data_3CJS
# 
_entry.id   3CJS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3CJS         
RCSB  RCSB046861   
WWPDB D_1000046861 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2NXC 'Apo-form of T. thermophilus ribosomal protein L11 methyltransferase (PrmA)' unspecified 
PDB 2NXE 'T. thermophilus ribosomal protein L11 methyltransferase (PrmA) in complex with S-Adenosyl-L-Methionine' unspecified 
PDB 2NXJ 'T.thermophilus ribosomal protein L11 methyltransferase (PrmA) in space group P 21 21 2' unspecified 
PDB 2NXN 'T. thermophilus ribosomal protein L11 methyltransferase (PrmA) in complex with ribosomal protein L11' unspecified 
PDB 1UFK 'Apo-form of T. thermophilus ribosomal protein L11 methyltransferase (PrmA)at 1.9 A resolution' unspecified 
PDB 3CJQ 
'Ribosomal protein L11 methyltransferase (PrmA) in complex with dimethylated ribosomal protein L11 in space group P212121' 
unspecified 
PDB 3CJR 'Ribosomal protein L11 methyltransferase (PrmA) in complex with ribosomal protein L11 (K39A) and inhibitor Sinefungin.' 
unspecified 
PDB 3CJT . unspecified 
PDB 3CJU . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3CJS 
_pdbx_database_status.recvd_initial_deposition_date   2008-03-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Demirci, H.'    1 
'Gregory, S.T.'  2 
'Dahlberg, A.E.' 3 
'Jogl, G.'       4 
# 
_citation.id                        primary 
_citation.title                     'Multiple-Site Trimethylation of Ribosomal Protein L11 by the PrmA Methyltransferase.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            16 
_citation.page_first                1059 
_citation.page_last                 1066 
_citation.year                      2008 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18611379 
_citation.pdbx_database_id_DOI      10.1016/j.str.2008.03.016 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Demirci, H.'    1 
primary 'Gregory, S.T.'  2 
primary 'Dahlberg, A.E.' 3 
primary 'Jogl, G.'       4 
# 
_cell.entry_id           3CJS 
_cell.length_a           103.211 
_cell.length_b           33.948 
_cell.length_c           71.090 
_cell.angle_alpha        90.00 
_cell.angle_beta         131.76 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3CJS 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ribosomal protein L11 methyltransferase' 6785.558 1   2.1.1.- ? 'N-Terminal Domain' ? 
2 polymer     man '50S ribosomal protein L11'               7516.837 2   ?       ? 'N-Terminal Domain' ? 
3 non-polymer syn 1,2-ETHANEDIOL                            62.068   3   ?       ? ?                   ? 
4 water       nat water                                     18.015   255 ?       ? ?                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'L11 Mtase' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no MWVYRLKGTLEALDPILPGLFDGGARGLWEREGEVWAFFPAPVDLPYEGVWEEVGDEDW              
MWVYRLKGTLEALDPILPGLFDGGARGLWEREGEVWAFFPAPVDLPYEGVWEEVGDEDW              A   ? 
2 'polypeptide(L)' no no MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTP 
MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTP B,C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  TRP n 
1 3  VAL n 
1 4  TYR n 
1 5  ARG n 
1 6  LEU n 
1 7  LYS n 
1 8  GLY n 
1 9  THR n 
1 10 LEU n 
1 11 GLU n 
1 12 ALA n 
1 13 LEU n 
1 14 ASP n 
1 15 PRO n 
1 16 ILE n 
1 17 LEU n 
1 18 PRO n 
1 19 GLY n 
1 20 LEU n 
1 21 PHE n 
1 22 ASP n 
1 23 GLY n 
1 24 GLY n 
1 25 ALA n 
1 26 ARG n 
1 27 GLY n 
1 28 LEU n 
1 29 TRP n 
1 30 GLU n 
1 31 ARG n 
1 32 GLU n 
1 33 GLY n 
1 34 GLU n 
1 35 VAL n 
1 36 TRP n 
1 37 ALA n 
1 38 PHE n 
1 39 PHE n 
1 40 PRO n 
1 41 ALA n 
1 42 PRO n 
1 43 VAL n 
1 44 ASP n 
1 45 LEU n 
1 46 PRO n 
1 47 TYR n 
1 48 GLU n 
1 49 GLY n 
1 50 VAL n 
1 51 TRP n 
1 52 GLU n 
1 53 GLU n 
1 54 VAL n 
1 55 GLY n 
1 56 ASP n 
1 57 GLU n 
1 58 ASP n 
1 59 TRP n 
2 1  MET n 
2 2  LYS n 
2 3  LYS n 
2 4  VAL n 
2 5  VAL n 
2 6  ALA n 
2 7  VAL n 
2 8  VAL n 
2 9  LYS n 
2 10 LEU n 
2 11 GLN n 
2 12 LEU n 
2 13 PRO n 
2 14 ALA n 
2 15 GLY n 
2 16 LYS n 
2 17 ALA n 
2 18 THR n 
2 19 PRO n 
2 20 ALA n 
2 21 PRO n 
2 22 PRO n 
2 23 VAL n 
2 24 GLY n 
2 25 PRO n 
2 26 ALA n 
2 27 LEU n 
2 28 GLY n 
2 29 GLN n 
2 30 HIS n 
2 31 GLY n 
2 32 ALA n 
2 33 ASN n 
2 34 ILE n 
2 35 MET n 
2 36 GLU n 
2 37 PHE n 
2 38 VAL n 
2 39 LYS n 
2 40 ALA n 
2 41 PHE n 
2 42 ASN n 
2 43 ALA n 
2 44 ALA n 
2 45 THR n 
2 46 ALA n 
2 47 ASN n 
2 48 MET n 
2 49 GLY n 
2 50 ASP n 
2 51 ALA n 
2 52 ILE n 
2 53 VAL n 
2 54 PRO n 
2 55 VAL n 
2 56 GLU n 
2 57 ILE n 
2 58 THR n 
2 59 ILE n 
2 60 TYR n 
2 61 ALA n 
2 62 ASP n 
2 63 ARG n 
2 64 SER n 
2 65 PHE n 
2 66 THR n 
2 67 PHE n 
2 68 VAL n 
2 69 THR n 
2 70 LYS n 
2 71 THR n 
2 72 PRO n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? ? prmA          ? HB8 ? ? ? ? 'Thermus thermophilus' ? ? ? ? ? ? ? ? ? 'Escherichia coli' ? ? ? ? ? ? ? 
'BL21 (DE3) Star'     ? ? ? ? ? ? ? plasmid ? ? ? pET26b ? ? 
2 1 sample ? ? ? ? ? 'rplK, rpl11' ? HB8 ? ? ? ? 'Thermus thermophilus' ? ? ? ? ? ? ? ? ? 'Escherichia coli' ? ? ? ? ? ? ? 
'BL21 (DE3) prmA::TC' ? ? ? ? ? ? ? plasmid ? ? ? pET11a ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP PRMA_THET8 Q84BQ9 1 MWVYRLKGTLEALDPILPGLFDGGARGLWEREGEVWAFFPAPVDLPYEGVWEEVGDEDW              1 ? 
2 UNP RL11_THETH P36238 2 MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTP 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3CJS A 1 ? 59 ? Q84BQ9 1 ? 59 ? 1 59 
2 2 3CJS B 1 ? 72 ? P36238 1 ? 72 ? 1 72 
3 2 3CJS C 1 ? 72 ? P36238 1 ? 72 ? 1 72 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                 'C4 H7 N O4'     133.103 
EDO non-polymer         . 1,2-ETHANEDIOL  'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE       ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3CJS 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.13 
_exptl_crystal.density_percent_sol   42.22 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    '22% w/v PEG3350, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2006-09-15 
_diffrn_detector.details                
;Variable vertical and fixed horizontal slits. KOHZU double crystal monochromator with a water-cooled flat first crystal and a sagittally focused second crystal positioned for a fixed exit beam condition. Located ~18 m from source and ~6 m from sample position. Mirror system consisting of two vertically stacked, fused silica, spherical mirrors, to provide vertical focusing and harmonic rejection. One of the mirrors is rhodium coated and the other is uncoated. Located ~19.7 m from source.
;
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    
;KOHZU double crystal monochromator with a water-cooled flat first crystal and a sagittally focused second crystal positioned for a fixed exit beam condition. Located ~18 m from source and ~6 m from sample position.
;
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9797 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X4A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X4A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9797 
# 
_reflns.entry_id                     3CJS 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3 
_reflns.d_resolution_high            1.37 
_reflns.d_resolution_low             30 
_reflns.number_all                   ? 
_reflns.number_obs                   37200 
_reflns.percent_possible_obs         95.1 
_reflns.pdbx_Rmerge_I_obs            0.053 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.37 
_reflns_shell.d_res_low              1.42 
_reflns_shell.percent_possible_all   84.7 
_reflns_shell.Rmerge_I_obs           0.386 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.6 
_reflns_shell.pdbx_redundancy        2.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3269 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3CJS 
_refine.ls_number_reflns_obs                     35338 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             25.72 
_refine.ls_d_res_high                            1.37 
_refine.ls_percent_reflns_obs                    95.02 
_refine.ls_R_factor_obs                          0.18166 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18034 
_refine.ls_R_factor_R_free                       0.20601 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1849 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.963 
_refine.correlation_coeff_Fo_to_Fc_free          0.951 
_refine.B_iso_mean                               19.711 
_refine.aniso_B[1][1]                            0.01 
_refine.aniso_B[2][2]                            -0.03 
_refine.aniso_B[3][3]                            0.05 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.02 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'pdb entries 2NXC, 2NXN' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.063 
_refine.pdbx_overall_ESU_R_Free                  0.065 
_refine.overall_SU_ML                            0.039 
_refine.overall_SU_B                             1.874 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1485 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         12 
_refine_hist.number_atoms_solvent             255 
_refine_hist.number_atoms_total               1752 
_refine_hist.d_res_high                       1.37 
_refine_hist.d_res_low                        25.72 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.008  0.022  ? 1511 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.280  1.958  ? 2058 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   5.621  5.000  ? 194  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   32.258 24.510 ? 51   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   11.368 15.000 ? 208  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   16.937 15.000 ? 5    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.084  0.200  ? 234  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.006  0.020  ? 1142 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.200  0.200  ? 762  'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.311  0.200  ? 1035 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.155  0.200  ? 185  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.184  0.200  ? 68   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.159  0.200  ? 61   'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.708  1.500  ? 1003 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.151  2.000  ? 1576 'X-RAY DIFFRACTION' ? 
r_scbond_it              1.637  3.000  ? 589  'X-RAY DIFFRACTION' ? 
r_scangle_it             2.345  4.500  ? 482  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.37 
_refine_ls_shell.d_res_low                        1.403 
_refine_ls_shell.number_reflns_R_work             2232 
_refine_ls_shell.R_factor_R_work                  0.248 
_refine_ls_shell.percent_reflns_obs               81.67 
_refine_ls_shell.R_factor_R_free                  0.274 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             112 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                2232 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3CJS 
_struct.title                     'Minimal Recognition Complex between PrmA and Ribosomal Protein L11' 
_struct.pdbx_descriptor           'Ribosomal protein L11 methyltransferase (E.C.2.1.1.-), 50S ribosomal protein L11' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3CJS 
_struct_keywords.pdbx_keywords   'TRANSFERASE/RIBOSOMAL PROTEIN' 
_struct_keywords.text            
;S-Adenosyl-L-Methionine dependent methyltransferase, post-translational modification, multi-specific trimethylation, Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding, TRANSFERASE-RIBOSOMAL PROTEIN COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LEU A 13 ? PRO A 15 ? LEU A 13 PRO A 15 5 ? 3  
HELX_P HELX_P2 2 ILE A 16 ? GLY A 23 ? ILE A 16 GLY A 23 1 ? 8  
HELX_P HELX_P3 3 PRO B 22 ? GLN B 29 ? PRO B 22 GLN B 29 1 ? 8  
HELX_P HELX_P4 4 ASN B 33 ? ALA B 46 ? ASN B 33 ALA B 46 1 ? 14 
HELX_P HELX_P5 5 ASN B 47 ? GLY B 49 ? ASN B 47 GLY B 49 5 ? 3  
HELX_P HELX_P6 6 PRO C 22 ? GLN C 29 ? PRO C 22 GLN C 29 1 ? 8  
HELX_P HELX_P7 7 ASN C 33 ? ALA C 46 ? ASN C 33 ALA C 46 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 MET 1  B . ? MET 1  B LYS 2  B ? LYS 2  B 1 9.59 
2 PRO 21 B . ? PRO 21 B PRO 22 B ? PRO 22 B 1 7.51 
3 THR 71 B . ? THR 71 B PRO 72 B ? PRO 72 B 1 4.04 
4 PRO 21 C . ? PRO 21 C PRO 22 C ? PRO 22 C 1 6.10 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 50 ? GLU A 53 ? VAL A 50 GLU A 53 
A 2 TRP A 2  ? LYS A 7  ? TRP A 2  LYS A 7  
A 3 GLU A 34 ? PHE A 39 ? GLU A 34 PHE A 39 
A 4 GLY A 27 ? ARG A 31 ? GLY A 27 ARG A 31 
A 5 VAL B 4  ? PRO B 13 ? VAL B 4  PRO B 13 
A 6 ILE B 52 ? TYR B 60 ? ILE B 52 TYR B 60 
A 7 PHE B 65 ? THR B 69 ? PHE B 65 THR B 69 
B 1 VAL C 4  ? PRO C 13 ? VAL C 4  PRO C 13 
B 2 ILE C 52 ? TYR C 60 ? ILE C 52 TYR C 60 
B 3 PHE C 65 ? THR C 69 ? PHE C 65 THR C 69 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLU A 52 ? O GLU A 52 N VAL A 3  ? N VAL A 3  
A 2 3 N TRP A 2  ? N TRP A 2  O PHE A 39 ? O PHE A 39 
A 3 4 O TRP A 36 ? O TRP A 36 N TRP A 29 ? N TRP A 29 
A 4 5 N GLU A 30 ? N GLU A 30 O LYS B 9  ? O LYS B 9  
A 5 6 N LEU B 12 ? N LEU B 12 O VAL B 53 ? O VAL B 53 
A 6 7 N THR B 58 ? N THR B 58 O THR B 66 ? O THR B 66 
B 1 2 N VAL C 8  ? N VAL C 8  O ILE C 57 ? O ILE C 57 
B 2 3 N THR C 58 ? N THR C 58 O THR C 66 ? O THR C 66 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE EDO B 73' 
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE EDO B 74' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE EDO B 75' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 LYS B 2  ? LYS B 2   . ? 1_555 ? 
2  AC1 6 LYS B 3  ? LYS B 3   . ? 1_555 ? 
3  AC1 6 THR B 58 ? THR B 58  . ? 2_656 ? 
4  AC1 6 TYR B 60 ? TYR B 60  . ? 2_656 ? 
5  AC1 6 THR B 66 ? THR B 66  . ? 2_656 ? 
6  AC1 6 HOH H .  ? HOH B 77  . ? 2_656 ? 
7  AC2 7 ARG A 26 ? ARG A 26  . ? 1_555 ? 
8  AC2 7 HOH G .  ? HOH A 110 . ? 1_555 ? 
9  AC2 7 ALA B 17 ? ALA B 17  . ? 1_555 ? 
10 AC2 7 THR B 18 ? THR B 18  . ? 1_555 ? 
11 AC2 7 ALA B 20 ? ALA B 20  . ? 1_555 ? 
12 AC2 7 PRO B 21 ? PRO B 21  . ? 1_555 ? 
13 AC2 7 HOH H .  ? HOH B 101 . ? 1_555 ? 
14 AC3 6 TRP A 2  ? TRP A 2   . ? 1_565 ? 
15 AC3 6 ALA A 41 ? ALA A 41  . ? 1_565 ? 
16 AC3 6 GLU A 53 ? GLU A 53  . ? 1_565 ? 
17 AC3 6 HOH G .  ? HOH A 69  . ? 1_565 ? 
18 AC3 6 GLU B 36 ? GLU B 36  . ? 1_555 ? 
19 AC3 6 ALA B 40 ? ALA B 40  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3CJS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3CJS 
_atom_sites.fract_transf_matrix[1][1]   0.009689 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.008651 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.029457 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018858 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 1  ? 10.524 -12.637 33.360  1.00 21.37  ? 1   MET A N   1 
ATOM   2    C CA  . MET A 1 1  ? 10.539 -12.273 31.919  1.00 20.76  ? 1   MET A CA  1 
ATOM   3    C C   . MET A 1 1  ? 11.457 -13.240 31.200  1.00 18.97  ? 1   MET A C   1 
ATOM   4    O O   . MET A 1 1  ? 12.338 -13.825 31.814  1.00 19.38  ? 1   MET A O   1 
ATOM   5    C CB  . MET A 1 1  ? 11.027 -10.830 31.741  1.00 21.44  ? 1   MET A CB  1 
ATOM   6    C CG  . MET A 1 1  ? 10.612 -10.181 30.439  1.00 22.83  ? 1   MET A CG  1 
ATOM   7    S SD  . MET A 1 1  ? 9.836  -8.545  30.598  1.00 23.64  ? 1   MET A SD  1 
ATOM   8    C CE  . MET A 1 1  ? 8.756  -8.687  29.174  1.00 23.43  ? 1   MET A CE  1 
ATOM   9    N N   . TRP A 1 2  ? 11.200 -13.433 29.916  1.00 16.23  ? 2   TRP A N   1 
ATOM   10   C CA  . TRP A 1 2  ? 12.080 -14.205 29.052  1.00 14.71  ? 2   TRP A CA  1 
ATOM   11   C C   . TRP A 1 2  ? 12.730 -13.268 28.054  1.00 14.98  ? 2   TRP A C   1 
ATOM   12   O O   . TRP A 1 2  ? 12.175 -12.208 27.720  1.00 16.04  ? 2   TRP A O   1 
ATOM   13   C CB  . TRP A 1 2  ? 11.299 -15.335 28.378  1.00 14.44  ? 2   TRP A CB  1 
ATOM   14   C CG  . TRP A 1 2  ? 11.078 -16.453 29.342  1.00 13.18  ? 2   TRP A CG  1 
ATOM   15   C CD1 . TRP A 1 2  ? 10.117 -16.529 30.319  1.00 14.13  ? 2   TRP A CD1 1 
ATOM   16   C CD2 . TRP A 1 2  ? 11.867 -17.632 29.455  1.00 12.23  ? 2   TRP A CD2 1 
ATOM   17   N NE1 . TRP A 1 2  ? 10.262 -17.696 31.023  1.00 13.90  ? 2   TRP A NE1 1 
ATOM   18   C CE2 . TRP A 1 2  ? 11.322 -18.399 30.509  1.00 12.16  ? 2   TRP A CE2 1 
ATOM   19   C CE3 . TRP A 1 2  ? 12.976 -18.131 28.757  1.00 12.91  ? 2   TRP A CE3 1 
ATOM   20   C CZ2 . TRP A 1 2  ? 11.861 -19.626 30.893  1.00 12.72  ? 2   TRP A CZ2 1 
ATOM   21   C CZ3 . TRP A 1 2  ? 13.509 -19.350 29.134  1.00 12.84  ? 2   TRP A CZ3 1 
ATOM   22   C CH2 . TRP A 1 2  ? 12.954 -20.088 30.197  1.00 12.72  ? 2   TRP A CH2 1 
ATOM   23   N N   . VAL A 1 3  ? 13.948 -13.605 27.662  1.00 13.87  ? 3   VAL A N   1 
ATOM   24   C CA  . VAL A 1 3  ? 14.588 -12.907 26.565  1.00 14.02  ? 3   VAL A CA  1 
ATOM   25   C C   . VAL A 1 3  ? 14.854 -13.877 25.418  1.00 12.72  ? 3   VAL A C   1 
ATOM   26   O O   . VAL A 1 3  ? 15.216 -15.035 25.644  1.00 12.66  ? 3   VAL A O   1 
ATOM   27   C CB  . VAL A 1 3  ? 15.893 -12.186 26.990  1.00 13.89  ? 3   VAL A CB  1 
ATOM   28   C CG1 . VAL A 1 3  ? 16.893 -13.114 27.593  1.00 17.21  ? 3   VAL A CG1 1 
ATOM   29   C CG2 . VAL A 1 3  ? 16.491 -11.442 25.825  1.00 17.26  ? 3   VAL A CG2 1 
ATOM   30   N N   . TYR A 1 4  ? 14.666 -13.388 24.202  1.00 12.03  ? 4   TYR A N   1 
ATOM   31   C CA  . TYR A 1 4  ? 15.040 -14.077 22.971  1.00 11.67  ? 4   TYR A CA  1 
ATOM   32   C C   . TYR A 1 4  ? 16.270 -13.346 22.459  1.00 12.02  ? 4   TYR A C   1 
ATOM   33   O O   . TYR A 1 4  ? 16.182 -12.175 22.093  1.00 12.15  ? 4   TYR A O   1 
ATOM   34   C CB  . TYR A 1 4  ? 13.907 -13.961 21.978  1.00 12.40  ? 4   TYR A CB  1 
ATOM   35   C CG  . TYR A 1 4  ? 13.954 -14.880 20.786  1.00 11.26  ? 4   TYR A CG  1 
ATOM   36   C CD1 . TYR A 1 4  ? 13.959 -16.264 20.945  1.00 11.54  ? 4   TYR A CD1 1 
ATOM   37   C CD2 . TYR A 1 4  ? 13.892 -14.371 19.489  1.00 12.68  ? 4   TYR A CD2 1 
ATOM   38   C CE1 . TYR A 1 4  ? 13.909 -17.115 19.848  1.00 12.08  ? 4   TYR A CE1 1 
ATOM   39   C CE2 . TYR A 1 4  ? 13.847 -15.213 18.384  1.00 12.01  ? 4   TYR A CE2 1 
ATOM   40   C CZ  . TYR A 1 4  ? 13.860 -16.589 18.563  1.00 11.54  ? 4   TYR A CZ  1 
ATOM   41   O OH  . TYR A 1 4  ? 13.814 -17.411 17.450  1.00 12.89  ? 4   TYR A OH  1 
ATOM   42   N N   . ARG A 1 5  ? 17.412 -14.033 22.460  1.00 11.81  ? 5   ARG A N   1 
ATOM   43   C CA  . ARG A 1 5  ? 18.677 -13.422 22.069  1.00 12.52  ? 5   ARG A CA  1 
ATOM   44   C C   . ARG A 1 5  ? 18.999 -13.806 20.645  1.00 12.02  ? 5   ARG A C   1 
ATOM   45   O O   . ARG A 1 5  ? 19.043 -15.003 20.311  1.00 11.77  ? 5   ARG A O   1 
ATOM   46   C CB  . ARG A 1 5  ? 19.799 -13.879 23.001  1.00 12.29  ? 5   ARG A CB  1 
ATOM   47   C CG  . ARG A 1 5  ? 19.569 -13.455 24.433  1.00 14.28  ? 5   ARG A CG  1 
ATOM   48   C CD  . ARG A 1 5  ? 20.629 -14.041 25.375  1.00 15.82  ? 5   ARG A CD  1 
ATOM   49   N NE  . ARG A 1 5  ? 21.984 -13.557 25.099  1.00 15.66  ? 5   ARG A NE  1 
ATOM   50   C CZ  . ARG A 1 5  ? 22.996 -13.606 25.963  1.00 16.70  ? 5   ARG A CZ  1 
ATOM   51   N NH1 . ARG A 1 5  ? 22.819 -14.122 27.176  1.00 17.63  ? 5   ARG A NH1 1 
ATOM   52   N NH2 . ARG A 1 5  ? 24.187 -13.134 25.614  1.00 17.95  ? 5   ARG A NH2 1 
ATOM   53   N N   . LEU A 1 6  ? 19.244 -12.799 19.811  1.00 12.13  ? 6   LEU A N   1 
ATOM   54   C CA  . LEU A 1 6  ? 19.584 -12.991 18.416  1.00 12.66  ? 6   LEU A CA  1 
ATOM   55   C C   . LEU A 1 6  ? 20.906 -12.307 18.109  1.00 13.07  ? 6   LEU A C   1 
ATOM   56   O O   . LEU A 1 6  ? 21.100 -11.136 18.433  1.00 13.06  ? 6   LEU A O   1 
ATOM   57   C CB  . LEU A 1 6  ? 18.488 -12.391 17.540  1.00 13.08  ? 6   LEU A CB  1 
ATOM   58   C CG  . LEU A 1 6  ? 17.148 -13.133 17.562  1.00 13.05  ? 6   LEU A CG  1 
ATOM   59   C CD1 . LEU A 1 6  ? 16.068 -12.187 17.111  1.00 14.58  ? 6   LEU A CD1 1 
ATOM   60   C CD2 . LEU A 1 6  ? 17.182 -14.373 16.684  1.00 14.24  ? 6   LEU A CD2 1 
ATOM   61   N N   . LYS A 1 7  ? 21.814 -13.034 17.473  1.00 13.39  ? 7   LYS A N   1 
ATOM   62   C CA  . LYS A 1 7  ? 23.028 -12.420 16.961  1.00 13.92  ? 7   LYS A CA  1 
ATOM   63   C C   . LYS A 1 7  ? 22.674 -11.370 15.911  1.00 13.84  ? 7   LYS A C   1 
ATOM   64   O O   . LYS A 1 7  ? 21.884 -11.644 15.009  1.00 14.71  ? 7   LYS A O   1 
ATOM   65   C CB  . LYS A 1 7  ? 23.932 -13.480 16.317  1.00 14.17  ? 7   LYS A CB  1 
ATOM   66   C CG  . LYS A 1 7  ? 25.211 -12.913 15.702  1.00 14.91  ? 7   LYS A CG  1 
ATOM   67   C CD  . LYS A 1 7  ? 26.119 -14.007 15.154  1.00 16.52  ? 7   LYS A CD  1 
ATOM   68   C CE  . LYS A 1 7  ? 25.481 -14.756 13.984  1.00 20.20  ? 7   LYS A CE  1 
ATOM   69   N NZ  . LYS A 1 7  ? 25.333 -13.909 12.763  1.00 22.82  ? 7   LYS A NZ  1 
ATOM   70   N N   . GLY A 1 8  ? 23.268 -10.184 16.031  1.00 13.08  ? 8   GLY A N   1 
ATOM   71   C CA  . GLY A 1 8  ? 23.053 -9.110  15.068  1.00 13.45  ? 8   GLY A CA  1 
ATOM   72   C C   . GLY A 1 8  ? 22.734 -7.789  15.738  1.00 13.89  ? 8   GLY A C   1 
ATOM   73   O O   . GLY A 1 8  ? 22.447 -7.730  16.933  1.00 15.16  ? 8   GLY A O   1 
ATOM   74   N N   . THR A 1 9  ? 22.758 -6.723  14.950  1.00 14.28  ? 9   THR A N   1 
ATOM   75   C CA  . THR A 1 9  ? 22.354 -5.398  15.416  1.00 14.00  ? 9   THR A CA  1 
ATOM   76   C C   . THR A 1 9  ? 20.907 -5.147  15.045  1.00 13.76  ? 9   THR A C   1 
ATOM   77   O O   . THR A 1 9  ? 20.330 -5.871  14.229  1.00 13.74  ? 9   THR A O   1 
ATOM   78   C CB  . THR A 1 9  ? 23.203 -4.306  14.741  1.00 13.86  ? 9   THR A CB  1 
ATOM   79   O OG1 . THR A 1 9  ? 23.020 -4.385  13.321  1.00 15.89  ? 9   THR A OG1 1 
ATOM   80   C CG2 . THR A 1 9  ? 24.687 -4.486  15.083  1.00 14.99  ? 9   THR A CG2 1 
ATOM   81   N N   . LEU A 1 10 ? 20.319 -4.103  15.627  1.00 13.41  ? 10  LEU A N   1 
ATOM   82   C CA  . LEU A 1 10 ? 18.959 -3.703  15.264  1.00 13.53  ? 10  LEU A CA  1 
ATOM   83   C C   . LEU A 1 10 ? 18.851 -3.385  13.776  1.00 13.88  ? 10  LEU A C   1 
ATOM   84   O O   . LEU A 1 10 ? 17.856 -3.729  13.137  1.00 14.29  ? 10  LEU A O   1 
ATOM   85   C CB  . LEU A 1 10 ? 18.481 -2.506  16.094  1.00 13.04  ? 10  LEU A CB  1 
ATOM   86   C CG  . LEU A 1 10 ? 18.194 -2.829  17.559  1.00 12.53  ? 10  LEU A CG  1 
ATOM   87   C CD1 . LEU A 1 10 ? 18.069 -1.528  18.339  1.00 13.31  ? 10  LEU A CD1 1 
ATOM   88   C CD2 . LEU A 1 10 ? 16.943 -3.692  17.721  1.00 11.32  ? 10  LEU A CD2 1 
ATOM   89   N N   . GLU A 1 11 ? 19.873 -2.734  13.229  1.00 15.15  ? 11  GLU A N   1 
ATOM   90   C CA  . GLU A 1 11 ? 19.918 -2.450  11.799  1.00 16.08  ? 11  GLU A CA  1 
ATOM   91   C C   . GLU A 1 11 ? 19.893 -3.736  10.978  1.00 16.25  ? 11  GLU A C   1 
ATOM   92   O O   . GLU A 1 11 ? 19.039 -3.914  10.110  1.00 17.02  ? 11  GLU A O   1 
ATOM   93   C CB  . GLU A 1 11 ? 21.163 -1.630  11.455  1.00 16.43  ? 11  GLU A CB  1 
ATOM   94   C CG  . GLU A 1 11 ? 20.993 -0.132  11.648  1.00 18.54  ? 11  GLU A CG  1 
ATOM   95   C CD  . GLU A 1 11 ? 21.821 0.678   10.669  0.00 20.00  ? 11  GLU A CD  1 
ATOM   96   O OE1 . GLU A 1 11 ? 21.488 0.679   9.465   1.00 82.88  ? 11  GLU A OE1 1 
ATOM   97   O OE2 . GLU A 1 11 ? 22.804 1.314   11.104  1.00 86.75  ? 11  GLU A OE2 1 
ATOM   98   N N   . ALA A 1 12 ? 20.837 -4.627  11.260  1.00 16.16  ? 12  ALA A N   1 
