B NZ    1 
ATOM   2607 N N     . MET B 2 112 ? 15.250 -24.451 -10.079 1.00 100.00 ? 112 MET B N     1 
ATOM   2608 C CA    . MET B 2 112 ? 14.825 -25.205 -11.263 1.00 100.00 ? 112 MET B CA    1 
ATOM   2609 C C     . MET B 2 112 ? 14.956 -26.728 -11.080 1.00 100.00 ? 112 MET B C     1 
ATOM   2610 O O     . MET B 2 112 ? 13.998 -27.456 -11.351 1.00 100.00 ? 112 MET B O     1 
ATOM   2611 C CB    . MET B 2 112 ? 15.565 -24.739 -12.527 1.00 100.00 ? 112 MET B CB    1 
ATOM   2612 C CG    . MET B 2 112 ? 15.295 -23.292 -12.932 1.00 100.00 ? 112 MET B CG    1 
ATOM   2613 S SD    . MET B 2 112 ? 15.786 -22.912 -14.631 1.00 100.00 ? 112 MET B SD    1 
ATOM   2614 C CE    . MET B 2 112 ? 17.574 -23.019 -14.535 1.00 100.00 ? 112 MET B CE    1 
ATOM   2615 N N     . PRO B 2 113 ? 16.133 -27.215 -10.623 1.00 100.00 ? 113 PRO B N     1 
ATOM   2616 C CA    . PRO B 2 113 ? 16.248 -28.647 -10.354 1.00 100.00 ? 113 PRO B CA    1 
ATOM   2617 C C     . PRO B 2 113 ? 15.886 -29.027 -8.909  1.00 100.00 ? 113 PRO B C     1 
ATOM   2618 O O     . PRO B 2 113 ? 16.524 -29.903 -8.317  1.00 100.00 ? 113 PRO B O     1 
ATOM   2619 C CB    . PRO B 2 113 ? 17.727 -28.940 -10.646 1.00 100.00 ? 113 PRO B CB    1 
ATOM   2620 C CG    . PRO B 2 113 ? 18.432 -27.594 -10.613 1.00 100.00 ? 113 PRO B CG    1 
ATOM   2621 C CD    . PRO B 2 113 ? 17.409 -26.527 -10.356 1.00 100.00 ? 113 PRO B CD    1 
ATOM   2622 N N     . ASP B 2 114 ? 14.866 -28.369 -8.358  1.00 100.00 ? 114 ASP B N     1 
ATOM   2623 C CA    . ASP B 2 114 ? 14.355 -28.688 -7.024  1.00 100.00 ? 114 ASP B CA    1 
ATOM   2624 C C     . ASP B 2 114 ? 12.827 -28.617 -6.986  1.00 100.00 ? 114 ASP B C     1 
ATOM   2625 O O     . ASP B 2 114 ? 12.177 -29.482 -6.394  1.00 100.00 ? 114 ASP B O     1 
ATOM   2626 C CB    . ASP B 2 114 ? 14.965 -27.762 -5.966  1.00 100.00 ? 114 ASP B CB    1 
ATOM   2627 C CG    . ASP B 2 114 ? 14.944 -28.369 -4.571  1.00 100.00 ? 114 ASP B CG    1 
ATOM   2628 O OD1   . ASP B 2 114 ? 13.843 -28.603 -4.027  1.00 100.00 ? 114 ASP B OD1   1 
ATOM   2629 O OD2   . ASP B 2 114 ? 16.037 -28.603 -4.010  1.00 100.00 ? 114 ASP B OD2   1 
ATOM   2630 N N     . LEU B 2 115 ? 12.264 -27.586 -7.615  1.00 100.00 ? 115 LEU B N     1 
ATOM   2631 C CA    . LEU B 2 115 ? 10.812 -27.433 -7.714  1.00 100.00 ? 115 LEU B CA    1 
ATOM   2632 C C     . LEU B 2 115 ? 10.238 -28.309 -8.826  1.00 100.00 ? 115 LEU B C     1 
ATOM   2633 O O     . LEU B 2 115 ? 10.898 -28.556 -9.838  1.00 100.00 ? 115 LEU B O     1 
ATOM   2634 C CB    . LEU B 2 115 ? 10.421 -25.966 -7.931  1.00 100.00 ? 115 LEU B CB    1 
ATOM   2635 C CG    . LEU B 2 115 ? 10.615 -24.971 -6.779  1.00 100.00 ? 115 LEU B CG    1 
ATOM   2636 C CD1   . LEU B 2 115 ? 10.360 -23.550 -7.260  1.00 100.00 ? 115 LEU B CD1   1 
ATOM   2637 C CD2   . LEU B 2 115 ? 9.727  -25.298 -5.581  1.00 100.00 ? 115 LEU B CD2   1 
ATOM   2638 N N     . ASN B 2 116 ? 9.003  -28.765 -8.628  1.00 100.00 ? 116 ASN B N     1 
ATOM   2639 C CA    . ASN B 2 116 ? 8.358  -29.709 -9.541  1.00 100.00 ? 116 ASN B CA    1 
ATOM   2640 C C     . ASN B 2 116 ? 7.712  -29.050 -10.763 1.00 100.00 ? 116 ASN B C     1 
ATOM   2641 O O     . ASN B 2 116 ? 7.440  -29.722 -11.762 1.00 100.00 ? 116 ASN B O     1 
ATOM   2642 C CB    . ASN B 2 116 ? 7.326  -30.555 -8.785  1.00 100.00 ? 116 ASN B CB    1 
ATOM   2643 C CG    . ASN B 2 116 ? 7.202  -31.967 -9.339  1.00 100.00 ? 116 ASN B CG    1 
ATOM   2644 O OD1   . ASN B 2 116 ? 7.568  -32.936 -8.674  1.00 100.00 ? 116 ASN B OD1   1 
ATOM   2645 N ND2   . ASN B 2 116 ? 6.684  -32.089 -10.558 1.00 100.00 ? 116 ASN B ND2   1 
ATOM   2646 N N     . THR B 2 117 ? 7.470  -27.742 -10.676 1.00 100.00 ? 117 THR B N     1 
ATOM   2647 C CA    . THR B 2 117 ? 6.865  -26.977 -11.773 1.00 100.00 ? 117 THR B CA    1 
ATOM   2648 C C     . THR B 2 117 ? 7.738  -26.994 -13.033 1.00 100.00 ? 117 THR B C     1 
ATOM   2649 O O     . THR B 2 117 ? 8.931  -26.682 -12.979 1.00 100.00 ? 117 THR B O     1 
ATOM   2650 C CB    . THR B 2 117 ? 6.511  -25.521 -11.347 1.00 100.00 ? 117 THR B CB    1 
ATOM   2651 O OG1   . THR B 2 117 ? 6.137  -24.752 -12.498 1.00 100.00 ? 117 THR B OG1   1 
ATOM   2652 C CG2   . THR B 2 117 ? 7.685  -24.841 -10.638 1.00 100.00 ? 117 THR B CG2   1 
ATOM   2653 N N     . THR B 2 118 ? 7.131  -27.368 -14.158 1.00 100.00 ? 118 THR B N     1 
ATOM   2654 C CA    . THR B 2 118 ? 7.852  -27.513 -15.426 1.00 100.00 ? 118 THR B CA    1 
ATOM   2655 C C     . THR B 2 118 ? 7.921  -26.200 -16.214 1.00 100.00 ? 118 THR B C     1 
ATOM   2656 O O     . THR B 2 118 ? 7.514  -26.136 -17.379 1.00 100.00 ? 118 THR B O     1 
ATOM   2657 C CB    . THR B 2 118 ? 7.250  -28.640 -16.309 1.00 100.00 ? 118 THR B CB    1 
ATOM   2658 O OG1   . THR B 2 118 ? 5.841  -28.432 -16.466 1.00 100.00 ? 118 THR B OG1   1 
ATOM   2659 C CG2   . THR B 2 118 ? 7.494  -30.009 -15.684 1.00 100.00 ? 118 THR B CG2   1 
ATOM   2660 N N     . ASP B 2 119 ? 8.439  -25.159 -15.566 1.00 100.00 ? 119 ASP B N     1 
ATOM   2661 C CA    . ASP B 2 119 ? 8.648  -23.863 -16.207 1.00 100.00 ? 119 ASP B CA    1 
ATOM   2662 C C     . ASP B 2 119 ? 9.882  -23.164 -15.644 1.00 100.00 ? 119 ASP B C     1 
ATOM   2663 O O     . ASP B 2 119 ? 10.131 -23.196 -14.436 1.00 100.00 ? 119 ASP B O     1 
ATOM   2664 C CB    . ASP B 2 119 ? 7.414  -22.967 -16.054 1.00 100.00 ? 119 ASP B CB    1 
ATOM   2665 C CG    . ASP B 2 119 ? 7.425  -21.783 -17.012 1.00 100.00 ? 119 ASP B CG    1 
ATOM   2666 O OD1   . ASP B 2 119 ? 7.642  -21.990 -18.226 1.00 100.00 ? 119 ASP B OD1   1 
ATOM   2667 O OD2   . ASP B 2 119 ? 7.206  -20.643 -16.553 1.00 100.00 ? 119 ASP B OD2   1 
ATOM   2668 N N     . LEU B 2 120 ? 10.645 -22.536 -16.535 1.00 100.00 ? 120 LEU B N     1 
ATOM   2669 C CA    . LEU B 2 120 ? 11.857 -21.801 -16.172 1.00 100.00 ? 120 LEU B CA    1 
ATOM   2670 C C     . LEU B 2 120 ? 11.527 -20.496 -15.442 1.00 100.00 ? 120 LEU B C     1 
ATOM   2671 O O     . LEU B 2 120 ? 12.309 -20.026 -14.611 1.00 100.00 ? 120 LEU B O     1 
ATOM   2672 C CB    . LEU B 2 120 ? 12.695 -21.526 -17.431 1.00 100.00 ? 120 LEU B CB    1 
ATOM   2673 C CG    . LEU B 2 120 ? 14.081 -20.872 -17.339 1.00 100.00 ? 120 LEU B CG    1 
ATOM   2674 C CD1   . LEU B 2 120 ? 15.031 -21.487 -18.357 1.00 100.00 ? 120 LEU B CD1   1 
ATOM   2675 C CD2   . LEU B 2 120 ? 14.007 -19.356 -17.517 1.00 100.00 ? 120 LEU B CD2   1 
ATOM   2676 N N     . GLU B 2 121 ? 10.363 -19.929 -15.751 1.00 100.00 ? 121 GLU B N     1 
ATOM   2677 C CA    . GLU B 2 121 ? 9.968  -18.616 -15.244 1.00 100.00 ? 121 GLU B CA    1 
ATOM   2678 C C     . GLU B 2 121 ? 9.026  -18.691 -14.038 1.00 100.00 ? 121 GLU B C     1 
ATOM   2679 O O     . GLU B 2 121 ? 9.186  -17.934 -13.078 1.00 100.00 ? 121 GLU B O     1 
ATOM   2680 C CB    . GLU B 2 121 ? 9.332  -17.793 -16.369 1.00 100.00 ? 121 GLU B CB    1 
ATOM   2681 C CG    . GLU B 2 121 ? 9.394  -16.284 -16.165 1.00 100.00 ? 121 GLU B CG    1 
ATOM   2682 C CD    . GLU B 2 121 ? 8.873  -15.506 -17.361 1.00 100.00 ? 121 GLU B CD    1 
ATOM   2683 O OE1   . GLU B 2 121 ? 9.249  -15.836 -18.507 1.00 100.00 ? 121 GLU B OE1   1 
ATOM   2684 O OE2   . GLU B 2 121 ? 8.092  -14.554 -17.153 1.00 100.00 ? 121 GLU B OE2   1 
ATOM   2685 N N     . ALA B 2 122 ? 8.053  -19.600 -14.095 1.00 100.00 ? 122 ALA B N     1 
ATOM   2686 C CA    . ALA B 2 122 ? 7.052  -19.739 -13.035 1.00 100.00 ? 122 ALA B CA    1 
ATOM   2687 C C     . ALA B 2 122 ? 7.610  -20.443 -11.796 1.00 100.00 ? 122 ALA B C     1 
ATOM   2688 O O     . ALA B 2 122 ? 7.365  -21.632 -11.575 1.00 100.00 ? 122 ALA B O     1 
ATOM   2689 C CB    . ALA B 2 122 ? 5.808  -20.456 -13.559 1.00 100.00 ? 122 ALA B CB    1 
ATOM   2690 N N     . ALA B 2 123 ? 8.365  -19.691 -10.998 1.00 100.00 ? 123 ALA B N     1 
ATOM   2691 C CA    . ALA B 2 123 ? 8.956  -20.193 -9.757  1.00 100.00 ? 123 ALA B CA    1 
ATOM   2692 C C     . ALA B 2 123 ? 9.084  -19.079 -8.718  1.00 100.00 ? 123 ALA B C     1 
ATOM   2693 O O     . ALA B 2 123 ? 8.830  -19.297 -7.531  1.00 100.00 ? 123 ALA B O     1 
ATOM   2694 C CB    . ALA B 2 123 ? 10.315 -20.833 -10.028 1.00 100.00 ? 123 ALA B CB    1 
ATOM   2695 N N     . ALA B 2 124 ? 9.467  -17.888 -9.182  1.00 100.00 ? 124 ALA B N     1 
ATOM   2696 C CA    . ALA B 2 124 ? 9.647  -16.710 -8.327  1.00 100.00 ? 124 ALA B CA    1 
ATOM   2697 C C     . ALA B 2 124 ? 8.345  -16.243 -7.673  1.00 100.00 ? 124 ALA B C     1 
ATOM   2698 O O     . ALA B 2 124 ? 8.366  -15.545 -6.656  1.00 100.00 ? 124 ALA B O     1 
ATOM   2699 C CB    . ALA B 2 124 ? 10.276 -15.573 -9.125  1.00 100.00 ? 124 ALA B CB    1 
ATOM   2700 N N     . ARG B 2 125 ? 7.221  -16.645 -8.264  1.00 100.00 ? 125 ARG B N     1 
ATOM   2701 C CA    . ARG B 2 125 ? 5.889  -16.274 -7.788  1.00 100.00 ? 125 ARG B CA    1 
ATOM   2702 C C     . ARG B 2 125 ? 5.451  -17.129 -6.593  1.00 100.00 ? 125 ARG B C     1 
ATOM   2703 O O     . ARG B 2 125 ? 4.327  -16.994 -6.101  1.00 100.00 ? 125 ARG B O     1 
ATOM   2704 C CB    . ARG B 2 125 ? 4.872  -16.403 -8.929  1.00 100.00 ? 125 ARG B CB    1 
ATOM   2705 C CG    . ARG B 2 125 ? 5.399  -15.963 -10.290 1.00 100.00 ? 125 ARG B CG    1 
ATOM   2706 C CD    . ARG B 2 125 ? 4.537  -16.497 -11.421 1.00 100.00 ? 125 ARG B CD    1 
ATOM   2707 N NE    . ARG B 2 125 ? 5.323  -16.762 -12.626 1.00 100.00 ? 125 ARG B NE    1 
ATOM   2708 C CZ    . ARG B 2 125 ? 5.562  -15.877 -13.592 1.00 100.00 ? 125 ARG B CZ    1 
ATOM   2709 N NH1   . ARG B 2 125 ? 5.079  -14.643 -13.515 1.00 100.00 ? 125 ARG B NH1   1 
ATOM   2710 N NH2   . ARG B 2 125 ? 6.291  -16.230 -14.642 1.00 100.00 ? 125 ARG B NH2   1 
ATOM   2711 N N     . MET B 2 126 ? 6.349  -17.997 -6.129  1.00 100.00 ? 126 MET B N     1 
ATOM   2712 C CA    . MET B 2 126 ? 6.060  -18.925 -5.038  1.00 100.00 ? 126 MET B CA    1 
ATOM   2713 C C     . MET B 2 126 ? 7.155  -18.909 -3.966  1.00 100.00 ? 126 MET B C     1 
ATOM   2714 O O     . MET B 2 126 ? 6.880  -19.149 -2.788  1.00 100.00 ? 126 MET B O     1 
ATOM   2715 C CB    . MET B 2 126 ? 5.872  -20.341 -5.592  1.00 100.00 ? 126 MET B CB    1 