ATOM   99   C CA  . ALA A 1 12 ? 20.984 -5.875  10.502  1.00 16.13  ? 12  ALA A CA  1 
ATOM   100  C C   . ALA A 1 12 ? 19.726 -6.740  10.552  1.00 15.98  ? 12  ALA A C   1 
ATOM   101  O O   . ALA A 1 12 ? 19.371 -7.392  9.565   1.00 17.15  ? 12  ALA A O   1 
ATOM   102  C CB  . ALA A 1 12 ? 22.183 -6.665  11.008  1.00 16.63  ? 12  ALA A CB  1 
ATOM   103  N N   . LEU A 1 13 ? 19.056 -6.744  11.702  1.00 14.63  ? 13  LEU A N   1 
ATOM   104  C CA  . LEU A 1 13 ? 17.886 -7.591  11.885  1.00 14.08  ? 13  LEU A CA  1 
ATOM   105  C C   . LEU A 1 13 ? 16.564 -6.885  11.586  1.00 13.80  ? 13  LEU A C   1 
ATOM   106  O O   . LEU A 1 13 ? 15.493 -7.470  11.753  1.00 13.33  ? 13  LEU A O   1 
ATOM   107  C CB  . LEU A 1 13 ? 17.873 -8.163  13.304  1.00 14.11  ? 13  LEU A CB  1 
ATOM   108  C CG  . LEU A 1 13 ? 19.032 -9.100  13.644  1.00 13.36  ? 13  LEU A CG  1 
ATOM   109  C CD1 . LEU A 1 13 ? 18.957 -9.508  15.103  1.00 15.02  ? 13  LEU A CD1 1 
ATOM   110  C CD2 . LEU A 1 13 ? 19.057 -10.334 12.722  1.00 16.04  ? 13  LEU A CD2 1 
ATOM   111  N N   . ASP A 1 14 ? 16.645 -5.641  11.119  1.00 13.96  ? 14  ASP A N   1 
ATOM   112  C CA  . ASP A 1 14 ? 15.456 -4.819  10.877  1.00 14.42  ? 14  ASP A CA  1 
ATOM   113  C C   . ASP A 1 14 ? 14.246 -5.557  10.269  1.00 14.12  ? 14  ASP A C   1 
ATOM   114  O O   . ASP A 1 14 ? 13.131 -5.427  10.780  1.00 13.97  ? 14  ASP A O   1 
ATOM   115  C CB  . ASP A 1 14 ? 15.815 -3.581  10.047  1.00 14.62  ? 14  ASP A CB  1 
ATOM   116  C CG  . ASP A 1 14 ? 14.644 -2.637  9.876   1.00 16.12  ? 14  ASP A CG  1 
ATOM   117  O OD1 . ASP A 1 14 ? 14.211 -2.032  10.881  1.00 18.11  ? 14  ASP A OD1 1 
ATOM   118  O OD2 . ASP A 1 14 ? 14.164 -2.499  8.734   1.00 18.55  ? 14  ASP A OD2 1 
ATOM   119  N N   . PRO A 1 15 ? 14.453 -6.327  9.173   1.00 13.79  ? 15  PRO A N   1 
ATOM   120  C CA  . PRO A 1 15 ? 13.298 -6.962  8.531   1.00 14.11  ? 15  PRO A CA  1 
ATOM   121  C C   . PRO A 1 15 ? 12.446 -7.862  9.418   1.00 13.94  ? 15  PRO A C   1 
ATOM   122  O O   . PRO A 1 15 ? 11.241 -7.960  9.190   1.00 14.78  ? 15  PRO A O   1 
ATOM   123  C CB  . PRO A 1 15 ? 13.932 -7.775  7.392   1.00 13.87  ? 15  PRO A CB  1 
ATOM   124  C CG  . PRO A 1 15 ? 15.195 -7.056  7.089   1.00 13.47  ? 15  PRO A CG  1 
ATOM   125  C CD  . PRO A 1 15 ? 15.698 -6.615  8.431   1.00 14.12  ? 15  PRO A CD  1 
ATOM   126  N N   . ILE A 1 16 ? 13.047 -8.498  10.425  1.00 13.73  ? 16  ILE A N   1 
ATOM   127  C CA  . ILE A 1 16 ? 12.281 -9.416  11.278  1.00 14.07  ? 16  ILE A CA  1 
ATOM   128  C C   . ILE A 1 16 ? 11.753 -8.798  12.576  1.00 14.22  ? 16  ILE A C   1 
ATOM   129  O O   . ILE A 1 16 ? 11.011 -9.441  13.317  1.00 14.17  ? 16  ILE A O   1 
ATOM   130  C CB  . ILE A 1 16 ? 13.053 -10.725 11.597  1.00 14.04  ? 16  ILE A CB  1 
ATOM   131  C CG1 . ILE A 1 16 ? 14.303 -10.454 12.439  1.00 14.15  ? 16  ILE A CG1 1 
ATOM   132  C CG2 . ILE A 1 16 ? 13.404 -11.453 10.307  1.00 14.80  ? 16  ILE A CG2 1 
ATOM   133  C CD1 . ILE A 1 16 ? 14.892 -11.715 13.073  1.00 13.90  ? 16  ILE A CD1 1 
ATOM   134  N N   . LEU A 1 17 ? 12.103 -7.541  12.832  1.00 14.98  ? 17  LEU A N   1 
ATOM   135  C CA  . LEU A 1 17 ? 11.742 -6.922  14.116  1.00 15.84  ? 17  LEU A CA  1 
ATOM   136  C C   . LEU A 1 17 ? 10.227 -6.720  14.333  1.00 16.44  ? 17  LEU A C   1 
ATOM   137  O O   . LEU A 1 17 ? 9.731  -7.017  15.420  1.00 16.26  ? 17  LEU A O   1 
ATOM   138  C CB  . LEU A 1 17 ? 12.537 -5.636  14.371  1.00 15.69  ? 17  LEU A CB  1 
ATOM   139  C CG  . LEU A 1 17 ? 14.069 -5.739  14.307  1.00 16.02  ? 17  LEU A CG  1 
ATOM   140  C CD1 . LEU A 1 17 ? 14.695 -4.404  14.666  1.00 16.51  ? 17  LEU A CD1 1 
ATOM   141  C CD2 . LEU A 1 17 ? 14.612 -6.836  15.199  1.00 15.60  ? 17  LEU A CD2 1 
ATOM   142  N N   . PRO A 1 18 ? 9.487  -6.224  13.315  1.00 17.41  ? 18  PRO A N   1 
ATOM   143  C CA  . PRO A 1 18 ? 8.027  -6.131  13.483  1.00 18.11  ? 18  PRO A CA  1 
ATOM   144  C C   . PRO A 1 18 ? 7.394  -7.481  13.836  1.00 18.76  ? 18  PRO A C   1 
ATOM   145  O O   . PRO A 1 18 ? 6.490  -7.541  14.677  1.00 19.52  ? 18  PRO A O   1 
ATOM   146  C CB  . PRO A 1 18 ? 7.549  -5.649  12.108  1.00 18.29  ? 18  PRO A CB  1 
ATOM   147  C CG  . PRO A 1 18 ? 8.715  -4.880  11.568  1.00 18.11  ? 18  PRO A CG  1 
ATOM   148  C CD  . PRO A 1 18 ? 9.908  -5.702  12.002  1.00 17.31  ? 18  PRO A CD  1 
ATOM   149  N N   . GLY A 1 19 ? 7.895  -8.554  13.232  1.00 19.01  ? 19  GLY A N   1 
ATOM   150  C CA  . GLY A 1 19 ? 7.437  -9.905  13.543  1.00 18.86  ? 19  GLY A CA  1 
ATOM   151  C C   . GLY A 1 19 ? 7.658  -10.304 14.992  1.00 18.71  ? 19  GLY A C   1 
ATOM   152  O O   . GLY A 1 19 ? 6.859  -11.046 15.564  1.00 19.37  ? 19  GLY A O   1 
ATOM   153  N N   . LEU A 1 20 ? 8.740  -9.814  15.594  1.00 17.64  ? 20  LEU A N   1 
ATOM   154  C CA  . LEU A 1 20 ? 8.993  -10.086 17.013  1.00 16.64  ? 20  LEU A CA  1 
ATOM   155  C C   . LEU A 1 20 ? 7.943  -9.398  17.882  1.00 16.22  ? 20  LEU A C   1 
ATOM   156  O O   . LEU A 1 20 ? 7.432  -9.984  18.830  1.00 16.02  ? 20  LEU A O   1 
ATOM   157  C CB  . LEU A 1 20 ? 10.408 -9.665  17.429  1.00 16.37  ? 20  LEU A CB  1 
ATOM   158  C CG  . LEU A 1 20 ? 11.579 -10.356 16.731  1.00 16.80  ? 20  LEU A CG  1 
ATOM   159  C CD1 . LEU A 1 20 ? 12.905 -9.780  17.190  1.00 17.20  ? 20  LEU A CD1 1 
ATOM   160  C CD2 . LEU A 1 20 ? 11.526 -11.868 16.965  1.00 19.25  ? 20  LEU A CD2 1 
ATOM   161  N N   . PHE A 1 21 ? 7.624  -8.148  17.558  1.00 15.71  ? 21  PHE A N   1 
ATOM   162  C CA  . PHE A 1 21 ? 6.567  -7.434  18.276  1.00 15.78  ? 21  PHE A CA  1 
ATOM   163  C C   . PHE A 1 21 ? 5.196  -8.074  18.070  1.00 16.43  ? 21  PHE A C   1 
ATOM   164  O O   . PHE A 1 21 ? 4.422  -8.215  19.022  1.00 15.98  ? 21  PHE A O   1 
ATOM   165  C CB  . PHE A 1 21 ? 6.551  -5.954  17.885  1.00 14.95  ? 21  PHE A CB  1 
ATOM   166  C CG  . PHE A 1 21 ? 7.645  -5.155  18.534  1.00 14.39  ? 21  PHE A CG  1 
ATOM   167  C CD1 . PHE A 1 21 ? 8.808  -4.834  17.836  1.00 14.47  ? 21  PHE A CD1 1 
ATOM   168  C CD2 . PHE A 1 21 ? 7.504  -4.709  19.846  1.00 13.69  ? 21  PHE A CD2 1 
ATOM   169  C CE1 . PHE A 1 21 ? 9.827  -4.087  18.449  1.00 14.41  ? 21  PHE A CE1 1 
ATOM   170  C CE2 . PHE A 1 21 ? 8.521  -3.963  20.463  1.00 13.68  ? 21  PHE A CE2 1 
ATOM   171  C CZ  . PHE A 1 21 ? 9.672  -3.660  19.762  1.00 13.68  ? 21  PHE A CZ  1 
ATOM   172  N N   . ASP A 1 22 ? 4.914  -8.479  16.830  1.00 17.39  ? 22  ASP A N   1 
ATOM   173  C CA  . ASP A 1 22 ? 3.666  -9.180  16.508  1.00 18.54  ? 22  ASP A CA  1 
ATOM   174  C C   . ASP A 1 22 ? 3.562  -10.480 17.315  1.00 18.49  ? 22  ASP A C   1 
ATOM   175  O O   . ASP A 1 22 ? 2.466  -10.897 17.708  1.00 19.34  ? 22  ASP A O   1 
ATOM   176  C CB  . ASP A 1 22 ? 3.601  -9.485  15.011  1.00 19.01  ? 22  ASP A CB  1 
ATOM   177  C CG  . ASP A 1 22 ? 3.434  -8.234  14.154  1.00 21.32  ? 22  ASP A CG  1 
ATOM   178  O OD1 . ASP A 1 22 ? 2.986  -7.182  14.669  1.00 23.83  ? 22  ASP A OD1 1 
ATOM   179  O OD2 . ASP A 1 22 ? 3.744  -8.311  12.944  1.00 25.04  ? 22  ASP A OD2 1 
ATOM   180  N N   . GLY A 1 23 ? 4.707  -11.107 17.565  1.00 18.01  ? 23  GLY A N   1 
ATOM   181  C CA  . GLY A 1 23 ? 4.756  -12.311 18.367  1.00 17.59  ? 23  GLY A CA  1 
ATOM   182  C C   . GLY A 1 23 ? 4.684  -12.079 19.867  1.00 17.18  ? 23  GLY A C   1 
ATOM   183  O O   . GLY A 1 23 ? 4.623  -13.039 20.632  1.00 17.45  ? 23  GLY A O   1 
ATOM   184  N N   . GLY A 1 24 ? 4.728  -10.813 20.292  1.00 16.11  ? 24  GLY A N   1 
ATOM   185  C CA  . GLY A 1 24 ? 4.543  -10.466 21.700  1.00 15.36  ? 24  GLY A CA  1 
ATOM   186  C C   . GLY A 1 24 ? 5.714  -9.768  22.389  1.00 14.46  ? 24  GLY A C   1 
ATOM   187  O O   . GLY A 1 24 ? 5.664  -9.530  23.594  1.00 15.07  ? 24  GLY A O   1 
ATOM   188  N N   . ALA A 1 25 ? 6.754  -9.417  21.643  1.00 13.98  ? 25  ALA A N   1 
ATOM   189  C CA  . ALA A 1 25 ? 7.895  -8.709  22.258  1.00 13.88  ? 25  ALA A CA  1 
ATOM   190  C C   . ALA A 1 25 ? 7.432  -7.376  22.843  1.00 13.44  ? 25  ALA A C   1 
ATOM   191  O O   . ALA A 1 25 ? 6.621  -6.655  22.226  1.00 13.99  ? 25  ALA A O   1 
ATOM   192  C CB  . ALA A 1 25 ? 9.014  -8.495  21.248  1.00 14.55  ? 25  ALA A CB  1 
ATOM   193  N N   . ARG A 1 26 ? 7.938  -7.046  24.029  1.00 12.86  ? 26  ARG A N   1 
ATOM   194  C CA  . ARG A 1 26 ? 7.561  -5.810  24.724  1.00 13.52  ? 26  ARG A CA  1 
ATOM   195  C C   . ARG A 1 26 ? 8.538  -4.672  24.412  1.00 12.44  ? 26  ARG A C   1 
ATOM   196  O O   . ARG A 1 26 ? 8.206  -3.482  24.542  1.00 12.38  ? 26  ARG A O   1 
ATOM   197  C CB  . ARG A 1 26 ? 7.475  -6.032  26.245  1.00 13.97  ? 26  ARG A CB  1 
ATOM   198  C CG  . ARG A 1 26 ? 6.573  -7.182  26.732  1.00 16.45  ? 26  ARG A CG  1 
ATOM   199  C CD  . ARG A 1 26 ? 5.120  -6.756  26.942  1.00 17.48  ? 26  ARG A CD  1 
ATOM   200  N NE  . ARG A 1 26 ? 4.950  -5.752  28.005  1.00 18.08  ? 26  ARG A NE  1 
ATOM   201  C CZ  . ARG A 1 26 ? 3.942  -4.888  28.079  1.00 18.43  ? 26  ARG A CZ  1 
ATOM   202  N NH1 . ARG A 1 26 ? 2.998  -4.866  27.143  1.00 18.72  ? 26  ARG A NH1 1 
ATOM   203  N NH2 . ARG A 1 26 ? 3.889  -4.015  29.085  1.00 16.55  ? 26  ARG A NH2 1 
ATOM   204  N N   . GLY A 1 27 ? 9.746  -5.041  24.013  1.00 11.16  ? 27  GLY A N   1 
ATOM   205  C CA  . GLY A 1 27 ? 10.767 -4.062  23.667  1.00 10.63  ? 27  GLY A CA  1 
ATOM   206  C C   . GLY A 1 27 ? 12.027 -4.803  23.275  1.00 10.59  ? 27  GLY A C   1 
ATOM   207  O O   . GLY A 1 27 ? 12.184 -5.991  23.615  1.00 11.27  ? 27  GLY A O   1 
ATOM   208  N N   . LEU A 1 28 ? 12.914 -4.101  22.568  1.00 10.36  ? 28  LEU A N   1 
ATOM   209  C CA  . LEU A 1 28 ? 14.183 -4.648  22.116  1.00 10.62  ? 28  LEU A CA  1 
ATOM   210  C C   . LEU A 1 28 ? 15.321 -3.844  22.712  1.00 10.38  ? 28  LEU A C   1 
ATOM   211  O O   . LEU A 1 28 ? 15.196 -2.628  22.888  1.00 10.81  ? 28  LEU A O   1 
ATOM   212  C CB  . LEU A 1 28 ? 14.278 -4.588  20.596  1.00 10.82  ? 28  LEU A CB  1 
ATOM   213  C CG  . LEU A 1 28 ? 13.116 -5.157  19.779  1.00 11.26  ? 28  LEU A CG  1 
ATOM   214  C CD1 . LEU A 1 28 ? 13.414 -4.984  18.276  1.00 11.80  ? 28  LEU A CD1 1 
ATOM   215  C CD2 . LEU A 1 28 ? 12.873 -6.620  20.123  1.00 12.17  ? 28  LEU A CD2 1 
ATOM   216  N N   . TRP A 1 29 ? 16.428 -4.517  22.998  1.00 10.34  ? 29  TRP A N   1 
ATOM   217  C CA  . TRP A 1 29 ? 17.614 -3.858  23.548  1.00 10.98  ? 29  TRP A CA  1 
ATOM   218  C C   . TRP A 1 29 ? 18.810 -4.411  22.810  1.00 11.19  ? 29  TRP A C   1 
ATOM   219  O O   . TRP A 1 29 ? 19.055 -5.623  22.830  1.00 11.28  ? 29  TRP A O   1 
ATOM   220  C CB  . TRP A 1 29 ? 17.691 -4.172  25.040  1.00 11.75  ? 29  TRP A CB  1 
ATOM   221  C CG  . TRP A 1 29 ? 18.836 -3.590  25.832  1.00 10.94  ? 29  TRP A CG  1 
ATOM   222  C CD1 . TRP A 1 29 ? 19.781 -2.680  25.425  1.00 11.46  ? 29  TRP A CD1 1 
ATOM   223  C CD2 . TRP A 1 29 ? 19.115 -3.865  27.211  1.00 11.94  ? 29  TRP A CD2 1 
ATOM   224  N NE1 . TRP A 1 29 ? 20.645 -2.393  26.473  1.00 11.66  ? 29  TRP A NE1 1 
ATOM   225  C CE2 . TRP A 1 29 ? 20.249 -3.103  27.575  1.00 11.19  ? 29  TRP A CE2 1 
ATOM   226  C CE3 . TRP A 1 29 ? 18.502 -4.679  28.180  1.00 13.43  ? 29  TRP A CE3 1 
ATOM   227  C CZ2 . TRP A 1 29 ? 20.804 -3.155  28.862  1.00 12.37  ? 29  TRP A CZ2 1 
ATOM   228  C CZ3 . TRP A 1 29 ? 19.052 -4.722  29.463  1.00 14.16  ? 29  TRP A CZ3 1 
ATOM   229  C CH2 . TRP A 1 29 ? 20.195 -3.970  29.784  1.00 13.09  ? 29  TRP A CH2 1 
ATOM   230  N N   . GLU A 1 30 ? 19.540 -3.529  22.128  1.00 11.02  ? 30  GLU A N   1 
ATOM   231  C CA  . GLU A 1 30 ? 20.742 -3.952  21.417  1.00 12.60  ? 30  GLU A CA  1 
ATOM   232  C C   . GLU A 1 30 ? 21.901 -3.988  22.405  1.00 13.49  ? 30  GLU A C   1 
ATOM   233  O O   . GLU A 1 30 ? 22.202 -2.980  23.040  1.00 12.67  ? 30  GLU A O   1 
ATOM   234  C CB  . GLU A 1 30 ? 21.052 -3.006  20.255  1.00 12.57  ? 30  GLU A CB  1 
ATOM   235  C CG  . GLU A 1 30 ? 22.250 -3.450  19.390  1.00 13.94  ? 30  GLU A CG  1 
ATOM   236  C CD  . GLU A 1 30 ? 22.543 -2.488  18.257  1.00 14.56  ? 30  GLU A CD  1 
ATOM   237  O OE1 . GLU A 1 30 ? 21.710 -2.362  17.345  1.00 15.22  ? 30  GLU A OE1 1 
ATOM   238  O OE2 . GLU A 1 30 ? 23.642 -1.882  18.252  1.00 20.85  ? 30  GLU A OE2 1 
ATOM   239  N N   . ARG A 1 31 ? 22.554 -5.143  22.524  1.00 14.83  ? 31  ARG A N   1 
ATOM   240  C CA  . ARG A 1 31 ? 23.662 -5.331  23.479  1.00 17.55  ? 31  ARG A CA  1 
ATOM   241  C C   . ARG A 1 31 ? 24.834 -6.081  22.866  1.00 18.59  ? 31  ARG A C   1 
ATOM   242  O O   . ARG A 1 31 ? 24.732 -7.279  22.618  1.00 19.70  ? 31  ARG A O   1 
ATOM   243  C CB  . ARG A 1 31 ? 23.210 -6.128  24.715  1.00 17.86  ? 31  ARG A CB  1 
ATOM   244  C CG  . ARG A 1 31 ? 21.919 -5.666  25.372  1.00 18.30  ? 31  ARG A CG  1 
ATOM   245  C CD  . ARG A 1 31 ? 21.664 -6.397  26.681  1.00 18.98  ? 31  ARG A CD  1 
ATOM   246  N NE  . ARG A 1 31 ? 22.550 -5.925  27.737  1.00 22.84  ? 31  ARG A NE  1 
ATOM   247  C CZ  . ARG A 1 31 ? 22.624 -6.448  28.956  1.00 24.73  ? 31  ARG A CZ  1 
ATOM   248  N NH1 . ARG A 1 31 ? 21.868 -7.485  29.291  1.00 26.58  ? 31  ARG A NH1 1 
ATOM   249  N NH2 . ARG A 1 31 ? 23.470 -5.936  29.838  1.00 25.34  ? 31  ARG A NH2 1 
ATOM   250  N N   . GLU A 1 32 ? 25.947 -5.386  22.658  1.00 20.01  ? 32  GLU A N   1 
ATOM   251  C CA  . GLU A 1 32 ? 27.191 -5.999  22.181  1.00 20.29  ? 32  GLU A CA  1 
ATOM   252  C C   . GLU A 1 32 ? 27.014 -7.130  21.160  1.00 20.26  ? 32  GLU A C   1 
ATOM   253  O O   . GLU A 1 32 ? 27.223 -8.303  21.471  1.00 20.85  ? 32  GLU A O   1 
ATOM   254  C CB  . GLU A 1 32 ? 28.028 -6.487  23.370  1.00 20.51  ? 32  GLU A CB  1 
ATOM   255  C CG  . GLU A 1 32 ? 28.730 -5.076  23.820  0.00 20.00  ? 32  GLU A CG  1 
ATOM   256  C CD  . GLU A 1 32 ? 29.361 -4.010  22.861  0.00 20.00  ? 32  GLU A CD  1 
ATOM   257  O OE1 . GLU A 1 32 ? 29.688 -4.282  21.668  0.00 20.00  ? 32  GLU A OE1 1 
ATOM   258  O OE2 . GLU A 1 32 ? 29.505 -2.893  23.328  0.00 20.00  ? 32  GLU A OE2 1 
ATOM   259  N N   . GLY A 1 33 ? 26.585 -6.767  19.957  1.00 20.45  ? 33  GLY A N   1 
ATOM   260  C CA  . GLY A 1 33 ? 26.500 -7.723  18.859  1.00 19.60  ? 33  GLY A CA  1 
ATOM   261  C C   . GLY A 1 33 ? 25.237 -8.567  18.841  1.00 18.38  ? 33  GLY A C   1 
ATOM   262  O O   . GLY A 1 33 ? 25.130 -9.489  18.032  1.00 19.34  ? 33  GLY A O   1 
ATOM   263  N N   . GLU A 1 34 ? 24.287 -8.261  19.731  1.00 16.71  ? 34  GLU A N   1 
ATOM   264  C CA  . GLU A 1 34 ? 23.063 -9.040  19.867  1.00 15.82  ? 34  GLU A CA  1 
ATOM   265  C C   . GLU A 1 34 ? 21.864 -8.125  20.004  1.00 14.88  ? 34  GLU A C   1 
ATOM   266  O O   . GLU A 1 34 ? 21.978 -6.992  20.490  1.00 15.21  ? 34  GLU A O   1 
ATOM   267  C CB  . GLU A 1 34 ? 23.108 -9.850  21.152  1.00 15.79  ? 34  GLU A CB  1 
ATOM   268  C CG  . GLU A 1 34 ? 23.922 -11.124 21.188  1.00 18.57  ? 34  GLU A CG  1 
ATOM   269  C CD  . GLU A 1 34 ? 23.596 -11.857 22.476  1.00 21.04  ? 34  GLU A CD  1 
ATOM   270  O OE1 . GLU A 1 34 ? 23.882 -11.301 23.558  1.00 22.98  ? 34  GLU A OE1 1 
ATOM   271  O OE2 . GLU A 1 34 ? 22.992 -12.940 22.413  1.00 23.40  ? 34  GLU A OE2 1 
ATOM   272  N N   . VAL A 1 35 ? 20.700 -8.642  19.626  1.00 13.33  ? 35  VAL A N   1 
ATOM   273  C CA  . VAL A 1 35 ? 19.437 -8.011  19.970  1.00 13.40  ? 35  VAL A CA  1 
ATOM   274  C C   . VAL A 1 35 ? 18.751 -8.893  21.001  1.00 13.61  ? 35  VAL A C   1 
ATOM   275  O O   . VAL A 1 35 ? 18.597 -10.109 20.794  1.00 13.32  ? 35  VAL A O   1 
ATOM   276  C CB  . VAL A 1 35 ? 18.550 -7.780  18.714  1.00 13.59  ? 35  VAL A CB  1 
ATOM   277  C CG1 . VAL A 1 35 ? 17.126 -7.344  19.104  1.00 14.44  ? 35  VAL A CG1 1 
ATOM   278  C CG2 . VAL A 1 35 ? 19.190 -6.767  17.780  1.00 13.96  ? 35  VAL A CG2 1 
ATOM   279  N N   . TRP A 1 36 ? 18.377 -8.277  22.125  1.00 12.66  ? 36  TRP A N   1 
ATOM   280  C CA  . TRP A 1 36 ? 17.597 -8.940  23.162  1.00 12.92  ? 36  TRP A CA  1 
ATOM   281  C C   . TRP A 1 36 ? 16.150 -8.502  23.032  1.00 12.43  ? 36  TRP A C   1 
ATOM   282  O O   . TRP A 1 36 ? 15.827 -7.316  23.179  1.00 12.84  ? 36  TRP A O   1 
ATOM   283  C CB  . TRP A 1 36 ? 18.115 -8.570  24.553  1.00 13.41  ? 36  TRP A CB  1 
ATOM   284  C CG  . TRP A 1 36 ? 19.462 -9.185  24.904  1.00 14.24  ? 36  TRP A CG  1 
ATOM   285  C CD1 . TRP A 1 36 ? 20.505 -9.438  24.052  1.00 16.82  ? 36  TRP A CD1 1 
ATOM   286  C CD2 . TRP A 1 36 ? 19.887 -9.612  26.195  1.00 14.88  ? 36  TRP A CD2 1 
ATOM   287  N NE1 . TRP A 1 36 ? 21.562 -9.989  24.743  1.00 17.13  ? 36  TRP A NE1 1 
ATOM   288  C CE2 . TRP A 1 36 ? 21.204 -10.113 26.059  1.00 14.61  ? 36  TRP A CE2 1 
ATOM   289  C CE3 . TRP A 1 36 ? 19.282 -9.631  27.457  1.00 17.19  ? 36  TRP A CE3 1 
ATOM   290  C CZ2 . TRP A 1 36 ? 21.927 -10.626 27.146  1.00 16.76  ? 36  TRP A CZ2 1 
ATOM   291  C CZ3 . TRP A 1 36 ? 19.996 -10.151 28.533  1.00 17.90  ? 36  TRP A CZ3 1 
ATOM   292  C CH2 . TRP A 1 36 ? 21.304 -10.641 28.367  1.00 17.04  ? 36  TRP A CH2 1 
ATOM   293  N N   . ALA A 1 37 ? 15.276 -9.461  22.764  1.00 12.28  ? 37  ALA A N   1 
ATOM   294  C CA  . ALA A 1 37 ? 13.847 -9.197  22.641  1.00 12.23  ? 37  ALA A CA  1 
ATOM   295  C C   . ALA A 1 37 ? 13.147 -9.741  23.872  1.00 12.32  ? 37  ALA A C   1 
ATOM   296  O O   . ALA A 1 37 ? 13.279 -10.924 24.174  1.00 12.70  ? 37  ALA A O   1 
ATOM   297  C CB  . ALA A 1 37 ? 13.311 -9.857  21.379  1.00 13.23  ? 37  ALA A CB  1 
ATOM   298  N N   . PHE A 1 38 ? 12.403 -8.897  24.578  1.00 12.66  ? 38  PHE A N   1 
ATOM   299  C CA  . PHE A 1 38 ? 11.797 -9.272  25.854  1.00 12.50  ? 38  PHE A CA  1 
ATOM   300  C C   . PHE A 1 38 ? 10.350 -9.709  25.723  1.00 12.99  ? 38  PHE A C   1 
ATOM   301  O O   . PHE A 1 38 ? 9.518  -8.980  25.172  1.00 13.39  ? 38  PHE A O   1 
ATOM   302  C CB  . PHE A 1 38 ? 11.924 -8.100  26.832  1.00 12.91  ? 38  PHE A CB  1 
ATOM   303  C CG  . PHE A 1 38 ? 13.322 -7.901  27.332  1.00 13.78  ? 38  PHE A CG  1 
ATOM   304  C CD1 . PHE A 1 38 ? 14.296 -7.307  26.526  1.00 13.55  ? 38  PHE A CD1 1 
ATOM   305  C CD2 . PHE A 1 38 ? 13.669 -8.325  28.603  1.00 14.98  ? 38  PHE A CD2 1 
ATOM   306  C CE1 . PHE A 1 38 ? 15.617 -7.142  26.984  1.00 15.09  ? 38  PHE A CE1 1 
ATOM   307  C CE2 . PHE A 1 38 ? 14.977 -8.162  29.084  1.00 16.04  ? 38  PHE A CE2 1 
ATOM   308  C CZ  . PHE A 1 38 ? 15.949 -7.571  28.266  1.00 14.12  ? 38  PHE A CZ  1 
ATOM   309  N N   . PHE A 1 39 ? 10.049 -10.884 26.265  1.00 12.26  ? 39  PHE A N   1 
ATOM   310  C CA  . PHE A 1 39 ? 8.721  -11.498 26.162  1.00 13.02  ? 39  PHE A CA  1 
ATOM   311  C C   . PHE A 1 39 ? 8.278  -11.956 27.540  1.00 13.18  ? 39  PHE A C   1 
ATOM   312  O O   . PHE A 1 39 ? 9.094  -12.451 28.314  1.00 13.76  ? 39  PHE A O   1 
ATOM   313  C CB  . PHE A 1 39 ? 8.766  -12.764 25.301  1.00 12.75  ? 39  PHE A CB  1 
ATOM   314  C CG  . PHE A 1 39 ? 8.986  -12.532 23.837  1.00 12.38  ? 39  PHE A CG  1 
ATOM   315  C CD1 . PHE A 1 39 ? 10.273 -12.365 23.330  1.00 13.39  ? 39  PHE A CD1 1 
ATOM   316  C CD2 . PHE A 1 39 ? 7.911  -12.540 22.945  1.00 13.10  ? 39  PHE A CD2 1 
ATOM   317  C CE1 . PHE A 1 39 ? 10.487 -12.185 21.973  1.00 13.42  ? 39  PHE A CE1 1 
ATOM   318  C CE2 . PHE A 1 39 ? 8.128  -12.371 21.580  1.00 12.74  ? 39  PHE A CE2 1 
ATOM   319  C CZ  . PHE A 1 39 ? 9.422  -12.190 21.090  1.00 13.48  ? 39  PHE A CZ  1 
ATOM   320  N N   . PRO A 1 40 ? 6.970  -11.868 27.844  1.00 12.63  ? 40  PRO A N   1 
ATOM   321  C CA  . PRO A 1 40 ? 6.525  -12.447 29.102  1.00 12.76  ? 40  PRO A CA  1 
ATOM   322  C C   . PRO A 1 40 ? 6.811  -13.947 29.206  1.00 12.27  ? 40  PRO A C   1 
ATOM   323  O O   . PRO A 1 40 ? 7.083  -14.442 30.296  1.00 13.55  ? 40  PRO A O   1 
ATOM   324  C CB  . PRO A 1 40 ? 5.014  -12.167 29.098  1.00 12.26  ? 40  PRO A CB  1 
ATOM   325  C CG  . PRO A 1 40 ? 4.885  -10.925 28.273  1.00 14.41  ? 40  PRO A CG  1 
ATOM   326  C CD  . PRO A 1 40 ? 5.883  -11.144 27.160  1.00 12.76  ? 40  PRO A CD  1 
ATOM   327  N N   . ALA A 1 41 ? 6.714  -14.664 28.089  1.00 11.86  ? 41  ALA A N   1 
ATOM   328  C CA  . ALA A 1 41 ? 7.050  -16.090 28.058  1.00 12.43  ? 41  ALA A CA  1 
ATOM   329  C C   . ALA A 1 41 ? 7.493  -16.420 26.651  1.00 12.34  ? 41  ALA A C   1 
ATOM   330  O O   . ALA A 1 41 ? 7.200  -15.669 25.715  1.00 13.34  ? 41  ALA A O   1 
ATOM   331  C CB  . ALA A 1 41 ? 5.842  -16.950 28.460  1.00 12.38  ? 41  ALA A CB  1 
ATOM   332  N N   . PRO A 1 42 ? 8.214  -17.541 26.481  1.00 12.19  ? 42  PRO A N   1 
ATOM   333  C CA  . PRO A 1 42 ? 8.574  -17.930 25.120  1.00 12.24  ? 42  PRO A CA  1 
ATOM   334  C C   . PRO A 1 42 ? 7.366  -18.106 24.214  1.00 12.46  ? 42  PRO A C   1 
ATOM   335  O O   . PRO A 1 42 ? 6.275  -18.431 24.685  1.00 12.63  ? 42  PRO A O   1 
ATOM   336  C CB  . PRO A 1 42 ? 9.344  -19.243 25.315  1.00 12.34  ? 42  PRO A CB  1 
ATOM   337  C CG  . PRO A 1 42 ? 9.897  -19.150 26.716  1.00 12.40  ? 42  PRO A CG  1 
ATOM   338  C CD  . PRO A 1 42 ? 8.767  -18.474 27.481  1.00 12.11  ? 42  PRO A CD  1 
ATOM   339  N N   . VAL A 1 43 ? 7.575  -17.850 22.924  1.00 12.27  ? 43  VAL A N   1 
ATOM   340  C CA  . VAL A 1 43 ? 6.537  -18.009 21.913  1.00 12.54  ? 43  VAL A CA  1 
ATOM   341  C C   . VAL A 1 43 ? 7.148  -18.687 20.697  1.00 12.03  ? 43  VAL A C   1 
ATOM   342  O O   . VAL A 1 43 ? 8.376  -18.763 20.561  1.00 12.61  ? 43  VAL A O   1 
ATOM   343  C CB  . VAL A 1 43 ? 5.918  -16.647 21.487  1.00 12.61  ? 43  VAL A CB  1 
ATOM   344  C CG1 . VAL A 1 43 ? 5.225  -15.971 22.663  1.00 15.32  ? 43  VAL A CG1 1 
ATOM   345  C CG2 . VAL A 1 43 ? 6.998  -15.713 20.903  1.00 12.92  ? 43  VAL A CG2 1 
ATOM   346  N N   . ASP A 1 44 ? 6.295  -19.180 19.815  1.00 12.78  ? 44  ASP A N   1 
ATOM   347  C CA  . ASP A 1 44 ? 6.709  -19.827 18.594  1.00 13.01  ? 44  ASP A CA  1 
ATOM   348  C C   . ASP A 1 44 ? 7.283  -18.826 17.567  1.00 13.40  ? 44  ASP A C   1 
ATOM   349  O O   . ASP A 1 44 ? 6.563  -17.985 17.047  1.00 13.54  ? 44  ASP A O   1 
ATOM   350  C CB  . ASP A 1 44 ? 5.491  -20.593 18.059  1.00 13.21  ? 44  ASP A CB  1 
ATOM   351  C CG  . ASP A 1 44 ? 5.726  -21.237 16.726  1.00 14.42  ? 44  ASP A CG  1 
ATOM   352  O OD1 . ASP A 1 44 ? 6.882  -21.433 16.325  1.00 16.60  ? 44  ASP A OD1 1 
ATOM   353  O OD2 . ASP A 1 44 ? 4.714  -21.574 16.069  1.00 16.72  ? 44  ASP A OD2 1 
ATOM   354  N N   . LEU A 1 45 ? 8.588  -18.917 17.311  1.00 13.06  ? 45  LEU A N   1 
ATOM   355  C CA  . LEU A 1 45 ? 9.299  -18.099 16.322  1.00 13.75  ? 45  LEU A CA  1 
ATOM   356  C C   . LEU A 1 45 ? 10.223 -19.006 15.522  1.00 13.94  ? 45  LEU A C   1 
ATOM   357  O O   . LEU A 1 45 ? 10.696 -20.008 16.059  1.00 14.77  ? 45  LEU A O   1 
ATOM   358  C CB  . LEU A 1 45 ? 10.133 -17.016 17.006  1.00 14.04  ? 45  LEU A CB  1 
ATOM   359  C CG  . LEU A 1 45 ? 9.371  -15.973 17.819  1.00 14.68  ? 45  LEU A CG  1 
ATOM   360  C CD1 . LEU A 1 45 ? 10.308 -15.195 18.729  1.00 15.51  ? 45  LEU A CD1 1 
ATOM   361  C CD2 . LEU A 1 45 ? 8.613  -15.028 16.901  1.00 14.61  ? 45  LEU A CD2 1 
ATOM   362  N N   . PRO A 1 46 ? 10.479 -18.668 14.243  1.00 14.14  ? 46  PRO A N   1 
ATOM   363  C CA  . PRO A 1 46 ? 11.282 -19.514 13.355  1.00 14.24  ? 46  PRO A CA  1 
ATOM   364  C C   . PRO A 1 46 ? 12.792 -19.243 13.344  1.00 14.44  ? 46  PRO A C   1 
ATOM   365  O O   . PRO A 1 46 ? 13.522 -19.898 12.606  1.00 15.95  ? 46  PRO A O   1 
ATOM   366  C CB  . PRO A 1 46 ? 10.698 -19.186 11.974  1.00 14.56  ? 46  PRO A CB  1 
ATOM   367  C CG  . PRO A 1 46 ? 10.342 -17.752 12.084  1.00 14.65  ? 46  PRO A CG  1 
ATOM   368  C CD  . PRO A 1 46 ? 9.910  -17.514 13.514  1.00 14.00  ? 46  PRO A CD  1 
ATOM   369  N N   . TYR A 1 47 ? 13.267 -18.315 14.168  1.00 12.51  ? 47  TYR A N   1 
ATOM   370  C CA  . TYR A 1 47 ? 14.606 -17.746 13.966  1.00 12.40  ? 47  TYR A CA  1 
ATOM   371  C C   . TYR A 1 47 ? 15.757 -18.462 14.644  1.00 11.94  ? 47  TYR A C   1 
ATOM   372  O O   . TYR A 1 47 ? 16.911 -18.119 14.407  1.00 11.85  ? 47  TYR A O   1 
ATOM   373  C CB  . TYR A 1 47 ? 14.639 -16.243 14.319  1.00 12.12  ? 47  TYR A CB  1 
ATOM   374  C CG  . TYR A 1 47 ? 13.574 -15.479 13.564  1.00 13.20  ? 47  TYR A CG  1 
ATOM   375  C CD1 . TYR A 1 47 ? 12.547 -14.836 14.245  1.00 14.24  ? 47  TYR A CD1 1 
ATOM   376  C CD2 . TYR A 1 47 ? 13.569 -15.453 12.168  1.00 13.39  ? 47  TYR A CD2 1 
ATOM   377  C CE1 . TYR A 1 47 ? 11.541 -14.146 13.555  1.00 15.50  ? 47  TYR A CE1 1 
ATOM   378  C CE2 . TYR A 1 47 ? 12.573 -14.791 11.473  1.00 15.28  ? 47  TYR A CE2 1 
ATOM   379  C CZ  . TYR A 1 47 ? 11.573 -14.137 12.170  1.00 14.31  ? 47  TYR A CZ  1 
ATOM   380  O OH  . TYR A 1 47 ? 10.605 -13.489 11.427  1.00 14.87  ? 47  TYR A OH  1 
ATOM   381  N N   . GLU A 1 48 ? 15.444 -19.441 15.494  1.00 11.48  ? 48  GLU A N   1 
ATOM   382  C CA  . GLU A 1 48 ? 16.472 -20.161 16.265  1.00 11.97  ? 48  GLU A CA  1 
ATOM   383  C C   . GLU A 1 48 ? 17.294 -19.206 17.135  1.00 11.68  ? 48  GLU A C   1 
ATOM   384  O O   . GLU A 1 48 ? 18.506 -19.389 17.316  1.00 12.50  ? 48  GLU A O   1 
ATOM   385  C CB  . GLU A 1 48 ? 17.360 -21.029 15.370  1.00 11.92  ? 48  GLU A CB  1 
ATOM   386  C CG  . GLU A 1 48 ? 16.541 -22.081 14.605  1.00 12.81  ? 48  GLU A CG  1 
ATOM   387  C CD  . GLU A 1 48 ? 17.352 -22.980 13.680  1.00 13.64  ? 48  GLU A CD  1 
ATOM   388  O OE1 . GLU A 1 48 ? 18.583 -23.090 13.846  1.00 15.13  ? 48  GLU A OE1 1 
ATOM   389  O OE2 . GLU A 1 48 ? 16.733 -23.586 12.779  1.00 15.25  ? 48  GLU A OE2 1 
ATOM   390  N N   . GLY A 1 49 ? 16.636 -18.187 17.668  1.00 11.42  ? 49  GLY A N   1 
ATOM   391  C CA  . GLY A 1 49 ? 17.258 -17.391 18.718  1.00 11.58  ? 49  GLY A CA  1 
ATOM   392  C C   . GLY A 1 49 ? 17.347 -18.212 19.994  1.00 11.46  ? 49  GLY A C   1 
ATOM   393  O O   . GLY A 1 49 ? 16.817 -19.325 20.078  1.00 12.72  ? 49  GLY A O   1 
ATOM   394  N N   . VAL A 1 50 ? 17.994 -17.652 21.004  1.00 11.13  ? 50  VAL A N   1 
ATOM   395  C CA  . VAL A 1 50 ? 18.192 -18.363 22.267  1.00 10.90  ? 50  VAL A CA  1 
ATOM   396  C C   . VAL A 1 50 ? 17.211 -17.810 23.291  1.00 10.79  ? 50  VAL A C   1 
ATOM   397  O O   . VAL A 1 50 ? 17.146 -16.598 23.515  1.00 11.07  ? 50  VAL A O   1 
ATOM   398  C CB  . VAL A 1 50 ? 19.613 -18.145 22.785  1.00 10.80  ? 50  VAL A CB  1 
ATOM   399  C CG1 . VAL A 1 50 ? 19.785 -18.811 24.145  1.00 11.65  ? 50  VAL A CG1 1 
ATOM   400  C CG2 . VAL A 1 50 ? 20.635 -18.687 21.787  1.00 11.69  ? 50  VAL A CG2 1 
ATOM   401  N N   . TRP A 1 51 ? 16.448 -18.713 23.904  1.00 10.38  ? 51  TRP A N   1 
ATOM   402  C CA  . TRP A 1 51 ? 15.557 -18.367 25.016  1.00 10.30  ? 51  TRP A CA  1 
ATOM   403  C C   . TRP A 1 51 ? 16.288 -18.438 26.349  1.00 11.03  ? 51  TRP A C   1 
ATOM   404  O O   . TRP A 1 51 ? 16.919 -19.451 26.669  1.00 10.36  ? 51  TRP A O   1 
ATOM   405  C CB  . TRP A 1 51 ? 14.325 -19.288 25.067  1.00 10.85  ? 51  TRP A CB  1 
ATOM   406  C CG  . TRP A 1 51 ? 13.349 -19.021 23.963  1.00 10.91  ? 51  TRP A CG  1 
ATOM   407  C CD1 . TRP A 1 51 ? 13.075 -19.822 22.886  1.00 11.23  ? 51  TRP A CD1 1 
ATOM   408  C CD2 . TRP A 1 51 ? 12.512 -17.867 23.827  1.00 10.88  ? 51  TRP A CD2 1 
ATOM   409  N NE1 . TRP A 1 51 ? 12.107 -19.232 22.100  1.00 11.16  ? 51  TRP A NE1 1 
ATOM   410  C CE2 . TRP A 1 51 ? 11.754 -18.030 22.656  1.00 10.61  ? 51  TRP A CE2 1 
ATOM   411  C CE3 . TRP A 1 51 ? 12.336 -16.704 24.592  1.00 10.87  ? 51  TRP A CE3 1 
ATOM   412  C CZ2 . TRP A 1 51 ? 10.841 -17.060 22.210  1.00 11.19  ? 51  TRP A CZ2 1 
ATOM   413  C CZ3 . TRP A 1 51 ? 11.418 -15.748 24.154  1.00 11.57  ? 51  TRP A CZ3 1 
ATOM   414  C CH2 . TRP A 1 51 ? 10.681 -15.939 22.970  1.00 12.46  ? 51  TRP A CH2 1 
ATOM   415  N N   . GLU A 1 52 ? 16.177 -17.361 27.125  1.00 11.08  ? 52  GLU A N   1 
ATOM   416  C CA  . GLU A 1 52 ? 16.809 -17.266 28.431  1.00 12.45  ? 52  GLU A CA  1 
ATOM   417  C C   . GLU A 1 52 ? 15.888 -16.520 29.396  1.00 12.25  ? 52  GLU A C   1 
ATOM   418  O O   . GLU A 1 52 ? 15.339 -15.476 29.048  1.00 12.58  ? 52  GLU A O   1 
ATOM   419  C CB  . GLU A 1 52 ? 18.148 -16.526 28.301  1.00 12.61  ? 52  GLU A CB  1 
ATOM   420  C CG  . GLU A 1 52 ? 18.899 -16.304 29.631  1.00 14.32  ? 52  GLU A CG  1 
ATOM   421  C CD  . GLU A 1 52 ? 20.216 -15.556 29.464  1.00 15.92  ? 52  GLU A CD  1 
ATOM   422  O OE1 . GLU A 1 52 ? 20.683 -15.416 28.325  1.00 19.12  ? 52  GLU A OE1 1 
ATOM   423  O OE2 . GLU A 1 52 ? 20.780 -15.113 30.492  1.00 21.40  ? 52  GLU A OE2 1 
ATOM   424  N N   . GLU A 1 53 ? 15.707 -17.051 30.597  1.00 12.73  ? 53  GLU A N   1 
ATOM   425  C CA  . GLU A 1 53 ? 14.893 -16.339 31.584  1.00 14.63  ? 53  GLU A CA  1 
ATOM   426  C C   . GLU A 1 53 ? 15.730 -15.315 32.323  1.00 16.56  ? 53  GLU A C   1 
ATOM   427  O O   . GLU A 1 53 ? 16.856 -15.607 32.735  1.00 16.39  ? 53  GLU A O   1 
ATOM   428  C CB  . GLU A 1 53 ? 14.223 -17.305 32.565  1.00 13.87  ? 53  GLU A CB  1 
ATOM   429  C CG  . GLU A 1 53 ? 13.132 -16.625 33.413  1.00 15.03  ? 53  GLU A CG  1 
ATOM   430  C CD  . GLU A 1 53 ? 12.267 -17.605 34.187  1.00 16.66  ? 53  GLU A CD  1 
ATOM   431  O OE1 . GLU A 1 53 ? 12.649 -18.788 34.324  1.00 18.89  ? 53  GLU A OE1 1 
ATOM   432  O OE2 . GLU A 1 53 ? 11.198 -17.171 34.669  1.00 20.51  ? 53  GLU A OE2 1 
ATOM   433  N N   . VAL A 1 54 ? 15.153 -14.129 32.498  1.00 19.28  ? 54  VAL A N   1 
ATOM   434  C CA  . VAL A 1 54 ? 15.812 -13.037 33.203  1.00 22.41  ? 54  VAL A CA  1 
ATOM   435  C C   . VAL A 1 54 ? 14.929 -12.524 34.336  1.00 23.97  ? 54  VAL A C   1 
ATOM   436  O O   . VAL A 1 54 ? 13.700 -12.513 34.218  1.00 24.18  ? 54  VAL A O   1 
ATOM   437  C CB  . VAL A 1 54 ? 16.184 -11.879 32.238  1.00 22.70  ? 54  VAL A CB  1 
ATOM   438  C CG1 . VAL A 1 54 ? 17.266 -12.322 31.254  1.00 24.14  ? 54  VAL A CG1 1 
ATOM   439  C CG2 . VAL A 1 54 ? 14.943 -11.327 31.500  1.00 23.36  ? 54  VAL A CG2 1 
ATOM   440  N N   . GLY A 1 55 ? 15.556 -12.123 35.439  1.00 26.36  ? 55  GLY A N   1 
ATOM   441  C CA  . GLY A 1 55 ? 14.845 -11.456 36.531  1.00 29.13  ? 55  GLY A CA  1 
ATOM   442  C C   . GLY A 1 55 ? 14.750 -9.970  36.235  1.00 30.90  ? 55  GLY A C   1 
ATOM   443  O O   . GLY A 1 55 ? 15.510 -9.447  35.413  1.00 31.72  ? 55  GLY A O   1 
ATOM   444  N N   . ASP A 1 56 ? 13.813 -9.288  36.890  1.00 32.29  ? 56  ASP A N   1 
ATOM   445  C CA  . ASP A 1 56 ? 13.643 -7.844  36.717  1.00 33.41  ? 56  ASP A CA  1 
ATOM   446  C C   . ASP A 1 56 ? 14.875 -7.077  37.198  1.00 33.75  ? 56  ASP A C   1 
ATOM   447  O O   . ASP A 1 56 ? 15.236 -6.045  36.624  1.00 34.01  ? 56  ASP A O   1 
ATOM   448  C CB  . ASP A 1 56 ? 12.388 -7.352  37.449  1.00 33.79  ? 56  ASP A CB  1 
ATOM   449  C CG  . ASP A 1 56 ? 11.110 -7.978  36.913  1.00 34.87  ? 56  ASP A CG  1 
ATOM   450  O OD1 . ASP A 1 56 ? 11.005 -8.185  35.683  1.00 35.63  ? 56  ASP A OD1 1 
ATOM   451  O OD2 . ASP A 1 56 ? 10.202 -8.262  37.727  1.00 36.72  ? 56  ASP A OD2 1 
ATOM   452  N N   . GLU A 1 57 ? 15.514 -7.595  38.247  1.00 33.94  ? 57  GLU A N   1 
ATOM   453  C CA  . GLU A 1 57 ? 16.714 -6.984  38.812  1.00 34.33  ? 57  GLU A CA  1 
ATOM   454  C C   . GLU A 1 57 ? 17.549 -8.014  39.565  1.00 34.55  ? 57  GLU A C   1 
ATOM   455  O O   . GLU A 1 57 ? 18.717 -7.776  39.872  1.00 34.76  ? 57  GLU A O   1 
ATOM   456  N N   . TRP A 1 59 ? 20.635 -7.322  37.759  1.00 31.49  ? 59  TRP A N   1 
ATOM   457  C CA  . TRP A 1 59 ? 21.849 -6.532  37.954  1.00 31.54  ? 59  TRP A CA  1 
ATOM   458  C C   . TRP A 1 59 ? 22.175 -6.363  39.437  1.00 31.66  ? 59  TRP A C   1 
ATOM   459  O O   . TRP A 1 59 ? 23.329 -6.136  39.807  1.00 32.03  ? 59  TRP A O   1 
ATOM   460  C CB  . TRP A 1 59 ? 21.732 -5.166  37.266  1.00 31.58  ? 59  TRP A CB  1 
ATOM   461  C CG  . TRP A 1 59 ? 20.662 -4.269  37.836  1.00 31.45  ? 59  TRP A CG  1 
ATOM   462  C CD1 . TRP A 1 59 ? 19.353 -4.208  37.455  1.00 31.38  ? 59  TRP A CD1 1 
ATOM   463  C CD2 . TRP A 1 59 ? 20.821 -3.302  38.883  1.00 31.33  ? 59  TRP A CD2 1 
ATOM   464  N NE1 . TRP A 1 59 ? 18.685 -3.263  38.198  1.00 31.63  ? 59  TRP A NE1 1 
ATOM   465  C CE2 . TRP A 1 59 ? 19.563 -2.692  39.082  1.00 31.30  ? 59  TRP A CE2 1 
ATOM   466  C CE3 . TRP A 1 59 ? 21.908 -2.889  39.669  1.00 31.26  ? 59  TRP A CE3 1 
ATOM   467  C CZ2 . TRP A 1 59 ? 19.357 -1.695  40.040  1.00 31.47  ? 59  TRP A CZ2 1 
ATOM   468  C CZ3 . TRP A 1 59 ? 21.702 -1.894  40.622  1.00 31.42  ? 59  TRP A CZ3 1 
ATOM   469  C CH2 . TRP A 1 59 ? 20.434 -1.310  40.797  1.00 31.47  ? 59  TRP A CH2 1 
ATOM   470  N N   . MET B 2 1  ? 30.741 16.915  32.712  1.00 25.85  ? 1   MET B N   1 
ATOM   471  C CA  . MET B 2 1  ? 30.419 17.823  31.570  1.00 25.51  ? 1   MET B CA  1 
ATOM   472  C C   . MET B 2 1  ? 29.096 17.532  30.821  1.00 24.90  ? 1   MET B C   1 
ATOM   473  O O   . MET B 2 1  ? 28.707 18.323  29.954  1.00 26.19  ? 1   MET B O   1 
ATOM   474  C CB  . MET B 2 1  ? 31.596 17.872  30.571  1.00 26.08  ? 1   MET B CB  1 
ATOM   475  C CG  . MET B 2 1  ? 31.614 16.718  29.579  1.00 26.59  ? 1   MET B CG  1 
ATOM   476  S SD  . MET B 2 1  ? 32.856 16.859  28.284  1.00 24.37  ? 1   MET B SD  1 
ATOM   477  C CE  . MET B 2 1  ? 32.113 15.880  26.994  1.00 26.92  ? 1   MET B CE  1 
ATOM   478  N N   . LYS B 2 2  ? 28.370 16.452  31.126  1.00 23.20  ? 2   LYS B N   1 
ATOM   479  C CA  . LYS B 2 2  ? 28.558 15.537  32.261  1.00 20.59  ? 2   LYS B CA  1 
ATOM   480  C C   . LYS B 2 2  ? 29.293 14.272  31.821  1.00 18.38  ? 2   LYS B C   1 
ATOM   481  O O   . LYS B 2 2  ? 29.404 14.023  30.627  1.00 19.47  ? 2   LYS B O   1 
ATOM   482  C CB  . LYS B 2 2  ? 27.180 15.156  32.798  1.00 20.62  ? 2   LYS B CB  1 
ATOM   483  C CG  . LYS B 2 2  ? 26.385 16.333  33.326  1.00 21.29  ? 2   LYS B CG  1 
ATOM   484  C CD  . LYS B 2 2  ? 24.949 15.931  33.646  1.00 22.68  ? 2   LYS B CD  1 
ATOM   485  C CE  . LYS B 2 2  ? 24.201 17.087  34.304  1.00 23.37  ? 2   LYS B CE  1 
ATOM   486  N NZ  . LYS B 2 2  ? 22.823 16.719  34.732  1.00 24.48  ? 2   LYS B NZ  1 
ATOM   487  N N   . LYS B 2 3  ? 29.763 13.469  32.779  1.00 15.79  ? 3   LYS B N   1 
ATOM   488  C CA  . LYS B 2 3  ? 30.424 12.191  32.455  1.00 13.80  ? 3   LYS B CA  1 
ATOM   489  C C   . LYS B 2 3  ? 29.418 11.082  32.195  1.00 12.94  ? 3   LYS B C   1 
ATOM   490  O O   . LYS B 2 3  ? 28.513 10.822  33.001  1.00 13.61  ? 3   LYS B O   1 
ATOM   491  C CB  . LYS B 2 3  ? 31.386 11.782  33.552  1.00 14.00  ? 3   LYS B CB  1 
ATOM   492  C CG  . LYS B 2 3  ? 32.596 12.665  33.558  1.00 13.55  ? 3   LYS B CG  1 
ATOM   493  C CD  . LYS B 2 3  ? 33.281 12.569  34.874  1.00 13.82  ? 3   LYS B CD  1 
ATOM   494  C CE  . LYS B 2 3  ? 34.449 13.510  34.898  1.00 11.27  ? 3   LYS B CE  1 
ATOM   495  N NZ  . LYS B 2 3  ? 34.889 13.567  36.298  1.00 12.11  ? 3   LYS B NZ  1 
ATOM   496  N N   . VAL B 2 4  ? 29.571 10.443  31.051  1.00 11.49  ? 4   VAL B N   1 
ATOM   497  C CA  . VAL B 2 4  ? 28.686 9.359   30.636  1.00 12.17  ? 4   VAL B CA  1 
ATOM   498  C C   . VAL B 2 4  ? 29.046 8.047   31.326  1.00 12.55  ? 4   VAL B C   1 
ATOM   499  O O   . VAL B 2 4  ? 30.227 7.664   31.389  1.00 12.06  ? 4   VAL B O   1 
ATOM   500  C CB  . VAL B 2 4  ? 28.759 9.174   29.113  1.00 12.15  ? 4   VAL B CB  1 
ATOM   501  C CG1 . VAL B 2 4  ? 27.872 8.009   28.629  1.00 14.53  ? 4   VAL B CG1 1 
ATOM   502  C CG2 . VAL B 2 4  ? 28.323 10.448  28.415  1.00 13.72  ? 4   VAL B CG2 1 
ATOM   503  N N   . VAL B 2 5  ? 28.030 7.347   31.834  1.00 12.15  ? 5   VAL B N   1 
ATOM   504  C CA  . VAL B 2 5  ? 28.232 5.997   32.374  1.00 12.80  ? 5   VAL B CA  1 
ATOM   505  C C   . VAL B 2 5  ? 27.664 4.886   31.493  1.00 13.09  ? 5   VAL B C   1 
ATOM   506  O O   . VAL B 2 5  ? 28.087 3.738   31.602  1.00 13.42  ? 5   VAL B O   1 
ATOM   507  C CB  . VAL B 2 5  ? 27.723 5.838   33.829  1.00 13.10  ? 5   VAL B CB  1 
ATOM   508  C CG1 . VAL B 2 5  ? 28.459 6.791   34.787  1.00 15.21  ? 5   VAL B CG1 1 
ATOM   509  C CG2 . VAL B 2 5  ? 26.229 6.031   33.915  1.00 14.92  ? 5   VAL B CG2 1 
ATOM   510  N N   . ALA B 2 6  ? 26.704 5.213   30.635  1.00 11.97  ? 6   ALA B N   1 
ATOM   511  C CA  . ALA B 2 6  ? 26.138 4.208   29.754  1.00 12.27  ? 6   ALA B CA  1 
ATOM   512  C C   . ALA B 2 6  ? 25.382 4.840   28.623  1.00 11.86  ? 6   ALA B C   1 
ATOM   513  O O   . ALA B 2 6  ? 24.874 5.961   28.752  1.00 12.23  ? 6   ALA B O   1 
ATOM   514  C CB  . ALA B 2 6  ? 25.195 3.299   30.532  1.00 12.90  ? 6   ALA B CB  1 
ATOM   515  N N   . VAL B 2 7  ? 25.285 4.095   27.533  1.00 12.54  ? 7   VAL B N   1 
ATOM   516  C CA  . VAL B 2 7  ? 24.362 4.409   26.456  1.00 13.98  ? 7   VAL B CA  1 
ATOM   517  C C   . VAL B 2 7  ? 23.551 3.154   26.176  1.00 14.07  ? 7   VAL B C   1 
ATOM   518  O O   . VAL B 2 7  ? 24.092 2.044   26.087  1.00 15.17  ? 7   VAL B O   1 
ATOM   519  C CB  . VAL B 2 7  ? 25.080 4.954   25.195  1.00 15.74  ? 7   VAL B CB  1 
ATOM   520  C CG1 . VAL B 2 7  ? 26.098 3.976   24.662  1.00 17.97  ? 7   VAL B CG1 1 
ATOM   521  C CG2 . VAL B 2 7  ? 24.085 5.390   24.106  1.00 17.47  ? 7   VAL B CG2 1 
ATOM   522  N N   . VAL B 2 8  ? 22.243 3.338   26.082  1.00 12.55  ? 8   VAL B N   1 
ATOM   523  C CA  . VAL B 2 8  ? 21.281 2.240   25.985  1.00 12.93  ? 8   VAL B CA  1 
ATOM   524  C C   . VAL B 2 8  ? 20.515 2.423   24.685  1.00 11.92  ? 8   VAL B C   1 
ATOM   525  O O   . VAL B 2 8  ? 19.899 3.473   24.486  1.00 12.28  ? 8   VAL B O   1 
ATOM   526  C CB  . VAL B 2 8  ? 20.298 2.287   27.193  1.00 13.18  ? 8   VAL B CB  1 
ATOM   527  C CG1 . VAL B 2 8  ? 19.220 1.236   27.049  1.00 14.52  ? 8   VAL B CG1 1 
ATOM   528  C CG2 . VAL B 2 8  ? 21.043 2.086   28.504  1.00 14.50  ? 8   VAL B CG2 1 
ATOM   529  N N   . LYS B 2 9  ? 20.554 1.421   23.812  1.00 12.08  ? 9   LYS B N   1 
ATOM   530  C CA  . LYS B 2 9  ? 19.926 1.476   22.497  1.00 11.82  ? 9   LYS B CA  1 
ATOM   531  C C   . LYS B 2 9  ? 18.742 0.504   22.501  1.00 11.02  ? 9   LYS B C   1 
ATOM   532  O O   . LYS B 2 9  ? 18.936 -0.711  22.596  1.00 11.22  ? 9   LYS B O   1 
ATOM   533  C CB  . LYS B 2 9  ? 20.944 1.097   21.413  1.00 13.47  ? 9   LYS B CB  1 
ATOM   534  C CG  . LYS B 2 9  ? 20.472 1.249   19.983  1.00 17.29  ? 9   LYS B CG  1 
ATOM   535  C CD  . LYS B 2 9  ? 21.646 1.196   19.023  1.00 21.69  ? 9   LYS B CD  1 
ATOM   536  C CE  . LYS B 2 9  ? 21.187 1.445   17.608  1.00 23.14  ? 9   LYS B CE  1 
ATOM   537  N NZ  . LYS B 2 9  ? 22.330 1.892   16.749  1.00 26.48  ? 9   LYS B NZ  1 
ATOM   538  N N   . LEU B 2 10 ? 17.530 1.057   22.427  1.00 10.89  ? 10  LEU B N   1 
ATOM   539  C CA  . LEU B 2 10 ? 16.289 0.273   22.492  1.00 11.36  ? 10  LEU B CA  1 
ATOM   540  C C   . LEU B 2 10 ? 15.445 0.502   21.245  1.00 11.98  ? 10  LEU B C   1 
ATOM   541  O O   . LEU B 2 10 ? 15.654 1.474   20.497  1.00 11.62  ? 10  LEU B O   1 
ATOM   542  C CB  . LEU B 2 10 ? 15.443 0.689   23.705  1.00 12.02  ? 10  LEU B CB  1 
ATOM   543  C CG  . LEU B 2 10 ? 16.092 0.716   25.096  1.00 11.91  ? 10  LEU B CG  1 
ATOM   544  C CD1 . LEU B 2 10 ? 15.110 1.210   26.172  1.00 13.34  ? 10  LEU B CD1 1 
ATOM   545  C CD2 . LEU B 2 10 ? 16.641 -0.671  25.446  1.00 12.52  ? 10  LEU B CD2 1 
ATOM   546  N N   . GLN B 2 11 ? 14.493 -0.404  21.023  1.00 11.46  ? 11  GLN B N   1 
ATOM   547  C CA  . GLN B 2 11 ? 13.311 -0.099  20.222  1.00 12.07  ? 11  GLN B CA  1 
ATOM   548  C C   . GLN B 2 11 ? 12.097 -0.398  21.079  1.00 10.94  ? 11  GLN B C   1 
ATOM   549  O O   . GLN B 2 11 ? 11.979 -1.479  21.670  1.00 11.27  ? 11  GLN B O   1 
ATOM   550  C CB  . GLN B 2 11 ? 13.271 -0.901  18.920  1.00 12.22  ? 11  GLN B CB  1 
ATOM   551  C CG  . GLN B 2 11 ? 14.306 -0.455  17.885  1.00 14.46  ? 11  GLN B CG  1 
ATOM   552  C CD  . GLN B 2 11 ? 14.114 -1.077  16.515  1.00 13.30  ? 11  GLN B CD  1 
ATOM   553  O OE1 . GLN B 2 11 ? 13.154 -1.800  16.264  1.00 14.63  ? 11  GLN B OE1 1 
ATOM   554  N NE2 . GLN B 2 11 ? 15.047 -0.778  15.610  1.00 14.81  ? 11  GLN B NE2 1 
ATOM   555  N N   . LEU B 2 12 ? 11.205 0.579   21.152  1.00 11.20  ? 12  LEU B N   1 
ATOM   556  C CA  . LEU B 2 12 ? 10.028 0.488   22.006  1.00 11.35  ? 12  LEU B CA  1 
ATOM   557  C C   . LEU B 2 12 ? 8.785  0.878   21.214  1.00 11.86  ? 12  LEU B C   1 
ATOM   558  O O   . LEU B 2 12 ? 8.865  1.704   20.303  1.00 12.42  ? 12  LEU B O   1 
ATOM   559  C CB  . LEU B 2 12 ? 10.166 1.417   23.225  1.00 12.49  ? 12  LEU B CB  1 
ATOM   560  C CG  . LEU B 2 12 ? 11.323 1.182   24.197  1.00 11.92  ? 12  LEU B CG  1 
ATOM   561  C CD1 . LEU B 2 12 ? 11.336 2.293   25.253  1.00 13.14  ? 12  LEU B CD1 1 
ATOM   562  C CD2 . LEU B 2 12 ? 11.247 -0.174  24.860  1.00 14.00  ? 12  LEU B CD2 1 
ATOM   563  N N   . PRO B 2 13 ? 7.632  0.288   21.544  1.00 11.75  ? 13  PRO B N   1 
ATOM   564  C CA  . PRO B 2 13 ? 6.393  0.684   20.877  1.00 11.88  ? 13  PRO B CA  1 
ATOM   565  C C   . PRO B 2 13 ? 6.005  2.108   21.272  1.00 11.54  ? 13  PRO B C   1 
ATOM   566  O O   . PRO B 2 13 ? 6.013  2.459   22.465  1.00 11.50  ? 13  PRO B O   1 
ATOM   567  C CB  . PRO B 2 13 ? 5.367  -0.342  21.382  1.00 12.49  ? 13  PRO B CB  1 
ATOM   568  C CG  . PRO B 2 13 ? 6.167  -1.449  21.941  1.00 15.10  ? 13  PRO B CG  1 
ATOM   569  C CD  . PRO B 2 13 ? 7.409  -0.805  22.498  1.00 13.58  ? 13  PRO B CD  1 
ATOM   570  N N   . ALA B 2 14 ? 5.709  2.918   20.258  1.00 12.06  ? 14  ALA B N   1 
ATOM   571  C CA  . ALA B 2 14 ? 5.306  4.309   20.471  1.00 12.53  ? 14  ALA B CA  1 
ATOM   572  C C   . ALA B 2 14 ? 4.201  4.453   21.519  1.00 12.27  ? 14  ALA B C   1 
ATOM   573  O O   . ALA B 2 14 ? 3.177  3.778   21.450  1.00 12.65  ? 14  ALA B O   1 
ATOM   574  C CB  . ALA B 2 14 ? 4.880  4.933   19.158  1.00 12.24  ? 14  ALA B CB  1 
ATOM   575  N N   . GLY B 2 15 ? 4.433  5.312   22.502  1.00 12.20  ? 15  GLY B N   1 
ATOM   576  C CA  . GLY B 2 15 ? 3.420  5.652   23.500  1.00 13.19  ? 15  GLY B CA  1 
ATOM   577  C C   . GLY B 2 15 ? 3.179  4.599   24.559  1.00 13.93  ? 15  GLY B C   1 
ATOM   578  O O   . GLY B 2 15 ? 2.376  4.812   25.480  1.00 14.74  ? 15  GLY B O   1 
ATOM   579  N N   . LYS B 2 16 ? 3.864  3.464   24.443  1.00 14.30  ? 16  LYS B N   1 
ATOM   580  C CA  . LYS B 2 16 ? 3.496  2.283   25.219  1.00 14.93  ? 16  LYS B CA  1 
ATOM   581  C C   . LYS B 2 16 ? 4.604  1.751   26.112  1.00 15.18  ? 16  LYS B C   1 
ATOM   582  O O   . LYS B 2 16 ? 4.544  0.595   26.560  1.00 17.38  ? 16  LYS B O   1 
ATOM   583  C CB  . LYS B 2 16 ? 2.958  1.179   24.291  1.00 15.48  ? 16  LYS B CB  1 
ATOM   584  C CG  . LYS B 2 16 ? 1.779  1.619   23.464  1.00 14.53  ? 16  LYS B CG  1 
ATOM   585  C CD  . LYS B 2 16 ? 1.412  0.609   22.389  1.00 16.34  ? 16  LYS B CD  1 
ATOM   586  C CE  . LYS B 2 16 ? 0.354  1.187   21.470  1.00 16.66  ? 16  LYS B CE  1 
ATOM   587  N NZ  . LYS B 2 16 ? 0.963  2.215   20.573  1.00 21.78  ? 16  LYS B NZ  1 
ATOM   588  N N   . ALA B 2 17 ? 5.615  2.576   26.388  1.00 14.31  ? 17  ALA B N   1 
ATOM   589  C CA  . ALA B 2 17 ? 6.668  2.173   27.325  1.00 14.31  ? 17  ALA B CA  1 
ATOM   590  C C   . ALA B 2 17 ? 6.109  1.971   28.730  1.00 13.96  ? 17  ALA B C   1 
ATOM   591  O O   . ALA B 2 17 ? 5.186  2.673   29.147  1.00 13.71  ? 17  ALA B O   1 
ATOM   592  C CB  . ALA B 2 17 ? 7.806  3.184   27.352  1.00 14.80  ? 17  ALA B CB  1 
ATOM   593  N N   . THR B 2 18 ? 6.694  1.028   29.458  1.00 13.42  ? 18  THR B N   1 
ATOM   594  C CA  . THR B 2 18 ? 6.398  0.849   30.878  1.00 13.71  ? 18  THR B CA  1 
ATOM   595  C C   . THR B 2 18 ? 7.720  0.647   31.622  1.00 13.65  ? 18  THR B C   1 
ATOM   596  O O   . THR B 2 18 ? 8.768  0.508   30.987  1.00 13.53  ? 18  THR B O   1 
ATOM   597  C CB  . THR B 2 18 ? 5.468  -0.362  31.143  1.00 13.60  ? 18  THR B CB  1 
ATOM   598  O OG1 . THR B 2 18 ? 6.216  -1.578  31.023  1.00 13.43  ? 18  THR B OG1 1 
ATOM   599  C CG2 . THR B 2 18 ? 4.290  -0.386  30.173  1.00 13.95  ? 18  THR B CG2 1 
ATOM   600  N N   . PRO B 2 19 ? 7.688  0.668   32.968  1.00 14.47  ? 19  PRO B N   1 
ATOM   601  C CA  . PRO B 2 19 ? 8.938  0.404   33.693  1.00 15.06  ? 19  PRO B CA  1 
ATOM   602  C C   . PRO B 2 19 ? 9.478  -1.021  33.572  1.00 15.46  ? 19  PRO B C   1 
ATOM   603  O O   . PRO B 2 19 ? 10.575 -1.308  34.081  1.00 16.44  ? 19  PRO B O   1 
ATOM   604  C CB  . PRO B 2 19 ? 8.572  0.698   35.152  1.00 15.42  ? 19  PRO B CB  1 
ATOM   605  C CG  . PRO B 2 19 ? 7.296  1.459   35.107  1.00 16.29  ? 19  PRO B CG  1 
ATOM   606  C CD  . PRO B 2 19 ? 6.585  1.028   33.878  1.00 14.80  ? 19  PRO B CD  1 
ATOM   607  N N   . ALA B 2 20 ? 8.718  -1.913  32.936  1.00 14.76  ? 20  ALA B N   1 
ATOM   608  C CA  . ALA B 2 20 ? 9.148  -3.299  32.785  1.00 14.90  ? 20  ALA B CA  1 
ATOM   609  C C   . ALA B 2 20 ? 10.362 -3.434  31.842  1.00 14.54  ? 20  ALA B C   1 
ATOM   610  O O   . ALA B 2 20 ? 10.716 -2.481  31.132  1.00 15.38  ? 20  ALA B O   1 
ATOM   611  C CB  . ALA B 2 20 ? 7.979  -4.155  32.314  1.00 15.03  ? 20  ALA B CB  1 
ATOM   612  N N   . PRO B 2 21 ? 11.035 -4.608  31.862  1.00 14.14  ? 21  PRO B N   1 
ATOM   613  C CA  . PRO B 2 21 ? 12.158 -4.842  30.942  1.00 14.04  ? 21  PRO B CA  1 
ATOM   614  C C   . PRO B 2 21 ? 11.760 -4.674  29.463  1.00 13.69  ? 21  PRO B C   1 
ATOM   615  O O   . PRO B 2 21 ? 10.657 -5.053  29.082  1.00 14.49  ? 21  PRO B O   1 
ATOM   616  C CB  . PRO B 2 21 ? 12.564 -6.289  31.258  1.00 14.61  ? 21  PRO B CB  1 
ATOM   617  C CG  . PRO B 2 21 ? 12.128 -6.482  32.685  1.00 14.48  ? 21  PRO B CG  1 
ATOM   618  C CD  . PRO B 2 21 ? 10.815 -5.766  32.752  1.00 14.50  ? 21  PRO B CD  1 
ATOM   619  N N   . PRO B 2 22 ? 12.658 -4.130  28.625  1.00 13.11  ? 22  PRO B N   1 
ATOM   620  C CA  . PRO B 2 22 ? 14.060 -3.787  28.869  1.00 12.66  ? 22  PRO B CA  1 
ATOM   621  C C   . PRO B 2 22 ? 14.311 -2.481  29.631  1.00 12.55  ? 22  PRO B C   1 
ATOM   622  O O   . PRO B 2 22 ? 15.433 -2.281  30.104  1.00 12.82  ? 22  PRO B O   1 
ATOM   623  C CB  . PRO B 2 22 ? 14.623 -3.650  27.449  1.00 12.79  ? 22  PRO B CB  1 
ATOM   624  C CG  . PRO B 2 22 ? 13.466 -3.132  26.647  1.00 13.24  ? 22  PRO B CG  1 
ATOM   625  C CD  . PRO B 2 22 ? 12.275 -3.862  27.223  1.00 12.54  ? 22  PRO B CD  1 
ATOM   626  N N   . VAL B 2 23 ? 13.303 -1.606  29.733  1.00 12.62  ? 23  VAL B N   1 
ATOM   627  C CA  . VAL B 2 23 ? 13.513 -0.272  30.309  1.00 12.84  ? 23  VAL B CA  1 
ATOM   628  C C   . VAL B 2 23 ? 14.016 -0.301  31.760  1.00 12.71  ? 23  VAL B C   1 
ATOM   629  O O   . VAL B 2 23 ? 15.015 0.339   32.078  1.00 12.50  ? 23  VAL B O   1 
ATOM   630  C CB  . VAL B 2 23 ? 12.248 0.590   30.197  1.00 13.26  ? 23  VAL B CB  1 
ATOM   631  C CG1 . VAL B 2 23 ? 12.412 1.921   30.933  1.00 14.48  ? 23  VAL B CG1 1 
ATOM   632  C CG2 . VAL B 2 23 ? 11.949 0.852   28.733  1.00 14.11  ? 23  VAL B CG2 1 
ATOM   633  N N   . GLY B 2 24 ? 13.324 -1.035  32.629  1.00 13.30  ? 24  GLY B N   1 
ATOM   634  C CA  . GLY B 2 24 ? 13.691 -1.087  34.042  1.00 13.39  ? 24  GLY B CA  1 
ATOM   635  C C   . GLY B 2 24 ? 15.145 -1.456  34.290  1.00 13.80  ? 24  GLY B C   1 
ATOM   636  O O   . GLY B 2 24 ? 15.878 -0.701  34.932  1.00 14.15  ? 24  GLY B O   1 