ATOM   2716 C CG    . MET B 2 126 ? 5.113  -21.292 -4.673  1.00 100.00 ? 126 MET B CG    1 
ATOM   2717 S SD    . MET B 2 126 ? 4.665  -22.848 -5.472  1.00 100.00 ? 126 MET B SD    1 
ATOM   2718 C CE    . MET B 2 126 ? 6.260  -23.653 -5.611  1.00 100.00 ? 126 MET B CE    1 
ATOM   2719 N N     . ILE B 2 127 ? 8.388  -18.627 -4.386  1.00 100.00 ? 127 ILE B N     1 
ATOM   2720 C CA    . ILE B 2 127 ? 9.539  -18.554 -3.478  1.00 100.00 ? 127 ILE B CA    1 
ATOM   2721 C C     . ILE B 2 127 ? 9.481  -17.291 -2.613  1.00 100.00 ? 127 ILE B C     1 
ATOM   2722 O O     . ILE B 2 127 ? 9.714  -17.350 -1.402  1.00 100.00 ? 127 ILE B O     1 
ATOM   2723 C CB    . ILE B 2 127 ? 10.886 -18.619 -4.252  1.00 100.00 ? 127 ILE B CB    1 
ATOM   2724 C CG1   . ILE B 2 127 ? 10.977 -19.916 -5.066  1.00 100.00 ? 127 ILE B CG1   1 
ATOM   2725 C CG2   . ILE B 2 127 ? 12.080 -18.501 -3.297  1.00 100.00 ? 127 ILE B CG2   1 
ATOM   2726 C CD1   . ILE B 2 127 ? 11.928 -19.847 -6.251  1.00 100.00 ? 127 ILE B CD1   1 
ATOM   2727 N N     . ALA B 2 128 ? 9.164  -16.160 -3.244  1.00 100.00 ? 128 ALA B N     1 
ATOM   2728 C CA    . ALA B 2 128 ? 9.047  -14.873 -2.554  1.00 100.00 ? 128 ALA B CA    1 
ATOM   2729 C C     . ALA B 2 128 ? 7.910  -14.867 -1.532  1.00 100.00 ? 128 ALA B C     1 
ATOM   2730 O O     . ALA B 2 128 ? 8.019  -14.232 -0.481  1.00 100.00 ? 128 ALA B O     1 
ATOM   2731 C CB    . ALA B 2 128 ? 8.868  -13.745 -3.562  1.00 100.00 ? 128 ALA B CB    1 
ATOM   2732 N N     . GLY B 2 129 ? 6.827  -15.574 -1.851  1.00 100.00 ? 129 GLY B N     1 
ATOM   2733 C CA    . GLY B 2 129 ? 5.693  -15.733 -0.942  1.00 100.00 ? 129 GLY B CA    1 
ATOM   2734 C C     . GLY B 2 129 ? 6.027  -16.617 0.245   1.00 100.00 ? 129 GLY B C     1 
ATOM   2735 O O     . GLY B 2 129 ? 5.605  -16.341 1.371   1.00 100.00 ? 129 GLY B O     1 
ATOM   2736 N N     . SER B 2 130 ? 6.790  -17.678 -0.012  1.00 100.00 ? 130 SER B N     1 
ATOM   2737 C CA    . SER B 2 130 ? 7.244  -18.598 1.031   1.00 100.00 ? 130 SER B CA    1 
ATOM   2738 C C     . SER B 2 130 ? 8.304  -17.957 1.931   1.00 100.00 ? 130 SER B C     1 
ATOM   2739 O O     . SER B 2 130 ? 8.488  -18.373 3.078   1.00 100.00 ? 130 SER B O     1 
ATOM   2740 C CB    . SER B 2 130 ? 7.787  -19.887 0.407   1.00 100.00 ? 130 SER B CB    1 
ATOM   2741 O OG    . SER B 2 130 ? 8.098  -20.848 1.401   1.00 100.00 ? 130 SER B OG    1 
ATOM   2742 N N     . ALA B 2 131 ? 8.993  -16.949 1.399   1.00 100.00 ? 131 ALA B N     1 
ATOM   2743 C CA    . ALA B 2 131 ? 10.004 -16.203 2.146   1.00 100.00 ? 131 ALA B CA    1 
ATOM   2744 C C     . ALA B 2 131 ? 9.382  -15.278 3.192   1.00 100.00 ? 131 ALA B C     1 
ATOM   2745 O O     . ALA B 2 131 ? 9.970  -15.049 4.251   1.00 100.00 ? 131 ALA B O     1 
ATOM   2746 C CB    . ALA B 2 131 ? 10.888 -15.408 1.192   1.00 100.00 ? 131 ALA B CB    1 
ATOM   2747 N N     . ARG B 2 132 ? 8.192  -14.759 2.885   1.00 100.00 ? 132 ARG B N     1 
ATOM   2748 C CA    . ARG B 2 132 ? 7.473  -13.827 3.761   1.00 100.00 ? 132 ARG B CA    1 
ATOM   2749 C C     . ARG B 2 132 ? 7.202  -14.406 5.148   1.00 100.00 ? 132 ARG B C     1 
ATOM   2750 O O     . ARG B 2 132 ? 7.322  -13.705 6.155   1.00 100.00 ? 132 ARG B O     1 
ATOM   2751 C CB    . ARG B 2 132 ? 6.156  -13.387 3.112   1.00 100.00 ? 132 ARG B CB    1 
ATOM   2752 C CG    . ARG B 2 132 ? 6.321  -12.519 1.874   1.00 100.00 ? 132 ARG B CG    1 
ATOM   2753 C CD    . ARG B 2 132 ? 5.054  -12.514 1.034   1.00 100.00 ? 132 ARG B CD    1 
ATOM   2754 N NE    . ARG B 2 132 ? 5.268  -11.903 -0.277  1.00 100.00 ? 132 ARG B NE    1 
ATOM   2755 C CZ    . ARG B 2 132 ? 4.427  -12.002 -1.304  1.00 100.00 ? 132 ARG B CZ    1 
ATOM   2756 N NH1   . ARG B 2 132 ? 3.300  -12.696 -1.191  1.00 100.00 ? 132 ARG B NH1   1 
ATOM   2757 N NH2   . ARG B 2 132 ? 4.716  -11.408 -2.454  1.00 100.00 ? 132 ARG B NH2   1 
ATOM   2758 N N     . SER B 2 133 ? 6.838  -15.686 5.189   1.00 99.97  ? 133 SER B N     1 
ATOM   2759 C CA    . SER B 2 133 ? 6.575  -16.382 6.445   1.00 99.94  ? 133 SER B CA    1 
ATOM   2760 C C     . SER B 2 133 ? 7.840  -17.057 6.968   1.00 99.91  ? 133 SER B C     1 
ATOM   2761 O O     . SER B 2 133 ? 8.148  -18.196 6.603   1.00 99.92  ? 133 SER B O     1 
ATOM   2762 C CB    . SER B 2 133 ? 5.453  -17.406 6.267   1.00 99.94  ? 133 SER B CB    1 
ATOM   2763 O OG    . SER B 2 133 ? 5.764  -18.336 5.244   1.00 99.94  ? 133 SER B OG    1 
ATOM   2764 N N     . MET B 2 134 ? 8.570  -16.339 7.820   1.00 99.86  ? 134 MET B N     1 
ATOM   2765 C CA    . MET B 2 134 ? 9.817  -16.840 8.403   1.00 99.79  ? 134 MET B CA    1 
ATOM   2766 C C     . MET B 2 134 ? 10.218 -16.173 9.734   1.00 99.76  ? 134 MET B C     1 
ATOM   2767 O O     . MET B 2 134 ? 10.753 -16.853 10.609  1.00 99.75  ? 134 MET B O     1 
ATOM   2768 C CB    . MET B 2 134 ? 10.966 -16.766 7.387   1.00 99.81  ? 134 MET B CB    1 
ATOM   2769 C CG    . MET B 2 134 ? 12.018 -17.855 7.558   1.00 99.79  ? 134 MET B CG    1 
ATOM   2770 S SD    . MET B 2 134 ? 12.761 -18.368 5.995   1.00 99.75  ? 134 MET B SD    1 
ATOM   2771 C CE    . MET B 2 134 ? 11.426 -19.318 5.267   1.00 99.71  ? 134 MET B CE    1 
ATOM   2772 N N     . GLY B 2 135 ? 9.977  -14.869 9.910   1.00 99.71  ? 135 GLY B N     1 
ATOM   2773 C CA    . GLY B 2 135 ? 9.342  -13.989 8.925   1.00 99.65  ? 135 GLY B CA    1 
ATOM   2774 C C     . GLY B 2 135 ? 10.302 -12.968 8.348   1.00 99.61  ? 135 GLY B C     1 
ATOM   2775 O O     . GLY B 2 135 ? 11.016 -12.288 9.088   1.00 99.61  ? 135 GLY B O     1 
ATOM   2776 N N     . VAL B 2 136 ? 10.313 -12.865 7.021   1.00 99.59  ? 136 VAL B N     1 
ATOM   2777 C CA    . VAL B 2 136 ? 11.221 -11.964 6.310   1.00 99.56  ? 136 VAL B CA    1 
ATOM   2778 C C     . VAL B 2 136 ? 10.431 -10.902 5.539   1.00 99.56  ? 136 VAL B C     1 
ATOM   2779 O O     . VAL B 2 136 ? 9.594  -11.228 4.693   1.00 99.55  ? 136 VAL B O     1 
ATOM   2780 C CB    . VAL B 2 136 ? 12.171 -12.747 5.358   1.00 99.54  ? 136 VAL B CB    1 
ATOM   2781 C CG1   . VAL B 2 136 ? 13.067 -11.802 4.569   1.00 99.53  ? 136 VAL B CG1   1 
ATOM   2782 C CG2   . VAL B 2 136 ? 13.017 -13.744 6.142   1.00 99.49  ? 136 VAL B CG2   1 
ATOM   2783 N N     . GLU B 2 137 ? 10.703 -9.636  5.848   1.00 99.55  ? 137 GLU B N     1 
ATOM   2784 C CA    . GLU B 2 137 ? 10.029 -8.511  5.203   1.00 99.55  ? 137 GLU B CA    1 
ATOM   2785 C C     . GLU B 2 137 ? 10.929 -7.845  4.169   1.00 99.56  ? 137 GLU B C     1 
ATOM   2786 O O     . GLU B 2 137 ? 10.521 -7.621  3.029   1.00 99.57  ? 137 GLU B O     1 
ATOM   2787 C CB    . GLU B 2 137 ? 9.575  -7.484  6.245   1.00 99.55  ? 137 GLU B CB    1 
ATOM   2788 C CG    . GLU B 2 137 ? 8.435  -7.959  7.141   1.00 99.55  ? 137 GLU B CG    1 
ATOM   2789 C CD    . GLU B 2 137 ? 8.033  -6.936  8.193   1.00 99.55  ? 137 GLU B CD    1 
ATOM   2790 O OE1   . GLU B 2 137 ? 8.128  -5.719  7.924   1.00 99.54  ? 137 GLU B OE1   1 
ATOM   2791 O OE2   . GLU B 2 137 ? 7.611  -7.354  9.292   1.00 99.55  ? 137 GLU B OE2   1 
HETATM 2792 N N     . SFG C 3 .   ? 46.847 -37.841 3.866   1.00 29.34  ? 255 SFG A N     1 
HETATM 2793 C CA    . SFG C 3 .   ? 45.789 -38.836 4.218   1.00 29.45  ? 255 SFG A CA    1 
HETATM 2794 C C     . SFG C 3 .   ? 45.518 -39.801 3.094   1.00 29.32  ? 255 SFG A C     1 
HETATM 2795 O O     . SFG C 3 .   ? 46.042 -39.663 1.990   1.00 28.89  ? 255 SFG A O     1 
HETATM 2796 O OXT   . SFG C 3 .   ? 44.772 -40.769 3.249   1.00 29.44  ? 255 SFG A OXT   1 
HETATM 2797 C CB    . SFG C 3 .   ? 44.507 -38.141 4.701   1.00 29.61  ? 255 SFG A CB    1 
HETATM 2798 C CG    . SFG C 3 .   ? 43.941 -37.091 3.747   1.00 30.64  ? 255 SFG A CG    1 
HETATM 2799 C CD    . SFG C 3 .   ? 42.640 -36.511 4.310   1.00 32.43  ? 255 SFG A CD    1 
HETATM 2800 N NE    . SFG C 3 .   ? 41.529 -36.974 3.501   1.00 33.25  ? 255 SFG A NE    1 
HETATM 2801 C "C5'" . SFG C 3 .   ? 42.639 -34.987 4.265   1.00 33.04  ? 255 SFG A "C5'" 1 
HETATM 2802 C "C4'" . SFG C 3 .   ? 43.251 -34.343 5.506   1.00 34.13  ? 255 SFG A "C4'" 1 
HETATM 2803 O "O4'" . SFG C 3 .   ? 43.733 -33.052 5.142   1.00 33.88  ? 255 SFG A "O4'" 1 
HETATM 2804 C "C3'" . SFG C 3 .   ? 42.278 -34.125 6.656   1.00 34.67  ? 255 SFG A "C3'" 1 
HETATM 2805 O "O3'" . SFG C 3 .   ? 42.827 -34.753 7.817   1.00 36.15  ? 255 SFG A "O3'" 1 
HETATM 2806 C "C2'" . SFG C 3 .   ? 42.213 -32.618 6.864   1.00 34.47  ? 255 SFG A "C2'" 1 
HETATM 2807 O "O2'" . SFG C 3 .   ? 42.245 -32.281 8.253   1.00 35.16  ? 255 SFG A "O2'" 1 
HETATM 2808 C "C1'" . SFG C 3 .   ? 43.466 -32.107 6.177   1.00 33.33  ? 255 SFG A "C1'" 1 
HETATM 2809 N N9    . SFG C 3 .   ? 43.342 -30.780 5.526   1.00 32.86  ? 255 SFG A N9    1 
HETATM 2810 C C8    . SFG C 3 .   ? 42.258 -30.281 4.900   1.00 32.62  ? 255 SFG A C8    1 
HETATM 2811 N N7    . SFG C 3 .   ? 42.512 -29.046 4.399   1.00 32.92  ? 255 SFG A N7    1 
HETATM 2812 C C5    . SFG C 3 .   ? 43.790 -28.741 4.697   1.00 32.59  ? 255 SFG A C5    1 
HETATM 2813 C C6    . SFG C 3 .   ? 44.699 -27.595 4.462   1.00 32.74  ? 255 SFG A C6    1 
HETATM 2814 N N6    . SFG C 3 .   ? 44.280 -26.495 3.791   1.00 32.51  ? 255 SFG A N6    1 
HETATM 2815 N N1    . SFG C 3 .   ? 45.967 -27.688 4.937   1.00 33.10  ? 255 SFG A N1    1 
HETATM 2816 C C2    . SFG C 3 .   ? 46.405 -28.777 5.609   1.00 32.77  ? 255 SFG A C2    1 
HETATM 2817 N N3    . SFG C 3 .   ? 45.629 -29.848 5.859   1.00 32.19  ? 255 SFG A N3    1 
HETATM 2818 C C4    . SFG C 3 .   ? 44.337 -29.892 5.434   1.00 32.67  ? 255 SFG A C4    1 
HETATM 2819 O O     . HOH D 4 .   ? 44.456 -49.773 8.629   1.00 38.72  ? 256 HOH A O     1 
HETATM 2820 O O     . HOH D 4 .   ? 45.716 -50.551 -4.588  1.00 48.43  ? 257 HOH A O     1 
HETATM 2821 O O     . HOH D 4 .   ? 45.504 -56.254 -10.474 1.00 61.97  ? 258 HOH A O     1 
HETATM 2822 O O     . HOH D 4 .   ? 42.987 -51.902 -5.710  1.00 66.47  ? 259 HOH A O     1 
HETATM 2823 O O     . HOH D 4 .   ? 49.226 -43.631 -8.645  1.00 26.56  ? 260 HOH A O     1 
HETATM 2824 O O     . HOH D 4 .   ? 57.368 -62.841 -1.465  1.00 68.62  ? 261 HOH A O     1 