ATOM   637  N N   . PRO B 2 25 ? 15.569 -2.636  33.820  1.00 14.41  ? 25  PRO B N   1 
ATOM   638  C CA  . PRO B 2 25 ? 16.967 -3.008  34.057  1.00 14.89  ? 25  PRO B CA  1 
ATOM   639  C C   . PRO B 2 25 ? 17.996 -2.169  33.308  1.00 14.71  ? 25  PRO B C   1 
ATOM   640  O O   . PRO B 2 25 ? 19.065 -1.887  33.860  1.00 15.11  ? 25  PRO B O   1 
ATOM   641  C CB  . PRO B 2 25 ? 17.038 -4.471  33.606  1.00 15.29  ? 25  PRO B CB  1 
ATOM   642  C CG  . PRO B 2 25 ? 15.843 -4.687  32.749  1.00 16.74  ? 25  PRO B CG  1 
ATOM   643  C CD  . PRO B 2 25 ? 14.795 -3.701  33.159  1.00 15.01  ? 25  PRO B CD  1 
ATOM   644  N N   . ALA B 2 26 ? 17.688 -1.774  32.070  1.00 13.66  ? 26  ALA B N   1 
ATOM   645  C CA  . ALA B 2 26 ? 18.661 -1.046  31.239  1.00 13.78  ? 26  ALA B CA  1 
ATOM   646  C C   . ALA B 2 26 ? 18.992 0.308   31.857  1.00 13.24  ? 26  ALA B C   1 
ATOM   647  O O   . ALA B 2 26 ? 20.157 0.714   31.917  1.00 14.12  ? 26  ALA B O   1 
ATOM   648  C CB  . ALA B 2 26 ? 18.153 -0.892  29.806  1.00 14.40  ? 26  ALA B CB  1 
ATOM   649  N N   . LEU B 2 27 ? 17.960 1.025   32.285  1.00 13.15  ? 27  LEU B N   1 
ATOM   650  C CA  . LEU B 2 27 ? 18.164 2.304   32.962  1.00 13.58  ? 27  LEU B CA  1 
ATOM   651  C C   . LEU B 2 27 ? 18.482 2.181   34.438  1.00 13.29  ? 27  LEU B C   1 
ATOM   652  O O   . LEU B 2 27 ? 19.356 2.882   34.933  1.00 13.26  ? 27  LEU B O   1 
ATOM   653  C CB  . LEU B 2 27 ? 16.936 3.189   32.788  1.00 13.63  ? 27  LEU B CB  1 
ATOM   654  C CG  . LEU B 2 27 ? 16.957 4.058   31.534  1.00 14.92  ? 27  LEU B CG  1 
ATOM   655  C CD1 . LEU B 2 27 ? 16.948 3.227   30.242  1.00 15.92  ? 27  LEU B CD1 1 
ATOM   656  C CD2 . LEU B 2 27 ? 15.771 4.970   31.577  1.00 17.21  ? 27  LEU B CD2 1 
ATOM   657  N N   . GLY B 2 28 ? 17.768 1.291   35.127  1.00 13.39  ? 28  GLY B N   1 
ATOM   658  C CA  . GLY B 2 28 ? 17.880 1.162   36.571  1.00 14.13  ? 28  GLY B CA  1 
ATOM   659  C C   . GLY B 2 28 ? 19.246 0.749   37.054  1.00 14.62  ? 28  GLY B C   1 
ATOM   660  O O   . GLY B 2 28 ? 19.672 1.184   38.116  1.00 15.20  ? 28  GLY B O   1 
ATOM   661  N N   . GLN B 2 29 ? 19.948 -0.073  36.277  1.00 15.19  ? 29  GLN B N   1 
ATOM   662  C CA  . GLN B 2 29 ? 21.283 -0.487  36.714  1.00 16.49  ? 29  GLN B CA  1 
ATOM   663  C C   . GLN B 2 29 ? 22.256 0.678   36.859  1.00 15.19  ? 29  GLN B C   1 
ATOM   664  O O   . GLN B 2 29 ? 23.239 0.579   37.583  1.00 15.09  ? 29  GLN B O   1 
ATOM   665  C CB  . GLN B 2 29 ? 21.868 -1.605  35.849  1.00 17.00  ? 29  GLN B CB  1 
ATOM   666  C CG  . GLN B 2 29 ? 22.206 -1.273  34.426  1.00 19.66  ? 29  GLN B CG  1 
ATOM   667  C CD  . GLN B 2 29 ? 22.894 -2.441  33.722  1.00 20.01  ? 29  GLN B CD  1 
ATOM   668  O OE1 . GLN B 2 29 ? 23.384 -3.372  34.370  1.00 25.16  ? 29  GLN B OE1 1 
ATOM   669  N NE2 . GLN B 2 29 ? 22.929 -2.398  32.391  1.00 25.97  ? 29  GLN B NE2 1 
ATOM   670  N N   . HIS B 2 30 ? 21.958 1.782   36.181  1.00 13.83  ? 30  HIS B N   1 
ATOM   671  C CA  . HIS B 2 30 ? 22.757 2.991   36.276  1.00 14.52  ? 30  HIS B CA  1 
ATOM   672  C C   . HIS B 2 30 ? 22.085 4.098   37.076  1.00 13.98  ? 30  HIS B C   1 
ATOM   673  O O   . HIS B 2 30 ? 22.600 5.209   37.174  1.00 15.00  ? 30  HIS B O   1 
ATOM   674  C CB  . HIS B 2 30 ? 23.144 3.448   34.871  1.00 14.49  ? 30  HIS B CB  1 
ATOM   675  C CG  . HIS B 2 30 ? 23.983 2.442   34.164  1.00 15.51  ? 30  HIS B CG  1 
ATOM   676  N ND1 . HIS B 2 30 ? 23.503 1.636   33.156  1.00 19.10  ? 30  HIS B ND1 1 
ATOM   677  C CD2 . HIS B 2 30 ? 25.259 2.054   34.387  1.00 16.40  ? 30  HIS B CD2 1 
ATOM   678  C CE1 . HIS B 2 30 ? 24.460 0.812   32.767  1.00 17.39  ? 30  HIS B CE1 1 
ATOM   679  N NE2 . HIS B 2 30 ? 25.537 1.051   33.490  1.00 20.35  ? 30  HIS B NE2 1 
ATOM   680  N N   . GLY B 2 31 ? 20.940 3.776   37.674  1.00 14.00  ? 31  GLY B N   1 
ATOM   681  C CA  . GLY B 2 31 ? 20.245 4.717   38.546  1.00 13.57  ? 31  GLY B CA  1 
ATOM   682  C C   . GLY B 2 31 ? 19.406 5.771   37.857  1.00 13.08  ? 31  GLY B C   1 
ATOM   683  O O   . GLY B 2 31 ? 18.919 6.683   38.516  1.00 13.58  ? 31  GLY B O   1 
ATOM   684  N N   . ALA B 2 32 ? 19.247 5.676   36.536  1.00 13.01  ? 32  ALA B N   1 
ATOM   685  C CA  . ALA B 2 32 ? 18.379 6.618   35.833  1.00 12.49  ? 32  ALA B CA  1 
ATOM   686  C C   . ALA B 2 32 ? 16.933 6.429   36.271  1.00 12.39  ? 32  ALA B C   1 
ATOM   687  O O   . ALA B 2 32 ? 16.489 5.310   36.483  1.00 12.31  ? 32  ALA B O   1 
ATOM   688  C CB  . ALA B 2 32 ? 18.492 6.440   34.326  1.00 12.89  ? 32  ALA B CB  1 
ATOM   689  N N   . ASN B 2 33 ? 16.200 7.534   36.357  1.00 12.06  ? 33  ASN B N   1 
ATOM   690  C CA  . ASN B 2 33 ? 14.837 7.505   36.849  1.00 12.43  ? 33  ASN B CA  1 
ATOM   691  C C   . ASN B 2 33 ? 13.922 6.838   35.834  1.00 12.40  ? 33  ASN B C   1 
ATOM   692  O O   . ASN B 2 33 ? 13.584 7.428   34.807  1.00 12.11  ? 33  ASN B O   1 
ATOM   693  C CB  . ASN B 2 33 ? 14.359 8.909   37.186  1.00 12.08  ? 33  ASN B CB  1 
ATOM   694  C CG  . ASN B 2 33 ? 13.047 8.896   37.927  1.00 11.85  ? 33  ASN B CG  1 
ATOM   695  O OD1 . ASN B 2 33 ? 12.085 8.288   37.481  1.00 13.87  ? 33  ASN B OD1 1 
ATOM   696  N ND2 . ASN B 2 33 ? 13.007 9.549   39.085  1.00 12.63  ? 33  ASN B ND2 1 
ATOM   697  N N   . ILE B 2 34 ? 13.539 5.598   36.131  1.00 12.43  ? 34  ILE B N   1 
ATOM   698  C CA  . ILE B 2 34 ? 12.800 4.763   35.185  1.00 13.31  ? 34  ILE B CA  1 
ATOM   699  C C   . ILE B 2 34 ? 11.476 5.397   34.784  1.00 13.36  ? 34  ILE B C   1 
ATOM   700  O O   . ILE B 2 34 ? 11.162 5.510   33.589  1.00 13.60  ? 34  ILE B O   1 
ATOM   701  C CB  . ILE B 2 34 ? 12.553 3.361   35.765  1.00 13.55  ? 34  ILE B CB  1 
ATOM   702  C CG1 . ILE B 2 34 ? 13.885 2.630   35.968  1.00 13.86  ? 34  ILE B CG1 1 
ATOM   703  C CG2 . ILE B 2 34 ? 11.628 2.555   34.850  1.00 14.53  ? 34  ILE B CG2 1 
ATOM   704  C CD1 . ILE B 2 34 ? 13.798 1.468   36.953  1.00 14.64  ? 34  ILE B CD1 1 
ATOM   705  N N   . MET B 2 35 ? 10.701 5.821   35.775  1.00 13.58  ? 35  MET B N   1 
ATOM   706  C CA  . MET B 2 35 ? 9.398  6.411   35.491  1.00 13.87  ? 35  MET B CA  1 
ATOM   707  C C   . MET B 2 35 ? 9.494  7.721   34.729  1.00 13.63  ? 35  MET B C   1 
ATOM   708  O O   . MET B 2 35 ? 8.664  8.004   33.873  1.00 13.72  ? 35  MET B O   1 
ATOM   709  C CB  . MET B 2 35 ? 8.573  6.572   36.776  1.00 14.96  ? 35  MET B CB  1 
ATOM   710  C CG  . MET B 2 35 ? 7.789  5.327   37.131  1.00 19.15  ? 35  MET B CG  1 
ATOM   711  S SD  . MET B 2 35 ? 6.609  4.909   35.823  1.00 25.75  ? 35  MET B SD  1 
ATOM   712  C CE  . MET B 2 35 ? 5.970  6.068   35.297  0.00 20.00  ? 35  MET B CE  1 
ATOM   713  N N   . GLU B 2 36 ? 10.513 8.523   35.023  1.00 13.23  ? 36  GLU B N   1 
ATOM   714  C CA  . GLU B 2 36 ? 10.694 9.753   34.277  1.00 12.97  ? 36  GLU B CA  1 
ATOM   715  C C   . GLU B 2 36 ? 10.968 9.452   32.810  1.00 12.11  ? 36  GLU B C   1 
ATOM   716  O O   . GLU B 2 36 ? 10.437 10.124  31.935  1.00 11.75  ? 36  GLU B O   1 
ATOM   717  C CB  . GLU B 2 36 ? 11.803 10.627  34.877  1.00 13.95  ? 36  GLU B CB  1 
ATOM   718  C CG  . GLU B 2 36 ? 11.347 11.457  36.072  1.00 17.20  ? 36  GLU B CG  1 
ATOM   719  C CD  . GLU B 2 36 ? 10.239 12.442  35.713  1.00 21.88  ? 36  GLU B CD  1 
ATOM   720  O OE1 . GLU B 2 36 ? 10.539 13.493  35.096  1.00 25.58  ? 36  GLU B OE1 1 
ATOM   721  O OE2 . GLU B 2 36 ? 9.068  12.176  36.059  1.00 25.67  ? 36  GLU B OE2 1 
ATOM   722  N N   . PHE B 2 37 ? 11.812 8.455   32.538  1.00 11.42  ? 37  PHE B N   1 
ATOM   723  C CA  . PHE B 2 37 ? 12.045 8.094   31.148  1.00 11.95  ? 37  PHE B CA  1 
ATOM   724  C C   . PHE B 2 37 ? 10.772 7.570   30.479  1.00 11.62  ? 37  PHE B C   1 
ATOM   725  O O   . PHE B 2 37 ? 10.456 7.943   29.355  1.00 12.19  ? 37  PHE B O   1 
ATOM   726  C CB  . PHE B 2 37 ? 13.168 7.059   30.965  1.00 12.20  ? 37  PHE B CB  1 
ATOM   727  C CG  . PHE B 2 37 ? 13.248 6.555   29.545  1.00 11.51  ? 37  PHE B CG  1 
ATOM   728  C CD1 . PHE B 2 37 ? 13.734 7.383   28.551  1.00 12.11  ? 37  PHE B CD1 1 
ATOM   729  C CD2 . PHE B 2 37 ? 12.702 5.321   29.187  1.00 11.73  ? 37  PHE B CD2 1 
ATOM   730  C CE1 . PHE B 2 37 ? 13.743 6.972   27.228  1.00 12.26  ? 37  PHE B CE1 1 
ATOM   731  C CE2 . PHE B 2 37 ? 12.713 4.904   27.868  1.00 11.96  ? 37  PHE B CE2 1 
ATOM   732  C CZ  . PHE B 2 37 ? 13.211 5.738   26.890  1.00 12.11  ? 37  PHE B CZ  1 
ATOM   733  N N   . VAL B 2 38 ? 10.055 6.691   31.169  1.00 11.98  ? 38  VAL B N   1 
ATOM   734  C CA  . VAL B 2 38 ? 8.807  6.129   30.617  1.00 12.01  ? 38  VAL B CA  1 
ATOM   735  C C   . VAL B 2 38 ? 7.856  7.254   30.216  1.00 11.32  ? 38  VAL B C   1 
ATOM   736  O O   . VAL B 2 38 ? 7.345  7.285   29.082  1.00 11.63  ? 38  VAL B O   1 
ATOM   737  C CB  . VAL B 2 38 ? 8.152  5.155   31.616  1.00 12.13  ? 38  VAL B CB  1 
ATOM   738  C CG1 . VAL B 2 38 ? 6.717  4.811   31.216  1.00 12.24  ? 38  VAL B CG1 1 
ATOM   739  C CG2 . VAL B 2 38 ? 8.995  3.901   31.746  1.00 13.55  ? 38  VAL B CG2 1 
ATOM   740  N N   . LYS B 2 39 ? 7.617  8.177   31.144  1.00 11.24  ? 39  LYS B N   1 
ATOM   741  C CA  . LYS B 2 39 ? 6.711  9.287   30.868  1.00 11.67  ? 39  LYS B CA  1 
ATOM   742  C C   . LYS B 2 39 ? 7.220  10.167  29.726  1.00 11.22  ? 39  LYS B C   1 
ATOM   743  O O   . LYS B 2 39 ? 6.455  10.602  28.889  1.00 11.47  ? 39  LYS B O   1 
ATOM   744  C CB  . LYS B 2 39 ? 6.488  10.122  32.121  1.00 12.78  ? 39  LYS B CB  1 
ATOM   745  C CG  . LYS B 2 39 ? 5.710  9.388   33.209  1.00 14.26  ? 39  LYS B CG  1 
ATOM   746  C CD  . LYS B 2 39 ? 5.498  10.267  34.424  1.00 18.76  ? 39  LYS B CD  1 
ATOM   747  C CE  . LYS B 2 39 ? 5.044  9.371   35.580  0.00 20.00  ? 39  LYS B CE  1 
ATOM   748  N NZ  . LYS B 2 39 ? 5.040  9.908   36.944  0.00 20.00  ? 39  LYS B NZ  1 
ATOM   749  N N   . ALA B 2 40 ? 8.526  10.431  29.700  1.00 11.00  ? 40  ALA B N   1 
ATOM   750  C CA  . ALA B 2 40 ? 9.098  11.302  28.675  1.00 11.17  ? 40  ALA B CA  1 
ATOM   751  C C   . ALA B 2 40 ? 9.056  10.660  27.291  1.00 11.32  ? 40  ALA B C   1 
ATOM   752  O O   . ALA B 2 40 ? 8.692  11.317  26.306  1.00 11.51  ? 40  ALA B O   1 
ATOM   753  C CB  . ALA B 2 40 ? 10.512 11.676  29.056  1.00 12.42  ? 40  ALA B CB  1 
ATOM   754  N N   . PHE B 2 41 ? 9.432  9.380   27.220  1.00 10.83  ? 41  PHE B N   1 
ATOM   755  C CA  . PHE B 2 41 ? 9.348  8.632   25.969  1.00 11.03  ? 41  PHE B CA  1 
ATOM   756  C C   . PHE B 2 41 ? 7.910  8.571   25.468  1.00 10.70  ? 41  PHE B C   1 
ATOM   757  O O   . PHE B 2 41 ? 7.653  8.771   24.275  1.00 11.35  ? 41  PHE B O   1 
ATOM   758  C CB  . PHE B 2 41 ? 9.915  7.207   26.116  1.00 11.21  ? 41  PHE B CB  1 
ATOM   759  C CG  . PHE B 2 41 ? 9.723  6.364   24.902  1.00 10.94  ? 41  PHE B CG  1 
ATOM   760  C CD1 . PHE B 2 41 ? 10.652 6.373   23.861  1.00 12.48  ? 41  PHE B CD1 1 
ATOM   761  C CD2 . PHE B 2 41 ? 8.574  5.594   24.769  1.00 10.98  ? 41  PHE B CD2 1 
ATOM   762  C CE1 . PHE B 2 41 ? 10.432 5.607   22.712  1.00 11.73  ? 41  PHE B CE1 1 
ATOM   763  C CE2 . PHE B 2 41 ? 8.347  4.828   23.630  1.00 12.11  ? 41  PHE B CE2 1 
ATOM   764  C CZ  . PHE B 2 41 ? 9.295  4.833   22.603  1.00 12.22  ? 41  PHE B CZ  1 
ATOM   765  N N   . ASN B 2 42 ? 6.983  8.282   26.374  1.00 10.19  ? 42  ASN B N   1 
ATOM   766  C CA  . ASN B 2 42 ? 5.575  8.200   25.967  1.00 10.38  ? 42  ASN B CA  1 
ATOM   767  C C   . ASN B 2 42 ? 5.026  9.550   25.489  1.00 10.85  ? 42  ASN B C   1 
ATOM   768  O O   . ASN B 2 42 ? 4.259  9.604   24.530  1.00 11.80  ? 42  ASN B O   1 
ATOM   769  C CB  . ASN B 2 42 ? 4.725  7.576   27.074  1.00 11.14  ? 42  ASN B CB  1 
ATOM   770  C CG  . ASN B 2 42 ? 4.970  6.086   27.214  1.00 10.91  ? 42  ASN B CG  1 
ATOM   771  O OD1 . ASN B 2 42 ? 5.510  5.443   26.309  1.00 12.47  ? 42  ASN B OD1 1 
ATOM   772  N ND2 . ASN B 2 42 ? 4.564  5.528   28.351  1.00 11.09  ? 42  ASN B ND2 1 
ATOM   773  N N   . ALA B 2 43 ? 5.459  10.638  26.126  1.00 11.07  ? 43  ALA B N   1 
ATOM   774  C CA  . ALA B 2 43 ? 5.073  11.965  25.664  1.00 11.47  ? 43  ALA B CA  1 
ATOM   775  C C   . ALA B 2 43 ? 5.671  12.231  24.276  1.00 11.00  ? 43  ALA B C   1 
ATOM   776  O O   . ALA B 2 43 ? 5.000  12.762  23.395  1.00 11.80  ? 43  ALA B O   1 
ATOM   777  C CB  . ALA B 2 43 ? 5.493  13.016  26.664  1.00 11.37  ? 43  ALA B CB  1 
ATOM   778  N N   . ALA B 2 44 ? 6.930  11.835  24.085  1.00 11.65  ? 44  ALA B N   1 
ATOM   779  C CA  . ALA B 2 44 ? 7.633  12.066  22.825  1.00 11.52  ? 44  ALA B CA  1 
ATOM   780  C C   . ALA B 2 44 ? 7.071  11.272  21.666  1.00 12.42  ? 44  ALA B C   1 
ATOM   781  O O   . ALA B 2 44 ? 7.304  11.617  20.512  1.00 13.23  ? 44  ALA B O   1 
ATOM   782  C CB  . ALA B 2 44 ? 9.129  11.750  22.992  1.00 11.54  ? 44  ALA B CB  1 
ATOM   783  N N   . THR B 2 45 ? 6.342  10.196  21.966  1.00 12.02  ? 45  THR B N   1 
ATOM   784  C CA  . THR B 2 45 ? 5.959  9.239   20.927  1.00 12.54  ? 45  THR B CA  1 
ATOM   785  C C   . THR B 2 45 ? 4.487  8.819   20.872  1.00 13.38  ? 45  THR B C   1 
ATOM   786  O O   . THR B 2 45 ? 4.104  8.175   19.910  1.00 12.85  ? 45  THR B O   1 
ATOM   787  C CB  . THR B 2 45 ? 6.792  7.938   21.023  1.00 12.20  ? 45  THR B CB  1 
ATOM   788  O OG1 . THR B 2 45 ? 6.496  7.276   22.262  1.00 11.96  ? 45  THR B OG1 1 
ATOM   789  C CG2 . THR B 2 45 ? 8.275  8.224   20.934  1.00 12.55  ? 45  THR B CG2 1 
ATOM   790  N N   . ALA B 2 46 ? 3.668  9.140   21.883  1.00 13.95  ? 46  ALA B N   1 
ATOM   791  C CA  . ALA B 2 46 ? 2.279  8.644   21.912  1.00 15.14  ? 46  ALA B CA  1 
ATOM   792  C C   . ALA B 2 46 ? 1.476  8.988   20.663  1.00 16.06  ? 46  ALA B C   1 
ATOM   793  O O   . ALA B 2 46 ? 0.650  8.192   20.213  1.00 16.14  ? 46  ALA B O   1 
ATOM   794  C CB  . ALA B 2 46 ? 1.540  9.114   23.172  1.00 14.93  ? 46  ALA B CB  1 
ATOM   795  N N   . ASN B 2 47 ? 1.742  10.154  20.081  1.00 16.72  ? 47  ASN B N   1 
ATOM   796  C CA  . ASN B 2 47 ? 0.979  10.585  18.920  1.00 18.00  ? 47  ASN B CA  1 
ATOM   797  C C   . ASN B 2 47 ? 1.447  9.966   17.593  1.00 19.00  ? 47  ASN B C   1 
ATOM   798  O O   . ASN B 2 47 ? 0.928  10.312  16.531  1.00 19.57  ? 47  ASN B O   1 
ATOM   799  C CB  . ASN B 2 47 ? 0.893  12.120  18.866  1.00 17.59  ? 47  ASN B CB  1 
ATOM   800  C CG  . ASN B 2 47 ? 0.004  12.698  19.976  1.00 18.43  ? 47  ASN B CG  1 
ATOM   801  O OD1 . ASN B 2 47 ? -0.534 11.960  20.803  1.00 19.05  ? 47  ASN B OD1 1 
ATOM   802  N ND2 . ASN B 2 47 ? -0.149 14.013  19.992  1.00 16.06  ? 47  ASN B ND2 1 
ATOM   803  N N   . MET B 2 48 ? 2.407  9.041   17.671  1.00 20.16  ? 48  MET B N   1 
ATOM   804  C CA  . MET B 2 48 ? 2.909  8.320   16.493  1.00 22.13  ? 48  MET B CA  1 
ATOM   805  C C   . MET B 2 48 ? 2.082  7.077   16.147  1.00 22.55  ? 48  MET B C   1 
ATOM   806  O O   . MET B 2 48 ? 2.337  6.410   15.138  1.00 23.62  ? 48  MET B O   1 
ATOM   807  C CB  . MET B 2 48 ? 4.377  7.920   16.695  1.00 20.89  ? 48  MET B CB  1 
ATOM   808  C CG  . MET B 2 48 ? 5.317  9.079   16.975  1.00 22.47  ? 48  MET B CG  1 
ATOM   809  S SD  . MET B 2 48 ? 6.979  8.549   17.394  1.00 25.53  ? 48  MET B SD  1 
ATOM   810  C CE  . MET B 2 48 ? 7.590  8.061   15.786  1.00 25.85  ? 48  MET B CE  1 
ATOM   811  N N   . GLY B 2 49 ? 1.097  6.758   16.982  1.00 22.86  ? 49  GLY B N   1 
ATOM   812  C CA  . GLY B 2 49 ? 0.251  5.586   16.755  1.00 22.30  ? 49  GLY B CA  1 
ATOM   813  C C   . GLY B 2 49 ? 0.952  4.260   17.019  1.00 22.37  ? 49  GLY B C   1 
ATOM   814  O O   . GLY B 2 49 ? 1.614  4.099   18.047  1.00 22.40  ? 49  GLY B O   1 
ATOM   815  N N   . ASP B 2 50 ? 0.813  3.318   16.081  1.00 22.45  ? 50  ASP B N   1 
ATOM   816  C CA  . ASP B 2 50 ? 1.284  1.924   16.259  1.00 22.51  ? 50  ASP B CA  1 
ATOM   817  C C   . ASP B 2 50 ? 2.766  1.657   15.888  1.00 22.04  ? 50  ASP B C   1 
ATOM   818  O O   . ASP B 2 50 ? 3.172  0.514   15.628  1.00 23.39  ? 50  ASP B O   1 
ATOM   819  C CB  . ASP B 2 50 ? 0.352  0.955   15.508  1.00 23.08  ? 50  ASP B CB  1 
ATOM   820  C CG  . ASP B 2 50 ? 0.337  -0.444  16.118  1.00 25.18  ? 50  ASP B CG  1 
ATOM   821  O OD1 . ASP B 2 50 ? 1.224  -0.769  16.939  1.00 28.26  ? 50  ASP B OD1 1 
ATOM   822  O OD2 . ASP B 2 50 ? -0.573 -1.228  15.773  1.00 27.79  ? 50  ASP B OD2 1 
ATOM   823  N N   . ALA B 2 51 ? 3.579  2.703   15.902  1.00 20.46  ? 51  ALA B N   1 
ATOM   824  C CA  . ALA B 2 51 ? 4.957  2.619   15.435  1.00 18.67  ? 51  ALA B CA  1 
ATOM   825  C C   . ALA B 2 51 ? 5.899  1.945   16.435  1.00 17.26  ? 51  ALA B C   1 
ATOM   826  O O   . ALA B 2 51 ? 5.628  1.902   17.638  1.00 16.63  ? 51  ALA B O   1 
ATOM   827  C CB  . ALA B 2 51 ? 5.463  4.010   15.109  1.00 18.88  ? 51  ALA B CB  1 
ATOM   828  N N   . ILE B 2 52 ? 7.004  1.418   15.913  1.00 15.45  ? 52  ILE B N   1 
ATOM   829  C CA  . ILE B 2 52 ? 8.131  0.986   16.732  1.00 15.19  ? 52  ILE B CA  1 
ATOM   830  C C   . ILE B 2 52 ? 9.207  2.061   16.642  1.00 14.72  ? 52  ILE B C   1 
ATOM   831  O O   . ILE B 2 52 ? 9.634  2.442   15.544  1.00 15.78  ? 52  ILE B O   1 
ATOM   832  C CB  . ILE B 2 52 ? 8.687  -0.359  16.255  1.00 15.00  ? 52  ILE B CB  1 
ATOM   833  C CG1 . ILE B 2 52 ? 7.598  -1.446  16.297  1.00 15.33  ? 52  ILE B CG1 1 
ATOM   834  C CG2 . ILE B 2 52 ? 9.930  -0.775  17.054  1.00 15.36  ? 52  ILE B CG2 1 
ATOM   835  C CD1 . ILE B 2 52 ? 6.915  -1.641  17.638  1.00 16.18  ? 52  ILE B CD1 1 
ATOM   836  N N   . VAL B 2 53 ? 9.650  2.555   17.794  1.00 13.65  ? 53  VAL B N   1 
ATOM   837  C CA  . VAL B 2 53 ? 10.522 3.731   17.823  1.00 13.27  ? 53  VAL B CA  1 
ATOM   838  C C   . VAL B 2 53 ? 11.919 3.390   18.342  1.00 12.58  ? 53  VAL B C   1 
ATOM   839  O O   . VAL B 2 53 ? 12.070 2.972   19.482  1.00 12.40  ? 53  VAL B O   1 
ATOM   840  C CB  . VAL B 2 53 ? 9.915  4.842   18.715  1.00 13.66  ? 53  VAL B CB  1 
ATOM   841  C CG1 . VAL B 2 53 ? 10.788 6.088   18.700  1.00 14.10  ? 53  VAL B CG1 1 
ATOM   842  C CG2 . VAL B 2 53 ? 8.499  5.179   18.251  1.00 15.57  ? 53  VAL B CG2 1 
ATOM   843  N N   . PRO B 2 54 ? 12.950 3.597   17.516  1.00 11.57  ? 54  PRO B N   1 
ATOM   844  C CA  . PRO B 2 54 ? 14.331 3.536   17.995  1.00 11.82  ? 54  PRO B CA  1 
ATOM   845  C C   . PRO B 2 54 ? 14.584 4.678   18.978  1.00 11.49  ? 54  PRO B C   1 
ATOM   846  O O   . PRO B 2 54 ? 14.216 5.819   18.714  1.00 11.31  ? 54  PRO B O   1 
ATOM   847  C CB  . PRO B 2 54 ? 15.161 3.761   16.725  1.00 12.61  ? 54  PRO B CB  1 
ATOM   848  C CG  . PRO B 2 54 ? 14.227 3.466   15.592  1.00 12.97  ? 54  PRO B CG  1 
ATOM   849  C CD  . PRO B 2 54 ? 12.881 3.897   16.072  1.00 11.63  ? 54  PRO B CD  1 
ATOM   850  N N   . VAL B 2 55 ? 15.182 4.366   20.119  1.00 11.18  ? 55  VAL B N   1 
ATOM   851  C CA  . VAL B 2 55 ? 15.496 5.382   21.112  1.00 11.49  ? 55  VAL B CA  1 
ATOM   852  C C   . VAL B 2 55 ? 16.831 5.051   21.749  1.00 11.54  ? 55  VAL B C   1 
ATOM   853  O O   . VAL B 2 55 ? 17.102 3.898   22.082  1.00 12.23  ? 55  VAL B O   1 
ATOM   854  C CB  . VAL B 2 55 ? 14.353 5.552   22.151  1.00 11.52  ? 55  VAL B CB  1 
ATOM   855  C CG1 . VAL B 2 55 ? 14.017 4.231   22.875  1.00 12.47  ? 55  VAL B CG1 1 
ATOM   856  C CG2 . VAL B 2 55 ? 14.710 6.655   23.154  1.00 12.53  ? 55  VAL B CG2 1 
ATOM   857  N N   . GLU B 2 56 ? 17.659 6.077   21.908  1.00 11.06  ? 56  GLU B N   1 
ATOM   858  C CA  . GLU B 2 56 ? 18.963 5.922   22.555  1.00 11.73  ? 56  GLU B CA  1 
ATOM   859  C C   . GLU B 2 56 ? 18.996 6.809   23.778  1.00 11.27  ? 56  GLU B C   1 
ATOM   860  O O   . GLU B 2 56 ? 18.753 8.020   23.687  1.00 10.99  ? 56  GLU B O   1 
ATOM   861  C CB  . GLU B 2 56 ? 20.095 6.280   21.604  1.00 12.61  ? 56  GLU B CB  1 
ATOM   862  C CG  . GLU B 2 56 ? 20.219 5.233   20.501  1.00 15.12  ? 56  GLU B CG  1 
ATOM   863  C CD  . GLU B 2 56 ? 21.290 5.543   19.501  1.00 19.73  ? 56  GLU B CD  1 
ATOM   864  O OE1 . GLU B 2 56 ? 22.294 6.182   19.874  1.00 22.97  ? 56  GLU B OE1 1 
ATOM   865  O OE2 . GLU B 2 56 ? 21.129 5.134   18.333  1.00 20.35  ? 56  GLU B OE2 1 
ATOM   866  N N   . ILE B 2 57 ? 19.291 6.192   24.921  1.00 10.58  ? 57  ILE B N   1 
ATOM   867  C CA  . ILE B 2 57 ? 19.306 6.873   26.213  1.00 11.22  ? 57  ILE B CA  1 
ATOM   868  C C   . ILE B 2 57 ? 20.746 6.943   26.683  1.00 11.08  ? 57  ILE B C   1 
ATOM   869  O O   . ILE B 2 57 ? 21.430 5.916   26.768  1.00 11.71  ? 57  ILE B O   1 
ATOM   870  C CB  . ILE B 2 57 ? 18.463 6.140   27.278  1.00 11.50  ? 57  ILE B CB  1 
ATOM   871  C CG1 . ILE B 2 57 ? 17.014 5.924   26.796  1.00 12.20  ? 57  ILE B CG1 1 
ATOM   872  C CG2 . ILE B 2 57 ? 18.455 6.928   28.581  1.00 12.02  ? 57  ILE B CG2 1 
ATOM   873  C CD1 . ILE B 2 57 ? 16.764 4.555   26.174  1.00 13.19  ? 57  ILE B CD1 1 
ATOM   874  N N   . THR B 2 58 ? 21.220 8.149   26.972  1.00 10.32  ? 58  THR B N   1 
ATOM   875  C CA  . THR B 2 58 ? 22.555 8.332   27.524  1.00 10.62  ? 58  THR B CA  1 
ATOM   876  C C   . THR B 2 58 ? 22.367 8.628   28.998  1.00 10.84  ? 58  THR B C   1 
ATOM   877  O O   . THR B 2 58 ? 21.572 9.504   29.367  1.00 11.74  ? 58  THR B O   1 
ATOM   878  C CB  . THR B 2 58 ? 23.265 9.492   26.824  1.00 10.86  ? 58  THR B CB  1 
ATOM   879  O OG1 . THR B 2 58 ? 23.382 9.179   25.430  1.00 11.10  ? 58  THR B OG1 1 
ATOM   880  C CG2 . THR B 2 58 ? 24.662 9.736   27.408  1.00 11.31  ? 58  THR B CG2 1 
ATOM   881  N N   . ILE B 2 59 ? 23.091 7.901   29.842  1.00 10.84  ? 59  ILE B N   1 
ATOM   882  C CA  . ILE B 2 59 ? 22.971 8.053   31.287  1.00 11.39  ? 59  ILE B CA  1 
ATOM   883  C C   . ILE B 2 59 ? 24.281 8.587   31.825  1.00 11.07  ? 59  ILE B C   1 
ATOM   884  O O   . ILE B 2 59 ? 25.354 8.114   31.439  1.00 11.43  ? 59  ILE B O   1 
ATOM   885  C CB  . ILE B 2 59 ? 22.593 6.712   31.979  1.00 11.12  ? 59  ILE B CB  1 
ATOM   886  C CG1 . ILE B 2 59 ? 21.291 6.139   31.389  1.00 12.56  ? 59  ILE B CG1 1 
ATOM   887  C CG2 . ILE B 2 59 ? 22.438 6.918   33.479  1.00 12.13  ? 59  ILE B CG2 1 
ATOM   888  C CD1 . ILE B 2 59 ? 20.975 4.679   31.776  1.00 12.79  ? 59  ILE B CD1 1 
ATOM   889  N N   . TYR B 2 60 ? 24.187 9.552   32.731  1.00 10.37  ? 60  TYR B N   1 
ATOM   890  C CA  . TYR B 2 60 ? 25.354 10.273  33.261  1.00 10.05  ? 60  TYR B CA  1 
ATOM   891  C C   . TYR B 2 60 ? 25.674 9.876   34.701  1.00 10.51  ? 60  TYR B C   1 
ATOM   892  O O   . TYR B 2 60 ? 24.872 9.228   35.380  1.00 11.26  ? 60  TYR B O   1 
ATOM   893  C CB  . TYR B 2 60 ? 25.174 11.795  33.126  1.00 11.04  ? 60  TYR B CB  1 
ATOM   894  C CG  . TYR B 2 60 ? 24.860 12.174  31.703  1.00 11.41  ? 60  TYR B CG  1 
ATOM   895  C CD1 . TYR B 2 60 ? 25.861 12.390  30.767  1.00 11.11  ? 60  TYR B CD1 1 
ATOM   896  C CD2 . TYR B 2 60 ? 23.540 12.261  31.290  1.00 11.73  ? 60  TYR B CD2 1 
ATOM   897  C CE1 . TYR B 2 60 ? 25.546 12.730  29.450  1.00 12.73  ? 60  TYR B CE1 1 
ATOM   898  C CE2 . TYR B 2 60 ? 23.218 12.554  29.976  1.00 12.15  ? 60  TYR B CE2 1 
ATOM   899  C CZ  . TYR B 2 60 ? 24.217 12.798  29.071  1.00 11.39  ? 60  TYR B CZ  1 
ATOM   900  O OH  . TYR B 2 60 ? 23.895 13.104  27.753  1.00 12.99  ? 60  TYR B OH  1 
ATOM   901  N N   . ALA B 2 61 ? 26.858 10.274  35.163  1.00 10.79  ? 61  ALA B N   1 
ATOM   902  C CA  . ALA B 2 61 ? 27.318 9.869   36.483  1.00 11.57  ? 61  ALA B CA  1 
ATOM   903  C C   . ALA B 2 61 ? 26.446 10.389  37.629  1.00 11.72  ? 61  ALA B C   1 
ATOM   904  O O   . ALA B 2 61 ? 26.420 9.794   38.705  1.00 13.14  ? 61  ALA B O   1 
ATOM   905  C CB  . ALA B 2 61 ? 28.782 10.258  36.678  1.00 11.58  ? 61  ALA B CB  1 
ATOM   906  N N   . ASP B 2 62 ? 25.733 11.489  37.394  1.00 11.55  ? 62  ASP B N   1 
ATOM   907  C CA  . ASP B 2 62 ? 24.792 12.018  38.397  1.00 12.98  ? 62  ASP B CA  1 
ATOM   908  C C   . ASP B 2 62 ? 23.406 11.364  38.307  1.00 12.87  ? 62  ASP B C   1 
ATOM   909  O O   . ASP B 2 62 ? 22.464 11.799  38.979  1.00 13.42  ? 62  ASP B O   1 
ATOM   910  C CB  . ASP B 2 62 ? 24.670 13.540  38.279  1.00 13.99  ? 62  ASP B CB  1 
ATOM   911  C CG  . ASP B 2 62 ? 23.981 13.981  36.999  1.00 15.40  ? 62  ASP B CG  1 
ATOM   912  O OD1 . ASP B 2 62 ? 23.834 13.161  36.065  1.00 13.41  ? 62  ASP B OD1 1 
ATOM   913  O OD2 . ASP B 2 62 ? 23.567 15.167  36.945  1.00 20.11  ? 62  ASP B OD2 1 
ATOM   914  N N   . ARG B 2 63 ? 23.300 10.330  37.467  1.00 12.43  ? 63  ARG B N   1 
ATOM   915  C CA  . ARG B 2 63 ? 22.081 9.523   37.268  1.00 13.35  ? 63  ARG B CA  1 
ATOM   916  C C   . ARG B 2 63 ? 21.024 10.209  36.405  1.00 13.29  ? 63  ARG B C   1 
ATOM   917  O O   . ARG B 2 63 ? 19.943 9.659   36.193  1.00 15.03  ? 63  ARG B O   1 
ATOM   918  C CB  . ARG B 2 63 ? 21.513 8.996   38.598  1.00 13.32  ? 63  ARG B CB  1 
ATOM   919  C CG  . ARG B 2 63 ? 22.504 8.084   39.317  1.00 14.50  ? 63  ARG B CG  1 
ATOM   920  C CD  . ARG B 2 63 ? 22.076 7.667   40.726  1.00 15.35  ? 63  ARG B CD  1 
ATOM   921  N NE  . ARG B 2 63 ? 23.245 7.166   41.449  1.00 22.18  ? 63  ARG B NE  1 
ATOM   922  C CZ  . ARG B 2 63 ? 24.063 7.922   42.178  1.00 22.33  ? 63  ARG B CZ  1 
ATOM   923  N NH1 . ARG B 2 63 ? 23.843 9.225   42.309  1.00 25.14  ? 63  ARG B NH1 1 
ATOM   924  N NH2 . ARG B 2 63 ? 25.173 7.721   42.777  0.00 20.00  ? 63  ARG B NH2 1 
ATOM   925  N N   . SER B 2 64 ? 21.352 11.384  35.888  1.00 12.43  ? 64  SER B N   1 
ATOM   926  C CA  . SER B 2 64 ? 20.476 12.045  34.920  1.00 12.46  ? 64  SER B CA  1 
ATOM   927  C C   . SER B 2 64 ? 20.577 11.312  33.580  1.00 12.10  ? 64  SER B C   1 
ATOM   928  O O   . SER B 2 64 ? 21.469 10.478  33.364  1.00 12.52  ? 64  SER B O   1 
ATOM   929  C CB  . SER B 2 64 ? 20.833 13.526  34.758  1.00 12.62  ? 64  SER B CB  1 
ATOM   930  O OG  . SER B 2 64 ? 22.108 13.686  34.159  1.00 13.66  ? 64  SER B OG  1 
ATOM   931  N N   . PHE B 2 65 ? 19.655 11.607  32.671  1.00 12.17  ? 65  PHE B N   1 
ATOM   932  C CA  . PHE B 2 65 ? 19.715 11.014  31.347  1.00 12.18  ? 65  PHE B CA  1 
ATOM   933  C C   . PHE B 2 65 ? 19.235 12.002  30.302  1.00 11.52  ? 65  PHE B C   1 
ATOM   934  O O   . PHE B 2 65 ? 18.520 12.970  30.606  1.00 12.07  ? 65  PHE B O   1 
ATOM   935  C CB  . PHE B 2 65 ? 18.885 9.716   31.277  1.00 12.36  ? 65  PHE B CB  1 
ATOM   936  C CG  . PHE B 2 65 ? 17.407 9.919   31.476  1.00 12.27  ? 65  PHE B CG  1 
ATOM   937  C CD1 . PHE B 2 65 ? 16.587 10.207  30.394  1.00 11.89  ? 65  PHE B CD1 1 
ATOM   938  C CD2 . PHE B 2 65 ? 16.827 9.827   32.743  1.00 13.69  ? 65  PHE B CD2 1 
ATOM   939  C CE1 . PHE B 2 65 ? 15.228 10.411  30.560  1.00 11.60  ? 65  PHE B CE1 1 
ATOM   940  C CE2 . PHE B 2 65 ? 15.470 10.028  32.907  1.00 13.74  ? 65  PHE B CE2 1 
ATOM   941  C CZ  . PHE B 2 65 ? 14.666 10.329  31.816  1.00 12.32  ? 65  PHE B CZ  1 
ATOM   942  N N   . THR B 2 66 ? 19.642 11.751  29.062  1.00 10.73  ? 66  THR B N   1 
ATOM   943  C CA  . THR B 2 66 ? 19.090 12.415  27.896  1.00 10.76  ? 66  THR B CA  1 
ATOM   944  C C   . THR B 2 66 ? 18.701 11.321  26.906  1.00 10.57  ? 66  THR B C   1 
ATOM   945  O O   . THR B 2 66 ? 19.184 10.181  27.002  1.00 10.99  ? 66  THR B O   1 
ATOM   946  C CB  . THR B 2 66 ? 20.097 13.392  27.248  1.00 11.04  ? 66  THR B CB  1 
ATOM   947  O OG1 . THR B 2 66 ? 21.309 12.695  26.931  1.00 11.71  ? 66  THR B OG1 1 
ATOM   948  C CG2 . THR B 2 66 ? 20.444 14.540  28.182  1.00 11.40  ? 66  THR B CG2 1 
ATOM   949  N N   . PHE B 2 67 ? 17.834 11.634  25.948  1.00 10.47  ? 67  PHE B N   1 
ATOM   950  C CA  . PHE B 2 67 ? 17.489 10.630  24.966  1.00 10.51  ? 67  PHE B CA  1 
ATOM   951  C C   . PHE B 2 67 ? 17.194 11.236  23.611  1.00 9.97   ? 67  PHE B C   1 
ATOM   952  O O   . PHE B 2 67 ? 16.872 12.422  23.503  1.00 10.37  ? 67  PHE B O   1 
ATOM   953  C CB  . PHE B 2 67 ? 16.370 9.689   25.446  1.00 11.00  ? 67  PHE B CB  1 
ATOM   954  C CG  . PHE B 2 67 ? 15.018 10.325  25.535  1.00 10.14  ? 67  PHE B CG  1 
ATOM   955  C CD1 . PHE B 2 67 ? 14.631 11.013  26.678  1.00 10.93  ? 67  PHE B CD1 1 
ATOM   956  C CD2 . PHE B 2 67 ? 14.119 10.222  24.484  1.00 11.76  ? 67  PHE B CD2 1 
ATOM   957  C CE1 . PHE B 2 67 ? 13.379 11.573  26.767  1.00 11.12  ? 67  PHE B CE1 1 
ATOM   958  C CE2 . PHE B 2 67 ? 12.849 10.802  24.563  1.00 11.74  ? 67  PHE B CE2 1 
ATOM   959  C CZ  . PHE B 2 67 ? 12.492 11.483  25.706  1.00 11.21  ? 67  PHE B CZ  1 
ATOM   960  N N   . VAL B 2 68 ? 17.329 10.405  22.580  1.00 10.53  ? 68  VAL B N   1 
ATOM   961  C CA  . VAL B 2 68 ? 17.056 10.777  21.193  1.00 10.80  ? 68  VAL B CA  1 
ATOM   962  C C   . VAL B 2 68 ? 16.185 9.676   20.597  1.00 10.86  ? 68  VAL B C   1 
ATOM   963  O O   . VAL B 2 68 ? 16.513 8.484   20.719  1.00 11.09  ? 68  VAL B O   1 
ATOM   964  C CB  . VAL B 2 68 ? 18.371 10.869  20.381  1.00 10.75  ? 68  VAL B CB  1 
ATOM   965  C CG1 . VAL B 2 68 ? 18.098 11.201  18.909  1.00 11.03  ? 68  VAL B CG1 1 
ATOM   966  C CG2 . VAL B 2 68 ? 19.344 11.878  21.003  1.00 12.86  ? 68  VAL B CG2 1 
ATOM   967  N N   . THR B 2 69 ? 15.080 10.073  19.973  1.00 11.30  ? 69  THR B N   1 
ATOM   968  C CA  . THR B 2 69 ? 14.238 9.136   19.230  1.00 12.50  ? 69  THR B CA  1 
ATOM   969  C C   . THR B 2 69 ? 14.403 9.350   17.737  1.00 14.07  ? 69  THR B C   1 
ATOM   970  O O   . THR B 2 69 ? 14.818 10.426  17.280  1.00 13.55  ? 69  THR B O   1 
ATOM   971  C CB  . THR B 2 69 ? 12.749 9.324   19.546  1.00 12.84  ? 69  THR B CB  1 
ATOM   972  O OG1 . THR B 2 69 ? 12.351 10.654  19.193  1.00 14.72  ? 69  THR B OG1 1 
ATOM   973  C CG2 . THR B 2 69 ? 12.456 9.042   21.026  1.00 13.41  ? 69  THR B CG2 1 
ATOM   974  N N   . LYS B 2 70 ? 14.061 8.316   16.970  1.00 16.21  ? 70  LYS B N   1 
ATOM   975  C CA  . LYS B 2 70 ? 14.005 8.420   15.514  1.00 18.99  ? 70  LYS B CA  1 
ATOM   976  C C   . LYS B 2 70 ? 12.582 8.114   15.063  1.00 20.28  ? 70  LYS B C   1 
ATOM   977  O O   . LYS B 2 70 ? 11.921 7.254   15.628  1.00 20.31  ? 70  LYS B O   1 
ATOM   978  C CB  . LYS B 2 70 ? 14.994 7.448   14.888  1.00 18.92  ? 70  LYS B CB  1 
ATOM   979  C CG  . LYS B 2 70 ? 16.409 7.678   15.363  1.00 20.40  ? 70  LYS B CG  1 
ATOM   980  C CD  . LYS B 2 70 ? 17.432 6.983   14.507  1.00 22.92  ? 70  LYS B CD  1 
ATOM   981  C CE  . LYS B 2 70 ? 18.824 7.319   15.018  1.00 23.60  ? 70  LYS B CE  1 
ATOM   982  N NZ  . LYS B 2 70 ? 19.888 6.546   14.321  1.00 27.18  ? 70  LYS B NZ  1 
ATOM   983  N N   . THR B 2 71 ? 12.103 8.880   14.084  1.00 22.75  ? 71  THR B N   1 
ATOM   984  C CA  . THR B 2 71 ? 10.787 8.668   13.489  1.00 25.15  ? 71  THR B CA  1 
ATOM   985  C C   . THR B 2 71 ? 10.982 7.836   12.227  1.00 26.23  ? 71  THR B C   1 
ATOM   986  O O   . THR B 2 71 ? 11.683 8.268   11.308  1.00 26.75  ? 71  THR B O   1 
ATOM   987  C CB  . THR B 2 71 ? 10.114 10.007  13.108  1.00 25.17  ? 71  THR B CB  1 
ATOM   988  O OG1 . THR B 2 71 ? 9.913  10.801  14.283  1.00 26.38  ? 71  THR B OG1 1 
ATOM   989  C CG2 . THR B 2 71 ? 8.768  9.765   12.425  1.00 26.02  ? 71  THR B CG2 1 
ATOM   990  N N   . PRO B 2 72 ? 10.371 6.652   12.156  1.00 27.83  ? 72  PRO B N   1 
ATOM   991  C CA  . PRO B 2 72 ? 9.459  6.137   13.173  1.00 28.66  ? 72  PRO B CA  1 
ATOM   992  C C   . PRO B 2 72 ? 9.859  4.721   13.546  1.00 29.28  ? 72  PRO B C   1 
ATOM   993  O O   . PRO B 2 72 ? 9.765  3.806   12.728  1.00 29.96  ? 72  PRO B O   1 
ATOM   994  C CB  . PRO B 2 72 ? 8.026  6.158   12.652  1.00 29.05  ? 72  PRO B CB  1 
ATOM   995  N N   . LYS C 2 3  ? -3.062 -11.315 -5.974  1.00 25.43  ? 3   LYS C N   1 
ATOM   996  C CA  . LYS C 2 3  ? -3.053 -12.805 -6.017  1.00 25.18  ? 3   LYS C CA  1 
ATOM   997  C C   . LYS C 2 3  ? -1.651 -13.359 -6.251  1.00 25.02  ? 3   LYS C C   1 
ATOM   998  O O   . LYS C 2 3  ? -0.761 -12.647 -6.726  1.00 25.23  ? 3   LYS C O   1 
ATOM   999  N N   . VAL C 2 4  ? -1.472 -14.637 -5.920  1.00 24.76  ? 4   VAL C N   1 
ATOM   1000 C CA  . VAL C 2 4  ? -0.203 -15.341 -6.120  1.00 24.54  ? 4   VAL C CA  1 
ATOM   1001 C C   . VAL C 2 4  ? 0.081  -15.522 -7.612  1.00 24.43  ? 4   VAL C C   1 
ATOM   1002 O O   . VAL C 2 4  ? -0.784 -15.981 -8.358  1.00 24.60  ? 4   VAL C O   1 
ATOM   1003 C CB  . VAL C 2 4  ? -0.221 -16.734 -5.432  1.00 24.53  ? 4   VAL C CB  1 
ATOM   1004 C CG1 . VAL C 2 4  ? 1.082  -17.496 -5.688  1.00 24.75  ? 4   VAL C CG1 1 
ATOM   1005 C CG2 . VAL C 2 4  ? -0.487 -16.598 -3.935  1.00 24.31  ? 4   VAL C CG2 1 
ATOM   1006 N N   . VAL C 2 5  ? 1.286  -15.156 -8.044  1.00 24.17  ? 5   VAL C N   1 
ATOM   1007 C CA  . VAL C 2 5  ? 1.681  -15.369 -9.441  1.00 24.12  ? 5   VAL C CA  1 
ATOM   1008 C C   . VAL C 2 5  ? 2.793  -16.411 -9.608  1.00 23.93  ? 5   VAL C C   1 
ATOM   1009 O O   . VAL C 2 5  ? 2.966  -16.966 -10.696 1.00 23.91  ? 5   VAL C O   1 
ATOM   1010 C CB  . VAL C 2 5  ? 2.052  -14.046 -10.176 1.00 24.10  ? 5   VAL C CB  1 
ATOM   1011 C CG1 . VAL C 2 5  ? 0.860  -13.097 -10.200 1.00 24.18  ? 5   VAL C CG1 1 
ATOM   1012 C CG2 . VAL C 2 5  ? 3.280  -13.380 -9.556  1.00 24.36  ? 5   VAL C CG2 1 
ATOM   1013 N N   . ALA C 2 6  ? 3.533  -16.674 -8.528  1.00 23.62  ? 6   ALA C N   1 
ATOM   1014 C CA  . ALA C 2 6  ? 4.664  -17.605 -8.564  1.00 23.54  ? 6   ALA C CA  1 
ATOM   1015 C C   . ALA C 2 6  ? 5.106  -18.078 -7.185  1.00 23.38  ? 6   ALA C C   1 
ATOM   1016 O O   . ALA C 2 6  ? 4.945  -17.366 -6.190  1.00 23.18  ? 6   ALA C O   1 
ATOM   1017 C CB  . ALA C 2 6  ? 5.844  -16.975 -9.294  1.00 23.40  ? 6   ALA C CB  1 
ATOM   1018 N N   . VAL C 2 7  ? 5.670  -19.286 -7.147  1.00 23.67  ? 7   VAL C N   1 
ATOM   1019 C CA  . VAL C 2 7  ? 6.272  -19.854 -5.940  1.00 23.86  ? 7   VAL C CA  1 
ATOM   1020 C C   . VAL C 2 7  ? 7.682  -20.372 -6.257  1.00 23.87  ? 7   VAL C C   1 
ATOM   1021 O O   . VAL C 2 7  ? 7.850  -21.454 -6.835  1.00 24.31  ? 7   VAL C O   1 
ATOM   1022 C CB  . VAL C 2 7  ? 5.405  -20.983 -5.324  1.00 23.82  ? 7   VAL C CB  1 
ATOM   1023 C CG1 . VAL C 2 7  ? 6.053  -21.531 -4.063  1.00 24.17  ? 7   VAL C CG1 1 
ATOM   1024 C CG2 . VAL C 2 7  ? 4.000  -20.481 -5.009  1.00 23.97  ? 7   VAL C CG2 1 
ATOM   1025 N N   . VAL C 2 8  ? 8.685  -19.582 -5.879  1.00 23.60  ? 8   VAL C N   1 
ATOM   1026 C CA  . VAL C 2 8  ? 10.088 -19.873 -6.182  1.00 23.29  ? 8   VAL C CA  1 
ATOM   1027 C C   . VAL C 2 8  ? 10.735 -20.644 -5.033  1.00 22.87  ? 8   VAL C C   1 
ATOM   1028 O O   . VAL C 2 8  ? 10.646 -20.239 -3.874  1.00 22.48  ? 8   VAL C O   1 
ATOM   1029 C CB  . VAL C 2 8  ? 10.883 -18.568 -6.449  1.00 23.57  ? 8   VAL C CB  1 
ATOM   1030 C CG1 . VAL C 2 8  ? 12.355 -18.862 -6.726  1.00 23.94  ? 8   VAL C CG1 1 
ATOM   1031 C CG2 . VAL C 2 8  ? 10.263 -17.796 -7.604  1.00 23.34  ? 8   VAL C CG2 1 
ATOM   1032 N N   . LYS C 2 9  ? 11.387 -21.754 -5.362  1.00 22.43  ? 9   LYS C N   1 
ATOM   1033 C CA  . LYS C 2 9  ? 12.088 -22.555 -4.367  1.00 22.09  ? 9   LYS C CA  1 
ATOM   1034 C C   . LYS C 2 9  ? 13.597 -22.431 -4.544  1.00 21.61  ? 9   LYS C C   1 
ATOM   1035 O O   . LYS C 2 9  ? 14.128 -22.723 -5.617  1.00 21.58  ? 9   LYS C O   1 
ATOM   1036 C CB  . LYS C 2 9  ? 11.641 -24.017 -4.442  1.00 22.33  ? 9   LYS C CB  1 
ATOM   1037 C CG  . LYS C 2 9  ? 10.178 -24.232 -4.072  1.00 23.14  ? 9   LYS C CG  1 
ATOM   1038 C CD  . LYS C 2 9  ? 9.688  -25.598 -4.524  1.00 23.53  ? 9   LYS C CD  1 
ATOM   1039 C CE  . LYS C 2 9  ? 8.570  -26.122 -3.714  0.00 20.00  ? 9   LYS C CE  1 
ATOM   1040 N NZ  . LYS C 2 9  ? 7.326  -26.194 -4.529  0.00 20.00  ? 9   LYS C NZ  1 
ATOM   1041 N N   . LEU C 2 10 ? 14.273 -21.975 -3.492  1.00 20.84  ? 10  LEU C N   1 
ATOM   1042 C CA  . LEU C 2 10 ? 15.728 -21.817 -3.493  1.00 20.21  ? 10  LEU C CA  1 
ATOM   1043 C C   . LEU C 2 10 ? 16.369 -22.487 -2.279  1.00 19.99  ? 10  LEU C C   1 
ATOM   1044 O O   . LEU C 2 10 ? 15.698 -22.754 -1.282  1.00 20.00  ? 10  LEU C O   1 
ATOM   1045 C CB  . LEU C 2 10 ? 16.120 -20.333 -3.520  1.00 19.89  ? 10  LEU C CB  1 
ATOM   1046 C CG  . LEU C 2 10 ? 15.647 -19.398 -4.642  1.00 19.23  ? 10  LEU C CG  1 
ATOM   1047 C CD1 . LEU C 2 10 ? 16.147 -17.993 -4.360  1.00 18.09  ? 10  LEU C CD1 1 
ATOM   1048 C CD2 . LEU C 2 10 ? 16.108 -19.863 -6.025  1.00 19.43  ? 10  LEU C CD2 1 
ATOM   1049 N N   . GLN C 2 11 ? 17.668 -22.758 -2.384  1.00 19.49  ? 11  GLN C N   1 
ATOM   1050 C CA  . GLN C 2 11 ? 18.468 -23.256 -1.266  1.00 19.22  ? 11  GLN C CA  1 
ATOM   1051 C C   . GLN C 2 11 ? 19.651 -22.311 -1.101  1.00 18.43  ? 11  GLN C C   1 
ATOM   1052 O O   . GLN C 2 11 ? 20.526 -22.252 -1.963  1.00 18.51  ? 11  GLN C O   1 
ATOM   1053 C CB  . GLN C 2 11 ? 18.965 -24.675 -1.539  1.00 19.34  ? 11  GLN C CB  1 
ATOM   1054 C CG  . GLN C 2 11 ? 17.889 -25.745 -1.486  1.00 20.58  ? 11  GLN C CG  1 
ATOM   1055 C CD  . GLN C 2 11 ? 18.447 -27.135 -1.720  1.00 20.38  ? 11  GLN C CD  1 
ATOM   1056 O OE1 . GLN C 2 11 ? 17.856 -27.930 -2.447  1.00 24.04  ? 11  GLN C OE1 1 
ATOM   1057 N NE2 . GLN C 2 11 ? 19.650 -27.579 -1.430  0.00 20.00  ? 11  GLN C NE2 1 
ATOM   1058 N N   . LEU C 2 12 ? 19.672 -21.562 -0.004  1.00 17.57  ? 12  LEU C N   1 
ATOM   1059 C CA  . LEU C 2 12 ? 20.655 -20.491 0.159   1.00 17.34  ? 12  LEU C CA  1 
ATOM   1060 C C   . LEU C 2 12 ? 21.452 -20.619 1.453   1.00 17.09  ? 12  LEU C C   1 
ATOM   1061 O O   . LEU C 2 12 ? 20.928 -21.118 2.448   1.00 17.33  ? 12  LEU C O   1 
ATOM   1062 C CB  . LEU C 2 12 ? 19.967 -19.122 0.111   1.00 17.08  ? 12  LEU C CB  1 
ATOM   1063 C CG  . LEU C 2 12 ? 19.071 -18.796 -1.097  1.00 16.96  ? 12  LEU C CG  1 
ATOM   1064 C CD1 . LEU C 2 12 ? 18.336 -17.475 -0.903  1.00 17.37  ? 12  LEU C CD1 1 
ATOM   1065 C CD2 . LEU C 2 12 ? 19.851 -18.795 -2.414  1.00 17.19  ? 12  LEU C CD2 1 
ATOM   1066 N N   . PRO C 2 13 ? 22.722 -20.161 1.443   1.00 16.81  ? 13  PRO C N   1 
ATOM   1067 C CA  . PRO C 2 13 ? 23.528 -20.186 2.671   1.00 16.80  ? 13  PRO C CA  1 
ATOM   1068 C C   . PRO C 2 13 ? 22.933 -19.244 3.702   1.00 16.56  ? 13  PRO C C   1 
ATOM   1069 O O   . PRO C 2 13 ? 22.696 -18.068 3.410   1.00 16.61  ? 13  PRO C O   1 
ATOM   1070 C CB  . PRO C 2 13 ? 24.903 -19.686 2.210   1.00 17.09  ? 13  PRO C CB  1 
ATOM   1071 C CG  . PRO C 2 13 ? 24.637 -18.920 0.942   1.00 17.06  ? 13  PRO C CG  1 
ATOM   1072 C CD  . PRO C 2 13 ? 23.459 -19.593 0.294   1.00 17.51  ? 13  PRO C CD  1 
ATOM   1073 N N   . ALA C 2 14 ? 22.684 -19.765 4.900   1.00 16.41  ? 14  ALA C N   1 
ATOM   1074 C CA  . ALA C 2 14 ? 22.091 -18.965 5.973   1.00 16.55  ? 14  ALA C CA  1 
ATOM   1075 C C   . ALA C 2 14 ? 22.875 -17.680 6.206   1.00 16.88  ? 14  ALA C C   1 
ATOM   1076 O O   . ALA C 2 14 ? 24.104 -17.698 6.312   1.00 17.08  ? 14  ALA C O   1 
ATOM   1077 C CB  . ALA C 2 14 ? 22.007 -19.775 7.260   1.00 16.39  ? 14  ALA C CB  1 
ATOM   1078 N N   . GLY C 2 15 ? 22.148 -16.566 6.261   1.00 17.47  ? 15  GLY C N   1 
ATOM   1079 C CA  . GLY C 2 15 ? 22.720 -15.251 6.535   1.00 18.16  ? 15  GLY C CA  1 
ATOM   1080 C C   . GLY C 2 15 ? 23.640 -14.679 5.467   1.00 18.77  ? 15  GLY C C   1 
ATOM   1081 O O   . GLY C 2 15 ? 24.208 -13.595 5.658   1.00 19.61  ? 15  GLY C O   1 
ATOM   1082 N N   . LYS C 2 16 ? 23.772 -15.382 4.338   1.00 18.70  ? 16  LYS C N   1 
ATOM   1083 C CA  . LYS C 2 16 ? 24.790 -15.060 3.335   1.00 19.02  ? 16  LYS C CA  1 
ATOM   1084 C C   . LYS C 2 16 ? 24.266 -14.958 1.900   1.00 18.61  ? 16  LYS C C   1 
ATOM   1085 O O   . LYS C 2 16 ? 25.029 -15.109 0.947   1.00 19.02  ? 16  LYS C O   1 
ATOM   1086 C CB  . LYS C 2 16 ? 25.955 -16.061 3.405   1.00 19.09  ? 16  LYS C CB  1 
ATOM   1087 C CG  . LYS C 2 16 ? 26.820 -15.935 4.654   1.00 19.69  ? 16  LYS C CG  1 
ATOM   1088 C CD  . LYS C 2 16 ? 28.254 -16.228 4.567   0.00 20.00  ? 16  LYS C CD  1 
ATOM   1089 C CE  . LYS C 2 16 ? 28.682 -16.893 5.866   0.00 20.00  ? 16  LYS C CE  1 
ATOM   1090 N NZ  . LYS C 2 16 ? 29.964 -17.634 5.714   0.00 20.00  ? 16  LYS C NZ  1 
ATOM   1091 N N   . ALA C 2 17 ? 22.970 -14.707 1.748   1.00 17.97  ? 17  ALA C N   1 
ATOM   1092 C CA  . ALA C 2 17 ? 22.401 -14.481 0.419   1.00 17.87  ? 17  ALA C CA  1 
ATOM   1093 C C   . ALA C 2 17 ? 22.923 -13.164 -0.154  1.00 17.91  ? 17  ALA C C   1 
ATOM   1094 O O   . ALA C 2 17 ? 23.227 -12.232 0.595   1.00 17.97  ? 17  ALA C O   1 
ATOM   1095 C CB  . ALA C 2 17 ? 20.884 -14.475 0.486   1.00 18.04  ? 17  ALA C CB  1 
ATOM   1096 N N   . THR C 2 18 ? 23.053 -13.117 -1.481  1.00 18.12  ? 18  THR C N   1 
ATOM   1097 C CA  . THR C 2 18 ? 23.448 -11.908 -2.211  1.00 18.49  ? 18  THR C CA  1 
ATOM   1098 C C   . THR C 2 18 ? 22.528 -11.766 -3.427  1.00 19.00  ? 18  THR C C   1 
ATOM   1099 O O   . THR C 2 18 ? 21.765 -12.685 -3.723  1.00 18.87  ? 18  THR C O   1 
ATOM   1100 C CB  . THR C 2 18 ? 24.920 -11.974 -2.705  1.00 18.52  ? 18  THR C CB  1 
ATOM   1101 O OG1 . THR C 2 18 ? 25.044 -12.973 -3.727  1.00 19.00  ? 18  THR C OG1 1 
ATOM   1102 C CG2 . THR C 2 18 ? 25.891 -12.267 -1.566  1.00 18.32  ? 18  THR C CG2 1 
ATOM   1103 N N   . PRO C 2 19 ? 22.590 -10.619 -4.138  1.00 19.38  ? 19  PRO C N   1 
ATOM   1104 C CA  . PRO C 2 19 ? 21.814 -10.499 -5.382  1.00 19.60  ? 19  PRO C CA  1 
ATOM   1105 C C   . PRO C 2 19 ? 22.276 -11.430 -6.513  1.00 19.75  ? 19  PRO C C   1 
ATOM   1106 O O   . PRO C 2 19 ? 21.587 -11.545 -7.524  1.00 19.72  ? 19  PRO C O   1 
ATOM   1107 C CB  . PRO C 2 19 ? 22.027 -9.034  -5.797  1.00 19.85  ? 19  PRO C CB  1 
ATOM   1108 C CG  . PRO C 2 19 ? 22.544 -8.347  -4.587  1.00 19.83  ? 19  PRO C CG  1 
ATOM   1109 C CD  . PRO C 2 19 ? 23.315 -9.373  -3.828  1.00 19.49  ? 19  PRO C CD  1 
ATOM   1110 N N   . ALA C 2 20 ? 23.423 -12.087 -6.342  1.00 20.05  ? 20  ALA C N   1 
ATOM   1111 C CA  . ALA C 2 20 ? 23.974 -12.982 -7.364  1.00 20.57  ? 20  ALA C CA  1 
ATOM   1112 C C   . ALA C 2 20 ? 23.037 -14.172 -7.638  1.00 20.65  ? 20  ALA C C   1 
ATOM   1113 O O   . ALA C 2 20 ? 22.184 -14.487 -6.806  1.00 21.12  ? 20  ALA C O   1 
ATOM   1114 C CB  . ALA C 2 20 ? 25.364 -13.469 -6.941  1.00 20.50  ? 20  ALA C CB  1 
ATOM   1115 N N   . PRO C 2 21 ? 23.176 -14.823 -8.814  1.00 21.05  ? 21  PRO C N   1 
ATOM   1116 C CA  . PRO C 2 21 ? 22.395 -16.035 -9.083  1.00 20.96  ? 21  PRO C CA  1 
ATOM   1117 C C   . PRO C 2 21 ? 22.562 -17.080 -7.974  1.00 21.10  ? 21  PRO C C   1 
ATOM   1118 O O   . PRO C 2 21 ? 23.659 -17.213 -7.422  1.00 21.31  ? 21  PRO C O   1 
ATOM   1119 C CB  . PRO C 2 21 ? 22.990 -16.537 -10.401 1.00 20.99  ? 21  PRO C CB  1 
ATOM   1120 C CG  . PRO C 2 21 ? 23.449 -15.286 -11.080 1.00 21.04  ? 21  PRO C CG  1 
ATOM   1121 C CD  . PRO C 2 21 ? 24.033 -14.468 -9.962  1.00 20.93  ? 21  PRO C CD  1 
ATOM   1122 N N   . PRO C 2 22 ? 21.486 -17.822 -7.642  1.00 20.78  ? 22  PRO C N   1 
ATOM   1123 C CA  . PRO C 2 22 ? 20.179 -17.833 -8.312  1.00 20.32  ? 22  PRO C CA  1 
ATOM   1124 C C   . PRO C 2 22 ? 19.213 -16.702 -7.912  1.00 19.19  ? 22  PRO C C   1 
ATOM   1125 O O   . PRO C 2 22 ? 18.154 -16.567 -8.528  1.00 18.52  ? 22  PRO C O   1 
ATOM   1126 C CB  . PRO C 2 22 ? 19.594 -19.182 -7.880  1.00 20.58  ? 22  PRO C CB  1 
ATOM   1127 C CG  . PRO C 2 22 ? 20.149 -19.398 -6.515  1.00 21.30  ? 22  PRO C CG  1 
ATOM   1128 C CD  . PRO C 2 22 ? 21.524 -18.765 -6.506  1.00 20.96  ? 22  PRO C CD  1 
ATOM   1129 N N   . VAL C 2 23 ? 19.576 -15.903 -6.909  1.00 18.18  ? 23  VAL C N   1 
ATOM   1130 C CA  . VAL C 2 23 ? 18.650 -14.939 -6.305  1.00 17.22  ? 23  VAL C CA  1 
ATOM   1131 C C   . VAL C 2 23 ? 18.153 -13.858 -7.282  1.00 16.67  ? 23  VAL C C   1 
ATOM   1132 O O   . VAL C 2 23 ? 16.947 -13.700 -7.472  1.00 16.02  ? 23  VAL C O   1 
ATOM   1133 C CB  . VAL C 2 23 ? 19.251 -14.288 -5.028  1.00 17.24  ? 23  VAL C CB  1 
ATOM   1134 C CG1 . VAL C 2 23 ? 18.320 -13.243 -4.478  1.00 17.20  ? 23  VAL C CG1 1 
ATOM   1135 C CG2 . VAL C 2 23 ? 19.530 -15.342 -3.956  1.00 17.43  ? 23  VAL C CG2 1 
ATOM   1136 N N   . GLY C 2 24 ? 19.083 -13.109 -7.870  1.00 15.85  ? 24  GLY C N   1 
ATOM   1137 C CA  . GLY C 2 24 ? 18.724 -12.076 -8.851  1.00 15.99  ? 24  GLY C CA  1 
ATOM   1138 C C   . GLY C 2 24 ? 17.744 -12.519 -9.934  1.00 16.16  ? 24  GLY C C   1 
ATOM   1139 O O   . GLY C 2 24 ? 16.669 -11.917 -10.079 1.00 15.64  ? 24  GLY C O   1 
ATOM   1140 N N   . PRO C 2 25 ? 18.112 -13.555 -10.714 1.00 16.66  ? 25  PRO C N   1 
ATOM   1141 C CA  . PRO C 2 25 ? 17.182 -14.049 -11.735 1.00 16.83  ? 25  PRO C CA  1 
ATOM   1142 C C   . PRO C 2 25 ? 15.855 -14.583 -11.200 1.00 16.79  ? 25  PRO C C   1 
ATOM   1143 O O   . PRO C 2 25 ? 14.806 -14.305 -11.781 1.00 16.67  ? 25  PRO C O   1 
ATOM   1144 C CB  . PRO C 2 25 ? 17.975 -15.168 -12.427 1.00 17.44  ? 25  PRO C CB  1 
ATOM   1145 C CG  . PRO C 2 25 ? 19.399 -14.855 -12.146 1.00 17.74  ? 25  PRO C CG  1 
ATOM   1146 C CD  . PRO C 2 25 ? 19.404 -14.265 -10.773 1.00 17.01  ? 25  PRO C CD  1 
ATOM   1147 N N   . ALA C 2 26 ? 15.900 -15.334 -10.099 1.00 16.47  ? 26  ALA C N   1 
ATOM   1148 C CA  . ALA C 2 26 ? 14.700 -16.002 -9.591  1.00 16.44  ? 26  ALA C CA  1 
ATOM   1149 C C   . ALA C 2 26 ? 13.646 -15.009 -9.131  1.00 16.41  ? 26  ALA C C   1 
ATOM   1150 O O   . ALA C 2 26 ? 12.456 -15.218 -9.370  1.00 16.70  ? 26  ALA C O   1 
ATOM   1151 C CB  . ALA C 2 26 ? 15.046 -16.980 -8.474  1.00 16.73  ? 26  ALA C CB  1 
ATOM   1152 N N   . LEU C 2 27 ? 14.087 -13.933 -8.482  1.00 16.46  ? 27  LEU C N   1 
ATOM   1153 C CA  . LEU C 2 27 ? 13.185 -12.889 -7.985  1.00 16.84  ? 27  LEU C CA  1 
ATOM   1154 C C   . LEU C 2 27 ? 12.874 -11.848 -9.060  1.00 16.10  ? 27  LEU C C   1 
ATOM   1155 O O   . LEU C 2 27 ? 11.731 -11.404 -9.204  1.00 15.91  ? 27  LEU C O   1 
ATOM   1156 C CB  . LEU C 2 27 ? 13.779 -12.202 -6.741  1.00 17.15  ? 27  LEU C CB  1 
ATOM   1157 C CG  . LEU C 2 27 ? 13.759 -12.835 -5.330  1.00 19.72  ? 27  LEU C CG  1 
ATOM   1158 C CD1 . LEU C 2 27 ? 12.420 -12.639 -4.657  1.00 21.12  ? 27  LEU C CD1 1 
ATOM   1159 C CD2 . LEU C 2 27 ? 14.181 -14.308 -5.328  1.00 20.13  ? 27  LEU C CD2 1 
ATOM   1160 N N   . GLY C 2 28 ? 13.903 -11.472 -9.816  1.00 15.13  ? 28  GLY C N   1 
ATOM   1161 C CA  . GLY C 2 28 ? 13.786 -10.424 -10.828 1.00 14.12  ? 28  GLY C CA  1 
ATOM   1162 C C   . GLY C 2 28 ? 12.838 -10.784 -11.953 1.00 14.37  ? 28  GLY C C   1 
ATOM   1163 O O   . GLY C 2 28 ? 12.170 -9.914  -12.500 1.00 14.19  ? 28  GLY C O   1 
ATOM   1164 N N   . GLN C 2 29 ? 12.766 -12.067 -12.294 1.00 13.92  ? 29  GLN C N   1 
ATOM   1165 C CA  . GLN C 2 29 ? 11.899 -12.511 -13.396 1.00 13.92  ? 29  GLN C CA  1 
ATOM   1166 C C   . GLN C 2 29 ? 10.432 -12.226 -13.092 1.00 14.03  ? 29  GLN C C   1 
ATOM   1167 O O   . GLN C 2 29 ? 9.613  -12.155 -14.004 1.00 13.23  ? 29  GLN C O   1 
ATOM   1168 C CB  . GLN C 2 29 ? 12.081 -14.008 -13.668 1.00 14.21  ? 29  GLN C CB  1 
ATOM   1169 C CG  . GLN C 2 29 ? 11.456 -14.863 -12.562 1.00 14.77  ? 29  GLN C CG  1 
ATOM   1170 C CD  . GLN C 2 29 ? 11.816 -16.323 -12.616 1.00 16.09  ? 29  GLN C CD  1 
ATOM   1171 O OE1 . GLN C 2 29 ? 11.951 -16.970 -11.569 1.00 17.83  ? 29  GLN C OE1 1 
ATOM   1172 N NE2 . GLN C 2 29 ? 11.945 -16.861 -13.801 1.00 15.72  ? 29  GLN C NE2 1 
ATOM   1173 N N   . HIS C 2 30 ? 10.117 -12.074 -11.803 1.00 14.09  ? 30  HIS C N   1 
ATOM   1174 C CA  . HIS C 2 30 ? 8.753  -11.796 -11.346 1.00 14.73  ? 30  HIS C CA  1 