HETATM 2825 O O     . HOH D 4 .   ? 43.978 -58.602 1.414   1.00 50.92  ? 262 HOH A O     1 
HETATM 2826 O O     . HOH D 4 .   ? 52.295 -35.741 -20.061 1.00 61.91  ? 263 HOH A O     1 
HETATM 2827 O O     . HOH D 4 .   ? 53.314 -48.923 -7.594  1.00 34.35  ? 264 HOH A O     1 
HETATM 2828 O O     . HOH D 4 .   ? 55.615 -57.996 4.397   1.00 53.44  ? 265 HOH A O     1 
HETATM 2829 O O     . HOH D 4 .   ? 62.822 -56.388 4.306   1.00 61.42  ? 266 HOH A O     1 
HETATM 2830 O O     . HOH D 4 .   ? 52.213 -60.958 -1.224  1.00 56.05  ? 267 HOH A O     1 
HETATM 2831 O O     . HOH D 4 .   ? 47.253 -54.778 -5.888  1.00 49.26  ? 268 HOH A O     1 
HETATM 2832 O O     . HOH D 4 .   ? 45.567 -47.083 -10.667 1.00 52.47  ? 269 HOH A O     1 
HETATM 2833 O O     . HOH D 4 .   ? 45.114 -34.679 -19.854 1.00 71.57  ? 270 HOH A O     1 
HETATM 2834 O O     . HOH D 4 .   ? 52.625 -24.081 -17.440 1.00 56.81  ? 271 HOH A O     1 
HETATM 2835 O O     . HOH D 4 .   ? 49.357 -34.735 -14.762 1.00 30.62  ? 272 HOH A O     1 
HETATM 2836 O O     . HOH D 4 .   ? 49.857 -36.643 -18.459 1.00 48.91  ? 273 HOH A O     1 
HETATM 2837 O O     . HOH D 4 .   ? 49.774 -44.170 -14.204 1.00 60.93  ? 274 HOH A O     1 
HETATM 2838 O O     . HOH D 4 .   ? 42.668 -22.042 -13.111 1.00 62.43  ? 275 HOH A O     1 
HETATM 2839 O O     . HOH D 4 .   ? 33.965 -40.682 -14.302 1.00 72.30  ? 276 HOH A O     1 
HETATM 2840 O O     . HOH D 4 .   ? 39.046 -23.368 -6.250  1.00 35.84  ? 277 HOH A O     1 
HETATM 2841 O O     . HOH D 4 .   ? 66.042 -22.240 1.273   1.00 42.43  ? 278 HOH A O     1 
HETATM 2842 O O     . HOH D 4 .   ? 44.927 -21.083 -9.194  1.00 33.48  ? 279 HOH A O     1 
HETATM 2843 O O     . HOH D 4 .   ? 37.827 -33.686 -5.756  1.00 27.38  ? 280 HOH A O     1 
HETATM 2844 O O     . HOH D 4 .   ? 44.758 -18.617 -7.811  1.00 57.90  ? 281 HOH A O     1 
HETATM 2845 O O     . HOH D 4 .   ? 52.498 -44.205 20.655  1.00 34.89  ? 282 HOH A O     1 
HETATM 2846 O O     . HOH D 4 .   ? 31.426 -27.036 -5.825  1.00 58.92  ? 283 HOH A O     1 
HETATM 2847 O O     . HOH D 4 .   ? 33.900 -26.996 -8.347  1.00 49.91  ? 284 HOH A O     1 
HETATM 2848 O O     . HOH D 4 .   ? 47.792 -35.762 1.979   1.00 21.62  ? 285 HOH A O     1 
HETATM 2849 O O     . HOH D 4 .   ? 49.075 -38.992 5.084   1.00 18.65  ? 286 HOH A O     1 
HETATM 2850 O O     . HOH D 4 .   ? 49.706 -16.283 -6.121  1.00 55.36  ? 287 HOH A O     1 
HETATM 2851 O O     . HOH D 4 .   ? 65.015 -30.824 -8.444  1.00 35.29  ? 288 HOH A O     1 
HETATM 2852 O O     . HOH D 4 .   ? 51.958 -17.310 6.723   1.00 60.76  ? 289 HOH A O     1 
HETATM 2853 O O     . HOH D 4 .   ? 65.467 -24.090 -3.764  1.00 51.15  ? 290 HOH A O     1 
HETATM 2854 O O     . HOH D 4 .   ? 69.259 -37.500 -2.215  1.00 61.65  ? 291 HOH A O     1 
HETATM 2855 O O     . HOH D 4 .   ? 61.655 -33.712 -9.528  1.00 31.62  ? 292 HOH A O     1 
HETATM 2856 O O     . HOH D 4 .   ? 67.898 -39.989 -6.973  1.00 30.22  ? 293 HOH A O     1 
HETATM 2857 O O     . HOH D 4 .   ? 61.561 -40.888 -9.919  1.00 53.50  ? 294 HOH A O     1 
HETATM 2858 O O     . HOH D 4 .   ? 38.187 -24.396 -8.578  1.00 38.15  ? 295 HOH A O     1 
HETATM 2859 O O     . HOH D 4 .   ? 46.086 -19.317 -1.293  1.00 64.27  ? 296 HOH A O     1 
HETATM 2860 O O     . HOH D 4 .   ? 63.201 -30.207 7.059   1.00 36.13  ? 297 HOH A O     1 
HETATM 2861 O O     . HOH D 4 .   ? 57.881 -25.031 1.335   1.00 30.86  ? 298 HOH A O     1 
HETATM 2862 O O     . HOH D 4 .   ? 64.468 -32.479 6.509   1.00 33.16  ? 299 HOH A O     1 
HETATM 2863 O O     . HOH D 4 .   ? 61.674 -32.540 4.916   1.00 31.27  ? 300 HOH A O     1 
HETATM 2864 O O     . HOH D 4 .   ? 59.933 -23.568 1.752   1.00 30.15  ? 301 HOH A O     1 
HETATM 2865 O O     . HOH D 4 .   ? 63.537 -22.490 3.590   1.00 32.23  ? 302 HOH A O     1 
HETATM 2866 O O     . HOH D 4 .   ? 55.196 -24.263 1.712   1.00 28.60  ? 303 HOH A O     1 
HETATM 2867 O O     . HOH D 4 .   ? 52.500 -18.929 2.955   1.00 62.13  ? 304 HOH A O     1 
HETATM 2868 O O     . HOH D 4 .   ? 40.164 -44.171 4.640   1.00 53.32  ? 305 HOH A O     1 
HETATM 2869 O O     . HOH D 4 .   ? 52.382 -28.338 15.857  1.00 40.00  ? 306 HOH A O     1 
HETATM 2870 O O     . HOH D 4 .   ? 58.343 -30.339 14.779  1.00 46.49  ? 307 HOH A O     1 
HETATM 2871 O O     . HOH D 4 .   ? 57.181 -38.952 14.242  1.00 40.46  ? 308 HOH A O     1 
HETATM 2872 O O     . HOH D 4 .   ? 53.255 -31.309 16.725  1.00 54.21  ? 309 HOH A O     1 
HETATM 2873 O O     . HOH D 4 .   ? 60.056 -35.952 17.336  1.00 59.76  ? 310 HOH A O     1 
HETATM 2874 O O     . HOH D 4 .   ? 58.301 -42.925 15.373  1.00 37.26  ? 311 HOH A O     1 
HETATM 2875 O O     . HOH D 4 .   ? 59.317 -47.125 16.523  1.00 34.39  ? 312 HOH A O     1 
HETATM 2876 O O     . HOH D 4 .   ? 56.532 -36.770 19.267  1.00 69.10  ? 313 HOH A O     1 
HETATM 2877 O O     . HOH D 4 .   ? 40.146 -30.438 9.172   1.00 43.79  ? 314 HOH A O     1 
HETATM 2878 O O     . HOH D 4 .   ? 51.173 -34.919 18.434  1.00 49.31  ? 315 HOH A O     1 
HETATM 2879 O O     . HOH D 4 .   ? 44.728 -24.854 17.136  1.00 54.33  ? 316 HOH A O     1 
HETATM 2880 O O     . HOH D 4 .   ? 65.255 -46.548 3.947   1.00 60.69  ? 317 HOH A O     1 
HETATM 2881 O O     . HOH D 4 .   ? 60.331 -44.562 16.231  1.00 46.30  ? 318 HOH A O     1 
HETATM 2882 O O     . HOH D 4 .   ? 63.547 -39.094 11.021  1.00 27.16  ? 319 HOH A O     1 
HETATM 2883 O O     . HOH D 4 .   ? 70.746 -37.706 4.595   1.00 45.07  ? 320 HOH A O     1 
HETATM 2884 O O     . HOH D 4 .   ? 66.607 -40.028 4.156   1.00 38.27  ? 321 HOH A O     1 
HETATM 2885 O O     . HOH D 4 .   ? 70.270 -37.931 1.998   1.00 35.21  ? 322 HOH A O     1 
HETATM 2886 O O     . HOH D 4 .   ? 68.581 -35.212 1.548   1.00 38.61  ? 323 HOH A O     1 
HETATM 2887 O O     . HOH D 4 .   ? 64.172 -32.309 -6.497  1.00 36.50  ? 324 HOH A O     1 
HETATM 2888 O O     . HOH D 4 .   ? 61.602 -34.133 -6.927  1.00 41.10  ? 325 HOH A O     1 
HETATM 2889 O O     . HOH D 4 .   ? 61.031 -36.678 -6.284  1.00 44.42  ? 326 HOH A O     1 
HETATM 2890 O O     . HOH D 4 .   ? 65.328 -35.695 -6.300  1.00 46.74  ? 327 HOH A O     1 
HETATM 2891 O O     . HOH D 4 .   ? 67.576 -37.756 -8.509  1.00 39.60  ? 328 HOH A O     1 
HETATM 2892 O O     . HOH D 4 .   ? 38.082 -43.797 -17.523 1.00 80.76  ? 329 HOH A O     1 
HETATM 2893 O O     . HOH D 4 .   ? 56.658 -58.936 -4.848  1.00 60.59  ? 330 HOH A O     1 
HETATM 2894 O O     . HOH D 4 .   ? 43.885 -53.065 -3.326  1.00 52.30  ? 331 HOH A O     1 
HETATM 2895 O O     . HOH D 4 .   ? 30.858 -42.958 -4.648  1.00 56.40  ? 332 HOH A O     1 
HETATM 2896 O O     . HOH D 4 .   ? 35.447 -45.228 -6.641  1.00 41.81  ? 333 HOH A O     1 
HETATM 2897 O O     . HOH D 4 .   ? 47.875 -29.272 -16.684 1.00 39.05  ? 334 HOH A O     1 
HETATM 2898 O O     . HOH D 4 .   ? 34.429 -43.808 -4.323  1.00 52.45  ? 335 HOH A O     1 
HETATM 2899 O O     . HOH D 4 .   ? 43.265 -54.524 -1.152  1.00 54.57  ? 336 HOH A O     1 
HETATM 2900 O O     . HOH D 4 .   ? 41.257 -52.721 -0.831  1.00 75.52  ? 337 HOH A O     1 
HETATM 2901 O O     . HOH D 4 .   ? 50.695 -48.174 20.894  1.00 66.01  ? 338 HOH A O     1 
HETATM 2902 O O     . HOH D 4 .   ? 44.454 -52.436 6.887   1.00 45.78  ? 339 HOH A O     1 
HETATM 2903 O O     . HOH D 4 .   ? 38.938 -53.090 1.724   1.00 67.89  ? 340 HOH A O     1 
HETATM 2904 O O     . HOH D 4 .   ? 42.618 -44.372 3.154   1.00 28.93  ? 341 HOH A O     1 
HETATM 2905 O O     . HOH D 4 .   ? 37.043 -46.934 1.646   1.00 51.64  ? 342 HOH A O     1 
HETATM 2906 O O     . HOH D 4 .   ? 36.400 -46.666 -1.302  1.00 51.39  ? 343 HOH A O     1 
HETATM 2907 O O     . HOH D 4 .   ? 23.759 -45.469 19.361  1.00 68.14  ? 344 HOH A O     1 
HETATM 2908 O O     . HOH D 4 .   ? 48.333 -46.001 -9.689  1.00 31.69  ? 345 HOH A O     1 
HETATM 2909 O O     . HOH D 4 .   ? 52.562 -47.753 -9.699  1.00 32.62  ? 346 HOH A O     1 
HETATM 2910 O O     . HOH D 4 .   ? 60.290 -52.180 5.414   1.00 44.43  ? 347 HOH A O     1 
HETATM 2911 O O     . HOH D 4 .   ? 58.733 -61.157 4.862   1.00 59.29  ? 348 HOH A O     1 
HETATM 2912 O O     . HOH D 4 .   ? 33.215 -37.244 -10.351 1.00 51.15  ? 349 HOH A O     1 
HETATM 2913 O O     . HOH D 4 .   ? 11.476 -49.826 18.997  1.00 70.22  ? 350 HOH A O     1 
HETATM 2914 O O     . HOH D 4 .   ? 62.688 -31.512 9.979   1.00 42.54  ? 351 HOH A O     1 
HETATM 2915 O O     . HOH D 4 .   ? 60.848 -31.570 7.723   1.00 20.41  ? 352 HOH A O     1 
HETATM 2916 O O     . HOH D 4 .   ? 67.338 -28.267 -4.999  1.00 54.90  ? 353 HOH A O     1 
HETATM 2917 O O     . HOH D 4 .   ? 66.427 -22.518 -11.867 1.00 37.49  ? 354 HOH A O     1 
HETATM 2918 O O     . HOH D 4 .   ? 56.655 -19.591 -7.457  1.00 43.10  ? 355 HOH A O     1 
HETATM 2919 O O     . HOH D 4 .   ? 61.202 -22.663 -4.300  1.00 46.77  ? 356 HOH A O     1 
HETATM 2920 O O     . HOH D 4 .   ? 66.628 -27.485 -7.575  1.00 31.69  ? 357 HOH A O     1 
HETATM 2921 O O     . HOH D 4 .   ? 61.438 -25.009 -11.782 1.00 40.74  ? 358 HOH A O     1 
HETATM 2922 O O     . HOH D 4 .   ? 46.999 -21.278 -10.846 1.00 34.38  ? 359 HOH A O     1 
HETATM 2923 O O     . HOH D 4 .   ? 63.085 -22.550 -11.931 1.00 27.36  ? 360 HOH A O     1 
HETATM 2924 O O     . HOH D 4 .   ? 55.731 -19.065 -13.440 1.00 63.84  ? 361 HOH A O     1 
HETATM 2925 O O     . HOH D 4 .   ? 60.235 -20.799 -6.109  1.00 58.85  ? 362 HOH A O     1 
HETATM 2926 O O     . HOH D 4 .   ? 45.300 -19.733 -13.855 1.00 61.41  ? 363 HOH A O     1 
HETATM 2927 O O     . HOH D 4 .   ? 48.262 -18.960 -11.177 1.00 40.22  ? 364 HOH A O     1 
HETATM 2928 O O     . HOH D 4 .   ? 47.406 -19.978 -3.692  1.00 47.34  ? 365 HOH A O     1 
HETATM 2929 O O     . HOH D 4 .   ? 48.531 -17.432 -3.991  1.00 51.62  ? 366 HOH A O     1 
HETATM 2930 O O     . HOH D 4 .   ? 40.772 -21.088 -8.255  1.00 60.93  ? 367 HOH A O     1 
HETATM 2931 O O     . HOH D 4 .   ? 41.175 -24.767 -20.964 1.00 69.98  ? 368 HOH A O     1 
HETATM 2932 O O     . HOH D 4 .   ? 44.857 -28.053 -19.316 1.00 62.06  ? 369 HOH A O     1 
HETATM 2933 O O     . HOH D 4 .   ? 47.545 -33.497 -16.180 1.00 51.85  ? 370 HOH A O     1 
HETATM 2934 O O     . HOH D 4 .   ? 39.579 -36.864 -15.813 1.00 48.35  ? 371 HOH A O     1 