ATOM   1175 C C   . HIS C 2 30 ? 8.607  -10.370 -10.828 1.00 15.13  ? 30  HIS C C   1 
ATOM   1176 O O   . HIS C 2 30 ? 7.558  -10.011 -10.285 1.00 15.39  ? 30  HIS C O   1 
ATOM   1177 C CB  . HIS C 2 30 ? 8.336  -12.804 -10.274 1.00 15.24  ? 30  HIS C CB  1 
ATOM   1178 C CG  . HIS C 2 30 ? 8.283  -14.210 -10.768 1.00 15.01  ? 30  HIS C CG  1 
ATOM   1179 N ND1 . HIS C 2 30 ? 9.094  -15.205 -10.272 1.00 17.41  ? 30  HIS C ND1 1 
ATOM   1180 C CD2 . HIS C 2 30 ? 7.540  -14.781 -11.746 1.00 16.57  ? 30  HIS C CD2 1 
ATOM   1181 C CE1 . HIS C 2 30 ? 8.843  -16.333 -10.913 1.00 16.24  ? 30  HIS C CE1 1 
ATOM   1182 N NE2 . HIS C 2 30 ? 7.909  -16.101 -11.815 1.00 17.63  ? 30  HIS C NE2 1 
ATOM   1183 N N   . GLY C 2 31 ? 9.646  -9.559  -11.005 1.00 15.17  ? 31  GLY C N   1 
ATOM   1184 C CA  . GLY C 2 31 ? 9.630  -8.151  -10.609 1.00 15.53  ? 31  GLY C CA  1 
ATOM   1185 C C   . GLY C 2 31 ? 9.712  -7.904  -9.112  1.00 15.40  ? 31  GLY C C   1 
ATOM   1186 O O   . GLY C 2 31 ? 9.439  -6.797  -8.652  1.00 16.34  ? 31  GLY C O   1 
ATOM   1187 N N   . ALA C 2 32 ? 10.107 -8.921  -8.361  1.00 15.53  ? 32  ALA C N   1 
ATOM   1188 C CA  . ALA C 2 32 ? 10.198 -8.785  -6.912  1.00 15.58  ? 32  ALA C CA  1 
ATOM   1189 C C   . ALA C 2 32 ? 11.470 -8.012  -6.565  1.00 15.68  ? 32  ALA C C   1 
ATOM   1190 O O   . ALA C 2 32 ? 12.441 -8.021  -7.339  1.00 16.07  ? 32  ALA C O   1 
ATOM   1191 C CB  . ALA C 2 32 ? 10.182 -10.146 -6.256  1.00 15.90  ? 32  ALA C CB  1 
ATOM   1192 N N   . ASN C 2 33 ? 11.450 -7.329  -5.421  1.00 15.38  ? 33  ASN C N   1 
ATOM   1193 C CA  . ASN C 2 33 ? 12.568 -6.497  -4.993  1.00 15.50  ? 33  ASN C CA  1 
ATOM   1194 C C   . ASN C 2 33 ? 13.686 -7.381  -4.455  1.00 15.54  ? 33  ASN C C   1 
ATOM   1195 O O   . ASN C 2 33 ? 13.586 -7.928  -3.353  1.00 14.97  ? 33  ASN C O   1 
ATOM   1196 C CB  . ASN C 2 33 ? 12.115 -5.487  -3.929  1.00 16.08  ? 33  ASN C CB  1 
ATOM   1197 C CG  . ASN C 2 33 ? 13.189 -4.461  -3.588  1.00 16.41  ? 33  ASN C CG  1 
ATOM   1198 O OD1 . ASN C 2 33 ? 14.371 -4.789  -3.454  1.00 16.98  ? 33  ASN C OD1 1 
ATOM   1199 N ND2 . ASN C 2 33 ? 12.771 -3.210  -3.416  1.00 19.91  ? 33  ASN C ND2 1 
ATOM   1200 N N   . ILE C 2 34 ? 14.749 -7.514  -5.241  1.00 15.59  ? 34  ILE C N   1 
ATOM   1201 C CA  . ILE C 2 34 ? 15.860 -8.416  -4.917  1.00 16.18  ? 34  ILE C CA  1 
ATOM   1202 C C   . ILE C 2 34 ? 16.541 -8.039  -3.611  1.00 15.89  ? 34  ILE C C   1 
ATOM   1203 O O   . ILE C 2 34 ? 16.748 -8.892  -2.742  1.00 15.62  ? 34  ILE C O   1 
ATOM   1204 C CB  . ILE C 2 34 ? 16.889 -8.471  -6.070  1.00 16.04  ? 34  ILE C CB  1 
ATOM   1205 C CG1 . ILE C 2 34 ? 16.247 -9.135  -7.289  1.00 16.65  ? 34  ILE C CG1 1 
ATOM   1206 C CG2 . ILE C 2 34 ? 18.176 -9.211  -5.640  1.00 16.87  ? 34  ILE C CG2 1 
ATOM   1207 C CD1 . ILE C 2 34 ? 16.881 -8.768  -8.595  1.00 16.89  ? 34  ILE C CD1 1 
ATOM   1208 N N   . MET C 2 35 ? 16.886 -6.762  -3.479  1.00 16.69  ? 35  MET C N   1 
ATOM   1209 C CA  . MET C 2 35 ? 17.522 -6.255  -2.271  1.00 17.63  ? 35  MET C CA  1 
ATOM   1210 C C   . MET C 2 35 ? 16.661 -6.518  -1.041  1.00 17.22  ? 35  MET C C   1 
ATOM   1211 O O   . MET C 2 35 ? 17.152 -7.010  -0.025  1.00 16.50  ? 35  MET C O   1 
ATOM   1212 C CB  . MET C 2 35 ? 17.807 -4.758  -2.403  1.00 18.40  ? 35  MET C CB  1 
ATOM   1213 C CG  . MET C 2 35 ? 19.021 -4.430  -3.258  1.00 21.63  ? 35  MET C CG  1 
ATOM   1214 S SD  . MET C 2 35 ? 20.558 -5.056  -2.554  1.00 31.66  ? 35  MET C SD  1 
ATOM   1215 C CE  . MET C 2 35 ? 20.342 -6.819  -2.783  0.00 20.00  ? 35  MET C CE  1 
ATOM   1216 N N   . GLU C 2 36 ? 15.377 -6.189  -1.137  1.00 16.95  ? 36  GLU C N   1 
ATOM   1217 C CA  . GLU C 2 36 ? 14.453 -6.421  -0.026  1.00 17.75  ? 36  GLU C CA  1 
ATOM   1218 C C   . GLU C 2 36 ? 14.469 -7.894  0.384   1.00 16.76  ? 36  GLU C C   1 
ATOM   1219 O O   . GLU C 2 36 ? 14.535 -8.203  1.576   1.00 16.37  ? 36  GLU C O   1 
ATOM   1220 C CB  . GLU C 2 36 ? 13.032 -5.964  -0.381  1.00 17.71  ? 36  GLU C CB  1 
ATOM   1221 C CG  . GLU C 2 36 ? 12.020 -6.075  0.763   1.00 19.57  ? 36  GLU C CG  1 
ATOM   1222 C CD  . GLU C 2 36 ? 10.591 -5.740  0.339   1.00 19.98  ? 36  GLU C CD  1 
ATOM   1223 O OE1 . GLU C 2 36 ? 10.372 -5.363  -0.829  1.00 23.51  ? 36  GLU C OE1 1 
ATOM   1224 O OE2 . GLU C 2 36 ? 9.683  -5.855  1.193   1.00 25.26  ? 36  GLU C OE2 1 
ATOM   1225 N N   . PHE C 2 37 ? 14.433 -8.799  -0.594  1.00 16.07  ? 37  PHE C N   1 
ATOM   1226 C CA  . PHE C 2 37 ? 14.470 -10.230 -0.281  1.00 15.66  ? 37  PHE C CA  1 
ATOM   1227 C C   . PHE C 2 37 ? 15.783 -10.653 0.370   1.00 15.40  ? 37  PHE C C   1 
ATOM   1228 O O   . PHE C 2 37 ? 15.772 -11.379 1.364   1.00 14.93  ? 37  PHE C O   1 
ATOM   1229 C CB  . PHE C 2 37 ? 14.196 -11.133 -1.501  1.00 16.07  ? 37  PHE C CB  1 
ATOM   1230 C CG  . PHE C 2 37 ? 14.461 -12.581 -1.207  1.00 15.67  ? 37  PHE C CG  1 
ATOM   1231 C CD1 . PHE C 2 37 ? 13.559 -13.325 -0.452  1.00 17.24  ? 37  PHE C CD1 1 
ATOM   1232 C CD2 . PHE C 2 37 ? 15.657 -13.172 -1.594  1.00 15.51  ? 37  PHE C CD2 1 
ATOM   1233 C CE1 . PHE C 2 37 ? 13.828 -14.653 -0.128  1.00 16.98  ? 37  PHE C CE1 1 
ATOM   1234 C CE2 . PHE C 2 37 ? 15.934 -14.497 -1.275  1.00 17.30  ? 37  PHE C CE2 1 
ATOM   1235 C CZ  . PHE C 2 37 ? 15.018 -15.236 -0.542  1.00 16.89  ? 37  PHE C CZ  1 
ATOM   1236 N N   . VAL C 2 38 ? 16.903 -10.210 -0.194  1.00 15.09  ? 38  VAL C N   1 
ATOM   1237 C CA  . VAL C 2 38 ? 18.220 -10.562 0.337   1.00 15.58  ? 38  VAL C CA  1 
ATOM   1238 C C   . VAL C 2 38 ? 18.323 -10.127 1.800   1.00 15.44  ? 38  VAL C C   1 
ATOM   1239 O O   . VAL C 2 38 ? 18.716 -10.926 2.668   1.00 15.90  ? 38  VAL C O   1 
ATOM   1240 C CB  . VAL C 2 38 ? 19.365 -9.953  -0.510  1.00 15.72  ? 38  VAL C CB  1 
ATOM   1241 C CG1 . VAL C 2 38 ? 20.711 -10.069 0.219   1.00 16.35  ? 38  VAL C CG1 1 
ATOM   1242 C CG2 . VAL C 2 38 ? 19.426 -10.627 -1.879  1.00 16.02  ? 38  VAL C CG2 1 
ATOM   1243 N N   . LYS C 2 39 ? 17.952 -8.878  2.076   1.00 15.59  ? 39  LYS C N   1 
ATOM   1244 C CA  . LYS C 2 39 ? 18.014 -8.356  3.446   1.00 15.47  ? 39  LYS C CA  1 
ATOM   1245 C C   . LYS C 2 39 ? 17.104 -9.136  4.396   1.00 15.16  ? 39  LYS C C   1 
ATOM   1246 O O   . LYS C 2 39 ? 17.500 -9.453  5.529   1.00 15.18  ? 39  LYS C O   1 
ATOM   1247 C CB  . LYS C 2 39 ? 17.689 -6.855  3.487   1.00 15.55  ? 39  LYS C CB  1 
ATOM   1248 C CG  . LYS C 2 39 ? 17.991 -6.186  4.827   1.00 18.34  ? 39  LYS C CG  1 
ATOM   1249 C CD  . LYS C 2 39 ? 17.948 -4.742  4.930   0.00 20.00  ? 39  LYS C CD  1 
ATOM   1250 C CE  . LYS C 2 39 ? 17.482 -4.142  6.229   0.00 20.00  ? 39  LYS C CE  1 
ATOM   1251 N NZ  . LYS C 2 39 ? 17.060 -5.213  7.166   0.00 20.00  ? 39  LYS C NZ  1 
ATOM   1252 N N   . ALA C 2 40 ? 15.902 -9.470  3.929   1.00 14.64  ? 40  ALA C N   1 
ATOM   1253 C CA  . ALA C 2 40 ? 14.919 -10.181 4.746   1.00 14.42  ? 40  ALA C CA  1 
ATOM   1254 C C   . ALA C 2 40 ? 15.315 -11.629 5.004   1.00 14.04  ? 40  ALA C C   1 
ATOM   1255 O O   . ALA C 2 40 ? 15.257 -12.095 6.157   1.00 13.91  ? 40  ALA C O   1 
ATOM   1256 C CB  . ALA C 2 40 ? 13.528 -10.094 4.115   1.00 14.48  ? 40  ALA C CB  1 
ATOM   1257 N N   . PHE C 2 41 ? 15.738 -12.331 3.953   1.00 14.02  ? 41  PHE C N   1 
ATOM   1258 C CA  . PHE C 2 41 ? 16.230 -13.697 4.102   1.00 13.86  ? 41  PHE C CA  1 
ATOM   1259 C C   . PHE C 2 41 ? 17.420 -13.750 5.056   1.00 14.26  ? 41  PHE C C   1 
ATOM   1260 O O   . PHE C 2 41 ? 17.462 -14.596 5.959   1.00 14.23  ? 41  PHE C O   1 
ATOM   1261 C CB  . PHE C 2 41 ? 16.619 -14.314 2.745   1.00 13.73  ? 41  PHE C CB  1 
ATOM   1262 C CG  . PHE C 2 41 ? 17.259 -15.673 2.881   1.00 13.86  ? 41  PHE C CG  1 
ATOM   1263 C CD1 . PHE C 2 41 ? 16.477 -16.820 2.949   1.00 13.92  ? 41  PHE C CD1 1 
ATOM   1264 C CD2 . PHE C 2 41 ? 18.643 -15.792 2.997   1.00 13.10  ? 41  PHE C CD2 1 
ATOM   1265 C CE1 . PHE C 2 41 ? 17.066 -18.064 3.109   1.00 12.93  ? 41  PHE C CE1 1 
ATOM   1266 C CE2 . PHE C 2 41 ? 19.246 -17.039 3.164   1.00 13.96  ? 41  PHE C CE2 1 
ATOM   1267 C CZ  . PHE C 2 41 ? 18.456 -18.174 3.217   1.00 13.78  ? 41  PHE C CZ  1 
ATOM   1268 N N   . ASN C 2 42 ? 18.381 -12.849 4.871   1.00 14.35  ? 42  ASN C N   1 
ATOM   1269 C CA  . ASN C 2 42 ? 19.571 -12.823 5.727   1.00 14.81  ? 42  ASN C CA  1 
ATOM   1270 C C   . ASN C 2 42 ? 19.265 -12.554 7.192   1.00 14.51  ? 42  ASN C C   1 
ATOM   1271 O O   . ASN C 2 42 ? 19.858 -13.182 8.071   1.00 14.78  ? 42  ASN C O   1 
ATOM   1272 C CB  . ASN C 2 42 ? 20.624 -11.854 5.188   1.00 14.84  ? 42  ASN C CB  1 
ATOM   1273 C CG  . ASN C 2 42 ? 21.346 -12.417 3.985   1.00 15.17  ? 42  ASN C CG  1 
ATOM   1274 O OD1 . ASN C 2 42 ? 21.283 -13.624 3.739   1.00 16.01  ? 42  ASN C OD1 1 
ATOM   1275 N ND2 . ASN C 2 42 ? 22.038 -11.560 3.230   1.00 15.85  ? 42  ASN C ND2 1 
ATOM   1276 N N   . ALA C 2 43 ? 18.321 -11.653 7.454   1.00 14.09  ? 43  ALA C N   1 
ATOM   1277 C CA  . ALA C 2 43 ? 17.880 -11.388 8.820   1.00 13.64  ? 43  ALA C CA  1 
ATOM   1278 C C   . ALA C 2 43 ? 17.149 -12.591 9.415   1.00 13.58  ? 43  ALA C C   1 
ATOM   1279 O O   . ALA C 2 43 ? 17.352 -12.922 10.581  1.00 13.60  ? 43  ALA C O   1 
ATOM   1280 C CB  . ALA C 2 43 ? 17.005 -10.148 8.874   1.00 13.91  ? 43  ALA C CB  1 
ATOM   1281 N N   . ALA C 2 44 ? 16.328 -13.267 8.613   1.00 13.30  ? 44  ALA C N   1 
ATOM   1282 C CA  . ALA C 2 44 ? 15.544 -14.405 9.103   1.00 13.33  ? 44  ALA C CA  1 
ATOM   1283 C C   . ALA C 2 44 ? 16.406 -15.637 9.357   1.00 12.95  ? 44  ALA C C   1 
ATOM   1284 O O   . ALA C 2 44 ? 15.997 -16.533 10.084  1.00 12.64  ? 44  ALA C O   1 
ATOM   1285 C CB  . ALA C 2 44 ? 14.432 -14.747 8.116   1.00 13.99  ? 44  ALA C CB  1 
ATOM   1286 N N   . THR C 2 45 ? 17.583 -15.679 8.736   1.00 12.99  ? 45  THR C N   1 
ATOM   1287 C CA  . THR C 2 45 ? 18.459 -16.843 8.820   1.00 13.01  ? 45  THR C CA  1 
ATOM   1288 C C   . THR C 2 45 ? 19.805 -16.552 9.485   1.00 13.15  ? 45  THR C C   1 
ATOM   1289 O O   . THR C 2 45 ? 20.684 -17.418 9.514   1.00 13.11  ? 45  THR C O   1 
ATOM   1290 C CB  . THR C 2 45 ? 18.701 -17.460 7.429   1.00 12.96  ? 45  THR C CB  1 
ATOM   1291 O OG1 . THR C 2 45 ? 19.325 -16.488 6.579   1.00 13.94  ? 45  THR C OG1 1 
ATOM   1292 C CG2 . THR C 2 45 ? 17.380 -17.912 6.821   1.00 14.56  ? 45  THR C CG2 1 
ATOM   1293 N N   . ALA C 2 46 ? 19.954 -15.348 10.040  1.00 13.28  ? 46  ALA C N   1 
ATOM   1294 C CA  . ALA C 2 46 ? 21.226 -14.899 10.620  1.00 13.52  ? 46  ALA C CA  1 
ATOM   1295 C C   . ALA C 2 46 ? 21.637 -15.712 11.841  1.00 13.62  ? 46  ALA C C   1 
ATOM   1296 O O   . ALA C 2 46 ? 22.795 -15.680 12.256  1.00 14.07  ? 46  ALA C O   1 
ATOM   1297 C CB  . ALA C 2 46 ? 21.151 -13.418 10.983  1.00 14.24  ? 46  ALA C CB  1 
ATOM   1298 N N   . ASN C 2 47 ? 20.673 -16.413 12.425  1.00 13.12  ? 47  ASN C N   1 
ATOM   1299 C CA  . ASN C 2 47 ? 20.914 -17.209 13.616  1.00 13.03  ? 47  ASN C CA  1 
ATOM   1300 C C   . ASN C 2 47 ? 20.782 -18.706 13.376  1.00 13.65  ? 47  ASN C C   1 
ATOM   1301 O O   . ASN C 2 47 ? 20.515 -19.492 14.293  1.00 14.03  ? 47  ASN C O   1 
ATOM   1302 C CB  . ASN C 2 47 ? 19.999 -16.714 14.732  1.00 12.67  ? 47  ASN C CB  1 
ATOM   1303 C CG  . ASN C 2 47 ? 20.459 -15.391 15.288  1.00 12.15  ? 47  ASN C CG  1 
ATOM   1304 O OD1 . ASN C 2 47 ? 20.142 -14.316 14.751  1.00 13.90  ? 47  ASN C OD1 1 
ATOM   1305 N ND2 . ASN C 2 47 ? 21.255 -15.457 16.332  1.00 9.79   ? 47  ASN C ND2 1 
ATOM   1306 N N   . MET C 2 48 ? 20.983 -19.096 12.117  1.00 14.36  ? 48  MET C N   1 
ATOM   1307 C CA  . MET C 2 48 ? 20.968 -20.509 11.738  1.00 15.49  ? 48  MET C CA  1 
ATOM   1308 C C   . MET C 2 48 ? 22.345 -21.044 11.315  1.00 16.09  ? 48  MET C C   1 
ATOM   1309 O O   . MET C 2 48 ? 22.440 -22.093 10.671  1.00 16.69  ? 48  MET C O   1 
ATOM   1310 C CB  . MET C 2 48 ? 19.939 -20.748 10.637  1.00 15.64  ? 48  MET C CB  1 
ATOM   1311 C CG  . MET C 2 48 ? 18.505 -20.527 11.062  1.00 14.91  ? 48  MET C CG  1 
ATOM   1312 S SD  . MET C 2 48 ? 17.420 -20.565 9.628   1.00 16.51  ? 48  MET C SD  1 
ATOM   1313 C CE  . MET C 2 48 ? 15.838 -20.248 10.385  1.00 18.12  ? 48  MET C CE  1 
ATOM   1314 N N   . GLY C 2 49 ? 23.404 -20.320 11.669  1.00 16.99  ? 49  GLY C N   1 
ATOM   1315 C CA  . GLY C 2 49 ? 24.777 -20.785 11.447  1.00 17.96  ? 49  GLY C CA  1 
ATOM   1316 C C   . GLY C 2 49 ? 25.137 -20.828 9.975   1.00 18.89  ? 49  GLY C C   1 
ATOM   1317 O O   . GLY C 2 49 ? 24.794 -19.916 9.223   1.00 19.39  ? 49  GLY C O   1 
ATOM   1318 N N   . ASP C 2 50 ? 25.825 -21.891 9.562   1.00 19.53  ? 50  ASP C N   1 
ATOM   1319 C CA  . ASP C 2 50 ? 26.227 -22.048 8.161   1.00 20.07  ? 50  ASP C CA  1 
ATOM   1320 C C   . ASP C 2 50 ? 25.366 -23.061 7.397   1.00 19.81  ? 50  ASP C C   1 
ATOM   1321 O O   . ASP C 2 50 ? 25.792 -23.620 6.378   1.00 19.84  ? 50  ASP C O   1 
ATOM   1322 C CB  . ASP C 2 50 ? 27.731 -22.365 8.044   1.00 20.81  ? 50  ASP C CB  1 
ATOM   1323 C CG  . ASP C 2 50 ? 28.174 -23.530 8.928   1.00 22.65  ? 50  ASP C CG  1 
ATOM   1324 O OD1 . ASP C 2 50 ? 27.373 -24.031 9.750   1.00 26.42  ? 50  ASP C OD1 1 
ATOM   1325 O OD2 . ASP C 2 50 ? 29.349 -23.942 8.812   1.00 25.33  ? 50  ASP C OD2 1 
ATOM   1326 N N   . ALA C 2 51 ? 24.150 -23.283 7.894   1.00 19.48  ? 51  ALA C N   1 
ATOM   1327 C CA  . ALA C 2 51 ? 23.187 -24.189 7.267   1.00 19.31  ? 51  ALA C CA  1 
ATOM   1328 C C   . ALA C 2 51 ? 22.789 -23.736 5.861   1.00 19.10  ? 51  ALA C C   1 
ATOM   1329 O O   . ALA C 2 51 ? 22.687 -22.542 5.591   1.00 18.63  ? 51  ALA C O   1 
ATOM   1330 C CB  . ALA C 2 51 ? 21.946 -24.316 8.150   1.00 19.43  ? 51  ALA C CB  1 
ATOM   1331 N N   . ILE C 2 52 ? 22.582 -24.692 4.963   1.00 19.01  ? 52  ILE C N   1 
ATOM   1332 C CA  . ILE C 2 52 ? 21.965 -24.377 3.680   1.00 19.09  ? 52  ILE C CA  1 
ATOM   1333 C C   . ILE C 2 52 ? 20.459 -24.416 3.914   1.00 19.26  ? 52  ILE C C   1 
ATOM   1334 O O   . ILE C 2 52 ? 19.900 -25.452 4.290   1.00 19.72  ? 52  ILE C O   1 
ATOM   1335 C CB  . ILE C 2 52 ? 22.391 -25.353 2.548   1.00 19.20  ? 52  ILE C CB  1 
ATOM   1336 C CG1 . ILE C 2 52 ? 23.923 -25.462 2.439   1.00 19.85  ? 52  ILE C CG1 1 
ATOM   1337 C CG2 . ILE C 2 52 ? 21.771 -24.934 1.209   1.00 18.88  ? 52  ILE C CG2 1 
ATOM   1338 C CD1 . ILE C 2 52 ? 24.690 -24.131 2.454   1.00 20.46  ? 52  ILE C CD1 1 
ATOM   1339 N N   . VAL C 2 53 ? 19.814 -23.268 3.738   1.00 19.14  ? 53  VAL C N   1 
ATOM   1340 C CA  . VAL C 2 53 ? 18.408 -23.122 4.086   1.00 19.16  ? 53  VAL C CA  1 
ATOM   1341 C C   . VAL C 2 53 ? 17.515 -23.188 2.850   1.00 19.43  ? 53  VAL C C   1 
ATOM   1342 O O   . VAL C 2 53 ? 17.606 -22.326 1.973   1.00 19.05  ? 53  VAL C O   1 
ATOM   1343 C CB  . VAL C 2 53 ? 18.139 -21.801 4.856   1.00 19.11  ? 53  VAL C CB  1 
ATOM   1344 C CG1 . VAL C 2 53 ? 16.664 -21.688 5.222   1.00 19.09  ? 53  VAL C CG1 1 
ATOM   1345 C CG2 . VAL C 2 53 ? 19.006 -21.711 6.104   1.00 19.58  ? 53  VAL C CG2 1 
ATOM   1346 N N   . PRO C 2 54 ? 16.646 -24.213 2.779   1.00 19.73  ? 54  PRO C N   1 
ATOM   1347 C CA  . PRO C 2 54 ? 15.640 -24.237 1.730   1.00 20.24  ? 54  PRO C CA  1 
ATOM   1348 C C   . PRO C 2 54 ? 14.602 -23.163 2.027   1.00 20.57  ? 54  PRO C C   1 
ATOM   1349 O O   . PRO C 2 54 ? 14.184 -23.001 3.184   1.00 20.84  ? 54  PRO C O   1 
ATOM   1350 C CB  . PRO C 2 54 ? 15.043 -25.651 1.829   1.00 20.51  ? 54  PRO C CB  1 
ATOM   1351 C CG  . PRO C 2 54 ? 15.959 -26.415 2.754   1.00 20.19  ? 54  PRO C CG  1 
ATOM   1352 C CD  . PRO C 2 54 ? 16.547 -25.389 3.662   1.00 19.75  ? 54  PRO C CD  1 
ATOM   1353 N N   . VAL C 2 55 ? 14.239 -22.406 0.998   1.00 20.64  ? 55  VAL C N   1 
ATOM   1354 C CA  . VAL C 2 55 ? 13.311 -21.293 1.147   1.00 20.92  ? 55  VAL C CA  1 
ATOM   1355 C C   . VAL C 2 55 ? 12.295 -21.302 0.016   1.00 21.22  ? 55  VAL C C   1 
ATOM   1356 O O   . VAL C 2 55 ? 12.644 -21.480 -1.153  1.00 21.35  ? 55  VAL C O   1 
ATOM   1357 C CB  . VAL C 2 55 ? 14.051 -19.918 1.284   1.00 21.12  ? 55  VAL C CB  1 
ATOM   1358 C CG1 . VAL C 2 55 ? 15.030 -19.685 0.140   1.00 21.06  ? 55  VAL C CG1 1 
ATOM   1359 C CG2 . VAL C 2 55 ? 13.062 -18.756 1.408   1.00 20.85  ? 55  VAL C CG2 1 
ATOM   1360 N N   . GLU C 2 56 ? 11.031 -21.137 0.384   1.00 21.38  ? 56  GLU C N   1 
ATOM   1361 C CA  . GLU C 2 56 ? 9.944  -21.095 -0.575  1.00 21.59  ? 56  GLU C CA  1 
ATOM   1362 C C   . GLU C 2 56 ? 9.422  -19.665 -0.605  1.00 20.90  ? 56  GLU C C   1 
ATOM   1363 O O   . GLU C 2 56 ? 8.918  -19.165 0.402   1.00 21.02  ? 56  GLU C O   1 
ATOM   1364 C CB  . GLU C 2 56 ? 8.853  -22.078 -0.147  1.00 21.99  ? 56  GLU C CB  1 
ATOM   1365 C CG  . GLU C 2 56 ? 7.711  -22.249 -1.120  1.00 22.94  ? 56  GLU C CG  1 
ATOM   1366 C CD  . GLU C 2 56 ? 6.618  -23.165 -0.586  1.00 23.05  ? 56  GLU C CD  1 
ATOM   1367 O OE1 . GLU C 2 56 ? 6.943  -24.190 0.054   1.00 25.73  ? 56  GLU C OE1 1 
ATOM   1368 O OE2 . GLU C 2 56 ? 5.426  -22.863 -0.815  1.00 25.99  ? 56  GLU C OE2 1 
ATOM   1369 N N   . ILE C 2 57 ? 9.574  -19.014 -1.755  1.00 19.96  ? 57  ILE C N   1 
ATOM   1370 C CA  . ILE C 2 57 ? 9.205  -17.614 -1.932  1.00 19.28  ? 57  ILE C CA  1 
ATOM   1371 C C   . ILE C 2 57 ? 7.939  -17.505 -2.773  1.00 18.88  ? 57  ILE C C   1 
ATOM   1372 O O   . ILE C 2 57 ? 7.917  -17.912 -3.936  1.00 18.77  ? 57  ILE C O   1 
ATOM   1373 C CB  . ILE C 2 57 ? 10.343 -16.809 -2.608  1.00 19.02  ? 57  ILE C CB  1 
ATOM   1374 C CG1 . ILE C 2 57 ? 11.664 -17.007 -1.858  1.00 19.13  ? 57  ILE C CG1 1 
ATOM   1375 C CG2 . ILE C 2 57 ? 9.983  -15.323 -2.706  1.00 18.68  ? 57  ILE C CG2 1 
ATOM   1376 C CD1 . ILE C 2 57 ? 12.880 -17.016 -2.748  1.00 19.48  ? 57  ILE C CD1 1 
ATOM   1377 N N   . THR C 2 58 ? 6.888  -16.960 -2.174  1.00 18.56  ? 58  THR C N   1 
ATOM   1378 C CA  . THR C 2 58 ? 5.636  -16.715 -2.869  1.00 18.36  ? 58  THR C CA  1 
ATOM   1379 C C   . THR C 2 58 ? 5.627  -15.258 -3.320  1.00 18.46  ? 58  THR C C   1 
ATOM   1380 O O   . THR C 2 58 ? 5.832  -14.348 -2.515  1.00 18.32  ? 58  THR C O   1 
ATOM   1381 C CB  . THR C 2 58 ? 4.423  -17.036 -1.969  1.00 18.51  ? 58  THR C CB  1 
ATOM   1382 O OG1 . THR C 2 58 ? 4.481  -18.413 -1.578  1.00 18.77  ? 58  THR C OG1 1 
ATOM   1383 C CG2 . THR C 2 58 ? 3.114  -16.785 -2.699  1.00 18.39  ? 58  THR C CG2 1 
ATOM   1384 N N   . ILE C 2 59 ? 5.432  -15.049 -4.617  1.00 18.55  ? 59  ILE C N   1 
ATOM   1385 C CA  . ILE C 2 59 ? 5.405  -13.708 -5.178  1.00 19.07  ? 59  ILE C CA  1 
ATOM   1386 C C   . ILE C 2 59 ? 4.002  -13.365 -5.674  1.00 19.25  ? 59  ILE C C   1 
ATOM   1387 O O   . ILE C 2 59 ? 3.322  -14.201 -6.271  1.00 19.66  ? 59  ILE C O   1 
ATOM   1388 C CB  . ILE C 2 59 ? 6.456  -13.553 -6.307  1.00 19.10  ? 59  ILE C CB  1 
ATOM   1389 C CG1 . ILE C 2 59 ? 7.850  -13.888 -5.760  1.00 19.97  ? 59  ILE C CG1 1 
ATOM   1390 C CG2 . ILE C 2 59 ? 6.424  -12.137 -6.887  1.00 19.22  ? 59  ILE C CG2 1 
ATOM   1391 C CD1 . ILE C 2 59 ? 8.859  -14.310 -6.811  1.00 21.67  ? 59  ILE C CD1 1 
ATOM   1392 N N   . TYR C 2 60 ? 3.584  -12.128 -5.421  1.00 19.38  ? 60  TYR C N   1 
ATOM   1393 C CA  . TYR C 2 60 ? 2.227  -11.677 -5.722  1.00 19.82  ? 60  TYR C CA  1 
ATOM   1394 C C   . TYR C 2 60 ? 2.202  -10.757 -6.935  1.00 20.25  ? 60  TYR C C   1 
ATOM   1395 O O   . TYR C 2 60 ? 3.254  -10.313 -7.397  1.00 20.30  ? 60  TYR C O   1 
ATOM   1396 C CB  . TYR C 2 60 ? 1.613  -11.007 -4.492  1.00 19.35  ? 60  TYR C CB  1 
ATOM   1397 C CG  . TYR C 2 60 ? 1.678  -11.910 -3.282  1.00 18.82  ? 60  TYR C CG  1 
ATOM   1398 C CD1 . TYR C 2 60 ? 0.687  -12.862 -3.049  1.00 19.37  ? 60  TYR C CD1 1 
ATOM   1399 C CD2 . TYR C 2 60 ? 2.755  -11.843 -2.394  1.00 18.65  ? 60  TYR C CD2 1 
ATOM   1400 C CE1 . TYR C 2 60 ? 0.752  -13.708 -1.958  1.00 17.52  ? 60  TYR C CE1 1 
ATOM   1401 C CE2 . TYR C 2 60 ? 2.831  -12.687 -1.294  1.00 17.73  ? 60  TYR C CE2 1 
ATOM   1402 C CZ  . TYR C 2 60 ? 1.825  -13.615 -1.084  1.00 18.26  ? 60  TYR C CZ  1 
ATOM   1403 O OH  . TYR C 2 60 ? 1.902  -14.455 -0.006  1.00 18.29  ? 60  TYR C OH  1 
ATOM   1404 N N   . ALA C 2 61 ? 1.002  -10.486 -7.446  1.00 20.92  ? 61  ALA C N   1 
ATOM   1405 C CA  . ALA C 2 61 ? 0.827  -9.702  -8.675  1.00 21.56  ? 61  ALA C CA  1 
ATOM   1406 C C   . ALA C 2 61 ? 1.336  -8.269  -8.542  1.00 21.92  ? 61  ALA C C   1 
ATOM   1407 O O   . ALA C 2 61 ? 1.774  -7.672  -9.527  1.00 22.04  ? 61  ALA C O   1 
ATOM   1408 C CB  . ALA C 2 61 ? -0.632 -9.714  -9.107  1.00 21.82  ? 61  ALA C CB  1 
ATOM   1409 N N   . ASP C 2 62 ? 1.286  -7.730  -7.325  1.00 22.22  ? 62  ASP C N   1 
ATOM   1410 C CA  . ASP C 2 62 ? 1.788  -6.382  -7.052  1.00 22.59  ? 62  ASP C CA  1 
ATOM   1411 C C   . ASP C 2 62 ? 3.302  -6.370  -6.813  1.00 22.49  ? 62  ASP C C   1 
ATOM   1412 O O   . ASP C 2 62 ? 3.870  -5.348  -6.416  1.00 22.69  ? 62  ASP C O   1 
ATOM   1413 C CB  . ASP C 2 62 ? 1.044  -5.756  -5.865  1.00 22.55  ? 62  ASP C CB  1 
ATOM   1414 C CG  . ASP C 2 62 ? 1.287  -6.491  -4.553  1.00 22.96  ? 62  ASP C CG  1 
ATOM   1415 O OD1 . ASP C 2 62 ? 1.869  -7.600  -4.556  1.00 22.25  ? 62  ASP C OD1 1 
ATOM   1416 O OD2 . ASP C 2 62 ? 0.886  -5.949  -3.502  1.00 23.52  ? 62  ASP C OD2 1 
ATOM   1417 N N   . ARG C 2 63 ? 3.930  -7.523  -7.045  1.00 22.32  ? 63  ARG C N   1 
ATOM   1418 C CA  . ARG C 2 63 ? 5.389  -7.718  -6.952  1.00 22.19  ? 63  ARG C CA  1 
ATOM   1419 C C   . ARG C 2 63 ? 5.932  -7.866  -5.528  1.00 21.86  ? 63  ARG C C   1 
ATOM   1420 O O   . ARG C 2 63 ? 7.141  -8.004  -5.346  1.00 22.35  ? 63  ARG C O   1 
ATOM   1421 C CB  . ARG C 2 63 ? 6.168  -6.652  -7.742  1.00 22.32  ? 63  ARG C CB  1 
ATOM   1422 C CG  . ARG C 2 63 ? 5.948  -6.724  -9.244  1.00 22.17  ? 63  ARG C CG  1 
ATOM   1423 C CD  . ARG C 2 63 ? 6.580  -5.547  -9.974  1.00 23.00  ? 63  ARG C CD  1 
ATOM   1424 N NE  . ARG C 2 63 ? 6.283  -5.587  -11.403 1.00 25.04  ? 63  ARG C NE  1 
ATOM   1425 C CZ  . ARG C 2 63 ? 6.976  -4.943  -12.341 1.00 25.50  ? 63  ARG C CZ  1 
ATOM   1426 N NH1 . ARG C 2 63 ? 8.028  -4.200  -12.011 1.00 26.24  ? 63  ARG C NH1 1 
ATOM   1427 N NH2 . ARG C 2 63 ? 6.480  -4.931  -13.484 0.00 20.00  ? 63  ARG C NH2 1 
ATOM   1428 N N   . SER C 2 64 ? 5.045  -7.855  -4.531  1.00 21.38  ? 64  SER C N   1 
ATOM   1429 C CA  . SER C 2 64 ? 5.429  -8.145  -3.152  1.00 20.85  ? 64  SER C CA  1 
ATOM   1430 C C   . SER C 2 64 ? 5.683  -9.646  -2.978  1.00 20.29  ? 64  SER C C   1 
ATOM   1431 O O   . SER C 2 64 ? 5.368  -10.438 -3.865  1.00 20.49  ? 64  SER C O   1 
ATOM   1432 C CB  . SER C 2 64 ? 4.347  -7.660  -2.178  1.00 21.08  ? 64  SER C CB  1 
ATOM   1433 O OG  . SER C 2 64 ? 3.138  -8.384  -2.342  1.00 21.53  ? 64  SER C OG  1 
ATOM   1434 N N   . PHE C 2 65 ? 6.242  -10.039 -1.835  1.00 19.91  ? 65  PHE C N   1 
ATOM   1435 C CA  . PHE C 2 65 ? 6.552  -11.449 -1.602  1.00 19.50  ? 65  PHE C CA  1 
ATOM   1436 C C   . PHE C 2 65 ? 6.433  -11.855 -0.136  1.00 19.29  ? 65  PHE C C   1 
ATOM   1437 O O   . PHE C 2 65 ? 6.523  -11.020 0.769   1.00 18.89  ? 65  PHE C O   1 
ATOM   1438 C CB  . PHE C 2 65 ? 7.961  -11.788 -2.121  1.00 19.52  ? 65  PHE C CB  1 
ATOM   1439 C CG  . PHE C 2 65 ? 9.059  -11.069 -1.392  1.00 19.82  ? 65  PHE C CG  1 
ATOM   1440 C CD1 . PHE C 2 65 ? 9.610  -11.604 -0.227  1.00 19.48  ? 65  PHE C CD1 1 
ATOM   1441 C CD2 . PHE C 2 65 ? 9.540  -9.853  -1.865  1.00 20.60  ? 65  PHE C CD2 1 
ATOM   1442 C CE1 . PHE C 2 65 ? 10.617 -10.931 0.464   1.00 20.82  ? 65  PHE C CE1 1 
ATOM   1443 C CE2 . PHE C 2 65 ? 10.547 -9.175  -1.181  1.00 21.23  ? 65  PHE C CE2 1 
ATOM   1444 C CZ  . PHE C 2 65 ? 11.086 -9.714  -0.021  1.00 20.96  ? 65  PHE C CZ  1 
ATOM   1445 N N   . THR C 2 66 ? 6.222  -13.148 0.082   1.00 19.11  ? 66  THR C N   1 
ATOM   1446 C CA  . THR C 2 66 ? 6.353  -13.755 1.403   1.00 19.49  ? 66  THR C CA  1 
ATOM   1447 C C   . THR C 2 66 ? 7.273  -14.960 1.230   1.00 19.75  ? 66  THR C C   1 
ATOM   1448 O O   . THR C 2 66 ? 7.413  -15.473 0.115   1.00 19.65  ? 66  THR C O   1 
ATOM   1449 C CB  . THR C 2 66 ? 4.982  -14.191 1.990   1.00 19.33  ? 66  THR C CB  1 
ATOM   1450 O OG1 . THR C 2 66 ? 4.340  -15.119 1.104   1.00 19.27  ? 66  THR C OG1 1 
ATOM   1451 C CG2 . THR C 2 66 ? 4.072  -12.987 2.203   1.00 19.16  ? 66  THR C CG2 1 
ATOM   1452 N N   . PHE C 2 67 ? 7.924  -15.397 2.307   1.00 20.38  ? 67  PHE C N   1 
ATOM   1453 C CA  . PHE C 2 67 ? 8.748  -16.608 2.231   1.00 21.02  ? 67  PHE C CA  1 
ATOM   1454 C C   . PHE C 2 67 ? 8.737  -17.422 3.513   1.00 21.66  ? 67  PHE C C   1 
ATOM   1455 O O   . PHE C 2 67 ? 8.577  -16.879 4.611   1.00 21.86  ? 67  PHE C O   1 
ATOM   1456 C CB  . PHE C 2 67 ? 10.191 -16.309 1.770   1.00 21.17  ? 67  PHE C CB  1 
ATOM   1457 C CG  . PHE C 2 67 ? 11.003 -15.506 2.749   1.00 21.29  ? 67  PHE C CG  1 
ATOM   1458 C CD1 . PHE C 2 67 ? 11.099 -14.124 2.624   1.00 22.47  ? 67  PHE C CD1 1 
ATOM   1459 C CD2 . PHE C 2 67 ? 11.693 -16.132 3.786   1.00 21.29  ? 67  PHE C CD2 1 
ATOM   1460 C CE1 . PHE C 2 67 ? 11.848 -13.375 3.533   1.00 23.12  ? 67  PHE C CE1 1 
ATOM   1461 C CE2 . PHE C 2 67 ? 12.445 -15.392 4.693   1.00 21.94  ? 67  PHE C CE2 1 
ATOM   1462 C CZ  . PHE C 2 67 ? 12.526 -14.013 4.564   1.00 22.33  ? 67  PHE C CZ  1 
ATOM   1463 N N   . VAL C 2 68 ? 8.895  -18.732 3.355   1.00 22.61  ? 68  VAL C N   1 
ATOM   1464 C CA  . VAL C 2 68 ? 9.026  -19.630 4.499   1.00 23.89  ? 68  VAL C CA  1 
ATOM   1465 C C   . VAL C 2 68 ? 10.387 -20.326 4.511   1.00 24.66  ? 68  VAL C C   1 
ATOM   1466 O O   . VAL C 2 68 ? 10.921 -20.700 3.462   1.00 24.24  ? 68  VAL C O   1 
ATOM   1467 C CB  . VAL C 2 68 ? 7.859  -20.660 4.597   1.00 23.86  ? 68  VAL C CB  1 
ATOM   1468 C CG1 . VAL C 2 68 ? 6.551  -19.950 4.916   1.00 24.30  ? 68  VAL C CG1 1 
ATOM   1469 C CG2 . VAL C 2 68 ? 7.723  -21.487 3.328   1.00 24.58  ? 68  VAL C CG2 1 
ATOM   1470 N N   . THR C 2 69 ? 10.940 -20.459 5.713   1.00 25.71  ? 69  THR C N   1 
ATOM   1471 C CA  . THR C 2 69 ? 12.194 -21.163 5.973   1.00 26.94  ? 69  THR C CA  1 
ATOM   1472 C C   . THR C 2 69 ? 11.923 -22.659 6.134   1.00 27.42  ? 69  THR C C   1 
ATOM   1473 O O   . THR C 2 69 ? 10.918 -23.050 6.736   1.00 27.59  ? 69  THR C O   1 
ATOM   1474 C CB  . THR C 2 69 ? 12.840 -20.641 7.284   1.00 27.15  ? 69  THR C CB  1 
ATOM   1475 O OG1 . THR C 2 69 ? 12.516 -19.491 7.868   0.00 20.00  ? 69  THR C OG1 1 
ATOM   1476 C CG2 . THR C 2 69 ? 14.224 -21.011 7.323   1.00 28.72  ? 69  THR C CG2 1 
ATOM   1477 N N   . LYS C 2 70 ? 12.812 -23.489 5.593   1.00 28.15  ? 70  LYS C N   1 
ATOM   1478 C CA  . LYS C 2 70 ? 12.691 -24.946 5.713   1.00 28.61  ? 70  LYS C CA  1 
ATOM   1479 C C   . LYS C 2 70 ? 13.981 -25.596 6.211   1.00 28.76  ? 70  LYS C C   1 
ATOM   1480 O O   . LYS C 2 70 ? 14.805 -24.952 6.863   1.00 29.02  ? 70  LYS C O   1 
ATOM   1481 C CB  . LYS C 2 70 ? 12.268 -25.573 4.380   1.00 28.79  ? 70  LYS C CB  1 
ATOM   1482 C CG  . LYS C 2 70 ? 10.763 -25.786 4.229   1.00 28.97  ? 70  LYS C CG  1 
ATOM   1483 C CD  . LYS C 2 70 ? 10.402 -26.354 2.854   1.00 28.94  ? 70  LYS C CD  1 
ATOM   1484 C CE  . LYS C 2 70 ? 10.739 -27.839 2.725   1.00 29.44  ? 70  LYS C CE  1 
ATOM   1485 N NZ  . LYS C 2 70 ? 9.891  -28.698 3.601   1.00 30.47  ? 70  LYS C NZ  1 
HETATM 1486 C C1  . EDO D 3 .  ? 32.054 12.322  28.815  1.00 10.18  ? 73  EDO B C1  1 
HETATM 1487 O O1  . EDO D 3 .  ? 31.674 11.044  29.295  1.00 9.81   ? 73  EDO B O1  1 
HETATM 1488 C C2  . EDO D 3 .  ? 33.436 12.645  29.353  1.00 9.69   ? 73  EDO B C2  1 
HETATM 1489 O O2  . EDO D 3 .  ? 34.415 11.897  28.615  1.00 8.85   ? 73  EDO B O2  1 
HETATM 1490 C C1  . EDO E 3 .  ? 8.327  -2.719  28.632  1.00 25.97  ? 74  EDO B C1  1 
HETATM 1491 O O1  . EDO E 3 .  ? 6.895  -2.573  28.717  1.00 24.60  ? 74  EDO B O1  1 
HETATM 1492 C C2  . EDO E 3 .  ? 8.941  -1.707  27.673  1.00 25.76  ? 74  EDO B C2  1 
HETATM 1493 O O2  . EDO E 3 .  ? 8.816  -0.386  28.210  1.00 25.31  ? 74  EDO B O2  1 
HETATM 1494 C C1  . EDO F 3 .  ? 7.887  13.678  31.045  1.00 25.99  ? 75  EDO B C1  1 
HETATM 1495 O O1  . EDO F 3 .  ? 6.937  14.731  30.879  1.00 28.03  ? 75  EDO B O1  1 
HETATM 1496 C C2  . EDO F 3 .  ? 8.209  13.491  32.525  1.00 26.19  ? 75  EDO B C2  1 
HETATM 1497 O O2  . EDO F 3 .  ? 8.817  14.681  33.046  1.00 25.38  ? 75  EDO B O2  1 
HETATM 1498 O O   . HOH G 4 .  ? 13.364 -21.487 16.130  1.00 13.91  ? 60  HOH A O   1 
HETATM 1499 O O   . HOH G 4 .  ? 17.679 -16.943 12.161  1.00 16.81  ? 61  HOH A O   1 
HETATM 1500 O O   . HOH G 4 .  ? 10.583 -20.092 19.651  1.00 10.81  ? 62  HOH A O   1 
HETATM 1501 O O   . HOH G 4 .  ? 23.068 -18.085 19.680  1.00 124.18 ? 63  HOH A O   1 
HETATM 1502 O O   . HOH G 4 .  ? 22.395 -0.688  24.392  1.00 13.34  ? 64  HOH A O   1 
HETATM 1503 O O   . HOH G 4 .  ? 1.415  -2.552  29.486  1.00 14.74  ? 65  HOH A O   1 
HETATM 1504 O O   . HOH G 4 .  ? 2.450  -6.908  25.358  1.00 22.61  ? 66  HOH A O   1 
HETATM 1505 O O   . HOH G 4 .  ? 3.303  -9.625  24.649  1.00 18.95  ? 67  HOH A O   1 
HETATM 1506 O O   . HOH G 4 .  ? 15.960 -1.579  12.916  1.00 20.28  ? 68  HOH A O   1 
HETATM 1507 O O   . HOH G 4 .  ? 7.202  -16.805 31.916  1.00 22.82  ? 69  HOH A O   1 
HETATM 1508 O O   . HOH G 4 .  ? 3.732  -17.776 25.502  1.00 21.76  ? 70  HOH A O   1 
HETATM 1509 O O   . HOH G 4 .  ? 23.301 -1.054  26.966  1.00 27.30  ? 71  HOH A O   1 
HETATM 1510 O O   . HOH G 4 .  ? 8.899  -8.728  10.577  1.00 36.03  ? 72  HOH A O   1 
HETATM 1511 O O   . HOH G 4 .  ? 3.386  -19.013 20.925  1.00 18.58  ? 73  HOH A O   1 
HETATM 1512 O O   . HOH G 4 .  ? 1.703  -2.453  25.785  1.00 20.44  ? 74  HOH A O   1 
HETATM 1513 O O   . HOH G 4 .  ? 23.551 -11.484 12.763  1.00 25.85  ? 75  HOH A O   1 
HETATM 1514 O O   . HOH G 4 .  ? 25.073 -7.350  12.915  1.00 32.52  ? 76  HOH A O   1 
HETATM 1515 O O   . HOH G 4 .  ? 11.009 -13.269 8.359   1.00 41.23  ? 77  HOH A O   1 
HETATM 1516 O O   . HOH G 4 .  ? 23.385 -17.201 29.787  1.00 40.18  ? 78  HOH A O   1 
HETATM 1517 O O   . HOH G 4 .  ? 12.827 -21.759 10.743  1.00 45.68  ? 79  HOH A O   1 
HETATM 1518 O O   . HOH G 4 .  ? 6.985  -22.373 14.039  1.00 52.08  ? 80  HOH A O   1 
HETATM 1519 O O   . HOH G 4 .  ? 5.236  -13.732 25.219  1.00 25.67  ? 81  HOH A O   1 
HETATM 1520 O O   . HOH G 4 .  ? 25.330 -9.807  38.843  1.00 46.20  ? 82  HOH A O   1 
HETATM 1521 O O   . HOH G 4 .  ? 26.827 -7.645  15.359  1.00 52.37  ? 83  HOH A O   1 
HETATM 1522 O O   . HOH G 4 .  ? 21.561 -9.568  38.962  1.00 45.40  ? 84  HOH A O   1 
HETATM 1523 O O   . HOH G 4 .  ? 9.510  -15.139 33.672  1.00 30.77  ? 85  HOH A O   1 
HETATM 1524 O O   . HOH G 4 .  ? 4.373  -16.637 17.403  1.00 34.47  ? 86  HOH A O   1 
HETATM 1525 O O   . HOH G 4 .  ? 18.502 -17.746 33.529  1.00 23.19  ? 87  HOH A O   1 
HETATM 1526 O O   . HOH G 4 .  ? 32.329 -9.825  11.177  1.00 57.64  ? 88  HOH A O   1 
HETATM 1527 O O   . HOH G 4 .  ? 22.447 -13.095 30.783  1.00 42.37  ? 89  HOH A O   1 
HETATM 1528 O O   . HOH G 4 .  ? 9.625  -11.405 12.262  1.00 32.99  ? 90  HOH A O   1 
HETATM 1529 O O   . HOH G 4 .  ? 9.241  -22.175 16.664  1.00 27.57  ? 91  HOH A O   1 
HETATM 1530 O O   . HOH G 4 .  ? 25.325 -8.866  27.072  1.00 41.72  ? 92  HOH A O   1 
HETATM 1531 O O   . HOH G 4 .  ? 24.907 -1.422  20.947  1.00 45.25  ? 93  HOH A O   1 
HETATM 1532 O O   . HOH G 4 .  ? 5.949  -17.786 14.182  1.00 36.52  ? 94  HOH A O   1 
HETATM 1533 O O   . HOH G 4 .  ? 5.502  -13.024 14.497  1.00 37.61  ? 95  HOH A O   1 
HETATM 1534 O O   . HOH G 4 .  ? 2.362  -19.948 16.216  1.00 36.56  ? 96  HOH A O   1 
HETATM 1535 O O   . HOH G 4 .  ? 3.704  -3.934  22.402  1.00 29.64  ? 97  HOH A O   1 
HETATM 1536 O O   . HOH G 4 .  ? 20.484 -22.960 15.733  1.00 21.07  ? 98  HOH A O   1 
HETATM 1537 O O   . HOH G 4 .  ? 24.163 -3.435  27.538  1.00 31.51  ? 99  HOH A O   1 
HETATM 1538 O O   . HOH G 4 .  ? 7.824  -7.389  34.299  1.00 35.84  ? 100 HOH A O   1 
HETATM 1539 O O   . HOH G 4 .  ? 6.762  -15.059 13.438  1.00 45.05  ? 101 HOH A O   1 
HETATM 1540 O O   . HOH G 4 .  ? 10.039 -10.687 35.187  1.00 36.82  ? 102 HOH A O   1 
HETATM 1541 O O   . HOH G 4 .  ? 21.121 -3.930  43.822  1.00 42.10  ? 103 HOH A O   1 
HETATM 1542 O O   . HOH G 4 .  ? 25.847 -13.418 19.122  1.00 36.39  ? 104 HOH A O   1 
HETATM 1543 O O   . HOH G 4 .  ? 24.222 -5.635  18.309  1.00 31.66  ? 105 HOH A O   1 
HETATM 1544 O O   . HOH G 4 .  ? 12.899 -19.804 18.166  1.00 10.74  ? 106 HOH A O   1 
HETATM 1545 O O   . HOH G 4 .  ? 0.473  -6.007  23.627  1.00 18.78  ? 107 HOH A O   1 
HETATM 1546 O O   . HOH G 4 .  ? 1.074  -3.347  23.398  1.00 30.85  ? 108 HOH A O   1 
HETATM 1547 O O   . HOH G 4 .  ? 15.911 -2.326  38.104  1.00 43.99  ? 109 HOH A O   1 
HETATM 1548 O O   . HOH G 4 .  ? 6.441  -2.419  26.047  1.00 36.40  ? 110 HOH A O   1 
HETATM 1549 O O   . HOH G 4 .  ? 30.418 -6.246  20.600  1.00 46.61  ? 111 HOH A O   1 
HETATM 1550 O O   . HOH G 4 .  ? 1.022  -11.162 20.435  1.00 35.74  ? 112 HOH A O   1 
HETATM 1551 O O   . HOH G 4 .  ? 26.227 -5.382  11.501  1.00 37.68  ? 113 HOH A O   1 
HETATM 1552 O O   . HOH G 4 .  ? 5.159  -3.443  24.412  1.00 31.12  ? 114 HOH A O   1 
HETATM 1553 O O   . HOH G 4 .  ? 3.430  -15.127 19.123  1.00 29.73  ? 115 HOH A O   1 
HETATM 1554 O O   . HOH G 4 .  ? 11.758 -2.941  11.693  1.00 38.03  ? 116 HOH A O   1 
HETATM 1555 O O   . HOH G 4 .  ? 6.203  -12.785 32.485  1.00 40.38  ? 117 HOH A O   1 
HETATM 1556 O O   . HOH G 4 .  ? 19.979 -24.767 12.250  1.00 40.18  ? 118 HOH A O   1 
HETATM 1557 O O   . HOH G 4 .  ? 13.961 -3.448  36.635  1.00 39.78  ? 119 HOH A O   1 
HETATM 1558 O O   . HOH G 4 .  ? 20.213 -25.083 17.670  1.00 23.89  ? 120 HOH A O   1 
HETATM 1559 O O   . HOH G 4 .  ? 13.206 1.346   12.454  1.00 50.25  ? 121 HOH A O   1 
HETATM 1560 O O   . HOH G 4 .  ? 19.646 0.652   14.719  1.00 27.76  ? 122 HOH A O   1 
HETATM 1561 O O   . HOH G 4 .  ? 21.720 -1.152  14.840  1.00 25.33  ? 123 HOH A O   1 
HETATM 1562 O O   . HOH G 4 .  ? 6.213  -7.935  9.257   1.00 52.77  ? 124 HOH A O   1 
HETATM 1563 O O   . HOH G 4 .  ? 3.730  -14.676 15.803  1.00 33.78  ? 125 HOH A O   1 
HETATM 1564 O O   . HOH G 4 .  ? 7.525  -15.379 10.972  1.00 47.56  ? 126 HOH A O   1 
HETATM 1565 O O   . HOH G 4 .  ? 1.602  -7.226  21.492  1.00 29.89  ? 127 HOH A O   1 
HETATM 1566 O O   . HOH G 4 .  ? 2.915  -9.557  26.507  1.00 28.61  ? 128 HOH A O   1 
HETATM 1567 O O   . HOH G 4 .  ? 29.279 -6.473  26.497  1.00 62.81  ? 129 HOH A O   1 
HETATM 1568 O O   . HOH G 4 .  ? 25.332 -9.263  24.354  1.00 43.62  ? 130 HOH A O   1 
HETATM 1569 O O   . HOH G 4 .  ? 27.477 -12.027 20.878  1.00 56.24  ? 131 HOH A O   1 
HETATM 1570 O O   . HOH G 4 .  ? 18.826 -7.849  32.165  1.00 53.21  ? 132 HOH A O   1 
HETATM 1571 O O   . HOH G 4 .  ? 25.112 -13.065 28.928  1.00 36.92  ? 133 HOH A O   1 
HETATM 1572 O O   . HOH G 4 .  ? 13.019 -21.157 33.236  1.00 134.76 ? 134 HOH A O   1 
HETATM 1573 O O   . HOH G 4 .  ? 25.780 -10.428 29.089  1.00 55.39  ? 135 HOH A O   1 
HETATM 1574 O O   . HOH G 4 .  ? 14.933 -5.296  42.231  1.00 44.14  ? 136 HOH A O   1 
HETATM 1575 O O   . HOH G 4 .  ? 16.305 -8.051  33.196  1.00 62.56  ? 137 HOH A O   1 
HETATM 1576 O O   . HOH G 4 .  ? 24.447 0.115   16.704  1.00 36.28  ? 138 HOH A O   1 
HETATM 1577 O O   . HOH G 4 .  ? 30.047 -2.299  18.244  1.00 41.98  ? 139 HOH A O   1 
HETATM 1578 O O   . HOH G 4 .  ? 21.381 3.299   12.204  1.00 57.04  ? 140 HOH A O   1 
HETATM 1579 O O   . HOH G 4 .  ? 6.034  -2.801  9.937   1.00 46.96  ? 141 HOH A O   1 
HETATM 1580 O O   . HOH G 4 .  ? 12.341 -7.957  40.815  1.00 57.70  ? 142 HOH A O   1 
HETATM 1581 O O   . HOH G 4 .  ? 12.569 -9.489  34.130  1.00 43.71  ? 143 HOH A O   1 
HETATM 1582 O O   . HOH G 4 .  ? 19.789 -6.454  35.009  1.00 53.47  ? 144 HOH A O   1 
HETATM 1583 O O   . HOH G 4 .  ? 14.641 -9.795  39.607  1.00 56.04  ? 145 HOH A O   1 
HETATM 1584 O O   . HOH G 4 .  ? 17.467 -7.480  35.563  1.00 41.03  ? 146 HOH A O   1 
HETATM 1585 O O   . HOH G 4 .  ? 22.853 -7.747  43.450  1.00 39.83  ? 147 HOH A O   1 
HETATM 1586 O O   . HOH G 4 .  ? 20.268 -5.644  41.982  1.00 55.13  ? 148 HOH A O   1 
HETATM 1587 O O   . HOH G 4 .  ? 25.133 -7.628  35.692  1.00 52.16  ? 149 HOH A O   1 
HETATM 1588 O O   . HOH G 4 .  ? 15.515 -16.719 36.041  1.00 49.29  ? 150 HOH A O   1 
HETATM 1589 O O   . HOH G 4 .  ? 21.513 -16.123 19.491  1.00 22.49  ? 151 HOH A O   1 
HETATM 1590 O O   . HOH G 4 .  ? 4.070  -6.736  21.290  1.00 26.06  ? 152 HOH A O   1 
HETATM 1591 O O   . HOH G 4 .  ? 4.332  -6.070  23.683  1.00 56.47  ? 153 HOH A O   1 
HETATM 1592 O O   . HOH G 4 .  ? 7.644  -20.027 14.065  1.00 35.79  ? 154 HOH A O   1 
HETATM 1593 O O   . HOH H 4 .  ? 16.405 14.339  31.542  1.00 17.12  ? 76  HOH B O   1 
HETATM 1594 O O   . HOH H 4 .  ? 21.305 9.301   23.583  1.00 8.20   ? 77  HOH B O   1 
HETATM 1595 O O   . HOH H 4 .  ? 17.317 10.096  36.160  1.00 16.72  ? 78  HOH B O   1 
HETATM 1596 O O   . HOH H 4 .  ? 17.749 2.171   18.599  1.00 16.85  ? 79  HOH B O   1 
HETATM 1597 O O   . HOH H 4 .  ? 14.646 12.887  20.052  1.00 10.93  ? 80  HOH B O   1 
HETATM 1598 O O   . HOH H 4 .  ? 11.256 5.509   38.633  1.00 18.35  ? 81  HOH B O   1 
HETATM 1599 O O   . HOH H 4 .  ? 22.388 -0.476  30.818  1.00 20.12  ? 82  HOH B O   1 
HETATM 1600 O O   . HOH H 4 .  ? 30.200 2.804   33.147  1.00 29.21  ? 83  HOH B O   1 
HETATM 1601 O O   . HOH H 4 .  ? 27.009 1.657   27.602  1.00 18.18  ? 84  HOH B O   1 
HETATM 1602 O O   . HOH H 4 .  ? 22.939 8.552   21.535  1.00 14.26  ? 85  HOH B O   1 
HETATM 1603 O O   . HOH H 4 .  ? 11.070 10.333  16.670  1.00 35.68  ? 86  HOH B O   1 
HETATM 1604 O O   . HOH H 4 .  ? 18.429 4.675   17.761  1.00 17.98  ? 87  HOH B O   1 
HETATM 1605 O O   . HOH H 4 .  ? 17.940 7.382   18.452  1.00 17.66  ? 88  HOH B O   1 
HETATM 1606 O O   . HOH H 4 .  ? 17.247 1.059   16.139  1.00 18.29  ? 89  HOH B O   1 
HETATM 1607 O O   . HOH H 4 .  ? 3.378  7.247   30.293  1.00 19.09  ? 90  HOH B O   1 
HETATM 1608 O O   . HOH H 4 .  ? 1.213  4.436   27.967  1.00 23.07  ? 91  HOH B O   1 
HETATM 1609 O O   . HOH H 4 .  ? 26.808 7.112   38.910  1.00 27.62  ? 92  HOH B O   1 
HETATM 1610 O O   . HOH H 4 .  ? 29.299 13.599  26.535  1.00 54.41  ? 93  HOH B O   1 
HETATM 1611 O O   . HOH H 4 .  ? 19.865 13.323  38.586  1.00 36.48  ? 94  HOH B O   1 
HETATM 1612 O O   . HOH H 4 .  ? 24.823 6.718   36.714  1.00 21.20  ? 95  HOH B O   1 
HETATM 1613 O O   . HOH H 4 .  ? 13.925 10.708  12.710  1.00 27.46  ? 96  HOH B O   1 
HETATM 1614 O O   . HOH H 4 .  ? 3.612  12.165  21.128  1.00 19.21  ? 97  HOH B O   1 
HETATM 1615 O O   . HOH H 4 .  ? 7.040  1.169   13.051  1.00 25.87  ? 98  HOH B O   1 
HETATM 1616 O O   . HOH H 4 .  ? 18.627 15.188  31.607  1.00 43.67  ? 99  HOH B O   1 
HETATM 1617 O O   . HOH H 4 .  ? 3.214  -0.428  18.697  1.00 58.72  ? 100 HOH B O   1 
HETATM 1618 O O   . HOH H 4 .  ? 7.833  -5.572  29.470  1.00 29.15  ? 101 HOH B O   1 
HETATM 1619 O O   . HOH H 4 .  ? 28.314 1.397   30.129  1.00 20.68  ? 102 HOH B O   1 
HETATM 1620 O O   . HOH H 4 .  ? 11.518 -1.824  14.022  1.00 28.68  ? 103 HOH B O   1 
HETATM 1621 O O   . HOH H 4 .  ? 21.878 6.554   16.183  1.00 31.59  ? 104 HOH B O   1 
HETATM 1622 O O   . HOH H 4 .  ? 0.928  15.608  17.944  1.00 44.97  ? 105 HOH B O   1 
HETATM 1623 O O   . HOH H 4 .  ? 2.858  2.018   19.192  1.00 28.35  ? 106 HOH B O   1 
HETATM 1624 O O   . HOH H 4 .  ? 2.320  6.397   19.282  1.00 131.55 ? 107 HOH B O   1 
HETATM 1625 O O   . HOH H 4 .  ? 22.127 11.277  42.147  1.00 47.22  ? 108 HOH B O   1 
HETATM 1626 O O   . HOH H 4 .  ? -1.871 10.278  22.292  1.00 29.03  ? 109 HOH B O   1 
HETATM 1627 O O   . HOH H 4 .  ? -1.174 3.973   14.113  1.00 40.24  ? 110 HOH B O   1 
HETATM 1628 O O   . HOH H 4 .  ? 26.554 3.071   36.939  1.00 33.71  ? 111 HOH B O   1 
HETATM 1629 O O   . HOH H 4 .  ? 1.635  1.504   27.822  1.00 34.93  ? 112 HOH B O   1 
HETATM 1630 O O   . HOH H 4 .  ? 32.174 8.637   36.022  1.00 33.71  ? 113 HOH B O   1 
HETATM 1631 O O   . HOH H 4 .  ? 11.466 -3.692  35.405  1.00 37.44  ? 114 HOH B O   1 
HETATM 1632 O O   . HOH H 4 .  ? -1.179 1.927   18.638  1.00 47.13  ? 115 HOH B O   1 
HETATM 1633 O O   . HOH H 4 .  ? -1.873 7.554   21.732  1.00 28.63  ? 116 HOH B O   1 
HETATM 1634 O O   . HOH H 4 .  ? 4.302  -1.884  26.469  1.00 26.84  ? 117 HOH B O   1 
HETATM 1635 O O   . HOH H 4 .  ? 26.594 -0.751  31.052  1.00 37.82  ? 118 HOH B O   1 
HETATM 1636 O O   . HOH H 4 .  ? 27.394 13.343  35.508  1.00 39.62  ? 119 HOH B O   1 
HETATM 1637 O O   . HOH H 4 .  ? 18.690 3.965   15.127  1.00 29.09  ? 120 HOH B O   1 
HETATM 1638 O O   . HOH H 4 .  ? 29.724 14.300  35.635  1.00 29.49  ? 121 HOH B O   1 
HETATM 1639 O O   . HOH H 4 .  ? 10.674 -0.613  38.073  1.00 60.18  ? 122 HOH B O   1 
HETATM 1640 O O   . HOH H 4 .  ? 15.255 13.516  33.820  1.00 58.42  ? 123 HOH B O   1 
HETATM 1641 O O   . HOH H 4 .  ? 8.174  10.193  37.544  1.00 39.35  ? 124 HOH B O   1 
HETATM 1642 O O   . HOH H 4 .  ? 1.971  17.118  19.811  1.00 34.19  ? 125 HOH B O   1 
HETATM 1643 O O   . HOH H 4 .  ? 2.603  2.874   29.799  1.00 31.77  ? 126 HOH B O   1 
HETATM 1644 O O   . HOH H 4 .  ? 9.739  3.714   39.866  1.00 29.93  ? 127 HOH B O   1 
HETATM 1645 O O   . HOH H 4 .  ? 24.390 5.162   20.774  1.00 81.08  ? 128 HOH B O   1 
HETATM 1646 O O   . HOH H 4 .  ? 26.127 0.706   38.330  1.00 43.59  ? 129 HOH B O   1 
HETATM 1647 O O   . HOH H 4 .  ? 3.896  2.896   32.168  1.00 47.90  ? 130 HOH B O   1 
HETATM 1648 O O   . HOH H 4 .  ? 13.043 5.473   12.575  1.00 30.98  ? 131 HOH B O   1 
HETATM 1649 O O   . HOH H 4 .  ? 16.849 2.826   13.585  1.00 31.93  ? 132 HOH B O   1 
HETATM 1650 O O   . HOH H 4 .  ? 10.982 4.369   10.456  1.00 49.94  ? 133 HOH B O   1 
HETATM 1651 O O   . HOH H 4 .  ? 13.254 13.022  38.341  1.00 80.46  ? 134 HOH B O   1 
HETATM 1652 O O   . HOH H 4 .  ? 32.596 19.794  33.148  1.00 86.07  ? 135 HOH B O   1 
HETATM 1653 O O   . HOH H 4 .  ? 26.652 20.524  26.780  1.00 50.25  ? 136 HOH B O   1 
HETATM 1654 O O   . HOH H 4 .  ? 16.636 12.640  36.445  1.00 33.08  ? 137 HOH B O   1 
HETATM 1655 O O   . HOH H 4 .  ? 6.095  -2.471  35.696  1.00 48.32  ? 138 HOH B O   1 
HETATM 1656 O O   . HOH H 4 .  ? 27.944 22.324  41.243  1.00 68.08  ? 139 HOH B O   1 
HETATM 1657 O O   . HOH H 4 .  ? 29.650 3.980   36.602  1.00 58.22  ? 140 HOH B O   1 
HETATM 1658 O O   . HOH H 4 .  ? 29.594 9.724   40.957  1.00 48.38  ? 141 HOH B O   1 
HETATM 1659 O O   . HOH H 4 .  ? 29.146 0.589   34.320  1.00 30.43  ? 142 HOH B O   1 
HETATM 1660 O O   . HOH H 4 .  ? 24.239 4.412   18.259  1.00 34.36  ? 143 HOH B O   1 
HETATM 1661 O O   . HOH H 4 .  ? 26.495 6.509   14.336  1.00 41.06  ? 144 HOH B O   1 
HETATM 1662 O O   . HOH H 4 .  ? 27.316 -0.777  36.384  1.00 64.10  ? 145 HOH B O   1 
HETATM 1663 O O   . HOH H 4 .  ? 0.597  13.596  33.182  1.00 40.34  ? 146 HOH B O   1 
HETATM 1664 O O   . HOH H 4 .  ? 4.941  13.747  35.198  1.00 52.95  ? 147 HOH B O   1 
HETATM 1665 O O   . HOH H 4 .  ? -3.762 5.514   16.176  1.00 67.75  ? 148 HOH B O   1 
HETATM 1666 O O   . HOH H 4 .  ? -5.034 3.700   12.447  1.00 66.18  ? 149 HOH B O   1 
HETATM 1667 O O   . HOH H 4 .  ? 20.446 -4.254  33.787  1.00 46.56  ? 150 HOH B O   1 
HETATM 1668 O O   . HOH H 4 .  ? 24.951 0.787   23.275  1.00 32.81  ? 151 HOH B O   1 
HETATM 1669 O O   . HOH H 4 .  ? 24.182 2.845   21.861  1.00 65.58  ? 152 HOH B O   1 
HETATM 1670 O O   . HOH H 4 .  ? 28.236 14.876  28.279  1.00 27.74  ? 153 HOH B O   1 
HETATM 1671 O O   . HOH H 4 .  ? 0.561  5.451   20.584  1.00 23.61  ? 154 HOH B O   1 
HETATM 1672 O O   . HOH H 4 .  ? 17.592 13.417  33.973  1.00 16.24  ? 155 HOH B O   1 
HETATM 1673 O O   . HOH H 4 .  ? 24.879 5.265   40.366  1.00 72.18  ? 156 HOH B O   1 
HETATM 1674 O O   . HOH H 4 .  ? 26.825 7.389   43.723  1.00 55.56  ? 157 HOH B O   1 
HETATM 1675 O O   . HOH H 4 .  ? 24.330 11.558  43.777  1.00 95.21  ? 158 HOH B O   1 
HETATM 1676 O O   . HOH H 4 .  ? 21.269 15.480  31.934  1.00 38.73  ? 159 HOH B O   1 
HETATM 1677 O O   . HOH H 4 .  ? 9.755  11.308  19.194  1.00 15.90  ? 160 HOH B O   1 
HETATM 1678 O O   . HOH I 4 .  ? 17.983 -14.200 12.919  1.00 16.60  ? 73  HOH C O   1 
HETATM 1679 O O   . HOH I 4 .  ? 22.386 -21.425 14.577  1.00 93.13  ? 74  HOH C O   1 
HETATM 1680 O O   . HOH I 4 .  ? 22.810 -16.434 -2.538  1.00 35.97  ? 75  HOH C O   1 
HETATM 1681 O O   . HOH I 4 .  ? 9.248  -19.210 -10.773 1.00 33.74  ? 76  HOH C O   1 
HETATM 1682 O O   . HOH I 4 .  ? 13.511 -7.687  -13.822 1.00 18.20  ? 77  HOH C O   1 
HETATM 1683 O O   . HOH I 4 .  ? 25.797 -9.563  -6.018  1.00 29.34  ? 78  HOH C O   1 
HETATM 1684 O O   . HOH I 4 .  ? 26.357 -19.376 5.573   1.00 34.66  ? 79  HOH C O   1 
HETATM 1685 O O   . HOH I 4 .  ? 9.010  -6.970  -3.997  1.00 25.21  ? 80  HOH C O   1 
HETATM 1686 O O   . HOH I 4 .  ? 13.084 -7.007  -9.652  1.00 26.09  ? 81  HOH C O   1 
HETATM 1687 O O   . HOH I 4 .  ? 23.760 -17.406 9.645   1.00 26.13  ? 82  HOH C O   1 
HETATM 1688 O O   . HOH I 4 .  ? 18.736 -1.811  -1.162  1.00 47.57  ? 83  HOH C O   1 
HETATM 1689 O O   . HOH I 4 .  ? 15.013 -5.527  -7.553  1.00 23.99  ? 84  HOH C O   1 
HETATM 1690 O O   . HOH I 4 .  ? 23.298 -19.174 15.496  1.00 27.96  ? 85  HOH C O   1 
HETATM 1691 O O   . HOH I 4 .  ? 10.293 -10.730 6.990   1.00 35.60  ? 86  HOH C O   1 
HETATM 1692 O O   . HOH I 4 .  ? -0.411 -16.837 -0.198  0.50 28.30  ? 87  HOH C O   1 
HETATM 1693 O O   . HOH I 4 .  ? 13.473 -17.919 9.420   1.00 37.21  ? 88  HOH C O   1 
HETATM 1694 O O   . HOH I 4 .  ? 6.225  -19.149 0.456   1.00 30.37  ? 89  HOH C O   1 
HETATM 1695 O O   . HOH I 4 .  ? 20.171 -8.407  6.164   1.00 46.21  ? 90  HOH C O   1 
HETATM 1696 O O   . HOH I 4 .  ? 18.782 -22.355 -4.956  1.00 32.56  ? 91  HOH C O   1 
HETATM 1697 O O   . HOH I 4 .  ? 11.097 -6.001  -13.204 1.00 24.96  ? 92  HOH C O   1 
HETATM 1698 O O   . HOH I 4 .  ? 6.970  -7.742  -0.121  1.00 28.94  ? 93  HOH C O   1 
HETATM 1699 O O   . HOH I 4 .  ? 4.911  -10.420 -9.881  1.00 41.02  ? 94  HOH C O   1 
HETATM 1700 O O   . HOH I 4 .  ? 14.840 -7.062  -11.588 1.00 22.27  ? 95  HOH C O   1 
HETATM 1701 O O   . HOH I 4 .  ? 16.573 -4.603  -5.501  1.00 28.95  ? 96  HOH C O   1 
HETATM 1702 O O   . HOH I 4 .  ? 11.228 -23.130 -7.985  1.00 39.80  ? 97  HOH C O   1 
HETATM 1703 O O   . HOH I 4 .  ? 0.315  -7.321  -1.431  1.00 43.11  ? 98  HOH C O   1 
HETATM 1704 O O   . HOH I 4 .  ? 24.542 -9.740  0.882   1.00 43.21  ? 99  HOH C O   1 
HETATM 1705 O O   . HOH I 4 .  ? 11.166 -16.521 8.398   1.00 37.10  ? 100 HOH C O   1 
HETATM 1706 O O   . HOH I 4 .  ? 14.031 -6.477  3.743   1.00 28.70  ? 101 HOH C O   1 
HETATM 1707 O O   . HOH I 4 .  ? 21.827 -25.466 -7.584  1.00 45.09  ? 102 HOH C O   1 
HETATM 1708 O O   . HOH I 4 .  ? 27.687 -13.770 0.914   1.00 47.23  ? 103 HOH C O   1 
HETATM 1709 O O   . HOH I 4 .  ? 4.805  -19.579 -11.295 1.00 59.88  ? 104 HOH C O   1 
HETATM 1710 O O   . HOH I 4 .  ? 10.047 -4.592  -7.272  1.00 31.88  ? 105 HOH C O   1 
HETATM 1711 O O   . HOH I 4 .  ? 10.673 -23.043 2.463   1.00 112.64 ? 106 HOH C O   1 
HETATM 1712 O O   . HOH I 4 .  ? 27.480 -20.712 13.819  1.00 27.55  ? 107 HOH C O   1 