HETATM 2935 O O     . HOH D 4 .   ? 44.646 -42.708 -15.902 1.00 65.53  ? 372 HOH A O     1 
HETATM 2936 O O     . HOH D 4 .   ? 38.991 -42.354 -11.844 1.00 43.91  ? 373 HOH A O     1 
HETATM 2937 O O     . HOH D 4 .   ? 49.347 -40.616 -17.699 1.00 32.92  ? 374 HOH A O     1 
HETATM 2938 O O     . HOH D 4 .   ? 45.136 -23.769 3.637   1.00 42.13  ? 375 HOH A O     1 
HETATM 2939 O O     . HOH D 4 .   ? 62.265 -42.235 9.749   1.00 33.40  ? 376 HOH A O     1 
HETATM 2940 O O     . HOH D 4 .   ? 57.016 -28.351 16.716  1.00 42.02  ? 377 HOH A O     1 
HETATM 2941 O O     . HOH D 4 .   ? 56.898 -32.300 15.561  1.00 52.53  ? 378 HOH A O     1 
HETATM 2942 O O     . HOH D 4 .   ? 41.273 -54.974 1.519   1.00 47.91  ? 379 HOH A O     1 
HETATM 2943 O O     . HOH D 4 .   ? 53.052 -52.940 -9.517  1.00 48.01  ? 380 HOH A O     1 
HETATM 2944 O O     . HOH D 4 .   ? 53.192 -61.924 14.697  1.00 93.02  ? 381 HOH A O     1 
HETATM 2945 O O     . HOH D 4 .   ? 52.033 -54.681 13.910  1.00 47.50  ? 382 HOH A O     1 
HETATM 2946 O O     . HOH D 4 .   ? 60.003 -57.708 3.519   1.00 60.35  ? 383 HOH A O     1 
HETATM 2947 O O     . HOH D 4 .   ? 45.221 -43.638 13.435  1.00 52.05  ? 384 HOH A O     1 
HETATM 2948 O O     . HOH D 4 .   ? 53.092 -45.173 24.871  1.00 52.54  ? 385 HOH A O     1 
HETATM 2949 O O     . HOH D 4 .   ? 53.323 -41.632 20.167  1.00 46.96  ? 386 HOH A O     1 
HETATM 2950 O O     . HOH D 4 .   ? 54.842 -33.634 19.288  1.00 57.10  ? 387 HOH A O     1 
HETATM 2951 O O     . HOH D 4 .   ? 51.658 -36.993 20.357  1.00 50.84  ? 388 HOH A O     1 
HETATM 2952 O O     . HOH D 4 .   ? 60.361 -39.931 -12.072 1.00 46.95  ? 389 HOH A O     1 
HETATM 2953 O O     . HOH D 4 .   ? 58.164 -38.541 -14.212 1.00 44.86  ? 390 HOH A O     1 
HETATM 2954 O O     . HOH D 4 .   ? 61.525 -38.209 -8.963  1.00 42.76  ? 391 HOH A O     1 
HETATM 2955 O O     . HOH D 4 .   ? 66.476 -42.665 5.296   1.00 46.52  ? 392 HOH A O     1 
HETATM 2956 O O     . HOH D 4 .   ? 45.196 -25.468 12.978  1.00 46.18  ? 393 HOH A O     1 
HETATM 2957 O O     . HOH D 4 .   ? 48.898 -23.271 13.140  1.00 47.57  ? 394 HOH A O     1 
HETATM 2958 O O     . HOH D 4 .   ? 50.216 -18.448 8.476   1.00 73.23  ? 395 HOH A O     1 
HETATM 2959 O O     . HOH D 4 .   ? 48.390 -22.384 3.683   1.00 54.19  ? 396 HOH A O     1 
HETATM 2960 O O     . HOH D 4 .   ? 53.998 -19.729 -0.225  1.00 49.26  ? 397 HOH A O     1 
HETATM 2961 O O     . HOH D 4 .   ? 54.070 -22.558 -0.284  1.00 34.07  ? 398 HOH A O     1 
HETATM 2962 O O     . HOH D 4 .   ? 11.434 -52.561 6.127   1.00 77.81  ? 399 HOH A O     1 
HETATM 2963 O O     . HOH D 4 .   ? 1.252  -41.554 12.593  1.00 71.31  ? 400 HOH A O     1 
HETATM 2964 O O     . HOH D 4 .   ? 8.817  -23.573 16.743  1.00 76.06  ? 401 HOH A O     1 
HETATM 2965 O O     . HOH D 4 .   ? 13.764 -31.614 27.056  1.00 68.14  ? 402 HOH A O     1 
HETATM 2966 O O     . HOH D 4 .   ? 13.504 -22.453 24.756  1.00 74.78  ? 403 HOH A O     1 
HETATM 2967 O O     . HOH D 4 .   ? 16.586 -26.794 27.606  1.00 75.13  ? 404 HOH A O     1 
HETATM 2968 O O     . HOH D 4 .   ? 20.031 -24.313 24.221  1.00 67.17  ? 405 HOH A O     1 
HETATM 2969 O O     . HOH D 4 .   ? 31.509 -35.240 17.786  1.00 68.47  ? 406 HOH A O     1 
HETATM 2970 O O     . HOH D 4 .   ? 19.200 -25.273 5.737   1.00 68.55  ? 407 HOH A O     1 
HETATM 2971 O O     . HOH D 4 .   ? 9.755  -37.488 -0.045  1.00 61.69  ? 408 HOH A O     1 
HETATM 2972 O O     . HOH D 4 .   ? 17.761 -46.693 13.628  1.00 68.16  ? 409 HOH A O     1 
HETATM 2973 O O     . HOH D 4 .   ? 13.731 -45.534 7.057   1.00 62.77  ? 410 HOH A O     1 
HETATM 2974 O O     . HOH D 4 .   ? 15.531 -44.367 4.567   1.00 50.73  ? 411 HOH A O     1 
HETATM 2975 O O     . HOH D 4 .   ? 10.083 -44.920 10.924  1.00 70.17  ? 412 HOH A O     1 
HETATM 2976 O O     . HOH D 4 .   ? 29.077 -34.065 17.116  1.00 73.57  ? 413 HOH A O     1 
HETATM 2977 O O     . HOH D 4 .   ? 31.868 -32.886 15.705  1.00 58.97  ? 414 HOH A O     1 
HETATM 2978 O O     . HOH D 4 .   ? 6.996  -38.536 24.401  1.00 70.32  ? 415 HOH A O     1 
HETATM 2979 O O     . HOH D 4 .   ? 37.094 -51.859 4.320   1.00 59.99  ? 416 HOH A O     1 
HETATM 2980 O O     . HOH D 4 .   ? 35.860 -53.574 6.024   1.00 53.04  ? 417 HOH A O     1 
HETATM 2981 O O     . HOH D 4 .   ? 57.542 -63.738 1.111   1.00 57.73  ? 418 HOH A O     1 
HETATM 2982 O O     . HOH D 4 .   ? 41.703 -60.033 13.069  1.00 88.14  ? 419 HOH A O     1 
HETATM 2983 O O     . HOH D 4 .   ? 45.564 -62.105 4.399   1.00 60.16  ? 420 HOH A O     1 
HETATM 2984 O O     . HOH D 4 .   ? 37.433 -48.409 -6.771  1.00 56.09  ? 421 HOH A O     1 
HETATM 2985 O O     . HOH D 4 .   ? 42.637 -48.837 -12.259 1.00 70.15  ? 422 HOH A O     1 
HETATM 2986 O O     . HOH D 4 .   ? 36.244 -53.928 -6.618  1.00 63.65  ? 423 HOH A O     1 
HETATM 2987 O O     . HOH D 4 .   ? 46.317 -52.400 -6.422  1.00 60.83  ? 424 HOH A O     1 
HETATM 2988 O O     . HOH D 4 .   ? 45.281 -45.279 -14.174 1.00 49.39  ? 425 HOH A O     1 
HETATM 2989 O O     . HOH D 4 .   ? 49.856 -48.099 -10.527 1.00 42.24  ? 426 HOH A O     1 
HETATM 2990 O O     . HOH D 4 .   ? 52.889 -51.116 -12.408 1.00 67.90  ? 427 HOH A O     1 
HETATM 2991 O O     . HOH D 4 .   ? 45.448 -47.899 -8.078  1.00 47.65  ? 428 HOH A O     1 
HETATM 2992 O O     . HOH D 4 .   ? 51.771 -50.941 -8.414  1.00 57.66  ? 429 HOH A O     1 
HETATM 2993 O O     . HOH D 4 .   ? 60.086 -60.536 -4.735  1.00 55.80  ? 430 HOH A O     1 
HETATM 2994 O O     . HOH D 4 .   ? 60.232 -55.058 3.149   1.00 55.03  ? 431 HOH A O     1 
HETATM 2995 O O     . HOH D 4 .   ? 53.027 -55.314 -8.495  1.00 49.50  ? 432 HOH A O     1 
HETATM 2996 O O     . HOH D 4 .   ? 55.149 -55.177 -4.186  1.00 51.57  ? 433 HOH A O     1 
HETATM 2997 O O     . HOH D 4 .   ? 58.755 -54.542 -3.930  1.00 45.09  ? 434 HOH A O     1 
HETATM 2998 O O     . HOH D 4 .   ? 59.145 -54.729 -1.334  1.00 56.21  ? 435 HOH A O     1 
HETATM 2999 O O     . HOH D 4 .   ? 61.363 -50.411 -0.951  1.00 90.11  ? 436 HOH A O     1 
HETATM 3000 O O     . HOH D 4 .   ? 61.250 -53.998 0.882   1.00 49.44  ? 437 HOH A O     1 
HETATM 3001 O O     . HOH D 4 .   ? 58.056 -41.371 -12.113 1.00 51.70  ? 438 HOH A O     1 
HETATM 3002 O O     . HOH D 4 .   ? 53.231 -40.143 -18.653 1.00 54.14  ? 439 HOH A O     1 
HETATM 3003 O O     . HOH D 4 .   ? 58.642 -42.421 -16.264 1.00 54.34  ? 440 HOH A O     1 
HETATM 3004 O O     . HOH D 4 .   ? 56.349 -42.969 -13.305 1.00 55.78  ? 441 HOH A O     1 
HETATM 3005 O O     . HOH D 4 .   ? 57.655 -44.499 -15.025 1.00 44.44  ? 442 HOH A O     1 
HETATM 3006 O O     . HOH D 4 .   ? 38.862 -34.758 -17.344 1.00 62.80  ? 443 HOH A O     1 
HETATM 3007 O O     . HOH D 4 .   ? 37.100 -22.182 -12.328 1.00 53.11  ? 444 HOH A O     1 
HETATM 3008 O O     . HOH D 4 .   ? 45.626 -22.525 -17.243 1.00 45.62  ? 445 HOH A O     1 
HETATM 3009 O O     . HOH D 4 .   ? 41.215 -30.982 -18.586 1.00 40.29  ? 446 HOH A O     1 
HETATM 3010 O O     . HOH D 4 .   ? 43.705 -24.576 -18.995 1.00 64.42  ? 447 HOH A O     1 
HETATM 3011 O O     . HOH D 4 .   ? 37.454 -26.266 -16.078 1.00 68.86  ? 448 HOH A O     1 
HETATM 3012 O O     . HOH D 4 .   ? 35.295 -24.316 -9.181  1.00 62.88  ? 449 HOH A O     1 
HETATM 3013 O O     . HOH D 4 .   ? 41.061 -24.088 -12.455 1.00 44.33  ? 450 HOH A O     1 
HETATM 3014 O O     . HOH D 4 .   ? 52.812 -19.817 -10.079 1.00 39.39  ? 451 HOH A O     1 
HETATM 3015 O O     . HOH D 4 .   ? 54.019 -19.315 -7.864  1.00 42.21  ? 452 HOH A O     1 
HETATM 3016 O O     . HOH D 4 .   ? 62.143 -20.515 -7.958  1.00 57.24  ? 453 HOH A O     1 
HETATM 3017 O O     . HOH D 4 .   ? 58.257 -26.033 -15.481 1.00 77.24  ? 454 HOH A O     1 
HETATM 3018 O O     . HOH D 4 .   ? 58.322 -19.013 -5.557  1.00 51.88  ? 455 HOH A O     1 
HETATM 3019 O O     . HOH D 4 .   ? 57.355 -23.790 -13.211 1.00 49.59  ? 456 HOH A O     1 
HETATM 3020 O O     . HOH D 4 .   ? 58.497 -25.181 -17.996 1.00 46.04  ? 457 HOH A O     1 
HETATM 3021 O O     . HOH D 4 .   ? 60.374 -23.119 -21.280 1.00 41.80  ? 458 HOH A O     1 
HETATM 3022 O O     . HOH D 4 .   ? 60.401 -32.122 -12.860 1.00 62.79  ? 459 HOH A O     1 
HETATM 3023 O O     . HOH D 4 .   ? 60.303 -24.590 -15.081 1.00 48.76  ? 460 HOH A O     1 
HETATM 3024 O O     . HOH D 4 .   ? 63.246 -33.171 -17.773 1.00 68.44  ? 461 HOH A O     1 
HETATM 3025 O O     . HOH D 4 .   ? 62.594 -32.020 -15.480 1.00 44.88  ? 462 HOH A O     1 
HETATM 3026 O O     . HOH D 4 .   ? 59.445 -30.597 -20.094 1.00 61.74  ? 463 HOH A O     1 
HETATM 3027 O O     . HOH D 4 .   ? 56.964 -34.821 14.906  1.00 32.53  ? 464 HOH A O     1 
HETATM 3028 O O     . HOH D 4 .   ? 56.279 -40.561 16.767  1.00 42.19  ? 465 HOH A O     1 
HETATM 3029 O O     . HOH D 4 .   ? 51.058 -40.132 20.073  1.00 38.92  ? 466 HOH A O     1 
HETATM 3030 O O     . HOH D 4 .   ? 45.192 -22.672 6.542   1.00 61.81  ? 467 HOH A O     1 
HETATM 3031 O O     . HOH D 4 .   ? 43.617 -19.940 0.076   1.00 66.04  ? 468 HOH A O     1 
HETATM 3032 O O     . HOH D 4 .   ? 41.525 -25.357 3.724   1.00 43.00  ? 469 HOH A O     1 
HETATM 3033 O O     . HOH D 4 .   ? 40.846 -24.431 6.248   1.00 60.22  ? 470 HOH A O     1 
HETATM 3034 O O     . HOH D 4 .   ? 40.156 -29.323 15.860  1.00 60.48  ? 471 HOH A O     1 
HETATM 3035 O O     . HOH D 4 .   ? 45.440 -23.487 10.258  1.00 65.43  ? 472 HOH A O     1 
HETATM 3036 O O     . HOH D 4 .   ? 39.982 -28.076 3.635   1.00 48.26  ? 473 HOH A O     1 
HETATM 3037 O O     . HOH D 4 .   ? 39.944 -33.320 1.782   1.00 53.34  ? 474 HOH A O     1 
HETATM 3038 O O     . HOH D 4 .   ? 3.728  -41.440 9.088   1.00 67.79  ? 475 HOH A O     1 
HETATM 3039 O O     . HOH D 4 .   ? 63.699 -42.065 5.435   1.00 31.86  ? 476 HOH A O     1 
HETATM 3040 O O     . HOH D 4 .   ? 60.328 -36.798 -14.626 1.00 55.30  ? 477 HOH A O     1 
HETATM 3041 O O     . HOH D 4 .   ? 61.234 -40.711 -16.271 1.00 48.09  ? 478 HOH A O     1 
HETATM 3042 O O     . HOH D 4 .   ? 67.017 -36.543 -3.196  1.00 48.24  ? 479 HOH A O     1 
HETATM 3043 O O     . HOH D 4 .   ? 36.536 -49.708 2.729   1.00 66.95  ? 480 HOH A O     1 