HETATM 1713 O O   . HOH I 4 .  ? 4.859  -17.533 2.128   1.00 37.83  ? 108 HOH C O   1 
HETATM 1714 O O   . HOH I 4 .  ? 4.632  -15.393 -14.442 1.00 41.03  ? 109 HOH C O   1 
HETATM 1715 O O   . HOH I 4 .  ? 6.004  -8.755  -13.546 1.00 29.84  ? 110 HOH C O   1 
HETATM 1716 O O   . HOH I 4 .  ? 25.107 -21.029 15.244  1.00 24.88  ? 111 HOH C O   1 
HETATM 1717 O O   . HOH I 4 .  ? 7.480  -13.589 4.723   1.00 41.72  ? 112 HOH C O   1 
HETATM 1718 O O   . HOH I 4 .  ? 28.330 -22.594 12.133  1.00 37.42  ? 113 HOH C O   1 
HETATM 1719 O O   . HOH I 4 .  ? 8.053  -6.007  -1.728  1.00 33.87  ? 114 HOH C O   1 
HETATM 1720 O O   . HOH I 4 .  ? 11.780 -19.923 -11.492 1.00 42.14  ? 115 HOH C O   1 
HETATM 1721 O O   . HOH I 4 .  ? 16.522 -11.731 -5.642  1.00 106.31 ? 116 HOH C O   1 
HETATM 1722 O O   . HOH I 4 .  ? 13.672 -25.143 -1.499  1.00 34.99  ? 117 HOH C O   1 
HETATM 1723 O O   . HOH I 4 .  ? 23.757 -12.478 8.214   1.00 44.90  ? 118 HOH C O   1 
HETATM 1724 O O   . HOH I 4 .  ? 27.006 -14.975 -4.328  1.00 46.25  ? 119 HOH C O   1 
HETATM 1725 O O   . HOH I 4 .  ? 23.656 -20.800 -9.118  1.00 48.03  ? 120 HOH C O   1 
HETATM 1726 O O   . HOH I 4 .  ? -3.928 -16.002 -5.489  1.00 44.65  ? 121 HOH C O   1 
HETATM 1727 O O   . HOH I 4 .  ? 23.545 -23.549 15.088  1.00 29.91  ? 122 HOH C O   1 
HETATM 1728 O O   . HOH I 4 .  ? 25.315 -16.924 17.525  1.00 39.00  ? 123 HOH C O   1 
HETATM 1729 O O   . HOH I 4 .  ? 9.890  -4.638  -17.133 1.00 31.65  ? 124 HOH C O   1 
HETATM 1730 O O   . HOH I 4 .  ? -6.004 -8.265  -4.964  1.00 54.04  ? 125 HOH C O   1 
HETATM 1731 O O   . HOH I 4 .  ? 18.033 -28.568 6.063   1.00 56.13  ? 126 HOH C O   1 
HETATM 1732 O O   . HOH I 4 .  ? 22.846 -17.562 17.134  1.00 33.10  ? 127 HOH C O   1 
HETATM 1733 O O   . HOH I 4 .  ? 27.777 -20.604 -0.431  1.00 46.51  ? 128 HOH C O   1 
HETATM 1734 O O   . HOH I 4 .  ? 12.771 -11.475 7.081   1.00 42.64  ? 129 HOH C O   1 
HETATM 1735 O O   . HOH I 4 .  ? 1.790  -20.099 -8.512  1.00 45.14  ? 130 HOH C O   1 
HETATM 1736 O O   . HOH I 4 .  ? 21.358 -21.237 -10.521 1.00 45.10  ? 131 HOH C O   1 
HETATM 1737 O O   . HOH I 4 .  ? 9.040  -18.618 -14.577 1.00 54.22  ? 132 HOH C O   1 
HETATM 1738 O O   . HOH I 4 .  ? 12.776 -3.893  -7.573  1.00 45.64  ? 133 HOH C O   1 
HETATM 1739 O O   . HOH I 4 .  ? 18.619 -26.189 7.097   1.00 46.13  ? 134 HOH C O   1 
HETATM 1740 O O   . HOH I 4 .  ? 26.485 -21.973 4.451   1.00 36.69  ? 135 HOH C O   1 
HETATM 1741 O O   . HOH I 4 .  ? 19.657 -28.692 2.916   1.00 55.94  ? 136 HOH C O   1 
HETATM 1742 O O   . HOH I 4 .  ? 15.406 -28.495 5.857   1.00 54.29  ? 137 HOH C O   1 
HETATM 1743 O O   . HOH I 4 .  ? 5.183  -5.716  1.027   1.00 48.58  ? 138 HOH C O   1 
HETATM 1744 O O   . HOH I 4 .  ? 3.194  -4.703  -11.360 1.00 52.66  ? 139 HOH C O   1 
HETATM 1745 O O   . HOH I 4 .  ? 28.132 -18.650 15.855  1.00 54.73  ? 140 HOH C O   1 
HETATM 1746 O O   . HOH I 4 .  ? 28.842 -16.088 16.159  1.00 55.58  ? 141 HOH C O   1 
HETATM 1747 O O   . HOH I 4 .  ? 24.208 -17.973 13.155  1.00 28.39  ? 142 HOH C O   1 
HETATM 1748 O O   . HOH I 4 .  ? -1.763 -9.364  -0.261  1.00 56.12  ? 143 HOH C O   1 
HETATM 1749 O O   . HOH I 4 .  ? -5.121 -10.677 -4.456  1.00 49.24  ? 144 HOH C O   1 
HETATM 1750 O O   . HOH I 4 .  ? 22.064 -11.935 -10.413 1.00 35.93  ? 145 HOH C O   1 
HETATM 1751 O O   . HOH I 4 .  ? 22.047 -8.695  4.014   1.00 28.39  ? 146 HOH C O   1 
HETATM 1752 O O   . HOH I 4 .  ? 14.232 -18.584 4.899   1.00 126.42 ? 147 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1  1  MET MET A . n 
A 1 2  TRP 2  2  2  TRP TRP A . n 
A 1 3  VAL 3  3  3  VAL VAL A . n 
A 1 4  TYR 4  4  4  TYR TYR A . n 
A 1 5  ARG 5  5  5  ARG ARG A . n 
A 1 6  LEU 6  6  6  LEU LEU A . n 
A 1 7  LYS 7  7  7  LYS LYS A . n 
A 1 8  GLY 8  8  8  GLY GLY A . n 
A 1 9  THR 9  9  9  THR THR A . n 
A 1 10 LEU 10 10 10 LEU LEU A . n 
A 1 11 GLU 11 11 11 GLU GLU A . n 
A 1 12 ALA 12 12 12 ALA ALA A . n 
A 1 13 LEU 13 13 13 LEU LEU A . n 
A 1 14 ASP 14 14 14 ASP ASP A . n 
A 1 15 PRO 15 15 15 PRO PRO A . n 
A 1 16 ILE 16 16 16 ILE ILE A . n 
A 1 17 LEU 17 17 17 LEU LEU A . n 
A 1 18 PRO 18 18 18 PRO PRO A . n 
A 1 19 GLY 19 19 19 GLY GLY A . n 
A 1 20 LEU 20 20 20 LEU LEU A . n 
A 1 21 PHE 21 21 21 PHE PHE A . n 
A 1 22 ASP 22 22 22 ASP ASP A . n 
A 1 23 GLY 23 23 23 GLY GLY A . n 
A 1 24 GLY 24 24 24 GLY GLY A . n 
A 1 25 ALA 25 25 25 ALA ALA A . n 
A 1 26 ARG 26 26 26 ARG ARG A . n 
A 1 27 GLY 27 27 27 GLY GLY A . n 
A 1 28 LEU 28 28 28 LEU LEU A . n 
A 1 29 TRP 29 29 29 TRP TRP A . n 
A 1 30 GLU 30 30 30 GLU GLU A . n 
A 1 31 ARG 31 31 31 ARG ARG A . n 
A 1 32 GLU 32 32 32 GLU GLU A . n 
A 1 33 GLY 33 33 33 GLY GLY A . n 
A 1 34 GLU 34 34 34 GLU GLU A . n 
A 1 35 VAL 35 35 35 VAL VAL A . n 
A 1 36 TRP 36 36 36 TRP TRP A . n 
A 1 37 ALA 37 37 37 ALA ALA A . n 
A 1 38 PHE 38 38 38 PHE PHE A . n 
A 1 39 PHE 39 39 39 PHE PHE A . n 
A 1 40 PRO 40 40 40 PRO PRO A . n 
A 1 41 ALA 41 41 41 ALA ALA A . n 
A 1 42 PRO 42 42 42 PRO PRO A . n 
A 1 43 VAL 43 43 43 VAL VAL A . n 
A 1 44 ASP 44 44 44 ASP ASP A . n 
A 1 45 LEU 45 45 45 LEU LEU A . n 
A 1 46 PRO 46 46 46 PRO PRO A . n 
A 1 47 TYR 47 47 47 TYR TYR A . n 
A 1 48 GLU 48 48 48 GLU GLU A . n 
A 1 49 GLY 49 49 49 GLY GLY A . n 
A 1 50 VAL 50 50 50 VAL VAL A . n 
A 1 51 TRP 51 51 51 TRP TRP A . n 
A 1 52 GLU 52 52 52 GLU GLU A . n 
A 1 53 GLU 53 53 53 GLU GLU A . n 
A 1 54 VAL 54 54 54 VAL VAL A . n 
A 1 55 GLY 55 55 55 GLY GLY A . n 
A 1 56 ASP 56 56 56 ASP ASP A . n 
A 1 57 GLU 57 57 57 GLU GLU A . n 
A 1 58 ASP 58 58 ?  ?   ?   A . n 
A 1 59 TRP 59 59 59 TRP TRP A . n 
B 2 1  MET 1  1  1  MET MET B . n 
B 2 2  LYS 2  2  2  LYS LYS B . n 
B 2 3  LYS 3  3  3  LYS LYS B . n 
B 2 4  VAL 4  4  4  VAL VAL B . n 
B 2 5  VAL 5  5  5  VAL VAL B . n 
B 2 6  ALA 6  6  6  ALA ALA B . n 
B 2 7  VAL 7  7  7  VAL VAL B . n 
B 2 8  VAL 8  8  8  VAL VAL B . n 
B 2 9  LYS 9  9  9  LYS LYS B . n 
B 2 10 LEU 10 10 10 LEU LEU B . n 
B 2 11 GLN 11 11 11 GLN GLN B . n 
B 2 12 LEU 12 12 12 LEU LEU B . n 
B 2 13 PRO 13 13 13 PRO PRO B . n 
B 2 14 ALA 14 14 14 ALA ALA B . n 
B 2 15 GLY 15 15 15 GLY GLY B . n 
B 2 16 LYS 16 16 16 LYS LYS B . n 
B 2 17 ALA 17 17 17 ALA ALA B . n 
B 2 18 THR 18 18 18 THR THR B . n 
B 2 19 PRO 19 19 19 PRO PRO B . n 
B 2 20 ALA 20 20 20 ALA ALA B . n 
B 2 21 PRO 21 21 21 PRO PRO B . n 
B 2 22 PRO 22 22 22 PRO PRO B . n 
B 2 23 VAL 23 23 23 VAL VAL B . n 
B 2 24 GLY 24 24 24 GLY GLY B . n 
B 2 25 PRO 25 25 25 PRO PRO B . n 
B 2 26 ALA 26 26 26 ALA ALA B . n 
B 2 27 LEU 27 27 27 LEU LEU B . n 
B 2 28 GLY 28 28 28 GLY GLY B . n 
B 2 29 GLN 29 29 29 GLN GLN B . n 
B 2 30 HIS 30 30 30 HIS HIS B . n 
B 2 31 GLY 31 31 31 GLY GLY B . n 
B 2 32 ALA 32 32 32 ALA ALA B . n 
B 2 33 ASN 33 33 33 ASN ASN B . n 
B 2 34 ILE 34 34 34 ILE ILE B . n 
B 2 35 MET 35 35 35 MET MET B . n 
B 2 36 GLU 36 36 36 GLU GLU B . n 
B 2 37 PHE 37 37 37 PHE PHE B . n 
B 2 38 VAL 38 38 38 VAL VAL B . n 
B 2 39 LYS 39 39 39 LYS LYS B . n 
B 2 40 ALA 40 40 40 ALA ALA B . n 
B 2 41 PHE 41 41 41 PHE PHE B . n 
B 2 42 ASN 42 42 42 ASN ASN B . n 
B 2 43 ALA 43 43 43 ALA ALA B . n 
B 2 44 ALA 44 44 44 ALA ALA B . n 
B 2 45 THR 45 45 45 THR THR B . n 
B 2 46 ALA 46 46 46 ALA ALA B . n 
B 2 47 ASN 47 47 47 ASN ASN B . n 
B 2 48 MET 48 48 48 MET MET B . n 
B 2 49 GLY 49 49 49 GLY GLY B . n 
B 2 50 ASP 50 50 50 ASP ASP B . n 
B 2 51 ALA 51 51 51 ALA ALA B . n 
B 2 52 ILE 52 52 52 ILE ILE B . n 
B 2 53 VAL 53 53 53 VAL VAL B . n 
B 2 54 PRO 54 54 54 PRO PRO B . n 
B 2 55 VAL 55 55 55 VAL VAL B . n 
B 2 56 GLU 56 56 56 GLU GLU B . n 
B 2 57 ILE 57 57 57 ILE ILE B . n 
B 2 58 THR 58 58 58 THR THR B . n 
B 2 59 ILE 59 59 59 ILE ILE B . n 
B 2 60 TYR 60 60 60 TYR TYR B . n 
B 2 61 ALA 61 61 61 ALA ALA B . n 
B 2 62 ASP 62 62 62 ASP ASP B . n 
B 2 63 ARG 63 63 63 ARG ARG B . n 
B 2 64 SER 64 64 64 SER SER B . n 
B 2 65 PHE 65 65 65 PHE PHE B . n 
B 2 66 THR 66 66 66 THR THR B . n 
B 2 67 PHE 67 67 67 PHE PHE B . n 
B 2 68 VAL 68 68 68 VAL VAL B . n 
B 2 69 THR 69 69 69 THR THR B . n 
B 2 70 LYS 70 70 70 LYS LYS B . n 
B 2 71 THR 71 71 71 THR THR B . n 
B 2 72 PRO 72 72 72 PRO ALA B . n 
C 2 1  MET 1  1  ?  ?   ?   C . n 
C 2 2  LYS 2  2  ?  ?   ?   C . n 
C 2 3  LYS 3  3  3  LYS LYS C . n 
C 2 4  VAL 4  4  4  VAL VAL C . n 
C 2 5  VAL 5  5  5  VAL VAL C . n 
C 2 6  ALA 6  6  6  ALA ALA C . n 
C 2 7  VAL 7  7  7  VAL VAL C . n 
C 2 8  VAL 8  8  8  VAL VAL C . n 
C 2 9  LYS 9  9  9  LYS LYS C . n 
C 2 10 LEU 10 10 10 LEU LEU C . n 
C 2 11 GLN 11 11 11 GLN GLN C . n 
C 2 12 LEU 12 12 12 LEU LEU C . n 
C 2 13 PRO 13 13 13 PRO PRO C . n 
C 2 14 ALA 14 14 14 ALA ALA C . n 
C 2 15 GLY 15 15 15 GLY GLY C . n 
C 2 16 LYS 16 16 16 LYS LYS C . n 
C 2 17 ALA 17 17 17 ALA ALA C . n 
C 2 18 THR 18 18 18 THR THR C . n 
C 2 19 PRO 19 19 19 PRO PRO C . n 
C 2 20 ALA 20 20 20 ALA ALA C . n 
C 2 21 PRO 21 21 21 PRO PRO C . n 
C 2 22 PRO 22 22 22 PRO PRO C . n 
C 2 23 VAL 23 23 23 VAL VAL C . n 
C 2 24 GLY 24 24 24 GLY GLY C . n 
C 2 25 PRO 25 25 25 PRO PRO C . n 
C 2 26 ALA 26 26 26 ALA ALA C . n 
C 2 27 LEU 27 27 27 LEU LEU C . n 
C 2 28 GLY 28 28 28 GLY GLY C . n 
C 2 29 GLN 29 29 29 GLN GLN C . n 
C 2 30 HIS 30 30 30 HIS HIS C . n 
C 2 31 GLY 31 31 31 GLY GLY C . n 
C 2 32 ALA 32 32 32 ALA ALA C . n 
C 2 33 ASN 33 33 33 ASN ASN C . n 
C 2 34 ILE 34 34 34 ILE ILE C . n 
C 2 35 MET 35 35 35 MET MET C . n 
C 2 36 GLU 36 36 36 GLU GLU C . n 
C 2 37 PHE 37 37 37 PHE PHE C . n 
C 2 38 VAL 38 38 38 VAL VAL C . n 
C 2 39 LYS 39 39 39 LYS LYS C . n 
C 2 40 ALA 40 40 40 ALA ALA C . n 
C 2 41 PHE 41 41 41 PHE PHE C . n 
C 2 42 ASN 42 42 42 ASN ASN C . n 
C 2 43 ALA 43 43 43 ALA ALA C . n 
C 2 44 ALA 44 44 44 ALA ALA C . n 
C 2 45 THR 45 45 45 THR THR C . n 
C 2 46 ALA 46 46 46 ALA ALA C . n 
C 2 47 ASN 47 47 47 ASN ASN C . n 
C 2 48 MET 48 48 48 MET MET C . n 
C 2 49 GLY 49 49 49 GLY GLY C . n 
C 2 50 ASP 50 50 50 ASP ASP C . n 
C 2 51 ALA 51 51 51 ALA ALA C . n 
C 2 52 ILE 52 52 52 ILE ILE C . n 
C 2 53 VAL 53 53 53 VAL VAL C . n 
C 2 54 PRO 54 54 54 PRO PRO C . n 
C 2 55 VAL 55 55 55 VAL VAL C . n 
C 2 56 GLU 56 56 56 GLU GLU C . n 
C 2 57 ILE 57 57 57 ILE ILE C . n 
C 2 58 THR 58 58 58 THR THR C . n 
C 2 59 ILE 59 59 59 ILE ILE C . n 
C 2 60 TYR 60 60 60 TYR TYR C . n 
C 2 61 ALA 61 61 61 ALA ALA C . n 
C 2 62 ASP 62 62 62 ASP ASP C . n 
C 2 63 ARG 63 63 63 ARG ARG C . n 
C 2 64 SER 64 64 64 SER SER C . n 
C 2 65 PHE 65 65 65 PHE PHE C . n 
C 2 66 THR 66 66 66 THR THR C . n 
C 2 67 PHE 67 67 67 PHE PHE C . n 
C 2 68 VAL 68 68 68 VAL VAL C . n 
C 2 69 THR 69 69 69 THR THR C . n 
C 2 70 LYS 70 70 70 LYS LYS C . n 
C 2 71 THR 71 71 ?  ?   ?   C . n 
C 2 72 PRO 72 72 ?  ?   ?   C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 3 EDO 1  73  1   EDO EDO B . 
E 3 EDO 1  74  2   EDO EDO B . 
F 3 EDO 1  75  3   EDO EDO B . 
G 4 HOH 1  60  1   HOH HOH A . 
G 4 HOH 2  61  4   HOH HOH A . 
G 4 HOH 3  62  6   HOH HOH A . 
G 4 HOH 4  63  7   HOH HOH A . 
G 4 HOH 5  64  8   HOH HOH A . 
G 4 HOH 6  65  16  HOH HOH A . 
G 4 HOH 7  66  21  HOH HOH A . 
G 4 HOH 8  67  23  HOH HOH A . 
G 4 HOH 9  68  24  HOH HOH A . 
G 4 HOH 10 69  27  HOH HOH A . 
G 4 HOH 11 70  30  HOH HOH A . 
G 4 HOH 12 71  33  HOH HOH A . 
G 4 HOH 13 72  38  HOH HOH A . 
G 4 HOH 14 73  42  HOH HOH A . 
G 4 HOH 15 74  45  HOH HOH A . 
G 4 HOH 16 75  46  HOH HOH A . 
G 4 HOH 17 76  47  HOH HOH A . 
G 4 HOH 18 77  51  HOH HOH A . 
G 4 HOH 19 78  52  HOH HOH A . 
G 4 HOH 20 79  57  HOH HOH A . 
G 4 HOH 21 80  58  HOH HOH A . 
G 4 HOH 22 81  59  HOH HOH A . 
G 4 HOH 23 82  61  HOH HOH A . 
G 4 HOH 24 83  64  HOH HOH A . 
G 4 HOH 25 84  70  HOH HOH A . 
G 4 HOH 26 85  73  HOH HOH A . 
G 4 HOH 27 86  74  HOH HOH A . 
G 4 HOH 28 87  78  HOH HOH A . 
G 4 HOH 29 88  81  HOH HOH A . 
G 4 HOH 30 89  83  HOH HOH A . 
G 4 HOH 31 90  84  HOH HOH A . 
G 4 HOH 32 91  86  HOH HOH A . 
G 4 HOH 33 92  91  HOH HOH A . 
G 4 HOH 34 93  92  HOH HOH A . 
G 4 HOH 35 94  93  HOH HOH A . 
G 4 HOH 36 95  101 HOH HOH A . 
G 4 HOH 37 96  102 HOH HOH A . 
G 4 HOH 38 97  104 HOH HOH A . 
G 4 HOH 39 98  109 HOH HOH A . 
G 4 HOH 40 99  110 HOH HOH A . 
G 4 HOH 41 100 114 HOH HOH A . 
G 4 HOH 42 101 117 HOH HOH A . 
G 4 HOH 43 102 119 HOH HOH A . 
G 4 HOH 44 103 124 HOH HOH A . 
G 4 HOH 45 104 134 HOH HOH A . 
G 4 HOH 46 105 136 HOH HOH A . 
G 4 HOH 47 106 137 HOH HOH A . 
G 4 HOH 48 107 139 HOH HOH A . 
G 4 HOH 49 108 140 HOH HOH A . 
G 4 HOH 50 109 141 HOH HOH A . 
G 4 HOH 51 110 142 HOH HOH A . 
G 4 HOH 52 111 144 HOH HOH A . 
G 4 HOH 53 112 145 HOH HOH A . 
G 4 HOH 54 113 148 HOH HOH A . 
G 4 HOH 55 114 149 HOH HOH A . 
G 4 HOH 56 115 154 HOH HOH A . 
G 4 HOH 57 116 156 HOH HOH A . 
G 4 HOH 58 117 161 HOH HOH A . 
G 4 HOH 59 118 166 HOH HOH A . 
G 4 HOH 60 119 167 HOH HOH A . 
G 4 HOH 61 120 172 HOH HOH A . 
G 4 HOH 62 121 174 HOH HOH A . 
G 4 HOH 63 122 181 HOH HOH A . 
G 4 HOH 64 123 182 HOH HOH A . 
G 4 HOH 65 124 184 HOH HOH A . 
G 4 HOH 66 125 185 HOH HOH A . 
G 4 HOH 67 126 186 HOH HOH A . 
G 4 HOH 68 127 187 HOH HOH A . 
G 4 HOH 69 128 188 HOH HOH A . 
G 4 HOH 70 129 189 HOH HOH A . 
G 4 HOH 71 130 190 HOH HOH A . 
G 4 HOH 72 131 191 HOH HOH A . 
G 4 HOH 73 132 192 HOH HOH A . 
G 4 HOH 74 133 193 HOH HOH A . 
G 4 HOH 75 134 194 HOH HOH A . 
G 4 HOH 76 135 195 HOH HOH A . 
G 4 HOH 77 136 197 HOH HOH A . 
G 4 HOH 78 137 198 HOH HOH A . 
G 4 HOH 79 138 204 HOH HOH A . 
G 4 HOH 80 139 206 HOH HOH A . 
G 4 HOH 81 140 207 HOH HOH A . 
G 4 HOH 82 141 223 HOH HOH A . 
G 4 HOH 83 142 225 HOH HOH A . 
G 4 HOH 84 143 226 HOH HOH A . 
G 4 HOH 85 144 227 HOH HOH A . 
G 4 HOH 86 145 228 HOH HOH A . 
G 4 HOH 87 146 230 HOH HOH A . 
G 4 HOH 88 147 231 HOH HOH A . 
G 4 HOH 89 148 232 HOH HOH A . 
G 4 HOH 90 149 233 HOH HOH A . 
G 4 HOH 91 150 234 HOH HOH A . 
G 4 HOH 92 151 235 HOH HOH A . 
G 4 HOH 93 152 239 HOH HOH A . 
G 4 HOH 94 153 240 HOH HOH A . 
G 4 HOH 95 154 243 HOH HOH A . 
H 4 HOH 1  76  2   HOH HOH B . 
H 4 HOH 2  77  3   HOH HOH B . 
H 4 HOH 3  78  5   HOH HOH B . 
H 4 HOH 4  79  9   HOH HOH B . 
H 4 HOH 5  80  10  HOH HOH B . 
H 4 HOH 6  81  11  HOH HOH B . 
H 4 HOH 7  82  12  HOH HOH B . 
H 4 HOH 8  83  14  HOH HOH B . 
H 4 HOH 9  84  15  HOH HOH B . 
H 4 HOH 10 85  18  HOH HOH B . 
H 4 HOH 11 86  19  HOH HOH B . 
H 4 HOH 12 87  22  HOH HOH B . 
H 4 HOH 13 88  25  HOH HOH B . 
H 4 HOH 14 89  26  HOH HOH B . 
H 4 HOH 15 90  28  HOH HOH B . 
H 4 HOH 16 91  32  HOH HOH B . 
H 4 HOH 17 92  37  HOH HOH B . 
H 4 HOH 18 93  39  HOH HOH B . 
H 4 HOH 19 94  41  HOH HOH B . 
H 4 HOH 20 95  43  HOH HOH B . 
H 4 HOH 21 96  44  HOH HOH B . 
H 4 HOH 22 97  48  HOH HOH B . 
H 4 HOH 23 98  49  HOH HOH B . 
H 4 HOH 24 99  50  HOH HOH B . 
H 4 HOH 25 100 55  HOH HOH B . 
H 4 HOH 26 101 56  HOH HOH B . 
H 4 HOH 27 102 62  HOH HOH B . 
H 4 HOH 28 103 65  HOH HOH B . 
H 4 HOH 29 104 66  HOH HOH B . 
H 4 HOH 30 105 68  HOH HOH B . 
H 4 HOH 31 106 69  HOH HOH B . 
H 4 HOH 32 107 76  HOH HOH B . 
H 4 HOH 33 108 85  HOH HOH B . 
H 4 HOH 34 109 88  HOH HOH B . 
H 4 HOH 35 110 95  HOH HOH B . 
H 4 HOH 36 111 96  HOH HOH B . 
H 4 HOH 37 112 103 HOH HOH B . 
H 4 HOH 38 113 105 HOH HOH B . 
H 4 HOH 39 114 106 HOH HOH B . 
H 4 HOH 40 115 111 HOH HOH B . 
H 4 HOH 41 116 113 HOH HOH B . 
H 4 HOH 42 117 115 HOH HOH B . 
H 4 HOH 43 118 118 HOH HOH B . 
H 4 HOH 44 119 120 HOH HOH B . 
H 4 HOH 45 120 122 HOH HOH B . 
H 4 HOH 46 121 127 HOH HOH B . 
H 4 HOH 47 122 133 HOH HOH B . 
H 4 HOH 48 123 138 HOH HOH B . 
H 4 HOH 49 124 143 HOH HOH B . 
H 4 HOH 50 125 150 HOH HOH B . 
H 4 HOH 51 126 157 HOH HOH B . 
H 4 HOH 52 127 159 HOH HOH B . 
H 4 HOH 53 128 163 HOH HOH B . 
H 4 HOH 54 129 165 HOH HOH B . 
H 4 HOH 55 130 171 HOH HOH B . 
H 4 HOH 56 131 173 HOH HOH B . 
H 4 HOH 57 132 175 HOH HOH B . 
H 4 HOH 58 133 176 HOH HOH B . 
H 4 HOH 59 134 177 HOH HOH B . 
H 4 HOH 60 135 178 HOH HOH B . 
H 4 HOH 61 136 179 HOH HOH B . 
H 4 HOH 62 137 180 HOH HOH B . 
H 4 HOH 63 138 196 HOH HOH B . 
H 4 HOH 64 139 199 HOH HOH B . 
H 4 HOH 65 140 200 HOH HOH B . 
H 4 HOH 66 141 201 HOH HOH B . 
H 4 HOH 67 142 202 HOH HOH B . 
H 4 HOH 68 143 203 HOH HOH B . 
H 4 HOH 69 144 205 HOH HOH B . 
H 4 HOH 70 145 208 HOH HOH B . 
H 4 HOH 71 146 209 HOH HOH B . 
H 4 HOH 72 147 210 HOH HOH B . 
H 4 HOH 73 148 211 HOH HOH B . 
H 4 HOH 74 149 212 HOH HOH B . 
H 4 HOH 75 150 229 HOH HOH B . 
H 4 HOH 76 151 241 HOH HOH B . 
H 4 HOH 77 152 242 HOH HOH B . 
H 4 HOH 78 153 244 HOH HOH B . 
H 4 HOH 79 154 245 HOH HOH B . 
H 4 HOH 80 155 246 HOH HOH B . 
H 4 HOH 81 156 247 HOH HOH B . 
H 4 HOH 82 157 248 HOH HOH B . 
H 4 HOH 83 158 249 HOH HOH B . 
H 4 HOH 84 159 250 HOH HOH B . 
H 4 HOH 85 160 251 HOH HOH B . 
I 4 HOH 1  73  13  HOH HOH C . 
I 4 HOH 2  74  17  HOH HOH C . 
I 4 HOH 3  75  20  HOH HOH C . 
I 4 HOH 4  76  29  HOH HOH C . 
I 4 HOH 5  77  31  HOH HOH C . 
I 4 HOH 6  78  34  HOH HOH C . 
I 4 HOH 7  79  35  HOH HOH C . 
I 4 HOH 8  80  36  HOH HOH C . 
I 4 HOH 9  81  40  HOH HOH C . 
I 4 HOH 10 82  53  HOH HOH C . 
I 4 HOH 11 83  54  HOH HOH C . 
I 4 HOH 12 84  60  HOH HOH C . 
I 4 HOH 13 85  63  HOH HOH C . 
I 4 HOH 14 86  67  HOH HOH C . 
I 4 HOH 15 87  71  HOH HOH C . 
I 4 HOH 16 88  72  HOH HOH C . 
I 4 HOH 17 89  75  HOH HOH C . 
I 4 HOH 18 90  77  HOH HOH C . 
I 4 HOH 19 91  79  HOH HOH C . 
I 4 HOH 20 92  80  HOH HOH C . 
I 4 HOH 21 93  82  HOH HOH C . 
I 4 HOH 22 94  87  HOH HOH C . 
I 4 HOH 23 95  89  HOH HOH C . 
I 4 HOH 24 96  90  HOH HOH C . 
I 4 HOH 25 97  94  HOH HOH C . 
I 4 HOH 26 98  97  HOH HOH C . 
I 4 HOH 27 99  98  HOH HOH C . 
I 4 HOH 28 100 99  HOH HOH C . 
I 4 HOH 29 101 100 HOH HOH C . 
I 4 HOH 30 102 107 HOH HOH C . 
I 4 HOH 31 103 108 HOH HOH C . 
I 4 HOH 32 104 112 HOH HOH C . 
I 4 HOH 33 105 116 HOH HOH C . 
I 4 HOH 34 106 121 HOH HOH C . 
I 4 HOH 35 107 123 HOH HOH C . 
I 4 HOH 36 108 125 HOH HOH C . 
I 4 HOH 37 109 126 HOH HOH C . 
I 4 HOH 38 110 128 HOH HOH C . 
I 4 HOH 39 111 129 HOH HOH C . 
I 4 HOH 40 112 130 HOH HOH C . 
I 4 HOH 41 113 131 HOH HOH C . 
I 4 HOH 42 114 132 HOH HOH C . 
I 4 HOH 43 115 135 HOH HOH C . 
I 4 HOH 44 116 146 HOH HOH C . 
I 4 HOH 45 117 147 HOH HOH C . 
I 4 HOH 46 118 151 HOH HOH C . 
I 4 HOH 47 119 152 HOH HOH C . 
I 4 HOH 48 120 153 HOH HOH C . 
I 4 HOH 49 121 155 HOH HOH C . 
I 4 HOH 50 122 158 HOH HOH C . 
I 4 HOH 51 123 160 HOH HOH C . 
I 4 HOH 52 124 162 HOH HOH C . 
I 4 HOH 53 125 164 HOH HOH C . 
I 4 HOH 54 126 168 HOH HOH C . 
I 4 HOH 55 127 169 HOH HOH C . 
I 4 HOH 56 128 170 HOH HOH C . 
I 4 HOH 57 129 183 HOH HOH C . 
I 4 HOH 58 130 213 HOH HOH C . 
I 4 HOH 59 131 214 HOH HOH C . 
I 4 HOH 60 132 215 HOH HOH C . 
I 4 HOH 61 133 216 HOH HOH C . 
I 4 HOH 62 134 217 HOH HOH C . 
I 4 HOH 63 135 218 HOH HOH C . 
I 4 HOH 64 136 219 HOH HOH C . 
I 4 HOH 65 137 220 HOH HOH C . 
I 4 HOH 66 138 221 HOH HOH C . 
I 4 HOH 67 139 224 HOH HOH C . 
I 4 HOH 68 140 236 HOH HOH C . 
I 4 HOH 69 141 237 HOH HOH C . 
I 4 HOH 70 142 238 HOH HOH C . 
I 4 HOH 71 143 252 HOH HOH C . 
I 4 HOH 72 144 253 HOH HOH C . 
I 4 HOH 73 145 254 HOH HOH C . 
I 4 HOH 74 146 255 HOH HOH C . 
I 4 HOH 75 147 256 HOH HOH C . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric   2 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,D,E,F,G,H 
2 1 C,I           
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1510 ? 
1 MORE         -8.7 ? 
1 'SSA (A^2)'  7510 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-05-20 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 14.5037 -10.9887 20.8493 -0.0464 -0.0553 -0.0198 0.0102 -0.0170 -0.0050 1.4459 5.0401 1.0754 -0.7907 -0.3308 0.1001  
0.0677  0.0255  0.1192  -0.3011 -0.0375 0.1578 0.0084 0.0268  -0.0302 'X-RAY DIFFRACTION' 
2 ? refined 14.8693 5.9084   27.2908 -0.0584 -0.0583 -0.0297 0.0007 0.0078  -0.0033 2.3434 1.4838 1.1756 0.5556  0.7165  0.2744  
0.0258  -0.1272 -0.0295 0.0251  -0.0492 0.1552 0.0270 -0.0369 0.0234  'X-RAY DIFFRACTION' 
3 ? refined 14.0196 -15.3145 -1.2123 0.0980  0.0754  -0.0723 0.0153 0.0299  0.0135  1.3538 1.0151 5.8011 -0.6523 2.0174  -1.3206 
-0.0867 0.1123  -0.0144 0.2409  0.1061  0.0179 0.1711 -0.1802 -0.0194 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 1 A 1 A 54 A 54 ? 'X-RAY DIFFRACTION' ? 
2 2 B 1 B 1 B 72 B 72 ? 'X-RAY DIFFRACTION' ? 
3 3 C 3 C 3 C 70 C 70 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement        5.2.0019 ? 1 
ADSC      'data collection' Quantum  ? 2 
DENZO     'data reduction'  .        ? 3 
SCALEPACK 'data scaling'    .        ? 4 
PHASER    phasing           .        ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 67 ? ? O A HOH 128 ? ? 1.90 
2 1 NH2 B ARG 63 ? ? O B HOH 157 ? ? 1.93 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     87 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     99 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   1_545 
_pdbx_validate_symm_contact.dist              2.18 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB A GLU 32 ? ? CG  A GLU 32 ? ? 1.639 1.517 0.122  0.019 N 
2 1 SD B MET 35 ? ? CE  B MET 35 ? ? 1.424 1.774 -0.350 0.056 N 
3 1 CZ C ARG 63 ? ? NH2 C ARG 63 ? ? 1.246 1.326 -0.080 0.013 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA  A GLU 32 ? ? CB A GLU 32 ? ? CG  A GLU 32 ? ? 99.94  113.40 -13.46 2.20 N 
2 1 CG  B MET 35 ? ? SD B MET 35 ? ? CE  B MET 35 ? ? 111.80 100.20 11.60  1.60 N 
3 1 NH1 B ARG 63 ? ? CZ B ARG 63 ? ? NH2 B ARG 63 ? ? 104.60 119.40 -14.80 1.10 N 
4 1 NE  B ARG 63 ? ? CZ B ARG 63 ? ? NH2 B ARG 63 ? ? 134.55 120.30 14.25  0.50 N 
5 1 N   B PRO 72 ? ? CA B PRO 72 ? ? CB  B PRO 72 ? ? 110.13 102.60 7.53   1.10 N 
6 1 NE  C ARG 63 ? ? CZ C ARG 63 ? ? NH2 C ARG 63 ? ? 116.32 120.30 -3.98  0.50 N 
7 1 CA  C THR 69 ? ? CB C THR 69 ? ? OG1 C THR 69 ? ? 124.08 109.00 15.08  2.10 N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    GLU 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     32 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             36.58 
_pdbx_validate_torsion.psi             69.78 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 0 A GLU 11 ? CD  ? A GLU 11 CD  
2  1 Y 0 A GLU 32 ? CG  ? A GLU 32 CG  
3  1 Y 0 A GLU 32 ? CD  ? A GLU 32 CD  
4  1 Y 0 A GLU 32 ? OE1 ? A GLU 32 OE1 
5  1 Y 0 A GLU 32 ? OE2 ? A GLU 32 OE2 
6  1 Y 1 A GLU 57 ? CB  ? A GLU 57 CB  
7  1 Y 1 A GLU 57 ? CG  ? A GLU 57 CG  
8  1 Y 1 A GLU 57 ? CD  ? A GLU 57 CD  
9  1 Y 1 A GLU 57 ? OE1 ? A GLU 57 OE1 
10 1 Y 1 A GLU 57 ? OE2 ? A GLU 57 OE2 
11 1 Y 0 B MET 35 ? CE  ? B MET 35 CE  
12 1 Y 0 B LYS 39 ? CE  ? B LYS 39 CE  
13 1 Y 0 B LYS 39 ? NZ  ? B LYS 39 NZ  
14 1 Y 0 B ARG 63 ? NH2 ? B ARG 63 NH2 
15 1 Y 1 B PRO 72 ? CG  ? B PRO 72 CG  
16 1 Y 1 B PRO 72 ? CD  ? B PRO 72 CD  
17 1 Y 1 C LYS 3  ? CB  ? C LYS 3  CB  
18 1 Y 1 C LYS 3  ? CG  ? C LYS 3  CG  
19 1 Y 1 C LYS 3  ? CD  ? C LYS 3  CD  
20 1 Y 1 C LYS 3  ? CE  ? C LYS 3  CE  
21 1 Y 1 C LYS 3  ? NZ  ? C LYS 3  NZ  
22 1 Y 0 C LYS 9  ? CE  ? C LYS 9  CE  
23 1 Y 0 C LYS 9  ? NZ  ? C LYS 9  NZ  
24 1 Y 0 C GLN 11 ? NE2 ? C GLN 11 NE2 
25 1 Y 0 C LYS 16 ? CD  ? C LYS 16 CD  
26 1 Y 0 C LYS 16 ? CE  ? C LYS 16 CE  
27 1 Y 0 C LYS 16 ? NZ  ? C LYS 16 NZ  
28 1 Y 0 C MET 35 ? CE  ? C MET 35 CE  
29 1 Y 0 C LYS 39 ? CD  ? C LYS 39 CD  
30 1 Y 0 C LYS 39 ? CE  ? C LYS 39 CE  
31 1 Y 0 C LYS 39 ? NZ  ? C LYS 39 NZ  
32 1 Y 0 C ARG 63 ? NH2 ? C ARG 63 NH2 
33 1 Y 0 C THR 69 ? OG1 ? C THR 69 OG1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASP 58 ? A ASP 58 
2 1 Y 1 C MET 1  ? C MET 1  
3 1 Y 1 C LYS 2  ? C LYS 2  
4 1 Y 1 C THR 71 ? C THR 71 
5 1 Y 1 C PRO 72 ? C PRO 72 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 1,2-ETHANEDIOL EDO 
4 water          HOH 
#