HETATM 3044 O O     . HOH D 4 .   ? 55.162 -61.328 -1.786  1.00 51.84  ? 481 HOH A O     1 
HETATM 3045 O O     . HOH D 4 .   ? 53.862 -43.552 22.836  1.00 48.01  ? 482 HOH A O     1 
HETATM 3046 O O     . HOH D 4 .   ? 58.907 -38.366 16.162  1.00 65.85  ? 483 HOH A O     1 
HETATM 3047 O O     . HOH D 4 .   ? 59.365 -34.123 15.714  1.00 61.67  ? 484 HOH A O     1 
HETATM 3048 O O     . HOH D 4 .   ? 59.844 -31.828 16.957  1.00 60.43  ? 485 HOH A O     1 
HETATM 3049 O O     . HOH D 4 .   ? 57.446 -38.815 20.810  1.00 57.87  ? 486 HOH A O     1 
HETATM 3050 O O     . HOH D 4 .   ? 14.562 -41.767 2.900   1.00 60.67  ? 487 HOH A O     1 
HETATM 3051 O O     . HOH D 4 .   ? 39.708 -47.187 -17.836 1.00 54.34  ? 488 HOH A O     1 
HETATM 3052 O O     . HOH D 4 .   ? 38.514 -46.111 -13.013 1.00 70.89  ? 489 HOH A O     1 
HETATM 3053 O O     . HOH D 4 .   ? 39.451 -48.346 -11.753 1.00 45.45  ? 490 HOH A O     1 
HETATM 3054 O O     . HOH D 4 .   ? 44.275 -18.955 -5.189  1.00 46.36  ? 491 HOH A O     1 
HETATM 3055 O O     . HOH D 4 .   ? 43.181 -22.617 2.145   1.00 73.33  ? 492 HOH A O     1 
HETATM 3056 O O     . HOH D 4 .   ? 41.871 -21.945 -0.169  1.00 58.41  ? 493 HOH A O     1 
HETATM 3057 O O     . HOH D 4 .   ? 52.789 -56.190 -4.313  1.00 63.77  ? 494 HOH A O     1 
HETATM 3058 O O     . HOH D 4 .   ? 57.282 -56.511 -3.122  1.00 79.19  ? 495 HOH A O     1 
HETATM 3059 O O     . HOH D 4 .   ? 43.354 -43.647 11.017  1.00 34.64  ? 496 HOH A O     1 
HETATM 3060 O O     . HOH D 4 .   ? 41.136 -35.951 1.170   1.00 47.15  ? 497 HOH A O     1 
HETATM 3061 O O     . HOH D 4 .   ? 39.574 -32.406 4.325   1.00 52.77  ? 498 HOH A O     1 
HETATM 3062 O O     . HOH D 4 .   ? 39.009 -55.192 3.767   1.00 50.55  ? 499 HOH A O     1 
HETATM 3063 O O     . HOH D 4 .   ? 51.585 -63.132 0.751   1.00 66.40  ? 500 HOH A O     1 
HETATM 3064 O O     . HOH D 4 .   ? 45.027 -65.262 4.887   1.00 63.82  ? 501 HOH A O     1 
HETATM 3065 O O     . HOH D 4 .   ? 47.685 -63.629 3.632   1.00 66.59  ? 502 HOH A O     1 
HETATM 3066 O O     . HOH D 4 .   ? 50.236 -62.731 3.827   1.00 52.40  ? 503 HOH A O     1 
HETATM 3067 O O     . HOH D 4 .   ? 63.379 -62.642 3.558   1.00 63.37  ? 504 HOH A O     1 
HETATM 3068 O O     . HOH D 4 .   ? 64.735 -57.609 5.780   1.00 62.01  ? 505 HOH A O     1 
HETATM 3069 O O     . HOH D 4 .   ? 51.674 -63.923 13.665  1.00 54.88  ? 506 HOH A O     1 
HETATM 3070 O O     . HOH D 4 .   ? 53.515 -57.766 11.141  1.00 59.84  ? 507 HOH A O     1 
HETATM 3071 O O     . HOH D 4 .   ? 50.274 -55.165 11.993  1.00 40.70  ? 508 HOH A O     1 
HETATM 3072 O O     . HOH D 4 .   ? 51.598 -52.119 16.016  1.00 41.87  ? 509 HOH A O     1 
HETATM 3073 O O     . HOH D 4 .   ? 47.454 -43.825 15.935  1.00 37.56  ? 510 HOH A O     1 
HETATM 3074 O O     . HOH D 4 .   ? 53.331 -34.029 17.120  1.00 41.39  ? 511 HOH A O     1 
HETATM 3075 O O     . HOH D 4 .   ? 47.147 -37.871 22.787  1.00 63.25  ? 512 HOH A O     1 
HETATM 3076 O O     . HOH D 4 .   ? 52.331 -21.075 1.400   1.00 61.11  ? 513 HOH A O     1 
HETATM 3077 O O     . HOH D 4 .   ? 51.333 -17.391 -4.091  1.00 61.83  ? 514 HOH A O     1 
HETATM 3078 O O     . HOH D 4 .   ? 35.863 -29.770 -13.610 1.00 64.82  ? 515 HOH A O     1 
HETATM 3079 O O     . HOH D 4 .   ? 50.314 -28.279 -16.644 1.00 75.72  ? 516 HOH A O     1 
HETATM 3080 O O     . HOH D 4 .   ? 43.240 -39.600 -15.341 1.00 52.35  ? 517 HOH A O     1 
HETATM 3081 O O     . HOH D 4 .   ? 39.934 -45.631 -15.136 1.00 58.06  ? 518 HOH A O     1 
HETATM 3082 O O     . HOH D 4 .   ? 40.214 -37.779 -0.593  1.00 47.61  ? 519 HOH A O     1 
HETATM 3083 O O     . HOH D 4 .   ? 40.907 -42.573 16.791  1.00 64.82  ? 520 HOH A O     1 
HETATM 3084 O O     . HOH D 4 .   ? 50.004 -51.184 17.903  1.00 56.94  ? 521 HOH A O     1 
HETATM 3085 O O     . HOH D 4 .   ? 40.701 -37.883 14.269  1.00 57.51  ? 522 HOH A O     1 
HETATM 3086 O O     . HOH D 4 .   ? 23.259 -47.598 21.417  1.00 66.38  ? 523 HOH A O     1 
HETATM 3087 O O     . HOH D 4 .   ? 27.313 -49.377 16.964  1.00 59.00  ? 524 HOH A O     1 
HETATM 3088 O O     . HOH D 4 .   ? 26.078 -46.984 17.159  1.00 58.57  ? 525 HOH A O     1 
HETATM 3089 O O     . HOH D 4 .   ? 29.209 -39.400 -7.080  1.00 73.38  ? 526 HOH A O     1 
HETATM 3090 O O     . HOH E 4 .   ? 25.089 -34.514 -7.842  1.00 56.12  ? 148 HOH B O     1 
HETATM 3091 O O     . HOH E 4 .   ? 38.555 -24.027 -1.623  1.00 60.48  ? 149 HOH B O     1 
HETATM 3092 O O     . HOH E 4 .   ? 35.935 -31.952 -5.082  1.00 33.02  ? 150 HOH B O     1 
HETATM 3093 O O     . HOH E 4 .   ? 27.251 -50.963 5.979   1.00 60.66  ? 151 HOH B O     1 
HETATM 3094 O O     . HOH E 4 .   ? 15.390 -29.374 -1.469  1.00 70.58  ? 152 HOH B O     1 
HETATM 3095 O O     . HOH E 4 .   ? 10.969 -6.003  0.759   1.00 60.40  ? 153 HOH B O     1 
HETATM 3096 O O     . HOH E 4 .   ? 17.754 -39.448 -6.930  1.00 50.05  ? 154 HOH B O     1 
HETATM 3097 O O     . HOH E 4 .   ? 21.582 -41.497 -8.028  1.00 53.54  ? 155 HOH B O     1 
HETATM 3098 O O     . HOH E 4 .   ? 26.017 -49.780 -18.192 1.00 71.07  ? 156 HOH B O     1 
HETATM 3099 O O     . HOH E 4 .   ? 13.716 -46.679 0.155   1.00 53.74  ? 157 HOH B O     1 
HETATM 3100 O O     . HOH E 4 .   ? 16.528 -47.611 -21.113 1.00 80.25  ? 158 HOH B O     1 
HETATM 3101 O O     . HOH E 4 .   ? 13.628 -49.809 8.621   1.00 62.43  ? 159 HOH B O     1 
HETATM 3102 O O     . HOH E 4 .   ? 34.888 -27.450 10.847  1.00 63.49  ? 160 HOH B O     1 
HETATM 3103 O O     . HOH E 4 .   ? 12.685 -41.385 -0.992  1.00 72.93  ? 161 HOH B O     1 
HETATM 3104 O O     . HOH E 4 .   ? 17.886 -46.673 5.000   1.00 54.04  ? 162 HOH B O     1 
HETATM 3105 O O     . HOH E 4 .   ? 21.907 -55.919 3.785   1.00 62.38  ? 163 HOH B O     1 
HETATM 3106 O O     . HOH E 4 .   ? 23.531 -54.289 -15.280 1.00 55.52  ? 164 HOH B O     1 
HETATM 3107 O O     . HOH E 4 .   ? 29.504 -52.969 -0.108  1.00 61.93  ? 165 HOH B O     1 
HETATM 3108 O O     . HOH E 4 .   ? 30.081 -51.872 -4.518  1.00 61.20  ? 166 HOH B O     1 
HETATM 3109 O O     . HOH E 4 .   ? 17.018 -58.474 -4.329  1.00 61.71  ? 167 HOH B O     1 
HETATM 3110 O O     . HOH E 4 .   ? 26.491 -58.058 -12.006 1.00 46.92  ? 168 HOH B O     1 
HETATM 3111 O O     . HOH E 4 .   ? 25.402 -55.373 -12.540 1.00 61.57  ? 169 HOH B O     1 
HETATM 3112 O O     . HOH E 4 .   ? 13.026 -49.479 -13.279 1.00 66.32  ? 170 HOH B O     1 
HETATM 3113 O O     . HOH E 4 .   ? 14.967 -49.011 -11.108 1.00 54.78  ? 171 HOH B O     1 
HETATM 3114 O O     . HOH E 4 .   ? 13.077 -33.656 -0.182  1.00 56.84  ? 172 HOH B O     1 
HETATM 3115 O O     . HOH E 4 .   ? 35.572 -42.141 4.657   1.00 49.09  ? 173 HOH B O     1 
HETATM 3116 O O     . HOH E 4 .   ? 34.702 -42.893 -1.770  1.00 29.25  ? 174 HOH B O     1 
HETATM 3117 O O     . HOH E 4 .   ? 29.393 -27.563 6.287   1.00 61.96  ? 175 HOH B O     1 
HETATM 3118 O O     . HOH E 4 .   ? 27.838 -35.963 11.218  1.00 70.39  ? 176 HOH B O     1 
HETATM 3119 O O     . HOH E 4 .   ? 26.751 -37.924 9.448   1.00 68.68  ? 177 HOH B O     1 
HETATM 3120 O O     . HOH E 4 .   ? 36.694 -36.809 0.818   1.00 50.98  ? 178 HOH B O     1 
HETATM 3121 O O     . HOH E 4 .   ? 36.131 -30.640 2.014   1.00 58.08  ? 179 HOH B O     1 
HETATM 3122 O O     . HOH E 4 .   ? 37.661 -34.300 0.651   1.00 49.16  ? 180 HOH B O     1 
HETATM 3123 O O     . HOH E 4 .   ? 36.212 -37.571 4.165   1.00 50.10  ? 181 HOH B O     1 
HETATM 3124 O O     . HOH E 4 .   ? 29.002 -47.918 -5.091  1.00 44.04  ? 182 HOH B O     1 
HETATM 3125 O O     . HOH E 4 .   ? 24.936 -24.347 8.352   1.00 72.09  ? 183 HOH B O     1 
HETATM 3126 O O     . HOH E 4 .   ? 20.117 -41.037 -5.849  1.00 39.42  ? 184 HOH B O     1 
HETATM 3127 O O     . HOH E 4 .   ? 12.705 -48.367 -3.716  1.00 61.16  ? 185 HOH B O     1 
HETATM 3128 O O     . HOH E 4 .   ? 25.611 -47.351 -11.089 1.00 52.84  ? 186 HOH B O     1 
HETATM 3129 O O     . HOH E 4 .   ? 21.675 -49.176 -13.518 1.00 54.31  ? 187 HOH B O     1 
HETATM 3130 O O     . HOH E 4 .   ? 17.123 -34.956 -0.633  1.00 54.74  ? 188 HOH B O     1 
HETATM 3131 O O     . HOH E 4 .   ? 15.382 -32.593 0.833   1.00 48.12  ? 189 HOH B O     1 
HETATM 3132 O O     . HOH E 4 .   ? 28.937 -43.127 -6.485  1.00 58.61  ? 190 HOH B O     1 
HETATM 3133 O O     . HOH E 4 .   ? 20.165 -12.192 5.768   1.00 67.85  ? 191 HOH B O     1 
HETATM 3134 O O     . HOH E 4 .   ? 13.697 -48.166 6.444   1.00 65.80  ? 192 HOH B O     1 
HETATM 3135 O O     . HOH E 4 .   ? 30.682 -51.225 5.096   1.00 70.40  ? 193 HOH B O     1 
HETATM 3136 O O     . HOH E 4 .   ? 31.933 -59.134 -1.288  1.00 70.97  ? 194 HOH B O     1 
HETATM 3137 O O     . HOH E 4 .   ? 27.230 -41.239 -7.240  1.00 38.24  ? 195 HOH B O     1 
HETATM 3138 O O     . HOH E 4 .   ? 27.215 -35.490 -6.529  1.00 58.06  ? 196 HOH B O     1 
HETATM 3139 O O     . HOH E 4 .   ? 24.593 -48.058 12.378  1.00 68.49  ? 197 HOH B O     1 
HETATM 3140 O O     . HOH E 4 .   ? 28.534 -49.751 -1.201  1.00 46.97  ? 198 HOH B O     1 
HETATM 3141 O O     . HOH E 4 .   ? 30.176 -49.492 -3.248  1.00 51.19  ? 199 HOH B O     1 
HETATM 3142 O O     . HOH E 4 .   ? 22.575 -54.301 -8.287  1.00 45.09  ? 200 HOH B O     1 
HETATM 3143 O O     . HOH E 4 .   ? 21.471 -19.727 6.800   1.00 61.07  ? 201 HOH B O     1 
HETATM 3144 O O     . HOH E 4 .   ? 10.433 -5.549  -3.396  1.00 64.99  ? 202 HOH B O     1 
HETATM 3145 O O     . HOH E 4 .   ? 18.866 -12.716 8.711   1.00 74.49  ? 203 HOH B O     1 
HETATM 3146 O O     . HOH E 4 .   ? 13.824 -9.197  8.416   1.00 65.61  ? 204 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   TRP 2   2   2   TRP TRP A . n 
A 1 3   VAL 3   3   3   VAL VAL A . n 
A 1 4   TYR 4   4   4   TYR TYR A . n 
A 1 5   ARG 5   5   5   ARG ARG A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LYS 7   7   7   LYS LYS A . n 
A 1 8   GLY 8   8   8   GLY GLY A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  LEU 10  10  10  LEU LEU A . n 
A 1 11  GLU 11  11  11  GLU GLU A . n 
A 1 12  ALA 12  12  12  ALA ALA A . n 
A 1 13  LEU 13  13  13  LEU LEU A . n 
A 1 14  ASP 14  14  14  ASP ASP A . n 
A 1 15  PRO 15  15  15  PRO PRO A . n 
A 1 16  ILE 16  16  16  ILE ILE A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  PRO 18  18  18  PRO PRO A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  PHE 21  21  21  PHE PHE A . n 
A 1 22  ASP 22  22  22  ASP ASP A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  ALA 25  25  25  ALA ALA A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  TRP 29  29  29  TRP TRP A . n 
A 1 30  GLU 30  30  30  GLU GLU A . n 
A 1 31  ARG 31  31  31  ARG ARG A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  TRP 36  36  36  TRP TRP A . n 
A 1 37  ALA 37  37  37  ALA ALA A . n 
A 1 38  PHE 38  38  38  PHE PHE A . n 
A 1 39  PHE 39  39  39  PHE PHE A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  PRO 42  42  42  PRO PRO A . n 
A 1 43  VAL 43  43  43  VAL VAL A . n 
A 1 44  ASP 44  44  44  ASP ASP A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  PRO 46  46  46  PRO PRO A . n 
A 1 47  TYR 47  47  47  TYR TYR A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  GLY 49  49  49  GLY GLY A . n 
A 1 50  VAL 50  50  50  VAL VAL A . n 
A 1 51  TRP 51  51  51  TRP TRP A . n 
A 1 52  GLU 52  52  52  GLU GLU A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  VAL 54  54  54  VAL VAL A . n 
A 1 55  GLY 55  55  ?   ?   ?   A . n 
A 1 56  ASP 56  56  ?   ?   ?   A . n 
A 1 57  GLU 57  57  ?   ?   ?   A . n 
A 1 58  ASP 58  58  ?   ?   ?   A . n 
A 1 59  TRP 59  59  ?   ?   ?   A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  TRP 63  63  63  TRP TRP A . n 
A 1 64  ARG 64  64  64  ARG ARG A . n 
A 1 65  ARG 65  65  65  ARG ARG A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  PRO 69  69  69  PRO PRO A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  ALA 72  72  72  ALA ALA A . n 
A 1 73  PRO 73  73  73  PRO PRO A . n 
A 1 74  PRO 74  74  74  PRO PRO A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  VAL 76  76  76  VAL VAL A . n 
A 1 77  VAL 77  77  77  VAL VAL A . n 
A 1 78  LEU 78  78  78  LEU LEU A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  PRO 80  80  80  PRO PRO A . n 
A 1 81  TRP 81  81  81  TRP TRP A . n 
A 1 82  HIS 82  82  82  HIS HIS A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  GLU 85  85  85  GLU GLU A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  ALA 87  87  87  ALA ALA A . n 
A 1 88  GLU 88  88  88  GLU GLU A . n 
A 1 89  ILE 89  89  89  ILE ILE A . n 
A 1 90  PRO 90  90  90  PRO PRO A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  VAL 92  92  92  VAL VAL A . n 
A 1 93  ILE 93  93  93  ILE ILE A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  GLY 96  96  96  GLY GLY A . n 
A 1 97  MET 97  97  97  MET MET A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  PHE 99  99  99  PHE PHE A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 THR 101 101 101 THR THR A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 HIS 103 103 103 HIS HIS A . n 
A 1 104 HIS 104 104 104 HIS HIS A . n 
A 1 105 GLU 105 105 105 GLU GLU A . n 
A 1 106 THR 106 106 106 THR THR A . n 
A 1 107 THR 107 107 107 THR THR A . n 
A 1 108 ARG 108 108 108 ARG ARG A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 ALA 110 110 110 ALA ALA A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 LYS 112 112 112 LYS LYS A . n 
A 1 113 ALA 113 113 113 ALA ALA A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 ALA 115 115 115 ALA ALA A . n 
A 1 116 ARG 116 116 116 ARG ARG A . n 
A 1 117 HIS 117 117 117 HIS HIS A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 ARG 119 119 119 ARG ARG A . n 
A 1 120 PRO 120 120 120 PRO PRO A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 ASP 122 122 122 ASP ASP A . n 
A 1 123 LYS 123 123 123 LYS LYS A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 ASP 126 126 126 ASP ASP A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 GLY 128 128 128 GLY GLY A . n 
A 1 129 THR 129 129 129 THR THR A . n 
A 1 130 GLY 130 130 130 GLY GLY A . n 
A 1 131 SER 131 131 131 SER SER A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 VAL 133 133 133 VAL VAL A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 ILE 136 136 136 ILE ILE A . n 
A 1 137 ALA 137 137 137 ALA ALA A . n 
A 1 138 ALA 138 138 138 ALA ALA A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 LYS 140 140 140 LYS LYS A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 GLY 142 142 142 GLY GLY A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 LYS 144 144 144 LYS LYS A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 GLY 147 147 147 GLY GLY A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 ASP 149 149 149 ASP ASP A . n 
A 1 150 ILE 150 150 150 ILE ILE A . n 
A 1 151 ASP 151 151 151 ASP ASP A . n 
A 1 152 PRO 152 152 152 PRO PRO A . n 
A 1 153 MET 153 153 153 MET MET A . n 
A 1 154 VAL 154 154 154 VAL VAL A . n 
A 1 155 LEU 155 155 155 LEU LEU A . n 
A 1 156 PRO 156 156 156 PRO PRO A . n 
A 1 157 GLN 157 157 157 GLN GLN A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 GLU 159 159 159 GLU GLU A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 ASN 161 161 161 ASN ASN A . n 
A 1 162 ALA 162 162 162 ALA ALA A . n 
A 1 163 LYS 163 163 163 LYS LYS A . n 
A 1 164 ARG 164 164 164 ARG ARG A . n 
A 1 165 ASN 165 165 165 ASN ASN A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 VAL 167 167 167 VAL VAL A . n 
A 1 168 ARG 168 168 168 ARG ARG A . n 
A 1 169 PRO 169 169 169 PRO PRO A . n 
A 1 170 ARG 170 170 170 ARG ARG A . n 
A 1 171 PHE 171 171 171 PHE PHE A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 GLU 173 173 173 GLU GLU A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 SER 175 175 175 SER SER A . n 
A 1 176 LEU 176 176 176 LEU LEU A . n 
A 1 177 GLU 177 177 177 GLU GLU A . n 
A 1 178 ALA 178 178 178 ALA ALA A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 PRO 181 181 181 PRO PRO A . n 
A 1 182 PHE 182 182 182 PHE PHE A . n 
A 1 183 GLY 183 183 183 GLY GLY A . n 
A 1 184 PRO 184 184 184 PRO PRO A . n 
A 1 185 PHE 185 185 185 PHE PHE A . n 
A 1 186 ASP 186 186 186 ASP ASP A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 LEU 188 188 188 LEU LEU A . n 
A 1 189 VAL 189 189 189 VAL VAL A . n 
A 1 190 ALA 190 190 190 ALA ALA A . n 
A 1 191 ASN 191 191 191 ASN ASN A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 TYR 193 193 193 TYR TYR A . n 
A 1 194 ALA 194 194 194 ALA ALA A . n 
A 1 195 GLU 195 195 195 GLU GLU A . n 
A 1 196 LEU 196 196 196 LEU LEU A . n 
A 1 197 HIS 197 197 197 HIS HIS A . n 
A 1 198 ALA 198 198 198 ALA ALA A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 PRO 202 202 202 PRO PRO A . n 
A 1 203 ARG 203 203 203 ARG ARG A . n 
A 1 204 TYR 204 204 204 TYR TYR A . n 
A 1 205 ARG 205 205 205 ARG ARG A . n 
A 1 206 GLU 206 206 206 GLU GLU A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 LEU 208 208 208 LEU LEU A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 PRO 210 210 210 PRO PRO A . n 
A 1 211 GLY 211 211 211 GLY GLY A . n 
A 1 212 GLY 212 212 212 GLY GLY A . n 
A 1 213 ARG 213 213 213 ARG ARG A . n 
A 1 214 ALA 214 214 214 ALA ALA A . n 
A 1 215 LEU 215 215 215 LEU LEU A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 THR 217 217 217 THR THR A . n 
A 1 218 GLY 218 218 218 GLY GLY A . n 
A 1 219 ILE 219 219 219 ILE ILE A . n 
A 1 220 LEU 220 220 220 LEU LEU A . n 
A 1 221 LYS 221 221 221 LYS LYS A . n 
A 1 222 ASP 222 222 222 ASP ASP A . n 
A 1 223 ARG 223 223 223 ARG ARG A . n 
A 1 224 ALA 224 224 224 ALA ALA A . n 
A 1 225 PRO 225 225 225 PRO PRO A . n 
A 1 226 LEU 226 226 226 LEU LEU A . n 
A 1 227 VAL 227 227 227 VAL VAL A . n 
A 1 228 ARG 228 228 228 ARG ARG A . n 
A 1 229 GLU 229 229 229 GLU GLU A . n 
A 1 230 ALA 230 230 230 ALA ALA A . n 
A 1 231 MET 231 231 231 MET MET A . n 
A 1 232 ALA 232 232 232 ALA ALA A . n 
A 1 233 GLY 233 233 233 GLY GLY A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 GLY 235 235 235 GLY GLY A . n 
A 1 236 PHE 236 236 236 PHE PHE A . n 
A 1 237 ARG 237 237 237 ARG ARG A . n 
A 1 238 PRO 238 238 238 PRO PRO A . n 
A 1 239 LEU 239 239 239 LEU LEU A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLU 241 241 241 GLU GLU A . n 
A 1 242 ALA 242 242 242 ALA ALA A . n 
A 1 243 ALA 243 243 243 ALA ALA A . n 
A 1 244 GLU 244 244 244 GLU GLU A . n 
A 1 245 GLY 245 245 245 GLY GLY A . n 
A 1 246 GLU 246 246 246 GLU GLU A . n 
A 1 247 TRP 247 247 247 TRP TRP A . n 
A 1 248 VAL 248 248 248 VAL VAL A . n 
A 1 249 LEU 249 249 249 LEU LEU A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 ALA 251 251 251 ALA ALA A . n 
A 1 252 TYR 252 252 252 TYR TYR A . n 
A 1 253 GLY 253 253 253 GLY GLY A . n 
A 1 254 ARG 254 254 254 ARG ARG A . n 
B 2 1   MET 1   1   1   MET MET B . n 
B 2 2   LYS 2   2   2   LYS LYS B . n 
B 2 3   LYS 3   3   3   LYS LYS B . n 
B 2 4   VAL 4   4   4   VAL VAL B . n 
B 2 5   VAL 5   5   5   VAL VAL B . n 
B 2 6   ALA 6   6   6   ALA ALA B . n 
B 2 7   VAL 7   7   7   VAL VAL B . n 
B 2 8   VAL 8   8   8   VAL VAL B . n 
B 2 9   LYS 9   9   9   LYS LYS B . n 
B 2 10  LEU 10  10  10  LEU LEU B . n 
B 2 11  GLN 11  11  11  GLN GLN B . n 
B 2 12  LEU 12  12  12  LEU LEU B . n 
B 2 13  PRO 13  13  13  PRO PRO B . n 
B 2 14  ALA 14  14  14  ALA ALA B . n 
B 2 15  GLY 15  15  15  GLY GLY B . n 
B 2 16  LYS 16  16  16  LYS LYS B . n 
B 2 17  ALA 17  17  17  ALA ALA B . n 
B 2 18  THR 18  18  18  THR THR B . n 
B 2 19  PRO 19  19  19  PRO PRO B . n 
B 2 20  ALA 20  20  20  ALA ALA B . n 
B 2 21  PRO 21  21  21  PRO PRO B . n 
B 2 22  PRO 22  22  22  PRO PRO B . n 
B 2 23  VAL 23  23  23  VAL VAL B . n 
B 2 24  GLY 24  24  24  GLY GLY B . n 
B 2 25  PRO 25  25  25  PRO PRO B . n 
B 2 26  ALA 26  26  26  ALA ALA B . n 
B 2 27  LEU 27  27  27  LEU LEU B . n 
B 2 28  GLY 28  28  28  GLY GLY B . n 
B 2 29  GLN 29  29  29  GLN GLN B . n 
B 2 30  HIS 30  30  30  HIS HIS B . n 
B 2 31  GLY 31  31  31  GLY GLY B . n 
B 2 32  ALA 32  32  32  ALA ALA B . n 
B 2 33  ASN 33  33  33  ASN ASN B . n 
B 2 34  ILE 34  34  34  ILE ILE B . n 
B 2 35  MET 35  35  35  MET MET B . n 
B 2 36  GLU 36  36  36  GLU GLU B . n 
B 2 37  PHE 37  37  37  PHE PHE B . n 
B 2 38  VAL 38  38  38  VAL VAL B . n 
B 2 39  ALA 39  39  39  ALA ALA B . n 
B 2 40  ALA 40  40  40  ALA ALA B . n 
B 2 41  PHE 41  41  41  PHE PHE B . n 
B 2 42  ASN 42  42  42  ASN ASN B . n 
B 2 43  ALA 43  43  43  ALA ALA B . n 
B 2 44  ALA 44  44  44  ALA ALA B . n 
B 2 45  THR 45  45  45  THR THR B . n 
B 2 46  ALA 46  46  46  ALA ALA B . n 
B 2 47  ASN 47  47  47  ASN ASN B . n 
B 2 48  MET 48  48  48  MET MET B . n 
B 2 49  GLY 49  49  49  GLY GLY B . n 
B 2 50  ASP 50  50  50  ASP ASP B . n 
B 2 51  ALA 51  51  51  ALA ALA B . n 
B 2 52  ILE 52  52  52  ILE ILE B . n 
B 2 53  VAL 53  53  53  VAL VAL B . n 
B 2 54  PRO 54  54  54  PRO PRO B . n 
B 2 55  VAL 55  55  55  VAL VAL B . n 
B 2 56  GLU 56  56  56  GLU GLU B . n 
B 2 57  ILE 57  57  57  ILE ILE B . n 
B 2 58  THR 58  58  58  THR THR B . n 
B 2 59  ILE 59  59  59  ILE ILE B . n 
B 2 60  TYR 60  60  60  TYR TYR B . n 
B 2 61  ALA 61  61  61  ALA ALA B . n 
B 2 62  ASP 62  62  62  ASP ASP B . n 
B 2 63  ARG 63  63  63  ARG ARG B . n 
B 2 64  SER 64  64  64  SER SER B . n 
B 2 65  PHE 65  65  65  PHE PHE B . n 
B 2 66  THR 66  66  66  THR THR B . n 
B 2 67  PHE 67  67  67  PHE PHE B . n 
B 2 68  VAL 68  68  68  VAL VAL B . n 
B 2 69  THR 69  69  69  THR THR B . n 
B 2 70  LYS 70  70  70  LYS LYS B . n 
B 2 71  THR 71  71  71  THR THR B . n 
B 2 72  PRO 72  72  72  PRO PRO B . n 
B 2 73  PRO 73  73  73  PRO PRO B . n 
B 2 74  ALA 74  74  74  ALA ALA B . n 
B 2 75  SER 75  75  75  SER SER B . n 
B 2 76  TYR 76  76  76  TYR TYR B . n 
B 2 77  LEU 77  77  77  LEU LEU B . n 
B 2 78  ILE 78  78  78  ILE ILE B . n 
B 2 79  ARG 79  79  79  ARG ARG B . n 
B 2 80  LYS 80  80  ?   ?   ?   B . n 
B 2 81  ALA 81  81  ?   ?   ?   B . n 
B 2 82  ALA 82  82  ?   ?   ?   B . n 
B 2 83  GLY 83  83  ?   ?   ?   B . n 
B 2 84  LEU 84  84  ?   ?   ?   B . n 
B 2 85  GLU 85  85  ?   ?   ?   B . n 
B 2 86  LYS 86  86  ?   ?   ?   B . n 
B 2 87  GLY 87  87  ?   ?   ?   B . n 
B 2 88  ALA 88  88  ?   ?   ?   B . n 
B 2 89  HIS 89  89  ?   ?   ?   B . n 
B 2 90  LYS 90  90  ?   ?   ?   B . n 
B 2 91  PRO 91  91  ?   ?   ?   B . n 
B 2 92  GLY 92  92  ?   ?   ?   B . n 
B 2 93  ARG 93  93  ?   ?   ?   B . n 
B 2 94  GLU 94  94  ?   ?   ?   B . n 
B 2 95  LYS 95  95  ?   ?   ?   B . n 
B 2 96  VAL 96  96  ?   ?   ?   B . n 
B 2 97  GLY 97  97  ?   ?   ?   B . n 
B 2 98  ARG 98  98  ?   ?   ?   B . n 
B 2 99  ILE 99  99  99  ILE ILE B . n 
B 2 100 THR 100 100 100 THR THR B . n 
B 2 101 TRP 101 101 101 TRP TRP B . n 
B 2 102 GLU 102 102 102 GLU GLU B . n 
B 2 103 GLN 103 103 103 GLN GLN B . n 
B 2 104 VAL 104 104 104 VAL VAL B . n 
B 2 105 LEU 105 105 105 LEU LEU B . n 
B 2 106 GLU 106 106 106 GLU GLU B . n 
B 2 107 ILE 107 107 107 ILE ILE B . n 
B 2 108 ALA 108 108 108 ALA ALA B . n 
B 2 109 LYS 109 109 109 LYS LYS B . n 
B 2 110 GLN 110 110 110 GLN GLN B . n 
B 2 111 LYS 111 111 111 LYS LYS B . n 
B 2 112 MET 112 112 112 MET MET B . n 
B 2 113 PRO 113 113 113 PRO PRO B . n 
B 2 114 ASP 114 114 114 ASP ASP B . n 
B 2 115 LEU 115 115 115 LEU LEU B . n 
B 2 116 ASN 116 116 116 ASN ASN B . n 
B 2 117 THR 117 117 117 THR THR B . n 
B 2 118 THR 118 118 118 THR THR B . n 
B 2 119 ASP 119 119 119 ASP ASP B . n 
B 2 120 LEU 120 120 120 LEU LEU B . n 
B 2 121 GLU 121 121 121 GLU GLU B . n 
B 2 122 ALA 122 122 122 ALA ALA B . n 
B 2 123 ALA 123 123 123 ALA ALA B . n 
B 2 124 ALA 124 124 124 ALA ALA B . n 
B 2 125 ARG 125 125 125 ARG ARG B . n 
B 2 126 MET 126 126 126 MET MET B . n 
B 2 127 ILE 127 127 127 ILE ILE B . n 
B 2 128 ALA 128 128 128 ALA ALA B . n 
B 2 129 GLY 129 129 129 GLY GLY B . n 
B 2 130 SER 130 130 130 SER SER B . n 
B 2 131 ALA 131 131 131 ALA ALA B . n 
B 2 132 ARG 132 132 132 ARG ARG B . n 
B 2 133 SER 133 133 133 SER SER B . n 
B 2 134 MET 134 134 134 MET MET B . n 
B 2 135 GLY 135 135 135 GLY GLY B . n 
B 2 136 VAL 136 136 136 VAL VAL B . n 
B 2 137 GLU 137 137 137 GLU GLU B . n 
B 2 138 VAL 138 138 ?   ?   ?   B . n 
B 2 139 VAL 139 139 ?   ?   ?   B . n 
B 2 140 GLY 140 140 ?   ?   ?   B . n 
B 2 141 ALA 141 141 ?   ?   ?   B . n 
B 2 142 PRO 142 142 ?   ?   ?   B . n 
B 2 143 GLU 143 143 ?   ?   ?   B . n 
B 2 144 VAL 144 144 ?   ?   ?   B . n 
B 2 145 LYS 145 145 ?   ?   ?   B . n 
B 2 146 ASP 146 146 ?   ?   ?   B . n 
B 2 147 ALA 147 147 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 SFG 1   255 101 SFG SFG A . 
D 4 HOH 1   256 1   HOH HOH A . 
D 4 HOH 2   257 2   HOH HOH A . 
D 4 HOH 3   258 3   HOH HOH A . 
D 4 HOH 4   259 4   HOH HOH A . 
D 4 HOH 5   260 5   HOH HOH A . 
D 4 HOH 6   261 6   HOH HOH A . 
D 4 HOH 7   262 7   HOH HOH A . 
D 4 HOH 8   263 8   HOH HOH A . 
D 4 HOH 9   264 9   HOH HOH A . 
D 4 HOH 10  265 10  HOH HOH A . 
D 4 HOH 11  266 11  HOH HOH A . 
D 4 HOH 12  267 12  HOH HOH A . 
D 4 HOH 13  268 14  HOH HOH A . 
D 4 HOH 14  269 15  HOH HOH A . 
D 4 HOH 15  270 16  HOH HOH A . 
D 4 HOH 16  271 17  HOH HOH A . 
D 4 HOH 17  272 18  HOH HOH A . 
D 4 HOH 18  273 19  HOH HOH A . 
D 4 HOH 19  274 20  HOH HOH A . 
D 4 HOH 20  275 21  HOH HOH A . 
D 4 HOH 21  276 22  HOH HOH A . 
D 4 HOH 22  277 23  HOH HOH A . 
D 4 HOH 23  278 24  HOH HOH A . 
D 4 HOH 24  279 25  HOH HOH A . 
D 4 HOH 25  280 26  HOH HOH A . 
D 4 HOH 26  281 27  HOH HOH A . 
D 4 HOH 27  282 28  HOH HOH A . 
D 4 HOH 28  283 30  HOH HOH A . 
D 4 HOH 29  284 31  HOH HOH A . 
D 4 HOH 30  285 32  HOH HOH A . 
D 4 HOH 31  286 34  HOH HOH A . 
D 4 HOH 32  287 35  HOH HOH A . 
D 4 HOH 33  288 36  HOH HOH A . 
D 4 HOH 34  289 37  HOH HOH A . 
D 4 HOH 35  290 38  HOH HOH A . 
D 4 HOH 36  291 39  HOH HOH A . 
D 4 HOH 37  292 40  HOH HOH A . 
D 4 HOH 38  293 41  HOH HOH A . 
D 4 HOH 39  294 42  HOH HOH A . 
D 4 HOH 40  295 43  HOH HOH A . 
D 4 HOH 41  296 44  HOH HOH A . 
D 4 HOH 42  297 45  HOH HOH A . 
D 4 HOH 43  298 46  HOH HOH A . 
D 4 HOH 44  299 47  HOH HOH A . 
D 4 HOH 45  300 48  HOH HOH A . 
D 4 HOH 46  301 49  HOH HOH A . 
D 4 HOH 47  302 50  HOH HOH A . 
D 4 HOH 48  303 51  HOH HOH A . 
D 4 HOH 49  304 52  HOH HOH A . 
D 4 HOH 50  305 53  HOH HOH A . 
D 4 HOH 51  306 54  HOH HOH A . 
D 4 HOH 52  307 55  HOH HOH A . 
D 4 HOH 53  308 56  HOH HOH A . 
D 4 HOH 54  309 57  HOH HOH A . 
D 4 HOH 55  310 58  HOH HOH A . 
D 4 HOH 56  311 59  HOH HOH A . 
D 4 HOH 57  312 60  HOH HOH A . 
D 4 HOH 58  313 61  HOH HOH A . 
D 4 HOH 59  314 62  HOH HOH A . 
D 4 HOH 60  315 63  HOH HOH A . 
D 4 HOH 61  316 64  HOH HOH A . 
D 4 HOH 62  317 65  HOH HOH A . 
D 4 HOH 63  318 66  HOH HOH A . 
D 4 HOH 64  319 67  HOH HOH A . 
D 4 HOH 65  320 68  HOH HOH A . 
D 4 HOH 66  321 69  HOH HOH A . 
D 4 HOH 67  322 70  HOH HOH A . 
D 4 HOH 68  323 71  HOH HOH A . 
D 4 HOH 69  324 72  HOH HOH A . 
D 4 HOH 70  325 73  HOH HOH A . 
D 4 HOH 71  326 74  HOH HOH A . 
D 4 HOH 72  327 75  HOH HOH A . 
D 4 HOH 73  328 76  HOH HOH A . 
D 4 HOH 74  329 77  HOH HOH A . 
D 4 HOH 75  330 78  HOH HOH A . 
D 4 HOH 76  331 79  HOH HOH A . 
D 4 HOH 77  332 80  HOH HOH A . 
D 4 HOH 78  333 81  HOH HOH A . 
D 4 HOH 79  334 82  HOH HOH A . 
D 4 HOH 80  335 83  HOH HOH A . 
D 4 HOH 81  336 84  HOH HOH A . 
D 4 HOH 82  337 85  HOH HOH A . 
D 4 HOH 83  338 86  HOH HOH A . 
D 4 HOH 84  339 87  HOH HOH A . 
D 4 HOH 85  340 88  HOH HOH A . 
D 4 HOH 86  341 90  HOH HOH A . 
D 4 HOH 87  342 91  HOH HOH A . 
D 4 HOH 88  343 92  HOH HOH A . 
D 4 HOH 89  344 93  HOH HOH A . 
D 4 HOH 90  345 94  HOH HOH A . 
D 4 HOH 91  346 95  HOH HOH A . 
D 4 HOH 92  347 96  HOH HOH A . 
D 4 HOH 93  348 97  HOH HOH A . 
D 4 HOH 94  349 99  HOH HOH A . 
D 4 HOH 95  350 100 HOH HOH A . 
D 4 HOH 96  351 101 HOH HOH A . 
D 4 HOH 97  352 102 HOH HOH A . 
D 4 HOH 98  353 103 HOH HOH A . 
D 4 HOH 99  354 104 HOH HOH A . 
D 4 HOH 100 355 105 HOH HOH A . 
D 4 HOH 101 356 106 HOH HOH A . 
D 4 HOH 102 357 107 HOH HOH A . 
D 4 HOH 103 358 108 HOH HOH A . 
D 4 HOH 104 359 109 HOH HOH A . 
D 4 HOH 105 360 110 HOH HOH A . 
D 4 HOH 106 361 111 HOH HOH A . 
D 4 HOH 107 362 112 HOH HOH A . 
D 4 HOH 108 363 113 HOH HOH A . 
D 4 HOH 109 364 114 HOH HOH A . 
D 4 HOH 110 365 115 HOH HOH A . 
D 4 HOH 111 366 116 HOH HOH A . 
D 4 HOH 112 367 117 HOH HOH A . 
D 4 HOH 113 368 118 HOH HOH A . 
D 4 HOH 114 369 119 HOH HOH A . 
D 4 HOH 115 370 120 HOH HOH A . 
D 4 HOH 116 371 121 HOH HOH A . 
D 4 HOH 117 372 122 HOH HOH A . 
D 4 HOH 118 373 123 HOH HOH A . 
D 4 HOH 119 374 124 HOH HOH A . 
D 4 HOH 120 375 125 HOH HOH A . 
D 4 HOH 121 376 126 HOH HOH A . 
D 4 HOH 122 377 127 HOH HOH A . 
D 4 HOH 123 378 128 HOH HOH A . 
D 4 HOH 124 379 129 HOH HOH A . 
D 4 HOH 125 380 130 HOH HOH A . 
D 4 HOH 126 381 131 HOH HOH A . 
D 4 HOH 127 382 132 HOH HOH A . 
D 4 HOH 128 383 133 HOH HOH A . 
D 4 HOH 129 384 134 HOH HOH A . 
D 4 HOH 130 385 135 HOH HOH A . 
D 4 HOH 131 386 136 HOH HOH A . 
D 4 HOH 132 387 137 HOH HOH A . 
D 4 HOH 133 388 138 HOH HOH A . 
D 4 HOH 134 389 139 HOH HOH A . 
D 4 HOH 135 390 140 HOH HOH A . 
D 4 HOH 136 391 141 HOH HOH A . 
D 4 HOH 137 392 142 HOH HOH A . 
D 4 HOH 138 393 143 HOH HOH A . 
D 4 HOH 139 394 144 HOH HOH A . 
D 4 HOH 140 395 145 HOH HOH A . 
D 4 HOH 141 396 147 HOH HOH A . 
D 4 HOH 142 397 148 HOH HOH A . 
D 4 HOH 143 398 149 HOH HOH A . 
D 4 HOH 144 399 159 HOH HOH A . 
D 4 HOH 145 400 169 HOH HOH A . 
D 4 HOH 146 401 170 HOH HOH A . 
D 4 HOH 147 402 171 HOH HOH A . 
D 4 HOH 148 403 172 HOH HOH A . 
D 4 HOH 149 404 173 HOH HOH A . 
D 4 HOH 150 405 174 HOH HOH A . 
D 4 HOH 151 406 175 HOH HOH A . 
D 4 HOH 152 407 176 HOH HOH A . 
D 4 HOH 153 408 178 HOH HOH A . 
D 4 HOH 154 409 179 HOH HOH A . 
D 4 HOH 155 410 180 HOH HOH A . 
D 4 HOH 156 411 181 HOH HOH A . 
D 4 HOH 157 412 184 HOH HOH A . 
D 4 HOH 158 413 185 HOH HOH A . 
D 4 HOH 159 414 189 HOH HOH A . 
D 4 HOH 160 415 190 HOH HOH A . 
D 4 HOH 161 416 191 HOH HOH A . 
D 4 HOH 162 417 192 HOH HOH A . 
D 4 HOH 163 418 193 HOH HOH A . 
D 4 HOH 164 419 194 HOH HOH A . 
D 4 HOH 165 420 195 HOH HOH A . 
D 4 HOH 166 421 196 HOH HOH A . 
D 4 HOH 167 422 197 HOH HOH A . 
D 4 HOH 168 423 198 HOH HOH A . 
D 4 HOH 169 424 199 HOH HOH A . 
D 4 HOH 170 425 200 HOH HOH A . 
D 4 HOH 171 426 201 HOH HOH A . 
D 4 HOH 172 427 202 HOH HOH A . 
D 4 HOH 173 428 203 HOH HOH A . 
D 4 HOH 174 429 204 HOH HOH A . 
D 4 HOH 175 430 205 HOH HOH A . 
D 4 HOH 176 431 206 HOH HOH A . 
D 4 HOH 177 432 207 HOH HOH A . 
D 4 HOH 178 433 208 HOH HOH A . 
D 4 HOH 179 434 209 HOH HOH A . 
D 4 HOH 180 435 210 HOH HOH A . 
D 4 HOH 181 436 211 HOH HOH A . 
D 4 HOH 182 437 212 HOH HOH A . 
D 4 HOH 183 438 213 HOH HOH A . 
D 4 HOH 184 439 214 HOH HOH A . 
D 4 HOH 185 440 215 HOH HOH A . 
D 4 HOH 186 441 216 HOH HOH A . 
D 4 HOH 187 442 217 HOH HOH A . 
D 4 HOH 188 443 218 HOH HOH A . 
D 4 HOH 189 444 219 HOH HOH A . 
D 4 HOH 190 445 220 HOH HOH A . 
D 4 HOH 191 446 221 HOH HOH A . 
D 4 HOH 192 447 222 HOH HOH A . 
D 4 HOH 193 448 223 HOH HOH A . 
D 4 HOH 194 449 224 HOH HOH A . 
D 4 HOH 195 450 225 HOH HOH A . 
D 4 HOH 196 451 226 HOH HOH A . 
D 4 HOH 197 452 227 HOH HOH A . 
D 4 HOH 198 453 228 HOH HOH A . 
D 4 HOH 199 454 229 HOH HOH A . 
D 4 HOH 200 455 230 HOH HOH A . 
D 4 HOH 201 456 231 HOH HOH A . 
D 4 HOH 202 457 232 HOH HOH A . 
D 4 HOH 203 458 233 HOH HOH A . 
D 4 HOH 204 459 234 HOH HOH A . 
D 4 HOH 205 460 235 HOH HOH A . 
D 4 HOH 206 461 236 HOH HOH A . 
D 4 HOH 207 462 237 HOH HOH A . 
D 4 HOH 208 463 238 HOH HOH A . 
D 4 HOH 209 464 239 HOH HOH A . 
D 4 HOH 210 465 240 HOH HOH A . 
D 4 HOH 211 466 241 HOH HOH A . 
D 4 HOH 212 467 242 HOH HOH A . 
D 4 HOH 213 468 243 HOH HOH A . 
D 4 HOH 214 469 244 HOH HOH A . 
D 4 HOH 215 470 245 HOH HOH A . 
D 4 HOH 216 471 246 HOH HOH A . 
D 4 HOH 217 472 247 HOH HOH A . 
D 4 HOH 218 473 249 HOH HOH A . 
D 4 HOH 219 474 251 HOH HOH A . 
D 4 HOH 220 475 254 HOH HOH A . 
D 4 HOH 221 476 255 HOH HOH A . 
D 4 HOH 222 477 256 HOH HOH A . 
D 4 HOH 223 478 257 HOH HOH A . 
D 4 HOH 224 479 258 HOH HOH A . 
D 4 HOH 225 480 260 HOH HOH A . 
D 4 HOH 226 481 261 HOH HOH A . 
D 4 HOH 227 482 262 HOH HOH A . 
D 4 HOH 228 483 263 HOH HOH A . 
D 4 HOH 229 484 264 HOH HOH A . 
D 4 HOH 230 485 265 HOH HOH A . 
D 4 HOH 231 486 266 HOH HOH A . 
D 4 HOH 232 487 275 HOH HOH A . 
D 4 HOH 233 488 276 HOH HOH A . 
D 4 HOH 234 489 277 HOH HOH A . 
D 4 HOH 235 490 278 HOH HOH A . 
D 4 HOH 236 491 279 HOH HOH A . 
D 4 HOH 237 492 280 HOH HOH A . 
D 4 HOH 238 493 281 HOH HOH A . 
D 4 HOH 239 494 282 HOH HOH A . 
D 4 HOH 240 495 283 HOH HOH A . 
D 4 HOH 241 496 284 HOH HOH A . 
D 4 HOH 242 497 285 HOH HOH A . 
D 4 HOH 243 498 287 HOH HOH A . 
D 4 HOH 244 499 292 HOH HOH A . 
D 4 HOH 245 500 293 HOH HOH A . 
D 4 HOH 246 501 294 HOH HOH A . 
D 4 HOH 247 502 295 HOH HOH A . 
D 4 HOH 248 503 296 HOH HOH A . 
D 4 HOH 249 504 297 HOH HOH A . 
D 4 HOH 250 505 298 HOH HOH A . 
D 4 HOH 251 506 299 HOH HOH A . 
D 4 HOH 252 507 300 HOH HOH A . 
D 4 HOH 253 508 301 HOH HOH A . 
D 4 HOH 254 509 302 HOH HOH A . 
D 4 HOH 255 510 303 HOH HOH A . 
D 4 HOH 256 511 304 HOH HOH A . 
D 4 HOH 257 512 305 HOH HOH A . 
D 4 HOH 258 513 306 HOH HOH A . 
D 4 HOH 259 514 307 HOH HOH A . 
D 4 HOH 260 515 308 HOH HOH A . 
D 4 HOH 261 516 309 HOH HOH A . 
D 4 HOH 262 517 310 HOH HOH A . 
D 4 HOH 263 518 313 HOH HOH A . 
D 4 HOH 264 519 314 HOH HOH A . 
D 4 HOH 265 520 315 HOH HOH A . 
D 4 HOH 266 521 316 HOH HOH A . 
D 4 HOH 267 522 317 HOH HOH A . 
D 4 HOH 268 523 318 HOH HOH A . 
D 4 HOH 269 524 319 HOH HOH A . 
D 4 HOH 270 525 321 HOH HOH A . 
D 4 HOH 271 526 324 HOH HOH A . 
E 4 HOH 1   148 13  HOH HOH B . 
E 4 HOH 2   149 29  HOH HOH B . 
E 4 HOH 3   150 33  HOH HOH B . 
E 4 HOH 4   151 89  HOH HOH B . 
E 4 HOH 5   152 98  HOH HOH B . 
E 4 HOH 6   153 146 HOH HOH B . 
E 4 HOH 7   154 150 HOH HOH B . 
E 4 HOH 8   155 151 HOH HOH B . 
E 4 HOH 9   156 152 HOH HOH B . 
E 4 HOH 10  157 153 HOH HOH B . 
E 4 HOH 11  158 154 HOH HOH B . 
E 4 HOH 12  159 155 HOH HOH B . 
E 4 HOH 13  160 156 HOH HOH B . 
E 4 HOH 14  161 157 HOH HOH B . 
E 4 HOH 15  162 158 HOH HOH B . 
E 4 HOH 16  163 160 HOH HOH B . 
E 4 HOH 17  164 161 HOH HOH B . 
E 4 HOH 18  165 162 HOH HOH B . 
E 4 HOH 19  166 163 HOH HOH B . 
E 4 HOH 20  167 164 HOH HOH B . 
E 4 HOH 21  168 165 HOH HOH B . 
E 4 HOH 22  169 166 HOH HOH B . 
E 4 HOH 23  170 167 HOH HOH B . 
E 4 HOH 24  171 168 HOH HOH B . 
E 4 HOH 25  172 177 HOH HOH B . 
E 4 HOH 26  173 182 HOH HOH B . 
E 4 HOH 27  174 183 HOH HOH B . 
E 4 HOH 28  175 186 HOH HOH B . 
E 4 HOH 29  176 187 HOH HOH B . 
E 4 HOH 30  177 188 HOH HOH B . 
E 4 HOH 31  178 248 HOH HOH B . 
E 4 HOH 32  179 250 HOH HOH B . 
E 4 HOH 33  180 252 HOH HOH B . 
E 4 HOH 34  181 253 HOH HOH B . 
E 4 HOH 35  182 259 HOH HOH B . 
E 4 HOH 36  183 267 HOH HOH B . 
E 4 HOH 37  184 268 HOH HOH B . 
E 4 HOH 38  185 269 HOH HOH B . 
E 4 HOH 39  186 270 HOH HOH B . 
E 4 HOH 40  187 271 HOH HOH B . 
E 4 HOH 41  188 272 HOH HOH B . 
E 4 HOH 42  189 273 HOH HOH B . 
E 4 HOH 43  190 274 HOH HOH B . 
E 4 HOH 44  191 288 HOH HOH B . 
E 4 HOH 45  192 289 HOH HOH B . 
E 4 HOH 46  193 290 HOH HOH B . 
E 4 HOH 47  194 291 HOH HOH B . 
E 4 HOH 48  195 311 HOH HOH B . 
E 4 HOH 49  196 312 HOH HOH B . 
E 4 HOH 50  197 320 HOH HOH B . 
E 4 HOH 51  198 322 HOH HOH B . 
E 4 HOH 52  199 323 HOH HOH B . 
E 4 HOH 53  200 325 HOH HOH B . 
E 4 HOH 54  201 326 HOH HOH B . 
E 4 HOH 55  202 327 HOH HOH B . 
E 4 HOH 56  203 328 HOH HOH B . 
E 4 HOH 57  204 329 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2320  ? 
1 MORE         -15.0 ? 
1 'SSA (A^2)'  17930 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-05-20 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 15.1242 -33.7993 14.2761 0.0472  -0.0180 0.0494  0.0752  0.5063 -0.2210 10.4200 14.6259 8.8551  -2.6382 0.7543  
-3.7491 -0.2243 -1.3499 0.5526  2.2938  0.4230  1.4962 -1.0932 -0.6329 -0.1987 'X-RAY DIFFRACTION' 
2 ? refined 50.2902 -38.0915 0.3797  -0.0705 -0.0101 -0.0587 -0.0080 0.0016 -0.0233 0.9713  1.7142  1.2331  0.0231  0.1727  
-0.1303 -0.0272 0.0080  -0.0183 0.0514  0.0041  0.1470 -0.0334 -0.1552 0.0232  'X-RAY DIFFRACTION' 
3 ? refined 24.9217 -40.8935 0.6663  -0.2526 -0.0595 -0.0588 -0.0288 0.0443 -0.1025 5.6825  7.4822  4.2644  0.8741  -1.0043 
-0.0893 0.1500  -0.5274 0.2428  0.2484  -0.0930 0.4467 -0.1330 -0.1551 -0.0571 'X-RAY DIFFRACTION' 
4 ? refined 13.0327 -18.2487 -4.1355 0.0112  -0.0031 0.0150  0.0405  0.0779 0.0191  13.4799 19.7455 14.2503 0.3590  3.9108  3.9122 
0.0654  0.9157  0.4250  -0.9318 -0.0119 0.2242 0.2066  -0.2233 -0.0534 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 1  A 1  A 54  A 54  ? 'X-RAY DIFFRACTION' ? 
2 2 A 67 A 67 A 254 A 254 ? 'X-RAY DIFFRACTION' ? 
3 3 B 1  B 1  B 70  B 70  ? 'X-RAY DIFFRACTION' ? 
4 4 B 73 B 73 B 137 B 137 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement        5.2.0019 ? 1 
ADSC      'data collection' Quantum  ? 2 
DENZO     'data reduction'  .        ? 3 
SCALEPACK 'data scaling'    .        ? 4 
PHASER    phasing           .        ? 5 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CZ 
_pdbx_validate_rmsd_bond.auth_asym_id_1            B 
_pdbx_validate_rmsd_bond.auth_comp_id_1            ARG 
_pdbx_validate_rmsd_bond.auth_seq_id_1             63 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            NH2 
_pdbx_validate_rmsd_bond.auth_asym_id_2            B 
_pdbx_validate_rmsd_bond.auth_comp_id_2            ARG 
_pdbx_validate_rmsd_bond.auth_seq_id_2             63 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.190 
_pdbx_validate_rmsd_bond.bond_target_value         1.326 
_pdbx_validate_rmsd_bond.bond_deviation            -0.136 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.013 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NH1 B ARG 63 ? ? CZ B ARG 63 ? ? NH2 B ARG 63 ? ? 107.76 119.40 -11.64 1.10 N 
2 1 NE  B ARG 63 ? ? CZ B ARG 63 ? ? NH2 B ARG 63 ? ? 131.88 120.30 11.58  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 31  ? ? -121.82 -152.89 
2  1 GLU A 48  ? ? 64.76   99.35   
3  1 SER A 175 ? ? -135.38 -147.85 
4  1 LEU A 192 ? ? -123.76 -118.06 
5  1 LYS B 2   ? ? 74.43   80.59   
6  1 ARG B 63  ? ? 79.41   -5.96   
7  1 PRO B 72  ? ? -99.71  -141.71 
8  1 TRP B 101 ? ? -100.15 -152.52 
9  1 PRO B 113 ? ? -90.71  38.26   
10 1 ASP B 114 ? ? -140.08 -42.79  
11 1 ALA B 123 ? ? -148.94 -39.93  
12 1 MET B 126 ? ? -131.41 -30.22  
13 1 MET B 134 ? ? -156.64 -36.44  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 0 A GLU 11 ? CD  ? A GLU 11 CD  
2 1 Y 0 A GLU 32 ? CG  ? A GLU 32 CG  
3 1 Y 0 A GLU 32 ? CD  ? A GLU 32 CD  
4 1 Y 0 A GLU 32 ? OE1 ? A GLU 32 OE1 
5 1 Y 0 A GLU 32 ? OE2 ? A GLU 32 OE2 
6 1 Y 0 B MET 35 ? CE  ? B MET 35 CE  
7 1 Y 0 B ARG 63 ? NH2 ? B ARG 63 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 55  ? A GLY 55  
2  1 Y 1 A ASP 56  ? A ASP 56  
3  1 Y 1 A GLU 57  ? A GLU 57  
4  1 Y 1 A ASP 58  ? A ASP 58  
5  1 Y 1 A TRP 59  ? A TRP 59  
6  1 Y 1 B LYS 80  ? B LYS 80  
7  1 Y 1 B ALA 81  ? B ALA 81  
8  1 Y 1 B ALA 82  ? B ALA 82  
9  1 Y 1 B GLY 83  ? B GLY 83  
10 1 Y 1 B LEU 84  ? B LEU 84  
11 1 Y 1 B GLU 85  ? B GLU 85  
12 1 Y 1 B LYS 86  ? B LYS 86  
13 1 Y 1 B GLY 87  ? B GLY 87  
14 1 Y 1 B ALA 88  ? B ALA 88  
15 1 Y 1 B HIS 89  ? B HIS 89  
16 1 Y 1 B LYS 90  ? B LYS 90  
17 1 Y 1 B PRO 91  ? B PRO 91  
18 1 Y 1 B GLY 92  ? B GLY 92  
19 1 Y 1 B ARG 93  ? B ARG 93  
20 1 Y 1 B GLU 94  ? B GLU 94  
21 1 Y 1 B LYS 95  ? B LYS 95  
22 1 Y 1 B VAL 96  ? B VAL 96  
23 1 Y 1 B GLY 97  ? B GLY 97  
24 1 Y 1 B ARG 98  ? B ARG 98  
25 1 Y 1 B VAL 138 ? B VAL 138 
26 1 Y 1 B VAL 139 ? B VAL 139 
27 1 Y 1 B GLY 140 ? B GLY 140 
28 1 Y 1 B ALA 141 ? B ALA 141 
29 1 Y 1 B PRO 142 ? B PRO 142 
30 1 Y 1 B GLU 143 ? B GLU 143 
31 1 Y 1 B VAL 144 ? B VAL 144 
32 1 Y 1 B LYS 145 ? B LYS 145 
33 1 Y 1 B ASP 146 ? B ASP 146 
34 1 Y 1 B ALA 147 ? B ALA 147 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 SINEFUNGIN SFG 
4 water      HOH 
#